data_2D8I
# 
_entry.id   2D8I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D8I         
RCSB  RCSB025119   
WWPDB D_1000025119 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk003000753.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D8I 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-06 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, X.R.'                                              1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian' 
_citation.journal_abbrev            'TO BE PUBLISHED' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Qin, X.R.'    1 
primary 'Hayashi, F.'  2 
primary 'Yokoyama, S.' 3 
# 
_cell.entry_id           2D8I 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2D8I 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'T-cell lymphoma invasion and metastasis 1 variant' 
_entity.formula_weight             12048.287 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALN
SSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALN
SSMLKDFLSQPSLGLLVRTYPELEEGVESGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk003000753.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   GLU n 
1 9   ILE n 
1 10  GLU n 
1 11  ILE n 
1 12  CYS n 
1 13  PRO n 
1 14  LYS n 
1 15  VAL n 
1 16  THR n 
1 17  GLN n 
1 18  SER n 
1 19  ILE n 
1 20  HIS n 
1 21  ILE n 
1 22  GLU n 
1 23  LYS n 
1 24  SER n 
1 25  ASP n 
1 26  THR n 
1 27  ALA n 
1 28  ALA n 
1 29  ASP n 
1 30  THR n 
1 31  TYR n 
1 32  GLY n 
1 33  PHE n 
1 34  SER n 
1 35  LEU n 
1 36  SER n 
1 37  SER n 
1 38  VAL n 
1 39  GLU n 
1 40  GLU n 
1 41  ASP n 
1 42  GLY n 
1 43  ILE n 
1 44  ARG n 
1 45  ARG n 
1 46  LEU n 
1 47  TYR n 
1 48  VAL n 
1 49  ASN n 
1 50  SER n 
1 51  VAL n 
1 52  LYS n 
1 53  GLU n 
1 54  THR n 
1 55  GLY n 
1 56  LEU n 
1 57  ALA n 
1 58  SER n 
1 59  LYS n 
1 60  LYS n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  ALA n 
1 65  GLY n 
1 66  ASP n 
1 67  GLU n 
1 68  ILE n 
1 69  LEU n 
1 70  GLU n 
1 71  ILE n 
1 72  ASN n 
1 73  ASN n 
1 74  ARG n 
1 75  ALA n 
1 76  ALA n 
1 77  ASP n 
1 78  ALA n 
1 79  LEU n 
1 80  ASN n 
1 81  SER n 
1 82  SER n 
1 83  MET n 
1 84  LEU n 
1 85  LYS n 
1 86  ASP n 
1 87  PHE n 
1 88  LEU n 
1 89  SER n 
1 90  GLN n 
1 91  PRO n 
1 92  SER n 
1 93  LEU n 
1 94  GLY n 
1 95  LEU n 
1 96  LEU n 
1 97  VAL n 
1 98  ARG n 
1 99  THR n 
1 100 TYR n 
1 101 PRO n 
1 102 GLU n 
1 103 LEU n 
1 104 GLU n 
1 105 GLU n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 SER n 
1 110 GLY n 
1 111 PRO n 
1 112 SER n 
1 113 SER n 
1 114 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 T1AM-1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050425-07 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    BAD92338 
_struct_ref.pdbx_db_accession          62087782 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDF
LSQPSLGLLVRTYPELEEGVE
;
_struct_ref.pdbx_align_begin           664 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2D8I 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 108 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             62087782 
_struct_ref_seq.db_align_beg                  664 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  764 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2D8I GLY A 1   ? GB 62087782 ? ? 'CLONING ARTIFACT' 1   1  
1 2D8I SER A 2   ? GB 62087782 ? ? 'CLONING ARTIFACT' 2   2  
1 2D8I SER A 3   ? GB 62087782 ? ? 'CLONING ARTIFACT' 3   3  
1 2D8I GLY A 4   ? GB 62087782 ? ? 'CLONING ARTIFACT' 4   4  
1 2D8I SER A 5   ? GB 62087782 ? ? 'CLONING ARTIFACT' 5   5  
1 2D8I SER A 6   ? GB 62087782 ? ? 'CLONING ARTIFACT' 6   6  
1 2D8I GLY A 7   ? GB 62087782 ? ? 'CLONING ARTIFACT' 7   7  
1 2D8I SER A 109 ? GB 62087782 ? ? 'CLONING ARTIFACT' 109 8  
1 2D8I GLY A 110 ? GB 62087782 ? ? 'CLONING ARTIFACT' 110 9  
1 2D8I PRO A 111 ? GB 62087782 ? ? 'CLONING ARTIFACT' 111 10 
1 2D8I SER A 112 ? GB 62087782 ? ? 'CLONING ARTIFACT' 112 11 
1 2D8I SER A 113 ? GB 62087782 ? ? 'CLONING ARTIFACT' 113 12 
1 2D8I GLY A 114 ? GB 62087782 ? ? 'CLONING ARTIFACT' 114 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.29mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3;' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2D8I 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2D8I 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2D8I 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9296   'Kobayashi, N'  4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2D8I 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2D8I 
_struct.title                     'Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian' 
_struct.pdbx_descriptor           'T-cell lymphoma invasion and metastasis 1 variant' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D8I 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM, SIGNALING PROTEIN' 
_struct_keywords.text            
;PDZ domain, T-cell lymphoma invasion and metastasis 1 variant, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM, SIGNALING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 56 ? GLY A 61 ? LEU A 56 GLY A 61 1 ? 6  
HELX_P HELX_P2 2 ALA A 75 ? LEU A 79 ? ALA A 75 LEU A 79 5 ? 5  
HELX_P HELX_P3 3 ASN A 80 ? SER A 89 ? ASN A 80 SER A 89 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 15 ? GLU A 22 ? VAL A 15 GLU A 22 
A 2 SER A 92 ? THR A 99 ? SER A 92 THR A 99 
A 3 ILE A 68 ? ILE A 71 ? ILE A 68 ILE A 71 
B 1 SER A 34 ? GLU A 40 ? SER A 34 GLU A 40 
B 2 ILE A 43 ? SER A 50 ? ILE A 43 SER A 50 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 15 ? N VAL A 15 O THR A 99 ? O THR A 99 
A 2 3 O LEU A 96 ? O LEU A 96 N LEU A 69 ? N LEU A 69 
B 1 2 N VAL A 38 ? N VAL A 38 O ARG A 45 ? O ARG A 45 
# 
_database_PDB_matrix.entry_id          2D8I 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D8I 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -15.444 -15.742 -9.189  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -14.198 -16.422 -8.890  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -14.389 -17.909 -8.665  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -14.802 -18.632 -9.571  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -15.869 -15.863 -10.064 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -13.515 -16.277 -9.713  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -13.769 -15.987 -7.998  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -14.086 -18.367 -7.455  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -14.221 -19.779 -7.116  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -14.677 -19.949 -5.670  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -14.638 -19.006 -4.880  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -12.892 -20.506 -7.332  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -13.075 -21.911 -7.335  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -13.761 -17.740 -6.774  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -14.966 -20.207 -7.769  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -12.471 -20.208 -8.280  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -12.209 -20.246 -6.536  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -12.573 -22.302 -6.617  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -15.110 -21.159 -5.331  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -15.578 -21.454 -3.982  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -16.329 -20.262 -3.396  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -16.145 -19.910 -2.232  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -14.399 -21.822 -3.080  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -13.501 -20.735 -2.945  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -15.117 -21.870 -6.006  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -16.252 -22.295 -4.041  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -14.768 -22.092 -2.102  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -13.870 -22.661 -3.508  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -13.828 -20.129 -2.277  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -17.179 -19.645 -4.212  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -17.945 -18.500 -3.758  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -18.947 -18.026 -4.792  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -19.266 -18.750 -5.735  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -17.285 -19.971 -5.131  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -18.475 -18.770 -2.856  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -17.265 -17.691 -3.535  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -19.445 -16.806 -4.615  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -20.420 -16.237 -5.538  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -19.750 -15.807 -6.840  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -18.564 -15.478 -6.861  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -21.126 -15.042 -4.895  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -21.711 -15.402 -3.656  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -19.150 -16.277 -3.844  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -21.152 -17.000 -5.759  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -20.409 -14.253 -4.725  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -21.902 -14.687 -5.557  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -21.957 -14.608 -3.175  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -20.519 -15.813 -7.924  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -20.001 -15.427 -9.231  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -20.205 -13.935 -9.477  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -20.803 -13.535 -10.475 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -20.686 -16.236 -10.334 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -22.085 -16.010 -10.338 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -21.458 -16.085 -7.842  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -18.942 -15.641 -9.244  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -20.284 -15.946 -11.292 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -20.504 -17.288 -10.170 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -22.530 -16.767 -10.724 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -19.702 -13.115 -8.559  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -19.839 -11.677 -8.694  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -21.169 -11.275 -9.298  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -22.208 -11.840 -8.958  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -19.235 -13.491 -7.783  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -19.747 -11.225 -7.718  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -19.044 -11.309 -9.326  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . GLU A 1 8   ? -21.138 -10.295 -10.196 1.00 0.00 ? 8   GLU A N    1  
ATOM 67    C CA   . GLU A 1 8   ? -22.352 -9.817  -10.847 1.00 0.00 ? 8   GLU A CA   1  
ATOM 68    C C    . GLU A 1 8   ? -22.512 -10.444 -12.229 1.00 0.00 ? 8   GLU A C    1  
ATOM 69    O O    . GLU A 1 8   ? -21.699 -10.212 -13.125 1.00 0.00 ? 8   GLU A O    1  
ATOM 70    C CB   . GLU A 1 8   ? -22.327 -8.292  -10.966 1.00 0.00 ? 8   GLU A CB   1  
ATOM 71    C CG   . GLU A 1 8   ? -22.605 -7.575  -9.656  1.00 0.00 ? 8   GLU A CG   1  
ATOM 72    C CD   . GLU A 1 8   ? -22.597 -6.065  -9.805  1.00 0.00 ? 8   GLU A CD   1  
ATOM 73    O OE1  . GLU A 1 8   ? -23.487 -5.534  -10.501 1.00 0.00 ? 8   GLU A OE1  1  
ATOM 74    O OE2  . GLU A 1 8   ? -21.701 -5.416  -9.226  1.00 0.00 ? 8   GLU A OE2  1  
ATOM 75    H H    . GLU A 1 8   ? -20.279 -9.884  -10.426 1.00 0.00 ? 8   GLU A H    1  
ATOM 76    H HA   . GLU A 1 8   ? -23.193 -10.107 -10.235 1.00 0.00 ? 8   GLU A HA   1  
ATOM 77    H HB2  . GLU A 1 8   ? -21.354 -7.987  -11.322 1.00 0.00 ? 8   GLU A HB2  1  
ATOM 78    H HB3  . GLU A 1 8   ? -23.074 -7.988  -11.685 1.00 0.00 ? 8   GLU A HB3  1  
ATOM 79    H HG2  . GLU A 1 8   ? -23.574 -7.880  -9.292  1.00 0.00 ? 8   GLU A HG2  1  
ATOM 80    H HG3  . GLU A 1 8   ? -21.847 -7.855  -8.939  1.00 0.00 ? 8   GLU A HG3  1  
ATOM 81    N N    . ILE A 1 9   ? -23.564 -11.239 -12.394 1.00 0.00 ? 9   ILE A N    1  
ATOM 82    C CA   . ILE A 1 9   ? -23.830 -11.899 -13.666 1.00 0.00 ? 9   ILE A CA   1  
ATOM 83    C C    . ILE A 1 9   ? -24.590 -10.978 -14.615 1.00 0.00 ? 9   ILE A C    1  
ATOM 84    O O    . ILE A 1 9   ? -25.810 -10.849 -14.525 1.00 0.00 ? 9   ILE A O    1  
ATOM 85    C CB   . ILE A 1 9   ? -24.638 -13.195 -13.470 1.00 0.00 ? 9   ILE A CB   1  
ATOM 86    C CG1  . ILE A 1 9   ? -23.889 -14.154 -12.543 1.00 0.00 ? 9   ILE A CG1  1  
ATOM 87    C CG2  . ILE A 1 9   ? -24.915 -13.855 -14.813 1.00 0.00 ? 9   ILE A CG2  1  
ATOM 88    C CD1  . ILE A 1 9   ? -24.797 -15.103 -11.793 1.00 0.00 ? 9   ILE A CD1  1  
ATOM 89    H H    . ILE A 1 9   ? -24.175 -11.385 -11.643 1.00 0.00 ? 9   ILE A H    1  
ATOM 90    H HA   . ILE A 1 9   ? -22.880 -12.155 -14.114 1.00 0.00 ? 9   ILE A HA   1  
ATOM 91    H HB   . ILE A 1 9   ? -25.585 -12.937 -13.021 1.00 0.00 ? 9   ILE A HB   1  
ATOM 92    H HG12 . ILE A 1 9   ? -23.202 -14.746 -13.127 1.00 0.00 ? 9   ILE A HG12 1  
ATOM 93    H HG13 . ILE A 1 9   ? -23.334 -13.579 -11.816 1.00 0.00 ? 9   ILE A HG13 1  
ATOM 94    H HG21 . ILE A 1 9   ? -24.027 -14.368 -15.151 1.00 0.00 ? 9   ILE A HG21 1  
ATOM 95    H HG22 . ILE A 1 9   ? -25.721 -14.565 -14.705 1.00 0.00 ? 9   ILE A HG22 1  
ATOM 96    H HG23 . ILE A 1 9   ? -25.193 -13.101 -15.534 1.00 0.00 ? 9   ILE A HG23 1  
ATOM 97    H HD11 . ILE A 1 9   ? -24.675 -14.955 -10.730 1.00 0.00 ? 9   ILE A HD11 1  
ATOM 98    H HD12 . ILE A 1 9   ? -25.823 -14.913 -12.069 1.00 0.00 ? 9   ILE A HD12 1  
ATOM 99    H HD13 . ILE A 1 9   ? -24.539 -16.122 -12.045 1.00 0.00 ? 9   ILE A HD13 1  
ATOM 100   N N    . GLU A 1 10  ? -23.859 -10.341 -15.525 1.00 0.00 ? 10  GLU A N    1  
ATOM 101   C CA   . GLU A 1 10  ? -24.465 -9.432  -16.491 1.00 0.00 ? 10  GLU A CA   1  
ATOM 102   C C    . GLU A 1 10  ? -23.668 -9.411  -17.792 1.00 0.00 ? 10  GLU A C    1  
ATOM 103   O O    . GLU A 1 10  ? -22.460 -9.648  -17.796 1.00 0.00 ? 10  GLU A O    1  
ATOM 104   C CB   . GLU A 1 10  ? -24.553 -8.019  -15.910 1.00 0.00 ? 10  GLU A CB   1  
ATOM 105   C CG   . GLU A 1 10  ? -25.755 -7.806  -15.006 1.00 0.00 ? 10  GLU A CG   1  
ATOM 106   C CD   . GLU A 1 10  ? -25.589 -8.464  -13.650 1.00 0.00 ? 10  GLU A CD   1  
ATOM 107   O OE1  . GLU A 1 10  ? -24.433 -8.720  -13.253 1.00 0.00 ? 10  GLU A OE1  1  
ATOM 108   O OE2  . GLU A 1 10  ? -26.614 -8.723  -12.986 1.00 0.00 ? 10  GLU A OE2  1  
ATOM 109   H H    . GLU A 1 10  ? -22.890 -10.485 -15.546 1.00 0.00 ? 10  GLU A H    1  
ATOM 110   H HA   . GLU A 1 10  ? -25.463 -9.788  -16.699 1.00 0.00 ? 10  GLU A HA   1  
ATOM 111   H HB2  . GLU A 1 10  ? -23.658 -7.822  -15.338 1.00 0.00 ? 10  GLU A HB2  1  
ATOM 112   H HB3  . GLU A 1 10  ? -24.611 -7.312  -16.724 1.00 0.00 ? 10  GLU A HB3  1  
ATOM 113   H HG2  . GLU A 1 10  ? -25.896 -6.745  -14.859 1.00 0.00 ? 10  GLU A HG2  1  
ATOM 114   H HG3  . GLU A 1 10  ? -26.629 -8.221  -15.486 1.00 0.00 ? 10  GLU A HG3  1  
ATOM 115   N N    . ILE A 1 11  ? -24.354 -9.126  -18.894 1.00 0.00 ? 11  ILE A N    1  
ATOM 116   C CA   . ILE A 1 11  ? -23.711 -9.074  -20.201 1.00 0.00 ? 11  ILE A CA   1  
ATOM 117   C C    . ILE A 1 11  ? -22.574 -8.057  -20.214 1.00 0.00 ? 11  ILE A C    1  
ATOM 118   O O    . ILE A 1 11  ? -21.617 -8.191  -20.976 1.00 0.00 ? 11  ILE A O    1  
ATOM 119   C CB   . ILE A 1 11  ? -24.718 -8.715  -21.310 1.00 0.00 ? 11  ILE A CB   1  
ATOM 120   C CG1  . ILE A 1 11  ? -25.869 -9.723  -21.328 1.00 0.00 ? 11  ILE A CG1  1  
ATOM 121   C CG2  . ILE A 1 11  ? -24.023 -8.672  -22.662 1.00 0.00 ? 11  ILE A CG2  1  
ATOM 122   C CD1  . ILE A 1 11  ? -27.162 -9.153  -21.868 1.00 0.00 ? 11  ILE A CD1  1  
ATOM 123   H H    . ILE A 1 11  ? -25.315 -8.947  -18.826 1.00 0.00 ? 11  ILE A H    1  
ATOM 124   H HA   . ILE A 1 11  ? -23.306 -10.053 -20.412 1.00 0.00 ? 11  ILE A HA   1  
ATOM 125   H HB   . ILE A 1 11  ? -25.112 -7.732  -21.103 1.00 0.00 ? 11  ILE A HB   1  
ATOM 126   H HG12 . ILE A 1 11  ? -25.594 -10.563 -21.946 1.00 0.00 ? 11  ILE A HG12 1  
ATOM 127   H HG13 . ILE A 1 11  ? -26.052 -10.067 -20.321 1.00 0.00 ? 11  ILE A HG13 1  
ATOM 128   H HG21 . ILE A 1 11  ? -23.695 -9.666  -22.931 1.00 0.00 ? 11  ILE A HG21 1  
ATOM 129   H HG22 . ILE A 1 11  ? -24.712 -8.307  -23.409 1.00 0.00 ? 11  ILE A HG22 1  
ATOM 130   H HG23 . ILE A 1 11  ? -23.168 -8.014  -22.608 1.00 0.00 ? 11  ILE A HG23 1  
ATOM 131   H HD11 . ILE A 1 11  ? -27.255 -9.399  -22.916 1.00 0.00 ? 11  ILE A HD11 1  
ATOM 132   H HD12 . ILE A 1 11  ? -27.995 -9.570  -21.324 1.00 0.00 ? 11  ILE A HD12 1  
ATOM 133   H HD13 . ILE A 1 11  ? -27.158 -8.078  -21.751 1.00 0.00 ? 11  ILE A HD13 1  
ATOM 134   N N    . CYS A 1 12  ? -22.686 -7.042  -19.364 1.00 0.00 ? 12  CYS A N    1  
ATOM 135   C CA   . CYS A 1 12  ? -21.667 -6.002  -19.276 1.00 0.00 ? 12  CYS A CA   1  
ATOM 136   C C    . CYS A 1 12  ? -21.161 -5.856  -17.844 1.00 0.00 ? 12  CYS A C    1  
ATOM 137   O O    . CYS A 1 12  ? -21.585 -4.975  -17.097 1.00 0.00 ? 12  CYS A O    1  
ATOM 138   C CB   . CYS A 1 12  ? -22.227 -4.668  -19.770 1.00 0.00 ? 12  CYS A CB   1  
ATOM 139   S SG   . CYS A 1 12  ? -22.432 -4.573  -21.564 1.00 0.00 ? 12  CYS A SG   1  
ATOM 140   H H    . CYS A 1 12  ? -23.473 -6.990  -18.781 1.00 0.00 ? 12  CYS A H    1  
ATOM 141   H HA   . CYS A 1 12  ? -20.842 -6.294  -19.908 1.00 0.00 ? 12  CYS A HA   1  
ATOM 142   H HB2  . CYS A 1 12  ? -23.195 -4.503  -19.321 1.00 0.00 ? 12  CYS A HB2  1  
ATOM 143   H HB3  . CYS A 1 12  ? -21.559 -3.873  -19.472 1.00 0.00 ? 12  CYS A HB3  1  
ATOM 144   H HG   . CYS A 1 12  ? -21.935 -5.681  -22.091 1.00 0.00 ? 12  CYS A HG   1  
ATOM 145   N N    . PRO A 1 13  ? -20.233 -6.742  -17.451 1.00 0.00 ? 13  PRO A N    1  
ATOM 146   C CA   . PRO A 1 13  ? -19.650 -6.733  -16.107 1.00 0.00 ? 13  PRO A CA   1  
ATOM 147   C C    . PRO A 1 13  ? -18.741 -5.531  -15.877 1.00 0.00 ? 13  PRO A C    1  
ATOM 148   O O    . PRO A 1 13  ? -18.580 -4.684  -16.756 1.00 0.00 ? 13  PRO A O    1  
ATOM 149   C CB   . PRO A 1 13  ? -18.841 -8.032  -16.062 1.00 0.00 ? 13  PRO A CB   1  
ATOM 150   C CG   . PRO A 1 13  ? -18.515 -8.324  -17.486 1.00 0.00 ? 13  PRO A CG   1  
ATOM 151   C CD   . PRO A 1 13  ? -19.682 -7.820  -18.290 1.00 0.00 ? 13  PRO A CD   1  
ATOM 152   H HA   . PRO A 1 13  ? -20.414 -6.757  -15.343 1.00 0.00 ? 13  PRO A HA   1  
ATOM 153   H HB2  . PRO A 1 13  ? -17.946 -7.881  -15.474 1.00 0.00 ? 13  PRO A HB2  1  
ATOM 154   H HB3  . PRO A 1 13  ? -19.438 -8.818  -15.625 1.00 0.00 ? 13  PRO A HB3  1  
ATOM 155   H HG2  . PRO A 1 13  ? -17.612 -7.805  -17.770 1.00 0.00 ? 13  PRO A HG2  1  
ATOM 156   H HG3  . PRO A 1 13  ? -18.397 -9.388  -17.625 1.00 0.00 ? 13  PRO A HG3  1  
ATOM 157   H HD2  . PRO A 1 13  ? -19.346 -7.434  -19.241 1.00 0.00 ? 13  PRO A HD2  1  
ATOM 158   H HD3  . PRO A 1 13  ? -20.408 -8.605  -18.434 1.00 0.00 ? 13  PRO A HD3  1  
ATOM 159   N N    . LYS A 1 14  ? -18.147 -5.462  -14.690 1.00 0.00 ? 14  LYS A N    1  
ATOM 160   C CA   . LYS A 1 14  ? -17.252 -4.364  -14.344 1.00 0.00 ? 14  LYS A CA   1  
ATOM 161   C C    . LYS A 1 14  ? -16.025 -4.357  -15.250 1.00 0.00 ? 14  LYS A C    1  
ATOM 162   O O    . LYS A 1 14  ? -15.767 -5.321  -15.970 1.00 0.00 ? 14  LYS A O    1  
ATOM 163   C CB   . LYS A 1 14  ? -16.819 -4.474  -12.881 1.00 0.00 ? 14  LYS A CB   1  
ATOM 164   C CG   . LYS A 1 14  ? -17.806 -3.857  -11.906 1.00 0.00 ? 14  LYS A CG   1  
ATOM 165   C CD   . LYS A 1 14  ? -18.858 -4.862  -11.467 1.00 0.00 ? 14  LYS A CD   1  
ATOM 166   C CE   . LYS A 1 14  ? -18.409 -5.637  -10.238 1.00 0.00 ? 14  LYS A CE   1  
ATOM 167   N NZ   . LYS A 1 14  ? -17.670 -6.877  -10.604 1.00 0.00 ? 14  LYS A NZ   1  
ATOM 168   H H    . LYS A 1 14  ? -18.315 -6.168  -14.030 1.00 0.00 ? 14  LYS A H    1  
ATOM 169   H HA   . LYS A 1 14  ? -17.792 -3.440  -14.483 1.00 0.00 ? 14  LYS A HA   1  
ATOM 170   H HB2  . LYS A 1 14  ? -16.701 -5.518  -12.630 1.00 0.00 ? 14  LYS A HB2  1  
ATOM 171   H HB3  . LYS A 1 14  ? -15.868 -3.975  -12.761 1.00 0.00 ? 14  LYS A HB3  1  
ATOM 172   H HG2  . LYS A 1 14  ? -17.270 -3.510  -11.035 1.00 0.00 ? 14  LYS A HG2  1  
ATOM 173   H HG3  . LYS A 1 14  ? -18.297 -3.022  -12.385 1.00 0.00 ? 14  LYS A HG3  1  
ATOM 174   H HD2  . LYS A 1 14  ? -19.771 -4.335  -11.232 1.00 0.00 ? 14  LYS A HD2  1  
ATOM 175   H HD3  . LYS A 1 14  ? -19.039 -5.557  -12.274 1.00 0.00 ? 14  LYS A HD3  1  
ATOM 176   H HE2  . LYS A 1 14  ? -17.764 -5.006  -9.645  1.00 0.00 ? 14  LYS A HE2  1  
ATOM 177   H HE3  . LYS A 1 14  ? -19.281 -5.905  -9.659  1.00 0.00 ? 14  LYS A HE3  1  
ATOM 178   H HZ1  . LYS A 1 14  ? -18.251 -7.466  -11.234 1.00 0.00 ? 14  LYS A HZ1  1  
ATOM 179   H HZ2  . LYS A 1 14  ? -17.445 -7.424  -9.749  1.00 0.00 ? 14  LYS A HZ2  1  
ATOM 180   H HZ3  . LYS A 1 14  ? -16.784 -6.635  -11.091 1.00 0.00 ? 14  LYS A HZ3  1  
ATOM 181   N N    . VAL A 1 15  ? -15.270 -3.264  -15.207 1.00 0.00 ? 15  VAL A N    1  
ATOM 182   C CA   . VAL A 1 15  ? -14.068 -3.133  -16.022 1.00 0.00 ? 15  VAL A CA   1  
ATOM 183   C C    . VAL A 1 15  ? -12.897 -2.615  -15.195 1.00 0.00 ? 15  VAL A C    1  
ATOM 184   O O    . VAL A 1 15  ? -13.061 -1.738  -14.346 1.00 0.00 ? 15  VAL A O    1  
ATOM 185   C CB   . VAL A 1 15  ? -14.299 -2.185  -17.214 1.00 0.00 ? 15  VAL A CB   1  
ATOM 186   C CG1  . VAL A 1 15  ? -15.299 -2.787  -18.189 1.00 0.00 ? 15  VAL A CG1  1  
ATOM 187   C CG2  . VAL A 1 15  ? -14.769 -0.822  -16.728 1.00 0.00 ? 15  VAL A CG2  1  
ATOM 188   H H    . VAL A 1 15  ? -15.527 -2.528  -14.613 1.00 0.00 ? 15  VAL A H    1  
ATOM 189   H HA   . VAL A 1 15  ? -13.818 -4.110  -16.409 1.00 0.00 ? 15  VAL A HA   1  
ATOM 190   H HB   . VAL A 1 15  ? -13.359 -2.055  -17.732 1.00 0.00 ? 15  VAL A HB   1  
ATOM 191   H HG11 . VAL A 1 15  ? -16.303 -2.574  -17.852 1.00 0.00 ? 15  VAL A HG11 1  
ATOM 192   H HG12 . VAL A 1 15  ? -15.149 -2.359  -19.170 1.00 0.00 ? 15  VAL A HG12 1  
ATOM 193   H HG13 . VAL A 1 15  ? -15.156 -3.857  -18.237 1.00 0.00 ? 15  VAL A HG13 1  
ATOM 194   H HG21 . VAL A 1 15  ? -15.377 -0.359  -17.491 1.00 0.00 ? 15  VAL A HG21 1  
ATOM 195   H HG22 . VAL A 1 15  ? -15.353 -0.943  -15.827 1.00 0.00 ? 15  VAL A HG22 1  
ATOM 196   H HG23 . VAL A 1 15  ? -13.913 -0.198  -16.521 1.00 0.00 ? 15  VAL A HG23 1  
ATOM 197   N N    . THR A 1 16  ? -11.712 -3.163  -15.448 1.00 0.00 ? 16  THR A N    1  
ATOM 198   C CA   . THR A 1 16  ? -10.513 -2.757  -14.726 1.00 0.00 ? 16  THR A CA   1  
ATOM 199   C C    . THR A 1 16  ? -9.809  -1.605  -15.434 1.00 0.00 ? 16  THR A C    1  
ATOM 200   O O    . THR A 1 16  ? -9.968  -1.415  -16.639 1.00 0.00 ? 16  THR A O    1  
ATOM 201   C CB   . THR A 1 16  ? -9.526  -3.930  -14.573 1.00 0.00 ? 16  THR A CB   1  
ATOM 202   O OG1  . THR A 1 16  ? -9.242  -4.502  -15.854 1.00 0.00 ? 16  THR A OG1  1  
ATOM 203   C CG2  . THR A 1 16  ? -10.093 -4.997  -13.649 1.00 0.00 ? 16  THR A CG2  1  
ATOM 204   H H    . THR A 1 16  ? -11.645 -3.857  -16.136 1.00 0.00 ? 16  THR A H    1  
ATOM 205   H HA   . THR A 1 16  ? -10.810 -2.433  -13.740 1.00 0.00 ? 16  THR A HA   1  
ATOM 206   H HB   . THR A 1 16  ? -8.608  -3.554  -14.143 1.00 0.00 ? 16  THR A HB   1  
ATOM 207   H HG1  . THR A 1 16  ? -9.869  -5.206  -16.036 1.00 0.00 ? 16  THR A HG1  1  
ATOM 208   H HG21 . THR A 1 16  ? -9.879  -4.737  -12.623 1.00 0.00 ? 16  THR A HG21 1  
ATOM 209   H HG22 . THR A 1 16  ? -9.642  -5.951  -13.881 1.00 0.00 ? 16  THR A HG22 1  
ATOM 210   H HG23 . THR A 1 16  ? -11.162 -5.061  -13.788 1.00 0.00 ? 16  THR A HG23 1  
ATOM 211   N N    . GLN A 1 17  ? -9.030  -0.839  -14.676 1.00 0.00 ? 17  GLN A N    1  
ATOM 212   C CA   . GLN A 1 17  ? -8.302  0.295   -15.233 1.00 0.00 ? 17  GLN A CA   1  
ATOM 213   C C    . GLN A 1 17  ? -6.906  0.397   -14.626 1.00 0.00 ? 17  GLN A C    1  
ATOM 214   O O    . GLN A 1 17  ? -6.739  0.298   -13.410 1.00 0.00 ? 17  GLN A O    1  
ATOM 215   C CB   . GLN A 1 17  ? -9.073  1.594   -14.988 1.00 0.00 ? 17  GLN A CB   1  
ATOM 216   C CG   . GLN A 1 17  ? -9.070  2.038   -13.534 1.00 0.00 ? 17  GLN A CG   1  
ATOM 217   C CD   . GLN A 1 17  ? -9.802  3.349   -13.323 1.00 0.00 ? 17  GLN A CD   1  
ATOM 218   O OE1  . GLN A 1 17  ? -9.612  4.307   -14.074 1.00 0.00 ? 17  GLN A OE1  1  
ATOM 219   N NE2  . GLN A 1 17  ? -10.644 3.399   -12.298 1.00 0.00 ? 17  GLN A NE2  1  
ATOM 220   H H    . GLN A 1 17  ? -8.944  -1.041  -13.722 1.00 0.00 ? 17  GLN A H    1  
ATOM 221   H HA   . GLN A 1 17  ? -8.207  0.139   -16.297 1.00 0.00 ? 17  GLN A HA   1  
ATOM 222   H HB2  . GLN A 1 17  ? -8.631  2.379   -15.583 1.00 0.00 ? 17  GLN A HB2  1  
ATOM 223   H HB3  . GLN A 1 17  ? -10.099 1.452   -15.296 1.00 0.00 ? 17  GLN A HB3  1  
ATOM 224   H HG2  . GLN A 1 17  ? -9.550  1.277   -12.937 1.00 0.00 ? 17  GLN A HG2  1  
ATOM 225   H HG3  . GLN A 1 17  ? -8.047  2.157   -13.210 1.00 0.00 ? 17  GLN A HG3  1  
ATOM 226   H HE21 . GLN A 1 17  ? -10.743 2.598   -11.742 1.00 0.00 ? 17  GLN A HE21 1  
ATOM 227   H HE22 . GLN A 1 17  ? -11.129 4.235   -12.138 1.00 0.00 ? 17  GLN A HE22 1  
ATOM 228   N N    . SER A 1 18  ? -5.908  0.595   -15.480 1.00 0.00 ? 18  SER A N    1  
ATOM 229   C CA   . SER A 1 18  ? -4.526  0.706   -15.028 1.00 0.00 ? 18  SER A CA   1  
ATOM 230   C C    . SER A 1 18  ? -4.142  2.166   -14.805 1.00 0.00 ? 18  SER A C    1  
ATOM 231   O O    . SER A 1 18  ? -4.049  2.946   -15.753 1.00 0.00 ? 18  SER A O    1  
ATOM 232   C CB   . SER A 1 18  ? -3.580  0.068   -16.048 1.00 0.00 ? 18  SER A CB   1  
ATOM 233   O OG   . SER A 1 18  ? -3.775  0.622   -17.338 1.00 0.00 ? 18  SER A OG   1  
ATOM 234   H H    . SER A 1 18  ? -6.105  0.666   -16.437 1.00 0.00 ? 18  SER A H    1  
ATOM 235   H HA   . SER A 1 18  ? -4.440  0.176   -14.091 1.00 0.00 ? 18  SER A HA   1  
ATOM 236   H HB2  . SER A 1 18  ? -2.559  0.241   -15.746 1.00 0.00 ? 18  SER A HB2  1  
ATOM 237   H HB3  . SER A 1 18  ? -3.768  -0.995  -16.093 1.00 0.00 ? 18  SER A HB3  1  
ATOM 238   H HG   . SER A 1 18  ? -4.034  1.543   -17.256 1.00 0.00 ? 18  SER A HG   1  
ATOM 239   N N    . ILE A 1 19  ? -3.922  2.527   -13.546 1.00 0.00 ? 19  ILE A N    1  
ATOM 240   C CA   . ILE A 1 19  ? -3.548  3.892   -13.198 1.00 0.00 ? 19  ILE A CA   1  
ATOM 241   C C    . ILE A 1 19  ? -2.102  3.961   -12.718 1.00 0.00 ? 19  ILE A C    1  
ATOM 242   O O    . ILE A 1 19  ? -1.793  3.583   -11.587 1.00 0.00 ? 19  ILE A O    1  
ATOM 243   C CB   . ILE A 1 19  ? -4.467  4.466   -12.104 1.00 0.00 ? 19  ILE A CB   1  
ATOM 244   C CG1  . ILE A 1 19  ? -5.894  4.621   -12.636 1.00 0.00 ? 19  ILE A CG1  1  
ATOM 245   C CG2  . ILE A 1 19  ? -3.933  5.802   -11.610 1.00 0.00 ? 19  ILE A CG2  1  
ATOM 246   C CD1  . ILE A 1 19  ? -6.954  4.519   -11.561 1.00 0.00 ? 19  ILE A CD1  1  
ATOM 247   H H    . ILE A 1 19  ? -4.012  1.860   -12.834 1.00 0.00 ? 19  ILE A H    1  
ATOM 248   H HA   . ILE A 1 19  ? -3.651  4.502   -14.084 1.00 0.00 ? 19  ILE A HA   1  
ATOM 249   H HB   . ILE A 1 19  ? -4.473  3.779   -11.272 1.00 0.00 ? 19  ILE A HB   1  
ATOM 250   H HG12 . ILE A 1 19  ? -5.993  5.586   -13.108 1.00 0.00 ? 19  ILE A HG12 1  
ATOM 251   H HG13 . ILE A 1 19  ? -6.084  3.847   -13.365 1.00 0.00 ? 19  ILE A HG13 1  
ATOM 252   H HG21 . ILE A 1 19  ? -4.672  6.276   -10.981 1.00 0.00 ? 19  ILE A HG21 1  
ATOM 253   H HG22 . ILE A 1 19  ? -3.029  5.640   -11.042 1.00 0.00 ? 19  ILE A HG22 1  
ATOM 254   H HG23 . ILE A 1 19  ? -3.718  6.439   -12.455 1.00 0.00 ? 19  ILE A HG23 1  
ATOM 255   H HD11 . ILE A 1 19  ? -7.808  3.984   -11.948 1.00 0.00 ? 19  ILE A HD11 1  
ATOM 256   H HD12 . ILE A 1 19  ? -6.553  3.992   -10.709 1.00 0.00 ? 19  ILE A HD12 1  
ATOM 257   H HD13 . ILE A 1 19  ? -7.257  5.511   -11.260 1.00 0.00 ? 19  ILE A HD13 1  
ATOM 258   N N    . HIS A 1 20  ? -1.219  4.447   -13.584 1.00 0.00 ? 20  HIS A N    1  
ATOM 259   C CA   . HIS A 1 20  ? 0.195   4.567   -13.248 1.00 0.00 ? 20  HIS A CA   1  
ATOM 260   C C    . HIS A 1 20  ? 0.533   5.993   -12.824 1.00 0.00 ? 20  HIS A C    1  
ATOM 261   O O    . HIS A 1 20  ? 0.214   6.952   -13.527 1.00 0.00 ? 20  HIS A O    1  
ATOM 262   C CB   . HIS A 1 20  ? 1.061   4.159   -14.441 1.00 0.00 ? 20  HIS A CB   1  
ATOM 263   C CG   . HIS A 1 20  ? 1.337   5.282   -15.392 1.00 0.00 ? 20  HIS A CG   1  
ATOM 264   N ND1  . HIS A 1 20  ? 2.521   5.989   -15.399 1.00 0.00 ? 20  HIS A ND1  1  
ATOM 265   C CD2  . HIS A 1 20  ? 0.575   5.818   -16.375 1.00 0.00 ? 20  HIS A CD2  1  
ATOM 266   C CE1  . HIS A 1 20  ? 2.475   6.913   -16.342 1.00 0.00 ? 20  HIS A CE1  1  
ATOM 267   N NE2  . HIS A 1 20  ? 1.305   6.830   -16.950 1.00 0.00 ? 20  HIS A NE2  1  
ATOM 268   H H    . HIS A 1 20  ? -1.526  4.731   -14.470 1.00 0.00 ? 20  HIS A H    1  
ATOM 269   H HA   . HIS A 1 20  ? 0.398   3.902   -12.423 1.00 0.00 ? 20  HIS A HA   1  
ATOM 270   H HB2  . HIS A 1 20  ? 2.010   3.791   -14.079 1.00 0.00 ? 20  HIS A HB2  1  
ATOM 271   H HB3  . HIS A 1 20  ? 0.561   3.374   -14.989 1.00 0.00 ? 20  HIS A HB3  1  
ATOM 272   H HD1  . HIS A 1 20  ? 3.281   5.838   -14.800 1.00 0.00 ? 20  HIS A HD1  1  
ATOM 273   H HD2  . HIS A 1 20  ? -0.422  5.508   -16.654 1.00 0.00 ? 20  HIS A HD2  1  
ATOM 274   H HE1  . HIS A 1 20  ? 3.259   7.616   -16.578 1.00 0.00 ? 20  HIS A HE1  1  
ATOM 275   H HE2  . HIS A 1 20  ? 0.977   7.453   -17.630 1.00 0.00 ? 20  HIS A HE2  1  
ATOM 276   N N    . ILE A 1 21  ? 1.179   6.125   -11.670 1.00 0.00 ? 21  ILE A N    1  
ATOM 277   C CA   . ILE A 1 21  ? 1.559   7.433   -11.153 1.00 0.00 ? 21  ILE A CA   1  
ATOM 278   C C    . ILE A 1 21  ? 3.061   7.662   -11.288 1.00 0.00 ? 21  ILE A C    1  
ATOM 279   O O    . ILE A 1 21  ? 3.862   6.770   -11.012 1.00 0.00 ? 21  ILE A O    1  
ATOM 280   C CB   . ILE A 1 21  ? 1.158   7.593   -9.674  1.00 0.00 ? 21  ILE A CB   1  
ATOM 281   C CG1  . ILE A 1 21  ? -0.232  7.000   -9.434  1.00 0.00 ? 21  ILE A CG1  1  
ATOM 282   C CG2  . ILE A 1 21  ? 1.192   9.059   -9.271  1.00 0.00 ? 21  ILE A CG2  1  
ATOM 283   C CD1  . ILE A 1 21  ? -0.518  6.702   -7.978  1.00 0.00 ? 21  ILE A CD1  1  
ATOM 284   H H    . ILE A 1 21  ? 1.405   5.323   -11.155 1.00 0.00 ? 21  ILE A H    1  
ATOM 285   H HA   . ILE A 1 21  ? 1.038   8.184   -11.729 1.00 0.00 ? 21  ILE A HA   1  
ATOM 286   H HB   . ILE A 1 21  ? 1.878   7.061   -9.070  1.00 0.00 ? 21  ILE A HB   1  
ATOM 287   H HG12 . ILE A 1 21  ? -0.978  7.697   -9.781  1.00 0.00 ? 21  ILE A HG12 1  
ATOM 288   H HG13 . ILE A 1 21  ? -0.322  6.077   -9.987  1.00 0.00 ? 21  ILE A HG13 1  
ATOM 289   H HG21 . ILE A 1 21  ? 2.200   9.436   -9.368  1.00 0.00 ? 21  ILE A HG21 1  
ATOM 290   H HG22 . ILE A 1 21  ? 0.535   9.624   -9.915  1.00 0.00 ? 21  ILE A HG22 1  
ATOM 291   H HG23 . ILE A 1 21  ? 0.867   9.159   -8.247  1.00 0.00 ? 21  ILE A HG23 1  
ATOM 292   H HD11 . ILE A 1 21  ? -0.969  7.567   -7.515  1.00 0.00 ? 21  ILE A HD11 1  
ATOM 293   H HD12 . ILE A 1 21  ? -1.192  5.862   -7.908  1.00 0.00 ? 21  ILE A HD12 1  
ATOM 294   H HD13 . ILE A 1 21  ? 0.406   6.464   -7.472  1.00 0.00 ? 21  ILE A HD13 1  
ATOM 295   N N    . GLU A 1 22  ? 3.434   8.865   -11.713 1.00 0.00 ? 22  GLU A N    1  
ATOM 296   C CA   . GLU A 1 22  ? 4.840   9.212   -11.884 1.00 0.00 ? 22  GLU A CA   1  
ATOM 297   C C    . GLU A 1 22  ? 5.144   10.573  -11.265 1.00 0.00 ? 22  GLU A C    1  
ATOM 298   O O    . GLU A 1 22  ? 4.447   11.554  -11.521 1.00 0.00 ? 22  GLU A O    1  
ATOM 299   C CB   . GLU A 1 22  ? 5.210   9.220   -13.369 1.00 0.00 ? 22  GLU A CB   1  
ATOM 300   C CG   . GLU A 1 22  ? 5.378   7.832   -13.962 1.00 0.00 ? 22  GLU A CG   1  
ATOM 301   C CD   . GLU A 1 22  ? 6.121   7.849   -15.284 1.00 0.00 ? 22  GLU A CD   1  
ATOM 302   O OE1  . GLU A 1 22  ? 6.966   8.748   -15.478 1.00 0.00 ? 22  GLU A OE1  1  
ATOM 303   O OE2  . GLU A 1 22  ? 5.858   6.964   -16.125 1.00 0.00 ? 22  GLU A OE2  1  
ATOM 304   H H    . GLU A 1 22  ? 2.749   9.535   -11.917 1.00 0.00 ? 22  GLU A H    1  
ATOM 305   H HA   . GLU A 1 22  ? 5.430   8.461   -11.380 1.00 0.00 ? 22  GLU A HA   1  
ATOM 306   H HB2  . GLU A 1 22  ? 4.433   9.733   -13.918 1.00 0.00 ? 22  GLU A HB2  1  
ATOM 307   H HB3  . GLU A 1 22  ? 6.139   9.757   -13.493 1.00 0.00 ? 22  GLU A HB3  1  
ATOM 308   H HG2  . GLU A 1 22  ? 5.931   7.221   -13.264 1.00 0.00 ? 22  GLU A HG2  1  
ATOM 309   H HG3  . GLU A 1 22  ? 4.401   7.401   -14.121 1.00 0.00 ? 22  GLU A HG3  1  
ATOM 310   N N    . LYS A 1 23  ? 6.191   10.624  -10.448 1.00 0.00 ? 23  LYS A N    1  
ATOM 311   C CA   . LYS A 1 23  ? 6.590   11.864  -9.792  1.00 0.00 ? 23  LYS A CA   1  
ATOM 312   C C    . LYS A 1 23  ? 7.833   12.453  -10.451 1.00 0.00 ? 23  LYS A C    1  
ATOM 313   O O    . LYS A 1 23  ? 8.489   11.796  -11.259 1.00 0.00 ? 23  LYS A O    1  
ATOM 314   C CB   . LYS A 1 23  ? 6.857   11.615  -8.305  1.00 0.00 ? 23  LYS A CB   1  
ATOM 315   C CG   . LYS A 1 23  ? 5.774   10.799  -7.621  1.00 0.00 ? 23  LYS A CG   1  
ATOM 316   C CD   . LYS A 1 23  ? 5.711   11.094  -6.132  1.00 0.00 ? 23  LYS A CD   1  
ATOM 317   C CE   . LYS A 1 23  ? 4.762   12.244  -5.831  1.00 0.00 ? 23  LYS A CE   1  
ATOM 318   N NZ   . LYS A 1 23  ? 5.139   13.481  -6.568  1.00 0.00 ? 23  LYS A NZ   1  
ATOM 319   H H    . LYS A 1 23  ? 6.709   9.808   -10.283 1.00 0.00 ? 23  LYS A H    1  
ATOM 320   H HA   . LYS A 1 23  ? 5.777   12.567  -9.890  1.00 0.00 ? 23  LYS A HA   1  
ATOM 321   H HB2  . LYS A 1 23  ? 7.794   11.088  -8.204  1.00 0.00 ? 23  LYS A HB2  1  
ATOM 322   H HB3  . LYS A 1 23  ? 6.933   12.568  -7.801  1.00 0.00 ? 23  LYS A HB3  1  
ATOM 323   H HG2  . LYS A 1 23  ? 4.819   11.040  -8.065  1.00 0.00 ? 23  LYS A HG2  1  
ATOM 324   H HG3  . LYS A 1 23  ? 5.984   9.748   -7.762  1.00 0.00 ? 23  LYS A HG3  1  
ATOM 325   H HD2  . LYS A 1 23  ? 5.365   10.212  -5.613  1.00 0.00 ? 23  LYS A HD2  1  
ATOM 326   H HD3  . LYS A 1 23  ? 6.700   11.354  -5.783  1.00 0.00 ? 23  LYS A HD3  1  
ATOM 327   H HE2  . LYS A 1 23  ? 3.763   11.954  -6.118  1.00 0.00 ? 23  LYS A HE2  1  
ATOM 328   H HE3  . LYS A 1 23  ? 4.787   12.445  -4.770  1.00 0.00 ? 23  LYS A HE3  1  
ATOM 329   H HZ1  . LYS A 1 23  ? 5.187   13.288  -7.589  1.00 0.00 ? 23  LYS A HZ1  1  
ATOM 330   H HZ2  . LYS A 1 23  ? 6.069   13.819  -6.248  1.00 0.00 ? 23  LYS A HZ2  1  
ATOM 331   H HZ3  . LYS A 1 23  ? 4.434   14.227  -6.400  1.00 0.00 ? 23  LYS A HZ3  1  
ATOM 332   N N    . SER A 1 24  ? 8.152   13.694  -10.099 1.00 0.00 ? 24  SER A N    1  
ATOM 333   C CA   . SER A 1 24  ? 9.315   14.372  -10.658 1.00 0.00 ? 24  SER A CA   1  
ATOM 334   C C    . SER A 1 24  ? 10.548  14.140  -9.791  1.00 0.00 ? 24  SER A C    1  
ATOM 335   O O    . SER A 1 24  ? 11.658  13.982  -10.300 1.00 0.00 ? 24  SER A O    1  
ATOM 336   C CB   . SER A 1 24  ? 9.044   15.872  -10.788 1.00 0.00 ? 24  SER A CB   1  
ATOM 337   O OG   . SER A 1 24  ? 8.477   16.181  -12.050 1.00 0.00 ? 24  SER A OG   1  
ATOM 338   H H    . SER A 1 24  ? 7.589   14.166  -9.449  1.00 0.00 ? 24  SER A H    1  
ATOM 339   H HA   . SER A 1 24  ? 9.498   13.962  -11.640 1.00 0.00 ? 24  SER A HA   1  
ATOM 340   H HB2  . SER A 1 24  ? 8.358   16.180  -10.014 1.00 0.00 ? 24  SER A HB2  1  
ATOM 341   H HB3  . SER A 1 24  ? 9.973   16.414  -10.682 1.00 0.00 ? 24  SER A HB3  1  
ATOM 342   H HG   . SER A 1 24  ? 7.939   15.443  -12.348 1.00 0.00 ? 24  SER A HG   1  
ATOM 343   N N    . ASP A 1 25  ? 10.345  14.121  -8.478  1.00 0.00 ? 25  ASP A N    1  
ATOM 344   C CA   . ASP A 1 25  ? 11.440  13.908  -7.538  1.00 0.00 ? 25  ASP A CA   1  
ATOM 345   C C    . ASP A 1 25  ? 10.928  13.289  -6.241  1.00 0.00 ? 25  ASP A C    1  
ATOM 346   O O    . ASP A 1 25  ? 10.001  13.806  -5.616  1.00 0.00 ? 25  ASP A O    1  
ATOM 347   C CB   . ASP A 1 25  ? 12.151  15.229  -7.242  1.00 0.00 ? 25  ASP A CB   1  
ATOM 348   C CG   . ASP A 1 25  ? 12.735  15.864  -8.489  1.00 0.00 ? 25  ASP A CG   1  
ATOM 349   O OD1  . ASP A 1 25  ? 11.963  16.460  -9.268  1.00 0.00 ? 25  ASP A OD1  1  
ATOM 350   O OD2  . ASP A 1 25  ? 13.965  15.764  -8.686  1.00 0.00 ? 25  ASP A OD2  1  
ATOM 351   H H    . ASP A 1 25  ? 9.437   14.254  -8.133  1.00 0.00 ? 25  ASP A H    1  
ATOM 352   H HA   . ASP A 1 25  ? 12.141  13.226  -7.995  1.00 0.00 ? 25  ASP A HA   1  
ATOM 353   H HB2  . ASP A 1 25  ? 11.446  15.921  -6.806  1.00 0.00 ? 25  ASP A HB2  1  
ATOM 354   H HB3  . ASP A 1 25  ? 12.954  15.049  -6.542  1.00 0.00 ? 25  ASP A HB3  1  
ATOM 355   N N    . THR A 1 26  ? 11.538  12.178  -5.840  1.00 0.00 ? 26  THR A N    1  
ATOM 356   C CA   . THR A 1 26  ? 11.144  11.487  -4.619  1.00 0.00 ? 26  THR A CA   1  
ATOM 357   C C    . THR A 1 26  ? 11.792  12.123  -3.394  1.00 0.00 ? 26  THR A C    1  
ATOM 358   O O    . THR A 1 26  ? 11.376  11.878  -2.262  1.00 0.00 ? 26  THR A O    1  
ATOM 359   C CB   . THR A 1 26  ? 11.523  9.995   -4.670  1.00 0.00 ? 26  THR A CB   1  
ATOM 360   O OG1  . THR A 1 26  ? 12.924  9.854   -4.926  1.00 0.00 ? 26  THR A OG1  1  
ATOM 361   C CG2  . THR A 1 26  ? 10.730  9.272   -5.748  1.00 0.00 ? 26  THR A CG2  1  
ATOM 362   H H    . THR A 1 26  ? 12.271  11.815  -6.381  1.00 0.00 ? 26  THR A H    1  
ATOM 363   H HA   . THR A 1 26  ? 10.070  11.562  -4.525  1.00 0.00 ? 26  THR A HA   1  
ATOM 364   H HB   . THR A 1 26  ? 11.292  9.548   -3.713  1.00 0.00 ? 26  THR A HB   1  
ATOM 365   H HG1  . THR A 1 26  ? 13.294  9.199   -4.329  1.00 0.00 ? 26  THR A HG1  1  
ATOM 366   H HG21 . THR A 1 26  ? 9.929   9.909   -6.094  1.00 0.00 ? 26  THR A HG21 1  
ATOM 367   H HG22 . THR A 1 26  ? 10.316  8.362   -5.342  1.00 0.00 ? 26  THR A HG22 1  
ATOM 368   H HG23 . THR A 1 26  ? 11.382  9.034   -6.575  1.00 0.00 ? 26  THR A HG23 1  
ATOM 369   N N    . ALA A 1 27  ? 12.813  12.941  -3.628  1.00 0.00 ? 27  ALA A N    1  
ATOM 370   C CA   . ALA A 1 27  ? 13.517  13.614  -2.544  1.00 0.00 ? 27  ALA A CA   1  
ATOM 371   C C    . ALA A 1 27  ? 12.594  14.574  -1.802  1.00 0.00 ? 27  ALA A C    1  
ATOM 372   O O    . ALA A 1 27  ? 12.750  14.797  -0.602  1.00 0.00 ? 27  ALA A O    1  
ATOM 373   C CB   . ALA A 1 27  ? 14.731  14.356  -3.083  1.00 0.00 ? 27  ALA A CB   1  
ATOM 374   H H    . ALA A 1 27  ? 13.099  13.096  -4.553  1.00 0.00 ? 27  ALA A H    1  
ATOM 375   H HA   . ALA A 1 27  ? 13.866  12.859  -1.853  1.00 0.00 ? 27  ALA A HA   1  
ATOM 376   H HB1  . ALA A 1 27  ? 15.200  13.764  -3.855  1.00 0.00 ? 27  ALA A HB1  1  
ATOM 377   H HB2  . ALA A 1 27  ? 14.419  15.304  -3.495  1.00 0.00 ? 27  ALA A HB2  1  
ATOM 378   H HB3  . ALA A 1 27  ? 15.434  14.526  -2.282  1.00 0.00 ? 27  ALA A HB3  1  
ATOM 379   N N    . ALA A 1 28  ? 11.632  15.139  -2.524  1.00 0.00 ? 28  ALA A N    1  
ATOM 380   C CA   . ALA A 1 28  ? 10.683  16.074  -1.934  1.00 0.00 ? 28  ALA A CA   1  
ATOM 381   C C    . ALA A 1 28  ? 9.248   15.698  -2.289  1.00 0.00 ? 28  ALA A C    1  
ATOM 382   O O    . ALA A 1 28  ? 8.428   15.439  -1.409  1.00 0.00 ? 28  ALA A O    1  
ATOM 383   C CB   . ALA A 1 28  ? 10.987  17.494  -2.390  1.00 0.00 ? 28  ALA A CB   1  
ATOM 384   H H    . ALA A 1 28  ? 11.559  14.921  -3.477  1.00 0.00 ? 28  ALA A H    1  
ATOM 385   H HA   . ALA A 1 28  ? 10.799  16.034  -0.860  1.00 0.00 ? 28  ALA A HA   1  
ATOM 386   H HB1  . ALA A 1 28  ? 12.053  17.607  -2.524  1.00 0.00 ? 28  ALA A HB1  1  
ATOM 387   H HB2  . ALA A 1 28  ? 10.483  17.687  -3.325  1.00 0.00 ? 28  ALA A HB2  1  
ATOM 388   H HB3  . ALA A 1 28  ? 10.642  18.193  -1.643  1.00 0.00 ? 28  ALA A HB3  1  
ATOM 389   N N    . ASP A 1 29  ? 8.953   15.671  -3.584  1.00 0.00 ? 29  ASP A N    1  
ATOM 390   C CA   . ASP A 1 29  ? 7.617   15.327  -4.056  1.00 0.00 ? 29  ASP A CA   1  
ATOM 391   C C    . ASP A 1 29  ? 7.306   13.858  -3.784  1.00 0.00 ? 29  ASP A C    1  
ATOM 392   O O    . ASP A 1 29  ? 7.688   12.978  -4.556  1.00 0.00 ? 29  ASP A O    1  
ATOM 393   C CB   . ASP A 1 29  ? 7.490   15.619  -5.552  1.00 0.00 ? 29  ASP A CB   1  
ATOM 394   C CG   . ASP A 1 29  ? 8.150   16.926  -5.945  1.00 0.00 ? 29  ASP A CG   1  
ATOM 395   O OD1  . ASP A 1 29  ? 7.797   17.970  -5.358  1.00 0.00 ? 29  ASP A OD1  1  
ATOM 396   O OD2  . ASP A 1 29  ? 9.022   16.905  -6.839  1.00 0.00 ? 29  ASP A OD2  1  
ATOM 397   H H    . ASP A 1 29  ? 9.650   15.888  -4.238  1.00 0.00 ? 29  ASP A H    1  
ATOM 398   H HA   . ASP A 1 29  ? 6.907   15.937  -3.519  1.00 0.00 ? 29  ASP A HA   1  
ATOM 399   H HB2  . ASP A 1 29  ? 7.957   14.820  -6.109  1.00 0.00 ? 29  ASP A HB2  1  
ATOM 400   H HB3  . ASP A 1 29  ? 6.444   15.671  -5.815  1.00 0.00 ? 29  ASP A HB3  1  
ATOM 401   N N    . THR A 1 30  ? 6.612   13.600  -2.680  1.00 0.00 ? 30  THR A N    1  
ATOM 402   C CA   . THR A 1 30  ? 6.252   12.239  -2.304  1.00 0.00 ? 30  THR A CA   1  
ATOM 403   C C    . THR A 1 30  ? 4.739   12.057  -2.280  1.00 0.00 ? 30  THR A C    1  
ATOM 404   O O    . THR A 1 30  ? 4.004   12.944  -1.845  1.00 0.00 ? 30  THR A O    1  
ATOM 405   C CB   . THR A 1 30  ? 6.825   11.867  -0.924  1.00 0.00 ? 30  THR A CB   1  
ATOM 406   O OG1  . THR A 1 30  ? 6.258   12.711  0.085   1.00 0.00 ? 30  THR A OG1  1  
ATOM 407   C CG2  . THR A 1 30  ? 8.340   12.002  -0.912  1.00 0.00 ? 30  THR A CG2  1  
ATOM 408   H H    . THR A 1 30  ? 6.336   14.344  -2.105  1.00 0.00 ? 30  THR A H    1  
ATOM 409   H HA   . THR A 1 30  ? 6.674   11.568  -3.038  1.00 0.00 ? 30  THR A HA   1  
ATOM 410   H HB   . THR A 1 30  ? 6.568   10.840  -0.709  1.00 0.00 ? 30  THR A HB   1  
ATOM 411   H HG1  . THR A 1 30  ? 6.151   13.599  -0.264  1.00 0.00 ? 30  THR A HG1  1  
ATOM 412   H HG21 . THR A 1 30  ? 8.783   11.126  -1.363  1.00 0.00 ? 30  THR A HG21 1  
ATOM 413   H HG22 . THR A 1 30  ? 8.685   12.096  0.107   1.00 0.00 ? 30  THR A HG22 1  
ATOM 414   H HG23 . THR A 1 30  ? 8.627   12.878  -1.473  1.00 0.00 ? 30  THR A HG23 1  
ATOM 415   N N    . TYR A 1 31  ? 4.279   10.902  -2.749  1.00 0.00 ? 31  TYR A N    1  
ATOM 416   C CA   . TYR A 1 31  ? 2.852   10.605  -2.783  1.00 0.00 ? 31  TYR A CA   1  
ATOM 417   C C    . TYR A 1 31  ? 2.172   11.050  -1.491  1.00 0.00 ? 31  TYR A C    1  
ATOM 418   O O    . TYR A 1 31  ? 2.830   11.278  -0.477  1.00 0.00 ? 31  TYR A O    1  
ATOM 419   C CB   . TYR A 1 31  ? 2.626   9.108   -3.001  1.00 0.00 ? 31  TYR A CB   1  
ATOM 420   C CG   . TYR A 1 31  ? 3.420   8.538   -4.154  1.00 0.00 ? 31  TYR A CG   1  
ATOM 421   C CD1  . TYR A 1 31  ? 3.187   8.956   -5.458  1.00 0.00 ? 31  TYR A CD1  1  
ATOM 422   C CD2  . TYR A 1 31  ? 4.405   7.581   -3.940  1.00 0.00 ? 31  TYR A CD2  1  
ATOM 423   C CE1  . TYR A 1 31  ? 3.909   8.438   -6.515  1.00 0.00 ? 31  TYR A CE1  1  
ATOM 424   C CE2  . TYR A 1 31  ? 5.133   7.058   -4.991  1.00 0.00 ? 31  TYR A CE2  1  
ATOM 425   C CZ   . TYR A 1 31  ? 4.882   7.489   -6.276  1.00 0.00 ? 31  TYR A CZ   1  
ATOM 426   O OH   . TYR A 1 31  ? 5.604   6.970   -7.326  1.00 0.00 ? 31  TYR A OH   1  
ATOM 427   H H    . TYR A 1 31  ? 4.914   10.234  -3.083  1.00 0.00 ? 31  TYR A H    1  
ATOM 428   H HA   . TYR A 1 31  ? 2.419   11.148  -3.610  1.00 0.00 ? 31  TYR A HA   1  
ATOM 429   H HB2  . TYR A 1 31  ? 2.911   8.574   -2.107  1.00 0.00 ? 31  TYR A HB2  1  
ATOM 430   H HB3  . TYR A 1 31  ? 1.579   8.934   -3.200  1.00 0.00 ? 31  TYR A HB3  1  
ATOM 431   H HD1  . TYR A 1 31  ? 2.425   9.700   -5.642  1.00 0.00 ? 31  TYR A HD1  1  
ATOM 432   H HD2  . TYR A 1 31  ? 4.600   7.245   -2.932  1.00 0.00 ? 31  TYR A HD2  1  
ATOM 433   H HE1  . TYR A 1 31  ? 3.713   8.775   -7.522  1.00 0.00 ? 31  TYR A HE1  1  
ATOM 434   H HE2  . TYR A 1 31  ? 5.894   6.314   -4.804  1.00 0.00 ? 31  TYR A HE2  1  
ATOM 435   H HH   . TYR A 1 31  ? 6.190   6.282   -7.003  1.00 0.00 ? 31  TYR A HH   1  
ATOM 436   N N    . GLY A 1 32  ? 0.849   11.171  -1.538  1.00 0.00 ? 32  GLY A N    1  
ATOM 437   C CA   . GLY A 1 32  ? 0.100   11.587  -0.366  1.00 0.00 ? 32  GLY A CA   1  
ATOM 438   C C    . GLY A 1 32  ? -1.084  10.685  -0.084  1.00 0.00 ? 32  GLY A C    1  
ATOM 439   O O    . GLY A 1 32  ? -2.013  11.071  0.626   1.00 0.00 ? 32  GLY A O    1  
ATOM 440   H H    . GLY A 1 32  ? 0.377   10.975  -2.374  1.00 0.00 ? 32  GLY A H    1  
ATOM 441   H HA2  . GLY A 1 32  ? 0.758   11.579  0.490   1.00 0.00 ? 32  GLY A HA2  1  
ATOM 442   H HA3  . GLY A 1 32  ? -0.259  12.594  -0.522  1.00 0.00 ? 32  GLY A HA3  1  
ATOM 443   N N    . PHE A 1 33  ? -1.054  9.479   -0.642  1.00 0.00 ? 33  PHE A N    1  
ATOM 444   C CA   . PHE A 1 33  ? -2.135  8.520   -0.448  1.00 0.00 ? 33  PHE A CA   1  
ATOM 445   C C    . PHE A 1 33  ? -1.664  7.331   0.384   1.00 0.00 ? 33  PHE A C    1  
ATOM 446   O O    . PHE A 1 33  ? -0.590  6.778   0.145   1.00 0.00 ? 33  PHE A O    1  
ATOM 447   C CB   . PHE A 1 33  ? -2.661  8.033   -1.800  1.00 0.00 ? 33  PHE A CB   1  
ATOM 448   C CG   . PHE A 1 33  ? -1.936  6.828   -2.328  1.00 0.00 ? 33  PHE A CG   1  
ATOM 449   C CD1  . PHE A 1 33  ? -0.610  6.917   -2.717  1.00 0.00 ? 33  PHE A CD1  1  
ATOM 450   C CD2  . PHE A 1 33  ? -2.581  5.606   -2.433  1.00 0.00 ? 33  PHE A CD2  1  
ATOM 451   C CE1  . PHE A 1 33  ? 0.060   5.810   -3.203  1.00 0.00 ? 33  PHE A CE1  1  
ATOM 452   C CE2  . PHE A 1 33  ? -1.917  4.496   -2.919  1.00 0.00 ? 33  PHE A CE2  1  
ATOM 453   C CZ   . PHE A 1 33  ? -0.595  4.597   -3.303  1.00 0.00 ? 33  PHE A CZ   1  
ATOM 454   H H    . PHE A 1 33  ? -0.286  9.229   -1.198  1.00 0.00 ? 33  PHE A H    1  
ATOM 455   H HA   . PHE A 1 33  ? -2.931  9.021   0.080   1.00 0.00 ? 33  PHE A HA   1  
ATOM 456   H HB2  . PHE A 1 33  ? -3.705  7.774   -1.700  1.00 0.00 ? 33  PHE A HB2  1  
ATOM 457   H HB3  . PHE A 1 33  ? -2.559  8.827   -2.525  1.00 0.00 ? 33  PHE A HB3  1  
ATOM 458   H HD1  . PHE A 1 33  ? -0.096  7.864   -2.638  1.00 0.00 ? 33  PHE A HD1  1  
ATOM 459   H HD2  . PHE A 1 33  ? -3.617  5.526   -2.133  1.00 0.00 ? 33  PHE A HD2  1  
ATOM 460   H HE1  . PHE A 1 33  ? 1.094   5.892   -3.503  1.00 0.00 ? 33  PHE A HE1  1  
ATOM 461   H HE2  . PHE A 1 33  ? -2.432  3.549   -2.996  1.00 0.00 ? 33  PHE A HE2  1  
ATOM 462   H HZ   . PHE A 1 33  ? -0.074  3.731   -3.683  1.00 0.00 ? 33  PHE A HZ   1  
ATOM 463   N N    . SER A 1 34  ? -2.475  6.944   1.363   1.00 0.00 ? 34  SER A N    1  
ATOM 464   C CA   . SER A 1 34  ? -2.141  5.823   2.235   1.00 0.00 ? 34  SER A CA   1  
ATOM 465   C C    . SER A 1 34  ? -2.893  4.564   1.815   1.00 0.00 ? 34  SER A C    1  
ATOM 466   O O    . SER A 1 34  ? -3.971  4.639   1.224   1.00 0.00 ? 34  SER A O    1  
ATOM 467   C CB   . SER A 1 34  ? -2.470  6.166   3.690   1.00 0.00 ? 34  SER A CB   1  
ATOM 468   O OG   . SER A 1 34  ? -3.607  7.007   3.771   1.00 0.00 ? 34  SER A OG   1  
ATOM 469   H H    . SER A 1 34  ? -3.318  7.425   1.504   1.00 0.00 ? 34  SER A H    1  
ATOM 470   H HA   . SER A 1 34  ? -1.080  5.641   2.148   1.00 0.00 ? 34  SER A HA   1  
ATOM 471   H HB2  . SER A 1 34  ? -2.671  5.256   4.234   1.00 0.00 ? 34  SER A HB2  1  
ATOM 472   H HB3  . SER A 1 34  ? -1.627  6.674   4.136   1.00 0.00 ? 34  SER A HB3  1  
ATOM 473   H HG   . SER A 1 34  ? -3.382  7.882   3.446   1.00 0.00 ? 34  SER A HG   1  
ATOM 474   N N    . LEU A 1 35  ? -2.317  3.408   2.124   1.00 0.00 ? 35  LEU A N    1  
ATOM 475   C CA   . LEU A 1 35  ? -2.931  2.131   1.779   1.00 0.00 ? 35  LEU A CA   1  
ATOM 476   C C    . LEU A 1 35  ? -3.224  1.311   3.031   1.00 0.00 ? 35  LEU A C    1  
ATOM 477   O O    . LEU A 1 35  ? -2.330  1.044   3.834   1.00 0.00 ? 35  LEU A O    1  
ATOM 478   C CB   . LEU A 1 35  ? -2.017  1.340   0.841   1.00 0.00 ? 35  LEU A CB   1  
ATOM 479   C CG   . LEU A 1 35  ? -2.140  1.666   -0.648  1.00 0.00 ? 35  LEU A CG   1  
ATOM 480   C CD1  . LEU A 1 35  ? -1.317  0.692   -1.477  1.00 0.00 ? 35  LEU A CD1  1  
ATOM 481   C CD2  . LEU A 1 35  ? -3.598  1.638   -1.082  1.00 0.00 ? 35  LEU A CD2  1  
ATOM 482   H H    . LEU A 1 35  ? -1.458  3.412   2.595   1.00 0.00 ? 35  LEU A H    1  
ATOM 483   H HA   . LEU A 1 35  ? -3.862  2.337   1.272   1.00 0.00 ? 35  LEU A HA   1  
ATOM 484   H HB2  . LEU A 1 35  ? -0.997  1.528   1.137   1.00 0.00 ? 35  LEU A HB2  1  
ATOM 485   H HB3  . LEU A 1 35  ? -2.241  0.290   0.970   1.00 0.00 ? 35  LEU A HB3  1  
ATOM 486   H HG   . LEU A 1 35  ? -1.756  2.661   -0.825  1.00 0.00 ? 35  LEU A HG   1  
ATOM 487   H HD11 . LEU A 1 35  ? -1.602  -0.320  -1.232  1.00 0.00 ? 35  LEU A HD11 1  
ATOM 488   H HD12 . LEU A 1 35  ? -0.268  0.832   -1.261  1.00 0.00 ? 35  LEU A HD12 1  
ATOM 489   H HD13 . LEU A 1 35  ? -1.496  0.873   -2.527  1.00 0.00 ? 35  LEU A HD13 1  
ATOM 490   H HD21 . LEU A 1 35  ? -4.087  2.546   -0.758  1.00 0.00 ? 35  LEU A HD21 1  
ATOM 491   H HD22 . LEU A 1 35  ? -4.090  0.786   -0.636  1.00 0.00 ? 35  LEU A HD22 1  
ATOM 492   H HD23 . LEU A 1 35  ? -3.653  1.564   -2.158  1.00 0.00 ? 35  LEU A HD23 1  
ATOM 493   N N    . SER A 1 36  ? -4.483  0.914   3.191   1.00 0.00 ? 36  SER A N    1  
ATOM 494   C CA   . SER A 1 36  ? -4.895  0.126   4.347   1.00 0.00 ? 36  SER A CA   1  
ATOM 495   C C    . SER A 1 36  ? -5.141  -1.327  3.954   1.00 0.00 ? 36  SER A C    1  
ATOM 496   O O    . SER A 1 36  ? -5.435  -1.627  2.797   1.00 0.00 ? 36  SER A O    1  
ATOM 497   C CB   . SER A 1 36  ? -6.160  0.720   4.970   1.00 0.00 ? 36  SER A CB   1  
ATOM 498   O OG   . SER A 1 36  ? -6.494  0.055   6.177   1.00 0.00 ? 36  SER A OG   1  
ATOM 499   H H    . SER A 1 36  ? -5.150  1.159   2.516   1.00 0.00 ? 36  SER A H    1  
ATOM 500   H HA   . SER A 1 36  ? -4.096  0.160   5.073   1.00 0.00 ? 36  SER A HA   1  
ATOM 501   H HB2  . SER A 1 36  ? -5.997  1.765   5.182   1.00 0.00 ? 36  SER A HB2  1  
ATOM 502   H HB3  . SER A 1 36  ? -6.982  0.616   4.277   1.00 0.00 ? 36  SER A HB3  1  
ATOM 503   H HG   . SER A 1 36  ? -7.297  0.436   6.540   1.00 0.00 ? 36  SER A HG   1  
ATOM 504   N N    . SER A 1 37  ? -5.020  -2.225  4.926   1.00 0.00 ? 37  SER A N    1  
ATOM 505   C CA   . SER A 1 37  ? -5.226  -3.648  4.682   1.00 0.00 ? 37  SER A CA   1  
ATOM 506   C C    . SER A 1 37  ? -6.460  -4.153  5.423   1.00 0.00 ? 37  SER A C    1  
ATOM 507   O O    . SER A 1 37  ? -6.636  -3.889  6.613   1.00 0.00 ? 37  SER A O    1  
ATOM 508   C CB   . SER A 1 37  ? -3.994  -4.445  5.118   1.00 0.00 ? 37  SER A CB   1  
ATOM 509   O OG   . SER A 1 37  ? -3.631  -4.134  6.451   1.00 0.00 ? 37  SER A OG   1  
ATOM 510   H H    . SER A 1 37  ? -4.784  -1.923  5.829   1.00 0.00 ? 37  SER A H    1  
ATOM 511   H HA   . SER A 1 37  ? -5.376  -3.784  3.622   1.00 0.00 ? 37  SER A HA   1  
ATOM 512   H HB2  . SER A 1 37  ? -4.210  -5.500  5.053   1.00 0.00 ? 37  SER A HB2  1  
ATOM 513   H HB3  . SER A 1 37  ? -3.166  -4.206  4.466   1.00 0.00 ? 37  SER A HB3  1  
ATOM 514   H HG   . SER A 1 37  ? -2.808  -3.639  6.452   1.00 0.00 ? 37  SER A HG   1  
ATOM 515   N N    . VAL A 1 38  ? -7.313  -4.882  4.710   1.00 0.00 ? 38  VAL A N    1  
ATOM 516   C CA   . VAL A 1 38  ? -8.531  -5.426  5.298   1.00 0.00 ? 38  VAL A CA   1  
ATOM 517   C C    . VAL A 1 38  ? -8.608  -6.936  5.104   1.00 0.00 ? 38  VAL A C    1  
ATOM 518   O O    . VAL A 1 38  ? -8.697  -7.423  3.978   1.00 0.00 ? 38  VAL A O    1  
ATOM 519   C CB   . VAL A 1 38  ? -9.788  -4.777  4.689   1.00 0.00 ? 38  VAL A CB   1  
ATOM 520   C CG1  . VAL A 1 38  ? -11.041 -5.267  5.398   1.00 0.00 ? 38  VAL A CG1  1  
ATOM 521   C CG2  . VAL A 1 38  ? -9.688  -3.260  4.753   1.00 0.00 ? 38  VAL A CG2  1  
ATOM 522   H H    . VAL A 1 38  ? -7.118  -5.059  3.766   1.00 0.00 ? 38  VAL A H    1  
ATOM 523   H HA   . VAL A 1 38  ? -8.517  -5.209  6.357   1.00 0.00 ? 38  VAL A HA   1  
ATOM 524   H HB   . VAL A 1 38  ? -9.851  -5.068  3.650   1.00 0.00 ? 38  VAL A HB   1  
ATOM 525   H HG11 . VAL A 1 38  ? -10.999 -6.342  5.498   1.00 0.00 ? 38  VAL A HG11 1  
ATOM 526   H HG12 . VAL A 1 38  ? -11.101 -4.815  6.377   1.00 0.00 ? 38  VAL A HG12 1  
ATOM 527   H HG13 . VAL A 1 38  ? -11.911 -4.993  4.821   1.00 0.00 ? 38  VAL A HG13 1  
ATOM 528   H HG21 . VAL A 1 38  ? -10.559 -2.864  5.252   1.00 0.00 ? 38  VAL A HG21 1  
ATOM 529   H HG22 . VAL A 1 38  ? -8.800  -2.980  5.302   1.00 0.00 ? 38  VAL A HG22 1  
ATOM 530   H HG23 . VAL A 1 38  ? -9.632  -2.860  3.752   1.00 0.00 ? 38  VAL A HG23 1  
ATOM 531   N N    . GLU A 1 39  ? -8.574  -7.672  6.211   1.00 0.00 ? 39  GLU A N    1  
ATOM 532   C CA   . GLU A 1 39  ? -8.639  -9.128  6.162   1.00 0.00 ? 39  GLU A CA   1  
ATOM 533   C C    . GLU A 1 39  ? -10.072 -9.615  6.355   1.00 0.00 ? 39  GLU A C    1  
ATOM 534   O O    . GLU A 1 39  ? -10.740 -9.243  7.320   1.00 0.00 ? 39  GLU A O    1  
ATOM 535   C CB   . GLU A 1 39  ? -7.733  -9.738  7.233   1.00 0.00 ? 39  GLU A CB   1  
ATOM 536   C CG   . GLU A 1 39  ? -7.236  -11.132 6.889   1.00 0.00 ? 39  GLU A CG   1  
ATOM 537   C CD   . GLU A 1 39  ? -6.968  -11.976 8.119   1.00 0.00 ? 39  GLU A CD   1  
ATOM 538   O OE1  . GLU A 1 39  ? -5.965  -11.710 8.814   1.00 0.00 ? 39  GLU A OE1  1  
ATOM 539   O OE2  . GLU A 1 39  ? -7.761  -12.903 8.388   1.00 0.00 ? 39  GLU A OE2  1  
ATOM 540   H H    . GLU A 1 39  ? -8.502  -7.226  7.080   1.00 0.00 ? 39  GLU A H    1  
ATOM 541   H HA   . GLU A 1 39  ? -8.293  -9.443  5.189   1.00 0.00 ? 39  GLU A HA   1  
ATOM 542   H HB2  . GLU A 1 39  ? -6.875  -9.096  7.370   1.00 0.00 ? 39  GLU A HB2  1  
ATOM 543   H HB3  . GLU A 1 39  ? -8.281  -9.793  8.162   1.00 0.00 ? 39  GLU A HB3  1  
ATOM 544   H HG2  . GLU A 1 39  ? -7.983  -11.628 6.287   1.00 0.00 ? 39  GLU A HG2  1  
ATOM 545   H HG3  . GLU A 1 39  ? -6.320  -11.045 6.323   1.00 0.00 ? 39  GLU A HG3  1  
ATOM 546   N N    . GLU A 1 40  ? -10.538 -10.449 5.430   1.00 0.00 ? 40  GLU A N    1  
ATOM 547   C CA   . GLU A 1 40  ? -11.892 -10.985 5.499   1.00 0.00 ? 40  GLU A CA   1  
ATOM 548   C C    . GLU A 1 40  ? -11.937 -12.417 4.972   1.00 0.00 ? 40  GLU A C    1  
ATOM 549   O O    . GLU A 1 40  ? -11.625 -12.671 3.809   1.00 0.00 ? 40  GLU A O    1  
ATOM 550   C CB   . GLU A 1 40  ? -12.854 -10.105 4.698   1.00 0.00 ? 40  GLU A CB   1  
ATOM 551   C CG   . GLU A 1 40  ? -12.800 -8.636  5.085   1.00 0.00 ? 40  GLU A CG   1  
ATOM 552   C CD   . GLU A 1 40  ? -13.734 -7.779  4.253   1.00 0.00 ? 40  GLU A CD   1  
ATOM 553   O OE1  . GLU A 1 40  ? -14.956 -7.812  4.509   1.00 0.00 ? 40  GLU A OE1  1  
ATOM 554   O OE2  . GLU A 1 40  ? -13.243 -7.075  3.346   1.00 0.00 ? 40  GLU A OE2  1  
ATOM 555   H H    . GLU A 1 40  ? -9.958  -10.708 4.685   1.00 0.00 ? 40  GLU A H    1  
ATOM 556   H HA   . GLU A 1 40  ? -12.197 -10.986 6.534   1.00 0.00 ? 40  GLU A HA   1  
ATOM 557   H HB2  . GLU A 1 40  ? -12.612 -10.189 3.649   1.00 0.00 ? 40  GLU A HB2  1  
ATOM 558   H HB3  . GLU A 1 40  ? -13.862 -10.459 4.856   1.00 0.00 ? 40  GLU A HB3  1  
ATOM 559   H HG2  . GLU A 1 40  ? -13.077 -8.540  6.124   1.00 0.00 ? 40  GLU A HG2  1  
ATOM 560   H HG3  . GLU A 1 40  ? -11.790 -8.278  4.949   1.00 0.00 ? 40  GLU A HG3  1  
ATOM 561   N N    . ASP A 1 41  ? -12.328 -13.347 5.836   1.00 0.00 ? 41  ASP A N    1  
ATOM 562   C CA   . ASP A 1 41  ? -12.415 -14.753 5.459   1.00 0.00 ? 41  ASP A CA   1  
ATOM 563   C C    . ASP A 1 41  ? -11.052 -15.285 5.028   1.00 0.00 ? 41  ASP A C    1  
ATOM 564   O O    . ASP A 1 41  ? -10.962 -16.196 4.206   1.00 0.00 ? 41  ASP A O    1  
ATOM 565   C CB   . ASP A 1 41  ? -13.430 -14.938 4.330   1.00 0.00 ? 41  ASP A CB   1  
ATOM 566   C CG   . ASP A 1 41  ? -14.853 -14.674 4.781   1.00 0.00 ? 41  ASP A CG   1  
ATOM 567   O OD1  . ASP A 1 41  ? -15.070 -13.681 5.508   1.00 0.00 ? 41  ASP A OD1  1  
ATOM 568   O OD2  . ASP A 1 41  ? -15.749 -15.459 4.407   1.00 0.00 ? 41  ASP A OD2  1  
ATOM 569   H H    . ASP A 1 41  ? -12.564 -13.081 6.750   1.00 0.00 ? 41  ASP A H    1  
ATOM 570   H HA   . ASP A 1 41  ? -12.747 -15.308 6.323   1.00 0.00 ? 41  ASP A HA   1  
ATOM 571   H HB2  . ASP A 1 41  ? -13.194 -14.255 3.527   1.00 0.00 ? 41  ASP A HB2  1  
ATOM 572   H HB3  . ASP A 1 41  ? -13.369 -15.952 3.963   1.00 0.00 ? 41  ASP A HB3  1  
ATOM 573   N N    . GLY A 1 42  ? -9.993  -14.709 5.588   1.00 0.00 ? 42  GLY A N    1  
ATOM 574   C CA   . GLY A 1 42  ? -8.648  -15.137 5.248   1.00 0.00 ? 42  GLY A CA   1  
ATOM 575   C C    . GLY A 1 42  ? -8.108  -14.431 4.020   1.00 0.00 ? 42  GLY A C    1  
ATOM 576   O O    . GLY A 1 42  ? -6.914  -14.505 3.728   1.00 0.00 ? 42  GLY A O    1  
ATOM 577   H H    . GLY A 1 42  ? -10.125 -13.986 6.237   1.00 0.00 ? 42  GLY A H    1  
ATOM 578   H HA2  . GLY A 1 42  ? -7.995  -14.934 6.083   1.00 0.00 ? 42  GLY A HA2  1  
ATOM 579   H HA3  . GLY A 1 42  ? -8.659  -16.201 5.061   1.00 0.00 ? 42  GLY A HA3  1  
ATOM 580   N N    . ILE A 1 43  ? -8.989  -13.746 3.298   1.00 0.00 ? 43  ILE A N    1  
ATOM 581   C CA   . ILE A 1 43  ? -8.593  -13.025 2.094   1.00 0.00 ? 43  ILE A CA   1  
ATOM 582   C C    . ILE A 1 43  ? -8.177  -11.595 2.422   1.00 0.00 ? 43  ILE A C    1  
ATOM 583   O O    . ILE A 1 43  ? -9.020  -10.741 2.696   1.00 0.00 ? 43  ILE A O    1  
ATOM 584   C CB   . ILE A 1 43  ? -9.731  -12.992 1.058   1.00 0.00 ? 43  ILE A CB   1  
ATOM 585   C CG1  . ILE A 1 43  ? -10.436 -14.349 0.999   1.00 0.00 ? 43  ILE A CG1  1  
ATOM 586   C CG2  . ILE A 1 43  ? -9.190  -12.611 -0.312  1.00 0.00 ? 43  ILE A CG2  1  
ATOM 587   C CD1  . ILE A 1 43  ? -11.776 -14.304 0.298   1.00 0.00 ? 43  ILE A CD1  1  
ATOM 588   H H    . ILE A 1 43  ? -9.926  -13.725 3.581   1.00 0.00 ? 43  ILE A H    1  
ATOM 589   H HA   . ILE A 1 43  ? -7.750  -13.543 1.658   1.00 0.00 ? 43  ILE A HA   1  
ATOM 590   H HB   . ILE A 1 43  ? -10.442 -12.238 1.360   1.00 0.00 ? 43  ILE A HB   1  
ATOM 591   H HG12 . ILE A 1 43  ? -9.810  -15.051 0.471   1.00 0.00 ? 43  ILE A HG12 1  
ATOM 592   H HG13 . ILE A 1 43  ? -10.600 -14.705 2.006   1.00 0.00 ? 43  ILE A HG13 1  
ATOM 593   H HG21 . ILE A 1 43  ? -8.436  -11.846 -0.200  1.00 0.00 ? 43  ILE A HG21 1  
ATOM 594   H HG22 . ILE A 1 43  ? -8.752  -13.480 -0.780  1.00 0.00 ? 43  ILE A HG22 1  
ATOM 595   H HG23 . ILE A 1 43  ? -9.995  -12.237 -0.926  1.00 0.00 ? 43  ILE A HG23 1  
ATOM 596   H HD11 . ILE A 1 43  ? -12.312 -15.223 0.485   1.00 0.00 ? 43  ILE A HD11 1  
ATOM 597   H HD12 . ILE A 1 43  ? -12.350 -13.469 0.671   1.00 0.00 ? 43  ILE A HD12 1  
ATOM 598   H HD13 . ILE A 1 43  ? -11.622 -14.188 -0.765  1.00 0.00 ? 43  ILE A HD13 1  
ATOM 599   N N    . ARG A 1 44  ? -6.873  -11.342 2.390   1.00 0.00 ? 44  ARG A N    1  
ATOM 600   C CA   . ARG A 1 44  ? -6.345  -10.015 2.683   1.00 0.00 ? 44  ARG A CA   1  
ATOM 601   C C    . ARG A 1 44  ? -6.428  -9.113  1.455   1.00 0.00 ? 44  ARG A C    1  
ATOM 602   O O    . ARG A 1 44  ? -5.896  -9.443  0.395   1.00 0.00 ? 44  ARG A O    1  
ATOM 603   C CB   . ARG A 1 44  ? -4.895  -10.113 3.161   1.00 0.00 ? 44  ARG A CB   1  
ATOM 604   C CG   . ARG A 1 44  ? -4.405  -8.868  3.880   1.00 0.00 ? 44  ARG A CG   1  
ATOM 605   C CD   . ARG A 1 44  ? -2.911  -8.662  3.684   1.00 0.00 ? 44  ARG A CD   1  
ATOM 606   N NE   . ARG A 1 44  ? -2.298  -7.983  4.822   1.00 0.00 ? 44  ARG A NE   1  
ATOM 607   C CZ   . ARG A 1 44  ? -2.240  -8.502  6.044   1.00 0.00 ? 44  ARG A CZ   1  
ATOM 608   N NH1  . ARG A 1 44  ? -2.756  -9.699  6.284   1.00 0.00 ? 44  ARG A NH1  1  
ATOM 609   N NH2  . ARG A 1 44  ? -1.665  -7.823  7.028   1.00 0.00 ? 44  ARG A NH2  1  
ATOM 610   H H    . ARG A 1 44  ? -6.251  -12.064 2.165   1.00 0.00 ? 44  ARG A H    1  
ATOM 611   H HA   . ARG A 1 44  ? -6.946  -9.585  3.471   1.00 0.00 ? 44  ARG A HA   1  
ATOM 612   H HB2  . ARG A 1 44  ? -4.807  -10.951 3.837   1.00 0.00 ? 44  ARG A HB2  1  
ATOM 613   H HB3  . ARG A 1 44  ? -4.258  -10.282 2.305   1.00 0.00 ? 44  ARG A HB3  1  
ATOM 614   H HG2  . ARG A 1 44  ? -4.930  -8.008  3.491   1.00 0.00 ? 44  ARG A HG2  1  
ATOM 615   H HG3  . ARG A 1 44  ? -4.610  -8.969  4.936   1.00 0.00 ? 44  ARG A HG3  1  
ATOM 616   H HD2  . ARG A 1 44  ? -2.442  -9.626  3.557   1.00 0.00 ? 44  ARG A HD2  1  
ATOM 617   H HD3  . ARG A 1 44  ? -2.757  -8.068  2.796   1.00 0.00 ? 44  ARG A HD3  1  
ATOM 618   H HE   . ARG A 1 44  ? -1.910  -7.097  4.667   1.00 0.00 ? 44  ARG A HE   1  
ATOM 619   H HH11 . ARG A 1 44  ? -3.189  -10.214 5.544   1.00 0.00 ? 44  ARG A HH11 1  
ATOM 620   H HH12 . ARG A 1 44  ? -2.711  -10.088 7.204   1.00 0.00 ? 44  ARG A HH12 1  
ATOM 621   H HH21 . ARG A 1 44  ? -1.275  -6.920  6.851   1.00 0.00 ? 44  ARG A HH21 1  
ATOM 622   H HH22 . ARG A 1 44  ? -1.623  -8.214  7.947   1.00 0.00 ? 44  ARG A HH22 1  
ATOM 623   N N    . ARG A 1 45  ? -7.098  -7.976  1.606   1.00 0.00 ? 45  ARG A N    1  
ATOM 624   C CA   . ARG A 1 45  ? -7.252  -7.028  0.509   1.00 0.00 ? 45  ARG A CA   1  
ATOM 625   C C    . ARG A 1 45  ? -6.716  -5.653  0.899   1.00 0.00 ? 45  ARG A C    1  
ATOM 626   O O    . ARG A 1 45  ? -6.553  -5.351  2.082   1.00 0.00 ? 45  ARG A O    1  
ATOM 627   C CB   . ARG A 1 45  ? -8.723  -6.918  0.104   1.00 0.00 ? 45  ARG A CB   1  
ATOM 628   C CG   . ARG A 1 45  ? -9.164  -7.984  -0.885  1.00 0.00 ? 45  ARG A CG   1  
ATOM 629   C CD   . ARG A 1 45  ? -9.318  -9.339  -0.212  1.00 0.00 ? 45  ARG A CD   1  
ATOM 630   N NE   . ARG A 1 45  ? -10.651 -9.519  0.357   1.00 0.00 ? 45  ARG A NE   1  
ATOM 631   C CZ   . ARG A 1 45  ? -11.697 -9.947  -0.341  1.00 0.00 ? 45  ARG A CZ   1  
ATOM 632   N NH1  . ARG A 1 45  ? -11.564 -10.239 -1.628  1.00 0.00 ? 45  ARG A NH1  1  
ATOM 633   N NH2  . ARG A 1 45  ? -12.878 -10.085 0.248   1.00 0.00 ? 45  ARG A NH2  1  
ATOM 634   H H    . ARG A 1 45  ? -7.500  -7.769  2.476   1.00 0.00 ? 45  ARG A H    1  
ATOM 635   H HA   . ARG A 1 45  ? -6.683  -7.398  -0.331  1.00 0.00 ? 45  ARG A HA   1  
ATOM 636   H HB2  . ARG A 1 45  ? -9.335  -7.004  0.990   1.00 0.00 ? 45  ARG A HB2  1  
ATOM 637   H HB3  . ARG A 1 45  ? -8.888  -5.950  -0.345  1.00 0.00 ? 45  ARG A HB3  1  
ATOM 638   H HG2  . ARG A 1 45  ? -10.114 -7.696  -1.311  1.00 0.00 ? 45  ARG A HG2  1  
ATOM 639   H HG3  . ARG A 1 45  ? -8.425  -8.063  -1.668  1.00 0.00 ? 45  ARG A HG3  1  
ATOM 640   H HD2  . ARG A 1 45  ? -9.143  -10.112 -0.945  1.00 0.00 ? 45  ARG A HD2  1  
ATOM 641   H HD3  . ARG A 1 45  ? -8.586  -9.419  0.577   1.00 0.00 ? 45  ARG A HD3  1  
ATOM 642   H HE   . ARG A 1 45  ? -10.771 -9.309  1.306   1.00 0.00 ? 45  ARG A HE   1  
ATOM 643   H HH11 . ARG A 1 45  ? -10.675 -10.136 -2.074  1.00 0.00 ? 45  ARG A HH11 1  
ATOM 644   H HH12 . ARG A 1 45  ? -12.353 -10.562 -2.151  1.00 0.00 ? 45  ARG A HH12 1  
ATOM 645   H HH21 . ARG A 1 45  ? -12.981 -9.867  1.217   1.00 0.00 ? 45  ARG A HH21 1  
ATOM 646   H HH22 . ARG A 1 45  ? -13.664 -10.408 -0.279  1.00 0.00 ? 45  ARG A HH22 1  
ATOM 647   N N    . LEU A 1 46  ? -6.443  -4.825  -0.103  1.00 0.00 ? 46  LEU A N    1  
ATOM 648   C CA   . LEU A 1 46  ? -5.925  -3.482  0.135   1.00 0.00 ? 46  LEU A CA   1  
ATOM 649   C C    . LEU A 1 46  ? -6.935  -2.424  -0.300  1.00 0.00 ? 46  LEU A C    1  
ATOM 650   O O    . LEU A 1 46  ? -7.618  -2.582  -1.312  1.00 0.00 ? 46  LEU A O    1  
ATOM 651   C CB   . LEU A 1 46  ? -4.607  -3.283  -0.615  1.00 0.00 ? 46  LEU A CB   1  
ATOM 652   C CG   . LEU A 1 46  ? -3.339  -3.685  0.140   1.00 0.00 ? 46  LEU A CG   1  
ATOM 653   C CD1  . LEU A 1 46  ? -3.174  -2.841  1.394   1.00 0.00 ? 46  LEU A CD1  1  
ATOM 654   C CD2  . LEU A 1 46  ? -3.374  -5.165  0.491   1.00 0.00 ? 46  LEU A CD2  1  
ATOM 655   H H    . LEU A 1 46  ? -6.594  -5.122  -1.024  1.00 0.00 ? 46  LEU A H    1  
ATOM 656   H HA   . LEU A 1 46  ? -5.747  -3.378  1.195   1.00 0.00 ? 46  LEU A HA   1  
ATOM 657   H HB2  . LEU A 1 46  ? -4.650  -3.866  -1.522  1.00 0.00 ? 46  LEU A HB2  1  
ATOM 658   H HB3  . LEU A 1 46  ? -4.525  -2.235  -0.866  1.00 0.00 ? 46  LEU A HB3  1  
ATOM 659   H HG   . LEU A 1 46  ? -2.480  -3.511  -0.494  1.00 0.00 ? 46  LEU A HG   1  
ATOM 660   H HD11 . LEU A 1 46  ? -3.788  -3.246  2.184   1.00 0.00 ? 46  LEU A HD11 1  
ATOM 661   H HD12 . LEU A 1 46  ? -3.477  -1.826  1.187   1.00 0.00 ? 46  LEU A HD12 1  
ATOM 662   H HD13 . LEU A 1 46  ? -2.138  -2.852  1.701   1.00 0.00 ? 46  LEU A HD13 1  
ATOM 663   H HD21 . LEU A 1 46  ? -3.646  -5.282  1.530   1.00 0.00 ? 46  LEU A HD21 1  
ATOM 664   H HD22 . LEU A 1 46  ? -2.398  -5.598  0.324   1.00 0.00 ? 46  LEU A HD22 1  
ATOM 665   H HD23 . LEU A 1 46  ? -4.102  -5.665  -0.131  1.00 0.00 ? 46  LEU A HD23 1  
ATOM 666   N N    . TYR A 1 47  ? -7.022  -1.345  0.471   1.00 0.00 ? 47  TYR A N    1  
ATOM 667   C CA   . TYR A 1 47  ? -7.948  -0.261  0.166   1.00 0.00 ? 47  TYR A CA   1  
ATOM 668   C C    . TYR A 1 47  ? -7.351  1.089   0.551   1.00 0.00 ? 47  TYR A C    1  
ATOM 669   O O    . TYR A 1 47  ? -6.781  1.244   1.631   1.00 0.00 ? 47  TYR A O    1  
ATOM 670   C CB   . TYR A 1 47  ? -9.273  -0.473  0.899   1.00 0.00 ? 47  TYR A CB   1  
ATOM 671   C CG   . TYR A 1 47  ? -9.935  -1.796  0.583   1.00 0.00 ? 47  TYR A CG   1  
ATOM 672   C CD1  . TYR A 1 47  ? -9.529  -2.966  1.213   1.00 0.00 ? 47  TYR A CD1  1  
ATOM 673   C CD2  . TYR A 1 47  ? -10.965 -1.876  -0.346  1.00 0.00 ? 47  TYR A CD2  1  
ATOM 674   C CE1  . TYR A 1 47  ? -10.129 -4.177  0.928   1.00 0.00 ? 47  TYR A CE1  1  
ATOM 675   C CE2  . TYR A 1 47  ? -11.573 -3.082  -0.636  1.00 0.00 ? 47  TYR A CE2  1  
ATOM 676   C CZ   . TYR A 1 47  ? -11.151 -4.229  0.003   1.00 0.00 ? 47  TYR A CZ   1  
ATOM 677   O OH   . TYR A 1 47  ? -11.753 -5.433  -0.285  1.00 0.00 ? 47  TYR A OH   1  
ATOM 678   H H    . TYR A 1 47  ? -6.451  -1.277  1.264   1.00 0.00 ? 47  TYR A H    1  
ATOM 679   H HA   . TYR A 1 47  ? -8.131  -0.271  -0.899  1.00 0.00 ? 47  TYR A HA   1  
ATOM 680   H HB2  . TYR A 1 47  ? -9.099  -0.436  1.963   1.00 0.00 ? 47  TYR A HB2  1  
ATOM 681   H HB3  . TYR A 1 47  ? -9.959  0.315   0.624   1.00 0.00 ? 47  TYR A HB3  1  
ATOM 682   H HD1  . TYR A 1 47  ? -8.728  -2.921  1.937   1.00 0.00 ? 47  TYR A HD1  1  
ATOM 683   H HD2  . TYR A 1 47  ? -11.293 -0.975  -0.845  1.00 0.00 ? 47  TYR A HD2  1  
ATOM 684   H HE1  . TYR A 1 47  ? -9.800  -5.075  1.428   1.00 0.00 ? 47  TYR A HE1  1  
ATOM 685   H HE2  . TYR A 1 47  ? -12.372 -3.124  -1.361  1.00 0.00 ? 47  TYR A HE2  1  
ATOM 686   H HH   . TYR A 1 47  ? -11.116 -6.143  -0.176  1.00 0.00 ? 47  TYR A HH   1  
ATOM 687   N N    . VAL A 1 48  ? -7.488  2.065   -0.341  1.00 0.00 ? 48  VAL A N    1  
ATOM 688   C CA   . VAL A 1 48  ? -6.965  3.404   -0.096  1.00 0.00 ? 48  VAL A CA   1  
ATOM 689   C C    . VAL A 1 48  ? -7.631  4.040   1.118   1.00 0.00 ? 48  VAL A C    1  
ATOM 690   O O    . VAL A 1 48  ? -8.851  3.990   1.267   1.00 0.00 ? 48  VAL A O    1  
ATOM 691   C CB   . VAL A 1 48  ? -7.169  4.319   -1.318  1.00 0.00 ? 48  VAL A CB   1  
ATOM 692   C CG1  . VAL A 1 48  ? -6.699  5.732   -1.012  1.00 0.00 ? 48  VAL A CG1  1  
ATOM 693   C CG2  . VAL A 1 48  ? -6.441  3.758   -2.531  1.00 0.00 ? 48  VAL A CG2  1  
ATOM 694   H H    . VAL A 1 48  ? -7.952  1.880   -1.184  1.00 0.00 ? 48  VAL A H    1  
ATOM 695   H HA   . VAL A 1 48  ? -5.904  3.319   0.090   1.00 0.00 ? 48  VAL A HA   1  
ATOM 696   H HB   . VAL A 1 48  ? -8.224  4.355   -1.543  1.00 0.00 ? 48  VAL A HB   1  
ATOM 697   H HG11 . VAL A 1 48  ? -5.895  5.998   -1.683  1.00 0.00 ? 48  VAL A HG11 1  
ATOM 698   H HG12 . VAL A 1 48  ? -7.521  6.421   -1.141  1.00 0.00 ? 48  VAL A HG12 1  
ATOM 699   H HG13 . VAL A 1 48  ? -6.345  5.781   0.008   1.00 0.00 ? 48  VAL A HG13 1  
ATOM 700   H HG21 . VAL A 1 48  ? -6.775  2.747   -2.714  1.00 0.00 ? 48  VAL A HG21 1  
ATOM 701   H HG22 . VAL A 1 48  ? -6.656  4.370   -3.395  1.00 0.00 ? 48  VAL A HG22 1  
ATOM 702   H HG23 . VAL A 1 48  ? -5.378  3.758   -2.345  1.00 0.00 ? 48  VAL A HG23 1  
ATOM 703   N N    . ASN A 1 49  ? -6.821  4.639   1.985   1.00 0.00 ? 49  ASN A N    1  
ATOM 704   C CA   . ASN A 1 49  ? -7.332  5.286   3.188   1.00 0.00 ? 49  ASN A CA   1  
ATOM 705   C C    . ASN A 1 49  ? -7.510  6.785   2.965   1.00 0.00 ? 49  ASN A C    1  
ATOM 706   O O    . ASN A 1 49  ? -8.511  7.370   3.379   1.00 0.00 ? 49  ASN A O    1  
ATOM 707   C CB   . ASN A 1 49  ? -6.385  5.043   4.365   1.00 0.00 ? 49  ASN A CB   1  
ATOM 708   C CG   . ASN A 1 49  ? -6.793  5.816   5.604   1.00 0.00 ? 49  ASN A CG   1  
ATOM 709   O OD1  . ASN A 1 49  ? -7.644  6.703   5.544   1.00 0.00 ? 49  ASN A OD1  1  
ATOM 710   N ND2  . ASN A 1 49  ? -6.184  5.483   6.736   1.00 0.00 ? 49  ASN A ND2  1  
ATOM 711   H H    . ASN A 1 49  ? -5.856  4.646   1.812   1.00 0.00 ? 49  ASN A H    1  
ATOM 712   H HA   . ASN A 1 49  ? -8.294  4.851   3.415   1.00 0.00 ? 49  ASN A HA   1  
ATOM 713   H HB2  . ASN A 1 49  ? -6.384  3.990   4.606   1.00 0.00 ? 49  ASN A HB2  1  
ATOM 714   H HB3  . ASN A 1 49  ? -5.387  5.346   4.085   1.00 0.00 ? 49  ASN A HB3  1  
ATOM 715   H HD21 . ASN A 1 49  ? -5.516  4.766   6.709   1.00 0.00 ? 49  ASN A HD21 1  
ATOM 716   H HD22 . ASN A 1 49  ? -6.429  5.966   7.553   1.00 0.00 ? 49  ASN A HD22 1  
ATOM 717   N N    . SER A 1 50  ? -6.532  7.401   2.309   1.00 0.00 ? 50  SER A N    1  
ATOM 718   C CA   . SER A 1 50  ? -6.579  8.832   2.033   1.00 0.00 ? 50  SER A CA   1  
ATOM 719   C C    . SER A 1 50  ? -5.865  9.157   0.725   1.00 0.00 ? 50  SER A C    1  
ATOM 720   O O    . SER A 1 50  ? -5.052  8.373   0.236   1.00 0.00 ? 50  SER A O    1  
ATOM 721   C CB   . SER A 1 50  ? -5.942  9.615   3.183   1.00 0.00 ? 50  SER A CB   1  
ATOM 722   O OG   . SER A 1 50  ? -6.352  10.971  3.166   1.00 0.00 ? 50  SER A OG   1  
ATOM 723   H H    . SER A 1 50  ? -5.760  6.880   2.004   1.00 0.00 ? 50  SER A H    1  
ATOM 724   H HA   . SER A 1 50  ? -7.616  9.119   1.945   1.00 0.00 ? 50  SER A HA   1  
ATOM 725   H HB2  . SER A 1 50  ? -6.238  9.174   4.123   1.00 0.00 ? 50  SER A HB2  1  
ATOM 726   H HB3  . SER A 1 50  ? -4.866  9.575   3.090   1.00 0.00 ? 50  SER A HB3  1  
ATOM 727   H HG   . SER A 1 50  ? -5.868  11.443  2.485   1.00 0.00 ? 50  SER A HG   1  
ATOM 728   N N    . VAL A 1 51  ? -6.176  10.321  0.162   1.00 0.00 ? 51  VAL A N    1  
ATOM 729   C CA   . VAL A 1 51  ? -5.564  10.752  -1.089  1.00 0.00 ? 51  VAL A CA   1  
ATOM 730   C C    . VAL A 1 51  ? -5.366  12.263  -1.112  1.00 0.00 ? 51  VAL A C    1  
ATOM 731   O O    . VAL A 1 51  ? -6.320  13.028  -0.969  1.00 0.00 ? 51  VAL A O    1  
ATOM 732   C CB   . VAL A 1 51  ? -6.418  10.339  -2.303  1.00 0.00 ? 51  VAL A CB   1  
ATOM 733   C CG1  . VAL A 1 51  ? -5.687  10.649  -3.600  1.00 0.00 ? 51  VAL A CG1  1  
ATOM 734   C CG2  . VAL A 1 51  ? -6.777  8.863   -2.223  1.00 0.00 ? 51  VAL A CG2  1  
ATOM 735   H H    . VAL A 1 51  ? -6.831  10.903  0.599   1.00 0.00 ? 51  VAL A H    1  
ATOM 736   H HA   . VAL A 1 51  ? -4.600  10.271  -1.173  1.00 0.00 ? 51  VAL A HA   1  
ATOM 737   H HB   . VAL A 1 51  ? -7.333  10.912  -2.286  1.00 0.00 ? 51  VAL A HB   1  
ATOM 738   H HG11 . VAL A 1 51  ? -6.342  10.455  -4.437  1.00 0.00 ? 51  VAL A HG11 1  
ATOM 739   H HG12 . VAL A 1 51  ? -5.389  11.687  -3.607  1.00 0.00 ? 51  VAL A HG12 1  
ATOM 740   H HG13 . VAL A 1 51  ? -4.811  10.022  -3.678  1.00 0.00 ? 51  VAL A HG13 1  
ATOM 741   H HG21 . VAL A 1 51  ? -7.235  8.656   -1.268  1.00 0.00 ? 51  VAL A HG21 1  
ATOM 742   H HG22 . VAL A 1 51  ? -7.471  8.617   -3.015  1.00 0.00 ? 51  VAL A HG22 1  
ATOM 743   H HG23 . VAL A 1 51  ? -5.883  8.268   -2.331  1.00 0.00 ? 51  VAL A HG23 1  
ATOM 744   N N    . LYS A 1 52  ? -4.120  12.689  -1.293  1.00 0.00 ? 52  LYS A N    1  
ATOM 745   C CA   . LYS A 1 52  ? -3.795  14.109  -1.336  1.00 0.00 ? 52  LYS A CA   1  
ATOM 746   C C    . LYS A 1 52  ? -4.452  14.781  -2.538  1.00 0.00 ? 52  LYS A C    1  
ATOM 747   O O    . LYS A 1 52  ? -4.307  14.324  -3.671  1.00 0.00 ? 52  LYS A O    1  
ATOM 748   C CB   . LYS A 1 52  ? -2.278  14.305  -1.395  1.00 0.00 ? 52  LYS A CB   1  
ATOM 749   C CG   . LYS A 1 52  ? -1.611  13.548  -2.530  1.00 0.00 ? 52  LYS A CG   1  
ATOM 750   C CD   . LYS A 1 52  ? -0.273  14.164  -2.901  1.00 0.00 ? 52  LYS A CD   1  
ATOM 751   C CE   . LYS A 1 52  ? 0.474   13.309  -3.912  1.00 0.00 ? 52  LYS A CE   1  
ATOM 752   N NZ   . LYS A 1 52  ? 1.512   14.090  -4.640  1.00 0.00 ? 52  LYS A NZ   1  
ATOM 753   H H    . LYS A 1 52  ? -3.402  12.030  -1.401  1.00 0.00 ? 52  LYS A H    1  
ATOM 754   H HA   . LYS A 1 52  ? -4.174  14.564  -0.433  1.00 0.00 ? 52  LYS A HA   1  
ATOM 755   H HB2  . LYS A 1 52  ? -2.068  15.357  -1.519  1.00 0.00 ? 52  LYS A HB2  1  
ATOM 756   H HB3  . LYS A 1 52  ? -1.848  13.967  -0.463  1.00 0.00 ? 52  LYS A HB3  1  
ATOM 757   H HG2  . LYS A 1 52  ? -1.451  12.525  -2.224  1.00 0.00 ? 52  LYS A HG2  1  
ATOM 758   H HG3  . LYS A 1 52  ? -2.259  13.570  -3.395  1.00 0.00 ? 52  LYS A HG3  1  
ATOM 759   H HD2  . LYS A 1 52  ? -0.442  15.141  -3.328  1.00 0.00 ? 52  LYS A HD2  1  
ATOM 760   H HD3  . LYS A 1 52  ? 0.329   14.259  -2.008  1.00 0.00 ? 52  LYS A HD3  1  
ATOM 761   H HE2  . LYS A 1 52  ? 0.950   12.492  -3.392  1.00 0.00 ? 52  LYS A HE2  1  
ATOM 762   H HE3  . LYS A 1 52  ? -0.235  12.916  -4.626  1.00 0.00 ? 52  LYS A HE3  1  
ATOM 763   H HZ1  . LYS A 1 52  ? 1.463   15.092  -4.366  1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 764   H HZ2  . LYS A 1 52  ? 1.361   14.016  -5.666  1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 765   H HZ3  . LYS A 1 52  ? 2.459   13.725  -4.413  1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 766   N N    . GLU A 1 53  ? -5.172  15.869  -2.282  1.00 0.00 ? 53  GLU A N    1  
ATOM 767   C CA   . GLU A 1 53  ? -5.850  16.603  -3.344  1.00 0.00 ? 53  GLU A CA   1  
ATOM 768   C C    . GLU A 1 53  ? -4.848  17.125  -4.369  1.00 0.00 ? 53  GLU A C    1  
ATOM 769   O O    . GLU A 1 53  ? -4.892  16.754  -5.543  1.00 0.00 ? 53  GLU A O    1  
ATOM 770   C CB   . GLU A 1 53  ? -6.651  17.768  -2.758  1.00 0.00 ? 53  GLU A CB   1  
ATOM 771   C CG   . GLU A 1 53  ? -7.321  18.635  -3.810  1.00 0.00 ? 53  GLU A CG   1  
ATOM 772   C CD   . GLU A 1 53  ? -8.095  19.791  -3.207  1.00 0.00 ? 53  GLU A CD   1  
ATOM 773   O OE1  . GLU A 1 53  ? -9.096  19.534  -2.506  1.00 0.00 ? 53  GLU A OE1  1  
ATOM 774   O OE2  . GLU A 1 53  ? -7.699  20.953  -3.435  1.00 0.00 ? 53  GLU A OE2  1  
ATOM 775   H H    . GLU A 1 53  ? -5.251  16.184  -1.357  1.00 0.00 ? 53  GLU A H    1  
ATOM 776   H HA   . GLU A 1 53  ? -6.529  15.923  -3.836  1.00 0.00 ? 53  GLU A HA   1  
ATOM 777   H HB2  . GLU A 1 53  ? -7.416  17.372  -2.107  1.00 0.00 ? 53  GLU A HB2  1  
ATOM 778   H HB3  . GLU A 1 53  ? -5.985  18.391  -2.180  1.00 0.00 ? 53  GLU A HB3  1  
ATOM 779   H HG2  . GLU A 1 53  ? -6.563  19.034  -4.467  1.00 0.00 ? 53  GLU A HG2  1  
ATOM 780   H HG3  . GLU A 1 53  ? -8.004  18.023  -4.381  1.00 0.00 ? 53  GLU A HG3  1  
ATOM 781   N N    . THR A 1 54  ? -3.944  17.989  -3.918  1.00 0.00 ? 54  THR A N    1  
ATOM 782   C CA   . THR A 1 54  ? -2.932  18.564  -4.795  1.00 0.00 ? 54  THR A CA   1  
ATOM 783   C C    . THR A 1 54  ? -1.813  17.566  -5.072  1.00 0.00 ? 54  THR A C    1  
ATOM 784   O O    . THR A 1 54  ? -0.636  17.872  -4.891  1.00 0.00 ? 54  THR A O    1  
ATOM 785   C CB   . THR A 1 54  ? -2.324  19.843  -4.188  1.00 0.00 ? 54  THR A CB   1  
ATOM 786   O OG1  . THR A 1 54  ? -1.726  19.548  -2.921  1.00 0.00 ? 54  THR A OG1  1  
ATOM 787   C CG2  . THR A 1 54  ? -3.387  20.918  -4.016  1.00 0.00 ? 54  THR A CG2  1  
ATOM 788   H H    . THR A 1 54  ? -3.960  18.246  -2.972  1.00 0.00 ? 54  THR A H    1  
ATOM 789   H HA   . THR A 1 54  ? -3.408  18.825  -5.729  1.00 0.00 ? 54  THR A HA   1  
ATOM 790   H HB   . THR A 1 54  ? -1.563  20.215  -4.859  1.00 0.00 ? 54  THR A HB   1  
ATOM 791   H HG1  . THR A 1 54  ? -1.676  20.351  -2.396  1.00 0.00 ? 54  THR A HG1  1  
ATOM 792   H HG21 . THR A 1 54  ? -3.331  21.615  -4.839  1.00 0.00 ? 54  THR A HG21 1  
ATOM 793   H HG22 . THR A 1 54  ? -3.220  21.443  -3.087  1.00 0.00 ? 54  THR A HG22 1  
ATOM 794   H HG23 . THR A 1 54  ? -4.364  20.458  -3.999  1.00 0.00 ? 54  THR A HG23 1  
ATOM 795   N N    . GLY A 1 55  ? -2.190  16.370  -5.514  1.00 0.00 ? 55  GLY A N    1  
ATOM 796   C CA   . GLY A 1 55  ? -1.206  15.345  -5.810  1.00 0.00 ? 55  GLY A CA   1  
ATOM 797   C C    . GLY A 1 55  ? -1.415  14.717  -7.174  1.00 0.00 ? 55  GLY A C    1  
ATOM 798   O O    . GLY A 1 55  ? -1.990  15.337  -8.070  1.00 0.00 ? 55  GLY A O    1  
ATOM 799   H H    . GLY A 1 55  ? -3.143  16.182  -5.640  1.00 0.00 ? 55  GLY A H    1  
ATOM 800   H HA2  . GLY A 1 55  ? -0.221  15.786  -5.776  1.00 0.00 ? 55  GLY A HA2  1  
ATOM 801   H HA3  . GLY A 1 55  ? -1.270  14.573  -5.058  1.00 0.00 ? 55  GLY A HA3  1  
ATOM 802   N N    . LEU A 1 56  ? -0.947  13.485  -7.334  1.00 0.00 ? 56  LEU A N    1  
ATOM 803   C CA   . LEU A 1 56  ? -1.084  12.772  -8.600  1.00 0.00 ? 56  LEU A CA   1  
ATOM 804   C C    . LEU A 1 56  ? -2.180  11.715  -8.513  1.00 0.00 ? 56  LEU A C    1  
ATOM 805   O O    . LEU A 1 56  ? -3.012  11.595  -9.412  1.00 0.00 ? 56  LEU A O    1  
ATOM 806   C CB   . LEU A 1 56  ? 0.244   12.117  -8.985  1.00 0.00 ? 56  LEU A CB   1  
ATOM 807   C CG   . LEU A 1 56  ? 1.491   12.989  -8.836  1.00 0.00 ? 56  LEU A CG   1  
ATOM 808   C CD1  . LEU A 1 56  ? 2.731   12.123  -8.672  1.00 0.00 ? 56  LEU A CD1  1  
ATOM 809   C CD2  . LEU A 1 56  ? 1.640   13.916  -10.033 1.00 0.00 ? 56  LEU A CD2  1  
ATOM 810   H H    . LEU A 1 56  ? -0.498  13.042  -6.584  1.00 0.00 ? 56  LEU A H    1  
ATOM 811   H HA   . LEU A 1 56  ? -1.354  13.492  -9.358  1.00 0.00 ? 56  LEU A HA   1  
ATOM 812   H HB2  . LEU A 1 56  ? 0.374   11.244  -8.364  1.00 0.00 ? 56  LEU A HB2  1  
ATOM 813   H HB3  . LEU A 1 56  ? 0.173   11.813  -10.020 1.00 0.00 ? 56  LEU A HB3  1  
ATOM 814   H HG   . LEU A 1 56  ? 1.392   13.599  -7.949  1.00 0.00 ? 56  LEU A HG   1  
ATOM 815   H HD11 . LEU A 1 56  ? 3.180   11.951  -9.639  1.00 0.00 ? 56  LEU A HD11 1  
ATOM 816   H HD12 . LEU A 1 56  ? 2.454   11.177  -8.231  1.00 0.00 ? 56  LEU A HD12 1  
ATOM 817   H HD13 . LEU A 1 56  ? 3.439   12.626  -8.030  1.00 0.00 ? 56  LEU A HD13 1  
ATOM 818   H HD21 . LEU A 1 56  ? 2.544   13.670  -10.568 1.00 0.00 ? 56  LEU A HD21 1  
ATOM 819   H HD22 . LEU A 1 56  ? 1.692   14.940  -9.690  1.00 0.00 ? 56  LEU A HD22 1  
ATOM 820   H HD23 . LEU A 1 56  ? 0.789   13.798  -10.687 1.00 0.00 ? 56  LEU A HD23 1  
ATOM 821   N N    . ALA A 1 57  ? -2.174  10.952  -7.425  1.00 0.00 ? 57  ALA A N    1  
ATOM 822   C CA   . ALA A 1 57  ? -3.170  9.907   -7.220  1.00 0.00 ? 57  ALA A CA   1  
ATOM 823   C C    . ALA A 1 57  ? -4.580  10.439  -7.454  1.00 0.00 ? 57  ALA A C    1  
ATOM 824   O O    . ALA A 1 57  ? -5.349  9.868   -8.227  1.00 0.00 ? 57  ALA A O    1  
ATOM 825   C CB   . ALA A 1 57  ? -3.048  9.331   -5.817  1.00 0.00 ? 57  ALA A CB   1  
ATOM 826   H H    . ALA A 1 57  ? -1.484  11.095  -6.745  1.00 0.00 ? 57  ALA A H    1  
ATOM 827   H HA   . ALA A 1 57  ? -2.973  9.114   -7.927  1.00 0.00 ? 57  ALA A HA   1  
ATOM 828   H HB1  . ALA A 1 57  ? -3.176  10.122  -5.092  1.00 0.00 ? 57  ALA A HB1  1  
ATOM 829   H HB2  . ALA A 1 57  ? -3.810  8.580   -5.669  1.00 0.00 ? 57  ALA A HB2  1  
ATOM 830   H HB3  . ALA A 1 57  ? -2.073  8.884   -5.695  1.00 0.00 ? 57  ALA A HB3  1  
ATOM 831   N N    . SER A 1 58  ? -4.913  11.537  -6.782  1.00 0.00 ? 58  SER A N    1  
ATOM 832   C CA   . SER A 1 58  ? -6.232  12.143  -6.915  1.00 0.00 ? 58  SER A CA   1  
ATOM 833   C C    . SER A 1 58  ? -6.517  12.514  -8.367  1.00 0.00 ? 58  SER A C    1  
ATOM 834   O O    . SER A 1 58  ? -7.364  11.905  -9.021  1.00 0.00 ? 58  SER A O    1  
ATOM 835   C CB   . SER A 1 58  ? -6.336  13.387  -6.029  1.00 0.00 ? 58  SER A CB   1  
ATOM 836   O OG   . SER A 1 58  ? -7.627  13.967  -6.115  1.00 0.00 ? 58  SER A OG   1  
ATOM 837   H H    . SER A 1 58  ? -4.256  11.946  -6.181  1.00 0.00 ? 58  SER A H    1  
ATOM 838   H HA   . SER A 1 58  ? -6.964  11.418  -6.590  1.00 0.00 ? 58  SER A HA   1  
ATOM 839   H HB2  . SER A 1 58  ? -6.146  13.112  -5.003  1.00 0.00 ? 58  SER A HB2  1  
ATOM 840   H HB3  . SER A 1 58  ? -5.605  14.115  -6.349  1.00 0.00 ? 58  SER A HB3  1  
ATOM 841   H HG   . SER A 1 58  ? -8.148  13.702  -5.353  1.00 0.00 ? 58  SER A HG   1  
ATOM 842   N N    . LYS A 1 59  ? -5.803  13.517  -8.866  1.00 0.00 ? 59  LYS A N    1  
ATOM 843   C CA   . LYS A 1 59  ? -5.975  13.970  -10.241 1.00 0.00 ? 59  LYS A CA   1  
ATOM 844   C C    . LYS A 1 59  ? -6.038  12.786  -11.200 1.00 0.00 ? 59  LYS A C    1  
ATOM 845   O O    . LYS A 1 59  ? -6.793  12.800  -12.172 1.00 0.00 ? 59  LYS A O    1  
ATOM 846   C CB   . LYS A 1 59  ? -4.830  14.903  -10.639 1.00 0.00 ? 59  LYS A CB   1  
ATOM 847   C CG   . LYS A 1 59  ? -3.456  14.267  -10.518 1.00 0.00 ? 59  LYS A CG   1  
ATOM 848   C CD   . LYS A 1 59  ? -2.355  15.235  -10.917 1.00 0.00 ? 59  LYS A CD   1  
ATOM 849   C CE   . LYS A 1 59  ? -2.644  15.883  -12.263 1.00 0.00 ? 59  LYS A CE   1  
ATOM 850   N NZ   . LYS A 1 59  ? -3.429  17.140  -12.117 1.00 0.00 ? 59  LYS A NZ   1  
ATOM 851   H H    . LYS A 1 59  ? -5.142  13.964  -8.294  1.00 0.00 ? 59  LYS A H    1  
ATOM 852   H HA   . LYS A 1 59  ? -6.907  14.513  -10.297 1.00 0.00 ? 59  LYS A HA   1  
ATOM 853   H HB2  . LYS A 1 59  ? -4.972  15.210  -11.665 1.00 0.00 ? 59  LYS A HB2  1  
ATOM 854   H HB3  . LYS A 1 59  ? -4.856  15.777  -10.004 1.00 0.00 ? 59  LYS A HB3  1  
ATOM 855   H HG2  . LYS A 1 59  ? -3.299  13.963  -9.493  1.00 0.00 ? 59  LYS A HG2  1  
ATOM 856   H HG3  . LYS A 1 59  ? -3.413  13.401  -11.163 1.00 0.00 ? 59  LYS A HG3  1  
ATOM 857   H HD2  . LYS A 1 59  ? -2.279  16.009  -10.167 1.00 0.00 ? 59  LYS A HD2  1  
ATOM 858   H HD3  . LYS A 1 59  ? -1.420  14.697  -10.979 1.00 0.00 ? 59  LYS A HD3  1  
ATOM 859   H HE2  . LYS A 1 59  ? -1.706  16.108  -12.747 1.00 0.00 ? 59  LYS A HE2  1  
ATOM 860   H HE3  . LYS A 1 59  ? -3.205  15.187  -12.869 1.00 0.00 ? 59  LYS A HE3  1  
ATOM 861   H HZ1  . LYS A 1 59  ? -2.791  17.938  -11.918 1.00 0.00 ? 59  LYS A HZ1  1  
ATOM 862   H HZ2  . LYS A 1 59  ? -4.106  17.049  -11.332 1.00 0.00 ? 59  LYS A HZ2  1  
ATOM 863   H HZ3  . LYS A 1 59  ? -3.953  17.338  -12.992 1.00 0.00 ? 59  LYS A HZ3  1  
ATOM 864   N N    . LYS A 1 60  ? -5.240  11.761  -10.920 1.00 0.00 ? 60  LYS A N    1  
ATOM 865   C CA   . LYS A 1 60  ? -5.206  10.567  -11.756 1.00 0.00 ? 60  LYS A CA   1  
ATOM 866   C C    . LYS A 1 60  ? -6.573  9.892   -11.796 1.00 0.00 ? 60  LYS A C    1  
ATOM 867   O O    . LYS A 1 60  ? -7.267  9.934   -12.811 1.00 0.00 ? 60  LYS A O    1  
ATOM 868   C CB   . LYS A 1 60  ? -4.155  9.584   -11.234 1.00 0.00 ? 60  LYS A CB   1  
ATOM 869   C CG   . LYS A 1 60  ? -2.744  9.897   -11.703 1.00 0.00 ? 60  LYS A CG   1  
ATOM 870   C CD   . LYS A 1 60  ? -2.580  9.637   -13.191 1.00 0.00 ? 60  LYS A CD   1  
ATOM 871   C CE   . LYS A 1 60  ? -1.159  9.920   -13.653 1.00 0.00 ? 60  LYS A CE   1  
ATOM 872   N NZ   . LYS A 1 60  ? -0.910  9.406   -15.028 1.00 0.00 ? 60  LYS A NZ   1  
ATOM 873   H H    . LYS A 1 60  ? -4.660  11.809  -10.131 1.00 0.00 ? 60  LYS A H    1  
ATOM 874   H HA   . LYS A 1 60  ? -4.937  10.870  -12.757 1.00 0.00 ? 60  LYS A HA   1  
ATOM 875   H HB2  . LYS A 1 60  ? -4.166  9.603   -10.155 1.00 0.00 ? 60  LYS A HB2  1  
ATOM 876   H HB3  . LYS A 1 60  ? -4.411  8.590   -11.571 1.00 0.00 ? 60  LYS A HB3  1  
ATOM 877   H HG2  . LYS A 1 60  ? -2.531  10.936  -11.504 1.00 0.00 ? 60  LYS A HG2  1  
ATOM 878   H HG3  . LYS A 1 60  ? -2.048  9.274   -11.159 1.00 0.00 ? 60  LYS A HG3  1  
ATOM 879   H HD2  . LYS A 1 60  ? -2.814  8.602   -13.395 1.00 0.00 ? 60  LYS A HD2  1  
ATOM 880   H HD3  . LYS A 1 60  ? -3.260  10.276  -13.736 1.00 0.00 ? 60  LYS A HD3  1  
ATOM 881   H HE2  . LYS A 1 60  ? -0.996  10.986  -13.641 1.00 0.00 ? 60  LYS A HE2  1  
ATOM 882   H HE3  . LYS A 1 60  ? -0.471  9.443   -12.970 1.00 0.00 ? 60  LYS A HE3  1  
ATOM 883   H HZ1  . LYS A 1 60  ? -0.006  9.774   -15.389 1.00 0.00 ? 60  LYS A HZ1  1  
ATOM 884   H HZ2  . LYS A 1 60  ? -1.673  9.708   -15.666 1.00 0.00 ? 60  LYS A HZ2  1  
ATOM 885   H HZ3  . LYS A 1 60  ? -0.870  8.367   -15.020 1.00 0.00 ? 60  LYS A HZ3  1  
ATOM 886   N N    . GLY A 1 61  ? -6.954  9.271   -10.685 1.00 0.00 ? 61  GLY A N    1  
ATOM 887   C CA   . GLY A 1 61  ? -8.238  8.597   -10.614 1.00 0.00 ? 61  GLY A CA   1  
ATOM 888   C C    . GLY A 1 61  ? -8.396  7.782   -9.346  1.00 0.00 ? 61  GLY A C    1  
ATOM 889   O O    . GLY A 1 61  ? -9.069  6.750   -9.342  1.00 0.00 ? 61  GLY A O    1  
ATOM 890   H H    . GLY A 1 61  ? -6.359  9.270   -9.905  1.00 0.00 ? 61  GLY A H    1  
ATOM 891   H HA2  . GLY A 1 61  ? -9.023  9.337   -10.655 1.00 0.00 ? 61  GLY A HA2  1  
ATOM 892   H HA3  . GLY A 1 61  ? -8.333  7.938   -11.465 1.00 0.00 ? 61  GLY A HA3  1  
ATOM 893   N N    . LEU A 1 62  ? -7.775  8.244   -8.267  1.00 0.00 ? 62  LEU A N    1  
ATOM 894   C CA   . LEU A 1 62  ? -7.848  7.549   -6.986  1.00 0.00 ? 62  LEU A CA   1  
ATOM 895   C C    . LEU A 1 62  ? -8.639  8.366   -5.969  1.00 0.00 ? 62  LEU A C    1  
ATOM 896   O O    . LEU A 1 62  ? -8.705  9.592   -6.056  1.00 0.00 ? 62  LEU A O    1  
ATOM 897   C CB   . LEU A 1 62  ? -6.442  7.273   -6.452  1.00 0.00 ? 62  LEU A CB   1  
ATOM 898   C CG   . LEU A 1 62  ? -5.791  5.970   -6.917  1.00 0.00 ? 62  LEU A CG   1  
ATOM 899   C CD1  . LEU A 1 62  ? -4.276  6.066   -6.823  1.00 0.00 ? 62  LEU A CD1  1  
ATOM 900   C CD2  . LEU A 1 62  ? -6.305  4.795   -6.098  1.00 0.00 ? 62  LEU A CD2  1  
ATOM 901   H H    . LEU A 1 62  ? -7.254  9.071   -8.331  1.00 0.00 ? 62  LEU A H    1  
ATOM 902   H HA   . LEU A 1 62  ? -8.354  6.609   -7.147  1.00 0.00 ? 62  LEU A HA   1  
ATOM 903   H HB2  . LEU A 1 62  ? -5.805  8.088   -6.759  1.00 0.00 ? 62  LEU A HB2  1  
ATOM 904   H HB3  . LEU A 1 62  ? -6.497  7.249   -5.372  1.00 0.00 ? 62  LEU A HB3  1  
ATOM 905   H HG   . LEU A 1 62  ? -6.050  5.796   -7.953  1.00 0.00 ? 62  LEU A HG   1  
ATOM 906   H HD11 . LEU A 1 62  ? -3.987  6.192   -5.790  1.00 0.00 ? 62  LEU A HD11 1  
ATOM 907   H HD12 . LEU A 1 62  ? -3.933  6.913   -7.399  1.00 0.00 ? 62  LEU A HD12 1  
ATOM 908   H HD13 . LEU A 1 62  ? -3.833  5.162   -7.213  1.00 0.00 ? 62  LEU A HD13 1  
ATOM 909   H HD21 . LEU A 1 62  ? -6.420  3.933   -6.739  1.00 0.00 ? 62  LEU A HD21 1  
ATOM 910   H HD22 . LEU A 1 62  ? -7.260  5.050   -5.663  1.00 0.00 ? 62  LEU A HD22 1  
ATOM 911   H HD23 . LEU A 1 62  ? -5.600  4.568   -5.313  1.00 0.00 ? 62  LEU A HD23 1  
ATOM 912   N N    . LYS A 1 63  ? -9.238  7.678   -5.002  1.00 0.00 ? 63  LYS A N    1  
ATOM 913   C CA   . LYS A 1 63  ? -10.022 8.338   -3.965  1.00 0.00 ? 63  LYS A CA   1  
ATOM 914   C C    . LYS A 1 63  ? -10.027 7.515   -2.681  1.00 0.00 ? 63  LYS A C    1  
ATOM 915   O O    . LYS A 1 63  ? -9.875  6.294   -2.714  1.00 0.00 ? 63  LYS A O    1  
ATOM 916   C CB   . LYS A 1 63  ? -11.458 8.560   -4.447  1.00 0.00 ? 63  LYS A CB   1  
ATOM 917   C CG   . LYS A 1 63  ? -12.195 9.643   -3.679  1.00 0.00 ? 63  LYS A CG   1  
ATOM 918   C CD   . LYS A 1 63  ? -13.692 9.384   -3.648  1.00 0.00 ? 63  LYS A CD   1  
ATOM 919   C CE   . LYS A 1 63  ? -14.352 10.071  -2.462  1.00 0.00 ? 63  LYS A CE   1  
ATOM 920   N NZ   . LYS A 1 63  ? -15.838 10.009  -2.542  1.00 0.00 ? 63  LYS A NZ   1  
ATOM 921   H H    . LYS A 1 63  ? -9.149  6.701   -4.986  1.00 0.00 ? 63  LYS A H    1  
ATOM 922   H HA   . LYS A 1 63  ? -9.567  9.295   -3.764  1.00 0.00 ? 63  LYS A HA   1  
ATOM 923   H HB2  . LYS A 1 63  ? -11.436 8.838   -5.490  1.00 0.00 ? 63  LYS A HB2  1  
ATOM 924   H HB3  . LYS A 1 63  ? -12.007 7.636   -4.341  1.00 0.00 ? 63  LYS A HB3  1  
ATOM 925   H HG2  . LYS A 1 63  ? -11.824 9.671   -2.666  1.00 0.00 ? 63  LYS A HG2  1  
ATOM 926   H HG3  . LYS A 1 63  ? -12.014 10.596  -4.157  1.00 0.00 ? 63  LYS A HG3  1  
ATOM 927   H HD2  . LYS A 1 63  ? -14.134 9.759   -4.559  1.00 0.00 ? 63  LYS A HD2  1  
ATOM 928   H HD3  . LYS A 1 63  ? -13.862 8.319   -3.576  1.00 0.00 ? 63  LYS A HD3  1  
ATOM 929   H HE2  . LYS A 1 63  ? -14.028 9.585   -1.555  1.00 0.00 ? 63  LYS A HE2  1  
ATOM 930   H HE3  . LYS A 1 63  ? -14.044 11.106  -2.446  1.00 0.00 ? 63  LYS A HE3  1  
ATOM 931   H HZ1  . LYS A 1 63  ? -16.208 10.875  -2.985  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM 932   H HZ2  . LYS A 1 63  ? -16.244 9.921   -1.589  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM 933   H HZ3  . LYS A 1 63  ? -16.132 9.189   -3.110  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM 934   N N    . ALA A 1 64  ? -10.204 8.192   -1.551  1.00 0.00 ? 64  ALA A N    1  
ATOM 935   C CA   . ALA A 1 64  ? -10.232 7.523   -0.256  1.00 0.00 ? 64  ALA A CA   1  
ATOM 936   C C    . ALA A 1 64  ? -11.368 6.508   -0.187  1.00 0.00 ? 64  ALA A C    1  
ATOM 937   O O    . ALA A 1 64  ? -12.517 6.864   0.067   1.00 0.00 ? 64  ALA A O    1  
ATOM 938   C CB   . ALA A 1 64  ? -10.367 8.545   0.863   1.00 0.00 ? 64  ALA A CB   1  
ATOM 939   H H    . ALA A 1 64  ? -10.319 9.164   -1.589  1.00 0.00 ? 64  ALA A H    1  
ATOM 940   H HA   . ALA A 1 64  ? -9.292  7.006   -0.127  1.00 0.00 ? 64  ALA A HA   1  
ATOM 941   H HB1  . ALA A 1 64  ? -9.851  8.186   1.742   1.00 0.00 ? 64  ALA A HB1  1  
ATOM 942   H HB2  . ALA A 1 64  ? -9.934  9.483   0.548   1.00 0.00 ? 64  ALA A HB2  1  
ATOM 943   H HB3  . ALA A 1 64  ? -11.412 8.690   1.094   1.00 0.00 ? 64  ALA A HB3  1  
ATOM 944   N N    . GLY A 1 65  ? -11.037 5.240   -0.417  1.00 0.00 ? 65  GLY A N    1  
ATOM 945   C CA   . GLY A 1 65  ? -12.041 4.193   -0.377  1.00 0.00 ? 65  GLY A CA   1  
ATOM 946   C C    . GLY A 1 65  ? -12.029 3.331   -1.624  1.00 0.00 ? 65  GLY A C    1  
ATOM 947   O O    . GLY A 1 65  ? -13.047 2.745   -1.992  1.00 0.00 ? 65  GLY A O    1  
ATOM 948   H H    . GLY A 1 65  ? -10.104 5.015   -0.615  1.00 0.00 ? 65  GLY A H    1  
ATOM 949   H HA2  . GLY A 1 65  ? -11.858 3.566   0.483   1.00 0.00 ? 65  GLY A HA2  1  
ATOM 950   H HA3  . GLY A 1 65  ? -13.015 4.648   -0.278  1.00 0.00 ? 65  GLY A HA3  1  
ATOM 951   N N    . ASP A 1 66  ? -10.875 3.255   -2.278  1.00 0.00 ? 66  ASP A N    1  
ATOM 952   C CA   . ASP A 1 66  ? -10.734 2.459   -3.492  1.00 0.00 ? 66  ASP A CA   1  
ATOM 953   C C    . ASP A 1 66  ? -10.387 1.012   -3.155  1.00 0.00 ? 66  ASP A C    1  
ATOM 954   O O    . ASP A 1 66  ? -10.277 0.647   -1.986  1.00 0.00 ? 66  ASP A O    1  
ATOM 955   C CB   . ASP A 1 66  ? -9.657  3.057   -4.398  1.00 0.00 ? 66  ASP A CB   1  
ATOM 956   C CG   . ASP A 1 66  ? -10.204 4.133   -5.315  1.00 0.00 ? 66  ASP A CG   1  
ATOM 957   O OD1  . ASP A 1 66  ? -10.910 5.036   -4.817  1.00 0.00 ? 66  ASP A OD1  1  
ATOM 958   O OD2  . ASP A 1 66  ? -9.926  4.073   -6.531  1.00 0.00 ? 66  ASP A OD2  1  
ATOM 959   H H    . ASP A 1 66  ? -10.098 3.746   -1.935  1.00 0.00 ? 66  ASP A H    1  
ATOM 960   H HA   . ASP A 1 66  ? -11.680 2.478   -4.012  1.00 0.00 ? 66  ASP A HA   1  
ATOM 961   H HB2  . ASP A 1 66  ? -8.882  3.493   -3.785  1.00 0.00 ? 66  ASP A HB2  1  
ATOM 962   H HB3  . ASP A 1 66  ? -9.231  2.273   -5.006  1.00 0.00 ? 66  ASP A HB3  1  
ATOM 963   N N    . GLU A 1 67  ? -10.218 0.194   -4.189  1.00 0.00 ? 67  GLU A N    1  
ATOM 964   C CA   . GLU A 1 67  ? -9.886  -1.214  -4.002  1.00 0.00 ? 67  GLU A CA   1  
ATOM 965   C C    . GLU A 1 67  ? -8.649  -1.593  -4.811  1.00 0.00 ? 67  GLU A C    1  
ATOM 966   O O    . GLU A 1 67  ? -8.677  -1.596  -6.042  1.00 0.00 ? 67  GLU A O    1  
ATOM 967   C CB   . GLU A 1 67  ? -11.067 -2.098  -4.410  1.00 0.00 ? 67  GLU A CB   1  
ATOM 968   C CG   . GLU A 1 67  ? -10.734 -3.580  -4.444  1.00 0.00 ? 67  GLU A CG   1  
ATOM 969   C CD   . GLU A 1 67  ? -10.864 -4.239  -3.085  1.00 0.00 ? 67  GLU A CD   1  
ATOM 970   O OE1  . GLU A 1 67  ? -9.871  -4.237  -2.328  1.00 0.00 ? 67  GLU A OE1  1  
ATOM 971   O OE2  . GLU A 1 67  ? -11.958 -4.758  -2.779  1.00 0.00 ? 67  GLU A OE2  1  
ATOM 972   H H    . GLU A 1 67  ? -10.320 0.544   -5.099  1.00 0.00 ? 67  GLU A H    1  
ATOM 973   H HA   . GLU A 1 67  ? -9.677  -1.369  -2.954  1.00 0.00 ? 67  GLU A HA   1  
ATOM 974   H HB2  . GLU A 1 67  ? -11.873 -1.947  -3.707  1.00 0.00 ? 67  GLU A HB2  1  
ATOM 975   H HB3  . GLU A 1 67  ? -11.399 -1.802  -5.394  1.00 0.00 ? 67  GLU A HB3  1  
ATOM 976   H HG2  . GLU A 1 67  ? -11.406 -4.071  -5.131  1.00 0.00 ? 67  GLU A HG2  1  
ATOM 977   H HG3  . GLU A 1 67  ? -9.717  -3.700  -4.790  1.00 0.00 ? 67  GLU A HG3  1  
ATOM 978   N N    . ILE A 1 68  ? -7.566  -1.912  -4.111  1.00 0.00 ? 68  ILE A N    1  
ATOM 979   C CA   . ILE A 1 68  ? -6.320  -2.294  -4.764  1.00 0.00 ? 68  ILE A CA   1  
ATOM 980   C C    . ILE A 1 68  ? -6.277  -3.794  -5.033  1.00 0.00 ? 68  ILE A C    1  
ATOM 981   O O    . ILE A 1 68  ? -6.298  -4.603  -4.104  1.00 0.00 ? 68  ILE A O    1  
ATOM 982   C CB   . ILE A 1 68  ? -5.097  -1.900  -3.914  1.00 0.00 ? 68  ILE A CB   1  
ATOM 983   C CG1  . ILE A 1 68  ? -5.232  -0.458  -3.422  1.00 0.00 ? 68  ILE A CG1  1  
ATOM 984   C CG2  . ILE A 1 68  ? -3.816  -2.074  -4.718  1.00 0.00 ? 68  ILE A CG2  1  
ATOM 985   C CD1  . ILE A 1 68  ? -5.072  0.572   -4.519  1.00 0.00 ? 68  ILE A CD1  1  
ATOM 986   H H    . ILE A 1 68  ? -7.607  -1.892  -3.132  1.00 0.00 ? 68  ILE A H    1  
ATOM 987   H HA   . ILE A 1 68  ? -6.263  -1.768  -5.706  1.00 0.00 ? 68  ILE A HA   1  
ATOM 988   H HB   . ILE A 1 68  ? -5.050  -2.561  -3.062  1.00 0.00 ? 68  ILE A HB   1  
ATOM 989   H HG12 . ILE A 1 68  ? -6.208  -0.324  -2.983  1.00 0.00 ? 68  ILE A HG12 1  
ATOM 990   H HG13 . ILE A 1 68  ? -4.476  -0.268  -2.674  1.00 0.00 ? 68  ILE A HG13 1  
ATOM 991   H HG21 . ILE A 1 68  ? -3.512  -3.109  -4.691  1.00 0.00 ? 68  ILE A HG21 1  
ATOM 992   H HG22 . ILE A 1 68  ? -3.992  -1.778  -5.742  1.00 0.00 ? 68  ILE A HG22 1  
ATOM 993   H HG23 . ILE A 1 68  ? -3.038  -1.458  -4.293  1.00 0.00 ? 68  ILE A HG23 1  
ATOM 994   H HD11 . ILE A 1 68  ? -5.091  1.562   -4.088  1.00 0.00 ? 68  ILE A HD11 1  
ATOM 995   H HD12 . ILE A 1 68  ? -4.131  0.417   -5.024  1.00 0.00 ? 68  ILE A HD12 1  
ATOM 996   H HD13 . ILE A 1 68  ? -5.882  0.472   -5.227  1.00 0.00 ? 68  ILE A HD13 1  
ATOM 997   N N    . LEU A 1 69  ? -6.215  -4.159  -6.308  1.00 0.00 ? 69  LEU A N    1  
ATOM 998   C CA   . LEU A 1 69  ? -6.167  -5.563  -6.701  1.00 0.00 ? 69  LEU A CA   1  
ATOM 999   C C    . LEU A 1 69  ? -4.725  -6.043  -6.831  1.00 0.00 ? 69  LEU A C    1  
ATOM 1000  O O    . LEU A 1 69  ? -4.332  -7.031  -6.212  1.00 0.00 ? 69  LEU A O    1  
ATOM 1001  C CB   . LEU A 1 69  ? -6.906  -5.769  -8.025  1.00 0.00 ? 69  LEU A CB   1  
ATOM 1002  C CG   . LEU A 1 69  ? -8.255  -5.062  -8.157  1.00 0.00 ? 69  LEU A CG   1  
ATOM 1003  C CD1  . LEU A 1 69  ? -8.653  -4.939  -9.619  1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1004  C CD2  . LEU A 1 69  ? -9.326  -5.805  -7.371  1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1005  H H    . LEU A 1 69  ? -6.201  -3.469  -7.004  1.00 0.00 ? 69  LEU A H    1  
ATOM 1006  H HA   . LEU A 1 69  ? -6.657  -6.139  -5.931  1.00 0.00 ? 69  LEU A HA   1  
ATOM 1007  H HB2  . LEU A 1 69  ? -6.267  -5.413  -8.818  1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1008  H HB3  . LEU A 1 69  ? -7.074  -6.829  -8.147  1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1009  H HG   . LEU A 1 69  ? -8.173  -4.063  -7.749  1.00 0.00 ? 69  LEU A HG   1  
ATOM 1010  H HD11 . LEU A 1 69  ? -7.862  -4.450  -10.168 1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1011  H HD12 . LEU A 1 69  ? -9.560  -4.358  -9.698  1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1012  H HD13 . LEU A 1 69  ? -8.820  -5.924  -10.030 1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1013  H HD21 . LEU A 1 69  ? -9.905  -6.419  -8.045  1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1014  H HD22 . LEU A 1 69  ? -9.977  -5.092  -6.886  1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1015  H HD23 . LEU A 1 69  ? -8.857  -6.430  -6.626  1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1016  N N    . GLU A 1 70  ? -3.941  -5.335  -7.638  1.00 0.00 ? 70  GLU A N    1  
ATOM 1017  C CA   . GLU A 1 70  ? -2.542  -5.688  -7.847  1.00 0.00 ? 70  GLU A CA   1  
ATOM 1018  C C    . GLU A 1 70  ? -1.664  -4.441  -7.878  1.00 0.00 ? 70  GLU A C    1  
ATOM 1019  O O    . GLU A 1 70  ? -2.139  -3.342  -8.167  1.00 0.00 ? 70  GLU A O    1  
ATOM 1020  C CB   . GLU A 1 70  ? -2.380  -6.471  -9.152  1.00 0.00 ? 70  GLU A CB   1  
ATOM 1021  C CG   . GLU A 1 70  ? -2.622  -7.963  -9.001  1.00 0.00 ? 70  GLU A CG   1  
ATOM 1022  C CD   . GLU A 1 70  ? -4.087  -8.333  -9.129  1.00 0.00 ? 70  GLU A CD   1  
ATOM 1023  O OE1  . GLU A 1 70  ? -4.820  -7.613  -9.839  1.00 0.00 ? 70  GLU A OE1  1  
ATOM 1024  O OE2  . GLU A 1 70  ? -4.500  -9.342  -8.521  1.00 0.00 ? 70  GLU A OE2  1  
ATOM 1025  H H    . GLU A 1 70  ? -4.313  -4.557  -8.104  1.00 0.00 ? 70  GLU A H    1  
ATOM 1026  H HA   . GLU A 1 70  ? -2.231  -6.313  -7.023  1.00 0.00 ? 70  GLU A HA   1  
ATOM 1027  H HB2  . GLU A 1 70  ? -3.081  -6.085  -9.879  1.00 0.00 ? 70  GLU A HB2  1  
ATOM 1028  H HB3  . GLU A 1 70  ? -1.376  -6.326  -9.522  1.00 0.00 ? 70  GLU A HB3  1  
ATOM 1029  H HG2  . GLU A 1 70  ? -2.067  -8.485  -9.766  1.00 0.00 ? 70  GLU A HG2  1  
ATOM 1030  H HG3  . GLU A 1 70  ? -2.271  -8.275  -8.028  1.00 0.00 ? 70  GLU A HG3  1  
ATOM 1031  N N    . ILE A 1 71  ? -0.382  -4.619  -7.577  1.00 0.00 ? 71  ILE A N    1  
ATOM 1032  C CA   . ILE A 1 71  ? 0.562   -3.509  -7.570  1.00 0.00 ? 71  ILE A CA   1  
ATOM 1033  C C    . ILE A 1 71  ? 1.877   -3.902  -8.234  1.00 0.00 ? 71  ILE A C    1  
ATOM 1034  O O    . ILE A 1 71  ? 2.665   -4.662  -7.673  1.00 0.00 ? 71  ILE A O    1  
ATOM 1035  C CB   . ILE A 1 71  ? 0.849   -3.022  -6.138  1.00 0.00 ? 71  ILE A CB   1  
ATOM 1036  C CG1  . ILE A 1 71  ? -0.462  -2.760  -5.393  1.00 0.00 ? 71  ILE A CG1  1  
ATOM 1037  C CG2  . ILE A 1 71  ? 1.708   -1.767  -6.166  1.00 0.00 ? 71  ILE A CG2  1  
ATOM 1038  C CD1  . ILE A 1 71  ? -0.305  -2.724  -3.889  1.00 0.00 ? 71  ILE A CD1  1  
ATOM 1039  H H    . ILE A 1 71  ? -0.064  -5.519  -7.355  1.00 0.00 ? 71  ILE A H    1  
ATOM 1040  H HA   . ILE A 1 71  ? 0.121   -2.693  -8.125  1.00 0.00 ? 71  ILE A HA   1  
ATOM 1041  H HB   . ILE A 1 71  ? 1.399   -3.794  -5.622  1.00 0.00 ? 71  ILE A HB   1  
ATOM 1042  H HG12 . ILE A 1 71  ? -0.864  -1.810  -5.707  1.00 0.00 ? 71  ILE A HG12 1  
ATOM 1043  H HG13 . ILE A 1 71  ? -1.167  -3.542  -5.635  1.00 0.00 ? 71  ILE A HG13 1  
ATOM 1044  H HG21 . ILE A 1 71  ? 2.730   -2.035  -6.391  1.00 0.00 ? 71  ILE A HG21 1  
ATOM 1045  H HG22 . ILE A 1 71  ? 1.338   -1.096  -6.927  1.00 0.00 ? 71  ILE A HG22 1  
ATOM 1046  H HG23 . ILE A 1 71  ? 1.666   -1.280  -5.204  1.00 0.00 ? 71  ILE A HG23 1  
ATOM 1047  H HD11 . ILE A 1 71  ? 0.391   -1.944  -3.618  1.00 0.00 ? 71  ILE A HD11 1  
ATOM 1048  H HD12 . ILE A 1 71  ? -1.263  -2.528  -3.431  1.00 0.00 ? 71  ILE A HD12 1  
ATOM 1049  H HD13 . ILE A 1 71  ? 0.071   -3.676  -3.543  1.00 0.00 ? 71  ILE A HD13 1  
ATOM 1050  N N    . ASN A 1 72  ? 2.109   -3.376  -9.433  1.00 0.00 ? 72  ASN A N    1  
ATOM 1051  C CA   . ASN A 1 72  ? 3.330   -3.671  -10.174 1.00 0.00 ? 72  ASN A CA   1  
ATOM 1052  C C    . ASN A 1 72  ? 3.447   -5.165  -10.458 1.00 0.00 ? 72  ASN A C    1  
ATOM 1053  O O    . ASN A 1 72  ? 4.538   -5.732  -10.417 1.00 0.00 ? 72  ASN A O    1  
ATOM 1054  C CB   . ASN A 1 72  ? 4.554   -3.192  -9.391  1.00 0.00 ? 72  ASN A CB   1  
ATOM 1055  C CG   . ASN A 1 72  ? 4.910   -1.751  -9.699  1.00 0.00 ? 72  ASN A CG   1  
ATOM 1056  O OD1  . ASN A 1 72  ? 5.429   -1.444  -10.773 1.00 0.00 ? 72  ASN A OD1  1  
ATOM 1057  N ND2  . ASN A 1 72  ? 4.632   -0.858  -8.756  1.00 0.00 ? 72  ASN A ND2  1  
ATOM 1058  H H    . ASN A 1 72  ? 1.443   -2.776  -9.829  1.00 0.00 ? 72  ASN A H    1  
ATOM 1059  H HA   . ASN A 1 72  ? 3.284   -3.140  -11.113 1.00 0.00 ? 72  ASN A HA   1  
ATOM 1060  H HB2  . ASN A 1 72  ? 4.352   -3.274  -8.333  1.00 0.00 ? 72  ASN A HB2  1  
ATOM 1061  H HB3  . ASN A 1 72  ? 5.400   -3.815  -9.641  1.00 0.00 ? 72  ASN A HB3  1  
ATOM 1062  H HD21 . ASN A 1 72  ? 4.219   -1.175  -7.926  1.00 0.00 ? 72  ASN A HD21 1  
ATOM 1063  H HD22 . ASN A 1 72  ? 4.851   0.081   -8.930  1.00 0.00 ? 72  ASN A HD22 1  
ATOM 1064  N N    . ASN A 1 73  ? 2.314   -5.797  -10.748 1.00 0.00 ? 73  ASN A N    1  
ATOM 1065  C CA   . ASN A 1 73  ? 2.288   -7.226  -11.039 1.00 0.00 ? 73  ASN A CA   1  
ATOM 1066  C C    . ASN A 1 73  ? 2.543   -8.043  -9.776  1.00 0.00 ? 73  ASN A C    1  
ATOM 1067  O O    . ASN A 1 73  ? 3.211   -9.077  -9.818  1.00 0.00 ? 73  ASN A O    1  
ATOM 1068  C CB   . ASN A 1 73  ? 3.334   -7.569  -12.102 1.00 0.00 ? 73  ASN A CB   1  
ATOM 1069  C CG   . ASN A 1 73  ? 2.987   -8.831  -12.868 1.00 0.00 ? 73  ASN A CG   1  
ATOM 1070  O OD1  . ASN A 1 73  ? 2.042   -8.852  -13.657 1.00 0.00 ? 73  ASN A OD1  1  
ATOM 1071  N ND2  . ASN A 1 73  ? 3.751   -9.892  -12.638 1.00 0.00 ? 73  ASN A ND2  1  
ATOM 1072  H H    . ASN A 1 73  ? 1.475   -5.291  -10.765 1.00 0.00 ? 73  ASN A H    1  
ATOM 1073  H HA   . ASN A 1 73  ? 1.308   -7.469  -11.420 1.00 0.00 ? 73  ASN A HA   1  
ATOM 1074  H HB2  . ASN A 1 73  ? 3.405   -6.753  -12.805 1.00 0.00 ? 73  ASN A HB2  1  
ATOM 1075  H HB3  . ASN A 1 73  ? 4.291   -7.712  -11.624 1.00 0.00 ? 73  ASN A HB3  1  
ATOM 1076  H HD21 . ASN A 1 73  ? 4.487   -9.803  -11.995 1.00 0.00 ? 73  ASN A HD21 1  
ATOM 1077  H HD22 . ASN A 1 73  ? 3.550   -10.721 -13.120 1.00 0.00 ? 73  ASN A HD22 1  
ATOM 1078  N N    . ARG A 1 74  ? 2.006   -7.573  -8.655  1.00 0.00 ? 74  ARG A N    1  
ATOM 1079  C CA   . ARG A 1 74  ? 2.175   -8.260  -7.380  1.00 0.00 ? 74  ARG A CA   1  
ATOM 1080  C C    . ARG A 1 74  ? 0.840   -8.394  -6.654  1.00 0.00 ? 74  ARG A C    1  
ATOM 1081  O O    . ARG A 1 74  ? 0.008   -7.488  -6.691  1.00 0.00 ? 74  ARG A O    1  
ATOM 1082  C CB   . ARG A 1 74  ? 3.173   -7.506  -6.500  1.00 0.00 ? 74  ARG A CB   1  
ATOM 1083  C CG   . ARG A 1 74  ? 4.600   -7.548  -7.023  1.00 0.00 ? 74  ARG A CG   1  
ATOM 1084  C CD   . ARG A 1 74  ? 5.226   -8.919  -6.823  1.00 0.00 ? 74  ARG A CD   1  
ATOM 1085  N NE   . ARG A 1 74  ? 6.652   -8.921  -7.140  1.00 0.00 ? 74  ARG A NE   1  
ATOM 1086  C CZ   . ARG A 1 74  ? 7.131   -9.061  -8.371  1.00 0.00 ? 74  ARG A CZ   1  
ATOM 1087  N NH1  . ARG A 1 74  ? 6.302   -9.208  -9.396  1.00 0.00 ? 74  ARG A NH1  1  
ATOM 1088  N NH2  . ARG A 1 74  ? 8.441   -9.052  -8.580  1.00 0.00 ? 74  ARG A NH2  1  
ATOM 1089  H H    . ARG A 1 74  ? 1.484   -6.744  -8.686  1.00 0.00 ? 74  ARG A H    1  
ATOM 1090  H HA   . ARG A 1 74  ? 2.562   -9.247  -7.584  1.00 0.00 ? 74  ARG A HA   1  
ATOM 1091  H HB2  . ARG A 1 74  ? 2.868   -6.472  -6.433  1.00 0.00 ? 74  ARG A HB2  1  
ATOM 1092  H HB3  . ARG A 1 74  ? 3.163   -7.940  -5.511  1.00 0.00 ? 74  ARG A HB3  1  
ATOM 1093  H HG2  . ARG A 1 74  ? 4.594   -7.318  -8.078  1.00 0.00 ? 74  ARG A HG2  1  
ATOM 1094  H HG3  . ARG A 1 74  ? 5.188   -6.812  -6.495  1.00 0.00 ? 74  ARG A HG3  1  
ATOM 1095  H HD2  . ARG A 1 74  ? 5.096   -9.213  -5.792  1.00 0.00 ? 74  ARG A HD2  1  
ATOM 1096  H HD3  . ARG A 1 74  ? 4.723   -9.627  -7.465  1.00 0.00 ? 74  ARG A HD3  1  
ATOM 1097  H HE   . ARG A 1 74  ? 7.282   -8.814  -6.398  1.00 0.00 ? 74  ARG A HE   1  
ATOM 1098  H HH11 . ARG A 1 74  ? 5.314   -9.214  -9.242  1.00 0.00 ? 74  ARG A HH11 1  
ATOM 1099  H HH12 . ARG A 1 74  ? 6.665   -9.312  -10.322 1.00 0.00 ? 74  ARG A HH12 1  
ATOM 1100  H HH21 . ARG A 1 74  ? 9.069   -8.941  -7.810  1.00 0.00 ? 74  ARG A HH21 1  
ATOM 1101  H HH22 . ARG A 1 74  ? 8.801   -9.157  -9.506  1.00 0.00 ? 74  ARG A HH22 1  
ATOM 1102  N N    . ALA A 1 75  ? 0.643   -9.531  -5.994  1.00 0.00 ? 75  ALA A N    1  
ATOM 1103  C CA   . ALA A 1 75  ? -0.590  -9.784  -5.258  1.00 0.00 ? 75  ALA A CA   1  
ATOM 1104  C C    . ALA A 1 75  ? -0.586  -9.059  -3.916  1.00 0.00 ? 75  ALA A C    1  
ATOM 1105  O O    . ALA A 1 75  ? 0.267   -9.313  -3.066  1.00 0.00 ? 75  ALA A O    1  
ATOM 1106  C CB   . ALA A 1 75  ? -0.785  -11.279 -5.053  1.00 0.00 ? 75  ALA A CB   1  
ATOM 1107  H H    . ALA A 1 75  ? 1.344   -10.216 -6.002  1.00 0.00 ? 75  ALA A H    1  
ATOM 1108  H HA   . ALA A 1 75  ? -1.414  -9.416  -5.852  1.00 0.00 ? 75  ALA A HA   1  
ATOM 1109  H HB1  . ALA A 1 75  ? 0.087   -11.807 -5.410  1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1110  H HB2  . ALA A 1 75  ? -0.925  -11.482 -4.002  1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1111  H HB3  . ALA A 1 75  ? -1.655  -11.606 -5.602  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1112  N N    . ALA A 1 76  ? -1.543  -8.156  -3.734  1.00 0.00 ? 76  ALA A N    1  
ATOM 1113  C CA   . ALA A 1 76  ? -1.651  -7.396  -2.495  1.00 0.00 ? 76  ALA A CA   1  
ATOM 1114  C C    . ALA A 1 76  ? -1.449  -8.296  -1.280  1.00 0.00 ? 76  ALA A C    1  
ATOM 1115  O O    . ALA A 1 76  ? -0.625  -8.008  -0.412  1.00 0.00 ? 76  ALA A O    1  
ATOM 1116  C CB   . ALA A 1 76  ? -3.000  -6.698  -2.419  1.00 0.00 ? 76  ALA A CB   1  
ATOM 1117  H H    . ALA A 1 76  ? -2.194  -7.998  -4.449  1.00 0.00 ? 76  ALA A H    1  
ATOM 1118  H HA   . ALA A 1 76  ? -0.881  -6.638  -2.500  1.00 0.00 ? 76  ALA A HA   1  
ATOM 1119  H HB1  . ALA A 1 76  ? -3.713  -7.347  -1.931  1.00 0.00 ? 76  ALA A HB1  1  
ATOM 1120  H HB2  . ALA A 1 76  ? -2.901  -5.783  -1.854  1.00 0.00 ? 76  ALA A HB2  1  
ATOM 1121  H HB3  . ALA A 1 76  ? -3.344  -6.471  -3.417  1.00 0.00 ? 76  ALA A HB3  1  
ATOM 1122  N N    . ASP A 1 77  ? -2.207  -9.385  -1.224  1.00 0.00 ? 77  ASP A N    1  
ATOM 1123  C CA   . ASP A 1 77  ? -2.111  -10.327 -0.115  1.00 0.00 ? 77  ASP A CA   1  
ATOM 1124  C C    . ASP A 1 77  ? -0.669  -10.781 0.090   1.00 0.00 ? 77  ASP A C    1  
ATOM 1125  O O    . ASP A 1 77  ? -0.212  -10.936 1.221   1.00 0.00 ? 77  ASP A O    1  
ATOM 1126  C CB   . ASP A 1 77  ? -3.009  -11.539 -0.369  1.00 0.00 ? 77  ASP A CB   1  
ATOM 1127  C CG   . ASP A 1 77  ? -2.711  -12.214 -1.694  1.00 0.00 ? 77  ASP A CG   1  
ATOM 1128  O OD1  . ASP A 1 77  ? -2.974  -11.596 -2.747  1.00 0.00 ? 77  ASP A OD1  1  
ATOM 1129  O OD2  . ASP A 1 77  ? -2.214  -13.359 -1.677  1.00 0.00 ? 77  ASP A OD2  1  
ATOM 1130  H H    . ASP A 1 77  ? -2.846  -9.560  -1.947  1.00 0.00 ? 77  ASP A H    1  
ATOM 1131  H HA   . ASP A 1 77  ? -2.447  -9.823  0.778   1.00 0.00 ? 77  ASP A HA   1  
ATOM 1132  H HB2  . ASP A 1 77  ? -2.862  -12.261 0.422   1.00 0.00 ? 77  ASP A HB2  1  
ATOM 1133  H HB3  . ASP A 1 77  ? -4.041  -11.221 -0.372  1.00 0.00 ? 77  ASP A HB3  1  
ATOM 1134  N N    . ALA A 1 78  ? 0.041   -10.992 -1.013  1.00 0.00 ? 78  ALA A N    1  
ATOM 1135  C CA   . ALA A 1 78  ? 1.431   -11.427 -0.955  1.00 0.00 ? 78  ALA A CA   1  
ATOM 1136  C C    . ALA A 1 78  ? 2.329   -10.325 -0.403  1.00 0.00 ? 78  ALA A C    1  
ATOM 1137  O O    . ALA A 1 78  ? 3.330   -10.598 0.259   1.00 0.00 ? 78  ALA A O    1  
ATOM 1138  C CB   . ALA A 1 78  ? 1.908   -11.858 -2.334  1.00 0.00 ? 78  ALA A CB   1  
ATOM 1139  H H    . ALA A 1 78  ? -0.379  -10.851 -1.887  1.00 0.00 ? 78  ALA A H    1  
ATOM 1140  H HA   . ALA A 1 78  ? 1.486   -12.284 -0.299  1.00 0.00 ? 78  ALA A HA   1  
ATOM 1141  H HB1  . ALA A 1 78  ? 2.139   -10.982 -2.924  1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1142  H HB2  . ALA A 1 78  ? 2.793   -12.469 -2.234  1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1143  H HB3  . ALA A 1 78  ? 1.131   -12.426 -2.822  1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1144  N N    . LEU A 1 79  ? 1.964   -9.078  -0.680  1.00 0.00 ? 79  LEU A N    1  
ATOM 1145  C CA   . LEU A 1 79  ? 2.737   -7.932  -0.211  1.00 0.00 ? 79  LEU A CA   1  
ATOM 1146  C C    . LEU A 1 79  ? 2.372   -7.582  1.227   1.00 0.00 ? 79  LEU A C    1  
ATOM 1147  O O    . LEU A 1 79  ? 1.199   -7.577  1.598   1.00 0.00 ? 79  LEU A O    1  
ATOM 1148  C CB   . LEU A 1 79  ? 2.497   -6.725  -1.119  1.00 0.00 ? 79  LEU A CB   1  
ATOM 1149  C CG   . LEU A 1 79  ? 2.650   -6.973  -2.620  1.00 0.00 ? 79  LEU A CG   1  
ATOM 1150  C CD1  . LEU A 1 79  ? 2.095   -5.800  -3.414  1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1151  C CD2  . LEU A 1 79  ? 4.109   -7.216  -2.975  1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1152  H H    . LEU A 1 79  ? 1.156   -8.922  -1.212  1.00 0.00 ? 79  LEU A H    1  
ATOM 1153  H HA   . LEU A 1 79  ? 3.782   -8.200  -0.250  1.00 0.00 ? 79  LEU A HA   1  
ATOM 1154  H HB2  . LEU A 1 79  ? 1.493   -6.373  -0.943  1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1155  H HB3  . LEU A 1 79  ? 3.201   -5.955  -0.837  1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1156  H HG   . LEU A 1 79  ? 2.087   -7.855  -2.892  1.00 0.00 ? 79  LEU A HG   1  
ATOM 1157  H HD11 . LEU A 1 79  ? 2.440   -4.875  -2.979  1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1158  H HD12 . LEU A 1 79  ? 1.015   -5.829  -3.390  1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1159  H HD13 . LEU A 1 79  ? 2.433   -5.866  -4.438  1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1160  H HD21 . LEU A 1 79  ? 4.735   -6.551  -2.398  1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1161  H HD22 . LEU A 1 79  ? 4.260   -7.027  -4.028  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1162  H HD23 . LEU A 1 79  ? 4.368   -8.240  -2.751  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1163  N N    . ASN A 1 80  ? 3.387   -7.285  2.034   1.00 0.00 ? 80  ASN A N    1  
ATOM 1164  C CA   . ASN A 1 80  ? 3.173   -6.931  3.432   1.00 0.00 ? 80  ASN A CA   1  
ATOM 1165  C C    . ASN A 1 80  ? 3.643   -5.507  3.711   1.00 0.00 ? 80  ASN A C    1  
ATOM 1166  O O    . ASN A 1 80  ? 4.252   -4.865  2.855   1.00 0.00 ? 80  ASN A O    1  
ATOM 1167  C CB   . ASN A 1 80  ? 3.910   -7.911  4.347   1.00 0.00 ? 80  ASN A CB   1  
ATOM 1168  C CG   . ASN A 1 80  ? 5.406   -7.661  4.376   1.00 0.00 ? 80  ASN A CG   1  
ATOM 1169  O OD1  . ASN A 1 80  ? 6.007   -7.304  3.363   1.00 0.00 ? 80  ASN A OD1  1  
ATOM 1170  N ND2  . ASN A 1 80  ? 6.014   -7.849  5.542   1.00 0.00 ? 80  ASN A ND2  1  
ATOM 1171  H H    . ASN A 1 80  ? 4.300   -7.306  1.681   1.00 0.00 ? 80  ASN A H    1  
ATOM 1172  H HA   . ASN A 1 80  ? 2.114   -6.994  3.632   1.00 0.00 ? 80  ASN A HA   1  
ATOM 1173  H HB2  . ASN A 1 80  ? 3.529   -7.812  5.353   1.00 0.00 ? 80  ASN A HB2  1  
ATOM 1174  H HB3  . ASN A 1 80  ? 3.739   -8.919  3.999   1.00 0.00 ? 80  ASN A HB3  1  
ATOM 1175  H HD21 . ASN A 1 80  ? 5.472   -8.134  6.307   1.00 0.00 ? 80  ASN A HD21 1  
ATOM 1176  H HD22 . ASN A 1 80  ? 6.980   -7.694  5.589   1.00 0.00 ? 80  ASN A HD22 1  
ATOM 1177  N N    . SER A 1 81  ? 3.356   -5.019  4.913   1.00 0.00 ? 81  SER A N    1  
ATOM 1178  C CA   . SER A 1 81  ? 3.746   -3.669  5.304   1.00 0.00 ? 81  SER A CA   1  
ATOM 1179  C C    . SER A 1 81  ? 5.144   -3.338  4.792   1.00 0.00 ? 81  SER A C    1  
ATOM 1180  O O    . SER A 1 81  ? 5.391   -2.240  4.295   1.00 0.00 ? 81  SER A O    1  
ATOM 1181  C CB   . SER A 1 81  ? 3.700   -3.523  6.826   1.00 0.00 ? 81  SER A CB   1  
ATOM 1182  O OG   . SER A 1 81  ? 4.353   -2.337  7.244   1.00 0.00 ? 81  SER A OG   1  
ATOM 1183  H H    . SER A 1 81  ? 2.867   -5.580  5.552   1.00 0.00 ? 81  SER A H    1  
ATOM 1184  H HA   . SER A 1 81  ? 3.041   -2.980  4.863   1.00 0.00 ? 81  SER A HA   1  
ATOM 1185  H HB2  . SER A 1 81  ? 2.672   -3.487  7.151   1.00 0.00 ? 81  SER A HB2  1  
ATOM 1186  H HB3  . SER A 1 81  ? 4.192   -4.370  7.281   1.00 0.00 ? 81  SER A HB3  1  
ATOM 1187  H HG   . SER A 1 81  ? 3.953   -2.021  8.058   1.00 0.00 ? 81  SER A HG   1  
ATOM 1188  N N    . SER A 1 82  ? 6.056   -4.298  4.917   1.00 0.00 ? 82  SER A N    1  
ATOM 1189  C CA   . SER A 1 82  ? 7.431   -4.108  4.471   1.00 0.00 ? 82  SER A CA   1  
ATOM 1190  C C    . SER A 1 82  ? 7.476   -3.731  2.993   1.00 0.00 ? 82  SER A C    1  
ATOM 1191  O O    . SER A 1 82  ? 7.946   -2.654  2.630   1.00 0.00 ? 82  SER A O    1  
ATOM 1192  C CB   . SER A 1 82  ? 8.247   -5.380  4.709   1.00 0.00 ? 82  SER A CB   1  
ATOM 1193  O OG   . SER A 1 82  ? 8.680   -5.464  6.056   1.00 0.00 ? 82  SER A OG   1  
ATOM 1194  H H    . SER A 1 82  ? 5.797   -5.152  5.322   1.00 0.00 ? 82  SER A H    1  
ATOM 1195  H HA   . SER A 1 82  ? 7.859   -3.303  5.048   1.00 0.00 ? 82  SER A HA   1  
ATOM 1196  H HB2  . SER A 1 82  ? 7.637   -6.243  4.485   1.00 0.00 ? 82  SER A HB2  1  
ATOM 1197  H HB3  . SER A 1 82  ? 9.114   -5.375  4.064   1.00 0.00 ? 82  SER A HB3  1  
ATOM 1198  H HG   . SER A 1 82  ? 8.178   -6.143  6.512   1.00 0.00 ? 82  SER A HG   1  
ATOM 1199  N N    . MET A 1 83  ? 6.982   -4.628  2.145   1.00 0.00 ? 83  MET A N    1  
ATOM 1200  C CA   . MET A 1 83  ? 6.964   -4.390  0.706   1.00 0.00 ? 83  MET A CA   1  
ATOM 1201  C C    . MET A 1 83  ? 6.231   -3.093  0.379   1.00 0.00 ? 83  MET A C    1  
ATOM 1202  O O    . MET A 1 83  ? 6.765   -2.222  -0.309  1.00 0.00 ? 83  MET A O    1  
ATOM 1203  C CB   . MET A 1 83  ? 6.300   -5.562  -0.018  1.00 0.00 ? 83  MET A CB   1  
ATOM 1204  C CG   . MET A 1 83  ? 7.237   -6.733  -0.267  1.00 0.00 ? 83  MET A CG   1  
ATOM 1205  S SD   . MET A 1 83  ? 6.362   -8.233  -0.750  1.00 0.00 ? 83  MET A SD   1  
ATOM 1206  C CE   . MET A 1 83  ? 6.276   -9.095  0.817   1.00 0.00 ? 83  MET A CE   1  
ATOM 1207  H H    . MET A 1 83  ? 6.621   -5.470  2.494   1.00 0.00 ? 83  MET A H    1  
ATOM 1208  H HA   . MET A 1 83  ? 7.987   -4.305  0.372   1.00 0.00 ? 83  MET A HA   1  
ATOM 1209  H HB2  . MET A 1 83  ? 5.470   -5.913  0.576   1.00 0.00 ? 83  MET A HB2  1  
ATOM 1210  H HB3  . MET A 1 83  ? 5.929   -5.218  -0.972  1.00 0.00 ? 83  MET A HB3  1  
ATOM 1211  H HG2  . MET A 1 83  ? 7.925   -6.465  -1.055  1.00 0.00 ? 83  MET A HG2  1  
ATOM 1212  H HG3  . MET A 1 83  ? 7.791   -6.931  0.639   1.00 0.00 ? 83  MET A HG3  1  
ATOM 1213  H HE1  . MET A 1 83  ? 6.764   -8.506  1.580   1.00 0.00 ? 83  MET A HE1  1  
ATOM 1214  H HE2  . MET A 1 83  ? 5.241   -9.248  1.088   1.00 0.00 ? 83  MET A HE2  1  
ATOM 1215  H HE3  . MET A 1 83  ? 6.771   -10.052 0.729   1.00 0.00 ? 83  MET A HE3  1  
ATOM 1216  N N    . LEU A 1 84  ? 5.005   -2.971  0.875   1.00 0.00 ? 84  LEU A N    1  
ATOM 1217  C CA   . LEU A 1 84  ? 4.197   -1.780  0.636   1.00 0.00 ? 84  LEU A CA   1  
ATOM 1218  C C    . LEU A 1 84  ? 5.041   -0.516  0.761   1.00 0.00 ? 84  LEU A C    1  
ATOM 1219  O O    . LEU A 1 84  ? 4.998   0.362   -0.101  1.00 0.00 ? 84  LEU A O    1  
ATOM 1220  C CB   . LEU A 1 84  ? 3.027   -1.726  1.620   1.00 0.00 ? 84  LEU A CB   1  
ATOM 1221  C CG   . LEU A 1 84  ? 1.819   -2.596  1.274   1.00 0.00 ? 84  LEU A CG   1  
ATOM 1222  C CD1  . LEU A 1 84  ? 0.933   -2.789  2.495   1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1223  C CD2  . LEU A 1 84  ? 1.027   -1.979  0.130   1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1224  H H    . LEU A 1 84  ? 4.633   -3.698  1.416   1.00 0.00 ? 84  LEU A H    1  
ATOM 1225  H HA   . LEU A 1 84  ? 3.809   -1.840  -0.370  1.00 0.00 ? 84  LEU A HA   1  
ATOM 1226  H HB2  . LEU A 1 84  ? 3.393   -2.038  2.586   1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1227  H HB3  . LEU A 1 84  ? 2.692   -0.700  1.678   1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1228  H HG   . LEU A 1 84  ? 2.164   -3.571  0.955   1.00 0.00 ? 84  LEU A HG   1  
ATOM 1229  H HD11 . LEU A 1 84  ? 0.876   -1.864  3.048   1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1230  H HD12 . LEU A 1 84  ? 1.351   -3.561  3.124   1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1231  H HD13 . LEU A 1 84  ? -0.058  -3.081  2.178   1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1232  H HD21 . LEU A 1 84  ? 1.687   -1.387  -0.486  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1233  H HD22 . LEU A 1 84  ? 0.247   -1.348  0.532   1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1234  H HD23 . LEU A 1 84  ? 0.584   -2.763  -0.466  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1235  N N    . LYS A 1 85  ? 5.811   -0.429  1.841   1.00 0.00 ? 85  LYS A N    1  
ATOM 1236  C CA   . LYS A 1 85  ? 6.668   0.726   2.080   1.00 0.00 ? 85  LYS A CA   1  
ATOM 1237  C C    . LYS A 1 85  ? 7.629   0.940   0.915   1.00 0.00 ? 85  LYS A C    1  
ATOM 1238  O O    . LYS A 1 85  ? 7.784   2.058   0.423   1.00 0.00 ? 85  LYS A O    1  
ATOM 1239  C CB   . LYS A 1 85  ? 7.457   0.541   3.378   1.00 0.00 ? 85  LYS A CB   1  
ATOM 1240  C CG   . LYS A 1 85  ? 8.250   1.770   3.787   1.00 0.00 ? 85  LYS A CG   1  
ATOM 1241  C CD   . LYS A 1 85  ? 9.471   1.397   4.612   1.00 0.00 ? 85  LYS A CD   1  
ATOM 1242  C CE   . LYS A 1 85  ? 9.076   0.783   5.946   1.00 0.00 ? 85  LYS A CE   1  
ATOM 1243  N NZ   . LYS A 1 85  ? 8.936   -0.696  5.856   1.00 0.00 ? 85  LYS A NZ   1  
ATOM 1244  H H    . LYS A 1 85  ? 5.802   -1.161  2.494   1.00 0.00 ? 85  LYS A H    1  
ATOM 1245  H HA   . LYS A 1 85  ? 6.035   1.595   2.173   1.00 0.00 ? 85  LYS A HA   1  
ATOM 1246  H HB2  . LYS A 1 85  ? 6.767   0.302   4.174   1.00 0.00 ? 85  LYS A HB2  1  
ATOM 1247  H HB3  . LYS A 1 85  ? 8.147   -0.281  3.252   1.00 0.00 ? 85  LYS A HB3  1  
ATOM 1248  H HG2  . LYS A 1 85  ? 8.575   2.291   2.899   1.00 0.00 ? 85  LYS A HG2  1  
ATOM 1249  H HG3  . LYS A 1 85  ? 7.615   2.418   4.374   1.00 0.00 ? 85  LYS A HG3  1  
ATOM 1250  H HD2  . LYS A 1 85  ? 10.062  0.681   4.060   1.00 0.00 ? 85  LYS A HD2  1  
ATOM 1251  H HD3  . LYS A 1 85  ? 10.057  2.287   4.794   1.00 0.00 ? 85  LYS A HD3  1  
ATOM 1252  H HE2  . LYS A 1 85  ? 9.835   1.021   6.676   1.00 0.00 ? 85  LYS A HE2  1  
ATOM 1253  H HE3  . LYS A 1 85  ? 8.132   1.207   6.257   1.00 0.00 ? 85  LYS A HE3  1  
ATOM 1254  H HZ1  . LYS A 1 85  ? 8.874   -0.989  4.860   1.00 0.00 ? 85  LYS A HZ1  1  
ATOM 1255  H HZ2  . LYS A 1 85  ? 8.075   -1.005  6.351   1.00 0.00 ? 85  LYS A HZ2  1  
ATOM 1256  H HZ3  . LYS A 1 85  ? 9.759   -1.160  6.292   1.00 0.00 ? 85  LYS A HZ3  1  
ATOM 1257  N N    . ASP A 1 86  ? 8.270   -0.138  0.477   1.00 0.00 ? 86  ASP A N    1  
ATOM 1258  C CA   . ASP A 1 86  ? 9.214   -0.069  -0.633  1.00 0.00 ? 86  ASP A CA   1  
ATOM 1259  C C    . ASP A 1 86  ? 8.544   0.495   -1.881  1.00 0.00 ? 86  ASP A C    1  
ATOM 1260  O O    . ASP A 1 86  ? 9.116   1.330   -2.583  1.00 0.00 ? 86  ASP A O    1  
ATOM 1261  C CB   . ASP A 1 86  ? 9.789   -1.455  -0.929  1.00 0.00 ? 86  ASP A CB   1  
ATOM 1262  C CG   . ASP A 1 86  ? 11.100  -1.388  -1.688  1.00 0.00 ? 86  ASP A CG   1  
ATOM 1263  O OD1  . ASP A 1 86  ? 11.062  -1.183  -2.919  1.00 0.00 ? 86  ASP A OD1  1  
ATOM 1264  O OD2  . ASP A 1 86  ? 12.163  -1.541  -1.051  1.00 0.00 ? 86  ASP A OD2  1  
ATOM 1265  H H    . ASP A 1 86  ? 8.104   -1.002  0.910   1.00 0.00 ? 86  ASP A H    1  
ATOM 1266  H HA   . ASP A 1 86  ? 10.019  0.590   -0.343  1.00 0.00 ? 86  ASP A HA   1  
ATOM 1267  H HB2  . ASP A 1 86  ? 9.961   -1.973  0.004   1.00 0.00 ? 86  ASP A HB2  1  
ATOM 1268  H HB3  . ASP A 1 86  ? 9.079   -2.013  -1.521  1.00 0.00 ? 86  ASP A HB3  1  
ATOM 1269  N N    . PHE A 1 87  ? 7.328   0.033   -2.155  1.00 0.00 ? 87  PHE A N    1  
ATOM 1270  C CA   . PHE A 1 87  ? 6.581   0.489   -3.320  1.00 0.00 ? 87  PHE A CA   1  
ATOM 1271  C C    . PHE A 1 87  ? 6.224   1.967   -3.193  1.00 0.00 ? 87  PHE A C    1  
ATOM 1272  O O    . PHE A 1 87  ? 6.169   2.693   -4.187  1.00 0.00 ? 87  PHE A O    1  
ATOM 1273  C CB   . PHE A 1 87  ? 5.307   -0.341  -3.493  1.00 0.00 ? 87  PHE A CB   1  
ATOM 1274  C CG   . PHE A 1 87  ? 5.499   -1.560  -4.349  1.00 0.00 ? 87  PHE A CG   1  
ATOM 1275  C CD1  . PHE A 1 87  ? 6.151   -1.472  -5.569  1.00 0.00 ? 87  PHE A CD1  1  
ATOM 1276  C CD2  . PHE A 1 87  ? 5.026   -2.795  -3.935  1.00 0.00 ? 87  PHE A CD2  1  
ATOM 1277  C CE1  . PHE A 1 87  ? 6.329   -2.592  -6.359  1.00 0.00 ? 87  PHE A CE1  1  
ATOM 1278  C CE2  . PHE A 1 87  ? 5.201   -3.919  -4.720  1.00 0.00 ? 87  PHE A CE2  1  
ATOM 1279  C CZ   . PHE A 1 87  ? 5.852   -3.817  -5.934  1.00 0.00 ? 87  PHE A CZ   1  
ATOM 1280  H H    . PHE A 1 87  ? 6.925   -0.632  -1.558  1.00 0.00 ? 87  PHE A H    1  
ATOM 1281  H HA   . PHE A 1 87  ? 7.208   0.356   -4.188  1.00 0.00 ? 87  PHE A HA   1  
ATOM 1282  H HB2  . PHE A 1 87  ? 4.965   -0.668  -2.523  1.00 0.00 ? 87  PHE A HB2  1  
ATOM 1283  H HB3  . PHE A 1 87  ? 4.546   0.272   -3.952  1.00 0.00 ? 87  PHE A HB3  1  
ATOM 1284  H HD1  . PHE A 1 87  ? 6.524   -0.513  -5.902  1.00 0.00 ? 87  PHE A HD1  1  
ATOM 1285  H HD2  . PHE A 1 87  ? 4.515   -2.876  -2.987  1.00 0.00 ? 87  PHE A HD2  1  
ATOM 1286  H HE1  . PHE A 1 87  ? 6.838   -2.509  -7.307  1.00 0.00 ? 87  PHE A HE1  1  
ATOM 1287  H HE2  . PHE A 1 87  ? 4.828   -4.875  -4.386  1.00 0.00 ? 87  PHE A HE2  1  
ATOM 1288  H HZ   . PHE A 1 87  ? 5.991   -4.693  -6.550  1.00 0.00 ? 87  PHE A HZ   1  
ATOM 1289  N N    . LEU A 1 88  ? 5.982   2.407   -1.963  1.00 0.00 ? 88  LEU A N    1  
ATOM 1290  C CA   . LEU A 1 88  ? 5.630   3.799   -1.704  1.00 0.00 ? 88  LEU A CA   1  
ATOM 1291  C C    . LEU A 1 88  ? 6.864   4.693   -1.762  1.00 0.00 ? 88  LEU A C    1  
ATOM 1292  O O    . LEU A 1 88  ? 6.754   5.918   -1.811  1.00 0.00 ? 88  LEU A O    1  
ATOM 1293  C CB   . LEU A 1 88  ? 4.955   3.929   -0.337  1.00 0.00 ? 88  LEU A CB   1  
ATOM 1294  C CG   . LEU A 1 88  ? 3.510   3.438   -0.252  1.00 0.00 ? 88  LEU A CG   1  
ATOM 1295  C CD1  . LEU A 1 88  ? 3.041   3.406   1.194   1.00 0.00 ? 88  LEU A CD1  1  
ATOM 1296  C CD2  . LEU A 1 88  ? 2.597   4.319   -1.092  1.00 0.00 ? 88  LEU A CD2  1  
ATOM 1297  H H    . LEU A 1 88  ? 6.041   1.783   -1.211  1.00 0.00 ? 88  LEU A H    1  
ATOM 1298  H HA   . LEU A 1 88  ? 4.936   4.113   -2.470  1.00 0.00 ? 88  LEU A HA   1  
ATOM 1299  H HB2  . LEU A 1 88  ? 5.538   3.364   0.374   1.00 0.00 ? 88  LEU A HB2  1  
ATOM 1300  H HB3  . LEU A 1 88  ? 4.967   4.974   -0.061  1.00 0.00 ? 88  LEU A HB3  1  
ATOM 1301  H HG   . LEU A 1 88  ? 3.455   2.430   -0.642  1.00 0.00 ? 88  LEU A HG   1  
ATOM 1302  H HD11 . LEU A 1 88  ? 3.837   3.746   1.838   1.00 0.00 ? 88  LEU A HD11 1  
ATOM 1303  H HD12 . LEU A 1 88  ? 2.767   2.397   1.462   1.00 0.00 ? 88  LEU A HD12 1  
ATOM 1304  H HD13 . LEU A 1 88  ? 2.183   4.054   1.308   1.00 0.00 ? 88  LEU A HD13 1  
ATOM 1305  H HD21 . LEU A 1 88  ? 2.774   4.125   -2.140  1.00 0.00 ? 88  LEU A HD21 1  
ATOM 1306  H HD22 . LEU A 1 88  ? 2.804   5.358   -0.879  1.00 0.00 ? 88  LEU A HD22 1  
ATOM 1307  H HD23 . LEU A 1 88  ? 1.567   4.100   -0.854  1.00 0.00 ? 88  LEU A HD23 1  
ATOM 1308  N N    . SER A 1 89  ? 8.039   4.072   -1.758  1.00 0.00 ? 89  SER A N    1  
ATOM 1309  C CA   . SER A 1 89  ? 9.295   4.811   -1.808  1.00 0.00 ? 89  SER A CA   1  
ATOM 1310  C C    . SER A 1 89  ? 9.885   4.785   -3.215  1.00 0.00 ? 89  SER A C    1  
ATOM 1311  O O    . SER A 1 89  ? 11.103  4.794   -3.388  1.00 0.00 ? 89  SER A O    1  
ATOM 1312  C CB   . SER A 1 89  ? 10.297  4.225   -0.812  1.00 0.00 ? 89  SER A CB   1  
ATOM 1313  O OG   . SER A 1 89  ? 10.134  4.800   0.473   1.00 0.00 ? 89  SER A OG   1  
ATOM 1314  H H    . SER A 1 89  ? 8.062   3.093   -1.718  1.00 0.00 ? 89  SER A H    1  
ATOM 1315  H HA   . SER A 1 89  ? 9.087   5.836   -1.537  1.00 0.00 ? 89  SER A HA   1  
ATOM 1316  H HB2  . SER A 1 89  ? 10.145  3.159   -0.738  1.00 0.00 ? 89  SER A HB2  1  
ATOM 1317  H HB3  . SER A 1 89  ? 11.301  4.423   -1.157  1.00 0.00 ? 89  SER A HB3  1  
ATOM 1318  H HG   . SER A 1 89  ? 10.673  5.592   0.540   1.00 0.00 ? 89  SER A HG   1  
ATOM 1319  N N    . GLN A 1 90  ? 9.011   4.753   -4.216  1.00 0.00 ? 90  GLN A N    1  
ATOM 1320  C CA   . GLN A 1 90  ? 9.444   4.724   -5.608  1.00 0.00 ? 90  GLN A CA   1  
ATOM 1321  C C    . GLN A 1 90  ? 8.884   5.916   -6.377  1.00 0.00 ? 90  GLN A C    1  
ATOM 1322  O O    . GLN A 1 90  ? 7.829   6.458   -6.047  1.00 0.00 ? 90  GLN A O    1  
ATOM 1323  C CB   . GLN A 1 90  ? 9.005   3.419   -6.274  1.00 0.00 ? 90  GLN A CB   1  
ATOM 1324  C CG   . GLN A 1 90  ? 9.542   2.174   -5.587  1.00 0.00 ? 90  GLN A CG   1  
ATOM 1325  C CD   . GLN A 1 90  ? 9.508   0.952   -6.484  1.00 0.00 ? 90  GLN A CD   1  
ATOM 1326  O OE1  . GLN A 1 90  ? 9.531   1.067   -7.709  1.00 0.00 ? 90  GLN A OE1  1  
ATOM 1327  N NE2  . GLN A 1 90  ? 9.454   -0.227  -5.876  1.00 0.00 ? 90  GLN A NE2  1  
ATOM 1328  H H    . GLN A 1 90  ? 8.052   4.747   -4.014  1.00 0.00 ? 90  GLN A H    1  
ATOM 1329  H HA   . GLN A 1 90  ? 10.522  4.778   -5.620  1.00 0.00 ? 90  GLN A HA   1  
ATOM 1330  H HB2  . GLN A 1 90  ? 7.926   3.371   -6.268  1.00 0.00 ? 90  GLN A HB2  1  
ATOM 1331  H HB3  . GLN A 1 90  ? 9.352   3.417   -7.297  1.00 0.00 ? 90  GLN A HB3  1  
ATOM 1332  H HG2  . GLN A 1 90  ? 10.564  2.355   -5.290  1.00 0.00 ? 90  GLN A HG2  1  
ATOM 1333  H HG3  . GLN A 1 90  ? 8.943   1.976   -4.710  1.00 0.00 ? 90  GLN A HG3  1  
ATOM 1334  H HE21 . GLN A 1 90  ? 9.437   -0.242  -4.895  1.00 0.00 ? 90  GLN A HE21 1  
ATOM 1335  H HE22 . GLN A 1 90  ? 9.430   -1.033  -6.431  1.00 0.00 ? 90  GLN A HE22 1  
ATOM 1336  N N    . PRO A 1 91  ? 9.605   6.334   -7.428  1.00 0.00 ? 91  PRO A N    1  
ATOM 1337  C CA   . PRO A 1 91  ? 9.199   7.466   -8.266  1.00 0.00 ? 91  PRO A CA   1  
ATOM 1338  C C    . PRO A 1 91  ? 7.969   7.150   -9.111  1.00 0.00 ? 91  PRO A C    1  
ATOM 1339  O O    . PRO A 1 91  ? 7.149   8.026   -9.383  1.00 0.00 ? 91  PRO A O    1  
ATOM 1340  C CB   . PRO A 1 91  ? 10.418  7.699   -9.162  1.00 0.00 ? 91  PRO A CB   1  
ATOM 1341  C CG   . PRO A 1 91  ? 11.105  6.379   -9.217  1.00 0.00 ? 91  PRO A CG   1  
ATOM 1342  C CD   . PRO A 1 91  ? 10.872  5.734   -7.879  1.00 0.00 ? 91  PRO A CD   1  
ATOM 1343  H HA   . PRO A 1 91  ? 9.010   8.350   -7.675  1.00 0.00 ? 91  PRO A HA   1  
ATOM 1344  H HB2  . PRO A 1 91  ? 10.091  8.017   -10.143 1.00 0.00 ? 91  PRO A HB2  1  
ATOM 1345  H HB3  . PRO A 1 91  ? 11.051  8.456   -8.725  1.00 0.00 ? 91  PRO A HB3  1  
ATOM 1346  H HG2  . PRO A 1 91  ? 10.679  5.775   -10.004 1.00 0.00 ? 91  PRO A HG2  1  
ATOM 1347  H HG3  . PRO A 1 91  ? 12.163  6.523   -9.384  1.00 0.00 ? 91  PRO A HG3  1  
ATOM 1348  H HD2  . PRO A 1 91  ? 10.775  4.664   -7.988  1.00 0.00 ? 91  PRO A HD2  1  
ATOM 1349  H HD3  . PRO A 1 91  ? 11.675  5.975   -7.199  1.00 0.00 ? 91  PRO A HD3  1  
ATOM 1350  N N    . SER A 1 92  ? 7.847   5.892   -9.523  1.00 0.00 ? 92  SER A N    1  
ATOM 1351  C CA   . SER A 1 92  ? 6.719   5.461   -10.340 1.00 0.00 ? 92  SER A CA   1  
ATOM 1352  C C    . SER A 1 92  ? 6.027   4.253   -9.717  1.00 0.00 ? 92  SER A C    1  
ATOM 1353  O O    . SER A 1 92  ? 6.681   3.339   -9.214  1.00 0.00 ? 92  SER A O    1  
ATOM 1354  C CB   . SER A 1 92  ? 7.188   5.120   -11.756 1.00 0.00 ? 92  SER A CB   1  
ATOM 1355  O OG   . SER A 1 92  ? 7.935   3.916   -11.770 1.00 0.00 ? 92  SER A OG   1  
ATOM 1356  H H    . SER A 1 92  ? 8.535   5.239   -9.274  1.00 0.00 ? 92  SER A H    1  
ATOM 1357  H HA   . SER A 1 92  ? 6.015   6.278   -10.391 1.00 0.00 ? 92  SER A HA   1  
ATOM 1358  H HB2  . SER A 1 92  ? 6.329   5.004   -12.399 1.00 0.00 ? 92  SER A HB2  1  
ATOM 1359  H HB3  . SER A 1 92  ? 7.811   5.921   -12.129 1.00 0.00 ? 92  SER A HB3  1  
ATOM 1360  H HG   . SER A 1 92  ? 8.605   3.962   -12.456 1.00 0.00 ? 92  SER A HG   1  
ATOM 1361  N N    . LEU A 1 93  ? 4.699   4.256   -9.753  1.00 0.00 ? 93  LEU A N    1  
ATOM 1362  C CA   . LEU A 1 93  ? 3.916   3.161   -9.192  1.00 0.00 ? 93  LEU A CA   1  
ATOM 1363  C C    . LEU A 1 93  ? 2.785   2.761   -10.135 1.00 0.00 ? 93  LEU A C    1  
ATOM 1364  O O    . LEU A 1 93  ? 2.184   3.609   -10.793 1.00 0.00 ? 93  LEU A O    1  
ATOM 1365  C CB   . LEU A 1 93  ? 3.343   3.562   -7.831  1.00 0.00 ? 93  LEU A CB   1  
ATOM 1366  C CG   . LEU A 1 93  ? 4.241   3.300   -6.622  1.00 0.00 ? 93  LEU A CG   1  
ATOM 1367  C CD1  . LEU A 1 93  ? 3.677   3.977   -5.382  1.00 0.00 ? 93  LEU A CD1  1  
ATOM 1368  C CD2  . LEU A 1 93  ? 4.399   1.804   -6.389  1.00 0.00 ? 93  LEU A CD2  1  
ATOM 1369  H H    . LEU A 1 93  ? 4.233   5.012   -10.167 1.00 0.00 ? 93  LEU A H    1  
ATOM 1370  H HA   . LEU A 1 93  ? 4.575   2.315   -9.061  1.00 0.00 ? 93  LEU A HA   1  
ATOM 1371  H HB2  . LEU A 1 93  ? 3.130   4.619   -7.861  1.00 0.00 ? 93  LEU A HB2  1  
ATOM 1372  H HB3  . LEU A 1 93  ? 2.422   3.015   -7.687  1.00 0.00 ? 93  LEU A HB3  1  
ATOM 1373  H HG   . LEU A 1 93  ? 5.221   3.715   -6.812  1.00 0.00 ? 93  LEU A HG   1  
ATOM 1374  H HD11 . LEU A 1 93  ? 2.627   4.179   -5.528  1.00 0.00 ? 93  LEU A HD11 1  
ATOM 1375  H HD12 . LEU A 1 93  ? 4.202   4.905   -5.209  1.00 0.00 ? 93  LEU A HD12 1  
ATOM 1376  H HD13 . LEU A 1 93  ? 3.805   3.328   -4.528  1.00 0.00 ? 93  LEU A HD13 1  
ATOM 1377  H HD21 . LEU A 1 93  ? 5.448   1.547   -6.406  1.00 0.00 ? 93  LEU A HD21 1  
ATOM 1378  H HD22 . LEU A 1 93  ? 3.883   1.262   -7.169  1.00 0.00 ? 93  LEU A HD22 1  
ATOM 1379  H HD23 . LEU A 1 93  ? 3.979   1.543   -5.429  1.00 0.00 ? 93  LEU A HD23 1  
ATOM 1380  N N    . GLY A 1 94  ? 2.499   1.464   -10.192 1.00 0.00 ? 94  GLY A N    1  
ATOM 1381  C CA   . GLY A 1 94  ? 1.440   0.975   -11.055 1.00 0.00 ? 94  GLY A CA   1  
ATOM 1382  C C    . GLY A 1 94  ? 0.389   0.191   -10.295 1.00 0.00 ? 94  GLY A C    1  
ATOM 1383  O O    . GLY A 1 94  ? 0.621   -0.952  -9.898  1.00 0.00 ? 94  GLY A O    1  
ATOM 1384  H H    . GLY A 1 94  ? 3.012   0.834   -9.644  1.00 0.00 ? 94  GLY A H    1  
ATOM 1385  H HA2  . GLY A 1 94  ? 0.967   1.816   -11.538 1.00 0.00 ? 94  GLY A HA2  1  
ATOM 1386  H HA3  . GLY A 1 94  ? 1.873   0.335   -11.810 1.00 0.00 ? 94  GLY A HA3  1  
ATOM 1387  N N    . LEU A 1 95  ? -0.771  0.805   -10.089 1.00 0.00 ? 95  LEU A N    1  
ATOM 1388  C CA   . LEU A 1 95  ? -1.863  0.158   -9.369  1.00 0.00 ? 95  LEU A CA   1  
ATOM 1389  C C    . LEU A 1 95  ? -2.939  -0.328  -10.335 1.00 0.00 ? 95  LEU A C    1  
ATOM 1390  O O    . LEU A 1 95  ? -3.059  0.176   -11.452 1.00 0.00 ? 95  LEU A O    1  
ATOM 1391  C CB   . LEU A 1 95  ? -2.472  1.124   -8.352  1.00 0.00 ? 95  LEU A CB   1  
ATOM 1392  C CG   . LEU A 1 95  ? -1.485  1.833   -7.424  1.00 0.00 ? 95  LEU A CG   1  
ATOM 1393  C CD1  . LEU A 1 95  ? -2.086  3.125   -6.892  1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1394  C CD2  . LEU A 1 95  ? -1.080  0.919   -6.277  1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1395  H H    . LEU A 1 95  ? -0.898  1.715   -10.428 1.00 0.00 ? 95  LEU A H    1  
ATOM 1396  H HA   . LEU A 1 95  ? -1.455  -0.694  -8.845  1.00 0.00 ? 95  LEU A HA   1  
ATOM 1397  H HB2  . LEU A 1 95  ? -3.014  1.880   -8.898  1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1398  H HB3  . LEU A 1 95  ? -3.162  0.563   -7.737  1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1399  H HG   . LEU A 1 95  ? -0.594  2.086   -7.982  1.00 0.00 ? 95  LEU A HG   1  
ATOM 1400  H HD11 . LEU A 1 95  ? -1.361  3.920   -6.974  1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1401  H HD12 . LEU A 1 95  ? -2.360  2.993   -5.855  1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1402  H HD13 . LEU A 1 95  ? -2.965  3.376   -7.467  1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1403  H HD21 . LEU A 1 95  ? -0.881  1.512   -5.397  1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1404  H HD22 . LEU A 1 95  ? -0.190  0.371   -6.551  1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1405  H HD23 . LEU A 1 95  ? -1.881  0.225   -6.070  1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1406  N N    . LEU A 1 96  ? -3.721  -1.308  -9.896  1.00 0.00 ? 96  LEU A N    1  
ATOM 1407  C CA   . LEU A 1 96  ? -4.790  -1.861  -10.720 1.00 0.00 ? 96  LEU A CA   1  
ATOM 1408  C C    . LEU A 1 96  ? -6.107  -1.898  -9.951  1.00 0.00 ? 96  LEU A C    1  
ATOM 1409  O O    . LEU A 1 96  ? -6.349  -2.807  -9.157  1.00 0.00 ? 96  LEU A O    1  
ATOM 1410  C CB   . LEU A 1 96  ? -4.422  -3.268  -11.192 1.00 0.00 ? 96  LEU A CB   1  
ATOM 1411  C CG   . LEU A 1 96  ? -5.442  -3.963  -12.094 1.00 0.00 ? 96  LEU A CG   1  
ATOM 1412  C CD1  . LEU A 1 96  ? -5.447  -3.331  -13.478 1.00 0.00 ? 96  LEU A CD1  1  
ATOM 1413  C CD2  . LEU A 1 96  ? -5.145  -5.452  -12.187 1.00 0.00 ? 96  LEU A CD2  1  
ATOM 1414  H H    . LEU A 1 96  ? -3.578  -1.668  -8.997  1.00 0.00 ? 96  LEU A H    1  
ATOM 1415  H HA   . LEU A 1 96  ? -4.909  -1.221  -11.582 1.00 0.00 ? 96  LEU A HA   1  
ATOM 1416  H HB2  . LEU A 1 96  ? -3.491  -3.202  -11.734 1.00 0.00 ? 96  LEU A HB2  1  
ATOM 1417  H HB3  . LEU A 1 96  ? -4.282  -3.884  -10.314 1.00 0.00 ? 96  LEU A HB3  1  
ATOM 1418  H HG   . LEU A 1 96  ? -6.429  -3.843  -11.670 1.00 0.00 ? 96  LEU A HG   1  
ATOM 1419  H HD11 . LEU A 1 96  ? -4.844  -3.926  -14.147 1.00 0.00 ? 96  LEU A HD11 1  
ATOM 1420  H HD12 . LEU A 1 96  ? -5.040  -2.333  -13.419 1.00 0.00 ? 96  LEU A HD12 1  
ATOM 1421  H HD13 . LEU A 1 96  ? -6.460  -3.286  -13.849 1.00 0.00 ? 96  LEU A HD13 1  
ATOM 1422  H HD21 . LEU A 1 96  ? -4.300  -5.691  -11.558 1.00 0.00 ? 96  LEU A HD21 1  
ATOM 1423  H HD22 . LEU A 1 96  ? -4.916  -5.711  -13.211 1.00 0.00 ? 96  LEU A HD22 1  
ATOM 1424  H HD23 . LEU A 1 96  ? -6.008  -6.012  -11.859 1.00 0.00 ? 96  LEU A HD23 1  
ATOM 1425  N N    . VAL A 1 97  ? -6.957  -0.905  -10.194 1.00 0.00 ? 97  VAL A N    1  
ATOM 1426  C CA   . VAL A 1 97  ? -8.251  -0.826  -9.527  1.00 0.00 ? 97  VAL A CA   1  
ATOM 1427  C C    . VAL A 1 97  ? -9.383  -1.195  -10.479 1.00 0.00 ? 97  VAL A C    1  
ATOM 1428  O O    . VAL A 1 97  ? -9.214  -1.177  -11.698 1.00 0.00 ? 97  VAL A O    1  
ATOM 1429  C CB   . VAL A 1 97  ? -8.507  0.585   -8.965  1.00 0.00 ? 97  VAL A CB   1  
ATOM 1430  C CG1  . VAL A 1 97  ? -7.515  0.907   -7.858  1.00 0.00 ? 97  VAL A CG1  1  
ATOM 1431  C CG2  . VAL A 1 97  ? -8.435  1.622   -10.075 1.00 0.00 ? 97  VAL A CG2  1  
ATOM 1432  H H    . VAL A 1 97  ? -6.708  -0.210  -10.838 1.00 0.00 ? 97  VAL A H    1  
ATOM 1433  H HA   . VAL A 1 97  ? -8.245  -1.524  -8.702  1.00 0.00 ? 97  VAL A HA   1  
ATOM 1434  H HB   . VAL A 1 97  ? -9.502  0.607   -8.544  1.00 0.00 ? 97  VAL A HB   1  
ATOM 1435  H HG11 . VAL A 1 97  ? -6.667  0.242   -7.930  1.00 0.00 ? 97  VAL A HG11 1  
ATOM 1436  H HG12 . VAL A 1 97  ? -7.183  1.929   -7.958  1.00 0.00 ? 97  VAL A HG12 1  
ATOM 1437  H HG13 . VAL A 1 97  ? -7.993  0.776   -6.898  1.00 0.00 ? 97  VAL A HG13 1  
ATOM 1438  H HG21 . VAL A 1 97  ? -8.925  2.528   -9.753  1.00 0.00 ? 97  VAL A HG21 1  
ATOM 1439  H HG22 . VAL A 1 97  ? -7.400  1.834   -10.303 1.00 0.00 ? 97  VAL A HG22 1  
ATOM 1440  H HG23 . VAL A 1 97  ? -8.926  1.240   -10.958 1.00 0.00 ? 97  VAL A HG23 1  
ATOM 1441  N N    . ARG A 1 98  ? -10.539 -1.530  -9.914  1.00 0.00 ? 98  ARG A N    1  
ATOM 1442  C CA   . ARG A 1 98  ? -11.700 -1.904  -10.712 1.00 0.00 ? 98  ARG A CA   1  
ATOM 1443  C C    . ARG A 1 98  ? -12.723 -0.773  -10.747 1.00 0.00 ? 98  ARG A C    1  
ATOM 1444  O O    . ARG A 1 98  ? -12.759 0.076   -9.855  1.00 0.00 ? 98  ARG A O    1  
ATOM 1445  C CB   . ARG A 1 98  ? -12.345 -3.172  -10.150 1.00 0.00 ? 98  ARG A CB   1  
ATOM 1446  C CG   . ARG A 1 98  ? -13.131 -3.965  -11.181 1.00 0.00 ? 98  ARG A CG   1  
ATOM 1447  C CD   . ARG A 1 98  ? -13.412 -5.380  -10.701 1.00 0.00 ? 98  ARG A CD   1  
ATOM 1448  N NE   . ARG A 1 98  ? -12.341 -6.304  -11.064 1.00 0.00 ? 98  ARG A NE   1  
ATOM 1449  C CZ   . ARG A 1 98  ? -12.370 -7.605  -10.795 1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1450  N NH1  . ARG A 1 98  ? -13.410 -8.131  -10.165 1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1451  N NH2  . ARG A 1 98  ? -11.357 -8.381  -11.158 1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1452  H H    . ARG A 1 98  ? -10.612 -1.525  -8.936  1.00 0.00 ? 98  ARG A H    1  
ATOM 1453  H HA   . ARG A 1 98  ? -11.361 -2.099  -11.719 1.00 0.00 ? 98  ARG A HA   1  
ATOM 1454  H HB2  . ARG A 1 98  ? -11.569 -3.810  -9.752  1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1455  H HB3  . ARG A 1 98  ? -13.017 -2.896  -9.352  1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1456  H HG2  . ARG A 1 98  ? -14.071 -3.466  -11.366 1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1457  H HG3  . ARG A 1 98  ? -12.560 -4.011  -12.097 1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1458  H HD2  . ARG A 1 98  ? -13.514 -5.367  -9.626  1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1459  H HD3  . ARG A 1 98  ? -14.335 -5.720  -11.146 1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1460  H HE   . ARG A 1 98  ? -11.562 -5.936  -11.531 1.00 0.00 ? 98  ARG A HE   1  
ATOM 1461  H HH11 . ARG A 1 98  ? -14.175 -7.549  -9.891  1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1462  H HH12 . ARG A 1 98  ? -13.430 -9.111  -9.965  1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1463  H HH21 . ARG A 1 98  ? -10.571 -7.987  -11.634 1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1464  H HH22 . ARG A 1 98  ? -11.380 -9.359  -10.955 1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1465  N N    . THR A 1 99  ? -13.555 -0.766  -11.785 1.00 0.00 ? 99  THR A N    1  
ATOM 1466  C CA   . THR A 1 99  ? -14.577 0.261   -11.938 1.00 0.00 ? 99  THR A CA   1  
ATOM 1467  C C    . THR A 1 99  ? -15.778 -0.270  -12.712 1.00 0.00 ? 99  THR A C    1  
ATOM 1468  O O    . THR A 1 99  ? -15.744 -1.378  -13.246 1.00 0.00 ? 99  THR A O    1  
ATOM 1469  C CB   . THR A 1 99  ? -14.023 1.503   -12.661 1.00 0.00 ? 99  THR A CB   1  
ATOM 1470  O OG1  . THR A 1 99  ? -14.934 2.599   -12.522 1.00 0.00 ? 99  THR A OG1  1  
ATOM 1471  C CG2  . THR A 1 99  ? -13.793 1.212   -14.136 1.00 0.00 ? 99  THR A CG2  1  
ATOM 1472  H H    . THR A 1 99  ? -13.477 -1.469  -12.463 1.00 0.00 ? 99  THR A H    1  
ATOM 1473  H HA   . THR A 1 99  ? -14.900 0.560   -10.951 1.00 0.00 ? 99  THR A HA   1  
ATOM 1474  H HB   . THR A 1 99  ? -13.077 1.771   -12.211 1.00 0.00 ? 99  THR A HB   1  
ATOM 1475  H HG1  . THR A 1 99  ? -15.581 2.569   -13.230 1.00 0.00 ? 99  THR A HG1  1  
ATOM 1476  H HG21 . THR A 1 99  ? -12.951 0.544   -14.245 1.00 0.00 ? 99  THR A HG21 1  
ATOM 1477  H HG22 . THR A 1 99  ? -13.590 2.135   -14.658 1.00 0.00 ? 99  THR A HG22 1  
ATOM 1478  H HG23 . THR A 1 99  ? -14.675 0.750   -14.553 1.00 0.00 ? 99  THR A HG23 1  
ATOM 1479  N N    . TYR A 1 100 ? -16.839 0.528   -12.769 1.00 0.00 ? 100 TYR A N    1  
ATOM 1480  C CA   . TYR A 1 100 ? -18.052 0.137   -13.478 1.00 0.00 ? 100 TYR A CA   1  
ATOM 1481  C C    . TYR A 1 100 ? -18.235 0.968   -14.744 1.00 0.00 ? 100 TYR A C    1  
ATOM 1482  O O    . TYR A 1 100 ? -17.957 2.167   -14.777 1.00 0.00 ? 100 TYR A O    1  
ATOM 1483  C CB   . TYR A 1 100 ? -19.272 0.297   -12.569 1.00 0.00 ? 100 TYR A CB   1  
ATOM 1484  C CG   . TYR A 1 100 ? -19.168 -0.478  -11.275 1.00 0.00 ? 100 TYR A CG   1  
ATOM 1485  C CD1  . TYR A 1 100 ? -18.159 -0.209  -10.359 1.00 0.00 ? 100 TYR A CD1  1  
ATOM 1486  C CD2  . TYR A 1 100 ? -20.081 -1.480  -10.968 1.00 0.00 ? 100 TYR A CD2  1  
ATOM 1487  C CE1  . TYR A 1 100 ? -18.061 -0.916  -9.176  1.00 0.00 ? 100 TYR A CE1  1  
ATOM 1488  C CE2  . TYR A 1 100 ? -19.991 -2.191  -9.787  1.00 0.00 ? 100 TYR A CE2  1  
ATOM 1489  C CZ   . TYR A 1 100 ? -18.979 -1.906  -8.894  1.00 0.00 ? 100 TYR A CZ   1  
ATOM 1490  O OH   . TYR A 1 100 ? -18.885 -2.611  -7.717  1.00 0.00 ? 100 TYR A OH   1  
ATOM 1491  H H    . TYR A 1 100 ? -16.806 1.401   -12.324 1.00 0.00 ? 100 TYR A H    1  
ATOM 1492  H HA   . TYR A 1 100 ? -17.954 -0.902  -13.754 1.00 0.00 ? 100 TYR A HA   1  
ATOM 1493  H HB2  . TYR A 1 100 ? -19.393 1.340   -12.320 1.00 0.00 ? 100 TYR A HB2  1  
ATOM 1494  H HB3  . TYR A 1 100 ? -20.151 -0.048  -13.093 1.00 0.00 ? 100 TYR A HB3  1  
ATOM 1495  H HD1  . TYR A 1 100 ? -17.442 0.567   -10.582 1.00 0.00 ? 100 TYR A HD1  1  
ATOM 1496  H HD2  . TYR A 1 100 ? -20.873 -1.702  -11.669 1.00 0.00 ? 100 TYR A HD2  1  
ATOM 1497  H HE1  . TYR A 1 100 ? -17.269 -0.692  -8.477  1.00 0.00 ? 100 TYR A HE1  1  
ATOM 1498  H HE2  . TYR A 1 100 ? -20.710 -2.967  -9.566  1.00 0.00 ? 100 TYR A HE2  1  
ATOM 1499  H HH   . TYR A 1 100 ? -19.490 -3.356  -7.741  1.00 0.00 ? 100 TYR A HH   1  
ATOM 1500  N N    . PRO A 1 101 ? -18.716 0.316   -15.813 1.00 0.00 ? 101 PRO A N    1  
ATOM 1501  C CA   . PRO A 1 101 ? -18.949 0.974   -17.102 1.00 0.00 ? 101 PRO A CA   1  
ATOM 1502  C C    . PRO A 1 101 ? -20.117 1.953   -17.051 1.00 0.00 ? 101 PRO A C    1  
ATOM 1503  O O    . PRO A 1 101 ? -21.015 1.818   -16.220 1.00 0.00 ? 101 PRO A O    1  
ATOM 1504  C CB   . PRO A 1 101 ? -19.268 -0.191  -18.042 1.00 0.00 ? 101 PRO A CB   1  
ATOM 1505  C CG   . PRO A 1 101 ? -19.799 -1.261  -17.152 1.00 0.00 ? 101 PRO A CG   1  
ATOM 1506  C CD   . PRO A 1 101 ? -19.070 -1.113  -15.846 1.00 0.00 ? 101 PRO A CD   1  
ATOM 1507  H HA   . PRO A 1 101 ? -18.065 1.489   -17.451 1.00 0.00 ? 101 PRO A HA   1  
ATOM 1508  H HB2  . PRO A 1 101 ? -20.005 0.121   -18.769 1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1509  H HB3  . PRO A 1 101 ? -18.368 -0.508  -18.548 1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1510  H HG2  . PRO A 1 101 ? -20.860 -1.126  -17.007 1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1511  H HG3  . PRO A 1 101 ? -19.598 -2.230  -17.585 1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1512  H HD2  . PRO A 1 101 ? -19.718 -1.368  -15.021 1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1513  H HD3  . PRO A 1 101 ? -18.183 -1.729  -15.837 1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1514  N N    . GLU A 1 102 ? -20.099 2.937   -17.944 1.00 0.00 ? 102 GLU A N    1  
ATOM 1515  C CA   . GLU A 1 102 ? -21.157 3.938   -17.999 1.00 0.00 ? 102 GLU A CA   1  
ATOM 1516  C C    . GLU A 1 102 ? -21.139 4.677   -19.334 1.00 0.00 ? 102 GLU A C    1  
ATOM 1517  O O    . GLU A 1 102 ? -20.109 4.743   -20.006 1.00 0.00 ? 102 GLU A O    1  
ATOM 1518  C CB   . GLU A 1 102 ? -21.006 4.936   -16.849 1.00 0.00 ? 102 GLU A CB   1  
ATOM 1519  C CG   . GLU A 1 102 ? -22.316 5.576   -16.422 1.00 0.00 ? 102 GLU A CG   1  
ATOM 1520  C CD   . GLU A 1 102 ? -23.060 4.749   -15.390 1.00 0.00 ? 102 GLU A CD   1  
ATOM 1521  O OE1  . GLU A 1 102 ? -23.780 3.811   -15.790 1.00 0.00 ? 102 GLU A OE1  1  
ATOM 1522  O OE2  . GLU A 1 102 ? -22.921 5.040   -14.184 1.00 0.00 ? 102 GLU A OE2  1  
ATOM 1523  H H    . GLU A 1 102 ? -19.355 2.992   -18.581 1.00 0.00 ? 102 GLU A H    1  
ATOM 1524  H HA   . GLU A 1 102 ? -22.103 3.427   -17.897 1.00 0.00 ? 102 GLU A HA   1  
ATOM 1525  H HB2  . GLU A 1 102 ? -20.584 4.424   -15.997 1.00 0.00 ? 102 GLU A HB2  1  
ATOM 1526  H HB3  . GLU A 1 102 ? -20.331 5.721   -17.157 1.00 0.00 ? 102 GLU A HB3  1  
ATOM 1527  H HG2  . GLU A 1 102 ? -22.108 6.547   -15.999 1.00 0.00 ? 102 GLU A HG2  1  
ATOM 1528  H HG3  . GLU A 1 102 ? -22.947 5.691   -17.291 1.00 0.00 ? 102 GLU A HG3  1  
ATOM 1529  N N    . LEU A 1 103 ? -22.285 5.231   -19.713 1.00 0.00 ? 103 LEU A N    1  
ATOM 1530  C CA   . LEU A 1 103 ? -22.403 5.965   -20.968 1.00 0.00 ? 103 LEU A CA   1  
ATOM 1531  C C    . LEU A 1 103 ? -21.753 7.341   -20.857 1.00 0.00 ? 103 LEU A C    1  
ATOM 1532  O O    . LEU A 1 103 ? -22.400 8.363   -21.087 1.00 0.00 ? 103 LEU A O    1  
ATOM 1533  C CB   . LEU A 1 103 ? -23.874 6.113   -21.359 1.00 0.00 ? 103 LEU A CB   1  
ATOM 1534  C CG   . LEU A 1 103 ? -24.160 6.259   -22.854 1.00 0.00 ? 103 LEU A CG   1  
ATOM 1535  C CD1  . LEU A 1 103 ? -25.595 5.865   -23.164 1.00 0.00 ? 103 LEU A CD1  1  
ATOM 1536  C CD2  . LEU A 1 103 ? -23.884 7.683   -23.314 1.00 0.00 ? 103 LEU A CD2  1  
ATOM 1537  H H    . LEU A 1 103 ? -23.072 5.145   -19.135 1.00 0.00 ? 103 LEU A H    1  
ATOM 1538  H HA   . LEU A 1 103 ? -21.891 5.400   -21.732 1.00 0.00 ? 103 LEU A HA   1  
ATOM 1539  H HB2  . LEU A 1 103 ? -24.400 5.240   -21.006 1.00 0.00 ? 103 LEU A HB2  1  
ATOM 1540  H HB3  . LEU A 1 103 ? -24.261 6.991   -20.861 1.00 0.00 ? 103 LEU A HB3  1  
ATOM 1541  H HG   . LEU A 1 103 ? -23.506 5.596   -23.405 1.00 0.00 ? 103 LEU A HG   1  
ATOM 1542  H HD11 . LEU A 1 103 ? -25.981 5.252   -22.364 1.00 0.00 ? 103 LEU A HD11 1  
ATOM 1543  H HD12 . LEU A 1 103 ? -25.624 5.309   -24.090 1.00 0.00 ? 103 LEU A HD12 1  
ATOM 1544  H HD13 . LEU A 1 103 ? -26.200 6.755   -23.261 1.00 0.00 ? 103 LEU A HD13 1  
ATOM 1545  H HD21 . LEU A 1 103 ? -24.193 7.794   -24.343 1.00 0.00 ? 103 LEU A HD21 1  
ATOM 1546  H HD22 . LEU A 1 103 ? -22.827 7.889   -23.231 1.00 0.00 ? 103 LEU A HD22 1  
ATOM 1547  H HD23 . LEU A 1 103 ? -24.436 8.374   -22.695 1.00 0.00 ? 103 LEU A HD23 1  
ATOM 1548  N N    . GLU A 1 104 ? -20.472 7.358   -20.505 1.00 0.00 ? 104 GLU A N    1  
ATOM 1549  C CA   . GLU A 1 104 ? -19.735 8.609   -20.365 1.00 0.00 ? 104 GLU A CA   1  
ATOM 1550  C C    . GLU A 1 104 ? -18.498 8.615   -21.258 1.00 0.00 ? 104 GLU A C    1  
ATOM 1551  O O    . GLU A 1 104 ? -17.571 9.395   -21.046 1.00 0.00 ? 104 GLU A O    1  
ATOM 1552  C CB   . GLU A 1 104 ? -19.326 8.825   -18.907 1.00 0.00 ? 104 GLU A CB   1  
ATOM 1553  C CG   . GLU A 1 104 ? -18.204 7.908   -18.447 1.00 0.00 ? 104 GLU A CG   1  
ATOM 1554  C CD   . GLU A 1 104 ? -17.380 8.512   -17.327 1.00 0.00 ? 104 GLU A CD   1  
ATOM 1555  O OE1  . GLU A 1 104 ? -16.451 9.291   -17.626 1.00 0.00 ? 104 GLU A OE1  1  
ATOM 1556  O OE2  . GLU A 1 104 ? -17.664 8.204   -16.150 1.00 0.00 ? 104 GLU A OE2  1  
ATOM 1557  H H    . GLU A 1 104 ? -20.011 6.510   -20.335 1.00 0.00 ? 104 GLU A H    1  
ATOM 1558  H HA   . GLU A 1 104 ? -20.388 9.414   -20.669 1.00 0.00 ? 104 GLU A HA   1  
ATOM 1559  H HB2  . GLU A 1 104 ? -19.000 9.848   -18.784 1.00 0.00 ? 104 GLU A HB2  1  
ATOM 1560  H HB3  . GLU A 1 104 ? -20.185 8.652   -18.275 1.00 0.00 ? 104 GLU A HB3  1  
ATOM 1561  H HG2  . GLU A 1 104 ? -18.634 6.982   -18.098 1.00 0.00 ? 104 GLU A HG2  1  
ATOM 1562  H HG3  . GLU A 1 104 ? -17.554 7.708   -19.286 1.00 0.00 ? 104 GLU A HG3  1  
ATOM 1563  N N    . GLU A 1 105 ? -18.493 7.738   -22.258 1.00 0.00 ? 105 GLU A N    1  
ATOM 1564  C CA   . GLU A 1 105 ? -17.370 7.642   -23.182 1.00 0.00 ? 105 GLU A CA   1  
ATOM 1565  C C    . GLU A 1 105 ? -17.480 8.691   -24.285 1.00 0.00 ? 105 GLU A C    1  
ATOM 1566  O O    . GLU A 1 105 ? -18.558 8.922   -24.832 1.00 0.00 ? 105 GLU A O    1  
ATOM 1567  C CB   . GLU A 1 105 ? -17.307 6.243   -23.799 1.00 0.00 ? 105 GLU A CB   1  
ATOM 1568  C CG   . GLU A 1 105 ? -17.009 5.146   -22.792 1.00 0.00 ? 105 GLU A CG   1  
ATOM 1569  C CD   . GLU A 1 105 ? -16.701 3.815   -23.451 1.00 0.00 ? 105 GLU A CD   1  
ATOM 1570  O OE1  . GLU A 1 105 ? -17.609 3.248   -24.094 1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1571  O OE2  . GLU A 1 105 ? -15.553 3.342   -23.324 1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1572  H H    . GLU A 1 105 ? -19.262 7.142   -22.376 1.00 0.00 ? 105 GLU A H    1  
ATOM 1573  H HA   . GLU A 1 105 ? -16.464 7.819   -22.623 1.00 0.00 ? 105 GLU A HA   1  
ATOM 1574  H HB2  . GLU A 1 105 ? -18.256 6.026   -24.267 1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1575  H HB3  . GLU A 1 105 ? -16.534 6.230   -24.553 1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1576  H HG2  . GLU A 1 105 ? -16.156 5.441   -22.199 1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1577  H HG3  . GLU A 1 105 ? -17.868 5.022   -22.148 1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1578  N N    . GLY A 1 106 ? -16.357 9.326   -24.605 1.00 0.00 ? 106 GLY A N    1  
ATOM 1579  C CA   . GLY A 1 106 ? -16.348 10.344  -25.639 1.00 0.00 ? 106 GLY A CA   1  
ATOM 1580  C C    . GLY A 1 106 ? -14.988 10.992  -25.804 1.00 0.00 ? 106 GLY A C    1  
ATOM 1581  O O    . GLY A 1 106 ? -14.296 10.757  -26.795 1.00 0.00 ? 106 GLY A O    1  
ATOM 1582  H H    . GLY A 1 106 ? -15.526 9.100   -24.135 1.00 0.00 ? 106 GLY A H    1  
ATOM 1583  H HA2  . GLY A 1 106 ? -16.636 9.891   -26.576 1.00 0.00 ? 106 GLY A HA2  1  
ATOM 1584  H HA3  . GLY A 1 106 ? -17.069 11.106  -25.383 1.00 0.00 ? 106 GLY A HA3  1  
ATOM 1585  N N    . VAL A 1 107 ? -14.603 11.811  -24.831 1.00 0.00 ? 107 VAL A N    1  
ATOM 1586  C CA   . VAL A 1 107 ? -13.316 12.496  -24.872 1.00 0.00 ? 107 VAL A CA   1  
ATOM 1587  C C    . VAL A 1 107 ? -12.487 12.184  -23.632 1.00 0.00 ? 107 VAL A C    1  
ATOM 1588  O O    . VAL A 1 107 ? -13.004 12.173  -22.515 1.00 0.00 ? 107 VAL A O    1  
ATOM 1589  C CB   . VAL A 1 107 ? -13.496 14.022  -24.986 1.00 0.00 ? 107 VAL A CB   1  
ATOM 1590  C CG1  . VAL A 1 107 ? -14.215 14.567  -23.761 1.00 0.00 ? 107 VAL A CG1  1  
ATOM 1591  C CG2  . VAL A 1 107 ? -12.150 14.704  -25.172 1.00 0.00 ? 107 VAL A CG2  1  
ATOM 1592  H H    . VAL A 1 107 ? -15.198 11.958  -24.066 1.00 0.00 ? 107 VAL A H    1  
ATOM 1593  H HA   . VAL A 1 107 ? -12.783 12.152  -25.746 1.00 0.00 ? 107 VAL A HA   1  
ATOM 1594  H HB   . VAL A 1 107 ? -14.104 14.229  -25.854 1.00 0.00 ? 107 VAL A HB   1  
ATOM 1595  H HG11 . VAL A 1 107 ? -14.791 13.778  -23.301 1.00 0.00 ? 107 VAL A HG11 1  
ATOM 1596  H HG12 . VAL A 1 107 ? -13.489 14.944  -23.056 1.00 0.00 ? 107 VAL A HG12 1  
ATOM 1597  H HG13 . VAL A 1 107 ? -14.877 15.368  -24.059 1.00 0.00 ? 107 VAL A HG13 1  
ATOM 1598  H HG21 . VAL A 1 107 ? -11.546 14.127  -25.856 1.00 0.00 ? 107 VAL A HG21 1  
ATOM 1599  H HG22 . VAL A 1 107 ? -12.300 15.696  -25.574 1.00 0.00 ? 107 VAL A HG22 1  
ATOM 1600  H HG23 . VAL A 1 107 ? -11.647 14.776  -24.219 1.00 0.00 ? 107 VAL A HG23 1  
ATOM 1601  N N    . GLU A 1 108 ? -11.198 11.931  -23.836 1.00 0.00 ? 108 GLU A N    1  
ATOM 1602  C CA   . GLU A 1 108 ? -10.297 11.619  -22.733 1.00 0.00 ? 108 GLU A CA   1  
ATOM 1603  C C    . GLU A 1 108 ? -9.553  12.867  -22.267 1.00 0.00 ? 108 GLU A C    1  
ATOM 1604  O O    . GLU A 1 108 ? -9.320  13.790  -23.047 1.00 0.00 ? 108 GLU A O    1  
ATOM 1605  C CB   . GLU A 1 108 ? -9.295  10.541  -23.153 1.00 0.00 ? 108 GLU A CB   1  
ATOM 1606  C CG   . GLU A 1 108 ? -8.223  11.045  -24.105 1.00 0.00 ? 108 GLU A CG   1  
ATOM 1607  C CD   . GLU A 1 108 ? -7.009  11.591  -23.379 1.00 0.00 ? 108 GLU A CD   1  
ATOM 1608  O OE1  . GLU A 1 108 ? -6.184  10.779  -22.911 1.00 0.00 ? 108 GLU A OE1  1  
ATOM 1609  O OE2  . GLU A 1 108 ? -6.884  12.830  -23.279 1.00 0.00 ? 108 GLU A OE2  1  
ATOM 1610  H H    . GLU A 1 108 ? -10.845 11.955  -24.750 1.00 0.00 ? 108 GLU A H    1  
ATOM 1611  H HA   . GLU A 1 108 ? -10.893 11.243  -21.915 1.00 0.00 ? 108 GLU A HA   1  
ATOM 1612  H HB2  . GLU A 1 108 ? -8.810  10.154  -22.270 1.00 0.00 ? 108 GLU A HB2  1  
ATOM 1613  H HB3  . GLU A 1 108 ? -9.831  9.740   -23.640 1.00 0.00 ? 108 GLU A HB3  1  
ATOM 1614  H HG2  . GLU A 1 108 ? -7.909  10.229  -24.737 1.00 0.00 ? 108 GLU A HG2  1  
ATOM 1615  H HG3  . GLU A 1 108 ? -8.643  11.831  -24.716 1.00 0.00 ? 108 GLU A HG3  1  
ATOM 1616  N N    . SER A 1 109 ? -9.185  12.887  -20.991 1.00 0.00 ? 109 SER A N    1  
ATOM 1617  C CA   . SER A 1 109 ? -8.471  14.023  -20.419 1.00 0.00 ? 109 SER A CA   1  
ATOM 1618  C C    . SER A 1 109 ? -6.964  13.862  -20.593 1.00 0.00 ? 109 SER A C    1  
ATOM 1619  O O    . SER A 1 109 ? -6.420  12.774  -20.410 1.00 0.00 ? 109 SER A O    1  
ATOM 1620  C CB   . SER A 1 109 ? -8.811  14.172  -18.935 1.00 0.00 ? 109 SER A CB   1  
ATOM 1621  O OG   . SER A 1 109 ? -8.220  15.339  -18.390 1.00 0.00 ? 109 SER A OG   1  
ATOM 1622  H H    . SER A 1 109 ? -9.400  12.121  -20.419 1.00 0.00 ? 109 SER A H    1  
ATOM 1623  H HA   . SER A 1 109 ? -8.789  14.912  -20.943 1.00 0.00 ? 109 SER A HA   1  
ATOM 1624  H HB2  . SER A 1 109 ? -9.882  14.238  -18.819 1.00 0.00 ? 109 SER A HB2  1  
ATOM 1625  H HB3  . SER A 1 109 ? -8.443  13.311  -18.396 1.00 0.00 ? 109 SER A HB3  1  
ATOM 1626  H HG   . SER A 1 109 ? -8.199  16.029  -19.057 1.00 0.00 ? 109 SER A HG   1  
ATOM 1627  N N    . GLY A 1 110 ? -6.295  14.954  -20.949 1.00 0.00 ? 110 GLY A N    1  
ATOM 1628  C CA   . GLY A 1 110 ? -4.857  14.914  -21.142 1.00 0.00 ? 110 GLY A CA   1  
ATOM 1629  C C    . GLY A 1 110 ? -4.392  15.860  -22.232 1.00 0.00 ? 110 GLY A C    1  
ATOM 1630  O O    . GLY A 1 110 ? -5.175  16.624  -22.796 1.00 0.00 ? 110 GLY A O    1  
ATOM 1631  H H    . GLY A 1 110 ? -6.782  15.795  -21.081 1.00 0.00 ? 110 GLY A H    1  
ATOM 1632  H HA2  . GLY A 1 110 ? -4.372  15.182  -20.216 1.00 0.00 ? 110 GLY A HA2  1  
ATOM 1633  H HA3  . GLY A 1 110 ? -4.570  13.907  -21.409 1.00 0.00 ? 110 GLY A HA3  1  
ATOM 1634  N N    . PRO A 1 111 ? -3.087  15.817  -22.541 1.00 0.00 ? 111 PRO A N    1  
ATOM 1635  C CA   . PRO A 1 111 ? -2.489  16.671  -23.571 1.00 0.00 ? 111 PRO A CA   1  
ATOM 1636  C C    . PRO A 1 111 ? -2.935  16.283  -24.976 1.00 0.00 ? 111 PRO A C    1  
ATOM 1637  O O    . PRO A 1 111 ? -3.301  17.140  -25.781 1.00 0.00 ? 111 PRO A O    1  
ATOM 1638  C CB   . PRO A 1 111 ? -0.987  16.432  -23.402 1.00 0.00 ? 111 PRO A CB   1  
ATOM 1639  C CG   . PRO A 1 111 ? -0.885  15.078  -22.788 1.00 0.00 ? 111 PRO A CG   1  
ATOM 1640  C CD   . PRO A 1 111 ? -2.096  14.930  -21.908 1.00 0.00 ? 111 PRO A CD   1  
ATOM 1641  H HA   . PRO A 1 111 ? -2.711  17.714  -23.399 1.00 0.00 ? 111 PRO A HA   1  
ATOM 1642  H HB2  . PRO A 1 111 ? -0.503  16.466  -24.368 1.00 0.00 ? 111 PRO A HB2  1  
ATOM 1643  H HB3  . PRO A 1 111 ? -0.569  17.190  -22.756 1.00 0.00 ? 111 PRO A HB3  1  
ATOM 1644  H HG2  . PRO A 1 111 ? -0.889  14.324  -23.560 1.00 0.00 ? 111 PRO A HG2  1  
ATOM 1645  H HG3  . PRO A 1 111 ? 0.017   15.009  -22.198 1.00 0.00 ? 111 PRO A HG3  1  
ATOM 1646  H HD2  . PRO A 1 111 ? -2.439  13.906  -21.908 1.00 0.00 ? 111 PRO A HD2  1  
ATOM 1647  H HD3  . PRO A 1 111 ? -1.874  15.257  -20.903 1.00 0.00 ? 111 PRO A HD3  1  
ATOM 1648  N N    . SER A 1 112 ? -2.903  14.986  -25.266 1.00 0.00 ? 112 SER A N    1  
ATOM 1649  C CA   . SER A 1 112 ? -3.301  14.485  -26.576 1.00 0.00 ? 112 SER A CA   1  
ATOM 1650  C C    . SER A 1 112 ? -4.648  15.066  -26.994 1.00 0.00 ? 112 SER A C    1  
ATOM 1651  O O    . SER A 1 112 ? -5.702  14.545  -26.626 1.00 0.00 ? 112 SER A O    1  
ATOM 1652  C CB   . SER A 1 112 ? -3.374  12.957  -26.561 1.00 0.00 ? 112 SER A CB   1  
ATOM 1653  O OG   . SER A 1 112 ? -2.082  12.385  -26.451 1.00 0.00 ? 112 SER A OG   1  
ATOM 1654  H H    . SER A 1 112 ? -2.601  14.351  -24.582 1.00 0.00 ? 112 SER A H    1  
ATOM 1655  H HA   . SER A 1 112 ? -2.552  14.793  -27.290 1.00 0.00 ? 112 SER A HA   1  
ATOM 1656  H HB2  . SER A 1 112 ? -3.969  12.636  -25.719 1.00 0.00 ? 112 SER A HB2  1  
ATOM 1657  H HB3  . SER A 1 112 ? -3.831  12.612  -27.477 1.00 0.00 ? 112 SER A HB3  1  
ATOM 1658  H HG   . SER A 1 112 ? -1.453  12.920  -26.940 1.00 0.00 ? 112 SER A HG   1  
ATOM 1659  N N    . SER A 1 113 ? -4.606  16.148  -27.764 1.00 0.00 ? 113 SER A N    1  
ATOM 1660  C CA   . SER A 1 113 ? -5.823  16.804  -28.229 1.00 0.00 ? 113 SER A CA   1  
ATOM 1661  C C    . SER A 1 113 ? -5.593  17.482  -29.576 1.00 0.00 ? 113 SER A C    1  
ATOM 1662  O O    . SER A 1 113 ? -4.884  18.483  -29.667 1.00 0.00 ? 113 SER A O    1  
ATOM 1663  C CB   . SER A 1 113 ? -6.297  17.833  -27.201 1.00 0.00 ? 113 SER A CB   1  
ATOM 1664  O OG   . SER A 1 113 ? -5.297  18.805  -26.953 1.00 0.00 ? 113 SER A OG   1  
ATOM 1665  H H    . SER A 1 113 ? -3.735  16.516  -28.023 1.00 0.00 ? 113 SER A H    1  
ATOM 1666  H HA   . SER A 1 113 ? -6.583  16.046  -28.345 1.00 0.00 ? 113 SER A HA   1  
ATOM 1667  H HB2  . SER A 1 113 ? -7.180  18.330  -27.574 1.00 0.00 ? 113 SER A HB2  1  
ATOM 1668  H HB3  . SER A 1 113 ? -6.532  17.330  -26.274 1.00 0.00 ? 113 SER A HB3  1  
ATOM 1669  H HG   . SER A 1 113 ? -4.770  18.932  -27.746 1.00 0.00 ? 113 SER A HG   1  
ATOM 1670  N N    . GLY A 1 114 ? -6.200  16.928  -30.622 1.00 0.00 ? 114 GLY A N    1  
ATOM 1671  C CA   . GLY A 1 114 ? -6.051  17.491  -31.951 1.00 0.00 ? 114 GLY A CA   1  
ATOM 1672  C C    . GLY A 1 114 ? -4.990  16.778  -32.766 1.00 0.00 ? 114 GLY A C    1  
ATOM 1673  O O    . GLY A 1 114 ? -4.511  17.306  -33.770 1.00 0.00 ? 114 GLY A O    1  
ATOM 1674  H H    . GLY A 1 114 ? -6.754  16.130  -30.489 1.00 0.00 ? 114 GLY A H    1  
ATOM 1675  H HA2  . GLY A 1 114 ? -6.996  17.421  -32.468 1.00 0.00 ? 114 GLY A HA2  1  
ATOM 1676  H HA3  . GLY A 1 114 ? -5.778  18.532  -31.859 1.00 0.00 ? 114 GLY A HA3  1  
ATOM 1677  N N    . GLY A 1 1   ? -27.324 -9.273  -13.364 1.00 0.00 ? 1   GLY A N    2  
ATOM 1678  C CA   . GLY A 1 1   ? -25.980 -9.680  -12.996 1.00 0.00 ? 1   GLY A CA   2  
ATOM 1679  C C    . GLY A 1 1   ? -25.455 -8.925  -11.791 1.00 0.00 ? 1   GLY A C    2  
ATOM 1680  O O    . GLY A 1 1   ? -26.119 -8.854  -10.757 1.00 0.00 ? 1   GLY A O    2  
ATOM 1681  H H1   . GLY A 1 1   ? -27.894 -8.823  -12.707 1.00 0.00 ? 1   GLY A H1   2  
ATOM 1682  H HA2  . GLY A 1 1   ? -25.984 -10.736 -12.772 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1683  H HA3  . GLY A 1 1   ? -25.321 -9.502  -13.833 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1684  N N    . SER A 1 2   ? -24.260 -8.360  -11.923 1.00 0.00 ? 2   SER A N    2  
ATOM 1685  C CA   . SER A 1 2   ? -23.643 -7.611  -10.834 1.00 0.00 ? 2   SER A CA   2  
ATOM 1686  C C    . SER A 1 2   ? -24.251 -6.216  -10.722 1.00 0.00 ? 2   SER A C    2  
ATOM 1687  O O    . SER A 1 2   ? -24.371 -5.498  -11.715 1.00 0.00 ? 2   SER A O    2  
ATOM 1688  C CB   . SER A 1 2   ? -22.132 -7.506  -11.050 1.00 0.00 ? 2   SER A CB   2  
ATOM 1689  O OG   . SER A 1 2   ? -21.836 -6.801  -12.244 1.00 0.00 ? 2   SER A OG   2  
ATOM 1690  H H    . SER A 1 2   ? -23.779 -8.451  -12.773 1.00 0.00 ? 2   SER A H    2  
ATOM 1691  H HA   . SER A 1 2   ? -23.830 -8.147  -9.916  1.00 0.00 ? 2   SER A HA   2  
ATOM 1692  H HB2  . SER A 1 2   ? -21.688 -6.982  -10.218 1.00 0.00 ? 2   SER A HB2  2  
ATOM 1693  H HB3  . SER A 1 2   ? -21.711 -8.498  -11.118 1.00 0.00 ? 2   SER A HB3  2  
ATOM 1694  H HG   . SER A 1 2   ? -22.492 -6.114  -12.382 1.00 0.00 ? 2   SER A HG   2  
ATOM 1695  N N    . SER A 1 3   ? -24.633 -5.839  -9.506  1.00 0.00 ? 3   SER A N    2  
ATOM 1696  C CA   . SER A 1 3   ? -25.232 -4.532  -9.263  1.00 0.00 ? 3   SER A CA   2  
ATOM 1697  C C    . SER A 1 3   ? -24.155 -3.468  -9.075  1.00 0.00 ? 3   SER A C    2  
ATOM 1698  O O    . SER A 1 3   ? -22.975 -3.782  -8.928  1.00 0.00 ? 3   SER A O    2  
ATOM 1699  C CB   . SER A 1 3   ? -26.136 -4.583  -8.030  1.00 0.00 ? 3   SER A CB   2  
ATOM 1700  O OG   . SER A 1 3   ? -27.230 -5.461  -8.236  1.00 0.00 ? 3   SER A OG   2  
ATOM 1701  H H    . SER A 1 3   ? -24.511 -6.457  -8.755  1.00 0.00 ? 3   SER A H    2  
ATOM 1702  H HA   . SER A 1 3   ? -25.829 -4.276  -10.126 1.00 0.00 ? 3   SER A HA   2  
ATOM 1703  H HB2  . SER A 1 3   ? -25.565 -4.931  -7.183  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1704  H HB3  . SER A 1 3   ? -26.517 -3.593  -7.826  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1705  H HG   . SER A 1 3   ? -27.888 -5.029  -8.784  1.00 0.00 ? 3   SER A HG   2  
ATOM 1706  N N    . GLY A 1 4   ? -24.573 -2.205  -9.082  1.00 0.00 ? 4   GLY A N    2  
ATOM 1707  C CA   . GLY A 1 4   ? -23.633 -1.113  -8.911  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1708  C C    . GLY A 1 4   ? -24.325 0.221   -8.711  1.00 0.00 ? 4   GLY A C    2  
ATOM 1709  O O    . GLY A 1 4   ? -24.551 0.648   -7.579  1.00 0.00 ? 4   GLY A O    2  
ATOM 1710  H H    . GLY A 1 4   ? -25.527 -2.014  -9.203  1.00 0.00 ? 4   GLY A H    2  
ATOM 1711  H HA2  . GLY A 1 4   ? -23.012 -1.317  -8.052  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1712  H HA3  . GLY A 1 4   ? -23.006 -1.052  -9.789  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1713  N N    . SER A 1 5   ? -24.661 0.883   -9.814  1.00 0.00 ? 5   SER A N    2  
ATOM 1714  C CA   . SER A 1 5   ? -25.326 2.179   -9.755  1.00 0.00 ? 5   SER A CA   2  
ATOM 1715  C C    . SER A 1 5   ? -26.832 2.026   -9.946  1.00 0.00 ? 5   SER A C    2  
ATOM 1716  O O    . SER A 1 5   ? -27.298 1.051   -10.534 1.00 0.00 ? 5   SER A O    2  
ATOM 1717  C CB   . SER A 1 5   ? -24.758 3.117   -10.822 1.00 0.00 ? 5   SER A CB   2  
ATOM 1718  O OG   . SER A 1 5   ? -23.384 3.378   -10.593 1.00 0.00 ? 5   SER A OG   2  
ATOM 1719  H H    . SER A 1 5   ? -24.454 0.491   -10.688 1.00 0.00 ? 5   SER A H    2  
ATOM 1720  H HA   . SER A 1 5   ? -25.140 2.603   -8.780  1.00 0.00 ? 5   SER A HA   2  
ATOM 1721  H HB2  . SER A 1 5   ? -24.868 2.660   -11.794 1.00 0.00 ? 5   SER A HB2  2  
ATOM 1722  H HB3  . SER A 1 5   ? -25.299 4.052   -10.801 1.00 0.00 ? 5   SER A HB3  2  
ATOM 1723  H HG   . SER A 1 5   ? -23.234 3.501   -9.653  1.00 0.00 ? 5   SER A HG   2  
ATOM 1724  N N    . SER A 1 6   ? -27.587 2.997   -9.443  1.00 0.00 ? 6   SER A N    2  
ATOM 1725  C CA   . SER A 1 6   ? -29.041 2.970   -9.553  1.00 0.00 ? 6   SER A CA   2  
ATOM 1726  C C    . SER A 1 6   ? -29.511 3.804   -10.741 1.00 0.00 ? 6   SER A C    2  
ATOM 1727  O O    . SER A 1 6   ? -30.488 4.545   -10.646 1.00 0.00 ? 6   SER A O    2  
ATOM 1728  C CB   . SER A 1 6   ? -29.682 3.491   -8.265  1.00 0.00 ? 6   SER A CB   2  
ATOM 1729  O OG   . SER A 1 6   ? -29.671 4.907   -8.227  1.00 0.00 ? 6   SER A OG   2  
ATOM 1730  H H    . SER A 1 6   ? -27.156 3.749   -8.984  1.00 0.00 ? 6   SER A H    2  
ATOM 1731  H HA   . SER A 1 6   ? -29.343 1.944   -9.706  1.00 0.00 ? 6   SER A HA   2  
ATOM 1732  H HB2  . SER A 1 6   ? -30.704 3.149   -8.211  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1733  H HB3  . SER A 1 6   ? -29.131 3.115   -7.415  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1734  H HG   . SER A 1 6   ? -30.060 5.208   -7.402  1.00 0.00 ? 6   SER A HG   2  
ATOM 1735  N N    . GLY A 1 7   ? -28.808 3.675   -11.862 1.00 0.00 ? 7   GLY A N    2  
ATOM 1736  C CA   . GLY A 1 7   ? -29.167 4.422   -13.054 1.00 0.00 ? 7   GLY A CA   2  
ATOM 1737  C C    . GLY A 1 7   ? -29.271 3.539   -14.282 1.00 0.00 ? 7   GLY A C    2  
ATOM 1738  O O    . GLY A 1 7   ? -30.371 3.214   -14.728 1.00 0.00 ? 7   GLY A O    2  
ATOM 1739  H H    . GLY A 1 7   ? -28.038 3.068   -11.880 1.00 0.00 ? 7   GLY A H    2  
ATOM 1740  H HA2  . GLY A 1 7   ? -30.118 4.906   -12.889 1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1741  H HA3  . GLY A 1 7   ? -28.416 5.178   -13.231 1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1742  N N    . GLU A 1 8   ? -28.124 3.152   -14.829 1.00 0.00 ? 8   GLU A N    2  
ATOM 1743  C CA   . GLU A 1 8   ? -28.092 2.304   -16.015 1.00 0.00 ? 8   GLU A CA   2  
ATOM 1744  C C    . GLU A 1 8   ? -27.036 1.211   -15.874 1.00 0.00 ? 8   GLU A C    2  
ATOM 1745  O O    . GLU A 1 8   ? -25.855 1.497   -15.676 1.00 0.00 ? 8   GLU A O    2  
ATOM 1746  C CB   . GLU A 1 8   ? -27.810 3.143   -17.263 1.00 0.00 ? 8   GLU A CB   2  
ATOM 1747  C CG   . GLU A 1 8   ? -29.035 3.863   -17.801 1.00 0.00 ? 8   GLU A CG   2  
ATOM 1748  C CD   . GLU A 1 8   ? -28.958 4.106   -19.296 1.00 0.00 ? 8   GLU A CD   2  
ATOM 1749  O OE1  . GLU A 1 8   ? -28.538 3.183   -20.026 1.00 0.00 ? 8   GLU A OE1  2  
ATOM 1750  O OE2  . GLU A 1 8   ? -29.318 5.217   -19.737 1.00 0.00 ? 8   GLU A OE2  2  
ATOM 1751  H H    . GLU A 1 8   ? -27.279 3.444   -14.427 1.00 0.00 ? 8   GLU A H    2  
ATOM 1752  H HA   . GLU A 1 8   ? -29.061 1.839   -16.117 1.00 0.00 ? 8   GLU A HA   2  
ATOM 1753  H HB2  . GLU A 1 8   ? -27.059 3.882   -17.023 1.00 0.00 ? 8   GLU A HB2  2  
ATOM 1754  H HB3  . GLU A 1 8   ? -27.429 2.496   -18.039 1.00 0.00 ? 8   GLU A HB3  2  
ATOM 1755  H HG2  . GLU A 1 8   ? -29.909 3.265   -17.594 1.00 0.00 ? 8   GLU A HG2  2  
ATOM 1756  H HG3  . GLU A 1 8   ? -29.125 4.816   -17.301 1.00 0.00 ? 8   GLU A HG3  2  
ATOM 1757  N N    . ILE A 1 9   ? -27.470 -0.040  -15.977 1.00 0.00 ? 9   ILE A N    2  
ATOM 1758  C CA   . ILE A 1 9   ? -26.563 -1.175  -15.862 1.00 0.00 ? 9   ILE A CA   2  
ATOM 1759  C C    . ILE A 1 9   ? -25.999 -1.568  -17.223 1.00 0.00 ? 9   ILE A C    2  
ATOM 1760  O O    . ILE A 1 9   ? -26.638 -1.360  -18.254 1.00 0.00 ? 9   ILE A O    2  
ATOM 1761  C CB   . ILE A 1 9   ? -27.265 -2.396  -15.238 1.00 0.00 ? 9   ILE A CB   2  
ATOM 1762  C CG1  . ILE A 1 9   ? -28.411 -2.867  -16.135 1.00 0.00 ? 9   ILE A CG1  2  
ATOM 1763  C CG2  . ILE A 1 9   ? -27.779 -2.057  -13.847 1.00 0.00 ? 9   ILE A CG2  2  
ATOM 1764  C CD1  . ILE A 1 9   ? -27.978 -3.846  -17.205 1.00 0.00 ? 9   ILE A CD1  2  
ATOM 1765  H H    . ILE A 1 9   ? -28.423 -0.204  -16.135 1.00 0.00 ? 9   ILE A H    2  
ATOM 1766  H HA   . ILE A 1 9   ? -25.747 -0.885  -15.216 1.00 0.00 ? 9   ILE A HA   2  
ATOM 1767  H HB   . ILE A 1 9   ? -26.540 -3.190  -15.144 1.00 0.00 ? 9   ILE A HB   2  
ATOM 1768  H HG12 . ILE A 1 9   ? -29.160 -3.350  -15.528 1.00 0.00 ? 9   ILE A HG12 2  
ATOM 1769  H HG13 . ILE A 1 9   ? -28.849 -2.010  -16.626 1.00 0.00 ? 9   ILE A HG13 2  
ATOM 1770  H HG21 . ILE A 1 9   ? -26.944 -1.831  -13.199 1.00 0.00 ? 9   ILE A HG21 2  
ATOM 1771  H HG22 . ILE A 1 9   ? -28.431 -1.198  -13.904 1.00 0.00 ? 9   ILE A HG22 2  
ATOM 1772  H HG23 . ILE A 1 9   ? -28.326 -2.899  -13.449 1.00 0.00 ? 9   ILE A HG23 2  
ATOM 1773  H HD11 . ILE A 1 9   ? -27.040 -4.299  -16.920 1.00 0.00 ? 9   ILE A HD11 2  
ATOM 1774  H HD12 . ILE A 1 9   ? -28.730 -4.612  -17.318 1.00 0.00 ? 9   ILE A HD12 2  
ATOM 1775  H HD13 . ILE A 1 9   ? -27.854 -3.322  -18.142 1.00 0.00 ? 9   ILE A HD13 2  
ATOM 1776  N N    . GLU A 1 10  ? -24.799 -2.140  -17.218 1.00 0.00 ? 10  GLU A N    2  
ATOM 1777  C CA   . GLU A 1 10  ? -24.149 -2.563  -18.453 1.00 0.00 ? 10  GLU A CA   2  
ATOM 1778  C C    . GLU A 1 10  ? -24.106 -4.086  -18.550 1.00 0.00 ? 10  GLU A C    2  
ATOM 1779  O O    . GLU A 1 10  ? -23.855 -4.775  -17.561 1.00 0.00 ? 10  GLU A O    2  
ATOM 1780  C CB   . GLU A 1 10  ? -22.730 -1.996  -18.530 1.00 0.00 ? 10  GLU A CB   2  
ATOM 1781  C CG   . GLU A 1 10  ? -22.239 -1.777  -19.951 1.00 0.00 ? 10  GLU A CG   2  
ATOM 1782  C CD   . GLU A 1 10  ? -23.286 -1.133  -20.838 1.00 0.00 ? 10  GLU A CD   2  
ATOM 1783  O OE1  . GLU A 1 10  ? -23.833 -0.082  -20.442 1.00 0.00 ? 10  GLU A OE1  2  
ATOM 1784  O OE2  . GLU A 1 10  ? -23.559 -1.679  -21.927 1.00 0.00 ? 10  GLU A OE2  2  
ATOM 1785  H H    . GLU A 1 10  ? -24.339 -2.279  -16.364 1.00 0.00 ? 10  GLU A H    2  
ATOM 1786  H HA   . GLU A 1 10  ? -24.726 -2.178  -19.280 1.00 0.00 ? 10  GLU A HA   2  
ATOM 1787  H HB2  . GLU A 1 10  ? -22.706 -1.049  -18.012 1.00 0.00 ? 10  GLU A HB2  2  
ATOM 1788  H HB3  . GLU A 1 10  ? -22.055 -2.681  -18.039 1.00 0.00 ? 10  GLU A HB3  2  
ATOM 1789  H HG2  . GLU A 1 10  ? -21.370 -1.137  -19.923 1.00 0.00 ? 10  GLU A HG2  2  
ATOM 1790  H HG3  . GLU A 1 10  ? -21.967 -2.732  -20.375 1.00 0.00 ? 10  GLU A HG3  2  
ATOM 1791  N N    . ILE A 1 11  ? -24.353 -4.603  -19.749 1.00 0.00 ? 11  ILE A N    2  
ATOM 1792  C CA   . ILE A 1 11  ? -24.342 -6.043  -19.977 1.00 0.00 ? 11  ILE A CA   2  
ATOM 1793  C C    . ILE A 1 11  ? -22.998 -6.650  -19.588 1.00 0.00 ? 11  ILE A C    2  
ATOM 1794  O O    . ILE A 1 11  ? -22.926 -7.805  -19.165 1.00 0.00 ? 11  ILE A O    2  
ATOM 1795  C CB   . ILE A 1 11  ? -24.640 -6.382  -21.449 1.00 0.00 ? 11  ILE A CB   2  
ATOM 1796  C CG1  . ILE A 1 11  ? -25.997 -5.809  -21.863 1.00 0.00 ? 11  ILE A CG1  2  
ATOM 1797  C CG2  . ILE A 1 11  ? -24.607 -7.889  -21.662 1.00 0.00 ? 11  ILE A CG2  2  
ATOM 1798  C CD1  . ILE A 1 11  ? -27.158 -6.378  -21.077 1.00 0.00 ? 11  ILE A CD1  2  
ATOM 1799  H H    . ILE A 1 11  ? -24.546 -4.002  -20.499 1.00 0.00 ? 11  ILE A H    2  
ATOM 1800  H HA   . ILE A 1 11  ? -25.114 -6.483  -19.363 1.00 0.00 ? 11  ILE A HA   2  
ATOM 1801  H HB   . ILE A 1 11  ? -23.868 -5.940  -22.060 1.00 0.00 ? 11  ILE A HB   2  
ATOM 1802  H HG12 . ILE A 1 11  ? -25.989 -4.741  -21.716 1.00 0.00 ? 11  ILE A HG12 2  
ATOM 1803  H HG13 . ILE A 1 11  ? -26.166 -6.024  -22.908 1.00 0.00 ? 11  ILE A HG13 2  
ATOM 1804  H HG21 . ILE A 1 11  ? -23.635 -8.270  -21.386 1.00 0.00 ? 11  ILE A HG21 2  
ATOM 1805  H HG22 . ILE A 1 11  ? -25.363 -8.355  -21.048 1.00 0.00 ? 11  ILE A HG22 2  
ATOM 1806  H HG23 . ILE A 1 11  ? -24.800 -8.110  -22.701 1.00 0.00 ? 11  ILE A HG23 2  
ATOM 1807  H HD11 . ILE A 1 11  ? -27.834 -6.886  -21.749 1.00 0.00 ? 11  ILE A HD11 2  
ATOM 1808  H HD12 . ILE A 1 11  ? -26.788 -7.076  -20.341 1.00 0.00 ? 11  ILE A HD12 2  
ATOM 1809  H HD13 . ILE A 1 11  ? -27.683 -5.575  -20.579 1.00 0.00 ? 11  ILE A HD13 2  
ATOM 1810  N N    . CYS A 1 12  ? -21.936 -5.865  -19.733 1.00 0.00 ? 12  CYS A N    2  
ATOM 1811  C CA   . CYS A 1 12  ? -20.594 -6.325  -19.396 1.00 0.00 ? 12  CYS A CA   2  
ATOM 1812  C C    . CYS A 1 12  ? -20.259 -6.007  -17.943 1.00 0.00 ? 12  CYS A C    2  
ATOM 1813  O O    . CYS A 1 12  ? -20.746 -5.035  -17.366 1.00 0.00 ? 12  CYS A O    2  
ATOM 1814  C CB   . CYS A 1 12  ? -19.563 -5.678  -20.323 1.00 0.00 ? 12  CYS A CB   2  
ATOM 1815  S SG   . CYS A 1 12  ? -19.527 -3.872  -20.240 1.00 0.00 ? 12  CYS A SG   2  
ATOM 1816  H H    . CYS A 1 12  ? -22.057 -4.954  -20.075 1.00 0.00 ? 12  CYS A H    2  
ATOM 1817  H HA   . CYS A 1 12  ? -20.567 -7.395  -19.533 1.00 0.00 ? 12  CYS A HA   2  
ATOM 1818  H HB2  . CYS A 1 12  ? -18.579 -6.038  -20.061 1.00 0.00 ? 12  CYS A HB2  2  
ATOM 1819  H HB3  . CYS A 1 12  ? -19.782 -5.958  -21.343 1.00 0.00 ? 12  CYS A HB3  2  
ATOM 1820  H HG   . CYS A 1 12  ? -20.161 -3.501  -19.139 1.00 0.00 ? 12  CYS A HG   2  
ATOM 1821  N N    . PRO A 1 13  ? -19.408 -6.847  -17.334 1.00 0.00 ? 13  PRO A N    2  
ATOM 1822  C CA   . PRO A 1 13  ? -18.990 -6.677  -15.939 1.00 0.00 ? 13  PRO A CA   2  
ATOM 1823  C C    . PRO A 1 13  ? -18.084 -5.465  -15.750 1.00 0.00 ? 13  PRO A C    2  
ATOM 1824  O O    . PRO A 1 13  ? -17.797 -4.736  -16.699 1.00 0.00 ? 13  PRO A O    2  
ATOM 1825  C CB   . PRO A 1 13  ? -18.225 -7.969  -15.638 1.00 0.00 ? 13  PRO A CB   2  
ATOM 1826  C CG   . PRO A 1 13  ? -17.739 -8.439  -16.966 1.00 0.00 ? 13  PRO A CG   2  
ATOM 1827  C CD   . PRO A 1 13  ? -18.788 -8.027  -17.961 1.00 0.00 ? 13  PRO A CD   2  
ATOM 1828  H HA   . PRO A 1 13  ? -19.840 -6.597  -15.277 1.00 0.00 ? 13  PRO A HA   2  
ATOM 1829  H HB2  . PRO A 1 13  ? -17.404 -7.756  -14.968 1.00 0.00 ? 13  PRO A HB2  2  
ATOM 1830  H HB3  . PRO A 1 13  ? -18.891 -8.687  -15.184 1.00 0.00 ? 13  PRO A HB3  2  
ATOM 1831  H HG2  . PRO A 1 13  ? -16.796 -7.970  -17.199 1.00 0.00 ? 13  PRO A HG2  2  
ATOM 1832  H HG3  . PRO A 1 13  ? -17.634 -9.514  -16.957 1.00 0.00 ? 13  PRO A HG3  2  
ATOM 1833  H HD2  . PRO A 1 13  ? -18.332 -7.767  -18.904 1.00 0.00 ? 13  PRO A HD2  2  
ATOM 1834  H HD3  . PRO A 1 13  ? -19.513 -8.816  -18.095 1.00 0.00 ? 13  PRO A HD3  2  
ATOM 1835  N N    . LYS A 1 14  ? -17.634 -5.256  -14.517 1.00 0.00 ? 14  LYS A N    2  
ATOM 1836  C CA   . LYS A 1 14  ? -16.759 -4.133  -14.201 1.00 0.00 ? 14  LYS A CA   2  
ATOM 1837  C C    . LYS A 1 14  ? -15.524 -4.138  -15.097 1.00 0.00 ? 14  LYS A C    2  
ATOM 1838  O O    . LYS A 1 14  ? -15.283 -5.094  -15.834 1.00 0.00 ? 14  LYS A O    2  
ATOM 1839  C CB   . LYS A 1 14  ? -16.335 -4.187  -12.732 1.00 0.00 ? 14  LYS A CB   2  
ATOM 1840  C CG   . LYS A 1 14  ? -17.386 -3.648  -11.776 1.00 0.00 ? 14  LYS A CG   2  
ATOM 1841  C CD   . LYS A 1 14  ? -18.435 -4.699  -11.451 1.00 0.00 ? 14  LYS A CD   2  
ATOM 1842  C CE   . LYS A 1 14  ? -19.066 -4.452  -10.089 1.00 0.00 ? 14  LYS A CE   2  
ATOM 1843  N NZ   . LYS A 1 14  ? -18.166 -4.865  -8.977  1.00 0.00 ? 14  LYS A NZ   2  
ATOM 1844  H H    . LYS A 1 14  ? -17.898 -5.872  -13.801 1.00 0.00 ? 14  LYS A H    2  
ATOM 1845  H HA   . LYS A 1 14  ? -17.311 -3.222  -14.375 1.00 0.00 ? 14  LYS A HA   2  
ATOM 1846  H HB2  . LYS A 1 14  ? -16.130 -5.213  -12.466 1.00 0.00 ? 14  LYS A HB2  2  
ATOM 1847  H HB3  . LYS A 1 14  ? -15.434 -3.604  -12.608 1.00 0.00 ? 14  LYS A HB3  2  
ATOM 1848  H HG2  . LYS A 1 14  ? -16.903 -3.341  -10.860 1.00 0.00 ? 14  LYS A HG2  2  
ATOM 1849  H HG3  . LYS A 1 14  ? -17.872 -2.797  -12.232 1.00 0.00 ? 14  LYS A HG3  2  
ATOM 1850  H HD2  . LYS A 1 14  ? -19.208 -4.669  -12.204 1.00 0.00 ? 14  LYS A HD2  2  
ATOM 1851  H HD3  . LYS A 1 14  ? -17.967 -5.673  -11.450 1.00 0.00 ? 14  LYS A HD3  2  
ATOM 1852  H HE2  . LYS A 1 14  ? -19.284 -3.400  -9.993  1.00 0.00 ? 14  LYS A HE2  2  
ATOM 1853  H HE3  . LYS A 1 14  ? -19.985 -5.017  -10.026 1.00 0.00 ? 14  LYS A HE3  2  
ATOM 1854  H HZ1  . LYS A 1 14  ? -18.670 -4.808  -8.069  1.00 0.00 ? 14  LYS A HZ1  2  
ATOM 1855  H HZ2  . LYS A 1 14  ? -17.335 -4.241  -8.939  1.00 0.00 ? 14  LYS A HZ2  2  
ATOM 1856  H HZ3  . LYS A 1 14  ? -17.844 -5.844  -9.122  1.00 0.00 ? 14  LYS A HZ3  2  
ATOM 1857  N N    . VAL A 1 15  ? -14.744 -3.064  -15.028 1.00 0.00 ? 15  VAL A N    2  
ATOM 1858  C CA   . VAL A 1 15  ? -13.533 -2.946  -15.831 1.00 0.00 ? 15  VAL A CA   2  
ATOM 1859  C C    . VAL A 1 15  ? -12.340 -2.545  -14.970 1.00 0.00 ? 15  VAL A C    2  
ATOM 1860  O O    . VAL A 1 15  ? -12.479 -1.786  -14.011 1.00 0.00 ? 15  VAL A O    2  
ATOM 1861  C CB   . VAL A 1 15  ? -13.707 -1.913  -16.960 1.00 0.00 ? 15  VAL A CB   2  
ATOM 1862  C CG1  . VAL A 1 15  ? -14.823 -2.335  -17.903 1.00 0.00 ? 15  VAL A CG1  2  
ATOM 1863  C CG2  . VAL A 1 15  ? -13.980 -0.532  -16.382 1.00 0.00 ? 15  VAL A CG2  2  
ATOM 1864  H H    . VAL A 1 15  ? -14.989 -2.334  -14.422 1.00 0.00 ? 15  VAL A H    2  
ATOM 1865  H HA   . VAL A 1 15  ? -13.334 -3.908  -16.279 1.00 0.00 ? 15  VAL A HA   2  
ATOM 1866  H HB   . VAL A 1 15  ? -12.787 -1.868  -17.525 1.00 0.00 ? 15  VAL A HB   2  
ATOM 1867  H HG11 . VAL A 1 15  ? -14.515 -2.165  -18.925 1.00 0.00 ? 15  VAL A HG11 2  
ATOM 1868  H HG12 . VAL A 1 15  ? -15.038 -3.384  -17.760 1.00 0.00 ? 15  VAL A HG12 2  
ATOM 1869  H HG13 . VAL A 1 15  ? -15.709 -1.754  -17.694 1.00 0.00 ? 15  VAL A HG13 2  
ATOM 1870  H HG21 . VAL A 1 15  ? -13.830 0.214   -17.148 1.00 0.00 ? 15  VAL A HG21 2  
ATOM 1871  H HG22 . VAL A 1 15  ? -15.000 -0.485  -16.028 1.00 0.00 ? 15  VAL A HG22 2  
ATOM 1872  H HG23 . VAL A 1 15  ? -13.305 -0.346  -15.560 1.00 0.00 ? 15  VAL A HG23 2  
ATOM 1873  N N    . THR A 1 16  ? -11.165 -3.060  -15.320 1.00 0.00 ? 16  THR A N    2  
ATOM 1874  C CA   . THR A 1 16  ? -9.947  -2.757  -14.580 1.00 0.00 ? 16  THR A CA   2  
ATOM 1875  C C    . THR A 1 16  ? -9.233  -1.546  -15.168 1.00 0.00 ? 16  THR A C    2  
ATOM 1876  O O    . THR A 1 16  ? -8.967  -1.494  -16.368 1.00 0.00 ? 16  THR A O    2  
ATOM 1877  C CB   . THR A 1 16  ? -8.980  -3.956  -14.574 1.00 0.00 ? 16  THR A CB   2  
ATOM 1878  O OG1  . THR A 1 16  ? -8.892  -4.521  -15.888 1.00 0.00 ? 16  THR A OG1  2  
ATOM 1879  C CG2  . THR A 1 16  ? -9.442  -5.020  -13.590 1.00 0.00 ? 16  THR A CG2  2  
ATOM 1880  H H    . THR A 1 16  ? -11.119 -3.659  -16.095 1.00 0.00 ? 16  THR A H    2  
ATOM 1881  H HA   . THR A 1 16  ? -10.223 -2.540  -13.558 1.00 0.00 ? 16  THR A HA   2  
ATOM 1882  H HB   . THR A 1 16  ? -8.002  -3.609  -14.274 1.00 0.00 ? 16  THR A HB   2  
ATOM 1883  H HG1  . THR A 1 16  ? -7.979  -4.497  -16.186 1.00 0.00 ? 16  THR A HG1  2  
ATOM 1884  H HG21 . THR A 1 16  ? -9.221  -4.699  -12.583 1.00 0.00 ? 16  THR A HG21 2  
ATOM 1885  H HG22 . THR A 1 16  ? -8.927  -5.947  -13.794 1.00 0.00 ? 16  THR A HG22 2  
ATOM 1886  H HG23 . THR A 1 16  ? -10.507 -5.168  -13.695 1.00 0.00 ? 16  THR A HG23 2  
ATOM 1887  N N    . GLN A 1 17  ? -8.925  -0.574  -14.315 1.00 0.00 ? 17  GLN A N    2  
ATOM 1888  C CA   . GLN A 1 17  ? -8.241  0.637   -14.752 1.00 0.00 ? 17  GLN A CA   2  
ATOM 1889  C C    . GLN A 1 17  ? -6.799  0.656   -14.258 1.00 0.00 ? 17  GLN A C    2  
ATOM 1890  O O    . GLN A 1 17  ? -6.539  0.513   -13.064 1.00 0.00 ? 17  GLN A O    2  
ATOM 1891  C CB   . GLN A 1 17  ? -8.982  1.877   -14.247 1.00 0.00 ? 17  GLN A CB   2  
ATOM 1892  C CG   . GLN A 1 17  ? -8.773  2.149   -12.766 1.00 0.00 ? 17  GLN A CG   2  
ATOM 1893  C CD   . GLN A 1 17  ? -9.575  3.338   -12.273 1.00 0.00 ? 17  GLN A CD   2  
ATOM 1894  O OE1  . GLN A 1 17  ? -10.259 3.259   -11.253 1.00 0.00 ? 17  GLN A OE1  2  
ATOM 1895  N NE2  . GLN A 1 17  ? -9.493  4.448   -12.996 1.00 0.00 ? 17  GLN A NE2  2  
ATOM 1896  H H    . GLN A 1 17  ? -9.164  -0.674  -13.370 1.00 0.00 ? 17  GLN A H    2  
ATOM 1897  H HA   . GLN A 1 17  ? -8.239  0.645   -15.831 1.00 0.00 ? 17  GLN A HA   2  
ATOM 1898  H HB2  . GLN A 1 17  ? -8.639  2.737   -14.802 1.00 0.00 ? 17  GLN A HB2  2  
ATOM 1899  H HB3  . GLN A 1 17  ? -10.040 1.745   -14.421 1.00 0.00 ? 17  GLN A HB3  2  
ATOM 1900  H HG2  . GLN A 1 17  ? -9.073  1.276   -12.207 1.00 0.00 ? 17  GLN A HG2  2  
ATOM 1901  H HG3  . GLN A 1 17  ? -7.725  2.343   -12.594 1.00 0.00 ? 17  GLN A HG3  2  
ATOM 1902  H HE21 . GLN A 1 17  ? -8.928  4.438   -13.798 1.00 0.00 ? 17  GLN A HE21 2  
ATOM 1903  H HE22 . GLN A 1 17  ? -10.001 5.231   -12.701 1.00 0.00 ? 17  GLN A HE22 2  
ATOM 1904  N N    . SER A 1 18  ? -5.863  0.834   -15.186 1.00 0.00 ? 18  SER A N    2  
ATOM 1905  C CA   . SER A 1 18  ? -4.446  0.867   -14.845 1.00 0.00 ? 18  SER A CA   2  
ATOM 1906  C C    . SER A 1 18  ? -3.993  2.293   -14.544 1.00 0.00 ? 18  SER A C    2  
ATOM 1907  O O    . SER A 1 18  ? -3.779  3.093   -15.455 1.00 0.00 ? 18  SER A O    2  
ATOM 1908  C CB   . SER A 1 18  ? -3.611  0.286   -15.988 1.00 0.00 ? 18  SER A CB   2  
ATOM 1909  O OG   . SER A 1 18  ? -3.806  1.017   -17.185 1.00 0.00 ? 18  SER A OG   2  
ATOM 1910  H H    . SER A 1 18  ? -6.133  0.942   -16.122 1.00 0.00 ? 18  SER A H    2  
ATOM 1911  H HA   . SER A 1 18  ? -4.303  0.263   -13.962 1.00 0.00 ? 18  SER A HA   2  
ATOM 1912  H HB2  . SER A 1 18  ? -2.565  0.325   -15.722 1.00 0.00 ? 18  SER A HB2  2  
ATOM 1913  H HB3  . SER A 1 18  ? -3.902  -0.741  -16.156 1.00 0.00 ? 18  SER A HB3  2  
ATOM 1914  H HG   . SER A 1 18  ? -3.592  1.941   -17.035 1.00 0.00 ? 18  SER A HG   2  
ATOM 1915  N N    . ILE A 1 19  ? -3.849  2.602   -13.260 1.00 0.00 ? 19  ILE A N    2  
ATOM 1916  C CA   . ILE A 1 19  ? -3.420  3.930   -12.838 1.00 0.00 ? 19  ILE A CA   2  
ATOM 1917  C C    . ILE A 1 19  ? -1.917  3.969   -12.588 1.00 0.00 ? 19  ILE A C    2  
ATOM 1918  O O    . ILE A 1 19  ? -1.436  3.504   -11.553 1.00 0.00 ? 19  ILE A O    2  
ATOM 1919  C CB   . ILE A 1 19  ? -4.154  4.378   -11.560 1.00 0.00 ? 19  ILE A CB   2  
ATOM 1920  C CG1  . ILE A 1 19  ? -5.656  4.500   -11.824 1.00 0.00 ? 19  ILE A CG1  2  
ATOM 1921  C CG2  . ILE A 1 19  ? -3.589  5.700   -11.061 1.00 0.00 ? 19  ILE A CG2  2  
ATOM 1922  C CD1  . ILE A 1 19  ? -6.500  4.387   -10.573 1.00 0.00 ? 19  ILE A CD1  2  
ATOM 1923  H H    . ILE A 1 19  ? -4.034  1.921   -12.580 1.00 0.00 ? 19  ILE A H    2  
ATOM 1924  H HA   . ILE A 1 19  ? -3.661  4.625   -13.629 1.00 0.00 ? 19  ILE A HA   2  
ATOM 1925  H HB   . ILE A 1 19  ? -3.988  3.633   -10.796 1.00 0.00 ? 19  ILE A HB   2  
ATOM 1926  H HG12 . ILE A 1 19  ? -5.860  5.457   -12.275 1.00 0.00 ? 19  ILE A HG12 2  
ATOM 1927  H HG13 . ILE A 1 19  ? -5.959  3.715   -12.502 1.00 0.00 ? 19  ILE A HG13 2  
ATOM 1928  H HG21 . ILE A 1 19  ? -3.292  6.306   -11.905 1.00 0.00 ? 19  ILE A HG21 2  
ATOM 1929  H HG22 . ILE A 1 19  ? -4.345  6.222   -10.493 1.00 0.00 ? 19  ILE A HG22 2  
ATOM 1930  H HG23 . ILE A 1 19  ? -2.732  5.512   -10.433 1.00 0.00 ? 19  ILE A HG23 2  
ATOM 1931  H HD11 . ILE A 1 19  ? -7.466  3.975   -10.826 1.00 0.00 ? 19  ILE A HD11 2  
ATOM 1932  H HD12 . ILE A 1 19  ? -6.007  3.742   -9.862  1.00 0.00 ? 19  ILE A HD12 2  
ATOM 1933  H HD13 . ILE A 1 19  ? -6.632  5.368   -10.139 1.00 0.00 ? 19  ILE A HD13 2  
ATOM 1934  N N    . HIS A 1 20  ? -1.178  4.528   -13.541 1.00 0.00 ? 20  HIS A N    2  
ATOM 1935  C CA   . HIS A 1 20  ? 0.272   4.631   -13.423 1.00 0.00 ? 20  HIS A CA   2  
ATOM 1936  C C    . HIS A 1 20  ? 0.682   6.025   -12.959 1.00 0.00 ? 20  HIS A C    2  
ATOM 1937  O O    . HIS A 1 20  ? 0.524   7.004   -13.689 1.00 0.00 ? 20  HIS A O    2  
ATOM 1938  C CB   . HIS A 1 20  ? 0.938   4.310   -14.761 1.00 0.00 ? 20  HIS A CB   2  
ATOM 1939  C CG   . HIS A 1 20  ? 0.755   2.888   -15.195 1.00 0.00 ? 20  HIS A CG   2  
ATOM 1940  N ND1  . HIS A 1 20  ? 1.786   2.109   -15.676 1.00 0.00 ? 20  HIS A ND1  2  
ATOM 1941  C CD2  . HIS A 1 20  ? -0.349  2.104   -15.218 1.00 0.00 ? 20  HIS A CD2  2  
ATOM 1942  C CE1  . HIS A 1 20  ? 1.324   0.908   -15.977 1.00 0.00 ? 20  HIS A CE1  2  
ATOM 1943  N NE2  . HIS A 1 20  ? 0.032   0.879   -15.708 1.00 0.00 ? 20  HIS A NE2  2  
ATOM 1944  H H    . HIS A 1 20  ? -1.619  4.881   -14.342 1.00 0.00 ? 20  HIS A H    2  
ATOM 1945  H HA   . HIS A 1 20  ? 0.597   3.911   -12.687 1.00 0.00 ? 20  HIS A HA   2  
ATOM 1946  H HB2  . HIS A 1 20  ? 0.518   4.946   -15.526 1.00 0.00 ? 20  HIS A HB2  2  
ATOM 1947  H HB3  . HIS A 1 20  ? 1.999   4.500   -14.684 1.00 0.00 ? 20  HIS A HB3  2  
ATOM 1948  H HD1  . HIS A 1 20  ? 2.717   2.394   -15.782 1.00 0.00 ? 20  HIS A HD1  2  
ATOM 1949  H HD2  . HIS A 1 20  ? -1.345  2.389   -14.909 1.00 0.00 ? 20  HIS A HD2  2  
ATOM 1950  H HE1  . HIS A 1 20  ? 1.905   0.089   -16.374 1.00 0.00 ? 20  HIS A HE1  2  
ATOM 1951  H HE2  . HIS A 1 20  ? -0.572  0.137   -15.918 1.00 0.00 ? 20  HIS A HE2  2  
ATOM 1952  N N    . ILE A 1 21  ? 1.209   6.107   -11.742 1.00 0.00 ? 21  ILE A N    2  
ATOM 1953  C CA   . ILE A 1 21  ? 1.642   7.382   -11.182 1.00 0.00 ? 21  ILE A CA   2  
ATOM 1954  C C    . ILE A 1 21  ? 3.147   7.567   -11.337 1.00 0.00 ? 21  ILE A C    2  
ATOM 1955  O O    . ILE A 1 21  ? 3.927   6.661   -11.046 1.00 0.00 ? 21  ILE A O    2  
ATOM 1956  C CB   . ILE A 1 21  ? 1.273   7.495   -9.691  1.00 0.00 ? 21  ILE A CB   2  
ATOM 1957  C CG1  . ILE A 1 21  ? -0.180  7.070   -9.468  1.00 0.00 ? 21  ILE A CG1  2  
ATOM 1958  C CG2  . ILE A 1 21  ? 1.495   8.917   -9.197  1.00 0.00 ? 21  ILE A CG2  2  
ATOM 1959  C CD1  . ILE A 1 21  ? -0.438  6.497   -8.092  1.00 0.00 ? 21  ILE A CD1  2  
ATOM 1960  H H    . ILE A 1 21  ? 1.309   5.292   -11.208 1.00 0.00 ? 21  ILE A H    2  
ATOM 1961  H HA   . ILE A 1 21  ? 1.135   8.171   -11.718 1.00 0.00 ? 21  ILE A HA   2  
ATOM 1962  H HB   . ILE A 1 21  ? 1.922   6.840   -9.131  1.00 0.00 ? 21  ILE A HB   2  
ATOM 1963  H HG12 . ILE A 1 21  ? -0.823  7.926   -9.596  1.00 0.00 ? 21  ILE A HG12 2  
ATOM 1964  H HG13 . ILE A 1 21  ? -0.442  6.316   -10.197 1.00 0.00 ? 21  ILE A HG13 2  
ATOM 1965  H HG21 . ILE A 1 21  ? 0.657   9.534   -9.485  1.00 0.00 ? 21  ILE A HG21 2  
ATOM 1966  H HG22 . ILE A 1 21  ? 1.585   8.914   -8.121  1.00 0.00 ? 21  ILE A HG22 2  
ATOM 1967  H HG23 . ILE A 1 21  ? 2.400   9.313   -9.633  1.00 0.00 ? 21  ILE A HG23 2  
ATOM 1968  H HD11 . ILE A 1 21  ? -0.714  5.456   -8.181  1.00 0.00 ? 21  ILE A HD11 2  
ATOM 1969  H HD12 . ILE A 1 21  ? 0.455   6.583   -7.493  1.00 0.00 ? 21  ILE A HD12 2  
ATOM 1970  H HD13 . ILE A 1 21  ? -1.242  7.042   -7.620  1.00 0.00 ? 21  ILE A HD13 2  
ATOM 1971  N N    . GLU A 1 22  ? 3.548   8.749   -11.796 1.00 0.00 ? 22  GLU A N    2  
ATOM 1972  C CA   . GLU A 1 22  ? 4.961   9.054   -11.989 1.00 0.00 ? 22  GLU A CA   2  
ATOM 1973  C C    . GLU A 1 22  ? 5.291   10.451  -11.474 1.00 0.00 ? 22  GLU A C    2  
ATOM 1974  O O    . GLU A 1 22  ? 4.772   11.449  -11.974 1.00 0.00 ? 22  GLU A O    2  
ATOM 1975  C CB   . GLU A 1 22  ? 5.332   8.943   -13.469 1.00 0.00 ? 22  GLU A CB   2  
ATOM 1976  C CG   . GLU A 1 22  ? 5.166   7.542   -14.035 1.00 0.00 ? 22  GLU A CG   2  
ATOM 1977  C CD   . GLU A 1 22  ? 4.827   7.547   -15.513 1.00 0.00 ? 22  GLU A CD   2  
ATOM 1978  O OE1  . GLU A 1 22  ? 5.721   7.865   -16.325 1.00 0.00 ? 22  GLU A OE1  2  
ATOM 1979  O OE2  . GLU A 1 22  ? 3.669   7.233   -15.858 1.00 0.00 ? 22  GLU A OE2  2  
ATOM 1980  H H    . GLU A 1 22  ? 2.878   9.431   -12.011 1.00 0.00 ? 22  GLU A H    2  
ATOM 1981  H HA   . GLU A 1 22  ? 5.535   8.332   -11.428 1.00 0.00 ? 22  GLU A HA   2  
ATOM 1982  H HB2  . GLU A 1 22  ? 4.705   9.615   -14.036 1.00 0.00 ? 22  GLU A HB2  2  
ATOM 1983  H HB3  . GLU A 1 22  ? 6.364   9.237   -13.592 1.00 0.00 ? 22  GLU A HB3  2  
ATOM 1984  H HG2  . GLU A 1 22  ? 6.088   6.999   -13.895 1.00 0.00 ? 22  GLU A HG2  2  
ATOM 1985  H HG3  . GLU A 1 22  ? 4.371   7.044   -13.500 1.00 0.00 ? 22  GLU A HG3  2  
ATOM 1986  N N    . LYS A 1 23  ? 6.158   10.516  -10.469 1.00 0.00 ? 23  LYS A N    2  
ATOM 1987  C CA   . LYS A 1 23  ? 6.560   11.790  -9.885  1.00 0.00 ? 23  LYS A CA   2  
ATOM 1988  C C    . LYS A 1 23  ? 7.794   12.346  -10.589 1.00 0.00 ? 23  LYS A C    2  
ATOM 1989  O O    . LYS A 1 23  ? 8.529   11.611  -11.247 1.00 0.00 ? 23  LYS A O    2  
ATOM 1990  C CB   . LYS A 1 23  ? 6.845   11.622  -8.391  1.00 0.00 ? 23  LYS A CB   2  
ATOM 1991  C CG   . LYS A 1 23  ? 6.007   10.541  -7.729  1.00 0.00 ? 23  LYS A CG   2  
ATOM 1992  C CD   . LYS A 1 23  ? 5.750   10.853  -6.265  1.00 0.00 ? 23  LYS A CD   2  
ATOM 1993  C CE   . LYS A 1 23  ? 4.477   11.665  -6.082  1.00 0.00 ? 23  LYS A CE   2  
ATOM 1994  N NZ   . LYS A 1 23  ? 4.736   13.129  -6.165  1.00 0.00 ? 23  LYS A NZ   2  
ATOM 1995  H H    . LYS A 1 23  ? 6.539   9.685   -10.112 1.00 0.00 ? 23  LYS A H    2  
ATOM 1996  H HA   . LYS A 1 23  ? 5.744   12.485  -10.011 1.00 0.00 ? 23  LYS A HA   2  
ATOM 1997  H HB2  . LYS A 1 23  ? 7.887   11.369  -8.261  1.00 0.00 ? 23  LYS A HB2  2  
ATOM 1998  H HB3  . LYS A 1 23  ? 6.646   12.559  -7.891  1.00 0.00 ? 23  LYS A HB3  2  
ATOM 1999  H HG2  . LYS A 1 23  ? 5.059   10.469  -8.242  1.00 0.00 ? 23  LYS A HG2  2  
ATOM 2000  H HG3  . LYS A 1 23  ? 6.530   9.598   -7.801  1.00 0.00 ? 23  LYS A HG3  2  
ATOM 2001  H HD2  . LYS A 1 23  ? 5.654   9.926   -5.719  1.00 0.00 ? 23  LYS A HD2  2  
ATOM 2002  H HD3  . LYS A 1 23  ? 6.586   11.417  -5.874  1.00 0.00 ? 23  LYS A HD3  2  
ATOM 2003  H HE2  . LYS A 1 23  ? 3.776   11.388  -6.855  1.00 0.00 ? 23  LYS A HE2  2  
ATOM 2004  H HE3  . LYS A 1 23  ? 4.055   11.436  -5.115  1.00 0.00 ? 23  LYS A HE3  2  
ATOM 2005  H HZ1  . LYS A 1 23  ? 4.954   13.399  -7.146  1.00 0.00 ? 23  LYS A HZ1  2  
ATOM 2006  H HZ2  . LYS A 1 23  ? 5.543   13.384  -5.560  1.00 0.00 ? 23  LYS A HZ2  2  
ATOM 2007  H HZ3  . LYS A 1 23  ? 3.899   13.659  -5.848  1.00 0.00 ? 23  LYS A HZ3  2  
ATOM 2008  N N    . SER A 1 24  ? 8.014   13.649  -10.444 1.00 0.00 ? 24  SER A N    2  
ATOM 2009  C CA   . SER A 1 24  ? 9.158   14.304  -11.069 1.00 0.00 ? 24  SER A CA   2  
ATOM 2010  C C    . SER A 1 24  ? 10.438  14.025  -10.287 1.00 0.00 ? 24  SER A C    2  
ATOM 2011  O O    . SER A 1 24  ? 11.503  13.823  -10.870 1.00 0.00 ? 24  SER A O    2  
ATOM 2012  C CB   . SER A 1 24  ? 8.921   15.813  -11.159 1.00 0.00 ? 24  SER A CB   2  
ATOM 2013  O OG   . SER A 1 24  ? 7.829   16.108  -12.013 1.00 0.00 ? 24  SER A OG   2  
ATOM 2014  H H    . SER A 1 24  ? 7.392   14.182  -9.907  1.00 0.00 ? 24  SER A H    2  
ATOM 2015  H HA   . SER A 1 24  ? 9.265   13.905  -12.066 1.00 0.00 ? 24  SER A HA   2  
ATOM 2016  H HB2  . SER A 1 24  ? 8.707   16.201  -10.175 1.00 0.00 ? 24  SER A HB2  2  
ATOM 2017  H HB3  . SER A 1 24  ? 9.808   16.291  -11.550 1.00 0.00 ? 24  SER A HB3  2  
ATOM 2018  H HG   . SER A 1 24  ? 7.010   16.061  -11.514 1.00 0.00 ? 24  SER A HG   2  
ATOM 2019  N N    . ASP A 1 25  ? 10.324  14.016  -8.963  1.00 0.00 ? 25  ASP A N    2  
ATOM 2020  C CA   . ASP A 1 25  ? 11.471  13.761  -8.099  1.00 0.00 ? 25  ASP A CA   2  
ATOM 2021  C C    . ASP A 1 25  ? 11.035  13.092  -6.800  1.00 0.00 ? 25  ASP A C    2  
ATOM 2022  O O    . ASP A 1 25  ? 10.013  13.454  -6.215  1.00 0.00 ? 25  ASP A O    2  
ATOM 2023  C CB   . ASP A 1 25  ? 12.207  15.066  -7.794  1.00 0.00 ? 25  ASP A CB   2  
ATOM 2024  C CG   . ASP A 1 25  ? 12.907  15.636  -9.012  1.00 0.00 ? 25  ASP A CG   2  
ATOM 2025  O OD1  . ASP A 1 25  ? 13.986  15.120  -9.373  1.00 0.00 ? 25  ASP A OD1  2  
ATOM 2026  O OD2  . ASP A 1 25  ? 12.375  16.597  -9.606  1.00 0.00 ? 25  ASP A OD2  2  
ATOM 2027  H H    . ASP A 1 25  ? 9.448   14.185  -8.557  1.00 0.00 ? 25  ASP A H    2  
ATOM 2028  H HA   . ASP A 1 25  ? 12.140  13.096  -8.624  1.00 0.00 ? 25  ASP A HA   2  
ATOM 2029  H HB2  . ASP A 1 25  ? 11.497  15.797  -7.435  1.00 0.00 ? 25  ASP A HB2  2  
ATOM 2030  H HB3  . ASP A 1 25  ? 12.947  14.884  -7.028  1.00 0.00 ? 25  ASP A HB3  2  
ATOM 2031  N N    . THR A 1 26  ? 11.815  12.113  -6.352  1.00 0.00 ? 26  THR A N    2  
ATOM 2032  C CA   . THR A 1 26  ? 11.508  11.392  -5.123  1.00 0.00 ? 26  THR A CA   2  
ATOM 2033  C C    . THR A 1 26  ? 12.122  12.084  -3.912  1.00 0.00 ? 26  THR A C    2  
ATOM 2034  O O    . THR A 1 26  ? 11.757  11.800  -2.772  1.00 0.00 ? 26  THR A O    2  
ATOM 2035  C CB   . THR A 1 26  ? 12.016  9.939   -5.183  1.00 0.00 ? 26  THR A CB   2  
ATOM 2036  O OG1  . THR A 1 26  ? 13.374  9.913   -5.636  1.00 0.00 ? 26  THR A OG1  2  
ATOM 2037  C CG2  . THR A 1 26  ? 11.150  9.100   -6.110  1.00 0.00 ? 26  THR A CG2  2  
ATOM 2038  H H    . THR A 1 26  ? 12.615  11.870  -6.863  1.00 0.00 ? 26  THR A H    2  
ATOM 2039  H HA   . THR A 1 26  ? 10.434  11.371  -5.008  1.00 0.00 ? 26  THR A HA   2  
ATOM 2040  H HB   . THR A 1 26  ? 11.968  9.516   -4.189  1.00 0.00 ? 26  THR A HB   2  
ATOM 2041  H HG1  . THR A 1 26  ? 13.926  10.403  -5.021  1.00 0.00 ? 26  THR A HG1  2  
ATOM 2042  H HG21 . THR A 1 26  ? 10.206  8.891   -5.630  1.00 0.00 ? 26  THR A HG21 2  
ATOM 2043  H HG22 . THR A 1 26  ? 11.655  8.172   -6.333  1.00 0.00 ? 26  THR A HG22 2  
ATOM 2044  H HG23 . THR A 1 26  ? 10.975  9.643   -7.027  1.00 0.00 ? 26  THR A HG23 2  
ATOM 2045  N N    . ALA A 1 27  ? 13.056  12.995  -4.167  1.00 0.00 ? 27  ALA A N    2  
ATOM 2046  C CA   . ALA A 1 27  ? 13.719  13.730  -3.096  1.00 0.00 ? 27  ALA A CA   2  
ATOM 2047  C C    . ALA A 1 27  ? 12.741  14.654  -2.379  1.00 0.00 ? 27  ALA A C    2  
ATOM 2048  O O    . ALA A 1 27  ? 12.870  14.899  -1.180  1.00 0.00 ? 27  ALA A O    2  
ATOM 2049  C CB   . ALA A 1 27  ? 14.891  14.525  -3.650  1.00 0.00 ? 27  ALA A CB   2  
ATOM 2050  H H    . ALA A 1 27  ? 13.304  13.177  -5.097  1.00 0.00 ? 27  ALA A H    2  
ATOM 2051  H HA   . ALA A 1 27  ? 14.105  13.011  -2.388  1.00 0.00 ? 27  ALA A HA   2  
ATOM 2052  H HB1  . ALA A 1 27  ? 14.663  15.580  -3.605  1.00 0.00 ? 27  ALA A HB1  2  
ATOM 2053  H HB2  . ALA A 1 27  ? 15.774  14.323  -3.061  1.00 0.00 ? 27  ALA A HB2  2  
ATOM 2054  H HB3  . ALA A 1 27  ? 15.068  14.238  -4.676  1.00 0.00 ? 27  ALA A HB3  2  
ATOM 2055  N N    . ALA A 1 28  ? 11.765  15.166  -3.121  1.00 0.00 ? 28  ALA A N    2  
ATOM 2056  C CA   . ALA A 1 28  ? 10.765  16.063  -2.554  1.00 0.00 ? 28  ALA A CA   2  
ATOM 2057  C C    . ALA A 1 28  ? 9.353   15.584  -2.874  1.00 0.00 ? 28  ALA A C    2  
ATOM 2058  O O    . ALA A 1 28  ? 8.632   15.115  -1.994  1.00 0.00 ? 28  ALA A O    2  
ATOM 2059  C CB   . ALA A 1 28  ? 10.973  17.479  -3.070  1.00 0.00 ? 28  ALA A CB   2  
ATOM 2060  H H    . ALA A 1 28  ? 11.715  14.934  -4.071  1.00 0.00 ? 28  ALA A H    2  
ATOM 2061  H HA   . ALA A 1 28  ? 10.896  16.074  -1.482  1.00 0.00 ? 28  ALA A HA   2  
ATOM 2062  H HB1  . ALA A 1 28  ? 11.935  17.844  -2.739  1.00 0.00 ? 28  ALA A HB1  2  
ATOM 2063  H HB2  . ALA A 1 28  ? 10.941  17.477  -4.150  1.00 0.00 ? 28  ALA A HB2  2  
ATOM 2064  H HB3  . ALA A 1 28  ? 10.194  18.120  -2.687  1.00 0.00 ? 28  ALA A HB3  2  
ATOM 2065  N N    . ASP A 1 29  ? 8.965   15.705  -4.139  1.00 0.00 ? 29  ASP A N    2  
ATOM 2066  C CA   . ASP A 1 29  ? 7.639   15.284  -4.575  1.00 0.00 ? 29  ASP A CA   2  
ATOM 2067  C C    . ASP A 1 29  ? 7.399   13.814  -4.244  1.00 0.00 ? 29  ASP A C    2  
ATOM 2068  O O    . ASP A 1 29  ? 8.029   12.925  -4.819  1.00 0.00 ? 29  ASP A O    2  
ATOM 2069  C CB   . ASP A 1 29  ? 7.476   15.513  -6.079  1.00 0.00 ? 29  ASP A CB   2  
ATOM 2070  C CG   . ASP A 1 29  ? 7.244   16.972  -6.420  1.00 0.00 ? 29  ASP A CG   2  
ATOM 2071  O OD1  . ASP A 1 29  ? 6.510   17.648  -5.668  1.00 0.00 ? 29  ASP A OD1  2  
ATOM 2072  O OD2  . ASP A 1 29  ? 7.796   17.438  -7.438  1.00 0.00 ? 29  ASP A OD2  2  
ATOM 2073  H H    . ASP A 1 29  ? 9.585   16.087  -4.795  1.00 0.00 ? 29  ASP A H    2  
ATOM 2074  H HA   . ASP A 1 29  ? 6.911   15.882  -4.049  1.00 0.00 ? 29  ASP A HA   2  
ATOM 2075  H HB2  . ASP A 1 29  ? 8.372   15.183  -6.586  1.00 0.00 ? 29  ASP A HB2  2  
ATOM 2076  H HB3  . ASP A 1 29  ? 6.633   14.940  -6.435  1.00 0.00 ? 29  ASP A HB3  2  
ATOM 2077  N N    . THR A 1 30  ? 6.485   13.564  -3.311  1.00 0.00 ? 30  THR A N    2  
ATOM 2078  C CA   . THR A 1 30  ? 6.164   12.203  -2.901  1.00 0.00 ? 30  THR A CA   2  
ATOM 2079  C C    . THR A 1 30  ? 4.656   12.001  -2.799  1.00 0.00 ? 30  THR A C    2  
ATOM 2080  O O    . THR A 1 30  ? 3.907   12.952  -2.577  1.00 0.00 ? 30  THR A O    2  
ATOM 2081  C CB   . THR A 1 30  ? 6.810   11.857  -1.546  1.00 0.00 ? 30  THR A CB   2  
ATOM 2082  O OG1  . THR A 1 30  ? 6.621   10.468  -1.254  1.00 0.00 ? 30  THR A OG1  2  
ATOM 2083  C CG2  . THR A 1 30  ? 6.213   12.702  -0.431  1.00 0.00 ? 30  THR A CG2  2  
ATOM 2084  H H    . THR A 1 30  ? 6.017   14.315  -2.889  1.00 0.00 ? 30  THR A H    2  
ATOM 2085  H HA   . THR A 1 30  ? 6.558   11.528  -3.647  1.00 0.00 ? 30  THR A HA   2  
ATOM 2086  H HB   . THR A 1 30  ? 7.869   12.064  -1.607  1.00 0.00 ? 30  THR A HB   2  
ATOM 2087  H HG1  . THR A 1 30  ? 7.243   9.946   -1.766  1.00 0.00 ? 30  THR A HG1  2  
ATOM 2088  H HG21 . THR A 1 30  ? 6.375   12.212  0.518   1.00 0.00 ? 30  THR A HG21 2  
ATOM 2089  H HG22 . THR A 1 30  ? 5.152   12.821  -0.598  1.00 0.00 ? 30  THR A HG22 2  
ATOM 2090  H HG23 . THR A 1 30  ? 6.687   13.671  -0.421  1.00 0.00 ? 30  THR A HG23 2  
ATOM 2091  N N    . TYR A 1 31  ? 4.219   10.758  -2.962  1.00 0.00 ? 31  TYR A N    2  
ATOM 2092  C CA   . TYR A 1 31  ? 2.799   10.432  -2.889  1.00 0.00 ? 31  TYR A CA   2  
ATOM 2093  C C    . TYR A 1 31  ? 2.191   10.933  -1.583  1.00 0.00 ? 31  TYR A C    2  
ATOM 2094  O O    . TYR A 1 31  ? 2.864   11.576  -0.778  1.00 0.00 ? 31  TYR A O    2  
ATOM 2095  C CB   . TYR A 1 31  ? 2.595   8.921   -3.013  1.00 0.00 ? 31  TYR A CB   2  
ATOM 2096  C CG   . TYR A 1 31  ? 3.294   8.311   -4.207  1.00 0.00 ? 31  TYR A CG   2  
ATOM 2097  C CD1  . TYR A 1 31  ? 3.074   8.798   -5.489  1.00 0.00 ? 31  TYR A CD1  2  
ATOM 2098  C CD2  . TYR A 1 31  ? 4.175   7.248   -4.052  1.00 0.00 ? 31  TYR A CD2  2  
ATOM 2099  C CE1  . TYR A 1 31  ? 3.710   8.243   -6.583  1.00 0.00 ? 31  TYR A CE1  2  
ATOM 2100  C CE2  . TYR A 1 31  ? 4.817   6.688   -5.140  1.00 0.00 ? 31  TYR A CE2  2  
ATOM 2101  C CZ   . TYR A 1 31  ? 4.580   7.189   -6.403  1.00 0.00 ? 31  TYR A CZ   2  
ATOM 2102  O OH   . TYR A 1 31  ? 5.217   6.634   -7.490  1.00 0.00 ? 31  TYR A OH   2  
ATOM 2103  H H    . TYR A 1 31  ? 4.865   10.042  -3.136  1.00 0.00 ? 31  TYR A H    2  
ATOM 2104  H HA   . TYR A 1 31  ? 2.304   10.921  -3.715  1.00 0.00 ? 31  TYR A HA   2  
ATOM 2105  H HB2  . TYR A 1 31  ? 2.975   8.439   -2.125  1.00 0.00 ? 31  TYR A HB2  2  
ATOM 2106  H HB3  . TYR A 1 31  ? 1.539   8.714   -3.105  1.00 0.00 ? 31  TYR A HB3  2  
ATOM 2107  H HD1  . TYR A 1 31  ? 2.392   9.625   -5.626  1.00 0.00 ? 31  TYR A HD1  2  
ATOM 2108  H HD2  . TYR A 1 31  ? 4.358   6.858   -3.061  1.00 0.00 ? 31  TYR A HD2  2  
ATOM 2109  H HE1  . TYR A 1 31  ? 3.525   8.636   -7.572  1.00 0.00 ? 31  TYR A HE1  2  
ATOM 2110  H HE2  . TYR A 1 31  ? 5.498   5.862   -5.000  1.00 0.00 ? 31  TYR A HE2  2  
ATOM 2111  H HH   . TYR A 1 31  ? 5.727   5.872   -7.207  1.00 0.00 ? 31  TYR A HH   2  
ATOM 2112  N N    . GLY A 1 32  ? 0.912   10.633  -1.379  1.00 0.00 ? 32  GLY A N    2  
ATOM 2113  C CA   . GLY A 1 32  ? 0.233   11.059  -0.170  1.00 0.00 ? 32  GLY A CA   2  
ATOM 2114  C C    . GLY A 1 32  ? -0.998  10.227  0.129   1.00 0.00 ? 32  GLY A C    2  
ATOM 2115  O O    . GLY A 1 32  ? -1.909  10.679  0.823   1.00 0.00 ? 32  GLY A O    2  
ATOM 2116  H H    . GLY A 1 32  ? 0.425   10.117  -2.056  1.00 0.00 ? 32  GLY A H    2  
ATOM 2117  H HA2  . GLY A 1 32  ? 0.918   10.981  0.661   1.00 0.00 ? 32  GLY A HA2  2  
ATOM 2118  H HA3  . GLY A 1 32  ? -0.064  12.092  -0.282  1.00 0.00 ? 32  GLY A HA3  2  
ATOM 2119  N N    . PHE A 1 33  ? -1.028  9.007   -0.398  1.00 0.00 ? 33  PHE A N    2  
ATOM 2120  C CA   . PHE A 1 33  ? -2.158  8.110   -0.186  1.00 0.00 ? 33  PHE A CA   2  
ATOM 2121  C C    . PHE A 1 33  ? -1.720  6.847   0.549   1.00 0.00 ? 33  PHE A C    2  
ATOM 2122  O O    . PHE A 1 33  ? -0.747  6.198   0.164   1.00 0.00 ? 33  PHE A O    2  
ATOM 2123  C CB   . PHE A 1 33  ? -2.798  7.739   -1.525  1.00 0.00 ? 33  PHE A CB   2  
ATOM 2124  C CG   . PHE A 1 33  ? -1.990  6.757   -2.325  1.00 0.00 ? 33  PHE A CG   2  
ATOM 2125  C CD1  . PHE A 1 33  ? -0.805  7.146   -2.929  1.00 0.00 ? 33  PHE A CD1  2  
ATOM 2126  C CD2  . PHE A 1 33  ? -2.414  5.447   -2.472  1.00 0.00 ? 33  PHE A CD2  2  
ATOM 2127  C CE1  . PHE A 1 33  ? -0.059  6.245   -3.665  1.00 0.00 ? 33  PHE A CE1  2  
ATOM 2128  C CE2  . PHE A 1 33  ? -1.673  4.541   -3.207  1.00 0.00 ? 33  PHE A CE2  2  
ATOM 2129  C CZ   . PHE A 1 33  ? -0.493  4.941   -3.804  1.00 0.00 ? 33  PHE A CZ   2  
ATOM 2130  H H    . PHE A 1 33  ? -0.271  8.703   -0.942  1.00 0.00 ? 33  PHE A H    2  
ATOM 2131  H HA   . PHE A 1 33  ? -2.884  8.631   0.418   1.00 0.00 ? 33  PHE A HA   2  
ATOM 2132  H HB2  . PHE A 1 33  ? -3.767  7.298   -1.343  1.00 0.00 ? 33  PHE A HB2  2  
ATOM 2133  H HB3  . PHE A 1 33  ? -2.919  8.632   -2.118  1.00 0.00 ? 33  PHE A HB3  2  
ATOM 2134  H HD1  . PHE A 1 33  ? -0.463  8.165   -2.820  1.00 0.00 ? 33  PHE A HD1  2  
ATOM 2135  H HD2  . PHE A 1 33  ? -3.337  5.133   -2.005  1.00 0.00 ? 33  PHE A HD2  2  
ATOM 2136  H HE1  . PHE A 1 33  ? 0.863   6.560   -4.131  1.00 0.00 ? 33  PHE A HE1  2  
ATOM 2137  H HE2  . PHE A 1 33  ? -2.015  3.523   -3.313  1.00 0.00 ? 33  PHE A HE2  2  
ATOM 2138  H HZ   . PHE A 1 33  ? 0.088   4.235   -4.379  1.00 0.00 ? 33  PHE A HZ   2  
ATOM 2139  N N    . SER A 1 34  ? -2.444  6.506   1.610   1.00 0.00 ? 34  SER A N    2  
ATOM 2140  C CA   . SER A 1 34  ? -2.128  5.323   2.402   1.00 0.00 ? 34  SER A CA   2  
ATOM 2141  C C    . SER A 1 34  ? -3.008  4.145   1.995   1.00 0.00 ? 34  SER A C    2  
ATOM 2142  O O    . SER A 1 34  ? -3.889  4.278   1.144   1.00 0.00 ? 34  SER A O    2  
ATOM 2143  C CB   . SER A 1 34  ? -2.309  5.619   3.892   1.00 0.00 ? 34  SER A CB   2  
ATOM 2144  O OG   . SER A 1 34  ? -1.222  6.373   4.399   1.00 0.00 ? 34  SER A OG   2  
ATOM 2145  H H    . SER A 1 34  ? -3.208  7.064   1.867   1.00 0.00 ? 34  SER A H    2  
ATOM 2146  H HA   . SER A 1 34  ? -1.096  5.067   2.218   1.00 0.00 ? 34  SER A HA   2  
ATOM 2147  H HB2  . SER A 1 34  ? -3.219  6.181   4.037   1.00 0.00 ? 34  SER A HB2  2  
ATOM 2148  H HB3  . SER A 1 34  ? -2.371  4.687   4.437   1.00 0.00 ? 34  SER A HB3  2  
ATOM 2149  H HG   . SER A 1 34  ? -0.419  6.132   3.930   1.00 0.00 ? 34  SER A HG   2  
ATOM 2150  N N    . LEU A 1 35  ? -2.764  2.993   2.609   1.00 0.00 ? 35  LEU A N    2  
ATOM 2151  C CA   . LEU A 1 35  ? -3.534  1.790   2.311   1.00 0.00 ? 35  LEU A CA   2  
ATOM 2152  C C    . LEU A 1 35  ? -3.901  1.048   3.593   1.00 0.00 ? 35  LEU A C    2  
ATOM 2153  O O    . LEU A 1 35  ? -3.152  1.067   4.569   1.00 0.00 ? 35  LEU A O    2  
ATOM 2154  C CB   . LEU A 1 35  ? -2.739  0.868   1.385   1.00 0.00 ? 35  LEU A CB   2  
ATOM 2155  C CG   . LEU A 1 35  ? -2.638  1.309   -0.076  1.00 0.00 ? 35  LEU A CG   2  
ATOM 2156  C CD1  . LEU A 1 35  ? -1.482  0.604   -0.768  1.00 0.00 ? 35  LEU A CD1  2  
ATOM 2157  C CD2  . LEU A 1 35  ? -3.945  1.037   -0.806  1.00 0.00 ? 35  LEU A CD2  2  
ATOM 2158  H H    . LEU A 1 35  ? -2.050  2.949   3.277   1.00 0.00 ? 35  LEU A H    2  
ATOM 2159  H HA   . LEU A 1 35  ? -4.442  2.092   1.812   1.00 0.00 ? 35  LEU A HA   2  
ATOM 2160  H HB2  . LEU A 1 35  ? -1.736  0.790   1.777   1.00 0.00 ? 35  LEU A HB2  2  
ATOM 2161  H HB3  . LEU A 1 35  ? -3.208  -0.106  1.406   1.00 0.00 ? 35  LEU A HB3  2  
ATOM 2162  H HG   . LEU A 1 35  ? -2.449  2.373   -0.112  1.00 0.00 ? 35  LEU A HG   2  
ATOM 2163  H HD11 . LEU A 1 35  ? -1.538  0.779   -1.831  1.00 0.00 ? 35  LEU A HD11 2  
ATOM 2164  H HD12 . LEU A 1 35  ? -1.540  -0.457  -0.574  1.00 0.00 ? 35  LEU A HD12 2  
ATOM 2165  H HD13 . LEU A 1 35  ? -0.546  0.988   -0.387  1.00 0.00 ? 35  LEU A HD13 2  
ATOM 2166  H HD21 . LEU A 1 35  ? -3.937  0.029   -1.194  1.00 0.00 ? 35  LEU A HD21 2  
ATOM 2167  H HD22 . LEU A 1 35  ? -4.052  1.736   -1.623  1.00 0.00 ? 35  LEU A HD22 2  
ATOM 2168  H HD23 . LEU A 1 35  ? -4.771  1.153   -0.121  1.00 0.00 ? 35  LEU A HD23 2  
ATOM 2169  N N    . SER A 1 36  ? -5.058  0.394   3.580   1.00 0.00 ? 36  SER A N    2  
ATOM 2170  C CA   . SER A 1 36  ? -5.526  -0.354  4.742   1.00 0.00 ? 36  SER A CA   2  
ATOM 2171  C C    . SER A 1 36  ? -5.608  -1.845  4.431   1.00 0.00 ? 36  SER A C    2  
ATOM 2172  O O    . SER A 1 36  ? -6.007  -2.241  3.336   1.00 0.00 ? 36  SER A O    2  
ATOM 2173  C CB   . SER A 1 36  ? -6.895  0.162   5.189   1.00 0.00 ? 36  SER A CB   2  
ATOM 2174  O OG   . SER A 1 36  ? -7.487  -0.715  6.132   1.00 0.00 ? 36  SER A OG   2  
ATOM 2175  H H    . SER A 1 36  ? -5.611  0.416   2.772   1.00 0.00 ? 36  SER A H    2  
ATOM 2176  H HA   . SER A 1 36  ? -4.816  -0.203  5.541   1.00 0.00 ? 36  SER A HA   2  
ATOM 2177  H HB2  . SER A 1 36  ? -6.780  1.135   5.643   1.00 0.00 ? 36  SER A HB2  2  
ATOM 2178  H HB3  . SER A 1 36  ? -7.545  0.240   4.330   1.00 0.00 ? 36  SER A HB3  2  
ATOM 2179  H HG   . SER A 1 36  ? -7.029  -0.638  6.972   1.00 0.00 ? 36  SER A HG   2  
ATOM 2180  N N    . SER A 1 37  ? -5.228  -2.668  5.404   1.00 0.00 ? 37  SER A N    2  
ATOM 2181  C CA   . SER A 1 37  ? -5.255  -4.116  5.234   1.00 0.00 ? 37  SER A CA   2  
ATOM 2182  C C    . SER A 1 37  ? -6.462  -4.723  5.942   1.00 0.00 ? 37  SER A C    2  
ATOM 2183  O O    . SER A 1 37  ? -6.596  -4.624  7.161   1.00 0.00 ? 37  SER A O    2  
ATOM 2184  C CB   . SER A 1 37  ? -3.966  -4.737  5.775   1.00 0.00 ? 37  SER A CB   2  
ATOM 2185  O OG   . SER A 1 37  ? -3.657  -4.232  7.063   1.00 0.00 ? 37  SER A OG   2  
ATOM 2186  H H    . SER A 1 37  ? -4.920  -2.291  6.255   1.00 0.00 ? 37  SER A H    2  
ATOM 2187  H HA   . SER A 1 37  ? -5.329  -4.324  4.177   1.00 0.00 ? 37  SER A HA   2  
ATOM 2188  H HB2  . SER A 1 37  ? -4.085  -5.808  5.841   1.00 0.00 ? 37  SER A HB2  2  
ATOM 2189  H HB3  . SER A 1 37  ? -3.150  -4.507  5.106   1.00 0.00 ? 37  SER A HB3  2  
ATOM 2190  H HG   . SER A 1 37  ? -4.462  -3.928  7.489   1.00 0.00 ? 37  SER A HG   2  
ATOM 2191  N N    . VAL A 1 38  ? -7.339  -5.354  5.167   1.00 0.00 ? 38  VAL A N    2  
ATOM 2192  C CA   . VAL A 1 38  ? -8.535  -5.979  5.718   1.00 0.00 ? 38  VAL A CA   2  
ATOM 2193  C C    . VAL A 1 38  ? -8.639  -7.439  5.290   1.00 0.00 ? 38  VAL A C    2  
ATOM 2194  O O    . VAL A 1 38  ? -8.123  -7.826  4.242   1.00 0.00 ? 38  VAL A O    2  
ATOM 2195  C CB   . VAL A 1 38  ? -9.810  -5.235  5.279   1.00 0.00 ? 38  VAL A CB   2  
ATOM 2196  C CG1  . VAL A 1 38  ? -11.049 -5.940  5.810   1.00 0.00 ? 38  VAL A CG1  2  
ATOM 2197  C CG2  . VAL A 1 38  ? -9.769  -3.788  5.745   1.00 0.00 ? 38  VAL A CG2  2  
ATOM 2198  H H    . VAL A 1 38  ? -7.177  -5.400  4.201   1.00 0.00 ? 38  VAL A H    2  
ATOM 2199  H HA   . VAL A 1 38  ? -8.469  -5.934  6.795   1.00 0.00 ? 38  VAL A HA   2  
ATOM 2200  H HB   . VAL A 1 38  ? -9.854  -5.243  4.200   1.00 0.00 ? 38  VAL A HB   2  
ATOM 2201  H HG11 . VAL A 1 38  ? -10.936 -6.117  6.870   1.00 0.00 ? 38  VAL A HG11 2  
ATOM 2202  H HG12 . VAL A 1 38  ? -11.917 -5.321  5.639   1.00 0.00 ? 38  VAL A HG12 2  
ATOM 2203  H HG13 . VAL A 1 38  ? -11.173 -6.884  5.300   1.00 0.00 ? 38  VAL A HG13 2  
ATOM 2204  H HG21 . VAL A 1 38  ? -9.448  -3.157  4.930   1.00 0.00 ? 38  VAL A HG21 2  
ATOM 2205  H HG22 . VAL A 1 38  ? -10.754 -3.485  6.068   1.00 0.00 ? 38  VAL A HG22 2  
ATOM 2206  H HG23 . VAL A 1 38  ? -9.076  -3.694  6.568   1.00 0.00 ? 38  VAL A HG23 2  
ATOM 2207  N N    . GLU A 1 39  ? -9.309  -8.244  6.108   1.00 0.00 ? 39  GLU A N    2  
ATOM 2208  C CA   . GLU A 1 39  ? -9.481  -9.662  5.813   1.00 0.00 ? 39  GLU A CA   2  
ATOM 2209  C C    . GLU A 1 39  ? -10.960 -10.025 5.726   1.00 0.00 ? 39  GLU A C    2  
ATOM 2210  O O    . GLU A 1 39  ? -11.672 -10.014 6.730   1.00 0.00 ? 39  GLU A O    2  
ATOM 2211  C CB   . GLU A 1 39  ? -8.797  -10.514 6.885   1.00 0.00 ? 39  GLU A CB   2  
ATOM 2212  C CG   . GLU A 1 39  ? -8.300  -11.855 6.370   1.00 0.00 ? 39  GLU A CG   2  
ATOM 2213  C CD   . GLU A 1 39  ? -8.270  -12.919 7.450   1.00 0.00 ? 39  GLU A CD   2  
ATOM 2214  O OE1  . GLU A 1 39  ? -9.356  -13.331 7.908   1.00 0.00 ? 39  GLU A OE1  2  
ATOM 2215  O OE2  . GLU A 1 39  ? -7.160  -13.339 7.837   1.00 0.00 ? 39  GLU A OE2  2  
ATOM 2216  H H    . GLU A 1 39  ? -9.698  -7.876  6.929   1.00 0.00 ? 39  GLU A H    2  
ATOM 2217  H HA   . GLU A 1 39  ? -9.017  -9.860  4.859   1.00 0.00 ? 39  GLU A HA   2  
ATOM 2218  H HB2  . GLU A 1 39  ? -7.953  -9.967  7.279   1.00 0.00 ? 39  GLU A HB2  2  
ATOM 2219  H HB3  . GLU A 1 39  ? -9.500  -10.697 7.684   1.00 0.00 ? 39  GLU A HB3  2  
ATOM 2220  H HG2  . GLU A 1 39  ? -8.954  -12.187 5.578   1.00 0.00 ? 39  GLU A HG2  2  
ATOM 2221  H HG3  . GLU A 1 39  ? -7.301  -11.729 5.982   1.00 0.00 ? 39  GLU A HG3  2  
ATOM 2222  N N    . GLU A 1 40  ? -11.415 -10.345 4.519   1.00 0.00 ? 40  GLU A N    2  
ATOM 2223  C CA   . GLU A 1 40  ? -12.810 -10.710 4.301   1.00 0.00 ? 40  GLU A CA   2  
ATOM 2224  C C    . GLU A 1 40  ? -12.949 -12.211 4.066   1.00 0.00 ? 40  GLU A C    2  
ATOM 2225  O O    . GLU A 1 40  ? -12.723 -12.701 2.959   1.00 0.00 ? 40  GLU A O    2  
ATOM 2226  C CB   . GLU A 1 40  ? -13.380 -9.941  3.107   1.00 0.00 ? 40  GLU A CB   2  
ATOM 2227  C CG   . GLU A 1 40  ? -12.951 -8.484  3.060   1.00 0.00 ? 40  GLU A CG   2  
ATOM 2228  C CD   . GLU A 1 40  ? -11.657 -8.281  2.296   1.00 0.00 ? 40  GLU A CD   2  
ATOM 2229  O OE1  . GLU A 1 40  ? -11.261 -9.196  1.545   1.00 0.00 ? 40  GLU A OE1  2  
ATOM 2230  O OE2  . GLU A 1 40  ? -11.041 -7.205  2.449   1.00 0.00 ? 40  GLU A OE2  2  
ATOM 2231  H H    . GLU A 1 40  ? -10.798 -10.335 3.757   1.00 0.00 ? 40  GLU A H    2  
ATOM 2232  H HA   . GLU A 1 40  ? -13.365 -10.443 5.187   1.00 0.00 ? 40  GLU A HA   2  
ATOM 2233  H HB2  . GLU A 1 40  ? -13.054 -10.421 2.196   1.00 0.00 ? 40  GLU A HB2  2  
ATOM 2234  H HB3  . GLU A 1 40  ? -14.459 -9.975  3.155   1.00 0.00 ? 40  GLU A HB3  2  
ATOM 2235  H HG2  . GLU A 1 40  ? -13.729 -7.908  2.581   1.00 0.00 ? 40  GLU A HG2  2  
ATOM 2236  H HG3  . GLU A 1 40  ? -12.814 -8.130  4.071   1.00 0.00 ? 40  GLU A HG3  2  
ATOM 2237  N N    . ASP A 1 41  ? -13.322 -12.936 5.115   1.00 0.00 ? 41  ASP A N    2  
ATOM 2238  C CA   . ASP A 1 41  ? -13.493 -14.381 5.024   1.00 0.00 ? 41  ASP A CA   2  
ATOM 2239  C C    . ASP A 1 41  ? -12.171 -15.064 4.685   1.00 0.00 ? 41  ASP A C    2  
ATOM 2240  O O    . ASP A 1 41  ? -12.132 -16.004 3.892   1.00 0.00 ? 41  ASP A O    2  
ATOM 2241  C CB   . ASP A 1 41  ? -14.545 -14.727 3.970   1.00 0.00 ? 41  ASP A CB   2  
ATOM 2242  C CG   . ASP A 1 41  ? -15.184 -16.080 4.212   1.00 0.00 ? 41  ASP A CG   2  
ATOM 2243  O OD1  . ASP A 1 41  ? -14.449 -17.089 4.223   1.00 0.00 ? 41  ASP A OD1  2  
ATOM 2244  O OD2  . ASP A 1 41  ? -16.419 -16.131 4.390   1.00 0.00 ? 41  ASP A OD2  2  
ATOM 2245  H H    . ASP A 1 41  ? -13.488 -12.487 5.971   1.00 0.00 ? 41  ASP A H    2  
ATOM 2246  H HA   . ASP A 1 41  ? -13.830 -14.736 5.986   1.00 0.00 ? 41  ASP A HA   2  
ATOM 2247  H HB2  . ASP A 1 41  ? -15.322 -13.976 3.986   1.00 0.00 ? 41  ASP A HB2  2  
ATOM 2248  H HB3  . ASP A 1 41  ? -14.080 -14.737 2.996   1.00 0.00 ? 41  ASP A HB3  2  
ATOM 2249  N N    . GLY A 1 42  ? -11.089 -14.583 5.290   1.00 0.00 ? 42  GLY A N    2  
ATOM 2250  C CA   . GLY A 1 42  ? -9.781  -15.157 5.037   1.00 0.00 ? 42  GLY A CA   2  
ATOM 2251  C C    . GLY A 1 42  ? -9.054  -14.468 3.899   1.00 0.00 ? 42  GLY A C    2  
ATOM 2252  O O    . GLY A 1 42  ? -7.824  -14.479 3.843   1.00 0.00 ? 42  GLY A O    2  
ATOM 2253  H H    . GLY A 1 42  ? -11.181 -13.831 5.912   1.00 0.00 ? 42  GLY A H    2  
ATOM 2254  H HA2  . GLY A 1 42  ? -9.185  -15.075 5.934   1.00 0.00 ? 42  GLY A HA2  2  
ATOM 2255  H HA3  . GLY A 1 42  ? -9.901  -16.202 4.791   1.00 0.00 ? 42  GLY A HA3  2  
ATOM 2256  N N    . ILE A 1 43  ? -9.816  -13.869 2.990   1.00 0.00 ? 43  ILE A N    2  
ATOM 2257  C CA   . ILE A 1 43  ? -9.237  -13.172 1.848   1.00 0.00 ? 43  ILE A CA   2  
ATOM 2258  C C    . ILE A 1 43  ? -8.799  -11.762 2.229   1.00 0.00 ? 43  ILE A C    2  
ATOM 2259  O O    . ILE A 1 43  ? -9.630  -10.876 2.431   1.00 0.00 ? 43  ILE A O    2  
ATOM 2260  C CB   . ILE A 1 43  ? -10.231 -13.090 0.675   1.00 0.00 ? 43  ILE A CB   2  
ATOM 2261  C CG1  . ILE A 1 43  ? -10.766 -14.482 0.334   1.00 0.00 ? 43  ILE A CG1  2  
ATOM 2262  C CG2  . ILE A 1 43  ? -9.566  -12.459 -0.539  1.00 0.00 ? 43  ILE A CG2  2  
ATOM 2263  C CD1  . ILE A 1 43  ? -12.163 -14.467 -0.247  1.00 0.00 ? 43  ILE A CD1  2  
ATOM 2264  H H    . ILE A 1 43  ? -10.790 -13.895 3.090   1.00 0.00 ? 43  ILE A H    2  
ATOM 2265  H HA   . ILE A 1 43  ? -8.371  -13.730 1.522   1.00 0.00 ? 43  ILE A HA   2  
ATOM 2266  H HB   . ILE A 1 43  ? -11.054 -12.459 0.974   1.00 0.00 ? 43  ILE A HB   2  
ATOM 2267  H HG12 . ILE A 1 43  ? -10.113 -14.945 -0.389  1.00 0.00 ? 43  ILE A HG12 2  
ATOM 2268  H HG13 . ILE A 1 43  ? -10.786 -15.082 1.232   1.00 0.00 ? 43  ILE A HG13 2  
ATOM 2269  H HG21 . ILE A 1 43  ? -9.542  -13.175 -1.348  1.00 0.00 ? 43  ILE A HG21 2  
ATOM 2270  H HG22 . ILE A 1 43  ? -10.128 -11.590 -0.846  1.00 0.00 ? 43  ILE A HG22 2  
ATOM 2271  H HG23 . ILE A 1 43  ? -8.558  -12.167 -0.287  1.00 0.00 ? 43  ILE A HG23 2  
ATOM 2272  H HD11 . ILE A 1 43  ? -12.798 -15.129 0.323   1.00 0.00 ? 43  ILE A HD11 2  
ATOM 2273  H HD12 . ILE A 1 43  ? -12.559 -13.463 -0.206  1.00 0.00 ? 43  ILE A HD12 2  
ATOM 2274  H HD13 . ILE A 1 43  ? -12.129 -14.798 -1.275  1.00 0.00 ? 43  ILE A HD13 2  
ATOM 2275  N N    . ARG A 1 44  ? -7.489  -11.560 2.323   1.00 0.00 ? 44  ARG A N    2  
ATOM 2276  C CA   . ARG A 1 44  ? -6.940  -10.256 2.679   1.00 0.00 ? 44  ARG A CA   2  
ATOM 2277  C C    . ARG A 1 44  ? -6.849  -9.352  1.453   1.00 0.00 ? 44  ARG A C    2  
ATOM 2278  O O    . ARG A 1 44  ? -6.328  -9.752  0.412   1.00 0.00 ? 44  ARG A O    2  
ATOM 2279  C CB   . ARG A 1 44  ? -5.557  -10.417 3.312   1.00 0.00 ? 44  ARG A CB   2  
ATOM 2280  C CG   . ARG A 1 44  ? -5.030  -9.144  3.954   1.00 0.00 ? 44  ARG A CG   2  
ATOM 2281  C CD   . ARG A 1 44  ? -4.285  -8.280  2.948   1.00 0.00 ? 44  ARG A CD   2  
ATOM 2282  N NE   . ARG A 1 44  ? -3.324  -7.392  3.596   1.00 0.00 ? 44  ARG A NE   2  
ATOM 2283  C CZ   . ARG A 1 44  ? -2.152  -7.799  4.072   1.00 0.00 ? 44  ARG A CZ   2  
ATOM 2284  N NH1  . ARG A 1 44  ? -1.799  -9.073  3.974   1.00 0.00 ? 44  ARG A NH1  2  
ATOM 2285  N NH2  . ARG A 1 44  ? -1.331  -6.930  4.648   1.00 0.00 ? 44  ARG A NH2  2  
ATOM 2286  H H    . ARG A 1 44  ? -6.876  -12.305 2.150   1.00 0.00 ? 44  ARG A H    2  
ATOM 2287  H HA   . ARG A 1 44  ? -7.605  -9.802  3.398   1.00 0.00 ? 44  ARG A HA   2  
ATOM 2288  H HB2  . ARG A 1 44  ? -5.608  -11.183 4.072   1.00 0.00 ? 44  ARG A HB2  2  
ATOM 2289  H HB3  . ARG A 1 44  ? -4.859  -10.725 2.548   1.00 0.00 ? 44  ARG A HB3  2  
ATOM 2290  H HG2  . ARG A 1 44  ? -5.861  -8.581  4.350   1.00 0.00 ? 44  ARG A HG2  2  
ATOM 2291  H HG3  . ARG A 1 44  ? -4.357  -9.409  4.756   1.00 0.00 ? 44  ARG A HG3  2  
ATOM 2292  H HD2  . ARG A 1 44  ? -3.758  -8.924  2.260   1.00 0.00 ? 44  ARG A HD2  2  
ATOM 2293  H HD3  . ARG A 1 44  ? -5.003  -7.684  2.405   1.00 0.00 ? 44  ARG A HD3  2  
ATOM 2294  H HE   . ARG A 1 44  ? -3.564  -6.446  3.679   1.00 0.00 ? 44  ARG A HE   2  
ATOM 2295  H HH11 . ARG A 1 44  ? -2.416  -9.729  3.539   1.00 0.00 ? 44  ARG A HH11 2  
ATOM 2296  H HH12 . ARG A 1 44  ? -0.916  -9.376  4.332   1.00 0.00 ? 44  ARG A HH12 2  
ATOM 2297  H HH21 . ARG A 1 44  ? -1.594  -5.968  4.724   1.00 0.00 ? 44  ARG A HH21 2  
ATOM 2298  H HH22 . ARG A 1 44  ? -0.450  -7.237  5.007   1.00 0.00 ? 44  ARG A HH22 2  
ATOM 2299  N N    . ARG A 1 45  ? -7.359  -8.132  1.585   1.00 0.00 ? 45  ARG A N    2  
ATOM 2300  C CA   . ARG A 1 45  ? -7.337  -7.172  0.488   1.00 0.00 ? 45  ARG A CA   2  
ATOM 2301  C C    . ARG A 1 45  ? -6.887  -5.799  0.977   1.00 0.00 ? 45  ARG A C    2  
ATOM 2302  O O    . ARG A 1 45  ? -6.851  -5.537  2.180   1.00 0.00 ? 45  ARG A O    2  
ATOM 2303  C CB   . ARG A 1 45  ? -8.721  -7.068  -0.156  1.00 0.00 ? 45  ARG A CB   2  
ATOM 2304  C CG   . ARG A 1 45  ? -9.203  -8.368  -0.778  1.00 0.00 ? 45  ARG A CG   2  
ATOM 2305  C CD   . ARG A 1 45  ? -10.147 -8.112  -1.942  1.00 0.00 ? 45  ARG A CD   2  
ATOM 2306  N NE   . ARG A 1 45  ? -11.073 -9.223  -2.150  1.00 0.00 ? 45  ARG A NE   2  
ATOM 2307  C CZ   . ARG A 1 45  ? -12.065 -9.197  -3.033  1.00 0.00 ? 45  ARG A CZ   2  
ATOM 2308  N NH1  . ARG A 1 45  ? -12.260 -8.123  -3.785  1.00 0.00 ? 45  ARG A NH1  2  
ATOM 2309  N NH2  . ARG A 1 45  ? -12.865 -10.247 -3.164  1.00 0.00 ? 45  ARG A NH2  2  
ATOM 2310  H H    . ARG A 1 45  ? -7.761  -7.872  2.440   1.00 0.00 ? 45  ARG A H    2  
ATOM 2311  H HA   . ARG A 1 45  ? -6.633  -7.527  -0.250  1.00 0.00 ? 45  ARG A HA   2  
ATOM 2312  H HB2  . ARG A 1 45  ? -9.435  -6.770  0.599   1.00 0.00 ? 45  ARG A HB2  2  
ATOM 2313  H HB3  . ARG A 1 45  ? -8.690  -6.314  -0.928  1.00 0.00 ? 45  ARG A HB3  2  
ATOM 2314  H HG2  . ARG A 1 45  ? -8.348  -8.922  -1.138  1.00 0.00 ? 45  ARG A HG2  2  
ATOM 2315  H HG3  . ARG A 1 45  ? -9.719  -8.947  -0.027  1.00 0.00 ? 45  ARG A HG3  2  
ATOM 2316  H HD2  . ARG A 1 45  ? -10.715 -7.217  -1.737  1.00 0.00 ? 45  ARG A HD2  2  
ATOM 2317  H HD3  . ARG A 1 45  ? -9.562  -7.970  -2.838  1.00 0.00 ? 45  ARG A HD3  2  
ATOM 2318  H HE   . ARG A 1 45  ? -10.947 -10.027 -1.605  1.00 0.00 ? 45  ARG A HE   2  
ATOM 2319  H HH11 . ARG A 1 45  ? -11.658 -7.330  -3.689  1.00 0.00 ? 45  ARG A HH11 2  
ATOM 2320  H HH12 . ARG A 1 45  ? -13.007 -8.106  -4.450  1.00 0.00 ? 45  ARG A HH12 2  
ATOM 2321  H HH21 . ARG A 1 45  ? -12.721 -11.059 -2.599  1.00 0.00 ? 45  ARG A HH21 2  
ATOM 2322  H HH22 . ARG A 1 45  ? -13.612 -10.227 -3.828  1.00 0.00 ? 45  ARG A HH22 2  
ATOM 2323  N N    . LEU A 1 46  ? -6.544  -4.925  0.036   1.00 0.00 ? 46  LEU A N    2  
ATOM 2324  C CA   . LEU A 1 46  ? -6.095  -3.578  0.371   1.00 0.00 ? 46  LEU A CA   2  
ATOM 2325  C C    . LEU A 1 46  ? -7.113  -2.537  -0.083  1.00 0.00 ? 46  LEU A C    2  
ATOM 2326  O O    . LEU A 1 46  ? -7.889  -2.774  -1.010  1.00 0.00 ? 46  LEU A O    2  
ATOM 2327  C CB   . LEU A 1 46  ? -4.738  -3.296  -0.275  1.00 0.00 ? 46  LEU A CB   2  
ATOM 2328  C CG   . LEU A 1 46  ? -3.532  -3.980  0.370   1.00 0.00 ? 46  LEU A CG   2  
ATOM 2329  C CD1  . LEU A 1 46  ? -3.381  -3.539  1.818   1.00 0.00 ? 46  LEU A CD1  2  
ATOM 2330  C CD2  . LEU A 1 46  ? -3.667  -5.493  0.282   1.00 0.00 ? 46  LEU A CD2  2  
ATOM 2331  H H    . LEU A 1 46  ? -6.593  -5.191  -0.905  1.00 0.00 ? 46  LEU A H    2  
ATOM 2332  H HA   . LEU A 1 46  ? -5.993  -3.520  1.444   1.00 0.00 ? 46  LEU A HA   2  
ATOM 2333  H HB2  . LEU A 1 46  ? -4.788  -3.618  -1.304  1.00 0.00 ? 46  LEU A HB2  2  
ATOM 2334  H HB3  . LEU A 1 46  ? -4.572  -2.228  -0.242  1.00 0.00 ? 46  LEU A HB3  2  
ATOM 2335  H HG   . LEU A 1 46  ? -2.635  -3.691  -0.161  1.00 0.00 ? 46  LEU A HG   2  
ATOM 2336  H HD11 . LEU A 1 46  ? -2.387  -3.778  2.165   1.00 0.00 ? 46  LEU A HD11 2  
ATOM 2337  H HD12 . LEU A 1 46  ? -4.109  -4.053  2.428   1.00 0.00 ? 46  LEU A HD12 2  
ATOM 2338  H HD13 . LEU A 1 46  ? -3.541  -2.473  1.889   1.00 0.00 ? 46  LEU A HD13 2  
ATOM 2339  H HD21 . LEU A 1 46  ? -4.458  -5.744  -0.409  1.00 0.00 ? 46  LEU A HD21 2  
ATOM 2340  H HD22 . LEU A 1 46  ? -3.903  -5.890  1.259   1.00 0.00 ? 46  LEU A HD22 2  
ATOM 2341  H HD23 . LEU A 1 46  ? -2.737  -5.917  -0.065  1.00 0.00 ? 46  LEU A HD23 2  
ATOM 2342  N N    . TYR A 1 47  ? -7.104  -1.382  0.573   1.00 0.00 ? 47  TYR A N    2  
ATOM 2343  C CA   . TYR A 1 47  ? -8.026  -0.304  0.238   1.00 0.00 ? 47  TYR A CA   2  
ATOM 2344  C C    . TYR A 1 47  ? -7.398  1.058   0.518   1.00 0.00 ? 47  TYR A C    2  
ATOM 2345  O O    . TYR A 1 47  ? -6.647  1.222   1.479   1.00 0.00 ? 47  TYR A O    2  
ATOM 2346  C CB   . TYR A 1 47  ? -9.326  -0.452  1.030   1.00 0.00 ? 47  TYR A CB   2  
ATOM 2347  C CG   . TYR A 1 47  ? -10.046 -1.757  0.775   1.00 0.00 ? 47  TYR A CG   2  
ATOM 2348  C CD1  . TYR A 1 47  ? -10.936 -1.886  -0.284  1.00 0.00 ? 47  TYR A CD1  2  
ATOM 2349  C CD2  . TYR A 1 47  ? -9.836  -2.860  1.593   1.00 0.00 ? 47  TYR A CD2  2  
ATOM 2350  C CE1  . TYR A 1 47  ? -11.597 -3.076  -0.520  1.00 0.00 ? 47  TYR A CE1  2  
ATOM 2351  C CE2  . TYR A 1 47  ? -10.491 -4.055  1.364   1.00 0.00 ? 47  TYR A CE2  2  
ATOM 2352  C CZ   . TYR A 1 47  ? -11.371 -4.158  0.306   1.00 0.00 ? 47  TYR A CZ   2  
ATOM 2353  O OH   . TYR A 1 47  ? -12.026 -5.345  0.073   1.00 0.00 ? 47  TYR A OH   2  
ATOM 2354  H H    . TYR A 1 47  ? -6.462  -1.252  1.303   1.00 0.00 ? 47  TYR A H    2  
ATOM 2355  H HA   . TYR A 1 47  ? -8.250  -0.375  -0.817  1.00 0.00 ? 47  TYR A HA   2  
ATOM 2356  H HB2  . TYR A 1 47  ? -9.105  -0.397  2.085   1.00 0.00 ? 47  TYR A HB2  2  
ATOM 2357  H HB3  . TYR A 1 47  ? -9.995  0.354   0.765   1.00 0.00 ? 47  TYR A HB3  2  
ATOM 2358  H HD1  . TYR A 1 47  ? -11.110 -1.038  -0.929  1.00 0.00 ? 47  TYR A HD1  2  
ATOM 2359  H HD2  . TYR A 1 47  ? -9.146  -2.776  2.421   1.00 0.00 ? 47  TYR A HD2  2  
ATOM 2360  H HE1  . TYR A 1 47  ? -12.285 -3.158  -1.348  1.00 0.00 ? 47  TYR A HE1  2  
ATOM 2361  H HE2  . TYR A 1 47  ? -10.315 -4.901  2.011   1.00 0.00 ? 47  TYR A HE2  2  
ATOM 2362  H HH   . TYR A 1 47  ? -11.768 -5.988  0.738   1.00 0.00 ? 47  TYR A HH   2  
ATOM 2363  N N    . VAL A 1 48  ? -7.713  2.033   -0.329  1.00 0.00 ? 48  VAL A N    2  
ATOM 2364  C CA   . VAL A 1 48  ? -7.182  3.382   -0.173  1.00 0.00 ? 48  VAL A CA   2  
ATOM 2365  C C    . VAL A 1 48  ? -7.803  4.081   1.031   1.00 0.00 ? 48  VAL A C    2  
ATOM 2366  O O    . VAL A 1 48  ? -8.968  4.473   1.001   1.00 0.00 ? 48  VAL A O    2  
ATOM 2367  C CB   . VAL A 1 48  ? -7.433  4.233   -1.432  1.00 0.00 ? 48  VAL A CB   2  
ATOM 2368  C CG1  . VAL A 1 48  ? -6.881  5.638   -1.246  1.00 0.00 ? 48  VAL A CG1  2  
ATOM 2369  C CG2  . VAL A 1 48  ? -6.819  3.568   -2.655  1.00 0.00 ? 48  VAL A CG2  2  
ATOM 2370  H H    . VAL A 1 48  ? -8.317  1.840   -1.076  1.00 0.00 ? 48  VAL A H    2  
ATOM 2371  H HA   . VAL A 1 48  ? -6.115  3.305   -0.022  1.00 0.00 ? 48  VAL A HA   2  
ATOM 2372  H HB   . VAL A 1 48  ? -8.500  4.306   -1.586  1.00 0.00 ? 48  VAL A HB   2  
ATOM 2373  H HG11 . VAL A 1 48  ? -6.038  5.606   -0.571  1.00 0.00 ? 48  VAL A HG11 2  
ATOM 2374  H HG12 . VAL A 1 48  ? -6.565  6.030   -2.201  1.00 0.00 ? 48  VAL A HG12 2  
ATOM 2375  H HG13 . VAL A 1 48  ? -7.649  6.274   -0.832  1.00 0.00 ? 48  VAL A HG13 2  
ATOM 2376  H HG21 . VAL A 1 48  ? -6.459  2.586   -2.387  1.00 0.00 ? 48  VAL A HG21 2  
ATOM 2377  H HG22 . VAL A 1 48  ? -7.567  3.477   -3.430  1.00 0.00 ? 48  VAL A HG22 2  
ATOM 2378  H HG23 . VAL A 1 48  ? -5.997  4.167   -3.017  1.00 0.00 ? 48  VAL A HG23 2  
ATOM 2379  N N    . ASN A 1 49  ? -7.015  4.233   2.091   1.00 0.00 ? 49  ASN A N    2  
ATOM 2380  C CA   . ASN A 1 49  ? -7.487  4.885   3.307   1.00 0.00 ? 49  ASN A CA   2  
ATOM 2381  C C    . ASN A 1 49  ? -7.707  6.377   3.074   1.00 0.00 ? 49  ASN A C    2  
ATOM 2382  O O    . ASN A 1 49  ? -8.782  6.908   3.353   1.00 0.00 ? 49  ASN A O    2  
ATOM 2383  C CB   . ASN A 1 49  ? -6.485  4.677   4.444   1.00 0.00 ? 49  ASN A CB   2  
ATOM 2384  C CG   . ASN A 1 49  ? -6.586  5.753   5.508   1.00 0.00 ? 49  ASN A CG   2  
ATOM 2385  O OD1  . ASN A 1 49  ? -5.683  6.575   5.664   1.00 0.00 ? 49  ASN A OD1  2  
ATOM 2386  N ND2  . ASN A 1 49  ? -7.690  5.752   6.247   1.00 0.00 ? 49  ASN A ND2  2  
ATOM 2387  H H    . ASN A 1 49  ? -6.094  3.899   2.055   1.00 0.00 ? 49  ASN A H    2  
ATOM 2388  H HA   . ASN A 1 49  ? -8.428  4.433   3.581   1.00 0.00 ? 49  ASN A HA   2  
ATOM 2389  H HB2  . ASN A 1 49  ? -6.671  3.720   4.909   1.00 0.00 ? 49  ASN A HB2  2  
ATOM 2390  H HB3  . ASN A 1 49  ? -5.484  4.688   4.041   1.00 0.00 ? 49  ASN A HB3  2  
ATOM 2391  H HD21 . ASN A 1 49  ? -8.367  5.067   6.067   1.00 0.00 ? 49  ASN A HD21 2  
ATOM 2392  H HD22 . ASN A 1 49  ? -7.782  6.437   6.942   1.00 0.00 ? 49  ASN A HD22 2  
ATOM 2393  N N    . SER A 1 50  ? -6.680  7.048   2.561   1.00 0.00 ? 50  SER A N    2  
ATOM 2394  C CA   . SER A 1 50  ? -6.759  8.479   2.293   1.00 0.00 ? 50  SER A CA   2  
ATOM 2395  C C    . SER A 1 50  ? -5.969  8.841   1.040   1.00 0.00 ? 50  SER A C    2  
ATOM 2396  O O    . SER A 1 50  ? -5.025  8.146   0.664   1.00 0.00 ? 50  SER A O    2  
ATOM 2397  C CB   . SER A 1 50  ? -6.231  9.273   3.490   1.00 0.00 ? 50  SER A CB   2  
ATOM 2398  O OG   . SER A 1 50  ? -6.738  10.596  3.488   1.00 0.00 ? 50  SER A OG   2  
ATOM 2399  H H    . SER A 1 50  ? -5.849  6.568   2.360   1.00 0.00 ? 50  SER A H    2  
ATOM 2400  H HA   . SER A 1 50  ? -7.797  8.730   2.135   1.00 0.00 ? 50  SER A HA   2  
ATOM 2401  H HB2  . SER A 1 50  ? -6.535  8.786   4.404   1.00 0.00 ? 50  SER A HB2  2  
ATOM 2402  H HB3  . SER A 1 50  ? -5.153  9.313   3.444   1.00 0.00 ? 50  SER A HB3  2  
ATOM 2403  H HG   . SER A 1 50  ? -7.579  10.618  3.951   1.00 0.00 ? 50  SER A HG   2  
ATOM 2404  N N    . VAL A 1 51  ? -6.361  9.936   0.396   1.00 0.00 ? 51  VAL A N    2  
ATOM 2405  C CA   . VAL A 1 51  ? -5.690  10.394  -0.815  1.00 0.00 ? 51  VAL A CA   2  
ATOM 2406  C C    . VAL A 1 51  ? -5.527  11.909  -0.813  1.00 0.00 ? 51  VAL A C    2  
ATOM 2407  O O    . VAL A 1 51  ? -6.475  12.647  -0.541  1.00 0.00 ? 51  VAL A O    2  
ATOM 2408  C CB   . VAL A 1 51  ? -6.464  9.973   -2.078  1.00 0.00 ? 51  VAL A CB   2  
ATOM 2409  C CG1  . VAL A 1 51  ? -5.914  10.686  -3.304  1.00 0.00 ? 51  VAL A CG1  2  
ATOM 2410  C CG2  . VAL A 1 51  ? -6.407  8.463   -2.259  1.00 0.00 ? 51  VAL A CG2  2  
ATOM 2411  H H    . VAL A 1 51  ? -7.120  10.449  0.745   1.00 0.00 ? 51  VAL A H    2  
ATOM 2412  H HA   . VAL A 1 51  ? -4.712  9.936   -0.848  1.00 0.00 ? 51  VAL A HA   2  
ATOM 2413  H HB   . VAL A 1 51  ? -7.498  10.260  -1.955  1.00 0.00 ? 51  VAL A HB   2  
ATOM 2414  H HG11 . VAL A 1 51  ? -5.919  10.010  -4.146  1.00 0.00 ? 51  VAL A HG11 2  
ATOM 2415  H HG12 . VAL A 1 51  ? -6.530  11.545  -3.527  1.00 0.00 ? 51  VAL A HG12 2  
ATOM 2416  H HG13 . VAL A 1 51  ? -4.902  11.009  -3.108  1.00 0.00 ? 51  VAL A HG13 2  
ATOM 2417  H HG21 . VAL A 1 51  ? -5.553  8.207   -2.868  1.00 0.00 ? 51  VAL A HG21 2  
ATOM 2418  H HG22 . VAL A 1 51  ? -6.317  7.987   -1.293  1.00 0.00 ? 51  VAL A HG22 2  
ATOM 2419  H HG23 . VAL A 1 51  ? -7.310  8.124   -2.744  1.00 0.00 ? 51  VAL A HG23 2  
ATOM 2420  N N    . LYS A 1 52  ? -4.319  12.369  -1.120  1.00 0.00 ? 52  LYS A N    2  
ATOM 2421  C CA   . LYS A 1 52  ? -4.029  13.798  -1.157  1.00 0.00 ? 52  LYS A CA   2  
ATOM 2422  C C    . LYS A 1 52  ? -4.964  14.517  -2.123  1.00 0.00 ? 52  LYS A C    2  
ATOM 2423  O O    . LYS A 1 52  ? -5.372  13.956  -3.139  1.00 0.00 ? 52  LYS A O    2  
ATOM 2424  C CB   . LYS A 1 52  ? -2.574  14.034  -1.566  1.00 0.00 ? 52  LYS A CB   2  
ATOM 2425  C CG   . LYS A 1 52  ? -2.176  13.310  -2.841  1.00 0.00 ? 52  LYS A CG   2  
ATOM 2426  C CD   . LYS A 1 52  ? -0.669  13.308  -3.034  1.00 0.00 ? 52  LYS A CD   2  
ATOM 2427  C CE   . LYS A 1 52  ? -0.246  12.324  -4.113  1.00 0.00 ? 52  LYS A CE   2  
ATOM 2428  N NZ   . LYS A 1 52  ? -0.820  10.969  -3.884  1.00 0.00 ? 52  LYS A NZ   2  
ATOM 2429  H H    . LYS A 1 52  ? -3.603  11.731  -1.327  1.00 0.00 ? 52  LYS A H    2  
ATOM 2430  H HA   . LYS A 1 52  ? -4.184  14.193  -0.164  1.00 0.00 ? 52  LYS A HA   2  
ATOM 2431  H HB2  . LYS A 1 52  ? -2.422  15.093  -1.716  1.00 0.00 ? 52  LYS A HB2  2  
ATOM 2432  H HB3  . LYS A 1 52  ? -1.929  13.695  -0.769  1.00 0.00 ? 52  LYS A HB3  2  
ATOM 2433  H HG2  . LYS A 1 52  ? -2.522  12.289  -2.787  1.00 0.00 ? 52  LYS A HG2  2  
ATOM 2434  H HG3  . LYS A 1 52  ? -2.637  13.805  -3.684  1.00 0.00 ? 52  LYS A HG3  2  
ATOM 2435  H HD2  . LYS A 1 52  ? -0.350  14.299  -3.321  1.00 0.00 ? 52  LYS A HD2  2  
ATOM 2436  H HD3  . LYS A 1 52  ? -0.196  13.032  -2.102  1.00 0.00 ? 52  LYS A HD3  2  
ATOM 2437  H HE2  . LYS A 1 52  ? -0.585  12.691  -5.070  1.00 0.00 ? 52  LYS A HE2  2  
ATOM 2438  H HE3  . LYS A 1 52  ? 0.832   12.254  -4.116  1.00 0.00 ? 52  LYS A HE3  2  
ATOM 2439  H HZ1  . LYS A 1 52  ? -0.144  10.239  -4.188  1.00 0.00 ? 52  LYS A HZ1  2  
ATOM 2440  H HZ2  . LYS A 1 52  ? -1.700  10.857  -4.426  1.00 0.00 ? 52  LYS A HZ2  2  
ATOM 2441  H HZ3  . LYS A 1 52  ? -1.027  10.835  -2.874  1.00 0.00 ? 52  LYS A HZ3  2  
ATOM 2442  N N    . GLU A 1 53  ? -5.298  15.763  -1.800  1.00 0.00 ? 53  GLU A N    2  
ATOM 2443  C CA   . GLU A 1 53  ? -6.184  16.558  -2.642  1.00 0.00 ? 53  GLU A CA   2  
ATOM 2444  C C    . GLU A 1 53  ? -5.424  17.149  -3.826  1.00 0.00 ? 53  GLU A C    2  
ATOM 2445  O O    . GLU A 1 53  ? -5.889  17.099  -4.965  1.00 0.00 ? 53  GLU A O    2  
ATOM 2446  C CB   . GLU A 1 53  ? -6.829  17.680  -1.825  1.00 0.00 ? 53  GLU A CB   2  
ATOM 2447  C CG   . GLU A 1 53  ? -5.928  18.232  -0.733  1.00 0.00 ? 53  GLU A CG   2  
ATOM 2448  C CD   . GLU A 1 53  ? -6.430  19.550  -0.174  1.00 0.00 ? 53  GLU A CD   2  
ATOM 2449  O OE1  . GLU A 1 53  ? -7.367  20.127  -0.764  1.00 0.00 ? 53  GLU A OE1  2  
ATOM 2450  O OE2  . GLU A 1 53  ? -5.885  20.003  0.855   1.00 0.00 ? 53  GLU A OE2  2  
ATOM 2451  H H    . GLU A 1 53  ? -4.940  16.156  -0.977  1.00 0.00 ? 53  GLU A H    2  
ATOM 2452  H HA   . GLU A 1 53  ? -6.959  15.907  -3.016  1.00 0.00 ? 53  GLU A HA   2  
ATOM 2453  H HB2  . GLU A 1 53  ? -7.091  18.489  -2.491  1.00 0.00 ? 53  GLU A HB2  2  
ATOM 2454  H HB3  . GLU A 1 53  ? -7.728  17.300  -1.363  1.00 0.00 ? 53  GLU A HB3  2  
ATOM 2455  H HG2  . GLU A 1 53  ? -5.877  17.514  0.072   1.00 0.00 ? 53  GLU A HG2  2  
ATOM 2456  H HG3  . GLU A 1 53  ? -4.940  18.385  -1.141  1.00 0.00 ? 53  GLU A HG3  2  
ATOM 2457  N N    . THR A 1 54  ? -4.251  17.711  -3.549  1.00 0.00 ? 54  THR A N    2  
ATOM 2458  C CA   . THR A 1 54  ? -3.427  18.313  -4.589  1.00 0.00 ? 54  THR A CA   2  
ATOM 2459  C C    . THR A 1 54  ? -2.245  17.417  -4.942  1.00 0.00 ? 54  THR A C    2  
ATOM 2460  O O    . THR A 1 54  ? -1.090  17.788  -4.738  1.00 0.00 ? 54  THR A O    2  
ATOM 2461  C CB   . THR A 1 54  ? -2.899  19.694  -4.158  1.00 0.00 ? 54  THR A CB   2  
ATOM 2462  O OG1  . THR A 1 54  ? -2.364  19.622  -2.832  1.00 0.00 ? 54  THR A OG1  2  
ATOM 2463  C CG2  . THR A 1 54  ? -4.006  20.736  -4.207  1.00 0.00 ? 54  THR A CG2  2  
ATOM 2464  H H    . THR A 1 54  ? -3.934  17.720  -2.622  1.00 0.00 ? 54  THR A H    2  
ATOM 2465  H HA   . THR A 1 54  ? -4.042  18.444  -5.468  1.00 0.00 ? 54  THR A HA   2  
ATOM 2466  H HB   . THR A 1 54  ? -2.114  19.991  -4.839  1.00 0.00 ? 54  THR A HB   2  
ATOM 2467  H HG1  . THR A 1 54  ? -2.038  18.734  -2.666  1.00 0.00 ? 54  THR A HG1  2  
ATOM 2468  H HG21 . THR A 1 54  ? -4.619  20.569  -5.081  1.00 0.00 ? 54  THR A HG21 2  
ATOM 2469  H HG22 . THR A 1 54  ? -3.570  21.723  -4.256  1.00 0.00 ? 54  THR A HG22 2  
ATOM 2470  H HG23 . THR A 1 54  ? -4.615  20.656  -3.320  1.00 0.00 ? 54  THR A HG23 2  
ATOM 2471  N N    . GLY A 1 55  ? -2.542  16.235  -5.473  1.00 0.00 ? 55  GLY A N    2  
ATOM 2472  C CA   . GLY A 1 55  ? -1.493  15.305  -5.846  1.00 0.00 ? 55  GLY A CA   2  
ATOM 2473  C C    . GLY A 1 55  ? -1.800  14.570  -7.136  1.00 0.00 ? 55  GLY A C    2  
ATOM 2474  O O    . GLY A 1 55  ? -2.778  14.880  -7.818  1.00 0.00 ? 55  GLY A O    2  
ATOM 2475  H H    . GLY A 1 55  ? -3.482  15.992  -5.612  1.00 0.00 ? 55  GLY A H    2  
ATOM 2476  H HA2  . GLY A 1 55  ? -0.569  15.850  -5.966  1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2477  H HA3  . GLY A 1 55  ? -1.371  14.580  -5.054  1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2478  N N    . LEU A 1 56  ? -0.964  13.595  -7.474  1.00 0.00 ? 56  LEU A N    2  
ATOM 2479  C CA   . LEU A 1 56  ? -1.150  12.815  -8.692  1.00 0.00 ? 56  LEU A CA   2  
ATOM 2480  C C    . LEU A 1 56  ? -2.282  11.807  -8.525  1.00 0.00 ? 56  LEU A C    2  
ATOM 2481  O O    . LEU A 1 56  ? -3.244  11.806  -9.292  1.00 0.00 ? 56  LEU A O    2  
ATOM 2482  C CB   . LEU A 1 56  ? 0.145   12.089  -9.060  1.00 0.00 ? 56  LEU A CB   2  
ATOM 2483  C CG   . LEU A 1 56  ? 1.434   12.899  -8.911  1.00 0.00 ? 56  LEU A CG   2  
ATOM 2484  C CD1  . LEU A 1 56  ? 2.650   12.008  -9.110  1.00 0.00 ? 56  LEU A CD1  2  
ATOM 2485  C CD2  . LEU A 1 56  ? 1.452   14.058  -9.896  1.00 0.00 ? 56  LEU A CD2  2  
ATOM 2486  H H    . LEU A 1 56  ? -0.202  13.394  -6.891  1.00 0.00 ? 56  LEU A H    2  
ATOM 2487  H HA   . LEU A 1 56  ? -1.408  13.499  -9.487  1.00 0.00 ? 56  LEU A HA   2  
ATOM 2488  H HB2  . LEU A 1 56  ? 0.227   11.219  -8.428  1.00 0.00 ? 56  LEU A HB2  2  
ATOM 2489  H HB3  . LEU A 1 56  ? 0.067   11.777  -10.092 1.00 0.00 ? 56  LEU A HB3  2  
ATOM 2490  H HG   . LEU A 1 56  ? 1.481   13.308  -7.911  1.00 0.00 ? 56  LEU A HG   2  
ATOM 2491  H HD11 . LEU A 1 56  ? 3.532   12.518  -8.754  1.00 0.00 ? 56  LEU A HD11 2  
ATOM 2492  H HD12 . LEU A 1 56  ? 2.763   11.783  -10.161 1.00 0.00 ? 56  LEU A HD12 2  
ATOM 2493  H HD13 . LEU A 1 56  ? 2.518   11.089  -8.558  1.00 0.00 ? 56  LEU A HD13 2  
ATOM 2494  H HD21 . LEU A 1 56  ? 2.251   14.738  -9.637  1.00 0.00 ? 56  LEU A HD21 2  
ATOM 2495  H HD22 . LEU A 1 56  ? 0.508   14.581  -9.855  1.00 0.00 ? 56  LEU A HD22 2  
ATOM 2496  H HD23 . LEU A 1 56  ? 1.611   13.679  -10.895 1.00 0.00 ? 56  LEU A HD23 2  
ATOM 2497  N N    . ALA A 1 57  ? -2.160  10.950  -7.517  1.00 0.00 ? 57  ALA A N    2  
ATOM 2498  C CA   . ALA A 1 57  ? -3.174  9.939   -7.246  1.00 0.00 ? 57  ALA A CA   2  
ATOM 2499  C C    . ALA A 1 57  ? -4.569  10.457  -7.581  1.00 0.00 ? 57  ALA A C    2  
ATOM 2500  O O    . ALA A 1 57  ? -5.174  10.044  -8.570  1.00 0.00 ? 57  ALA A O    2  
ATOM 2501  C CB   . ALA A 1 57  ? -3.108  9.500   -5.791  1.00 0.00 ? 57  ALA A CB   2  
ATOM 2502  H H    . ALA A 1 57  ? -1.369  11.000  -6.940  1.00 0.00 ? 57  ALA A H    2  
ATOM 2503  H HA   . ALA A 1 57  ? -2.962  9.079   -7.866  1.00 0.00 ? 57  ALA A HA   2  
ATOM 2504  H HB1  . ALA A 1 57  ? -2.082  9.284   -5.528  1.00 0.00 ? 57  ALA A HB1  2  
ATOM 2505  H HB2  . ALA A 1 57  ? -3.483  10.291  -5.159  1.00 0.00 ? 57  ALA A HB2  2  
ATOM 2506  H HB3  . ALA A 1 57  ? -3.708  8.613   -5.655  1.00 0.00 ? 57  ALA A HB3  2  
ATOM 2507  N N    . SER A 1 58  ? -5.074  11.363  -6.750  1.00 0.00 ? 58  SER A N    2  
ATOM 2508  C CA   . SER A 1 58  ? -6.399  11.935  -6.956  1.00 0.00 ? 58  SER A CA   2  
ATOM 2509  C C    . SER A 1 58  ? -6.625  12.268  -8.428  1.00 0.00 ? 58  SER A C    2  
ATOM 2510  O O    . SER A 1 58  ? -7.582  11.799  -9.043  1.00 0.00 ? 58  SER A O    2  
ATOM 2511  C CB   . SER A 1 58  ? -6.573  13.193  -6.104  1.00 0.00 ? 58  SER A CB   2  
ATOM 2512  O OG   . SER A 1 58  ? -5.719  14.233  -6.549  1.00 0.00 ? 58  SER A OG   2  
ATOM 2513  H H    . SER A 1 58  ? -4.542  11.653  -5.979  1.00 0.00 ? 58  SER A H    2  
ATOM 2514  H HA   . SER A 1 58  ? -7.128  11.199  -6.650  1.00 0.00 ? 58  SER A HA   2  
ATOM 2515  H HB2  . SER A 1 58  ? -7.596  13.531  -6.170  1.00 0.00 ? 58  SER A HB2  2  
ATOM 2516  H HB3  . SER A 1 58  ? -6.335  12.964  -5.075  1.00 0.00 ? 58  SER A HB3  2  
ATOM 2517  H HG   . SER A 1 58  ? -6.248  14.967  -6.870  1.00 0.00 ? 58  SER A HG   2  
ATOM 2518  N N    . LYS A 1 59  ? -5.736  13.082  -8.986  1.00 0.00 ? 59  LYS A N    2  
ATOM 2519  C CA   . LYS A 1 59  ? -5.834  13.479  -10.386 1.00 0.00 ? 59  LYS A CA   2  
ATOM 2520  C C    . LYS A 1 59  ? -6.079  12.267  -11.279 1.00 0.00 ? 59  LYS A C    2  
ATOM 2521  O O    . LYS A 1 59  ? -7.057  12.220  -12.026 1.00 0.00 ? 59  LYS A O    2  
ATOM 2522  C CB   . LYS A 1 59  ? -4.557  14.199  -10.824 1.00 0.00 ? 59  LYS A CB   2  
ATOM 2523  C CG   . LYS A 1 59  ? -4.481  15.642  -10.356 1.00 0.00 ? 59  LYS A CG   2  
ATOM 2524  C CD   . LYS A 1 59  ? -3.425  16.422  -11.121 1.00 0.00 ? 59  LYS A CD   2  
ATOM 2525  C CE   . LYS A 1 59  ? -2.044  15.809  -10.947 1.00 0.00 ? 59  LYS A CE   2  
ATOM 2526  N NZ   . LYS A 1 59  ? -0.976  16.682  -11.508 1.00 0.00 ? 59  LYS A NZ   2  
ATOM 2527  H H    . LYS A 1 59  ? -4.994  13.424  -8.444  1.00 0.00 ? 59  LYS A H    2  
ATOM 2528  H HA   . LYS A 1 59  ? -6.670  14.156  -10.481 1.00 0.00 ? 59  LYS A HA   2  
ATOM 2529  H HB2  . LYS A 1 59  ? -3.705  13.668  -10.428 1.00 0.00 ? 59  LYS A HB2  2  
ATOM 2530  H HB3  . LYS A 1 59  ? -4.506  14.190  -11.904 1.00 0.00 ? 59  LYS A HB3  2  
ATOM 2531  H HG2  . LYS A 1 59  ? -5.441  16.112  -10.508 1.00 0.00 ? 59  LYS A HG2  2  
ATOM 2532  H HG3  . LYS A 1 59  ? -4.234  15.656  -9.303  1.00 0.00 ? 59  LYS A HG3  2  
ATOM 2533  H HD2  . LYS A 1 59  ? -3.678  16.419  -12.171 1.00 0.00 ? 59  LYS A HD2  2  
ATOM 2534  H HD3  . LYS A 1 59  ? -3.407  17.439  -10.756 1.00 0.00 ? 59  LYS A HD3  2  
ATOM 2535  H HE2  . LYS A 1 59  ? -1.860  15.662  -9.893  1.00 0.00 ? 59  LYS A HE2  2  
ATOM 2536  H HE3  . LYS A 1 59  ? -2.022  14.856  -11.453 1.00 0.00 ? 59  LYS A HE3  2  
ATOM 2537  H HZ1  . LYS A 1 59  ? -1.400  17.463  -12.047 1.00 0.00 ? 59  LYS A HZ1  2  
ATOM 2538  H HZ2  . LYS A 1 59  ? -0.362  16.132  -12.141 1.00 0.00 ? 59  LYS A HZ2  2  
ATOM 2539  H HZ3  . LYS A 1 59  ? -0.398  17.078  -10.740 1.00 0.00 ? 59  LYS A HZ3  2  
ATOM 2540  N N    . LYS A 1 60  ? -5.186  11.287  -11.197 1.00 0.00 ? 60  LYS A N    2  
ATOM 2541  C CA   . LYS A 1 60  ? -5.306  10.073  -11.996 1.00 0.00 ? 60  LYS A CA   2  
ATOM 2542  C C    . LYS A 1 60  ? -6.708  9.484   -11.883 1.00 0.00 ? 60  LYS A C    2  
ATOM 2543  O O    . LYS A 1 60  ? -7.402  9.313   -12.885 1.00 0.00 ? 60  LYS A O    2  
ATOM 2544  C CB   . LYS A 1 60  ? -4.270  9.039   -11.548 1.00 0.00 ? 60  LYS A CB   2  
ATOM 2545  C CG   . LYS A 1 60  ? -2.885  9.276   -12.125 1.00 0.00 ? 60  LYS A CG   2  
ATOM 2546  C CD   . LYS A 1 60  ? -2.836  8.952   -13.609 1.00 0.00 ? 60  LYS A CD   2  
ATOM 2547  C CE   . LYS A 1 60  ? -1.539  9.432   -14.242 1.00 0.00 ? 60  LYS A CE   2  
ATOM 2548  N NZ   . LYS A 1 60  ? -1.544  9.251   -15.720 1.00 0.00 ? 60  LYS A NZ   2  
ATOM 2549  H H    . LYS A 1 60  ? -4.427  11.382  -10.583 1.00 0.00 ? 60  LYS A H    2  
ATOM 2550  H HA   . LYS A 1 60  ? -5.119  10.334  -13.026 1.00 0.00 ? 60  LYS A HA   2  
ATOM 2551  H HB2  . LYS A 1 60  ? -4.197  9.063   -10.470 1.00 0.00 ? 60  LYS A HB2  2  
ATOM 2552  H HB3  . LYS A 1 60  ? -4.602  8.058   -11.855 1.00 0.00 ? 60  LYS A HB3  2  
ATOM 2553  H HG2  . LYS A 1 60  ? -2.619  10.313  -11.985 1.00 0.00 ? 60  LYS A HG2  2  
ATOM 2554  H HG3  . LYS A 1 60  ? -2.176  8.648   -11.605 1.00 0.00 ? 60  LYS A HG3  2  
ATOM 2555  H HD2  . LYS A 1 60  ? -2.912  7.882   -13.738 1.00 0.00 ? 60  LYS A HD2  2  
ATOM 2556  H HD3  . LYS A 1 60  ? -3.668  9.436   -14.101 1.00 0.00 ? 60  LYS A HD3  2  
ATOM 2557  H HE2  . LYS A 1 60  ? -1.410  10.479  -14.016 1.00 0.00 ? 60  LYS A HE2  2  
ATOM 2558  H HE3  . LYS A 1 60  ? -0.719  8.869   -13.821 1.00 0.00 ? 60  LYS A HE3  2  
ATOM 2559  H HZ1  . LYS A 1 60  ? -1.189  8.304   -15.965 1.00 0.00 ? 60  LYS A HZ1  2  
ATOM 2560  H HZ2  . LYS A 1 60  ? -0.934  9.964   -16.169 1.00 0.00 ? 60  LYS A HZ2  2  
ATOM 2561  H HZ3  . LYS A 1 60  ? -2.510  9.354   -16.090 1.00 0.00 ? 60  LYS A HZ3  2  
ATOM 2562  N N    . GLY A 1 61  ? -7.120  9.178   -10.657 1.00 0.00 ? 61  GLY A N    2  
ATOM 2563  C CA   . GLY A 1 61  ? -8.439  8.613   -10.437 1.00 0.00 ? 61  GLY A CA   2  
ATOM 2564  C C    . GLY A 1 61  ? -8.509  7.779   -9.173  1.00 0.00 ? 61  GLY A C    2  
ATOM 2565  O O    . GLY A 1 61  ? -9.127  6.713   -9.157  1.00 0.00 ? 61  GLY A O    2  
ATOM 2566  H H    . GLY A 1 61  ? -6.524  9.336   -9.895  1.00 0.00 ? 61  GLY A H    2  
ATOM 2567  H HA2  . GLY A 1 61  ? -9.156  9.417   -10.366 1.00 0.00 ? 61  GLY A HA2  2  
ATOM 2568  H HA3  . GLY A 1 61  ? -8.696  7.989   -11.280 1.00 0.00 ? 61  GLY A HA3  2  
ATOM 2569  N N    . LEU A 1 62  ? -7.874  8.263   -8.111  1.00 0.00 ? 62  LEU A N    2  
ATOM 2570  C CA   . LEU A 1 62  ? -7.866  7.554   -6.836  1.00 0.00 ? 62  LEU A CA   2  
ATOM 2571  C C    . LEU A 1 62  ? -8.695  8.297   -5.794  1.00 0.00 ? 62  LEU A C    2  
ATOM 2572  O O    . LEU A 1 62  ? -8.757  9.527   -5.796  1.00 0.00 ? 62  LEU A O    2  
ATOM 2573  C CB   . LEU A 1 62  ? -6.431  7.383   -6.335  1.00 0.00 ? 62  LEU A CB   2  
ATOM 2574  C CG   . LEU A 1 62  ? -5.711  6.110   -6.782  1.00 0.00 ? 62  LEU A CG   2  
ATOM 2575  C CD1  . LEU A 1 62  ? -4.203  6.291   -6.697  1.00 0.00 ? 62  LEU A CD1  2  
ATOM 2576  C CD2  . LEU A 1 62  ? -6.155  4.922   -5.940  1.00 0.00 ? 62  LEU A CD2  2  
ATOM 2577  H H    . LEU A 1 62  ? -7.400  9.117   -8.185  1.00 0.00 ? 62  LEU A H    2  
ATOM 2578  H HA   . LEU A 1 62  ? -8.301  6.579   -6.997  1.00 0.00 ? 62  LEU A HA   2  
ATOM 2579  H HB2  . LEU A 1 62  ? -5.856  8.227   -6.684  1.00 0.00 ? 62  LEU A HB2  2  
ATOM 2580  H HB3  . LEU A 1 62  ? -6.456  7.388   -5.255  1.00 0.00 ? 62  LEU A HB3  2  
ATOM 2581  H HG   . LEU A 1 62  ? -5.964  5.904   -7.813  1.00 0.00 ? 62  LEU A HG   2  
ATOM 2582  H HD11 . LEU A 1 62  ? -3.713  5.477   -7.209  1.00 0.00 ? 62  LEU A HD11 2  
ATOM 2583  H HD12 . LEU A 1 62  ? -3.900  6.299   -5.660  1.00 0.00 ? 62  LEU A HD12 2  
ATOM 2584  H HD13 . LEU A 1 62  ? -3.927  7.227   -7.160  1.00 0.00 ? 62  LEU A HD13 2  
ATOM 2585  H HD21 . LEU A 1 62  ? -6.748  4.254   -6.547  1.00 0.00 ? 62  LEU A HD21 2  
ATOM 2586  H HD22 . LEU A 1 62  ? -6.748  5.273   -5.107  1.00 0.00 ? 62  LEU A HD22 2  
ATOM 2587  H HD23 . LEU A 1 62  ? -5.287  4.399   -5.570  1.00 0.00 ? 62  LEU A HD23 2  
ATOM 2588  N N    . LYS A 1 63  ? -9.330  7.543   -4.903  1.00 0.00 ? 63  LYS A N    2  
ATOM 2589  C CA   . LYS A 1 63  ? -10.153 8.129   -3.852  1.00 0.00 ? 63  LYS A CA   2  
ATOM 2590  C C    . LYS A 1 63  ? -10.162 7.243   -2.611  1.00 0.00 ? 63  LYS A C    2  
ATOM 2591  O O    . LYS A 1 63  ? -9.976  6.030   -2.701  1.00 0.00 ? 63  LYS A O    2  
ATOM 2592  C CB   . LYS A 1 63  ? -11.584 8.338   -4.353  1.00 0.00 ? 63  LYS A CB   2  
ATOM 2593  C CG   . LYS A 1 63  ? -11.812 9.696   -4.994  1.00 0.00 ? 63  LYS A CG   2  
ATOM 2594  C CD   . LYS A 1 63  ? -12.235 10.733  -3.968  1.00 0.00 ? 63  LYS A CD   2  
ATOM 2595  C CE   . LYS A 1 63  ? -12.195 12.139  -4.547  1.00 0.00 ? 63  LYS A CE   2  
ATOM 2596  N NZ   . LYS A 1 63  ? -12.309 13.179  -3.487  1.00 0.00 ? 63  LYS A NZ   2  
ATOM 2597  H H    . LYS A 1 63  ? -9.242  6.568   -4.953  1.00 0.00 ? 63  LYS A H    2  
ATOM 2598  H HA   . LYS A 1 63  ? -9.728  9.087   -3.593  1.00 0.00 ? 63  LYS A HA   2  
ATOM 2599  H HB2  . LYS A 1 63  ? -11.812 7.575   -5.084  1.00 0.00 ? 63  LYS A HB2  2  
ATOM 2600  H HB3  . LYS A 1 63  ? -12.263 8.238   -3.519  1.00 0.00 ? 63  LYS A HB3  2  
ATOM 2601  H HG2  . LYS A 1 63  ? -10.895 10.021  -5.463  1.00 0.00 ? 63  LYS A HG2  2  
ATOM 2602  H HG3  . LYS A 1 63  ? -12.588 9.605   -5.742  1.00 0.00 ? 63  LYS A HG3  2  
ATOM 2603  H HD2  . LYS A 1 63  ? -13.242 10.518  -3.644  1.00 0.00 ? 63  LYS A HD2  2  
ATOM 2604  H HD3  . LYS A 1 63  ? -11.564 10.683  -3.121  1.00 0.00 ? 63  LYS A HD3  2  
ATOM 2605  H HE2  . LYS A 1 63  ? -11.261 12.272  -5.072  1.00 0.00 ? 63  LYS A HE2  2  
ATOM 2606  H HE3  . LYS A 1 63  ? -13.016 12.252  -5.240  1.00 0.00 ? 63  LYS A HE3  2  
ATOM 2607  H HZ1  . LYS A 1 63  ? -12.502 14.106  -3.917  1.00 0.00 ? 63  LYS A HZ1  2  
ATOM 2608  H HZ2  . LYS A 1 63  ? -11.421 13.238  -2.948  1.00 0.00 ? 63  LYS A HZ2  2  
ATOM 2609  H HZ3  . LYS A 1 63  ? -13.083 12.942  -2.835  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM 2610  N N    . ALA A 1 64  ? -10.382 7.857   -1.453  1.00 0.00 ? 64  ALA A N    2  
ATOM 2611  C CA   . ALA A 1 64  ? -10.419 7.124   -0.194  1.00 0.00 ? 64  ALA A CA   2  
ATOM 2612  C C    . ALA A 1 64  ? -11.572 6.127   -0.173  1.00 0.00 ? 64  ALA A C    2  
ATOM 2613  O O    . ALA A 1 64  ? -12.729 6.505   0.007   1.00 0.00 ? 64  ALA A O    2  
ATOM 2614  C CB   . ALA A 1 64  ? -10.532 8.089   0.977   1.00 0.00 ? 64  ALA A CB   2  
ATOM 2615  H H    . ALA A 1 64  ? -10.523 8.827   -1.445  1.00 0.00 ? 64  ALA A H    2  
ATOM 2616  H HA   . ALA A 1 64  ? -9.488  6.584   -0.095  1.00 0.00 ? 64  ALA A HA   2  
ATOM 2617  H HB1  . ALA A 1 64  ? -10.740 9.082   0.605   1.00 0.00 ? 64  ALA A HB1  2  
ATOM 2618  H HB2  . ALA A 1 64  ? -11.333 7.773   1.628   1.00 0.00 ? 64  ALA A HB2  2  
ATOM 2619  H HB3  . ALA A 1 64  ? -9.603  8.098   1.527   1.00 0.00 ? 64  ALA A HB3  2  
ATOM 2620  N N    . GLY A 1 65  ? -11.249 4.850   -0.360  1.00 0.00 ? 65  GLY A N    2  
ATOM 2621  C CA   . GLY A 1 65  ? -12.270 3.819   -0.360  1.00 0.00 ? 65  GLY A CA   2  
ATOM 2622  C C    . GLY A 1 65  ? -12.000 2.736   -1.385  1.00 0.00 ? 65  GLY A C    2  
ATOM 2623  O O    . GLY A 1 65  ? -12.283 1.561   -1.147  1.00 0.00 ? 65  GLY A O    2  
ATOM 2624  H H    . GLY A 1 65  ? -10.310 4.607   -0.499  1.00 0.00 ? 65  GLY A H    2  
ATOM 2625  H HA2  . GLY A 1 65  ? -12.312 3.370   0.621   1.00 0.00 ? 65  GLY A HA2  2  
ATOM 2626  H HA3  . GLY A 1 65  ? -13.225 4.274   -0.578  1.00 0.00 ? 65  GLY A HA3  2  
ATOM 2627  N N    . ASP A 1 66  ? -11.452 3.130   -2.529  1.00 0.00 ? 66  ASP A N    2  
ATOM 2628  C CA   . ASP A 1 66  ? -11.144 2.183   -3.595  1.00 0.00 ? 66  ASP A CA   2  
ATOM 2629  C C    . ASP A 1 66  ? -10.430 0.954   -3.041  1.00 0.00 ? 66  ASP A C    2  
ATOM 2630  O O    . ASP A 1 66  ? -10.088 0.904   -1.860  1.00 0.00 ? 66  ASP A O    2  
ATOM 2631  C CB   . ASP A 1 66  ? -10.279 2.852   -4.665  1.00 0.00 ? 66  ASP A CB   2  
ATOM 2632  C CG   . ASP A 1 66  ? -11.057 3.850   -5.498  1.00 0.00 ? 66  ASP A CG   2  
ATOM 2633  O OD1  . ASP A 1 66  ? -11.472 4.890   -4.945  1.00 0.00 ? 66  ASP A OD1  2  
ATOM 2634  O OD2  . ASP A 1 66  ? -11.251 3.592   -6.705  1.00 0.00 ? 66  ASP A OD2  2  
ATOM 2635  H H    . ASP A 1 66  ? -11.249 4.080   -2.660  1.00 0.00 ? 66  ASP A H    2  
ATOM 2636  H HA   . ASP A 1 66  ? -12.076 1.872   -4.042  1.00 0.00 ? 66  ASP A HA   2  
ATOM 2637  H HB2  . ASP A 1 66  ? -9.462  3.371   -4.186  1.00 0.00 ? 66  ASP A HB2  2  
ATOM 2638  H HB3  . ASP A 1 66  ? -9.881  2.093   -5.323  1.00 0.00 ? 66  ASP A HB3  2  
ATOM 2639  N N    . GLU A 1 67  ? -10.211 -0.035  -3.902  1.00 0.00 ? 67  GLU A N    2  
ATOM 2640  C CA   . GLU A 1 67  ? -9.540  -1.264  -3.497  1.00 0.00 ? 67  GLU A CA   2  
ATOM 2641  C C    . GLU A 1 67  ? -8.422  -1.621  -4.473  1.00 0.00 ? 67  GLU A C    2  
ATOM 2642  O O    . GLU A 1 67  ? -8.640  -1.694  -5.683  1.00 0.00 ? 67  GLU A O    2  
ATOM 2643  C CB   . GLU A 1 67  ? -10.544 -2.415  -3.412  1.00 0.00 ? 67  GLU A CB   2  
ATOM 2644  C CG   . GLU A 1 67  ? -10.881 -3.030  -4.760  1.00 0.00 ? 67  GLU A CG   2  
ATOM 2645  C CD   . GLU A 1 67  ? -12.115 -3.909  -4.708  1.00 0.00 ? 67  GLU A CD   2  
ATOM 2646  O OE1  . GLU A 1 67  ? -12.343 -4.550  -3.660  1.00 0.00 ? 67  GLU A OE1  2  
ATOM 2647  O OE2  . GLU A 1 67  ? -12.854 -3.957  -5.714  1.00 0.00 ? 67  GLU A OE2  2  
ATOM 2648  H H    . GLU A 1 67  ? -10.507 0.065   -4.831  1.00 0.00 ? 67  GLU A H    2  
ATOM 2649  H HA   . GLU A 1 67  ? -9.110  -1.101  -2.521  1.00 0.00 ? 67  GLU A HA   2  
ATOM 2650  H HB2  . GLU A 1 67  ? -10.135 -3.189  -2.779  1.00 0.00 ? 67  GLU A HB2  2  
ATOM 2651  H HB3  . GLU A 1 67  ? -11.458 -2.047  -2.970  1.00 0.00 ? 67  GLU A HB3  2  
ATOM 2652  H HG2  . GLU A 1 67  ? -11.054 -2.236  -5.471  1.00 0.00 ? 67  GLU A HG2  2  
ATOM 2653  H HG3  . GLU A 1 67  ? -10.044 -3.629  -5.088  1.00 0.00 ? 67  GLU A HG3  2  
ATOM 2654  N N    . ILE A 1 68  ? -7.226  -1.842  -3.939  1.00 0.00 ? 68  ILE A N    2  
ATOM 2655  C CA   . ILE A 1 68  ? -6.075  -2.191  -4.762  1.00 0.00 ? 68  ILE A CA   2  
ATOM 2656  C C    . ILE A 1 68  ? -5.965  -3.702  -4.941  1.00 0.00 ? 68  ILE A C    2  
ATOM 2657  O O    . ILE A 1 68  ? -5.729  -4.436  -3.981  1.00 0.00 ? 68  ILE A O    2  
ATOM 2658  C CB   . ILE A 1 68  ? -4.764  -1.662  -4.150  1.00 0.00 ? 68  ILE A CB   2  
ATOM 2659  C CG1  . ILE A 1 68  ? -4.978  -0.266  -3.561  1.00 0.00 ? 68  ILE A CG1  2  
ATOM 2660  C CG2  . ILE A 1 68  ? -3.662  -1.637  -5.199  1.00 0.00 ? 68  ILE A CG2  2  
ATOM 2661  C CD1  . ILE A 1 68  ? -5.528  0.732   -4.555  1.00 0.00 ? 68  ILE A CD1  2  
ATOM 2662  H H    . ILE A 1 68  ? -7.115  -1.769  -2.968  1.00 0.00 ? 68  ILE A H    2  
ATOM 2663  H HA   . ILE A 1 68  ? -6.207  -1.733  -5.731  1.00 0.00 ? 68  ILE A HA   2  
ATOM 2664  H HB   . ILE A 1 68  ? -4.463  -2.335  -3.362  1.00 0.00 ? 68  ILE A HB   2  
ATOM 2665  H HG12 . ILE A 1 68  ? -5.673  -0.332  -2.739  1.00 0.00 ? 68  ILE A HG12 2  
ATOM 2666  H HG13 . ILE A 1 68  ? -4.033  0.112   -3.198  1.00 0.00 ? 68  ILE A HG13 2  
ATOM 2667  H HG21 . ILE A 1 68  ? -3.888  -2.353  -5.975  1.00 0.00 ? 68  ILE A HG21 2  
ATOM 2668  H HG22 . ILE A 1 68  ? -3.599  -0.649  -5.630  1.00 0.00 ? 68  ILE A HG22 2  
ATOM 2669  H HG23 . ILE A 1 68  ? -2.720  -1.890  -4.738  1.00 0.00 ? 68  ILE A HG23 2  
ATOM 2670  H HD11 . ILE A 1 68  ? -5.460  0.322   -5.552  1.00 0.00 ? 68  ILE A HD11 2  
ATOM 2671  H HD12 . ILE A 1 68  ? -6.560  0.943   -4.321  1.00 0.00 ? 68  ILE A HD12 2  
ATOM 2672  H HD13 . ILE A 1 68  ? -4.953  1.646   -4.503  1.00 0.00 ? 68  ILE A HD13 2  
ATOM 2673  N N    . LEU A 1 69  ? -6.136  -4.159  -6.176  1.00 0.00 ? 69  LEU A N    2  
ATOM 2674  C CA   . LEU A 1 69  ? -6.055  -5.583  -6.483  1.00 0.00 ? 69  LEU A CA   2  
ATOM 2675  C C    . LEU A 1 69  ? -4.602  -6.035  -6.588  1.00 0.00 ? 69  LEU A C    2  
ATOM 2676  O O    . LEU A 1 69  ? -4.197  -7.006  -5.950  1.00 0.00 ? 69  LEU A O    2  
ATOM 2677  C CB   . LEU A 1 69  ? -6.791  -5.886  -7.789  1.00 0.00 ? 69  LEU A CB   2  
ATOM 2678  C CG   . LEU A 1 69  ? -8.199  -5.304  -7.917  1.00 0.00 ? 69  LEU A CG   2  
ATOM 2679  C CD1  . LEU A 1 69  ? -8.527  -5.013  -9.373  1.00 0.00 ? 69  LEU A CD1  2  
ATOM 2680  C CD2  . LEU A 1 69  ? -9.226  -6.253  -7.316  1.00 0.00 ? 69  LEU A CD2  2  
ATOM 2681  H H    . LEU A 1 69  ? -6.322  -3.525  -6.900  1.00 0.00 ? 69  LEU A H    2  
ATOM 2682  H HA   . LEU A 1 69  ? -6.530  -6.123  -5.678  1.00 0.00 ? 69  LEU A HA   2  
ATOM 2683  H HB2  . LEU A 1 69  ? -6.198  -5.496  -8.602  1.00 0.00 ? 69  LEU A HB2  2  
ATOM 2684  H HB3  . LEU A 1 69  ? -6.866  -6.960  -7.884  1.00 0.00 ? 69  LEU A HB3  2  
ATOM 2685  H HG   . LEU A 1 69  ? -8.247  -4.371  -7.372  1.00 0.00 ? 69  LEU A HG   2  
ATOM 2686  H HD11 . LEU A 1 69  ? -8.253  -5.863  -9.980  1.00 0.00 ? 69  LEU A HD11 2  
ATOM 2687  H HD12 . LEU A 1 69  ? -7.976  -4.144  -9.700  1.00 0.00 ? 69  LEU A HD12 2  
ATOM 2688  H HD13 . LEU A 1 69  ? -9.586  -4.826  -9.473  1.00 0.00 ? 69  LEU A HD13 2  
ATOM 2689  H HD21 . LEU A 1 69  ? -10.180 -6.105  -7.800  1.00 0.00 ? 69  LEU A HD21 2  
ATOM 2690  H HD22 . LEU A 1 69  ? -9.324  -6.055  -6.259  1.00 0.00 ? 69  LEU A HD22 2  
ATOM 2691  H HD23 . LEU A 1 69  ? -8.902  -7.273  -7.464  1.00 0.00 ? 69  LEU A HD23 2  
ATOM 2692  N N    . GLU A 1 70  ? -3.823  -5.323  -7.397  1.00 0.00 ? 70  GLU A N    2  
ATOM 2693  C CA   . GLU A 1 70  ? -2.415  -5.651  -7.583  1.00 0.00 ? 70  GLU A CA   2  
ATOM 2694  C C    . GLU A 1 70  ? -1.571  -4.384  -7.695  1.00 0.00 ? 70  GLU A C    2  
ATOM 2695  O O    . GLU A 1 70  ? -2.070  -3.325  -8.075  1.00 0.00 ? 70  GLU A O    2  
ATOM 2696  C CB   . GLU A 1 70  ? -2.230  -6.512  -8.835  1.00 0.00 ? 70  GLU A CB   2  
ATOM 2697  C CG   . GLU A 1 70  ? -2.442  -7.996  -8.589  1.00 0.00 ? 70  GLU A CG   2  
ATOM 2698  C CD   . GLU A 1 70  ? -2.870  -8.739  -9.840  1.00 0.00 ? 70  GLU A CD   2  
ATOM 2699  O OE1  . GLU A 1 70  ? -2.390  -8.380  -10.936 1.00 0.00 ? 70  GLU A OE1  2  
ATOM 2700  O OE2  . GLU A 1 70  ? -3.683  -9.679  -9.723  1.00 0.00 ? 70  GLU A OE2  2  
ATOM 2701  H H    . GLU A 1 70  ? -4.204  -4.560  -7.879  1.00 0.00 ? 70  GLU A H    2  
ATOM 2702  H HA   . GLU A 1 70  ? -2.088  -6.212  -6.721  1.00 0.00 ? 70  GLU A HA   2  
ATOM 2703  H HB2  . GLU A 1 70  ? -2.935  -6.188  -9.587  1.00 0.00 ? 70  GLU A HB2  2  
ATOM 2704  H HB3  . GLU A 1 70  ? -1.227  -6.370  -9.210  1.00 0.00 ? 70  GLU A HB3  2  
ATOM 2705  H HG2  . GLU A 1 70  ? -1.517  -8.425  -8.233  1.00 0.00 ? 70  GLU A HG2  2  
ATOM 2706  H HG3  . GLU A 1 70  ? -3.207  -8.118  -7.837  1.00 0.00 ? 70  GLU A HG3  2  
ATOM 2707  N N    . ILE A 1 71  ? -0.290  -4.502  -7.361  1.00 0.00 ? 71  ILE A N    2  
ATOM 2708  C CA   . ILE A 1 71  ? 0.623   -3.368  -7.424  1.00 0.00 ? 71  ILE A CA   2  
ATOM 2709  C C    . ILE A 1 71  ? 1.891   -3.725  -8.191  1.00 0.00 ? 71  ILE A C    2  
ATOM 2710  O O    . ILE A 1 71  ? 2.760   -4.430  -7.680  1.00 0.00 ? 71  ILE A O    2  
ATOM 2711  C CB   . ILE A 1 71  ? 1.009   -2.877  -6.016  1.00 0.00 ? 71  ILE A CB   2  
ATOM 2712  C CG1  . ILE A 1 71  ? -0.245  -2.514  -5.217  1.00 0.00 ? 71  ILE A CG1  2  
ATOM 2713  C CG2  . ILE A 1 71  ? 1.947   -1.683  -6.110  1.00 0.00 ? 71  ILE A CG2  2  
ATOM 2714  C CD1  . ILE A 1 71  ? -0.047  -2.580  -3.719  1.00 0.00 ? 71  ILE A CD1  2  
ATOM 2715  H H    . ILE A 1 71  ? 0.048   -5.373  -7.065  1.00 0.00 ? 71  ILE A H    2  
ATOM 2716  H HA   . ILE A 1 71  ? 0.118   -2.563  -7.939  1.00 0.00 ? 71  ILE A HA   2  
ATOM 2717  H HB   . ILE A 1 71  ? 1.530   -3.675  -5.511  1.00 0.00 ? 71  ILE A HB   2  
ATOM 2718  H HG12 . ILE A 1 71  ? -0.545  -1.509  -5.467  1.00 0.00 ? 71  ILE A HG12 2  
ATOM 2719  H HG13 . ILE A 1 71  ? -1.040  -3.198  -5.479  1.00 0.00 ? 71  ILE A HG13 2  
ATOM 2720  H HG21 . ILE A 1 71  ? 1.476   -0.900  -6.686  1.00 0.00 ? 71  ILE A HG21 2  
ATOM 2721  H HG22 . ILE A 1 71  ? 2.165   -1.318  -5.118  1.00 0.00 ? 71  ILE A HG22 2  
ATOM 2722  H HG23 . ILE A 1 71  ? 2.865   -1.983  -6.594  1.00 0.00 ? 71  ILE A HG23 2  
ATOM 2723  H HD11 . ILE A 1 71  ? 1.009   -2.558  -3.494  1.00 0.00 ? 71  ILE A HD11 2  
ATOM 2724  H HD12 . ILE A 1 71  ? -0.533  -1.736  -3.253  1.00 0.00 ? 71  ILE A HD12 2  
ATOM 2725  H HD13 . ILE A 1 71  ? -0.476  -3.497  -3.340  1.00 0.00 ? 71  ILE A HD13 2  
ATOM 2726  N N    . ASN A 1 72  ? 1.991   -3.232  -9.421  1.00 0.00 ? 72  ASN A N    2  
ATOM 2727  C CA   . ASN A 1 72  ? 3.155   -3.498  -10.259 1.00 0.00 ? 72  ASN A CA   2  
ATOM 2728  C C    . ASN A 1 72  ? 3.291   -4.991  -10.542 1.00 0.00 ? 72  ASN A C    2  
ATOM 2729  O O    . ASN A 1 72  ? 4.396   -5.532  -10.552 1.00 0.00 ? 72  ASN A O    2  
ATOM 2730  C CB   . ASN A 1 72  ? 4.425   -2.977  -9.584  1.00 0.00 ? 72  ASN A CB   2  
ATOM 2731  C CG   . ASN A 1 72  ? 4.310   -1.520  -9.180  1.00 0.00 ? 72  ASN A CG   2  
ATOM 2732  O OD1  . ASN A 1 72  ? 3.210   -0.973  -9.095  1.00 0.00 ? 72  ASN A OD1  2  
ATOM 2733  N ND2  . ASN A 1 72  ? 5.448   -0.884  -8.929  1.00 0.00 ? 72  ASN A ND2  2  
ATOM 2734  H H    . ASN A 1 72  ? 1.265   -2.676  -9.774  1.00 0.00 ? 72  ASN A H    2  
ATOM 2735  H HA   . ASN A 1 72  ? 3.015   -2.977  -11.194 1.00 0.00 ? 72  ASN A HA   2  
ATOM 2736  H HB2  . ASN A 1 72  ? 4.620   -3.562  -8.697  1.00 0.00 ? 72  ASN A HB2  2  
ATOM 2737  H HB3  . ASN A 1 72  ? 5.256   -3.078  -10.266 1.00 0.00 ? 72  ASN A HB3  2  
ATOM 2738  H HD21 . ASN A 1 72  ? 6.287   -1.383  -9.018  1.00 0.00 ? 72  ASN A HD21 2  
ATOM 2739  H HD22 . ASN A 1 72  ? 5.402   0.059   -8.665  1.00 0.00 ? 72  ASN A HD22 2  
ATOM 2740  N N    . ASN A 1 73  ? 2.160   -5.650  -10.772 1.00 0.00 ? 73  ASN A N    2  
ATOM 2741  C CA   . ASN A 1 73  ? 2.153   -7.080  -11.056 1.00 0.00 ? 73  ASN A CA   2  
ATOM 2742  C C    . ASN A 1 73  ? 2.450   -7.886  -9.795  1.00 0.00 ? 73  ASN A C    2  
ATOM 2743  O O    . ASN A 1 73  ? 3.086   -8.939  -9.854  1.00 0.00 ? 73  ASN A O    2  
ATOM 2744  C CB   . ASN A 1 73  ? 3.181   -7.411  -12.140 1.00 0.00 ? 73  ASN A CB   2  
ATOM 2745  C CG   . ASN A 1 73  ? 3.142   -6.427  -13.292 1.00 0.00 ? 73  ASN A CG   2  
ATOM 2746  O OD1  . ASN A 1 73  ? 2.222   -6.446  -14.110 1.00 0.00 ? 73  ASN A OD1  2  
ATOM 2747  N ND2  . ASN A 1 73  ? 4.146   -5.560  -13.363 1.00 0.00 ? 73  ASN A ND2  2  
ATOM 2748  H H    . ASN A 1 73  ? 1.310   -5.163  -10.750 1.00 0.00 ? 73  ASN A H    2  
ATOM 2749  H HA   . ASN A 1 73  ? 1.169   -7.342  -11.413 1.00 0.00 ? 73  ASN A HA   2  
ATOM 2750  H HB2  . ASN A 1 73  ? 4.170   -7.391  -11.707 1.00 0.00 ? 73  ASN A HB2  2  
ATOM 2751  H HB3  . ASN A 1 73  ? 2.981   -8.399  -12.527 1.00 0.00 ? 73  ASN A HB3  2  
ATOM 2752  H HD21 . ASN A 1 73  ? 4.845   -5.603  -12.677 1.00 0.00 ? 73  ASN A HD21 2  
ATOM 2753  H HD22 . ASN A 1 73  ? 4.146   -4.912  -14.098 1.00 0.00 ? 73  ASN A HD22 2  
ATOM 2754  N N    . ARG A 1 74  ? 1.984   -7.385  -8.655  1.00 0.00 ? 74  ARG A N    2  
ATOM 2755  C CA   . ARG A 1 74  ? 2.200   -8.057  -7.380  1.00 0.00 ? 74  ARG A CA   2  
ATOM 2756  C C    . ARG A 1 74  ? 0.890   -8.198  -6.611  1.00 0.00 ? 74  ARG A C    2  
ATOM 2757  O O    . ARG A 1 74  ? 0.054   -7.295  -6.620  1.00 0.00 ? 74  ARG A O    2  
ATOM 2758  C CB   . ARG A 1 74  ? 3.218   -7.286  -6.538  1.00 0.00 ? 74  ARG A CB   2  
ATOM 2759  C CG   . ARG A 1 74  ? 4.616   -7.272  -7.134  1.00 0.00 ? 74  ARG A CG   2  
ATOM 2760  C CD   . ARG A 1 74  ? 5.394   -8.524  -6.758  1.00 0.00 ? 74  ARG A CD   2  
ATOM 2761  N NE   . ARG A 1 74  ? 6.419   -8.849  -7.747  1.00 0.00 ? 74  ARG A NE   2  
ATOM 2762  C CZ   . ARG A 1 74  ? 7.040   -10.022 -7.803  1.00 0.00 ? 74  ARG A CZ   2  
ATOM 2763  N NH1  . ARG A 1 74  ? 6.742   -10.976 -6.932  1.00 0.00 ? 74  ARG A NH1  2  
ATOM 2764  N NH2  . ARG A 1 74  ? 7.962   -10.242 -8.732  1.00 0.00 ? 74  ARG A NH2  2  
ATOM 2765  H H    . ARG A 1 74  ? 1.485   -6.542  -8.672  1.00 0.00 ? 74  ARG A H    2  
ATOM 2766  H HA   . ARG A 1 74  ? 2.590   -9.043  -7.586  1.00 0.00 ? 74  ARG A HA   2  
ATOM 2767  H HB2  . ARG A 1 74  ? 2.884   -6.263  -6.438  1.00 0.00 ? 74  ARG A HB2  2  
ATOM 2768  H HB3  . ARG A 1 74  ? 3.272   -7.736  -5.558  1.00 0.00 ? 74  ARG A HB3  2  
ATOM 2769  H HG2  . ARG A 1 74  ? 4.539   -7.220  -8.210  1.00 0.00 ? 74  ARG A HG2  2  
ATOM 2770  H HG3  . ARG A 1 74  ? 5.146   -6.406  -6.766  1.00 0.00 ? 74  ARG A HG3  2  
ATOM 2771  H HD2  . ARG A 1 74  ? 5.868   -8.364  -5.802  1.00 0.00 ? 74  ARG A HD2  2  
ATOM 2772  H HD3  . ARG A 1 74  ? 4.704   -9.351  -6.683  1.00 0.00 ? 74  ARG A HD3  2  
ATOM 2773  H HE   . ARG A 1 74  ? 6.655   -8.158  -8.400  1.00 0.00 ? 74  ARG A HE   2  
ATOM 2774  H HH11 . ARG A 1 74  ? 6.047   -10.813 -6.232  1.00 0.00 ? 74  ARG A HH11 2  
ATOM 2775  H HH12 . ARG A 1 74  ? 7.210   -11.859 -6.977  1.00 0.00 ? 74  ARG A HH12 2  
ATOM 2776  H HH21 . ARG A 1 74  ? 8.189   -9.525  -9.390  1.00 0.00 ? 74  ARG A HH21 2  
ATOM 2777  H HH22 . ARG A 1 74  ? 8.429   -11.125 -8.773  1.00 0.00 ? 74  ARG A HH22 2  
ATOM 2778  N N    . ALA A 1 75  ? 0.719   -9.336  -5.946  1.00 0.00 ? 75  ALA A N    2  
ATOM 2779  C CA   . ALA A 1 75  ? -0.488  -9.594  -5.171  1.00 0.00 ? 75  ALA A CA   2  
ATOM 2780  C C    . ALA A 1 75  ? -0.519  -8.745  -3.905  1.00 0.00 ? 75  ALA A C    2  
ATOM 2781  O O    . ALA A 1 75  ? 0.299   -8.926  -3.004  1.00 0.00 ? 75  ALA A O    2  
ATOM 2782  C CB   . ALA A 1 75  ? -0.584  -11.072 -4.820  1.00 0.00 ? 75  ALA A CB   2  
ATOM 2783  H H    . ALA A 1 75  ? 1.422   -10.018 -5.977  1.00 0.00 ? 75  ALA A H    2  
ATOM 2784  H HA   . ALA A 1 75  ? -1.340  -9.339  -5.785  1.00 0.00 ? 75  ALA A HA   2  
ATOM 2785  H HB1  . ALA A 1 75  ? 0.403   -11.510 -4.839  1.00 0.00 ? 75  ALA A HB1  2  
ATOM 2786  H HB2  . ALA A 1 75  ? -1.009  -11.180 -3.834  1.00 0.00 ? 75  ALA A HB2  2  
ATOM 2787  H HB3  . ALA A 1 75  ? -1.214  -11.572 -5.541  1.00 0.00 ? 75  ALA A HB3  2  
ATOM 2788  N N    . ALA A 1 76  ? -1.469  -7.817  -3.844  1.00 0.00 ? 76  ALA A N    2  
ATOM 2789  C CA   . ALA A 1 76  ? -1.607  -6.941  -2.687  1.00 0.00 ? 76  ALA A CA   2  
ATOM 2790  C C    . ALA A 1 76  ? -1.424  -7.715  -1.387  1.00 0.00 ? 76  ALA A C    2  
ATOM 2791  O O    . ALA A 1 76  ? -0.648  -7.316  -0.519  1.00 0.00 ? 76  ALA A O    2  
ATOM 2792  C CB   . ALA A 1 76  ? -2.963  -6.251  -2.707  1.00 0.00 ? 76  ALA A CB   2  
ATOM 2793  H H    . ALA A 1 76  ? -2.092  -7.720  -4.594  1.00 0.00 ? 76  ALA A H    2  
ATOM 2794  H HA   . ALA A 1 76  ? -0.842  -6.180  -2.752  1.00 0.00 ? 76  ALA A HA   2  
ATOM 2795  H HB1  . ALA A 1 76  ? -3.678  -6.849  -2.161  1.00 0.00 ? 76  ALA A HB1  2  
ATOM 2796  H HB2  . ALA A 1 76  ? -2.879  -5.278  -2.245  1.00 0.00 ? 76  ALA A HB2  2  
ATOM 2797  H HB3  . ALA A 1 76  ? -3.294  -6.137  -3.728  1.00 0.00 ? 76  ALA A HB3  2  
ATOM 2798  N N    . ASP A 1 77  ? -2.145  -8.824  -1.258  1.00 0.00 ? 77  ASP A N    2  
ATOM 2799  C CA   . ASP A 1 77  ? -2.062  -9.655  -0.062  1.00 0.00 ? 77  ASP A CA   2  
ATOM 2800  C C    . ASP A 1 77  ? -0.623  -10.091 0.198   1.00 0.00 ? 77  ASP A C    2  
ATOM 2801  O O    . ASP A 1 77  ? -0.164  -10.099 1.339   1.00 0.00 ? 77  ASP A O    2  
ATOM 2802  C CB   . ASP A 1 77  ? -2.962  -10.883 -0.206  1.00 0.00 ? 77  ASP A CB   2  
ATOM 2803  C CG   . ASP A 1 77  ? -2.545  -12.017 0.711   1.00 0.00 ? 77  ASP A CG   2  
ATOM 2804  O OD1  . ASP A 1 77  ? -2.130  -11.733 1.854   1.00 0.00 ? 77  ASP A OD1  2  
ATOM 2805  O OD2  . ASP A 1 77  ? -2.632  -13.188 0.284   1.00 0.00 ? 77  ASP A OD2  2  
ATOM 2806  H H    . ASP A 1 77  ? -2.747  -9.090  -1.984  1.00 0.00 ? 77  ASP A H    2  
ATOM 2807  H HA   . ASP A 1 77  ? -2.403  -9.066  0.775   1.00 0.00 ? 77  ASP A HA   2  
ATOM 2808  H HB2  . ASP A 1 77  ? -3.978  -10.607 0.034   1.00 0.00 ? 77  ASP A HB2  2  
ATOM 2809  H HB3  . ASP A 1 77  ? -2.920  -11.235 -1.226  1.00 0.00 ? 77  ASP A HB3  2  
ATOM 2810  N N    . ALA A 1 78  ? 0.082   -10.453 -0.869  1.00 0.00 ? 78  ALA A N    2  
ATOM 2811  C CA   . ALA A 1 78  ? 1.468   -10.889 -0.756  1.00 0.00 ? 78  ALA A CA   2  
ATOM 2812  C C    . ALA A 1 78  ? 2.360   -9.758  -0.256  1.00 0.00 ? 78  ALA A C    2  
ATOM 2813  O O    . ALA A 1 78  ? 3.320   -9.990  0.481   1.00 0.00 ? 78  ALA A O    2  
ATOM 2814  C CB   . ALA A 1 78  ? 1.970   -11.406 -2.096  1.00 0.00 ? 78  ALA A CB   2  
ATOM 2815  H H    . ALA A 1 78  ? -0.340  -10.425 -1.753  1.00 0.00 ? 78  ALA A H    2  
ATOM 2816  H HA   . ALA A 1 78  ? 1.505   -11.703 -0.047  1.00 0.00 ? 78  ALA A HA   2  
ATOM 2817  H HB1  . ALA A 1 78  ? 2.258   -12.442 -1.996  1.00 0.00 ? 78  ALA A HB1  2  
ATOM 2818  H HB2  . ALA A 1 78  ? 1.184   -11.320 -2.832  1.00 0.00 ? 78  ALA A HB2  2  
ATOM 2819  H HB3  . ALA A 1 78  ? 2.823   -10.823 -2.410  1.00 0.00 ? 78  ALA A HB3  2  
ATOM 2820  N N    . LEU A 1 79  ? 2.039   -8.534  -0.661  1.00 0.00 ? 79  LEU A N    2  
ATOM 2821  C CA   . LEU A 1 79  ? 2.813   -7.366  -0.254  1.00 0.00 ? 79  LEU A CA   2  
ATOM 2822  C C    . LEU A 1 79  ? 2.510   -6.990  1.193   1.00 0.00 ? 79  LEU A C    2  
ATOM 2823  O O    . LEU A 1 79  ? 1.355   -6.789  1.564   1.00 0.00 ? 79  LEU A O    2  
ATOM 2824  C CB   . LEU A 1 79  ? 2.509   -6.183  -1.174  1.00 0.00 ? 79  LEU A CB   2  
ATOM 2825  C CG   . LEU A 1 79  ? 2.733   -6.420  -2.668  1.00 0.00 ? 79  LEU A CG   2  
ATOM 2826  C CD1  . LEU A 1 79  ? 1.987   -5.381  -3.491  1.00 0.00 ? 79  LEU A CD1  2  
ATOM 2827  C CD2  . LEU A 1 79  ? 4.219   -6.395  -2.995  1.00 0.00 ? 79  LEU A CD2  2  
ATOM 2828  H H    . LEU A 1 79  ? 1.264   -8.412  -1.247  1.00 0.00 ? 79  LEU A H    2  
ATOM 2829  H HA   . LEU A 1 79  ? 3.860   -7.617  -0.337  1.00 0.00 ? 79  LEU A HA   2  
ATOM 2830  H HB2  . LEU A 1 79  ? 1.473   -5.913  -1.034  1.00 0.00 ? 79  LEU A HB2  2  
ATOM 2831  H HB3  . LEU A 1 79  ? 3.138   -5.358  -0.871  1.00 0.00 ? 79  LEU A HB3  2  
ATOM 2832  H HG   . LEU A 1 79  ? 2.347   -7.394  -2.934  1.00 0.00 ? 79  LEU A HG   2  
ATOM 2833  H HD11 . LEU A 1 79  ? 0.975   -5.715  -3.661  1.00 0.00 ? 79  LEU A HD11 2  
ATOM 2834  H HD12 . LEU A 1 79  ? 2.486   -5.248  -4.440  1.00 0.00 ? 79  LEU A HD12 2  
ATOM 2835  H HD13 . LEU A 1 79  ? 1.973   -4.442  -2.958  1.00 0.00 ? 79  LEU A HD13 2  
ATOM 2836  H HD21 . LEU A 1 79  ? 4.489   -5.417  -3.365  1.00 0.00 ? 79  LEU A HD21 2  
ATOM 2837  H HD22 . LEU A 1 79  ? 4.433   -7.138  -3.750  1.00 0.00 ? 79  LEU A HD22 2  
ATOM 2838  H HD23 . LEU A 1 79  ? 4.787   -6.613  -2.103  1.00 0.00 ? 79  LEU A HD23 2  
ATOM 2839  N N    . ASN A 1 80  ? 3.558   -6.894  2.006   1.00 0.00 ? 80  ASN A N    2  
ATOM 2840  C CA   . ASN A 1 80  ? 3.405   -6.540  3.412   1.00 0.00 ? 80  ASN A CA   2  
ATOM 2841  C C    . ASN A 1 80  ? 3.784   -5.082  3.650   1.00 0.00 ? 80  ASN A C    2  
ATOM 2842  O O    . ASN A 1 80  ? 4.277   -4.403  2.750   1.00 0.00 ? 80  ASN A O    2  
ATOM 2843  C CB   . ASN A 1 80  ? 4.268   -7.453  4.286   1.00 0.00 ? 80  ASN A CB   2  
ATOM 2844  C CG   . ASN A 1 80  ? 4.450   -8.831  3.680   1.00 0.00 ? 80  ASN A CG   2  
ATOM 2845  O OD1  . ASN A 1 80  ? 3.486   -9.577  3.506   1.00 0.00 ? 80  ASN A OD1  2  
ATOM 2846  N ND2  . ASN A 1 80  ? 5.690   -9.175  3.355   1.00 0.00 ? 80  ASN A ND2  2  
ATOM 2847  H H    . ASN A 1 80  ? 4.455   -7.066  1.651   1.00 0.00 ? 80  ASN A H    2  
ATOM 2848  H HA   . ASN A 1 80  ? 2.367   -6.679  3.677   1.00 0.00 ? 80  ASN A HA   2  
ATOM 2849  H HB2  . ASN A 1 80  ? 5.243   -7.004  4.411   1.00 0.00 ? 80  ASN A HB2  2  
ATOM 2850  H HB3  . ASN A 1 80  ? 3.800   -7.563  5.253   1.00 0.00 ? 80  ASN A HB3  2  
ATOM 2851  H HD21 . ASN A 1 80  ? 6.409   -8.530  3.523   1.00 0.00 ? 80  ASN A HD21 2  
ATOM 2852  H HD22 . ASN A 1 80  ? 5.836   -10.061 2.961   1.00 0.00 ? 80  ASN A HD22 2  
ATOM 2853  N N    . SER A 1 81  ? 3.551   -4.607  4.870   1.00 0.00 ? 81  SER A N    2  
ATOM 2854  C CA   . SER A 1 81  ? 3.864   -3.229  5.226   1.00 0.00 ? 81  SER A CA   2  
ATOM 2855  C C    . SER A 1 81  ? 5.269   -2.854  4.763   1.00 0.00 ? 81  SER A C    2  
ATOM 2856  O O    . SER A 1 81  ? 5.475   -1.801  4.160   1.00 0.00 ? 81  SER A O    2  
ATOM 2857  C CB   . SER A 1 81  ? 3.745   -3.031  6.739   1.00 0.00 ? 81  SER A CB   2  
ATOM 2858  O OG   . SER A 1 81  ? 4.480   -4.017  7.442   1.00 0.00 ? 81  SER A OG   2  
ATOM 2859  H H    . SER A 1 81  ? 3.156   -5.198  5.545   1.00 0.00 ? 81  SER A H    2  
ATOM 2860  H HA   . SER A 1 81  ? 3.151   -2.587  4.730   1.00 0.00 ? 81  SER A HA   2  
ATOM 2861  H HB2  . SER A 1 81  ? 4.128   -2.057  7.003   1.00 0.00 ? 81  SER A HB2  2  
ATOM 2862  H HB3  . SER A 1 81  ? 2.705   -3.099  7.027   1.00 0.00 ? 81  SER A HB3  2  
ATOM 2863  H HG   . SER A 1 81  ? 4.367   -4.868  7.012   1.00 0.00 ? 81  SER A HG   2  
ATOM 2864  N N    . SER A 1 82  ? 6.232   -3.724  5.049   1.00 0.00 ? 82  SER A N    2  
ATOM 2865  C CA   . SER A 1 82  ? 7.618   -3.484  4.666   1.00 0.00 ? 82  SER A CA   2  
ATOM 2866  C C    . SER A 1 82  ? 7.727   -3.207  3.169   1.00 0.00 ? 82  SER A C    2  
ATOM 2867  O O    . SER A 1 82  ? 8.189   -2.144  2.756   1.00 0.00 ? 82  SER A O    2  
ATOM 2868  C CB   . SER A 1 82  ? 8.488   -4.686  5.038   1.00 0.00 ? 82  SER A CB   2  
ATOM 2869  O OG   . SER A 1 82  ? 9.831   -4.294  5.260   1.00 0.00 ? 82  SER A OG   2  
ATOM 2870  H H    . SER A 1 82  ? 6.004   -4.546  5.532   1.00 0.00 ? 82  SER A H    2  
ATOM 2871  H HA   . SER A 1 82  ? 7.966   -2.617  5.207   1.00 0.00 ? 82  SER A HA   2  
ATOM 2872  H HB2  . SER A 1 82  ? 8.104   -5.139  5.940   1.00 0.00 ? 82  SER A HB2  2  
ATOM 2873  H HB3  . SER A 1 82  ? 8.464   -5.408  4.234   1.00 0.00 ? 82  SER A HB3  2  
ATOM 2874  H HG   . SER A 1 82  ? 9.960   -4.105  6.193   1.00 0.00 ? 82  SER A HG   2  
ATOM 2875  N N    . MET A 1 83  ? 7.300   -4.173  2.362   1.00 0.00 ? 83  MET A N    2  
ATOM 2876  C CA   . MET A 1 83  ? 7.349   -4.033  0.912   1.00 0.00 ? 83  MET A CA   2  
ATOM 2877  C C    . MET A 1 83  ? 6.653   -2.751  0.465   1.00 0.00 ? 83  MET A C    2  
ATOM 2878  O O    . MET A 1 83  ? 7.249   -1.913  -0.213  1.00 0.00 ? 83  MET A O    2  
ATOM 2879  C CB   . MET A 1 83  ? 6.695   -5.242  0.239   1.00 0.00 ? 83  MET A CB   2  
ATOM 2880  C CG   . MET A 1 83  ? 7.655   -6.396  -0.002  1.00 0.00 ? 83  MET A CG   2  
ATOM 2881  S SD   . MET A 1 83  ? 6.847   -7.830  -0.737  1.00 0.00 ? 83  MET A SD   2  
ATOM 2882  C CE   . MET A 1 83  ? 7.046   -9.038  0.570   1.00 0.00 ? 83  MET A CE   2  
ATOM 2883  H H    . MET A 1 83  ? 6.943   -4.999  2.751   1.00 0.00 ? 83  MET A H    2  
ATOM 2884  H HA   . MET A 1 83  ? 8.387   -3.987  0.618   1.00 0.00 ? 83  MET A HA   2  
ATOM 2885  H HB2  . MET A 1 83  ? 5.891   -5.597  0.866   1.00 0.00 ? 83  MET A HB2  2  
ATOM 2886  H HB3  . MET A 1 83  ? 6.290   -4.935  -0.713  1.00 0.00 ? 83  MET A HB3  2  
ATOM 2887  H HG2  . MET A 1 83  ? 8.439   -6.063  -0.666  1.00 0.00 ? 83  MET A HG2  2  
ATOM 2888  H HG3  . MET A 1 83  ? 8.088   -6.689  0.943   1.00 0.00 ? 83  MET A HG3  2  
ATOM 2889  H HE1  . MET A 1 83  ? 7.022   -8.540  1.528   1.00 0.00 ? 83  MET A HE1  2  
ATOM 2890  H HE2  . MET A 1 83  ? 6.245   -9.760  0.519   1.00 0.00 ? 83  MET A HE2  2  
ATOM 2891  H HE3  . MET A 1 83  ? 7.994   -9.543  0.452   1.00 0.00 ? 83  MET A HE3  2  
ATOM 2892  N N    . LEU A 1 84  ? 5.390   -2.604  0.849   1.00 0.00 ? 84  LEU A N    2  
ATOM 2893  C CA   . LEU A 1 84  ? 4.613   -1.423  0.488   1.00 0.00 ? 84  LEU A CA   2  
ATOM 2894  C C    . LEU A 1 84  ? 5.459   -0.159  0.602   1.00 0.00 ? 84  LEU A C    2  
ATOM 2895  O O    . LEU A 1 84  ? 5.507   0.654   -0.321  1.00 0.00 ? 84  LEU A O    2  
ATOM 2896  C CB   . LEU A 1 84  ? 3.379   -1.307  1.385   1.00 0.00 ? 84  LEU A CB   2  
ATOM 2897  C CG   . LEU A 1 84  ? 2.160   -2.124  0.957   1.00 0.00 ? 84  LEU A CG   2  
ATOM 2898  C CD1  . LEU A 1 84  ? 1.167   -2.242  2.103   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 2899  C CD2  . LEU A 1 84  ? 1.498   -1.498  -0.262  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 2900  H H    . LEU A 1 84  ? 4.969   -3.305  1.389   1.00 0.00 ? 84  LEU A H    2  
ATOM 2901  H HA   . LEU A 1 84  ? 4.294   -1.537  -0.537  1.00 0.00 ? 84  LEU A HA   2  
ATOM 2902  H HB2  . LEU A 1 84  ? 3.659   -1.626  2.376   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 2903  H HB3  . LEU A 1 84  ? 3.088   -0.266  1.412   1.00 0.00 ? 84  LEU A HB3  2  
ATOM 2904  H HG   . LEU A 1 84  ? 2.479   -3.122  0.689   1.00 0.00 ? 84  LEU A HG   2  
ATOM 2905  H HD11 . LEU A 1 84  ? 0.293   -2.781  1.769   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 2906  H HD12 . LEU A 1 84  ? 0.877   -1.254  2.430   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 2907  H HD13 . LEU A 1 84  ? 1.626   -2.772  2.924   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 2908  H HD21 . LEU A 1 84  ? 0.617   -2.065  -0.525  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 2909  H HD22 . LEU A 1 84  ? 2.191   -1.505  -1.091  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 2910  H HD23 . LEU A 1 84  ? 1.218   -0.480  -0.036  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 2911  N N    . LYS A 1 85  ? 6.127   0.000   1.740   1.00 0.00 ? 85  LYS A N    2  
ATOM 2912  C CA   . LYS A 1 85  ? 6.975   1.162   1.974   1.00 0.00 ? 85  LYS A CA   2  
ATOM 2913  C C    . LYS A 1 85  ? 7.987   1.334   0.846   1.00 0.00 ? 85  LYS A C    2  
ATOM 2914  O O    . LYS A 1 85  ? 8.151   2.429   0.308   1.00 0.00 ? 85  LYS A O    2  
ATOM 2915  C CB   . LYS A 1 85  ? 7.704   1.026   3.313   1.00 0.00 ? 85  LYS A CB   2  
ATOM 2916  C CG   . LYS A 1 85  ? 6.807   1.240   4.519   1.00 0.00 ? 85  LYS A CG   2  
ATOM 2917  C CD   . LYS A 1 85  ? 7.322   0.491   5.737   1.00 0.00 ? 85  LYS A CD   2  
ATOM 2918  C CE   . LYS A 1 85  ? 8.517   1.196   6.360   1.00 0.00 ? 85  LYS A CE   2  
ATOM 2919  N NZ   . LYS A 1 85  ? 9.036   0.463   7.548   1.00 0.00 ? 85  LYS A NZ   2  
ATOM 2920  H H    . LYS A 1 85  ? 6.048   -0.683  2.439   1.00 0.00 ? 85  LYS A H    2  
ATOM 2921  H HA   . LYS A 1 85  ? 6.339   2.035   2.008   1.00 0.00 ? 85  LYS A HA   2  
ATOM 2922  H HB2  . LYS A 1 85  ? 8.130   0.035   3.377   1.00 0.00 ? 85  LYS A HB2  2  
ATOM 2923  H HB3  . LYS A 1 85  ? 8.502   1.754   3.350   1.00 0.00 ? 85  LYS A HB3  2  
ATOM 2924  H HG2  . LYS A 1 85  ? 6.771   2.295   4.747   1.00 0.00 ? 85  LYS A HG2  2  
ATOM 2925  H HG3  . LYS A 1 85  ? 5.813   0.886   4.284   1.00 0.00 ? 85  LYS A HG3  2  
ATOM 2926  H HD2  . LYS A 1 85  ? 6.532   0.429   6.471   1.00 0.00 ? 85  LYS A HD2  2  
ATOM 2927  H HD3  . LYS A 1 85  ? 7.618   -0.504  5.438   1.00 0.00 ? 85  LYS A HD3  2  
ATOM 2928  H HE2  . LYS A 1 85  ? 9.301   1.269   5.622   1.00 0.00 ? 85  LYS A HE2  2  
ATOM 2929  H HE3  . LYS A 1 85  ? 8.215   2.188   6.663   1.00 0.00 ? 85  LYS A HE3  2  
ATOM 2930  H HZ1  . LYS A 1 85  ? 8.581   -0.469  7.619   1.00 0.00 ? 85  LYS A HZ1  2  
ATOM 2931  H HZ2  . LYS A 1 85  ? 8.835   1.001   8.415   1.00 0.00 ? 85  LYS A HZ2  2  
ATOM 2932  H HZ3  . LYS A 1 85  ? 10.064  0.330   7.465   1.00 0.00 ? 85  LYS A HZ3  2  
ATOM 2933  N N    . ASP A 1 86  ? 8.662   0.246   0.494   1.00 0.00 ? 86  ASP A N    2  
ATOM 2934  C CA   . ASP A 1 86  ? 9.657   0.276   -0.572  1.00 0.00 ? 86  ASP A CA   2  
ATOM 2935  C C    . ASP A 1 86  ? 9.023   0.692   -1.896  1.00 0.00 ? 86  ASP A C    2  
ATOM 2936  O O    . ASP A 1 86  ? 9.648   1.376   -2.708  1.00 0.00 ? 86  ASP A O    2  
ATOM 2937  C CB   . ASP A 1 86  ? 10.320  -1.095  -0.719  1.00 0.00 ? 86  ASP A CB   2  
ATOM 2938  C CG   . ASP A 1 86  ? 11.447  -1.087  -1.733  1.00 0.00 ? 86  ASP A CG   2  
ATOM 2939  O OD1  . ASP A 1 86  ? 11.372  -0.297  -2.697  1.00 0.00 ? 86  ASP A OD1  2  
ATOM 2940  O OD2  . ASP A 1 86  ? 12.404  -1.872  -1.563  1.00 0.00 ? 86  ASP A OD2  2  
ATOM 2941  H H    . ASP A 1 86  ? 8.487   -0.598  0.961   1.00 0.00 ? 86  ASP A H    2  
ATOM 2942  H HA   . ASP A 1 86  ? 10.409  1.002   -0.304  1.00 0.00 ? 86  ASP A HA   2  
ATOM 2943  H HB2  . ASP A 1 86  ? 10.723  -1.396  0.237   1.00 0.00 ? 86  ASP A HB2  2  
ATOM 2944  H HB3  . ASP A 1 86  ? 9.579   -1.814  -1.036  1.00 0.00 ? 86  ASP A HB3  2  
ATOM 2945  N N    . PHE A 1 87  ? 7.779   0.274   -2.108  1.00 0.00 ? 87  PHE A N    2  
ATOM 2946  C CA   . PHE A 1 87  ? 7.061   0.602   -3.334  1.00 0.00 ? 87  PHE A CA   2  
ATOM 2947  C C    . PHE A 1 87  ? 6.837   2.107   -3.447  1.00 0.00 ? 87  PHE A C    2  
ATOM 2948  O O    . PHE A 1 87  ? 6.995   2.691   -4.520  1.00 0.00 ? 87  PHE A O    2  
ATOM 2949  C CB   . PHE A 1 87  ? 5.718   -0.130  -3.374  1.00 0.00 ? 87  PHE A CB   2  
ATOM 2950  C CG   . PHE A 1 87  ? 5.811   -1.524  -3.926  1.00 0.00 ? 87  PHE A CG   2  
ATOM 2951  C CD1  . PHE A 1 87  ? 6.712   -2.434  -3.397  1.00 0.00 ? 87  PHE A CD1  2  
ATOM 2952  C CD2  . PHE A 1 87  ? 4.997   -1.925  -4.973  1.00 0.00 ? 87  PHE A CD2  2  
ATOM 2953  C CE1  . PHE A 1 87  ? 6.801   -3.717  -3.904  1.00 0.00 ? 87  PHE A CE1  2  
ATOM 2954  C CE2  . PHE A 1 87  ? 5.080   -3.206  -5.483  1.00 0.00 ? 87  PHE A CE2  2  
ATOM 2955  C CZ   . PHE A 1 87  ? 5.983   -4.104  -4.947  1.00 0.00 ? 87  PHE A CZ   2  
ATOM 2956  H H    . PHE A 1 87  ? 7.334   -0.268  -1.423  1.00 0.00 ? 87  PHE A H    2  
ATOM 2957  H HA   . PHE A 1 87  ? 7.664   0.276   -4.167  1.00 0.00 ? 87  PHE A HA   2  
ATOM 2958  H HB2  . PHE A 1 87  ? 5.322   -0.196  -2.372  1.00 0.00 ? 87  PHE A HB2  2  
ATOM 2959  H HB3  . PHE A 1 87  ? 5.031   0.428   -3.992  1.00 0.00 ? 87  PHE A HB3  2  
ATOM 2960  H HD1  . PHE A 1 87  ? 7.352   -2.133  -2.580  1.00 0.00 ? 87  PHE A HD1  2  
ATOM 2961  H HD2  . PHE A 1 87  ? 4.290   -1.223  -5.393  1.00 0.00 ? 87  PHE A HD2  2  
ATOM 2962  H HE1  . PHE A 1 87  ? 7.507   -4.417  -3.482  1.00 0.00 ? 87  PHE A HE1  2  
ATOM 2963  H HE2  . PHE A 1 87  ? 4.439   -3.505  -6.299  1.00 0.00 ? 87  PHE A HE2  2  
ATOM 2964  H HZ   . PHE A 1 87  ? 6.050   -5.105  -5.345  1.00 0.00 ? 87  PHE A HZ   2  
ATOM 2965  N N    . LEU A 1 88  ? 6.467   2.729   -2.333  1.00 0.00 ? 88  LEU A N    2  
ATOM 2966  C CA   . LEU A 1 88  ? 6.220   4.167   -2.306  1.00 0.00 ? 88  LEU A CA   2  
ATOM 2967  C C    . LEU A 1 88  ? 7.522   4.946   -2.462  1.00 0.00 ? 88  LEU A C    2  
ATOM 2968  O O    . LEU A 1 88  ? 7.519   6.099   -2.894  1.00 0.00 ? 88  LEU A O    2  
ATOM 2969  C CB   . LEU A 1 88  ? 5.530   4.561   -0.999  1.00 0.00 ? 88  LEU A CB   2  
ATOM 2970  C CG   . LEU A 1 88  ? 4.181   3.894   -0.725  1.00 0.00 ? 88  LEU A CG   2  
ATOM 2971  C CD1  . LEU A 1 88  ? 3.579   4.420   0.569   1.00 0.00 ? 88  LEU A CD1  2  
ATOM 2972  C CD2  . LEU A 1 88  ? 3.228   4.120   -1.889  1.00 0.00 ? 88  LEU A CD2  2  
ATOM 2973  H H    . LEU A 1 88  ? 6.357   2.211   -1.509  1.00 0.00 ? 88  LEU A H    2  
ATOM 2974  H HA   . LEU A 1 88  ? 5.569   4.406   -3.134  1.00 0.00 ? 88  LEU A HA   2  
ATOM 2975  H HB2  . LEU A 1 88  ? 6.194   4.310   -0.186  1.00 0.00 ? 88  LEU A HB2  2  
ATOM 2976  H HB3  . LEU A 1 88  ? 5.374   5.630   -1.018  1.00 0.00 ? 88  LEU A HB3  2  
ATOM 2977  H HG   . LEU A 1 88  ? 4.329   2.829   -0.614  1.00 0.00 ? 88  LEU A HG   2  
ATOM 2978  H HD11 . LEU A 1 88  ? 3.065   5.350   0.375   1.00 0.00 ? 88  LEU A HD11 2  
ATOM 2979  H HD12 . LEU A 1 88  ? 4.365   4.587   1.290   1.00 0.00 ? 88  LEU A HD12 2  
ATOM 2980  H HD13 . LEU A 1 88  ? 2.880   3.696   0.961   1.00 0.00 ? 88  LEU A HD13 2  
ATOM 2981  H HD21 . LEU A 1 88  ? 3.676   4.805   -2.593  1.00 0.00 ? 88  LEU A HD21 2  
ATOM 2982  H HD22 . LEU A 1 88  ? 2.302   4.537   -1.521  1.00 0.00 ? 88  LEU A HD22 2  
ATOM 2983  H HD23 . LEU A 1 88  ? 3.029   3.178   -2.379  1.00 0.00 ? 88  LEU A HD23 2  
ATOM 2984  N N    . SER A 1 89  ? 8.633   4.308   -2.111  1.00 0.00 ? 89  SER A N    2  
ATOM 2985  C CA   . SER A 1 89  ? 9.943   4.942   -2.210  1.00 0.00 ? 89  SER A CA   2  
ATOM 2986  C C    . SER A 1 89  ? 10.404  5.011   -3.663  1.00 0.00 ? 89  SER A C    2  
ATOM 2987  O O    . SER A 1 89  ? 11.499  5.490   -3.954  1.00 0.00 ? 89  SER A O    2  
ATOM 2988  C CB   . SER A 1 89  ? 10.969  4.175   -1.373  1.00 0.00 ? 89  SER A CB   2  
ATOM 2989  O OG   . SER A 1 89  ? 12.166  4.919   -1.228  1.00 0.00 ? 89  SER A OG   2  
ATOM 2990  H H    . SER A 1 89  ? 8.571   3.389   -1.774  1.00 0.00 ? 89  SER A H    2  
ATOM 2991  H HA   . SER A 1 89  ? 9.855   5.947   -1.824  1.00 0.00 ? 89  SER A HA   2  
ATOM 2992  H HB2  . SER A 1 89  ? 10.558  3.981   -0.394  1.00 0.00 ? 89  SER A HB2  2  
ATOM 2993  H HB3  . SER A 1 89  ? 11.198  3.238   -1.860  1.00 0.00 ? 89  SER A HB3  2  
ATOM 2994  H HG   . SER A 1 89  ? 12.379  5.350   -2.059  1.00 0.00 ? 89  SER A HG   2  
ATOM 2995  N N    . GLN A 1 90  ? 9.559   4.530   -4.569  1.00 0.00 ? 90  GLN A N    2  
ATOM 2996  C CA   . GLN A 1 90  ? 9.879   4.536   -5.991  1.00 0.00 ? 90  GLN A CA   2  
ATOM 2997  C C    . GLN A 1 90  ? 9.249   5.739   -6.686  1.00 0.00 ? 90  GLN A C    2  
ATOM 2998  O O    . GLN A 1 90  ? 8.149   6.177   -6.347  1.00 0.00 ? 90  GLN A O    2  
ATOM 2999  C CB   . GLN A 1 90  ? 9.398   3.242   -6.650  1.00 0.00 ? 90  GLN A CB   2  
ATOM 3000  C CG   . GLN A 1 90  ? 9.931   1.985   -5.982  1.00 0.00 ? 90  GLN A CG   2  
ATOM 3001  C CD   . GLN A 1 90  ? 11.444  1.905   -6.011  1.00 0.00 ? 90  GLN A CD   2  
ATOM 3002  O OE1  . GLN A 1 90  ? 12.087  2.422   -6.925  1.00 0.00 ? 90  GLN A OE1  2  
ATOM 3003  N NE2  . GLN A 1 90  ? 12.023  1.254   -5.009  1.00 0.00 ? 90  GLN A NE2  2  
ATOM 3004  H H    . GLN A 1 90  ? 8.700   4.162   -4.274  1.00 0.00 ? 90  GLN A H    2  
ATOM 3005  H HA   . GLN A 1 90  ? 10.952  4.602   -6.089  1.00 0.00 ? 90  GLN A HA   2  
ATOM 3006  H HB2  . GLN A 1 90  ? 8.319   3.214   -6.614  1.00 0.00 ? 90  GLN A HB2  2  
ATOM 3007  H HB3  . GLN A 1 90  ? 9.717   3.238   -7.682  1.00 0.00 ? 90  GLN A HB3  2  
ATOM 3008  H HG2  . GLN A 1 90  ? 9.606   1.975   -4.952  1.00 0.00 ? 90  GLN A HG2  2  
ATOM 3009  H HG3  . GLN A 1 90  ? 9.529   1.123   -6.494  1.00 0.00 ? 90  GLN A HG3  2  
ATOM 3010  H HE21 . GLN A 1 90  ? 11.447  0.866   -4.316  1.00 0.00 ? 90  GLN A HE21 2  
ATOM 3011  H HE22 . GLN A 1 90  ? 12.999  1.186   -5.003  1.00 0.00 ? 90  GLN A HE22 2  
ATOM 3012  N N    . PRO A 1 91  ? 9.961   6.288   -7.681  1.00 0.00 ? 91  PRO A N    2  
ATOM 3013  C CA   . PRO A 1 91  ? 9.491   7.448   -8.444  1.00 0.00 ? 91  PRO A CA   2  
ATOM 3014  C C    . PRO A 1 91  ? 8.309   7.109   -9.346  1.00 0.00 ? 91  PRO A C    2  
ATOM 3015  O O    . PRO A 1 91  ? 7.565   7.993   -9.769  1.00 0.00 ? 91  PRO A O    2  
ATOM 3016  C CB   . PRO A 1 91  ? 10.710  7.838   -9.284  1.00 0.00 ? 91  PRO A CB   2  
ATOM 3017  C CG   . PRO A 1 91  ? 11.496  6.579   -9.417  1.00 0.00 ? 91  PRO A CG   2  
ATOM 3018  C CD   . PRO A 1 91  ? 11.280  5.819   -8.138  1.00 0.00 ? 91  PRO A CD   2  
ATOM 3019  H HA   . PRO A 1 91  ? 9.223   8.268   -7.794  1.00 0.00 ? 91  PRO A HA   2  
ATOM 3020  H HB2  . PRO A 1 91  ? 10.384  8.205   -10.247 1.00 0.00 ? 91  PRO A HB2  2  
ATOM 3021  H HB3  . PRO A 1 91  ? 11.274  8.603   -8.773  1.00 0.00 ? 91  PRO A HB3  2  
ATOM 3022  H HG2  . PRO A 1 91  ? 11.135  6.008   -10.259 1.00 0.00 ? 91  PRO A HG2  2  
ATOM 3023  H HG3  . PRO A 1 91  ? 12.543  6.813   -9.542  1.00 0.00 ? 91  PRO A HG3  2  
ATOM 3024  H HD2  . PRO A 1 91  ? 11.266  4.756   -8.329  1.00 0.00 ? 91  PRO A HD2  2  
ATOM 3025  H HD3  . PRO A 1 91  ? 12.047  6.065   -7.419  1.00 0.00 ? 91  PRO A HD3  2  
ATOM 3026  N N    . SER A 1 92  ? 8.142   5.822   -9.636  1.00 0.00 ? 92  SER A N    2  
ATOM 3027  C CA   . SER A 1 92  ? 7.052   5.366   -10.490 1.00 0.00 ? 92  SER A CA   2  
ATOM 3028  C C    . SER A 1 92  ? 6.357   4.152   -9.882  1.00 0.00 ? 92  SER A C    2  
ATOM 3029  O O    . SER A 1 92  ? 7.007   3.188   -9.475  1.00 0.00 ? 92  SER A O    2  
ATOM 3030  C CB   . SER A 1 92  ? 7.579   5.021   -11.884 1.00 0.00 ? 92  SER A CB   2  
ATOM 3031  O OG   . SER A 1 92  ? 8.048   3.685   -11.936 1.00 0.00 ? 92  SER A OG   2  
ATOM 3032  H H    . SER A 1 92  ? 8.769   5.164   -9.268  1.00 0.00 ? 92  SER A H    2  
ATOM 3033  H HA   . SER A 1 92  ? 6.338   6.172   -10.574 1.00 0.00 ? 92  SER A HA   2  
ATOM 3034  H HB2  . SER A 1 92  ? 6.785   5.139   -12.606 1.00 0.00 ? 92  SER A HB2  2  
ATOM 3035  H HB3  . SER A 1 92  ? 8.394   5.686   -12.133 1.00 0.00 ? 92  SER A HB3  2  
ATOM 3036  H HG   . SER A 1 92  ? 8.904   3.629   -11.505 1.00 0.00 ? 92  SER A HG   2  
ATOM 3037  N N    . LEU A 1 93  ? 5.031   4.206   -9.822  1.00 0.00 ? 93  LEU A N    2  
ATOM 3038  C CA   . LEU A 1 93  ? 4.244   3.112   -9.264  1.00 0.00 ? 93  LEU A CA   2  
ATOM 3039  C C    . LEU A 1 93  ? 3.065   2.772   -10.169 1.00 0.00 ? 93  LEU A C    2  
ATOM 3040  O O    . LEU A 1 93  ? 2.492   3.648   -10.816 1.00 0.00 ? 93  LEU A O    2  
ATOM 3041  C CB   . LEU A 1 93  ? 3.741   3.480   -7.867  1.00 0.00 ? 93  LEU A CB   2  
ATOM 3042  C CG   . LEU A 1 93  ? 4.693   3.179   -6.709  1.00 0.00 ? 93  LEU A CG   2  
ATOM 3043  C CD1  . LEU A 1 93  ? 3.989   3.374   -5.375  1.00 0.00 ? 93  LEU A CD1  2  
ATOM 3044  C CD2  . LEU A 1 93  ? 5.241   1.764   -6.824  1.00 0.00 ? 93  LEU A CD2  2  
ATOM 3045  H H    . LEU A 1 93  ? 4.568   5.001   -10.162 1.00 0.00 ? 93  LEU A H    2  
ATOM 3046  H HA   . LEU A 1 93  ? 4.887   2.247   -9.190  1.00 0.00 ? 93  LEU A HA   2  
ATOM 3047  H HB2  . LEU A 1 93  ? 3.535   4.540   -7.859  1.00 0.00 ? 93  LEU A HB2  2  
ATOM 3048  H HB3  . LEU A 1 93  ? 2.824   2.936   -7.693  1.00 0.00 ? 93  LEU A HB3  2  
ATOM 3049  H HG   . LEU A 1 93  ? 5.527   3.866   -6.749  1.00 0.00 ? 93  LEU A HG   2  
ATOM 3050  H HD11 . LEU A 1 93  ? 2.953   3.087   -5.470  1.00 0.00 ? 93  LEU A HD11 2  
ATOM 3051  H HD12 . LEU A 1 93  ? 4.050   4.412   -5.084  1.00 0.00 ? 93  LEU A HD12 2  
ATOM 3052  H HD13 . LEU A 1 93  ? 4.466   2.761   -4.624  1.00 0.00 ? 93  LEU A HD13 2  
ATOM 3053  H HD21 . LEU A 1 93  ? 4.515   1.137   -7.319  1.00 0.00 ? 93  LEU A HD21 2  
ATOM 3054  H HD22 . LEU A 1 93  ? 5.440   1.374   -5.836  1.00 0.00 ? 93  LEU A HD22 2  
ATOM 3055  H HD23 . LEU A 1 93  ? 6.156   1.778   -7.397  1.00 0.00 ? 93  LEU A HD23 2  
ATOM 3056  N N    . GLY A 1 94  ? 2.705   1.492   -10.208 1.00 0.00 ? 94  GLY A N    2  
ATOM 3057  C CA   . GLY A 1 94  ? 1.594   1.059   -11.035 1.00 0.00 ? 94  GLY A CA   2  
ATOM 3058  C C    . GLY A 1 94  ? 0.517   0.352   -10.236 1.00 0.00 ? 94  GLY A C    2  
ATOM 3059  O O    . GLY A 1 94  ? 0.655   -0.826  -9.901  1.00 0.00 ? 94  GLY A O    2  
ATOM 3060  H H    . GLY A 1 94  ? 3.198   0.837   -9.671  1.00 0.00 ? 94  GLY A H    2  
ATOM 3061  H HA2  . GLY A 1 94  ? 1.161   1.922   -11.518 1.00 0.00 ? 94  GLY A HA2  2  
ATOM 3062  H HA3  . GLY A 1 94  ? 1.965   0.384   -11.792 1.00 0.00 ? 94  GLY A HA3  2  
ATOM 3063  N N    . LEU A 1 95  ? -0.556  1.071   -9.927  1.00 0.00 ? 95  LEU A N    2  
ATOM 3064  C CA   . LEU A 1 95  ? -1.661  0.505   -9.160  1.00 0.00 ? 95  LEU A CA   2  
ATOM 3065  C C    . LEU A 1 95  ? -2.744  -0.040  -10.085 1.00 0.00 ? 95  LEU A C    2  
ATOM 3066  O O    . LEU A 1 95  ? -2.912  0.436   -11.209 1.00 0.00 ? 95  LEU A O    2  
ATOM 3067  C CB   . LEU A 1 95  ? -2.255  1.563   -8.228  1.00 0.00 ? 95  LEU A CB   2  
ATOM 3068  C CG   . LEU A 1 95  ? -1.324  2.095   -7.138  1.00 0.00 ? 95  LEU A CG   2  
ATOM 3069  C CD1  . LEU A 1 95  ? -2.039  3.135   -6.287  1.00 0.00 ? 95  LEU A CD1  2  
ATOM 3070  C CD2  . LEU A 1 95  ? -0.811  0.955   -6.270  1.00 0.00 ? 95  LEU A CD2  2  
ATOM 3071  H H    . LEU A 1 95  ? -0.609  2.003   -10.221 1.00 0.00 ? 95  LEU A H    2  
ATOM 3072  H HA   . LEU A 1 95  ? -1.270  -0.308  -8.566  1.00 0.00 ? 95  LEU A HA   2  
ATOM 3073  H HB2  . LEU A 1 95  ? -2.567  2.399   -8.834  1.00 0.00 ? 95  LEU A HB2  2  
ATOM 3074  H HB3  . LEU A 1 95  ? -3.119  1.129   -7.745  1.00 0.00 ? 95  LEU A HB3  2  
ATOM 3075  H HG   . LEU A 1 95  ? -0.473  2.573   -7.602  1.00 0.00 ? 95  LEU A HG   2  
ATOM 3076  H HD11 . LEU A 1 95  ? -2.872  3.541   -6.840  1.00 0.00 ? 95  LEU A HD11 2  
ATOM 3077  H HD12 . LEU A 1 95  ? -1.351  3.929   -6.037  1.00 0.00 ? 95  LEU A HD12 2  
ATOM 3078  H HD13 . LEU A 1 95  ? -2.399  2.671   -5.380  1.00 0.00 ? 95  LEU A HD13 2  
ATOM 3079  H HD21 . LEU A 1 95  ? -0.914  1.221   -5.229  1.00 0.00 ? 95  LEU A HD21 2  
ATOM 3080  H HD22 . LEU A 1 95  ? 0.230   0.773   -6.494  1.00 0.00 ? 95  LEU A HD22 2  
ATOM 3081  H HD23 . LEU A 1 95  ? -1.385  0.063   -6.473  1.00 0.00 ? 95  LEU A HD23 2  
ATOM 3082  N N    . LEU A 1 96  ? -3.477  -1.038  -9.606  1.00 0.00 ? 96  LEU A N    2  
ATOM 3083  C CA   . LEU A 1 96  ? -4.547  -1.647  -10.389 1.00 0.00 ? 96  LEU A CA   2  
ATOM 3084  C C    . LEU A 1 96  ? -5.840  -1.717  -9.583  1.00 0.00 ? 96  LEU A C    2  
ATOM 3085  O O    . LEU A 1 96  ? -5.996  -2.574  -8.713  1.00 0.00 ? 96  LEU A O    2  
ATOM 3086  C CB   . LEU A 1 96  ? -4.139  -3.049  -10.843 1.00 0.00 ? 96  LEU A CB   2  
ATOM 3087  C CG   . LEU A 1 96  ? -5.217  -3.864  -11.558 1.00 0.00 ? 96  LEU A CG   2  
ATOM 3088  C CD1  . LEU A 1 96  ? -5.284  -3.486  -13.029 1.00 0.00 ? 96  LEU A CD1  2  
ATOM 3089  C CD2  . LEU A 1 96  ? -4.953  -5.354  -11.400 1.00 0.00 ? 96  LEU A CD2  2  
ATOM 3090  H H    . LEU A 1 96  ? -3.296  -1.375  -8.704  1.00 0.00 ? 96  LEU A H    2  
ATOM 3091  H HA   . LEU A 1 96  ? -4.713  -1.029  -11.259 1.00 0.00 ? 96  LEU A HA   2  
ATOM 3092  H HB2  . LEU A 1 96  ? -3.301  -2.948  -11.516 1.00 0.00 ? 96  LEU A HB2  2  
ATOM 3093  H HB3  . LEU A 1 96  ? -3.830  -3.603  -9.968  1.00 0.00 ? 96  LEU A HB3  2  
ATOM 3094  H HG   . LEU A 1 96  ? -6.178  -3.645  -11.114 1.00 0.00 ? 96  LEU A HG   2  
ATOM 3095  H HD11 . LEU A 1 96  ? -4.287  -3.296  -13.398 1.00 0.00 ? 96  LEU A HD11 2  
ATOM 3096  H HD12 . LEU A 1 96  ? -5.887  -2.597  -13.146 1.00 0.00 ? 96  LEU A HD12 2  
ATOM 3097  H HD13 . LEU A 1 96  ? -5.727  -4.297  -13.589 1.00 0.00 ? 96  LEU A HD13 2  
ATOM 3098  H HD21 . LEU A 1 96  ? -5.849  -5.906  -11.641 1.00 0.00 ? 96  LEU A HD21 2  
ATOM 3099  H HD22 . LEU A 1 96  ? -4.666  -5.562  -10.379 1.00 0.00 ? 96  LEU A HD22 2  
ATOM 3100  H HD23 . LEU A 1 96  ? -4.156  -5.651  -12.066 1.00 0.00 ? 96  LEU A HD23 2  
ATOM 3101  N N    . VAL A 1 97  ? -6.766  -0.811  -9.879  1.00 0.00 ? 97  VAL A N    2  
ATOM 3102  C CA   . VAL A 1 97  ? -8.048  -0.772  -9.185  1.00 0.00 ? 97  VAL A CA   2  
ATOM 3103  C C    . VAL A 1 97  ? -9.201  -1.044  -10.144 1.00 0.00 ? 97  VAL A C    2  
ATOM 3104  O O    . VAL A 1 97  ? -9.083  -0.827  -11.350 1.00 0.00 ? 97  VAL A O    2  
ATOM 3105  C CB   . VAL A 1 97  ? -8.274  0.588   -8.500  1.00 0.00 ? 97  VAL A CB   2  
ATOM 3106  C CG1  . VAL A 1 97  ? -7.244  0.812   -7.403  1.00 0.00 ? 97  VAL A CG1  2  
ATOM 3107  C CG2  . VAL A 1 97  ? -8.228  1.714   -9.522  1.00 0.00 ? 97  VAL A CG2  2  
ATOM 3108  H H    . VAL A 1 97  ? -6.584  -0.154  -10.583 1.00 0.00 ? 97  VAL A H    2  
ATOM 3109  H HA   . VAL A 1 97  ? -8.038  -1.538  -8.423  1.00 0.00 ? 97  VAL A HA   2  
ATOM 3110  H HB   . VAL A 1 97  ? -9.254  0.582   -8.046  1.00 0.00 ? 97  VAL A HB   2  
ATOM 3111  H HG11 . VAL A 1 97  ? -6.927  -0.142  -7.008  1.00 0.00 ? 97  VAL A HG11 2  
ATOM 3112  H HG12 . VAL A 1 97  ? -6.391  1.336   -7.810  1.00 0.00 ? 97  VAL A HG12 2  
ATOM 3113  H HG13 . VAL A 1 97  ? -7.683  1.400   -6.611  1.00 0.00 ? 97  VAL A HG13 2  
ATOM 3114  H HG21 . VAL A 1 97  ? -7.628  2.525   -9.137  1.00 0.00 ? 97  VAL A HG21 2  
ATOM 3115  H HG22 . VAL A 1 97  ? -7.791  1.348   -10.441 1.00 0.00 ? 97  VAL A HG22 2  
ATOM 3116  H HG23 . VAL A 1 97  ? -9.230  2.066   -9.716  1.00 0.00 ? 97  VAL A HG23 2  
ATOM 3117  N N    . ARG A 1 98  ? -10.317 -1.519  -9.600  1.00 0.00 ? 98  ARG A N    2  
ATOM 3118  C CA   . ARG A 1 98  ? -11.492 -1.821  -10.408 1.00 0.00 ? 98  ARG A CA   2  
ATOM 3119  C C    . ARG A 1 98  ? -12.437 -0.623  -10.461 1.00 0.00 ? 98  ARG A C    2  
ATOM 3120  O O    . ARG A 1 98  ? -12.462 0.204   -9.549  1.00 0.00 ? 98  ARG A O    2  
ATOM 3121  C CB   . ARG A 1 98  ? -12.226 -3.038  -9.843  1.00 0.00 ? 98  ARG A CB   2  
ATOM 3122  C CG   . ARG A 1 98  ? -12.960 -3.850  -10.898 1.00 0.00 ? 98  ARG A CG   2  
ATOM 3123  C CD   . ARG A 1 98  ? -12.068 -4.932  -11.487 1.00 0.00 ? 98  ARG A CD   2  
ATOM 3124  N NE   . ARG A 1 98  ? -12.713 -5.628  -12.598 1.00 0.00 ? 98  ARG A NE   2  
ATOM 3125  C CZ   . ARG A 1 98  ? -12.362 -6.841  -13.009 1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3126  N NH1  . ARG A 1 98  ? -11.377 -7.490  -12.403 1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3127  N NH2  . ARG A 1 98  ? -12.996 -7.408  -14.027 1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3128  H H    . ARG A 1 98  ? -10.350 -1.671  -8.632  1.00 0.00 ? 98  ARG A H    2  
ATOM 3129  H HA   . ARG A 1 98  ? -11.158 -2.046  -11.409 1.00 0.00 ? 98  ARG A HA   2  
ATOM 3130  H HB2  . ARG A 1 98  ? -11.509 -3.684  -9.358  1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3131  H HB3  . ARG A 1 98  ? -12.947 -2.702  -9.113  1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3132  H HG2  . ARG A 1 98  ? -13.822 -4.318  -10.444 1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3133  H HG3  . ARG A 1 98  ? -13.280 -3.189  -11.689 1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3134  H HD2  . ARG A 1 98  ? -11.157 -4.475  -11.842 1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3135  H HD3  . ARG A 1 98  ? -11.834 -5.648  -10.714 1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3136  H HE   . ARG A 1 98  ? -13.444 -5.166  -13.060 1.00 0.00 ? 98  ARG A HE   2  
ATOM 3137  H HH11 . ARG A 1 98  ? -10.897 -7.066  -11.635 1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3138  H HH12 . ARG A 1 98  ? -11.114 -8.404  -12.714 1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3139  H HH21 . ARG A 1 98  ? -13.739 -6.922  -14.486 1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3140  H HH22 . ARG A 1 98  ? -12.731 -8.321  -14.335 1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3141  N N    . THR A 1 99  ? -13.214 -0.537  -11.537 1.00 0.00 ? 99  THR A N    2  
ATOM 3142  C CA   . THR A 1 99  ? -14.159 0.559   -11.711 1.00 0.00 ? 99  THR A CA   2  
ATOM 3143  C C    . THR A 1 99  ? -15.387 0.107   -12.492 1.00 0.00 ? 99  THR A C    2  
ATOM 3144  O O    . THR A 1 99  ? -15.426 -1.006  -13.018 1.00 0.00 ? 99  THR A O    2  
ATOM 3145  C CB   . THR A 1 99  ? -13.510 1.750   -12.442 1.00 0.00 ? 99  THR A CB   2  
ATOM 3146  O OG1  . THR A 1 99  ? -14.342 2.909   -12.325 1.00 0.00 ? 99  THR A OG1  2  
ATOM 3147  C CG2  . THR A 1 99  ? -13.286 1.426   -13.911 1.00 0.00 ? 99  THR A CG2  2  
ATOM 3148  H H    . THR A 1 99  ? -13.148 -1.227  -12.229 1.00 0.00 ? 99  THR A H    2  
ATOM 3149  H HA   . THR A 1 99  ? -14.469 0.891   -10.731 1.00 0.00 ? 99  THR A HA   2  
ATOM 3150  H HB   . THR A 1 99  ? -12.553 1.955   -11.984 1.00 0.00 ? 99  THR A HB   2  
ATOM 3151  H HG1  . THR A 1 99  ? -14.974 2.923   -13.048 1.00 0.00 ? 99  THR A HG1  2  
ATOM 3152  H HG21 . THR A 1 99  ? -12.442 0.759   -14.008 1.00 0.00 ? 99  THR A HG21 2  
ATOM 3153  H HG22 . THR A 1 99  ? -13.088 2.338   -14.455 1.00 0.00 ? 99  THR A HG22 2  
ATOM 3154  H HG23 . THR A 1 99  ? -14.168 0.950   -14.313 1.00 0.00 ? 99  THR A HG23 2  
ATOM 3155  N N    . TYR A 1 100 ? -16.389 0.976   -12.564 1.00 0.00 ? 100 TYR A N    2  
ATOM 3156  C CA   . TYR A 1 100 ? -17.621 0.665   -13.279 1.00 0.00 ? 100 TYR A CA   2  
ATOM 3157  C C    . TYR A 1 100 ? -17.682 1.411   -14.609 1.00 0.00 ? 100 TYR A C    2  
ATOM 3158  O O    . TYR A 1 100 ? -17.377 2.600   -14.697 1.00 0.00 ? 100 TYR A O    2  
ATOM 3159  C CB   . TYR A 1 100 ? -18.837 1.023   -12.424 1.00 0.00 ? 100 TYR A CB   2  
ATOM 3160  C CG   . TYR A 1 100 ? -18.592 0.893   -10.938 1.00 0.00 ? 100 TYR A CG   2  
ATOM 3161  C CD1  . TYR A 1 100 ? -18.244 -0.329  -10.376 1.00 0.00 ? 100 TYR A CD1  2  
ATOM 3162  C CD2  . TYR A 1 100 ? -18.708 1.992   -10.096 1.00 0.00 ? 100 TYR A CD2  2  
ATOM 3163  C CE1  . TYR A 1 100 ? -18.019 -0.453  -9.018  1.00 0.00 ? 100 TYR A CE1  2  
ATOM 3164  C CE2  . TYR A 1 100 ? -18.484 1.878   -8.737  1.00 0.00 ? 100 TYR A CE2  2  
ATOM 3165  C CZ   . TYR A 1 100 ? -18.140 0.654   -8.203  1.00 0.00 ? 100 TYR A CZ   2  
ATOM 3166  O OH   . TYR A 1 100 ? -17.917 0.536   -6.851  1.00 0.00 ? 100 TYR A OH   2  
ATOM 3167  H H    . TYR A 1 100 ? -16.300 1.847   -12.124 1.00 0.00 ? 100 TYR A H    2  
ATOM 3168  H HA   . TYR A 1 100 ? -17.631 -0.398  -13.475 1.00 0.00 ? 100 TYR A HA   2  
ATOM 3169  H HB2  . TYR A 1 100 ? -19.121 2.045   -12.624 1.00 0.00 ? 100 TYR A HB2  2  
ATOM 3170  H HB3  . TYR A 1 100 ? -19.657 0.369   -12.684 1.00 0.00 ? 100 TYR A HB3  2  
ATOM 3171  H HD1  . TYR A 1 100 ? -18.150 -1.194  -11.016 1.00 0.00 ? 100 TYR A HD1  2  
ATOM 3172  H HD2  . TYR A 1 100 ? -18.978 2.950   -10.517 1.00 0.00 ? 100 TYR A HD2  2  
ATOM 3173  H HE1  . TYR A 1 100 ? -17.750 -1.411  -8.599  1.00 0.00 ? 100 TYR A HE1  2  
ATOM 3174  H HE2  . TYR A 1 100 ? -18.579 2.744   -8.099  1.00 0.00 ? 100 TYR A HE2  2  
ATOM 3175  H HH   . TYR A 1 100 ? -17.909 1.408   -6.450  1.00 0.00 ? 100 TYR A HH   2  
ATOM 3176  N N    . PRO A 1 101 ? -18.086 0.696   -15.669 1.00 0.00 ? 101 PRO A N    2  
ATOM 3177  C CA   . PRO A 1 101 ? -18.199 1.269   -17.014 1.00 0.00 ? 101 PRO A CA   2  
ATOM 3178  C C    . PRO A 1 101 ? -19.347 2.267   -17.125 1.00 0.00 ? 101 PRO A C    2  
ATOM 3179  O O    . PRO A 1 101 ? -20.500 1.931   -16.855 1.00 0.00 ? 101 PRO A O    2  
ATOM 3180  C CB   . PRO A 1 101 ? -18.464 0.048   -17.899 1.00 0.00 ? 101 PRO A CB   2  
ATOM 3181  C CG   . PRO A 1 101 ? -19.088 -0.952  -16.988 1.00 0.00 ? 101 PRO A CG   2  
ATOM 3182  C CD   . PRO A 1 101 ? -18.466 -0.726  -15.637 1.00 0.00 ? 101 PRO A CD   2  
ATOM 3183  H HA   . PRO A 1 101 ? -17.279 1.745   -17.320 1.00 0.00 ? 101 PRO A HA   2  
ATOM 3184  H HB2  . PRO A 1 101 ? -19.132 0.322   -18.703 1.00 0.00 ? 101 PRO A HB2  2  
ATOM 3185  H HB3  . PRO A 1 101 ? -17.532 -0.315  -18.305 1.00 0.00 ? 101 PRO A HB3  2  
ATOM 3186  H HG2  . PRO A 1 101 ? -20.154 -0.791  -16.941 1.00 0.00 ? 101 PRO A HG2  2  
ATOM 3187  H HG3  . PRO A 1 101 ? -18.872 -1.951  -17.337 1.00 0.00 ? 101 PRO A HG3  2  
ATOM 3188  H HD2  . PRO A 1 101 ? -19.185 -0.916  -14.854 1.00 0.00 ? 101 PRO A HD2  2  
ATOM 3189  H HD3  . PRO A 1 101 ? -17.595 -1.354  -15.513 1.00 0.00 ? 101 PRO A HD3  2  
ATOM 3190  N N    . GLU A 1 102 ? -19.024 3.493   -17.523 1.00 0.00 ? 102 GLU A N    2  
ATOM 3191  C CA   . GLU A 1 102 ? -20.029 4.538   -17.669 1.00 0.00 ? 102 GLU A CA   2  
ATOM 3192  C C    . GLU A 1 102 ? -19.923 5.209   -19.036 1.00 0.00 ? 102 GLU A C    2  
ATOM 3193  O O    . GLU A 1 102 ? -18.838 5.305   -19.610 1.00 0.00 ? 102 GLU A O    2  
ATOM 3194  C CB   . GLU A 1 102 ? -19.875 5.583   -16.562 1.00 0.00 ? 102 GLU A CB   2  
ATOM 3195  C CG   . GLU A 1 102 ? -18.661 6.481   -16.738 1.00 0.00 ? 102 GLU A CG   2  
ATOM 3196  C CD   . GLU A 1 102 ? -18.253 7.169   -15.450 1.00 0.00 ? 102 GLU A CD   2  
ATOM 3197  O OE1  . GLU A 1 102 ? -17.967 6.459   -14.463 1.00 0.00 ? 102 GLU A OE1  2  
ATOM 3198  O OE2  . GLU A 1 102 ? -18.219 8.417   -15.429 1.00 0.00 ? 102 GLU A OE2  2  
ATOM 3199  H H    . GLU A 1 102 ? -18.087 3.699   -17.724 1.00 0.00 ? 102 GLU A H    2  
ATOM 3200  H HA   . GLU A 1 102 ? -21.002 4.077   -17.583 1.00 0.00 ? 102 GLU A HA   2  
ATOM 3201  H HB2  . GLU A 1 102 ? -20.758 6.205   -16.545 1.00 0.00 ? 102 GLU A HB2  2  
ATOM 3202  H HB3  . GLU A 1 102 ? -19.785 5.075   -15.614 1.00 0.00 ? 102 GLU A HB3  2  
ATOM 3203  H HG2  . GLU A 1 102 ? -17.833 5.882   -17.086 1.00 0.00 ? 102 GLU A HG2  2  
ATOM 3204  H HG3  . GLU A 1 102 ? -18.892 7.236   -17.475 1.00 0.00 ? 102 GLU A HG3  2  
ATOM 3205  N N    . LEU A 1 103 ? -21.057 5.671   -19.551 1.00 0.00 ? 103 LEU A N    2  
ATOM 3206  C CA   . LEU A 1 103 ? -21.093 6.333   -20.851 1.00 0.00 ? 103 LEU A CA   2  
ATOM 3207  C C    . LEU A 1 103 ? -20.561 7.759   -20.751 1.00 0.00 ? 103 LEU A C    2  
ATOM 3208  O O    . LEU A 1 103 ? -20.124 8.195   -19.686 1.00 0.00 ? 103 LEU A O    2  
ATOM 3209  C CB   . LEU A 1 103 ? -22.521 6.346   -21.399 1.00 0.00 ? 103 LEU A CB   2  
ATOM 3210  C CG   . LEU A 1 103 ? -23.004 5.047   -22.044 1.00 0.00 ? 103 LEU A CG   2  
ATOM 3211  C CD1  . LEU A 1 103 ? -22.647 5.020   -23.522 1.00 0.00 ? 103 LEU A CD1  2  
ATOM 3212  C CD2  . LEU A 1 103 ? -22.411 3.843   -21.328 1.00 0.00 ? 103 LEU A CD2  2  
ATOM 3213  H H    . LEU A 1 103 ? -21.890 5.565   -19.047 1.00 0.00 ? 103 LEU A H    2  
ATOM 3214  H HA   . LEU A 1 103 ? -20.462 5.773   -21.525 1.00 0.00 ? 103 LEU A HA   2  
ATOM 3215  H HB2  . LEU A 1 103 ? -23.186 6.577   -20.581 1.00 0.00 ? 103 LEU A HB2  2  
ATOM 3216  H HB3  . LEU A 1 103 ? -22.582 7.129   -22.142 1.00 0.00 ? 103 LEU A HB3  2  
ATOM 3217  H HG   . LEU A 1 103 ? -24.081 4.990   -21.961 1.00 0.00 ? 103 LEU A HG   2  
ATOM 3218  H HD11 . LEU A 1 103 ? -22.307 4.032   -23.792 1.00 0.00 ? 103 LEU A HD11 2  
ATOM 3219  H HD12 . LEU A 1 103 ? -21.862 5.736   -23.716 1.00 0.00 ? 103 LEU A HD12 2  
ATOM 3220  H HD13 . LEU A 1 103 ? -23.518 5.275   -24.108 1.00 0.00 ? 103 LEU A HD13 2  
ATOM 3221  H HD21 . LEU A 1 103 ? -22.640 3.902   -20.275 1.00 0.00 ? 103 LEU A HD21 2  
ATOM 3222  H HD22 . LEU A 1 103 ? -21.339 3.836   -21.463 1.00 0.00 ? 103 LEU A HD22 2  
ATOM 3223  H HD23 . LEU A 1 103 ? -22.832 2.937   -21.738 1.00 0.00 ? 103 LEU A HD23 2  
ATOM 3224  N N    . GLU A 1 104 ? -20.603 8.480   -21.866 1.00 0.00 ? 104 GLU A N    2  
ATOM 3225  C CA   . GLU A 1 104 ? -20.126 9.858   -21.903 1.00 0.00 ? 104 GLU A CA   2  
ATOM 3226  C C    . GLU A 1 104 ? -18.650 9.933   -21.520 1.00 0.00 ? 104 GLU A C    2  
ATOM 3227  O O    . GLU A 1 104 ? -18.264 10.710  -20.648 1.00 0.00 ? 104 GLU A O    2  
ATOM 3228  C CB   . GLU A 1 104 ? -20.954 10.733  -20.959 1.00 0.00 ? 104 GLU A CB   2  
ATOM 3229  C CG   . GLU A 1 104 ? -20.674 12.219  -21.105 1.00 0.00 ? 104 GLU A CG   2  
ATOM 3230  C CD   . GLU A 1 104 ? -21.076 13.011  -19.876 1.00 0.00 ? 104 GLU A CD   2  
ATOM 3231  O OE1  . GLU A 1 104 ? -20.233 13.165  -18.967 1.00 0.00 ? 104 GLU A OE1  2  
ATOM 3232  O OE2  . GLU A 1 104 ? -22.233 13.478  -19.823 1.00 0.00 ? 104 GLU A OE2  2  
ATOM 3233  H H    . GLU A 1 104 ? -20.962 8.077   -22.684 1.00 0.00 ? 104 GLU A H    2  
ATOM 3234  H HA   . GLU A 1 104 ? -20.242 10.223  -22.912 1.00 0.00 ? 104 GLU A HA   2  
ATOM 3235  H HB2  . GLU A 1 104 ? -22.002 10.563  -21.158 1.00 0.00 ? 104 GLU A HB2  2  
ATOM 3236  H HB3  . GLU A 1 104 ? -20.739 10.445  -19.941 1.00 0.00 ? 104 GLU A HB3  2  
ATOM 3237  H HG2  . GLU A 1 104 ? -19.617 12.358  -21.273 1.00 0.00 ? 104 GLU A HG2  2  
ATOM 3238  H HG3  . GLU A 1 104 ? -21.225 12.595  -21.954 1.00 0.00 ? 104 GLU A HG3  2  
ATOM 3239  N N    . GLU A 1 105 ? -17.832 9.119   -22.179 1.00 0.00 ? 105 GLU A N    2  
ATOM 3240  C CA   . GLU A 1 105 ? -16.400 9.092   -21.907 1.00 0.00 ? 105 GLU A CA   2  
ATOM 3241  C C    . GLU A 1 105 ? -15.664 10.122  -22.761 1.00 0.00 ? 105 GLU A C    2  
ATOM 3242  O O    . GLU A 1 105 ? -15.250 9.832   -23.882 1.00 0.00 ? 105 GLU A O    2  
ATOM 3243  C CB   . GLU A 1 105 ? -15.833 7.696   -22.172 1.00 0.00 ? 105 GLU A CB   2  
ATOM 3244  C CG   . GLU A 1 105 ? -16.537 6.596   -21.394 1.00 0.00 ? 105 GLU A CG   2  
ATOM 3245  C CD   . GLU A 1 105 ? -17.746 6.047   -22.126 1.00 0.00 ? 105 GLU A CD   2  
ATOM 3246  O OE1  . GLU A 1 105 ? -18.678 6.830   -22.405 1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3247  O OE2  . GLU A 1 105 ? -17.760 4.833   -22.419 1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3248  H H    . GLU A 1 105 ? -18.200 8.522   -22.864 1.00 0.00 ? 105 GLU A H    2  
ATOM 3249  H HA   . GLU A 1 105 ? -16.255 9.338   -20.866 1.00 0.00 ? 105 GLU A HA   2  
ATOM 3250  H HB2  . GLU A 1 105 ? -15.923 7.478   -23.226 1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3251  H HB3  . GLU A 1 105 ? -14.788 7.688   -21.901 1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3252  H HG2  . GLU A 1 105 ? -15.840 5.789   -21.227 1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3253  H HG3  . GLU A 1 105 ? -16.859 6.995   -20.444 1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3254  N N    . GLY A 1 106 ? -15.507 11.327  -22.221 1.00 0.00 ? 106 GLY A N    2  
ATOM 3255  C CA   . GLY A 1 106 ? -14.823 12.381  -22.946 1.00 0.00 ? 106 GLY A CA   2  
ATOM 3256  C C    . GLY A 1 106 ? -15.013 13.742  -22.306 1.00 0.00 ? 106 GLY A C    2  
ATOM 3257  O O    . GLY A 1 106 ? -15.253 14.733  -22.997 1.00 0.00 ? 106 GLY A O    2  
ATOM 3258  H H    . GLY A 1 106 ? -15.858 11.500  -21.322 1.00 0.00 ? 106 GLY A H    2  
ATOM 3259  H HA2  . GLY A 1 106 ? -13.768 12.155  -22.978 1.00 0.00 ? 106 GLY A HA2  2  
ATOM 3260  H HA3  . GLY A 1 106 ? -15.205 12.414  -23.955 1.00 0.00 ? 106 GLY A HA3  2  
ATOM 3261  N N    . VAL A 1 107 ? -14.909 13.792  -20.982 1.00 0.00 ? 107 VAL A N    2  
ATOM 3262  C CA   . VAL A 1 107 ? -15.072 15.042  -20.249 1.00 0.00 ? 107 VAL A CA   2  
ATOM 3263  C C    . VAL A 1 107 ? -13.920 15.999  -20.532 1.00 0.00 ? 107 VAL A C    2  
ATOM 3264  O O    . VAL A 1 107 ? -12.911 15.614  -21.122 1.00 0.00 ? 107 VAL A O    2  
ATOM 3265  C CB   . VAL A 1 107 ? -15.159 14.795  -18.731 1.00 0.00 ? 107 VAL A CB   2  
ATOM 3266  C CG1  . VAL A 1 107 ? -16.366 13.931  -18.398 1.00 0.00 ? 107 VAL A CG1  2  
ATOM 3267  C CG2  . VAL A 1 107 ? -13.877 14.152  -18.222 1.00 0.00 ? 107 VAL A CG2  2  
ATOM 3268  H H    . VAL A 1 107 ? -14.717 12.969  -20.486 1.00 0.00 ? 107 VAL A H    2  
ATOM 3269  H HA   . VAL A 1 107 ? -15.996 15.500  -20.571 1.00 0.00 ? 107 VAL A HA   2  
ATOM 3270  H HB   . VAL A 1 107 ? -15.279 15.748  -18.238 1.00 0.00 ? 107 VAL A HB   2  
ATOM 3271  H HG11 . VAL A 1 107 ? -16.048 13.077  -17.819 1.00 0.00 ? 107 VAL A HG11 2  
ATOM 3272  H HG12 . VAL A 1 107 ? -17.077 14.511  -17.828 1.00 0.00 ? 107 VAL A HG12 2  
ATOM 3273  H HG13 . VAL A 1 107 ? -16.829 13.592  -19.314 1.00 0.00 ? 107 VAL A HG13 2  
ATOM 3274  H HG21 . VAL A 1 107 ? -14.053 13.104  -18.029 1.00 0.00 ? 107 VAL A HG21 2  
ATOM 3275  H HG22 . VAL A 1 107 ? -13.101 14.255  -18.967 1.00 0.00 ? 107 VAL A HG22 2  
ATOM 3276  H HG23 . VAL A 1 107 ? -13.567 14.640  -17.310 1.00 0.00 ? 107 VAL A HG23 2  
ATOM 3277  N N    . GLU A 1 108 ? -14.078 17.249  -20.106 1.00 0.00 ? 108 GLU A N    2  
ATOM 3278  C CA   . GLU A 1 108 ? -13.049 18.262  -20.315 1.00 0.00 ? 108 GLU A CA   2  
ATOM 3279  C C    . GLU A 1 108 ? -12.418 18.120  -21.697 1.00 0.00 ? 108 GLU A C    2  
ATOM 3280  O O    . GLU A 1 108 ? -11.248 18.447  -21.893 1.00 0.00 ? 108 GLU A O    2  
ATOM 3281  C CB   . GLU A 1 108 ? -11.970 18.154  -19.235 1.00 0.00 ? 108 GLU A CB   2  
ATOM 3282  C CG   . GLU A 1 108 ? -11.374 16.763  -19.107 1.00 0.00 ? 108 GLU A CG   2  
ATOM 3283  C CD   . GLU A 1 108 ? -10.252 16.700  -18.089 1.00 0.00 ? 108 GLU A CD   2  
ATOM 3284  O OE1  . GLU A 1 108 ? -9.121  17.108  -18.427 1.00 0.00 ? 108 GLU A OE1  2  
ATOM 3285  O OE2  . GLU A 1 108 ? -10.505 16.244  -16.955 1.00 0.00 ? 108 GLU A OE2  2  
ATOM 3286  H H    . GLU A 1 108 ? -14.905 17.495  -19.642 1.00 0.00 ? 108 GLU A H    2  
ATOM 3287  H HA   . GLU A 1 108 ? -13.520 19.231  -20.245 1.00 0.00 ? 108 GLU A HA   2  
ATOM 3288  H HB2  . GLU A 1 108 ? -11.174 18.845  -19.470 1.00 0.00 ? 108 GLU A HB2  2  
ATOM 3289  H HB3  . GLU A 1 108 ? -12.402 18.427  -18.284 1.00 0.00 ? 108 GLU A HB3  2  
ATOM 3290  H HG2  . GLU A 1 108 ? -12.152 16.078  -18.804 1.00 0.00 ? 108 GLU A HG2  2  
ATOM 3291  H HG3  . GLU A 1 108 ? -10.985 16.461  -20.069 1.00 0.00 ? 108 GLU A HG3  2  
ATOM 3292  N N    . SER A 1 109 ? -13.202 17.629  -22.651 1.00 0.00 ? 109 SER A N    2  
ATOM 3293  C CA   . SER A 1 109 ? -12.719 17.439  -24.014 1.00 0.00 ? 109 SER A CA   2  
ATOM 3294  C C    . SER A 1 109 ? -13.149 18.597  -24.909 1.00 0.00 ? 109 SER A C    2  
ATOM 3295  O O    . SER A 1 109 ? -14.180 19.227  -24.676 1.00 0.00 ? 109 SER A O    2  
ATOM 3296  C CB   . SER A 1 109 ? -13.242 16.118  -24.583 1.00 0.00 ? 109 SER A CB   2  
ATOM 3297  O OG   . SER A 1 109 ? -12.745 15.014  -23.848 1.00 0.00 ? 109 SER A OG   2  
ATOM 3298  H H    . SER A 1 109 ? -14.126 17.386  -22.433 1.00 0.00 ? 109 SER A H    2  
ATOM 3299  H HA   . SER A 1 109 ? -11.641 17.405  -23.982 1.00 0.00 ? 109 SER A HA   2  
ATOM 3300  H HB2  . SER A 1 109 ? -14.320 16.110  -24.536 1.00 0.00 ? 109 SER A HB2  2  
ATOM 3301  H HB3  . SER A 1 109 ? -12.925 16.023  -25.612 1.00 0.00 ? 109 SER A HB3  2  
ATOM 3302  H HG   . SER A 1 109 ? -12.901 15.156  -22.911 1.00 0.00 ? 109 SER A HG   2  
ATOM 3303  N N    . GLY A 1 110 ? -12.351 18.872  -25.936 1.00 0.00 ? 110 GLY A N    2  
ATOM 3304  C CA   . GLY A 1 110 ? -12.664 19.953  -26.851 1.00 0.00 ? 110 GLY A CA   2  
ATOM 3305  C C    . GLY A 1 110 ? -12.299 21.313  -26.289 1.00 0.00 ? 110 GLY A C    2  
ATOM 3306  O O    . GLY A 1 110 ? -13.136 22.023  -25.731 1.00 0.00 ? 110 GLY A O    2  
ATOM 3307  H H    . GLY A 1 110 ? -11.542 18.335  -26.073 1.00 0.00 ? 110 GLY A H    2  
ATOM 3308  H HA2  . GLY A 1 110 ? -12.123 19.799  -27.773 1.00 0.00 ? 110 GLY A HA2  2  
ATOM 3309  H HA3  . GLY A 1 110 ? -13.724 19.936  -27.061 1.00 0.00 ? 110 GLY A HA3  2  
ATOM 3310  N N    . PRO A 1 111 ? -11.021 21.693  -26.432 1.00 0.00 ? 111 PRO A N    2  
ATOM 3311  C CA   . PRO A 1 111 ? -10.517 22.978  -25.940 1.00 0.00 ? 111 PRO A CA   2  
ATOM 3312  C C    . PRO A 1 111 ? -11.060 24.158  -26.739 1.00 0.00 ? 111 PRO A C    2  
ATOM 3313  O O    . PRO A 1 111 ? -11.255 24.062  -27.950 1.00 0.00 ? 111 PRO A O    2  
ATOM 3314  C CB   . PRO A 1 111 ? -9.002  22.860  -26.124 1.00 0.00 ? 111 PRO A CB   2  
ATOM 3315  C CG   . PRO A 1 111 ? -8.830  21.870  -27.224 1.00 0.00 ? 111 PRO A CG   2  
ATOM 3316  C CD   . PRO A 1 111 ? -9.969  20.897  -27.087 1.00 0.00 ? 111 PRO A CD   2  
ATOM 3317  H HA   . PRO A 1 111 ? -10.744 23.119  -24.893 1.00 0.00 ? 111 PRO A HA   2  
ATOM 3318  H HB2  . PRO A 1 111 ? -8.592  23.824  -26.391 1.00 0.00 ? 111 PRO A HB2  2  
ATOM 3319  H HB3  . PRO A 1 111 ? -8.550  22.512  -25.207 1.00 0.00 ? 111 PRO A HB3  2  
ATOM 3320  H HG2  . PRO A 1 111 ? -8.877  22.370  -28.179 1.00 0.00 ? 111 PRO A HG2  2  
ATOM 3321  H HG3  . PRO A 1 111 ? -7.885  21.358  -27.113 1.00 0.00 ? 111 PRO A HG3  2  
ATOM 3322  H HD2  . PRO A 1 111 ? -10.292 20.555  -28.059 1.00 0.00 ? 111 PRO A HD2  2  
ATOM 3323  H HD3  . PRO A 1 111 ? -9.678  20.061  -26.469 1.00 0.00 ? 111 PRO A HD3  2  
ATOM 3324  N N    . SER A 1 112 ? -11.301 25.271  -26.052 1.00 0.00 ? 112 SER A N    2  
ATOM 3325  C CA   . SER A 1 112 ? -11.824 26.469  -26.698 1.00 0.00 ? 112 SER A CA   2  
ATOM 3326  C C    . SER A 1 112 ? -10.926 27.671  -26.423 1.00 0.00 ? 112 SER A C    2  
ATOM 3327  O O    . SER A 1 112 ? -10.036 27.613  -25.574 1.00 0.00 ? 112 SER A O    2  
ATOM 3328  C CB   . SER A 1 112 ? -13.245 26.757  -26.210 1.00 0.00 ? 112 SER A CB   2  
ATOM 3329  O OG   . SER A 1 112 ? -13.277 26.923  -24.803 1.00 0.00 ? 112 SER A OG   2  
ATOM 3330  H H    . SER A 1 112 ? -11.124 25.285  -25.088 1.00 0.00 ? 112 SER A H    2  
ATOM 3331  H HA   . SER A 1 112 ? -11.848 26.288  -27.763 1.00 0.00 ? 112 SER A HA   2  
ATOM 3332  H HB2  . SER A 1 112 ? -13.606 27.662  -26.675 1.00 0.00 ? 112 SER A HB2  2  
ATOM 3333  H HB3  . SER A 1 112 ? -13.889 25.933  -26.479 1.00 0.00 ? 112 SER A HB3  2  
ATOM 3334  H HG   . SER A 1 112 ? -13.119 27.844  -24.585 1.00 0.00 ? 112 SER A HG   2  
ATOM 3335  N N    . SER A 1 113 ? -11.166 28.759  -27.148 1.00 0.00 ? 113 SER A N    2  
ATOM 3336  C CA   . SER A 1 113 ? -10.377 29.975  -26.985 1.00 0.00 ? 113 SER A CA   2  
ATOM 3337  C C    . SER A 1 113 ? -11.180 31.203  -27.402 1.00 0.00 ? 113 SER A C    2  
ATOM 3338  O O    . SER A 1 113 ? -12.152 31.099  -28.149 1.00 0.00 ? 113 SER A O    2  
ATOM 3339  C CB   . SER A 1 113 ? -9.092  29.888  -27.811 1.00 0.00 ? 113 SER A CB   2  
ATOM 3340  O OG   . SER A 1 113 ? -8.105  29.124  -27.139 1.00 0.00 ? 113 SER A OG   2  
ATOM 3341  H H    . SER A 1 113 ? -11.890 28.743  -27.809 1.00 0.00 ? 113 SER A H    2  
ATOM 3342  H HA   . SER A 1 113 ? -10.119 30.065  -25.941 1.00 0.00 ? 113 SER A HA   2  
ATOM 3343  H HB2  . SER A 1 113 ? -9.307  29.421  -28.760 1.00 0.00 ? 113 SER A HB2  2  
ATOM 3344  H HB3  . SER A 1 113 ? -8.707  30.883  -27.979 1.00 0.00 ? 113 SER A HB3  2  
ATOM 3345  H HG   . SER A 1 113 ? -7.436  29.710  -26.780 1.00 0.00 ? 113 SER A HG   2  
ATOM 3346  N N    . GLY A 1 114 ? -10.766 32.368  -26.912 1.00 0.00 ? 114 GLY A N    2  
ATOM 3347  C CA   . GLY A 1 114 ? -11.457 33.600  -27.243 1.00 0.00 ? 114 GLY A CA   2  
ATOM 3348  C C    . GLY A 1 114 ? -10.532 34.639  -27.846 1.00 0.00 ? 114 GLY A C    2  
ATOM 3349  O O    . GLY A 1 114 ? -10.721 35.839  -27.645 1.00 0.00 ? 114 GLY A O    2  
ATOM 3350  H H    . GLY A 1 114 ? -9.984  32.390  -26.320 1.00 0.00 ? 114 GLY A H    2  
ATOM 3351  H HA2  . GLY A 1 114 ? -12.244 33.380  -27.949 1.00 0.00 ? 114 GLY A HA2  2  
ATOM 3352  H HA3  . GLY A 1 114 ? -11.897 34.005  -26.344 1.00 0.00 ? 114 GLY A HA3  2  
ATOM 3353  N N    . GLY A 1 1   ? -37.810 -2.787  2.360   1.00 0.00 ? 1   GLY A N    3  
ATOM 3354  C CA   . GLY A 1 1   ? -37.891 -3.040  3.786   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3355  C C    . GLY A 1 1   ? -37.553 -1.816  4.613   1.00 0.00 ? 1   GLY A C    3  
ATOM 3356  O O    . GLY A 1 1   ? -37.609 -0.690  4.119   1.00 0.00 ? 1   GLY A O    3  
ATOM 3357  H H1   . GLY A 1 1   ? -37.819 -1.865  2.027   1.00 0.00 ? 1   GLY A H1   3  
ATOM 3358  H HA2  . GLY A 1 1   ? -38.894 -3.360  4.028   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3359  H HA3  . GLY A 1 1   ? -37.201 -3.832  4.039   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3360  N N    . SER A 1 2   ? -37.202 -2.035  5.876   1.00 0.00 ? 2   SER A N    3  
ATOM 3361  C CA   . SER A 1 2   ? -36.859 -0.939  6.775   1.00 0.00 ? 2   SER A CA   3  
ATOM 3362  C C    . SER A 1 2   ? -35.651 -0.167  6.254   1.00 0.00 ? 2   SER A C    3  
ATOM 3363  O O    . SER A 1 2   ? -34.986 -0.595  5.311   1.00 0.00 ? 2   SER A O    3  
ATOM 3364  C CB   . SER A 1 2   ? -36.570 -1.475  8.179   1.00 0.00 ? 2   SER A CB   3  
ATOM 3365  O OG   . SER A 1 2   ? -35.412 -2.292  8.184   1.00 0.00 ? 2   SER A OG   3  
ATOM 3366  H H    . SER A 1 2   ? -37.176 -2.956  6.212   1.00 0.00 ? 2   SER A H    3  
ATOM 3367  H HA   . SER A 1 2   ? -37.706 -0.271  6.822   1.00 0.00 ? 2   SER A HA   3  
ATOM 3368  H HB2  . SER A 1 2   ? -36.414 -0.646  8.853   1.00 0.00 ? 2   SER A HB2  3  
ATOM 3369  H HB3  . SER A 1 2   ? -37.412 -2.061  8.518   1.00 0.00 ? 2   SER A HB3  3  
ATOM 3370  H HG   . SER A 1 2   ? -34.731 -1.886  7.643   1.00 0.00 ? 2   SER A HG   3  
ATOM 3371  N N    . SER A 1 3   ? -35.374 0.975   6.876   1.00 0.00 ? 3   SER A N    3  
ATOM 3372  C CA   . SER A 1 3   ? -34.249 1.811   6.474   1.00 0.00 ? 3   SER A CA   3  
ATOM 3373  C C    . SER A 1 3   ? -33.225 1.922   7.599   1.00 0.00 ? 3   SER A C    3  
ATOM 3374  O O    . SER A 1 3   ? -33.514 2.463   8.665   1.00 0.00 ? 3   SER A O    3  
ATOM 3375  C CB   . SER A 1 3   ? -34.738 3.204   6.074   1.00 0.00 ? 3   SER A CB   3  
ATOM 3376  O OG   . SER A 1 3   ? -35.503 3.793   7.112   1.00 0.00 ? 3   SER A OG   3  
ATOM 3377  H H    . SER A 1 3   ? -35.942 1.263   7.621   1.00 0.00 ? 3   SER A H    3  
ATOM 3378  H HA   . SER A 1 3   ? -33.779 1.345   5.620   1.00 0.00 ? 3   SER A HA   3  
ATOM 3379  H HB2  . SER A 1 3   ? -33.888 3.836   5.867   1.00 0.00 ? 3   SER A HB2  3  
ATOM 3380  H HB3  . SER A 1 3   ? -35.353 3.127   5.189   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3381  H HG   . SER A 1 3   ? -36.365 4.043   6.772   1.00 0.00 ? 3   SER A HG   3  
ATOM 3382  N N    . GLY A 1 4   ? -32.025 1.405   7.353   1.00 0.00 ? 4   GLY A N    3  
ATOM 3383  C CA   . GLY A 1 4   ? -30.976 1.455   8.354   1.00 0.00 ? 4   GLY A CA   3  
ATOM 3384  C C    . GLY A 1 4   ? -29.618 1.083   7.790   1.00 0.00 ? 4   GLY A C    3  
ATOM 3385  O O    . GLY A 1 4   ? -28.625 1.764   8.046   1.00 0.00 ? 4   GLY A O    3  
ATOM 3386  H H    . GLY A 1 4   ? -31.851 0.985   6.484   1.00 0.00 ? 4   GLY A H    3  
ATOM 3387  H HA2  . GLY A 1 4   ? -30.925 2.456   8.756   1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3388  H HA3  . GLY A 1 4   ? -31.221 0.769   9.151   1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3389  N N    . SER A 1 5   ? -29.575 -0.001  7.022   1.00 0.00 ? 5   SER A N    3  
ATOM 3390  C CA   . SER A 1 5   ? -28.328 -0.465  6.426   1.00 0.00 ? 5   SER A CA   3  
ATOM 3391  C C    . SER A 1 5   ? -28.454 -0.560  4.908   1.00 0.00 ? 5   SER A C    3  
ATOM 3392  O O    . SER A 1 5   ? -29.492 -0.964  4.384   1.00 0.00 ? 5   SER A O    3  
ATOM 3393  C CB   . SER A 1 5   ? -27.939 -1.828  7.002   1.00 0.00 ? 5   SER A CB   3  
ATOM 3394  O OG   . SER A 1 5   ? -26.776 -2.336  6.370   1.00 0.00 ? 5   SER A OG   3  
ATOM 3395  H H    . SER A 1 5   ? -30.401 -0.501  6.855   1.00 0.00 ? 5   SER A H    3  
ATOM 3396  H HA   . SER A 1 5   ? -27.558 0.252   6.667   1.00 0.00 ? 5   SER A HA   3  
ATOM 3397  H HB2  . SER A 1 5   ? -27.744 -1.726  8.059   1.00 0.00 ? 5   SER A HB2  3  
ATOM 3398  H HB3  . SER A 1 5   ? -28.750 -2.525  6.851   1.00 0.00 ? 5   SER A HB3  3  
ATOM 3399  H HG   . SER A 1 5   ? -26.126 -2.570  7.036   1.00 0.00 ? 5   SER A HG   3  
ATOM 3400  N N    . SER A 1 6   ? -27.389 -0.183  4.207   1.00 0.00 ? 6   SER A N    3  
ATOM 3401  C CA   . SER A 1 6   ? -27.381 -0.222  2.750   1.00 0.00 ? 6   SER A CA   3  
ATOM 3402  C C    . SER A 1 6   ? -26.231 -1.083  2.236   1.00 0.00 ? 6   SER A C    3  
ATOM 3403  O O    . SER A 1 6   ? -25.092 -0.946  2.679   1.00 0.00 ? 6   SER A O    3  
ATOM 3404  C CB   . SER A 1 6   ? -27.266 1.194   2.182   1.00 0.00 ? 6   SER A CB   3  
ATOM 3405  O OG   . SER A 1 6   ? -28.323 2.017   2.645   1.00 0.00 ? 6   SER A OG   3  
ATOM 3406  H H    . SER A 1 6   ? -26.591 0.130   4.683   1.00 0.00 ? 6   SER A H    3  
ATOM 3407  H HA   . SER A 1 6   ? -28.314 -0.656  2.424   1.00 0.00 ? 6   SER A HA   3  
ATOM 3408  H HB2  . SER A 1 6   ? -26.327 1.628   2.491   1.00 0.00 ? 6   SER A HB2  3  
ATOM 3409  H HB3  . SER A 1 6   ? -27.305 1.151   1.103   1.00 0.00 ? 6   SER A HB3  3  
ATOM 3410  H HG   . SER A 1 6   ? -28.602 1.721   3.514   1.00 0.00 ? 6   SER A HG   3  
ATOM 3411  N N    . GLY A 1 7   ? -26.540 -1.971  1.296   1.00 0.00 ? 7   GLY A N    3  
ATOM 3412  C CA   . GLY A 1 7   ? -25.523 -2.842  0.736   1.00 0.00 ? 7   GLY A CA   3  
ATOM 3413  C C    . GLY A 1 7   ? -26.091 -3.824  -0.271  1.00 0.00 ? 7   GLY A C    3  
ATOM 3414  O O    . GLY A 1 7   ? -26.387 -4.969  0.069   1.00 0.00 ? 7   GLY A O    3  
ATOM 3415  H H    . GLY A 1 7   ? -27.466 -2.036  0.980   1.00 0.00 ? 7   GLY A H    3  
ATOM 3416  H HA2  . GLY A 1 7   ? -24.774 -2.236  0.249   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3417  H HA3  . GLY A 1 7   ? -25.059 -3.396  1.538   1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3418  N N    . GLU A 1 8   ? -26.244 -3.374  -1.512  1.00 0.00 ? 8   GLU A N    3  
ATOM 3419  C CA   . GLU A 1 8   ? -26.782 -4.221  -2.570  1.00 0.00 ? 8   GLU A CA   3  
ATOM 3420  C C    . GLU A 1 8   ? -25.833 -4.271  -3.763  1.00 0.00 ? 8   GLU A C    3  
ATOM 3421  O O    . GLU A 1 8   ? -25.293 -3.247  -4.184  1.00 0.00 ? 8   GLU A O    3  
ATOM 3422  C CB   . GLU A 1 8   ? -28.153 -3.708  -3.016  1.00 0.00 ? 8   GLU A CB   3  
ATOM 3423  C CG   . GLU A 1 8   ? -28.090 -2.413  -3.809  1.00 0.00 ? 8   GLU A CG   3  
ATOM 3424  C CD   . GLU A 1 8   ? -29.424 -1.694  -3.858  1.00 0.00 ? 8   GLU A CD   3  
ATOM 3425  O OE1  . GLU A 1 8   ? -30.395 -2.279  -4.382  1.00 0.00 ? 8   GLU A OE1  3  
ATOM 3426  O OE2  . GLU A 1 8   ? -29.496 -0.545  -3.373  1.00 0.00 ? 8   GLU A OE2  3  
ATOM 3427  H H    . GLU A 1 8   ? -25.989 -2.451  -1.721  1.00 0.00 ? 8   GLU A H    3  
ATOM 3428  H HA   . GLU A 1 8   ? -26.894 -5.218  -2.172  1.00 0.00 ? 8   GLU A HA   3  
ATOM 3429  H HB2  . GLU A 1 8   ? -28.623 -4.461  -3.632  1.00 0.00 ? 8   GLU A HB2  3  
ATOM 3430  H HB3  . GLU A 1 8   ? -28.763 -3.540  -2.141  1.00 0.00 ? 8   GLU A HB3  3  
ATOM 3431  H HG2  . GLU A 1 8   ? -27.363 -1.760  -3.350  1.00 0.00 ? 8   GLU A HG2  3  
ATOM 3432  H HG3  . GLU A 1 8   ? -27.782 -2.639  -4.819  1.00 0.00 ? 8   GLU A HG3  3  
ATOM 3433  N N    . ILE A 1 9   ? -25.633 -5.468  -4.303  1.00 0.00 ? 9   ILE A N    3  
ATOM 3434  C CA   . ILE A 1 9   ? -24.750 -5.652  -5.448  1.00 0.00 ? 9   ILE A CA   3  
ATOM 3435  C C    . ILE A 1 9   ? -25.481 -5.377  -6.757  1.00 0.00 ? 9   ILE A C    3  
ATOM 3436  O O    . ILE A 1 9   ? -26.511 -5.988  -7.044  1.00 0.00 ? 9   ILE A O    3  
ATOM 3437  C CB   . ILE A 1 9   ? -24.168 -7.078  -5.487  1.00 0.00 ? 9   ILE A CB   3  
ATOM 3438  C CG1  . ILE A 1 9   ? -23.473 -7.405  -4.164  1.00 0.00 ? 9   ILE A CG1  3  
ATOM 3439  C CG2  . ILE A 1 9   ? -23.199 -7.223  -6.651  1.00 0.00 ? 9   ILE A CG2  3  
ATOM 3440  C CD1  . ILE A 1 9   ? -23.366 -8.889  -3.889  1.00 0.00 ? 9   ILE A CD1  3  
ATOM 3441  H H    . ILE A 1 9   ? -26.092 -6.246  -3.924  1.00 0.00 ? 9   ILE A H    3  
ATOM 3442  H HA   . ILE A 1 9   ? -23.931 -4.953  -5.352  1.00 0.00 ? 9   ILE A HA   3  
ATOM 3443  H HB   . ILE A 1 9   ? -24.982 -7.770  -5.639  1.00 0.00 ? 9   ILE A HB   3  
ATOM 3444  H HG12 . ILE A 1 9   ? -22.475 -6.998  -4.178  1.00 0.00 ? 9   ILE A HG12 3  
ATOM 3445  H HG13 . ILE A 1 9   ? -24.029 -6.956  -3.353  1.00 0.00 ? 9   ILE A HG13 3  
ATOM 3446  H HG21 . ILE A 1 9   ? -22.204 -6.956  -6.325  1.00 0.00 ? 9   ILE A HG21 3  
ATOM 3447  H HG22 . ILE A 1 9   ? -23.202 -8.246  -6.996  1.00 0.00 ? 9   ILE A HG22 3  
ATOM 3448  H HG23 . ILE A 1 9   ? -23.502 -6.570  -7.455  1.00 0.00 ? 9   ILE A HG23 3  
ATOM 3449  H HD11 . ILE A 1 9   ? -23.116 -9.045  -2.850  1.00 0.00 ? 9   ILE A HD11 3  
ATOM 3450  H HD12 . ILE A 1 9   ? -24.309 -9.365  -4.108  1.00 0.00 ? 9   ILE A HD12 3  
ATOM 3451  H HD13 . ILE A 1 9   ? -22.593 -9.315  -4.512  1.00 0.00 ? 9   ILE A HD13 3  
ATOM 3452  N N    . GLU A 1 10  ? -24.942 -4.456  -7.549  1.00 0.00 ? 10  GLU A N    3  
ATOM 3453  C CA   . GLU A 1 10  ? -25.544 -4.101  -8.829  1.00 0.00 ? 10  GLU A CA   3  
ATOM 3454  C C    . GLU A 1 10  ? -25.433 -5.256  -9.820  1.00 0.00 ? 10  GLU A C    3  
ATOM 3455  O O    . GLU A 1 10  ? -24.651 -6.186  -9.621  1.00 0.00 ? 10  GLU A O    3  
ATOM 3456  C CB   . GLU A 1 10  ? -24.872 -2.853  -9.405  1.00 0.00 ? 10  GLU A CB   3  
ATOM 3457  C CG   . GLU A 1 10  ? -23.418 -3.068  -9.791  1.00 0.00 ? 10  GLU A CG   3  
ATOM 3458  C CD   . GLU A 1 10  ? -22.759 -1.803  -10.306 1.00 0.00 ? 10  GLU A CD   3  
ATOM 3459  O OE1  . GLU A 1 10  ? -23.156 -0.705  -9.863  1.00 0.00 ? 10  GLU A OE1  3  
ATOM 3460  O OE2  . GLU A 1 10  ? -21.846 -1.911  -11.151 1.00 0.00 ? 10  GLU A OE2  3  
ATOM 3461  H H    . GLU A 1 10  ? -24.120 -4.003  -7.265  1.00 0.00 ? 10  GLU A H    3  
ATOM 3462  H HA   . GLU A 1 10  ? -26.588 -3.890  -8.656  1.00 0.00 ? 10  GLU A HA   3  
ATOM 3463  H HB2  . GLU A 1 10  ? -25.415 -2.541  -10.285 1.00 0.00 ? 10  GLU A HB2  3  
ATOM 3464  H HB3  . GLU A 1 10  ? -24.914 -2.064  -8.669  1.00 0.00 ? 10  GLU A HB3  3  
ATOM 3465  H HG2  . GLU A 1 10  ? -22.875 -3.411  -8.923  1.00 0.00 ? 10  GLU A HG2  3  
ATOM 3466  H HG3  . GLU A 1 10  ? -23.372 -3.821  -10.564 1.00 0.00 ? 10  GLU A HG3  3  
ATOM 3467  N N    . ILE A 1 11  ? -26.222 -5.189  -10.887 1.00 0.00 ? 11  ILE A N    3  
ATOM 3468  C CA   . ILE A 1 11  ? -26.212 -6.228  -11.910 1.00 0.00 ? 11  ILE A CA   3  
ATOM 3469  C C    . ILE A 1 11  ? -25.125 -5.969  -12.947 1.00 0.00 ? 11  ILE A C    3  
ATOM 3470  O O    . ILE A 1 11  ? -24.352 -6.865  -13.288 1.00 0.00 ? 11  ILE A O    3  
ATOM 3471  C CB   . ILE A 1 11  ? -27.573 -6.328  -12.624 1.00 0.00 ? 11  ILE A CB   3  
ATOM 3472  C CG1  . ILE A 1 11  ? -28.709 -6.376  -11.600 1.00 0.00 ? 11  ILE A CG1  3  
ATOM 3473  C CG2  . ILE A 1 11  ? -27.611 -7.554  -13.523 1.00 0.00 ? 11  ILE A CG2  3  
ATOM 3474  C CD1  . ILE A 1 11  ? -28.997 -7.768  -11.082 1.00 0.00 ? 11  ILE A CD1  3  
ATOM 3475  H H    . ILE A 1 11  ? -26.824 -4.423  -10.990 1.00 0.00 ? 11  ILE A H    3  
ATOM 3476  H HA   . ILE A 1 11  ? -26.013 -7.172  -11.423 1.00 0.00 ? 11  ILE A HA   3  
ATOM 3477  H HB   . ILE A 1 11  ? -27.694 -5.452  -13.244 1.00 0.00 ? 11  ILE A HB   3  
ATOM 3478  H HG12 . ILE A 1 11  ? -28.451 -5.756  -10.756 1.00 0.00 ? 11  ILE A HG12 3  
ATOM 3479  H HG13 . ILE A 1 11  ? -29.612 -5.997  -12.056 1.00 0.00 ? 11  ILE A HG13 3  
ATOM 3480  H HG21 . ILE A 1 11  ? -28.590 -7.643  -13.970 1.00 0.00 ? 11  ILE A HG21 3  
ATOM 3481  H HG22 . ILE A 1 11  ? -26.869 -7.452  -14.301 1.00 0.00 ? 11  ILE A HG22 3  
ATOM 3482  H HG23 . ILE A 1 11  ? -27.401 -8.437  -12.938 1.00 0.00 ? 11  ILE A HG23 3  
ATOM 3483  H HD11 . ILE A 1 11  ? -29.836 -7.734  -10.403 1.00 0.00 ? 11  ILE A HD11 3  
ATOM 3484  H HD12 . ILE A 1 11  ? -29.230 -8.419  -11.911 1.00 0.00 ? 11  ILE A HD12 3  
ATOM 3485  H HD13 . ILE A 1 11  ? -28.129 -8.145  -10.561 1.00 0.00 ? 11  ILE A HD13 3  
ATOM 3486  N N    . CYS A 1 12  ? -25.069 -4.738  -13.442 1.00 0.00 ? 12  CYS A N    3  
ATOM 3487  C CA   . CYS A 1 12  ? -24.075 -4.359  -14.440 1.00 0.00 ? 12  CYS A CA   3  
ATOM 3488  C C    . CYS A 1 12  ? -22.685 -4.838  -14.031 1.00 0.00 ? 12  CYS A C    3  
ATOM 3489  O O    . CYS A 1 12  ? -22.299 -4.777  -12.864 1.00 0.00 ? 12  CYS A O    3  
ATOM 3490  C CB   . CYS A 1 12  ? -24.068 -2.842  -14.634 1.00 0.00 ? 12  CYS A CB   3  
ATOM 3491  S SG   . CYS A 1 12  ? -25.367 -2.234  -15.736 1.00 0.00 ? 12  CYS A SG   3  
ATOM 3492  H H    . CYS A 1 12  ? -25.712 -4.067  -13.131 1.00 0.00 ? 12  CYS A H    3  
ATOM 3493  H HA   . CYS A 1 12  ? -24.345 -4.832  -15.372 1.00 0.00 ? 12  CYS A HA   3  
ATOM 3494  H HB2  . CYS A 1 12  ? -24.201 -2.364  -13.675 1.00 0.00 ? 12  CYS A HB2  3  
ATOM 3495  H HB3  . CYS A 1 12  ? -23.117 -2.544  -15.049 1.00 0.00 ? 12  CYS A HB3  3  
ATOM 3496  H HG   . CYS A 1 12  ? -24.954 -2.399  -16.984 1.00 0.00 ? 12  CYS A HG   3  
ATOM 3497  N N    . PRO A 1 13  ? -21.915 -5.327  -15.014 1.00 0.00 ? 13  PRO A N    3  
ATOM 3498  C CA   . PRO A 1 13  ? -20.556 -5.826  -14.781 1.00 0.00 ? 13  PRO A CA   3  
ATOM 3499  C C    . PRO A 1 13  ? -19.578 -4.708  -14.438 1.00 0.00 ? 13  PRO A C    3  
ATOM 3500  O O    . PRO A 1 13  ? -19.970 -3.551  -14.285 1.00 0.00 ? 13  PRO A O    3  
ATOM 3501  C CB   . PRO A 1 13  ? -20.182 -6.473  -16.117 1.00 0.00 ? 13  PRO A CB   3  
ATOM 3502  C CG   . PRO A 1 13  ? -21.022 -5.769  -17.127 1.00 0.00 ? 13  PRO A CG   3  
ATOM 3503  C CD   . PRO A 1 13  ? -22.310 -5.429  -16.429 1.00 0.00 ? 13  PRO A CD   3  
ATOM 3504  H HA   . PRO A 1 13  ? -20.537 -6.573  -14.001 1.00 0.00 ? 13  PRO A HA   3  
ATOM 3505  H HB2  . PRO A 1 13  ? -19.128 -6.326  -16.308 1.00 0.00 ? 13  PRO A HB2  3  
ATOM 3506  H HB3  . PRO A 1 13  ? -20.404 -7.528  -16.086 1.00 0.00 ? 13  PRO A HB3  3  
ATOM 3507  H HG2  . PRO A 1 13  ? -20.525 -4.870  -17.456 1.00 0.00 ? 13  PRO A HG2  3  
ATOM 3508  H HG3  . PRO A 1 13  ? -21.212 -6.423  -17.965 1.00 0.00 ? 13  PRO A HG3  3  
ATOM 3509  H HD2  . PRO A 1 13  ? -22.697 -4.488  -16.790 1.00 0.00 ? 13  PRO A HD2  3  
ATOM 3510  H HD3  . PRO A 1 13  ? -23.035 -6.217  -16.570 1.00 0.00 ? 13  PRO A HD3  3  
ATOM 3511  N N    . LYS A 1 14  ? -18.303 -5.060  -14.318 1.00 0.00 ? 14  LYS A N    3  
ATOM 3512  C CA   . LYS A 1 14  ? -17.267 -4.086  -13.994 1.00 0.00 ? 14  LYS A CA   3  
ATOM 3513  C C    . LYS A 1 14  ? -16.081 -4.217  -14.944 1.00 0.00 ? 14  LYS A C    3  
ATOM 3514  O O    . LYS A 1 14  ? -15.984 -5.182  -15.703 1.00 0.00 ? 14  LYS A O    3  
ATOM 3515  C CB   . LYS A 1 14  ? -16.799 -4.270  -12.549 1.00 0.00 ? 14  LYS A CB   3  
ATOM 3516  C CG   . LYS A 1 14  ? -17.912 -4.127  -11.526 1.00 0.00 ? 14  LYS A CG   3  
ATOM 3517  C CD   . LYS A 1 14  ? -18.072 -2.686  -11.073 1.00 0.00 ? 14  LYS A CD   3  
ATOM 3518  C CE   . LYS A 1 14  ? -17.198 -2.380  -9.867  1.00 0.00 ? 14  LYS A CE   3  
ATOM 3519  N NZ   . LYS A 1 14  ? -15.749 -2.421  -10.208 1.00 0.00 ? 14  LYS A NZ   3  
ATOM 3520  H H    . LYS A 1 14  ? -18.051 -5.999  -14.451 1.00 0.00 ? 14  LYS A H    3  
ATOM 3521  H HA   . LYS A 1 14  ? -17.693 -3.100  -14.103 1.00 0.00 ? 14  LYS A HA   3  
ATOM 3522  H HB2  . LYS A 1 14  ? -16.367 -5.255  -12.445 1.00 0.00 ? 14  LYS A HB2  3  
ATOM 3523  H HB3  . LYS A 1 14  ? -16.042 -3.531  -12.331 1.00 0.00 ? 14  LYS A HB3  3  
ATOM 3524  H HG2  . LYS A 1 14  ? -18.840 -4.460  -11.968 1.00 0.00 ? 14  LYS A HG2  3  
ATOM 3525  H HG3  . LYS A 1 14  ? -17.681 -4.741  -10.667 1.00 0.00 ? 14  LYS A HG3  3  
ATOM 3526  H HD2  . LYS A 1 14  ? -17.791 -2.030  -11.884 1.00 0.00 ? 14  LYS A HD2  3  
ATOM 3527  H HD3  . LYS A 1 14  ? -19.106 -2.513  -10.811 1.00 0.00 ? 14  LYS A HD3  3  
ATOM 3528  H HE2  . LYS A 1 14  ? -17.444 -1.395  -9.501  1.00 0.00 ? 14  LYS A HE2  3  
ATOM 3529  H HE3  . LYS A 1 14  ? -17.399 -3.111  -9.098  1.00 0.00 ? 14  LYS A HE3  3  
ATOM 3530  H HZ1  . LYS A 1 14  ? -15.195 -1.934  -9.474  1.00 0.00 ? 14  LYS A HZ1  3  
ATOM 3531  H HZ2  . LYS A 1 14  ? -15.583 -1.951  -11.121 1.00 0.00 ? 14  LYS A HZ2  3  
ATOM 3532  H HZ3  . LYS A 1 14  ? -15.425 -3.407  -10.274 1.00 0.00 ? 14  LYS A HZ3  3  
ATOM 3533  N N    . VAL A 1 15  ? -15.180 -3.241  -14.897 1.00 0.00 ? 15  VAL A N    3  
ATOM 3534  C CA   . VAL A 1 15  ? -13.998 -3.249  -15.751 1.00 0.00 ? 15  VAL A CA   3  
ATOM 3535  C C    . VAL A 1 15  ? -12.744 -2.899  -14.959 1.00 0.00 ? 15  VAL A C    3  
ATOM 3536  O O    . VAL A 1 15  ? -12.788 -2.092  -14.029 1.00 0.00 ? 15  VAL A O    3  
ATOM 3537  C CB   . VAL A 1 15  ? -14.146 -2.259  -16.922 1.00 0.00 ? 15  VAL A CB   3  
ATOM 3538  C CG1  . VAL A 1 15  ? -15.187 -2.756  -17.913 1.00 0.00 ? 15  VAL A CG1  3  
ATOM 3539  C CG2  . VAL A 1 15  ? -14.507 -0.874  -16.406 1.00 0.00 ? 15  VAL A CG2  3  
ATOM 3540  H H    . VAL A 1 15  ? -15.312 -2.499  -14.271 1.00 0.00 ? 15  VAL A H    3  
ATOM 3541  H HA   . VAL A 1 15  ? -13.888 -4.243  -16.160 1.00 0.00 ? 15  VAL A HA   3  
ATOM 3542  H HB   . VAL A 1 15  ? -13.197 -2.193  -17.433 1.00 0.00 ? 15  VAL A HB   3  
ATOM 3543  H HG11 . VAL A 1 15  ? -16.103 -2.985  -17.389 1.00 0.00 ? 15  VAL A HG11 3  
ATOM 3544  H HG12 . VAL A 1 15  ? -15.376 -1.990  -18.652 1.00 0.00 ? 15  VAL A HG12 3  
ATOM 3545  H HG13 . VAL A 1 15  ? -14.822 -3.646  -18.403 1.00 0.00 ? 15  VAL A HG13 3  
ATOM 3546  H HG21 . VAL A 1 15  ? -13.840 -0.144  -16.839 1.00 0.00 ? 15  VAL A HG21 3  
ATOM 3547  H HG22 . VAL A 1 15  ? -15.525 -0.640  -16.683 1.00 0.00 ? 15  VAL A HG22 3  
ATOM 3548  H HG23 . VAL A 1 15  ? -14.414 -0.855  -15.330 1.00 0.00 ? 15  VAL A HG23 3  
ATOM 3549  N N    . THR A 1 16  ? -11.624 -3.510  -15.332 1.00 0.00 ? 16  THR A N    3  
ATOM 3550  C CA   . THR A 1 16  ? -10.357 -3.263  -14.657 1.00 0.00 ? 16  THR A CA   3  
ATOM 3551  C C    . THR A 1 16  ? -9.612  -2.096  -15.294 1.00 0.00 ? 16  THR A C    3  
ATOM 3552  O O    . THR A 1 16  ? -9.548  -1.984  -16.518 1.00 0.00 ? 16  THR A O    3  
ATOM 3553  C CB   . THR A 1 16  ? -9.453  -4.511  -14.684 1.00 0.00 ? 16  THR A CB   3  
ATOM 3554  O OG1  . THR A 1 16  ? -9.584  -5.182  -15.943 1.00 0.00 ? 16  THR A OG1  3  
ATOM 3555  C CG2  . THR A 1 16  ? -9.813  -5.465  -13.555 1.00 0.00 ? 16  THR A CG2  3  
ATOM 3556  H H    . THR A 1 16  ? -11.653 -4.142  -16.080 1.00 0.00 ? 16  THR A H    3  
ATOM 3557  H HA   . THR A 1 16  ? -10.570 -3.022  -13.625 1.00 0.00 ? 16  THR A HA   3  
ATOM 3558  H HB   . THR A 1 16  ? -8.427  -4.196  -14.557 1.00 0.00 ? 16  THR A HB   3  
ATOM 3559  H HG1  . THR A 1 16  ? -9.331  -4.585  -16.651 1.00 0.00 ? 16  THR A HG1  3  
ATOM 3560  H HG21 . THR A 1 16  ? -10.218 -4.904  -12.725 1.00 0.00 ? 16  THR A HG21 3  
ATOM 3561  H HG22 . THR A 1 16  ? -8.928  -5.994  -13.235 1.00 0.00 ? 16  THR A HG22 3  
ATOM 3562  H HG23 . THR A 1 16  ? -10.550 -6.173  -13.904 1.00 0.00 ? 16  THR A HG23 3  
ATOM 3563  N N    . GLN A 1 17  ? -9.050  -1.231  -14.456 1.00 0.00 ? 17  GLN A N    3  
ATOM 3564  C CA   . GLN A 1 17  ? -8.309  -0.072  -14.939 1.00 0.00 ? 17  GLN A CA   3  
ATOM 3565  C C    . GLN A 1 17  ? -7.024  0.124   -14.142 1.00 0.00 ? 17  GLN A C    3  
ATOM 3566  O O    . GLN A 1 17  ? -7.040  0.131   -12.911 1.00 0.00 ? 17  GLN A O    3  
ATOM 3567  C CB   . GLN A 1 17  ? -9.175  1.187   -14.851 1.00 0.00 ? 17  GLN A CB   3  
ATOM 3568  C CG   . GLN A 1 17  ? -9.264  1.767   -13.449 1.00 0.00 ? 17  GLN A CG   3  
ATOM 3569  C CD   . GLN A 1 17  ? -10.040 3.068   -13.404 1.00 0.00 ? 17  GLN A CD   3  
ATOM 3570  O OE1  . GLN A 1 17  ? -10.518 3.555   -14.429 1.00 0.00 ? 17  GLN A OE1  3  
ATOM 3571  N NE2  . GLN A 1 17  ? -10.170 3.639   -12.212 1.00 0.00 ? 17  GLN A NE2  3  
ATOM 3572  H H    . GLN A 1 17  ? -9.136  -1.375  -13.491 1.00 0.00 ? 17  GLN A H    3  
ATOM 3573  H HA   . GLN A 1 17  ? -8.053  -0.249  -15.973 1.00 0.00 ? 17  GLN A HA   3  
ATOM 3574  H HB2  . GLN A 1 17  ? -8.761  1.940   -15.504 1.00 0.00 ? 17  GLN A HB2  3  
ATOM 3575  H HB3  . GLN A 1 17  ? -10.174 0.945   -15.181 1.00 0.00 ? 17  GLN A HB3  3  
ATOM 3576  H HG2  . GLN A 1 17  ? -9.755  1.050   -12.807 1.00 0.00 ? 17  GLN A HG2  3  
ATOM 3577  H HG3  . GLN A 1 17  ? -8.263  1.948   -13.084 1.00 0.00 ? 17  GLN A HG3  3  
ATOM 3578  H HE21 . GLN A 1 17  ? -9.761  3.195   -11.439 1.00 0.00 ? 17  GLN A HE21 3  
ATOM 3579  H HE22 . GLN A 1 17  ? -10.666 4.481   -12.154 1.00 0.00 ? 17  GLN A HE22 3  
ATOM 3580  N N    . SER A 1 18  ? -5.911  0.283   -14.852 1.00 0.00 ? 18  SER A N    3  
ATOM 3581  C CA   . SER A 1 18  ? -4.616  0.474   -14.210 1.00 0.00 ? 18  SER A CA   3  
ATOM 3582  C C    . SER A 1 18  ? -4.185  1.936   -14.281 1.00 0.00 ? 18  SER A C    3  
ATOM 3583  O O    . SER A 1 18  ? -4.225  2.555   -15.345 1.00 0.00 ? 18  SER A O    3  
ATOM 3584  C CB   . SER A 1 18  ? -3.559  -0.413  -14.871 1.00 0.00 ? 18  SER A CB   3  
ATOM 3585  O OG   . SER A 1 18  ? -3.266  0.034   -16.183 1.00 0.00 ? 18  SER A OG   3  
ATOM 3586  H H    . SER A 1 18  ? -5.963  0.268   -15.830 1.00 0.00 ? 18  SER A H    3  
ATOM 3587  H HA   . SER A 1 18  ? -4.715  0.190   -13.173 1.00 0.00 ? 18  SER A HA   3  
ATOM 3588  H HB2  . SER A 1 18  ? -2.653  -0.387  -14.284 1.00 0.00 ? 18  SER A HB2  3  
ATOM 3589  H HB3  . SER A 1 18  ? -3.926  -1.428  -14.922 1.00 0.00 ? 18  SER A HB3  3  
ATOM 3590  H HG   . SER A 1 18  ? -2.355  -0.178  -16.398 1.00 0.00 ? 18  SER A HG   3  
ATOM 3591  N N    . ILE A 1 19  ? -3.775  2.482   -13.141 1.00 0.00 ? 19  ILE A N    3  
ATOM 3592  C CA   . ILE A 1 19  ? -3.336  3.870   -13.074 1.00 0.00 ? 19  ILE A CA   3  
ATOM 3593  C C    . ILE A 1 19  ? -1.831  3.960   -12.841 1.00 0.00 ? 19  ILE A C    3  
ATOM 3594  O O    . ILE A 1 19  ? -1.322  3.503   -11.817 1.00 0.00 ? 19  ILE A O    3  
ATOM 3595  C CB   . ILE A 1 19  ? -4.064  4.637   -11.954 1.00 0.00 ? 19  ILE A CB   3  
ATOM 3596  C CG1  . ILE A 1 19  ? -5.576  4.606   -12.185 1.00 0.00 ? 19  ILE A CG1  3  
ATOM 3597  C CG2  . ILE A 1 19  ? -3.563  6.071   -11.882 1.00 0.00 ? 19  ILE A CG2  3  
ATOM 3598  C CD1  . ILE A 1 19  ? -6.264  3.430   -11.529 1.00 0.00 ? 19  ILE A CD1  3  
ATOM 3599  H H    . ILE A 1 19  ? -3.766  1.937   -12.327 1.00 0.00 ? 19  ILE A H    3  
ATOM 3600  H HA   . ILE A 1 19  ? -3.572  4.340   -14.017 1.00 0.00 ? 19  ILE A HA   3  
ATOM 3601  H HB   . ILE A 1 19  ? -3.841  4.155   -11.014 1.00 0.00 ? 19  ILE A HB   3  
ATOM 3602  H HG12 . ILE A 1 19  ? -6.013  5.509   -11.788 1.00 0.00 ? 19  ILE A HG12 3  
ATOM 3603  H HG13 . ILE A 1 19  ? -5.769  4.555   -13.247 1.00 0.00 ? 19  ILE A HG13 3  
ATOM 3604  H HG21 . ILE A 1 19  ? -2.609  6.145   -12.383 1.00 0.00 ? 19  ILE A HG21 3  
ATOM 3605  H HG22 . ILE A 1 19  ? -4.273  6.725   -12.365 1.00 0.00 ? 19  ILE A HG22 3  
ATOM 3606  H HG23 . ILE A 1 19  ? -3.450  6.362   -10.848 1.00 0.00 ? 19  ILE A HG23 3  
ATOM 3607  H HD11 . ILE A 1 19  ? -7.104  3.781   -10.948 1.00 0.00 ? 19  ILE A HD11 3  
ATOM 3608  H HD12 . ILE A 1 19  ? -6.611  2.745   -12.288 1.00 0.00 ? 19  ILE A HD12 3  
ATOM 3609  H HD13 . ILE A 1 19  ? -5.566  2.922   -10.879 1.00 0.00 ? 19  ILE A HD13 3  
ATOM 3610  N N    . HIS A 1 20  ? -1.125  4.554   -13.797 1.00 0.00 ? 20  HIS A N    3  
ATOM 3611  C CA   . HIS A 1 20  ? 0.322   4.707   -13.695 1.00 0.00 ? 20  HIS A CA   3  
ATOM 3612  C C    . HIS A 1 20  ? 0.687   6.091   -13.165 1.00 0.00 ? 20  HIS A C    3  
ATOM 3613  O O    . HIS A 1 20  ? 0.516   7.095   -13.856 1.00 0.00 ? 20  HIS A O    3  
ATOM 3614  C CB   . HIS A 1 20  ? 0.977   4.482   -15.058 1.00 0.00 ? 20  HIS A CB   3  
ATOM 3615  C CG   . HIS A 1 20  ? 0.809   5.633   -16.001 1.00 0.00 ? 20  HIS A CG   3  
ATOM 3616  N ND1  . HIS A 1 20  ? -0.240  5.731   -16.891 1.00 0.00 ? 20  HIS A ND1  3  
ATOM 3617  C CD2  . HIS A 1 20  ? 1.564   6.741   -16.189 1.00 0.00 ? 20  HIS A CD2  3  
ATOM 3618  C CE1  . HIS A 1 20  ? -0.122  6.848   -17.586 1.00 0.00 ? 20  HIS A CE1  3  
ATOM 3619  N NE2  . HIS A 1 20  ? 0.964   7.480   -17.179 1.00 0.00 ? 20  HIS A NE2  3  
ATOM 3620  H H    . HIS A 1 20  ? -1.587  4.898   -14.589 1.00 0.00 ? 20  HIS A H    3  
ATOM 3621  H HA   . HIS A 1 20  ? 0.687   3.963   -13.003 1.00 0.00 ? 20  HIS A HA   3  
ATOM 3622  H HB2  . HIS A 1 20  ? 2.036   4.320   -14.919 1.00 0.00 ? 20  HIS A HB2  3  
ATOM 3623  H HB3  . HIS A 1 20  ? 0.541   3.608   -15.520 1.00 0.00 ? 20  HIS A HB3  3  
ATOM 3624  H HD1  . HIS A 1 20  ? -0.962  5.078   -16.998 1.00 0.00 ? 20  HIS A HD1  3  
ATOM 3625  H HD2  . HIS A 1 20  ? 2.471   6.998   -15.659 1.00 0.00 ? 20  HIS A HD2  3  
ATOM 3626  H HE1  . HIS A 1 20  ? -0.798  7.188   -18.356 1.00 0.00 ? 20  HIS A HE1  3  
ATOM 3627  H HE2  . HIS A 1 20  ? 1.332   8.291   -17.588 1.00 0.00 ? 20  HIS A HE2  3  
ATOM 3628  N N    . ILE A 1 21  ? 1.188   6.135   -11.935 1.00 0.00 ? 21  ILE A N    3  
ATOM 3629  C CA   . ILE A 1 21  ? 1.576   7.395   -11.314 1.00 0.00 ? 21  ILE A CA   3  
ATOM 3630  C C    . ILE A 1 21  ? 3.081   7.616   -11.414 1.00 0.00 ? 21  ILE A C    3  
ATOM 3631  O O    . ILE A 1 21  ? 3.865   6.673   -11.317 1.00 0.00 ? 21  ILE A O    3  
ATOM 3632  C CB   . ILE A 1 21  ? 1.158   7.444   -9.832  1.00 0.00 ? 21  ILE A CB   3  
ATOM 3633  C CG1  . ILE A 1 21  ? -0.281  6.950   -9.669  1.00 0.00 ? 21  ILE A CG1  3  
ATOM 3634  C CG2  . ILE A 1 21  ? 1.304   8.857   -9.287  1.00 0.00 ? 21  ILE A CG2  3  
ATOM 3635  C CD1  . ILE A 1 21  ? -0.684  6.728   -8.228  1.00 0.00 ? 21  ILE A CD1  3  
ATOM 3636  H H    . ILE A 1 21  ? 1.300   5.300   -11.435 1.00 0.00 ? 21  ILE A H    3  
ATOM 3637  H HA   . ILE A 1 21  ? 1.070   8.194   -11.836 1.00 0.00 ? 21  ILE A HA   3  
ATOM 3638  H HB   . ILE A 1 21  ? 1.818   6.799   -9.274  1.00 0.00 ? 21  ILE A HB   3  
ATOM 3639  H HG12 . ILE A 1 21  ? -0.955  7.677   -10.093 1.00 0.00 ? 21  ILE A HG12 3  
ATOM 3640  H HG13 . ILE A 1 21  ? -0.393  6.012   -10.194 1.00 0.00 ? 21  ILE A HG13 3  
ATOM 3641  H HG21 . ILE A 1 21  ? 0.404   9.417   -9.495  1.00 0.00 ? 21  ILE A HG21 3  
ATOM 3642  H HG22 . ILE A 1 21  ? 1.463   8.816   -8.220  1.00 0.00 ? 21  ILE A HG22 3  
ATOM 3643  H HG23 . ILE A 1 21  ? 2.146   9.340   -9.759  1.00 0.00 ? 21  ILE A HG23 3  
ATOM 3644  H HD11 . ILE A 1 21  ? -0.599  5.678   -7.987  1.00 0.00 ? 21  ILE A HD11 3  
ATOM 3645  H HD12 . ILE A 1 21  ? -0.036  7.299   -7.580  1.00 0.00 ? 21  ILE A HD12 3  
ATOM 3646  H HD13 . ILE A 1 21  ? -1.706  7.047   -8.087  1.00 0.00 ? 21  ILE A HD13 3  
ATOM 3647  N N    . GLU A 1 22  ? 3.478   8.871   -11.606 1.00 0.00 ? 22  GLU A N    3  
ATOM 3648  C CA   . GLU A 1 22  ? 4.890   9.216   -11.717 1.00 0.00 ? 22  GLU A CA   3  
ATOM 3649  C C    . GLU A 1 22  ? 5.171   10.573  -11.079 1.00 0.00 ? 22  GLU A C    3  
ATOM 3650  O O    . GLU A 1 22  ? 4.687   11.604  -11.548 1.00 0.00 ? 22  GLU A O    3  
ATOM 3651  C CB   . GLU A 1 22  ? 5.320   9.232   -13.186 1.00 0.00 ? 22  GLU A CB   3  
ATOM 3652  C CG   . GLU A 1 22  ? 5.253   7.869   -13.854 1.00 0.00 ? 22  GLU A CG   3  
ATOM 3653  C CD   . GLU A 1 22  ? 5.187   7.963   -15.366 1.00 0.00 ? 22  GLU A CD   3  
ATOM 3654  O OE1  . GLU A 1 22  ? 4.169   8.465   -15.886 1.00 0.00 ? 22  GLU A OE1  3  
ATOM 3655  O OE2  . GLU A 1 22  ? 6.155   7.535   -16.029 1.00 0.00 ? 22  GLU A OE2  3  
ATOM 3656  H H    . GLU A 1 22  ? 2.805   9.580   -11.675 1.00 0.00 ? 22  GLU A H    3  
ATOM 3657  H HA   . GLU A 1 22  ? 5.458   8.462   -11.194 1.00 0.00 ? 22  GLU A HA   3  
ATOM 3658  H HB2  . GLU A 1 22  ? 4.677   9.908   -13.729 1.00 0.00 ? 22  GLU A HB2  3  
ATOM 3659  H HB3  . GLU A 1 22  ? 6.337   9.590   -13.246 1.00 0.00 ? 22  GLU A HB3  3  
ATOM 3660  H HG2  . GLU A 1 22  ? 6.133   7.305   -13.582 1.00 0.00 ? 22  GLU A HG2  3  
ATOM 3661  H HG3  . GLU A 1 22  ? 4.373   7.352   -13.502 1.00 0.00 ? 22  GLU A HG3  3  
ATOM 3662  N N    . LYS A 1 23  ? 5.954   10.566  -10.006 1.00 0.00 ? 23  LYS A N    3  
ATOM 3663  C CA   . LYS A 1 23  ? 6.301   11.795  -9.303  1.00 0.00 ? 23  LYS A CA   3  
ATOM 3664  C C    . LYS A 1 23  ? 7.501   12.475  -9.954  1.00 0.00 ? 23  LYS A C    3  
ATOM 3665  O O    . LYS A 1 23  ? 8.199   11.874  -10.771 1.00 0.00 ? 23  LYS A O    3  
ATOM 3666  C CB   . LYS A 1 23  ? 6.606   11.496  -7.833  1.00 0.00 ? 23  LYS A CB   3  
ATOM 3667  C CG   . LYS A 1 23  ? 5.450   10.849  -7.091  1.00 0.00 ? 23  LYS A CG   3  
ATOM 3668  C CD   . LYS A 1 23  ? 5.452   11.225  -5.618  1.00 0.00 ? 23  LYS A CD   3  
ATOM 3669  C CE   . LYS A 1 23  ? 4.640   12.486  -5.364  1.00 0.00 ? 23  LYS A CE   3  
ATOM 3670  N NZ   . LYS A 1 23  ? 4.891   13.526  -6.401  1.00 0.00 ? 23  LYS A NZ   3  
ATOM 3671  H H    . LYS A 1 23  ? 6.309   9.712   -9.680  1.00 0.00 ? 23  LYS A H    3  
ATOM 3672  H HA   . LYS A 1 23  ? 5.452   12.459  -9.357  1.00 0.00 ? 23  LYS A HA   3  
ATOM 3673  H HB2  . LYS A 1 23  ? 7.457   10.832  -7.782  1.00 0.00 ? 23  LYS A HB2  3  
ATOM 3674  H HB3  . LYS A 1 23  ? 6.854   12.422  -7.334  1.00 0.00 ? 23  LYS A HB3  3  
ATOM 3675  H HG2  . LYS A 1 23  ? 4.521   11.177  -7.534  1.00 0.00 ? 23  LYS A HG2  3  
ATOM 3676  H HG3  . LYS A 1 23  ? 5.534   9.775   -7.179  1.00 0.00 ? 23  LYS A HG3  3  
ATOM 3677  H HD2  . LYS A 1 23  ? 5.024   10.414  -5.048  1.00 0.00 ? 23  LYS A HD2  3  
ATOM 3678  H HD3  . LYS A 1 23  ? 6.471   11.394  -5.300  1.00 0.00 ? 23  LYS A HD3  3  
ATOM 3679  H HE2  . LYS A 1 23  ? 3.591   12.230  -5.370  1.00 0.00 ? 23  LYS A HE2  3  
ATOM 3680  H HE3  . LYS A 1 23  ? 4.909   12.882  -4.396  1.00 0.00 ? 23  LYS A HE3  3  
ATOM 3681  H HZ1  . LYS A 1 23  ? 4.944   13.086  -7.342  1.00 0.00 ? 23  LYS A HZ1  3  
ATOM 3682  H HZ2  . LYS A 1 23  ? 5.789   14.014  -6.207  1.00 0.00 ? 23  LYS A HZ2  3  
ATOM 3683  H HZ3  . LYS A 1 23  ? 4.121   14.225  -6.399  1.00 0.00 ? 23  LYS A HZ3  3  
ATOM 3684  N N    . SER A 1 24  ? 7.735   13.730  -9.587  1.00 0.00 ? 24  SER A N    3  
ATOM 3685  C CA   . SER A 1 24  ? 8.850   14.493  -10.137 1.00 0.00 ? 24  SER A CA   3  
ATOM 3686  C C    . SER A 1 24  ? 9.882   14.803  -9.057  1.00 0.00 ? 24  SER A C    3  
ATOM 3687  O O    . SER A 1 24  ? 9.683   15.693  -8.231  1.00 0.00 ? 24  SER A O    3  
ATOM 3688  C CB   . SER A 1 24  ? 8.345   15.793  -10.765 1.00 0.00 ? 24  SER A CB   3  
ATOM 3689  O OG   . SER A 1 24  ? 9.362   16.420  -11.528 1.00 0.00 ? 24  SER A OG   3  
ATOM 3690  H H    . SER A 1 24  ? 7.143   14.155  -8.931  1.00 0.00 ? 24  SER A H    3  
ATOM 3691  H HA   . SER A 1 24  ? 9.317   13.891  -10.903 1.00 0.00 ? 24  SER A HA   3  
ATOM 3692  H HB2  . SER A 1 24  ? 7.508   15.577  -11.412 1.00 0.00 ? 24  SER A HB2  3  
ATOM 3693  H HB3  . SER A 1 24  ? 8.030   16.469  -9.983  1.00 0.00 ? 24  SER A HB3  3  
ATOM 3694  H HG   . SER A 1 24  ? 9.153   16.345  -12.462 1.00 0.00 ? 24  SER A HG   3  
ATOM 3695  N N    . ASP A 1 25  ? 10.985  14.063  -9.072  1.00 0.00 ? 25  ASP A N    3  
ATOM 3696  C CA   . ASP A 1 25  ? 12.050  14.258  -8.095  1.00 0.00 ? 25  ASP A CA   3  
ATOM 3697  C C    . ASP A 1 25  ? 11.651  13.692  -6.736  1.00 0.00 ? 25  ASP A C    3  
ATOM 3698  O O    . ASP A 1 25  ? 11.678  14.396  -5.725  1.00 0.00 ? 25  ASP A O    3  
ATOM 3699  C CB   . ASP A 1 25  ? 12.384  15.745  -7.964  1.00 0.00 ? 25  ASP A CB   3  
ATOM 3700  C CG   . ASP A 1 25  ? 12.364  16.463  -9.299  1.00 0.00 ? 25  ASP A CG   3  
ATOM 3701  O OD1  . ASP A 1 25  ? 13.074  16.015  -10.224 1.00 0.00 ? 25  ASP A OD1  3  
ATOM 3702  O OD2  . ASP A 1 25  ? 11.638  17.472  -9.419  1.00 0.00 ? 25  ASP A OD2  3  
ATOM 3703  H H    . ASP A 1 25  ? 11.085  13.368  -9.756  1.00 0.00 ? 25  ASP A H    3  
ATOM 3704  H HA   . ASP A 1 25  ? 12.924  13.733  -8.448  1.00 0.00 ? 25  ASP A HA   3  
ATOM 3705  H HB2  . ASP A 1 25  ? 11.659  16.214  -7.314  1.00 0.00 ? 25  ASP A HB2  3  
ATOM 3706  H HB3  . ASP A 1 25  ? 13.369  15.850  -7.533  1.00 0.00 ? 25  ASP A HB3  3  
ATOM 3707  N N    . THR A 1 26  ? 11.280  12.416  -6.718  1.00 0.00 ? 26  THR A N    3  
ATOM 3708  C CA   . THR A 1 26  ? 10.874  11.755  -5.484  1.00 0.00 ? 26  THR A CA   3  
ATOM 3709  C C    . THR A 1 26  ? 11.688  12.257  -4.297  1.00 0.00 ? 26  THR A C    3  
ATOM 3710  O O    . THR A 1 26  ? 11.200  12.295  -3.168  1.00 0.00 ? 26  THR A O    3  
ATOM 3711  C CB   . THR A 1 26  ? 11.029  10.226  -5.588  1.00 0.00 ? 26  THR A CB   3  
ATOM 3712  O OG1  . THR A 1 26  ? 9.956   9.676   -6.361  1.00 0.00 ? 26  THR A OG1  3  
ATOM 3713  C CG2  . THR A 1 26  ? 11.044  9.588   -4.207  1.00 0.00 ? 26  THR A CG2  3  
ATOM 3714  H H    . THR A 1 26  ? 11.279  11.907  -7.556  1.00 0.00 ? 26  THR A H    3  
ATOM 3715  H HA   . THR A 1 26  ? 9.831   11.979  -5.313  1.00 0.00 ? 26  THR A HA   3  
ATOM 3716  H HB   . THR A 1 26  ? 11.966  10.007  -6.079  1.00 0.00 ? 26  THR A HB   3  
ATOM 3717  H HG1  . THR A 1 26  ? 9.690   10.308  -7.034  1.00 0.00 ? 26  THR A HG1  3  
ATOM 3718  H HG21 . THR A 1 26  ? 11.033  8.513   -4.306  1.00 0.00 ? 26  THR A HG21 3  
ATOM 3719  H HG22 . THR A 1 26  ? 10.173  9.908   -3.653  1.00 0.00 ? 26  THR A HG22 3  
ATOM 3720  H HG23 . THR A 1 26  ? 11.936  9.892   -3.681  1.00 0.00 ? 26  THR A HG23 3  
ATOM 3721  N N    . ALA A 1 27  ? 12.933  12.643  -4.560  1.00 0.00 ? 27  ALA A N    3  
ATOM 3722  C CA   . ALA A 1 27  ? 13.814  13.146  -3.514  1.00 0.00 ? 27  ALA A CA   3  
ATOM 3723  C C    . ALA A 1 27  ? 13.029  13.921  -2.461  1.00 0.00 ? 27  ALA A C    3  
ATOM 3724  O O    . ALA A 1 27  ? 13.301  13.813  -1.266  1.00 0.00 ? 27  ALA A O    3  
ATOM 3725  C CB   . ALA A 1 27  ? 14.902  14.023  -4.117  1.00 0.00 ? 27  ALA A CB   3  
ATOM 3726  H H    . ALA A 1 27  ? 13.265  12.589  -5.481  1.00 0.00 ? 27  ALA A H    3  
ATOM 3727  H HA   . ALA A 1 27  ? 14.290  12.298  -3.042  1.00 0.00 ? 27  ALA A HA   3  
ATOM 3728  H HB1  . ALA A 1 27  ? 15.564  13.413  -4.714  1.00 0.00 ? 27  ALA A HB1  3  
ATOM 3729  H HB2  . ALA A 1 27  ? 14.449  14.781  -4.738  1.00 0.00 ? 27  ALA A HB2  3  
ATOM 3730  H HB3  . ALA A 1 27  ? 15.463  14.494  -3.324  1.00 0.00 ? 27  ALA A HB3  3  
ATOM 3731  N N    . ALA A 1 28  ? 12.056  14.705  -2.913  1.00 0.00 ? 28  ALA A N    3  
ATOM 3732  C CA   . ALA A 1 28  ? 11.231  15.497  -2.010  1.00 0.00 ? 28  ALA A CA   3  
ATOM 3733  C C    . ALA A 1 28  ? 9.756   15.136  -2.154  1.00 0.00 ? 28  ALA A C    3  
ATOM 3734  O O    . ALA A 1 28  ? 9.140   14.621  -1.221  1.00 0.00 ? 28  ALA A O    3  
ATOM 3735  C CB   . ALA A 1 28  ? 11.441  16.982  -2.269  1.00 0.00 ? 28  ALA A CB   3  
ATOM 3736  H H    . ALA A 1 28  ? 11.887  14.749  -3.877  1.00 0.00 ? 28  ALA A H    3  
ATOM 3737  H HA   . ALA A 1 28  ? 11.546  15.285  -0.998  1.00 0.00 ? 28  ALA A HA   3  
ATOM 3738  H HB1  . ALA A 1 28  ? 10.844  17.555  -1.575  1.00 0.00 ? 28  ALA A HB1  3  
ATOM 3739  H HB2  . ALA A 1 28  ? 12.484  17.226  -2.136  1.00 0.00 ? 28  ALA A HB2  3  
ATOM 3740  H HB3  . ALA A 1 28  ? 11.142  17.216  -3.280  1.00 0.00 ? 28  ALA A HB3  3  
ATOM 3741  N N    . ASP A 1 29  ? 9.197   15.410  -3.327  1.00 0.00 ? 29  ASP A N    3  
ATOM 3742  C CA   . ASP A 1 29  ? 7.794   15.114  -3.593  1.00 0.00 ? 29  ASP A CA   3  
ATOM 3743  C C    . ASP A 1 29  ? 7.499   13.634  -3.369  1.00 0.00 ? 29  ASP A C    3  
ATOM 3744  O O    . ASP A 1 29  ? 8.227   12.765  -3.851  1.00 0.00 ? 29  ASP A O    3  
ATOM 3745  C CB   . ASP A 1 29  ? 7.429   15.509  -5.024  1.00 0.00 ? 29  ASP A CB   3  
ATOM 3746  C CG   . ASP A 1 29  ? 7.909   16.903  -5.381  1.00 0.00 ? 29  ASP A CG   3  
ATOM 3747  O OD1  . ASP A 1 29  ? 9.041   17.257  -4.991  1.00 0.00 ? 29  ASP A OD1  3  
ATOM 3748  O OD2  . ASP A 1 29  ? 7.153   17.639  -6.049  1.00 0.00 ? 29  ASP A OD2  3  
ATOM 3749  H H    . ASP A 1 29  ? 9.740   15.821  -4.031  1.00 0.00 ? 29  ASP A H    3  
ATOM 3750  H HA   . ASP A 1 29  ? 7.196   15.695  -2.906  1.00 0.00 ? 29  ASP A HA   3  
ATOM 3751  H HB2  . ASP A 1 29  ? 7.880   14.807  -5.711  1.00 0.00 ? 29  ASP A HB2  3  
ATOM 3752  H HB3  . ASP A 1 29  ? 6.356   15.478  -5.137  1.00 0.00 ? 29  ASP A HB3  3  
ATOM 3753  N N    . THR A 1 30  ? 6.427   13.353  -2.635  1.00 0.00 ? 30  THR A N    3  
ATOM 3754  C CA   . THR A 1 30  ? 6.037   11.979  -2.346  1.00 0.00 ? 30  THR A CA   3  
ATOM 3755  C C    . THR A 1 30  ? 4.520   11.829  -2.335  1.00 0.00 ? 30  THR A C    3  
ATOM 3756  O O    . THR A 1 30  ? 3.803   12.710  -1.862  1.00 0.00 ? 30  THR A O    3  
ATOM 3757  C CB   . THR A 1 30  ? 6.598   11.509  -0.991  1.00 0.00 ? 30  THR A CB   3  
ATOM 3758  O OG1  . THR A 1 30  ? 6.416   12.531  -0.004  1.00 0.00 ? 30  THR A OG1  3  
ATOM 3759  C CG2  . THR A 1 30  ? 8.076   11.167  -1.106  1.00 0.00 ? 30  THR A CG2  3  
ATOM 3760  H H    . THR A 1 30  ? 5.887   14.089  -2.279  1.00 0.00 ? 30  THR A H    3  
ATOM 3761  H HA   . THR A 1 30  ? 6.447   11.346  -3.120  1.00 0.00 ? 30  THR A HA   3  
ATOM 3762  H HB   . THR A 1 30  ? 6.061   10.623  -0.684  1.00 0.00 ? 30  THR A HB   3  
ATOM 3763  H HG1  . THR A 1 30  ? 7.068   13.223  -0.136  1.00 0.00 ? 30  THR A HG1  3  
ATOM 3764  H HG21 . THR A 1 30  ? 8.371   10.557  -0.265  1.00 0.00 ? 30  THR A HG21 3  
ATOM 3765  H HG22 . THR A 1 30  ? 8.657   12.077  -1.112  1.00 0.00 ? 30  THR A HG22 3  
ATOM 3766  H HG23 . THR A 1 30  ? 8.248   10.623  -2.023  1.00 0.00 ? 30  THR A HG23 3  
ATOM 3767  N N    . TYR A 1 31  ? 4.038   10.707  -2.858  1.00 0.00 ? 31  TYR A N    3  
ATOM 3768  C CA   . TYR A 1 31  ? 2.605   10.442  -2.910  1.00 0.00 ? 31  TYR A CA   3  
ATOM 3769  C C    . TYR A 1 31  ? 1.934   10.817  -1.592  1.00 0.00 ? 31  TYR A C    3  
ATOM 3770  O O    . TYR A 1 31  ? 2.553   10.767  -0.530  1.00 0.00 ? 31  TYR A O    3  
ATOM 3771  C CB   . TYR A 1 31  ? 2.349   8.967   -3.223  1.00 0.00 ? 31  TYR A CB   3  
ATOM 3772  C CG   . TYR A 1 31  ? 3.126   8.458   -4.416  1.00 0.00 ? 31  TYR A CG   3  
ATOM 3773  C CD1  . TYR A 1 31  ? 2.895   8.965   -5.689  1.00 0.00 ? 31  TYR A CD1  3  
ATOM 3774  C CD2  . TYR A 1 31  ? 4.092   7.470   -4.270  1.00 0.00 ? 31  TYR A CD2  3  
ATOM 3775  C CE1  . TYR A 1 31  ? 3.602   8.502   -6.781  1.00 0.00 ? 31  TYR A CE1  3  
ATOM 3776  C CE2  . TYR A 1 31  ? 4.805   7.002   -5.357  1.00 0.00 ? 31  TYR A CE2  3  
ATOM 3777  C CZ   . TYR A 1 31  ? 4.556   7.521   -6.611  1.00 0.00 ? 31  TYR A CZ   3  
ATOM 3778  O OH   . TYR A 1 31  ? 5.264   7.058   -7.696  1.00 0.00 ? 31  TYR A OH   3  
ATOM 3779  H H    . TYR A 1 31  ? 4.660   10.042  -3.220  1.00 0.00 ? 31  TYR A H    3  
ATOM 3780  H HA   . TYR A 1 31  ? 2.184   11.046  -3.700  1.00 0.00 ? 31  TYR A HA   3  
ATOM 3781  H HB2  . TYR A 1 31  ? 2.627   8.371   -2.368  1.00 0.00 ? 31  TYR A HB2  3  
ATOM 3782  H HB3  . TYR A 1 31  ? 1.298   8.827   -3.428  1.00 0.00 ? 31  TYR A HB3  3  
ATOM 3783  H HD1  . TYR A 1 31  ? 2.148   9.734   -5.819  1.00 0.00 ? 31  TYR A HD1  3  
ATOM 3784  H HD2  . TYR A 1 31  ? 4.285   7.065   -3.287  1.00 0.00 ? 31  TYR A HD2  3  
ATOM 3785  H HE1  . TYR A 1 31  ? 3.408   8.909   -7.763  1.00 0.00 ? 31  TYR A HE1  3  
ATOM 3786  H HE2  . TYR A 1 31  ? 5.552   6.233   -5.224  1.00 0.00 ? 31  TYR A HE2  3  
ATOM 3787  H HH   . TYR A 1 31  ? 4.686   7.019   -8.462  1.00 0.00 ? 31  TYR A HH   3  
ATOM 3788  N N    . GLY A 1 32  ? 0.661   11.194  -1.670  1.00 0.00 ? 32  GLY A N    3  
ATOM 3789  C CA   . GLY A 1 32  ? -0.075  11.572  -0.478  1.00 0.00 ? 32  GLY A CA   3  
ATOM 3790  C C    . GLY A 1 32  ? -1.277  10.682  -0.232  1.00 0.00 ? 32  GLY A C    3  
ATOM 3791  O O    . GLY A 1 32  ? -2.343  11.160  0.158   1.00 0.00 ? 32  GLY A O    3  
ATOM 3792  H H    . GLY A 1 32  ? 0.218   11.215  -2.544  1.00 0.00 ? 32  GLY A H    3  
ATOM 3793  H HA2  . GLY A 1 32  ? 0.585   11.511  0.374   1.00 0.00 ? 32  GLY A HA2  3  
ATOM 3794  H HA3  . GLY A 1 32  ? -0.413  12.592  -0.586  1.00 0.00 ? 32  GLY A HA3  3  
ATOM 3795  N N    . PHE A 1 33  ? -1.108  9.385   -0.462  1.00 0.00 ? 33  PHE A N    3  
ATOM 3796  C CA   . PHE A 1 33  ? -2.189  8.426   -0.266  1.00 0.00 ? 33  PHE A CA   3  
ATOM 3797  C C    . PHE A 1 33  ? -1.699  7.205   0.508   1.00 0.00 ? 33  PHE A C    3  
ATOM 3798  O O    . PHE A 1 33  ? -0.553  6.780   0.358   1.00 0.00 ? 33  PHE A O    3  
ATOM 3799  C CB   . PHE A 1 33  ? -2.765  7.991   -1.615  1.00 0.00 ? 33  PHE A CB   3  
ATOM 3800  C CG   . PHE A 1 33  ? -2.081  6.789   -2.200  1.00 0.00 ? 33  PHE A CG   3  
ATOM 3801  C CD1  . PHE A 1 33  ? -0.711  6.789   -2.409  1.00 0.00 ? 33  PHE A CD1  3  
ATOM 3802  C CD2  . PHE A 1 33  ? -2.807  5.659   -2.540  1.00 0.00 ? 33  PHE A CD2  3  
ATOM 3803  C CE1  . PHE A 1 33  ? -0.079  5.684   -2.948  1.00 0.00 ? 33  PHE A CE1  3  
ATOM 3804  C CE2  . PHE A 1 33  ? -2.180  4.551   -3.079  1.00 0.00 ? 33  PHE A CE2  3  
ATOM 3805  C CZ   . PHE A 1 33  ? -0.814  4.564   -3.282  1.00 0.00 ? 33  PHE A CZ   3  
ATOM 3806  H H    . PHE A 1 33  ? -0.234  9.064   -0.772  1.00 0.00 ? 33  PHE A H    3  
ATOM 3807  H HA   . PHE A 1 33  ? -2.963  8.913   0.307   1.00 0.00 ? 33  PHE A HA   3  
ATOM 3808  H HB2  . PHE A 1 33  ? -3.810  7.750   -1.491  1.00 0.00 ? 33  PHE A HB2  3  
ATOM 3809  H HB3  . PHE A 1 33  ? -2.668  8.805   -2.318  1.00 0.00 ? 33  PHE A HB3  3  
ATOM 3810  H HD1  . PHE A 1 33  ? -0.134  7.664   -2.148  1.00 0.00 ? 33  PHE A HD1  3  
ATOM 3811  H HD2  . PHE A 1 33  ? -3.876  5.649   -2.381  1.00 0.00 ? 33  PHE A HD2  3  
ATOM 3812  H HE1  . PHE A 1 33  ? 0.989   5.696   -3.106  1.00 0.00 ? 33  PHE A HE1  3  
ATOM 3813  H HE2  . PHE A 1 33  ? -2.758  3.677   -3.339  1.00 0.00 ? 33  PHE A HE2  3  
ATOM 3814  H HZ   . PHE A 1 33  ? -0.323  3.699   -3.704  1.00 0.00 ? 33  PHE A HZ   3  
ATOM 3815  N N    . SER A 1 34  ? -2.576  6.645   1.335   1.00 0.00 ? 34  SER A N    3  
ATOM 3816  C CA   . SER A 1 34  ? -2.233  5.476   2.136   1.00 0.00 ? 34  SER A CA   3  
ATOM 3817  C C    . SER A 1 34  ? -3.035  4.257   1.690   1.00 0.00 ? 34  SER A C    3  
ATOM 3818  O O    . SER A 1 34  ? -4.013  4.380   0.951   1.00 0.00 ? 34  SER A O    3  
ATOM 3819  C CB   . SER A 1 34  ? -2.489  5.754   3.619   1.00 0.00 ? 34  SER A CB   3  
ATOM 3820  O OG   . SER A 1 34  ? -1.714  4.897   4.439   1.00 0.00 ? 34  SER A OG   3  
ATOM 3821  H H    . SER A 1 34  ? -3.474  7.030   1.411   1.00 0.00 ? 34  SER A H    3  
ATOM 3822  H HA   . SER A 1 34  ? -1.182  5.273   1.993   1.00 0.00 ? 34  SER A HA   3  
ATOM 3823  H HB2  . SER A 1 34  ? -2.228  6.778   3.841   1.00 0.00 ? 34  SER A HB2  3  
ATOM 3824  H HB3  . SER A 1 34  ? -3.535  5.593   3.837   1.00 0.00 ? 34  SER A HB3  3  
ATOM 3825  H HG   . SER A 1 34  ? -0.912  4.646   3.974   1.00 0.00 ? 34  SER A HG   3  
ATOM 3826  N N    . LEU A 1 35  ? -2.614  3.082   2.143   1.00 0.00 ? 35  LEU A N    3  
ATOM 3827  C CA   . LEU A 1 35  ? -3.292  1.839   1.791   1.00 0.00 ? 35  LEU A CA   3  
ATOM 3828  C C    . LEU A 1 35  ? -3.549  0.989   3.032   1.00 0.00 ? 35  LEU A C    3  
ATOM 3829  O O    . LEU A 1 35  ? -2.625  0.664   3.776   1.00 0.00 ? 35  LEU A O    3  
ATOM 3830  C CB   . LEU A 1 35  ? -2.458  1.048   0.782   1.00 0.00 ? 35  LEU A CB   3  
ATOM 3831  C CG   . LEU A 1 35  ? -2.424  1.604   -0.642  1.00 0.00 ? 35  LEU A CG   3  
ATOM 3832  C CD1  . LEU A 1 35  ? -1.463  0.802   -1.506  1.00 0.00 ? 35  LEU A CD1  3  
ATOM 3833  C CD2  . LEU A 1 35  ? -3.819  1.600   -1.250  1.00 0.00 ? 35  LEU A CD2  3  
ATOM 3834  H H    . LEU A 1 35  ? -1.829  3.048   2.728   1.00 0.00 ? 35  LEU A H    3  
ATOM 3835  H HA   . LEU A 1 35  ? -4.240  2.094   1.342   1.00 0.00 ? 35  LEU A HA   3  
ATOM 3836  H HB2  . LEU A 1 35  ? -1.443  1.013   1.147   1.00 0.00 ? 35  LEU A HB2  3  
ATOM 3837  H HB3  . LEU A 1 35  ? -2.858  0.045   0.737   1.00 0.00 ? 35  LEU A HB3  3  
ATOM 3838  H HG   . LEU A 1 35  ? -2.073  2.626   -0.615  1.00 0.00 ? 35  LEU A HG   3  
ATOM 3839  H HD11 . LEU A 1 35  ? -0.592  1.401   -1.727  1.00 0.00 ? 35  LEU A HD11 3  
ATOM 3840  H HD12 . LEU A 1 35  ? -1.953  0.524   -2.427  1.00 0.00 ? 35  LEU A HD12 3  
ATOM 3841  H HD13 . LEU A 1 35  ? -1.162  -0.090  -0.976  1.00 0.00 ? 35  LEU A HD13 3  
ATOM 3842  H HD21 . LEU A 1 35  ? -4.234  0.605   -1.192  1.00 0.00 ? 35  LEU A HD21 3  
ATOM 3843  H HD22 . LEU A 1 35  ? -3.762  1.907   -2.284  1.00 0.00 ? 35  LEU A HD22 3  
ATOM 3844  H HD23 . LEU A 1 35  ? -4.451  2.285   -0.704  1.00 0.00 ? 35  LEU A HD23 3  
ATOM 3845  N N    . SER A 1 36  ? -4.811  0.631   3.246   1.00 0.00 ? 36  SER A N    3  
ATOM 3846  C CA   . SER A 1 36  ? -5.191  -0.180  4.397   1.00 0.00 ? 36  SER A CA   3  
ATOM 3847  C C    . SER A 1 36  ? -5.436  -1.628  3.984   1.00 0.00 ? 36  SER A C    3  
ATOM 3848  O O    . SER A 1 36  ? -5.938  -1.897  2.893   1.00 0.00 ? 36  SER A O    3  
ATOM 3849  C CB   . SER A 1 36  ? -6.446  0.393   5.059   1.00 0.00 ? 36  SER A CB   3  
ATOM 3850  O OG   . SER A 1 36  ? -6.579  -0.076  6.390   1.00 0.00 ? 36  SER A OG   3  
ATOM 3851  H H    . SER A 1 36  ? -5.504  0.922   2.616   1.00 0.00 ? 36  SER A H    3  
ATOM 3852  H HA   . SER A 1 36  ? -4.376  -0.152  5.105   1.00 0.00 ? 36  SER A HA   3  
ATOM 3853  H HB2  . SER A 1 36  ? -6.382  1.470   5.075   1.00 0.00 ? 36  SER A HB2  3  
ATOM 3854  H HB3  . SER A 1 36  ? -7.316  0.092   4.495   1.00 0.00 ? 36  SER A HB3  3  
ATOM 3855  H HG   . SER A 1 36  ? -6.393  -1.018  6.418   1.00 0.00 ? 36  SER A HG   3  
ATOM 3856  N N    . SER A 1 37  ? -5.077  -2.556  4.865   1.00 0.00 ? 37  SER A N    3  
ATOM 3857  C CA   . SER A 1 37  ? -5.253  -3.978  4.592   1.00 0.00 ? 37  SER A CA   3  
ATOM 3858  C C    . SER A 1 37  ? -6.331  -4.574  5.492   1.00 0.00 ? 37  SER A C    3  
ATOM 3859  O O    . SER A 1 37  ? -6.397  -4.273  6.684   1.00 0.00 ? 37  SER A O    3  
ATOM 3860  C CB   . SER A 1 37  ? -3.934  -4.725  4.793   1.00 0.00 ? 37  SER A CB   3  
ATOM 3861  O OG   . SER A 1 37  ? -2.896  -4.146  4.020   1.00 0.00 ? 37  SER A OG   3  
ATOM 3862  H H    . SER A 1 37  ? -4.681  -2.278  5.718   1.00 0.00 ? 37  SER A H    3  
ATOM 3863  H HA   . SER A 1 37  ? -5.562  -4.082  3.562   1.00 0.00 ? 37  SER A HA   3  
ATOM 3864  H HB2  . SER A 1 37  ? -3.655  -4.684  5.835   1.00 0.00 ? 37  SER A HB2  3  
ATOM 3865  H HB3  . SER A 1 37  ? -4.058  -5.756  4.494   1.00 0.00 ? 37  SER A HB3  3  
ATOM 3866  H HG   . SER A 1 37  ? -2.576  -4.788  3.383   1.00 0.00 ? 37  SER A HG   3  
ATOM 3867  N N    . VAL A 1 38  ? -7.175  -5.422  4.912   1.00 0.00 ? 38  VAL A N    3  
ATOM 3868  C CA   . VAL A 1 38  ? -8.250  -6.063  5.660   1.00 0.00 ? 38  VAL A CA   3  
ATOM 3869  C C    . VAL A 1 38  ? -8.391  -7.530  5.272   1.00 0.00 ? 38  VAL A C    3  
ATOM 3870  O O    . VAL A 1 38  ? -8.524  -7.860  4.094   1.00 0.00 ? 38  VAL A O    3  
ATOM 3871  C CB   . VAL A 1 38  ? -9.596  -5.350  5.430   1.00 0.00 ? 38  VAL A CB   3  
ATOM 3872  C CG1  . VAL A 1 38  ? -10.624 -5.808  6.453   1.00 0.00 ? 38  VAL A CG1  3  
ATOM 3873  C CG2  . VAL A 1 38  ? -9.415  -3.841  5.483   1.00 0.00 ? 38  VAL A CG2  3  
ATOM 3874  H H    . VAL A 1 38  ? -7.071  -5.622  3.958   1.00 0.00 ? 38  VAL A H    3  
ATOM 3875  H HA   . VAL A 1 38  ? -8.008  -6.000  6.711   1.00 0.00 ? 38  VAL A HA   3  
ATOM 3876  H HB   . VAL A 1 38  ? -9.956  -5.614  4.447   1.00 0.00 ? 38  VAL A HB   3  
ATOM 3877  H HG11 . VAL A 1 38  ? -10.356 -5.428  7.428   1.00 0.00 ? 38  VAL A HG11 3  
ATOM 3878  H HG12 . VAL A 1 38  ? -11.599 -5.435  6.176   1.00 0.00 ? 38  VAL A HG12 3  
ATOM 3879  H HG13 . VAL A 1 38  ? -10.647 -6.887  6.482   1.00 0.00 ? 38  VAL A HG13 3  
ATOM 3880  H HG21 . VAL A 1 38  ? -9.050  -3.489  4.529   1.00 0.00 ? 38  VAL A HG21 3  
ATOM 3881  H HG22 . VAL A 1 38  ? -10.363 -3.371  5.701   1.00 0.00 ? 38  VAL A HG22 3  
ATOM 3882  H HG23 . VAL A 1 38  ? -8.703  -3.590  6.255   1.00 0.00 ? 38  VAL A HG23 3  
ATOM 3883  N N    . GLU A 1 39  ? -8.362  -8.407  6.271   1.00 0.00 ? 39  GLU A N    3  
ATOM 3884  C CA   . GLU A 1 39  ? -8.487  -9.840  6.033   1.00 0.00 ? 39  GLU A CA   3  
ATOM 3885  C C    . GLU A 1 39  ? -9.913  -10.313 6.298   1.00 0.00 ? 39  GLU A C    3  
ATOM 3886  O O    . GLU A 1 39  ? -10.346 -10.397 7.446   1.00 0.00 ? 39  GLU A O    3  
ATOM 3887  C CB   . GLU A 1 39  ? -7.508  -10.614 6.918   1.00 0.00 ? 39  GLU A CB   3  
ATOM 3888  C CG   . GLU A 1 39  ? -7.034  -11.920 6.304   1.00 0.00 ? 39  GLU A CG   3  
ATOM 3889  C CD   . GLU A 1 39  ? -6.651  -12.951 7.348   1.00 0.00 ? 39  GLU A CD   3  
ATOM 3890  O OE1  . GLU A 1 39  ? -7.548  -13.682 7.817   1.00 0.00 ? 39  GLU A OE1  3  
ATOM 3891  O OE2  . GLU A 1 39  ? -5.454  -13.026 7.696   1.00 0.00 ? 39  GLU A OE2  3  
ATOM 3892  H H    . GLU A 1 39  ? -8.254  -8.082  7.189   1.00 0.00 ? 39  GLU A H    3  
ATOM 3893  H HA   . GLU A 1 39  ? -8.246  -10.026 4.997   1.00 0.00 ? 39  GLU A HA   3  
ATOM 3894  H HB2  . GLU A 1 39  ? -6.645  -9.993  7.107   1.00 0.00 ? 39  GLU A HB2  3  
ATOM 3895  H HB3  . GLU A 1 39  ? -7.992  -10.837 7.858   1.00 0.00 ? 39  GLU A HB3  3  
ATOM 3896  H HG2  . GLU A 1 39  ? -7.827  -12.325 5.694   1.00 0.00 ? 39  GLU A HG2  3  
ATOM 3897  H HG3  . GLU A 1 39  ? -6.172  -11.719 5.685   1.00 0.00 ? 39  GLU A HG3  3  
ATOM 3898  N N    . GLU A 1 40  ? -10.638 -10.620 5.226   1.00 0.00 ? 40  GLU A N    3  
ATOM 3899  C CA   . GLU A 1 40  ? -12.015 -11.083 5.343   1.00 0.00 ? 40  GLU A CA   3  
ATOM 3900  C C    . GLU A 1 40  ? -12.131 -12.552 4.943   1.00 0.00 ? 40  GLU A C    3  
ATOM 3901  O O    . GLU A 1 40  ? -11.803 -12.928 3.818   1.00 0.00 ? 40  GLU A O    3  
ATOM 3902  C CB   . GLU A 1 40  ? -12.939 -10.232 4.470   1.00 0.00 ? 40  GLU A CB   3  
ATOM 3903  C CG   . GLU A 1 40  ? -13.083 -8.798  4.954   1.00 0.00 ? 40  GLU A CG   3  
ATOM 3904  C CD   . GLU A 1 40  ? -12.001 -7.887  4.407   1.00 0.00 ? 40  GLU A CD   3  
ATOM 3905  O OE1  . GLU A 1 40  ? -10.876 -8.376  4.173   1.00 0.00 ? 40  GLU A OE1  3  
ATOM 3906  O OE2  . GLU A 1 40  ? -12.279 -6.685  4.213   1.00 0.00 ? 40  GLU A OE2  3  
ATOM 3907  H H    . GLU A 1 40  ? -10.236 -10.533 4.336   1.00 0.00 ? 40  GLU A H    3  
ATOM 3908  H HA   . GLU A 1 40  ? -12.314 -10.979 6.375   1.00 0.00 ? 40  GLU A HA   3  
ATOM 3909  H HB2  . GLU A 1 40  ? -12.548 -10.213 3.463   1.00 0.00 ? 40  GLU A HB2  3  
ATOM 3910  H HB3  . GLU A 1 40  ? -13.920 -10.684 4.456   1.00 0.00 ? 40  GLU A HB3  3  
ATOM 3911  H HG2  . GLU A 1 40  ? -14.044 -8.420  4.639   1.00 0.00 ? 40  GLU A HG2  3  
ATOM 3912  H HG3  . GLU A 1 40  ? -13.029 -8.789  6.032   1.00 0.00 ? 40  GLU A HG3  3  
ATOM 3913  N N    . ASP A 1 41  ? -12.600 -13.376 5.873   1.00 0.00 ? 41  ASP A N    3  
ATOM 3914  C CA   . ASP A 1 41  ? -12.760 -14.803 5.619   1.00 0.00 ? 41  ASP A CA   3  
ATOM 3915  C C    . ASP A 1 41  ? -11.436 -15.432 5.197   1.00 0.00 ? 41  ASP A C    3  
ATOM 3916  O O    . ASP A 1 41  ? -11.413 -16.449 4.504   1.00 0.00 ? 41  ASP A O    3  
ATOM 3917  C CB   . ASP A 1 41  ? -13.817 -15.035 4.538   1.00 0.00 ? 41  ASP A CB   3  
ATOM 3918  C CG   . ASP A 1 41  ? -14.957 -14.039 4.619   1.00 0.00 ? 41  ASP A CG   3  
ATOM 3919  O OD1  . ASP A 1 41  ? -15.707 -14.078 5.617   1.00 0.00 ? 41  ASP A OD1  3  
ATOM 3920  O OD2  . ASP A 1 41  ? -15.099 -13.222 3.686   1.00 0.00 ? 41  ASP A OD2  3  
ATOM 3921  H H    . ASP A 1 41  ? -12.845 -13.017 6.751   1.00 0.00 ? 41  ASP A H    3  
ATOM 3922  H HA   . ASP A 1 41  ? -13.089 -15.269 6.536   1.00 0.00 ? 41  ASP A HA   3  
ATOM 3923  H HB2  . ASP A 1 41  ? -13.354 -14.945 3.566   1.00 0.00 ? 41  ASP A HB2  3  
ATOM 3924  H HB3  . ASP A 1 41  ? -14.223 -16.030 4.648   1.00 0.00 ? 41  ASP A HB3  3  
ATOM 3925  N N    . GLY A 1 42  ? -10.334 -14.819 5.619   1.00 0.00 ? 42  GLY A N    3  
ATOM 3926  C CA   . GLY A 1 42  ? -9.021  -15.332 5.274   1.00 0.00 ? 42  GLY A CA   3  
ATOM 3927  C C    . GLY A 1 42  ? -8.411  -14.613 4.087   1.00 0.00 ? 42  GLY A C    3  
ATOM 3928  O O    . GLY A 1 42  ? -7.191  -14.602 3.919   1.00 0.00 ? 42  GLY A O    3  
ATOM 3929  H H    . GLY A 1 42  ? -10.413 -14.012 6.169   1.00 0.00 ? 42  GLY A H    3  
ATOM 3930  H HA2  . GLY A 1 42  ? -8.367  -15.219 6.125   1.00 0.00 ? 42  GLY A HA2  3  
ATOM 3931  H HA3  . GLY A 1 42  ? -9.109  -16.383 5.037   1.00 0.00 ? 42  GLY A HA3  3  
ATOM 3932  N N    . ILE A 1 43  ? -9.261  -14.013 3.260   1.00 0.00 ? 43  ILE A N    3  
ATOM 3933  C CA   . ILE A 1 43  ? -8.798  -13.289 2.083   1.00 0.00 ? 43  ILE A CA   3  
ATOM 3934  C C    . ILE A 1 43  ? -8.385  -11.866 2.440   1.00 0.00 ? 43  ILE A C    3  
ATOM 3935  O O    . ILE A 1 43  ? -9.185  -11.088 2.959   1.00 0.00 ? 43  ILE A O    3  
ATOM 3936  C CB   . ILE A 1 43  ? -9.883  -13.238 0.991   1.00 0.00 ? 43  ILE A CB   3  
ATOM 3937  C CG1  . ILE A 1 43  ? -10.511 -14.620 0.800   1.00 0.00 ? 43  ILE A CG1  3  
ATOM 3938  C CG2  . ILE A 1 43  ? -9.294  -12.733 -0.318  1.00 0.00 ? 43  ILE A CG2  3  
ATOM 3939  C CD1  . ILE A 1 43  ? -11.830 -14.587 0.060   1.00 0.00 ? 43  ILE A CD1  3  
ATOM 3940  H H    . ILE A 1 43  ? -10.222 -14.057 3.447   1.00 0.00 ? 43  ILE A H    3  
ATOM 3941  H HA   . ILE A 1 43  ? -7.940  -13.813 1.686   1.00 0.00 ? 43  ILE A HA   3  
ATOM 3942  H HB   . ILE A 1 43  ? -10.647 -12.543 1.305   1.00 0.00 ? 43  ILE A HB   3  
ATOM 3943  H HG12 . ILE A 1 43  ? -9.833  -15.243 0.240   1.00 0.00 ? 43  ILE A HG12 3  
ATOM 3944  H HG13 . ILE A 1 43  ? -10.685 -15.065 1.769   1.00 0.00 ? 43  ILE A HG13 3  
ATOM 3945  H HG21 . ILE A 1 43  ? -8.632  -13.482 -0.727  1.00 0.00 ? 43  ILE A HG21 3  
ATOM 3946  H HG22 . ILE A 1 43  ? -10.091 -12.537 -1.019  1.00 0.00 ? 43  ILE A HG22 3  
ATOM 3947  H HG23 . ILE A 1 43  ? -8.741  -11.824 -0.137  1.00 0.00 ? 43  ILE A HG23 3  
ATOM 3948  H HD11 . ILE A 1 43  ? -12.460 -13.816 0.479   1.00 0.00 ? 43  ILE A HD11 3  
ATOM 3949  H HD12 . ILE A 1 43  ? -11.652 -14.380 -0.984  1.00 0.00 ? 43  ILE A HD12 3  
ATOM 3950  H HD13 . ILE A 1 43  ? -12.322 -15.545 0.158   1.00 0.00 ? 43  ILE A HD13 3  
ATOM 3951  N N    . ARG A 1 44  ? -7.130  -11.531 2.156   1.00 0.00 ? 44  ARG A N    3  
ATOM 3952  C CA   . ARG A 1 44  ? -6.610  -10.201 2.447   1.00 0.00 ? 44  ARG A CA   3  
ATOM 3953  C C    . ARG A 1 44  ? -6.841  -9.257  1.270   1.00 0.00 ? 44  ARG A C    3  
ATOM 3954  O O    . ARG A 1 44  ? -6.530  -9.589  0.125   1.00 0.00 ? 44  ARG A O    3  
ATOM 3955  C CB   . ARG A 1 44  ? -5.116  -10.273 2.771   1.00 0.00 ? 44  ARG A CB   3  
ATOM 3956  C CG   . ARG A 1 44  ? -4.617  -9.105  3.605   1.00 0.00 ? 44  ARG A CG   3  
ATOM 3957  C CD   . ARG A 1 44  ? -3.157  -8.795  3.312   1.00 0.00 ? 44  ARG A CD   3  
ATOM 3958  N NE   . ARG A 1 44  ? -2.482  -8.202  4.463   1.00 0.00 ? 44  ARG A NE   3  
ATOM 3959  C CZ   . ARG A 1 44  ? -2.115  -8.894  5.536   1.00 0.00 ? 44  ARG A CZ   3  
ATOM 3960  N NH1  . ARG A 1 44  ? -2.358  -10.195 5.605   1.00 0.00 ? 44  ARG A NH1  3  
ATOM 3961  N NH2  . ARG A 1 44  ? -1.504  -8.283  6.543   1.00 0.00 ? 44  ARG A NH2  3  
ATOM 3962  H H    . ARG A 1 44  ? -6.540  -12.195 1.742   1.00 0.00 ? 44  ARG A H    3  
ATOM 3963  H HA   . ARG A 1 44  ? -7.138  -9.819  3.308   1.00 0.00 ? 44  ARG A HA   3  
ATOM 3964  H HB2  . ARG A 1 44  ? -4.922  -11.185 3.316   1.00 0.00 ? 44  ARG A HB2  3  
ATOM 3965  H HB3  . ARG A 1 44  ? -4.560  -10.291 1.846   1.00 0.00 ? 44  ARG A HB3  3  
ATOM 3966  H HG2  . ARG A 1 44  ? -5.211  -8.232  3.378   1.00 0.00 ? 44  ARG A HG2  3  
ATOM 3967  H HG3  . ARG A 1 44  ? -4.720  -9.352  4.651   1.00 0.00 ? 44  ARG A HG3  3  
ATOM 3968  H HD2  . ARG A 1 44  ? -2.655  -9.712  3.045   1.00 0.00 ? 44  ARG A HD2  3  
ATOM 3969  H HD3  . ARG A 1 44  ? -3.110  -8.104  2.483   1.00 0.00 ? 44  ARG A HD3  3  
ATOM 3970  H HE   . ARG A 1 44  ? -2.292  -7.241  4.433   1.00 0.00 ? 44  ARG A HE   3  
ATOM 3971  H HH11 . ARG A 1 44  ? -2.818  -10.658 4.847   1.00 0.00 ? 44  ARG A HH11 3  
ATOM 3972  H HH12 . ARG A 1 44  ? -2.080  -10.714 6.414   1.00 0.00 ? 44  ARG A HH12 3  
ATOM 3973  H HH21 . ARG A 1 44  ? -1.319  -7.302  6.495   1.00 0.00 ? 44  ARG A HH21 3  
ATOM 3974  H HH22 . ARG A 1 44  ? -1.229  -8.804  7.351   1.00 0.00 ? 44  ARG A HH22 3  
ATOM 3975  N N    . ARG A 1 45  ? -7.387  -8.081  1.559   1.00 0.00 ? 45  ARG A N    3  
ATOM 3976  C CA   . ARG A 1 45  ? -7.661  -7.091  0.524   1.00 0.00 ? 45  ARG A CA   3  
ATOM 3977  C C    . ARG A 1 45  ? -7.051  -5.741  0.889   1.00 0.00 ? 45  ARG A C    3  
ATOM 3978  O O    . ARG A 1 45  ? -6.593  -5.538  2.014   1.00 0.00 ? 45  ARG A O    3  
ATOM 3979  C CB   . ARG A 1 45  ? -9.170  -6.941  0.318   1.00 0.00 ? 45  ARG A CB   3  
ATOM 3980  C CG   . ARG A 1 45  ? -9.815  -8.143  -0.353  1.00 0.00 ? 45  ARG A CG   3  
ATOM 3981  C CD   . ARG A 1 45  ? -10.171 -9.221  0.658   1.00 0.00 ? 45  ARG A CD   3  
ATOM 3982  N NE   . ARG A 1 45  ? -11.233 -10.098 0.172   1.00 0.00 ? 45  ARG A NE   3  
ATOM 3983  C CZ   . ARG A 1 45  ? -12.477 -9.691  -0.055  1.00 0.00 ? 45  ARG A CZ   3  
ATOM 3984  N NH1  . ARG A 1 45  ? -12.813 -8.426  0.159   1.00 0.00 ? 45  ARG A NH1  3  
ATOM 3985  N NH2  . ARG A 1 45  ? -13.387 -10.549 -0.497  1.00 0.00 ? 45  ARG A NH2  3  
ATOM 3986  H H    . ARG A 1 45  ? -7.613  -7.874  2.490   1.00 0.00 ? 45  ARG A H    3  
ATOM 3987  H HA   . ARG A 1 45  ? -7.214  -7.439  -0.395  1.00 0.00 ? 45  ARG A HA   3  
ATOM 3988  H HB2  . ARG A 1 45  ? -9.641  -6.799  1.280   1.00 0.00 ? 45  ARG A HB2  3  
ATOM 3989  H HB3  . ARG A 1 45  ? -9.353  -6.073  -0.295  1.00 0.00 ? 45  ARG A HB3  3  
ATOM 3990  H HG2  . ARG A 1 45  ? -10.717 -7.823  -0.853  1.00 0.00 ? 45  ARG A HG2  3  
ATOM 3991  H HG3  . ARG A 1 45  ? -9.126  -8.553  -1.076  1.00 0.00 ? 45  ARG A HG3  3  
ATOM 3992  H HD2  . ARG A 1 45  ? -9.291  -9.814  0.858   1.00 0.00 ? 45  ARG A HD2  3  
ATOM 3993  H HD3  . ARG A 1 45  ? -10.499 -8.746  1.571   1.00 0.00 ? 45  ARG A HD3  3  
ATOM 3994  H HE   . ARG A 1 45  ? -11.006 -11.037 0.008   1.00 0.00 ? 45  ARG A HE   3  
ATOM 3995  H HH11 . ARG A 1 45  ? -12.129 -7.777  0.491   1.00 0.00 ? 45  ARG A HH11 3  
ATOM 3996  H HH12 . ARG A 1 45  ? -13.750 -8.121  -0.015  1.00 0.00 ? 45  ARG A HH12 3  
ATOM 3997  H HH21 . ARG A 1 45  ? -13.137 -11.503 -0.660  1.00 0.00 ? 45  ARG A HH21 3  
ATOM 3998  H HH22 . ARG A 1 45  ? -14.323 -10.241 -0.668  1.00 0.00 ? 45  ARG A HH22 3  
ATOM 3999  N N    . LEU A 1 46  ? -7.046  -4.822  -0.070  1.00 0.00 ? 46  LEU A N    3  
ATOM 4000  C CA   . LEU A 1 46  ? -6.491  -3.490  0.149   1.00 0.00 ? 46  LEU A CA   3  
ATOM 4001  C C    . LEU A 1 46  ? -7.511  -2.411  -0.199  1.00 0.00 ? 46  LEU A C    3  
ATOM 4002  O O    . LEU A 1 46  ? -8.347  -2.595  -1.085  1.00 0.00 ? 46  LEU A O    3  
ATOM 4003  C CB   . LEU A 1 46  ? -5.225  -3.300  -0.688  1.00 0.00 ? 46  LEU A CB   3  
ATOM 4004  C CG   . LEU A 1 46  ? -3.911  -3.707  -0.020  1.00 0.00 ? 46  LEU A CG   3  
ATOM 4005  C CD1  . LEU A 1 46  ? -3.554  -2.731  1.091   1.00 0.00 ? 46  LEU A CD1  3  
ATOM 4006  C CD2  . LEU A 1 46  ? -4.006  -5.125  0.524   1.00 0.00 ? 46  LEU A CD2  3  
ATOM 4007  H H    . LEU A 1 46  ? -7.425  -5.042  -0.946  1.00 0.00 ? 46  LEU A H    3  
ATOM 4008  H HA   . LEU A 1 46  ? -6.238  -3.405  1.195   1.00 0.00 ? 46  LEU A HA   3  
ATOM 4009  H HB2  . LEU A 1 46  ? -5.333  -3.886  -1.588  1.00 0.00 ? 46  LEU A HB2  3  
ATOM 4010  H HB3  . LEU A 1 46  ? -5.156  -2.253  -0.948  1.00 0.00 ? 46  LEU A HB3  3  
ATOM 4011  H HG   . LEU A 1 46  ? -3.118  -3.681  -0.754  1.00 0.00 ? 46  LEU A HG   3  
ATOM 4012  H HD11 . LEU A 1 46  ? -2.482  -2.612  1.134   1.00 0.00 ? 46  LEU A HD11 3  
ATOM 4013  H HD12 . LEU A 1 46  ? -3.911  -3.114  2.035   1.00 0.00 ? 46  LEU A HD12 3  
ATOM 4014  H HD13 . LEU A 1 46  ? -4.016  -1.775  0.893   1.00 0.00 ? 46  LEU A HD13 3  
ATOM 4015  H HD21 . LEU A 1 46  ? -4.680  -5.702  -0.092  1.00 0.00 ? 46  LEU A HD21 3  
ATOM 4016  H HD22 . LEU A 1 46  ? -4.378  -5.098  1.537   1.00 0.00 ? 46  LEU A HD22 3  
ATOM 4017  H HD23 . LEU A 1 46  ? -3.027  -5.581  0.511   1.00 0.00 ? 46  LEU A HD23 3  
ATOM 4018  N N    . TYR A 1 47  ? -7.436  -1.285  0.501   1.00 0.00 ? 47  TYR A N    3  
ATOM 4019  C CA   . TYR A 1 47  ? -8.353  -0.176  0.266   1.00 0.00 ? 47  TYR A CA   3  
ATOM 4020  C C    . TYR A 1 47  ? -7.679  1.160   0.564   1.00 0.00 ? 47  TYR A C    3  
ATOM 4021  O O    . TYR A 1 47  ? -6.992  1.311   1.574   1.00 0.00 ? 47  TYR A O    3  
ATOM 4022  C CB   . TYR A 1 47  ? -9.605  -0.331  1.130   1.00 0.00 ? 47  TYR A CB   3  
ATOM 4023  C CG   . TYR A 1 47  ? -10.327 -1.643  0.920   1.00 0.00 ? 47  TYR A CG   3  
ATOM 4024  C CD1  . TYR A 1 47  ? -11.168 -1.830  -0.169  1.00 0.00 ? 47  TYR A CD1  3  
ATOM 4025  C CD2  . TYR A 1 47  ? -10.166 -2.697  1.812   1.00 0.00 ? 47  TYR A CD2  3  
ATOM 4026  C CE1  . TYR A 1 47  ? -11.829 -3.027  -0.364  1.00 0.00 ? 47  TYR A CE1  3  
ATOM 4027  C CE2  . TYR A 1 47  ? -10.822 -3.898  1.625   1.00 0.00 ? 47  TYR A CE2  3  
ATOM 4028  C CZ   . TYR A 1 47  ? -11.653 -4.058  0.535   1.00 0.00 ? 47  TYR A CZ   3  
ATOM 4029  O OH   . TYR A 1 47  ? -12.309 -5.253  0.344   1.00 0.00 ? 47  TYR A OH   3  
ATOM 4030  H H    . TYR A 1 47  ? -6.748  -1.198  1.194   1.00 0.00 ? 47  TYR A H    3  
ATOM 4031  H HA   . TYR A 1 47  ? -8.640  -0.198  -0.775  1.00 0.00 ? 47  TYR A HA   3  
ATOM 4032  H HB2  . TYR A 1 47  ? -9.327  -0.269  2.171   1.00 0.00 ? 47  TYR A HB2  3  
ATOM 4033  H HB3  . TYR A 1 47  ? -10.295 0.468   0.898   1.00 0.00 ? 47  TYR A HB3  3  
ATOM 4034  H HD1  . TYR A 1 47  ? -11.303 -1.021  -0.872  1.00 0.00 ? 47  TYR A HD1  3  
ATOM 4035  H HD2  . TYR A 1 47  ? -9.515  -2.568  2.665   1.00 0.00 ? 47  TYR A HD2  3  
ATOM 4036  H HE1  . TYR A 1 47  ? -12.479 -3.153  -1.218  1.00 0.00 ? 47  TYR A HE1  3  
ATOM 4037  H HE2  . TYR A 1 47  ? -10.685 -4.705  2.329   1.00 0.00 ? 47  TYR A HE2  3  
ATOM 4038  H HH   . TYR A 1 47  ? -11.866 -5.754  -0.345  1.00 0.00 ? 47  TYR A HH   3  
ATOM 4039  N N    . VAL A 1 48  ? -7.881  2.128   -0.325  1.00 0.00 ? 48  VAL A N    3  
ATOM 4040  C CA   . VAL A 1 48  ? -7.295  3.453   -0.158  1.00 0.00 ? 48  VAL A CA   3  
ATOM 4041  C C    . VAL A 1 48  ? -8.009  4.236   0.938   1.00 0.00 ? 48  VAL A C    3  
ATOM 4042  O O    . VAL A 1 48  ? -9.188  4.563   0.814   1.00 0.00 ? 48  VAL A O    3  
ATOM 4043  C CB   . VAL A 1 48  ? -7.352  4.260   -1.469  1.00 0.00 ? 48  VAL A CB   3  
ATOM 4044  C CG1  . VAL A 1 48  ? -6.688  5.617   -1.290  1.00 0.00 ? 48  VAL A CG1  3  
ATOM 4045  C CG2  . VAL A 1 48  ? -6.697  3.483   -2.601  1.00 0.00 ? 48  VAL A CG2  3  
ATOM 4046  H H    . VAL A 1 48  ? -8.438  1.947   -1.110  1.00 0.00 ? 48  VAL A H    3  
ATOM 4047  H HA   . VAL A 1 48  ? -6.259  3.328   0.118   1.00 0.00 ? 48  VAL A HA   3  
ATOM 4048  H HB   . VAL A 1 48  ? -8.388  4.422   -1.725  1.00 0.00 ? 48  VAL A HB   3  
ATOM 4049  H HG11 . VAL A 1 48  ? -7.408  6.398   -1.488  1.00 0.00 ? 48  VAL A HG11 3  
ATOM 4050  H HG12 . VAL A 1 48  ? -6.324  5.709   -0.277  1.00 0.00 ? 48  VAL A HG12 3  
ATOM 4051  H HG13 . VAL A 1 48  ? -5.862  5.707   -1.979  1.00 0.00 ? 48  VAL A HG13 3  
ATOM 4052  H HG21 . VAL A 1 48  ? -7.072  3.842   -3.548  1.00 0.00 ? 48  VAL A HG21 3  
ATOM 4053  H HG22 . VAL A 1 48  ? -5.626  3.622   -2.562  1.00 0.00 ? 48  VAL A HG22 3  
ATOM 4054  H HG23 . VAL A 1 48  ? -6.926  2.433   -2.498  1.00 0.00 ? 48  VAL A HG23 3  
ATOM 4055  N N    . ASN A 1 49  ? -7.285  4.532   2.013   1.00 0.00 ? 49  ASN A N    3  
ATOM 4056  C CA   . ASN A 1 49  ? -7.849  5.277   3.132   1.00 0.00 ? 49  ASN A CA   3  
ATOM 4057  C C    . ASN A 1 49  ? -7.924  6.767   2.812   1.00 0.00 ? 49  ASN A C    3  
ATOM 4058  O O    . ASN A 1 49  ? -8.967  7.398   2.985   1.00 0.00 ? 49  ASN A O    3  
ATOM 4059  C CB   . ASN A 1 49  ? -7.010  5.057   4.393   1.00 0.00 ? 49  ASN A CB   3  
ATOM 4060  C CG   . ASN A 1 49  ? -7.063  6.242   5.338   1.00 0.00 ? 49  ASN A CG   3  
ATOM 4061  O OD1  . ASN A 1 49  ? -8.110  6.867   5.508   1.00 0.00 ? 49  ASN A OD1  3  
ATOM 4062  N ND2  . ASN A 1 49  ? -5.931  6.556   5.956   1.00 0.00 ? 49  ASN A ND2  3  
ATOM 4063  H H    . ASN A 1 49  ? -6.349  4.244   2.054   1.00 0.00 ? 49  ASN A H    3  
ATOM 4064  H HA   . ASN A 1 49  ? -8.848  4.907   3.307   1.00 0.00 ? 49  ASN A HA   3  
ATOM 4065  H HB2  . ASN A 1 49  ? -7.379  4.187   4.916   1.00 0.00 ? 49  ASN A HB2  3  
ATOM 4066  H HB3  . ASN A 1 49  ? -5.981  4.891   4.109   1.00 0.00 ? 49  ASN A HB3  3  
ATOM 4067  H HD21 . ASN A 1 49  ? -5.136  6.013   5.772   1.00 0.00 ? 49  ASN A HD21 3  
ATOM 4068  H HD22 . ASN A 1 49  ? -5.937  7.317   6.573   1.00 0.00 ? 49  ASN A HD22 3  
ATOM 4069  N N    . SER A 1 50  ? -6.811  7.323   2.345   1.00 0.00 ? 50  SER A N    3  
ATOM 4070  C CA   . SER A 1 50  ? -6.749  8.739   2.003   1.00 0.00 ? 50  SER A CA   3  
ATOM 4071  C C    . SER A 1 50  ? -5.947  8.955   0.723   1.00 0.00 ? 50  SER A C    3  
ATOM 4072  O O    . SER A 1 50  ? -5.235  8.062   0.265   1.00 0.00 ? 50  SER A O    3  
ATOM 4073  C CB   . SER A 1 50  ? -6.123  9.535   3.150   1.00 0.00 ? 50  SER A CB   3  
ATOM 4074  O OG   . SER A 1 50  ? -4.827  9.052   3.459   1.00 0.00 ? 50  SER A OG   3  
ATOM 4075  H H    . SER A 1 50  ? -6.011  6.768   2.229   1.00 0.00 ? 50  SER A H    3  
ATOM 4076  H HA   . SER A 1 50  ? -7.759  9.086   1.845   1.00 0.00 ? 50  SER A HA   3  
ATOM 4077  H HB2  . SER A 1 50  ? -6.048  10.574  2.866   1.00 0.00 ? 50  SER A HB2  3  
ATOM 4078  H HB3  . SER A 1 50  ? -6.747  9.447   4.028   1.00 0.00 ? 50  SER A HB3  3  
ATOM 4079  H HG   . SER A 1 50  ? -4.430  9.609   4.132   1.00 0.00 ? 50  SER A HG   3  
ATOM 4080  N N    . VAL A 1 51  ? -6.070  10.148  0.150   1.00 0.00 ? 51  VAL A N    3  
ATOM 4081  C CA   . VAL A 1 51  ? -5.357  10.483  -1.077  1.00 0.00 ? 51  VAL A CA   3  
ATOM 4082  C C    . VAL A 1 51  ? -4.897  11.937  -1.066  1.00 0.00 ? 51  VAL A C    3  
ATOM 4083  O O    . VAL A 1 51  ? -5.596  12.817  -0.565  1.00 0.00 ? 51  VAL A O    3  
ATOM 4084  C CB   . VAL A 1 51  ? -6.235  10.244  -2.320  1.00 0.00 ? 51  VAL A CB   3  
ATOM 4085  C CG1  . VAL A 1 51  ? -5.496  10.659  -3.583  1.00 0.00 ? 51  VAL A CG1  3  
ATOM 4086  C CG2  . VAL A 1 51  ? -6.662  8.786   -2.397  1.00 0.00 ? 51  VAL A CG2  3  
ATOM 4087  H H    . VAL A 1 51  ? -6.653  10.819  0.562   1.00 0.00 ? 51  VAL A H    3  
ATOM 4088  H HA   . VAL A 1 51  ? -4.490  9.842   -1.146  1.00 0.00 ? 51  VAL A HA   3  
ATOM 4089  H HB   . VAL A 1 51  ? -7.122  10.853  -2.231  1.00 0.00 ? 51  VAL A HB   3  
ATOM 4090  H HG11 . VAL A 1 51  ? -6.053  10.331  -4.449  1.00 0.00 ? 51  VAL A HG11 3  
ATOM 4091  H HG12 . VAL A 1 51  ? -5.395  11.734  -3.605  1.00 0.00 ? 51  VAL A HG12 3  
ATOM 4092  H HG13 . VAL A 1 51  ? -4.517  10.204  -3.593  1.00 0.00 ? 51  VAL A HG13 3  
ATOM 4093  H HG21 . VAL A 1 51  ? -5.794  8.151   -2.294  1.00 0.00 ? 51  VAL A HG21 3  
ATOM 4094  H HG22 . VAL A 1 51  ? -7.360  8.572   -1.600  1.00 0.00 ? 51  VAL A HG22 3  
ATOM 4095  H HG23 . VAL A 1 51  ? -7.135  8.599   -3.349  1.00 0.00 ? 51  VAL A HG23 3  
ATOM 4096  N N    . LYS A 1 52  ? -3.715  12.182  -1.622  1.00 0.00 ? 52  LYS A N    3  
ATOM 4097  C CA   . LYS A 1 52  ? -3.160  13.529  -1.678  1.00 0.00 ? 52  LYS A CA   3  
ATOM 4098  C C    . LYS A 1 52  ? -4.158  14.503  -2.297  1.00 0.00 ? 52  LYS A C    3  
ATOM 4099  O O    . LYS A 1 52  ? -4.499  14.390  -3.474  1.00 0.00 ? 52  LYS A O    3  
ATOM 4100  C CB   . LYS A 1 52  ? -1.859  13.534  -2.484  1.00 0.00 ? 52  LYS A CB   3  
ATOM 4101  C CG   . LYS A 1 52  ? -0.867  14.590  -2.031  1.00 0.00 ? 52  LYS A CG   3  
ATOM 4102  C CD   . LYS A 1 52  ? 0.496   14.388  -2.673  1.00 0.00 ? 52  LYS A CD   3  
ATOM 4103  C CE   . LYS A 1 52  ? 1.616   14.876  -1.768  1.00 0.00 ? 52  LYS A CE   3  
ATOM 4104  N NZ   . LYS A 1 52  ? 1.337   16.233  -1.223  1.00 0.00 ? 52  LYS A NZ   3  
ATOM 4105  H H    . LYS A 1 52  ? -3.204  11.438  -2.005  1.00 0.00 ? 52  LYS A H    3  
ATOM 4106  H HA   . LYS A 1 52  ? -2.949  13.843  -0.667  1.00 0.00 ? 52  LYS A HA   3  
ATOM 4107  H HB2  . LYS A 1 52  ? -1.390  12.565  -2.393  1.00 0.00 ? 52  LYS A HB2  3  
ATOM 4108  H HB3  . LYS A 1 52  ? -2.094  13.713  -3.523  1.00 0.00 ? 52  LYS A HB3  3  
ATOM 4109  H HG2  . LYS A 1 52  ? -1.241  15.565  -2.307  1.00 0.00 ? 52  LYS A HG2  3  
ATOM 4110  H HG3  . LYS A 1 52  ? -0.760  14.534  -0.957  1.00 0.00 ? 52  LYS A HG3  3  
ATOM 4111  H HD2  . LYS A 1 52  ? 0.639   13.335  -2.869  1.00 0.00 ? 52  LYS A HD2  3  
ATOM 4112  H HD3  . LYS A 1 52  ? 0.530   14.937  -3.604  1.00 0.00 ? 52  LYS A HD3  3  
ATOM 4113  H HE2  . LYS A 1 52  ? 1.726   14.184  -0.948  1.00 0.00 ? 52  LYS A HE2  3  
ATOM 4114  H HE3  . LYS A 1 52  ? 2.533   14.907  -2.338  1.00 0.00 ? 52  LYS A HE3  3  
ATOM 4115  H HZ1  . LYS A 1 52  ? 1.936   16.939  -1.698  1.00 0.00 ? 52  LYS A HZ1  3  
ATOM 4116  H HZ2  . LYS A 1 52  ? 1.538   16.257  -0.203  1.00 0.00 ? 52  LYS A HZ2  3  
ATOM 4117  H HZ3  . LYS A 1 52  ? 0.339   16.482  -1.376  1.00 0.00 ? 52  LYS A HZ3  3  
ATOM 4118  N N    . GLU A 1 53  ? -4.620  15.458  -1.497  1.00 0.00 ? 53  GLU A N    3  
ATOM 4119  C CA   . GLU A 1 53  ? -5.578  16.452  -1.969  1.00 0.00 ? 53  GLU A CA   3  
ATOM 4120  C C    . GLU A 1 53  ? -5.070  17.141  -3.232  1.00 0.00 ? 53  GLU A C    3  
ATOM 4121  O O    . GLU A 1 53  ? -5.801  17.284  -4.213  1.00 0.00 ? 53  GLU A O    3  
ATOM 4122  C CB   . GLU A 1 53  ? -5.845  17.492  -0.879  1.00 0.00 ? 53  GLU A CB   3  
ATOM 4123  C CG   . GLU A 1 53  ? -4.633  18.345  -0.542  1.00 0.00 ? 53  GLU A CG   3  
ATOM 4124  C CD   . GLU A 1 53  ? -3.471  17.525  -0.017  1.00 0.00 ? 53  GLU A CD   3  
ATOM 4125  O OE1  . GLU A 1 53  ? -3.684  16.719  0.913   1.00 0.00 ? 53  GLU A OE1  3  
ATOM 4126  O OE2  . GLU A 1 53  ? -2.347  17.689  -0.537  1.00 0.00 ? 53  GLU A OE2  3  
ATOM 4127  H H    . GLU A 1 53  ? -4.310  15.496  -0.568  1.00 0.00 ? 53  GLU A H    3  
ATOM 4128  H HA   . GLU A 1 53  ? -6.500  15.940  -2.198  1.00 0.00 ? 53  GLU A HA   3  
ATOM 4129  H HB2  . GLU A 1 53  ? -6.639  18.146  -1.209  1.00 0.00 ? 53  GLU A HB2  3  
ATOM 4130  H HB3  . GLU A 1 53  ? -6.161  16.982  0.019   1.00 0.00 ? 53  GLU A HB3  3  
ATOM 4131  H HG2  . GLU A 1 53  ? -4.314  18.863  -1.433  1.00 0.00 ? 53  GLU A HG2  3  
ATOM 4132  H HG3  . GLU A 1 53  ? -4.915  19.066  0.211   1.00 0.00 ? 53  GLU A HG3  3  
ATOM 4133  N N    . THR A 1 54  ? -3.811  17.567  -3.201  1.00 0.00 ? 54  THR A N    3  
ATOM 4134  C CA   . THR A 1 54  ? -3.205  18.242  -4.342  1.00 0.00 ? 54  THR A CA   3  
ATOM 4135  C C    . THR A 1 54  ? -1.967  17.497  -4.828  1.00 0.00 ? 54  THR A C    3  
ATOM 4136  O O    . THR A 1 54  ? -0.879  18.066  -4.909  1.00 0.00 ? 54  THR A O    3  
ATOM 4137  C CB   . THR A 1 54  ? -2.813  19.691  -3.994  1.00 0.00 ? 54  THR A CB   3  
ATOM 4138  O OG1  . THR A 1 54  ? -1.926  19.702  -2.870  1.00 0.00 ? 54  THR A OG1  3  
ATOM 4139  C CG2  . THR A 1 54  ? -4.047  20.524  -3.680  1.00 0.00 ? 54  THR A CG2  3  
ATOM 4140  H H    . THR A 1 54  ? -3.279  17.424  -2.391  1.00 0.00 ? 54  THR A H    3  
ATOM 4141  H HA   . THR A 1 54  ? -3.933  18.270  -5.139  1.00 0.00 ? 54  THR A HA   3  
ATOM 4142  H HB   . THR A 1 54  ? -2.310  20.126  -4.845  1.00 0.00 ? 54  THR A HB   3  
ATOM 4143  H HG1  . THR A 1 54  ? -1.038  19.921  -3.166  1.00 0.00 ? 54  THR A HG1  3  
ATOM 4144  H HG21 . THR A 1 54  ? -3.791  21.292  -2.965  1.00 0.00 ? 54  THR A HG21 3  
ATOM 4145  H HG22 . THR A 1 54  ? -4.815  19.888  -3.266  1.00 0.00 ? 54  THR A HG22 3  
ATOM 4146  H HG23 . THR A 1 54  ? -4.410  20.984  -4.586  1.00 0.00 ? 54  THR A HG23 3  
ATOM 4147  N N    . GLY A 1 55  ? -2.140  16.219  -5.151  1.00 0.00 ? 55  GLY A N    3  
ATOM 4148  C CA   . GLY A 1 55  ? -1.028  15.416  -5.626  1.00 0.00 ? 55  GLY A CA   3  
ATOM 4149  C C    . GLY A 1 55  ? -1.248  14.895  -7.032  1.00 0.00 ? 55  GLY A C    3  
ATOM 4150  O O    . GLY A 1 55  ? -1.652  15.644  -7.924  1.00 0.00 ? 55  GLY A O    3  
ATOM 4151  H H    . GLY A 1 55  ? -3.031  15.817  -5.066  1.00 0.00 ? 55  GLY A H    3  
ATOM 4152  H HA2  . GLY A 1 55  ? -0.132  16.018  -5.612  1.00 0.00 ? 55  GLY A HA2  3  
ATOM 4153  H HA3  . GLY A 1 55  ? -0.896  14.576  -4.960  1.00 0.00 ? 55  GLY A HA3  3  
ATOM 4154  N N    . LEU A 1 56  ? -0.981  13.610  -7.234  1.00 0.00 ? 56  LEU A N    3  
ATOM 4155  C CA   . LEU A 1 56  ? -1.151  12.989  -8.543  1.00 0.00 ? 56  LEU A CA   3  
ATOM 4156  C C    . LEU A 1 56  ? -2.299  11.986  -8.525  1.00 0.00 ? 56  LEU A C    3  
ATOM 4157  O O    . LEU A 1 56  ? -3.336  12.202  -9.153  1.00 0.00 ? 56  LEU A O    3  
ATOM 4158  C CB   . LEU A 1 56  ? 0.142   12.294  -8.971  1.00 0.00 ? 56  LEU A CB   3  
ATOM 4159  C CG   . LEU A 1 56  ? 1.416   13.137  -8.893  1.00 0.00 ? 56  LEU A CG   3  
ATOM 4160  C CD1  . LEU A 1 56  ? 2.625   12.255  -8.623  1.00 0.00 ? 56  LEU A CD1  3  
ATOM 4161  C CD2  . LEU A 1 56  ? 1.609   13.932  -10.176 1.00 0.00 ? 56  LEU A CD2  3  
ATOM 4162  H H    . LEU A 1 56  ? -0.663  13.064  -6.485  1.00 0.00 ? 56  LEU A H    3  
ATOM 4163  H HA   . LEU A 1 56  ? -1.382  13.770  -9.252  1.00 0.00 ? 56  LEU A HA   3  
ATOM 4164  H HB2  . LEU A 1 56  ? 0.279   11.430  -8.338  1.00 0.00 ? 56  LEU A HB2  3  
ATOM 4165  H HB3  . LEU A 1 56  ? 0.020   11.971  -9.996  1.00 0.00 ? 56  LEU A HB3  3  
ATOM 4166  H HG   . LEU A 1 56  ? 1.326   13.838  -8.075  1.00 0.00 ? 56  LEU A HG   3  
ATOM 4167  H HD11 . LEU A 1 56  ? 3.131   12.600  -7.735  1.00 0.00 ? 56  LEU A HD11 3  
ATOM 4168  H HD12 . LEU A 1 56  ? 3.300   12.303  -9.464  1.00 0.00 ? 56  LEU A HD12 3  
ATOM 4169  H HD13 . LEU A 1 56  ? 2.301   11.234  -8.481  1.00 0.00 ? 56  LEU A HD13 3  
ATOM 4170  H HD21 . LEU A 1 56  ? 1.657   13.253  -11.015 1.00 0.00 ? 56  LEU A HD21 3  
ATOM 4171  H HD22 . LEU A 1 56  ? 2.528   14.496  -10.115 1.00 0.00 ? 56  LEU A HD22 3  
ATOM 4172  H HD23 . LEU A 1 56  ? 0.778   14.609  -10.308 1.00 0.00 ? 56  LEU A HD23 3  
ATOM 4173  N N    . ALA A 1 57  ? -2.108  10.888  -7.800  1.00 0.00 ? 57  ALA A N    3  
ATOM 4174  C CA   . ALA A 1 57  ? -3.130  9.853   -7.697  1.00 0.00 ? 57  ALA A CA   3  
ATOM 4175  C C    . ALA A 1 57  ? -4.529  10.457  -7.738  1.00 0.00 ? 57  ALA A C    3  
ATOM 4176  O O    . ALA A 1 57  ? -5.452  9.873   -8.305  1.00 0.00 ? 57  ALA A O    3  
ATOM 4177  C CB   . ALA A 1 57  ? -2.937  9.047   -6.421  1.00 0.00 ? 57  ALA A CB   3  
ATOM 4178  H H    . ALA A 1 57  ? -1.261  10.773  -7.322  1.00 0.00 ? 57  ALA A H    3  
ATOM 4179  H HA   . ALA A 1 57  ? -3.013  9.184   -8.538  1.00 0.00 ? 57  ALA A HA   3  
ATOM 4180  H HB1  . ALA A 1 57  ? -3.876  8.592   -6.139  1.00 0.00 ? 57  ALA A HB1  3  
ATOM 4181  H HB2  . ALA A 1 57  ? -2.199  8.277   -6.590  1.00 0.00 ? 57  ALA A HB2  3  
ATOM 4182  H HB3  . ALA A 1 57  ? -2.602  9.701   -5.630  1.00 0.00 ? 57  ALA A HB3  3  
ATOM 4183  N N    . SER A 1 58  ? -4.680  11.631  -7.131  1.00 0.00 ? 58  SER A N    3  
ATOM 4184  C CA   . SER A 1 58  ? -5.969  12.312  -7.094  1.00 0.00 ? 58  SER A CA   3  
ATOM 4185  C C    . SER A 1 58  ? -6.362  12.807  -8.483  1.00 0.00 ? 58  SER A C    3  
ATOM 4186  O O    . SER A 1 58  ? -7.460  12.530  -8.967  1.00 0.00 ? 58  SER A O    3  
ATOM 4187  C CB   . SER A 1 58  ? -5.921  13.487  -6.116  1.00 0.00 ? 58  SER A CB   3  
ATOM 4188  O OG   . SER A 1 58  ? -6.911  14.452  -6.428  1.00 0.00 ? 58  SER A OG   3  
ATOM 4189  H H    . SER A 1 58  ? -3.906  12.047  -6.697  1.00 0.00 ? 58  SER A H    3  
ATOM 4190  H HA   . SER A 1 58  ? -6.709  11.603  -6.755  1.00 0.00 ? 58  SER A HA   3  
ATOM 4191  H HB2  . SER A 1 58  ? -6.092  13.125  -5.114  1.00 0.00 ? 58  SER A HB2  3  
ATOM 4192  H HB3  . SER A 1 58  ? -4.949  13.956  -6.169  1.00 0.00 ? 58  SER A HB3  3  
ATOM 4193  H HG   . SER A 1 58  ? -7.684  14.012  -6.790  1.00 0.00 ? 58  SER A HG   3  
ATOM 4194  N N    . LYS A 1 59  ? -5.457  13.542  -9.120  1.00 0.00 ? 59  LYS A N    3  
ATOM 4195  C CA   . LYS A 1 59  ? -5.705  14.076  -10.454 1.00 0.00 ? 59  LYS A CA   3  
ATOM 4196  C C    . LYS A 1 59  ? -5.704  12.962  -11.495 1.00 0.00 ? 59  LYS A C    3  
ATOM 4197  O O    . LYS A 1 59  ? -5.978  13.198  -12.672 1.00 0.00 ? 59  LYS A O    3  
ATOM 4198  C CB   . LYS A 1 59  ? -4.648  15.124  -10.811 1.00 0.00 ? 59  LYS A CB   3  
ATOM 4199  C CG   . LYS A 1 59  ? -3.372  14.530  -11.381 1.00 0.00 ? 59  LYS A CG   3  
ATOM 4200  C CD   . LYS A 1 59  ? -2.226  15.527  -11.339 1.00 0.00 ? 59  LYS A CD   3  
ATOM 4201  C CE   . LYS A 1 59  ? -2.469  16.695  -12.283 1.00 0.00 ? 59  LYS A CE   3  
ATOM 4202  N NZ   . LYS A 1 59  ? -2.256  16.312  -13.706 1.00 0.00 ? 59  LYS A NZ   3  
ATOM 4203  H H    . LYS A 1 59  ? -4.599  13.729  -8.682  1.00 0.00 ? 59  LYS A H    3  
ATOM 4204  H HA   . LYS A 1 59  ? -6.677  14.546  -10.447 1.00 0.00 ? 59  LYS A HA   3  
ATOM 4205  H HB2  . LYS A 1 59  ? -5.063  15.802  -11.542 1.00 0.00 ? 59  LYS A HB2  3  
ATOM 4206  H HB3  . LYS A 1 59  ? -4.395  15.680  -9.920  1.00 0.00 ? 59  LYS A HB3  3  
ATOM 4207  H HG2  . LYS A 1 59  ? -3.099  13.661  -10.801 1.00 0.00 ? 59  LYS A HG2  3  
ATOM 4208  H HG3  . LYS A 1 59  ? -3.547  14.240  -12.407 1.00 0.00 ? 59  LYS A HG3  3  
ATOM 4209  H HD2  . LYS A 1 59  ? -2.126  15.906  -10.333 1.00 0.00 ? 59  LYS A HD2  3  
ATOM 4210  H HD3  . LYS A 1 59  ? -1.313  15.026  -11.629 1.00 0.00 ? 59  LYS A HD3  3  
ATOM 4211  H HE2  . LYS A 1 59  ? -3.485  17.035  -12.159 1.00 0.00 ? 59  LYS A HE2  3  
ATOM 4212  H HE3  . LYS A 1 59  ? -1.788  17.494  -12.028 1.00 0.00 ? 59  LYS A HE3  3  
ATOM 4213  H HZ1  . LYS A 1 59  ? -2.888  16.863  -14.322 1.00 0.00 ? 59  LYS A HZ1  3  
ATOM 4214  H HZ2  . LYS A 1 59  ? -2.457  15.301  -13.838 1.00 0.00 ? 59  LYS A HZ2  3  
ATOM 4215  H HZ3  . LYS A 1 59  ? -1.271  16.498  -13.983 1.00 0.00 ? 59  LYS A HZ3  3  
ATOM 4216  N N    . LYS A 1 60  ? -5.396  11.747  -11.055 1.00 0.00 ? 60  LYS A N    3  
ATOM 4217  C CA   . LYS A 1 60  ? -5.361  10.595  -11.947 1.00 0.00 ? 60  LYS A CA   3  
ATOM 4218  C C    . LYS A 1 60  ? -6.719  9.901   -11.992 1.00 0.00 ? 60  LYS A C    3  
ATOM 4219  O O    . LYS A 1 60  ? -7.290  9.702   -13.064 1.00 0.00 ? 60  LYS A O    3  
ATOM 4220  C CB   . LYS A 1 60  ? -4.286  9.605   -11.495 1.00 0.00 ? 60  LYS A CB   3  
ATOM 4221  C CG   . LYS A 1 60  ? -2.927  9.851   -12.129 1.00 0.00 ? 60  LYS A CG   3  
ATOM 4222  C CD   . LYS A 1 60  ? -2.603  11.334  -12.195 1.00 0.00 ? 60  LYS A CD   3  
ATOM 4223  C CE   . LYS A 1 60  ? -1.210  11.575  -12.754 1.00 0.00 ? 60  LYS A CE   3  
ATOM 4224  N NZ   . LYS A 1 60  ? -1.121  12.871  -13.483 1.00 0.00 ? 60  LYS A NZ   3  
ATOM 4225  H H    . LYS A 1 60  ? -5.186  11.622  -10.105 1.00 0.00 ? 60  LYS A H    3  
ATOM 4226  H HA   . LYS A 1 60  ? -5.119  10.949  -12.938 1.00 0.00 ? 60  LYS A HA   3  
ATOM 4227  H HB2  . LYS A 1 60  ? -4.177  9.674   -10.423 1.00 0.00 ? 60  LYS A HB2  3  
ATOM 4228  H HB3  . LYS A 1 60  ? -4.603  8.604   -11.752 1.00 0.00 ? 60  LYS A HB3  3  
ATOM 4229  H HG2  . LYS A 1 60  ? -2.170  9.354   -11.541 1.00 0.00 ? 60  LYS A HG2  3  
ATOM 4230  H HG3  . LYS A 1 60  ? -2.930  9.447   -13.131 1.00 0.00 ? 60  LYS A HG3  3  
ATOM 4231  H HD2  . LYS A 1 60  ? -3.325  11.823  -12.832 1.00 0.00 ? 60  LYS A HD2  3  
ATOM 4232  H HD3  . LYS A 1 60  ? -2.659  11.750  -11.199 1.00 0.00 ? 60  LYS A HD3  3  
ATOM 4233  H HE2  . LYS A 1 60  ? -0.505  11.583  -11.937 1.00 0.00 ? 60  LYS A HE2  3  
ATOM 4234  H HE3  . LYS A 1 60  ? -0.965  10.772  -13.434 1.00 0.00 ? 60  LYS A HE3  3  
ATOM 4235  H HZ1  . LYS A 1 60  ? -1.652  12.815  -14.376 1.00 0.00 ? 60  LYS A HZ1  3  
ATOM 4236  H HZ2  . LYS A 1 60  ? -0.129  13.094  -13.696 1.00 0.00 ? 60  LYS A HZ2  3  
ATOM 4237  H HZ3  . LYS A 1 60  ? -1.521  13.636  -12.902 1.00 0.00 ? 60  LYS A HZ3  3  
ATOM 4238  N N    . GLY A 1 61  ? -7.231  9.536   -10.821 1.00 0.00 ? 61  GLY A N    3  
ATOM 4239  C CA   . GLY A 1 61  ? -8.519  8.870   -10.750 1.00 0.00 ? 61  GLY A CA   3  
ATOM 4240  C C    . GLY A 1 61  ? -8.787  8.270   -9.383  1.00 0.00 ? 61  GLY A C    3  
ATOM 4241  O O    . GLY A 1 61  ? -9.938  8.036   -9.014  1.00 0.00 ? 61  GLY A O    3  
ATOM 4242  H H    . GLY A 1 61  ? -6.731  9.720   -9.999  1.00 0.00 ? 61  GLY A H    3  
ATOM 4243  H HA2  . GLY A 1 61  ? -9.295  9.585   -10.976 1.00 0.00 ? 61  GLY A HA2  3  
ATOM 4244  H HA3  . GLY A 1 61  ? -8.544  8.081   -11.487 1.00 0.00 ? 61  GLY A HA3  3  
ATOM 4245  N N    . LEU A 1 62  ? -7.721  8.020   -8.630  1.00 0.00 ? 62  LEU A N    3  
ATOM 4246  C CA   . LEU A 1 62  ? -7.846  7.442   -7.296  1.00 0.00 ? 62  LEU A CA   3  
ATOM 4247  C C    . LEU A 1 62  ? -8.650  8.358   -6.379  1.00 0.00 ? 62  LEU A C    3  
ATOM 4248  O O    . LEU A 1 62  ? -8.872  9.528   -6.691  1.00 0.00 ? 62  LEU A O    3  
ATOM 4249  C CB   . LEU A 1 62  ? -6.462  7.189   -6.697  1.00 0.00 ? 62  LEU A CB   3  
ATOM 4250  C CG   . LEU A 1 62  ? -5.795  5.868   -7.084  1.00 0.00 ? 62  LEU A CG   3  
ATOM 4251  C CD1  . LEU A 1 62  ? -4.291  5.948   -6.871  1.00 0.00 ? 62  LEU A CD1  3  
ATOM 4252  C CD2  . LEU A 1 62  ? -6.388  4.717   -6.285  1.00 0.00 ? 62  LEU A CD2  3  
ATOM 4253  H H    . LEU A 1 62  ? -6.830  8.228   -8.978  1.00 0.00 ? 62  LEU A H    3  
ATOM 4254  H HA   . LEU A 1 62  ? -8.367  6.501   -7.390  1.00 0.00 ? 62  LEU A HA   3  
ATOM 4255  H HB2  . LEU A 1 62  ? -5.813  7.992   -7.012  1.00 0.00 ? 62  LEU A HB2  3  
ATOM 4256  H HB3  . LEU A 1 62  ? -6.560  7.209   -5.621  1.00 0.00 ? 62  LEU A HB3  3  
ATOM 4257  H HG   . LEU A 1 62  ? -5.973  5.676   -8.133  1.00 0.00 ? 62  LEU A HG   3  
ATOM 4258  H HD11 . LEU A 1 62  ? -3.834  6.444   -7.714  1.00 0.00 ? 62  LEU A HD11 3  
ATOM 4259  H HD12 . LEU A 1 62  ? -3.887  4.951   -6.778  1.00 0.00 ? 62  LEU A HD12 3  
ATOM 4260  H HD13 . LEU A 1 62  ? -4.084  6.506   -5.970  1.00 0.00 ? 62  LEU A HD13 3  
ATOM 4261  H HD21 . LEU A 1 62  ? -6.839  4.005   -6.960  1.00 0.00 ? 62  LEU A HD21 3  
ATOM 4262  H HD22 . LEU A 1 62  ? -7.139  5.098   -5.608  1.00 0.00 ? 62  LEU A HD22 3  
ATOM 4263  H HD23 . LEU A 1 62  ? -5.606  4.232   -5.719  1.00 0.00 ? 62  LEU A HD23 3  
ATOM 4264  N N    . LYS A 1 63  ? -9.083  7.819   -5.245  1.00 0.00 ? 63  LYS A N    3  
ATOM 4265  C CA   . LYS A 1 63  ? -9.860  8.588   -4.279  1.00 0.00 ? 63  LYS A CA   3  
ATOM 4266  C C    . LYS A 1 63  ? -10.114 7.774   -3.014  1.00 0.00 ? 63  LYS A C    3  
ATOM 4267  O O    . LYS A 1 63  ? -10.126 6.544   -3.048  1.00 0.00 ? 63  LYS A O    3  
ATOM 4268  C CB   . LYS A 1 63  ? -11.191 9.023   -4.895  1.00 0.00 ? 63  LYS A CB   3  
ATOM 4269  C CG   . LYS A 1 63  ? -11.801 10.242  -4.226  1.00 0.00 ? 63  LYS A CG   3  
ATOM 4270  C CD   . LYS A 1 63  ? -13.318 10.223  -4.308  1.00 0.00 ? 63  LYS A CD   3  
ATOM 4271  C CE   . LYS A 1 63  ? -13.940 11.245  -3.368  1.00 0.00 ? 63  LYS A CE   3  
ATOM 4272  N NZ   . LYS A 1 63  ? -15.416 11.337  -3.548  1.00 0.00 ? 63  LYS A NZ   3  
ATOM 4273  H H    . LYS A 1 63  ? -8.875  6.880   -5.052  1.00 0.00 ? 63  LYS A H    3  
ATOM 4274  H HA   . LYS A 1 63  ? -9.289  9.466   -4.018  1.00 0.00 ? 63  LYS A HA   3  
ATOM 4275  H HB2  . LYS A 1 63  ? -11.034 9.252   -5.939  1.00 0.00 ? 63  LYS A HB2  3  
ATOM 4276  H HB3  . LYS A 1 63  ? -11.894 8.206   -4.816  1.00 0.00 ? 63  LYS A HB3  3  
ATOM 4277  H HG2  . LYS A 1 63  ? -11.508 10.256  -3.186  1.00 0.00 ? 63  LYS A HG2  3  
ATOM 4278  H HG3  . LYS A 1 63  ? -11.434 11.132  -4.717  1.00 0.00 ? 63  LYS A HG3  3  
ATOM 4279  H HD2  . LYS A 1 63  ? -13.618 10.452  -5.320  1.00 0.00 ? 63  LYS A HD2  3  
ATOM 4280  H HD3  . LYS A 1 63  ? -13.672 9.238   -4.040  1.00 0.00 ? 63  LYS A HD3  3  
ATOM 4281  H HE2  . LYS A 1 63  ? -13.728 10.954  -2.351  1.00 0.00 ? 63  LYS A HE2  3  
ATOM 4282  H HE3  . LYS A 1 63  ? -13.501 12.211  -3.566  1.00 0.00 ? 63  LYS A HE3  3  
ATOM 4283  H HZ1  . LYS A 1 63  ? -15.637 11.723  -4.488  1.00 0.00 ? 63  LYS A HZ1  3  
ATOM 4284  H HZ2  . LYS A 1 63  ? -15.825 11.962  -2.824  1.00 0.00 ? 63  LYS A HZ2  3  
ATOM 4285  H HZ3  . LYS A 1 63  ? -15.846 10.395  -3.461  1.00 0.00 ? 63  LYS A HZ3  3  
ATOM 4286  N N    . ALA A 1 64  ? -10.319 8.469   -1.900  1.00 0.00 ? 64  ALA A N    3  
ATOM 4287  C CA   . ALA A 1 64  ? -10.577 7.810   -0.626  1.00 0.00 ? 64  ALA A CA   3  
ATOM 4288  C C    . ALA A 1 64  ? -11.869 7.001   -0.678  1.00 0.00 ? 64  ALA A C    3  
ATOM 4289  O O    . ALA A 1 64  ? -12.947 7.514   -0.382  1.00 0.00 ? 64  ALA A O    3  
ATOM 4290  C CB   . ALA A 1 64  ? -10.640 8.837   0.496   1.00 0.00 ? 64  ALA A CB   3  
ATOM 4291  H H    . ALA A 1 64  ? -10.298 9.448   -1.937  1.00 0.00 ? 64  ALA A H    3  
ATOM 4292  H HA   . ALA A 1 64  ? -9.753  7.141   -0.423  1.00 0.00 ? 64  ALA A HA   3  
ATOM 4293  H HB1  . ALA A 1 64  ? -10.767 9.823   0.073   1.00 0.00 ? 64  ALA A HB1  3  
ATOM 4294  H HB2  . ALA A 1 64  ? -11.475 8.612   1.143   1.00 0.00 ? 64  ALA A HB2  3  
ATOM 4295  H HB3  . ALA A 1 64  ? -9.724  8.804   1.065   1.00 0.00 ? 64  ALA A HB3  3  
ATOM 4296  N N    . GLY A 1 65  ? -11.751 5.731   -1.056  1.00 0.00 ? 65  GLY A N    3  
ATOM 4297  C CA   . GLY A 1 65  ? -12.918 4.872   -1.141  1.00 0.00 ? 65  GLY A CA   3  
ATOM 4298  C C    . GLY A 1 65  ? -12.821 3.874   -2.278  1.00 0.00 ? 65  GLY A C    3  
ATOM 4299  O O    . GLY A 1 65  ? -13.796 3.643   -2.993  1.00 0.00 ? 65  GLY A O    3  
ATOM 4300  H H    . GLY A 1 65  ? -10.866 5.376   -1.280  1.00 0.00 ? 65  GLY A H    3  
ATOM 4301  H HA2  . GLY A 1 65  ? -13.022 4.333   -0.211  1.00 0.00 ? 65  GLY A HA2  3  
ATOM 4302  H HA3  . GLY A 1 65  ? -13.793 5.486   -1.290  1.00 0.00 ? 65  GLY A HA3  3  
ATOM 4303  N N    . ASP A 1 66  ? -11.644 3.284   -2.446  1.00 0.00 ? 66  ASP A N    3  
ATOM 4304  C CA   . ASP A 1 66  ? -11.423 2.306   -3.505  1.00 0.00 ? 66  ASP A CA   3  
ATOM 4305  C C    . ASP A 1 66  ? -10.657 1.096   -2.978  1.00 0.00 ? 66  ASP A C    3  
ATOM 4306  O O    . ASP A 1 66  ? -10.182 1.099   -1.843  1.00 0.00 ? 66  ASP A O    3  
ATOM 4307  C CB   . ASP A 1 66  ? -10.657 2.943   -4.666  1.00 0.00 ? 66  ASP A CB   3  
ATOM 4308  C CG   . ASP A 1 66  ? -11.487 3.968   -5.414  1.00 0.00 ? 66  ASP A CG   3  
ATOM 4309  O OD1  . ASP A 1 66  ? -12.275 4.685   -4.761  1.00 0.00 ? 66  ASP A OD1  3  
ATOM 4310  O OD2  . ASP A 1 66  ? -11.348 4.055   -6.651  1.00 0.00 ? 66  ASP A OD2  3  
ATOM 4311  H H    . ASP A 1 66  ? -10.904 3.510   -1.843  1.00 0.00 ? 66  ASP A H    3  
ATOM 4312  H HA   . ASP A 1 66  ? -12.388 1.978   -3.860  1.00 0.00 ? 66  ASP A HA   3  
ATOM 4313  H HB2  . ASP A 1 66  ? -9.775  3.433   -4.281  1.00 0.00 ? 66  ASP A HB2  3  
ATOM 4314  H HB3  . ASP A 1 66  ? -10.361 2.170   -5.360  1.00 0.00 ? 66  ASP A HB3  3  
ATOM 4315  N N    . GLU A 1 67  ? -10.544 0.065   -3.809  1.00 0.00 ? 67  GLU A N    3  
ATOM 4316  C CA   . GLU A 1 67  ? -9.838  -1.151  -3.424  1.00 0.00 ? 67  GLU A CA   3  
ATOM 4317  C C    . GLU A 1 67  ? -8.741  -1.485  -4.431  1.00 0.00 ? 67  GLU A C    3  
ATOM 4318  O O    . GLU A 1 67  ? -8.888  -1.241  -5.629  1.00 0.00 ? 67  GLU A O    3  
ATOM 4319  C CB   . GLU A 1 67  ? -10.817 -2.323  -3.313  1.00 0.00 ? 67  GLU A CB   3  
ATOM 4320  C CG   . GLU A 1 67  ? -11.274 -2.863  -4.658  1.00 0.00 ? 67  GLU A CG   3  
ATOM 4321  C CD   . GLU A 1 67  ? -12.440 -2.084  -5.234  1.00 0.00 ? 67  GLU A CD   3  
ATOM 4322  O OE1  . GLU A 1 67  ? -13.592 -2.366  -4.842  1.00 0.00 ? 67  GLU A OE1  3  
ATOM 4323  O OE2  . GLU A 1 67  ? -12.202 -1.193  -6.075  1.00 0.00 ? 67  GLU A OE2  3  
ATOM 4324  H H    . GLU A 1 67  ? -10.946 0.123   -4.701  1.00 0.00 ? 67  GLU A H    3  
ATOM 4325  H HA   . GLU A 1 67  ? -9.385  -0.981  -2.459  1.00 0.00 ? 67  GLU A HA   3  
ATOM 4326  H HB2  . GLU A 1 67  ? -10.340 -3.124  -2.769  1.00 0.00 ? 67  GLU A HB2  3  
ATOM 4327  H HB3  . GLU A 1 67  ? -11.688 -1.996  -2.765  1.00 0.00 ? 67  GLU A HB3  3  
ATOM 4328  H HG2  . GLU A 1 67  ? -10.449 -2.810  -5.352  1.00 0.00 ? 67  GLU A HG2  3  
ATOM 4329  H HG3  . GLU A 1 67  ? -11.574 -3.893  -4.534  1.00 0.00 ? 67  GLU A HG3  3  
ATOM 4330  N N    . ILE A 1 68  ? -7.641  -2.043  -3.935  1.00 0.00 ? 68  ILE A N    3  
ATOM 4331  C CA   . ILE A 1 68  ? -6.520  -2.410  -4.790  1.00 0.00 ? 68  ILE A CA   3  
ATOM 4332  C C    . ILE A 1 68  ? -6.554  -3.896  -5.134  1.00 0.00 ? 68  ILE A C    3  
ATOM 4333  O O    . ILE A 1 68  ? -6.850  -4.735  -4.282  1.00 0.00 ? 68  ILE A O    3  
ATOM 4334  C CB   . ILE A 1 68  ? -5.171  -2.080  -4.123  1.00 0.00 ? 68  ILE A CB   3  
ATOM 4335  C CG1  . ILE A 1 68  ? -5.178  -0.645  -3.593  1.00 0.00 ? 68  ILE A CG1  3  
ATOM 4336  C CG2  . ILE A 1 68  ? -4.030  -2.281  -5.109  1.00 0.00 ? 68  ILE A CG2  3  
ATOM 4337  C CD1  . ILE A 1 68  ? -5.779  0.353   -4.558  1.00 0.00 ? 68  ILE A CD1  3  
ATOM 4338  H H    . ILE A 1 68  ? -7.584  -2.213  -2.972  1.00 0.00 ? 68  ILE A H    3  
ATOM 4339  H HA   . ILE A 1 68  ? -6.597  -1.839  -5.704  1.00 0.00 ? 68  ILE A HA   3  
ATOM 4340  H HB   . ILE A 1 68  ? -5.027  -2.760  -3.298  1.00 0.00 ? 68  ILE A HB   3  
ATOM 4341  H HG12 . ILE A 1 68  ? -5.751  -0.608  -2.680  1.00 0.00 ? 68  ILE A HG12 3  
ATOM 4342  H HG13 . ILE A 1 68  ? -4.162  -0.340  -3.388  1.00 0.00 ? 68  ILE A HG13 3  
ATOM 4343  H HG21 . ILE A 1 68  ? -3.195  -1.658  -4.823  1.00 0.00 ? 68  ILE A HG21 3  
ATOM 4344  H HG22 . ILE A 1 68  ? -3.725  -3.317  -5.100  1.00 0.00 ? 68  ILE A HG22 3  
ATOM 4345  H HG23 . ILE A 1 68  ? -4.358  -2.010  -6.101  1.00 0.00 ? 68  ILE A HG23 3  
ATOM 4346  H HD11 . ILE A 1 68  ? -5.307  0.249   -5.525  1.00 0.00 ? 68  ILE A HD11 3  
ATOM 4347  H HD12 . ILE A 1 68  ? -6.838  0.172   -4.652  1.00 0.00 ? 68  ILE A HD12 3  
ATOM 4348  H HD13 . ILE A 1 68  ? -5.616  1.355   -4.187  1.00 0.00 ? 68  ILE A HD13 3  
ATOM 4349  N N    . LEU A 1 69  ? -6.246  -4.215  -6.386  1.00 0.00 ? 69  LEU A N    3  
ATOM 4350  C CA   . LEU A 1 69  ? -6.239  -5.600  -6.843  1.00 0.00 ? 69  LEU A CA   3  
ATOM 4351  C C    . LEU A 1 69  ? -4.812  -6.100  -7.046  1.00 0.00 ? 69  LEU A C    3  
ATOM 4352  O O    . LEU A 1 69  ? -4.513  -7.267  -6.799  1.00 0.00 ? 69  LEU A O    3  
ATOM 4353  C CB   . LEU A 1 69  ? -7.028  -5.732  -8.147  1.00 0.00 ? 69  LEU A CB   3  
ATOM 4354  C CG   . LEU A 1 69  ? -8.434  -5.131  -8.145  1.00 0.00 ? 69  LEU A CG   3  
ATOM 4355  C CD1  . LEU A 1 69  ? -8.952  -4.979  -9.567  1.00 0.00 ? 69  LEU A CD1  3  
ATOM 4356  C CD2  . LEU A 1 69  ? -9.380  -5.990  -7.320  1.00 0.00 ? 69  LEU A CD2  3  
ATOM 4357  H H    . LEU A 1 69  ? -6.018  -3.503  -7.019  1.00 0.00 ? 69  LEU A H    3  
ATOM 4358  H HA   . LEU A 1 69  ? -6.714  -6.202  -6.083  1.00 0.00 ? 69  LEU A HA   3  
ATOM 4359  H HB2  . LEU A 1 69  ? -6.462  -5.245  -8.926  1.00 0.00 ? 69  LEU A HB2  3  
ATOM 4360  H HB3  . LEU A 1 69  ? -7.117  -6.785  -8.374  1.00 0.00 ? 69  LEU A HB3  3  
ATOM 4361  H HG   . LEU A 1 69  ? -8.397  -4.147  -7.697  1.00 0.00 ? 69  LEU A HG   3  
ATOM 4362  H HD11 . LEU A 1 69  ? -8.928  -5.937  -10.063 1.00 0.00 ? 69  LEU A HD11 3  
ATOM 4363  H HD12 . LEU A 1 69  ? -8.328  -4.280  -10.104 1.00 0.00 ? 69  LEU A HD12 3  
ATOM 4364  H HD13 . LEU A 1 69  ? -9.967  -4.610  -9.542  1.00 0.00 ? 69  LEU A HD13 3  
ATOM 4365  H HD21 . LEU A 1 69  ? -10.399 -5.796  -7.622  1.00 0.00 ? 69  LEU A HD21 3  
ATOM 4366  H HD22 . LEU A 1 69  ? -9.264  -5.750  -6.272  1.00 0.00 ? 69  LEU A HD22 3  
ATOM 4367  H HD23 . LEU A 1 69  ? -9.150  -7.033  -7.478  1.00 0.00 ? 69  LEU A HD23 3  
ATOM 4368  N N    . GLU A 1 70  ? -3.936  -5.206  -7.495  1.00 0.00 ? 70  GLU A N    3  
ATOM 4369  C CA   . GLU A 1 70  ? -2.541  -5.557  -7.729  1.00 0.00 ? 70  GLU A CA   3  
ATOM 4370  C C    . GLU A 1 70  ? -1.665  -4.308  -7.770  1.00 0.00 ? 70  GLU A C    3  
ATOM 4371  O O    . GLU A 1 70  ? -2.138  -3.216  -8.085  1.00 0.00 ? 70  GLU A O    3  
ATOM 4372  C CB   . GLU A 1 70  ? -2.400  -6.334  -9.040  1.00 0.00 ? 70  GLU A CB   3  
ATOM 4373  C CG   . GLU A 1 70  ? -2.717  -7.814  -8.907  1.00 0.00 ? 70  GLU A CG   3  
ATOM 4374  C CD   . GLU A 1 70  ? -1.965  -8.665  -9.911  1.00 0.00 ? 70  GLU A CD   3  
ATOM 4375  O OE1  . GLU A 1 70  ? -0.782  -8.976  -9.656  1.00 0.00 ? 70  GLU A OE1  3  
ATOM 4376  O OE2  . GLU A 1 70  ? -2.557  -9.020  -10.952 1.00 0.00 ? 70  GLU A OE2  3  
ATOM 4377  H H    . GLU A 1 70  ? -4.236  -4.291  -7.674  1.00 0.00 ? 70  GLU A H    3  
ATOM 4378  H HA   . GLU A 1 70  ? -2.215  -6.184  -6.913  1.00 0.00 ? 70  GLU A HA   3  
ATOM 4379  H HB2  . GLU A 1 70  ? -3.070  -5.908  -9.772  1.00 0.00 ? 70  GLU A HB2  3  
ATOM 4380  H HB3  . GLU A 1 70  ? -1.385  -6.236  -9.395  1.00 0.00 ? 70  GLU A HB3  3  
ATOM 4381  H HG2  . GLU A 1 70  ? -2.451  -8.139  -7.912  1.00 0.00 ? 70  GLU A HG2  3  
ATOM 4382  H HG3  . GLU A 1 70  ? -3.777  -7.957  -9.059  1.00 0.00 ? 70  GLU A HG3  3  
ATOM 4383  N N    . ILE A 1 71  ? -0.387  -4.478  -7.448  1.00 0.00 ? 71  ILE A N    3  
ATOM 4384  C CA   . ILE A 1 71  ? 0.554   -3.365  -7.447  1.00 0.00 ? 71  ILE A CA   3  
ATOM 4385  C C    . ILE A 1 71  ? 1.826   -3.721  -8.210  1.00 0.00 ? 71  ILE A C    3  
ATOM 4386  O O    . ILE A 1 71  ? 2.690   -4.431  -7.698  1.00 0.00 ? 71  ILE A O    3  
ATOM 4387  C CB   . ILE A 1 71  ? 0.929   -2.945  -6.014  1.00 0.00 ? 71  ILE A CB   3  
ATOM 4388  C CG1  . ILE A 1 71  ? -0.333  -2.743  -5.172  1.00 0.00 ? 71  ILE A CG1  3  
ATOM 4389  C CG2  . ILE A 1 71  ? 1.767   -1.675  -6.036  1.00 0.00 ? 71  ILE A CG2  3  
ATOM 4390  C CD1  . ILE A 1 71  ? -0.046  -2.370  -3.734  1.00 0.00 ? 71  ILE A CD1  3  
ATOM 4391  H H    . ILE A 1 71  ? -0.070  -5.372  -7.205  1.00 0.00 ? 71  ILE A H    3  
ATOM 4392  H HA   . ILE A 1 71  ? 0.078   -2.526  -7.934  1.00 0.00 ? 71  ILE A HA   3  
ATOM 4393  H HB   . ILE A 1 71  ? 1.523   -3.732  -5.576  1.00 0.00 ? 71  ILE A HB   3  
ATOM 4394  H HG12 . ILE A 1 71  ? -0.925  -1.954  -5.607  1.00 0.00 ? 71  ILE A HG12 3  
ATOM 4395  H HG13 . ILE A 1 71  ? -0.906  -3.659  -5.171  1.00 0.00 ? 71  ILE A HG13 3  
ATOM 4396  H HG21 . ILE A 1 71  ? 1.180   -0.864  -6.442  1.00 0.00 ? 71  ILE A HG21 3  
ATOM 4397  H HG22 . ILE A 1 71  ? 2.073   -1.429  -5.031  1.00 0.00 ? 71  ILE A HG22 3  
ATOM 4398  H HG23 . ILE A 1 71  ? 2.640   -1.830  -6.651  1.00 0.00 ? 71  ILE A HG23 3  
ATOM 4399  H HD11 . ILE A 1 71  ? 1.022   -2.330  -3.578  1.00 0.00 ? 71  ILE A HD11 3  
ATOM 4400  H HD12 . ILE A 1 71  ? -0.479  -1.405  -3.519  1.00 0.00 ? 71  ILE A HD12 3  
ATOM 4401  H HD13 . ILE A 1 71  ? -0.477  -3.112  -3.078  1.00 0.00 ? 71  ILE A HD13 3  
ATOM 4402  N N    . ASN A 1 72  ? 1.934   -3.220  -9.436  1.00 0.00 ? 72  ASN A N    3  
ATOM 4403  C CA   . ASN A 1 72  ? 3.102   -3.484  -10.269 1.00 0.00 ? 72  ASN A CA   3  
ATOM 4404  C C    . ASN A 1 72  ? 3.254   -4.979  -10.534 1.00 0.00 ? 72  ASN A C    3  
ATOM 4405  O O    . ASN A 1 72  ? 4.363   -5.512  -10.519 1.00 0.00 ? 72  ASN A O    3  
ATOM 4406  C CB   . ASN A 1 72  ? 4.366   -2.942  -9.599  1.00 0.00 ? 72  ASN A CB   3  
ATOM 4407  C CG   . ASN A 1 72  ? 4.626   -1.489  -9.947  1.00 0.00 ? 72  ASN A CG   3  
ATOM 4408  O OD1  . ASN A 1 72  ? 4.666   -1.117  -11.120 1.00 0.00 ? 72  ASN A OD1  3  
ATOM 4409  N ND2  . ASN A 1 72  ? 4.805   -0.659  -8.926  1.00 0.00 ? 72  ASN A ND2  3  
ATOM 4410  H H    . ASN A 1 72  ? 1.212   -2.660  -9.790  1.00 0.00 ? 72  ASN A H    3  
ATOM 4411  H HA   . ASN A 1 72  ? 2.958   -2.977  -11.211 1.00 0.00 ? 72  ASN A HA   3  
ATOM 4412  H HB2  . ASN A 1 72  ? 4.260   -3.021  -8.527  1.00 0.00 ? 72  ASN A HB2  3  
ATOM 4413  H HB3  . ASN A 1 72  ? 5.215   -3.527  -9.918  1.00 0.00 ? 72  ASN A HB3  3  
ATOM 4414  H HD21 . ASN A 1 72  ? 4.759   -1.025  -8.018  1.00 0.00 ? 72  ASN A HD21 3  
ATOM 4415  H HD22 . ASN A 1 72  ? 4.974   0.286   -9.122  1.00 0.00 ? 72  ASN A HD22 3  
ATOM 4416  N N    . ASN A 1 73  ? 2.133   -5.649  -10.776 1.00 0.00 ? 73  ASN A N    3  
ATOM 4417  C CA   . ASN A 1 73  ? 2.141   -7.083  -11.044 1.00 0.00 ? 73  ASN A CA   3  
ATOM 4418  C C    . ASN A 1 73  ? 2.453   -7.871  -9.776  1.00 0.00 ? 73  ASN A C    3  
ATOM 4419  O O    . ASN A 1 73  ? 3.193   -8.855  -9.810  1.00 0.00 ? 73  ASN A O    3  
ATOM 4420  C CB   . ASN A 1 73  ? 3.168   -7.414  -12.129 1.00 0.00 ? 73  ASN A CB   3  
ATOM 4421  C CG   . ASN A 1 73  ? 2.862   -8.719  -12.836 1.00 0.00 ? 73  ASN A CG   3  
ATOM 4422  O OD1  . ASN A 1 73  ? 3.363   -9.777  -12.455 1.00 0.00 ? 73  ASN A OD1  3  
ATOM 4423  N ND2  . ASN A 1 73  ? 2.034   -8.651  -13.872 1.00 0.00 ? 73  ASN A ND2  3  
ATOM 4424  H H    . ASN A 1 73  ? 1.278   -5.169  -10.774 1.00 0.00 ? 73  ASN A H    3  
ATOM 4425  H HA   . ASN A 1 73  ? 1.159   -7.360  -11.394 1.00 0.00 ? 73  ASN A HA   3  
ATOM 4426  H HB2  . ASN A 1 73  ? 3.175   -6.622  -12.863 1.00 0.00 ? 73  ASN A HB2  3  
ATOM 4427  H HB3  . ASN A 1 73  ? 4.147   -7.490  -11.679 1.00 0.00 ? 73  ASN A HB3  3  
ATOM 4428  H HD21 . ASN A 1 73  ? 1.673   -7.774  -14.119 1.00 0.00 ? 73  ASN A HD21 3  
ATOM 4429  H HD22 . ASN A 1 73  ? 1.818   -9.480  -14.348 1.00 0.00 ? 73  ASN A HD22 3  
ATOM 4430  N N    . ARG A 1 74  ? 1.882   -7.433  -8.658  1.00 0.00 ? 74  ARG A N    3  
ATOM 4431  C CA   . ARG A 1 74  ? 2.099   -8.097  -7.378  1.00 0.00 ? 74  ARG A CA   3  
ATOM 4432  C C    . ARG A 1 74  ? 0.796   -8.199  -6.591  1.00 0.00 ? 74  ARG A C    3  
ATOM 4433  O O    . ARG A 1 74  ? 0.001   -7.260  -6.563  1.00 0.00 ? 74  ARG A O    3  
ATOM 4434  C CB   . ARG A 1 74  ? 3.146   -7.341  -6.558  1.00 0.00 ? 74  ARG A CB   3  
ATOM 4435  C CG   . ARG A 1 74  ? 4.558   -7.472  -7.104  1.00 0.00 ? 74  ARG A CG   3  
ATOM 4436  C CD   . ARG A 1 74  ? 5.133   -8.854  -6.836  1.00 0.00 ? 74  ARG A CD   3  
ATOM 4437  N NE   . ARG A 1 74  ? 6.452   -9.025  -7.440  1.00 0.00 ? 74  ARG A NE   3  
ATOM 4438  C CZ   . ARG A 1 74  ? 7.227   -10.082 -7.226  1.00 0.00 ? 74  ARG A CZ   3  
ATOM 4439  N NH1  . ARG A 1 74  ? 6.817   -11.058 -6.427  1.00 0.00 ? 74  ARG A NH1  3  
ATOM 4440  N NH2  . ARG A 1 74  ? 8.414   -10.165 -7.812  1.00 0.00 ? 74  ARG A NH2  3  
ATOM 4441  H H    . ARG A 1 74  ? 1.302   -6.644  -8.695  1.00 0.00 ? 74  ARG A H    3  
ATOM 4442  H HA   . ARG A 1 74  ? 2.463   -9.094  -7.579  1.00 0.00 ? 74  ARG A HA   3  
ATOM 4443  H HB2  . ARG A 1 74  ? 2.885   -6.293  -6.542  1.00 0.00 ? 74  ARG A HB2  3  
ATOM 4444  H HB3  . ARG A 1 74  ? 3.137   -7.721  -5.548  1.00 0.00 ? 74  ARG A HB3  3  
ATOM 4445  H HG2  . ARG A 1 74  ? 4.539   -7.303  -8.170  1.00 0.00 ? 74  ARG A HG2  3  
ATOM 4446  H HG3  . ARG A 1 74  ? 5.187   -6.732  -6.631  1.00 0.00 ? 74  ARG A HG3  3  
ATOM 4447  H HD2  . ARG A 1 74  ? 5.216   -8.994  -5.769  1.00 0.00 ? 74  ARG A HD2  3  
ATOM 4448  H HD3  . ARG A 1 74  ? 4.461   -9.594  -7.245  1.00 0.00 ? 74  ARG A HD3  3  
ATOM 4449  H HE   . ARG A 1 74  ? 6.774   -8.316  -8.034  1.00 0.00 ? 74  ARG A HE   3  
ATOM 4450  H HH11 . ARG A 1 74  ? 5.922   -10.999 -5.985  1.00 0.00 ? 74  ARG A HH11 3  
ATOM 4451  H HH12 . ARG A 1 74  ? 7.402   -11.854 -6.269  1.00 0.00 ? 74  ARG A HH12 3  
ATOM 4452  H HH21 . ARG A 1 74  ? 8.727   -9.432  -8.415  1.00 0.00 ? 74  ARG A HH21 3  
ATOM 4453  H HH22 . ARG A 1 74  ? 8.997   -10.961 -7.650  1.00 0.00 ? 74  ARG A HH22 3  
ATOM 4454  N N    . ALA A 1 75  ? 0.584   -9.346  -5.953  1.00 0.00 ? 75  ALA A N    3  
ATOM 4455  C CA   . ALA A 1 75  ? -0.621  -9.569  -5.164  1.00 0.00 ? 75  ALA A CA   3  
ATOM 4456  C C    . ALA A 1 75  ? -0.574  -8.787  -3.856  1.00 0.00 ? 75  ALA A C    3  
ATOM 4457  O O    . ALA A 1 75  ? 0.359   -8.934  -3.067  1.00 0.00 ? 75  ALA A O    3  
ATOM 4458  C CB   . ALA A 1 75  ? -0.802  -11.054 -4.887  1.00 0.00 ? 75  ALA A CB   3  
ATOM 4459  H H    . ALA A 1 75  ? 1.255   -10.057 -6.013  1.00 0.00 ? 75  ALA A H    3  
ATOM 4460  H HA   . ALA A 1 75  ? -1.467  -9.231  -5.744  1.00 0.00 ? 75  ALA A HA   3  
ATOM 4461  H HB1  . ALA A 1 75  ? 0.167   -11.518 -4.769  1.00 0.00 ? 75  ALA A HB1  3  
ATOM 4462  H HB2  . ALA A 1 75  ? -1.376  -11.184 -3.982  1.00 0.00 ? 75  ALA A HB2  3  
ATOM 4463  H HB3  . ALA A 1 75  ? -1.323  -11.514 -5.713  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 4464  N N    . ALA A 1 76  ? -1.586  -7.955  -3.633  1.00 0.00 ? 76  ALA A N    3  
ATOM 4465  C CA   . ALA A 1 76  ? -1.660  -7.150  -2.420  1.00 0.00 ? 76  ALA A CA   3  
ATOM 4466  C C    . ALA A 1 76  ? -1.390  -7.998  -1.182  1.00 0.00 ? 76  ALA A C    3  
ATOM 4467  O O    . ALA A 1 76  ? -0.672  -7.577  -0.274  1.00 0.00 ? 76  ALA A O    3  
ATOM 4468  C CB   . ALA A 1 76  ? -3.021  -6.478  -2.315  1.00 0.00 ? 76  ALA A CB   3  
ATOM 4469  H H    . ALA A 1 76  ? -2.300  -7.881  -4.300  1.00 0.00 ? 76  ALA A H    3  
ATOM 4470  H HA   . ALA A 1 76  ? -0.908  -6.377  -2.486  1.00 0.00 ? 76  ALA A HA   3  
ATOM 4471  H HB1  . ALA A 1 76  ? -3.528  -6.543  -3.267  1.00 0.00 ? 76  ALA A HB1  3  
ATOM 4472  H HB2  . ALA A 1 76  ? -3.610  -6.975  -1.558  1.00 0.00 ? 76  ALA A HB2  3  
ATOM 4473  H HB3  . ALA A 1 76  ? -2.890  -5.441  -2.046  1.00 0.00 ? 76  ALA A HB3  3  
ATOM 4474  N N    . ASP A 1 77  ? -1.969  -9.193  -1.151  1.00 0.00 ? 77  ASP A N    3  
ATOM 4475  C CA   . ASP A 1 77  ? -1.789  -10.101 -0.023  1.00 0.00 ? 77  ASP A CA   3  
ATOM 4476  C C    . ASP A 1 77  ? -0.317  -10.455 0.160   1.00 0.00 ? 77  ASP A C    3  
ATOM 4477  O O    . ASP A 1 77  ? 0.167   -10.574 1.285   1.00 0.00 ? 77  ASP A O    3  
ATOM 4478  C CB   . ASP A 1 77  ? -2.612  -11.373 -0.230  1.00 0.00 ? 77  ASP A CB   3  
ATOM 4479  C CG   . ASP A 1 77  ? -2.064  -12.550 0.555   1.00 0.00 ? 77  ASP A CG   3  
ATOM 4480  O OD1  . ASP A 1 77  ? -1.743  -12.369 1.748   1.00 0.00 ? 77  ASP A OD1  3  
ATOM 4481  O OD2  . ASP A 1 77  ? -1.956  -13.651 -0.025  1.00 0.00 ? 77  ASP A OD2  3  
ATOM 4482  H H    . ASP A 1 77  ? -2.530  -9.472  -1.905  1.00 0.00 ? 77  ASP A H    3  
ATOM 4483  H HA   . ASP A 1 77  ? -2.139  -9.598  0.866   1.00 0.00 ? 77  ASP A HA   3  
ATOM 4484  H HB2  . ASP A 1 77  ? -3.628  -11.194 0.090   1.00 0.00 ? 77  ASP A HB2  3  
ATOM 4485  H HB3  . ASP A 1 77  ? -2.608  -11.630 -1.279  1.00 0.00 ? 77  ASP A HB3  3  
ATOM 4486  N N    . ALA A 1 78  ? 0.389   -10.624 -0.953  1.00 0.00 ? 78  ALA A N    3  
ATOM 4487  C CA   . ALA A 1 78  ? 1.805   -10.965 -0.915  1.00 0.00 ? 78  ALA A CA   3  
ATOM 4488  C C    . ALA A 1 78  ? 2.630   -9.819  -0.339  1.00 0.00 ? 78  ALA A C    3  
ATOM 4489  O O    . ALA A 1 78  ? 3.616   -10.042 0.364   1.00 0.00 ? 78  ALA A O    3  
ATOM 4490  C CB   . ALA A 1 78  ? 2.299   -11.325 -2.309  1.00 0.00 ? 78  ALA A CB   3  
ATOM 4491  H H    . ALA A 1 78  ? -0.054  -10.516 -1.821  1.00 0.00 ? 78  ALA A H    3  
ATOM 4492  H HA   . ALA A 1 78  ? 1.923   -11.833 -0.283  1.00 0.00 ? 78  ALA A HA   3  
ATOM 4493  H HB1  . ALA A 1 78  ? 1.552   -11.921 -2.811  1.00 0.00 ? 78  ALA A HB1  3  
ATOM 4494  H HB2  . ALA A 1 78  ? 2.478   -10.421 -2.872  1.00 0.00 ? 78  ALA A HB2  3  
ATOM 4495  H HB3  . ALA A 1 78  ? 3.217   -11.888 -2.231  1.00 0.00 ? 78  ALA A HB3  3  
ATOM 4496  N N    . LEU A 1 79  ? 2.222   -8.592  -0.643  1.00 0.00 ? 79  LEU A N    3  
ATOM 4497  C CA   . LEU A 1 79  ? 2.924   -7.409  -0.156  1.00 0.00 ? 79  LEU A CA   3  
ATOM 4498  C C    . LEU A 1 79  ? 2.658   -7.192  1.331   1.00 0.00 ? 79  LEU A C    3  
ATOM 4499  O O    . LEU A 1 79  ? 1.522   -7.301  1.791   1.00 0.00 ? 79  LEU A O    3  
ATOM 4500  C CB   . LEU A 1 79  ? 2.493   -6.174  -0.948  1.00 0.00 ? 79  LEU A CB   3  
ATOM 4501  C CG   . LEU A 1 79  ? 2.666   -6.256  -2.465  1.00 0.00 ? 79  LEU A CG   3  
ATOM 4502  C CD1  . LEU A 1 79  ? 1.666   -5.349  -3.166  1.00 0.00 ? 79  LEU A CD1  3  
ATOM 4503  C CD2  . LEU A 1 79  ? 4.089   -5.890  -2.860  1.00 0.00 ? 79  LEU A CD2  3  
ATOM 4504  H H    . LEU A 1 79  ? 1.430   -8.477  -1.208  1.00 0.00 ? 79  LEU A H    3  
ATOM 4505  H HA   . LEU A 1 79  ? 3.982   -7.569  -0.300  1.00 0.00 ? 79  LEU A HA   3  
ATOM 4506  H HB2  . LEU A 1 79  ? 1.449   -5.997  -0.744  1.00 0.00 ? 79  LEU A HB2  3  
ATOM 4507  H HB3  . LEU A 1 79  ? 3.075   -5.335  -0.593  1.00 0.00 ? 79  LEU A HB3  3  
ATOM 4508  H HG   . LEU A 1 79  ? 2.479   -7.271  -2.788  1.00 0.00 ? 79  LEU A HG   3  
ATOM 4509  H HD11 . LEU A 1 79  ? 1.221   -5.877  -3.995  1.00 0.00 ? 79  LEU A HD11 3  
ATOM 4510  H HD12 . LEU A 1 79  ? 2.174   -4.468  -3.531  1.00 0.00 ? 79  LEU A HD12 3  
ATOM 4511  H HD13 . LEU A 1 79  ? 0.895   -5.056  -2.468  1.00 0.00 ? 79  LEU A HD13 3  
ATOM 4512  H HD21 . LEU A 1 79  ? 4.160   -4.821  -3.000  1.00 0.00 ? 79  LEU A HD21 3  
ATOM 4513  H HD22 . LEU A 1 79  ? 4.347   -6.390  -3.783  1.00 0.00 ? 79  LEU A HD22 3  
ATOM 4514  H HD23 . LEU A 1 79  ? 4.770   -6.197  -2.081  1.00 0.00 ? 79  LEU A HD23 3  
ATOM 4515  N N    . ASN A 1 80  ? 3.714   -6.882  2.076   1.00 0.00 ? 80  ASN A N    3  
ATOM 4516  C CA   . ASN A 1 80  ? 3.594   -6.648  3.511   1.00 0.00 ? 80  ASN A CA   3  
ATOM 4517  C C    . ASN A 1 80  ? 4.052   -5.238  3.871   1.00 0.00 ? 80  ASN A C    3  
ATOM 4518  O O    . ASN A 1 80  ? 4.693   -4.558  3.070   1.00 0.00 ? 80  ASN A O    3  
ATOM 4519  C CB   . ASN A 1 80  ? 4.418   -7.677  4.287   1.00 0.00 ? 80  ASN A CB   3  
ATOM 4520  C CG   . ASN A 1 80  ? 5.904   -7.557  4.010   1.00 0.00 ? 80  ASN A CG   3  
ATOM 4521  O OD1  . ASN A 1 80  ? 6.408   -6.470  3.730   1.00 0.00 ? 80  ASN A OD1  3  
ATOM 4522  N ND2  . ASN A 1 80  ? 6.612   -8.678  4.087   1.00 0.00 ? 80  ASN A ND2  3  
ATOM 4523  H H    . ASN A 1 80  ? 4.594   -6.810  1.652   1.00 0.00 ? 80  ASN A H    3  
ATOM 4524  H HA   . ASN A 1 80  ? 2.554   -6.756  3.778   1.00 0.00 ? 80  ASN A HA   3  
ATOM 4525  H HB2  . ASN A 1 80  ? 4.256   -7.534  5.346   1.00 0.00 ? 80  ASN A HB2  3  
ATOM 4526  H HB3  . ASN A 1 80  ? 4.097   -8.670  4.009   1.00 0.00 ? 80  ASN A HB3  3  
ATOM 4527  H HD21 . ASN A 1 80  ? 6.143   -9.508  4.315   1.00 0.00 ? 80  ASN A HD21 3  
ATOM 4528  H HD22 . ASN A 1 80  ? 7.575   -8.629  3.913   1.00 0.00 ? 80  ASN A HD22 3  
ATOM 4529  N N    . SER A 1 81  ? 3.717   -4.805  5.083   1.00 0.00 ? 81  SER A N    3  
ATOM 4530  C CA   . SER A 1 81  ? 4.091   -3.474  5.549   1.00 0.00 ? 81  SER A CA   3  
ATOM 4531  C C    . SER A 1 81  ? 5.453   -3.067  4.996   1.00 0.00 ? 81  SER A C    3  
ATOM 4532  O O    . SER A 1 81  ? 5.606   -1.988  4.424   1.00 0.00 ? 81  SER A O    3  
ATOM 4533  C CB   . SER A 1 81  ? 4.116   -3.435  7.078   1.00 0.00 ? 81  SER A CB   3  
ATOM 4534  O OG   . SER A 1 81  ? 5.062   -4.355  7.596   1.00 0.00 ? 81  SER A OG   3  
ATOM 4535  H H    . SER A 1 81  ? 3.205   -5.393  5.676   1.00 0.00 ? 81  SER A H    3  
ATOM 4536  H HA   . SER A 1 81  ? 3.347   -2.777  5.192   1.00 0.00 ? 81  SER A HA   3  
ATOM 4537  H HB2  . SER A 1 81  ? 4.381   -2.442  7.406   1.00 0.00 ? 81  SER A HB2  3  
ATOM 4538  H HB3  . SER A 1 81  ? 3.138   -3.691  7.458   1.00 0.00 ? 81  SER A HB3  3  
ATOM 4539  H HG   . SER A 1 81  ? 5.813   -3.875  7.954   1.00 0.00 ? 81  SER A HG   3  
ATOM 4540  N N    . SER A 1 82  ? 6.440   -3.940  5.171   1.00 0.00 ? 82  SER A N    3  
ATOM 4541  C CA   . SER A 1 82  ? 7.792   -3.671  4.694   1.00 0.00 ? 82  SER A CA   3  
ATOM 4542  C C    . SER A 1 82  ? 7.788   -3.354  3.201   1.00 0.00 ? 82  SER A C    3  
ATOM 4543  O O    . SER A 1 82  ? 8.032   -2.218  2.796   1.00 0.00 ? 82  SER A O    3  
ATOM 4544  C CB   . SER A 1 82  ? 8.701   -4.870  4.969   1.00 0.00 ? 82  SER A CB   3  
ATOM 4545  O OG   . SER A 1 82  ? 10.057  -4.471  5.067   1.00 0.00 ? 82  SER A OG   3  
ATOM 4546  H H    . SER A 1 82  ? 6.256   -4.784  5.635   1.00 0.00 ? 82  SER A H    3  
ATOM 4547  H HA   . SER A 1 82  ? 8.169   -2.814  5.231   1.00 0.00 ? 82  SER A HA   3  
ATOM 4548  H HB2  . SER A 1 82  ? 8.407   -5.336  5.897   1.00 0.00 ? 82  SER A HB2  3  
ATOM 4549  H HB3  . SER A 1 82  ? 8.605   -5.583  4.163   1.00 0.00 ? 82  SER A HB3  3  
ATOM 4550  H HG   . SER A 1 82  ? 10.231  -4.143  5.953   1.00 0.00 ? 82  SER A HG   3  
ATOM 4551  N N    . MET A 1 83  ? 7.507   -4.367  2.388   1.00 0.00 ? 83  MET A N    3  
ATOM 4552  C CA   . MET A 1 83  ? 7.470   -4.197  0.940   1.00 0.00 ? 83  MET A CA   3  
ATOM 4553  C C    . MET A 1 83  ? 6.707   -2.931  0.561   1.00 0.00 ? 83  MET A C    3  
ATOM 4554  O O    . MET A 1 83  ? 7.240   -2.054  -0.120  1.00 0.00 ? 83  MET A O    3  
ATOM 4555  C CB   . MET A 1 83  ? 6.821   -5.414  0.279   1.00 0.00 ? 83  MET A CB   3  
ATOM 4556  C CG   . MET A 1 83  ? 7.812   -6.507  -0.088  1.00 0.00 ? 83  MET A CG   3  
ATOM 4557  S SD   . MET A 1 83  ? 7.111   -7.732  -1.210  1.00 0.00 ? 83  MET A SD   3  
ATOM 4558  C CE   . MET A 1 83  ? 6.250   -8.796  -0.054  1.00 0.00 ? 83  MET A CE   3  
ATOM 4559  H H    . MET A 1 83  ? 7.320   -5.250  2.770   1.00 0.00 ? 83  MET A H    3  
ATOM 4560  H HA   . MET A 1 83  ? 8.487   -4.108  0.591   1.00 0.00 ? 83  MET A HA   3  
ATOM 4561  H HB2  . MET A 1 83  ? 6.092   -5.832  0.957   1.00 0.00 ? 83  MET A HB2  3  
ATOM 4562  H HB3  . MET A 1 83  ? 6.320   -5.095  -0.623  1.00 0.00 ? 83  MET A HB3  3  
ATOM 4563  H HG2  . MET A 1 83  ? 8.669   -6.053  -0.564  1.00 0.00 ? 83  MET A HG2  3  
ATOM 4564  H HG3  . MET A 1 83  ? 8.127   -7.005  0.817   1.00 0.00 ? 83  MET A HG3  3  
ATOM 4565  H HE1  . MET A 1 83  ? 6.965   -9.418  0.464   1.00 0.00 ? 83  MET A HE1  3  
ATOM 4566  H HE2  . MET A 1 83  ? 5.714   -8.190  0.661   1.00 0.00 ? 83  MET A HE2  3  
ATOM 4567  H HE3  . MET A 1 83  ? 5.552   -9.421  -0.592  1.00 0.00 ? 83  MET A HE3  3  
ATOM 4568  N N    . LEU A 1 84  ? 5.459   -2.842  1.007   1.00 0.00 ? 84  LEU A N    3  
ATOM 4569  C CA   . LEU A 1 84  ? 4.623   -1.683  0.714   1.00 0.00 ? 84  LEU A CA   3  
ATOM 4570  C C    . LEU A 1 84  ? 5.415   -0.388  0.864   1.00 0.00 ? 84  LEU A C    3  
ATOM 4571  O O    . LEU A 1 84  ? 5.367   0.486   -0.002  1.00 0.00 ? 84  LEU A O    3  
ATOM 4572  C CB   . LEU A 1 84  ? 3.406   -1.660  1.640   1.00 0.00 ? 84  LEU A CB   3  
ATOM 4573  C CG   . LEU A 1 84  ? 2.236   -2.556  1.234   1.00 0.00 ? 84  LEU A CG   3  
ATOM 4574  C CD1  . LEU A 1 84  ? 1.284   -2.755  2.404   1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4575  C CD2  . LEU A 1 84  ? 1.501   -1.965  0.040   1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4576  H H    . LEU A 1 84  ? 5.090   -3.573  1.545   1.00 0.00 ? 84  LEU A H    3  
ATOM 4577  H HA   . LEU A 1 84  ? 4.285   -1.768  -0.308  1.00 0.00 ? 84  LEU A HA   3  
ATOM 4578  H HB2  . LEU A 1 84  ? 3.732   -1.968  2.622   1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4579  H HB3  . LEU A 1 84  ? 3.045   -0.643  1.685   1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4580  H HG   . LEU A 1 84  ? 2.617   -3.527  0.946   1.00 0.00 ? 84  LEU A HG   3  
ATOM 4581  H HD11 . LEU A 1 84  ? 0.370   -3.208  2.051   1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4582  H HD12 . LEU A 1 84  ? 1.062   -1.798  2.853   1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4583  H HD13 . LEU A 1 84  ? 1.746   -3.398  3.138   1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4584  H HD21 . LEU A 1 84  ? 1.224   -0.944  0.258   1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4585  H HD22 . LEU A 1 84  ? 0.610   -2.545  -0.158  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4586  H HD23 . LEU A 1 84  ? 2.145   -1.987  -0.826  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4587  N N    . LYS A 1 85  ? 6.146   -0.273  1.968   1.00 0.00 ? 85  LYS A N    3  
ATOM 4588  C CA   . LYS A 1 85  ? 6.952   0.913   2.231   1.00 0.00 ? 85  LYS A CA   3  
ATOM 4589  C C    . LYS A 1 85  ? 7.897   1.198   1.068   1.00 0.00 ? 85  LYS A C    3  
ATOM 4590  O O    . LYS A 1 85  ? 7.943   2.315   0.552   1.00 0.00 ? 85  LYS A O    3  
ATOM 4591  C CB   . LYS A 1 85  ? 7.755   0.733   3.521   1.00 0.00 ? 85  LYS A CB   3  
ATOM 4592  C CG   . LYS A 1 85  ? 8.405   2.013   4.017   1.00 0.00 ? 85  LYS A CG   3  
ATOM 4593  C CD   . LYS A 1 85  ? 9.486   1.727   5.046   1.00 0.00 ? 85  LYS A CD   3  
ATOM 4594  C CE   . LYS A 1 85  ? 8.893   1.487   6.426   1.00 0.00 ? 85  LYS A CE   3  
ATOM 4595  N NZ   . LYS A 1 85  ? 8.637   2.764   7.149   1.00 0.00 ? 85  LYS A NZ   3  
ATOM 4596  H H    . LYS A 1 85  ? 6.144   -1.004  2.621   1.00 0.00 ? 85  LYS A H    3  
ATOM 4597  H HA   . LYS A 1 85  ? 6.282   1.751   2.348   1.00 0.00 ? 85  LYS A HA   3  
ATOM 4598  H HB2  . LYS A 1 85  ? 7.095   0.366   4.294   1.00 0.00 ? 85  LYS A HB2  3  
ATOM 4599  H HB3  . LYS A 1 85  ? 8.533   0.003   3.348   1.00 0.00 ? 85  LYS A HB3  3  
ATOM 4600  H HG2  . LYS A 1 85  ? 8.849   2.529   3.179   1.00 0.00 ? 85  LYS A HG2  3  
ATOM 4601  H HG3  . LYS A 1 85  ? 7.648   2.639   4.468   1.00 0.00 ? 85  LYS A HG3  3  
ATOM 4602  H HD2  . LYS A 1 85  ? 10.035  0.847   4.744   1.00 0.00 ? 85  LYS A HD2  3  
ATOM 4603  H HD3  . LYS A 1 85  ? 10.158  2.573   5.094   1.00 0.00 ? 85  LYS A HD3  3  
ATOM 4604  H HE2  . LYS A 1 85  ? 7.962   0.953   6.315   1.00 0.00 ? 85  LYS A HE2  3  
ATOM 4605  H HE3  . LYS A 1 85  ? 9.585   0.890   7.001   1.00 0.00 ? 85  LYS A HE3  3  
ATOM 4606  H HZ1  . LYS A 1 85  ? 8.531   3.544   6.469   1.00 0.00 ? 85  LYS A HZ1  3  
ATOM 4607  H HZ2  . LYS A 1 85  ? 9.430   2.979   7.785   1.00 0.00 ? 85  LYS A HZ2  3  
ATOM 4608  H HZ3  . LYS A 1 85  ? 7.766   2.687   7.711   1.00 0.00 ? 85  LYS A HZ3  3  
ATOM 4609  N N    . ASP A 1 86  ? 8.648   0.181   0.659   1.00 0.00 ? 86  ASP A N    3  
ATOM 4610  C CA   . ASP A 1 86  ? 9.590   0.322   -0.446  1.00 0.00 ? 86  ASP A CA   3  
ATOM 4611  C C    . ASP A 1 86  ? 8.875   0.773   -1.715  1.00 0.00 ? 86  ASP A C    3  
ATOM 4612  O O    . ASP A 1 86  ? 9.281   1.741   -2.359  1.00 0.00 ? 86  ASP A O    3  
ATOM 4613  C CB   . ASP A 1 86  ? 10.316  -1.001  -0.697  1.00 0.00 ? 86  ASP A CB   3  
ATOM 4614  C CG   . ASP A 1 86  ? 11.495  -0.845  -1.637  1.00 0.00 ? 86  ASP A CG   3  
ATOM 4615  O OD1  . ASP A 1 86  ? 12.184  0.194   -1.558  1.00 0.00 ? 86  ASP A OD1  3  
ATOM 4616  O OD2  . ASP A 1 86  ? 11.729  -1.762  -2.451  1.00 0.00 ? 86  ASP A OD2  3  
ATOM 4617  H H    . ASP A 1 86  ? 8.566   -0.685  1.110   1.00 0.00 ? 86  ASP A H    3  
ATOM 4618  H HA   . ASP A 1 86  ? 10.315  1.073   -0.170  1.00 0.00 ? 86  ASP A HA   3  
ATOM 4619  H HB2  . ASP A 1 86  ? 10.679  -1.389  0.244   1.00 0.00 ? 86  ASP A HB2  3  
ATOM 4620  H HB3  . ASP A 1 86  ? 9.623   -1.707  -1.130  1.00 0.00 ? 86  ASP A HB3  3  
ATOM 4621  N N    . PHE A 1 87  ? 7.809   0.064   -2.072  1.00 0.00 ? 87  PHE A N    3  
ATOM 4622  C CA   . PHE A 1 87  ? 7.038   0.390   -3.266  1.00 0.00 ? 87  PHE A CA   3  
ATOM 4623  C C    . PHE A 1 87  ? 6.686   1.874   -3.298  1.00 0.00 ? 87  PHE A C    3  
ATOM 4624  O O    . PHE A 1 87  ? 6.845   2.540   -4.322  1.00 0.00 ? 87  PHE A O    3  
ATOM 4625  C CB   . PHE A 1 87  ? 5.760   -0.450  -3.319  1.00 0.00 ? 87  PHE A CB   3  
ATOM 4626  C CG   . PHE A 1 87  ? 5.977   -1.838  -3.850  1.00 0.00 ? 87  PHE A CG   3  
ATOM 4627  C CD1  . PHE A 1 87  ? 7.045   -2.603  -3.411  1.00 0.00 ? 87  PHE A CD1  3  
ATOM 4628  C CD2  . PHE A 1 87  ? 5.112   -2.378  -4.788  1.00 0.00 ? 87  PHE A CD2  3  
ATOM 4629  C CE1  . PHE A 1 87  ? 7.248   -3.880  -3.898  1.00 0.00 ? 87  PHE A CE1  3  
ATOM 4630  C CE2  . PHE A 1 87  ? 5.309   -3.655  -5.280  1.00 0.00 ? 87  PHE A CE2  3  
ATOM 4631  C CZ   . PHE A 1 87  ? 6.378   -4.408  -4.833  1.00 0.00 ? 87  PHE A CZ   3  
ATOM 4632  H H    . PHE A 1 87  ? 7.534   -0.697  -1.518  1.00 0.00 ? 87  PHE A H    3  
ATOM 4633  H HA   . PHE A 1 87  ? 7.647   0.158   -4.126  1.00 0.00 ? 87  PHE A HA   3  
ATOM 4634  H HB2  . PHE A 1 87  ? 5.353   -0.536  -2.323  1.00 0.00 ? 87  PHE A HB2  3  
ATOM 4635  H HB3  . PHE A 1 87  ? 5.041   0.042   -3.956  1.00 0.00 ? 87  PHE A HB3  3  
ATOM 4636  H HD1  . PHE A 1 87  ? 7.726   -2.193  -2.679  1.00 0.00 ? 87  PHE A HD1  3  
ATOM 4637  H HD2  . PHE A 1 87  ? 4.276   -1.790  -5.138  1.00 0.00 ? 87  PHE A HD2  3  
ATOM 4638  H HE1  . PHE A 1 87  ? 8.084   -4.467  -3.547  1.00 0.00 ? 87  PHE A HE1  3  
ATOM 4639  H HE2  . PHE A 1 87  ? 4.627   -4.064  -6.010  1.00 0.00 ? 87  PHE A HE2  3  
ATOM 4640  H HZ   . PHE A 1 87  ? 6.534   -5.405  -5.216  1.00 0.00 ? 87  PHE A HZ   3  
ATOM 4641  N N    . LEU A 1 88  ? 6.206   2.387   -2.170  1.00 0.00 ? 88  LEU A N    3  
ATOM 4642  C CA   . LEU A 1 88  ? 5.831   3.792   -2.067  1.00 0.00 ? 88  LEU A CA   3  
ATOM 4643  C C    . LEU A 1 88  ? 7.056   4.694   -2.184  1.00 0.00 ? 88  LEU A C    3  
ATOM 4644  O O    . LEU A 1 88  ? 6.940   5.877   -2.502  1.00 0.00 ? 88  LEU A O    3  
ATOM 4645  C CB   . LEU A 1 88  ? 5.116   4.054   -0.740  1.00 0.00 ? 88  LEU A CB   3  
ATOM 4646  C CG   . LEU A 1 88  ? 3.846   3.239   -0.490  1.00 0.00 ? 88  LEU A CG   3  
ATOM 4647  C CD1  . LEU A 1 88  ? 3.511   3.216   0.994   1.00 0.00 ? 88  LEU A CD1  3  
ATOM 4648  C CD2  . LEU A 1 88  ? 2.683   3.804   -1.292  1.00 0.00 ? 88  LEU A CD2  3  
ATOM 4649  H H    . LEU A 1 88  ? 6.102   1.807   -1.387  1.00 0.00 ? 88  LEU A H    3  
ATOM 4650  H HA   . LEU A 1 88  ? 5.156   4.015   -2.880  1.00 0.00 ? 88  LEU A HA   3  
ATOM 4651  H HB2  . LEU A 1 88  ? 5.810   3.838   0.057   1.00 0.00 ? 88  LEU A HB2  3  
ATOM 4652  H HB3  . LEU A 1 88  ? 4.850   5.101   -0.709  1.00 0.00 ? 88  LEU A HB3  3  
ATOM 4653  H HG   . LEU A 1 88  ? 4.011   2.220   -0.810  1.00 0.00 ? 88  LEU A HG   3  
ATOM 4654  H HD11 . LEU A 1 88  ? 2.708   2.517   1.170   1.00 0.00 ? 88  LEU A HD11 3  
ATOM 4655  H HD12 . LEU A 1 88  ? 3.205   4.203   1.309   1.00 0.00 ? 88  LEU A HD12 3  
ATOM 4656  H HD13 . LEU A 1 88  ? 4.383   2.913   1.555   1.00 0.00 ? 88  LEU A HD13 3  
ATOM 4657  H HD21 . LEU A 1 88  ? 3.024   4.649   -1.872  1.00 0.00 ? 88  LEU A HD21 3  
ATOM 4658  H HD22 . LEU A 1 88  ? 1.901   4.122   -0.618  1.00 0.00 ? 88  LEU A HD22 3  
ATOM 4659  H HD23 . LEU A 1 88  ? 2.301   3.043   -1.956  1.00 0.00 ? 88  LEU A HD23 3  
ATOM 4660  N N    . SER A 1 89  ? 8.229   4.125   -1.927  1.00 0.00 ? 89  SER A N    3  
ATOM 4661  C CA   . SER A 1 89  ? 9.476   4.877   -2.002  1.00 0.00 ? 89  SER A CA   3  
ATOM 4662  C C    . SER A 1 89  ? 9.952   4.998   -3.446  1.00 0.00 ? 89  SER A C    3  
ATOM 4663  O O    . SER A 1 89  ? 11.061  5.461   -3.708  1.00 0.00 ? 89  SER A O    3  
ATOM 4664  C CB   . SER A 1 89  ? 10.555  4.202   -1.152  1.00 0.00 ? 89  SER A CB   3  
ATOM 4665  O OG   . SER A 1 89  ? 11.258  3.227   -1.902  1.00 0.00 ? 89  SER A OG   3  
ATOM 4666  H H    . SER A 1 89  ? 8.256   3.177   -1.678  1.00 0.00 ? 89  SER A H    3  
ATOM 4667  H HA   . SER A 1 89  ? 9.290   5.867   -1.612  1.00 0.00 ? 89  SER A HA   3  
ATOM 4668  H HB2  . SER A 1 89  ? 11.255  4.947   -0.807  1.00 0.00 ? 89  SER A HB2  3  
ATOM 4669  H HB3  . SER A 1 89  ? 10.092  3.722   -0.302  1.00 0.00 ? 89  SER A HB3  3  
ATOM 4670  H HG   . SER A 1 89  ? 12.067  3.611   -2.249  1.00 0.00 ? 89  SER A HG   3  
ATOM 4671  N N    . GLN A 1 90  ? 9.103   4.577   -4.379  1.00 0.00 ? 90  GLN A N    3  
ATOM 4672  C CA   . GLN A 1 90  ? 9.437   4.637   -5.797  1.00 0.00 ? 90  GLN A CA   3  
ATOM 4673  C C    . GLN A 1 90  ? 8.728   5.806   -6.474  1.00 0.00 ? 90  GLN A C    3  
ATOM 4674  O O    . GLN A 1 90  ? 7.583   6.134   -6.162  1.00 0.00 ? 90  GLN A O    3  
ATOM 4675  C CB   . GLN A 1 90  ? 9.058   3.326   -6.488  1.00 0.00 ? 90  GLN A CB   3  
ATOM 4676  C CG   . GLN A 1 90  ? 9.632   2.093   -5.809  1.00 0.00 ? 90  GLN A CG   3  
ATOM 4677  C CD   . GLN A 1 90  ? 11.047  1.785   -6.258  1.00 0.00 ? 90  GLN A CD   3  
ATOM 4678  O OE1  . GLN A 1 90  ? 11.425  2.068   -7.396  1.00 0.00 ? 90  GLN A OE1  3  
ATOM 4679  N NE2  . GLN A 1 90  ? 11.838  1.203   -5.365  1.00 0.00 ? 90  GLN A NE2  3  
ATOM 4680  H H    . GLN A 1 90  ? 8.234   4.218   -4.107  1.00 0.00 ? 90  GLN A H    3  
ATOM 4681  H HA   . GLN A 1 90  ? 10.503  4.782   -5.881  1.00 0.00 ? 90  GLN A HA   3  
ATOM 4682  H HB2  . GLN A 1 90  ? 7.982   3.237   -6.499  1.00 0.00 ? 90  GLN A HB2  3  
ATOM 4683  H HB3  . GLN A 1 90  ? 9.419   3.352   -7.505  1.00 0.00 ? 90  GLN A HB3  3  
ATOM 4684  H HG2  . GLN A 1 90  ? 9.637   2.255   -4.742  1.00 0.00 ? 90  GLN A HG2  3  
ATOM 4685  H HG3  . GLN A 1 90  ? 9.004   1.246   -6.041  1.00 0.00 ? 90  GLN A HG3  3  
ATOM 4686  H HE21 . GLN A 1 90  ? 11.468  1.007   -4.478  1.00 0.00 ? 90  GLN A HE21 3  
ATOM 4687  H HE22 . GLN A 1 90  ? 12.757  0.993   -5.628  1.00 0.00 ? 90  GLN A HE22 3  
ATOM 4688  N N    . PRO A 1 91  ? 9.423   6.451   -7.423  1.00 0.00 ? 91  PRO A N    3  
ATOM 4689  C CA   . PRO A 1 91  ? 8.879   7.593   -8.164  1.00 0.00 ? 91  PRO A CA   3  
ATOM 4690  C C    . PRO A 1 91  ? 7.764   7.186   -9.120  1.00 0.00 ? 91  PRO A C    3  
ATOM 4691  O O    . PRO A 1 91  ? 6.879   7.983   -9.433  1.00 0.00 ? 91  PRO A O    3  
ATOM 4692  C CB   . PRO A 1 91  ? 10.088  8.117   -8.944  1.00 0.00 ? 91  PRO A CB   3  
ATOM 4693  C CG   . PRO A 1 91  ? 10.985  6.937   -9.090  1.00 0.00 ? 91  PRO A CG   3  
ATOM 4694  C CD   . PRO A 1 91  ? 10.793  6.114   -7.846  1.00 0.00 ? 91  PRO A CD   3  
ATOM 4695  H HA   . PRO A 1 91  ? 8.518   8.362   -7.497  1.00 0.00 ? 91  PRO A HA   3  
ATOM 4696  H HB2  . PRO A 1 91  ? 9.764   8.489   -9.906  1.00 0.00 ? 91  PRO A HB2  3  
ATOM 4697  H HB3  . PRO A 1 91  ? 10.564  8.909   -8.387  1.00 0.00 ? 91  PRO A HB3  3  
ATOM 4698  H HG2  . PRO A 1 91  ? 10.705  6.368   -9.963  1.00 0.00 ? 91  PRO A HG2  3  
ATOM 4699  H HG3  . PRO A 1 91  ? 12.012  7.264   -9.167  1.00 0.00 ? 91  PRO A HG3  3  
ATOM 4700  H HD2  . PRO A 1 91  ? 10.879  5.062   -8.072  1.00 0.00 ? 91  PRO A HD2  3  
ATOM 4701  H HD3  . PRO A 1 91  ? 11.510  6.399   -7.090  1.00 0.00 ? 91  PRO A HD3  3  
ATOM 4702  N N    . SER A 1 92  ? 7.811   5.940   -9.581  1.00 0.00 ? 92  SER A N    3  
ATOM 4703  C CA   . SER A 1 92  ? 6.805   5.428   -10.505 1.00 0.00 ? 92  SER A CA   3  
ATOM 4704  C C    . SER A 1 92  ? 6.174   4.148   -9.966  1.00 0.00 ? 92  SER A C    3  
ATOM 4705  O O    . SER A 1 92  ? 6.862   3.153   -9.731  1.00 0.00 ? 92  SER A O    3  
ATOM 4706  C CB   . SER A 1 92  ? 7.429   5.164   -11.876 1.00 0.00 ? 92  SER A CB   3  
ATOM 4707  O OG   . SER A 1 92  ? 7.972   3.857   -11.947 1.00 0.00 ? 92  SER A OG   3  
ATOM 4708  H H    . SER A 1 92  ? 8.541   5.352   -9.295  1.00 0.00 ? 92  SER A H    3  
ATOM 4709  H HA   . SER A 1 92  ? 6.036   6.179   -10.607 1.00 0.00 ? 92  SER A HA   3  
ATOM 4710  H HB2  . SER A 1 92  ? 6.673   5.268   -12.639 1.00 0.00 ? 92  SER A HB2  3  
ATOM 4711  H HB3  . SER A 1 92  ? 8.219   5.880   -12.053 1.00 0.00 ? 92  SER A HB3  3  
ATOM 4712  H HG   . SER A 1 92  ? 7.958   3.553   -12.857 1.00 0.00 ? 92  SER A HG   3  
ATOM 4713  N N    . LEU A 1 93  ? 4.861   4.180   -9.771  1.00 0.00 ? 93  LEU A N    3  
ATOM 4714  C CA   . LEU A 1 93  ? 4.134   3.023   -9.259  1.00 0.00 ? 93  LEU A CA   3  
ATOM 4715  C C    . LEU A 1 93  ? 2.926   2.707   -10.135 1.00 0.00 ? 93  LEU A C    3  
ATOM 4716  O O    . LEU A 1 93  ? 2.350   3.597   -10.760 1.00 0.00 ? 93  LEU A O    3  
ATOM 4717  C CB   . LEU A 1 93  ? 3.684   3.274   -7.819  1.00 0.00 ? 93  LEU A CB   3  
ATOM 4718  C CG   . LEU A 1 93  ? 4.681   2.889   -6.727  1.00 0.00 ? 93  LEU A CG   3  
ATOM 4719  C CD1  . LEU A 1 93  ? 4.282   3.509   -5.397  1.00 0.00 ? 93  LEU A CD1  3  
ATOM 4720  C CD2  . LEU A 1 93  ? 4.779   1.376   -6.603  1.00 0.00 ? 93  LEU A CD2  3  
ATOM 4721  H H    . LEU A 1 93  ? 4.366   5.000   -9.976  1.00 0.00 ? 93  LEU A H    3  
ATOM 4722  H HA   . LEU A 1 93  ? 4.806   2.177   -9.275  1.00 0.00 ? 93  LEU A HA   3  
ATOM 4723  H HB2  . LEU A 1 93  ? 3.473   4.328   -7.718  1.00 0.00 ? 93  LEU A HB2  3  
ATOM 4724  H HB3  . LEU A 1 93  ? 2.776   2.710   -7.655  1.00 0.00 ? 93  LEU A HB3  3  
ATOM 4725  H HG   . LEU A 1 93  ? 5.659   3.268   -6.991  1.00 0.00 ? 93  LEU A HG   3  
ATOM 4726  H HD11 . LEU A 1 93  ? 4.219   2.738   -4.644  1.00 0.00 ? 93  LEU A HD11 3  
ATOM 4727  H HD12 . LEU A 1 93  ? 3.322   3.992   -5.499  1.00 0.00 ? 93  LEU A HD12 3  
ATOM 4728  H HD13 . LEU A 1 93  ? 5.022   4.240   -5.104  1.00 0.00 ? 93  LEU A HD13 3  
ATOM 4729  H HD21 . LEU A 1 93  ? 5.185   1.119   -5.636  1.00 0.00 ? 93  LEU A HD21 3  
ATOM 4730  H HD22 . LEU A 1 93  ? 5.428   0.993   -7.378  1.00 0.00 ? 93  LEU A HD22 3  
ATOM 4731  H HD23 . LEU A 1 93  ? 3.796   0.942   -6.709  1.00 0.00 ? 93  LEU A HD23 3  
ATOM 4732  N N    . GLY A 1 94  ? 2.545   1.434   -10.173 1.00 0.00 ? 94  GLY A N    3  
ATOM 4733  C CA   . GLY A 1 94  ? 1.406   1.024   -10.973 1.00 0.00 ? 94  GLY A CA   3  
ATOM 4734  C C    . GLY A 1 94  ? 0.370   0.269   -10.164 1.00 0.00 ? 94  GLY A C    3  
ATOM 4735  O O    . GLY A 1 94  ? 0.648   -0.809  -9.638  1.00 0.00 ? 94  GLY A O    3  
ATOM 4736  H H    . GLY A 1 94  ? 3.042   0.767   -9.654  1.00 0.00 ? 94  GLY A H    3  
ATOM 4737  H HA2  . GLY A 1 94  ? 0.944   1.903   -11.399 1.00 0.00 ? 94  GLY A HA2  3  
ATOM 4738  H HA3  . GLY A 1 94  ? 1.753   0.388   -11.775 1.00 0.00 ? 94  GLY A HA3  3  
ATOM 4739  N N    . LEU A 1 95  ? -0.827  0.836   -10.061 1.00 0.00 ? 95  LEU A N    3  
ATOM 4740  C CA   . LEU A 1 95  ? -1.908  0.210   -9.308  1.00 0.00 ? 95  LEU A CA   3  
ATOM 4741  C C    . LEU A 1 95  ? -2.994  -0.310  -10.244 1.00 0.00 ? 95  LEU A C    3  
ATOM 4742  O O    . LEU A 1 95  ? -3.187  0.216   -11.341 1.00 0.00 ? 95  LEU A O    3  
ATOM 4743  C CB   . LEU A 1 95  ? -2.508  1.207   -8.316  1.00 0.00 ? 95  LEU A CB   3  
ATOM 4744  C CG   . LEU A 1 95  ? -1.528  1.851   -7.335  1.00 0.00 ? 95  LEU A CG   3  
ATOM 4745  C CD1  . LEU A 1 95  ? -2.142  3.090   -6.703  1.00 0.00 ? 95  LEU A CD1  3  
ATOM 4746  C CD2  . LEU A 1 95  ? -1.112  0.854   -6.264  1.00 0.00 ? 95  LEU A CD2  3  
ATOM 4747  H H    . LEU A 1 95  ? -0.988  1.696   -10.502 1.00 0.00 ? 95  LEU A H    3  
ATOM 4748  H HA   . LEU A 1 95  ? -1.491  -0.623  -8.762  1.00 0.00 ? 95  LEU A HA   3  
ATOM 4749  H HB2  . LEU A 1 95  ? -2.976  1.997   -8.883  1.00 0.00 ? 95  LEU A HB2  3  
ATOM 4750  H HB3  . LEU A 1 95  ? -3.260  0.686   -7.739  1.00 0.00 ? 95  LEU A HB3  3  
ATOM 4751  H HG   . LEU A 1 95  ? -0.640  2.156   -7.872  1.00 0.00 ? 95  LEU A HG   3  
ATOM 4752  H HD11 . LEU A 1 95  ? -1.461  3.495   -5.970  1.00 0.00 ? 95  LEU A HD11 3  
ATOM 4753  H HD12 . LEU A 1 95  ? -3.072  2.826   -6.223  1.00 0.00 ? 95  LEU A HD12 3  
ATOM 4754  H HD13 . LEU A 1 95  ? -2.330  3.829   -7.468  1.00 0.00 ? 95  LEU A HD13 3  
ATOM 4755  H HD21 . LEU A 1 95  ? -0.234  1.220   -5.752  1.00 0.00 ? 95  LEU A HD21 3  
ATOM 4756  H HD22 . LEU A 1 95  ? -0.889  -0.098  -6.725  1.00 0.00 ? 95  LEU A HD22 3  
ATOM 4757  H HD23 . LEU A 1 95  ? -1.917  0.731   -5.554  1.00 0.00 ? 95  LEU A HD23 3  
ATOM 4758  N N    . LEU A 1 96  ? -3.702  -1.344  -9.804  1.00 0.00 ? 96  LEU A N    3  
ATOM 4759  C CA   . LEU A 1 96  ? -4.772  -1.934  -10.602 1.00 0.00 ? 96  LEU A CA   3  
ATOM 4760  C C    . LEU A 1 96  ? -6.086  -1.945  -9.828  1.00 0.00 ? 96  LEU A C    3  
ATOM 4761  O O    . LEU A 1 96  ? -6.316  -2.814  -8.986  1.00 0.00 ? 96  LEU A O    3  
ATOM 4762  C CB   . LEU A 1 96  ? -4.399  -3.359  -11.016 1.00 0.00 ? 96  LEU A CB   3  
ATOM 4763  C CG   . LEU A 1 96  ? -5.339  -4.035  -12.015 1.00 0.00 ? 96  LEU A CG   3  
ATOM 4764  C CD1  . LEU A 1 96  ? -5.033  -3.573  -13.431 1.00 0.00 ? 96  LEU A CD1  3  
ATOM 4765  C CD2  . LEU A 1 96  ? -5.228  -5.549  -11.910 1.00 0.00 ? 96  LEU A CD2  3  
ATOM 4766  H H    . LEU A 1 96  ? -3.502  -1.720  -8.922  1.00 0.00 ? 96  LEU A H    3  
ATOM 4767  H HA   . LEU A 1 96  ? -4.895  -1.331  -11.489 1.00 0.00 ? 96  LEU A HA   3  
ATOM 4768  H HB2  . LEU A 1 96  ? -3.415  -3.328  -11.457 1.00 0.00 ? 96  LEU A HB2  3  
ATOM 4769  H HB3  . LEU A 1 96  ? -4.373  -3.966  -10.122 1.00 0.00 ? 96  LEU A HB3  3  
ATOM 4770  H HG   . LEU A 1 96  ? -6.358  -3.756  -11.786 1.00 0.00 ? 96  LEU A HG   3  
ATOM 4771  H HD11 . LEU A 1 96  ? -4.406  -4.302  -13.921 1.00 0.00 ? 96  LEU A HD11 3  
ATOM 4772  H HD12 . LEU A 1 96  ? -4.521  -2.622  -13.397 1.00 0.00 ? 96  LEU A HD12 3  
ATOM 4773  H HD13 . LEU A 1 96  ? -5.957  -3.464  -13.981 1.00 0.00 ? 96  LEU A HD13 3  
ATOM 4774  H HD21 . LEU A 1 96  ? -6.153  -5.950  -11.522 1.00 0.00 ? 96  LEU A HD21 3  
ATOM 4775  H HD22 . LEU A 1 96  ? -4.417  -5.805  -11.245 1.00 0.00 ? 96  LEU A HD22 3  
ATOM 4776  H HD23 . LEU A 1 96  ? -5.038  -5.964  -12.889 1.00 0.00 ? 96  LEU A HD23 3  
ATOM 4777  N N    . VAL A 1 97  ? -6.946  -0.974  -10.119 1.00 0.00 ? 97  VAL A N    3  
ATOM 4778  C CA   . VAL A 1 97  ? -8.239  -0.873  -9.453  1.00 0.00 ? 97  VAL A CA   3  
ATOM 4779  C C    . VAL A 1 97  ? -9.381  -1.139  -10.427 1.00 0.00 ? 97  VAL A C    3  
ATOM 4780  O O    . VAL A 1 97  ? -9.217  -1.016  -11.641 1.00 0.00 ? 97  VAL A O    3  
ATOM 4781  C CB   . VAL A 1 97  ? -8.435  0.515   -8.815  1.00 0.00 ? 97  VAL A CB   3  
ATOM 4782  C CG1  . VAL A 1 97  ? -7.386  0.763   -7.743  1.00 0.00 ? 97  VAL A CG1  3  
ATOM 4783  C CG2  . VAL A 1 97  ? -8.390  1.601   -9.880  1.00 0.00 ? 97  VAL A CG2  3  
ATOM 4784  H H    . VAL A 1 97  ? -6.706  -0.310  -10.799 1.00 0.00 ? 97  VAL A H    3  
ATOM 4785  H HA   . VAL A 1 97  ? -8.269  -1.614  -8.668  1.00 0.00 ? 97  VAL A HA   3  
ATOM 4786  H HB   . VAL A 1 97  ? -9.409  0.540   -8.347  1.00 0.00 ? 97  VAL A HB   3  
ATOM 4787  H HG11 . VAL A 1 97  ? -7.707  1.575   -7.107  1.00 0.00 ? 97  VAL A HG11 3  
ATOM 4788  H HG12 . VAL A 1 97  ? -7.257  -0.131  -7.151  1.00 0.00 ? 97  VAL A HG12 3  
ATOM 4789  H HG13 . VAL A 1 97  ? -6.448  1.023   -8.211  1.00 0.00 ? 97  VAL A HG13 3  
ATOM 4790  H HG21 . VAL A 1 97  ? -8.982  2.444   -9.558  1.00 0.00 ? 97  VAL A HG21 3  
ATOM 4791  H HG22 . VAL A 1 97  ? -7.367  1.916   -10.029 1.00 0.00 ? 97  VAL A HG22 3  
ATOM 4792  H HG23 . VAL A 1 97  ? -8.786  1.214   -10.807 1.00 0.00 ? 97  VAL A HG23 3  
ATOM 4793  N N    . ARG A 1 98  ? -10.540 -1.503  -9.887  1.00 0.00 ? 98  ARG A N    3  
ATOM 4794  C CA   . ARG A 1 98  ? -11.710 -1.787  -10.709 1.00 0.00 ? 98  ARG A CA   3  
ATOM 4795  C C    . ARG A 1 98  ? -12.627 -0.569  -10.789 1.00 0.00 ? 98  ARG A C    3  
ATOM 4796  O O    . ARG A 1 98  ? -12.663 0.256   -9.875  1.00 0.00 ? 98  ARG A O    3  
ATOM 4797  C CB   . ARG A 1 98  ? -12.480 -2.981  -10.143 1.00 0.00 ? 98  ARG A CB   3  
ATOM 4798  C CG   . ARG A 1 98  ? -13.214 -3.789  -11.200 1.00 0.00 ? 98  ARG A CG   3  
ATOM 4799  C CD   . ARG A 1 98  ? -13.781 -5.077  -10.623 1.00 0.00 ? 98  ARG A CD   3  
ATOM 4800  N NE   . ARG A 1 98  ? -12.831 -6.183  -10.717 1.00 0.00 ? 98  ARG A NE   3  
ATOM 4801  C CZ   . ARG A 1 98  ? -12.553 -6.819  -11.850 1.00 0.00 ? 98  ARG A CZ   3  
ATOM 4802  N NH1  . ARG A 1 98  ? -13.148 -6.460  -12.979 1.00 0.00 ? 98  ARG A NH1  3  
ATOM 4803  N NH2  . ARG A 1 98  ? -11.677 -7.816  -11.854 1.00 0.00 ? 98  ARG A NH2  3  
ATOM 4804  H H    . ARG A 1 98  ? -10.609 -1.583  -8.913  1.00 0.00 ? 98  ARG A H    3  
ATOM 4805  H HA   . ARG A 1 98  ? -11.367 -2.030  -11.703 1.00 0.00 ? 98  ARG A HA   3  
ATOM 4806  H HB2  . ARG A 1 98  ? -11.785 -3.637  -9.639  1.00 0.00 ? 98  ARG A HB2  3  
ATOM 4807  H HB3  . ARG A 1 98  ? -13.204 -2.621  -9.428  1.00 0.00 ? 98  ARG A HB3  3  
ATOM 4808  H HG2  . ARG A 1 98  ? -14.027 -3.196  -11.593 1.00 0.00 ? 98  ARG A HG2  3  
ATOM 4809  H HG3  . ARG A 1 98  ? -12.526 -4.033  -11.996 1.00 0.00 ? 98  ARG A HG3  3  
ATOM 4810  H HD2  . ARG A 1 98  ? -14.026 -4.914  -9.585  1.00 0.00 ? 98  ARG A HD2  3  
ATOM 4811  H HD3  . ARG A 1 98  ? -14.676 -5.337  -11.168 1.00 0.00 ? 98  ARG A HD3  3  
ATOM 4812  H HE   . ARG A 1 98  ? -12.380 -6.465  -9.894  1.00 0.00 ? 98  ARG A HE   3  
ATOM 4813  H HH11 . ARG A 1 98  ? -13.808 -5.708  -12.978 1.00 0.00 ? 98  ARG A HH11 3  
ATOM 4814  H HH12 . ARG A 1 98  ? -12.936 -6.939  -13.831 1.00 0.00 ? 98  ARG A HH12 3  
ATOM 4815  H HH21 . ARG A 1 98  ? -11.226 -8.089  -11.005 1.00 0.00 ? 98  ARG A HH21 3  
ATOM 4816  H HH22 . ARG A 1 98  ? -11.468 -8.293  -12.707 1.00 0.00 ? 98  ARG A HH22 3  
ATOM 4817  N N    . THR A 1 99  ? -13.366 -0.463  -11.889 1.00 0.00 ? 99  THR A N    3  
ATOM 4818  C CA   . THR A 1 99  ? -14.281 0.654   -12.089 1.00 0.00 ? 99  THR A CA   3  
ATOM 4819  C C    . THR A 1 99  ? -15.530 0.212   -12.843 1.00 0.00 ? 99  THR A C    3  
ATOM 4820  O O    . THR A 1 99  ? -15.607 -0.916  -13.330 1.00 0.00 ? 99  THR A O    3  
ATOM 4821  C CB   . THR A 1 99  ? -13.606 1.801   -12.864 1.00 0.00 ? 99  THR A CB   3  
ATOM 4822  O OG1  . THR A 1 99  ? -14.350 3.013   -12.692 1.00 0.00 ? 99  THR A OG1  3  
ATOM 4823  C CG2  . THR A 1 99  ? -13.505 1.468   -14.345 1.00 0.00 ? 99  THR A CG2  3  
ATOM 4824  H H    . THR A 1 99  ? -13.293 -1.152  -12.581 1.00 0.00 ? 99  THR A H    3  
ATOM 4825  H HA   . THR A 1 99  ? -14.571 1.026   -11.117 1.00 0.00 ? 99  THR A HA   3  
ATOM 4826  H HB   . THR A 1 99  ? -12.608 1.941   -12.473 1.00 0.00 ? 99  THR A HB   3  
ATOM 4827  H HG1  . THR A 1 99  ? -13.747 3.732   -12.489 1.00 0.00 ? 99  THR A HG1  3  
ATOM 4828  H HG21 . THR A 1 99  ? -12.914 0.573   -14.473 1.00 0.00 ? 99  THR A HG21 3  
ATOM 4829  H HG22 . THR A 1 99  ? -13.035 2.288   -14.867 1.00 0.00 ? 99  THR A HG22 3  
ATOM 4830  H HG23 . THR A 1 99  ? -14.494 1.306   -14.745 1.00 0.00 ? 99  THR A HG23 3  
ATOM 4831  N N    . TYR A 1 100 ? -16.506 1.109   -12.937 1.00 0.00 ? 100 TYR A N    3  
ATOM 4832  C CA   . TYR A 1 100 ? -17.753 0.811   -13.631 1.00 0.00 ? 100 TYR A CA   3  
ATOM 4833  C C    . TYR A 1 100 ? -17.718 1.334   -15.064 1.00 0.00 ? 100 TYR A C    3  
ATOM 4834  O O    . TYR A 1 100 ? -17.230 2.430   -15.340 1.00 0.00 ? 100 TYR A O    3  
ATOM 4835  C CB   . TYR A 1 100 ? -18.937 1.423   -12.882 1.00 0.00 ? 100 TYR A CB   3  
ATOM 4836  C CG   . TYR A 1 100 ? -18.944 1.111   -11.402 1.00 0.00 ? 100 TYR A CG   3  
ATOM 4837  C CD1  . TYR A 1 100 ? -19.584 -0.022  -10.914 1.00 0.00 ? 100 TYR A CD1  3  
ATOM 4838  C CD2  . TYR A 1 100 ? -18.312 1.949   -10.492 1.00 0.00 ? 100 TYR A CD2  3  
ATOM 4839  C CE1  . TYR A 1 100 ? -19.593 -0.311  -9.563  1.00 0.00 ? 100 TYR A CE1  3  
ATOM 4840  C CE2  . TYR A 1 100 ? -18.315 1.667   -9.140  1.00 0.00 ? 100 TYR A CE2  3  
ATOM 4841  C CZ   . TYR A 1 100 ? -18.957 0.536   -8.680  1.00 0.00 ? 100 TYR A CZ   3  
ATOM 4842  O OH   . TYR A 1 100 ? -18.964 0.253   -7.334  1.00 0.00 ? 100 TYR A OH   3  
ATOM 4843  H H    . TYR A 1 100 ? -16.386 1.991   -12.529 1.00 0.00 ? 100 TYR A H    3  
ATOM 4844  H HA   . TYR A 1 100 ? -17.871 -0.263  -13.655 1.00 0.00 ? 100 TYR A HA   3  
ATOM 4845  H HB2  . TYR A 1 100 ? -18.910 2.496   -12.993 1.00 0.00 ? 100 TYR A HB2  3  
ATOM 4846  H HB3  . TYR A 1 100 ? -19.857 1.045   -13.305 1.00 0.00 ? 100 TYR A HB3  3  
ATOM 4847  H HD1  . TYR A 1 100 ? -20.081 -0.684  -11.608 1.00 0.00 ? 100 TYR A HD1  3  
ATOM 4848  H HD2  . TYR A 1 100 ? -17.811 2.835   -10.856 1.00 0.00 ? 100 TYR A HD2  3  
ATOM 4849  H HE1  . TYR A 1 100 ? -20.095 -1.197  -9.203  1.00 0.00 ? 100 TYR A HE1  3  
ATOM 4850  H HE2  . TYR A 1 100 ? -17.818 2.331   -8.448  1.00 0.00 ? 100 TYR A HE2  3  
ATOM 4851  H HH   . TYR A 1 100 ? -18.548 -0.600  -7.184  1.00 0.00 ? 100 TYR A HH   3  
ATOM 4852  N N    . PRO A 1 101 ? -18.249 0.532   -15.999 1.00 0.00 ? 101 PRO A N    3  
ATOM 4853  C CA   . PRO A 1 101 ? -18.292 0.893   -17.419 1.00 0.00 ? 101 PRO A CA   3  
ATOM 4854  C C    . PRO A 1 101 ? -19.270 2.030   -17.699 1.00 0.00 ? 101 PRO A C    3  
ATOM 4855  O O    . PRO A 1 101 ? -20.273 2.183   -17.003 1.00 0.00 ? 101 PRO A O    3  
ATOM 4856  C CB   . PRO A 1 101 ? -18.763 -0.396  -18.098 1.00 0.00 ? 101 PRO A CB   3  
ATOM 4857  C CG   . PRO A 1 101 ? -19.521 -1.124  -17.044 1.00 0.00 ? 101 PRO A CG   3  
ATOM 4858  C CD   . PRO A 1 101 ? -18.848 -0.788  -15.742 1.00 0.00 ? 101 PRO A CD   3  
ATOM 4859  H HA   . PRO A 1 101 ? -17.314 1.161   -17.790 1.00 0.00 ? 101 PRO A HA   3  
ATOM 4860  H HB2  . PRO A 1 101 ? -19.392 -0.152  -18.942 1.00 0.00 ? 101 PRO A HB2  3  
ATOM 4861  H HB3  . PRO A 1 101 ? -17.907 -0.963  -18.433 1.00 0.00 ? 101 PRO A HB3  3  
ATOM 4862  H HG2  . PRO A 1 101 ? -20.548 -0.791  -17.033 1.00 0.00 ? 101 PRO A HG2  3  
ATOM 4863  H HG3  . PRO A 1 101 ? -19.473 -2.188  -17.226 1.00 0.00 ? 101 PRO A HG3  3  
ATOM 4864  H HD2  . PRO A 1 101 ? -19.575 -0.733  -14.945 1.00 0.00 ? 101 PRO A HD2  3  
ATOM 4865  H HD3  . PRO A 1 101 ? -18.087 -1.518  -15.511 1.00 0.00 ? 101 PRO A HD3  3  
ATOM 4866  N N    . GLU A 1 102 ? -18.970 2.824   -18.723 1.00 0.00 ? 102 GLU A N    3  
ATOM 4867  C CA   . GLU A 1 102 ? -19.823 3.947   -19.093 1.00 0.00 ? 102 GLU A CA   3  
ATOM 4868  C C    . GLU A 1 102 ? -19.327 4.606   -20.376 1.00 0.00 ? 102 GLU A C    3  
ATOM 4869  O O    . GLU A 1 102 ? -18.152 4.497   -20.731 1.00 0.00 ? 102 GLU A O    3  
ATOM 4870  C CB   . GLU A 1 102 ? -19.869 4.976   -17.962 1.00 0.00 ? 102 GLU A CB   3  
ATOM 4871  C CG   . GLU A 1 102 ? -21.146 5.799   -17.939 1.00 0.00 ? 102 GLU A CG   3  
ATOM 4872  C CD   . GLU A 1 102 ? -22.392 4.947   -18.078 1.00 0.00 ? 102 GLU A CD   3  
ATOM 4873  O OE1  . GLU A 1 102 ? -22.809 4.690   -19.227 1.00 0.00 ? 102 GLU A OE1  3  
ATOM 4874  O OE2  . GLU A 1 102 ? -22.950 4.537   -17.039 1.00 0.00 ? 102 GLU A OE2  3  
ATOM 4875  H H    . GLU A 1 102 ? -18.156 2.650   -19.240 1.00 0.00 ? 102 GLU A H    3  
ATOM 4876  H HA   . GLU A 1 102 ? -20.819 3.565   -19.260 1.00 0.00 ? 102 GLU A HA   3  
ATOM 4877  H HB2  . GLU A 1 102 ? -19.781 4.459   -17.017 1.00 0.00 ? 102 GLU A HB2  3  
ATOM 4878  H HB3  . GLU A 1 102 ? -19.033 5.651   -18.072 1.00 0.00 ? 102 GLU A HB3  3  
ATOM 4879  H HG2  . GLU A 1 102 ? -21.197 6.335   -17.003 1.00 0.00 ? 102 GLU A HG2  3  
ATOM 4880  H HG3  . GLU A 1 102 ? -21.118 6.506   -18.756 1.00 0.00 ? 102 GLU A HG3  3  
ATOM 4881  N N    . LEU A 1 103 ? -20.230 5.292   -21.069 1.00 0.00 ? 103 LEU A N    3  
ATOM 4882  C CA   . LEU A 1 103 ? -19.885 5.970   -22.314 1.00 0.00 ? 103 LEU A CA   3  
ATOM 4883  C C    . LEU A 1 103 ? -19.329 7.363   -22.039 1.00 0.00 ? 103 LEU A C    3  
ATOM 4884  O O    . LEU A 1 103 ? -19.721 8.336   -22.683 1.00 0.00 ? 103 LEU A O    3  
ATOM 4885  C CB   . LEU A 1 103 ? -21.114 6.068   -23.221 1.00 0.00 ? 103 LEU A CB   3  
ATOM 4886  C CG   . LEU A 1 103 ? -20.858 6.557   -24.647 1.00 0.00 ? 103 LEU A CG   3  
ATOM 4887  C CD1  . LEU A 1 103 ? -20.499 5.391   -25.554 1.00 0.00 ? 103 LEU A CD1  3  
ATOM 4888  C CD2  . LEU A 1 103 ? -22.074 7.298   -25.183 1.00 0.00 ? 103 LEU A CD2  3  
ATOM 4889  H H    . LEU A 1 103 ? -21.150 5.343   -20.737 1.00 0.00 ? 103 LEU A H    3  
ATOM 4890  H HA   . LEU A 1 103 ? -19.127 5.384   -22.812 1.00 0.00 ? 103 LEU A HA   3  
ATOM 4891  H HB2  . LEU A 1 103 ? -21.558 5.087   -23.283 1.00 0.00 ? 103 LEU A HB2  3  
ATOM 4892  H HB3  . LEU A 1 103 ? -21.812 6.750   -22.757 1.00 0.00 ? 103 LEU A HB3  3  
ATOM 4893  H HG   . LEU A 1 103 ? -20.022 7.244   -24.641 1.00 0.00 ? 103 LEU A HG   3  
ATOM 4894  H HD11 . LEU A 1 103 ? -19.873 5.741   -26.361 1.00 0.00 ? 103 LEU A HD11 3  
ATOM 4895  H HD12 . LEU A 1 103 ? -21.402 4.960   -25.961 1.00 0.00 ? 103 LEU A HD12 3  
ATOM 4896  H HD13 . LEU A 1 103 ? -19.968 4.642   -24.985 1.00 0.00 ? 103 LEU A HD13 3  
ATOM 4897  H HD21 . LEU A 1 103 ? -22.119 7.186   -26.256 1.00 0.00 ? 103 LEU A HD21 3  
ATOM 4898  H HD22 . LEU A 1 103 ? -21.995 8.346   -24.934 1.00 0.00 ? 103 LEU A HD22 3  
ATOM 4899  H HD23 . LEU A 1 103 ? -22.969 6.888   -24.740 1.00 0.00 ? 103 LEU A HD23 3  
ATOM 4900  N N    . GLU A 1 104 ? -18.412 7.450   -21.080 1.00 0.00 ? 104 GLU A N    3  
ATOM 4901  C CA   . GLU A 1 104 ? -17.802 8.725   -20.722 1.00 0.00 ? 104 GLU A CA   3  
ATOM 4902  C C    . GLU A 1 104 ? -16.280 8.644   -20.813 1.00 0.00 ? 104 GLU A C    3  
ATOM 4903  O O    . GLU A 1 104 ? -15.577 8.891   -19.834 1.00 0.00 ? 104 GLU A O    3  
ATOM 4904  C CB   . GLU A 1 104 ? -18.218 9.136   -19.309 1.00 0.00 ? 104 GLU A CB   3  
ATOM 4905  C CG   . GLU A 1 104 ? -17.986 10.608  -19.009 1.00 0.00 ? 104 GLU A CG   3  
ATOM 4906  C CD   . GLU A 1 104 ? -17.763 10.875  -17.533 1.00 0.00 ? 104 GLU A CD   3  
ATOM 4907  O OE1  . GLU A 1 104 ? -16.936 10.166  -16.921 1.00 0.00 ? 104 GLU A OE1  3  
ATOM 4908  O OE2  . GLU A 1 104 ? -18.415 11.791  -16.991 1.00 0.00 ? 104 GLU A OE2  3  
ATOM 4909  H H    . GLU A 1 104 ? -18.141 6.639   -20.603 1.00 0.00 ? 104 GLU A H    3  
ATOM 4910  H HA   . GLU A 1 104 ? -18.152 9.469   -21.422 1.00 0.00 ? 104 GLU A HA   3  
ATOM 4911  H HB2  . GLU A 1 104 ? -19.270 8.925   -19.180 1.00 0.00 ? 104 GLU A HB2  3  
ATOM 4912  H HB3  . GLU A 1 104 ? -17.654 8.552   -18.596 1.00 0.00 ? 104 GLU A HB3  3  
ATOM 4913  H HG2  . GLU A 1 104 ? -17.115 10.940  -19.555 1.00 0.00 ? 104 GLU A HG2  3  
ATOM 4914  H HG3  . GLU A 1 104 ? -18.849 11.169  -19.335 1.00 0.00 ? 104 GLU A HG3  3  
ATOM 4915  N N    . GLU A 1 105 ? -15.781 8.295   -21.994 1.00 0.00 ? 105 GLU A N    3  
ATOM 4916  C CA   . GLU A 1 105 ? -14.344 8.180   -22.212 1.00 0.00 ? 105 GLU A CA   3  
ATOM 4917  C C    . GLU A 1 105 ? -14.031 8.000   -23.695 1.00 0.00 ? 105 GLU A C    3  
ATOM 4918  O O    . GLU A 1 105 ? -14.934 7.852   -24.518 1.00 0.00 ? 105 GLU A O    3  
ATOM 4919  C CB   . GLU A 1 105 ? -13.778 7.003   -21.414 1.00 0.00 ? 105 GLU A CB   3  
ATOM 4920  C CG   . GLU A 1 105 ? -14.214 5.646   -21.939 1.00 0.00 ? 105 GLU A CG   3  
ATOM 4921  C CD   . GLU A 1 105 ? -13.211 4.551   -21.631 1.00 0.00 ? 105 GLU A CD   3  
ATOM 4922  O OE1  . GLU A 1 105 ? -11.995 4.825   -21.695 1.00 0.00 ? 105 GLU A OE1  3  
ATOM 4923  O OE2  . GLU A 1 105 ? -13.643 3.420   -21.325 1.00 0.00 ? 105 GLU A OE2  3  
ATOM 4924  H H    . GLU A 1 105 ? -16.394 8.110   -22.737 1.00 0.00 ? 105 GLU A H    3  
ATOM 4925  H HA   . GLU A 1 105 ? -13.882 9.092   -21.867 1.00 0.00 ? 105 GLU A HA   3  
ATOM 4926  H HB2  . GLU A 1 105 ? -12.699 7.049   -21.445 1.00 0.00 ? 105 GLU A HB2  3  
ATOM 4927  H HB3  . GLU A 1 105 ? -14.103 7.090   -20.388 1.00 0.00 ? 105 GLU A HB3  3  
ATOM 4928  H HG2  . GLU A 1 105 ? -15.159 5.385   -21.485 1.00 0.00 ? 105 GLU A HG2  3  
ATOM 4929  H HG3  . GLU A 1 105 ? -14.337 5.710   -23.010 1.00 0.00 ? 105 GLU A HG3  3  
ATOM 4930  N N    . GLY A 1 106 ? -12.744 8.016   -24.028 1.00 0.00 ? 106 GLY A N    3  
ATOM 4931  C CA   . GLY A 1 106 ? -12.334 7.855   -25.411 1.00 0.00 ? 106 GLY A CA   3  
ATOM 4932  C C    . GLY A 1 106 ? -10.947 8.410   -25.672 1.00 0.00 ? 106 GLY A C    3  
ATOM 4933  O O    . GLY A 1 106 ? -10.014 7.659   -25.959 1.00 0.00 ? 106 GLY A O    3  
ATOM 4934  H H    . GLY A 1 106 ? -12.067 8.138   -23.329 1.00 0.00 ? 106 GLY A H    3  
ATOM 4935  H HA2  . GLY A 1 106 ? -12.343 6.804   -25.658 1.00 0.00 ? 106 GLY A HA2  3  
ATOM 4936  H HA3  . GLY A 1 106 ? -13.040 8.370   -26.046 1.00 0.00 ? 106 GLY A HA3  3  
ATOM 4937  N N    . VAL A 1 107 ? -10.811 9.728   -25.575 1.00 0.00 ? 107 VAL A N    3  
ATOM 4938  C CA   . VAL A 1 107 ? -9.528  10.383  -25.804 1.00 0.00 ? 107 VAL A CA   3  
ATOM 4939  C C    . VAL A 1 107 ? -9.264  11.456  -24.754 1.00 0.00 ? 107 VAL A C    3  
ATOM 4940  O O    . VAL A 1 107 ? -10.187 12.122  -24.288 1.00 0.00 ? 107 VAL A O    3  
ATOM 4941  C CB   . VAL A 1 107 ? -9.467  11.024  -27.204 1.00 0.00 ? 107 VAL A CB   3  
ATOM 4942  C CG1  . VAL A 1 107 ? -10.506 12.127  -27.332 1.00 0.00 ? 107 VAL A CG1  3  
ATOM 4943  C CG2  . VAL A 1 107 ? -8.071  11.559  -27.483 1.00 0.00 ? 107 VAL A CG2  3  
ATOM 4944  H H    . VAL A 1 107 ? -11.591 10.274  -25.344 1.00 0.00 ? 107 VAL A H    3  
ATOM 4945  H HA   . VAL A 1 107 ? -8.754  9.632   -25.741 1.00 0.00 ? 107 VAL A HA   3  
ATOM 4946  H HB   . VAL A 1 107 ? -9.691  10.262  -27.936 1.00 0.00 ? 107 VAL A HB   3  
ATOM 4947  H HG11 . VAL A 1 107 ? -11.230 12.034  -26.536 1.00 0.00 ? 107 VAL A HG11 3  
ATOM 4948  H HG12 . VAL A 1 107 ? -10.019 13.089  -27.267 1.00 0.00 ? 107 VAL A HG12 3  
ATOM 4949  H HG13 . VAL A 1 107 ? -11.007 12.041  -28.285 1.00 0.00 ? 107 VAL A HG13 3  
ATOM 4950  H HG21 . VAL A 1 107 ? -7.844  11.442  -28.532 1.00 0.00 ? 107 VAL A HG21 3  
ATOM 4951  H HG22 . VAL A 1 107 ? -8.027  12.606  -27.221 1.00 0.00 ? 107 VAL A HG22 3  
ATOM 4952  H HG23 . VAL A 1 107 ? -7.350  11.011  -26.895 1.00 0.00 ? 107 VAL A HG23 3  
ATOM 4953  N N    . GLU A 1 108 ? -7.996  11.618  -24.387 1.00 0.00 ? 108 GLU A N    3  
ATOM 4954  C CA   . GLU A 1 108 ? -7.611  12.610  -23.391 1.00 0.00 ? 108 GLU A CA   3  
ATOM 4955  C C    . GLU A 1 108 ? -7.598  14.011  -23.996 1.00 0.00 ? 108 GLU A C    3  
ATOM 4956  O O    . GLU A 1 108 ? -6.720  14.349  -24.790 1.00 0.00 ? 108 GLU A O    3  
ATOM 4957  C CB   . GLU A 1 108 ? -6.232  12.279  -22.816 1.00 0.00 ? 108 GLU A CB   3  
ATOM 4958  C CG   . GLU A 1 108 ? -5.965  12.923  -21.465 1.00 0.00 ? 108 GLU A CG   3  
ATOM 4959  C CD   . GLU A 1 108 ? -6.497  14.341  -21.380 1.00 0.00 ? 108 GLU A CD   3  
ATOM 4960  O OE1  . GLU A 1 108 ? -5.747  15.278  -21.722 1.00 0.00 ? 108 GLU A OE1  3  
ATOM 4961  O OE2  . GLU A 1 108 ? -7.665  14.512  -20.971 1.00 0.00 ? 108 GLU A OE2  3  
ATOM 4962  H H    . GLU A 1 108 ? -7.305  11.056  -24.795 1.00 0.00 ? 108 GLU A H    3  
ATOM 4963  H HA   . GLU A 1 108 ? -8.339  12.581  -22.595 1.00 0.00 ? 108 GLU A HA   3  
ATOM 4964  H HB2  . GLU A 1 108 ? -6.150  11.208  -22.704 1.00 0.00 ? 108 GLU A HB2  3  
ATOM 4965  H HB3  . GLU A 1 108 ? -5.476  12.619  -23.508 1.00 0.00 ? 108 GLU A HB3  3  
ATOM 4966  H HG2  . GLU A 1 108 ? -6.440  12.330  -20.698 1.00 0.00 ? 108 GLU A HG2  3  
ATOM 4967  H HG3  . GLU A 1 108 ? -4.899  12.943  -21.295 1.00 0.00 ? 108 GLU A HG3  3  
ATOM 4968  N N    . SER A 1 109 ? -8.580  14.823  -23.614 1.00 0.00 ? 109 SER A N    3  
ATOM 4969  C CA   . SER A 1 109 ? -8.685  16.186  -24.122 1.00 0.00 ? 109 SER A CA   3  
ATOM 4970  C C    . SER A 1 109 ? -7.517  17.038  -23.636 1.00 0.00 ? 109 SER A C    3  
ATOM 4971  O O    . SER A 1 109 ? -7.241  17.109  -22.439 1.00 0.00 ? 109 SER A O    3  
ATOM 4972  C CB   . SER A 1 109 ? -10.008 16.815  -23.681 1.00 0.00 ? 109 SER A CB   3  
ATOM 4973  O OG   . SER A 1 109 ? -9.917  17.321  -22.361 1.00 0.00 ? 109 SER A OG   3  
ATOM 4974  H H    . SER A 1 109 ? -9.250  14.495  -22.979 1.00 0.00 ? 109 SER A H    3  
ATOM 4975  H HA   . SER A 1 109 ? -8.659  16.141  -25.200 1.00 0.00 ? 109 SER A HA   3  
ATOM 4976  H HB2  . SER A 1 109 ? -10.258 17.626  -24.348 1.00 0.00 ? 109 SER A HB2  3  
ATOM 4977  H HB3  . SER A 1 109 ? -10.788 16.068  -23.715 1.00 0.00 ? 109 SER A HB3  3  
ATOM 4978  H HG   . SER A 1 109 ? -9.665  18.247  -22.389 1.00 0.00 ? 109 SER A HG   3  
ATOM 4979  N N    . GLY A 1 110 ? -6.832  17.684  -24.576 1.00 0.00 ? 110 GLY A N    3  
ATOM 4980  C CA   . GLY A 1 110 ? -5.701  18.523  -24.226 1.00 0.00 ? 110 GLY A CA   3  
ATOM 4981  C C    . GLY A 1 110 ? -6.105  19.959  -23.960 1.00 0.00 ? 110 GLY A C    3  
ATOM 4982  O O    . GLY A 1 110 ? -6.507  20.319  -22.854 1.00 0.00 ? 110 GLY A O    3  
ATOM 4983  H H    . GLY A 1 110 ? -7.098  17.589  -25.515 1.00 0.00 ? 110 GLY A H    3  
ATOM 4984  H HA2  . GLY A 1 110 ? -5.231  18.122  -23.340 1.00 0.00 ? 110 GLY A HA2  3  
ATOM 4985  H HA3  . GLY A 1 110 ? -4.990  18.505  -25.038 1.00 0.00 ? 110 GLY A HA3  3  
ATOM 4986  N N    . PRO A 1 111 ? -5.999  20.809  -24.993 1.00 0.00 ? 111 PRO A N    3  
ATOM 4987  C CA   . PRO A 1 111 ? -6.350  22.228  -24.890 1.00 0.00 ? 111 PRO A CA   3  
ATOM 4988  C C    . PRO A 1 111 ? -7.852  22.444  -24.741 1.00 0.00 ? 111 PRO A C    3  
ATOM 4989  O O    . PRO A 1 111 ? -8.635  21.497  -24.816 1.00 0.00 ? 111 PRO A O    3  
ATOM 4990  C CB   . PRO A 1 111 ? -5.855  22.813  -26.215 1.00 0.00 ? 111 PRO A CB   3  
ATOM 4991  C CG   . PRO A 1 111 ? -5.859  21.663  -27.162 1.00 0.00 ? 111 PRO A CG   3  
ATOM 4992  C CD   . PRO A 1 111 ? -5.527  20.448  -26.341 1.00 0.00 ? 111 PRO A CD   3  
ATOM 4993  H HA   . PRO A 1 111 ? -5.836  22.706  -24.069 1.00 0.00 ? 111 PRO A HA   3  
ATOM 4994  H HB2  . PRO A 1 111 ? -6.526  23.596  -26.539 1.00 0.00 ? 111 PRO A HB2  3  
ATOM 4995  H HB3  . PRO A 1 111 ? -4.860  23.214  -26.086 1.00 0.00 ? 111 PRO A HB3  3  
ATOM 4996  H HG2  . PRO A 1 111 ? -6.837  21.558  -27.608 1.00 0.00 ? 111 PRO A HG2  3  
ATOM 4997  H HG3  . PRO A 1 111 ? -5.111  21.814  -27.926 1.00 0.00 ? 111 PRO A HG3  3  
ATOM 4998  H HD2  . PRO A 1 111 ? -6.054  19.583  -26.715 1.00 0.00 ? 111 PRO A HD2  3  
ATOM 4999  H HD3  . PRO A 1 111 ? -4.461  20.273  -26.341 1.00 0.00 ? 111 PRO A HD3  3  
ATOM 5000  N N    . SER A 1 112 ? -8.248  23.695  -24.531 1.00 0.00 ? 112 SER A N    3  
ATOM 5001  C CA   . SER A 1 112 ? -9.656  24.035  -24.368 1.00 0.00 ? 112 SER A CA   3  
ATOM 5002  C C    . SER A 1 112 ? -10.350 23.044  -23.438 1.00 0.00 ? 112 SER A C    3  
ATOM 5003  O O    . SER A 1 112 ? -11.379 22.466  -23.785 1.00 0.00 ? 112 SER A O    3  
ATOM 5004  C CB   . SER A 1 112 ? -10.359 24.053  -25.727 1.00 0.00 ? 112 SER A CB   3  
ATOM 5005  O OG   . SER A 1 112 ? -10.036 25.227  -26.452 1.00 0.00 ? 112 SER A OG   3  
ATOM 5006  H H    . SER A 1 112 ? -7.575  24.407  -24.481 1.00 0.00 ? 112 SER A H    3  
ATOM 5007  H HA   . SER A 1 112 ? -9.711  25.020  -23.930 1.00 0.00 ? 112 SER A HA   3  
ATOM 5008  H HB2  . SER A 1 112 ? -10.048 23.194  -26.301 1.00 0.00 ? 112 SER A HB2  3  
ATOM 5009  H HB3  . SER A 1 112 ? -11.428 24.019  -25.577 1.00 0.00 ? 112 SER A HB3  3  
ATOM 5010  H HG   . SER A 1 112 ? -10.500 25.977  -26.071 1.00 0.00 ? 112 SER A HG   3  
ATOM 5011  N N    . SER A 1 113 ? -9.778  22.854  -22.253 1.00 0.00 ? 113 SER A N    3  
ATOM 5012  C CA   . SER A 1 113 ? -10.337 21.930  -21.273 1.00 0.00 ? 113 SER A CA   3  
ATOM 5013  C C    . SER A 1 113 ? -11.321 22.646  -20.352 1.00 0.00 ? 113 SER A C    3  
ATOM 5014  O O    . SER A 1 113 ? -10.937 23.515  -19.571 1.00 0.00 ? 113 SER A O    3  
ATOM 5015  C CB   . SER A 1 113 ? -9.220  21.291  -20.447 1.00 0.00 ? 113 SER A CB   3  
ATOM 5016  O OG   . SER A 1 113 ? -8.733  22.191  -19.466 1.00 0.00 ? 113 SER A OG   3  
ATOM 5017  H H    . SER A 1 113 ? -8.958  23.344  -22.035 1.00 0.00 ? 113 SER A H    3  
ATOM 5018  H HA   . SER A 1 113 ? -10.864 21.156  -21.811 1.00 0.00 ? 113 SER A HA   3  
ATOM 5019  H HB2  . SER A 1 113 ? -9.600  20.410  -19.953 1.00 0.00 ? 113 SER A HB2  3  
ATOM 5020  H HB3  . SER A 1 113 ? -8.406  21.014  -21.101 1.00 0.00 ? 113 SER A HB3  3  
ATOM 5021  H HG   . SER A 1 113 ? -9.165  22.015  -18.627 1.00 0.00 ? 113 SER A HG   3  
ATOM 5022  N N    . GLY A 1 114 ? -12.593 22.273  -20.451 1.00 0.00 ? 114 GLY A N    3  
ATOM 5023  C CA   . GLY A 1 114 ? -13.613 22.889  -19.623 1.00 0.00 ? 114 GLY A CA   3  
ATOM 5024  C C    . GLY A 1 114 ? -14.963 22.945  -20.310 1.00 0.00 ? 114 GLY A C    3  
ATOM 5025  O O    . GLY A 1 114 ? -15.107 23.575  -21.358 1.00 0.00 ? 114 GLY A O    3  
ATOM 5026  H H    . GLY A 1 114 ? -12.842 21.575  -21.093 1.00 0.00 ? 114 GLY A H    3  
ATOM 5027  H HA2  . GLY A 1 114 ? -13.710 22.322  -18.709 1.00 0.00 ? 114 GLY A HA2  3  
ATOM 5028  H HA3  . GLY A 1 114 ? -13.304 23.895  -19.379 1.00 0.00 ? 114 GLY A HA3  3  
ATOM 5029  N N    . GLY A 1 1   ? -31.645 -17.331 -14.377 1.00 0.00 ? 1   GLY A N    4  
ATOM 5030  C CA   . GLY A 1 1   ? -30.459 -18.129 -14.632 1.00 0.00 ? 1   GLY A CA   4  
ATOM 5031  C C    . GLY A 1 1   ? -29.239 -17.603 -13.902 1.00 0.00 ? 1   GLY A C    4  
ATOM 5032  O O    . GLY A 1 1   ? -29.054 -17.871 -12.715 1.00 0.00 ? 1   GLY A O    4  
ATOM 5033  H H1   . GLY A 1 1   ? -32.142 -16.943 -15.128 1.00 0.00 ? 1   GLY A H1   4  
ATOM 5034  H HA2  . GLY A 1 1   ? -30.646 -19.143 -14.314 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5035  H HA3  . GLY A 1 1   ? -30.258 -18.126 -15.693 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5036  N N    . SER A 1 2   ? -28.403 -16.853 -14.613 1.00 0.00 ? 2   SER A N    4  
ATOM 5037  C CA   . SER A 1 2   ? -27.191 -16.293 -14.027 1.00 0.00 ? 2   SER A CA   4  
ATOM 5038  C C    . SER A 1 2   ? -26.282 -17.399 -13.498 1.00 0.00 ? 2   SER A C    4  
ATOM 5039  O O    . SER A 1 2   ? -25.700 -17.277 -12.421 1.00 0.00 ? 2   SER A O    4  
ATOM 5040  C CB   . SER A 1 2   ? -27.546 -15.325 -12.897 1.00 0.00 ? 2   SER A CB   4  
ATOM 5041  O OG   . SER A 1 2   ? -28.152 -14.149 -13.405 1.00 0.00 ? 2   SER A OG   4  
ATOM 5042  H H    . SER A 1 2   ? -28.605 -16.675 -15.556 1.00 0.00 ? 2   SER A H    4  
ATOM 5043  H HA   . SER A 1 2   ? -26.667 -15.753 -14.802 1.00 0.00 ? 2   SER A HA   4  
ATOM 5044  H HB2  . SER A 1 2   ? -28.233 -15.805 -12.218 1.00 0.00 ? 2   SER A HB2  4  
ATOM 5045  H HB3  . SER A 1 2   ? -26.646 -15.051 -12.366 1.00 0.00 ? 2   SER A HB3  4  
ATOM 5046  H HG   . SER A 1 2   ? -28.614 -14.354 -14.221 1.00 0.00 ? 2   SER A HG   4  
ATOM 5047  N N    . SER A 1 3   ? -26.166 -18.478 -14.265 1.00 0.00 ? 3   SER A N    4  
ATOM 5048  C CA   . SER A 1 3   ? -25.332 -19.608 -13.873 1.00 0.00 ? 3   SER A CA   4  
ATOM 5049  C C    . SER A 1 3   ? -24.549 -20.146 -15.068 1.00 0.00 ? 3   SER A C    4  
ATOM 5050  O O    . SER A 1 3   ? -24.894 -19.884 -16.219 1.00 0.00 ? 3   SER A O    4  
ATOM 5051  C CB   . SER A 1 3   ? -26.193 -20.720 -13.271 1.00 0.00 ? 3   SER A CB   4  
ATOM 5052  O OG   . SER A 1 3   ? -25.395 -21.818 -12.862 1.00 0.00 ? 3   SER A OG   4  
ATOM 5053  H H    . SER A 1 3   ? -26.655 -18.516 -15.114 1.00 0.00 ? 3   SER A H    4  
ATOM 5054  H HA   . SER A 1 3   ? -24.633 -19.261 -13.127 1.00 0.00 ? 3   SER A HA   4  
ATOM 5055  H HB2  . SER A 1 3   ? -26.723 -20.337 -12.412 1.00 0.00 ? 3   SER A HB2  4  
ATOM 5056  H HB3  . SER A 1 3   ? -26.903 -21.062 -14.010 1.00 0.00 ? 3   SER A HB3  4  
ATOM 5057  H HG   . SER A 1 3   ? -25.681 -22.611 -13.322 1.00 0.00 ? 3   SER A HG   4  
ATOM 5058  N N    . GLY A 1 4   ? -23.492 -20.901 -14.783 1.00 0.00 ? 4   GLY A N    4  
ATOM 5059  C CA   . GLY A 1 4   ? -22.676 -21.464 -15.843 1.00 0.00 ? 4   GLY A CA   4  
ATOM 5060  C C    . GLY A 1 4   ? -21.367 -20.721 -16.024 1.00 0.00 ? 4   GLY A C    4  
ATOM 5061  O O    . GLY A 1 4   ? -20.296 -21.327 -16.019 1.00 0.00 ? 4   GLY A O    4  
ATOM 5062  H H    . GLY A 1 4   ? -23.265 -21.077 -13.846 1.00 0.00 ? 4   GLY A H    4  
ATOM 5063  H HA2  . GLY A 1 4   ? -22.463 -22.496 -15.609 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5064  H HA3  . GLY A 1 4   ? -23.231 -21.423 -16.769 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5065  N N    . SER A 1 5   ? -21.454 -19.405 -16.186 1.00 0.00 ? 5   SER A N    4  
ATOM 5066  C CA   . SER A 1 5   ? -20.267 -18.578 -16.375 1.00 0.00 ? 5   SER A CA   4  
ATOM 5067  C C    . SER A 1 5   ? -20.248 -17.419 -15.384 1.00 0.00 ? 5   SER A C    4  
ATOM 5068  O O    . SER A 1 5   ? -20.966 -16.433 -15.552 1.00 0.00 ? 5   SER A O    4  
ATOM 5069  C CB   . SER A 1 5   ? -20.217 -18.041 -17.807 1.00 0.00 ? 5   SER A CB   4  
ATOM 5070  O OG   . SER A 1 5   ? -19.673 -19.003 -18.694 1.00 0.00 ? 5   SER A OG   4  
ATOM 5071  H H    . SER A 1 5   ? -22.337 -18.979 -16.181 1.00 0.00 ? 5   SER A H    4  
ATOM 5072  H HA   . SER A 1 5   ? -19.400 -19.199 -16.202 1.00 0.00 ? 5   SER A HA   4  
ATOM 5073  H HB2  . SER A 1 5   ? -21.216 -17.794 -18.131 1.00 0.00 ? 5   SER A HB2  4  
ATOM 5074  H HB3  . SER A 1 5   ? -19.600 -17.155 -17.834 1.00 0.00 ? 5   SER A HB3  4  
ATOM 5075  H HG   . SER A 1 5   ? -19.907 -19.885 -18.393 1.00 0.00 ? 5   SER A HG   4  
ATOM 5076  N N    . SER A 1 6   ? -19.423 -17.546 -14.350 1.00 0.00 ? 6   SER A N    4  
ATOM 5077  C CA   . SER A 1 6   ? -19.313 -16.511 -13.328 1.00 0.00 ? 6   SER A CA   4  
ATOM 5078  C C    . SER A 1 6   ? -18.747 -15.223 -13.919 1.00 0.00 ? 6   SER A C    4  
ATOM 5079  O O    . SER A 1 6   ? -19.352 -14.158 -13.807 1.00 0.00 ? 6   SER A O    4  
ATOM 5080  C CB   . SER A 1 6   ? -18.424 -16.992 -12.179 1.00 0.00 ? 6   SER A CB   4  
ATOM 5081  O OG   . SER A 1 6   ? -17.105 -17.251 -12.628 1.00 0.00 ? 6   SER A OG   4  
ATOM 5082  H H    . SER A 1 6   ? -18.877 -18.356 -14.272 1.00 0.00 ? 6   SER A H    4  
ATOM 5083  H HA   . SER A 1 6   ? -20.304 -16.314 -12.948 1.00 0.00 ? 6   SER A HA   4  
ATOM 5084  H HB2  . SER A 1 6   ? -18.388 -16.232 -11.414 1.00 0.00 ? 6   SER A HB2  4  
ATOM 5085  H HB3  . SER A 1 6   ? -18.836 -17.901 -11.766 1.00 0.00 ? 6   SER A HB3  4  
ATOM 5086  H HG   . SER A 1 6   ? -17.119 -17.965 -13.269 1.00 0.00 ? 6   SER A HG   4  
ATOM 5087  N N    . GLY A 1 7   ? -17.581 -15.330 -14.549 1.00 0.00 ? 7   GLY A N    4  
ATOM 5088  C CA   . GLY A 1 7   ? -16.952 -14.167 -15.147 1.00 0.00 ? 7   GLY A CA   4  
ATOM 5089  C C    . GLY A 1 7   ? -17.469 -13.883 -16.544 1.00 0.00 ? 7   GLY A C    4  
ATOM 5090  O O    . GLY A 1 7   ? -17.838 -14.802 -17.274 1.00 0.00 ? 7   GLY A O    4  
ATOM 5091  H H    . GLY A 1 7   ? -17.144 -16.205 -14.607 1.00 0.00 ? 7   GLY A H    4  
ATOM 5092  H HA2  . GLY A 1 7   ? -17.142 -13.307 -14.523 1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5093  H HA3  . GLY A 1 7   ? -15.886 -14.335 -15.198 1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5094  N N    . GLU A 1 8   ? -17.496 -12.607 -16.915 1.00 0.00 ? 8   GLU A N    4  
ATOM 5095  C CA   . GLU A 1 8   ? -17.974 -12.206 -18.233 1.00 0.00 ? 8   GLU A CA   4  
ATOM 5096  C C    . GLU A 1 8   ? -17.527 -10.785 -18.565 1.00 0.00 ? 8   GLU A C    4  
ATOM 5097  O O    . GLU A 1 8   ? -17.507 -9.911  -17.698 1.00 0.00 ? 8   GLU A O    4  
ATOM 5098  C CB   . GLU A 1 8   ? -19.500 -12.299 -18.296 1.00 0.00 ? 8   GLU A CB   4  
ATOM 5099  C CG   . GLU A 1 8   ? -20.050 -12.315 -19.713 1.00 0.00 ? 8   GLU A CG   4  
ATOM 5100  C CD   . GLU A 1 8   ? -21.555 -12.501 -19.752 1.00 0.00 ? 8   GLU A CD   4  
ATOM 5101  O OE1  . GLU A 1 8   ? -22.220 -12.168 -18.748 1.00 0.00 ? 8   GLU A OE1  4  
ATOM 5102  O OE2  . GLU A 1 8   ? -22.067 -12.978 -20.786 1.00 0.00 ? 8   GLU A OE2  4  
ATOM 5103  H H    . GLU A 1 8   ? -17.188 -11.920 -16.288 1.00 0.00 ? 8   GLU A H    4  
ATOM 5104  H HA   . GLU A 1 8   ? -17.551 -12.882 -18.960 1.00 0.00 ? 8   GLU A HA   4  
ATOM 5105  H HB2  . GLU A 1 8   ? -19.814 -13.205 -17.800 1.00 0.00 ? 8   GLU A HB2  4  
ATOM 5106  H HB3  . GLU A 1 8   ? -19.922 -11.451 -17.778 1.00 0.00 ? 8   GLU A HB3  4  
ATOM 5107  H HG2  . GLU A 1 8   ? -19.807 -11.377 -20.190 1.00 0.00 ? 8   GLU A HG2  4  
ATOM 5108  H HG3  . GLU A 1 8   ? -19.588 -13.125 -20.256 1.00 0.00 ? 8   GLU A HG3  4  
ATOM 5109  N N    . ILE A 1 9   ? -17.167 -10.563 -19.824 1.00 0.00 ? 9   ILE A N    4  
ATOM 5110  C CA   . ILE A 1 9   ? -16.720 -9.250  -20.271 1.00 0.00 ? 9   ILE A CA   4  
ATOM 5111  C C    . ILE A 1 9   ? -17.873 -8.452  -20.871 1.00 0.00 ? 9   ILE A C    4  
ATOM 5112  O O    . ILE A 1 9   ? -18.511 -8.889  -21.828 1.00 0.00 ? 9   ILE A O    4  
ATOM 5113  C CB   . ILE A 1 9   ? -15.592 -9.363  -21.313 1.00 0.00 ? 9   ILE A CB   4  
ATOM 5114  C CG1  . ILE A 1 9   ? -14.394 -10.109 -20.721 1.00 0.00 ? 9   ILE A CG1  4  
ATOM 5115  C CG2  . ILE A 1 9   ? -15.176 -7.982  -21.796 1.00 0.00 ? 9   ILE A CG2  4  
ATOM 5116  C CD1  . ILE A 1 9   ? -13.506 -10.750 -21.764 1.00 0.00 ? 9   ILE A CD1  4  
ATOM 5117  H H    . ILE A 1 9   ? -17.204 -11.300 -20.469 1.00 0.00 ? 9   ILE A H    4  
ATOM 5118  H HA   . ILE A 1 9   ? -16.337 -8.718  -19.412 1.00 0.00 ? 9   ILE A HA   4  
ATOM 5119  H HB   . ILE A 1 9   ? -15.968 -9.916  -22.160 1.00 0.00 ? 9   ILE A HB   4  
ATOM 5120  H HG12 . ILE A 1 9   ? -13.792 -9.417  -20.154 1.00 0.00 ? 9   ILE A HG12 4  
ATOM 5121  H HG13 . ILE A 1 9   ? -14.754 -10.889 -20.065 1.00 0.00 ? 9   ILE A HG13 4  
ATOM 5122  H HG21 . ILE A 1 9   ? -14.100 -7.901  -21.772 1.00 0.00 ? 9   ILE A HG21 4  
ATOM 5123  H HG22 . ILE A 1 9   ? -15.525 -7.835  -22.808 1.00 0.00 ? 9   ILE A HG22 4  
ATOM 5124  H HG23 . ILE A 1 9   ? -15.609 -7.230  -21.153 1.00 0.00 ? 9   ILE A HG23 4  
ATOM 5125  H HD11 . ILE A 1 9   ? -14.108 -11.076 -22.599 1.00 0.00 ? 9   ILE A HD11 4  
ATOM 5126  H HD12 . ILE A 1 9   ? -12.774 -10.034 -22.105 1.00 0.00 ? 9   ILE A HD12 4  
ATOM 5127  H HD13 . ILE A 1 9   ? -13.001 -11.603 -21.332 1.00 0.00 ? 9   ILE A HD13 4  
ATOM 5128  N N    . GLU A 1 10  ? -18.132 -7.278  -20.303 1.00 0.00 ? 10  GLU A N    4  
ATOM 5129  C CA   . GLU A 1 10  ? -19.207 -6.418  -20.783 1.00 0.00 ? 10  GLU A CA   4  
ATOM 5130  C C    . GLU A 1 10  ? -19.120 -5.033  -20.149 1.00 0.00 ? 10  GLU A C    4  
ATOM 5131  O O    . GLU A 1 10  ? -18.379 -4.824  -19.188 1.00 0.00 ? 10  GLU A O    4  
ATOM 5132  C CB   . GLU A 1 10  ? -20.568 -7.047  -20.476 1.00 0.00 ? 10  GLU A CB   4  
ATOM 5133  C CG   . GLU A 1 10  ? -21.670 -6.607  -21.426 1.00 0.00 ? 10  GLU A CG   4  
ATOM 5134  C CD   . GLU A 1 10  ? -22.940 -7.420  -21.263 1.00 0.00 ? 10  GLU A CD   4  
ATOM 5135  O OE1  . GLU A 1 10  ? -22.852 -8.568  -20.779 1.00 0.00 ? 10  GLU A OE1  4  
ATOM 5136  O OE2  . GLU A 1 10  ? -24.021 -6.907  -21.618 1.00 0.00 ? 10  GLU A OE2  4  
ATOM 5137  H H    . GLU A 1 10  ? -17.588 -6.984  -19.543 1.00 0.00 ? 10  GLU A H    4  
ATOM 5138  H HA   . GLU A 1 10  ? -19.100 -6.319  -21.852 1.00 0.00 ? 10  GLU A HA   4  
ATOM 5139  H HB2  . GLU A 1 10  ? -20.477 -8.121  -20.536 1.00 0.00 ? 10  GLU A HB2  4  
ATOM 5140  H HB3  . GLU A 1 10  ? -20.858 -6.775  -19.472 1.00 0.00 ? 10  GLU A HB3  4  
ATOM 5141  H HG2  . GLU A 1 10  ? -21.898 -5.569  -21.237 1.00 0.00 ? 10  GLU A HG2  4  
ATOM 5142  H HG3  . GLU A 1 10  ? -21.317 -6.718  -22.441 1.00 0.00 ? 10  GLU A HG3  4  
ATOM 5143  N N    . ILE A 1 11  ? -19.882 -4.090  -20.695 1.00 0.00 ? 11  ILE A N    4  
ATOM 5144  C CA   . ILE A 1 11  ? -19.891 -2.726  -20.183 1.00 0.00 ? 11  ILE A CA   4  
ATOM 5145  C C    . ILE A 1 11  ? -20.806 -2.600  -18.970 1.00 0.00 ? 11  ILE A C    4  
ATOM 5146  O O    . ILE A 1 11  ? -20.566 -1.782  -18.081 1.00 0.00 ? 11  ILE A O    4  
ATOM 5147  C CB   . ILE A 1 11  ? -20.345 -1.724  -21.261 1.00 0.00 ? 11  ILE A CB   4  
ATOM 5148  C CG1  . ILE A 1 11  ? -19.447 -1.826  -22.495 1.00 0.00 ? 11  ILE A CG1  4  
ATOM 5149  C CG2  . ILE A 1 11  ? -20.332 -0.307  -20.706 1.00 0.00 ? 11  ILE A CG2  4  
ATOM 5150  C CD1  . ILE A 1 11  ? -20.109 -1.345  -23.767 1.00 0.00 ? 11  ILE A CD1  4  
ATOM 5151  H H    . ILE A 1 11  ? -20.451 -4.319  -21.459 1.00 0.00 ? 11  ILE A H    4  
ATOM 5152  H HA   . ILE A 1 11  ? -18.883 -2.474  -19.888 1.00 0.00 ? 11  ILE A HA   4  
ATOM 5153  H HB   . ILE A 1 11  ? -21.359 -1.965  -21.542 1.00 0.00 ? 11  ILE A HB   4  
ATOM 5154  H HG12 . ILE A 1 11  ? -18.561 -1.232  -22.338 1.00 0.00 ? 11  ILE A HG12 4  
ATOM 5155  H HG13 . ILE A 1 11  ? -19.162 -2.859  -22.639 1.00 0.00 ? 11  ILE A HG13 4  
ATOM 5156  H HG21 . ILE A 1 11  ? -19.315 -0.012  -20.496 1.00 0.00 ? 11  ILE A HG21 4  
ATOM 5157  H HG22 . ILE A 1 11  ? -20.758 0.368   -21.434 1.00 0.00 ? 11  ILE A HG22 4  
ATOM 5158  H HG23 . ILE A 1 11  ? -20.913 -0.271  -19.797 1.00 0.00 ? 11  ILE A HG23 4  
ATOM 5159  H HD11 . ILE A 1 11  ? -20.349 -2.193  -24.392 1.00 0.00 ? 11  ILE A HD11 4  
ATOM 5160  H HD12 . ILE A 1 11  ? -21.014 -0.810  -23.522 1.00 0.00 ? 11  ILE A HD12 4  
ATOM 5161  H HD13 . ILE A 1 11  ? -19.435 -0.688  -24.298 1.00 0.00 ? 11  ILE A HD13 4  
ATOM 5162  N N    . CYS A 1 12  ? -21.854 -3.415  -18.940 1.00 0.00 ? 12  CYS A N    4  
ATOM 5163  C CA   . CYS A 1 12  ? -22.806 -3.396  -17.834 1.00 0.00 ? 12  CYS A CA   4  
ATOM 5164  C C    . CYS A 1 12  ? -22.081 -3.390  -16.493 1.00 0.00 ? 12  CYS A C    4  
ATOM 5165  O O    . CYS A 1 12  ? -22.226 -2.473  -15.685 1.00 0.00 ? 12  CYS A O    4  
ATOM 5166  C CB   . CYS A 1 12  ? -23.740 -4.604  -17.918 1.00 0.00 ? 12  CYS A CB   4  
ATOM 5167  S SG   . CYS A 1 12  ? -25.292 -4.279  -18.787 1.00 0.00 ? 12  CYS A SG   4  
ATOM 5168  H H    . CYS A 1 12  ? -21.992 -4.045  -19.678 1.00 0.00 ? 12  CYS A H    4  
ATOM 5169  H HA   . CYS A 1 12  ? -23.391 -2.493  -17.917 1.00 0.00 ? 12  CYS A HA   4  
ATOM 5170  H HB2  . CYS A 1 12  ? -23.235 -5.405  -18.437 1.00 0.00 ? 12  CYS A HB2  4  
ATOM 5171  H HB3  . CYS A 1 12  ? -23.984 -4.930  -16.917 1.00 0.00 ? 12  CYS A HB3  4  
ATOM 5172  H HG   . CYS A 1 12  ? -25.190 -3.097  -19.375 1.00 0.00 ? 12  CYS A HG   4  
ATOM 5173  N N    . PRO A 1 13  ? -21.282 -4.439  -16.247 1.00 0.00 ? 13  PRO A N    4  
ATOM 5174  C CA   . PRO A 1 13  ? -20.519 -4.579  -15.003 1.00 0.00 ? 13  PRO A CA   4  
ATOM 5175  C C    . PRO A 1 13  ? -19.384 -3.566  -14.902 1.00 0.00 ? 13  PRO A C    4  
ATOM 5176  O O    . PRO A 1 13  ? -19.292 -2.638  -15.707 1.00 0.00 ? 13  PRO A O    4  
ATOM 5177  C CB   . PRO A 1 13  ? -19.960 -6.002  -15.087 1.00 0.00 ? 13  PRO A CB   4  
ATOM 5178  C CG   . PRO A 1 13  ? -19.901 -6.300  -16.546 1.00 0.00 ? 13  PRO A CG   4  
ATOM 5179  C CD   . PRO A 1 13  ? -21.061 -5.569  -17.165 1.00 0.00 ? 13  PRO A CD   4  
ATOM 5180  H HA   . PRO A 1 13  ? -21.156 -4.492  -14.135 1.00 0.00 ? 13  PRO A HA   4  
ATOM 5181  H HB2  . PRO A 1 13  ? -18.978 -6.033  -14.637 1.00 0.00 ? 13  PRO A HB2  4  
ATOM 5182  H HB3  . PRO A 1 13  ? -20.620 -6.683  -14.572 1.00 0.00 ? 13  PRO A HB3  4  
ATOM 5183  H HG2  . PRO A 1 13  ? -18.970 -5.941  -16.957 1.00 0.00 ? 13  PRO A HG2  4  
ATOM 5184  H HG3  . PRO A 1 13  ? -19.999 -7.363  -16.707 1.00 0.00 ? 13  PRO A HG3  4  
ATOM 5185  H HD2  . PRO A 1 13  ? -20.803 -5.219  -18.153 1.00 0.00 ? 13  PRO A HD2  4  
ATOM 5186  H HD3  . PRO A 1 13  ? -21.931 -6.208  -17.205 1.00 0.00 ? 13  PRO A HD3  4  
ATOM 5187  N N    . LYS A 1 14  ? -18.520 -3.749  -13.910 1.00 0.00 ? 14  LYS A N    4  
ATOM 5188  C CA   . LYS A 1 14  ? -17.388 -2.853  -13.704 1.00 0.00 ? 14  LYS A CA   4  
ATOM 5189  C C    . LYS A 1 14  ? -16.192 -3.284  -14.546 1.00 0.00 ? 14  LYS A C    4  
ATOM 5190  O O    . LYS A 1 14  ? -16.252 -4.285  -15.261 1.00 0.00 ? 14  LYS A O    4  
ATOM 5191  C CB   . LYS A 1 14  ? -16.999 -2.821  -12.224 1.00 0.00 ? 14  LYS A CB   4  
ATOM 5192  C CG   . LYS A 1 14  ? -16.565 -4.171  -11.680 1.00 0.00 ? 14  LYS A CG   4  
ATOM 5193  C CD   . LYS A 1 14  ? -16.537 -4.177  -10.161 1.00 0.00 ? 14  LYS A CD   4  
ATOM 5194  C CE   . LYS A 1 14  ? -16.673 -5.587  -9.607  1.00 0.00 ? 14  LYS A CE   4  
ATOM 5195  N NZ   . LYS A 1 14  ? -16.364 -5.642  -8.151  1.00 0.00 ? 14  LYS A NZ   4  
ATOM 5196  H H    . LYS A 1 14  ? -18.646 -4.507  -13.300 1.00 0.00 ? 14  LYS A H    4  
ATOM 5197  H HA   . LYS A 1 14  ? -17.690 -1.862  -14.009 1.00 0.00 ? 14  LYS A HA   4  
ATOM 5198  H HB2  . LYS A 1 14  ? -16.183 -2.125  -12.094 1.00 0.00 ? 14  LYS A HB2  4  
ATOM 5199  H HB3  . LYS A 1 14  ? -17.847 -2.480  -11.648 1.00 0.00 ? 14  LYS A HB3  4  
ATOM 5200  H HG2  . LYS A 1 14  ? -17.260 -4.925  -12.019 1.00 0.00 ? 14  LYS A HG2  4  
ATOM 5201  H HG3  . LYS A 1 14  ? -15.576 -4.397  -12.051 1.00 0.00 ? 14  LYS A HG3  4  
ATOM 5202  H HD2  . LYS A 1 14  ? -15.599 -3.760  -9.826  1.00 0.00 ? 14  LYS A HD2  4  
ATOM 5203  H HD3  . LYS A 1 14  ? -17.354 -3.573  -9.792  1.00 0.00 ? 14  LYS A HD3  4  
ATOM 5204  H HE2  . LYS A 1 14  ? -17.686 -5.925  -9.764  1.00 0.00 ? 14  LYS A HE2  4  
ATOM 5205  H HE3  . LYS A 1 14  ? -15.991 -6.235  -10.136 1.00 0.00 ? 14  LYS A HE3  4  
ATOM 5206  H HZ1  . LYS A 1 14  ? -15.337 -5.566  -8.001  1.00 0.00 ? 14  LYS A HZ1  4  
ATOM 5207  H HZ2  . LYS A 1 14  ? -16.696 -6.543  -7.749  1.00 0.00 ? 14  LYS A HZ2  4  
ATOM 5208  H HZ3  . LYS A 1 14  ? -16.835 -4.859  -7.655  1.00 0.00 ? 14  LYS A HZ3  4  
ATOM 5209  N N    . VAL A 1 15  ? -15.106 -2.523  -14.457 1.00 0.00 ? 15  VAL A N    4  
ATOM 5210  C CA   . VAL A 1 15  ? -13.894 -2.829  -15.209 1.00 0.00 ? 15  VAL A CA   4  
ATOM 5211  C C    . VAL A 1 15  ? -12.647 -2.529  -14.385 1.00 0.00 ? 15  VAL A C    4  
ATOM 5212  O O    . VAL A 1 15  ? -12.709 -1.832  -13.372 1.00 0.00 ? 15  VAL A O    4  
ATOM 5213  C CB   . VAL A 1 15  ? -13.833 -2.028  -16.523 1.00 0.00 ? 15  VAL A CB   4  
ATOM 5214  C CG1  . VAL A 1 15  ? -14.956 -2.450  -17.458 1.00 0.00 ? 15  VAL A CG1  4  
ATOM 5215  C CG2  . VAL A 1 15  ? -13.897 -0.535  -16.240 1.00 0.00 ? 15  VAL A CG2  4  
ATOM 5216  H H    . VAL A 1 15  ? -15.119 -1.738  -13.870 1.00 0.00 ? 15  VAL A H    4  
ATOM 5217  H HA   . VAL A 1 15  ? -13.909 -3.881  -15.453 1.00 0.00 ? 15  VAL A HA   4  
ATOM 5218  H HB   . VAL A 1 15  ? -12.891 -2.242  -17.007 1.00 0.00 ? 15  VAL A HB   4  
ATOM 5219  H HG11 . VAL A 1 15  ? -15.825 -1.835  -17.277 1.00 0.00 ? 15  VAL A HG11 4  
ATOM 5220  H HG12 . VAL A 1 15  ? -14.635 -2.330  -18.483 1.00 0.00 ? 15  VAL A HG12 4  
ATOM 5221  H HG13 . VAL A 1 15  ? -15.204 -3.486  -17.278 1.00 0.00 ? 15  VAL A HG13 4  
ATOM 5222  H HG21 . VAL A 1 15  ? -14.889 -0.275  -15.905 1.00 0.00 ? 15  VAL A HG21 4  
ATOM 5223  H HG22 . VAL A 1 15  ? -13.180 -0.282  -15.472 1.00 0.00 ? 15  VAL A HG22 4  
ATOM 5224  H HG23 . VAL A 1 15  ? -13.665 0.013   -17.142 1.00 0.00 ? 15  VAL A HG23 4  
ATOM 5225  N N    . THR A 1 16  ? -11.511 -3.061  -14.827 1.00 0.00 ? 16  THR A N    4  
ATOM 5226  C CA   . THR A 1 16  ? -10.248 -2.852  -14.132 1.00 0.00 ? 16  THR A CA   4  
ATOM 5227  C C    . THR A 1 16  ? -9.418  -1.768  -14.811 1.00 0.00 ? 16  THR A C    4  
ATOM 5228  O O    . THR A 1 16  ? -9.143  -1.845  -16.008 1.00 0.00 ? 16  THR A O    4  
ATOM 5229  C CB   . THR A 1 16  ? -9.421  -4.150  -14.067 1.00 0.00 ? 16  THR A CB   4  
ATOM 5230  O OG1  . THR A 1 16  ? -9.423  -4.797  -15.344 1.00 0.00 ? 16  THR A OG1  4  
ATOM 5231  C CG2  . THR A 1 16  ? -9.978  -5.095  -13.013 1.00 0.00 ? 16  THR A CG2  4  
ATOM 5232  H H    . THR A 1 16  ? -11.525 -3.608  -15.641 1.00 0.00 ? 16  THR A H    4  
ATOM 5233  H HA   . THR A 1 16  ? -10.470 -2.541  -13.121 1.00 0.00 ? 16  THR A HA   4  
ATOM 5234  H HB   . THR A 1 16  ? -8.404  -3.898  -13.802 1.00 0.00 ? 16  THR A HB   4  
ATOM 5235  H HG1  . THR A 1 16  ? -8.794  -5.523  -15.337 1.00 0.00 ? 16  THR A HG1  4  
ATOM 5236  H HG21 . THR A 1 16  ? -10.950 -5.448  -13.324 1.00 0.00 ? 16  THR A HG21 4  
ATOM 5237  H HG22 . THR A 1 16  ? -10.068 -4.572  -12.072 1.00 0.00 ? 16  THR A HG22 4  
ATOM 5238  H HG23 . THR A 1 16  ? -9.311  -5.936  -12.895 1.00 0.00 ? 16  THR A HG23 4  
ATOM 5239  N N    . GLN A 1 17  ? -9.024  -0.761  -14.040 1.00 0.00 ? 17  GLN A N    4  
ATOM 5240  C CA   . GLN A 1 17  ? -8.225  0.339   -14.569 1.00 0.00 ? 17  GLN A CA   4  
ATOM 5241  C C    . GLN A 1 17  ? -6.831  0.346   -13.950 1.00 0.00 ? 17  GLN A C    4  
ATOM 5242  O O    . GLN A 1 17  ? -6.682  0.262   -12.731 1.00 0.00 ? 17  GLN A O    4  
ATOM 5243  C CB   . GLN A 1 17  ? -8.921  1.675   -14.304 1.00 0.00 ? 17  GLN A CB   4  
ATOM 5244  C CG   . GLN A 1 17  ? -9.301  1.885   -12.848 1.00 0.00 ? 17  GLN A CG   4  
ATOM 5245  C CD   . GLN A 1 17  ? -9.795  3.292   -12.570 1.00 0.00 ? 17  GLN A CD   4  
ATOM 5246  O OE1  . GLN A 1 17  ? -9.679  4.180   -13.415 1.00 0.00 ? 17  GLN A OE1  4  
ATOM 5247  N NE2  . GLN A 1 17  ? -10.348 3.501   -11.382 1.00 0.00 ? 17  GLN A NE2  4  
ATOM 5248  H H    . GLN A 1 17  ? -9.275  -0.757  -13.093 1.00 0.00 ? 17  GLN A H    4  
ATOM 5249  H HA   . GLN A 1 17  ? -8.132  0.197   -15.635 1.00 0.00 ? 17  GLN A HA   4  
ATOM 5250  H HB2  . GLN A 1 17  ? -8.261  2.476   -14.601 1.00 0.00 ? 17  GLN A HB2  4  
ATOM 5251  H HB3  . GLN A 1 17  ? -9.821  1.722   -14.899 1.00 0.00 ? 17  GLN A HB3  4  
ATOM 5252  H HG2  . GLN A 1 17  ? -10.084 1.188   -12.589 1.00 0.00 ? 17  GLN A HG2  4  
ATOM 5253  H HG3  . GLN A 1 17  ? -8.434  1.695   -12.232 1.00 0.00 ? 17  GLN A HG3  4  
ATOM 5254  H HE21 . GLN A 1 17  ? -10.405 2.747   -10.758 1.00 0.00 ? 17  GLN A HE21 4  
ATOM 5255  H HE22 . GLN A 1 17  ? -10.675 4.401   -11.176 1.00 0.00 ? 17  GLN A HE22 4  
ATOM 5256  N N    . SER A 1 18  ? -5.813  0.448   -14.799 1.00 0.00 ? 18  SER A N    4  
ATOM 5257  C CA   . SER A 1 18  ? -4.431  0.462   -14.336 1.00 0.00 ? 18  SER A CA   4  
ATOM 5258  C C    . SER A 1 18  ? -3.909  1.892   -14.227 1.00 0.00 ? 18  SER A C    4  
ATOM 5259  O O    . SER A 1 18  ? -3.613  2.534   -15.235 1.00 0.00 ? 18  SER A O    4  
ATOM 5260  C CB   . SER A 1 18  ? -3.544  -0.345  -15.286 1.00 0.00 ? 18  SER A CB   4  
ATOM 5261  O OG   . SER A 1 18  ? -3.656  0.131   -16.616 1.00 0.00 ? 18  SER A OG   4  
ATOM 5262  H H    . SER A 1 18  ? -5.997  0.512   -15.760 1.00 0.00 ? 18  SER A H    4  
ATOM 5263  H HA   . SER A 1 18  ? -4.404  0.006   -13.357 1.00 0.00 ? 18  SER A HA   4  
ATOM 5264  H HB2  . SER A 1 18  ? -2.515  -0.262  -14.972 1.00 0.00 ? 18  SER A HB2  4  
ATOM 5265  H HB3  . SER A 1 18  ? -3.845  -1.383  -15.260 1.00 0.00 ? 18  SER A HB3  4  
ATOM 5266  H HG   . SER A 1 18  ? -3.122  0.922   -16.719 1.00 0.00 ? 18  SER A HG   4  
ATOM 5267  N N    . ILE A 1 19  ? -3.800  2.383   -12.997 1.00 0.00 ? 19  ILE A N    4  
ATOM 5268  C CA   . ILE A 1 19  ? -3.314  3.736   -12.755 1.00 0.00 ? 19  ILE A CA   4  
ATOM 5269  C C    . ILE A 1 19  ? -1.809  3.743   -12.512 1.00 0.00 ? 19  ILE A C    4  
ATOM 5270  O O    . ILE A 1 19  ? -1.318  3.119   -11.571 1.00 0.00 ? 19  ILE A O    4  
ATOM 5271  C CB   . ILE A 1 19  ? -4.021  4.381   -11.549 1.00 0.00 ? 19  ILE A CB   4  
ATOM 5272  C CG1  . ILE A 1 19  ? -5.525  4.490   -11.810 1.00 0.00 ? 19  ILE A CG1  4  
ATOM 5273  C CG2  . ILE A 1 19  ? -3.428  5.752   -11.259 1.00 0.00 ? 19  ILE A CG2  4  
ATOM 5274  C CD1  . ILE A 1 19  ? -6.294  3.240   -11.443 1.00 0.00 ? 19  ILE A CD1  4  
ATOM 5275  H H    . ILE A 1 19  ? -4.053  1.822   -12.234 1.00 0.00 ? 19  ILE A H    4  
ATOM 5276  H HA   . ILE A 1 19  ? -3.529  4.328   -13.633 1.00 0.00 ? 19  ILE A HA   4  
ATOM 5277  H HB   . ILE A 1 19  ? -3.857  3.754   -10.686 1.00 0.00 ? 19  ILE A HB   4  
ATOM 5278  H HG12 . ILE A 1 19  ? -5.926  5.307   -11.231 1.00 0.00 ? 19  ILE A HG12 4  
ATOM 5279  H HG13 . ILE A 1 19  ? -5.687  4.685   -12.860 1.00 0.00 ? 19  ILE A HG13 4  
ATOM 5280  H HG21 . ILE A 1 19  ? -2.593  5.930   -11.920 1.00 0.00 ? 19  ILE A HG21 4  
ATOM 5281  H HG22 . ILE A 1 19  ? -4.180  6.510   -11.418 1.00 0.00 ? 19  ILE A HG22 4  
ATOM 5282  H HG23 . ILE A 1 19  ? -3.090  5.788   -10.234 1.00 0.00 ? 19  ILE A HG23 4  
ATOM 5283  H HD11 . ILE A 1 19  ? -7.018  3.473   -10.677 1.00 0.00 ? 19  ILE A HD11 4  
ATOM 5284  H HD12 . ILE A 1 19  ? -6.801  2.860   -12.317 1.00 0.00 ? 19  ILE A HD12 4  
ATOM 5285  H HD13 . ILE A 1 19  ? -5.608  2.491   -11.072 1.00 0.00 ? 19  ILE A HD13 4  
ATOM 5286  N N    . HIS A 1 20  ? -1.080  4.456   -13.366 1.00 0.00 ? 20  HIS A N    4  
ATOM 5287  C CA   . HIS A 1 20  ? 0.370   4.547   -13.242 1.00 0.00 ? 20  HIS A CA   4  
ATOM 5288  C C    . HIS A 1 20  ? 0.797   5.968   -12.888 1.00 0.00 ? 20  HIS A C    4  
ATOM 5289  O O    . HIS A 1 20  ? 0.740   6.870   -13.725 1.00 0.00 ? 20  HIS A O    4  
ATOM 5290  C CB   . HIS A 1 20  ? 1.043   4.110   -14.544 1.00 0.00 ? 20  HIS A CB   4  
ATOM 5291  C CG   . HIS A 1 20  ? 0.605   2.759   -15.020 1.00 0.00 ? 20  HIS A CG   4  
ATOM 5292  N ND1  . HIS A 1 20  ? 1.334   1.609   -14.796 1.00 0.00 ? 20  HIS A ND1  4  
ATOM 5293  C CD2  . HIS A 1 20  ? -0.495  2.376   -15.709 1.00 0.00 ? 20  HIS A CD2  4  
ATOM 5294  C CE1  . HIS A 1 20  ? 0.702   0.579   -15.330 1.00 0.00 ? 20  HIS A CE1  4  
ATOM 5295  N NE2  . HIS A 1 20  ? -0.412  1.018   -15.889 1.00 0.00 ? 20  HIS A NE2  4  
ATOM 5296  H H    . HIS A 1 20  ? -1.529  4.931   -14.096 1.00 0.00 ? 20  HIS A H    4  
ATOM 5297  H HA   . HIS A 1 20  ? 0.678   3.884   -12.448 1.00 0.00 ? 20  HIS A HA   4  
ATOM 5298  H HB2  . HIS A 1 20  ? 0.811   4.825   -15.319 1.00 0.00 ? 20  HIS A HB2  4  
ATOM 5299  H HB3  . HIS A 1 20  ? 2.113   4.080   -14.397 1.00 0.00 ? 20  HIS A HB3  4  
ATOM 5300  H HD1  . HIS A 1 20  ? 2.188   1.557   -14.320 1.00 0.00 ? 20  HIS A HD1  4  
ATOM 5301  H HD2  . HIS A 1 20  ? -1.292  3.020   -16.055 1.00 0.00 ? 20  HIS A HD2  4  
ATOM 5302  H HE1  . HIS A 1 20  ? 1.037   -0.447  -15.311 1.00 0.00 ? 20  HIS A HE1  4  
ATOM 5303  H HE2  . HIS A 1 20  ? -1.023  0.475   -16.429 1.00 0.00 ? 20  HIS A HE2  4  
ATOM 5304  N N    . ILE A 1 21  ? 1.223   6.160   -11.644 1.00 0.00 ? 21  ILE A N    4  
ATOM 5305  C CA   . ILE A 1 21  ? 1.659   7.472   -11.180 1.00 0.00 ? 21  ILE A CA   4  
ATOM 5306  C C    . ILE A 1 21  ? 3.175   7.607   -11.262 1.00 0.00 ? 21  ILE A C    4  
ATOM 5307  O O    . ILE A 1 21  ? 3.908   6.649   -11.017 1.00 0.00 ? 21  ILE A O    4  
ATOM 5308  C CB   . ILE A 1 21  ? 1.208   7.735   -9.731  1.00 0.00 ? 21  ILE A CB   4  
ATOM 5309  C CG1  . ILE A 1 21  ? -0.259  7.341   -9.551  1.00 0.00 ? 21  ILE A CG1  4  
ATOM 5310  C CG2  . ILE A 1 21  ? 1.418   9.197   -9.369  1.00 0.00 ? 21  ILE A CG2  4  
ATOM 5311  C CD1  . ILE A 1 21  ? -0.644  7.085   -8.111  1.00 0.00 ? 21  ILE A CD1  4  
ATOM 5312  H H    . ILE A 1 21  ? 1.245   5.402   -11.024 1.00 0.00 ? 21  ILE A H    4  
ATOM 5313  H HA   . ILE A 1 21  ? 1.206   8.218   -11.818 1.00 0.00 ? 21  ILE A HA   4  
ATOM 5314  H HB   . ILE A 1 21  ? 1.818   7.135   -9.074  1.00 0.00 ? 21  ILE A HB   4  
ATOM 5315  H HG12 . ILE A 1 21  ? -0.887  8.134   -9.925  1.00 0.00 ? 21  ILE A HG12 4  
ATOM 5316  H HG13 . ILE A 1 21  ? -0.453  6.438   -10.112 1.00 0.00 ? 21  ILE A HG13 4  
ATOM 5317  H HG21 . ILE A 1 21  ? 1.211   9.341   -8.318  1.00 0.00 ? 21  ILE A HG21 4  
ATOM 5318  H HG22 . ILE A 1 21  ? 2.441   9.475   -9.575  1.00 0.00 ? 21  ILE A HG22 4  
ATOM 5319  H HG23 . ILE A 1 21  ? 0.752   9.813   -9.954  1.00 0.00 ? 21  ILE A HG23 4  
ATOM 5320  H HD11 . ILE A 1 21  ? 0.005   7.652   -7.458  1.00 0.00 ? 21  ILE A HD11 4  
ATOM 5321  H HD12 . ILE A 1 21  ? -1.668  7.386   -7.952  1.00 0.00 ? 21  ILE A HD12 4  
ATOM 5322  H HD13 . ILE A 1 21  ? -0.540  6.032   -7.892  1.00 0.00 ? 21  ILE A HD13 4  
ATOM 5323  N N    . GLU A 1 22  ? 3.639   8.805   -11.606 1.00 0.00 ? 22  GLU A N    4  
ATOM 5324  C CA   . GLU A 1 22  ? 5.070   9.065   -11.719 1.00 0.00 ? 22  GLU A CA   4  
ATOM 5325  C C    . GLU A 1 22  ? 5.434   10.393  -11.060 1.00 0.00 ? 22  GLU A C    4  
ATOM 5326  O O    . GLU A 1 22  ? 4.773   11.409  -11.276 1.00 0.00 ? 22  GLU A O    4  
ATOM 5327  C CB   . GLU A 1 22  ? 5.494   9.079   -13.189 1.00 0.00 ? 22  GLU A CB   4  
ATOM 5328  C CG   . GLU A 1 22  ? 5.908   7.715   -13.716 1.00 0.00 ? 22  GLU A CG   4  
ATOM 5329  C CD   . GLU A 1 22  ? 7.320   7.338   -13.312 1.00 0.00 ? 22  GLU A CD   4  
ATOM 5330  O OE1  . GLU A 1 22  ? 7.773   7.797   -12.243 1.00 0.00 ? 22  GLU A OE1  4  
ATOM 5331  O OE2  . GLU A 1 22  ? 7.971   6.583   -14.064 1.00 0.00 ? 22  GLU A OE2  4  
ATOM 5332  H H    . GLU A 1 22  ? 3.005   9.529   -11.789 1.00 0.00 ? 22  GLU A H    4  
ATOM 5333  H HA   . GLU A 1 22  ? 5.593   8.270   -11.210 1.00 0.00 ? 22  GLU A HA   4  
ATOM 5334  H HB2  . GLU A 1 22  ? 4.669   9.438   -13.786 1.00 0.00 ? 22  GLU A HB2  4  
ATOM 5335  H HB3  . GLU A 1 22  ? 6.329   9.754   -13.303 1.00 0.00 ? 22  GLU A HB3  4  
ATOM 5336  H HG2  . GLU A 1 22  ? 5.228   6.972   -13.327 1.00 0.00 ? 22  GLU A HG2  4  
ATOM 5337  H HG3  . GLU A 1 22  ? 5.848   7.727   -14.794 1.00 0.00 ? 22  GLU A HG3  4  
ATOM 5338  N N    . LYS A 1 23  ? 6.491   10.377  -10.255 1.00 0.00 ? 23  LYS A N    4  
ATOM 5339  C CA   . LYS A 1 23  ? 6.946   11.578  -9.565  1.00 0.00 ? 23  LYS A CA   4  
ATOM 5340  C C    . LYS A 1 23  ? 8.330   11.994  -10.052 1.00 0.00 ? 23  LYS A C    4  
ATOM 5341  O O    . LYS A 1 23  ? 9.275   11.207  -10.013 1.00 0.00 ? 23  LYS A O    4  
ATOM 5342  C CB   . LYS A 1 23  ? 6.976   11.341  -8.053  1.00 0.00 ? 23  LYS A CB   4  
ATOM 5343  C CG   . LYS A 1 23  ? 5.610   11.438  -7.395  1.00 0.00 ? 23  LYS A CG   4  
ATOM 5344  C CD   . LYS A 1 23  ? 5.727   11.724  -5.907  1.00 0.00 ? 23  LYS A CD   4  
ATOM 5345  C CE   . LYS A 1 23  ? 4.534   12.516  -5.396  1.00 0.00 ? 23  LYS A CE   4  
ATOM 5346  N NZ   . LYS A 1 23  ? 3.265   12.090  -6.049  1.00 0.00 ? 23  LYS A NZ   4  
ATOM 5347  H H    . LYS A 1 23  ? 6.978   9.536   -10.123 1.00 0.00 ? 23  LYS A H    4  
ATOM 5348  H HA   . LYS A 1 23  ? 6.247   12.371  -9.783  1.00 0.00 ? 23  LYS A HA   4  
ATOM 5349  H HB2  . LYS A 1 23  ? 7.375   10.356  -7.863  1.00 0.00 ? 23  LYS A HB2  4  
ATOM 5350  H HB3  . LYS A 1 23  ? 7.624   12.077  -7.599  1.00 0.00 ? 23  LYS A HB3  4  
ATOM 5351  H HG2  . LYS A 1 23  ? 5.052   12.236  -7.861  1.00 0.00 ? 23  LYS A HG2  4  
ATOM 5352  H HG3  . LYS A 1 23  ? 5.087   10.502  -7.533  1.00 0.00 ? 23  LYS A HG3  4  
ATOM 5353  H HD2  . LYS A 1 23  ? 5.778   10.787  -5.372  1.00 0.00 ? 23  LYS A HD2  4  
ATOM 5354  H HD3  . LYS A 1 23  ? 6.629   12.292  -5.729  1.00 0.00 ? 23  LYS A HD3  4  
ATOM 5355  H HE2  . LYS A 1 23  ? 4.449   12.367  -4.331  1.00 0.00 ? 23  LYS A HE2  4  
ATOM 5356  H HE3  . LYS A 1 23  ? 4.700   13.564  -5.601  1.00 0.00 ? 23  LYS A HE3  4  
ATOM 5357  H HZ1  . LYS A 1 23  ? 2.501   12.039  -5.345  1.00 0.00 ? 23  LYS A HZ1  4  
ATOM 5358  H HZ2  . LYS A 1 23  ? 3.384   11.153  -6.484  1.00 0.00 ? 23  LYS A HZ2  4  
ATOM 5359  H HZ3  . LYS A 1 23  ? 2.996   12.772  -6.787  1.00 0.00 ? 23  LYS A HZ3  4  
ATOM 5360  N N    . SER A 1 24  ? 8.442   13.237  -10.510 1.00 0.00 ? 24  SER A N    4  
ATOM 5361  C CA   . SER A 1 24  ? 9.710   13.757  -11.008 1.00 0.00 ? 24  SER A CA   4  
ATOM 5362  C C    . SER A 1 24  ? 10.825  13.532  -9.992  1.00 0.00 ? 24  SER A C    4  
ATOM 5363  O O    . SER A 1 24  ? 11.929  13.118  -10.347 1.00 0.00 ? 24  SER A O    4  
ATOM 5364  C CB   . SER A 1 24  ? 9.585   15.250  -11.322 1.00 0.00 ? 24  SER A CB   4  
ATOM 5365  O OG   . SER A 1 24  ? 10.859  15.836  -11.525 1.00 0.00 ? 24  SER A OG   4  
ATOM 5366  H H    . SER A 1 24  ? 7.651   13.817  -10.516 1.00 0.00 ? 24  SER A H    4  
ATOM 5367  H HA   . SER A 1 24  ? 9.953   13.226  -11.916 1.00 0.00 ? 24  SER A HA   4  
ATOM 5368  H HB2  . SER A 1 24  ? 8.996   15.378  -12.217 1.00 0.00 ? 24  SER A HB2  4  
ATOM 5369  H HB3  . SER A 1 24  ? 9.099   15.749  -10.496 1.00 0.00 ? 24  SER A HB3  4  
ATOM 5370  H HG   . SER A 1 24  ? 11.421  15.223  -12.004 1.00 0.00 ? 24  SER A HG   4  
ATOM 5371  N N    . ASP A 1 25  ? 10.529  13.807  -8.726  1.00 0.00 ? 25  ASP A N    4  
ATOM 5372  C CA   . ASP A 1 25  ? 11.505  13.633  -7.657  1.00 0.00 ? 25  ASP A CA   4  
ATOM 5373  C C    . ASP A 1 25  ? 10.947  12.745  -6.550  1.00 0.00 ? 25  ASP A C    4  
ATOM 5374  O O    . ASP A 1 25  ? 9.790   12.324  -6.600  1.00 0.00 ? 25  ASP A O    4  
ATOM 5375  C CB   . ASP A 1 25  ? 11.911  14.991  -7.082  1.00 0.00 ? 25  ASP A CB   4  
ATOM 5376  C CG   . ASP A 1 25  ? 12.939  15.700  -7.942  1.00 0.00 ? 25  ASP A CG   4  
ATOM 5377  O OD1  . ASP A 1 25  ? 14.036  15.137  -8.141  1.00 0.00 ? 25  ASP A OD1  4  
ATOM 5378  O OD2  . ASP A 1 25  ? 12.646  16.817  -8.417  1.00 0.00 ? 25  ASP A OD2  4  
ATOM 5379  H H    . ASP A 1 25  ? 9.631   14.133  -8.506  1.00 0.00 ? 25  ASP A H    4  
ATOM 5380  H HA   . ASP A 1 25  ? 12.377  13.156  -8.078  1.00 0.00 ? 25  ASP A HA   4  
ATOM 5381  H HB2  . ASP A 1 25  ? 11.035  15.620  -7.009  1.00 0.00 ? 25  ASP A HB2  4  
ATOM 5382  H HB3  . ASP A 1 25  ? 12.329  14.847  -6.097  1.00 0.00 ? 25  ASP A HB3  4  
ATOM 5383  N N    . THR A 1 26  ? 11.776  12.461  -5.550  1.00 0.00 ? 26  THR A N    4  
ATOM 5384  C CA   . THR A 1 26  ? 11.366  11.621  -4.432  1.00 0.00 ? 26  THR A CA   4  
ATOM 5385  C C    . THR A 1 26  ? 11.542  12.349  -3.104  1.00 0.00 ? 26  THR A C    4  
ATOM 5386  O O    . THR A 1 26  ? 10.567  12.771  -2.483  1.00 0.00 ? 26  THR A O    4  
ATOM 5387  C CB   . THR A 1 26  ? 12.168  10.306  -4.394  1.00 0.00 ? 26  THR A CB   4  
ATOM 5388  O OG1  . THR A 1 26  ? 13.570  10.589  -4.323  1.00 0.00 ? 26  THR A OG1  4  
ATOM 5389  C CG2  . THR A 1 26  ? 11.878  9.459   -5.624  1.00 0.00 ? 26  THR A CG2  4  
ATOM 5390  H H    . THR A 1 26  ? 12.685  12.826  -5.567  1.00 0.00 ? 26  THR A H    4  
ATOM 5391  H HA   . THR A 1 26  ? 10.322  11.378  -4.563  1.00 0.00 ? 26  THR A HA   4  
ATOM 5392  H HB   . THR A 1 26  ? 11.876  9.750   -3.515  1.00 0.00 ? 26  THR A HB   4  
ATOM 5393  H HG1  . THR A 1 26  ? 14.068  9.789   -4.507  1.00 0.00 ? 26  THR A HG1  4  
ATOM 5394  H HG21 . THR A 1 26  ? 11.096  9.925   -6.205  1.00 0.00 ? 26  THR A HG21 4  
ATOM 5395  H HG22 . THR A 1 26  ? 11.559  8.475   -5.316  1.00 0.00 ? 26  THR A HG22 4  
ATOM 5396  H HG23 . THR A 1 26  ? 12.771  9.378   -6.224  1.00 0.00 ? 26  THR A HG23 4  
ATOM 5397  N N    . ALA A 1 27  ? 12.791  12.493  -2.675  1.00 0.00 ? 27  ALA A N    4  
ATOM 5398  C CA   . ALA A 1 27  ? 13.095  13.173  -1.421  1.00 0.00 ? 27  ALA A CA   4  
ATOM 5399  C C    . ALA A 1 27  ? 12.280  14.454  -1.281  1.00 0.00 ? 27  ALA A C    4  
ATOM 5400  O O    . ALA A 1 27  ? 12.006  14.908  -0.170  1.00 0.00 ? 27  ALA A O    4  
ATOM 5401  C CB   . ALA A 1 27  ? 14.583  13.478  -1.333  1.00 0.00 ? 27  ALA A CB   4  
ATOM 5402  H H    . ALA A 1 27  ? 13.527  12.135  -3.214  1.00 0.00 ? 27  ALA A H    4  
ATOM 5403  H HA   . ALA A 1 27  ? 12.840  12.506  -0.610  1.00 0.00 ? 27  ALA A HA   4  
ATOM 5404  H HB1  . ALA A 1 27  ? 14.844  13.698  -0.308  1.00 0.00 ? 27  ALA A HB1  4  
ATOM 5405  H HB2  . ALA A 1 27  ? 15.146  12.622  -1.673  1.00 0.00 ? 27  ALA A HB2  4  
ATOM 5406  H HB3  . ALA A 1 27  ? 14.812  14.331  -1.955  1.00 0.00 ? 27  ALA A HB3  4  
ATOM 5407  N N    . ALA A 1 28  ? 11.897  15.033  -2.414  1.00 0.00 ? 28  ALA A N    4  
ATOM 5408  C CA   . ALA A 1 28  ? 11.113  16.262  -2.417  1.00 0.00 ? 28  ALA A CA   4  
ATOM 5409  C C    . ALA A 1 28  ? 9.628   15.966  -2.597  1.00 0.00 ? 28  ALA A C    4  
ATOM 5410  O O    . ALA A 1 28  ? 8.802   16.364  -1.777  1.00 0.00 ? 28  ALA A O    4  
ATOM 5411  C CB   . ALA A 1 28  ? 11.603  17.199  -3.511  1.00 0.00 ? 28  ALA A CB   4  
ATOM 5412  H H    . ALA A 1 28  ? 12.147  14.624  -3.268  1.00 0.00 ? 28  ALA A H    4  
ATOM 5413  H HA   . ALA A 1 28  ? 11.259  16.753  -1.465  1.00 0.00 ? 28  ALA A HA   4  
ATOM 5414  H HB1  . ALA A 1 28  ? 11.635  16.667  -4.451  1.00 0.00 ? 28  ALA A HB1  4  
ATOM 5415  H HB2  . ALA A 1 28  ? 10.930  18.038  -3.595  1.00 0.00 ? 28  ALA A HB2  4  
ATOM 5416  H HB3  . ALA A 1 28  ? 12.593  17.553  -3.264  1.00 0.00 ? 28  ALA A HB3  4  
ATOM 5417  N N    . ASP A 1 29  ? 9.297   15.265  -3.676  1.00 0.00 ? 29  ASP A N    4  
ATOM 5418  C CA   . ASP A 1 29  ? 7.911   14.914  -3.964  1.00 0.00 ? 29  ASP A CA   4  
ATOM 5419  C C    . ASP A 1 29  ? 7.546   13.575  -3.332  1.00 0.00 ? 29  ASP A C    4  
ATOM 5420  O O    . ASP A 1 29  ? 8.238   12.575  -3.527  1.00 0.00 ? 29  ASP A O    4  
ATOM 5421  C CB   . ASP A 1 29  ? 7.680   14.859  -5.475  1.00 0.00 ? 29  ASP A CB   4  
ATOM 5422  C CG   . ASP A 1 29  ? 7.544   16.238  -6.091  1.00 0.00 ? 29  ASP A CG   4  
ATOM 5423  O OD1  . ASP A 1 29  ? 6.622   16.979  -5.691  1.00 0.00 ? 29  ASP A OD1  4  
ATOM 5424  O OD2  . ASP A 1 29  ? 8.361   16.577  -6.973  1.00 0.00 ? 29  ASP A OD2  4  
ATOM 5425  H H    . ASP A 1 29  ? 10.002  14.975  -4.293  1.00 0.00 ? 29  ASP A H    4  
ATOM 5426  H HA   . ASP A 1 29  ? 7.280   15.681  -3.541  1.00 0.00 ? 29  ASP A HA   4  
ATOM 5427  H HB2  . ASP A 1 29  ? 8.516   14.358  -5.943  1.00 0.00 ? 29  ASP A HB2  4  
ATOM 5428  H HB3  . ASP A 1 29  ? 6.775   14.304  -5.675  1.00 0.00 ? 29  ASP A HB3  4  
ATOM 5429  N N    . THR A 1 30  ? 6.455   13.562  -2.573  1.00 0.00 ? 30  THR A N    4  
ATOM 5430  C CA   . THR A 1 30  ? 6.000   12.346  -1.910  1.00 0.00 ? 30  THR A CA   4  
ATOM 5431  C C    . THR A 1 30  ? 4.483   12.217  -1.980  1.00 0.00 ? 30  THR A C    4  
ATOM 5432  O O    . THR A 1 30  ? 3.754   13.129  -1.590  1.00 0.00 ? 30  THR A O    4  
ATOM 5433  C CB   . THR A 1 30  ? 6.439   12.313  -0.434  1.00 0.00 ? 30  THR A CB   4  
ATOM 5434  O OG1  . THR A 1 30  ? 6.517   13.646  0.084   1.00 0.00 ? 30  THR A OG1  4  
ATOM 5435  C CG2  . THR A 1 30  ? 7.788   11.626  -0.286  1.00 0.00 ? 30  THR A CG2  4  
ATOM 5436  H H    . THR A 1 30  ? 5.946   14.391  -2.456  1.00 0.00 ? 30  THR A H    4  
ATOM 5437  H HA   . THR A 1 30  ? 6.447   11.503  -2.416  1.00 0.00 ? 30  THR A HA   4  
ATOM 5438  H HB   . THR A 1 30  ? 5.704   11.758  0.132   1.00 0.00 ? 30  THR A HB   4  
ATOM 5439  H HG1  . THR A 1 30  ? 7.141   13.670  0.814   1.00 0.00 ? 30  THR A HG1  4  
ATOM 5440  H HG21 . THR A 1 30  ? 7.940   11.350  0.747   1.00 0.00 ? 30  THR A HG21 4  
ATOM 5441  H HG22 . THR A 1 30  ? 8.571   12.300  -0.598  1.00 0.00 ? 30  THR A HG22 4  
ATOM 5442  H HG23 . THR A 1 30  ? 7.809   10.739  -0.901  1.00 0.00 ? 30  THR A HG23 4  
ATOM 5443  N N    . TYR A 1 31  ? 4.013   11.080  -2.480  1.00 0.00 ? 31  TYR A N    4  
ATOM 5444  C CA   . TYR A 1 31  ? 2.581   10.832  -2.603  1.00 0.00 ? 31  TYR A CA   4  
ATOM 5445  C C    . TYR A 1 31  ? 1.845   11.256  -1.336  1.00 0.00 ? 31  TYR A C    4  
ATOM 5446  O O    . TYR A 1 31  ? 2.462   11.549  -0.313  1.00 0.00 ? 31  TYR A O    4  
ATOM 5447  C CB   . TYR A 1 31  ? 2.321   9.352   -2.887  1.00 0.00 ? 31  TYR A CB   4  
ATOM 5448  C CG   . TYR A 1 31  ? 3.124   8.807   -4.046  1.00 0.00 ? 31  TYR A CG   4  
ATOM 5449  C CD1  . TYR A 1 31  ? 2.916   9.270   -5.340  1.00 0.00 ? 31  TYR A CD1  4  
ATOM 5450  C CD2  . TYR A 1 31  ? 4.092   7.830   -3.848  1.00 0.00 ? 31  TYR A CD2  4  
ATOM 5451  C CE1  . TYR A 1 31  ? 3.646   8.774   -6.402  1.00 0.00 ? 31  TYR A CE1  4  
ATOM 5452  C CE2  . TYR A 1 31  ? 4.828   7.330   -4.904  1.00 0.00 ? 31  TYR A CE2  4  
ATOM 5453  C CZ   . TYR A 1 31  ? 4.602   7.805   -6.179  1.00 0.00 ? 31  TYR A CZ   4  
ATOM 5454  O OH   . TYR A 1 31  ? 5.333   7.309   -7.235  1.00 0.00 ? 31  TYR A OH   4  
ATOM 5455  H H    . TYR A 1 31  ? 4.644   10.390  -2.775  1.00 0.00 ? 31  TYR A H    4  
ATOM 5456  H HA   . TYR A 1 31  ? 2.214   11.418  -3.433  1.00 0.00 ? 31  TYR A HA   4  
ATOM 5457  H HB2  . TYR A 1 31  ? 2.572   8.775   -2.010  1.00 0.00 ? 31  TYR A HB2  4  
ATOM 5458  H HB3  . TYR A 1 31  ? 1.274   9.215   -3.114  1.00 0.00 ? 31  TYR A HB3  4  
ATOM 5459  H HD1  . TYR A 1 31  ? 2.167   10.030  -5.510  1.00 0.00 ? 31  TYR A HD1  4  
ATOM 5460  H HD2  . TYR A 1 31  ? 4.267   7.460   -2.848  1.00 0.00 ? 31  TYR A HD2  4  
ATOM 5461  H HE1  . TYR A 1 31  ? 3.469   9.147   -7.400  1.00 0.00 ? 31  TYR A HE1  4  
ATOM 5462  H HE2  . TYR A 1 31  ? 5.576   6.570   -4.731  1.00 0.00 ? 31  TYR A HE2  4  
ATOM 5463  H HH   . TYR A 1 31  ? 6.252   7.221   -6.973  1.00 0.00 ? 31  TYR A HH   4  
ATOM 5464  N N    . GLY A 1 32  ? 0.517   11.286  -1.413  1.00 0.00 ? 32  GLY A N    4  
ATOM 5465  C CA   . GLY A 1 32  ? -0.284  11.675  -0.267  1.00 0.00 ? 32  GLY A CA   4  
ATOM 5466  C C    . GLY A 1 32  ? -1.428  10.716  -0.008  1.00 0.00 ? 32  GLY A C    4  
ATOM 5467  O O    . GLY A 1 32  ? -2.321  11.004  0.790   1.00 0.00 ? 32  GLY A O    4  
ATOM 5468  H H    . GLY A 1 32  ? 0.079   11.043  -2.255  1.00 0.00 ? 32  GLY A H    4  
ATOM 5469  H HA2  . GLY A 1 32  ? 0.350   11.707  0.607   1.00 0.00 ? 32  GLY A HA2  4  
ATOM 5470  H HA3  . GLY A 1 32  ? -0.688  12.661  -0.443  1.00 0.00 ? 32  GLY A HA3  4  
ATOM 5471  N N    . PHE A 1 33  ? -1.405  9.572   -0.685  1.00 0.00 ? 33  PHE A N    4  
ATOM 5472  C CA   . PHE A 1 33  ? -2.451  8.568   -0.526  1.00 0.00 ? 33  PHE A CA   4  
ATOM 5473  C C    . PHE A 1 33  ? -1.956  7.397   0.318   1.00 0.00 ? 33  PHE A C    4  
ATOM 5474  O O    . PHE A 1 33  ? -0.797  6.994   0.222   1.00 0.00 ? 33  PHE A O    4  
ATOM 5475  C CB   . PHE A 1 33  ? -2.916  8.065   -1.894  1.00 0.00 ? 33  PHE A CB   4  
ATOM 5476  C CG   . PHE A 1 33  ? -2.138  6.883   -2.395  1.00 0.00 ? 33  PHE A CG   4  
ATOM 5477  C CD1  . PHE A 1 33  ? -0.780  6.989   -2.652  1.00 0.00 ? 33  PHE A CD1  4  
ATOM 5478  C CD2  . PHE A 1 33  ? -2.763  5.664   -2.607  1.00 0.00 ? 33  PHE A CD2  4  
ATOM 5479  C CE1  . PHE A 1 33  ? -0.062  5.903   -3.114  1.00 0.00 ? 33  PHE A CE1  4  
ATOM 5480  C CE2  . PHE A 1 33  ? -2.049  4.574   -3.068  1.00 0.00 ? 33  PHE A CE2  4  
ATOM 5481  C CZ   . PHE A 1 33  ? -0.696  4.693   -3.321  1.00 0.00 ? 33  PHE A CZ   4  
ATOM 5482  H H    . PHE A 1 33  ? -0.667  9.400   -1.307  1.00 0.00 ? 33  PHE A H    4  
ATOM 5483  H HA   . PHE A 1 33  ? -3.283  9.034   -0.021  1.00 0.00 ? 33  PHE A HA   4  
ATOM 5484  H HB2  . PHE A 1 33  ? -3.954  7.775   -1.828  1.00 0.00 ? 33  PHE A HB2  4  
ATOM 5485  H HB3  . PHE A 1 33  ? -2.814  8.861   -2.616  1.00 0.00 ? 33  PHE A HB3  4  
ATOM 5486  H HD1  . PHE A 1 33  ? -0.282  7.934   -2.490  1.00 0.00 ? 33  PHE A HD1  4  
ATOM 5487  H HD2  . PHE A 1 33  ? -3.821  5.570   -2.409  1.00 0.00 ? 33  PHE A HD2  4  
ATOM 5488  H HE1  . PHE A 1 33  ? 0.996   5.998   -3.311  1.00 0.00 ? 33  PHE A HE1  4  
ATOM 5489  H HE2  . PHE A 1 33  ? -2.549  3.630   -3.229  1.00 0.00 ? 33  PHE A HE2  4  
ATOM 5490  H HZ   . PHE A 1 33  ? -0.137  3.843   -3.682  1.00 0.00 ? 33  PHE A HZ   4  
ATOM 5491  N N    . SER A 1 34  ? -2.844  6.855   1.145   1.00 0.00 ? 34  SER A N    4  
ATOM 5492  C CA   . SER A 1 34  ? -2.498  5.733   2.010   1.00 0.00 ? 34  SER A CA   4  
ATOM 5493  C C    . SER A 1 34  ? -3.314  4.496   1.647   1.00 0.00 ? 34  SER A C    4  
ATOM 5494  O O    . SER A 1 34  ? -4.222  4.558   0.817   1.00 0.00 ? 34  SER A O    4  
ATOM 5495  C CB   . SER A 1 34  ? -2.733  6.100   3.476   1.00 0.00 ? 34  SER A CB   4  
ATOM 5496  O OG   . SER A 1 34  ? -1.828  7.105   3.901   1.00 0.00 ? 34  SER A OG   4  
ATOM 5497  H H    . SER A 1 34  ? -3.753  7.221   1.177   1.00 0.00 ? 34  SER A H    4  
ATOM 5498  H HA   . SER A 1 34  ? -1.451  5.514   1.865   1.00 0.00 ? 34  SER A HA   4  
ATOM 5499  H HB2  . SER A 1 34  ? -3.741  6.467   3.596   1.00 0.00 ? 34  SER A HB2  4  
ATOM 5500  H HB3  . SER A 1 34  ? -2.593  5.223   4.091   1.00 0.00 ? 34  SER A HB3  4  
ATOM 5501  H HG   . SER A 1 34  ? -2.297  7.936   4.002   1.00 0.00 ? 34  SER A HG   4  
ATOM 5502  N N    . LEU A 1 35  ? -2.985  3.373   2.275   1.00 0.00 ? 35  LEU A N    4  
ATOM 5503  C CA   . LEU A 1 35  ? -3.686  2.119   2.020   1.00 0.00 ? 35  LEU A CA   4  
ATOM 5504  C C    . LEU A 1 35  ? -3.950  1.368   3.321   1.00 0.00 ? 35  LEU A C    4  
ATOM 5505  O O    . LEU A 1 35  ? -3.112  1.355   4.222   1.00 0.00 ? 35  LEU A O    4  
ATOM 5506  C CB   . LEU A 1 35  ? -2.872  1.242   1.067   1.00 0.00 ? 35  LEU A CB   4  
ATOM 5507  C CG   . LEU A 1 35  ? -2.577  1.839   -0.309  1.00 0.00 ? 35  LEU A CG   4  
ATOM 5508  C CD1  . LEU A 1 35  ? -1.535  1.007   -1.040  1.00 0.00 ? 35  LEU A CD1  4  
ATOM 5509  C CD2  . LEU A 1 35  ? -3.853  1.940   -1.131  1.00 0.00 ? 35  LEU A CD2  4  
ATOM 5510  H H    . LEU A 1 35  ? -2.253  3.385   2.926   1.00 0.00 ? 35  LEU A H    4  
ATOM 5511  H HA   . LEU A 1 35  ? -4.632  2.357   1.557   1.00 0.00 ? 35  LEU A HA   4  
ATOM 5512  H HB2  . LEU A 1 35  ? -1.928  1.025   1.543   1.00 0.00 ? 35  LEU A HB2  4  
ATOM 5513  H HB3  . LEU A 1 35  ? -3.419  0.321   0.919   1.00 0.00 ? 35  LEU A HB3  4  
ATOM 5514  H HG   . LEU A 1 35  ? -2.179  2.837   -0.183  1.00 0.00 ? 35  LEU A HG   4  
ATOM 5515  H HD11 . LEU A 1 35  ? -1.363  1.425   -2.020  1.00 0.00 ? 35  LEU A HD11 4  
ATOM 5516  H HD12 . LEU A 1 35  ? -1.889  -0.008  -1.139  1.00 0.00 ? 35  LEU A HD12 4  
ATOM 5517  H HD13 . LEU A 1 35  ? -0.612  1.013   -0.478  1.00 0.00 ? 35  LEU A HD13 4  
ATOM 5518  H HD21 . LEU A 1 35  ? -3.895  1.119   -1.832  1.00 0.00 ? 35  LEU A HD21 4  
ATOM 5519  H HD22 . LEU A 1 35  ? -3.860  2.876   -1.672  1.00 0.00 ? 35  LEU A HD22 4  
ATOM 5520  H HD23 . LEU A 1 35  ? -4.709  1.897   -0.474  1.00 0.00 ? 35  LEU A HD23 4  
ATOM 5521  N N    . SER A 1 36  ? -5.120  0.743   3.410   1.00 0.00 ? 36  SER A N    4  
ATOM 5522  C CA   . SER A 1 36  ? -5.495  -0.010  4.602   1.00 0.00 ? 36  SER A CA   4  
ATOM 5523  C C    . SER A 1 36  ? -5.717  -1.481  4.267   1.00 0.00 ? 36  SER A C    4  
ATOM 5524  O O    . SER A 1 36  ? -6.415  -1.813  3.309   1.00 0.00 ? 36  SER A O    4  
ATOM 5525  C CB   . SER A 1 36  ? -6.762  0.580   5.225   1.00 0.00 ? 36  SER A CB   4  
ATOM 5526  O OG   . SER A 1 36  ? -7.106  -0.099  6.420   1.00 0.00 ? 36  SER A OG   4  
ATOM 5527  H H    . SER A 1 36  ? -5.746  0.791   2.658   1.00 0.00 ? 36  SER A H    4  
ATOM 5528  H HA   . SER A 1 36  ? -4.685  0.068   5.312   1.00 0.00 ? 36  SER A HA   4  
ATOM 5529  H HB2  . SER A 1 36  ? -6.597  1.622   5.452   1.00 0.00 ? 36  SER A HB2  4  
ATOM 5530  H HB3  . SER A 1 36  ? -7.580  0.489   4.525   1.00 0.00 ? 36  SER A HB3  4  
ATOM 5531  H HG   . SER A 1 36  ? -7.926  -0.581  6.290   1.00 0.00 ? 36  SER A HG   4  
ATOM 5532  N N    . SER A 1 37  ? -5.118  -2.360  5.065   1.00 0.00 ? 37  SER A N    4  
ATOM 5533  C CA   . SER A 1 37  ? -5.246  -3.797  4.852   1.00 0.00 ? 37  SER A CA   4  
ATOM 5534  C C    . SER A 1 37  ? -6.408  -4.364  5.661   1.00 0.00 ? 37  SER A C    4  
ATOM 5535  O O    . SER A 1 37  ? -6.501  -4.151  6.870   1.00 0.00 ? 37  SER A O    4  
ATOM 5536  C CB   . SER A 1 37  ? -3.947  -4.508  5.237   1.00 0.00 ? 37  SER A CB   4  
ATOM 5537  O OG   . SER A 1 37  ? -2.824  -3.867  4.658   1.00 0.00 ? 37  SER A OG   4  
ATOM 5538  H H    . SER A 1 37  ? -4.575  -2.033  5.813   1.00 0.00 ? 37  SER A H    4  
ATOM 5539  H HA   . SER A 1 37  ? -5.439  -3.961  3.803   1.00 0.00 ? 37  SER A HA   4  
ATOM 5540  H HB2  . SER A 1 37  ? -3.839  -4.498  6.311   1.00 0.00 ? 37  SER A HB2  4  
ATOM 5541  H HB3  . SER A 1 37  ? -3.983  -5.530  4.888   1.00 0.00 ? 37  SER A HB3  4  
ATOM 5542  H HG   . SER A 1 37  ? -2.762  -2.968  4.990   1.00 0.00 ? 37  SER A HG   4  
ATOM 5543  N N    . VAL A 1 38  ? -7.294  -5.088  4.984   1.00 0.00 ? 38  VAL A N    4  
ATOM 5544  C CA   . VAL A 1 38  ? -8.451  -5.688  5.638   1.00 0.00 ? 38  VAL A CA   4  
ATOM 5545  C C    . VAL A 1 38  ? -8.562  -7.172  5.307   1.00 0.00 ? 38  VAL A C    4  
ATOM 5546  O O    . VAL A 1 38  ? -8.720  -7.548  4.147   1.00 0.00 ? 38  VAL A O    4  
ATOM 5547  C CB   . VAL A 1 38  ? -9.757  -4.982  5.227   1.00 0.00 ? 38  VAL A CB   4  
ATOM 5548  C CG1  . VAL A 1 38  ? -10.944 -5.585  5.962   1.00 0.00 ? 38  VAL A CG1  4  
ATOM 5549  C CG2  . VAL A 1 38  ? -9.660  -3.487  5.489   1.00 0.00 ? 38  VAL A CG2  4  
ATOM 5550  H H    . VAL A 1 38  ? -7.166  -5.223  4.022   1.00 0.00 ? 38  VAL A H    4  
ATOM 5551  H HA   . VAL A 1 38  ? -8.327  -5.575  6.706   1.00 0.00 ? 38  VAL A HA   4  
ATOM 5552  H HB   . VAL A 1 38  ? -9.904  -5.132  4.167   1.00 0.00 ? 38  VAL A HB   4  
ATOM 5553  H HG11 . VAL A 1 38  ? -11.525 -4.796  6.416   1.00 0.00 ? 38  VAL A HG11 4  
ATOM 5554  H HG12 . VAL A 1 38  ? -11.562 -6.131  5.263   1.00 0.00 ? 38  VAL A HG12 4  
ATOM 5555  H HG13 . VAL A 1 38  ? -10.589 -6.257  6.729   1.00 0.00 ? 38  VAL A HG13 4  
ATOM 5556  H HG21 . VAL A 1 38  ? -9.053  -3.027  4.724   1.00 0.00 ? 38  VAL A HG21 4  
ATOM 5557  H HG22 . VAL A 1 38  ? -10.650 -3.054  5.473   1.00 0.00 ? 38  VAL A HG22 4  
ATOM 5558  H HG23 . VAL A 1 38  ? -9.210  -3.320  6.456   1.00 0.00 ? 38  VAL A HG23 4  
ATOM 5559  N N    . GLU A 1 39  ? -8.478  -8.010  6.336   1.00 0.00 ? 39  GLU A N    4  
ATOM 5560  C CA   . GLU A 1 39  ? -8.568  -9.454  6.153   1.00 0.00 ? 39  GLU A CA   4  
ATOM 5561  C C    . GLU A 1 39  ? -10.021 -9.917  6.191   1.00 0.00 ? 39  GLU A C    4  
ATOM 5562  O O    . GLU A 1 39  ? -10.694 -9.799  7.214   1.00 0.00 ? 39  GLU A O    4  
ATOM 5563  C CB   . GLU A 1 39  ? -7.762  -10.178 7.233   1.00 0.00 ? 39  GLU A CB   4  
ATOM 5564  C CG   . GLU A 1 39  ? -7.207  -11.519 6.782   1.00 0.00 ? 39  GLU A CG   4  
ATOM 5565  C CD   . GLU A 1 39  ? -7.023  -12.490 7.932   1.00 0.00 ? 39  GLU A CD   4  
ATOM 5566  O OE1  . GLU A 1 39  ? -6.410  -12.098 8.947   1.00 0.00 ? 39  GLU A OE1  4  
ATOM 5567  O OE2  . GLU A 1 39  ? -7.490  -13.642 7.817   1.00 0.00 ? 39  GLU A OE2  4  
ATOM 5568  H H    . GLU A 1 39  ? -8.351  -7.649  7.238   1.00 0.00 ? 39  GLU A H    4  
ATOM 5569  H HA   . GLU A 1 39  ? -8.152  -9.692  5.186   1.00 0.00 ? 39  GLU A HA   4  
ATOM 5570  H HB2  . GLU A 1 39  ? -6.935  -9.551  7.530   1.00 0.00 ? 39  GLU A HB2  4  
ATOM 5571  H HB3  . GLU A 1 39  ? -8.400  -10.346 8.089   1.00 0.00 ? 39  GLU A HB3  4  
ATOM 5572  H HG2  . GLU A 1 39  ? -7.890  -11.955 6.069   1.00 0.00 ? 39  GLU A HG2  4  
ATOM 5573  H HG3  . GLU A 1 39  ? -6.250  -11.357 6.310   1.00 0.00 ? 39  GLU A HG3  4  
ATOM 5574  N N    . GLU A 1 40  ? -10.498 -10.444 5.067   1.00 0.00 ? 40  GLU A N    4  
ATOM 5575  C CA   . GLU A 1 40  ? -11.872 -10.923 4.972   1.00 0.00 ? 40  GLU A CA   4  
ATOM 5576  C C    . GLU A 1 40  ? -11.912 -12.446 4.886   1.00 0.00 ? 40  GLU A C    4  
ATOM 5577  O O    . GLU A 1 40  ? -11.705 -13.024 3.818   1.00 0.00 ? 40  GLU A O    4  
ATOM 5578  C CB   . GLU A 1 40  ? -12.564 -10.314 3.750   1.00 0.00 ? 40  GLU A CB   4  
ATOM 5579  C CG   . GLU A 1 40  ? -14.067 -10.165 3.914   1.00 0.00 ? 40  GLU A CG   4  
ATOM 5580  C CD   . GLU A 1 40  ? -14.782 -9.968  2.592   1.00 0.00 ? 40  GLU A CD   4  
ATOM 5581  O OE1  . GLU A 1 40  ? -14.682 -10.860 1.724   1.00 0.00 ? 40  GLU A OE1  4  
ATOM 5582  O OE2  . GLU A 1 40  ? -15.442 -8.920  2.425   1.00 0.00 ? 40  GLU A OE2  4  
ATOM 5583  H H    . GLU A 1 40  ? -9.912  -10.511 4.284   1.00 0.00 ? 40  GLU A H    4  
ATOM 5584  H HA   . GLU A 1 40  ? -12.395 -10.611 5.863   1.00 0.00 ? 40  GLU A HA   4  
ATOM 5585  H HB2  . GLU A 1 40  ? -12.144 -9.337  3.563   1.00 0.00 ? 40  GLU A HB2  4  
ATOM 5586  H HB3  . GLU A 1 40  ? -12.378 -10.946 2.894   1.00 0.00 ? 40  GLU A HB3  4  
ATOM 5587  H HG2  . GLU A 1 40  ? -14.455 -11.056 4.386   1.00 0.00 ? 40  GLU A HG2  4  
ATOM 5588  H HG3  . GLU A 1 40  ? -14.265 -9.310  4.545   1.00 0.00 ? 40  GLU A HG3  4  
ATOM 5589  N N    . ASP A 1 41  ? -12.178 -13.090 6.017   1.00 0.00 ? 41  ASP A N    4  
ATOM 5590  C CA   . ASP A 1 41  ? -12.246 -14.546 6.071   1.00 0.00 ? 41  ASP A CA   4  
ATOM 5591  C C    . ASP A 1 41  ? -11.003 -15.171 5.446   1.00 0.00 ? 41  ASP A C    4  
ATOM 5592  O O    . ASP A 1 41  ? -11.097 -16.117 4.665   1.00 0.00 ? 41  ASP A O    4  
ATOM 5593  C CB   . ASP A 1 41  ? -13.500 -15.046 5.352   1.00 0.00 ? 41  ASP A CB   4  
ATOM 5594  C CG   . ASP A 1 41  ? -13.855 -16.471 5.730   1.00 0.00 ? 41  ASP A CG   4  
ATOM 5595  O OD1  . ASP A 1 41  ? -13.925 -16.763 6.942   1.00 0.00 ? 41  ASP A OD1  4  
ATOM 5596  O OD2  . ASP A 1 41  ? -14.062 -17.293 4.814   1.00 0.00 ? 41  ASP A OD2  4  
ATOM 5597  H H    . ASP A 1 41  ? -12.334 -12.573 6.835   1.00 0.00 ? 41  ASP A H    4  
ATOM 5598  H HA   . ASP A 1 41  ? -12.297 -14.837 7.109   1.00 0.00 ? 41  ASP A HA   4  
ATOM 5599  H HB2  . ASP A 1 41  ? -14.333 -14.408 5.608   1.00 0.00 ? 41  ASP A HB2  4  
ATOM 5600  H HB3  . ASP A 1 41  ? -13.336 -15.006 4.285   1.00 0.00 ? 41  ASP A HB3  4  
ATOM 5601  N N    . GLY A 1 42  ? -9.837  -14.634 5.795   1.00 0.00 ? 42  GLY A N    4  
ATOM 5602  C CA   . GLY A 1 42  ? -8.592  -15.151 5.258   1.00 0.00 ? 42  GLY A CA   4  
ATOM 5603  C C    . GLY A 1 42  ? -8.164  -14.435 3.992   1.00 0.00 ? 42  GLY A C    4  
ATOM 5604  O O    . GLY A 1 42  ? -6.974  -14.362 3.685   1.00 0.00 ? 42  GLY A O    4  
ATOM 5605  H H    . GLY A 1 42  ? -9.823  -13.880 6.421   1.00 0.00 ? 42  GLY A H    4  
ATOM 5606  H HA2  . GLY A 1 42  ? -7.818  -15.039 6.002   1.00 0.00 ? 42  GLY A HA2  4  
ATOM 5607  H HA3  . GLY A 1 42  ? -8.717  -16.201 5.038   1.00 0.00 ? 42  GLY A HA3  4  
ATOM 5608  N N    . ILE A 1 43  ? -9.136  -13.906 3.256   1.00 0.00 ? 43  ILE A N    4  
ATOM 5609  C CA   . ILE A 1 43  ? -8.853  -13.193 2.017   1.00 0.00 ? 43  ILE A CA   4  
ATOM 5610  C C    . ILE A 1 43  ? -8.403  -11.763 2.296   1.00 0.00 ? 43  ILE A C    4  
ATOM 5611  O O    . ILE A 1 43  ? -9.218  -10.895 2.607   1.00 0.00 ? 43  ILE A O    4  
ATOM 5612  C CB   . ILE A 1 43  ? -10.085 -13.161 1.093   1.00 0.00 ? 43  ILE A CB   4  
ATOM 5613  C CG1  . ILE A 1 43  ? -10.514 -14.583 0.728   1.00 0.00 ? 43  ILE A CG1  4  
ATOM 5614  C CG2  . ILE A 1 43  ? -9.784  -12.355 -0.162  1.00 0.00 ? 43  ILE A CG2  4  
ATOM 5615  C CD1  . ILE A 1 43  ? -11.946 -14.678 0.250   1.00 0.00 ? 43  ILE A CD1  4  
ATOM 5616  H H    . ILE A 1 43  ? -10.065 -13.998 3.554   1.00 0.00 ? 43  ILE A H    4  
ATOM 5617  H HA   . ILE A 1 43  ? -8.058  -13.717 1.506   1.00 0.00 ? 43  ILE A HA   4  
ATOM 5618  H HB   . ILE A 1 43  ? -10.890 -12.673 1.620   1.00 0.00 ? 43  ILE A HB   4  
ATOM 5619  H HG12 . ILE A 1 43  ? -9.877  -14.955 -0.058  1.00 0.00 ? 43  ILE A HG12 4  
ATOM 5620  H HG13 . ILE A 1 43  ? -10.411 -15.216 1.598   1.00 0.00 ? 43  ILE A HG13 4  
ATOM 5621  H HG21 . ILE A 1 43  ? -8.752  -12.036 -0.146  1.00 0.00 ? 43  ILE A HG21 4  
ATOM 5622  H HG22 . ILE A 1 43  ? -9.957  -12.968 -1.034  1.00 0.00 ? 43  ILE A HG22 4  
ATOM 5623  H HG23 . ILE A 1 43  ? -10.428 -11.489 -0.197  1.00 0.00 ? 43  ILE A HG23 4  
ATOM 5624  H HD11 . ILE A 1 43  ? -12.295 -15.695 0.356   1.00 0.00 ? 43  ILE A HD11 4  
ATOM 5625  H HD12 . ILE A 1 43  ? -12.567 -14.021 0.839   1.00 0.00 ? 43  ILE A HD12 4  
ATOM 5626  H HD13 . ILE A 1 43  ? -11.998 -14.387 -0.789  1.00 0.00 ? 43  ILE A HD13 4  
ATOM 5627  N N    . ARG A 1 44  ? -7.101  -11.526 2.181   1.00 0.00 ? 44  ARG A N    4  
ATOM 5628  C CA   . ARG A 1 44  ? -6.541  -10.201 2.420   1.00 0.00 ? 44  ARG A CA   4  
ATOM 5629  C C    . ARG A 1 44  ? -6.870  -9.256  1.268   1.00 0.00 ? 44  ARG A C    4  
ATOM 5630  O O    . ARG A 1 44  ? -6.804  -9.639  0.100   1.00 0.00 ? 44  ARG A O    4  
ATOM 5631  C CB   . ARG A 1 44  ? -5.025  -10.290 2.605   1.00 0.00 ? 44  ARG A CB   4  
ATOM 5632  C CG   . ARG A 1 44  ? -4.459  -9.214  3.517   1.00 0.00 ? 44  ARG A CG   4  
ATOM 5633  C CD   . ARG A 1 44  ? -3.014  -8.892  3.169   1.00 0.00 ? 44  ARG A CD   4  
ATOM 5634  N NE   . ARG A 1 44  ? -2.448  -7.882  4.060   1.00 0.00 ? 44  ARG A NE   4  
ATOM 5635  C CZ   . ARG A 1 44  ? -1.151  -7.607  4.128   1.00 0.00 ? 44  ARG A CZ   4  
ATOM 5636  N NH1  . ARG A 1 44  ? -0.289  -8.262  3.362   1.00 0.00 ? 44  ARG A NH1  4  
ATOM 5637  N NH2  . ARG A 1 44  ? -0.712  -6.674  4.964   1.00 0.00 ? 44  ARG A NH2  4  
ATOM 5638  H H    . ARG A 1 44  ? -6.501  -12.259 1.930   1.00 0.00 ? 44  ARG A H    4  
ATOM 5639  H HA   . ARG A 1 44  ? -6.983  -9.813  3.326   1.00 0.00 ? 44  ARG A HA   4  
ATOM 5640  H HB2  . ARG A 1 44  ? -4.781  -11.253 3.028   1.00 0.00 ? 44  ARG A HB2  4  
ATOM 5641  H HB3  . ARG A 1 44  ? -4.551  -10.198 1.640   1.00 0.00 ? 44  ARG A HB3  4  
ATOM 5642  H HG2  . ARG A 1 44  ? -5.051  -8.317  3.411   1.00 0.00 ? 44  ARG A HG2  4  
ATOM 5643  H HG3  . ARG A 1 44  ? -4.506  -9.560  4.539   1.00 0.00 ? 44  ARG A HG3  4  
ATOM 5644  H HD2  . ARG A 1 44  ? -2.429  -9.796  3.248   1.00 0.00 ? 44  ARG A HD2  4  
ATOM 5645  H HD3  . ARG A 1 44  ? -2.975  -8.526  2.154   1.00 0.00 ? 44  ARG A HD3  4  
ATOM 5646  H HE   . ARG A 1 44  ? -3.067  -7.386  4.634   1.00 0.00 ? 44  ARG A HE   4  
ATOM 5647  H HH11 . ARG A 1 44  ? -0.617  -8.965  2.731   1.00 0.00 ? 44  ARG A HH11 4  
ATOM 5648  H HH12 . ARG A 1 44  ? 0.687   -8.052  3.415   1.00 0.00 ? 44  ARG A HH12 4  
ATOM 5649  H HH21 . ARG A 1 44  ? -1.359  -6.177  5.542   1.00 0.00 ? 44  ARG A HH21 4  
ATOM 5650  H HH22 . ARG A 1 44  ? 0.264   -6.467  5.014   1.00 0.00 ? 44  ARG A HH22 4  
ATOM 5651  N N    . ARG A 1 45  ? -7.223  -8.020  1.605   1.00 0.00 ? 45  ARG A N    4  
ATOM 5652  C CA   . ARG A 1 45  ? -7.563  -7.021  0.599   1.00 0.00 ? 45  ARG A CA   4  
ATOM 5653  C C    . ARG A 1 45  ? -7.058  -5.642  1.010   1.00 0.00 ? 45  ARG A C    4  
ATOM 5654  O O    . ARG A 1 45  ? -6.953  -5.336  2.199   1.00 0.00 ? 45  ARG A O    4  
ATOM 5655  C CB   . ARG A 1 45  ? -9.077  -6.978  0.384   1.00 0.00 ? 45  ARG A CB   4  
ATOM 5656  C CG   . ARG A 1 45  ? -9.639  -8.240  -0.250  1.00 0.00 ? 45  ARG A CG   4  
ATOM 5657  C CD   . ARG A 1 45  ? -9.607  -8.163  -1.768  1.00 0.00 ? 45  ARG A CD   4  
ATOM 5658  N NE   . ARG A 1 45  ? -9.759  -9.477  -2.386  1.00 0.00 ? 45  ARG A NE   4  
ATOM 5659  C CZ   . ARG A 1 45  ? -9.650  -9.691  -3.693  1.00 0.00 ? 45  ARG A CZ   4  
ATOM 5660  N NH1  . ARG A 1 45  ? -9.388  -8.684  -4.514  1.00 0.00 ? 45  ARG A NH1  4  
ATOM 5661  N NH2  . ARG A 1 45  ? -9.802  -10.916 -4.180  1.00 0.00 ? 45  ARG A NH2  4  
ATOM 5662  H H    . ARG A 1 45  ? -7.257  -7.774  2.554   1.00 0.00 ? 45  ARG A H    4  
ATOM 5663  H HA   . ARG A 1 45  ? -7.085  -7.306  -0.326  1.00 0.00 ? 45  ARG A HA   4  
ATOM 5664  H HB2  . ARG A 1 45  ? -9.561  -6.836  1.340   1.00 0.00 ? 45  ARG A HB2  4  
ATOM 5665  H HB3  . ARG A 1 45  ? -9.314  -6.143  -0.257  1.00 0.00 ? 45  ARG A HB3  4  
ATOM 5666  H HG2  . ARG A 1 45  ? -9.047  -9.086  0.069   1.00 0.00 ? 45  ARG A HG2  4  
ATOM 5667  H HG3  . ARG A 1 45  ? -10.661 -8.371  0.074   1.00 0.00 ? 45  ARG A HG3  4  
ATOM 5668  H HD2  . ARG A 1 45  ? -10.412 -7.524  -2.100  1.00 0.00 ? 45  ARG A HD2  4  
ATOM 5669  H HD3  . ARG A 1 45  ? -8.662  -7.738  -2.073  1.00 0.00 ? 45  ARG A HD3  4  
ATOM 5670  H HE   . ARG A 1 45  ? -9.953  -10.236 -1.798  1.00 0.00 ? 45  ARG A HE   4  
ATOM 5671  H HH11 . ARG A 1 45  ? -9.272  -7.760  -4.149  1.00 0.00 ? 45  ARG A HH11 4  
ATOM 5672  H HH12 . ARG A 1 45  ? -9.305  -8.848  -5.497  1.00 0.00 ? 45  ARG A HH12 4  
ATOM 5673  H HH21 . ARG A 1 45  ? -9.999  -11.678 -3.564  1.00 0.00 ? 45  ARG A HH21 4  
ATOM 5674  H HH22 . ARG A 1 45  ? -9.719  -11.076 -5.163  1.00 0.00 ? 45  ARG A HH22 4  
ATOM 5675  N N    . LEU A 1 46  ? -6.745  -4.813  0.020   1.00 0.00 ? 46  LEU A N    4  
ATOM 5676  C CA   . LEU A 1 46  ? -6.250  -3.465  0.278   1.00 0.00 ? 46  LEU A CA   4  
ATOM 5677  C C    . LEU A 1 46  ? -7.239  -2.417  -0.221  1.00 0.00 ? 46  LEU A C    4  
ATOM 5678  O O    . LEU A 1 46  ? -7.937  -2.630  -1.212  1.00 0.00 ? 46  LEU A O    4  
ATOM 5679  C CB   . LEU A 1 46  ? -4.891  -3.262  -0.395  1.00 0.00 ? 46  LEU A CB   4  
ATOM 5680  C CG   . LEU A 1 46  ? -3.665  -3.622  0.445   1.00 0.00 ? 46  LEU A CG   4  
ATOM 5681  C CD1  . LEU A 1 46  ? -3.579  -2.730  1.674   1.00 0.00 ? 46  LEU A CD1  4  
ATOM 5682  C CD2  . LEU A 1 46  ? -3.709  -5.088  0.851   1.00 0.00 ? 46  LEU A CD2  4  
ATOM 5683  H H    . LEU A 1 46  ? -6.850  -5.113  -0.906  1.00 0.00 ? 46  LEU A H    4  
ATOM 5684  H HA   . LEU A 1 46  ? -6.133  -3.354  1.346   1.00 0.00 ? 46  LEU A HA   4  
ATOM 5685  H HB2  . LEU A 1 46  ? -4.870  -3.870  -1.287  1.00 0.00 ? 46  LEU A HB2  4  
ATOM 5686  H HB3  . LEU A 1 46  ? -4.811  -2.220  -0.669  1.00 0.00 ? 46  LEU A HB3  4  
ATOM 5687  H HG   . LEU A 1 46  ? -2.773  -3.464  -0.145  1.00 0.00 ? 46  LEU A HG   4  
ATOM 5688  H HD11 . LEU A 1 46  ? -4.114  -3.189  2.491   1.00 0.00 ? 46  LEU A HD11 4  
ATOM 5689  H HD12 . LEU A 1 46  ? -4.018  -1.768  1.451   1.00 0.00 ? 46  LEU A HD12 4  
ATOM 5690  H HD13 . LEU A 1 46  ? -2.543  -2.597  1.950   1.00 0.00 ? 46  LEU A HD13 4  
ATOM 5691  H HD21 . LEU A 1 46  ? -3.374  -5.189  1.873   1.00 0.00 ? 46  LEU A HD21 4  
ATOM 5692  H HD22 . LEU A 1 46  ? -3.061  -5.661  0.203   1.00 0.00 ? 46  LEU A HD22 4  
ATOM 5693  H HD23 . LEU A 1 46  ? -4.721  -5.456  0.766   1.00 0.00 ? 46  LEU A HD23 4  
ATOM 5694  N N    . TYR A 1 47  ? -7.291  -1.284  0.471   1.00 0.00 ? 47  TYR A N    4  
ATOM 5695  C CA   . TYR A 1 47  ? -8.194  -0.202  0.098   1.00 0.00 ? 47  TYR A CA   4  
ATOM 5696  C C    . TYR A 1 47  ? -7.547  1.158   0.347   1.00 0.00 ? 47  TYR A C    4  
ATOM 5697  O O    . TYR A 1 47  ? -6.632  1.284   1.160   1.00 0.00 ? 47  TYR A O    4  
ATOM 5698  C CB   . TYR A 1 47  ? -9.502  -0.308  0.884   1.00 0.00 ? 47  TYR A CB   4  
ATOM 5699  C CG   . TYR A 1 47  ? -10.228 -1.618  0.678   1.00 0.00 ? 47  TYR A CG   4  
ATOM 5700  C CD1  . TYR A 1 47  ? -9.941  -2.725  1.467   1.00 0.00 ? 47  TYR A CD1  4  
ATOM 5701  C CD2  . TYR A 1 47  ? -11.199 -1.750  -0.307  1.00 0.00 ? 47  TYR A CD2  4  
ATOM 5702  C CE1  . TYR A 1 47  ? -10.601 -3.925  1.282   1.00 0.00 ? 47  TYR A CE1  4  
ATOM 5703  C CE2  . TYR A 1 47  ? -11.865 -2.945  -0.499  1.00 0.00 ? 47  TYR A CE2  4  
ATOM 5704  C CZ   . TYR A 1 47  ? -11.563 -4.029  0.298   1.00 0.00 ? 47  TYR A CZ   4  
ATOM 5705  O OH   . TYR A 1 47  ? -12.223 -5.222  0.110   1.00 0.00 ? 47  TYR A OH   4  
ATOM 5706  H H    . TYR A 1 47  ? -6.709  -1.173  1.252   1.00 0.00 ? 47  TYR A H    4  
ATOM 5707  H HA   . TYR A 1 47  ? -8.410  -0.298  -0.956  1.00 0.00 ? 47  TYR A HA   4  
ATOM 5708  H HB2  . TYR A 1 47  ? -9.290  -0.209  1.937   1.00 0.00 ? 47  TYR A HB2  4  
ATOM 5709  H HB3  . TYR A 1 47  ? -10.163 0.490   0.578   1.00 0.00 ? 47  TYR A HB3  4  
ATOM 5710  H HD1  . TYR A 1 47  ? -9.188  -2.640  2.237   1.00 0.00 ? 47  TYR A HD1  4  
ATOM 5711  H HD2  . TYR A 1 47  ? -11.433 -0.898  -0.930  1.00 0.00 ? 47  TYR A HD2  4  
ATOM 5712  H HE1  . TYR A 1 47  ? -10.365 -4.774  1.906   1.00 0.00 ? 47  TYR A HE1  4  
ATOM 5713  H HE2  . TYR A 1 47  ? -12.617 -3.027  -1.269  1.00 0.00 ? 47  TYR A HE2  4  
ATOM 5714  H HH   . TYR A 1 47  ? -12.342 -5.658  0.956   1.00 0.00 ? 47  TYR A HH   4  
ATOM 5715  N N    . VAL A 1 48  ? -8.031  2.174   -0.361  1.00 0.00 ? 48  VAL A N    4  
ATOM 5716  C CA   . VAL A 1 48  ? -7.503  3.525   -0.217  1.00 0.00 ? 48  VAL A CA   4  
ATOM 5717  C C    . VAL A 1 48  ? -8.327  4.334   0.778   1.00 0.00 ? 48  VAL A C    4  
ATOM 5718  O O    . VAL A 1 48  ? -9.535  4.496   0.613   1.00 0.00 ? 48  VAL A O    4  
ATOM 5719  C CB   . VAL A 1 48  ? -7.479  4.265   -1.568  1.00 0.00 ? 48  VAL A CB   4  
ATOM 5720  C CG1  . VAL A 1 48  ? -6.788  5.613   -1.427  1.00 0.00 ? 48  VAL A CG1  4  
ATOM 5721  C CG2  . VAL A 1 48  ? -6.795  3.415   -2.629  1.00 0.00 ? 48  VAL A CG2  4  
ATOM 5722  H H    . VAL A 1 48  ? -8.761  2.011   -0.994  1.00 0.00 ? 48  VAL A H    4  
ATOM 5723  H HA   . VAL A 1 48  ? -6.488  3.450   0.146   1.00 0.00 ? 48  VAL A HA   4  
ATOM 5724  H HB   . VAL A 1 48  ? -8.499  4.439   -1.879  1.00 0.00 ? 48  VAL A HB   4  
ATOM 5725  H HG11 . VAL A 1 48  ? -5.967  5.671   -2.127  1.00 0.00 ? 48  VAL A HG11 4  
ATOM 5726  H HG12 . VAL A 1 48  ? -7.495  6.403   -1.633  1.00 0.00 ? 48  VAL A HG12 4  
ATOM 5727  H HG13 . VAL A 1 48  ? -6.410  5.719   -0.421  1.00 0.00 ? 48  VAL A HG13 4  
ATOM 5728  H HG21 . VAL A 1 48  ? -7.261  2.441   -2.663  1.00 0.00 ? 48  VAL A HG21 4  
ATOM 5729  H HG22 . VAL A 1 48  ? -6.892  3.894   -3.592  1.00 0.00 ? 48  VAL A HG22 4  
ATOM 5730  H HG23 . VAL A 1 48  ? -5.749  3.306   -2.384  1.00 0.00 ? 48  VAL A HG23 4  
ATOM 5731  N N    . ASN A 1 49  ? -7.664  4.842   1.812   1.00 0.00 ? 49  ASN A N    4  
ATOM 5732  C CA   . ASN A 1 49  ? -8.335  5.635   2.835   1.00 0.00 ? 49  ASN A CA   4  
ATOM 5733  C C    . ASN A 1 49  ? -8.290  7.121   2.489   1.00 0.00 ? 49  ASN A C    4  
ATOM 5734  O O    . ASN A 1 49  ? -9.322  7.789   2.439   1.00 0.00 ? 49  ASN A O    4  
ATOM 5735  C CB   . ASN A 1 49  ? -7.686  5.399   4.201   1.00 0.00 ? 49  ASN A CB   4  
ATOM 5736  C CG   . ASN A 1 49  ? -8.047  6.475   5.206   1.00 0.00 ? 49  ASN A CG   4  
ATOM 5737  O OD1  . ASN A 1 49  ? -8.919  7.307   4.956   1.00 0.00 ? 49  ASN A OD1  4  
ATOM 5738  N ND2  . ASN A 1 49  ? -7.375  6.463   6.352   1.00 0.00 ? 49  ASN A ND2  4  
ATOM 5739  H H    . ASN A 1 49  ? -6.700  4.679   1.889   1.00 0.00 ? 49  ASN A H    4  
ATOM 5740  H HA   . ASN A 1 49  ? -9.366  5.319   2.877   1.00 0.00 ? 49  ASN A HA   4  
ATOM 5741  H HB2  . ASN A 1 49  ? -8.016  4.446   4.588   1.00 0.00 ? 49  ASN A HB2  4  
ATOM 5742  H HB3  . ASN A 1 49  ? -6.613  5.384   4.085   1.00 0.00 ? 49  ASN A HB3  4  
ATOM 5743  H HD21 . ASN A 1 49  ? -6.694  5.770   6.482   1.00 0.00 ? 49  ASN A HD21 4  
ATOM 5744  H HD22 . ASN A 1 49  ? -7.589  7.147   7.020   1.00 0.00 ? 49  ASN A HD22 4  
ATOM 5745  N N    . SER A 1 50  ? -7.085  7.630   2.250   1.00 0.00 ? 50  SER A N    4  
ATOM 5746  C CA   . SER A 1 50  ? -6.904  9.037   1.911   1.00 0.00 ? 50  SER A CA   4  
ATOM 5747  C C    . SER A 1 50  ? -6.119  9.186   0.612   1.00 0.00 ? 50  SER A C    4  
ATOM 5748  O O    . SER A 1 50  ? -5.357  8.299   0.228   1.00 0.00 ? 50  SER A O    4  
ATOM 5749  C CB   . SER A 1 50  ? -6.181  9.767   3.045   1.00 0.00 ? 50  SER A CB   4  
ATOM 5750  O OG   . SER A 1 50  ? -4.998  9.083   3.419   1.00 0.00 ? 50  SER A OG   4  
ATOM 5751  H H    . SER A 1 50  ? -6.300  7.047   2.306   1.00 0.00 ? 50  SER A H    4  
ATOM 5752  H HA   . SER A 1 50  ? -7.883  9.475   1.779   1.00 0.00 ? 50  SER A HA   4  
ATOM 5753  H HB2  . SER A 1 50  ? -5.920  10.763  2.719   1.00 0.00 ? 50  SER A HB2  4  
ATOM 5754  H HB3  . SER A 1 50  ? -6.835  9.830   3.903   1.00 0.00 ? 50  SER A HB3  4  
ATOM 5755  H HG   . SER A 1 50  ? -4.711  8.521   2.696   1.00 0.00 ? 50  SER A HG   4  
ATOM 5756  N N    . VAL A 1 51  ? -6.309  10.317  -0.061  1.00 0.00 ? 51  VAL A N    4  
ATOM 5757  C CA   . VAL A 1 51  ? -5.619  10.584  -1.317  1.00 0.00 ? 51  VAL A CA   4  
ATOM 5758  C C    . VAL A 1 51  ? -5.285  12.065  -1.455  1.00 0.00 ? 51  VAL A C    4  
ATOM 5759  O O    . VAL A 1 51  ? -6.007  12.926  -0.952  1.00 0.00 ? 51  VAL A O    4  
ATOM 5760  C CB   . VAL A 1 51  ? -6.464  10.145  -2.527  1.00 0.00 ? 51  VAL A CB   4  
ATOM 5761  C CG1  . VAL A 1 51  ? -5.748  10.477  -3.827  1.00 0.00 ? 51  VAL A CG1  4  
ATOM 5762  C CG2  . VAL A 1 51  ? -6.777  8.658   -2.446  1.00 0.00 ? 51  VAL A CG2  4  
ATOM 5763  H H    . VAL A 1 51  ? -6.929  10.987  0.296   1.00 0.00 ? 51  VAL A H    4  
ATOM 5764  H HA   . VAL A 1 51  ? -4.700  10.016  -1.320  1.00 0.00 ? 51  VAL A HA   4  
ATOM 5765  H HB   . VAL A 1 51  ? -7.396  10.689  -2.506  1.00 0.00 ? 51  VAL A HB   4  
ATOM 5766  H HG11 . VAL A 1 51  ? -4.680  10.430  -3.672  1.00 0.00 ? 51  VAL A HG11 4  
ATOM 5767  H HG12 . VAL A 1 51  ? -6.034  9.765   -4.588  1.00 0.00 ? 51  VAL A HG12 4  
ATOM 5768  H HG13 . VAL A 1 51  ? -6.021  11.473  -4.144  1.00 0.00 ? 51  VAL A HG13 4  
ATOM 5769  H HG21 . VAL A 1 51  ? -5.934  8.137   -2.017  1.00 0.00 ? 51  VAL A HG21 4  
ATOM 5770  H HG22 . VAL A 1 51  ? -7.648  8.507   -1.825  1.00 0.00 ? 51  VAL A HG22 4  
ATOM 5771  H HG23 . VAL A 1 51  ? -6.970  8.276   -3.437  1.00 0.00 ? 51  VAL A HG23 4  
ATOM 5772  N N    . LYS A 1 52  ? -4.184  12.357  -2.141  1.00 0.00 ? 52  LYS A N    4  
ATOM 5773  C CA   . LYS A 1 52  ? -3.754  13.734  -2.349  1.00 0.00 ? 52  LYS A CA   4  
ATOM 5774  C C    . LYS A 1 52  ? -4.887  14.578  -2.924  1.00 0.00 ? 52  LYS A C    4  
ATOM 5775  O O    . LYS A 1 52  ? -5.574  14.158  -3.854  1.00 0.00 ? 52  LYS A O    4  
ATOM 5776  C CB   . LYS A 1 52  ? -2.545  13.776  -3.287  1.00 0.00 ? 52  LYS A CB   4  
ATOM 5777  C CG   . LYS A 1 52  ? -1.212  13.679  -2.566  1.00 0.00 ? 52  LYS A CG   4  
ATOM 5778  C CD   . LYS A 1 52  ? -0.099  14.342  -3.360  1.00 0.00 ? 52  LYS A CD   4  
ATOM 5779  C CE   . LYS A 1 52  ? 1.241   14.221  -2.650  1.00 0.00 ? 52  LYS A CE   4  
ATOM 5780  N NZ   . LYS A 1 52  ? 2.138   15.368  -2.960  1.00 0.00 ? 52  LYS A NZ   4  
ATOM 5781  H H    . LYS A 1 52  ? -3.649  11.626  -2.518  1.00 0.00 ? 52  LYS A H    4  
ATOM 5782  H HA   . LYS A 1 52  ? -3.469  14.141  -1.390  1.00 0.00 ? 52  LYS A HA   4  
ATOM 5783  H HB2  . LYS A 1 52  ? -2.616  12.953  -3.982  1.00 0.00 ? 52  LYS A HB2  4  
ATOM 5784  H HB3  . LYS A 1 52  ? -2.565  14.705  -3.839  1.00 0.00 ? 52  LYS A HB3  4  
ATOM 5785  H HG2  . LYS A 1 52  ? -1.295  14.167  -1.606  1.00 0.00 ? 52  LYS A HG2  4  
ATOM 5786  H HG3  . LYS A 1 52  ? -0.967  12.636  -2.421  1.00 0.00 ? 52  LYS A HG3  4  
ATOM 5787  H HD2  . LYS A 1 52  ? -0.025  13.867  -4.326  1.00 0.00 ? 52  LYS A HD2  4  
ATOM 5788  H HD3  . LYS A 1 52  ? -0.335  15.389  -3.488  1.00 0.00 ? 52  LYS A HD3  4  
ATOM 5789  H HE2  . LYS A 1 52  ? 1.067   14.188  -1.585  1.00 0.00 ? 52  LYS A HE2  4  
ATOM 5790  H HE3  . LYS A 1 52  ? 1.719   13.305  -2.965  1.00 0.00 ? 52  LYS A HE3  4  
ATOM 5791  H HZ1  . LYS A 1 52  ? 1.670   16.264  -2.715  1.00 0.00 ? 52  LYS A HZ1  4  
ATOM 5792  H HZ2  . LYS A 1 52  ? 2.370   15.377  -3.973  1.00 0.00 ? 52  LYS A HZ2  4  
ATOM 5793  H HZ3  . LYS A 1 52  ? 3.020   15.290  -2.414  1.00 0.00 ? 52  LYS A HZ3  4  
ATOM 5794  N N    . GLU A 1 53  ? -5.074  15.769  -2.365  1.00 0.00 ? 53  GLU A N    4  
ATOM 5795  C CA   . GLU A 1 53  ? -6.124  16.671  -2.824  1.00 0.00 ? 53  GLU A CA   4  
ATOM 5796  C C    . GLU A 1 53  ? -5.754  17.298  -4.165  1.00 0.00 ? 53  GLU A C    4  
ATOM 5797  O O    . GLU A 1 53  ? -6.579  17.376  -5.076  1.00 0.00 ? 53  GLU A O    4  
ATOM 5798  C CB   . GLU A 1 53  ? -6.374  17.768  -1.787  1.00 0.00 ? 53  GLU A CB   4  
ATOM 5799  C CG   . GLU A 1 53  ? -5.140  18.593  -1.464  1.00 0.00 ? 53  GLU A CG   4  
ATOM 5800  C CD   . GLU A 1 53  ? -5.186  19.191  -0.071  1.00 0.00 ? 53  GLU A CD   4  
ATOM 5801  O OE1  . GLU A 1 53  ? -6.281  19.608  0.360   1.00 0.00 ? 53  GLU A OE1  4  
ATOM 5802  O OE2  . GLU A 1 53  ? -4.126  19.242  0.587   1.00 0.00 ? 53  GLU A OE2  4  
ATOM 5803  H H    . GLU A 1 53  ? -4.494  16.048  -1.626  1.00 0.00 ? 53  GLU A H    4  
ATOM 5804  H HA   . GLU A 1 53  ? -7.027  16.093  -2.947  1.00 0.00 ? 53  GLU A HA   4  
ATOM 5805  H HB2  . GLU A 1 53  ? -7.139  18.433  -2.161  1.00 0.00 ? 53  GLU A HB2  4  
ATOM 5806  H HB3  . GLU A 1 53  ? -6.724  17.310  -0.874  1.00 0.00 ? 53  GLU A HB3  4  
ATOM 5807  H HG2  . GLU A 1 53  ? -4.269  17.959  -1.538  1.00 0.00 ? 53  GLU A HG2  4  
ATOM 5808  H HG3  . GLU A 1 53  ? -5.061  19.396  -2.182  1.00 0.00 ? 53  GLU A HG3  4  
ATOM 5809  N N    . THR A 1 54  ? -4.507  17.745  -4.279  1.00 0.00 ? 54  THR A N    4  
ATOM 5810  C CA   . THR A 1 54  ? -4.028  18.367  -5.506  1.00 0.00 ? 54  THR A CA   4  
ATOM 5811  C C    . THR A 1 54  ? -2.684  17.784  -5.930  1.00 0.00 ? 54  THR A C    4  
ATOM 5812  O O    . THR A 1 54  ? -1.760  18.518  -6.277  1.00 0.00 ? 54  THR A O    4  
ATOM 5813  C CB   . THR A 1 54  ? -3.884  19.893  -5.345  1.00 0.00 ? 54  THR A CB   4  
ATOM 5814  O OG1  . THR A 1 54  ? -3.078  20.190  -4.199  1.00 0.00 ? 54  THR A OG1  4  
ATOM 5815  C CG2  . THR A 1 54  ? -5.247  20.552  -5.196  1.00 0.00 ? 54  THR A CG2  4  
ATOM 5816  H H    . THR A 1 54  ? -3.897  17.655  -3.518  1.00 0.00 ? 54  THR A H    4  
ATOM 5817  H HA   . THR A 1 54  ? -4.754  18.176  -6.283  1.00 0.00 ? 54  THR A HA   4  
ATOM 5818  H HB   . THR A 1 54  ? -3.403  20.289  -6.227  1.00 0.00 ? 54  THR A HB   4  
ATOM 5819  H HG1  . THR A 1 54  ? -3.475  19.798  -3.418  1.00 0.00 ? 54  THR A HG1  4  
ATOM 5820  H HG21 . THR A 1 54  ? -5.923  19.873  -4.696  1.00 0.00 ? 54  THR A HG21 4  
ATOM 5821  H HG22 . THR A 1 54  ? -5.638  20.794  -6.173  1.00 0.00 ? 54  THR A HG22 4  
ATOM 5822  H HG23 . THR A 1 54  ? -5.148  21.455  -4.614  1.00 0.00 ? 54  THR A HG23 4  
ATOM 5823  N N    . GLY A 1 55  ? -2.584  16.459  -5.899  1.00 0.00 ? 55  GLY A N    4  
ATOM 5824  C CA   . GLY A 1 55  ? -1.349  15.800  -6.283  1.00 0.00 ? 55  GLY A CA   4  
ATOM 5825  C C    . GLY A 1 55  ? -1.482  15.030  -7.582  1.00 0.00 ? 55  GLY A C    4  
ATOM 5826  O O    . GLY A 1 55  ? -2.013  15.546  -8.567  1.00 0.00 ? 55  GLY A O    4  
ATOM 5827  H H    . GLY A 1 55  ? -3.354  15.924  -5.614  1.00 0.00 ? 55  GLY A H    4  
ATOM 5828  H HA2  . GLY A 1 55  ? -0.576  16.545  -6.396  1.00 0.00 ? 55  GLY A HA2  4  
ATOM 5829  H HA3  . GLY A 1 55  ? -1.062  15.114  -5.500  1.00 0.00 ? 55  GLY A HA3  4  
ATOM 5830  N N    . LEU A 1 56  ? -0.998  13.793  -7.587  1.00 0.00 ? 56  LEU A N    4  
ATOM 5831  C CA   . LEU A 1 56  ? -1.064  12.950  -8.776  1.00 0.00 ? 56  LEU A CA   4  
ATOM 5832  C C    . LEU A 1 56  ? -2.192  11.929  -8.658  1.00 0.00 ? 56  LEU A C    4  
ATOM 5833  O O    . LEU A 1 56  ? -3.081  11.872  -9.506  1.00 0.00 ? 56  LEU A O    4  
ATOM 5834  C CB   . LEU A 1 56  ? 0.269   12.232  -8.991  1.00 0.00 ? 56  LEU A CB   4  
ATOM 5835  C CG   . LEU A 1 56  ? 1.521   13.107  -8.925  1.00 0.00 ? 56  LEU A CG   4  
ATOM 5836  C CD1  . LEU A 1 56  ? 2.773   12.261  -9.095  1.00 0.00 ? 56  LEU A CD1  4  
ATOM 5837  C CD2  . LEU A 1 56  ? 1.465   14.199  -9.984  1.00 0.00 ? 56  LEU A CD2  4  
ATOM 5838  H H    . LEU A 1 56  ? -0.587  13.437  -6.772  1.00 0.00 ? 56  LEU A H    4  
ATOM 5839  H HA   . LEU A 1 56  ? -1.260  13.589  -9.624  1.00 0.00 ? 56  LEU A HA   4  
ATOM 5840  H HB2  . LEU A 1 56  ? 0.359   11.469  -8.233  1.00 0.00 ? 56  LEU A HB2  4  
ATOM 5841  H HB3  . LEU A 1 56  ? 0.240   11.767  -9.966  1.00 0.00 ? 56  LEU A HB3  4  
ATOM 5842  H HG   . LEU A 1 56  ? 1.570   13.583  -7.955  1.00 0.00 ? 56  LEU A HG   4  
ATOM 5843  H HD11 . LEU A 1 56  ? 2.705   11.697  -10.012 1.00 0.00 ? 56  LEU A HD11 4  
ATOM 5844  H HD12 . LEU A 1 56  ? 2.865   11.582  -8.260  1.00 0.00 ? 56  LEU A HD12 4  
ATOM 5845  H HD13 . LEU A 1 56  ? 3.640   12.905  -9.131  1.00 0.00 ? 56  LEU A HD13 4  
ATOM 5846  H HD21 . LEU A 1 56  ? 0.849   13.869  -10.807 1.00 0.00 ? 56  LEU A HD21 4  
ATOM 5847  H HD22 . LEU A 1 56  ? 2.464   14.405  -10.341 1.00 0.00 ? 56  LEU A HD22 4  
ATOM 5848  H HD23 . LEU A 1 56  ? 1.043   15.095  -9.554  1.00 0.00 ? 56  LEU A HD23 4  
ATOM 5849  N N    . ALA A 1 57  ? -2.148  11.127  -7.600  1.00 0.00 ? 57  ALA A N    4  
ATOM 5850  C CA   . ALA A 1 57  ? -3.168  10.111  -7.369  1.00 0.00 ? 57  ALA A CA   4  
ATOM 5851  C C    . ALA A 1 57  ? -4.544  10.608  -7.798  1.00 0.00 ? 57  ALA A C    4  
ATOM 5852  O O    . ALA A 1 57  ? -5.068  10.196  -8.833  1.00 0.00 ? 57  ALA A O    4  
ATOM 5853  C CB   . ALA A 1 57  ? -3.185  9.705   -5.903  1.00 0.00 ? 57  ALA A CB   4  
ATOM 5854  H H    . ALA A 1 57  ? -1.413  11.221  -6.959  1.00 0.00 ? 57  ALA A H    4  
ATOM 5855  H HA   . ALA A 1 57  ? -2.911  9.241   -7.955  1.00 0.00 ? 57  ALA A HA   4  
ATOM 5856  H HB1  . ALA A 1 57  ? -3.156  10.590  -5.284  1.00 0.00 ? 57  ALA A HB1  4  
ATOM 5857  H HB2  . ALA A 1 57  ? -4.087  9.149   -5.694  1.00 0.00 ? 57  ALA A HB2  4  
ATOM 5858  H HB3  . ALA A 1 57  ? -2.324  9.089   -5.690  1.00 0.00 ? 57  ALA A HB3  4  
ATOM 5859  N N    . SER A 1 58  ? -5.125  11.495  -6.996  1.00 0.00 ? 58  SER A N    4  
ATOM 5860  C CA   . SER A 1 58  ? -6.443  12.044  -7.291  1.00 0.00 ? 58  SER A CA   4  
ATOM 5861  C C    . SER A 1 58  ? -6.572  12.381  -8.774  1.00 0.00 ? 58  SER A C    4  
ATOM 5862  O O    . SER A 1 58  ? -7.390  11.799  -9.486  1.00 0.00 ? 58  SER A O    4  
ATOM 5863  C CB   . SER A 1 58  ? -6.698  13.295  -6.448  1.00 0.00 ? 58  SER A CB   4  
ATOM 5864  O OG   . SER A 1 58  ? -7.918  13.917  -6.814  1.00 0.00 ? 58  SER A OG   4  
ATOM 5865  H H    . SER A 1 58  ? -4.656  11.784  -6.185  1.00 0.00 ? 58  SER A H    4  
ATOM 5866  H HA   . SER A 1 58  ? -7.178  11.294  -7.039  1.00 0.00 ? 58  SER A HA   4  
ATOM 5867  H HB2  . SER A 1 58  ? -6.748  13.019  -5.406  1.00 0.00 ? 58  SER A HB2  4  
ATOM 5868  H HB3  . SER A 1 58  ? -5.890  13.997  -6.597  1.00 0.00 ? 58  SER A HB3  4  
ATOM 5869  H HG   . SER A 1 58  ? -8.558  13.808  -6.107  1.00 0.00 ? 58  SER A HG   4  
ATOM 5870  N N    . LYS A 1 59  ? -5.757  13.326  -9.232  1.00 0.00 ? 59  LYS A N    4  
ATOM 5871  C CA   . LYS A 1 59  ? -5.777  13.742  -10.629 1.00 0.00 ? 59  LYS A CA   4  
ATOM 5872  C C    . LYS A 1 59  ? -6.044  12.553  -11.547 1.00 0.00 ? 59  LYS A C    4  
ATOM 5873  O O    . LYS A 1 59  ? -7.005  12.553  -12.316 1.00 0.00 ? 59  LYS A O    4  
ATOM 5874  C CB   . LYS A 1 59  ? -4.448  14.402  -11.005 1.00 0.00 ? 59  LYS A CB   4  
ATOM 5875  C CG   . LYS A 1 59  ? -4.361  15.865  -10.604 1.00 0.00 ? 59  LYS A CG   4  
ATOM 5876  C CD   . LYS A 1 59  ? -3.159  16.545  -11.236 1.00 0.00 ? 59  LYS A CD   4  
ATOM 5877  C CE   . LYS A 1 59  ? -3.367  16.774  -12.726 1.00 0.00 ? 59  LYS A CE   4  
ATOM 5878  N NZ   . LYS A 1 59  ? -2.352  17.706  -13.291 1.00 0.00 ? 59  LYS A NZ   4  
ATOM 5879  H H    . LYS A 1 59  ? -5.127  13.754  -8.614  1.00 0.00 ? 59  LYS A H    4  
ATOM 5880  H HA   . LYS A 1 59  ? -6.573  14.461  -10.750 1.00 0.00 ? 59  LYS A HA   4  
ATOM 5881  H HB2  . LYS A 1 59  ? -3.645  13.869  -10.518 1.00 0.00 ? 59  LYS A HB2  4  
ATOM 5882  H HB3  . LYS A 1 59  ? -4.317  14.335  -12.075 1.00 0.00 ? 59  LYS A HB3  4  
ATOM 5883  H HG2  . LYS A 1 59  ? -5.259  16.371  -10.927 1.00 0.00 ? 59  LYS A HG2  4  
ATOM 5884  H HG3  . LYS A 1 59  ? -4.276  15.930  -9.529  1.00 0.00 ? 59  LYS A HG3  4  
ATOM 5885  H HD2  . LYS A 1 59  ? -3.002  17.499  -10.756 1.00 0.00 ? 59  LYS A HD2  4  
ATOM 5886  H HD3  . LYS A 1 59  ? -2.288  15.921  -11.095 1.00 0.00 ? 59  LYS A HD3  4  
ATOM 5887  H HE2  . LYS A 1 59  ? -3.295  15.826  -13.236 1.00 0.00 ? 59  LYS A HE2  4  
ATOM 5888  H HE3  . LYS A 1 59  ? -4.351  17.191  -12.878 1.00 0.00 ? 59  LYS A HE3  4  
ATOM 5889  H HZ1  . LYS A 1 59  ? -2.815  18.410  -13.901 1.00 0.00 ? 59  LYS A HZ1  4  
ATOM 5890  H HZ2  . LYS A 1 59  ? -1.657  17.178  -13.856 1.00 0.00 ? 59  LYS A HZ2  4  
ATOM 5891  H HZ3  . LYS A 1 59  ? -1.855  18.202  -12.523 1.00 0.00 ? 59  LYS A HZ3  4  
ATOM 5892  N N    . LYS A 1 60  ? -5.187  11.541  -11.460 1.00 0.00 ? 60  LYS A N    4  
ATOM 5893  C CA   . LYS A 1 60  ? -5.331  10.344  -12.281 1.00 0.00 ? 60  LYS A CA   4  
ATOM 5894  C C    . LYS A 1 60  ? -6.745  9.781   -12.178 1.00 0.00 ? 60  LYS A C    4  
ATOM 5895  O O    . LYS A 1 60  ? -7.489  9.764   -13.158 1.00 0.00 ? 60  LYS A O    4  
ATOM 5896  C CB   . LYS A 1 60  ? -4.316  9.282   -11.853 1.00 0.00 ? 60  LYS A CB   4  
ATOM 5897  C CG   . LYS A 1 60  ? -2.871  9.732   -11.989 1.00 0.00 ? 60  LYS A CG   4  
ATOM 5898  C CD   . LYS A 1 60  ? -2.377  9.594   -13.419 1.00 0.00 ? 60  LYS A CD   4  
ATOM 5899  C CE   . LYS A 1 60  ? -0.870  9.778   -13.508 1.00 0.00 ? 60  LYS A CE   4  
ATOM 5900  N NZ   . LYS A 1 60  ? -0.490  11.217  -13.575 1.00 0.00 ? 60  LYS A NZ   4  
ATOM 5901  H H    . LYS A 1 60  ? -4.440  11.600  -10.828 1.00 0.00 ? 60  LYS A H    4  
ATOM 5902  H HA   . LYS A 1 60  ? -5.140  10.620  -13.307 1.00 0.00 ? 60  LYS A HA   4  
ATOM 5903  H HB2  . LYS A 1 60  ? -4.495  9.026   -10.819 1.00 0.00 ? 60  LYS A HB2  4  
ATOM 5904  H HB3  . LYS A 1 60  ? -4.455  8.401   -12.463 1.00 0.00 ? 60  LYS A HB3  4  
ATOM 5905  H HG2  . LYS A 1 60  ? -2.797  10.768  -11.692 1.00 0.00 ? 60  LYS A HG2  4  
ATOM 5906  H HG3  . LYS A 1 60  ? -2.253  9.125   -11.343 1.00 0.00 ? 60  LYS A HG3  4  
ATOM 5907  H HD2  . LYS A 1 60  ? -2.630  8.610   -13.785 1.00 0.00 ? 60  LYS A HD2  4  
ATOM 5908  H HD3  . LYS A 1 60  ? -2.859  10.343  -14.031 1.00 0.00 ? 60  LYS A HD3  4  
ATOM 5909  H HE2  . LYS A 1 60  ? -0.414  9.335   -12.636 1.00 0.00 ? 60  LYS A HE2  4  
ATOM 5910  H HE3  . LYS A 1 60  ? -0.511  9.278   -14.395 1.00 0.00 ? 60  LYS A HE3  4  
ATOM 5911  H HZ1  . LYS A 1 60  ? -1.269  11.808  -13.222 1.00 0.00 ? 60  LYS A HZ1  4  
ATOM 5912  H HZ2  . LYS A 1 60  ? -0.283  11.486  -14.558 1.00 0.00 ? 60  LYS A HZ2  4  
ATOM 5913  H HZ3  . LYS A 1 60  ? 0.355   11.391  -12.994 1.00 0.00 ? 60  LYS A HZ3  4  
ATOM 5914  N N    . GLY A 1 61  ? -7.110  9.322   -10.985 1.00 0.00 ? 61  GLY A N    4  
ATOM 5915  C CA   . GLY A 1 61  ? -8.434  8.766   -10.777 1.00 0.00 ? 61  GLY A CA   4  
ATOM 5916  C C    . GLY A 1 61  ? -8.638  8.270   -9.359  1.00 0.00 ? 61  GLY A C    4  
ATOM 5917  O O    . GLY A 1 61  ? -9.762  8.252   -8.856  1.00 0.00 ? 61  GLY A O    4  
ATOM 5918  H H    . GLY A 1 61  ? -6.474  9.361   -10.240 1.00 0.00 ? 61  GLY A H    4  
ATOM 5919  H HA2  . GLY A 1 61  ? -9.170  9.527   -10.991 1.00 0.00 ? 61  GLY A HA2  4  
ATOM 5920  H HA3  . GLY A 1 61  ? -8.576  7.940   -11.458 1.00 0.00 ? 61  GLY A HA3  4  
ATOM 5921  N N    . LEU A 1 62  ? -7.550  7.866   -8.712  1.00 0.00 ? 62  LEU A N    4  
ATOM 5922  C CA   . LEU A 1 62  ? -7.615  7.366   -7.343  1.00 0.00 ? 62  LEU A CA   4  
ATOM 5923  C C    . LEU A 1 62  ? -8.488  8.267   -6.475  1.00 0.00 ? 62  LEU A C    4  
ATOM 5924  O O    . LEU A 1 62  ? -8.737  9.423   -6.816  1.00 0.00 ? 62  LEU A O    4  
ATOM 5925  C CB   . LEU A 1 62  ? -6.210  7.271   -6.747  1.00 0.00 ? 62  LEU A CB   4  
ATOM 5926  C CG   . LEU A 1 62  ? -5.477  5.947   -6.964  1.00 0.00 ? 62  LEU A CG   4  
ATOM 5927  C CD1  . LEU A 1 62  ? -3.971  6.162   -6.951  1.00 0.00 ? 62  LEU A CD1  4  
ATOM 5928  C CD2  . LEU A 1 62  ? -5.881  4.933   -5.904  1.00 0.00 ? 62  LEU A CD2  4  
ATOM 5929  H H    . LEU A 1 62  ? -6.683  7.905   -9.165  1.00 0.00 ? 62  LEU A H    4  
ATOM 5930  H HA   . LEU A 1 62  ? -8.053  6.380   -7.372  1.00 0.00 ? 62  LEU A HA   4  
ATOM 5931  H HB2  . LEU A 1 62  ? -5.611  8.056   -7.185  1.00 0.00 ? 62  LEU A HB2  4  
ATOM 5932  H HB3  . LEU A 1 62  ? -6.291  7.435   -5.682  1.00 0.00 ? 62  LEU A HB3  4  
ATOM 5933  H HG   . LEU A 1 62  ? -5.748  5.547   -7.931  1.00 0.00 ? 62  LEU A HG   4  
ATOM 5934  H HD11 . LEU A 1 62  ? -3.756  7.212   -7.074  1.00 0.00 ? 62  LEU A HD11 4  
ATOM 5935  H HD12 . LEU A 1 62  ? -3.521  5.605   -7.760  1.00 0.00 ? 62  LEU A HD12 4  
ATOM 5936  H HD13 . LEU A 1 62  ? -3.567  5.819   -6.010  1.00 0.00 ? 62  LEU A HD13 4  
ATOM 5937  H HD21 . LEU A 1 62  ? -5.165  4.126   -5.886  1.00 0.00 ? 62  LEU A HD21 4  
ATOM 5938  H HD22 . LEU A 1 62  ? -6.861  4.540   -6.137  1.00 0.00 ? 62  LEU A HD22 4  
ATOM 5939  H HD23 . LEU A 1 62  ? -5.906  5.414   -4.937  1.00 0.00 ? 62  LEU A HD23 4  
ATOM 5940  N N    . LYS A 1 63  ? -8.949  7.729   -5.351  1.00 0.00 ? 63  LYS A N    4  
ATOM 5941  C CA   . LYS A 1 63  ? -9.792  8.484   -4.431  1.00 0.00 ? 63  LYS A CA   4  
ATOM 5942  C C    . LYS A 1 63  ? -10.012 7.709   -3.136  1.00 0.00 ? 63  LYS A C    4  
ATOM 5943  O O    . LYS A 1 63  ? -10.052 6.479   -3.136  1.00 0.00 ? 63  LYS A O    4  
ATOM 5944  C CB   . LYS A 1 63  ? -11.139 8.800   -5.084  1.00 0.00 ? 63  LYS A CB   4  
ATOM 5945  C CG   . LYS A 1 63  ? -11.881 9.949   -4.422  1.00 0.00 ? 63  LYS A CG   4  
ATOM 5946  C CD   . LYS A 1 63  ? -13.338 9.991   -4.850  1.00 0.00 ? 63  LYS A CD   4  
ATOM 5947  C CE   . LYS A 1 63  ? -13.514 10.753  -6.155  1.00 0.00 ? 63  LYS A CE   4  
ATOM 5948  N NZ   . LYS A 1 63  ? -13.238 12.207  -5.990  1.00 0.00 ? 63  LYS A NZ   4  
ATOM 5949  H H    . LYS A 1 63  ? -8.716  6.802   -5.134  1.00 0.00 ? 63  LYS A H    4  
ATOM 5950  H HA   . LYS A 1 63  ? -9.286  9.410   -4.202  1.00 0.00 ? 63  LYS A HA   4  
ATOM 5951  H HB2  . LYS A 1 63  ? -10.973 9.056   -6.120  1.00 0.00 ? 63  LYS A HB2  4  
ATOM 5952  H HB3  . LYS A 1 63  ? -11.765 7.920   -5.036  1.00 0.00 ? 63  LYS A HB3  4  
ATOM 5953  H HG2  . LYS A 1 63  ? -11.835 9.825   -3.350  1.00 0.00 ? 63  LYS A HG2  4  
ATOM 5954  H HG3  . LYS A 1 63  ? -11.406 10.879  -4.699  1.00 0.00 ? 63  LYS A HG3  4  
ATOM 5955  H HD2  . LYS A 1 63  ? -13.695 8.981   -4.985  1.00 0.00 ? 63  LYS A HD2  4  
ATOM 5956  H HD3  . LYS A 1 63  ? -13.917 10.479  -4.078  1.00 0.00 ? 63  LYS A HD3  4  
ATOM 5957  H HE2  . LYS A 1 63  ? -12.834 10.347  -6.888  1.00 0.00 ? 63  LYS A HE2  4  
ATOM 5958  H HE3  . LYS A 1 63  ? -14.530 10.625  -6.497  1.00 0.00 ? 63  LYS A HE3  4  
ATOM 5959  H HZ1  . LYS A 1 63  ? -13.132 12.438  -4.982  1.00 0.00 ? 63  LYS A HZ1  4  
ATOM 5960  H HZ2  . LYS A 1 63  ? -14.022 12.766  -6.382  1.00 0.00 ? 63  LYS A HZ2  4  
ATOM 5961  H HZ3  . LYS A 1 63  ? -12.361 12.463  -6.487  1.00 0.00 ? 63  LYS A HZ3  4  
ATOM 5962  N N    . ALA A 1 64  ? -10.156 8.438   -2.033  1.00 0.00 ? 64  ALA A N    4  
ATOM 5963  C CA   . ALA A 1 64  ? -10.376 7.819   -0.732  1.00 0.00 ? 64  ALA A CA   4  
ATOM 5964  C C    . ALA A 1 64  ? -11.577 6.879   -0.767  1.00 0.00 ? 64  ALA A C    4  
ATOM 5965  O O    . ALA A 1 64  ? -12.724 7.322   -0.774  1.00 0.00 ? 64  ALA A O    4  
ATOM 5966  C CB   . ALA A 1 64  ? -10.571 8.887   0.334   1.00 0.00 ? 64  ALA A CB   4  
ATOM 5967  H H    . ALA A 1 64  ? -10.115 9.415   -2.097  1.00 0.00 ? 64  ALA A H    4  
ATOM 5968  H HA   . ALA A 1 64  ? -9.493  7.250   -0.480  1.00 0.00 ? 64  ALA A HA   4  
ATOM 5969  H HB1  . ALA A 1 64  ? -11.124 8.470   1.163   1.00 0.00 ? 64  ALA A HB1  4  
ATOM 5970  H HB2  . ALA A 1 64  ? -9.607  9.230   0.680   1.00 0.00 ? 64  ALA A HB2  4  
ATOM 5971  H HB3  . ALA A 1 64  ? -11.120 9.717   -0.084  1.00 0.00 ? 64  ALA A HB3  4  
ATOM 5972  N N    . GLY A 1 65  ? -11.304 5.578   -0.790  1.00 0.00 ? 65  GLY A N    4  
ATOM 5973  C CA   . GLY A 1 65  ? -12.372 4.596   -0.825  1.00 0.00 ? 65  GLY A CA   4  
ATOM 5974  C C    . GLY A 1 65  ? -12.334 3.743   -2.077  1.00 0.00 ? 65  GLY A C    4  
ATOM 5975  O O    . GLY A 1 65  ? -13.367 3.495   -2.699  1.00 0.00 ? 65  GLY A O    4  
ATOM 5976  H H    . GLY A 1 65  ? -10.369 5.283   -0.783  1.00 0.00 ? 65  GLY A H    4  
ATOM 5977  H HA2  . GLY A 1 65  ? -12.284 3.955   0.039   1.00 0.00 ? 65  GLY A HA2  4  
ATOM 5978  H HA3  . GLY A 1 65  ? -13.320 5.112   -0.784  1.00 0.00 ? 65  GLY A HA3  4  
ATOM 5979  N N    . ASP A 1 66  ? -11.140 3.294   -2.449  1.00 0.00 ? 66  ASP A N    4  
ATOM 5980  C CA   . ASP A 1 66  ? -10.972 2.463   -3.636  1.00 0.00 ? 66  ASP A CA   4  
ATOM 5981  C C    . ASP A 1 66  ? -10.625 1.028   -3.250  1.00 0.00 ? 66  ASP A C    4  
ATOM 5982  O O    . ASP A 1 66  ? -10.401 0.728   -2.078  1.00 0.00 ? 66  ASP A O    4  
ATOM 5983  C CB   . ASP A 1 66  ? -9.879  3.040   -4.537  1.00 0.00 ? 66  ASP A CB   4  
ATOM 5984  C CG   . ASP A 1 66  ? -10.306 4.330   -5.210  1.00 0.00 ? 66  ASP A CG   4  
ATOM 5985  O OD1  . ASP A 1 66  ? -11.217 5.002   -4.682  1.00 0.00 ? 66  ASP A OD1  4  
ATOM 5986  O OD2  . ASP A 1 66  ? -9.728  4.668   -6.264  1.00 0.00 ? 66  ASP A OD2  4  
ATOM 5987  H H    . ASP A 1 66  ? -10.354 3.525   -1.912  1.00 0.00 ? 66  ASP A H    4  
ATOM 5988  H HA   . ASP A 1 66  ? -11.907 2.461   -4.175  1.00 0.00 ? 66  ASP A HA   4  
ATOM 5989  H HB2  . ASP A 1 66  ? -9.000  3.240   -3.943  1.00 0.00 ? 66  ASP A HB2  4  
ATOM 5990  H HB3  . ASP A 1 66  ? -9.635  2.319   -5.303  1.00 0.00 ? 66  ASP A HB3  4  
ATOM 5991  N N    . GLU A 1 67  ? -10.583 0.147   -4.245  1.00 0.00 ? 67  GLU A N    4  
ATOM 5992  C CA   . GLU A 1 67  ? -10.265 -1.256  -4.008  1.00 0.00 ? 67  GLU A CA   4  
ATOM 5993  C C    . GLU A 1 67  ? -9.045  -1.682  -4.820  1.00 0.00 ? 67  GLU A C    4  
ATOM 5994  O O    . GLU A 1 67  ? -9.089  -1.724  -6.050  1.00 0.00 ? 67  GLU A O    4  
ATOM 5995  C CB   . GLU A 1 67  ? -11.462 -2.140  -4.365  1.00 0.00 ? 67  GLU A CB   4  
ATOM 5996  C CG   . GLU A 1 67  ? -11.148 -3.627  -4.347  1.00 0.00 ? 67  GLU A CG   4  
ATOM 5997  C CD   . GLU A 1 67  ? -11.246 -4.227  -2.958  1.00 0.00 ? 67  GLU A CD   4  
ATOM 5998  O OE1  . GLU A 1 67  ? -10.265 -4.115  -2.193  1.00 0.00 ? 67  GLU A OE1  4  
ATOM 5999  O OE2  . GLU A 1 67  ? -12.303 -4.808  -2.635  1.00 0.00 ? 67  GLU A OE2  4  
ATOM 6000  H H    . GLU A 1 67  ? -10.771 0.448   -5.158  1.00 0.00 ? 67  GLU A H    4  
ATOM 6001  H HA   . GLU A 1 67  ? -10.043 -1.373  -2.959  1.00 0.00 ? 67  GLU A HA   4  
ATOM 6002  H HB2  . GLU A 1 67  ? -12.257 -1.952  -3.657  1.00 0.00 ? 67  GLU A HB2  4  
ATOM 6003  H HB3  . GLU A 1 67  ? -11.805 -1.878  -5.355  1.00 0.00 ? 67  GLU A HB3  4  
ATOM 6004  H HG2  . GLU A 1 67  ? -11.846 -4.137  -4.993  1.00 0.00 ? 67  GLU A HG2  4  
ATOM 6005  H HG3  . GLU A 1 67  ? -10.144 -3.774  -4.716  1.00 0.00 ? 67  GLU A HG3  4  
ATOM 6006  N N    . ILE A 1 68  ? -7.958  -1.996  -4.123  1.00 0.00 ? 68  ILE A N    4  
ATOM 6007  C CA   . ILE A 1 68  ? -6.727  -2.419  -4.778  1.00 0.00 ? 68  ILE A CA   4  
ATOM 6008  C C    . ILE A 1 68  ? -6.736  -3.919  -5.051  1.00 0.00 ? 68  ILE A C    4  
ATOM 6009  O O    . ILE A 1 68  ? -7.224  -4.706  -4.238  1.00 0.00 ? 68  ILE A O    4  
ATOM 6010  C CB   . ILE A 1 68  ? -5.490  -2.070  -3.929  1.00 0.00 ? 68  ILE A CB   4  
ATOM 6011  C CG1  . ILE A 1 68  ? -5.546  -0.608  -3.482  1.00 0.00 ? 68  ILE A CG1  4  
ATOM 6012  C CG2  . ILE A 1 68  ? -4.215  -2.341  -4.715  1.00 0.00 ? 68  ILE A CG2  4  
ATOM 6013  C CD1  . ILE A 1 68  ? -5.356  0.377   -4.613  1.00 0.00 ? 68  ILE A CD1  4  
ATOM 6014  H H    . ILE A 1 68  ? -7.986  -1.942  -3.145  1.00 0.00 ? 68  ILE A H    4  
ATOM 6015  H HA   . ILE A 1 68  ? -6.653  -1.893  -5.719  1.00 0.00 ? 68  ILE A HA   4  
ATOM 6016  H HB   . ILE A 1 68  ? -5.488  -2.707  -3.057  1.00 0.00 ? 68  ILE A HB   4  
ATOM 6017  H HG12 . ILE A 1 68  ? -6.506  -0.413  -3.030  1.00 0.00 ? 68  ILE A HG12 4  
ATOM 6018  H HG13 . ILE A 1 68  ? -4.768  -0.433  -2.753  1.00 0.00 ? 68  ILE A HG13 4  
ATOM 6019  H HG21 . ILE A 1 68  ? -4.469  -2.625  -5.726  1.00 0.00 ? 68  ILE A HG21 4  
ATOM 6020  H HG22 . ILE A 1 68  ? -3.609  -1.448  -4.734  1.00 0.00 ? 68  ILE A HG22 4  
ATOM 6021  H HG23 . ILE A 1 68  ? -3.665  -3.141  -4.244  1.00 0.00 ? 68  ILE A HG23 4  
ATOM 6022  H HD11 . ILE A 1 68  ? -4.369  0.812   -4.551  1.00 0.00 ? 68  ILE A HD11 4  
ATOM 6023  H HD12 . ILE A 1 68  ? -5.467  -0.133  -5.558  1.00 0.00 ? 68  ILE A HD12 4  
ATOM 6024  H HD13 . ILE A 1 68  ? -6.098  1.160   -4.537  1.00 0.00 ? 68  ILE A HD13 4  
ATOM 6025  N N    . LEU A 1 69  ? -6.193  -4.309  -6.199  1.00 0.00 ? 69  LEU A N    4  
ATOM 6026  C CA   . LEU A 1 69  ? -6.137  -5.716  -6.579  1.00 0.00 ? 69  LEU A CA   4  
ATOM 6027  C C    . LEU A 1 69  ? -4.694  -6.170  -6.774  1.00 0.00 ? 69  LEU A C    4  
ATOM 6028  O O    . LEU A 1 69  ? -4.335  -7.293  -6.422  1.00 0.00 ? 69  LEU A O    4  
ATOM 6029  C CB   . LEU A 1 69  ? -6.935  -5.950  -7.863  1.00 0.00 ? 69  LEU A CB   4  
ATOM 6030  C CG   . LEU A 1 69  ? -8.389  -5.478  -7.845  1.00 0.00 ? 69  LEU A CG   4  
ATOM 6031  C CD1  . LEU A 1 69  ? -8.855  -5.130  -9.250  1.00 0.00 ? 69  LEU A CD1  4  
ATOM 6032  C CD2  . LEU A 1 69  ? -9.288  -6.541  -7.232  1.00 0.00 ? 69  LEU A CD2  4  
ATOM 6033  H H    . LEU A 1 69  ? -5.821  -3.636  -6.805  1.00 0.00 ? 69  LEU A H    4  
ATOM 6034  H HA   . LEU A 1 69  ? -6.579  -6.293  -5.780  1.00 0.00 ? 69  LEU A HA   4  
ATOM 6035  H HB2  . LEU A 1 69  ? -6.430  -5.433  -8.665  1.00 0.00 ? 69  LEU A HB2  4  
ATOM 6036  H HB3  . LEU A 1 69  ? -6.933  -7.012  -8.064  1.00 0.00 ? 69  LEU A HB3  4  
ATOM 6037  H HG   . LEU A 1 69  ? -8.464  -4.585  -7.239  1.00 0.00 ? 69  LEU A HG   4  
ATOM 6038  H HD11 . LEU A 1 69  ? -8.049  -4.656  -9.790  1.00 0.00 ? 69  LEU A HD11 4  
ATOM 6039  H HD12 . LEU A 1 69  ? -9.696  -4.455  -9.194  1.00 0.00 ? 69  LEU A HD12 4  
ATOM 6040  H HD13 . LEU A 1 69  ? -9.152  -6.032  -9.765  1.00 0.00 ? 69  LEU A HD13 4  
ATOM 6041  H HD21 . LEU A 1 69  ? -8.805  -6.962  -6.362  1.00 0.00 ? 69  LEU A HD21 4  
ATOM 6042  H HD22 . LEU A 1 69  ? -9.468  -7.322  -7.956  1.00 0.00 ? 69  LEU A HD22 4  
ATOM 6043  H HD23 . LEU A 1 69  ? -10.227 -6.095  -6.941  1.00 0.00 ? 69  LEU A HD23 4  
ATOM 6044  N N    . GLU A 1 70  ? -3.872  -5.289  -7.335  1.00 0.00 ? 70  GLU A N    4  
ATOM 6045  C CA   . GLU A 1 70  ? -2.468  -5.600  -7.574  1.00 0.00 ? 70  GLU A CA   4  
ATOM 6046  C C    . GLU A 1 70  ? -1.619  -4.332  -7.554  1.00 0.00 ? 70  GLU A C    4  
ATOM 6047  O O    . GLU A 1 70  ? -2.112  -3.238  -7.831  1.00 0.00 ? 70  GLU A O    4  
ATOM 6048  C CB   . GLU A 1 70  ? -2.303  -6.316  -8.916  1.00 0.00 ? 70  GLU A CB   4  
ATOM 6049  C CG   . GLU A 1 70  ? -2.472  -7.823  -8.826  1.00 0.00 ? 70  GLU A CG   4  
ATOM 6050  C CD   . GLU A 1 70  ? -3.928  -8.248  -8.830  1.00 0.00 ? 70  GLU A CD   4  
ATOM 6051  O OE1  . GLU A 1 70  ? -4.748  -7.547  -9.459  1.00 0.00 ? 70  GLU A OE1  4  
ATOM 6052  O OE2  . GLU A 1 70  ? -4.247  -9.280  -8.204  1.00 0.00 ? 70  GLU A OE2  4  
ATOM 6053  H H    . GLU A 1 70  ? -4.218  -4.409  -7.594  1.00 0.00 ? 70  GLU A H    4  
ATOM 6054  H HA   . GLU A 1 70  ? -2.134  -6.255  -6.784  1.00 0.00 ? 70  GLU A HA   4  
ATOM 6055  H HB2  . GLU A 1 70  ? -3.038  -5.932  -9.608  1.00 0.00 ? 70  GLU A HB2  4  
ATOM 6056  H HB3  . GLU A 1 70  ? -1.315  -6.109  -9.302  1.00 0.00 ? 70  GLU A HB3  4  
ATOM 6057  H HG2  . GLU A 1 70  ? -1.979  -8.279  -9.671  1.00 0.00 ? 70  GLU A HG2  4  
ATOM 6058  H HG3  . GLU A 1 70  ? -2.013  -8.171  -7.912  1.00 0.00 ? 70  GLU A HG3  4  
ATOM 6059  N N    . ILE A 1 71  ? -0.341  -4.488  -7.225  1.00 0.00 ? 71  ILE A N    4  
ATOM 6060  C CA   . ILE A 1 71  ? 0.577   -3.357  -7.169  1.00 0.00 ? 71  ILE A CA   4  
ATOM 6061  C C    . ILE A 1 71  ? 1.872   -3.663  -7.912  1.00 0.00 ? 71  ILE A C    4  
ATOM 6062  O O    . ILE A 1 71  ? 2.741   -4.367  -7.401  1.00 0.00 ? 71  ILE A O    4  
ATOM 6063  C CB   . ILE A 1 71  ? 0.910   -2.973  -5.715  1.00 0.00 ? 71  ILE A CB   4  
ATOM 6064  C CG1  . ILE A 1 71  ? -0.352  -2.513  -4.983  1.00 0.00 ? 71  ILE A CG1  4  
ATOM 6065  C CG2  . ILE A 1 71  ? 1.974   -1.886  -5.685  1.00 0.00 ? 71  ILE A CG2  4  
ATOM 6066  C CD1  . ILE A 1 71  ? -0.174  -2.396  -3.486  1.00 0.00 ? 71  ILE A CD1  4  
ATOM 6067  H H    . ILE A 1 71  ? -0.007  -5.385  -7.015  1.00 0.00 ? 71  ILE A H    4  
ATOM 6068  H HA   . ILE A 1 71  ? 0.094   -2.513  -7.641  1.00 0.00 ? 71  ILE A HA   4  
ATOM 6069  H HB   . ILE A 1 71  ? 1.307   -3.846  -5.219  1.00 0.00 ? 71  ILE A HB   4  
ATOM 6070  H HG12 . ILE A 1 71  ? -0.645  -1.544  -5.358  1.00 0.00 ? 71  ILE A HG12 4  
ATOM 6071  H HG13 . ILE A 1 71  ? -1.146  -3.221  -5.170  1.00 0.00 ? 71  ILE A HG13 4  
ATOM 6072  H HG21 . ILE A 1 71  ? 2.875   -2.251  -6.154  1.00 0.00 ? 71  ILE A HG21 4  
ATOM 6073  H HG22 . ILE A 1 71  ? 1.616   -1.019  -6.219  1.00 0.00 ? 71  ILE A HG22 4  
ATOM 6074  H HG23 . ILE A 1 71  ? 2.184   -1.617  -4.661  1.00 0.00 ? 71  ILE A HG23 4  
ATOM 6075  H HD11 . ILE A 1 71  ? -0.622  -1.476  -3.140  1.00 0.00 ? 71  ILE A HD11 4  
ATOM 6076  H HD12 . ILE A 1 71  ? -0.650  -3.235  -3.000  1.00 0.00 ? 71  ILE A HD12 4  
ATOM 6077  H HD13 . ILE A 1 71  ? 0.880   -2.394  -3.248  1.00 0.00 ? 71  ILE A HD13 4  
ATOM 6078  N N    . ASN A 1 72  ? 1.995   -3.126  -9.122  1.00 0.00 ? 72  ASN A N    4  
ATOM 6079  C CA   . ASN A 1 72  ? 3.186   -3.341  -9.936  1.00 0.00 ? 72  ASN A CA   4  
ATOM 6080  C C    . ASN A 1 72  ? 3.347   -4.817  -10.285 1.00 0.00 ? 72  ASN A C    4  
ATOM 6081  O O    . ASN A 1 72  ? 4.425   -5.389  -10.126 1.00 0.00 ? 72  ASN A O    4  
ATOM 6082  C CB   . ASN A 1 72  ? 4.430   -2.840  -9.199  1.00 0.00 ? 72  ASN A CB   4  
ATOM 6083  C CG   . ASN A 1 72  ? 4.336   -1.370  -8.840  1.00 0.00 ? 72  ASN A CG   4  
ATOM 6084  O OD1  . ASN A 1 72  ? 3.253   -0.854  -8.566  1.00 0.00 ? 72  ASN A OD1  4  
ATOM 6085  N ND2  . ASN A 1 72  ? 5.476   -0.688  -8.839  1.00 0.00 ? 72  ASN A ND2  4  
ATOM 6086  H H    . ASN A 1 72  ? 1.268   -2.573  -9.476  1.00 0.00 ? 72  ASN A H    4  
ATOM 6087  H HA   . ASN A 1 72  ? 3.068   -2.777  -10.850 1.00 0.00 ? 72  ASN A HA   4  
ATOM 6088  H HB2  . ASN A 1 72  ? 4.553   -3.407  -8.288  1.00 0.00 ? 72  ASN A HB2  4  
ATOM 6089  H HB3  . ASN A 1 72  ? 5.296   -2.985  -9.828  1.00 0.00 ? 72  ASN A HB3  4  
ATOM 6090  H HD21 . ASN A 1 72  ? 6.301   -1.164  -9.067  1.00 0.00 ? 72  ASN A HD21 4  
ATOM 6091  H HD22 . ASN A 1 72  ? 5.444   0.264   -8.610  1.00 0.00 ? 72  ASN A HD22 4  
ATOM 6092  N N    . ASN A 1 73  ? 2.268   -5.428  -10.763 1.00 0.00 ? 73  ASN A N    4  
ATOM 6093  C CA   . ASN A 1 73  ? 2.289   -6.838  -11.135 1.00 0.00 ? 73  ASN A CA   4  
ATOM 6094  C C    . ASN A 1 73  ? 2.555   -7.718  -9.917  1.00 0.00 ? 73  ASN A C    4  
ATOM 6095  O O    . ASN A 1 73  ? 3.168   -8.780  -10.028 1.00 0.00 ? 73  ASN A O    4  
ATOM 6096  C CB   . ASN A 1 73  ? 3.357   -7.089  -12.202 1.00 0.00 ? 73  ASN A CB   4  
ATOM 6097  C CG   . ASN A 1 73  ? 3.166   -6.215  -13.427 1.00 0.00 ? 73  ASN A CG   4  
ATOM 6098  O OD1  . ASN A 1 73  ? 2.039   -5.943  -13.839 1.00 0.00 ? 73  ASN A OD1  4  
ATOM 6099  N ND2  . ASN A 1 73  ? 4.271   -5.772  -14.015 1.00 0.00 ? 73  ASN A ND2  4  
ATOM 6100  H H    . ASN A 1 73  ? 1.437   -4.919  -10.867 1.00 0.00 ? 73  ASN A H    4  
ATOM 6101  H HA   . ASN A 1 73  ? 1.321   -7.088  -11.541 1.00 0.00 ? 73  ASN A HA   4  
ATOM 6102  H HB2  . ASN A 1 73  ? 4.331   -6.882  -11.784 1.00 0.00 ? 73  ASN A HB2  4  
ATOM 6103  H HB3  . ASN A 1 73  ? 3.314   -8.123  -12.509 1.00 0.00 ? 73  ASN A HB3  4  
ATOM 6104  H HD21 . ASN A 1 73  ? 5.136   -6.030  -13.631 1.00 0.00 ? 73  ASN A HD21 4  
ATOM 6105  H HD22 . ASN A 1 73  ? 4.177   -5.205  -14.808 1.00 0.00 ? 73  ASN A HD22 4  
ATOM 6106  N N    . ARG A 1 74  ? 2.089   -7.269  -8.756  1.00 0.00 ? 74  ARG A N    4  
ATOM 6107  C CA   . ARG A 1 74  ? 2.277   -8.014  -7.518  1.00 0.00 ? 74  ARG A CA   4  
ATOM 6108  C C    . ARG A 1 74  ? 0.963   -8.134  -6.751  1.00 0.00 ? 74  ARG A C    4  
ATOM 6109  O O    . ARG A 1 74  ? 0.236   -7.154  -6.589  1.00 0.00 ? 74  ARG A O    4  
ATOM 6110  C CB   . ARG A 1 74  ? 3.331   -7.334  -6.642  1.00 0.00 ? 74  ARG A CB   4  
ATOM 6111  C CG   . ARG A 1 74  ? 4.705   -7.262  -7.288  1.00 0.00 ? 74  ARG A CG   4  
ATOM 6112  C CD   . ARG A 1 74  ? 5.467   -8.568  -7.123  1.00 0.00 ? 74  ARG A CD   4  
ATOM 6113  N NE   . ARG A 1 74  ? 5.177   -9.510  -8.201  1.00 0.00 ? 74  ARG A NE   4  
ATOM 6114  C CZ   . ARG A 1 74  ? 5.743   -10.708 -8.301  1.00 0.00 ? 74  ARG A CZ   4  
ATOM 6115  N NH1  . ARG A 1 74  ? 6.624   -11.107 -7.394  1.00 0.00 ? 74  ARG A NH1  4  
ATOM 6116  N NH2  . ARG A 1 74  ? 5.429   -11.509 -9.311  1.00 0.00 ? 74  ARG A NH2  4  
ATOM 6117  H H    . ARG A 1 74  ? 1.609   -6.415  -8.732  1.00 0.00 ? 74  ARG A H    4  
ATOM 6118  H HA   . ARG A 1 74  ? 2.621   -9.005  -7.775  1.00 0.00 ? 74  ARG A HA   4  
ATOM 6119  H HB2  . ARG A 1 74  ? 3.006   -6.326  -6.426  1.00 0.00 ? 74  ARG A HB2  4  
ATOM 6120  H HB3  . ARG A 1 74  ? 3.420   -7.881  -5.716  1.00 0.00 ? 74  ARG A HB3  4  
ATOM 6121  H HG2  . ARG A 1 74  ? 4.587   -7.058  -8.342  1.00 0.00 ? 74  ARG A HG2  4  
ATOM 6122  H HG3  . ARG A 1 74  ? 5.268   -6.465  -6.825  1.00 0.00 ? 74  ARG A HG3  4  
ATOM 6123  H HD2  . ARG A 1 74  ? 6.525   -8.354  -7.119  1.00 0.00 ? 74  ARG A HD2  4  
ATOM 6124  H HD3  . ARG A 1 74  ? 5.187   -9.015  -6.181  1.00 0.00 ? 74  ARG A HD3  4  
ATOM 6125  H HE   . ARG A 1 74  ? 4.530   -9.235  -8.882  1.00 0.00 ? 74  ARG A HE   4  
ATOM 6126  H HH11 . ARG A 1 74  ? 6.862   -10.506 -6.631  1.00 0.00 ? 74  ARG A HH11 4  
ATOM 6127  H HH12 . ARG A 1 74  ? 7.047   -12.010 -7.471  1.00 0.00 ? 74  ARG A HH12 4  
ATOM 6128  H HH21 . ARG A 1 74  ? 4.765   -11.211 -9.997  1.00 0.00 ? 74  ARG A HH21 4  
ATOM 6129  H HH22 . ARG A 1 74  ? 5.855   -12.410 -9.386  1.00 0.00 ? 74  ARG A HH22 4  
ATOM 6130  N N    . ALA A 1 75  ? 0.666   -9.341  -6.281  1.00 0.00 ? 75  ALA A N    4  
ATOM 6131  C CA   . ALA A 1 75  ? -0.559  -9.589  -5.531  1.00 0.00 ? 75  ALA A CA   4  
ATOM 6132  C C    . ALA A 1 75  ? -0.456  -9.034  -4.114  1.00 0.00 ? 75  ALA A C    4  
ATOM 6133  O O    . ALA A 1 75  ? 0.385   -9.469  -3.327  1.00 0.00 ? 75  ALA A O    4  
ATOM 6134  C CB   . ALA A 1 75  ? -0.865  -11.079 -5.496  1.00 0.00 ? 75  ALA A CB   4  
ATOM 6135  H H    . ALA A 1 75  ? 1.286   -10.083 -6.443  1.00 0.00 ? 75  ALA A H    4  
ATOM 6136  H HA   . ALA A 1 75  ? -1.370  -9.091  -6.043  1.00 0.00 ? 75  ALA A HA   4  
ATOM 6137  H HB1  . ALA A 1 75  ? -0.039  -11.625 -5.929  1.00 0.00 ? 75  ALA A HB1  4  
ATOM 6138  H HB2  . ALA A 1 75  ? -1.007  -11.393 -4.473  1.00 0.00 ? 75  ALA A HB2  4  
ATOM 6139  H HB3  . ALA A 1 75  ? -1.763  -11.275 -6.061  1.00 0.00 ? 75  ALA A HB3  4  
ATOM 6140  N N    . ALA A 1 76  ? -1.315  -8.072  -3.796  1.00 0.00 ? 76  ALA A N    4  
ATOM 6141  C CA   . ALA A 1 76  ? -1.321  -7.460  -2.473  1.00 0.00 ? 76  ALA A CA   4  
ATOM 6142  C C    . ALA A 1 76  ? -1.067  -8.498  -1.386  1.00 0.00 ? 76  ALA A C    4  
ATOM 6143  O O    . ALA A 1 76  ? -0.105  -8.393  -0.625  1.00 0.00 ? 76  ALA A O    4  
ATOM 6144  C CB   . ALA A 1 76  ? -2.643  -6.747  -2.227  1.00 0.00 ? 76  ALA A CB   4  
ATOM 6145  H H    . ALA A 1 76  ? -1.962  -7.768  -4.466  1.00 0.00 ? 76  ALA A H    4  
ATOM 6146  H HA   . ALA A 1 76  ? -0.532  -6.722  -2.443  1.00 0.00 ? 76  ALA A HA   4  
ATOM 6147  H HB1  . ALA A 1 76  ? -3.101  -7.140  -1.330  1.00 0.00 ? 76  ALA A HB1  4  
ATOM 6148  H HB2  . ALA A 1 76  ? -2.464  -5.689  -2.107  1.00 0.00 ? 76  ALA A HB2  4  
ATOM 6149  H HB3  . ALA A 1 76  ? -3.301  -6.910  -3.068  1.00 0.00 ? 76  ALA A HB3  4  
ATOM 6150  N N    . ASP A 1 77  ? -1.937  -9.501  -1.317  1.00 0.00 ? 77  ASP A N    4  
ATOM 6151  C CA   . ASP A 1 77  ? -1.806  -10.559 -0.323  1.00 0.00 ? 77  ASP A CA   4  
ATOM 6152  C C    . ASP A 1 77  ? -0.388  -11.120 -0.309  1.00 0.00 ? 77  ASP A C    4  
ATOM 6153  O O    . ASP A 1 77  ? 0.148   -11.454 0.748   1.00 0.00 ? 77  ASP A O    4  
ATOM 6154  C CB   . ASP A 1 77  ? -2.808  -11.680 -0.606  1.00 0.00 ? 77  ASP A CB   4  
ATOM 6155  C CG   . ASP A 1 77  ? -2.551  -12.365 -1.933  1.00 0.00 ? 77  ASP A CG   4  
ATOM 6156  O OD1  . ASP A 1 77  ? -1.591  -13.160 -2.013  1.00 0.00 ? 77  ASP A OD1  4  
ATOM 6157  O OD2  . ASP A 1 77  ? -3.308  -12.106 -2.892  1.00 0.00 ? 77  ASP A OD2  4  
ATOM 6158  H H    . ASP A 1 77  ? -2.684  -9.529  -1.952  1.00 0.00 ? 77  ASP A H    4  
ATOM 6159  H HA   . ASP A 1 77  ? -2.021  -10.133 0.645   1.00 0.00 ? 77  ASP A HA   4  
ATOM 6160  H HB2  . ASP A 1 77  ? -2.742  -12.419 0.179   1.00 0.00 ? 77  ASP A HB2  4  
ATOM 6161  H HB3  . ASP A 1 77  ? -3.806  -11.266 -0.622  1.00 0.00 ? 77  ASP A HB3  4  
ATOM 6162  N N    . ALA A 1 78  ? 0.215   -11.221 -1.489  1.00 0.00 ? 78  ALA A N    4  
ATOM 6163  C CA   . ALA A 1 78  ? 1.571   -11.740 -1.612  1.00 0.00 ? 78  ALA A CA   4  
ATOM 6164  C C    . ALA A 1 78  ? 2.592   -10.740 -1.082  1.00 0.00 ? 78  ALA A C    4  
ATOM 6165  O O    . ALA A 1 78  ? 3.676   -11.120 -0.637  1.00 0.00 ? 78  ALA A O    4  
ATOM 6166  C CB   . ALA A 1 78  ? 1.873   -12.088 -3.062  1.00 0.00 ? 78  ALA A CB   4  
ATOM 6167  H H    . ALA A 1 78  ? -0.264  -10.938 -2.296  1.00 0.00 ? 78  ALA A H    4  
ATOM 6168  H HA   . ALA A 1 78  ? 1.635   -12.648 -1.029  1.00 0.00 ? 78  ALA A HA   4  
ATOM 6169  H HB1  . ALA A 1 78  ? 2.339   -13.062 -3.108  1.00 0.00 ? 78  ALA A HB1  4  
ATOM 6170  H HB2  . ALA A 1 78  ? 0.954   -12.102 -3.628  1.00 0.00 ? 78  ALA A HB2  4  
ATOM 6171  H HB3  . ALA A 1 78  ? 2.542   -11.349 -3.478  1.00 0.00 ? 78  ALA A HB3  4  
ATOM 6172  N N    . LEU A 1 79  ? 2.241   -9.460  -1.134  1.00 0.00 ? 79  LEU A N    4  
ATOM 6173  C CA   . LEU A 1 79  ? 3.128   -8.403  -0.660  1.00 0.00 ? 79  LEU A CA   4  
ATOM 6174  C C    . LEU A 1 79  ? 2.962   -8.186  0.841   1.00 0.00 ? 79  LEU A C    4  
ATOM 6175  O O    . LEU A 1 79  ? 1.874   -8.362  1.387   1.00 0.00 ? 79  LEU A O    4  
ATOM 6176  C CB   . LEU A 1 79  ? 2.847   -7.099  -1.409  1.00 0.00 ? 79  LEU A CB   4  
ATOM 6177  C CG   . LEU A 1 79  ? 2.893   -7.180  -2.936  1.00 0.00 ? 79  LEU A CG   4  
ATOM 6178  C CD1  . LEU A 1 79  ? 2.218   -5.965  -3.554  1.00 0.00 ? 79  LEU A CD1  4  
ATOM 6179  C CD2  . LEU A 1 79  ? 4.330   -7.299  -3.421  1.00 0.00 ? 79  LEU A CD2  4  
ATOM 6180  H H    . LEU A 1 79  ? 1.365   -9.218  -1.500  1.00 0.00 ? 79  LEU A H    4  
ATOM 6181  H HA   . LEU A 1 79  ? 4.144   -8.710  -0.857  1.00 0.00 ? 79  LEU A HA   4  
ATOM 6182  H HB2  . LEU A 1 79  ? 1.863   -6.760  -1.126  1.00 0.00 ? 79  LEU A HB2  4  
ATOM 6183  H HB3  . LEU A 1 79  ? 3.582   -6.372  -1.093  1.00 0.00 ? 79  LEU A HB3  4  
ATOM 6184  H HG   . LEU A 1 79  ? 2.356   -8.061  -3.260  1.00 0.00 ? 79  LEU A HG   4  
ATOM 6185  H HD11 . LEU A 1 79  ? 2.783   -5.639  -4.415  1.00 0.00 ? 79  LEU A HD11 4  
ATOM 6186  H HD12 . LEU A 1 79  ? 2.176   -5.168  -2.828  1.00 0.00 ? 79  LEU A HD12 4  
ATOM 6187  H HD13 . LEU A 1 79  ? 1.215   -6.227  -3.860  1.00 0.00 ? 79  LEU A HD13 4  
ATOM 6188  H HD21 . LEU A 1 79  ? 4.573   -8.340  -3.575  1.00 0.00 ? 79  LEU A HD21 4  
ATOM 6189  H HD22 . LEU A 1 79  ? 4.996   -6.880  -2.680  1.00 0.00 ? 79  LEU A HD22 4  
ATOM 6190  H HD23 . LEU A 1 79  ? 4.442   -6.761  -4.351  1.00 0.00 ? 79  LEU A HD23 4  
ATOM 6191  N N    . ASN A 1 80  ? 4.049   -7.800  1.501   1.00 0.00 ? 80  ASN A N    4  
ATOM 6192  C CA   . ASN A 1 80  ? 4.024   -7.557  2.939   1.00 0.00 ? 80  ASN A CA   4  
ATOM 6193  C C    . ASN A 1 80  ? 4.304   -6.089  3.248   1.00 0.00 ? 80  ASN A C    4  
ATOM 6194  O O    . ASN A 1 80  ? 4.829   -5.357  2.409   1.00 0.00 ? 80  ASN A O    4  
ATOM 6195  C CB   . ASN A 1 80  ? 5.051   -8.443  3.646   1.00 0.00 ? 80  ASN A CB   4  
ATOM 6196  C CG   . ASN A 1 80  ? 5.214   -9.791  2.969   1.00 0.00 ? 80  ASN A CG   4  
ATOM 6197  O OD1  . ASN A 1 80  ? 4.642   -10.790 3.405   1.00 0.00 ? 80  ASN A OD1  4  
ATOM 6198  N ND2  . ASN A 1 80  ? 5.999   -9.824  1.898   1.00 0.00 ? 80  ASN A ND2  4  
ATOM 6199  H H    . ASN A 1 80  ? 4.888   -7.676  1.011   1.00 0.00 ? 80  ASN A H    4  
ATOM 6200  H HA   . ASN A 1 80  ? 3.037   -7.806  3.300   1.00 0.00 ? 80  ASN A HA   4  
ATOM 6201  H HB2  . ASN A 1 80  ? 6.009   -7.944  3.646   1.00 0.00 ? 80  ASN A HB2  4  
ATOM 6202  H HB3  . ASN A 1 80  ? 4.735   -8.608  4.665   1.00 0.00 ? 80  ASN A HB3  4  
ATOM 6203  H HD21 . ASN A 1 80  ? 6.422   -8.988  1.609   1.00 0.00 ? 80  ASN A HD21 4  
ATOM 6204  H HD22 . ASN A 1 80  ? 6.122   -10.682 1.441   1.00 0.00 ? 80  ASN A HD22 4  
ATOM 6205  N N    . SER A 1 81  ? 3.950   -5.666  4.457   1.00 0.00 ? 81  SER A N    4  
ATOM 6206  C CA   . SER A 1 81  ? 4.161   -4.285  4.876   1.00 0.00 ? 81  SER A CA   4  
ATOM 6207  C C    . SER A 1 81  ? 5.516   -3.773  4.398   1.00 0.00 ? 81  SER A C    4  
ATOM 6208  O O    . SER A 1 81  ? 5.645   -2.624  3.978   1.00 0.00 ? 81  SER A O    4  
ATOM 6209  C CB   . SER A 1 81  ? 4.069   -4.172  6.399   1.00 0.00 ? 81  SER A CB   4  
ATOM 6210  O OG   . SER A 1 81  ? 5.010   -5.022  7.031   1.00 0.00 ? 81  SER A OG   4  
ATOM 6211  H H    . SER A 1 81  ? 3.536   -6.298  5.082   1.00 0.00 ? 81  SER A H    4  
ATOM 6212  H HA   . SER A 1 81  ? 3.384   -3.682  4.431   1.00 0.00 ? 81  SER A HA   4  
ATOM 6213  H HB2  . SER A 1 81  ? 4.267   -3.153  6.694   1.00 0.00 ? 81  SER A HB2  4  
ATOM 6214  H HB3  . SER A 1 81  ? 3.076   -4.454  6.718   1.00 0.00 ? 81  SER A HB3  4  
ATOM 6215  H HG   . SER A 1 81  ? 4.666   -5.303  7.883   1.00 0.00 ? 81  SER A HG   4  
ATOM 6216  N N    . SER A 1 82  ? 6.525   -4.636  4.466   1.00 0.00 ? 82  SER A N    4  
ATOM 6217  C CA   . SER A 1 82  ? 7.873   -4.271  4.044   1.00 0.00 ? 82  SER A CA   4  
ATOM 6218  C C    . SER A 1 82  ? 7.887   -3.846  2.579   1.00 0.00 ? 82  SER A C    4  
ATOM 6219  O O    . SER A 1 82  ? 8.544   -2.873  2.210   1.00 0.00 ? 82  SER A O    4  
ATOM 6220  C CB   . SER A 1 82  ? 8.831   -5.445  4.255   1.00 0.00 ? 82  SER A CB   4  
ATOM 6221  O OG   . SER A 1 82  ? 10.086  -5.194  3.647   1.00 0.00 ? 82  SER A OG   4  
ATOM 6222  H H    . SER A 1 82  ? 6.360   -5.539  4.810   1.00 0.00 ? 82  SER A H    4  
ATOM 6223  H HA   . SER A 1 82  ? 8.196   -3.440  4.651   1.00 0.00 ? 82  SER A HA   4  
ATOM 6224  H HB2  . SER A 1 82  ? 8.981   -5.598  5.313   1.00 0.00 ? 82  SER A HB2  4  
ATOM 6225  H HB3  . SER A 1 82  ? 8.405   -6.337  3.818   1.00 0.00 ? 82  SER A HB3  4  
ATOM 6226  H HG   . SER A 1 82  ? 10.199  -5.775  2.892   1.00 0.00 ? 82  SER A HG   4  
ATOM 6227  N N    . MET A 1 83  ? 7.156   -4.582  1.748   1.00 0.00 ? 83  MET A N    4  
ATOM 6228  C CA   . MET A 1 83  ? 7.083   -4.281  0.323   1.00 0.00 ? 83  MET A CA   4  
ATOM 6229  C C    . MET A 1 83  ? 6.427   -2.924  0.088   1.00 0.00 ? 83  MET A C    4  
ATOM 6230  O O    . MET A 1 83  ? 7.040   -2.016  -0.475  1.00 0.00 ? 83  MET A O    4  
ATOM 6231  C CB   . MET A 1 83  ? 6.302   -5.372  -0.411  1.00 0.00 ? 83  MET A CB   4  
ATOM 6232  C CG   . MET A 1 83  ? 6.756   -6.781  -0.066  1.00 0.00 ? 83  MET A CG   4  
ATOM 6233  S SD   . MET A 1 83  ? 8.481   -7.080  -0.497  1.00 0.00 ? 83  MET A SD   4  
ATOM 6234  C CE   . MET A 1 83  ? 8.616   -8.833  -0.160  1.00 0.00 ? 83  MET A CE   4  
ATOM 6235  H H    . MET A 1 83  ? 6.653   -5.346  2.101   1.00 0.00 ? 83  MET A H    4  
ATOM 6236  H HA   . MET A 1 83  ? 8.091   -4.252  -0.061  1.00 0.00 ? 83  MET A HA   4  
ATOM 6237  H HB2  . MET A 1 83  ? 5.256   -5.282  -0.158  1.00 0.00 ? 83  MET A HB2  4  
ATOM 6238  H HB3  . MET A 1 83  ? 6.420   -5.230  -1.475  1.00 0.00 ? 83  MET A HB3  4  
ATOM 6239  H HG2  . MET A 1 83  ? 6.634   -6.935  0.995   1.00 0.00 ? 83  MET A HG2  4  
ATOM 6240  H HG3  . MET A 1 83  ? 6.138   -7.485  -0.603  1.00 0.00 ? 83  MET A HG3  4  
ATOM 6241  H HE1  . MET A 1 83  ? 7.888   -9.371  -0.749  1.00 0.00 ? 83  MET A HE1  4  
ATOM 6242  H HE2  . MET A 1 83  ? 9.609   -9.174  -0.415  1.00 0.00 ? 83  MET A HE2  4  
ATOM 6243  H HE3  . MET A 1 83  ? 8.433   -9.013  0.890   1.00 0.00 ? 83  MET A HE3  4  
ATOM 6244  N N    . LEU A 1 84  ? 5.178   -2.792  0.521   1.00 0.00 ? 84  LEU A N    4  
ATOM 6245  C CA   . LEU A 1 84  ? 4.438   -1.546  0.356   1.00 0.00 ? 84  LEU A CA   4  
ATOM 6246  C C    . LEU A 1 84  ? 5.344   -0.341  0.591   1.00 0.00 ? 84  LEU A C    4  
ATOM 6247  O O    . LEU A 1 84  ? 5.322   0.625   -0.173  1.00 0.00 ? 84  LEU A O    4  
ATOM 6248  C CB   . LEU A 1 84  ? 3.252   -1.502  1.321   1.00 0.00 ? 84  LEU A CB   4  
ATOM 6249  C CG   . LEU A 1 84  ? 1.983   -2.216  0.857   1.00 0.00 ? 84  LEU A CG   4  
ATOM 6250  C CD1  . LEU A 1 84  ? 1.059   -2.484  2.035   1.00 0.00 ? 84  LEU A CD1  4  
ATOM 6251  C CD2  . LEU A 1 84  ? 1.268   -1.396  -0.208  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 6252  H H    . LEU A 1 84  ? 4.742   -3.551  0.961   1.00 0.00 ? 84  LEU A H    4  
ATOM 6253  H HA   . LEU A 1 84  ? 4.069   -1.511  -0.658  1.00 0.00 ? 84  LEU A HA   4  
ATOM 6254  H HB2  . LEU A 1 84  ? 3.565   -1.955  2.250   1.00 0.00 ? 84  LEU A HB2  4  
ATOM 6255  H HB3  . LEU A 1 84  ? 3.005   -0.464  1.494   1.00 0.00 ? 84  LEU A HB3  4  
ATOM 6256  H HG   . LEU A 1 84  ? 2.252   -3.169  0.421   1.00 0.00 ? 84  LEU A HG   4  
ATOM 6257  H HD11 . LEU A 1 84  ? 0.162   -2.973  1.686   1.00 0.00 ? 84  LEU A HD11 4  
ATOM 6258  H HD12 . LEU A 1 84  ? 0.798   -1.548  2.507   1.00 0.00 ? 84  LEU A HD12 4  
ATOM 6259  H HD13 . LEU A 1 84  ? 1.562   -3.119  2.749   1.00 0.00 ? 84  LEU A HD13 4  
ATOM 6260  H HD21 . LEU A 1 84  ? 0.719   -0.595  0.264   1.00 0.00 ? 84  LEU A HD21 4  
ATOM 6261  H HD22 . LEU A 1 84  ? 0.583   -2.031  -0.751  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 6262  H HD23 . LEU A 1 84  ? 1.995   -0.982  -0.890  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 6263  N N    . LYS A 1 85  ? 6.141   -0.404  1.652   1.00 0.00 ? 85  LYS A N    4  
ATOM 6264  C CA   . LYS A 1 85  ? 7.058   0.680   1.986   1.00 0.00 ? 85  LYS A CA   4  
ATOM 6265  C C    . LYS A 1 85  ? 8.060   0.912   0.860   1.00 0.00 ? 85  LYS A C    4  
ATOM 6266  O O    . LYS A 1 85  ? 8.244   2.041   0.403   1.00 0.00 ? 85  LYS A O    4  
ATOM 6267  C CB   . LYS A 1 85  ? 7.800   0.364   3.287   1.00 0.00 ? 85  LYS A CB   4  
ATOM 6268  C CG   . LYS A 1 85  ? 8.351   1.594   3.987   1.00 0.00 ? 85  LYS A CG   4  
ATOM 6269  C CD   . LYS A 1 85  ? 9.107   1.224   5.252   1.00 0.00 ? 85  LYS A CD   4  
ATOM 6270  C CE   . LYS A 1 85  ? 10.469  0.626   4.934   1.00 0.00 ? 85  LYS A CE   4  
ATOM 6271  N NZ   . LYS A 1 85  ? 11.501  1.679   4.723   1.00 0.00 ? 85  LYS A NZ   4  
ATOM 6272  H H    . LYS A 1 85  ? 6.113   -1.200  2.224   1.00 0.00 ? 85  LYS A H    4  
ATOM 6273  H HA   . LYS A 1 85  ? 6.474   1.577   2.124   1.00 0.00 ? 85  LYS A HA   4  
ATOM 6274  H HB2  . LYS A 1 85  ? 7.122   -0.136  3.962   1.00 0.00 ? 85  LYS A HB2  4  
ATOM 6275  H HB3  . LYS A 1 85  ? 8.626   -0.298  3.064   1.00 0.00 ? 85  LYS A HB3  4  
ATOM 6276  H HG2  . LYS A 1 85  ? 9.024   2.108   3.316   1.00 0.00 ? 85  LYS A HG2  4  
ATOM 6277  H HG3  . LYS A 1 85  ? 7.530   2.247   4.246   1.00 0.00 ? 85  LYS A HG3  4  
ATOM 6278  H HD2  . LYS A 1 85  ? 9.247   2.112   5.850   1.00 0.00 ? 85  LYS A HD2  4  
ATOM 6279  H HD3  . LYS A 1 85  ? 8.527   0.502   5.809   1.00 0.00 ? 85  LYS A HD3  4  
ATOM 6280  H HE2  . LYS A 1 85  ? 10.772  -0.004  5.756   1.00 0.00 ? 85  LYS A HE2  4  
ATOM 6281  H HE3  . LYS A 1 85  ? 10.385  0.031   4.036   1.00 0.00 ? 85  LYS A HE3  4  
ATOM 6282  H HZ1  . LYS A 1 85  ? 11.584  2.273   5.573   1.00 0.00 ? 85  LYS A HZ1  4  
ATOM 6283  H HZ2  . LYS A 1 85  ? 11.237  2.281   3.917   1.00 0.00 ? 85  LYS A HZ2  4  
ATOM 6284  H HZ3  . LYS A 1 85  ? 12.423  1.241   4.527   1.00 0.00 ? 85  LYS A HZ3  4  
ATOM 6285  N N    . ASP A 1 86  ? 8.703   -0.162  0.416   1.00 0.00 ? 86  ASP A N    4  
ATOM 6286  C CA   . ASP A 1 86  ? 9.685   -0.075  -0.659  1.00 0.00 ? 86  ASP A CA   4  
ATOM 6287  C C    . ASP A 1 86  ? 9.072   0.559   -1.904  1.00 0.00 ? 86  ASP A C    4  
ATOM 6288  O O    . ASP A 1 86  ? 9.642   1.482   -2.488  1.00 0.00 ? 86  ASP A O    4  
ATOM 6289  C CB   . ASP A 1 86  ? 10.229  -1.464  -0.995  1.00 0.00 ? 86  ASP A CB   4  
ATOM 6290  C CG   . ASP A 1 86  ? 11.612  -1.410  -1.614  1.00 0.00 ? 86  ASP A CG   4  
ATOM 6291  O OD1  . ASP A 1 86  ? 12.352  -0.444  -1.331  1.00 0.00 ? 86  ASP A OD1  4  
ATOM 6292  O OD2  . ASP A 1 86  ? 11.955  -2.333  -2.382  1.00 0.00 ? 86  ASP A OD2  4  
ATOM 6293  H H    . ASP A 1 86  ? 8.513   -1.034  0.820   1.00 0.00 ? 86  ASP A H    4  
ATOM 6294  H HA   . ASP A 1 86  ? 10.498  0.547   -0.317  1.00 0.00 ? 86  ASP A HA   4  
ATOM 6295  H HB2  . ASP A 1 86  ? 10.284  -2.051  -0.089  1.00 0.00 ? 86  ASP A HB2  4  
ATOM 6296  H HB3  . ASP A 1 86  ? 9.561   -1.947  -1.692  1.00 0.00 ? 86  ASP A HB3  4  
ATOM 6297  N N    . PHE A 1 87  ? 7.909   0.058   -2.306  1.00 0.00 ? 87  PHE A N    4  
ATOM 6298  C CA   . PHE A 1 87  ? 7.220   0.574   -3.483  1.00 0.00 ? 87  PHE A CA   4  
ATOM 6299  C C    . PHE A 1 87  ? 6.990   2.078   -3.363  1.00 0.00 ? 87  PHE A C    4  
ATOM 6300  O O    . PHE A 1 87  ? 7.401   2.851   -4.230  1.00 0.00 ? 87  PHE A O    4  
ATOM 6301  C CB   . PHE A 1 87  ? 5.883   -0.144  -3.673  1.00 0.00 ? 87  PHE A CB   4  
ATOM 6302  C CG   . PHE A 1 87  ? 5.981   -1.381  -4.520  1.00 0.00 ? 87  PHE A CG   4  
ATOM 6303  C CD1  . PHE A 1 87  ? 6.661   -1.357  -5.727  1.00 0.00 ? 87  PHE A CD1  4  
ATOM 6304  C CD2  . PHE A 1 87  ? 5.393   -2.566  -4.110  1.00 0.00 ? 87  PHE A CD2  4  
ATOM 6305  C CE1  . PHE A 1 87  ? 6.754   -2.494  -6.509  1.00 0.00 ? 87  PHE A CE1  4  
ATOM 6306  C CE2  . PHE A 1 87  ? 5.483   -3.706  -4.887  1.00 0.00 ? 87  PHE A CE2  4  
ATOM 6307  C CZ   . PHE A 1 87  ? 6.163   -3.669  -6.088  1.00 0.00 ? 87  PHE A CZ   4  
ATOM 6308  H H    . PHE A 1 87  ? 7.505   -0.677  -1.800  1.00 0.00 ? 87  PHE A H    4  
ATOM 6309  H HA   . PHE A 1 87  ? 7.846   0.385   -4.342  1.00 0.00 ? 87  PHE A HA   4  
ATOM 6310  H HB2  . PHE A 1 87  ? 5.497   -0.434  -2.707  1.00 0.00 ? 87  PHE A HB2  4  
ATOM 6311  H HB3  . PHE A 1 87  ? 5.185   0.530   -4.147  1.00 0.00 ? 87  PHE A HB3  4  
ATOM 6312  H HD1  . PHE A 1 87  ? 7.123   -0.438  -6.057  1.00 0.00 ? 87  PHE A HD1  4  
ATOM 6313  H HD2  . PHE A 1 87  ? 4.860   -2.596  -3.171  1.00 0.00 ? 87  PHE A HD2  4  
ATOM 6314  H HE1  . PHE A 1 87  ? 7.286   -2.461  -7.448  1.00 0.00 ? 87  PHE A HE1  4  
ATOM 6315  H HE2  . PHE A 1 87  ? 5.020   -4.623  -4.556  1.00 0.00 ? 87  PHE A HE2  4  
ATOM 6316  H HZ   . PHE A 1 87  ? 6.235   -4.558  -6.697  1.00 0.00 ? 87  PHE A HZ   4  
ATOM 6317  N N    . LEU A 1 88  ? 6.332   2.485   -2.284  1.00 0.00 ? 88  LEU A N    4  
ATOM 6318  C CA   . LEU A 1 88  ? 6.046   3.896   -2.049  1.00 0.00 ? 88  LEU A CA   4  
ATOM 6319  C C    . LEU A 1 88  ? 7.329   4.720   -2.056  1.00 0.00 ? 88  LEU A C    4  
ATOM 6320  O O    . LEU A 1 88  ? 7.295   5.939   -2.227  1.00 0.00 ? 88  LEU A O    4  
ATOM 6321  C CB   . LEU A 1 88  ? 5.319   4.074   -0.715  1.00 0.00 ? 88  LEU A CB   4  
ATOM 6322  C CG   . LEU A 1 88  ? 3.939   3.424   -0.610  1.00 0.00 ? 88  LEU A CG   4  
ATOM 6323  C CD1  . LEU A 1 88  ? 3.432   3.476   0.822   1.00 0.00 ? 88  LEU A CD1  4  
ATOM 6324  C CD2  . LEU A 1 88  ? 2.956   4.104   -1.552  1.00 0.00 ? 88  LEU A CD2  4  
ATOM 6325  H H    . LEU A 1 88  ? 6.030   1.822   -1.629  1.00 0.00 ? 88  LEU A H    4  
ATOM 6326  H HA   . LEU A 1 88  ? 5.406   4.242   -2.848  1.00 0.00 ? 88  LEU A HA   4  
ATOM 6327  H HB2  . LEU A 1 88  ? 5.942   3.655   0.059   1.00 0.00 ? 88  LEU A HB2  4  
ATOM 6328  H HB3  . LEU A 1 88  ? 5.200   5.135   -0.544  1.00 0.00 ? 88  LEU A HB3  4  
ATOM 6329  H HG   . LEU A 1 88  ? 4.015   2.384   -0.899  1.00 0.00 ? 88  LEU A HG   4  
ATOM 6330  H HD11 . LEU A 1 88  ? 3.490   2.492   1.261   1.00 0.00 ? 88  LEU A HD11 4  
ATOM 6331  H HD12 . LEU A 1 88  ? 2.406   3.813   0.829   1.00 0.00 ? 88  LEU A HD12 4  
ATOM 6332  H HD13 . LEU A 1 88  ? 4.039   4.163   1.394   1.00 0.00 ? 88  LEU A HD13 4  
ATOM 6333  H HD21 . LEU A 1 88  ? 3.011   3.640   -2.526  1.00 0.00 ? 88  LEU A HD21 4  
ATOM 6334  H HD22 . LEU A 1 88  ? 3.205   5.151   -1.637  1.00 0.00 ? 88  LEU A HD22 4  
ATOM 6335  H HD23 . LEU A 1 88  ? 1.954   4.002   -1.161  1.00 0.00 ? 88  LEU A HD23 4  
ATOM 6336  N N    . SER A 1 89  ? 8.460   4.046   -1.872  1.00 0.00 ? 89  SER A N    4  
ATOM 6337  C CA   . SER A 1 89  ? 9.755   4.716   -1.856  1.00 0.00 ? 89  SER A CA   4  
ATOM 6338  C C    . SER A 1 89  ? 10.255  4.967   -3.275  1.00 0.00 ? 89  SER A C    4  
ATOM 6339  O O    . SER A 1 89  ? 11.396  5.383   -3.478  1.00 0.00 ? 89  SER A O    4  
ATOM 6340  C CB   . SER A 1 89  ? 10.776  3.879   -1.084  1.00 0.00 ? 89  SER A CB   4  
ATOM 6341  O OG   . SER A 1 89  ? 11.941  4.634   -0.794  1.00 0.00 ? 89  SER A OG   4  
ATOM 6342  H H    . SER A 1 89  ? 8.422   3.076   -1.742  1.00 0.00 ? 89  SER A H    4  
ATOM 6343  H HA   . SER A 1 89  ? 9.630   5.666   -1.357  1.00 0.00 ? 89  SER A HA   4  
ATOM 6344  H HB2  . SER A 1 89  ? 10.338  3.547   -0.155  1.00 0.00 ? 89  SER A HB2  4  
ATOM 6345  H HB3  . SER A 1 89  ? 11.056  3.021   -1.677  1.00 0.00 ? 89  SER A HB3  4  
ATOM 6346  H HG   . SER A 1 89  ? 12.056  5.313   -1.463  1.00 0.00 ? 89  SER A HG   4  
ATOM 6347  N N    . GLN A 1 90  ? 9.392   4.712   -4.253  1.00 0.00 ? 90  GLN A N    4  
ATOM 6348  C CA   . GLN A 1 90  ? 9.746   4.909   -5.654  1.00 0.00 ? 90  GLN A CA   4  
ATOM 6349  C C    . GLN A 1 90  ? 8.866   5.978   -6.293  1.00 0.00 ? 90  GLN A C    4  
ATOM 6350  O O    . GLN A 1 90  ? 7.694   6.138   -5.950  1.00 0.00 ? 90  GLN A O    4  
ATOM 6351  C CB   . GLN A 1 90  ? 9.614   3.595   -6.425  1.00 0.00 ? 90  GLN A CB   4  
ATOM 6352  C CG   . GLN A 1 90  ? 10.416  2.453   -5.823  1.00 0.00 ? 90  GLN A CG   4  
ATOM 6353  C CD   . GLN A 1 90  ? 10.267  1.160   -6.602  1.00 0.00 ? 90  GLN A CD   4  
ATOM 6354  O OE1  . GLN A 1 90  ? 9.961   1.173   -7.795  1.00 0.00 ? 90  GLN A OE1  4  
ATOM 6355  N NE2  . GLN A 1 90  ? 10.482  0.036   -5.930  1.00 0.00 ? 90  GLN A NE2  4  
ATOM 6356  H H    . GLN A 1 90  ? 8.498   4.383   -4.028  1.00 0.00 ? 90  GLN A H    4  
ATOM 6357  H HA   . GLN A 1 90  ? 10.774  5.237   -5.693  1.00 0.00 ? 90  GLN A HA   4  
ATOM 6358  H HB2  . GLN A 1 90  ? 8.574   3.305   -6.444  1.00 0.00 ? 90  GLN A HB2  4  
ATOM 6359  H HB3  . GLN A 1 90  ? 9.954   3.750   -7.438  1.00 0.00 ? 90  GLN A HB3  4  
ATOM 6360  H HG2  . GLN A 1 90  ? 11.460  2.729   -5.813  1.00 0.00 ? 90  GLN A HG2  4  
ATOM 6361  H HG3  . GLN A 1 90  ? 10.078  2.287   -4.811  1.00 0.00 ? 90  GLN A HG3  4  
ATOM 6362  H HE21 . GLN A 1 90  ? 10.720  0.102   -4.981  1.00 0.00 ? 90  GLN A HE21 4  
ATOM 6363  H HE22 . GLN A 1 90  ? 10.391  -0.814  -6.408  1.00 0.00 ? 90  GLN A HE22 4  
ATOM 6364  N N    . PRO A 1 91  ? 9.441   6.729   -7.243  1.00 0.00 ? 91  PRO A N    4  
ATOM 6365  C CA   . PRO A 1 91  ? 8.726   7.796   -7.950  1.00 0.00 ? 91  PRO A CA   4  
ATOM 6366  C C    . PRO A 1 91  ? 7.656   7.253   -8.890  1.00 0.00 ? 91  PRO A C    4  
ATOM 6367  O O    . PRO A 1 91  ? 6.711   7.958   -9.244  1.00 0.00 ? 91  PRO A O    4  
ATOM 6368  C CB   . PRO A 1 91  ? 9.831   8.497   -8.745  1.00 0.00 ? 91  PRO A CB   4  
ATOM 6369  C CG   . PRO A 1 91  ? 10.880  7.456   -8.933  1.00 0.00 ? 91  PRO A CG   4  
ATOM 6370  C CD   . PRO A 1 91  ? 10.834  6.595   -7.702  1.00 0.00 ? 91  PRO A CD   4  
ATOM 6371  H HA   . PRO A 1 91  ? 8.277   8.497   -7.261  1.00 0.00 ? 91  PRO A HA   4  
ATOM 6372  H HB2  . PRO A 1 91  ? 9.436   8.836   -9.692  1.00 0.00 ? 91  PRO A HB2  4  
ATOM 6373  H HB3  . PRO A 1 91  ? 10.206  9.339   -8.183  1.00 0.00 ? 91  PRO A HB3  4  
ATOM 6374  H HG2  . PRO A 1 91  ? 10.661  6.868   -9.811  1.00 0.00 ? 91  PRO A HG2  4  
ATOM 6375  H HG3  . PRO A 1 91  ? 11.849  7.925   -9.025  1.00 0.00 ? 91  PRO A HG3  4  
ATOM 6376  H HD2  . PRO A 1 91  ? 11.060  5.568   -7.951  1.00 0.00 ? 91  PRO A HD2  4  
ATOM 6377  H HD3  . PRO A 1 91  ? 11.522  6.964   -6.956  1.00 0.00 ? 91  PRO A HD3  4  
ATOM 6378  N N    . SER A 1 92  ? 7.809   5.995   -9.290  1.00 0.00 ? 92  SER A N    4  
ATOM 6379  C CA   . SER A 1 92  ? 6.857   5.358   -10.192 1.00 0.00 ? 92  SER A CA   4  
ATOM 6380  C C    . SER A 1 92  ? 6.186   4.164   -9.519  1.00 0.00 ? 92  SER A C    4  
ATOM 6381  O O    . SER A 1 92  ? 6.856   3.296   -8.957  1.00 0.00 ? 92  SER A O    4  
ATOM 6382  C CB   . SER A 1 92  ? 7.559   4.907   -11.474 1.00 0.00 ? 92  SER A CB   4  
ATOM 6383  O OG   . SER A 1 92  ? 8.187   3.649   -11.296 1.00 0.00 ? 92  SER A OG   4  
ATOM 6384  H H    . SER A 1 92  ? 8.583   5.483   -8.972  1.00 0.00 ? 92  SER A H    4  
ATOM 6385  H HA   . SER A 1 92  ? 6.100   6.086   -10.443 1.00 0.00 ? 92  SER A HA   4  
ATOM 6386  H HB2  . SER A 1 92  ? 6.834   4.825   -12.269 1.00 0.00 ? 92  SER A HB2  4  
ATOM 6387  H HB3  . SER A 1 92  ? 8.310   5.635   -11.745 1.00 0.00 ? 92  SER A HB3  4  
ATOM 6388  H HG   . SER A 1 92  ? 7.790   3.006   -11.889 1.00 0.00 ? 92  SER A HG   4  
ATOM 6389  N N    . LEU A 1 93  ? 4.860   4.126   -9.580  1.00 0.00 ? 93  LEU A N    4  
ATOM 6390  C CA   . LEU A 1 93  ? 4.096   3.039   -8.977  1.00 0.00 ? 93  LEU A CA   4  
ATOM 6391  C C    . LEU A 1 93  ? 2.881   2.688   -9.830  1.00 0.00 ? 93  LEU A C    4  
ATOM 6392  O O    . LEU A 1 93  ? 2.384   3.517   -10.591 1.00 0.00 ? 93  LEU A O    4  
ATOM 6393  C CB   . LEU A 1 93  ? 3.649   3.425   -7.566  1.00 0.00 ? 93  LEU A CB   4  
ATOM 6394  C CG   . LEU A 1 93  ? 4.617   3.076   -6.436  1.00 0.00 ? 93  LEU A CG   4  
ATOM 6395  C CD1  . LEU A 1 93  ? 5.585   4.223   -6.189  1.00 0.00 ? 93  LEU A CD1  4  
ATOM 6396  C CD2  . LEU A 1 93  ? 3.853   2.738   -5.164  1.00 0.00 ? 93  LEU A CD2  4  
ATOM 6397  H H    . LEU A 1 93  ? 4.381   4.846   -10.042 1.00 0.00 ? 93  LEU A H    4  
ATOM 6398  H HA   . LEU A 1 93  ? 4.741   2.175   -8.918  1.00 0.00 ? 93  LEU A HA   4  
ATOM 6399  H HB2  . LEU A 1 93  ? 3.492   4.493   -7.550  1.00 0.00 ? 93  LEU A HB2  4  
ATOM 6400  H HB3  . LEU A 1 93  ? 2.712   2.923   -7.368  1.00 0.00 ? 93  LEU A HB3  4  
ATOM 6401  H HG   . LEU A 1 93  ? 5.195   2.208   -6.721  1.00 0.00 ? 93  LEU A HG   4  
ATOM 6402  H HD11 . LEU A 1 93  ? 6.548   3.978   -6.610  1.00 0.00 ? 93  LEU A HD11 4  
ATOM 6403  H HD12 . LEU A 1 93  ? 5.688   4.385   -5.127  1.00 0.00 ? 93  LEU A HD12 4  
ATOM 6404  H HD13 . LEU A 1 93  ? 5.206   5.121   -6.655  1.00 0.00 ? 93  LEU A HD13 4  
ATOM 6405  H HD21 . LEU A 1 93  ? 3.166   1.928   -5.362  1.00 0.00 ? 93  LEU A HD21 4  
ATOM 6406  H HD22 . LEU A 1 93  ? 3.300   3.606   -4.835  1.00 0.00 ? 93  LEU A HD22 4  
ATOM 6407  H HD23 . LEU A 1 93  ? 4.549   2.441   -4.394  1.00 0.00 ? 93  LEU A HD23 4  
ATOM 6408  N N    . GLY A 1 94  ? 2.407   1.454   -9.696  1.00 0.00 ? 94  GLY A N    4  
ATOM 6409  C CA   . GLY A 1 94  ? 1.253   1.016   -10.459 1.00 0.00 ? 94  GLY A CA   4  
ATOM 6410  C C    . GLY A 1 94  ? 0.172   0.414   -9.582  1.00 0.00 ? 94  GLY A C    4  
ATOM 6411  O O    . GLY A 1 94  ? 0.418   -0.548  -8.853  1.00 0.00 ? 94  GLY A O    4  
ATOM 6412  H H    . GLY A 1 94  ? 2.844   0.835   -9.074  1.00 0.00 ? 94  GLY A H    4  
ATOM 6413  H HA2  . GLY A 1 94  ? 0.842   1.862   -10.989 1.00 0.00 ? 94  GLY A HA2  4  
ATOM 6414  H HA3  . GLY A 1 94  ? 1.571   0.274   -11.177 1.00 0.00 ? 94  GLY A HA3  4  
ATOM 6415  N N    . LEU A 1 95  ? -1.027  0.982   -9.650  1.00 0.00 ? 95  LEU A N    4  
ATOM 6416  C CA   . LEU A 1 95  ? -2.149  0.497   -8.855  1.00 0.00 ? 95  LEU A CA   4  
ATOM 6417  C C    . LEU A 1 95  ? -3.283  0.011   -9.752  1.00 0.00 ? 95  LEU A C    4  
ATOM 6418  O O    . LEU A 1 95  ? -3.786  0.757   -10.594 1.00 0.00 ? 95  LEU A O    4  
ATOM 6419  C CB   . LEU A 1 95  ? -2.657  1.602   -7.926  1.00 0.00 ? 95  LEU A CB   4  
ATOM 6420  C CG   . LEU A 1 95  ? -1.614  2.236   -7.005  1.00 0.00 ? 95  LEU A CG   4  
ATOM 6421  C CD1  . LEU A 1 95  ? -2.182  3.472   -6.326  1.00 0.00 ? 95  LEU A CD1  4  
ATOM 6422  C CD2  . LEU A 1 95  ? -1.133  1.229   -5.970  1.00 0.00 ? 95  LEU A CD2  4  
ATOM 6423  H H    . LEU A 1 95  ? -1.162  1.745   -10.250 1.00 0.00 ? 95  LEU A H    4  
ATOM 6424  H HA   . LEU A 1 95  ? -1.799  -0.332  -8.258  1.00 0.00 ? 95  LEU A HA   4  
ATOM 6425  H HB2  . LEU A 1 95  ? -3.075  2.384   -8.540  1.00 0.00 ? 95  LEU A HB2  4  
ATOM 6426  H HB3  . LEU A 1 95  ? -3.434  1.179   -7.305  1.00 0.00 ? 95  LEU A HB3  4  
ATOM 6427  H HG   . LEU A 1 95  ? -0.761  2.543   -7.595  1.00 0.00 ? 95  LEU A HG   4  
ATOM 6428  H HD11 . LEU A 1 95  ? -1.586  3.713   -5.459  1.00 0.00 ? 95  LEU A HD11 4  
ATOM 6429  H HD12 . LEU A 1 95  ? -3.200  3.278   -6.020  1.00 0.00 ? 95  LEU A HD12 4  
ATOM 6430  H HD13 . LEU A 1 95  ? -2.166  4.302   -7.017  1.00 0.00 ? 95  LEU A HD13 4  
ATOM 6431  H HD21 . LEU A 1 95  ? -0.316  1.655   -5.407  1.00 0.00 ? 95  LEU A HD21 4  
ATOM 6432  H HD22 . LEU A 1 95  ? -0.798  0.332   -6.469  1.00 0.00 ? 95  LEU A HD22 4  
ATOM 6433  H HD23 . LEU A 1 95  ? -1.945  0.987   -5.300  1.00 0.00 ? 95  LEU A HD23 4  
ATOM 6434  N N    . LEU A 1 96  ? -3.683  -1.242  -9.566  1.00 0.00 ? 96  LEU A N    4  
ATOM 6435  C CA   . LEU A 1 96  ? -4.760  -1.827  -10.357 1.00 0.00 ? 96  LEU A CA   4  
ATOM 6436  C C    . LEU A 1 96  ? -6.047  -1.916  -9.543  1.00 0.00 ? 96  LEU A C    4  
ATOM 6437  O O    . LEU A 1 96  ? -6.216  -2.823  -8.727  1.00 0.00 ? 96  LEU A O    4  
ATOM 6438  C CB   . LEU A 1 96  ? -4.358  -3.218  -10.851 1.00 0.00 ? 96  LEU A CB   4  
ATOM 6439  C CG   . LEU A 1 96  ? -5.365  -3.924  -11.760 1.00 0.00 ? 96  LEU A CG   4  
ATOM 6440  C CD1  . LEU A 1 96  ? -5.381  -3.283  -13.138 1.00 0.00 ? 96  LEU A CD1  4  
ATOM 6441  C CD2  . LEU A 1 96  ? -5.041  -5.408  -11.863 1.00 0.00 ? 96  LEU A CD2  4  
ATOM 6442  H H    . LEU A 1 96  ? -3.244  -1.787  -8.880  1.00 0.00 ? 96  LEU A H    4  
ATOM 6443  H HA   . LEU A 1 96  ? -4.930  -1.187  -11.209 1.00 0.00 ? 96  LEU A HA   4  
ATOM 6444  H HB2  . LEU A 1 96  ? -3.432  -3.120  -11.397 1.00 0.00 ? 96  LEU A HB2  4  
ATOM 6445  H HB3  . LEU A 1 96  ? -4.198  -3.843  -9.984  1.00 0.00 ? 96  LEU A HB3  4  
ATOM 6446  H HG   . LEU A 1 96  ? -6.354  -3.826  -11.335 1.00 0.00 ? 96  LEU A HG   4  
ATOM 6447  H HD11 . LEU A 1 96  ? -4.404  -3.373  -13.589 1.00 0.00 ? 96  LEU A HD11 4  
ATOM 6448  H HD12 . LEU A 1 96  ? -5.641  -2.239  -13.047 1.00 0.00 ? 96  LEU A HD12 4  
ATOM 6449  H HD13 . LEU A 1 96  ? -6.111  -3.783  -13.759 1.00 0.00 ? 96  LEU A HD13 4  
ATOM 6450  H HD21 . LEU A 1 96  ? -4.035  -5.531  -12.236 1.00 0.00 ? 96  LEU A HD21 4  
ATOM 6451  H HD22 . LEU A 1 96  ? -5.737  -5.882  -12.540 1.00 0.00 ? 96  LEU A HD22 4  
ATOM 6452  H HD23 . LEU A 1 96  ? -5.121  -5.862  -10.887 1.00 0.00 ? 96  LEU A HD23 4  
ATOM 6453  N N    . VAL A 1 97  ? -6.952  -0.971  -9.773  1.00 0.00 ? 97  VAL A N    4  
ATOM 6454  C CA   . VAL A 1 97  ? -8.226  -0.944  -9.064  1.00 0.00 ? 97  VAL A CA   4  
ATOM 6455  C C    . VAL A 1 97  ? -9.392  -1.164  -10.021 1.00 0.00 ? 97  VAL A C    4  
ATOM 6456  O O    . VAL A 1 97  ? -9.255  -0.996  -11.232 1.00 0.00 ? 97  VAL A O    4  
ATOM 6457  C CB   . VAL A 1 97  ? -8.429  0.391   -8.324  1.00 0.00 ? 97  VAL A CB   4  
ATOM 6458  C CG1  . VAL A 1 97  ? -7.330  0.603   -7.293  1.00 0.00 ? 97  VAL A CG1  4  
ATOM 6459  C CG2  . VAL A 1 97  ? -8.473  1.546   -9.313  1.00 0.00 ? 97  VAL A CG2  4  
ATOM 6460  H H    . VAL A 1 97  ? -6.760  -0.275  -10.435 1.00 0.00 ? 97  VAL A H    4  
ATOM 6461  H HA   . VAL A 1 97  ? -8.218  -1.739  -8.332  1.00 0.00 ? 97  VAL A HA   4  
ATOM 6462  H HB   . VAL A 1 97  ? -9.375  0.352   -7.805  1.00 0.00 ? 97  VAL A HB   4  
ATOM 6463  H HG11 . VAL A 1 97  ? -7.526  -0.012  -6.427  1.00 0.00 ? 97  VAL A HG11 4  
ATOM 6464  H HG12 . VAL A 1 97  ? -6.377  0.330   -7.722  1.00 0.00 ? 97  VAL A HG12 4  
ATOM 6465  H HG13 . VAL A 1 97  ? -7.308  1.642   -6.999  1.00 0.00 ? 97  VAL A HG13 4  
ATOM 6466  H HG21 . VAL A 1 97  ? -7.724  2.277   -9.046  1.00 0.00 ? 97  VAL A HG21 4  
ATOM 6467  H HG22 . VAL A 1 97  ? -8.276  1.176   -10.308 1.00 0.00 ? 97  VAL A HG22 4  
ATOM 6468  H HG23 . VAL A 1 97  ? -9.450  2.006   -9.287  1.00 0.00 ? 97  VAL A HG23 4  
ATOM 6469  N N    . ARG A 1 98  ? -10.541 -1.541  -9.468  1.00 0.00 ? 98  ARG A N    4  
ATOM 6470  C CA   . ARG A 1 98  ? -11.732 -1.786  -10.273 1.00 0.00 ? 98  ARG A CA   4  
ATOM 6471  C C    . ARG A 1 98  ? -12.749 -0.663  -10.092 1.00 0.00 ? 98  ARG A C    4  
ATOM 6472  O O    . ARG A 1 98  ? -12.952 -0.165  -8.984  1.00 0.00 ? 98  ARG A O    4  
ATOM 6473  C CB   . ARG A 1 98  ? -12.364 -3.126  -9.893  1.00 0.00 ? 98  ARG A CB   4  
ATOM 6474  C CG   . ARG A 1 98  ? -13.102 -3.798  -11.040 1.00 0.00 ? 98  ARG A CG   4  
ATOM 6475  C CD   . ARG A 1 98  ? -13.365 -5.267  -10.748 1.00 0.00 ? 98  ARG A CD   4  
ATOM 6476  N NE   . ARG A 1 98  ? -12.144 -6.065  -10.812 1.00 0.00 ? 98  ARG A NE   4  
ATOM 6477  C CZ   . ARG A 1 98  ? -12.132 -7.372  -11.052 1.00 0.00 ? 98  ARG A CZ   4  
ATOM 6478  N NH1  . ARG A 1 98  ? -13.270 -8.023  -11.250 1.00 0.00 ? 98  ARG A NH1  4  
ATOM 6479  N NH2  . ARG A 1 98  ? -10.980 -8.029  -11.094 1.00 0.00 ? 98  ARG A NH2  4  
ATOM 6480  H H    . ARG A 1 98  ? -10.588 -1.659  -8.496  1.00 0.00 ? 98  ARG A H    4  
ATOM 6481  H HA   . ARG A 1 98  ? -11.431 -1.820  -11.309 1.00 0.00 ? 98  ARG A HA   4  
ATOM 6482  H HB2  . ARG A 1 98  ? -11.586 -3.795  -9.554  1.00 0.00 ? 98  ARG A HB2  4  
ATOM 6483  H HB3  . ARG A 1 98  ? -13.064 -2.965  -9.088  1.00 0.00 ? 98  ARG A HB3  4  
ATOM 6484  H HG2  . ARG A 1 98  ? -14.047 -3.297  -11.190 1.00 0.00 ? 98  ARG A HG2  4  
ATOM 6485  H HG3  . ARG A 1 98  ? -12.504 -3.719  -11.935 1.00 0.00 ? 98  ARG A HG3  4  
ATOM 6486  H HD2  . ARG A 1 98  ? -13.789 -5.353  -9.759  1.00 0.00 ? 98  ARG A HD2  4  
ATOM 6487  H HD3  . ARG A 1 98  ? -14.069 -5.643  -11.475 1.00 0.00 ? 98  ARG A HD3  4  
ATOM 6488  H HE   . ARG A 1 98  ? -11.292 -5.604  -10.669 1.00 0.00 ? 98  ARG A HE   4  
ATOM 6489  H HH11 . ARG A 1 98  ? -14.139 -7.530  -11.219 1.00 0.00 ? 98  ARG A HH11 4  
ATOM 6490  H HH12 . ARG A 1 98  ? -13.258 -9.007  -11.431 1.00 0.00 ? 98  ARG A HH12 4  
ATOM 6491  H HH21 . ARG A 1 98  ? -10.121 -7.541  -10.946 1.00 0.00 ? 98  ARG A HH21 4  
ATOM 6492  H HH22 . ARG A 1 98  ? -10.972 -9.012  -11.275 1.00 0.00 ? 98  ARG A HH22 4  
ATOM 6493  N N    . THR A 1 99  ? -13.387 -0.267  -11.190 1.00 0.00 ? 99  THR A N    4  
ATOM 6494  C CA   . THR A 1 99  ? -14.382 0.797   -11.154 1.00 0.00 ? 99  THR A CA   4  
ATOM 6495  C C    . THR A 1 99  ? -15.443 0.595   -12.230 1.00 0.00 ? 99  THR A C    4  
ATOM 6496  O O    . THR A 1 99  ? -15.196 -0.058  -13.244 1.00 0.00 ? 99  THR A O    4  
ATOM 6497  C CB   . THR A 1 99  ? -13.731 2.181   -11.343 1.00 0.00 ? 99  THR A CB   4  
ATOM 6498  O OG1  . THR A 1 99  ? -14.592 3.202   -10.826 1.00 0.00 ? 99  THR A OG1  4  
ATOM 6499  C CG2  . THR A 1 99  ? -13.446 2.448   -12.814 1.00 0.00 ? 99  THR A CG2  4  
ATOM 6500  H H    . THR A 1 99  ? -13.183 -0.703  -12.043 1.00 0.00 ? 99  THR A H    4  
ATOM 6501  H HA   . THR A 1 99  ? -14.858 0.777   -10.184 1.00 0.00 ? 99  THR A HA   4  
ATOM 6502  H HB   . THR A 1 99  ? -12.797 2.199   -10.801 1.00 0.00 ? 99  THR A HB   4  
ATOM 6503  H HG1  . THR A 1 99  ? -15.177 3.511   -11.522 1.00 0.00 ? 99  THR A HG1  4  
ATOM 6504  H HG21 . THR A 1 99  ? -13.121 1.534   -13.289 1.00 0.00 ? 99  THR A HG21 4  
ATOM 6505  H HG22 . THR A 1 99  ? -12.672 3.195   -12.900 1.00 0.00 ? 99  THR A HG22 4  
ATOM 6506  H HG23 . THR A 1 99  ? -14.345 2.803   -13.295 1.00 0.00 ? 99  THR A HG23 4  
ATOM 6507  N N    . TYR A 1 100 ? -16.623 1.160   -12.003 1.00 0.00 ? 100 TYR A N    4  
ATOM 6508  C CA   . TYR A 1 100 ? -17.723 1.040   -12.953 1.00 0.00 ? 100 TYR A CA   4  
ATOM 6509  C C    . TYR A 1 100 ? -17.555 2.024   -14.107 1.00 0.00 ? 100 TYR A C    4  
ATOM 6510  O O    . TYR A 1 100 ? -17.195 3.186   -13.919 1.00 0.00 ? 100 TYR A O    4  
ATOM 6511  C CB   . TYR A 1 100 ? -19.060 1.284   -12.251 1.00 0.00 ? 100 TYR A CB   4  
ATOM 6512  C CG   . TYR A 1 100 ? -19.193 0.555   -10.933 1.00 0.00 ? 100 TYR A CG   4  
ATOM 6513  C CD1  . TYR A 1 100 ? -19.494 -0.801  -10.894 1.00 0.00 ? 100 TYR A CD1  4  
ATOM 6514  C CD2  . TYR A 1 100 ? -19.020 1.222   -9.727  1.00 0.00 ? 100 TYR A CD2  4  
ATOM 6515  C CE1  . TYR A 1 100 ? -19.618 -1.471  -9.692  1.00 0.00 ? 100 TYR A CE1  4  
ATOM 6516  C CE2  . TYR A 1 100 ? -19.140 0.560   -8.521  1.00 0.00 ? 100 TYR A CE2  4  
ATOM 6517  C CZ   . TYR A 1 100 ? -19.439 -0.786  -8.508  1.00 0.00 ? 100 TYR A CZ   4  
ATOM 6518  O OH   . TYR A 1 100 ? -19.561 -1.449  -7.309  1.00 0.00 ? 100 TYR A OH   4  
ATOM 6519  H H    . TYR A 1 100 ? -16.760 1.668   -11.176 1.00 0.00 ? 100 TYR A H    4  
ATOM 6520  H HA   . TYR A 1 100 ? -17.712 0.035   -13.348 1.00 0.00 ? 100 TYR A HA   4  
ATOM 6521  H HB2  . TYR A 1 100 ? -19.171 2.339   -12.058 1.00 0.00 ? 100 TYR A HB2  4  
ATOM 6522  H HB3  . TYR A 1 100 ? -19.862 0.954   -12.895 1.00 0.00 ? 100 TYR A HB3  4  
ATOM 6523  H HD1  . TYR A 1 100 ? -19.633 -1.335  -11.823 1.00 0.00 ? 100 TYR A HD1  4  
ATOM 6524  H HD2  . TYR A 1 100 ? -18.786 2.277   -9.740  1.00 0.00 ? 100 TYR A HD2  4  
ATOM 6525  H HE1  . TYR A 1 100 ? -19.852 -2.526  -9.682  1.00 0.00 ? 100 TYR A HE1  4  
ATOM 6526  H HE2  . TYR A 1 100 ? -19.001 1.096   -7.593  1.00 0.00 ? 100 TYR A HE2  4  
ATOM 6527  H HH   . TYR A 1 100 ? -20.491 -1.559  -7.097  1.00 0.00 ? 100 TYR A HH   4  
ATOM 6528  N N    . PRO A 1 101 ? -17.824 1.548   -15.332 1.00 0.00 ? 101 PRO A N    4  
ATOM 6529  C CA   . PRO A 1 101 ? -17.711 2.368   -16.542 1.00 0.00 ? 101 PRO A CA   4  
ATOM 6530  C C    . PRO A 1 101 ? -18.790 3.443   -16.616 1.00 0.00 ? 101 PRO A C    4  
ATOM 6531  O O    . PRO A 1 101 ? -19.974 3.159   -16.437 1.00 0.00 ? 101 PRO A O    4  
ATOM 6532  C CB   . PRO A 1 101 ? -17.887 1.355   -17.675 1.00 0.00 ? 101 PRO A CB   4  
ATOM 6533  C CG   . PRO A 1 101 ? -18.679 0.246   -17.072 1.00 0.00 ? 101 PRO A CG   4  
ATOM 6534  C CD   . PRO A 1 101 ? -18.258 0.173   -15.631 1.00 0.00 ? 101 PRO A CD   4  
ATOM 6535  H HA   . PRO A 1 101 ? -16.738 2.831   -16.619 1.00 0.00 ? 101 PRO A HA   4  
ATOM 6536  H HB2  . PRO A 1 101 ? -18.416 1.818   -18.497 1.00 0.00 ? 101 PRO A HB2  4  
ATOM 6537  H HB3  . PRO A 1 101 ? -16.920 1.012   -18.010 1.00 0.00 ? 101 PRO A HB3  4  
ATOM 6538  H HG2  . PRO A 1 101 ? -19.733 0.466   -17.145 1.00 0.00 ? 101 PRO A HG2  4  
ATOM 6539  H HG3  . PRO A 1 101 ? -18.452 -0.682  -17.576 1.00 0.00 ? 101 PRO A HG3  4  
ATOM 6540  H HD2  . PRO A 1 101 ? -19.093 -0.111  -15.008 1.00 0.00 ? 101 PRO A HD2  4  
ATOM 6541  H HD3  . PRO A 1 101 ? -17.441 -0.523  -15.511 1.00 0.00 ? 101 PRO A HD3  4  
ATOM 6542  N N    . GLU A 1 102 ? -18.373 4.677   -16.881 1.00 0.00 ? 102 GLU A N    4  
ATOM 6543  C CA   . GLU A 1 102 ? -19.306 5.794   -16.979 1.00 0.00 ? 102 GLU A CA   4  
ATOM 6544  C C    . GLU A 1 102 ? -19.852 5.925   -18.397 1.00 0.00 ? 102 GLU A C    4  
ATOM 6545  O O    . GLU A 1 102 ? -19.403 5.235   -19.314 1.00 0.00 ? 102 GLU A O    4  
ATOM 6546  C CB   . GLU A 1 102 ? -18.620 7.097   -16.562 1.00 0.00 ? 102 GLU A CB   4  
ATOM 6547  C CG   . GLU A 1 102 ? -18.658 7.353   -15.065 1.00 0.00 ? 102 GLU A CG   4  
ATOM 6548  C CD   . GLU A 1 102 ? -17.487 6.724   -14.336 1.00 0.00 ? 102 GLU A CD   4  
ATOM 6549  O OE1  . GLU A 1 102 ? -16.335 7.122   -14.608 1.00 0.00 ? 102 GLU A OE1  4  
ATOM 6550  O OE2  . GLU A 1 102 ? -17.723 5.833   -13.493 1.00 0.00 ? 102 GLU A OE2  4  
ATOM 6551  H H    . GLU A 1 102 ? -17.416 4.840   -17.014 1.00 0.00 ? 102 GLU A H    4  
ATOM 6552  H HA   . GLU A 1 102 ? -20.127 5.599   -16.306 1.00 0.00 ? 102 GLU A HA   4  
ATOM 6553  H HB2  . GLU A 1 102 ? -17.587 7.063   -16.875 1.00 0.00 ? 102 GLU A HB2  4  
ATOM 6554  H HB3  . GLU A 1 102 ? -19.110 7.921   -17.059 1.00 0.00 ? 102 GLU A HB3  4  
ATOM 6555  H HG2  . GLU A 1 102 ? -18.638 8.419   -14.894 1.00 0.00 ? 102 GLU A HG2  4  
ATOM 6556  H HG3  . GLU A 1 102 ? -19.574 6.943   -14.665 1.00 0.00 ? 102 GLU A HG3  4  
ATOM 6557  N N    . LEU A 1 103 ? -20.824 6.813   -18.571 1.00 0.00 ? 103 LEU A N    4  
ATOM 6558  C CA   . LEU A 1 103 ? -21.433 7.035   -19.878 1.00 0.00 ? 103 LEU A CA   4  
ATOM 6559  C C    . LEU A 1 103 ? -20.761 8.197   -20.602 1.00 0.00 ? 103 LEU A C    4  
ATOM 6560  O O    . LEU A 1 103 ? -21.207 8.617   -21.669 1.00 0.00 ? 103 LEU A O    4  
ATOM 6561  C CB   . LEU A 1 103 ? -22.930 7.312   -19.724 1.00 0.00 ? 103 LEU A CB   4  
ATOM 6562  C CG   . LEU A 1 103 ? -23.344 8.085   -18.472 1.00 0.00 ? 103 LEU A CG   4  
ATOM 6563  C CD1  . LEU A 1 103 ? -22.600 9.408   -18.390 1.00 0.00 ? 103 LEU A CD1  4  
ATOM 6564  C CD2  . LEU A 1 103 ? -24.849 8.315   -18.461 1.00 0.00 ? 103 LEU A CD2  4  
ATOM 6565  H H    . LEU A 1 103 ? -21.140 7.333   -17.803 1.00 0.00 ? 103 LEU A H    4  
ATOM 6566  H HA   . LEU A 1 103 ? -21.299 6.137   -20.462 1.00 0.00 ? 103 LEU A HA   4  
ATOM 6567  H HB2  . LEU A 1 103 ? -23.251 7.879   -20.584 1.00 0.00 ? 103 LEU A HB2  4  
ATOM 6568  H HB3  . LEU A 1 103 ? -23.442 6.360   -19.712 1.00 0.00 ? 103 LEU A HB3  4  
ATOM 6569  H HG   . LEU A 1 103 ? -23.088 7.504   -17.597 1.00 0.00 ? 103 LEU A HG   4  
ATOM 6570  H HD11 . LEU A 1 103 ? -21.551 9.244   -18.582 1.00 0.00 ? 103 LEU A HD11 4  
ATOM 6571  H HD12 . LEU A 1 103 ? -22.724 9.831   -17.404 1.00 0.00 ? 103 LEU A HD12 4  
ATOM 6572  H HD13 . LEU A 1 103 ? -22.999 10.091  -19.127 1.00 0.00 ? 103 LEU A HD13 4  
ATOM 6573  H HD21 . LEU A 1 103 ? -25.193 8.393   -17.440 1.00 0.00 ? 103 LEU A HD21 4  
ATOM 6574  H HD22 . LEU A 1 103 ? -25.343 7.485   -18.944 1.00 0.00 ? 103 LEU A HD22 4  
ATOM 6575  H HD23 . LEU A 1 103 ? -25.077 9.228   -18.989 1.00 0.00 ? 103 LEU A HD23 4  
ATOM 6576  N N    . GLU A 1 104 ? -19.685 8.711   -20.014 1.00 0.00 ? 104 GLU A N    4  
ATOM 6577  C CA   . GLU A 1 104 ? -18.951 9.824   -20.605 1.00 0.00 ? 104 GLU A CA   4  
ATOM 6578  C C    . GLU A 1 104 ? -17.828 9.318   -21.506 1.00 0.00 ? 104 GLU A C    4  
ATOM 6579  O O    . GLU A 1 104 ? -16.859 10.030  -21.765 1.00 0.00 ? 104 GLU A O    4  
ATOM 6580  C CB   . GLU A 1 104 ? -18.375 10.723  -19.509 1.00 0.00 ? 104 GLU A CB   4  
ATOM 6581  C CG   . GLU A 1 104 ? -17.475 9.988   -18.529 1.00 0.00 ? 104 GLU A CG   4  
ATOM 6582  C CD   . GLU A 1 104 ? -16.420 10.888  -17.918 1.00 0.00 ? 104 GLU A CD   4  
ATOM 6583  O OE1  . GLU A 1 104 ? -15.654 11.510  -18.683 1.00 0.00 ? 104 GLU A OE1  4  
ATOM 6584  O OE2  . GLU A 1 104 ? -16.360 10.971  -16.673 1.00 0.00 ? 104 GLU A OE2  4  
ATOM 6585  H H    . GLU A 1 104 ? -19.378 8.333   -19.164 1.00 0.00 ? 104 GLU A H    4  
ATOM 6586  H HA   . GLU A 1 104 ? -19.643 10.398  -21.201 1.00 0.00 ? 104 GLU A HA   4  
ATOM 6587  H HB2  . GLU A 1 104 ? -17.800 11.511  -19.972 1.00 0.00 ? 104 GLU A HB2  4  
ATOM 6588  H HB3  . GLU A 1 104 ? -19.191 11.162  -18.955 1.00 0.00 ? 104 GLU A HB3  4  
ATOM 6589  H HG2  . GLU A 1 104 ? -18.084 9.582   -17.735 1.00 0.00 ? 104 GLU A HG2  4  
ATOM 6590  H HG3  . GLU A 1 104 ? -16.981 9.181   -19.050 1.00 0.00 ? 104 GLU A HG3  4  
ATOM 6591  N N    . GLU A 1 105 ? -17.967 8.083   -21.979 1.00 0.00 ? 105 GLU A N    4  
ATOM 6592  C CA   . GLU A 1 105 ? -16.964 7.482   -22.849 1.00 0.00 ? 105 GLU A CA   4  
ATOM 6593  C C    . GLU A 1 105 ? -17.619 6.583   -23.894 1.00 0.00 ? 105 GLU A C    4  
ATOM 6594  O O    . GLU A 1 105 ? -18.722 6.078   -23.691 1.00 0.00 ? 105 GLU A O    4  
ATOM 6595  C CB   . GLU A 1 105 ? -15.959 6.675   -22.025 1.00 0.00 ? 105 GLU A CB   4  
ATOM 6596  C CG   . GLU A 1 105 ? -16.523 5.372   -21.483 1.00 0.00 ? 105 GLU A CG   4  
ATOM 6597  C CD   . GLU A 1 105 ? -15.441 4.363   -21.149 1.00 0.00 ? 105 GLU A CD   4  
ATOM 6598  O OE1  . GLU A 1 105 ? -14.820 4.493   -20.073 1.00 0.00 ? 105 GLU A OE1  4  
ATOM 6599  O OE2  . GLU A 1 105 ? -15.216 3.443   -21.963 1.00 0.00 ? 105 GLU A OE2  4  
ATOM 6600  H H    . GLU A 1 105 ? -18.763 7.565   -21.736 1.00 0.00 ? 105 GLU A H    4  
ATOM 6601  H HA   . GLU A 1 105 ? -16.442 8.280   -23.355 1.00 0.00 ? 105 GLU A HA   4  
ATOM 6602  H HB2  . GLU A 1 105 ? -15.105 6.444   -22.645 1.00 0.00 ? 105 GLU A HB2  4  
ATOM 6603  H HB3  . GLU A 1 105 ? -15.633 7.276   -21.189 1.00 0.00 ? 105 GLU A HB3  4  
ATOM 6604  H HG2  . GLU A 1 105 ? -17.085 5.583   -20.586 1.00 0.00 ? 105 GLU A HG2  4  
ATOM 6605  H HG3  . GLU A 1 105 ? -17.179 4.942   -22.226 1.00 0.00 ? 105 GLU A HG3  4  
ATOM 6606  N N    . GLY A 1 106 ? -16.930 6.390   -25.015 1.00 0.00 ? 106 GLY A N    4  
ATOM 6607  C CA   . GLY A 1 106 ? -17.459 5.553   -26.076 1.00 0.00 ? 106 GLY A CA   4  
ATOM 6608  C C    . GLY A 1 106 ? -17.716 6.329   -27.353 1.00 0.00 ? 106 GLY A C    4  
ATOM 6609  O O    . GLY A 1 106 ? -16.780 6.719   -28.050 1.00 0.00 ? 106 GLY A O    4  
ATOM 6610  H H    . GLY A 1 106 ? -16.055 6.818   -25.122 1.00 0.00 ? 106 GLY A H    4  
ATOM 6611  H HA2  . GLY A 1 106 ? -16.753 4.763   -26.283 1.00 0.00 ? 106 GLY A HA2  4  
ATOM 6612  H HA3  . GLY A 1 106 ? -18.388 5.114   -25.743 1.00 0.00 ? 106 GLY A HA3  4  
ATOM 6613  N N    . VAL A 1 107 ? -18.990 6.553   -27.661 1.00 0.00 ? 107 VAL A N    4  
ATOM 6614  C CA   . VAL A 1 107 ? -19.368 7.287   -28.863 1.00 0.00 ? 107 VAL A CA   4  
ATOM 6615  C C    . VAL A 1 107 ? -19.568 8.768   -28.562 1.00 0.00 ? 107 VAL A C    4  
ATOM 6616  O O    . VAL A 1 107 ? -20.649 9.186   -28.150 1.00 0.00 ? 107 VAL A O    4  
ATOM 6617  C CB   . VAL A 1 107 ? -20.659 6.721   -29.484 1.00 0.00 ? 107 VAL A CB   4  
ATOM 6618  C CG1  . VAL A 1 107 ? -21.085 7.555   -30.682 1.00 0.00 ? 107 VAL A CG1  4  
ATOM 6619  C CG2  . VAL A 1 107 ? -20.466 5.265   -29.878 1.00 0.00 ? 107 VAL A CG2  4  
ATOM 6620  H H    . VAL A 1 107 ? -19.692 6.217   -27.066 1.00 0.00 ? 107 VAL A H    4  
ATOM 6621  H HA   . VAL A 1 107 ? -18.570 7.181   -29.584 1.00 0.00 ? 107 VAL A HA   4  
ATOM 6622  H HB   . VAL A 1 107 ? -21.442 6.771   -28.742 1.00 0.00 ? 107 VAL A HB   4  
ATOM 6623  H HG11 . VAL A 1 107 ? -20.522 8.476   -30.698 1.00 0.00 ? 107 VAL A HG11 4  
ATOM 6624  H HG12 . VAL A 1 107 ? -20.897 7.001   -31.591 1.00 0.00 ? 107 VAL A HG12 4  
ATOM 6625  H HG13 . VAL A 1 107 ? -22.139 7.779   -30.608 1.00 0.00 ? 107 VAL A HG13 4  
ATOM 6626  H HG21 . VAL A 1 107 ? -19.848 4.772   -29.142 1.00 0.00 ? 107 VAL A HG21 4  
ATOM 6627  H HG22 . VAL A 1 107 ? -21.427 4.774   -29.926 1.00 0.00 ? 107 VAL A HG22 4  
ATOM 6628  H HG23 . VAL A 1 107 ? -19.987 5.213   -30.844 1.00 0.00 ? 107 VAL A HG23 4  
ATOM 6629  N N    . GLU A 1 108 ? -18.518 9.556   -28.771 1.00 0.00 ? 108 GLU A N    4  
ATOM 6630  C CA   . GLU A 1 108 ? -18.580 10.992  -28.522 1.00 0.00 ? 108 GLU A CA   4  
ATOM 6631  C C    . GLU A 1 108 ? -19.118 11.733  -29.742 1.00 0.00 ? 108 GLU A C    4  
ATOM 6632  O O    . GLU A 1 108 ? -19.195 11.176  -30.837 1.00 0.00 ? 108 GLU A O    4  
ATOM 6633  C CB   . GLU A 1 108 ? -17.194 11.528  -28.155 1.00 0.00 ? 108 GLU A CB   4  
ATOM 6634  C CG   . GLU A 1 108 ? -16.249 11.632  -29.340 1.00 0.00 ? 108 GLU A CG   4  
ATOM 6635  C CD   . GLU A 1 108 ? -16.442 12.912  -30.130 1.00 0.00 ? 108 GLU A CD   4  
ATOM 6636  O OE1  . GLU A 1 108 ? -16.092 13.990  -29.606 1.00 0.00 ? 108 GLU A OE1  4  
ATOM 6637  O OE2  . GLU A 1 108 ? -16.943 12.836  -31.271 1.00 0.00 ? 108 GLU A OE2  4  
ATOM 6638  H H    . GLU A 1 108 ? -17.683 9.164   -29.101 1.00 0.00 ? 108 GLU A H    4  
ATOM 6639  H HA   . GLU A 1 108 ? -19.250 11.156  -27.692 1.00 0.00 ? 108 GLU A HA   4  
ATOM 6640  H HB2  . GLU A 1 108 ? -17.305 12.511  -27.722 1.00 0.00 ? 108 GLU A HB2  4  
ATOM 6641  H HB3  . GLU A 1 108 ? -16.749 10.870  -27.424 1.00 0.00 ? 108 GLU A HB3  4  
ATOM 6642  H HG2  . GLU A 1 108 ? -15.233 11.601  -28.978 1.00 0.00 ? 108 GLU A HG2  4  
ATOM 6643  H HG3  . GLU A 1 108 ? -16.421 10.792  -29.997 1.00 0.00 ? 108 GLU A HG3  4  
ATOM 6644  N N    . SER A 1 109 ? -19.490 12.994  -29.544 1.00 0.00 ? 109 SER A N    4  
ATOM 6645  C CA   . SER A 1 109 ? -20.026 13.812  -30.627 1.00 0.00 ? 109 SER A CA   4  
ATOM 6646  C C    . SER A 1 109 ? -19.298 15.150  -30.707 1.00 0.00 ? 109 SER A C    4  
ATOM 6647  O O    . SER A 1 109 ? -19.408 15.985  -29.810 1.00 0.00 ? 109 SER A O    4  
ATOM 6648  C CB   . SER A 1 109 ? -21.524 14.045  -30.425 1.00 0.00 ? 109 SER A CB   4  
ATOM 6649  O OG   . SER A 1 109 ? -22.264 12.867  -30.695 1.00 0.00 ? 109 SER A OG   4  
ATOM 6650  H H    . SER A 1 109 ? -19.405 13.382  -28.648 1.00 0.00 ? 109 SER A H    4  
ATOM 6651  H HA   . SER A 1 109 ? -19.874 13.277  -31.552 1.00 0.00 ? 109 SER A HA   4  
ATOM 6652  H HB2  . SER A 1 109 ? -21.705 14.342  -29.403 1.00 0.00 ? 109 SER A HB2  4  
ATOM 6653  H HB3  . SER A 1 109 ? -21.857 14.826  -31.092 1.00 0.00 ? 109 SER A HB3  4  
ATOM 6654  H HG   . SER A 1 109 ? -22.626 12.912  -31.583 1.00 0.00 ? 109 SER A HG   4  
ATOM 6655  N N    . GLY A 1 110 ? -18.553 15.347  -31.791 1.00 0.00 ? 110 GLY A N    4  
ATOM 6656  C CA   . GLY A 1 110 ? -17.817 16.585  -31.970 1.00 0.00 ? 110 GLY A CA   4  
ATOM 6657  C C    . GLY A 1 110 ? -17.212 17.093  -30.676 1.00 0.00 ? 110 GLY A C    4  
ATOM 6658  O O    . GLY A 1 110 ? -16.162 16.627  -30.232 1.00 0.00 ? 110 GLY A O    4  
ATOM 6659  H H    . GLY A 1 110 ? -18.502 14.646  -32.474 1.00 0.00 ? 110 GLY A H    4  
ATOM 6660  H HA2  . GLY A 1 110 ? -17.025 16.420  -32.686 1.00 0.00 ? 110 GLY A HA2  4  
ATOM 6661  H HA3  . GLY A 1 110 ? -18.489 17.337  -32.359 1.00 0.00 ? 110 GLY A HA3  4  
ATOM 6662  N N    . PRO A 1 111 ? -17.881 18.072  -30.049 1.00 0.00 ? 111 PRO A N    4  
ATOM 6663  C CA   . PRO A 1 111 ? -17.420 18.665  -28.791 1.00 0.00 ? 111 PRO A CA   4  
ATOM 6664  C C    . PRO A 1 111 ? -17.539 17.699  -27.617 1.00 0.00 ? 111 PRO A C    4  
ATOM 6665  O O    . PRO A 1 111 ? -18.566 17.043  -27.442 1.00 0.00 ? 111 PRO A O    4  
ATOM 6666  C CB   . PRO A 1 111 ? -18.358 19.859  -28.597 1.00 0.00 ? 111 PRO A CB   4  
ATOM 6667  C CG   . PRO A 1 111 ? -19.593 19.496  -29.347 1.00 0.00 ? 111 PRO A CG   4  
ATOM 6668  C CD   . PRO A 1 111 ? -19.139 18.675  -30.521 1.00 0.00 ? 111 PRO A CD   4  
ATOM 6669  H HA   . PRO A 1 111 ? -16.401 19.014  -28.866 1.00 0.00 ? 111 PRO A HA   4  
ATOM 6670  H HB2  . PRO A 1 111 ? -18.559 19.995  -27.544 1.00 0.00 ? 111 PRO A HB2  4  
ATOM 6671  H HB3  . PRO A 1 111 ? -17.900 20.750  -28.999 1.00 0.00 ? 111 PRO A HB3  4  
ATOM 6672  H HG2  . PRO A 1 111 ? -20.249 18.916  -28.715 1.00 0.00 ? 111 PRO A HG2  4  
ATOM 6673  H HG3  . PRO A 1 111 ? -20.093 20.391  -29.686 1.00 0.00 ? 111 PRO A HG3  4  
ATOM 6674  H HD2  . PRO A 1 111 ? -19.868 17.913  -30.754 1.00 0.00 ? 111 PRO A HD2  4  
ATOM 6675  H HD3  . PRO A 1 111 ? -18.964 19.308  -31.379 1.00 0.00 ? 111 PRO A HD3  4  
ATOM 6676  N N    . SER A 1 112 ? -16.482 17.616  -26.815 1.00 0.00 ? 112 SER A N    4  
ATOM 6677  C CA   . SER A 1 112 ? -16.467 16.727  -25.660 1.00 0.00 ? 112 SER A CA   4  
ATOM 6678  C C    . SER A 1 112 ? -16.340 17.522  -24.364 1.00 0.00 ? 112 SER A C    4  
ATOM 6679  O O    . SER A 1 112 ? -15.236 17.748  -23.867 1.00 0.00 ? 112 SER A O    4  
ATOM 6680  C CB   . SER A 1 112 ? -15.314 15.727  -25.773 1.00 0.00 ? 112 SER A CB   4  
ATOM 6681  O OG   . SER A 1 112 ? -15.307 14.830  -24.676 1.00 0.00 ? 112 SER A OG   4  
ATOM 6682  H H    . SER A 1 112 ? -15.692 18.164  -27.008 1.00 0.00 ? 112 SER A H    4  
ATOM 6683  H HA   . SER A 1 112 ? -17.401 16.185  -25.646 1.00 0.00 ? 112 SER A HA   4  
ATOM 6684  H HB2  . SER A 1 112 ? -15.421 15.161  -26.686 1.00 0.00 ? 112 SER A HB2  4  
ATOM 6685  H HB3  . SER A 1 112 ? -14.377 16.264  -25.790 1.00 0.00 ? 112 SER A HB3  4  
ATOM 6686  H HG   . SER A 1 112 ? -14.523 14.982  -24.143 1.00 0.00 ? 112 SER A HG   4  
ATOM 6687  N N    . SER A 1 113 ? -17.477 17.944  -23.821 1.00 0.00 ? 113 SER A N    4  
ATOM 6688  C CA   . SER A 1 113 ? -17.495 18.717  -22.585 1.00 0.00 ? 113 SER A CA   4  
ATOM 6689  C C    . SER A 1 113 ? -17.186 17.829  -21.384 1.00 0.00 ? 113 SER A C    4  
ATOM 6690  O O    . SER A 1 113 ? -17.720 16.728  -21.259 1.00 0.00 ? 113 SER A O    4  
ATOM 6691  C CB   . SER A 1 113 ? -18.856 19.391  -22.399 1.00 0.00 ? 113 SER A CB   4  
ATOM 6692  O OG   . SER A 1 113 ? -19.860 18.437  -22.098 1.00 0.00 ? 113 SER A OG   4  
ATOM 6693  H H    . SER A 1 113 ? -18.326 17.731  -24.265 1.00 0.00 ? 113 SER A H    4  
ATOM 6694  H HA   . SER A 1 113 ? -16.733 19.479  -22.660 1.00 0.00 ? 113 SER A HA   4  
ATOM 6695  H HB2  . SER A 1 113 ? -18.795 20.100  -21.588 1.00 0.00 ? 113 SER A HB2  4  
ATOM 6696  H HB3  . SER A 1 113 ? -19.126 19.906  -23.310 1.00 0.00 ? 113 SER A HB3  4  
ATOM 6697  H HG   . SER A 1 113 ? -20.046 17.911  -22.879 1.00 0.00 ? 113 SER A HG   4  
ATOM 6698  N N    . GLY A 1 114 ? -16.319 18.317  -20.502 1.00 0.00 ? 114 GLY A N    4  
ATOM 6699  C CA   . GLY A 1 114 ? -15.953 17.555  -19.322 1.00 0.00 ? 114 GLY A CA   4  
ATOM 6700  C C    . GLY A 1 114 ? -15.013 18.317  -18.409 1.00 0.00 ? 114 GLY A C    4  
ATOM 6701  O O    . GLY A 1 114 ? -13.959 18.785  -18.842 1.00 0.00 ? 114 GLY A O    4  
ATOM 6702  H H    . GLY A 1 114 ? -15.924 19.201  -20.654 1.00 0.00 ? 114 GLY A H    4  
ATOM 6703  H HA2  . GLY A 1 114 ? -16.849 17.309  -18.774 1.00 0.00 ? 114 GLY A HA2  4  
ATOM 6704  H HA3  . GLY A 1 114 ? -15.470 16.641  -19.634 1.00 0.00 ? 114 GLY A HA3  4  
ATOM 6705  N N    . GLY A 1 1   ? -12.208 -25.533 -20.994 1.00 0.00 ? 1   GLY A N    5  
ATOM 6706  C CA   . GLY A 1 1   ? -11.501 -24.902 -22.093 1.00 0.00 ? 1   GLY A CA   5  
ATOM 6707  C C    . GLY A 1 1   ? -10.792 -23.630 -21.671 1.00 0.00 ? 1   GLY A C    5  
ATOM 6708  O O    . GLY A 1 1   ? -9.617  -23.434 -21.983 1.00 0.00 ? 1   GLY A O    5  
ATOM 6709  H H1   . GLY A 1 1   ? -12.056 -26.481 -20.796 1.00 0.00 ? 1   GLY A H1   5  
ATOM 6710  H HA2  . GLY A 1 1   ? -10.771 -25.596 -22.483 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6711  H HA3  . GLY A 1 1   ? -12.209 -24.664 -22.873 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6712  N N    . SER A 1 2   ? -11.507 -22.763 -20.962 1.00 0.00 ? 2   SER A N    5  
ATOM 6713  C CA   . SER A 1 2   ? -10.941 -21.500 -20.502 1.00 0.00 ? 2   SER A CA   5  
ATOM 6714  C C    . SER A 1 2   ? -10.339 -20.719 -21.666 1.00 0.00 ? 2   SER A C    5  
ATOM 6715  O O    . SER A 1 2   ? -9.260  -20.139 -21.547 1.00 0.00 ? 2   SER A O    5  
ATOM 6716  C CB   . SER A 1 2   ? -9.873  -21.754 -19.437 1.00 0.00 ? 2   SER A CB   5  
ATOM 6717  O OG   . SER A 1 2   ? -9.430  -20.538 -18.859 1.00 0.00 ? 2   SER A OG   5  
ATOM 6718  H H    . SER A 1 2   ? -12.439 -22.976 -20.746 1.00 0.00 ? 2   SER A H    5  
ATOM 6719  H HA   . SER A 1 2   ? -11.740 -20.918 -20.068 1.00 0.00 ? 2   SER A HA   5  
ATOM 6720  H HB2  . SER A 1 2   ? -10.285 -22.379 -18.659 1.00 0.00 ? 2   SER A HB2  5  
ATOM 6721  H HB3  . SER A 1 2   ? -9.028  -22.253 -19.890 1.00 0.00 ? 2   SER A HB3  5  
ATOM 6722  H HG   . SER A 1 2   ? -10.127 -19.882 -18.921 1.00 0.00 ? 2   SER A HG   5  
ATOM 6723  N N    . SER A 1 3   ? -11.046 -20.708 -22.792 1.00 0.00 ? 3   SER A N    5  
ATOM 6724  C CA   . SER A 1 3   ? -10.580 -20.002 -23.980 1.00 0.00 ? 3   SER A CA   5  
ATOM 6725  C C    . SER A 1 3   ? -11.004 -18.537 -23.941 1.00 0.00 ? 3   SER A C    5  
ATOM 6726  O O    . SER A 1 3   ? -11.451 -17.981 -24.943 1.00 0.00 ? 3   SER A O    5  
ATOM 6727  C CB   . SER A 1 3   ? -11.128 -20.669 -25.243 1.00 0.00 ? 3   SER A CB   5  
ATOM 6728  O OG   . SER A 1 3   ? -10.335 -20.349 -26.373 1.00 0.00 ? 3   SER A OG   5  
ATOM 6729  H H    . SER A 1 3   ? -11.899 -21.190 -22.825 1.00 0.00 ? 3   SER A H    5  
ATOM 6730  H HA   . SER A 1 3   ? -9.502  -20.053 -23.995 1.00 0.00 ? 3   SER A HA   5  
ATOM 6731  H HB2  . SER A 1 3   ? -11.128 -21.740 -25.110 1.00 0.00 ? 3   SER A HB2  5  
ATOM 6732  H HB3  . SER A 1 3   ? -12.138 -20.328 -25.418 1.00 0.00 ? 3   SER A HB3  5  
ATOM 6733  H HG   . SER A 1 3   ? -10.891 -20.315 -27.155 1.00 0.00 ? 3   SER A HG   5  
ATOM 6734  N N    . GLY A 1 4   ? -10.858 -17.916 -22.774 1.00 0.00 ? 4   GLY A N    5  
ATOM 6735  C CA   . GLY A 1 4   ? -11.230 -16.521 -22.625 1.00 0.00 ? 4   GLY A CA   5  
ATOM 6736  C C    . GLY A 1 4   ? -12.642 -16.350 -22.102 1.00 0.00 ? 4   GLY A C    5  
ATOM 6737  O O    . GLY A 1 4   ? -12.887 -15.535 -21.212 1.00 0.00 ? 4   GLY A O    5  
ATOM 6738  H H    . GLY A 1 4   ? -10.496 -18.409 -22.009 1.00 0.00 ? 4   GLY A H    5  
ATOM 6739  H HA2  . GLY A 1 4   ? -10.543 -16.048 -21.939 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6740  H HA3  . GLY A 1 4   ? -11.153 -16.035 -23.586 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6741  N N    . SER A 1 5   ? -13.574 -17.118 -22.656 1.00 0.00 ? 5   SER A N    5  
ATOM 6742  C CA   . SER A 1 5   ? -14.971 -17.044 -22.244 1.00 0.00 ? 5   SER A CA   5  
ATOM 6743  C C    . SER A 1 5   ? -15.091 -17.078 -20.723 1.00 0.00 ? 5   SER A C    5  
ATOM 6744  O O    . SER A 1 5   ? -15.066 -18.145 -20.111 1.00 0.00 ? 5   SER A O    5  
ATOM 6745  C CB   . SER A 1 5   ? -15.767 -18.198 -22.855 1.00 0.00 ? 5   SER A CB   5  
ATOM 6746  O OG   . SER A 1 5   ? -17.160 -17.950 -22.785 1.00 0.00 ? 5   SER A OG   5  
ATOM 6747  H H    . SER A 1 5   ? -13.316 -17.749 -23.361 1.00 0.00 ? 5   SER A H    5  
ATOM 6748  H HA   . SER A 1 5   ? -15.373 -16.109 -22.604 1.00 0.00 ? 5   SER A HA   5  
ATOM 6749  H HB2  . SER A 1 5   ? -15.486 -18.317 -23.890 1.00 0.00 ? 5   SER A HB2  5  
ATOM 6750  H HB3  . SER A 1 5   ? -15.548 -19.109 -22.316 1.00 0.00 ? 5   SER A HB3  5  
ATOM 6751  H HG   . SER A 1 5   ? -17.346 -17.373 -22.041 1.00 0.00 ? 5   SER A HG   5  
ATOM 6752  N N    . SER A 1 6   ? -15.220 -15.900 -20.120 1.00 0.00 ? 6   SER A N    5  
ATOM 6753  C CA   . SER A 1 6   ? -15.340 -15.793 -18.670 1.00 0.00 ? 6   SER A CA   5  
ATOM 6754  C C    . SER A 1 6   ? -16.720 -15.275 -18.277 1.00 0.00 ? 6   SER A C    5  
ATOM 6755  O O    . SER A 1 6   ? -17.411 -14.645 -19.077 1.00 0.00 ? 6   SER A O    5  
ATOM 6756  C CB   . SER A 1 6   ? -14.257 -14.867 -18.115 1.00 0.00 ? 6   SER A CB   5  
ATOM 6757  O OG   . SER A 1 6   ? -14.170 -14.973 -16.705 1.00 0.00 ? 6   SER A OG   5  
ATOM 6758  H H    . SER A 1 6   ? -15.233 -15.084 -20.663 1.00 0.00 ? 6   SER A H    5  
ATOM 6759  H HA   . SER A 1 6   ? -15.207 -16.780 -18.253 1.00 0.00 ? 6   SER A HA   5  
ATOM 6760  H HB2  . SER A 1 6   ? -13.304 -15.134 -18.544 1.00 0.00 ? 6   SER A HB2  5  
ATOM 6761  H HB3  . SER A 1 6   ? -14.494 -13.845 -18.373 1.00 0.00 ? 6   SER A HB3  5  
ATOM 6762  H HG   . SER A 1 6   ? -13.313 -15.334 -16.463 1.00 0.00 ? 6   SER A HG   5  
ATOM 6763  N N    . GLY A 1 7   ? -17.115 -15.545 -17.036 1.00 0.00 ? 7   GLY A N    5  
ATOM 6764  C CA   . GLY A 1 7   ? -18.410 -15.099 -16.556 1.00 0.00 ? 7   GLY A CA   5  
ATOM 6765  C C    . GLY A 1 7   ? -18.321 -13.817 -15.752 1.00 0.00 ? 7   GLY A C    5  
ATOM 6766  O O    . GLY A 1 7   ? -17.904 -12.781 -16.269 1.00 0.00 ? 7   GLY A O    5  
ATOM 6767  H H    . GLY A 1 7   ? -16.522 -16.051 -16.442 1.00 0.00 ? 7   GLY A H    5  
ATOM 6768  H HA2  . GLY A 1 7   ? -19.059 -14.936 -17.404 1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6769  H HA3  . GLY A 1 7   ? -18.836 -15.872 -15.933 1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6770  N N    . GLU A 1 8   ? -18.715 -13.887 -14.484 1.00 0.00 ? 8   GLU A N    5  
ATOM 6771  C CA   . GLU A 1 8   ? -18.679 -12.722 -13.609 1.00 0.00 ? 8   GLU A CA   5  
ATOM 6772  C C    . GLU A 1 8   ? -19.417 -11.544 -14.240 1.00 0.00 ? 8   GLU A C    5  
ATOM 6773  O O    . GLU A 1 8   ? -18.965 -10.401 -14.161 1.00 0.00 ? 8   GLU A O    5  
ATOM 6774  C CB   . GLU A 1 8   ? -17.232 -12.328 -13.305 1.00 0.00 ? 8   GLU A CB   5  
ATOM 6775  C CG   . GLU A 1 8   ? -16.473 -13.371 -12.503 1.00 0.00 ? 8   GLU A CG   5  
ATOM 6776  C CD   . GLU A 1 8   ? -14.973 -13.153 -12.534 1.00 0.00 ? 8   GLU A CD   5  
ATOM 6777  O OE1  . GLU A 1 8   ? -14.401 -13.110 -13.644 1.00 0.00 ? 8   GLU A OE1  5  
ATOM 6778  O OE2  . GLU A 1 8   ? -14.370 -13.024 -11.448 1.00 0.00 ? 8   GLU A OE2  5  
ATOM 6779  H H    . GLU A 1 8   ? -19.037 -14.742 -14.130 1.00 0.00 ? 8   GLU A H    5  
ATOM 6780  H HA   . GLU A 1 8   ? -19.172 -12.986 -12.685 1.00 0.00 ? 8   GLU A HA   5  
ATOM 6781  H HB2  . GLU A 1 8   ? -16.711 -12.171 -14.238 1.00 0.00 ? 8   GLU A HB2  5  
ATOM 6782  H HB3  . GLU A 1 8   ? -17.233 -11.405 -12.745 1.00 0.00 ? 8   GLU A HB3  5  
ATOM 6783  H HG2  . GLU A 1 8   ? -16.806 -13.331 -11.477 1.00 0.00 ? 8   GLU A HG2  5  
ATOM 6784  H HG3  . GLU A 1 8   ? -16.688 -14.348 -12.912 1.00 0.00 ? 8   GLU A HG3  5  
ATOM 6785  N N    . ILE A 1 9   ? -20.553 -11.832 -14.866 1.00 0.00 ? 9   ILE A N    5  
ATOM 6786  C CA   . ILE A 1 9   ? -21.353 -10.798 -15.510 1.00 0.00 ? 9   ILE A CA   5  
ATOM 6787  C C    . ILE A 1 9   ? -22.431 -10.271 -14.569 1.00 0.00 ? 9   ILE A C    5  
ATOM 6788  O O    . ILE A 1 9   ? -22.978 -11.017 -13.757 1.00 0.00 ? 9   ILE A O    5  
ATOM 6789  C CB   . ILE A 1 9   ? -22.020 -11.322 -16.796 1.00 0.00 ? 9   ILE A CB   5  
ATOM 6790  C CG1  . ILE A 1 9   ? -22.852 -12.570 -16.492 1.00 0.00 ? 9   ILE A CG1  5  
ATOM 6791  C CG2  . ILE A 1 9   ? -20.969 -11.624 -17.853 1.00 0.00 ? 9   ILE A CG2  5  
ATOM 6792  C CD1  . ILE A 1 9   ? -23.949 -12.825 -17.502 1.00 0.00 ? 9   ILE A CD1  5  
ATOM 6793  H H    . ILE A 1 9   ? -20.860 -12.762 -14.895 1.00 0.00 ? 9   ILE A H    5  
ATOM 6794  H HA   . ILE A 1 9   ? -20.693 -9.985  -15.777 1.00 0.00 ? 9   ILE A HA   5  
ATOM 6795  H HB   . ILE A 1 9   ? -22.670 -10.550 -17.178 1.00 0.00 ? 9   ILE A HB   5  
ATOM 6796  H HG12 . ILE A 1 9   ? -22.205 -13.433 -16.481 1.00 0.00 ? 9   ILE A HG12 5  
ATOM 6797  H HG13 . ILE A 1 9   ? -23.313 -12.459 -15.521 1.00 0.00 ? 9   ILE A HG13 5  
ATOM 6798  H HG21 . ILE A 1 9   ? -20.181 -12.220 -17.418 1.00 0.00 ? 9   ILE A HG21 5  
ATOM 6799  H HG22 . ILE A 1 9   ? -21.424 -12.169 -18.667 1.00 0.00 ? 9   ILE A HG22 5  
ATOM 6800  H HG23 . ILE A 1 9   ? -20.557 -10.698 -18.226 1.00 0.00 ? 9   ILE A HG23 5  
ATOM 6801  H HD11 . ILE A 1 9   ? -24.666 -13.518 -17.087 1.00 0.00 ? 9   ILE A HD11 5  
ATOM 6802  H HD12 . ILE A 1 9   ? -24.442 -11.895 -17.742 1.00 0.00 ? 9   ILE A HD12 5  
ATOM 6803  H HD13 . ILE A 1 9   ? -23.520 -13.247 -18.400 1.00 0.00 ? 9   ILE A HD13 5  
ATOM 6804  N N    . GLU A 1 10  ? -22.732 -8.982  -14.686 1.00 0.00 ? 10  GLU A N    5  
ATOM 6805  C CA   . GLU A 1 10  ? -23.746 -8.355  -13.846 1.00 0.00 ? 10  GLU A CA   5  
ATOM 6806  C C    . GLU A 1 10  ? -24.287 -7.087  -14.500 1.00 0.00 ? 10  GLU A C    5  
ATOM 6807  O O    . GLU A 1 10  ? -23.675 -6.540  -15.418 1.00 0.00 ? 10  GLU A O    5  
ATOM 6808  C CB   . GLU A 1 10  ? -23.166 -8.025  -12.469 1.00 0.00 ? 10  GLU A CB   5  
ATOM 6809  C CG   . GLU A 1 10  ? -24.222 -7.693  -11.428 1.00 0.00 ? 10  GLU A CG   5  
ATOM 6810  C CD   . GLU A 1 10  ? -23.680 -7.740  -10.013 1.00 0.00 ? 10  GLU A CD   5  
ATOM 6811  O OE1  . GLU A 1 10  ? -22.956 -6.799  -9.624  1.00 0.00 ? 10  GLU A OE1  5  
ATOM 6812  O OE2  . GLU A 1 10  ? -23.979 -8.716  -9.294  1.00 0.00 ? 10  GLU A OE2  5  
ATOM 6813  H H    . GLU A 1 10  ? -22.261 -8.439  -15.353 1.00 0.00 ? 10  GLU A H    5  
ATOM 6814  H HA   . GLU A 1 10  ? -24.557 -9.058  -13.726 1.00 0.00 ? 10  GLU A HA   5  
ATOM 6815  H HB2  . GLU A 1 10  ? -22.597 -8.873  -12.118 1.00 0.00 ? 10  GLU A HB2  5  
ATOM 6816  H HB3  . GLU A 1 10  ? -22.506 -7.175  -12.565 1.00 0.00 ? 10  GLU A HB3  5  
ATOM 6817  H HG2  . GLU A 1 10  ? -24.599 -6.700  -11.620 1.00 0.00 ? 10  GLU A HG2  5  
ATOM 6818  H HG3  . GLU A 1 10  ? -25.029 -8.406  -11.512 1.00 0.00 ? 10  GLU A HG3  5  
ATOM 6819  N N    . ILE A 1 11  ? -25.438 -6.626  -14.021 1.00 0.00 ? 11  ILE A N    5  
ATOM 6820  C CA   . ILE A 1 11  ? -26.061 -5.423  -14.558 1.00 0.00 ? 11  ILE A CA   5  
ATOM 6821  C C    . ILE A 1 11  ? -25.023 -4.338  -14.823 1.00 0.00 ? 11  ILE A C    5  
ATOM 6822  O O    . ILE A 1 11  ? -25.067 -3.661  -15.851 1.00 0.00 ? 11  ILE A O    5  
ATOM 6823  C CB   . ILE A 1 11  ? -27.133 -4.870  -13.601 1.00 0.00 ? 11  ILE A CB   5  
ATOM 6824  C CG1  . ILE A 1 11  ? -28.199 -5.932  -13.324 1.00 0.00 ? 11  ILE A CG1  5  
ATOM 6825  C CG2  . ILE A 1 11  ? -27.767 -3.616  -14.185 1.00 0.00 ? 11  ILE A CG2  5  
ATOM 6826  C CD1  . ILE A 1 11  ? -28.976 -6.344  -14.555 1.00 0.00 ? 11  ILE A CD1  5  
ATOM 6827  H H    . ILE A 1 11  ? -25.877 -7.106  -13.289 1.00 0.00 ? 11  ILE A H    5  
ATOM 6828  H HA   . ILE A 1 11  ? -26.540 -5.684  -15.491 1.00 0.00 ? 11  ILE A HA   5  
ATOM 6829  H HB   . ILE A 1 11  ? -26.652 -4.602  -12.673 1.00 0.00 ? 11  ILE A HB   5  
ATOM 6830  H HG12 . ILE A 1 11  ? -27.724 -6.814  -12.923 1.00 0.00 ? 11  ILE A HG12 5  
ATOM 6831  H HG13 . ILE A 1 11  ? -28.902 -5.546  -12.601 1.00 0.00 ? 11  ILE A HG13 5  
ATOM 6832  H HG21 . ILE A 1 11  ? -27.332 -2.743  -13.720 1.00 0.00 ? 11  ILE A HG21 5  
ATOM 6833  H HG22 . ILE A 1 11  ? -27.587 -3.583  -15.249 1.00 0.00 ? 11  ILE A HG22 5  
ATOM 6834  H HG23 . ILE A 1 11  ? -28.831 -3.630  -13.999 1.00 0.00 ? 11  ILE A HG23 5  
ATOM 6835  H HD11 . ILE A 1 11  ? -29.992 -6.581  -14.277 1.00 0.00 ? 11  ILE A HD11 5  
ATOM 6836  H HD12 . ILE A 1 11  ? -28.977 -5.534  -15.269 1.00 0.00 ? 11  ILE A HD12 5  
ATOM 6837  H HD13 . ILE A 1 11  ? -28.513 -7.214  -14.999 1.00 0.00 ? 11  ILE A HD13 5  
ATOM 6838  N N    . CYS A 1 12  ? -24.090 -4.179  -13.891 1.00 0.00 ? 12  CYS A N    5  
ATOM 6839  C CA   . CYS A 1 12  ? -23.040 -3.176  -14.024 1.00 0.00 ? 12  CYS A CA   5  
ATOM 6840  C C    . CYS A 1 12  ? -21.660 -3.825  -13.982 1.00 0.00 ? 12  CYS A C    5  
ATOM 6841  O O    . CYS A 1 12  ? -21.027 -3.929  -12.931 1.00 0.00 ? 12  CYS A O    5  
ATOM 6842  C CB   . CYS A 1 12  ? -23.159 -2.132  -12.913 1.00 0.00 ? 12  CYS A CB   5  
ATOM 6843  S SG   . CYS A 1 12  ? -24.639 -1.100  -13.026 1.00 0.00 ? 12  CYS A SG   5  
ATOM 6844  H H    . CYS A 1 12  ? -24.108 -4.749  -13.094 1.00 0.00 ? 12  CYS A H    5  
ATOM 6845  H HA   . CYS A 1 12  ? -23.166 -2.689  -14.979 1.00 0.00 ? 12  CYS A HA   5  
ATOM 6846  H HB2  . CYS A 1 12  ? -23.182 -2.635  -11.958 1.00 0.00 ? 12  CYS A HB2  5  
ATOM 6847  H HB3  . CYS A 1 12  ? -22.299 -1.480  -12.948 1.00 0.00 ? 12  CYS A HB3  5  
ATOM 6848  H HG   . CYS A 1 12  ? -25.631 -1.740  -12.427 1.00 0.00 ? 12  CYS A HG   5  
ATOM 6849  N N    . PRO A 1 13  ? -21.182 -4.275  -15.152 1.00 0.00 ? 13  PRO A N    5  
ATOM 6850  C CA   . PRO A 1 13  ? -19.873 -4.923  -15.275 1.00 0.00 ? 13  PRO A CA   5  
ATOM 6851  C C    . PRO A 1 13  ? -18.720 -3.947  -15.068 1.00 0.00 ? 13  PRO A C    5  
ATOM 6852  O O    . PRO A 1 13  ? -18.440 -3.109  -15.926 1.00 0.00 ? 13  PRO A O    5  
ATOM 6853  C CB   . PRO A 1 13  ? -19.873 -5.453  -16.712 1.00 0.00 ? 13  PRO A CB   5  
ATOM 6854  C CG   . PRO A 1 13  ? -20.824 -4.567  -17.441 1.00 0.00 ? 13  PRO A CG   5  
ATOM 6855  C CD   . PRO A 1 13  ? -21.882 -4.185  -16.444 1.00 0.00 ? 13  PRO A CD   5  
ATOM 6856  H HA   . PRO A 1 13  ? -19.772 -5.749  -14.586 1.00 0.00 ? 13  PRO A HA   5  
ATOM 6857  H HB2  . PRO A 1 13  ? -18.875 -5.387  -17.122 1.00 0.00 ? 13  PRO A HB2  5  
ATOM 6858  H HB3  . PRO A 1 13  ? -20.205 -6.480  -16.720 1.00 0.00 ? 13  PRO A HB3  5  
ATOM 6859  H HG2  . PRO A 1 13  ? -20.308 -3.688  -17.797 1.00 0.00 ? 13  PRO A HG2  5  
ATOM 6860  H HG3  . PRO A 1 13  ? -21.264 -5.105  -18.268 1.00 0.00 ? 13  PRO A HG3  5  
ATOM 6861  H HD2  . PRO A 1 13  ? -22.226 -3.178  -16.627 1.00 0.00 ? 13  PRO A HD2  5  
ATOM 6862  H HD3  . PRO A 1 13  ? -22.707 -4.881  -16.484 1.00 0.00 ? 13  PRO A HD3  5  
ATOM 6863  N N    . LYS A 1 14  ? -18.054 -4.059  -13.924 1.00 0.00 ? 14  LYS A N    5  
ATOM 6864  C CA   . LYS A 1 14  ? -16.930 -3.188  -13.603 1.00 0.00 ? 14  LYS A CA   5  
ATOM 6865  C C    . LYS A 1 14  ? -15.720 -3.519  -14.471 1.00 0.00 ? 14  LYS A C    5  
ATOM 6866  O O    . LYS A 1 14  ? -15.463 -4.683  -14.777 1.00 0.00 ? 14  LYS A O    5  
ATOM 6867  C CB   . LYS A 1 14  ? -16.561 -3.319  -12.124 1.00 0.00 ? 14  LYS A CB   5  
ATOM 6868  C CG   . LYS A 1 14  ? -17.509 -2.583  -11.193 1.00 0.00 ? 14  LYS A CG   5  
ATOM 6869  C CD   . LYS A 1 14  ? -16.943 -2.482  -9.787  1.00 0.00 ? 14  LYS A CD   5  
ATOM 6870  C CE   . LYS A 1 14  ? -16.930 -3.835  -9.093  1.00 0.00 ? 14  LYS A CE   5  
ATOM 6871  N NZ   . LYS A 1 14  ? -18.306 -4.316  -8.787  1.00 0.00 ? 14  LYS A NZ   5  
ATOM 6872  H H    . LYS A 1 14  ? -18.324 -4.747  -13.279 1.00 0.00 ? 14  LYS A H    5  
ATOM 6873  H HA   . LYS A 1 14  ? -17.232 -2.170  -13.801 1.00 0.00 ? 14  LYS A HA   5  
ATOM 6874  H HB2  . LYS A 1 14  ? -16.567 -4.366  -11.856 1.00 0.00 ? 14  LYS A HB2  5  
ATOM 6875  H HB3  . LYS A 1 14  ? -15.567 -2.924  -11.977 1.00 0.00 ? 14  LYS A HB3  5  
ATOM 6876  H HG2  . LYS A 1 14  ? -17.673 -1.587  -11.576 1.00 0.00 ? 14  LYS A HG2  5  
ATOM 6877  H HG3  . LYS A 1 14  ? -18.449 -3.116  -11.156 1.00 0.00 ? 14  LYS A HG3  5  
ATOM 6878  H HD2  . LYS A 1 14  ? -15.932 -2.108  -9.841  1.00 0.00 ? 14  LYS A HD2  5  
ATOM 6879  H HD3  . LYS A 1 14  ? -17.551 -1.798  -9.212  1.00 0.00 ? 14  LYS A HD3  5  
ATOM 6880  H HE2  . LYS A 1 14  ? -16.443 -4.551  -9.738  1.00 0.00 ? 14  LYS A HE2  5  
ATOM 6881  H HE3  . LYS A 1 14  ? -16.375 -3.747  -8.170  1.00 0.00 ? 14  LYS A HE3  5  
ATOM 6882  H HZ1  . LYS A 1 14  ? -19.004 -3.766  -9.327  1.00 0.00 ? 14  LYS A HZ1  5  
ATOM 6883  H HZ2  . LYS A 1 14  ? -18.505 -4.206  -7.772  1.00 0.00 ? 14  LYS A HZ2  5  
ATOM 6884  H HZ3  . LYS A 1 14  ? -18.399 -5.320  -9.041  1.00 0.00 ? 14  LYS A HZ3  5  
ATOM 6885  N N    . VAL A 1 15  ? -14.979 -2.488  -14.864 1.00 0.00 ? 15  VAL A N    5  
ATOM 6886  C CA   . VAL A 1 15  ? -13.794 -2.670  -15.694 1.00 0.00 ? 15  VAL A CA   5  
ATOM 6887  C C    . VAL A 1 15  ? -12.527 -2.295  -14.934 1.00 0.00 ? 15  VAL A C    5  
ATOM 6888  O O    . VAL A 1 15  ? -12.557 -1.464  -14.026 1.00 0.00 ? 15  VAL A O    5  
ATOM 6889  C CB   . VAL A 1 15  ? -13.876 -1.827  -16.981 1.00 0.00 ? 15  VAL A CB   5  
ATOM 6890  C CG1  . VAL A 1 15  ? -15.051 -2.272  -17.838 1.00 0.00 ? 15  VAL A CG1  5  
ATOM 6891  C CG2  . VAL A 1 15  ? -13.982 -0.348  -16.642 1.00 0.00 ? 15  VAL A CG2  5  
ATOM 6892  H H    . VAL A 1 15  ? -15.235 -1.583  -14.588 1.00 0.00 ? 15  VAL A H    5  
ATOM 6893  H HA   . VAL A 1 15  ? -13.740 -3.712  -15.974 1.00 0.00 ? 15  VAL A HA   5  
ATOM 6894  H HB   . VAL A 1 15  ? -12.968 -1.981  -17.546 1.00 0.00 ? 15  VAL A HB   5  
ATOM 6895  H HG11 . VAL A 1 15  ? -14.975 -1.818  -18.815 1.00 0.00 ? 15  VAL A HG11 5  
ATOM 6896  H HG12 . VAL A 1 15  ? -15.037 -3.348  -17.937 1.00 0.00 ? 15  VAL A HG12 5  
ATOM 6897  H HG13 . VAL A 1 15  ? -15.974 -1.965  -17.369 1.00 0.00 ? 15  VAL A HG13 5  
ATOM 6898  H HG21 . VAL A 1 15  ? -13.827 0.238   -17.536 1.00 0.00 ? 15  VAL A HG21 5  
ATOM 6899  H HG22 . VAL A 1 15  ? -14.964 -0.139  -16.241 1.00 0.00 ? 15  VAL A HG22 5  
ATOM 6900  H HG23 . VAL A 1 15  ? -13.232 -0.091  -15.909 1.00 0.00 ? 15  VAL A HG23 5  
ATOM 6901  N N    . THR A 1 16  ? -11.413 -2.915  -15.310 1.00 0.00 ? 16  THR A N    5  
ATOM 6902  C CA   . THR A 1 16  ? -10.134 -2.648  -14.663 1.00 0.00 ? 16  THR A CA   5  
ATOM 6903  C C    . THR A 1 16  ? -9.400  -1.501  -15.349 1.00 0.00 ? 16  THR A C    5  
ATOM 6904  O O    . THR A 1 16  ? -9.349  -1.431  -16.576 1.00 0.00 ? 16  THR A O    5  
ATOM 6905  C CB   . THR A 1 16  ? -9.231  -3.895  -14.667 1.00 0.00 ? 16  THR A CB   5  
ATOM 6906  O OG1  . THR A 1 16  ? -9.169  -4.451  -15.985 1.00 0.00 ? 16  THR A OG1  5  
ATOM 6907  C CG2  . THR A 1 16  ? -9.750  -4.943  -13.694 1.00 0.00 ? 16  THR A CG2  5  
ATOM 6908  H H    . THR A 1 16  ? -11.453 -3.568  -16.040 1.00 0.00 ? 16  THR A H    5  
ATOM 6909  H HA   . THR A 1 16  ? -10.331 -2.374  -13.636 1.00 0.00 ? 16  THR A HA   5  
ATOM 6910  H HB   . THR A 1 16  ? -8.237  -3.602  -14.361 1.00 0.00 ? 16  THR A HB   5  
ATOM 6911  H HG1  . THR A 1 16  ? -9.213  -3.744  -16.633 1.00 0.00 ? 16  THR A HG1  5  
ATOM 6912  H HG21 . THR A 1 16  ? -9.602  -5.928  -14.111 1.00 0.00 ? 16  THR A HG21 5  
ATOM 6913  H HG22 . THR A 1 16  ? -10.803 -4.780  -13.519 1.00 0.00 ? 16  THR A HG22 5  
ATOM 6914  H HG23 . THR A 1 16  ? -9.214  -4.863  -12.760 1.00 0.00 ? 16  THR A HG23 5  
ATOM 6915  N N    . GLN A 1 17  ? -8.834  -0.604  -14.548 1.00 0.00 ? 17  GLN A N    5  
ATOM 6916  C CA   . GLN A 1 17  ? -8.102  0.540   -15.079 1.00 0.00 ? 17  GLN A CA   5  
ATOM 6917  C C    . GLN A 1 17  ? -6.715  0.638   -14.453 1.00 0.00 ? 17  GLN A C    5  
ATOM 6918  O O    . GLN A 1 17  ? -6.580  0.759   -13.235 1.00 0.00 ? 17  GLN A O    5  
ATOM 6919  C CB   . GLN A 1 17  ? -8.881  1.832   -14.826 1.00 0.00 ? 17  GLN A CB   5  
ATOM 6920  C CG   . GLN A 1 17  ? -9.081  2.143   -13.352 1.00 0.00 ? 17  GLN A CG   5  
ATOM 6921  C CD   . GLN A 1 17  ? -10.003 3.325   -13.124 1.00 0.00 ? 17  GLN A CD   5  
ATOM 6922  O OE1  . GLN A 1 17  ? -10.746 3.728   -14.019 1.00 0.00 ? 17  GLN A OE1  5  
ATOM 6923  N NE2  . GLN A 1 17  ? -9.958  3.888   -11.923 1.00 0.00 ? 17  GLN A NE2  5  
ATOM 6924  H H    . GLN A 1 17  ? -8.909  -0.715  -13.577 1.00 0.00 ? 17  GLN A H    5  
ATOM 6925  H HA   . GLN A 1 17  ? -7.994  0.398   -16.144 1.00 0.00 ? 17  GLN A HA   5  
ATOM 6926  H HB2  . GLN A 1 17  ? -8.346  2.655   -15.276 1.00 0.00 ? 17  GLN A HB2  5  
ATOM 6927  H HB3  . GLN A 1 17  ? -9.853  1.748   -15.289 1.00 0.00 ? 17  GLN A HB3  5  
ATOM 6928  H HG2  . GLN A 1 17  ? -9.508  1.276   -12.869 1.00 0.00 ? 17  GLN A HG2  5  
ATOM 6929  H HG3  . GLN A 1 17  ? -8.121  2.363   -12.910 1.00 0.00 ? 17  GLN A HG3  5  
ATOM 6930  H HE21 . GLN A 1 17  ? -9.340  3.514   -11.260 1.00 0.00 ? 17  GLN A HE21 5  
ATOM 6931  H HE22 . GLN A 1 17  ? -10.542 4.655   -11.749 1.00 0.00 ? 17  GLN A HE22 5  
ATOM 6932  N N    . SER A 1 18  ? -5.687  0.583   -15.293 1.00 0.00 ? 18  SER A N    5  
ATOM 6933  C CA   . SER A 1 18  ? -4.309  0.661   -14.822 1.00 0.00 ? 18  SER A CA   5  
ATOM 6934  C C    . SER A 1 18  ? -3.892  2.112   -14.600 1.00 0.00 ? 18  SER A C    5  
ATOM 6935  O O    . SER A 1 18  ? -3.774  2.887   -15.550 1.00 0.00 ? 18  SER A O    5  
ATOM 6936  C CB   . SER A 1 18  ? -3.366  -0.005  -15.825 1.00 0.00 ? 18  SER A CB   5  
ATOM 6937  O OG   . SER A 1 18  ? -3.508  0.565   -17.115 1.00 0.00 ? 18  SER A OG   5  
ATOM 6938  H H    . SER A 1 18  ? -5.859  0.485   -16.253 1.00 0.00 ? 18  SER A H    5  
ATOM 6939  H HA   . SER A 1 18  ? -4.250  0.134   -13.881 1.00 0.00 ? 18  SER A HA   5  
ATOM 6940  H HB2  . SER A 1 18  ? -2.346  0.126   -15.498 1.00 0.00 ? 18  SER A HB2  5  
ATOM 6941  H HB3  . SER A 1 18  ? -3.593  -1.060  -15.883 1.00 0.00 ? 18  SER A HB3  5  
ATOM 6942  H HG   . SER A 1 18  ? -2.720  0.386   -17.633 1.00 0.00 ? 18  SER A HG   5  
ATOM 6943  N N    . ILE A 1 19  ? -3.671  2.471   -13.340 1.00 0.00 ? 19  ILE A N    5  
ATOM 6944  C CA   . ILE A 1 19  ? -3.266  3.828   -12.994 1.00 0.00 ? 19  ILE A CA   5  
ATOM 6945  C C    . ILE A 1 19  ? -1.800  3.875   -12.578 1.00 0.00 ? 19  ILE A C    5  
ATOM 6946  O O    . ILE A 1 19  ? -1.436  3.423   -11.492 1.00 0.00 ? 19  ILE A O    5  
ATOM 6947  C CB   . ILE A 1 19  ? -4.129  4.399   -11.853 1.00 0.00 ? 19  ILE A CB   5  
ATOM 6948  C CG1  . ILE A 1 19  ? -5.593  4.493   -12.290 1.00 0.00 ? 19  ILE A CG1  5  
ATOM 6949  C CG2  . ILE A 1 19  ? -3.609  5.763   -11.427 1.00 0.00 ? 19  ILE A CG2  5  
ATOM 6950  C CD1  . ILE A 1 19  ? -6.574  4.383   -11.144 1.00 0.00 ? 19  ILE A CD1  5  
ATOM 6951  H H    . ILE A 1 19  ? -3.781  1.808   -12.628 1.00 0.00 ? 19  ILE A H    5  
ATOM 6952  H HA   . ILE A 1 19  ? -3.402  4.450   -13.867 1.00 0.00 ? 19  ILE A HA   5  
ATOM 6953  H HB   . ILE A 1 19  ? -4.056  3.732   -11.007 1.00 0.00 ? 19  ILE A HB   5  
ATOM 6954  H HG12 . ILE A 1 19  ? -5.756  5.442   -12.776 1.00 0.00 ? 19  ILE A HG12 5  
ATOM 6955  H HG13 . ILE A 1 19  ? -5.805  3.695   -12.987 1.00 0.00 ? 19  ILE A HG13 5  
ATOM 6956  H HG21 . ILE A 1 19  ? -2.977  5.652   -10.558 1.00 0.00 ? 19  ILE A HG21 5  
ATOM 6957  H HG22 . ILE A 1 19  ? -3.038  6.198   -12.233 1.00 0.00 ? 19  ILE A HG22 5  
ATOM 6958  H HG23 . ILE A 1 19  ? -4.441  6.407   -11.186 1.00 0.00 ? 19  ILE A HG23 5  
ATOM 6959  H HD11 . ILE A 1 19  ? -6.741  5.361   -10.717 1.00 0.00 ? 19  ILE A HD11 5  
ATOM 6960  H HD12 . ILE A 1 19  ? -7.508  3.983   -11.506 1.00 0.00 ? 19  ILE A HD12 5  
ATOM 6961  H HD13 . ILE A 1 19  ? -6.170  3.726   -10.386 1.00 0.00 ? 19  ILE A HD13 5  
ATOM 6962  N N    . HIS A 1 20  ? -0.961  4.427   -13.450 1.00 0.00 ? 20  HIS A N    5  
ATOM 6963  C CA   . HIS A 1 20  ? 0.467   4.536   -13.173 1.00 0.00 ? 20  HIS A CA   5  
ATOM 6964  C C    . HIS A 1 20  ? 0.831   5.954   -12.744 1.00 0.00 ? 20  HIS A C    5  
ATOM 6965  O O    . HIS A 1 20  ? 0.708   6.899   -13.524 1.00 0.00 ? 20  HIS A O    5  
ATOM 6966  C CB   . HIS A 1 20  ? 1.279   4.140   -14.406 1.00 0.00 ? 20  HIS A CB   5  
ATOM 6967  C CG   . HIS A 1 20  ? 1.186   5.129   -15.527 1.00 0.00 ? 20  HIS A CG   5  
ATOM 6968  N ND1  . HIS A 1 20  ? 2.282   5.785   -16.045 1.00 0.00 ? 20  HIS A ND1  5  
ATOM 6969  C CD2  . HIS A 1 20  ? 0.118   5.570   -16.232 1.00 0.00 ? 20  HIS A CD2  5  
ATOM 6970  C CE1  . HIS A 1 20  ? 1.892   6.589   -17.018 1.00 0.00 ? 20  HIS A CE1  5  
ATOM 6971  N NE2  . HIS A 1 20  ? 0.583   6.477   -17.152 1.00 0.00 ? 20  HIS A NE2  5  
ATOM 6972  H H    . HIS A 1 20  ? -1.311  4.770   -14.298 1.00 0.00 ? 20  HIS A H    5  
ATOM 6973  H HA   . HIS A 1 20  ? 0.701   3.858   -12.366 1.00 0.00 ? 20  HIS A HA   5  
ATOM 6974  H HB2  . HIS A 1 20  ? 2.319   4.049   -14.130 1.00 0.00 ? 20  HIS A HB2  5  
ATOM 6975  H HB3  . HIS A 1 20  ? 0.924   3.187   -14.772 1.00 0.00 ? 20  HIS A HB3  5  
ATOM 6976  H HD1  . HIS A 1 20  ? 3.208   5.679   -15.743 1.00 0.00 ? 20  HIS A HD1  5  
ATOM 6977  H HD2  . HIS A 1 20  ? -0.911  5.266   -16.096 1.00 0.00 ? 20  HIS A HD2  5  
ATOM 6978  H HE1  . HIS A 1 20  ? 2.534   7.229   -17.605 1.00 0.00 ? 20  HIS A HE1  5  
ATOM 6979  H HE2  . HIS A 1 20  ? 0.027   7.025   -17.744 1.00 0.00 ? 20  HIS A HE2  5  
ATOM 6980  N N    . ILE A 1 21  ? 1.276   6.095   -11.500 1.00 0.00 ? 21  ILE A N    5  
ATOM 6981  C CA   . ILE A 1 21  ? 1.658   7.398   -10.968 1.00 0.00 ? 21  ILE A CA   5  
ATOM 6982  C C    . ILE A 1 21  ? 3.168   7.599   -11.038 1.00 0.00 ? 21  ILE A C    5  
ATOM 6983  O O    . ILE A 1 21  ? 3.937   6.766   -10.560 1.00 0.00 ? 21  ILE A O    5  
ATOM 6984  C CB   . ILE A 1 21  ? 1.195   7.568   -9.509  1.00 0.00 ? 21  ILE A CB   5  
ATOM 6985  C CG1  . ILE A 1 21  ? -0.302  7.273   -9.389  1.00 0.00 ? 21  ILE A CG1  5  
ATOM 6986  C CG2  . ILE A 1 21  ? 1.505   8.973   -9.016  1.00 0.00 ? 21  ILE A CG2  5  
ATOM 6987  C CD1  . ILE A 1 21  ? -0.708  6.758   -8.026  1.00 0.00 ? 21  ILE A CD1  5  
ATOM 6988  H H    . ILE A 1 21  ? 1.352   5.304   -10.927 1.00 0.00 ? 21  ILE A H    5  
ATOM 6989  H HA   . ILE A 1 21  ? 1.176   8.156   -11.569 1.00 0.00 ? 21  ILE A HA   5  
ATOM 6990  H HB   . ILE A 1 21  ? 1.743   6.868   -8.897  1.00 0.00 ? 21  ILE A HB   5  
ATOM 6991  H HG12 . ILE A 1 21  ? -0.857  8.178   -9.580  1.00 0.00 ? 21  ILE A HG12 5  
ATOM 6992  H HG13 . ILE A 1 21  ? -0.574  6.527   -10.121 1.00 0.00 ? 21  ILE A HG13 5  
ATOM 6993  H HG21 . ILE A 1 21  ? 2.456   9.293   -9.415  1.00 0.00 ? 21  ILE A HG21 5  
ATOM 6994  H HG22 . ILE A 1 21  ? 0.731   9.649   -9.347  1.00 0.00 ? 21  ILE A HG22 5  
ATOM 6995  H HG23 . ILE A 1 21  ? 1.548   8.975   -7.937  1.00 0.00 ? 21  ILE A HG23 5  
ATOM 6996  H HD11 . ILE A 1 21  ? -1.319  7.497   -7.529  1.00 0.00 ? 21  ILE A HD11 5  
ATOM 6997  H HD12 . ILE A 1 21  ? -1.269  5.843   -8.139  1.00 0.00 ? 21  ILE A HD12 5  
ATOM 6998  H HD13 . ILE A 1 21  ? 0.176   6.567   -7.435  1.00 0.00 ? 21  ILE A HD13 5  
ATOM 6999  N N    . GLU A 1 22  ? 3.584   8.712   -11.634 1.00 0.00 ? 22  GLU A N    5  
ATOM 7000  C CA   . GLU A 1 22  ? 5.003   9.023   -11.765 1.00 0.00 ? 22  GLU A CA   5  
ATOM 7001  C C    . GLU A 1 22  ? 5.323   10.375  -11.134 1.00 0.00 ? 22  GLU A C    5  
ATOM 7002  O O    . GLU A 1 22  ? 4.699   11.387  -11.455 1.00 0.00 ? 22  GLU A O    5  
ATOM 7003  C CB   . GLU A 1 22  ? 5.414   9.024   -13.238 1.00 0.00 ? 22  GLU A CB   5  
ATOM 7004  C CG   . GLU A 1 22  ? 5.104   7.722   -13.958 1.00 0.00 ? 22  GLU A CG   5  
ATOM 7005  C CD   . GLU A 1 22  ? 5.213   7.849   -15.465 1.00 0.00 ? 22  GLU A CD   5  
ATOM 7006  O OE1  . GLU A 1 22  ? 6.043   8.655   -15.934 1.00 0.00 ? 22  GLU A OE1  5  
ATOM 7007  O OE2  . GLU A 1 22  ? 4.468   7.142   -16.175 1.00 0.00 ? 22  GLU A OE2  5  
ATOM 7008  H H    . GLU A 1 22  ? 2.922   9.337   -11.996 1.00 0.00 ? 22  GLU A H    5  
ATOM 7009  H HA   . GLU A 1 22  ? 5.559   8.257   -11.246 1.00 0.00 ? 22  GLU A HA   5  
ATOM 7010  H HB2  . GLU A 1 22  ? 4.894   9.824   -13.744 1.00 0.00 ? 22  GLU A HB2  5  
ATOM 7011  H HB3  . GLU A 1 22  ? 6.477   9.202   -13.302 1.00 0.00 ? 22  GLU A HB3  5  
ATOM 7012  H HG2  . GLU A 1 22  ? 5.801   6.967   -13.625 1.00 0.00 ? 22  GLU A HG2  5  
ATOM 7013  H HG3  . GLU A 1 22  ? 4.099   7.418   -13.708 1.00 0.00 ? 22  GLU A HG3  5  
ATOM 7014  N N    . LYS A 1 23  ? 6.301   10.385  -10.235 1.00 0.00 ? 23  LYS A N    5  
ATOM 7015  C CA   . LYS A 1 23  ? 6.707   11.611  -9.558  1.00 0.00 ? 23  LYS A CA   5  
ATOM 7016  C C    . LYS A 1 23  ? 7.919   12.235  -10.243 1.00 0.00 ? 23  LYS A C    5  
ATOM 7017  O O    . LYS A 1 23  ? 8.847   11.532  -10.644 1.00 0.00 ? 23  LYS A O    5  
ATOM 7018  C CB   . LYS A 1 23  ? 7.028   11.326  -8.090  1.00 0.00 ? 23  LYS A CB   5  
ATOM 7019  C CG   . LYS A 1 23  ? 5.898   10.640  -7.342  1.00 0.00 ? 23  LYS A CG   5  
ATOM 7020  C CD   . LYS A 1 23  ? 5.928   10.972  -5.860  1.00 0.00 ? 23  LYS A CD   5  
ATOM 7021  C CE   . LYS A 1 23  ? 5.186   12.267  -5.564  1.00 0.00 ? 23  LYS A CE   5  
ATOM 7022  N NZ   . LYS A 1 23  ? 3.746   12.027  -5.270  1.00 0.00 ? 23  LYS A NZ   5  
ATOM 7023  H H    . LYS A 1 23  ? 6.762   9.546   -10.021 1.00 0.00 ? 23  LYS A H    5  
ATOM 7024  H HA   . LYS A 1 23  ? 5.883   12.307  -9.609  1.00 0.00 ? 23  LYS A HA   5  
ATOM 7025  H HB2  . LYS A 1 23  ? 7.901   10.692  -8.041  1.00 0.00 ? 23  LYS A HB2  5  
ATOM 7026  H HB3  . LYS A 1 23  ? 7.245   12.261  -7.593  1.00 0.00 ? 23  LYS A HB3  5  
ATOM 7027  H HG2  . LYS A 1 23  ? 4.955   10.967  -7.754  1.00 0.00 ? 23  LYS A HG2  5  
ATOM 7028  H HG3  . LYS A 1 23  ? 5.995   9.570   -7.464  1.00 0.00 ? 23  LYS A HG3  5  
ATOM 7029  H HD2  . LYS A 1 23  ? 5.460   10.169  -5.310  1.00 0.00 ? 23  LYS A HD2  5  
ATOM 7030  H HD3  . LYS A 1 23  ? 6.956   11.076  -5.543  1.00 0.00 ? 23  LYS A HD3  5  
ATOM 7031  H HE2  . LYS A 1 23  ? 5.645   12.742  -4.710  1.00 0.00 ? 23  LYS A HE2  5  
ATOM 7032  H HE3  . LYS A 1 23  ? 5.267   12.917  -6.423  1.00 0.00 ? 23  LYS A HE3  5  
ATOM 7033  H HZ1  . LYS A 1 23  ? 3.629   11.728  -4.281  1.00 0.00 ? 23  LYS A HZ1  5  
ATOM 7034  H HZ2  . LYS A 1 23  ? 3.374   11.282  -5.893  1.00 0.00 ? 23  LYS A HZ2  5  
ATOM 7035  H HZ3  . LYS A 1 23  ? 3.200   12.898  -5.425  1.00 0.00 ? 23  LYS A HZ3  5  
ATOM 7036  N N    . SER A 1 24  ? 7.904   13.558  -10.373 1.00 0.00 ? 24  SER A N    5  
ATOM 7037  C CA   . SER A 1 24  ? 9.002   14.275  -11.011 1.00 0.00 ? 24  SER A CA   5  
ATOM 7038  C C    . SER A 1 24  ? 10.215  14.345  -10.089 1.00 0.00 ? 24  SER A C    5  
ATOM 7039  O O    . SER A 1 24  ? 11.312  13.924  -10.455 1.00 0.00 ? 24  SER A O    5  
ATOM 7040  C CB   . SER A 1 24  ? 8.559   15.688  -11.398 1.00 0.00 ? 24  SER A CB   5  
ATOM 7041  O OG   . SER A 1 24  ? 9.421   16.243  -12.376 1.00 0.00 ? 24  SER A OG   5  
ATOM 7042  H H    . SER A 1 24  ? 7.136   14.063  -10.033 1.00 0.00 ? 24  SER A H    5  
ATOM 7043  H HA   . SER A 1 24  ? 9.275   13.735  -11.906 1.00 0.00 ? 24  SER A HA   5  
ATOM 7044  H HB2  . SER A 1 24  ? 7.557   15.651  -11.798 1.00 0.00 ? 24  SER A HB2  5  
ATOM 7045  H HB3  . SER A 1 24  ? 8.574   16.319  -10.521 1.00 0.00 ? 24  SER A HB3  5  
ATOM 7046  H HG   . SER A 1 24  ? 8.918   16.817  -12.958 1.00 0.00 ? 24  SER A HG   5  
ATOM 7047  N N    . ASP A 1 25  ? 10.009  14.879  -8.890  1.00 0.00 ? 25  ASP A N    5  
ATOM 7048  C CA   . ASP A 1 25  ? 11.084  15.004  -7.914  1.00 0.00 ? 25  ASP A CA   5  
ATOM 7049  C C    . ASP A 1 25  ? 10.782  14.182  -6.665  1.00 0.00 ? 25  ASP A C    5  
ATOM 7050  O O    . ASP A 1 25  ? 10.243  14.696  -5.684  1.00 0.00 ? 25  ASP A O    5  
ATOM 7051  C CB   . ASP A 1 25  ? 11.291  16.472  -7.535  1.00 0.00 ? 25  ASP A CB   5  
ATOM 7052  C CG   . ASP A 1 25  ? 11.979  17.261  -8.632  1.00 0.00 ? 25  ASP A CG   5  
ATOM 7053  O OD1  . ASP A 1 25  ? 11.676  17.016  -9.818  1.00 0.00 ? 25  ASP A OD1  5  
ATOM 7054  O OD2  . ASP A 1 25  ? 12.822  18.122  -8.303  1.00 0.00 ? 25  ASP A OD2  5  
ATOM 7055  H H    . ASP A 1 25  ? 9.111   15.197  -8.657  1.00 0.00 ? 25  ASP A H    5  
ATOM 7056  H HA   . ASP A 1 25  ? 11.989  14.628  -8.367  1.00 0.00 ? 25  ASP A HA   5  
ATOM 7057  H HB2  . ASP A 1 25  ? 10.330  16.925  -7.340  1.00 0.00 ? 25  ASP A HB2  5  
ATOM 7058  H HB3  . ASP A 1 25  ? 11.897  16.525  -6.643  1.00 0.00 ? 25  ASP A HB3  5  
ATOM 7059  N N    . THR A 1 26  ? 11.132  12.900  -6.707  1.00 0.00 ? 26  THR A N    5  
ATOM 7060  C CA   . THR A 1 26  ? 10.897  12.006  -5.581  1.00 0.00 ? 26  THR A CA   5  
ATOM 7061  C C    . THR A 1 26  ? 11.599  12.507  -4.324  1.00 0.00 ? 26  THR A C    5  
ATOM 7062  O O    . THR A 1 26  ? 11.050  12.438  -3.225  1.00 0.00 ? 26  THR A O    5  
ATOM 7063  C CB   . THR A 1 26  ? 11.379  10.575  -5.889  1.00 0.00 ? 26  THR A CB   5  
ATOM 7064  O OG1  . THR A 1 26  ? 10.862  10.146  -7.153  1.00 0.00 ? 26  THR A OG1  5  
ATOM 7065  C CG2  . THR A 1 26  ? 10.937  9.609   -4.800  1.00 0.00 ? 26  THR A CG2  5  
ATOM 7066  H H    . THR A 1 26  ? 11.558  12.549  -7.517  1.00 0.00 ? 26  THR A H    5  
ATOM 7067  H HA   . THR A 1 26  ? 9.832   11.973  -5.398  1.00 0.00 ? 26  THR A HA   5  
ATOM 7068  H HB   . THR A 1 26  ? 12.458  10.577  -5.931  1.00 0.00 ? 26  THR A HB   5  
ATOM 7069  H HG1  . THR A 1 26  ? 9.905   10.228  -7.153  1.00 0.00 ? 26  THR A HG1  5  
ATOM 7070  H HG21 . THR A 1 26  ? 11.298  8.618   -5.030  1.00 0.00 ? 26  THR A HG21 5  
ATOM 7071  H HG22 . THR A 1 26  ? 9.858   9.597   -4.746  1.00 0.00 ? 26  THR A HG22 5  
ATOM 7072  H HG23 . THR A 1 26  ? 11.341  9.928   -3.851  1.00 0.00 ? 26  THR A HG23 5  
ATOM 7073  N N    . ALA A 1 27  ? 12.817  13.012  -4.494  1.00 0.00 ? 27  ALA A N    5  
ATOM 7074  C CA   . ALA A 1 27  ? 13.593  13.527  -3.374  1.00 0.00 ? 27  ALA A CA   5  
ATOM 7075  C C    . ALA A 1 27  ? 12.689  14.177  -2.332  1.00 0.00 ? 27  ALA A C    5  
ATOM 7076  O O    . ALA A 1 27  ? 12.756  13.850  -1.147  1.00 0.00 ? 27  ALA A O    5  
ATOM 7077  C CB   . ALA A 1 27  ? 14.634  14.523  -3.866  1.00 0.00 ? 27  ALA A CB   5  
ATOM 7078  H H    . ALA A 1 27  ? 13.201  13.039  -5.395  1.00 0.00 ? 27  ALA A H    5  
ATOM 7079  H HA   . ALA A 1 27  ? 14.113  12.697  -2.918  1.00 0.00 ? 27  ALA A HA   5  
ATOM 7080  H HB1  . ALA A 1 27  ? 14.141  15.325  -4.396  1.00 0.00 ? 27  ALA A HB1  5  
ATOM 7081  H HB2  . ALA A 1 27  ? 15.174  14.926  -3.023  1.00 0.00 ? 27  ALA A HB2  5  
ATOM 7082  H HB3  . ALA A 1 27  ? 15.323  14.023  -4.530  1.00 0.00 ? 27  ALA A HB3  5  
ATOM 7083  N N    . ALA A 1 28  ? 11.844  15.099  -2.781  1.00 0.00 ? 28  ALA A N    5  
ATOM 7084  C CA   . ALA A 1 28  ? 10.925  15.793  -1.887  1.00 0.00 ? 28  ALA A CA   5  
ATOM 7085  C C    . ALA A 1 28  ? 9.493   15.308  -2.086  1.00 0.00 ? 28  ALA A C    5  
ATOM 7086  O O    . ALA A 1 28  ? 8.875   14.773  -1.166  1.00 0.00 ? 28  ALA A O    5  
ATOM 7087  C CB   . ALA A 1 28  ? 11.010  17.296  -2.107  1.00 0.00 ? 28  ALA A CB   5  
ATOM 7088  H H    . ALA A 1 28  ? 11.837  15.316  -3.736  1.00 0.00 ? 28  ALA A H    5  
ATOM 7089  H HA   . ALA A 1 28  ? 11.227  15.585  -0.871  1.00 0.00 ? 28  ALA A HA   5  
ATOM 7090  H HB1  . ALA A 1 28  ? 11.348  17.773  -1.198  1.00 0.00 ? 28  ALA A HB1  5  
ATOM 7091  H HB2  . ALA A 1 28  ? 11.707  17.505  -2.904  1.00 0.00 ? 28  ALA A HB2  5  
ATOM 7092  H HB3  . ALA A 1 28  ? 10.035  17.677  -2.372  1.00 0.00 ? 28  ALA A HB3  5  
ATOM 7093  N N    . ASP A 1 29  ? 8.972   15.498  -3.293  1.00 0.00 ? 29  ASP A N    5  
ATOM 7094  C CA   . ASP A 1 29  ? 7.612   15.078  -3.613  1.00 0.00 ? 29  ASP A CA   5  
ATOM 7095  C C    . ASP A 1 29  ? 7.420   13.592  -3.328  1.00 0.00 ? 29  ASP A C    5  
ATOM 7096  O O    . ASP A 1 29  ? 8.232   12.760  -3.736  1.00 0.00 ? 29  ASP A O    5  
ATOM 7097  C CB   . ASP A 1 29  ? 7.297   15.374  -5.081  1.00 0.00 ? 29  ASP A CB   5  
ATOM 7098  C CG   . ASP A 1 29  ? 7.690   16.780  -5.486  1.00 0.00 ? 29  ASP A CG   5  
ATOM 7099  O OD1  . ASP A 1 29  ? 7.599   17.691  -4.636  1.00 0.00 ? 29  ASP A OD1  5  
ATOM 7100  O OD2  . ASP A 1 29  ? 8.091   16.971  -6.653  1.00 0.00 ? 29  ASP A OD2  5  
ATOM 7101  H H    . ASP A 1 29  ? 9.514   15.930  -3.986  1.00 0.00 ? 29  ASP A H    5  
ATOM 7102  H HA   . ASP A 1 29  ? 6.935   15.642  -2.989  1.00 0.00 ? 29  ASP A HA   5  
ATOM 7103  H HB2  . ASP A 1 29  ? 7.834   14.675  -5.705  1.00 0.00 ? 29  ASP A HB2  5  
ATOM 7104  H HB3  . ASP A 1 29  ? 6.236   15.254  -5.245  1.00 0.00 ? 29  ASP A HB3  5  
ATOM 7105  N N    . THR A 1 30  ? 6.341   13.264  -2.624  1.00 0.00 ? 30  THR A N    5  
ATOM 7106  C CA   . THR A 1 30  ? 6.044   11.879  -2.281  1.00 0.00 ? 30  THR A CA   5  
ATOM 7107  C C    . THR A 1 30  ? 4.542   11.657  -2.148  1.00 0.00 ? 30  THR A C    5  
ATOM 7108  O O    . THR A 1 30  ? 3.851   12.411  -1.462  1.00 0.00 ? 30  THR A O    5  
ATOM 7109  C CB   . THR A 1 30  ? 6.732   11.465  -0.967  1.00 0.00 ? 30  THR A CB   5  
ATOM 7110  O OG1  . THR A 1 30  ? 6.341   10.135  -0.607  1.00 0.00 ? 30  THR A OG1  5  
ATOM 7111  C CG2  . THR A 1 30  ? 6.374   12.426  0.157   1.00 0.00 ? 30  THR A CG2  5  
ATOM 7112  H H    . THR A 1 30  ? 5.732   13.972  -2.327  1.00 0.00 ? 30  THR A H    5  
ATOM 7113  H HA   . THR A 1 30  ? 6.422   11.251  -3.075  1.00 0.00 ? 30  THR A HA   5  
ATOM 7114  H HB   . THR A 1 30  ? 7.802   11.490  -1.116  1.00 0.00 ? 30  THR A HB   5  
ATOM 7115  H HG1  . THR A 1 30  ? 6.119   9.641   -1.400  1.00 0.00 ? 30  THR A HG1  5  
ATOM 7116  H HG21 . THR A 1 30  ? 6.935   12.168  1.043   1.00 0.00 ? 30  THR A HG21 5  
ATOM 7117  H HG22 . THR A 1 30  ? 5.317   12.357  0.367   1.00 0.00 ? 30  THR A HG22 5  
ATOM 7118  H HG23 . THR A 1 30  ? 6.618   13.434  -0.141  1.00 0.00 ? 30  THR A HG23 5  
ATOM 7119  N N    . TYR A 1 31  ? 4.041   10.617  -2.806  1.00 0.00 ? 31  TYR A N    5  
ATOM 7120  C CA   . TYR A 1 31  ? 2.620   10.296  -2.761  1.00 0.00 ? 31  TYR A CA   5  
ATOM 7121  C C    . TYR A 1 31  ? 2.046   10.557  -1.372  1.00 0.00 ? 31  TYR A C    5  
ATOM 7122  O O    . TYR A 1 31  ? 2.748   10.450  -0.367  1.00 0.00 ? 31  TYR A O    5  
ATOM 7123  C CB   . TYR A 1 31  ? 2.393   8.835   -3.153  1.00 0.00 ? 31  TYR A CB   5  
ATOM 7124  C CG   . TYR A 1 31  ? 3.231   8.386   -4.328  1.00 0.00 ? 31  TYR A CG   5  
ATOM 7125  C CD1  . TYR A 1 31  ? 3.058   8.951   -5.586  1.00 0.00 ? 31  TYR A CD1  5  
ATOM 7126  C CD2  . TYR A 1 31  ? 4.196   7.397   -4.182  1.00 0.00 ? 31  TYR A CD2  5  
ATOM 7127  C CE1  . TYR A 1 31  ? 3.820   8.543   -6.663  1.00 0.00 ? 31  TYR A CE1  5  
ATOM 7128  C CE2  . TYR A 1 31  ? 4.964   6.984   -5.253  1.00 0.00 ? 31  TYR A CE2  5  
ATOM 7129  C CZ   . TYR A 1 31  ? 4.773   7.560   -6.492  1.00 0.00 ? 31  TYR A CZ   5  
ATOM 7130  O OH   . TYR A 1 31  ? 5.535   7.152   -7.562  1.00 0.00 ? 31  TYR A OH   5  
ATOM 7131  H H    . TYR A 1 31  ? 4.642   10.052  -3.335  1.00 0.00 ? 31  TYR A H    5  
ATOM 7132  H HA   . TYR A 1 31  ? 2.114   10.932  -3.473  1.00 0.00 ? 31  TYR A HA   5  
ATOM 7133  H HB2  . TYR A 1 31  ? 2.635   8.202   -2.313  1.00 0.00 ? 31  TYR A HB2  5  
ATOM 7134  H HB3  . TYR A 1 31  ? 1.354   8.696   -3.413  1.00 0.00 ? 31  TYR A HB3  5  
ATOM 7135  H HD1  . TYR A 1 31  ? 2.311   9.721   -5.717  1.00 0.00 ? 31  TYR A HD1  5  
ATOM 7136  H HD2  . TYR A 1 31  ? 4.344   6.948   -3.210  1.00 0.00 ? 31  TYR A HD2  5  
ATOM 7137  H HE1  . TYR A 1 31  ? 3.671   8.994   -7.633  1.00 0.00 ? 31  TYR A HE1  5  
ATOM 7138  H HE2  . TYR A 1 31  ? 5.710   6.214   -5.119  1.00 0.00 ? 31  TYR A HE2  5  
ATOM 7139  H HH   . TYR A 1 31  ? 6.466   7.258   -7.350  1.00 0.00 ? 31  TYR A HH   5  
ATOM 7140  N N    . GLY A 1 32  ? 0.762   10.900  -1.324  1.00 0.00 ? 32  GLY A N    5  
ATOM 7141  C CA   . GLY A 1 32  ? 0.113   11.171  -0.054  1.00 0.00 ? 32  GLY A CA   5  
ATOM 7142  C C    . GLY A 1 32  ? -1.110  10.304  0.168   1.00 0.00 ? 32  GLY A C    5  
ATOM 7143  O O    . GLY A 1 32  ? -2.033  10.692  0.886   1.00 0.00 ? 32  GLY A O    5  
ATOM 7144  H H    . GLY A 1 32  ? 0.251   10.970  -2.157  1.00 0.00 ? 32  GLY A H    5  
ATOM 7145  H HA2  . GLY A 1 32  ? 0.819   10.991  0.743   1.00 0.00 ? 32  GLY A HA2  5  
ATOM 7146  H HA3  . GLY A 1 32  ? -0.186  12.208  -0.030  1.00 0.00 ? 32  GLY A HA3  5  
ATOM 7147  N N    . PHE A 1 33  ? -1.121  9.128   -0.450  1.00 0.00 ? 33  PHE A N    5  
ATOM 7148  C CA   . PHE A 1 33  ? -2.242  8.205   -0.318  1.00 0.00 ? 33  PHE A CA   5  
ATOM 7149  C C    . PHE A 1 33  ? -1.862  7.008   0.549   1.00 0.00 ? 33  PHE A C    5  
ATOM 7150  O O    . PHE A 1 33  ? -0.831  6.371   0.331   1.00 0.00 ? 33  PHE A O    5  
ATOM 7151  C CB   . PHE A 1 33  ? -2.700  7.725   -1.697  1.00 0.00 ? 33  PHE A CB   5  
ATOM 7152  C CG   . PHE A 1 33  ? -2.000  6.480   -2.161  1.00 0.00 ? 33  PHE A CG   5  
ATOM 7153  C CD1  . PHE A 1 33  ? -0.638  6.489   -2.415  1.00 0.00 ? 33  PHE A CD1  5  
ATOM 7154  C CD2  . PHE A 1 33  ? -2.703  5.300   -2.343  1.00 0.00 ? 33  PHE A CD2  5  
ATOM 7155  C CE1  . PHE A 1 33  ? 0.009   5.344   -2.843  1.00 0.00 ? 33  PHE A CE1  5  
ATOM 7156  C CE2  . PHE A 1 33  ? -2.062  4.152   -2.770  1.00 0.00 ? 33  PHE A CE2  5  
ATOM 7157  C CZ   . PHE A 1 33  ? -0.704  4.175   -3.020  1.00 0.00 ? 33  PHE A CZ   5  
ATOM 7158  H H    . PHE A 1 33  ? -0.356  8.875   -1.009  1.00 0.00 ? 33  PHE A H    5  
ATOM 7159  H HA   . PHE A 1 33  ? -3.053  8.735   0.156   1.00 0.00 ? 33  PHE A HA   5  
ATOM 7160  H HB2  . PHE A 1 33  ? -3.758  7.517   -1.665  1.00 0.00 ? 33  PHE A HB2  5  
ATOM 7161  H HB3  . PHE A 1 33  ? -2.511  8.503   -2.422  1.00 0.00 ? 33  PHE A HB3  5  
ATOM 7162  H HD1  . PHE A 1 33  ? -0.078  7.402   -2.277  1.00 0.00 ? 33  PHE A HD1  5  
ATOM 7163  H HD2  . PHE A 1 33  ? -3.767  5.282   -2.147  1.00 0.00 ? 33  PHE A HD2  5  
ATOM 7164  H HE1  . PHE A 1 33  ? 1.071   5.364   -3.038  1.00 0.00 ? 33  PHE A HE1  5  
ATOM 7165  H HE2  . PHE A 1 33  ? -2.623  3.240   -2.907  1.00 0.00 ? 33  PHE A HE2  5  
ATOM 7166  H HZ   . PHE A 1 33  ? -0.202  3.279   -3.354  1.00 0.00 ? 33  PHE A HZ   5  
ATOM 7167  N N    . SER A 1 34  ? -2.703  6.708   1.534   1.00 0.00 ? 34  SER A N    5  
ATOM 7168  C CA   . SER A 1 34  ? -2.454  5.592   2.438   1.00 0.00 ? 34  SER A CA   5  
ATOM 7169  C C    . SER A 1 34  ? -3.261  4.366   2.022   1.00 0.00 ? 34  SER A C    5  
ATOM 7170  O O    . SER A 1 34  ? -4.098  4.436   1.121   1.00 0.00 ? 34  SER A O    5  
ATOM 7171  C CB   . SER A 1 34  ? -2.804  5.983   3.875   1.00 0.00 ? 34  SER A CB   5  
ATOM 7172  O OG   . SER A 1 34  ? -1.919  6.976   4.363   1.00 0.00 ? 34  SER A OG   5  
ATOM 7173  H H    . SER A 1 34  ? -3.508  7.254   1.658   1.00 0.00 ? 34  SER A H    5  
ATOM 7174  H HA   . SER A 1 34  ? -1.403  5.350   2.386   1.00 0.00 ? 34  SER A HA   5  
ATOM 7175  H HB2  . SER A 1 34  ? -3.811  6.369   3.905   1.00 0.00 ? 34  SER A HB2  5  
ATOM 7176  H HB3  . SER A 1 34  ? -2.733  5.111   4.510   1.00 0.00 ? 34  SER A HB3  5  
ATOM 7177  H HG   . SER A 1 34  ? -2.025  7.780   3.850   1.00 0.00 ? 34  SER A HG   5  
ATOM 7178  N N    . LEU A 1 35  ? -3.005  3.243   2.684   1.00 0.00 ? 35  LEU A N    5  
ATOM 7179  C CA   . LEU A 1 35  ? -3.707  2.000   2.385   1.00 0.00 ? 35  LEU A CA   5  
ATOM 7180  C C    . LEU A 1 35  ? -4.029  1.235   3.664   1.00 0.00 ? 35  LEU A C    5  
ATOM 7181  O O    . LEU A 1 35  ? -3.179  1.088   4.542   1.00 0.00 ? 35  LEU A O    5  
ATOM 7182  C CB   . LEU A 1 35  ? -2.864  1.127   1.453   1.00 0.00 ? 35  LEU A CB   5  
ATOM 7183  C CG   . LEU A 1 35  ? -2.831  1.551   -0.016  1.00 0.00 ? 35  LEU A CG   5  
ATOM 7184  C CD1  . LEU A 1 35  ? -1.676  0.877   -0.740  1.00 0.00 ? 35  LEU A CD1  5  
ATOM 7185  C CD2  . LEU A 1 35  ? -4.153  1.225   -0.696  1.00 0.00 ? 35  LEU A CD2  5  
ATOM 7186  H H    . LEU A 1 35  ? -2.327  3.249   3.392   1.00 0.00 ? 35  LEU A H    5  
ATOM 7187  H HA   . LEU A 1 35  ? -4.632  2.254   1.888   1.00 0.00 ? 35  LEU A HA   5  
ATOM 7188  H HB2  . LEU A 1 35  ? -1.850  1.133   1.822   1.00 0.00 ? 35  LEU A HB2  5  
ATOM 7189  H HB3  . LEU A 1 35  ? -3.257  0.121   1.499   1.00 0.00 ? 35  LEU A HB3  5  
ATOM 7190  H HG   . LEU A 1 35  ? -2.680  2.621   -0.072  1.00 0.00 ? 35  LEU A HG   5  
ATOM 7191  H HD11 . LEU A 1 35  ? -2.020  -0.043  -1.188  1.00 0.00 ? 35  LEU A HD11 5  
ATOM 7192  H HD12 . LEU A 1 35  ? -0.887  0.661   -0.035  1.00 0.00 ? 35  LEU A HD12 5  
ATOM 7193  H HD13 . LEU A 1 35  ? -1.301  1.535   -1.510  1.00 0.00 ? 35  LEU A HD13 5  
ATOM 7194  H HD21 . LEU A 1 35  ? -4.038  0.333   -1.294  1.00 0.00 ? 35  LEU A HD21 5  
ATOM 7195  H HD22 . LEU A 1 35  ? -4.444  2.049   -1.331  1.00 0.00 ? 35  LEU A HD22 5  
ATOM 7196  H HD23 . LEU A 1 35  ? -4.912  1.061   0.054   1.00 0.00 ? 35  LEU A HD23 5  
ATOM 7197  N N    . SER A 1 36  ? -5.262  0.747   3.761   1.00 0.00 ? 36  SER A N    5  
ATOM 7198  C CA   . SER A 1 36  ? -5.697  -0.003  4.934   1.00 0.00 ? 36  SER A CA   5  
ATOM 7199  C C    . SER A 1 36  ? -5.776  -1.495  4.626   1.00 0.00 ? 36  SER A C    5  
ATOM 7200  O O    . SER A 1 36  ? -6.192  -1.895  3.539   1.00 0.00 ? 36  SER A O    5  
ATOM 7201  C CB   . SER A 1 36  ? -7.059  0.503   5.412   1.00 0.00 ? 36  SER A CB   5  
ATOM 7202  O OG   . SER A 1 36  ? -7.576  -0.320  6.443   1.00 0.00 ? 36  SER A OG   5  
ATOM 7203  H H    . SER A 1 36  ? -5.894  0.897   3.027   1.00 0.00 ? 36  SER A H    5  
ATOM 7204  H HA   . SER A 1 36  ? -4.969  0.154   5.716   1.00 0.00 ? 36  SER A HA   5  
ATOM 7205  H HB2  . SER A 1 36  ? -6.954  1.509   5.790   1.00 0.00 ? 36  SER A HB2  5  
ATOM 7206  H HB3  . SER A 1 36  ? -7.752  0.501   4.583   1.00 0.00 ? 36  SER A HB3  5  
ATOM 7207  H HG   . SER A 1 36  ? -8.535  -0.336  6.390   1.00 0.00 ? 36  SER A HG   5  
ATOM 7208  N N    . SER A 1 37  ? -5.373  -2.314  5.592   1.00 0.00 ? 37  SER A N    5  
ATOM 7209  C CA   . SER A 1 37  ? -5.394  -3.762  5.425   1.00 0.00 ? 37  SER A CA   5  
ATOM 7210  C C    . SER A 1 37  ? -6.612  -4.371  6.112   1.00 0.00 ? 37  SER A C    5  
ATOM 7211  O O    . SER A 1 37  ? -6.769  -4.269  7.329   1.00 0.00 ? 37  SER A O    5  
ATOM 7212  C CB   . SER A 1 37  ? -4.113  -4.381  5.989   1.00 0.00 ? 37  SER A CB   5  
ATOM 7213  O OG   . SER A 1 37  ? -3.800  -3.834  7.259   1.00 0.00 ? 37  SER A OG   5  
ATOM 7214  H H    . SER A 1 37  ? -5.052  -1.935  6.437   1.00 0.00 ? 37  SER A H    5  
ATOM 7215  H HA   . SER A 1 37  ? -5.449  -3.973  4.367   1.00 0.00 ? 37  SER A HA   5  
ATOM 7216  H HB2  . SER A 1 37  ? -4.247  -5.447  6.093   1.00 0.00 ? 37  SER A HB2  5  
ATOM 7217  H HB3  . SER A 1 37  ? -3.294  -4.184  5.313   1.00 0.00 ? 37  SER A HB3  5  
ATOM 7218  H HG   . SER A 1 37  ? -2.912  -3.468  7.239   1.00 0.00 ? 37  SER A HG   5  
ATOM 7219  N N    . VAL A 1 38  ? -7.473  -5.006  5.323   1.00 0.00 ? 38  VAL A N    5  
ATOM 7220  C CA   . VAL A 1 38  ? -8.678  -5.633  5.854   1.00 0.00 ? 38  VAL A CA   5  
ATOM 7221  C C    . VAL A 1 38  ? -8.680  -7.134  5.585   1.00 0.00 ? 38  VAL A C    5  
ATOM 7222  O O    . VAL A 1 38  ? -8.682  -7.567  4.434   1.00 0.00 ? 38  VAL A O    5  
ATOM 7223  C CB   . VAL A 1 38  ? -9.949  -5.012  5.246   1.00 0.00 ? 38  VAL A CB   5  
ATOM 7224  C CG1  . VAL A 1 38  ? -11.194 -5.660  5.833   1.00 0.00 ? 38  VAL A CG1  5  
ATOM 7225  C CG2  . VAL A 1 38  ? -9.965  -3.507  5.470   1.00 0.00 ? 38  VAL A CG2  5  
ATOM 7226  H H    . VAL A 1 38  ? -7.294  -5.055  4.361   1.00 0.00 ? 38  VAL A H    5  
ATOM 7227  H HA   . VAL A 1 38  ? -8.697  -5.469  6.922   1.00 0.00 ? 38  VAL A HA   5  
ATOM 7228  H HB   . VAL A 1 38  ? -9.942  -5.196  4.182   1.00 0.00 ? 38  VAL A HB   5  
ATOM 7229  H HG11 . VAL A 1 38  ? -11.451 -5.169  6.761   1.00 0.00 ? 38  VAL A HG11 5  
ATOM 7230  H HG12 . VAL A 1 38  ? -12.012 -5.565  5.135   1.00 0.00 ? 38  VAL A HG12 5  
ATOM 7231  H HG13 . VAL A 1 38  ? -11.000 -6.705  6.023   1.00 0.00 ? 38  VAL A HG13 5  
ATOM 7232  H HG21 . VAL A 1 38  ? -10.663 -3.049  4.785   1.00 0.00 ? 38  VAL A HG21 5  
ATOM 7233  H HG22 . VAL A 1 38  ? -10.268 -3.297  6.486   1.00 0.00 ? 38  VAL A HG22 5  
ATOM 7234  H HG23 . VAL A 1 38  ? -8.977  -3.107  5.300   1.00 0.00 ? 38  VAL A HG23 5  
ATOM 7235  N N    . GLU A 1 39  ? -8.681  -7.922  6.656   1.00 0.00 ? 39  GLU A N    5  
ATOM 7236  C CA   . GLU A 1 39  ? -8.683  -9.375  6.534   1.00 0.00 ? 39  GLU A CA   5  
ATOM 7237  C C    . GLU A 1 39  ? -10.107 -9.922  6.572   1.00 0.00 ? 39  GLU A C    5  
ATOM 7238  O O    . GLU A 1 39  ? -10.907 -9.539  7.425   1.00 0.00 ? 39  GLU A O    5  
ATOM 7239  C CB   . GLU A 1 39  ? -7.854  -10.004 7.656   1.00 0.00 ? 39  GLU A CB   5  
ATOM 7240  C CG   . GLU A 1 39  ? -7.200  -11.319 7.265   1.00 0.00 ? 39  GLU A CG   5  
ATOM 7241  C CD   . GLU A 1 39  ? -7.026  -12.256 8.444   1.00 0.00 ? 39  GLU A CD   5  
ATOM 7242  O OE1  . GLU A 1 39  ? -6.179  -11.963 9.314   1.00 0.00 ? 39  GLU A OE1  5  
ATOM 7243  O OE2  . GLU A 1 39  ? -7.735  -13.283 8.497   1.00 0.00 ? 39  GLU A OE2  5  
ATOM 7244  H H    . GLU A 1 39  ? -8.680  -7.516  7.548   1.00 0.00 ? 39  GLU A H    5  
ATOM 7245  H HA   . GLU A 1 39  ? -8.238  -9.629  5.584   1.00 0.00 ? 39  GLU A HA   5  
ATOM 7246  H HB2  . GLU A 1 39  ? -7.077  -9.311  7.945   1.00 0.00 ? 39  GLU A HB2  5  
ATOM 7247  H HB3  . GLU A 1 39  ? -8.497  -10.184 8.504   1.00 0.00 ? 39  GLU A HB3  5  
ATOM 7248  H HG2  . GLU A 1 39  ? -7.817  -11.807 6.526   1.00 0.00 ? 39  GLU A HG2  5  
ATOM 7249  H HG3  . GLU A 1 39  ? -6.229  -11.112 6.842   1.00 0.00 ? 39  GLU A HG3  5  
ATOM 7250  N N    . GLU A 1 40  ? -10.415 -10.818 5.640   1.00 0.00 ? 40  GLU A N    5  
ATOM 7251  C CA   . GLU A 1 40  ? -11.743 -11.417 5.566   1.00 0.00 ? 40  GLU A CA   5  
ATOM 7252  C C    . GLU A 1 40  ? -11.659 -12.875 5.125   1.00 0.00 ? 40  GLU A C    5  
ATOM 7253  O O    . GLU A 1 40  ? -11.298 -13.170 3.985   1.00 0.00 ? 40  GLU A O    5  
ATOM 7254  C CB   . GLU A 1 40  ? -12.628 -10.630 4.597   1.00 0.00 ? 40  GLU A CB   5  
ATOM 7255  C CG   . GLU A 1 40  ? -13.264 -9.397  5.217   1.00 0.00 ? 40  GLU A CG   5  
ATOM 7256  C CD   . GLU A 1 40  ? -14.445 -8.884  4.417   1.00 0.00 ? 40  GLU A CD   5  
ATOM 7257  O OE1  . GLU A 1 40  ? -15.235 -9.716  3.924   1.00 0.00 ? 40  GLU A OE1  5  
ATOM 7258  O OE2  . GLU A 1 40  ? -14.580 -7.650  4.285   1.00 0.00 ? 40  GLU A OE2  5  
ATOM 7259  H H    . GLU A 1 40  ? -9.734  -11.083 4.987   1.00 0.00 ? 40  GLU A H    5  
ATOM 7260  H HA   . GLU A 1 40  ? -12.181 -11.376 6.552   1.00 0.00 ? 40  GLU A HA   5  
ATOM 7261  H HB2  . GLU A 1 40  ? -12.029 -10.316 3.755   1.00 0.00 ? 40  GLU A HB2  5  
ATOM 7262  H HB3  . GLU A 1 40  ? -13.418 -11.276 4.244   1.00 0.00 ? 40  GLU A HB3  5  
ATOM 7263  H HG2  . GLU A 1 40  ? -13.602 -9.644  6.212   1.00 0.00 ? 40  GLU A HG2  5  
ATOM 7264  H HG3  . GLU A 1 40  ? -12.520 -8.615  5.275   1.00 0.00 ? 40  GLU A HG3  5  
ATOM 7265  N N    . ASP A 1 41  ? -11.994 -13.783 6.035   1.00 0.00 ? 41  ASP A N    5  
ATOM 7266  C CA   . ASP A 1 41  ? -11.957 -15.210 5.741   1.00 0.00 ? 41  ASP A CA   5  
ATOM 7267  C C    . ASP A 1 41  ? -10.546 -15.651 5.364   1.00 0.00 ? 41  ASP A C    5  
ATOM 7268  O O    . ASP A 1 41  ? -10.363 -16.526 4.519   1.00 0.00 ? 41  ASP A O    5  
ATOM 7269  C CB   . ASP A 1 41  ? -12.928 -15.545 4.608   1.00 0.00 ? 41  ASP A CB   5  
ATOM 7270  C CG   . ASP A 1 41  ? -14.378 -15.382 5.022   1.00 0.00 ? 41  ASP A CG   5  
ATOM 7271  O OD1  . ASP A 1 41  ? -14.703 -15.707 6.182   1.00 0.00 ? 41  ASP A OD1  5  
ATOM 7272  O OD2  . ASP A 1 41  ? -15.187 -14.930 4.184   1.00 0.00 ? 41  ASP A OD2  5  
ATOM 7273  H H    . ASP A 1 41  ? -12.273 -13.485 6.926   1.00 0.00 ? 41  ASP A H    5  
ATOM 7274  H HA   . ASP A 1 41  ? -12.260 -15.740 6.631   1.00 0.00 ? 41  ASP A HA   5  
ATOM 7275  H HB2  . ASP A 1 41  ? -12.736 -14.888 3.772   1.00 0.00 ? 41  ASP A HB2  5  
ATOM 7276  H HB3  . ASP A 1 41  ? -12.773 -16.568 4.300   1.00 0.00 ? 41  ASP A HB3  5  
ATOM 7277  N N    . GLY A 1 42  ? -9.550  -15.038 5.998   1.00 0.00 ? 42  GLY A N    5  
ATOM 7278  C CA   . GLY A 1 42  ? -8.169  -15.380 5.715   1.00 0.00 ? 42  GLY A CA   5  
ATOM 7279  C C    . GLY A 1 42  ? -7.587  -14.554 4.584   1.00 0.00 ? 42  GLY A C    5  
ATOM 7280  O O    . GLY A 1 42  ? -6.374  -14.353 4.514   1.00 0.00 ? 42  GLY A O    5  
ATOM 7281  H H    . GLY A 1 42  ? -9.756  -14.348 6.662   1.00 0.00 ? 42  GLY A H    5  
ATOM 7282  H HA2  . GLY A 1 42  ? -7.580  -15.218 6.605   1.00 0.00 ? 42  GLY A HA2  5  
ATOM 7283  H HA3  . GLY A 1 42  ? -8.116  -16.424 5.445   1.00 0.00 ? 42  GLY A HA3  5  
ATOM 7284  N N    . ILE A 1 43  ? -8.453  -14.076 3.697   1.00 0.00 ? 43  ILE A N    5  
ATOM 7285  C CA   . ILE A 1 43  ? -8.017  -13.268 2.564   1.00 0.00 ? 43  ILE A CA   5  
ATOM 7286  C C    . ILE A 1 43  ? -7.899  -11.797 2.951   1.00 0.00 ? 43  ILE A C    5  
ATOM 7287  O O    . ILE A 1 43  ? -8.883  -11.166 3.340   1.00 0.00 ? 43  ILE A O    5  
ATOM 7288  C CB   . ILE A 1 43  ? -8.986  -13.398 1.375   1.00 0.00 ? 43  ILE A CB   5  
ATOM 7289  C CG1  . ILE A 1 43  ? -9.354  -14.865 1.147   1.00 0.00 ? 43  ILE A CG1  5  
ATOM 7290  C CG2  . ILE A 1 43  ? -8.368  -12.800 0.120   1.00 0.00 ? 43  ILE A CG2  5  
ATOM 7291  C CD1  . ILE A 1 43  ? -10.723 -15.057 0.532   1.00 0.00 ? 43  ILE A CD1  5  
ATOM 7292  H H    . ILE A 1 43  ? -9.407  -14.270 3.807   1.00 0.00 ? 43  ILE A H    5  
ATOM 7293  H HA   . ILE A 1 43  ? -7.047  -13.626 2.253   1.00 0.00 ? 43  ILE A HA   5  
ATOM 7294  H HB   . ILE A 1 43  ? -9.882  -12.841 1.606   1.00 0.00 ? 43  ILE A HB   5  
ATOM 7295  H HG12 . ILE A 1 43  ? -8.629  -15.314 0.486   1.00 0.00 ? 43  ILE A HG12 5  
ATOM 7296  H HG13 . ILE A 1 43  ? -9.340  -15.384 2.095   1.00 0.00 ? 43  ILE A HG13 5  
ATOM 7297  H HG21 . ILE A 1 43  ? -8.772  -13.294 -0.751  1.00 0.00 ? 43  ILE A HG21 5  
ATOM 7298  H HG22 . ILE A 1 43  ? -8.596  -11.746 0.073   1.00 0.00 ? 43  ILE A HG22 5  
ATOM 7299  H HG23 . ILE A 1 43  ? -7.297  -12.936 0.146   1.00 0.00 ? 43  ILE A HG23 5  
ATOM 7300  H HD11 . ILE A 1 43  ? -10.950 -14.219 -0.110  1.00 0.00 ? 43  ILE A HD11 5  
ATOM 7301  H HD12 . ILE A 1 43  ? -10.735 -15.968 -0.046  1.00 0.00 ? 43  ILE A HD12 5  
ATOM 7302  H HD13 . ILE A 1 43  ? -11.464 -15.119 1.316   1.00 0.00 ? 43  ILE A HD13 5  
ATOM 7303  N N    . ARG A 1 44  ? -6.690  -11.257 2.840   1.00 0.00 ? 44  ARG A N    5  
ATOM 7304  C CA   . ARG A 1 44  ? -6.444  -9.860  3.177   1.00 0.00 ? 44  ARG A CA   5  
ATOM 7305  C C    . ARG A 1 44  ? -6.515  -8.980  1.933   1.00 0.00 ? 44  ARG A C    5  
ATOM 7306  O O    . ARG A 1 44  ? -5.904  -9.285  0.909   1.00 0.00 ? 44  ARG A O    5  
ATOM 7307  C CB   . ARG A 1 44  ? -5.075  -9.709  3.844   1.00 0.00 ? 44  ARG A CB   5  
ATOM 7308  C CG   . ARG A 1 44  ? -4.640  -8.263  4.020   1.00 0.00 ? 44  ARG A CG   5  
ATOM 7309  C CD   . ARG A 1 44  ? -3.858  -7.766  2.814   1.00 0.00 ? 44  ARG A CD   5  
ATOM 7310  N NE   . ARG A 1 44  ? -2.438  -8.097  2.909   1.00 0.00 ? 44  ARG A NE   5  
ATOM 7311  C CZ   . ARG A 1 44  ? -1.608  -7.529  3.776   1.00 0.00 ? 44  ARG A CZ   5  
ATOM 7312  N NH1  . ARG A 1 44  ? -2.053  -6.607  4.619   1.00 0.00 ? 44  ARG A NH1  5  
ATOM 7313  N NH2  . ARG A 1 44  ? -0.329  -7.883  3.801   1.00 0.00 ? 44  ARG A NH2  5  
ATOM 7314  H H    . ARG A 1 44  ? -5.946  -11.811 2.524   1.00 0.00 ? 44  ARG A H    5  
ATOM 7315  H HA   . ARG A 1 44  ? -7.209  -9.546  3.871   1.00 0.00 ? 44  ARG A HA   5  
ATOM 7316  H HB2  . ARG A 1 44  ? -5.110  -10.172 4.820   1.00 0.00 ? 44  ARG A HB2  5  
ATOM 7317  H HB3  . ARG A 1 44  ? -4.336  -10.214 3.241   1.00 0.00 ? 44  ARG A HB3  5  
ATOM 7318  H HG2  . ARG A 1 44  ? -5.517  -7.645  4.145   1.00 0.00 ? 44  ARG A HG2  5  
ATOM 7319  H HG3  . ARG A 1 44  ? -4.017  -8.189  4.899   1.00 0.00 ? 44  ARG A HG3  5  
ATOM 7320  H HD2  . ARG A 1 44  ? -4.265  -8.223  1.925   1.00 0.00 ? 44  ARG A HD2  5  
ATOM 7321  H HD3  . ARG A 1 44  ? -3.965  -6.694  2.750   1.00 0.00 ? 44  ARG A HD3  5  
ATOM 7322  H HE   . ARG A 1 44  ? -2.089  -8.776  2.295   1.00 0.00 ? 44  ARG A HE   5  
ATOM 7323  H HH11 . ARG A 1 44  ? -3.016  -6.339  4.603   1.00 0.00 ? 44  ARG A HH11 5  
ATOM 7324  H HH12 . ARG A 1 44  ? -1.425  -6.181  5.272   1.00 0.00 ? 44  ARG A HH12 5  
ATOM 7325  H HH21 . ARG A 1 44  ? 0.010   -8.577  3.168   1.00 0.00 ? 44  ARG A HH21 5  
ATOM 7326  H HH22 . ARG A 1 44  ? 0.295   -7.455  4.454   1.00 0.00 ? 44  ARG A HH22 5  
ATOM 7327  N N    . ARG A 1 45  ? -7.266  -7.888  2.030   1.00 0.00 ? 45  ARG A N    5  
ATOM 7328  C CA   . ARG A 1 45  ? -7.419  -6.964  0.912   1.00 0.00 ? 45  ARG A CA   5  
ATOM 7329  C C    . ARG A 1 45  ? -6.910  -5.574  1.282   1.00 0.00 ? 45  ARG A C    5  
ATOM 7330  O O    . ARG A 1 45  ? -6.700  -5.270  2.457   1.00 0.00 ? 45  ARG A O    5  
ATOM 7331  C CB   . ARG A 1 45  ? -8.886  -6.885  0.485   1.00 0.00 ? 45  ARG A CB   5  
ATOM 7332  C CG   . ARG A 1 45  ? -9.269  -7.912  -0.568  1.00 0.00 ? 45  ARG A CG   5  
ATOM 7333  C CD   . ARG A 1 45  ? -9.371  -9.308  0.026   1.00 0.00 ? 45  ARG A CD   5  
ATOM 7334  N NE   . ARG A 1 45  ? -9.976  -10.256 -0.905  1.00 0.00 ? 45  ARG A NE   5  
ATOM 7335  C CZ   . ARG A 1 45  ? -9.380  -10.679 -2.014  1.00 0.00 ? 45  ARG A CZ   5  
ATOM 7336  N NH1  . ARG A 1 45  ? -8.169  -10.240 -2.329  1.00 0.00 ? 45  ARG A NH1  5  
ATOM 7337  N NH2  . ARG A 1 45  ? -9.995  -11.543 -2.811  1.00 0.00 ? 45  ARG A NH2  5  
ATOM 7338  H H    . ARG A 1 45  ? -7.729  -7.698  2.873   1.00 0.00 ? 45  ARG A H    5  
ATOM 7339  H HA   . ARG A 1 45  ? -6.833  -7.341  0.088   1.00 0.00 ? 45  ARG A HA   5  
ATOM 7340  H HB2  . ARG A 1 45  ? -9.510  -7.041  1.352   1.00 0.00 ? 45  ARG A HB2  5  
ATOM 7341  H HB3  . ARG A 1 45  ? -9.079  -5.901  0.085   1.00 0.00 ? 45  ARG A HB3  5  
ATOM 7342  H HG2  . ARG A 1 45  ? -10.226 -7.642  -0.989  1.00 0.00 ? 45  ARG A HG2  5  
ATOM 7343  H HG3  . ARG A 1 45  ? -8.519  -7.914  -1.345  1.00 0.00 ? 45  ARG A HG3  5  
ATOM 7344  H HD2  . ARG A 1 45  ? -8.378  -9.650  0.279   1.00 0.00 ? 45  ARG A HD2  5  
ATOM 7345  H HD3  . ARG A 1 45  ? -9.974  -9.261  0.921   1.00 0.00 ? 45  ARG A HD3  5  
ATOM 7346  H HE   . ARG A 1 45  ? -10.870 -10.594 -0.692  1.00 0.00 ? 45  ARG A HE   5  
ATOM 7347  H HH11 . ARG A 1 45  ? -7.703  -9.590  -1.730  1.00 0.00 ? 45  ARG A HH11 5  
ATOM 7348  H HH12 . ARG A 1 45  ? -7.722  -10.561 -3.164  1.00 0.00 ? 45  ARG A HH12 5  
ATOM 7349  H HH21 . ARG A 1 45  ? -10.908 -11.877 -2.578  1.00 0.00 ? 45  ARG A HH21 5  
ATOM 7350  H HH22 . ARG A 1 45  ? -9.546  -11.861 -3.646  1.00 0.00 ? 45  ARG A HH22 5  
ATOM 7351  N N    . LEU A 1 46  ? -6.714  -4.733  0.272   1.00 0.00 ? 46  LEU A N    5  
ATOM 7352  C CA   . LEU A 1 46  ? -6.229  -3.375  0.491   1.00 0.00 ? 46  LEU A CA   5  
ATOM 7353  C C    . LEU A 1 46  ? -7.271  -2.349  0.057   1.00 0.00 ? 46  LEU A C    5  
ATOM 7354  O O    . LEU A 1 46  ? -8.048  -2.590  -0.867  1.00 0.00 ? 46  LEU A O    5  
ATOM 7355  C CB   . LEU A 1 46  ? -4.925  -3.148  -0.275  1.00 0.00 ? 46  LEU A CB   5  
ATOM 7356  C CG   . LEU A 1 46  ? -3.642  -3.562  0.448   1.00 0.00 ? 46  LEU A CG   5  
ATOM 7357  C CD1  . LEU A 1 46  ? -3.346  -2.610  1.596   1.00 0.00 ? 46  LEU A CD1  5  
ATOM 7358  C CD2  . LEU A 1 46  ? -3.752  -4.993  0.953   1.00 0.00 ? 46  LEU A CD2  5  
ATOM 7359  H H    . LEU A 1 46  ? -6.899  -5.032  -0.642  1.00 0.00 ? 46  LEU A H    5  
ATOM 7360  H HA   . LEU A 1 46  ? -6.043  -3.256  1.548   1.00 0.00 ? 46  LEU A HA   5  
ATOM 7361  H HB2  . LEU A 1 46  ? -4.980  -3.708  -1.196  1.00 0.00 ? 46  LEU A HB2  5  
ATOM 7362  H HB3  . LEU A 1 46  ? -4.853  -2.094  -0.500  1.00 0.00 ? 46  LEU A HB3  5  
ATOM 7363  H HG   . LEU A 1 46  ? -2.814  -3.514  -0.246  1.00 0.00 ? 46  LEU A HG   5  
ATOM 7364  H HD11 . LEU A 1 46  ? -2.723  -1.803  1.243   1.00 0.00 ? 46  LEU A HD11 5  
ATOM 7365  H HD12 . LEU A 1 46  ? -2.832  -3.144  2.382   1.00 0.00 ? 46  LEU A HD12 5  
ATOM 7366  H HD13 . LEU A 1 46  ? -4.273  -2.210  1.980   1.00 0.00 ? 46  LEU A HD13 5  
ATOM 7367  H HD21 . LEU A 1 46  ? -2.811  -5.294  1.389   1.00 0.00 ? 46  LEU A HD21 5  
ATOM 7368  H HD22 . LEU A 1 46  ? -3.993  -5.648  0.129   1.00 0.00 ? 46  LEU A HD22 5  
ATOM 7369  H HD23 . LEU A 1 46  ? -4.530  -5.052  1.700   1.00 0.00 ? 46  LEU A HD23 5  
ATOM 7370  N N    . TYR A 1 47  ? -7.281  -1.203  0.729   1.00 0.00 ? 47  TYR A N    5  
ATOM 7371  C CA   . TYR A 1 47  ? -8.227  -0.139  0.413   1.00 0.00 ? 47  TYR A CA   5  
ATOM 7372  C C    . TYR A 1 47  ? -7.610  1.233   0.668   1.00 0.00 ? 47  TYR A C    5  
ATOM 7373  O O    . TYR A 1 47  ? -7.004  1.469   1.713   1.00 0.00 ? 47  TYR A O    5  
ATOM 7374  C CB   . TYR A 1 47  ? -9.502  -0.300  1.243   1.00 0.00 ? 47  TYR A CB   5  
ATOM 7375  C CG   . TYR A 1 47  ? -10.241 -1.591  0.975   1.00 0.00 ? 47  TYR A CG   5  
ATOM 7376  C CD1  . TYR A 1 47  ? -9.941  -2.747  1.686   1.00 0.00 ? 47  TYR A CD1  5  
ATOM 7377  C CD2  . TYR A 1 47  ? -11.238 -1.656  0.010   1.00 0.00 ? 47  TYR A CD2  5  
ATOM 7378  C CE1  . TYR A 1 47  ? -10.612 -3.929  1.443   1.00 0.00 ? 47  TYR A CE1  5  
ATOM 7379  C CE2  . TYR A 1 47  ? -11.917 -2.834  -0.238  1.00 0.00 ? 47  TYR A CE2  5  
ATOM 7380  C CZ   . TYR A 1 47  ? -11.600 -3.968  0.481   1.00 0.00 ? 47  TYR A CZ   5  
ATOM 7381  O OH   . TYR A 1 47  ? -12.272 -5.143  0.236   1.00 0.00 ? 47  TYR A OH   5  
ATOM 7382  H H    . TYR A 1 47  ? -6.637  -1.069  1.455   1.00 0.00 ? 47  TYR A H    5  
ATOM 7383  H HA   . TYR A 1 47  ? -8.479  -0.220  -0.634  1.00 0.00 ? 47  TYR A HA   5  
ATOM 7384  H HB2  . TYR A 1 47  ? -9.246  -0.277  2.292   1.00 0.00 ? 47  TYR A HB2  5  
ATOM 7385  H HB3  . TYR A 1 47  ? -10.172 0.518   1.023   1.00 0.00 ? 47  TYR A HB3  5  
ATOM 7386  H HD1  . TYR A 1 47  ? -9.167  -2.714  2.439   1.00 0.00 ? 47  TYR A HD1  5  
ATOM 7387  H HD2  . TYR A 1 47  ? -11.484 -0.767  -0.552  1.00 0.00 ? 47  TYR A HD2  5  
ATOM 7388  H HE1  . TYR A 1 47  ? -10.365 -4.818  2.006   1.00 0.00 ? 47  TYR A HE1  5  
ATOM 7389  H HE2  . TYR A 1 47  ? -12.689 -2.865  -0.992  1.00 0.00 ? 47  TYR A HE2  5  
ATOM 7390  H HH   . TYR A 1 47  ? -12.713 -5.433  1.038   1.00 0.00 ? 47  TYR A HH   5  
ATOM 7391  N N    . VAL A 1 48  ? -7.770  2.134   -0.296  1.00 0.00 ? 48  VAL A N    5  
ATOM 7392  C CA   . VAL A 1 48  ? -7.231  3.484   -0.177  1.00 0.00 ? 48  VAL A CA   5  
ATOM 7393  C C    . VAL A 1 48  ? -7.908  4.248   0.955   1.00 0.00 ? 48  VAL A C    5  
ATOM 7394  O O    . VAL A 1 48  ? -9.084  4.597   0.866   1.00 0.00 ? 48  VAL A O    5  
ATOM 7395  C CB   . VAL A 1 48  ? -7.401  4.273   -1.488  1.00 0.00 ? 48  VAL A CB   5  
ATOM 7396  C CG1  . VAL A 1 48  ? -6.763  5.649   -1.370  1.00 0.00 ? 48  VAL A CG1  5  
ATOM 7397  C CG2  . VAL A 1 48  ? -6.808  3.500   -2.656  1.00 0.00 ? 48  VAL A CG2  5  
ATOM 7398  H H    . VAL A 1 48  ? -8.263  1.886   -1.105  1.00 0.00 ? 48  VAL A H    5  
ATOM 7399  H HA   . VAL A 1 48  ? -6.175  3.404   0.036   1.00 0.00 ? 48  VAL A HA   5  
ATOM 7400  H HB   . VAL A 1 48  ? -8.458  4.405   -1.671  1.00 0.00 ? 48  VAL A HB   5  
ATOM 7401  H HG11 . VAL A 1 48  ? -5.697  5.565   -1.521  1.00 0.00 ? 48  VAL A HG11 5  
ATOM 7402  H HG12 . VAL A 1 48  ? -7.184  6.307   -2.117  1.00 0.00 ? 48  VAL A HG12 5  
ATOM 7403  H HG13 . VAL A 1 48  ? -6.956  6.051   -0.386  1.00 0.00 ? 48  VAL A HG13 5  
ATOM 7404  H HG21 . VAL A 1 48  ? -7.546  2.814   -3.044  1.00 0.00 ? 48  VAL A HG21 5  
ATOM 7405  H HG22 . VAL A 1 48  ? -6.515  4.190   -3.434  1.00 0.00 ? 48  VAL A HG22 5  
ATOM 7406  H HG23 . VAL A 1 48  ? -5.943  2.948   -2.321  1.00 0.00 ? 48  VAL A HG23 5  
ATOM 7407  N N    . ASN A 1 49  ? -7.156  4.505   2.021   1.00 0.00 ? 49  ASN A N    5  
ATOM 7408  C CA   . ASN A 1 49  ? -7.684  5.229   3.172   1.00 0.00 ? 49  ASN A CA   5  
ATOM 7409  C C    . ASN A 1 49  ? -7.636  6.735   2.936   1.00 0.00 ? 49  ASN A C    5  
ATOM 7410  O O    . ASN A 1 49  ? -8.573  7.457   3.275   1.00 0.00 ? 49  ASN A O    5  
ATOM 7411  C CB   . ASN A 1 49  ? -6.891  4.873   4.431   1.00 0.00 ? 49  ASN A CB   5  
ATOM 7412  C CG   . ASN A 1 49  ? -7.315  5.695   5.633   1.00 0.00 ? 49  ASN A CG   5  
ATOM 7413  O OD1  . ASN A 1 49  ? -7.830  6.804   5.490   1.00 0.00 ? 49  ASN A OD1  5  
ATOM 7414  N ND2  . ASN A 1 49  ? -7.100  5.153   6.826   1.00 0.00 ? 49  ASN A ND2  5  
ATOM 7415  H H    . ASN A 1 49  ? -6.225  4.201   2.033   1.00 0.00 ? 49  ASN A H    5  
ATOM 7416  H HA   . ASN A 1 49  ? -8.712  4.930   3.308   1.00 0.00 ? 49  ASN A HA   5  
ATOM 7417  H HB2  . ASN A 1 49  ? -7.044  3.829   4.662   1.00 0.00 ? 49  ASN A HB2  5  
ATOM 7418  H HB3  . ASN A 1 49  ? -5.841  5.048   4.250   1.00 0.00 ? 49  ASN A HB3  5  
ATOM 7419  H HD21 . ASN A 1 49  ? -6.686  4.266   6.864   1.00 0.00 ? 49  ASN A HD21 5  
ATOM 7420  H HD22 . ASN A 1 49  ? -7.365  5.663   7.620   1.00 0.00 ? 49  ASN A HD22 5  
ATOM 7421  N N    . SER A 1 50  ? -6.537  7.203   2.352   1.00 0.00 ? 50  SER A N    5  
ATOM 7422  C CA   . SER A 1 50  ? -6.364  8.624   2.074   1.00 0.00 ? 50  SER A CA   5  
ATOM 7423  C C    . SER A 1 50  ? -5.781  8.837   0.680   1.00 0.00 ? 50  SER A C    5  
ATOM 7424  O O    . SER A 1 50  ? -5.227  7.917   0.079   1.00 0.00 ? 50  SER A O    5  
ATOM 7425  C CB   . SER A 1 50  ? -5.454  9.264   3.123   1.00 0.00 ? 50  SER A CB   5  
ATOM 7426  O OG   . SER A 1 50  ? -5.313  10.656  2.895   1.00 0.00 ? 50  SER A OG   5  
ATOM 7427  H H    . SER A 1 50  ? -5.824  6.577   2.106   1.00 0.00 ? 50  SER A H    5  
ATOM 7428  H HA   . SER A 1 50  ? -7.337  9.091   2.120   1.00 0.00 ? 50  SER A HA   5  
ATOM 7429  H HB2  . SER A 1 50  ? -5.878  9.114   4.104   1.00 0.00 ? 50  SER A HB2  5  
ATOM 7430  H HB3  . SER A 1 50  ? -4.478  8.803   3.078   1.00 0.00 ? 50  SER A HB3  5  
ATOM 7431  H HG   . SER A 1 50  ? -4.885  11.062  3.652   1.00 0.00 ? 50  SER A HG   5  
ATOM 7432  N N    . VAL A 1 51  ? -5.912  10.058  0.172   1.00 0.00 ? 51  VAL A N    5  
ATOM 7433  C CA   . VAL A 1 51  ? -5.398  10.395  -1.151  1.00 0.00 ? 51  VAL A CA   5  
ATOM 7434  C C    . VAL A 1 51  ? -4.745  11.773  -1.152  1.00 0.00 ? 51  VAL A C    5  
ATOM 7435  O O    . VAL A 1 51  ? -5.217  12.696  -0.488  1.00 0.00 ? 51  VAL A O    5  
ATOM 7436  C CB   . VAL A 1 51  ? -6.514  10.366  -2.211  1.00 0.00 ? 51  VAL A CB   5  
ATOM 7437  C CG1  . VAL A 1 51  ? -5.990  10.857  -3.552  1.00 0.00 ? 51  VAL A CG1  5  
ATOM 7438  C CG2  . VAL A 1 51  ? -7.094  8.966   -2.336  1.00 0.00 ? 51  VAL A CG2  5  
ATOM 7439  H H    . VAL A 1 51  ? -6.364  10.750  0.699   1.00 0.00 ? 51  VAL A H    5  
ATOM 7440  H HA   . VAL A 1 51  ? -4.656  9.656   -1.419  1.00 0.00 ? 51  VAL A HA   5  
ATOM 7441  H HB   . VAL A 1 51  ? -7.303  11.032  -1.892  1.00 0.00 ? 51  VAL A HB   5  
ATOM 7442  H HG11 . VAL A 1 51  ? -6.190  11.914  -3.651  1.00 0.00 ? 51  VAL A HG11 5  
ATOM 7443  H HG12 . VAL A 1 51  ? -4.926  10.684  -3.608  1.00 0.00 ? 51  VAL A HG12 5  
ATOM 7444  H HG13 . VAL A 1 51  ? -6.485  10.322  -4.349  1.00 0.00 ? 51  VAL A HG13 5  
ATOM 7445  H HG21 . VAL A 1 51  ? -7.174  8.702   -3.380  1.00 0.00 ? 51  VAL A HG21 5  
ATOM 7446  H HG22 . VAL A 1 51  ? -6.445  8.261   -1.837  1.00 0.00 ? 51  VAL A HG22 5  
ATOM 7447  H HG23 . VAL A 1 51  ? -8.072  8.938   -1.881  1.00 0.00 ? 51  VAL A HG23 5  
ATOM 7448  N N    . LYS A 1 52  ? -3.657  11.906  -1.904  1.00 0.00 ? 52  LYS A N    5  
ATOM 7449  C CA   . LYS A 1 52  ? -2.940  13.171  -1.995  1.00 0.00 ? 52  LYS A CA   5  
ATOM 7450  C C    . LYS A 1 52  ? -3.813  14.248  -2.632  1.00 0.00 ? 52  LYS A C    5  
ATOM 7451  O O    . LYS A 1 52  ? -4.189  14.143  -3.799  1.00 0.00 ? 52  LYS A O    5  
ATOM 7452  C CB   . LYS A 1 52  ? -1.655  12.995  -2.807  1.00 0.00 ? 52  LYS A CB   5  
ATOM 7453  C CG   . LYS A 1 52  ? -0.543  13.947  -2.400  1.00 0.00 ? 52  LYS A CG   5  
ATOM 7454  C CD   . LYS A 1 52  ? 0.613   13.907  -3.386  1.00 0.00 ? 52  LYS A CD   5  
ATOM 7455  C CE   . LYS A 1 52  ? 1.907   14.389  -2.747  1.00 0.00 ? 52  LYS A CE   5  
ATOM 7456  N NZ   . LYS A 1 52  ? 1.813   15.808  -2.305  1.00 0.00 ? 52  LYS A NZ   5  
ATOM 7457  H H    . LYS A 1 52  ? -3.330  11.133  -2.411  1.00 0.00 ? 52  LYS A H    5  
ATOM 7458  H HA   . LYS A 1 52  ? -2.683  13.480  -0.993  1.00 0.00 ? 52  LYS A HA   5  
ATOM 7459  H HB2  . LYS A 1 52  ? -1.299  11.983  -2.680  1.00 0.00 ? 52  LYS A HB2  5  
ATOM 7460  H HB3  . LYS A 1 52  ? -1.878  13.161  -3.851  1.00 0.00 ? 52  LYS A HB3  5  
ATOM 7461  H HG2  . LYS A 1 52  ? -0.936  14.951  -2.364  1.00 0.00 ? 52  LYS A HG2  5  
ATOM 7462  H HG3  . LYS A 1 52  ? -0.180  13.664  -1.422  1.00 0.00 ? 52  LYS A HG3  5  
ATOM 7463  H HD2  . LYS A 1 52  ? 0.750   12.891  -3.727  1.00 0.00 ? 52  LYS A HD2  5  
ATOM 7464  H HD3  . LYS A 1 52  ? 0.379   14.543  -4.228  1.00 0.00 ? 52  LYS A HD3  5  
ATOM 7465  H HE2  . LYS A 1 52  ? 2.123   13.768  -1.891  1.00 0.00 ? 52  LYS A HE2  5  
ATOM 7466  H HE3  . LYS A 1 52  ? 2.705   14.297  -3.469  1.00 0.00 ? 52  LYS A HE3  5  
ATOM 7467  H HZ1  . LYS A 1 52  ? 0.961   16.251  -2.706  1.00 0.00 ? 52  LYS A HZ1  5  
ATOM 7468  H HZ2  . LYS A 1 52  ? 2.648   16.338  -2.625  1.00 0.00 ? 52  LYS A HZ2  5  
ATOM 7469  H HZ3  . LYS A 1 52  ? 1.760   15.857  -1.268  1.00 0.00 ? 52  LYS A HZ3  5  
ATOM 7470  N N    . GLU A 1 53  ? -4.129  15.281  -1.858  1.00 0.00 ? 53  GLU A N    5  
ATOM 7471  C CA   . GLU A 1 53  ? -4.957  16.376  -2.349  1.00 0.00 ? 53  GLU A CA   5  
ATOM 7472  C C    . GLU A 1 53  ? -4.262  17.116  -3.488  1.00 0.00 ? 53  GLU A C    5  
ATOM 7473  O O    . GLU A 1 53  ? -3.117  17.549  -3.356  1.00 0.00 ? 53  GLU A O    5  
ATOM 7474  C CB   . GLU A 1 53  ? -5.278  17.351  -1.214  1.00 0.00 ? 53  GLU A CB   5  
ATOM 7475  C CG   . GLU A 1 53  ? -6.391  18.330  -1.548  1.00 0.00 ? 53  GLU A CG   5  
ATOM 7476  C CD   . GLU A 1 53  ? -6.865  19.110  -0.337  1.00 0.00 ? 53  GLU A CD   5  
ATOM 7477  O OE1  . GLU A 1 53  ? -7.495  18.500  0.552   1.00 0.00 ? 53  GLU A OE1  5  
ATOM 7478  O OE2  . GLU A 1 53  ? -6.606  20.330  -0.279  1.00 0.00 ? 53  GLU A OE2  5  
ATOM 7479  H H    . GLU A 1 53  ? -3.798  15.308  -0.936  1.00 0.00 ? 53  GLU A H    5  
ATOM 7480  H HA   . GLU A 1 53  ? -5.879  15.955  -2.720  1.00 0.00 ? 53  GLU A HA   5  
ATOM 7481  H HB2  . GLU A 1 53  ? -5.573  16.786  -0.342  1.00 0.00 ? 53  GLU A HB2  5  
ATOM 7482  H HB3  . GLU A 1 53  ? -4.388  17.917  -0.980  1.00 0.00 ? 53  GLU A HB3  5  
ATOM 7483  H HG2  . GLU A 1 53  ? -6.028  19.029  -2.287  1.00 0.00 ? 53  GLU A HG2  5  
ATOM 7484  H HG3  . GLU A 1 53  ? -7.227  17.780  -1.955  1.00 0.00 ? 53  GLU A HG3  5  
ATOM 7485  N N    . THR A 1 54  ? -4.963  17.258  -4.609  1.00 0.00 ? 54  THR A N    5  
ATOM 7486  C CA   . THR A 1 54  ? -4.414  17.943  -5.773  1.00 0.00 ? 54  THR A CA   5  
ATOM 7487  C C    . THR A 1 54  ? -3.018  17.430  -6.105  1.00 0.00 ? 54  THR A C    5  
ATOM 7488  O O    . THR A 1 54  ? -2.161  18.185  -6.562  1.00 0.00 ? 54  THR A O    5  
ATOM 7489  C CB   . THR A 1 54  ? -4.350  19.466  -5.549  1.00 0.00 ? 54  THR A CB   5  
ATOM 7490  O OG1  . THR A 1 54  ? -3.446  19.766  -4.480  1.00 0.00 ? 54  THR A OG1  5  
ATOM 7491  C CG2  . THR A 1 54  ? -5.728  20.024  -5.228  1.00 0.00 ? 54  THR A CG2  5  
ATOM 7492  H H    . THR A 1 54  ? -5.871  16.891  -4.653  1.00 0.00 ? 54  THR A H    5  
ATOM 7493  H HA   . THR A 1 54  ? -5.067  17.750  -6.612  1.00 0.00 ? 54  THR A HA   5  
ATOM 7494  H HB   . THR A 1 54  ? -3.991  19.932  -6.456  1.00 0.00 ? 54  THR A HB   5  
ATOM 7495  H HG1  . THR A 1 54  ? -3.845  19.514  -3.644  1.00 0.00 ? 54  THR A HG1  5  
ATOM 7496  H HG21 . THR A 1 54  ? -6.290  20.144  -6.142  1.00 0.00 ? 54  THR A HG21 5  
ATOM 7497  H HG22 . THR A 1 54  ? -5.623  20.982  -4.740  1.00 0.00 ? 54  THR A HG22 5  
ATOM 7498  H HG23 . THR A 1 54  ? -6.249  19.342  -4.573  1.00 0.00 ? 54  THR A HG23 5  
ATOM 7499  N N    . GLY A 1 55  ? -2.795  16.140  -5.872  1.00 0.00 ? 55  GLY A N    5  
ATOM 7500  C CA   . GLY A 1 55  ? -1.500  15.548  -6.153  1.00 0.00 ? 55  GLY A CA   5  
ATOM 7501  C C    . GLY A 1 55  ? -1.482  14.788  -7.464  1.00 0.00 ? 55  GLY A C    5  
ATOM 7502  O O    . GLY A 1 55  ? -1.933  15.298  -8.492  1.00 0.00 ? 55  GLY A O    5  
ATOM 7503  H H    . GLY A 1 55  ? -3.516  15.585  -5.506  1.00 0.00 ? 55  GLY A H    5  
ATOM 7504  H HA2  . GLY A 1 55  ? -0.759  16.332  -6.192  1.00 0.00 ? 55  GLY A HA2  5  
ATOM 7505  H HA3  . GLY A 1 55  ? -1.247  14.867  -5.353  1.00 0.00 ? 55  GLY A HA3  5  
ATOM 7506  N N    . LEU A 1 56  ? -0.960  13.568  -7.432  1.00 0.00 ? 56  LEU A N    5  
ATOM 7507  C CA   . LEU A 1 56  ? -0.883  12.736  -8.629  1.00 0.00 ? 56  LEU A CA   5  
ATOM 7508  C C    . LEU A 1 56  ? -1.942  11.640  -8.598  1.00 0.00 ? 56  LEU A C    5  
ATOM 7509  O O    . LEU A 1 56  ? -2.718  11.486  -9.542  1.00 0.00 ? 56  LEU A O    5  
ATOM 7510  C CB   . LEU A 1 56  ? 0.509   12.114  -8.752  1.00 0.00 ? 56  LEU A CB   5  
ATOM 7511  C CG   . LEU A 1 56  ? 1.690   13.063  -8.545  1.00 0.00 ? 56  LEU A CG   5  
ATOM 7512  C CD1  . LEU A 1 56  ? 3.002   12.295  -8.571  1.00 0.00 ? 56  LEU A CD1  5  
ATOM 7513  C CD2  . LEU A 1 56  ? 1.688   14.156  -9.604  1.00 0.00 ? 56  LEU A CD2  5  
ATOM 7514  H H    . LEU A 1 56  ? -0.617  13.216  -6.585  1.00 0.00 ? 56  LEU A H    5  
ATOM 7515  H HA   . LEU A 1 56  ? -1.062  13.370  -9.484  1.00 0.00 ? 56  LEU A HA   5  
ATOM 7516  H HB2  . LEU A 1 56  ? 0.585   11.326  -8.018  1.00 0.00 ? 56  LEU A HB2  5  
ATOM 7517  H HB3  . LEU A 1 56  ? 0.594   11.689  -9.743  1.00 0.00 ? 56  LEU A HB3  5  
ATOM 7518  H HG   . LEU A 1 56  ? 1.599   13.534  -7.576  1.00 0.00 ? 56  LEU A HG   5  
ATOM 7519  H HD11 . LEU A 1 56  ? 3.658   12.728  -9.311  1.00 0.00 ? 56  LEU A HD11 5  
ATOM 7520  H HD12 . LEU A 1 56  ? 2.810   11.262  -8.821  1.00 0.00 ? 56  LEU A HD12 5  
ATOM 7521  H HD13 . LEU A 1 56  ? 3.470   12.349  -7.599  1.00 0.00 ? 56  LEU A HD13 5  
ATOM 7522  H HD21 . LEU A 1 56  ? 0.775   14.728  -9.528  1.00 0.00 ? 56  LEU A HD21 5  
ATOM 7523  H HD22 . LEU A 1 56  ? 1.750   13.706  -10.585 1.00 0.00 ? 56  LEU A HD22 5  
ATOM 7524  H HD23 . LEU A 1 56  ? 2.536   14.806  -9.451  1.00 0.00 ? 56  LEU A HD23 5  
ATOM 7525  N N    . ALA A 1 57  ? -1.971  10.881  -7.508  1.00 0.00 ? 57  ALA A N    5  
ATOM 7526  C CA   . ALA A 1 57  ? -2.938  9.802   -7.353  1.00 0.00 ? 57  ALA A CA   5  
ATOM 7527  C C    . ALA A 1 57  ? -4.339  10.259  -7.744  1.00 0.00 ? 57  ALA A C    5  
ATOM 7528  O O    . ALA A 1 57  ? -4.972  9.671   -8.621  1.00 0.00 ? 57  ALA A O    5  
ATOM 7529  C CB   . ALA A 1 57  ? -2.929  9.287   -5.921  1.00 0.00 ? 57  ALA A CB   5  
ATOM 7530  H H    . ALA A 1 57  ? -1.327  11.053  -6.789  1.00 0.00 ? 57  ALA A H    5  
ATOM 7531  H HA   . ALA A 1 57  ? -2.640  8.991   -8.002  1.00 0.00 ? 57  ALA A HA   5  
ATOM 7532  H HB1  . ALA A 1 57  ? -2.688  10.098  -5.249  1.00 0.00 ? 57  ALA A HB1  5  
ATOM 7533  H HB2  . ALA A 1 57  ? -3.904  8.892   -5.675  1.00 0.00 ? 57  ALA A HB2  5  
ATOM 7534  H HB3  . ALA A 1 57  ? -2.189  8.507   -5.823  1.00 0.00 ? 57  ALA A HB3  5  
ATOM 7535  N N    . SER A 1 58  ? -4.817  11.312  -7.088  1.00 0.00 ? 58  SER A N    5  
ATOM 7536  C CA   . SER A 1 58  ? -6.146  11.846  -7.365  1.00 0.00 ? 58  SER A CA   5  
ATOM 7537  C C    . SER A 1 58  ? -6.317  12.131  -8.854  1.00 0.00 ? 58  SER A C    5  
ATOM 7538  O O    . SER A 1 58  ? -7.077  11.451  -9.545  1.00 0.00 ? 58  SER A O    5  
ATOM 7539  C CB   . SER A 1 58  ? -6.383  13.124  -6.558  1.00 0.00 ? 58  SER A CB   5  
ATOM 7540  O OG   . SER A 1 58  ? -7.620  13.722  -6.904  1.00 0.00 ? 58  SER A OG   5  
ATOM 7541  H H    . SER A 1 58  ? -4.264  11.738  -6.400  1.00 0.00 ? 58  SER A H    5  
ATOM 7542  H HA   . SER A 1 58  ? -6.870  11.102  -7.067  1.00 0.00 ? 58  SER A HA   5  
ATOM 7543  H HB2  . SER A 1 58  ? -6.394  12.885  -5.506  1.00 0.00 ? 58  SER A HB2  5  
ATOM 7544  H HB3  . SER A 1 58  ? -5.588  13.826  -6.761  1.00 0.00 ? 58  SER A HB3  5  
ATOM 7545  H HG   . SER A 1 58  ? -7.485  14.654  -7.090  1.00 0.00 ? 58  SER A HG   5  
ATOM 7546  N N    . LYS A 1 59  ? -5.606  13.141  -9.342  1.00 0.00 ? 59  LYS A N    5  
ATOM 7547  C CA   . LYS A 1 59  ? -5.677  13.518  -10.749 1.00 0.00 ? 59  LYS A CA   5  
ATOM 7548  C C    . LYS A 1 59  ? -5.839  12.287  -11.634 1.00 0.00 ? 59  LYS A C    5  
ATOM 7549  O O    . LYS A 1 59  ? -6.792  12.187  -12.408 1.00 0.00 ? 59  LYS A O    5  
ATOM 7550  C CB   . LYS A 1 59  ? -4.419  14.290  -11.155 1.00 0.00 ? 59  LYS A CB   5  
ATOM 7551  C CG   . LYS A 1 59  ? -4.294  15.647  -10.484 1.00 0.00 ? 59  LYS A CG   5  
ATOM 7552  C CD   . LYS A 1 59  ? -3.247  16.512  -11.165 1.00 0.00 ? 59  LYS A CD   5  
ATOM 7553  C CE   . LYS A 1 59  ? -3.225  17.919  -10.587 1.00 0.00 ? 59  LYS A CE   5  
ATOM 7554  N NZ   . LYS A 1 59  ? -2.095  18.723  -11.128 1.00 0.00 ? 59  LYS A NZ   5  
ATOM 7555  H H    . LYS A 1 59  ? -5.018  13.646  -8.741  1.00 0.00 ? 59  LYS A H    5  
ATOM 7556  H HA   . LYS A 1 59  ? -6.538  14.156  -10.878 1.00 0.00 ? 59  LYS A HA   5  
ATOM 7557  H HB2  . LYS A 1 59  ? -3.551  13.702  -10.895 1.00 0.00 ? 59  LYS A HB2  5  
ATOM 7558  H HB3  . LYS A 1 59  ? -4.434  14.441  -12.225 1.00 0.00 ? 59  LYS A HB3  5  
ATOM 7559  H HG2  . LYS A 1 59  ? -5.248  16.151  -10.531 1.00 0.00 ? 59  LYS A HG2  5  
ATOM 7560  H HG3  . LYS A 1 59  ? -4.012  15.502  -9.450  1.00 0.00 ? 59  LYS A HG3  5  
ATOM 7561  H HD2  . LYS A 1 59  ? -2.275  16.063  -11.025 1.00 0.00 ? 59  LYS A HD2  5  
ATOM 7562  H HD3  . LYS A 1 59  ? -3.472  16.569  -12.221 1.00 0.00 ? 59  LYS A HD3  5  
ATOM 7563  H HE2  . LYS A 1 59  ? -4.155  18.409  -10.833 1.00 0.00 ? 59  LYS A HE2  5  
ATOM 7564  H HE3  . LYS A 1 59  ? -3.127  17.851  -9.514  1.00 0.00 ? 59  LYS A HE3  5  
ATOM 7565  H HZ1  . LYS A 1 59  ? -1.221  18.159  -11.122 1.00 0.00 ? 59  LYS A HZ1  5  
ATOM 7566  H HZ2  . LYS A 1 59  ? -1.950  19.572  -10.546 1.00 0.00 ? 59  LYS A HZ2  5  
ATOM 7567  H HZ3  . LYS A 1 59  ? -2.299  19.015  -12.105 1.00 0.00 ? 59  LYS A HZ3  5  
ATOM 7568  N N    . LYS A 1 60  ? -4.904  11.351  -11.515 1.00 0.00 ? 60  LYS A N    5  
ATOM 7569  C CA   . LYS A 1 60  ? -4.944  10.124  -12.303 1.00 0.00 ? 60  LYS A CA   5  
ATOM 7570  C C    . LYS A 1 60  ? -6.299  9.437   -12.170 1.00 0.00 ? 60  LYS A C    5  
ATOM 7571  O O    . LYS A 1 60  ? -6.988  9.206   -13.163 1.00 0.00 ? 60  LYS A O    5  
ATOM 7572  C CB   . LYS A 1 60  ? -3.831  9.172   -11.858 1.00 0.00 ? 60  LYS A CB   5  
ATOM 7573  C CG   . LYS A 1 60  ? -2.433  9.716   -12.097 1.00 0.00 ? 60  LYS A CG   5  
ATOM 7574  C CD   . LYS A 1 60  ? -2.029  9.594   -13.556 1.00 0.00 ? 60  LYS A CD   5  
ATOM 7575  C CE   . LYS A 1 60  ? -0.550  9.890   -13.752 1.00 0.00 ? 60  LYS A CE   5  
ATOM 7576  N NZ   . LYS A 1 60  ? -0.177  9.928   -15.193 1.00 0.00 ? 60  LYS A NZ   5  
ATOM 7577  H H    . LYS A 1 60  ? -4.168  11.488  -10.881 1.00 0.00 ? 60  LYS A H    5  
ATOM 7578  H HA   . LYS A 1 60  ? -4.787  10.389  -13.337 1.00 0.00 ? 60  LYS A HA   5  
ATOM 7579  H HB2  . LYS A 1 60  ? -3.943  8.975   -10.802 1.00 0.00 ? 60  LYS A HB2  5  
ATOM 7580  H HB3  . LYS A 1 60  ? -3.931  8.243   -12.401 1.00 0.00 ? 60  LYS A HB3  5  
ATOM 7581  H HG2  . LYS A 1 60  ? -2.409  10.758  -11.814 1.00 0.00 ? 60  LYS A HG2  5  
ATOM 7582  H HG3  . LYS A 1 60  ? -1.732  9.161   -11.490 1.00 0.00 ? 60  LYS A HG3  5  
ATOM 7583  H HD2  . LYS A 1 60  ? -2.230  8.588   -13.894 1.00 0.00 ? 60  LYS A HD2  5  
ATOM 7584  H HD3  . LYS A 1 60  ? -2.608  10.294  -14.141 1.00 0.00 ? 60  LYS A HD3  5  
ATOM 7585  H HE2  . LYS A 1 60  ? -0.326  10.846  -13.305 1.00 0.00 ? 60  LYS A HE2  5  
ATOM 7586  H HE3  . LYS A 1 60  ? 0.026   9.119   -13.260 1.00 0.00 ? 60  LYS A HE3  5  
ATOM 7587  H HZ1  . LYS A 1 60  ? -0.289  8.985   -15.616 1.00 0.00 ? 60  LYS A HZ1  5  
ATOM 7588  H HZ2  . LYS A 1 60  ? 0.813   10.228  -15.298 1.00 0.00 ? 60  LYS A HZ2  5  
ATOM 7589  H HZ3  . LYS A 1 60  ? -0.788  10.599  -15.702 1.00 0.00 ? 60  LYS A HZ3  5  
ATOM 7590  N N    . GLY A 1 61  ? -6.676  9.114   -10.937 1.00 0.00 ? 61  GLY A N    5  
ATOM 7591  C CA   . GLY A 1 61  ? -7.948  8.457   -10.698 1.00 0.00 ? 61  GLY A CA   5  
ATOM 7592  C C    . GLY A 1 61  ? -7.952  7.650   -9.415  1.00 0.00 ? 61  GLY A C    5  
ATOM 7593  O O    . GLY A 1 61  ? -8.170  6.438   -9.435  1.00 0.00 ? 61  GLY A O    5  
ATOM 7594  H H    . GLY A 1 61  ? -6.085  9.323   -10.183 1.00 0.00 ? 61  GLY A H    5  
ATOM 7595  H HA2  . GLY A 1 61  ? -8.722  9.207   -10.642 1.00 0.00 ? 61  GLY A HA2  5  
ATOM 7596  H HA3  . GLY A 1 61  ? -8.159  7.796   -11.526 1.00 0.00 ? 61  GLY A HA3  5  
ATOM 7597  N N    . LEU A 1 62  ? -7.708  8.322   -8.295  1.00 0.00 ? 62  LEU A N    5  
ATOM 7598  C CA   . LEU A 1 62  ? -7.682  7.659   -6.996  1.00 0.00 ? 62  LEU A CA   5  
ATOM 7599  C C    . LEU A 1 62  ? -8.495  8.442   -5.969  1.00 0.00 ? 62  LEU A C    5  
ATOM 7600  O O    . LEU A 1 62  ? -8.683  9.652   -6.102  1.00 0.00 ? 62  LEU A O    5  
ATOM 7601  C CB   . LEU A 1 62  ? -6.241  7.502   -6.509  1.00 0.00 ? 62  LEU A CB   5  
ATOM 7602  C CG   . LEU A 1 62  ? -5.496  6.263   -7.006  1.00 0.00 ? 62  LEU A CG   5  
ATOM 7603  C CD1  . LEU A 1 62  ? -3.999  6.527   -7.064  1.00 0.00 ? 62  LEU A CD1  5  
ATOM 7604  C CD2  . LEU A 1 62  ? -5.795  5.067   -6.114  1.00 0.00 ? 62  LEU A CD2  5  
ATOM 7605  H H    . LEU A 1 62  ? -7.541  9.286   -8.342  1.00 0.00 ? 62  LEU A H    5  
ATOM 7606  H HA   . LEU A 1 62  ? -8.122  6.681   -7.114  1.00 0.00 ? 62  LEU A HA   5  
ATOM 7607  H HB2  . LEU A 1 62  ? -5.687  8.371   -6.830  1.00 0.00 ? 62  LEU A HB2  5  
ATOM 7608  H HB3  . LEU A 1 62  ? -6.259  7.468   -5.429  1.00 0.00 ? 62  LEU A HB3  5  
ATOM 7609  H HG   . LEU A 1 62  ? -5.831  6.027   -8.007  1.00 0.00 ? 62  LEU A HG   5  
ATOM 7610  H HD11 . LEU A 1 62  ? -3.631  6.730   -6.069  1.00 0.00 ? 62  LEU A HD11 5  
ATOM 7611  H HD12 . LEU A 1 62  ? -3.808  7.378   -7.700  1.00 0.00 ? 62  LEU A HD12 5  
ATOM 7612  H HD13 . LEU A 1 62  ? -3.496  5.659   -7.464  1.00 0.00 ? 62  LEU A HD13 5  
ATOM 7613  H HD21 . LEU A 1 62  ? -6.381  4.346   -6.664  1.00 0.00 ? 62  LEU A HD21 5  
ATOM 7614  H HD22 . LEU A 1 62  ? -6.350  5.395   -5.247  1.00 0.00 ? 62  LEU A HD22 5  
ATOM 7615  H HD23 . LEU A 1 62  ? -4.867  4.613   -5.798  1.00 0.00 ? 62  LEU A HD23 5  
ATOM 7616  N N    . LYS A 1 63  ? -8.973  7.745   -4.944  1.00 0.00 ? 63  LYS A N    5  
ATOM 7617  C CA   . LYS A 1 63  ? -9.762  8.374   -3.892  1.00 0.00 ? 63  LYS A CA   5  
ATOM 7618  C C    . LYS A 1 63  ? -9.906  7.445   -2.691  1.00 0.00 ? 63  LYS A C    5  
ATOM 7619  O O    . LYS A 1 63  ? -9.709  6.236   -2.802  1.00 0.00 ? 63  LYS A O    5  
ATOM 7620  C CB   . LYS A 1 63  ? -11.146 8.756   -4.423  1.00 0.00 ? 63  LYS A CB   5  
ATOM 7621  C CG   . LYS A 1 63  ? -11.889 9.738   -3.534  1.00 0.00 ? 63  LYS A CG   5  
ATOM 7622  C CD   . LYS A 1 63  ? -13.002 10.444  -4.290  1.00 0.00 ? 63  LYS A CD   5  
ATOM 7623  C CE   . LYS A 1 63  ? -14.189 9.522   -4.522  1.00 0.00 ? 63  LYS A CE   5  
ATOM 7624  N NZ   . LYS A 1 63  ? -15.032 9.979   -5.662  1.00 0.00 ? 63  LYS A NZ   5  
ATOM 7625  H H    . LYS A 1 63  ? -8.789  6.783   -4.893  1.00 0.00 ? 63  LYS A H    5  
ATOM 7626  H HA   . LYS A 1 63  ? -9.246  9.269   -3.580  1.00 0.00 ? 63  LYS A HA   5  
ATOM 7627  H HB2  . LYS A 1 63  ? -11.032 9.203   -5.400  1.00 0.00 ? 63  LYS A HB2  5  
ATOM 7628  H HB3  . LYS A 1 63  ? -11.743 7.861   -4.514  1.00 0.00 ? 63  LYS A HB3  5  
ATOM 7629  H HG2  . LYS A 1 63  ? -12.319 9.201   -2.701  1.00 0.00 ? 63  LYS A HG2  5  
ATOM 7630  H HG3  . LYS A 1 63  ? -11.191 10.477  -3.166  1.00 0.00 ? 63  LYS A HG3  5  
ATOM 7631  H HD2  . LYS A 1 63  ? -13.330 11.298  -3.716  1.00 0.00 ? 63  LYS A HD2  5  
ATOM 7632  H HD3  . LYS A 1 63  ? -12.621 10.775  -5.246  1.00 0.00 ? 63  LYS A HD3  5  
ATOM 7633  H HE2  . LYS A 1 63  ? -13.822 8.529   -4.733  1.00 0.00 ? 63  LYS A HE2  5  
ATOM 7634  H HE3  . LYS A 1 63  ? -14.792 9.501   -3.626  1.00 0.00 ? 63  LYS A HE3  5  
ATOM 7635  H HZ1  . LYS A 1 63  ? -14.607 9.678   -6.563  1.00 0.00 ? 63  LYS A HZ1  5  
ATOM 7636  H HZ2  . LYS A 1 63  ? -15.106 11.017  -5.658  1.00 0.00 ? 63  LYS A HZ2  5  
ATOM 7637  H HZ3  . LYS A 1 63  ? -15.986 9.573   -5.587  1.00 0.00 ? 63  LYS A HZ3  5  
ATOM 7638  N N    . ALA A 1 64  ? -10.253 8.019   -1.543  1.00 0.00 ? 64  ALA A N    5  
ATOM 7639  C CA   . ALA A 1 64  ? -10.427 7.241   -0.322  1.00 0.00 ? 64  ALA A CA   5  
ATOM 7640  C C    . ALA A 1 64  ? -11.677 6.371   -0.399  1.00 0.00 ? 64  ALA A C    5  
ATOM 7641  O O    . ALA A 1 64  ? -12.776 6.817   -0.074  1.00 0.00 ? 64  ALA A O    5  
ATOM 7642  C CB   . ALA A 1 64  ? -10.497 8.164   0.886   1.00 0.00 ? 64  ALA A CB   5  
ATOM 7643  H H    . ALA A 1 64  ? -10.396 8.988   -1.517  1.00 0.00 ? 64  ALA A H    5  
ATOM 7644  H HA   . ALA A 1 64  ? -9.563  6.603   -0.207  1.00 0.00 ? 64  ALA A HA   5  
ATOM 7645  H HB1  . ALA A 1 64  ? -10.495 7.572   1.790   1.00 0.00 ? 64  ALA A HB1  5  
ATOM 7646  H HB2  . ALA A 1 64  ? -9.642  8.823   0.885   1.00 0.00 ? 64  ALA A HB2  5  
ATOM 7647  H HB3  . ALA A 1 64  ? -11.403 8.749   0.839   1.00 0.00 ? 64  ALA A HB3  5  
ATOM 7648  N N    . GLY A 1 65  ? -11.500 5.127   -0.832  1.00 0.00 ? 65  GLY A N    5  
ATOM 7649  C CA   . GLY A 1 65  ? -12.623 4.214   -0.945  1.00 0.00 ? 65  GLY A CA   5  
ATOM 7650  C C    . GLY A 1 65  ? -12.512 3.303   -2.151  1.00 0.00 ? 65  GLY A C    5  
ATOM 7651  O O    . GLY A 1 65  ? -13.520 2.934   -2.754  1.00 0.00 ? 65  GLY A O    5  
ATOM 7652  H H    . GLY A 1 65  ? -10.600 4.826   -1.078  1.00 0.00 ? 65  GLY A H    5  
ATOM 7653  H HA2  . GLY A 1 65  ? -12.671 3.608   -0.052  1.00 0.00 ? 65  GLY A HA2  5  
ATOM 7654  H HA3  . GLY A 1 65  ? -13.533 4.790   -1.026  1.00 0.00 ? 65  GLY A HA3  5  
ATOM 7655  N N    . ASP A 1 66  ? -11.284 2.942   -2.506  1.00 0.00 ? 66  ASP A N    5  
ATOM 7656  C CA   . ASP A 1 66  ? -11.044 2.069   -3.649  1.00 0.00 ? 66  ASP A CA   5  
ATOM 7657  C C    . ASP A 1 66  ? -10.384 0.766   -3.209  1.00 0.00 ? 66  ASP A C    5  
ATOM 7658  O O    . ASP A 1 66  ? -9.901  0.654   -2.083  1.00 0.00 ? 66  ASP A O    5  
ATOM 7659  C CB   . ASP A 1 66  ? -10.165 2.776   -4.682  1.00 0.00 ? 66  ASP A CB   5  
ATOM 7660  C CG   . ASP A 1 66  ? -10.436 2.299   -6.096  1.00 0.00 ? 66  ASP A CG   5  
ATOM 7661  O OD1  . ASP A 1 66  ? -11.452 1.603   -6.303  1.00 0.00 ? 66  ASP A OD1  5  
ATOM 7662  O OD2  . ASP A 1 66  ? -9.632  2.622   -6.995  1.00 0.00 ? 66  ASP A OD2  5  
ATOM 7663  H H    . ASP A 1 66  ? -10.520 3.269   -1.986  1.00 0.00 ? 66  ASP A H    5  
ATOM 7664  H HA   . ASP A 1 66  ? -11.998 1.840   -4.098  1.00 0.00 ? 66  ASP A HA   5  
ATOM 7665  H HB2  . ASP A 1 66  ? -10.355 3.839   -4.639  1.00 0.00 ? 66  ASP A HB2  5  
ATOM 7666  H HB3  . ASP A 1 66  ? -9.127  2.590   -4.451  1.00 0.00 ? 66  ASP A HB3  5  
ATOM 7667  N N    . GLU A 1 67  ? -10.369 -0.216  -4.105  1.00 0.00 ? 67  GLU A N    5  
ATOM 7668  C CA   . GLU A 1 67  ? -9.770  -1.512  -3.807  1.00 0.00 ? 67  GLU A CA   5  
ATOM 7669  C C    . GLU A 1 67  ? -8.644  -1.829  -4.787  1.00 0.00 ? 67  GLU A C    5  
ATOM 7670  O O    . GLU A 1 67  ? -8.867  -1.925  -5.994  1.00 0.00 ? 67  GLU A O    5  
ATOM 7671  C CB   . GLU A 1 67  ? -10.831 -2.613  -3.858  1.00 0.00 ? 67  GLU A CB   5  
ATOM 7672  C CG   . GLU A 1 67  ? -10.256 -4.017  -3.773  1.00 0.00 ? 67  GLU A CG   5  
ATOM 7673  C CD   . GLU A 1 67  ? -9.288  -4.182  -2.618  1.00 0.00 ? 67  GLU A CD   5  
ATOM 7674  O OE1  . GLU A 1 67  ? -9.747  -4.199  -1.457  1.00 0.00 ? 67  GLU A OE1  5  
ATOM 7675  O OE2  . GLU A 1 67  ? -8.071  -4.294  -2.875  1.00 0.00 ? 67  GLU A OE2  5  
ATOM 7676  H H    . GLU A 1 67  ? -10.770 -0.066  -4.986  1.00 0.00 ? 67  GLU A H    5  
ATOM 7677  H HA   . GLU A 1 67  ? -9.360  -1.466  -2.809  1.00 0.00 ? 67  GLU A HA   5  
ATOM 7678  H HB2  . GLU A 1 67  ? -11.515 -2.476  -3.034  1.00 0.00 ? 67  GLU A HB2  5  
ATOM 7679  H HB3  . GLU A 1 67  ? -11.377 -2.526  -4.786  1.00 0.00 ? 67  GLU A HB3  5  
ATOM 7680  H HG2  . GLU A 1 67  ? -11.067 -4.718  -3.646  1.00 0.00 ? 67  GLU A HG2  5  
ATOM 7681  H HG3  . GLU A 1 67  ? -9.735  -4.235  -4.694  1.00 0.00 ? 67  GLU A HG3  5  
ATOM 7682  N N    . ILE A 1 68  ? -7.435  -1.990  -4.259  1.00 0.00 ? 68  ILE A N    5  
ATOM 7683  C CA   . ILE A 1 68  ? -6.275  -2.296  -5.086  1.00 0.00 ? 68  ILE A CA   5  
ATOM 7684  C C    . ILE A 1 68  ? -6.183  -3.792  -5.371  1.00 0.00 ? 68  ILE A C    5  
ATOM 7685  O O    . ILE A 1 68  ? -6.029  -4.601  -4.455  1.00 0.00 ? 68  ILE A O    5  
ATOM 7686  C CB   . ILE A 1 68  ? -4.968  -1.830  -4.418  1.00 0.00 ? 68  ILE A CB   5  
ATOM 7687  C CG1  . ILE A 1 68  ? -5.091  -0.373  -3.969  1.00 0.00 ? 68  ILE A CG1  5  
ATOM 7688  C CG2  . ILE A 1 68  ? -3.796  -2.000  -5.372  1.00 0.00 ? 68  ILE A CG2  5  
ATOM 7689  C CD1  . ILE A 1 68  ? -4.912  0.623   -5.094  1.00 0.00 ? 68  ILE A CD1  5  
ATOM 7690  H H    . ILE A 1 68  ? -7.322  -1.901  -3.290  1.00 0.00 ? 68  ILE A H    5  
ATOM 7691  H HA   . ILE A 1 68  ? -6.385  -1.769  -6.023  1.00 0.00 ? 68  ILE A HA   5  
ATOM 7692  H HB   . ILE A 1 68  ? -4.790  -2.452  -3.554  1.00 0.00 ? 68  ILE A HB   5  
ATOM 7693  H HG12 . ILE A 1 68  ? -6.068  -0.216  -3.540  1.00 0.00 ? 68  ILE A HG12 5  
ATOM 7694  H HG13 . ILE A 1 68  ? -4.337  -0.170  -3.222  1.00 0.00 ? 68  ILE A HG13 5  
ATOM 7695  H HG21 . ILE A 1 68  ? -3.812  -2.996  -5.790  1.00 0.00 ? 68  ILE A HG21 5  
ATOM 7696  H HG22 . ILE A 1 68  ? -3.874  -1.276  -6.170  1.00 0.00 ? 68  ILE A HG22 5  
ATOM 7697  H HG23 . ILE A 1 68  ? -2.871  -1.848  -4.837  1.00 0.00 ? 68  ILE A HG23 5  
ATOM 7698  H HD11 . ILE A 1 68  ? -5.200  1.607   -4.753  1.00 0.00 ? 68  ILE A HD11 5  
ATOM 7699  H HD12 . ILE A 1 68  ? -3.878  0.636   -5.403  1.00 0.00 ? 68  ILE A HD12 5  
ATOM 7700  H HD13 . ILE A 1 68  ? -5.534  0.336   -5.930  1.00 0.00 ? 68  ILE A HD13 5  
ATOM 7701  N N    . LEU A 1 69  ? -6.275  -4.152  -6.646  1.00 0.00 ? 69  LEU A N    5  
ATOM 7702  C CA   . LEU A 1 69  ? -6.200  -5.551  -7.053  1.00 0.00 ? 69  LEU A CA   5  
ATOM 7703  C C    . LEU A 1 69  ? -4.749  -6.007  -7.169  1.00 0.00 ? 69  LEU A C    5  
ATOM 7704  O O    . LEU A 1 69  ? -4.404  -7.119  -6.769  1.00 0.00 ? 69  LEU A O    5  
ATOM 7705  C CB   . LEU A 1 69  ? -6.919  -5.754  -8.388  1.00 0.00 ? 69  LEU A CB   5  
ATOM 7706  C CG   . LEU A 1 69  ? -8.374  -5.288  -8.444  1.00 0.00 ? 69  LEU A CG   5  
ATOM 7707  C CD1  . LEU A 1 69  ? -8.747  -4.874  -9.859  1.00 0.00 ? 69  LEU A CD1  5  
ATOM 7708  C CD2  . LEU A 1 69  ? -9.305  -6.383  -7.944  1.00 0.00 ? 69  LEU A CD2  5  
ATOM 7709  H H    . LEU A 1 69  ? -6.397  -3.463  -7.331  1.00 0.00 ? 69  LEU A H    5  
ATOM 7710  H HA   . LEU A 1 69  ? -6.691  -6.143  -6.295  1.00 0.00 ? 69  LEU A HA   5  
ATOM 7711  H HB2  . LEU A 1 69  ? -6.369  -5.215  -9.144  1.00 0.00 ? 69  LEU A HB2  5  
ATOM 7712  H HB3  . LEU A 1 69  ? -6.900  -6.811  -8.615  1.00 0.00 ? 69  LEU A HB3  5  
ATOM 7713  H HG   . LEU A 1 69  ? -8.494  -4.426  -7.802  1.00 0.00 ? 69  LEU A HG   5  
ATOM 7714  H HD11 . LEU A 1 69  ? -8.944  -3.813  -9.883  1.00 0.00 ? 69  LEU A HD11 5  
ATOM 7715  H HD12 . LEU A 1 69  ? -9.631  -5.411  -10.170 1.00 0.00 ? 69  LEU A HD12 5  
ATOM 7716  H HD13 . LEU A 1 69  ? -7.931  -5.104  -10.528 1.00 0.00 ? 69  LEU A HD13 5  
ATOM 7717  H HD21 . LEU A 1 69  ? -9.429  -7.129  -8.715  1.00 0.00 ? 69  LEU A HD21 5  
ATOM 7718  H HD22 . LEU A 1 69  ? -10.266 -5.954  -7.700  1.00 0.00 ? 69  LEU A HD22 5  
ATOM 7719  H HD23 . LEU A 1 69  ? -8.880  -6.841  -7.063  1.00 0.00 ? 69  LEU A HD23 5  
ATOM 7720  N N    . GLU A 1 70  ? -3.904  -5.140  -7.717  1.00 0.00 ? 70  GLU A N    5  
ATOM 7721  C CA   . GLU A 1 70  ? -2.489  -5.454  -7.884  1.00 0.00 ? 70  GLU A CA   5  
ATOM 7722  C C    . GLU A 1 70  ? -1.645  -4.183  -7.876  1.00 0.00 ? 70  GLU A C    5  
ATOM 7723  O O    . GLU A 1 70  ? -2.153  -3.087  -8.115  1.00 0.00 ? 70  GLU A O    5  
ATOM 7724  C CB   . GLU A 1 70  ? -2.265  -6.220  -9.189  1.00 0.00 ? 70  GLU A CB   5  
ATOM 7725  C CG   . GLU A 1 70  ? -2.440  -7.723  -9.050  1.00 0.00 ? 70  GLU A CG   5  
ATOM 7726  C CD   . GLU A 1 70  ? -2.060  -8.474  -10.311 1.00 0.00 ? 70  GLU A CD   5  
ATOM 7727  O OE1  . GLU A 1 70  ? -0.847  -8.617  -10.573 1.00 0.00 ? 70  GLU A OE1  5  
ATOM 7728  O OE2  . GLU A 1 70  ? -2.974  -8.918  -11.037 1.00 0.00 ? 70  GLU A OE2  5  
ATOM 7729  H H    . GLU A 1 70  ? -4.239  -4.269  -8.016  1.00 0.00 ? 70  GLU A H    5  
ATOM 7730  H HA   . GLU A 1 70  ? -2.188  -6.077  -7.055  1.00 0.00 ? 70  GLU A HA   5  
ATOM 7731  H HB2  . GLU A 1 70  ? -2.967  -5.863  -9.927  1.00 0.00 ? 70  GLU A HB2  5  
ATOM 7732  H HB3  . GLU A 1 70  ? -1.261  -6.027  -9.537  1.00 0.00 ? 70  GLU A HB3  5  
ATOM 7733  H HG2  . GLU A 1 70  ? -1.817  -8.072  -8.240  1.00 0.00 ? 70  GLU A HG2  5  
ATOM 7734  H HG3  . GLU A 1 70  ? -3.475  -7.933  -8.823  1.00 0.00 ? 70  GLU A HG3  5  
ATOM 7735  N N    . ILE A 1 71  ? -0.355  -4.338  -7.598  1.00 0.00 ? 71  ILE A N    5  
ATOM 7736  C CA   . ILE A 1 71  ? 0.560   -3.204  -7.560  1.00 0.00 ? 71  ILE A CA   5  
ATOM 7737  C C    . ILE A 1 71  ? 1.881   -3.540  -8.243  1.00 0.00 ? 71  ILE A C    5  
ATOM 7738  O O    . ILE A 1 71  ? 2.710   -4.263  -7.693  1.00 0.00 ? 71  ILE A O    5  
ATOM 7739  C CB   . ILE A 1 71  ? 0.842   -2.758  -6.113  1.00 0.00 ? 71  ILE A CB   5  
ATOM 7740  C CG1  . ILE A 1 71  ? -0.461  -2.363  -5.415  1.00 0.00 ? 71  ILE A CG1  5  
ATOM 7741  C CG2  . ILE A 1 71  ? 1.829   -1.600  -6.099  1.00 0.00 ? 71  ILE A CG2  5  
ATOM 7742  C CD1  . ILE A 1 71  ? -0.368  -2.385  -3.905  1.00 0.00 ? 71  ILE A CD1  5  
ATOM 7743  H H    . ILE A 1 71  ? -0.010  -5.237  -7.416  1.00 0.00 ? 71  ILE A H    5  
ATOM 7744  H HA   . ILE A 1 71  ? 0.094   -2.383  -8.084  1.00 0.00 ? 71  ILE A HA   5  
ATOM 7745  H HB   . ILE A 1 71  ? 1.288   -3.586  -5.585  1.00 0.00 ? 71  ILE A HB   5  
ATOM 7746  H HG12 . ILE A 1 71  ? -0.734  -1.363  -5.715  1.00 0.00 ? 71  ILE A HG12 5  
ATOM 7747  H HG13 . ILE A 1 71  ? -1.241  -3.049  -5.710  1.00 0.00 ? 71  ILE A HG13 5  
ATOM 7748  H HG21 . ILE A 1 71  ? 2.774   -1.928  -6.509  1.00 0.00 ? 71  ILE A HG21 5  
ATOM 7749  H HG22 . ILE A 1 71  ? 1.441   -0.789  -6.696  1.00 0.00 ? 71  ILE A HG22 5  
ATOM 7750  H HG23 . ILE A 1 71  ? 1.975   -1.263  -5.084  1.00 0.00 ? 71  ILE A HG23 5  
ATOM 7751  H HD11 . ILE A 1 71  ? -0.897  -1.536  -3.499  1.00 0.00 ? 71  ILE A HD11 5  
ATOM 7752  H HD12 . ILE A 1 71  ? -0.806  -3.297  -3.530  1.00 0.00 ? 71  ILE A HD12 5  
ATOM 7753  H HD13 . ILE A 1 71  ? 0.670   -2.336  -3.608  1.00 0.00 ? 71  ILE A HD13 5  
ATOM 7754  N N    . ASN A 1 72  ? 2.070   -3.007  -9.446  1.00 0.00 ? 72  ASN A N    5  
ATOM 7755  C CA   . ASN A 1 72  ? 3.292   -3.249  -10.205 1.00 0.00 ? 72  ASN A CA   5  
ATOM 7756  C C    . ASN A 1 72  ? 3.445   -4.731  -10.532 1.00 0.00 ? 72  ASN A C    5  
ATOM 7757  O O    . ASN A 1 72  ? 4.504   -5.319  -10.317 1.00 0.00 ? 72  ASN A O    5  
ATOM 7758  C CB   . ASN A 1 72  ? 4.511   -2.760  -9.419  1.00 0.00 ? 72  ASN A CB   5  
ATOM 7759  C CG   . ASN A 1 72  ? 4.759   -1.276  -9.602  1.00 0.00 ? 72  ASN A CG   5  
ATOM 7760  O OD1  . ASN A 1 72  ? 4.276   -0.667  -10.557 1.00 0.00 ? 72  ASN A OD1  5  
ATOM 7761  N ND2  . ASN A 1 72  ? 5.517   -0.686  -8.685  1.00 0.00 ? 72  ASN A ND2  5  
ATOM 7762  H H    . ASN A 1 72  ? 1.373   -2.438  -9.833  1.00 0.00 ? 72  ASN A H    5  
ATOM 7763  H HA   . ASN A 1 72  ? 3.224   -2.693  -11.128 1.00 0.00 ? 72  ASN A HA   5  
ATOM 7764  H HB2  . ASN A 1 72  ? 4.354   -2.953  -8.368  1.00 0.00 ? 72  ASN A HB2  5  
ATOM 7765  H HB3  . ASN A 1 72  ? 5.386   -3.297  -9.753  1.00 0.00 ? 72  ASN A HB3  5  
ATOM 7766  H HD21 . ASN A 1 72  ? 5.868   -1.233  -7.952  1.00 0.00 ? 72  ASN A HD21 5  
ATOM 7767  H HD22 . ASN A 1 72  ? 5.693   0.274   -8.778  1.00 0.00 ? 72  ASN A HD22 5  
ATOM 7768  N N    . ASN A 1 73  ? 2.378   -5.329  -11.054 1.00 0.00 ? 73  ASN A N    5  
ATOM 7769  C CA   . ASN A 1 73  ? 2.394   -6.743  -11.412 1.00 0.00 ? 73  ASN A CA   5  
ATOM 7770  C C    . ASN A 1 73  ? 2.623   -7.613  -10.180 1.00 0.00 ? 73  ASN A C    5  
ATOM 7771  O O    . ASN A 1 73  ? 3.355   -8.601  -10.232 1.00 0.00 ? 73  ASN A O    5  
ATOM 7772  C CB   . ASN A 1 73  ? 3.482   -7.016  -12.452 1.00 0.00 ? 73  ASN A CB   5  
ATOM 7773  C CG   . ASN A 1 73  ? 3.039   -6.662  -13.858 1.00 0.00 ? 73  ASN A CG   5  
ATOM 7774  O OD1  . ASN A 1 73  ? 3.672   -5.852  -14.535 1.00 0.00 ? 73  ASN A OD1  5  
ATOM 7775  N ND2  . ASN A 1 73  ? 1.946   -7.270  -14.305 1.00 0.00 ? 73  ASN A ND2  5  
ATOM 7776  H H    . ASN A 1 73  ? 1.562   -4.808  -11.203 1.00 0.00 ? 73  ASN A H    5  
ATOM 7777  H HA   . ASN A 1 73  ? 1.432   -6.987  -11.837 1.00 0.00 ? 73  ASN A HA   5  
ATOM 7778  H HB2  . ASN A 1 73  ? 4.356   -6.428  -12.212 1.00 0.00 ? 73  ASN A HB2  5  
ATOM 7779  H HB3  . ASN A 1 73  ? 3.740   -8.064  -12.428 1.00 0.00 ? 73  ASN A HB3  5  
ATOM 7780  H HD21 . ASN A 1 73  ? 1.492   -7.903  -13.710 1.00 0.00 ? 73  ASN A HD21 5  
ATOM 7781  H HD22 . ASN A 1 73  ? 1.638   -7.060  -15.211 1.00 0.00 ? 73  ASN A HD22 5  
ATOM 7782  N N    . ARG A 1 74  ? 1.991   -7.239  -9.072  1.00 0.00 ? 74  ARG A N    5  
ATOM 7783  C CA   . ARG A 1 74  ? 2.126   -7.984  -7.826  1.00 0.00 ? 74  ARG A CA   5  
ATOM 7784  C C    . ARG A 1 74  ? 0.803   -8.017  -7.066  1.00 0.00 ? 74  ARG A C    5  
ATOM 7785  O O    . ARG A 1 74  ? 0.098   -7.011  -6.983  1.00 0.00 ? 74  ARG A O    5  
ATOM 7786  C CB   . ARG A 1 74  ? 3.215   -7.362  -6.950  1.00 0.00 ? 74  ARG A CB   5  
ATOM 7787  C CG   . ARG A 1 74  ? 4.606   -7.447  -7.556  1.00 0.00 ? 74  ARG A CG   5  
ATOM 7788  C CD   . ARG A 1 74  ? 5.149   -8.867  -7.506  1.00 0.00 ? 74  ARG A CD   5  
ATOM 7789  N NE   . ARG A 1 74  ? 6.224   -9.076  -8.473  1.00 0.00 ? 74  ARG A NE   5  
ATOM 7790  C CZ   . ARG A 1 74  ? 7.429   -8.527  -8.363  1.00 0.00 ? 74  ARG A CZ   5  
ATOM 7791  N NH1  . ARG A 1 74  ? 7.711   -7.741  -7.333  1.00 0.00 ? 74  ARG A NH1  5  
ATOM 7792  N NH2  . ARG A 1 74  ? 8.354   -8.765  -9.283  1.00 0.00 ? 74  ARG A NH2  5  
ATOM 7793  H H    . ARG A 1 74  ? 1.421   -6.442  -9.092  1.00 0.00 ? 74  ARG A H    5  
ATOM 7794  H HA   . ARG A 1 74  ? 2.410   -8.996  -8.074  1.00 0.00 ? 74  ARG A HA   5  
ATOM 7795  H HB2  . ARG A 1 74  ? 2.979   -6.320  -6.789  1.00 0.00 ? 74  ARG A HB2  5  
ATOM 7796  H HB3  . ARG A 1 74  ? 3.228   -7.871  -5.998  1.00 0.00 ? 74  ARG A HB3  5  
ATOM 7797  H HG2  . ARG A 1 74  ? 4.560   -7.127  -8.586  1.00 0.00 ? 74  ARG A HG2  5  
ATOM 7798  H HG3  . ARG A 1 74  ? 5.269   -6.797  -7.004  1.00 0.00 ? 74  ARG A HG3  5  
ATOM 7799  H HD2  . ARG A 1 74  ? 5.529   -9.058  -6.513  1.00 0.00 ? 74  ARG A HD2  5  
ATOM 7800  H HD3  . ARG A 1 74  ? 4.345   -9.553  -7.721  1.00 0.00 ? 74  ARG A HD3  5  
ATOM 7801  H HE   . ARG A 1 74  ? 6.037   -9.654  -9.241  1.00 0.00 ? 74  ARG A HE   5  
ATOM 7802  H HH11 . ARG A 1 74  ? 7.016   -7.560  -6.637  1.00 0.00 ? 74  ARG A HH11 5  
ATOM 7803  H HH12 . ARG A 1 74  ? 8.619   -7.330  -7.252  1.00 0.00 ? 74  ARG A HH12 5  
ATOM 7804  H HH21 . ARG A 1 74  ? 8.145   -9.358  -10.061 1.00 0.00 ? 74  ARG A HH21 5  
ATOM 7805  H HH22 . ARG A 1 74  ? 9.260   -8.352  -9.200  1.00 0.00 ? 74  ARG A HH22 5  
ATOM 7806  N N    . ALA A 1 75  ? 0.473   -9.179  -6.513  1.00 0.00 ? 75  ALA A N    5  
ATOM 7807  C CA   . ALA A 1 75  ? -0.764  -9.343  -5.759  1.00 0.00 ? 75  ALA A CA   5  
ATOM 7808  C C    . ALA A 1 75  ? -0.743  -8.507  -4.483  1.00 0.00 ? 75  ALA A C    5  
ATOM 7809  O O    . ALA A 1 75  ? 0.247   -8.497  -3.753  1.00 0.00 ? 75  ALA A O    5  
ATOM 7810  C CB   . ALA A 1 75  ? -0.990  -10.810 -5.427  1.00 0.00 ? 75  ALA A CB   5  
ATOM 7811  H H    . ALA A 1 75  ? 1.076   -9.945  -6.614  1.00 0.00 ? 75  ALA A H    5  
ATOM 7812  H HA   . ALA A 1 75  ? -1.581  -9.010  -6.382  1.00 0.00 ? 75  ALA A HA   5  
ATOM 7813  H HB1  . ALA A 1 75  ? -1.553  -11.276 -6.223  1.00 0.00 ? 75  ALA A HB1  5  
ATOM 7814  H HB2  . ALA A 1 75  ? -0.036  -11.306 -5.322  1.00 0.00 ? 75  ALA A HB2  5  
ATOM 7815  H HB3  . ALA A 1 75  ? -1.541  -10.889 -4.502  1.00 0.00 ? 75  ALA A HB3  5  
ATOM 7816  N N    . ALA A 1 76  ? -1.842  -7.807  -4.222  1.00 0.00 ? 76  ALA A N    5  
ATOM 7817  C CA   . ALA A 1 76  ? -1.950  -6.969  -3.034  1.00 0.00 ? 76  ALA A CA   5  
ATOM 7818  C C    . ALA A 1 76  ? -1.675  -7.774  -1.769  1.00 0.00 ? 76  ALA A C    5  
ATOM 7819  O O    . ALA A 1 76  ? -0.765  -7.454  -1.004  1.00 0.00 ? 76  ALA A O    5  
ATOM 7820  C CB   . ALA A 1 76  ? -3.328  -6.327  -2.965  1.00 0.00 ? 76  ALA A CB   5  
ATOM 7821  H H    . ALA A 1 76  ? -2.599  -7.856  -4.843  1.00 0.00 ? 76  ALA A H    5  
ATOM 7822  H HA   . ALA A 1 76  ? -1.216  -6.180  -3.114  1.00 0.00 ? 76  ALA A HA   5  
ATOM 7823  H HB1  . ALA A 1 76  ? -3.781  -6.342  -3.946  1.00 0.00 ? 76  ALA A HB1  5  
ATOM 7824  H HB2  . ALA A 1 76  ? -3.948  -6.879  -2.274  1.00 0.00 ? 76  ALA A HB2  5  
ATOM 7825  H HB3  . ALA A 1 76  ? -3.233  -5.306  -2.627  1.00 0.00 ? 76  ALA A HB3  5  
ATOM 7826  N N    . ASP A 1 77  ? -2.467  -8.818  -1.553  1.00 0.00 ? 77  ASP A N    5  
ATOM 7827  C CA   . ASP A 1 77  ? -2.308  -9.669  -0.380  1.00 0.00 ? 77  ASP A CA   5  
ATOM 7828  C C    . ASP A 1 77  ? -0.859  -10.122 -0.229  1.00 0.00 ? 77  ASP A C    5  
ATOM 7829  O O    . ASP A 1 77  ? -0.313  -10.131 0.873   1.00 0.00 ? 77  ASP A O    5  
ATOM 7830  C CB   . ASP A 1 77  ? -3.229  -10.887 -0.477  1.00 0.00 ? 77  ASP A CB   5  
ATOM 7831  C CG   . ASP A 1 77  ? -3.204  -11.522 -1.854  1.00 0.00 ? 77  ASP A CG   5  
ATOM 7832  O OD1  . ASP A 1 77  ? -3.958  -11.059 -2.735  1.00 0.00 ? 77  ASP A OD1  5  
ATOM 7833  O OD2  . ASP A 1 77  ? -2.430  -12.482 -2.049  1.00 0.00 ? 77  ASP A OD2  5  
ATOM 7834  H H    . ASP A 1 77  ? -3.175  -9.023  -2.200  1.00 0.00 ? 77  ASP A H    5  
ATOM 7835  H HA   . ASP A 1 77  ? -2.583  -9.091  0.489   1.00 0.00 ? 77  ASP A HA   5  
ATOM 7836  H HB2  . ASP A 1 77  ? -2.916  -11.626 0.246   1.00 0.00 ? 77  ASP A HB2  5  
ATOM 7837  H HB3  . ASP A 1 77  ? -4.242  -10.582 -0.259  1.00 0.00 ? 77  ASP A HB3  5  
ATOM 7838  N N    . ALA A 1 78  ? -0.244  -10.500 -1.345  1.00 0.00 ? 78  ALA A N    5  
ATOM 7839  C CA   . ALA A 1 78  ? 1.141   -10.953 -1.337  1.00 0.00 ? 78  ALA A CA   5  
ATOM 7840  C C    . ALA A 1 78  ? 2.060   -9.901  -0.725  1.00 0.00 ? 78  ALA A C    5  
ATOM 7841  O O    . ALA A 1 78  ? 3.009   -10.230 -0.011  1.00 0.00 ? 78  ALA A O    5  
ATOM 7842  C CB   . ALA A 1 78  ? 1.593   -11.294 -2.749  1.00 0.00 ? 78  ALA A CB   5  
ATOM 7843  H H    . ALA A 1 78  ? -0.733  -10.471 -2.193  1.00 0.00 ? 78  ALA A H    5  
ATOM 7844  H HA   . ALA A 1 78  ? 1.195   -11.853 -0.742  1.00 0.00 ? 78  ALA A HA   5  
ATOM 7845  H HB1  . ALA A 1 78  ? 2.070   -12.263 -2.750  1.00 0.00 ? 78  ALA A HB1  5  
ATOM 7846  H HB2  . ALA A 1 78  ? 0.736   -11.314 -3.406  1.00 0.00 ? 78  ALA A HB2  5  
ATOM 7847  H HB3  . ALA A 1 78  ? 2.294   -10.547 -3.093  1.00 0.00 ? 78  ALA A HB3  5  
ATOM 7848  N N    . LEU A 1 79  ? 1.774   -8.635  -1.008  1.00 0.00 ? 79  LEU A N    5  
ATOM 7849  C CA   . LEU A 1 79  ? 2.575   -7.534  -0.486  1.00 0.00 ? 79  LEU A CA   5  
ATOM 7850  C C    . LEU A 1 79  ? 2.257   -7.279  0.984   1.00 0.00 ? 79  LEU A C    5  
ATOM 7851  O O    . LEU A 1 79  ? 1.093   -7.174  1.368   1.00 0.00 ? 79  LEU A O    5  
ATOM 7852  C CB   . LEU A 1 79  ? 2.325   -6.264  -1.301  1.00 0.00 ? 79  LEU A CB   5  
ATOM 7853  C CG   . LEU A 1 79  ? 2.501   -6.393  -2.815  1.00 0.00 ? 79  LEU A CG   5  
ATOM 7854  C CD1  . LEU A 1 79  ? 1.742   -5.290  -3.536  1.00 0.00 ? 79  LEU A CD1  5  
ATOM 7855  C CD2  . LEU A 1 79  ? 3.977   -6.357  -3.185  1.00 0.00 ? 79  LEU A CD2  5  
ATOM 7856  H H    . LEU A 1 79  ? 1.005   -8.436  -1.582  1.00 0.00 ? 79  LEU A H    5  
ATOM 7857  H HA   . LEU A 1 79  ? 3.615   -7.810  -0.574  1.00 0.00 ? 79  LEU A HA   5  
ATOM 7858  H HB2  . LEU A 1 79  ? 1.312   -5.944  -1.112  1.00 0.00 ? 79  LEU A HB2  5  
ATOM 7859  H HB3  . LEU A 1 79  ? 3.012   -5.507  -0.951  1.00 0.00 ? 79  LEU A HB3  5  
ATOM 7860  H HG   . LEU A 1 79  ? 2.097   -7.342  -3.138  1.00 0.00 ? 79  LEU A HG   5  
ATOM 7861  H HD11 . LEU A 1 79  ? 2.194   -5.113  -4.500  1.00 0.00 ? 79  LEU A HD11 5  
ATOM 7862  H HD12 . LEU A 1 79  ? 1.777   -4.385  -2.949  1.00 0.00 ? 79  LEU A HD12 5  
ATOM 7863  H HD13 . LEU A 1 79  ? 0.713   -5.591  -3.671  1.00 0.00 ? 79  LEU A HD13 5  
ATOM 7864  H HD21 . LEU A 1 79  ? 4.083   -6.017  -4.205  1.00 0.00 ? 79  LEU A HD21 5  
ATOM 7865  H HD22 . LEU A 1 79  ? 4.396   -7.348  -3.091  1.00 0.00 ? 79  LEU A HD22 5  
ATOM 7866  H HD23 . LEU A 1 79  ? 4.497   -5.681  -2.524  1.00 0.00 ? 79  LEU A HD23 5  
ATOM 7867  N N    . ASN A 1 80  ? 3.301   -7.179  1.801   1.00 0.00 ? 80  ASN A N    5  
ATOM 7868  C CA   . ASN A 1 80  ? 3.133   -6.934  3.229   1.00 0.00 ? 80  ASN A CA   5  
ATOM 7869  C C    . ASN A 1 80  ? 3.606   -5.531  3.600   1.00 0.00 ? 80  ASN A C    5  
ATOM 7870  O O    . ASN A 1 80  ? 4.329   -4.888  2.839   1.00 0.00 ? 80  ASN A O    5  
ATOM 7871  C CB   . ASN A 1 80  ? 3.906   -7.976  4.040   1.00 0.00 ? 80  ASN A CB   5  
ATOM 7872  C CG   . ASN A 1 80  ? 3.706   -7.809  5.534   1.00 0.00 ? 80  ASN A CG   5  
ATOM 7873  O OD1  . ASN A 1 80  ? 2.580   -7.859  6.031   1.00 0.00 ? 80  ASN A OD1  5  
ATOM 7874  N ND2  . ASN A 1 80  ? 4.800   -7.611  6.259   1.00 0.00 ? 80  ASN A ND2  5  
ATOM 7875  H H    . ASN A 1 80  ? 4.205   -7.272  1.435   1.00 0.00 ? 80  ASN A H    5  
ATOM 7876  H HA   . ASN A 1 80  ? 2.082   -7.019  3.458   1.00 0.00 ? 80  ASN A HA   5  
ATOM 7877  H HB2  . ASN A 1 80  ? 3.569   -8.963  3.760   1.00 0.00 ? 80  ASN A HB2  5  
ATOM 7878  H HB3  . ASN A 1 80  ? 4.959   -7.884  3.824   1.00 0.00 ? 80  ASN A HB3  5  
ATOM 7879  H HD21 . ASN A 1 80  ? 5.664   -7.583  5.796   1.00 0.00 ? 80  ASN A HD21 5  
ATOM 7880  H HD22 . ASN A 1 80  ? 4.700   -7.501  7.228   1.00 0.00 ? 80  ASN A HD22 5  
ATOM 7881  N N    . SER A 1 81  ? 3.193   -5.065  4.774   1.00 0.00 ? 81  SER A N    5  
ATOM 7882  C CA   . SER A 1 81  ? 3.571   -3.738  5.245   1.00 0.00 ? 81  SER A CA   5  
ATOM 7883  C C    . SER A 1 81  ? 4.999   -3.400  4.827   1.00 0.00 ? 81  SER A C    5  
ATOM 7884  O O    . SER A 1 81  ? 5.272   -2.303  4.339   1.00 0.00 ? 81  SER A O    5  
ATOM 7885  C CB   . SER A 1 81  ? 3.441   -3.657  6.767   1.00 0.00 ? 81  SER A CB   5  
ATOM 7886  O OG   . SER A 1 81  ? 3.194   -2.327  7.188   1.00 0.00 ? 81  SER A OG   5  
ATOM 7887  H H    . SER A 1 81  ? 2.618   -5.626  5.335   1.00 0.00 ? 81  SER A H    5  
ATOM 7888  H HA   . SER A 1 81  ? 2.898   -3.022  4.796   1.00 0.00 ? 81  SER A HA   5  
ATOM 7889  H HB2  . SER A 1 81  ? 2.621   -4.281  7.089   1.00 0.00 ? 81  SER A HB2  5  
ATOM 7890  H HB3  . SER A 1 81  ? 4.357   -4.002  7.223   1.00 0.00 ? 81  SER A HB3  5  
ATOM 7891  H HG   . SER A 1 81  ? 2.598   -2.334  7.941   1.00 0.00 ? 81  SER A HG   5  
ATOM 7892  N N    . SER A 1 82  ? 5.907   -4.351  5.022   1.00 0.00 ? 82  SER A N    5  
ATOM 7893  C CA   . SER A 1 82  ? 7.308   -4.154  4.669   1.00 0.00 ? 82  SER A CA   5  
ATOM 7894  C C    . SER A 1 82  ? 7.452   -3.796  3.193   1.00 0.00 ? 82  SER A C    5  
ATOM 7895  O O    . SER A 1 82  ? 7.930   -2.716  2.849   1.00 0.00 ? 82  SER A O    5  
ATOM 7896  C CB   . SER A 1 82  ? 8.117   -5.414  4.982   1.00 0.00 ? 82  SER A CB   5  
ATOM 7897  O OG   . SER A 1 82  ? 9.493   -5.113  5.135   1.00 0.00 ? 82  SER A OG   5  
ATOM 7898  H H    . SER A 1 82  ? 5.628   -5.204  5.415   1.00 0.00 ? 82  SER A H    5  
ATOM 7899  H HA   . SER A 1 82  ? 7.688   -3.336  5.264   1.00 0.00 ? 82  SER A HA   5  
ATOM 7900  H HB2  . SER A 1 82  ? 7.753   -5.855  5.898   1.00 0.00 ? 82  SER A HB2  5  
ATOM 7901  H HB3  . SER A 1 82  ? 8.003   -6.121  4.172   1.00 0.00 ? 82  SER A HB3  5  
ATOM 7902  H HG   . SER A 1 82  ? 9.678   -4.924  6.058   1.00 0.00 ? 82  SER A HG   5  
ATOM 7903  N N    . MET A 1 83  ? 7.035   -4.713  2.326   1.00 0.00 ? 83  MET A N    5  
ATOM 7904  C CA   . MET A 1 83  ? 7.116   -4.495  0.886   1.00 0.00 ? 83  MET A CA   5  
ATOM 7905  C C    . MET A 1 83  ? 6.437   -3.185  0.496   1.00 0.00 ? 83  MET A C    5  
ATOM 7906  O O    . MET A 1 83  ? 7.031   -2.345  -0.182  1.00 0.00 ? 83  MET A O    5  
ATOM 7907  C CB   . MET A 1 83  ? 6.471   -5.661  0.135   1.00 0.00 ? 83  MET A CB   5  
ATOM 7908  C CG   . MET A 1 83  ? 7.260   -6.956  0.230   1.00 0.00 ? 83  MET A CG   5  
ATOM 7909  S SD   . MET A 1 83  ? 6.213   -8.419  0.101   1.00 0.00 ? 83  MET A SD   5  
ATOM 7910  C CE   . MET A 1 83  ? 6.557   -9.219  1.666   1.00 0.00 ? 83  MET A CE   5  
ATOM 7911  H H    . MET A 1 83  ? 6.663   -5.555  2.661   1.00 0.00 ? 83  MET A H    5  
ATOM 7912  H HA   . MET A 1 83  ? 8.160   -4.439  0.618   1.00 0.00 ? 83  MET A HA   5  
ATOM 7913  H HB2  . MET A 1 83  ? 5.485   -5.834  0.541   1.00 0.00 ? 83  MET A HB2  5  
ATOM 7914  H HB3  . MET A 1 83  ? 6.380   -5.396  -0.908  1.00 0.00 ? 83  MET A HB3  5  
ATOM 7915  H HG2  . MET A 1 83  ? 7.986   -6.980  -0.569  1.00 0.00 ? 83  MET A HG2  5  
ATOM 7916  H HG3  . MET A 1 83  ? 7.773   -6.980  1.180   1.00 0.00 ? 83  MET A HG3  5  
ATOM 7917  H HE1  . MET A 1 83  ? 6.750   -10.269 1.499   1.00 0.00 ? 83  MET A HE1  5  
ATOM 7918  H HE2  . MET A 1 83  ? 7.422   -8.762  2.122   1.00 0.00 ? 83  MET A HE2  5  
ATOM 7919  H HE3  . MET A 1 83  ? 5.704   -9.110  2.321   1.00 0.00 ? 83  MET A HE3  5  
ATOM 7920  N N    . LEU A 1 84  ? 5.192   -3.018  0.927   1.00 0.00 ? 84  LEU A N    5  
ATOM 7921  C CA   . LEU A 1 84  ? 4.433   -1.811  0.622   1.00 0.00 ? 84  LEU A CA   5  
ATOM 7922  C C    . LEU A 1 84  ? 5.280   -0.563  0.848   1.00 0.00 ? 84  LEU A C    5  
ATOM 7923  O O    . LEU A 1 84  ? 5.328   0.330   0.001   1.00 0.00 ? 84  LEU A O    5  
ATOM 7924  C CB   . LEU A 1 84  ? 3.171   -1.747  1.484   1.00 0.00 ? 84  LEU A CB   5  
ATOM 7925  C CG   . LEU A 1 84  ? 1.987   -2.587  1.004   1.00 0.00 ? 84  LEU A CG   5  
ATOM 7926  C CD1  . LEU A 1 84  ? 0.933   -2.697  2.095   1.00 0.00 ? 84  LEU A CD1  5  
ATOM 7927  C CD2  . LEU A 1 84  ? 1.387   -1.990  -0.261  1.00 0.00 ? 84  LEU A CD2  5  
ATOM 7928  H H    . LEU A 1 84  ? 4.772   -3.723  1.463   1.00 0.00 ? 84  LEU A H    5  
ATOM 7929  H HA   . LEU A 1 84  ? 4.146   -1.853  -0.419  1.00 0.00 ? 84  LEU A HA   5  
ATOM 7930  H HB2  . LEU A 1 84  ? 3.431   -2.080  2.477   1.00 0.00 ? 84  LEU A HB2  5  
ATOM 7931  H HB3  . LEU A 1 84  ? 2.851   -0.715  1.525   1.00 0.00 ? 84  LEU A HB3  5  
ATOM 7932  H HG   . LEU A 1 84  ? 2.332   -3.585  0.773   1.00 0.00 ? 84  LEU A HG   5  
ATOM 7933  H HD11 . LEU A 1 84  ? 1.009   -3.662  2.573   1.00 0.00 ? 84  LEU A HD11 5  
ATOM 7934  H HD12 . LEU A 1 84  ? -0.049  -2.588  1.660   1.00 0.00 ? 84  LEU A HD12 5  
ATOM 7935  H HD13 . LEU A 1 84  ? 1.091   -1.919  2.827   1.00 0.00 ? 84  LEU A HD13 5  
ATOM 7936  H HD21 . LEU A 1 84  ? 0.745   -2.719  -0.733  1.00 0.00 ? 84  LEU A HD21 5  
ATOM 7937  H HD22 . LEU A 1 84  ? 2.181   -1.716  -0.941  1.00 0.00 ? 84  LEU A HD22 5  
ATOM 7938  H HD23 . LEU A 1 84  ? 0.810   -1.113  -0.006  1.00 0.00 ? 84  LEU A HD23 5  
ATOM 7939  N N    . LYS A 1 85  ? 5.950   -0.508  1.994   1.00 0.00 ? 85  LYS A N    5  
ATOM 7940  C CA   . LYS A 1 85  ? 6.799   0.628   2.331   1.00 0.00 ? 85  LYS A CA   5  
ATOM 7941  C C    . LYS A 1 85  ? 7.724   0.980   1.169   1.00 0.00 ? 85  LYS A C    5  
ATOM 7942  O O    . LYS A 1 85  ? 7.689   2.097   0.653   1.00 0.00 ? 85  LYS A O    5  
ATOM 7943  C CB   . LYS A 1 85  ? 7.627   0.319   3.580   1.00 0.00 ? 85  LYS A CB   5  
ATOM 7944  C CG   . LYS A 1 85  ? 8.393   1.517   4.114   1.00 0.00 ? 85  LYS A CG   5  
ATOM 7945  C CD   . LYS A 1 85  ? 8.699   1.368   5.595   1.00 0.00 ? 85  LYS A CD   5  
ATOM 7946  C CE   . LYS A 1 85  ? 7.459   1.594   6.446   1.00 0.00 ? 85  LYS A CE   5  
ATOM 7947  N NZ   . LYS A 1 85  ? 7.804   1.860   7.870   1.00 0.00 ? 85  LYS A NZ   5  
ATOM 7948  H H    . LYS A 1 85  ? 5.871   -1.251  2.629   1.00 0.00 ? 85  LYS A H    5  
ATOM 7949  H HA   . LYS A 1 85  ? 6.159   1.472   2.534   1.00 0.00 ? 85  LYS A HA   5  
ATOM 7950  H HB2  . LYS A 1 85  ? 6.966   -0.035  4.357   1.00 0.00 ? 85  LYS A HB2  5  
ATOM 7951  H HB3  . LYS A 1 85  ? 8.339   -0.459  3.342   1.00 0.00 ? 85  LYS A HB3  5  
ATOM 7952  H HG2  . LYS A 1 85  ? 9.323   1.609   3.573   1.00 0.00 ? 85  LYS A HG2  5  
ATOM 7953  H HG3  . LYS A 1 85  ? 7.799   2.407   3.966   1.00 0.00 ? 85  LYS A HG3  5  
ATOM 7954  H HD2  . LYS A 1 85  ? 9.071   0.371   5.779   1.00 0.00 ? 85  LYS A HD2  5  
ATOM 7955  H HD3  . LYS A 1 85  ? 9.452   2.092   5.872   1.00 0.00 ? 85  LYS A HD3  5  
ATOM 7956  H HE2  . LYS A 1 85  ? 6.917   2.440   6.052   1.00 0.00 ? 85  LYS A HE2  5  
ATOM 7957  H HE3  . LYS A 1 85  ? 6.837   0.713   6.393   1.00 0.00 ? 85  LYS A HE3  5  
ATOM 7958  H HZ1  . LYS A 1 85  ? 6.967   1.722   8.472   1.00 0.00 ? 85  LYS A HZ1  5  
ATOM 7959  H HZ2  . LYS A 1 85  ? 8.138   2.838   7.980   1.00 0.00 ? 85  LYS A HZ2  5  
ATOM 7960  H HZ3  . LYS A 1 85  ? 8.554   1.211   8.183   1.00 0.00 ? 85  LYS A HZ3  5  
ATOM 7961  N N    . ASP A 1 86  ? 8.547   0.020   0.763   1.00 0.00 ? 86  ASP A N    5  
ATOM 7962  C CA   . ASP A 1 86  ? 9.479   0.228   -0.339  1.00 0.00 ? 86  ASP A CA   5  
ATOM 7963  C C    . ASP A 1 86  ? 8.746   0.713   -1.586  1.00 0.00 ? 86  ASP A C    5  
ATOM 7964  O O    . ASP A 1 86  ? 9.106   1.734   -2.172  1.00 0.00 ? 86  ASP A O    5  
ATOM 7965  C CB   . ASP A 1 86  ? 10.234  -1.066  -0.648  1.00 0.00 ? 86  ASP A CB   5  
ATOM 7966  C CG   . ASP A 1 86  ? 11.250  -0.892  -1.759  1.00 0.00 ? 86  ASP A CG   5  
ATOM 7967  O OD1  . ASP A 1 86  ? 12.139  -0.026  -1.621  1.00 0.00 ? 86  ASP A OD1  5  
ATOM 7968  O OD2  . ASP A 1 86  ? 11.157  -1.624  -2.767  1.00 0.00 ? 86  ASP A OD2  5  
ATOM 7969  H H    . ASP A 1 86  ? 8.527   -0.850  1.215   1.00 0.00 ? 86  ASP A H    5  
ATOM 7970  H HA   . ASP A 1 86  ? 10.187  0.984   -0.037  1.00 0.00 ? 86  ASP A HA   5  
ATOM 7971  H HB2  . ASP A 1 86  ? 10.754  -1.393  0.242   1.00 0.00 ? 86  ASP A HB2  5  
ATOM 7972  H HB3  . ASP A 1 86  ? 9.527   -1.826  -0.946  1.00 0.00 ? 86  ASP A HB3  5  
ATOM 7973  N N    . PHE A 1 87  ? 7.717   -0.027  -1.987  1.00 0.00 ? 87  PHE A N    5  
ATOM 7974  C CA   . PHE A 1 87  ? 6.934   0.327   -3.165  1.00 0.00 ? 87  PHE A CA   5  
ATOM 7975  C C    . PHE A 1 87  ? 6.529   1.798   -3.128  1.00 0.00 ? 87  PHE A C    5  
ATOM 7976  O O    . PHE A 1 87  ? 6.800   2.552   -4.063  1.00 0.00 ? 87  PHE A O    5  
ATOM 7977  C CB   . PHE A 1 87  ? 5.688   -0.555  -3.259  1.00 0.00 ? 87  PHE A CB   5  
ATOM 7978  C CG   . PHE A 1 87  ? 5.938   -1.877  -3.927  1.00 0.00 ? 87  PHE A CG   5  
ATOM 7979  C CD1  . PHE A 1 87  ? 6.904   -2.743  -3.439  1.00 0.00 ? 87  PHE A CD1  5  
ATOM 7980  C CD2  . PHE A 1 87  ? 5.206   -2.255  -5.041  1.00 0.00 ? 87  PHE A CD2  5  
ATOM 7981  C CE1  . PHE A 1 87  ? 7.136   -3.959  -4.052  1.00 0.00 ? 87  PHE A CE1  5  
ATOM 7982  C CE2  . PHE A 1 87  ? 5.434   -3.470  -5.658  1.00 0.00 ? 87  PHE A CE2  5  
ATOM 7983  C CZ   . PHE A 1 87  ? 6.400   -4.324  -5.162  1.00 0.00 ? 87  PHE A CZ   5  
ATOM 7984  H H    . PHE A 1 87  ? 7.479   -0.830  -1.477  1.00 0.00 ? 87  PHE A H    5  
ATOM 7985  H HA   . PHE A 1 87  ? 7.551   0.158   -4.034  1.00 0.00 ? 87  PHE A HA   5  
ATOM 7986  H HB2  . PHE A 1 87  ? 5.318   -0.751  -2.264  1.00 0.00 ? 87  PHE A HB2  5  
ATOM 7987  H HB3  . PHE A 1 87  ? 4.929   -0.035  -3.824  1.00 0.00 ? 87  PHE A HB3  5  
ATOM 7988  H HD1  . PHE A 1 87  ? 7.480   -2.459  -2.571  1.00 0.00 ? 87  PHE A HD1  5  
ATOM 7989  H HD2  . PHE A 1 87  ? 4.450   -1.587  -5.430  1.00 0.00 ? 87  PHE A HD2  5  
ATOM 7990  H HE1  . PHE A 1 87  ? 7.891   -4.625  -3.662  1.00 0.00 ? 87  PHE A HE1  5  
ATOM 7991  H HE2  . PHE A 1 87  ? 4.856   -3.752  -6.526  1.00 0.00 ? 87  PHE A HE2  5  
ATOM 7992  H HZ   . PHE A 1 87  ? 6.580   -5.274  -5.643  1.00 0.00 ? 87  PHE A HZ   5  
ATOM 7993  N N    . LEU A 1 88  ? 5.878   2.198   -2.041  1.00 0.00 ? 88  LEU A N    5  
ATOM 7994  C CA   . LEU A 1 88  ? 5.434   3.578   -1.881  1.00 0.00 ? 88  LEU A CA   5  
ATOM 7995  C C    . LEU A 1 88  ? 6.608   4.545   -1.999  1.00 0.00 ? 88  LEU A C    5  
ATOM 7996  O O    . LEU A 1 88  ? 6.430   5.713   -2.344  1.00 0.00 ? 88  LEU A O    5  
ATOM 7997  C CB   . LEU A 1 88  ? 4.744   3.759   -0.528  1.00 0.00 ? 88  LEU A CB   5  
ATOM 7998  C CG   . LEU A 1 88  ? 3.489   2.916   -0.297  1.00 0.00 ? 88  LEU A CG   5  
ATOM 7999  C CD1  . LEU A 1 88  ? 3.118   2.903   1.178   1.00 0.00 ? 88  LEU A CD1  5  
ATOM 8000  C CD2  . LEU A 1 88  ? 2.332   3.440   -1.135  1.00 0.00 ? 88  LEU A CD2  5  
ATOM 8001  H H    . LEU A 1 88  ? 5.691   1.551   -1.330  1.00 0.00 ? 88  LEU A H    5  
ATOM 8002  H HA   . LEU A 1 88  ? 4.726   3.792   -2.668  1.00 0.00 ? 88  LEU A HA   5  
ATOM 8003  H HB2  . LEU A 1 88  ? 5.457   3.508   0.243   1.00 0.00 ? 88  LEU A HB2  5  
ATOM 8004  H HB3  . LEU A 1 88  ? 4.466   4.799   -0.435  1.00 0.00 ? 88  LEU A HB3  5  
ATOM 8005  H HG   . LEU A 1 88  ? 3.687   1.896   -0.599  1.00 0.00 ? 88  LEU A HG   5  
ATOM 8006  H HD11 . LEU A 1 88  ? 2.231   3.498   1.331   1.00 0.00 ? 88  LEU A HD11 5  
ATOM 8007  H HD12 . LEU A 1 88  ? 3.932   3.315   1.757   1.00 0.00 ? 88  LEU A HD12 5  
ATOM 8008  H HD13 . LEU A 1 88  ? 2.930   1.887   1.494   1.00 0.00 ? 88  LEU A HD13 5  
ATOM 8009  H HD21 . LEU A 1 88  ? 1.434   3.458   -0.536  1.00 0.00 ? 88  LEU A HD21 5  
ATOM 8010  H HD22 . LEU A 1 88  ? 2.184   2.794   -1.988  1.00 0.00 ? 88  LEU A HD22 5  
ATOM 8011  H HD23 . LEU A 1 88  ? 2.559   4.440   -1.475  1.00 0.00 ? 88  LEU A HD23 5  
ATOM 8012  N N    . SER A 1 89  ? 7.807   4.049   -1.711  1.00 0.00 ? 89  SER A N    5  
ATOM 8013  C CA   . SER A 1 89  ? 9.011   4.870   -1.784  1.00 0.00 ? 89  SER A CA   5  
ATOM 8014  C C    . SER A 1 89  ? 9.648   4.779   -3.167  1.00 0.00 ? 89  SER A C    5  
ATOM 8015  O O    . SER A 1 89  ? 10.872  4.787   -3.299  1.00 0.00 ? 89  SER A O    5  
ATOM 8016  C CB   . SER A 1 89  ? 10.016  4.433   -0.716  1.00 0.00 ? 89  SER A CB   5  
ATOM 8017  O OG   . SER A 1 89  ? 9.802   5.127   0.501   1.00 0.00 ? 89  SER A OG   5  
ATOM 8018  H H    . SER A 1 89  ? 7.884   3.110   -1.442  1.00 0.00 ? 89  SER A H    5  
ATOM 8019  H HA   . SER A 1 89  ? 8.725   5.895   -1.599  1.00 0.00 ? 89  SER A HA   5  
ATOM 8020  H HB2  . SER A 1 89  ? 9.909   3.374   -0.536  1.00 0.00 ? 89  SER A HB2  5  
ATOM 8021  H HB3  . SER A 1 89  ? 11.018  4.640   -1.063  1.00 0.00 ? 89  SER A HB3  5  
ATOM 8022  H HG   . SER A 1 89  ? 9.526   6.027   0.312   1.00 0.00 ? 89  SER A HG   5  
ATOM 8023  N N    . GLN A 1 90  ? 8.809   4.692   -4.194  1.00 0.00 ? 90  GLN A N    5  
ATOM 8024  C CA   . GLN A 1 90  ? 9.290   4.598   -5.567  1.00 0.00 ? 90  GLN A CA   5  
ATOM 8025  C C    . GLN A 1 90  ? 8.816   5.789   -6.392  1.00 0.00 ? 90  GLN A C    5  
ATOM 8026  O O    . GLN A 1 90  ? 7.735   6.337   -6.173  1.00 0.00 ? 90  GLN A O    5  
ATOM 8027  C CB   . GLN A 1 90  ? 8.812   3.295   -6.209  1.00 0.00 ? 90  GLN A CB   5  
ATOM 8028  C CG   . GLN A 1 90  ? 9.326   2.047   -5.509  1.00 0.00 ? 90  GLN A CG   5  
ATOM 8029  C CD   . GLN A 1 90  ? 10.677  1.599   -6.031  1.00 0.00 ? 90  GLN A CD   5  
ATOM 8030  O OE1  . GLN A 1 90  ? 10.992  1.781   -7.208  1.00 0.00 ? 90  GLN A OE1  5  
ATOM 8031  N NE2  . GLN A 1 90  ? 11.484  1.010   -5.157  1.00 0.00 ? 90  GLN A NE2  5  
ATOM 8032  H H    . GLN A 1 90  ? 7.845   4.690   -4.024  1.00 0.00 ? 90  GLN A H    5  
ATOM 8033  H HA   . GLN A 1 90  ? 10.369  4.601   -5.541  1.00 0.00 ? 90  GLN A HA   5  
ATOM 8034  H HB2  . GLN A 1 90  ? 7.733   3.273   -6.191  1.00 0.00 ? 90  GLN A HB2  5  
ATOM 8035  H HB3  . GLN A 1 90  ? 9.148   3.269   -7.235  1.00 0.00 ? 90  GLN A HB3  5  
ATOM 8036  H HG2  . GLN A 1 90  ? 9.417   2.254   -4.453  1.00 0.00 ? 90  GLN A HG2  5  
ATOM 8037  H HG3  . GLN A 1 90  ? 8.615   1.248   -5.659  1.00 0.00 ? 90  GLN A HG3  5  
ATOM 8038  H HE21 . GLN A 1 90  ? 11.166  0.898   -4.236  1.00 0.00 ? 90  GLN A HE21 5  
ATOM 8039  H HE22 . GLN A 1 90  ? 12.363  0.710   -5.467  1.00 0.00 ? 90  GLN A HE22 5  
ATOM 8040  N N    . PRO A 1 91  ? 9.642   6.202   -7.365  1.00 0.00 ? 91  PRO A N    5  
ATOM 8041  C CA   . PRO A 1 91  ? 9.328   7.333   -8.243  1.00 0.00 ? 91  PRO A CA   5  
ATOM 8042  C C    . PRO A 1 91  ? 8.189   7.019   -9.208  1.00 0.00 ? 91  PRO A C    5  
ATOM 8043  O O    . PRO A 1 91  ? 7.597   7.922   -9.799  1.00 0.00 ? 91  PRO A O    5  
ATOM 8044  C CB   . PRO A 1 91  ? 10.632  7.559   -9.011  1.00 0.00 ? 91  PRO A CB   5  
ATOM 8045  C CG   . PRO A 1 91  ? 11.317  6.236   -8.992  1.00 0.00 ? 91  PRO A CG   5  
ATOM 8046  C CD   . PRO A 1 91  ? 10.946  5.596   -7.683  1.00 0.00 ? 91  PRO A CD   5  
ATOM 8047  H HA   . PRO A 1 91  ? 9.083   8.220   -7.677  1.00 0.00 ? 91  PRO A HA   5  
ATOM 8048  H HB2  . PRO A 1 91  ? 10.409  7.875   -10.021 1.00 0.00 ? 91  PRO A HB2  5  
ATOM 8049  H HB3  . PRO A 1 91  ? 11.221  8.315   -8.513  1.00 0.00 ? 91  PRO A HB3  5  
ATOM 8050  H HG2  . PRO A 1 91  ? 10.971  5.632   -9.817  1.00 0.00 ? 91  PRO A HG2  5  
ATOM 8051  H HG3  . PRO A 1 91  ? 12.386  6.376   -9.051  1.00 0.00 ? 91  PRO A HG3  5  
ATOM 8052  H HD2  . PRO A 1 91  ? 10.856  4.526   -7.798  1.00 0.00 ? 91  PRO A HD2  5  
ATOM 8053  H HD3  . PRO A 1 91  ? 11.677  5.836   -6.925  1.00 0.00 ? 91  PRO A HD3  5  
ATOM 8054  N N    . SER A 1 92  ? 7.888   5.734   -9.363  1.00 0.00 ? 92  SER A N    5  
ATOM 8055  C CA   . SER A 1 92  ? 6.822   5.301   -10.259 1.00 0.00 ? 92  SER A CA   5  
ATOM 8056  C C    . SER A 1 92  ? 6.103   4.079   -9.696  1.00 0.00 ? 92  SER A C    5  
ATOM 8057  O O    . SER A 1 92  ? 6.732   3.079   -9.348  1.00 0.00 ? 92  SER A O    5  
ATOM 8058  C CB   . SER A 1 92  ? 7.390   4.980   -11.643 1.00 0.00 ? 92  SER A CB   5  
ATOM 8059  O OG   . SER A 1 92  ? 8.376   3.965   -11.567 1.00 0.00 ? 92  SER A OG   5  
ATOM 8060  H H    . SER A 1 92  ? 8.397   5.061   -8.863  1.00 0.00 ? 92  SER A H    5  
ATOM 8061  H HA   . SER A 1 92  ? 6.115   6.111   -10.348 1.00 0.00 ? 92  SER A HA   5  
ATOM 8062  H HB2  . SER A 1 92  ? 6.592   4.642   -12.287 1.00 0.00 ? 92  SER A HB2  5  
ATOM 8063  H HB3  . SER A 1 92  ? 7.837   5.870   -12.060 1.00 0.00 ? 92  SER A HB3  5  
ATOM 8064  H HG   . SER A 1 92  ? 9.172   4.322   -11.166 1.00 0.00 ? 92  SER A HG   5  
ATOM 8065  N N    . LEU A 1 93  ? 4.780   4.167   -9.610  1.00 0.00 ? 93  LEU A N    5  
ATOM 8066  C CA   . LEU A 1 93  ? 3.972   3.069   -9.090  1.00 0.00 ? 93  LEU A CA   5  
ATOM 8067  C C    . LEU A 1 93  ? 2.828   2.736   -10.043 1.00 0.00 ? 93  LEU A C    5  
ATOM 8068  O O    . LEU A 1 93  ? 2.280   3.617   -10.702 1.00 0.00 ? 93  LEU A O    5  
ATOM 8069  C CB   . LEU A 1 93  ? 3.415   3.428   -7.712  1.00 0.00 ? 93  LEU A CB   5  
ATOM 8070  C CG   . LEU A 1 93  ? 4.313   3.100   -6.518  1.00 0.00 ? 93  LEU A CG   5  
ATOM 8071  C CD1  . LEU A 1 93  ? 3.691   3.608   -5.227  1.00 0.00 ? 93  LEU A CD1  5  
ATOM 8072  C CD2  . LEU A 1 93  ? 4.565   1.601   -6.437  1.00 0.00 ? 93  LEU A CD2  5  
ATOM 8073  H H    . LEU A 1 93  ? 4.335   4.989   -9.903  1.00 0.00 ? 93  LEU A H    5  
ATOM 8074  H HA   . LEU A 1 93  ? 4.611   2.203   -8.997  1.00 0.00 ? 93  LEU A HA   5  
ATOM 8075  H HB2  . LEU A 1 93  ? 3.224   4.490   -7.699  1.00 0.00 ? 93  LEU A HB2  5  
ATOM 8076  H HB3  . LEU A 1 93  ? 2.484   2.895   -7.583  1.00 0.00 ? 93  LEU A HB3  5  
ATOM 8077  H HG   . LEU A 1 93  ? 5.266   3.594   -6.646  1.00 0.00 ? 93  LEU A HG   5  
ATOM 8078  H HD11 . LEU A 1 93  ? 4.059   3.025   -4.396  1.00 0.00 ? 93  LEU A HD11 5  
ATOM 8079  H HD12 . LEU A 1 93  ? 2.616   3.514   -5.284  1.00 0.00 ? 93  LEU A HD12 5  
ATOM 8080  H HD13 . LEU A 1 93  ? 3.955   4.645   -5.084  1.00 0.00 ? 93  LEU A HD13 5  
ATOM 8081  H HD21 . LEU A 1 93  ? 3.666   1.070   -6.712  1.00 0.00 ? 93  LEU A HD21 5  
ATOM 8082  H HD22 . LEU A 1 93  ? 4.845   1.337   -5.428  1.00 0.00 ? 93  LEU A HD22 5  
ATOM 8083  H HD23 . LEU A 1 93  ? 5.363   1.334   -7.114  1.00 0.00 ? 93  LEU A HD23 5  
ATOM 8084  N N    . GLY A 1 94  ? 2.472   1.456   -10.107 1.00 0.00 ? 94  GLY A N    5  
ATOM 8085  C CA   . GLY A 1 94  ? 1.394   1.029   -10.980 1.00 0.00 ? 94  GLY A CA   5  
ATOM 8086  C C    . GLY A 1 94  ? 0.303   0.287   -10.233 1.00 0.00 ? 94  GLY A C    5  
ATOM 8087  O O    . GLY A 1 94  ? 0.456   -0.889  -9.903  1.00 0.00 ? 94  GLY A O    5  
ATOM 8088  H H    . GLY A 1 94  ? 2.946   0.797   -9.558  1.00 0.00 ? 94  GLY A H    5  
ATOM 8089  H HA2  . GLY A 1 94  ? 0.964   1.899   -11.454 1.00 0.00 ? 94  GLY A HA2  5  
ATOM 8090  H HA3  . GLY A 1 94  ? 1.799   0.379   -11.741 1.00 0.00 ? 94  GLY A HA3  5  
ATOM 8091  N N    . LEU A 1 95  ? -0.801  0.976   -9.965  1.00 0.00 ? 95  LEU A N    5  
ATOM 8092  C CA   . LEU A 1 95  ? -1.922  0.375   -9.250  1.00 0.00 ? 95  LEU A CA   5  
ATOM 8093  C C    . LEU A 1 95  ? -3.007  -0.078  -10.222 1.00 0.00 ? 95  LEU A C    5  
ATOM 8094  O O    . LEU A 1 95  ? -3.203  0.527   -11.277 1.00 0.00 ? 95  LEU A O    5  
ATOM 8095  C CB   . LEU A 1 95  ? -2.504  1.371   -8.246  1.00 0.00 ? 95  LEU A CB   5  
ATOM 8096  C CG   . LEU A 1 95  ? -1.507  2.008   -7.277  1.00 0.00 ? 95  LEU A CG   5  
ATOM 8097  C CD1  . LEU A 1 95  ? -2.165  3.139   -6.502  1.00 0.00 ? 95  LEU A CD1  5  
ATOM 8098  C CD2  . LEU A 1 95  ? -0.946  0.962   -6.325  1.00 0.00 ? 95  LEU A CD2  5  
ATOM 8099  H H    . LEU A 1 95  ? -0.865  1.909   -10.253 1.00 0.00 ? 95  LEU A H    5  
ATOM 8100  H HA   . LEU A 1 95  ? -1.551  -0.487  -8.716  1.00 0.00 ? 95  LEU A HA   5  
ATOM 8101  H HB2  . LEU A 1 95  ? -2.977  2.165   -8.803  1.00 0.00 ? 95  LEU A HB2  5  
ATOM 8102  H HB3  . LEU A 1 95  ? -3.250  0.851   -7.661  1.00 0.00 ? 95  LEU A HB3  5  
ATOM 8103  H HG   . LEU A 1 95  ? -0.684  2.424   -7.841  1.00 0.00 ? 95  LEU A HG   5  
ATOM 8104  H HD11 . LEU A 1 95  ? -2.896  3.627   -7.128  1.00 0.00 ? 95  LEU A HD11 5  
ATOM 8105  H HD12 . LEU A 1 95  ? -1.413  3.854   -6.203  1.00 0.00 ? 95  LEU A HD12 5  
ATOM 8106  H HD13 . LEU A 1 95  ? -2.650  2.739   -5.624  1.00 0.00 ? 95  LEU A HD13 5  
ATOM 8107  H HD21 . LEU A 1 95  ? -0.413  1.453   -5.525  1.00 0.00 ? 95  LEU A HD21 5  
ATOM 8108  H HD22 . LEU A 1 95  ? -0.271  0.312   -6.862  1.00 0.00 ? 95  LEU A HD22 5  
ATOM 8109  H HD23 . LEU A 1 95  ? -1.756  0.379   -5.913  1.00 0.00 ? 95  LEU A HD23 5  
ATOM 8110  N N    . LEU A 1 96  ? -3.711  -1.144  -9.859  1.00 0.00 ? 96  LEU A N    5  
ATOM 8111  C CA   . LEU A 1 96  ? -4.779  -1.678  -10.698 1.00 0.00 ? 96  LEU A CA   5  
ATOM 8112  C C    . LEU A 1 96  ? -6.099  -1.723  -9.935  1.00 0.00 ? 96  LEU A C    5  
ATOM 8113  O O    . LEU A 1 96  ? -6.337  -2.631  -9.138  1.00 0.00 ? 96  LEU A O    5  
ATOM 8114  C CB   . LEU A 1 96  ? -4.414  -3.078  -11.193 1.00 0.00 ? 96  LEU A CB   5  
ATOM 8115  C CG   . LEU A 1 96  ? -5.458  -3.774  -12.068 1.00 0.00 ? 96  LEU A CG   5  
ATOM 8116  C CD1  . LEU A 1 96  ? -5.613  -3.046  -13.394 1.00 0.00 ? 96  LEU A CD1  5  
ATOM 8117  C CD2  . LEU A 1 96  ? -5.077  -5.229  -12.297 1.00 0.00 ? 96  LEU A CD2  5  
ATOM 8118  H H    . LEU A 1 96  ? -3.509  -1.584  -9.008  1.00 0.00 ? 96  LEU A H    5  
ATOM 8119  H HA   . LEU A 1 96  ? -4.891  -1.022  -11.548 1.00 0.00 ? 96  LEU A HA   5  
ATOM 8120  H HB2  . LEU A 1 96  ? -3.503  -3.000  -11.765 1.00 0.00 ? 96  LEU A HB2  5  
ATOM 8121  H HB3  . LEU A 1 96  ? -4.241  -3.700  -10.326 1.00 0.00 ? 96  LEU A HB3  5  
ATOM 8122  H HG   . LEU A 1 96  ? -6.414  -3.753  -11.562 1.00 0.00 ? 96  LEU A HG   5  
ATOM 8123  H HD11 . LEU A 1 96  ? -4.914  -2.225  -13.438 1.00 0.00 ? 96  LEU A HD11 5  
ATOM 8124  H HD12 . LEU A 1 96  ? -6.621  -2.667  -13.481 1.00 0.00 ? 96  LEU A HD12 5  
ATOM 8125  H HD13 . LEU A 1 96  ? -5.416  -3.731  -14.206 1.00 0.00 ? 96  LEU A HD13 5  
ATOM 8126  H HD21 . LEU A 1 96  ? -5.960  -5.847  -12.226 1.00 0.00 ? 96  LEU A HD21 5  
ATOM 8127  H HD22 . LEU A 1 96  ? -4.362  -5.536  -11.548 1.00 0.00 ? 96  LEU A HD22 5  
ATOM 8128  H HD23 . LEU A 1 96  ? -4.640  -5.336  -13.279 1.00 0.00 ? 96  LEU A HD23 5  
ATOM 8129  N N    . VAL A 1 97  ? -6.956  -0.739  -10.187 1.00 0.00 ? 97  VAL A N    5  
ATOM 8130  C CA   . VAL A 1 97  ? -8.255  -0.668  -9.526  1.00 0.00 ? 97  VAL A CA   5  
ATOM 8131  C C    . VAL A 1 97  ? -9.390  -0.852  -10.526 1.00 0.00 ? 97  VAL A C    5  
ATOM 8132  O O    . VAL A 1 97  ? -9.196  -0.715  -11.734 1.00 0.00 ? 97  VAL A O    5  
ATOM 8133  C CB   . VAL A 1 97  ? -8.440  0.676   -8.797  1.00 0.00 ? 97  VAL A CB   5  
ATOM 8134  C CG1  . VAL A 1 97  ? -7.367  0.860   -7.735  1.00 0.00 ? 97  VAL A CG1  5  
ATOM 8135  C CG2  . VAL A 1 97  ? -8.423  1.828   -9.790  1.00 0.00 ? 97  VAL A CG2  5  
ATOM 8136  H H    . VAL A 1 97  ? -6.710  -0.044  -10.832 1.00 0.00 ? 97  VAL A H    5  
ATOM 8137  H HA   . VAL A 1 97  ? -8.300  -1.461  -8.794  1.00 0.00 ? 97  VAL A HA   5  
ATOM 8138  H HB   . VAL A 1 97  ? -9.402  0.665   -8.306  1.00 0.00 ? 97  VAL A HB   5  
ATOM 8139  H HG11 . VAL A 1 97  ? -6.444  1.165   -8.206  1.00 0.00 ? 97  VAL A HG11 5  
ATOM 8140  H HG12 . VAL A 1 97  ? -7.681  1.618   -7.032  1.00 0.00 ? 97  VAL A HG12 5  
ATOM 8141  H HG13 . VAL A 1 97  ? -7.212  -0.073  -7.214  1.00 0.00 ? 97  VAL A HG13 5  
ATOM 8142  H HG21 . VAL A 1 97  ? -8.238  1.444   -10.782 1.00 0.00 ? 97  VAL A HG21 5  
ATOM 8143  H HG22 . VAL A 1 97  ? -9.378  2.333   -9.772  1.00 0.00 ? 97  VAL A HG22 5  
ATOM 8144  H HG23 . VAL A 1 97  ? -7.643  2.524   -9.521  1.00 0.00 ? 97  VAL A HG23 5  
ATOM 8145  N N    . ARG A 1 98  ? -10.577 -1.163  -10.015 1.00 0.00 ? 98  ARG A N    5  
ATOM 8146  C CA   . ARG A 1 98  ? -11.745 -1.367  -10.863 1.00 0.00 ? 98  ARG A CA   5  
ATOM 8147  C C    . ARG A 1 98  ? -12.669 -0.153  -10.817 1.00 0.00 ? 98  ARG A C    5  
ATOM 8148  O O    . ARG A 1 98  ? -12.731 0.556   -9.813  1.00 0.00 ? 98  ARG A O    5  
ATOM 8149  C CB   . ARG A 1 98  ? -12.508 -2.619  -10.425 1.00 0.00 ? 98  ARG A CB   5  
ATOM 8150  C CG   . ARG A 1 98  ? -12.032 -3.892  -11.106 1.00 0.00 ? 98  ARG A CG   5  
ATOM 8151  C CD   . ARG A 1 98  ? -12.779 -5.112  -10.590 1.00 0.00 ? 98  ARG A CD   5  
ATOM 8152  N NE   . ARG A 1 98  ? -12.095 -6.356  -10.931 1.00 0.00 ? 98  ARG A NE   5  
ATOM 8153  C CZ   . ARG A 1 98  ? -12.228 -6.971  -12.101 1.00 0.00 ? 98  ARG A CZ   5  
ATOM 8154  N NH1  . ARG A 1 98  ? -13.013 -6.459  -13.038 1.00 0.00 ? 98  ARG A NH1  5  
ATOM 8155  N NH2  . ARG A 1 98  ? -11.572 -8.101  -12.336 1.00 0.00 ? 98  ARG A NH2  5  
ATOM 8156  H H    . ARG A 1 98  ? -10.669 -1.259  -9.044  1.00 0.00 ? 98  ARG A H    5  
ATOM 8157  H HA   . ARG A 1 98  ? -11.399 -1.504  -11.877 1.00 0.00 ? 98  ARG A HA   5  
ATOM 8158  H HB2  . ARG A 1 98  ? -12.391 -2.742  -9.358  1.00 0.00 ? 98  ARG A HB2  5  
ATOM 8159  H HB3  . ARG A 1 98  ? -13.555 -2.485  -10.651 1.00 0.00 ? 98  ARG A HB3  5  
ATOM 8160  H HG2  . ARG A 1 98  ? -12.199 -3.804  -12.169 1.00 0.00 ? 98  ARG A HG2  5  
ATOM 8161  H HG3  . ARG A 1 98  ? -10.977 -4.018  -10.914 1.00 0.00 ? 98  ARG A HG3  5  
ATOM 8162  H HD2  . ARG A 1 98  ? -12.862 -5.040  -9.516  1.00 0.00 ? 98  ARG A HD2  5  
ATOM 8163  H HD3  . ARG A 1 98  ? -13.767 -5.123  -11.027 1.00 0.00 ? 98  ARG A HD3  5  
ATOM 8164  H HE   . ARG A 1 98  ? -11.510 -6.753  -10.253 1.00 0.00 ? 98  ARG A HE   5  
ATOM 8165  H HH11 . ARG A 1 98  ? -13.508 -5.607  -12.864 1.00 0.00 ? 98  ARG A HH11 5  
ATOM 8166  H HH12 . ARG A 1 98  ? -13.110 -6.923  -13.918 1.00 0.00 ? 98  ARG A HH12 5  
ATOM 8167  H HH21 . ARG A 1 98  ? -10.979 -8.490  -11.632 1.00 0.00 ? 98  ARG A HH21 5  
ATOM 8168  H HH22 . ARG A 1 98  ? -11.672 -8.563  -13.216 1.00 0.00 ? 98  ARG A HH22 5  
ATOM 8169  N N    . THR A 1 99  ? -13.385 0.080   -11.913 1.00 0.00 ? 99  THR A N    5  
ATOM 8170  C CA   . THR A 1 99  ? -14.304 1.208   -11.999 1.00 0.00 ? 99  THR A CA   5  
ATOM 8171  C C    . THR A 1 99  ? -15.519 0.863   -12.852 1.00 0.00 ? 99  THR A C    5  
ATOM 8172  O O    . THR A 1 99  ? -15.471 -0.048  -13.679 1.00 0.00 ? 99  THR A O    5  
ATOM 8173  C CB   . THR A 1 99  ? -13.613 2.452   -12.589 1.00 0.00 ? 99  THR A CB   5  
ATOM 8174  O OG1  . THR A 1 99  ? -14.430 3.610   -12.384 1.00 0.00 ? 99  THR A OG1  5  
ATOM 8175  C CG2  . THR A 1 99  ? -13.347 2.269   -14.076 1.00 0.00 ? 99  THR A CG2  5  
ATOM 8176  H H    . THR A 1 99  ? -13.292 -0.521  -12.681 1.00 0.00 ? 99  THR A H    5  
ATOM 8177  H HA   . THR A 1 99  ? -14.634 1.446   -10.998 1.00 0.00 ? 99  THR A HA   5  
ATOM 8178  H HB   . THR A 1 99  ? -12.668 2.593   -12.084 1.00 0.00 ? 99  THR A HB   5  
ATOM 8179  H HG1  . THR A 1 99  ? -14.073 4.346   -12.886 1.00 0.00 ? 99  THR A HG1  5  
ATOM 8180  H HG21 . THR A 1 99  ? -13.714 3.129   -14.616 1.00 0.00 ? 99  THR A HG21 5  
ATOM 8181  H HG22 . THR A 1 99  ? -13.853 1.381   -14.425 1.00 0.00 ? 99  THR A HG22 5  
ATOM 8182  H HG23 . THR A 1 99  ? -12.285 2.167   -14.241 1.00 0.00 ? 99  THR A HG23 5  
ATOM 8183  N N    . TYR A 1 100 ? -16.608 1.597   -12.647 1.00 0.00 ? 100 TYR A N    5  
ATOM 8184  C CA   . TYR A 1 100 ? -17.837 1.367   -13.396 1.00 0.00 ? 100 TYR A CA   5  
ATOM 8185  C C    . TYR A 1 100 ? -17.797 2.085   -14.742 1.00 0.00 ? 100 TYR A C    5  
ATOM 8186  O O    . TYR A 1 100 ? -17.447 3.262   -14.836 1.00 0.00 ? 100 TYR A O    5  
ATOM 8187  C CB   . TYR A 1 100 ? -19.047 1.840   -12.589 1.00 0.00 ? 100 TYR A CB   5  
ATOM 8188  C CG   . TYR A 1 100 ? -18.995 1.444   -11.131 1.00 0.00 ? 100 TYR A CG   5  
ATOM 8189  C CD1  . TYR A 1 100 ? -18.329 2.231   -10.200 1.00 0.00 ? 100 TYR A CD1  5  
ATOM 8190  C CD2  . TYR A 1 100 ? -19.613 0.282   -10.685 1.00 0.00 ? 100 TYR A CD2  5  
ATOM 8191  C CE1  . TYR A 1 100 ? -18.279 1.872   -8.867  1.00 0.00 ? 100 TYR A CE1  5  
ATOM 8192  C CE2  . TYR A 1 100 ? -19.568 -0.084  -9.353  1.00 0.00 ? 100 TYR A CE2  5  
ATOM 8193  C CZ   . TYR A 1 100 ? -18.900 0.714   -8.448  1.00 0.00 ? 100 TYR A CZ   5  
ATOM 8194  O OH   . TYR A 1 100 ? -18.853 0.353   -7.121  1.00 0.00 ? 100 TYR A OH   5  
ATOM 8195  H H    . TYR A 1 100 ? -16.584 2.309   -11.974 1.00 0.00 ? 100 TYR A H    5  
ATOM 8196  H HA   . TYR A 1 100 ? -17.926 0.305   -13.570 1.00 0.00 ? 100 TYR A HA   5  
ATOM 8197  H HB2  . TYR A 1 100 ? -19.105 2.917   -12.637 1.00 0.00 ? 100 TYR A HB2  5  
ATOM 8198  H HB3  . TYR A 1 100 ? -19.944 1.417   -13.017 1.00 0.00 ? 100 TYR A HB3  5  
ATOM 8199  H HD1  . TYR A 1 100 ? -17.844 3.138   -10.531 1.00 0.00 ? 100 TYR A HD1  5  
ATOM 8200  H HD2  . TYR A 1 100 ? -20.135 -0.341  -11.396 1.00 0.00 ? 100 TYR A HD2  5  
ATOM 8201  H HE1  . TYR A 1 100 ? -17.756 2.497   -8.158  1.00 0.00 ? 100 TYR A HE1  5  
ATOM 8202  H HE2  . TYR A 1 100 ? -20.054 -0.991  -9.025  1.00 0.00 ? 100 TYR A HE2  5  
ATOM 8203  H HH   . TYR A 1 100 ? -18.174 0.865   -6.675  1.00 0.00 ? 100 TYR A HH   5  
ATOM 8204  N N    . PRO A 1 101 ? -18.163 1.360   -15.809 1.00 0.00 ? 101 PRO A N    5  
ATOM 8205  C CA   . PRO A 1 101 ? -18.179 1.907   -17.169 1.00 0.00 ? 101 PRO A CA   5  
ATOM 8206  C C    . PRO A 1 101 ? -19.285 2.938   -17.367 1.00 0.00 ? 101 PRO A C    5  
ATOM 8207  O O    . PRO A 1 101 ? -20.458 2.657   -17.123 1.00 0.00 ? 101 PRO A O    5  
ATOM 8208  C CB   . PRO A 1 101 ? -18.434 0.676   -18.043 1.00 0.00 ? 101 PRO A CB   5  
ATOM 8209  C CG   . PRO A 1 101 ? -19.142 -0.283  -17.149 1.00 0.00 ? 101 PRO A CG   5  
ATOM 8210  C CD   . PRO A 1 101 ? -18.591 -0.048  -15.770 1.00 0.00 ? 101 PRO A CD   5  
ATOM 8211  H HA   . PRO A 1 101 ? -17.228 2.346   -17.432 1.00 0.00 ? 101 PRO A HA   5  
ATOM 8212  H HB2  . PRO A 1 101 ? -19.045 0.953   -18.890 1.00 0.00 ? 101 PRO A HB2  5  
ATOM 8213  H HB3  . PRO A 1 101 ? -17.493 0.273   -18.387 1.00 0.00 ? 101 PRO A HB3  5  
ATOM 8214  H HG2  . PRO A 1 101 ? -20.203 -0.087  -17.168 1.00 0.00 ? 101 PRO A HG2  5  
ATOM 8215  H HG3  . PRO A 1 101 ? -18.941 -1.296  -17.465 1.00 0.00 ? 101 PRO A HG3  5  
ATOM 8216  H HD2  . PRO A 1 101 ? -19.360 -0.197  -15.026 1.00 0.00 ? 101 PRO A HD2  5  
ATOM 8217  H HD3  . PRO A 1 101 ? -17.751 -0.700  -15.583 1.00 0.00 ? 101 PRO A HD3  5  
ATOM 8218  N N    . GLU A 1 102 ? -18.903 4.131   -17.811 1.00 0.00 ? 102 GLU A N    5  
ATOM 8219  C CA   . GLU A 1 102 ? -19.864 5.204   -18.041 1.00 0.00 ? 102 GLU A CA   5  
ATOM 8220  C C    . GLU A 1 102 ? -19.404 6.112   -19.178 1.00 0.00 ? 102 GLU A C    5  
ATOM 8221  O O    . GLU A 1 102 ? -18.301 5.957   -19.704 1.00 0.00 ? 102 GLU A O    5  
ATOM 8222  C CB   . GLU A 1 102 ? -20.059 6.025   -16.765 1.00 0.00 ? 102 GLU A CB   5  
ATOM 8223  C CG   . GLU A 1 102 ? -21.159 5.493   -15.861 1.00 0.00 ? 102 GLU A CG   5  
ATOM 8224  C CD   . GLU A 1 102 ? -22.545 5.721   -16.432 1.00 0.00 ? 102 GLU A CD   5  
ATOM 8225  O OE1  . GLU A 1 102 ? -23.098 6.822   -16.223 1.00 0.00 ? 102 GLU A OE1  5  
ATOM 8226  O OE2  . GLU A 1 102 ? -23.076 4.801   -17.087 1.00 0.00 ? 102 GLU A OE2  5  
ATOM 8227  H H    . GLU A 1 102 ? -17.953 4.294   -17.988 1.00 0.00 ? 102 GLU A H    5  
ATOM 8228  H HA   . GLU A 1 102 ? -20.805 4.753   -18.315 1.00 0.00 ? 102 GLU A HA   5  
ATOM 8229  H HB2  . GLU A 1 102 ? -19.134 6.029   -16.208 1.00 0.00 ? 102 GLU A HB2  5  
ATOM 8230  H HB3  . GLU A 1 102 ? -20.308 7.040   -17.039 1.00 0.00 ? 102 GLU A HB3  5  
ATOM 8231  H HG2  . GLU A 1 102 ? -21.013 4.432   -15.724 1.00 0.00 ? 102 GLU A HG2  5  
ATOM 8232  H HG3  . GLU A 1 102 ? -21.093 5.990   -14.905 1.00 0.00 ? 102 GLU A HG3  5  
ATOM 8233  N N    . LEU A 1 103 ? -20.257 7.059   -19.552 1.00 0.00 ? 103 LEU A N    5  
ATOM 8234  C CA   . LEU A 1 103 ? -19.939 7.993   -20.627 1.00 0.00 ? 103 LEU A CA   5  
ATOM 8235  C C    . LEU A 1 103 ? -18.948 9.051   -20.155 1.00 0.00 ? 103 LEU A C    5  
ATOM 8236  O O    . LEU A 1 103 ? -18.633 9.990   -20.885 1.00 0.00 ? 103 LEU A O    5  
ATOM 8237  C CB   . LEU A 1 103 ? -21.215 8.665   -21.138 1.00 0.00 ? 103 LEU A CB   5  
ATOM 8238  C CG   . LEU A 1 103 ? -21.993 9.494   -20.116 1.00 0.00 ? 103 LEU A CG   5  
ATOM 8239  C CD1  . LEU A 1 103 ? -21.508 10.935  -20.116 1.00 0.00 ? 103 LEU A CD1  5  
ATOM 8240  C CD2  . LEU A 1 103 ? -23.486 9.431   -20.403 1.00 0.00 ? 103 LEU A CD2  5  
ATOM 8241  H H    . LEU A 1 103 ? -21.120 7.133   -19.095 1.00 0.00 ? 103 LEU A H    5  
ATOM 8242  H HA   . LEU A 1 103 ? -19.491 7.430   -21.433 1.00 0.00 ? 103 LEU A HA   5  
ATOM 8243  H HB2  . LEU A 1 103 ? -20.941 9.318   -21.953 1.00 0.00 ? 103 LEU A HB2  5  
ATOM 8244  H HB3  . LEU A 1 103 ? -21.872 7.889   -21.506 1.00 0.00 ? 103 LEU A HB3  5  
ATOM 8245  H HG   . LEU A 1 103 ? -21.824 9.086   -19.128 1.00 0.00 ? 103 LEU A HG   5  
ATOM 8246  H HD11 . LEU A 1 103 ? -20.571 10.999  -20.648 1.00 0.00 ? 103 LEU A HD11 5  
ATOM 8247  H HD12 . LEU A 1 103 ? -21.369 11.268  -19.099 1.00 0.00 ? 103 LEU A HD12 5  
ATOM 8248  H HD13 . LEU A 1 103 ? -22.242 11.561  -20.603 1.00 0.00 ? 103 LEU A HD13 5  
ATOM 8249  H HD21 . LEU A 1 103 ? -23.885 10.433  -20.454 1.00 0.00 ? 103 LEU A HD21 5  
ATOM 8250  H HD22 . LEU A 1 103 ? -23.982 8.886   -19.613 1.00 0.00 ? 103 LEU A HD22 5  
ATOM 8251  H HD23 . LEU A 1 103 ? -23.650 8.929   -21.345 1.00 0.00 ? 103 LEU A HD23 5  
ATOM 8252  N N    . GLU A 1 104 ? -18.458 8.890   -18.929 1.00 0.00 ? 104 GLU A N    5  
ATOM 8253  C CA   . GLU A 1 104 ? -17.501 9.832   -18.360 1.00 0.00 ? 104 GLU A CA   5  
ATOM 8254  C C    . GLU A 1 104 ? -16.087 9.260   -18.400 1.00 0.00 ? 104 GLU A C    5  
ATOM 8255  O O    . GLU A 1 104 ? -15.316 9.419   -17.454 1.00 0.00 ? 104 GLU A O    5  
ATOM 8256  C CB   . GLU A 1 104 ? -17.884 10.175  -16.919 1.00 0.00 ? 104 GLU A CB   5  
ATOM 8257  C CG   . GLU A 1 104 ? -17.736 9.009   -15.956 1.00 0.00 ? 104 GLU A CG   5  
ATOM 8258  C CD   . GLU A 1 104 ? -18.546 9.194   -14.687 1.00 0.00 ? 104 GLU A CD   5  
ATOM 8259  O OE1  . GLU A 1 104 ? -18.559 10.321  -14.151 1.00 0.00 ? 104 GLU A OE1  5  
ATOM 8260  O OE2  . GLU A 1 104 ? -19.166 8.210   -14.232 1.00 0.00 ? 104 GLU A OE2  5  
ATOM 8261  H H    . GLU A 1 104 ? -18.748 8.122   -18.395 1.00 0.00 ? 104 GLU A H    5  
ATOM 8262  H HA   . GLU A 1 104 ? -17.529 10.733  -18.954 1.00 0.00 ? 104 GLU A HA   5  
ATOM 8263  H HB2  . GLU A 1 104 ? -17.255 10.982  -16.574 1.00 0.00 ? 104 GLU A HB2  5  
ATOM 8264  H HB3  . GLU A 1 104 ? -18.913 10.501  -16.901 1.00 0.00 ? 104 GLU A HB3  5  
ATOM 8265  H HG2  . GLU A 1 104 ? -18.069 8.107   -16.449 1.00 0.00 ? 104 GLU A HG2  5  
ATOM 8266  H HG3  . GLU A 1 104 ? -16.694 8.908   -15.689 1.00 0.00 ? 104 GLU A HG3  5  
ATOM 8267  N N    . GLU A 1 105 ? -15.754 8.595   -19.502 1.00 0.00 ? 105 GLU A N    5  
ATOM 8268  C CA   . GLU A 1 105 ? -14.433 7.999   -19.664 1.00 0.00 ? 105 GLU A CA   5  
ATOM 8269  C C    . GLU A 1 105 ? -13.472 8.979   -20.329 1.00 0.00 ? 105 GLU A C    5  
ATOM 8270  O O    . GLU A 1 105 ? -13.612 9.300   -21.509 1.00 0.00 ? 105 GLU A O    5  
ATOM 8271  C CB   . GLU A 1 105 ? -14.527 6.717   -20.494 1.00 0.00 ? 105 GLU A CB   5  
ATOM 8272  C CG   . GLU A 1 105 ? -13.465 5.687   -20.145 1.00 0.00 ? 105 GLU A CG   5  
ATOM 8273  C CD   . GLU A 1 105 ? -13.086 4.816   -21.328 1.00 0.00 ? 105 GLU A CD   5  
ATOM 8274  O OE1  . GLU A 1 105 ? -13.262 5.270   -22.478 1.00 0.00 ? 105 GLU A OE1  5  
ATOM 8275  O OE2  . GLU A 1 105 ? -12.615 3.682   -21.103 1.00 0.00 ? 105 GLU A OE2  5  
ATOM 8276  H H    . GLU A 1 105 ? -16.413 8.502   -20.222 1.00 0.00 ? 105 GLU A H    5  
ATOM 8277  H HA   . GLU A 1 105 ? -14.057 7.754   -18.683 1.00 0.00 ? 105 GLU A HA   5  
ATOM 8278  H HB2  . GLU A 1 105 ? -15.498 6.270   -20.337 1.00 0.00 ? 105 GLU A HB2  5  
ATOM 8279  H HB3  . GLU A 1 105 ? -14.422 6.971   -21.539 1.00 0.00 ? 105 GLU A HB3  5  
ATOM 8280  H HG2  . GLU A 1 105 ? -12.582 6.203   -19.800 1.00 0.00 ? 105 GLU A HG2  5  
ATOM 8281  H HG3  . GLU A 1 105 ? -13.842 5.053   -19.356 1.00 0.00 ? 105 GLU A HG3  5  
ATOM 8282  N N    . GLY A 1 106 ? -12.494 9.453   -19.563 1.00 0.00 ? 106 GLY A N    5  
ATOM 8283  C CA   . GLY A 1 106 ? -11.524 10.392  -20.093 1.00 0.00 ? 106 GLY A CA   5  
ATOM 8284  C C    . GLY A 1 106 ? -11.054 11.390  -19.054 1.00 0.00 ? 106 GLY A C    5  
ATOM 8285  O O    . GLY A 1 106 ? -11.799 12.289  -18.664 1.00 0.00 ? 106 GLY A O    5  
ATOM 8286  H H    . GLY A 1 106 ? -12.431 9.161   -18.629 1.00 0.00 ? 106 GLY A H    5  
ATOM 8287  H HA2  . GLY A 1 106 ? -10.670 9.842   -20.461 1.00 0.00 ? 106 GLY A HA2  5  
ATOM 8288  H HA3  . GLY A 1 106 ? -11.974 10.931  -20.915 1.00 0.00 ? 106 GLY A HA3  5  
ATOM 8289  N N    . VAL A 1 107 ? -9.814  11.231  -18.601 1.00 0.00 ? 107 VAL A N    5  
ATOM 8290  C CA   . VAL A 1 107 ? -9.245  12.125  -17.599 1.00 0.00 ? 107 VAL A CA   5  
ATOM 8291  C C    . VAL A 1 107 ? -9.362  13.582  -18.033 1.00 0.00 ? 107 VAL A C    5  
ATOM 8292  O O    . VAL A 1 107 ? -8.657  14.029  -18.937 1.00 0.00 ? 107 VAL A O    5  
ATOM 8293  C CB   . VAL A 1 107 ? -7.764  11.798  -17.331 1.00 0.00 ? 107 VAL A CB   5  
ATOM 8294  C CG1  . VAL A 1 107 ? -7.186  12.751  -16.297 1.00 0.00 ? 107 VAL A CG1  5  
ATOM 8295  C CG2  . VAL A 1 107 ? -7.612  10.353  -16.881 1.00 0.00 ? 107 VAL A CG2  5  
ATOM 8296  H H    . VAL A 1 107 ? -9.268  10.496  -18.950 1.00 0.00 ? 107 VAL A H    5  
ATOM 8297  H HA   . VAL A 1 107 ? -9.795  11.988  -16.679 1.00 0.00 ? 107 VAL A HA   5  
ATOM 8298  H HB   . VAL A 1 107 ? -7.216  11.926  -18.253 1.00 0.00 ? 107 VAL A HB   5  
ATOM 8299  H HG11 . VAL A 1 107 ? -7.164  12.266  -15.332 1.00 0.00 ? 107 VAL A HG11 5  
ATOM 8300  H HG12 . VAL A 1 107 ? -6.182  13.029  -16.584 1.00 0.00 ? 107 VAL A HG12 5  
ATOM 8301  H HG13 . VAL A 1 107 ? -7.802  13.637  -16.239 1.00 0.00 ? 107 VAL A HG13 5  
ATOM 8302  H HG21 . VAL A 1 107 ? -7.268  10.330  -15.857 1.00 0.00 ? 107 VAL A HG21 5  
ATOM 8303  H HG22 . VAL A 1 107 ? -8.565  9.851   -16.951 1.00 0.00 ? 107 VAL A HG22 5  
ATOM 8304  H HG23 . VAL A 1 107 ? -6.894  9.852   -17.513 1.00 0.00 ? 107 VAL A HG23 5  
ATOM 8305  N N    . GLU A 1 108 ? -10.257 14.318  -17.381 1.00 0.00 ? 108 GLU A N    5  
ATOM 8306  C CA   . GLU A 1 108 ? -10.467 15.725  -17.701 1.00 0.00 ? 108 GLU A CA   5  
ATOM 8307  C C    . GLU A 1 108 ? -9.981  16.619  -16.563 1.00 0.00 ? 108 GLU A C    5  
ATOM 8308  O O    . GLU A 1 108 ? -10.641 17.593  -16.201 1.00 0.00 ? 108 GLU A O    5  
ATOM 8309  C CB   . GLU A 1 108 ? -11.947 15.993  -17.979 1.00 0.00 ? 108 GLU A CB   5  
ATOM 8310  C CG   . GLU A 1 108 ? -12.187 17.149  -18.936 1.00 0.00 ? 108 GLU A CG   5  
ATOM 8311  C CD   . GLU A 1 108 ? -12.092 18.500  -18.255 1.00 0.00 ? 108 GLU A CD   5  
ATOM 8312  O OE1  . GLU A 1 108 ? -13.075 18.906  -17.601 1.00 0.00 ? 108 GLU A OE1  5  
ATOM 8313  O OE2  . GLU A 1 108 ? -11.033 19.151  -18.376 1.00 0.00 ? 108 GLU A OE2  5  
ATOM 8314  H H    . GLU A 1 108 ? -10.790 13.905  -16.670 1.00 0.00 ? 108 GLU A H    5  
ATOM 8315  H HA   . GLU A 1 108 ? -9.896  15.952  -18.589 1.00 0.00 ? 108 GLU A HA   5  
ATOM 8316  H HB2  . GLU A 1 108 ? -12.388 15.104  -18.403 1.00 0.00 ? 108 GLU A HB2  5  
ATOM 8317  H HB3  . GLU A 1 108 ? -12.441 16.219  -17.045 1.00 0.00 ? 108 GLU A HB3  5  
ATOM 8318  H HG2  . GLU A 1 108 ? -11.449 17.107  -19.723 1.00 0.00 ? 108 GLU A HG2  5  
ATOM 8319  H HG3  . GLU A 1 108 ? -13.173 17.046  -19.364 1.00 0.00 ? 108 GLU A HG3  5  
ATOM 8320  N N    . SER A 1 109 ? -8.824  16.279  -16.004 1.00 0.00 ? 109 SER A N    5  
ATOM 8321  C CA   . SER A 1 109 ? -8.252  17.048  -14.904 1.00 0.00 ? 109 SER A CA   5  
ATOM 8322  C C    . SER A 1 109 ? -7.086  17.904  -15.389 1.00 0.00 ? 109 SER A C    5  
ATOM 8323  O O    . SER A 1 109 ? -6.515  17.652  -16.449 1.00 0.00 ? 109 SER A O    5  
ATOM 8324  C CB   . SER A 1 109 ? -7.783  16.111  -13.789 1.00 0.00 ? 109 SER A CB   5  
ATOM 8325  O OG   . SER A 1 109 ? -6.665  15.345  -14.204 1.00 0.00 ? 109 SER A OG   5  
ATOM 8326  H H    . SER A 1 109 ? -8.346  15.492  -16.337 1.00 0.00 ? 109 SER A H    5  
ATOM 8327  H HA   . SER A 1 109 ? -9.023  17.697  -14.517 1.00 0.00 ? 109 SER A HA   5  
ATOM 8328  H HB2  . SER A 1 109 ? -7.504  16.695  -12.926 1.00 0.00 ? 109 SER A HB2  5  
ATOM 8329  H HB3  . SER A 1 109 ? -8.587  15.439  -13.525 1.00 0.00 ? 109 SER A HB3  5  
ATOM 8330  H HG   . SER A 1 109 ? -6.292  15.728  -15.001 1.00 0.00 ? 109 SER A HG   5  
ATOM 8331  N N    . GLY A 1 110 ? -6.738  18.919  -14.603 1.00 0.00 ? 110 GLY A N    5  
ATOM 8332  C CA   . GLY A 1 110 ? -5.643  19.798  -14.968 1.00 0.00 ? 110 GLY A CA   5  
ATOM 8333  C C    . GLY A 1 110 ? -5.361  20.844  -13.908 1.00 0.00 ? 110 GLY A C    5  
ATOM 8334  O O    . GLY A 1 110 ? -6.269  21.348  -13.247 1.00 0.00 ? 110 GLY A O    5  
ATOM 8335  H H    . GLY A 1 110 ? -7.230  19.072  -13.769 1.00 0.00 ? 110 GLY A H    5  
ATOM 8336  H HA2  . GLY A 1 110 ? -4.754  19.204  -15.118 1.00 0.00 ? 110 GLY A HA2  5  
ATOM 8337  H HA3  . GLY A 1 110 ? -5.890  20.297  -15.894 1.00 0.00 ? 110 GLY A HA3  5  
ATOM 8338  N N    . PRO A 1 111 ? -4.076  21.185  -13.734 1.00 0.00 ? 111 PRO A N    5  
ATOM 8339  C CA   . PRO A 1 111 ? -3.647  22.180  -12.747 1.00 0.00 ? 111 PRO A CA   5  
ATOM 8340  C C    . PRO A 1 111 ? -4.072  23.594  -13.128 1.00 0.00 ? 111 PRO A C    5  
ATOM 8341  O O    . PRO A 1 111 ? -3.499  24.202  -14.033 1.00 0.00 ? 111 PRO A O    5  
ATOM 8342  C CB   . PRO A 1 111 ? -2.121  22.058  -12.760 1.00 0.00 ? 111 PRO A CB   5  
ATOM 8343  C CG   . PRO A 1 111 ? -1.795  21.522  -14.111 1.00 0.00 ? 111 PRO A CG   5  
ATOM 8344  C CD   . PRO A 1 111 ? -2.941  20.624  -14.487 1.00 0.00 ? 111 PRO A CD   5  
ATOM 8345  H HA   . PRO A 1 111 ? -4.021  21.947  -11.760 1.00 0.00 ? 111 PRO A HA   5  
ATOM 8346  H HB2  . PRO A 1 111 ? -1.679  23.032  -12.602 1.00 0.00 ? 111 PRO A HB2  5  
ATOM 8347  H HB3  . PRO A 1 111 ? -1.804  21.382  -11.980 1.00 0.00 ? 111 PRO A HB3  5  
ATOM 8348  H HG2  . PRO A 1 111 ? -1.707  22.334  -14.816 1.00 0.00 ? 111 PRO A HG2  5  
ATOM 8349  H HG3  . PRO A 1 111 ? -0.876  20.957  -14.069 1.00 0.00 ? 111 PRO A HG3  5  
ATOM 8350  H HD2  . PRO A 1 111 ? -3.124  20.671  -15.551 1.00 0.00 ? 111 PRO A HD2  5  
ATOM 8351  H HD3  . PRO A 1 111 ? -2.741  19.608  -14.182 1.00 0.00 ? 111 PRO A HD3  5  
ATOM 8352  N N    . SER A 1 112 ? -5.078  24.113  -12.432 1.00 0.00 ? 112 SER A N    5  
ATOM 8353  C CA   . SER A 1 112 ? -5.582  25.455  -12.700 1.00 0.00 ? 112 SER A CA   5  
ATOM 8354  C C    . SER A 1 112 ? -4.476  26.493  -12.535 1.00 0.00 ? 112 SER A C    5  
ATOM 8355  O O    . SER A 1 112 ? -4.149  26.895  -11.418 1.00 0.00 ? 112 SER A O    5  
ATOM 8356  C CB   . SER A 1 112 ? -6.748  25.781  -11.764 1.00 0.00 ? 112 SER A CB   5  
ATOM 8357  O OG   . SER A 1 112 ? -6.990  27.177  -11.719 1.00 0.00 ? 112 SER A OG   5  
ATOM 8358  H H    . SER A 1 112 ? -5.494  23.578  -11.723 1.00 0.00 ? 112 SER A H    5  
ATOM 8359  H HA   . SER A 1 112 ? -5.933  25.479  -13.721 1.00 0.00 ? 112 SER A HA   5  
ATOM 8360  H HB2  . SER A 1 112 ? -7.639  25.285  -12.117 1.00 0.00 ? 112 SER A HB2  5  
ATOM 8361  H HB3  . SER A 1 112 ? -6.513  25.436  -10.768 1.00 0.00 ? 112 SER A HB3  5  
ATOM 8362  H HG   . SER A 1 112 ? -6.703  27.578  -12.543 1.00 0.00 ? 112 SER A HG   5  
ATOM 8363  N N    . SER A 1 113 ? -3.904  26.922  -13.655 1.00 0.00 ? 113 SER A N    5  
ATOM 8364  C CA   . SER A 1 113 ? -2.832  27.910  -13.636 1.00 0.00 ? 113 SER A CA   5  
ATOM 8365  C C    . SER A 1 113 ? -3.386  29.317  -13.844 1.00 0.00 ? 113 SER A C    5  
ATOM 8366  O O    . SER A 1 113 ? -4.242  29.538  -14.699 1.00 0.00 ? 113 SER A O    5  
ATOM 8367  C CB   . SER A 1 113 ? -1.797  27.592  -14.716 1.00 0.00 ? 113 SER A CB   5  
ATOM 8368  O OG   . SER A 1 113 ? -1.234  26.306  -14.520 1.00 0.00 ? 113 SER A OG   5  
ATOM 8369  H H    . SER A 1 113 ? -4.209  26.563  -14.515 1.00 0.00 ? 113 SER A H    5  
ATOM 8370  H HA   . SER A 1 113 ? -2.355  27.864  -12.668 1.00 0.00 ? 113 SER A HA   5  
ATOM 8371  H HB2  . SER A 1 113 ? -2.271  27.620  -15.685 1.00 0.00 ? 113 SER A HB2  5  
ATOM 8372  H HB3  . SER A 1 113 ? -1.006  28.328  -14.681 1.00 0.00 ? 113 SER A HB3  5  
ATOM 8373  H HG   . SER A 1 113 ? -0.386  26.392  -14.079 1.00 0.00 ? 113 SER A HG   5  
ATOM 8374  N N    . GLY A 1 114 ? -2.889  30.265  -13.056 1.00 0.00 ? 114 GLY A N    5  
ATOM 8375  C CA   . GLY A 1 114 ? -3.345  31.638  -13.168 1.00 0.00 ? 114 GLY A CA   5  
ATOM 8376  C C    . GLY A 1 114 ? -4.856  31.744  -13.224 1.00 0.00 ? 114 GLY A C    5  
ATOM 8377  O O    . GLY A 1 114 ? -5.565  30.895  -12.685 1.00 0.00 ? 114 GLY A O    5  
ATOM 8378  H H    . GLY A 1 114 ? -2.207  30.030  -12.391 1.00 0.00 ? 114 GLY A H    5  
ATOM 8379  H HA2  . GLY A 1 114 ? -2.986  32.196  -12.317 1.00 0.00 ? 114 GLY A HA2  5  
ATOM 8380  H HA3  . GLY A 1 114 ? -2.932  32.069  -14.068 1.00 0.00 ? 114 GLY A HA3  5  
ATOM 8381  N N    . GLY A 1 1   ? -3.577  14.133  -22.836 1.00 0.00 ? 1   GLY A N    6  
ATOM 8382  C CA   . GLY A 1 1   ? -3.148  12.955  -23.567 1.00 0.00 ? 1   GLY A CA   6  
ATOM 8383  C C    . GLY A 1 1   ? -3.691  12.920  -24.981 1.00 0.00 ? 1   GLY A C    6  
ATOM 8384  O O    . GLY A 1 1   ? -4.783  13.423  -25.246 1.00 0.00 ? 1   GLY A O    6  
ATOM 8385  H H1   . GLY A 1 1   ? -4.027  14.033  -21.971 1.00 0.00 ? 1   GLY A H1   6  
ATOM 8386  H HA2  . GLY A 1 1   ? -2.069  12.942  -23.606 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8387  H HA3  . GLY A 1 1   ? -3.489  12.075  -23.041 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8388  N N    . SER A 1 2   ? -2.927  12.327  -25.893 1.00 0.00 ? 2   SER A N    6  
ATOM 8389  C CA   . SER A 1 2   ? -3.336  12.234  -27.290 1.00 0.00 ? 2   SER A CA   6  
ATOM 8390  C C    . SER A 1 2   ? -4.596  11.386  -27.432 1.00 0.00 ? 2   SER A C    6  
ATOM 8391  O O    . SER A 1 2   ? -5.609  11.844  -27.961 1.00 0.00 ? 2   SER A O    6  
ATOM 8392  C CB   . SER A 1 2   ? -2.208  11.638  -28.134 1.00 0.00 ? 2   SER A CB   6  
ATOM 8393  O OG   . SER A 1 2   ? -2.446  11.839  -29.517 1.00 0.00 ? 2   SER A OG   6  
ATOM 8394  H H    . SER A 1 2   ? -2.067  11.945  -25.620 1.00 0.00 ? 2   SER A H    6  
ATOM 8395  H HA   . SER A 1 2   ? -3.547  13.234  -27.640 1.00 0.00 ? 2   SER A HA   6  
ATOM 8396  H HB2  . SER A 1 2   ? -1.275  12.110  -27.869 1.00 0.00 ? 2   SER A HB2  6  
ATOM 8397  H HB3  . SER A 1 2   ? -2.142  10.576  -27.943 1.00 0.00 ? 2   SER A HB3  6  
ATOM 8398  H HG   . SER A 1 2   ? -1.761  12.406  -29.880 1.00 0.00 ? 2   SER A HG   6  
ATOM 8399  N N    . SER A 1 3   ? -4.525  10.148  -26.955 1.00 0.00 ? 3   SER A N    6  
ATOM 8400  C CA   . SER A 1 3   ? -5.658  9.233   -27.032 1.00 0.00 ? 3   SER A CA   6  
ATOM 8401  C C    . SER A 1 3   ? -6.271  9.011   -25.653 1.00 0.00 ? 3   SER A C    6  
ATOM 8402  O O    . SER A 1 3   ? -5.570  9.012   -24.642 1.00 0.00 ? 3   SER A O    6  
ATOM 8403  C CB   . SER A 1 3   ? -5.221  7.894   -27.630 1.00 0.00 ? 3   SER A CB   6  
ATOM 8404  O OG   . SER A 1 3   ? -4.143  7.337   -26.898 1.00 0.00 ? 3   SER A OG   6  
ATOM 8405  H H    . SER A 1 3   ? -3.689  9.841   -26.545 1.00 0.00 ? 3   SER A H    6  
ATOM 8406  H HA   . SER A 1 3   ? -6.402  9.679   -27.676 1.00 0.00 ? 3   SER A HA   6  
ATOM 8407  H HB2  . SER A 1 3   ? -6.050  7.204   -27.607 1.00 0.00 ? 3   SER A HB2  6  
ATOM 8408  H HB3  . SER A 1 3   ? -4.907  8.046   -28.653 1.00 0.00 ? 3   SER A HB3  6  
ATOM 8409  H HG   . SER A 1 3   ? -4.475  6.941   -26.090 1.00 0.00 ? 3   SER A HG   6  
ATOM 8410  N N    . GLY A 1 4   ? -7.587  8.820   -25.620 1.00 0.00 ? 4   GLY A N    6  
ATOM 8411  C CA   . GLY A 1 4   ? -8.274  8.599   -24.361 1.00 0.00 ? 4   GLY A CA   6  
ATOM 8412  C C    . GLY A 1 4   ? -9.319  7.506   -24.455 1.00 0.00 ? 4   GLY A C    6  
ATOM 8413  O O    . GLY A 1 4   ? -9.022  6.388   -24.877 1.00 0.00 ? 4   GLY A O    6  
ATOM 8414  H H    . GLY A 1 4   ? -8.095  8.830   -26.458 1.00 0.00 ? 4   GLY A H    6  
ATOM 8415  H HA2  . GLY A 1 4   ? -7.547  8.325   -23.610 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8416  H HA3  . GLY A 1 4   ? -8.756  9.518   -24.062 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8417  N N    . SER A 1 5   ? -10.546 7.827   -24.058 1.00 0.00 ? 5   SER A N    6  
ATOM 8418  C CA   . SER A 1 5   ? -11.639 6.862   -24.094 1.00 0.00 ? 5   SER A CA   6  
ATOM 8419  C C    . SER A 1 5   ? -12.657 7.234   -25.167 1.00 0.00 ? 5   SER A C    6  
ATOM 8420  O O    . SER A 1 5   ? -13.053 8.393   -25.288 1.00 0.00 ? 5   SER A O    6  
ATOM 8421  C CB   . SER A 1 5   ? -12.324 6.784   -22.729 1.00 0.00 ? 5   SER A CB   6  
ATOM 8422  O OG   . SER A 1 5   ? -11.492 6.146   -21.776 1.00 0.00 ? 5   SER A OG   6  
ATOM 8423  H H    . SER A 1 5   ? -10.721 8.735   -23.731 1.00 0.00 ? 5   SER A H    6  
ATOM 8424  H HA   . SER A 1 5   ? -11.219 5.896   -24.332 1.00 0.00 ? 5   SER A HA   6  
ATOM 8425  H HB2  . SER A 1 5   ? -12.546 7.782   -22.383 1.00 0.00 ? 5   SER A HB2  6  
ATOM 8426  H HB3  . SER A 1 5   ? -13.243 6.223   -22.822 1.00 0.00 ? 5   SER A HB3  6  
ATOM 8427  H HG   . SER A 1 5   ? -10.699 6.669   -21.642 1.00 0.00 ? 5   SER A HG   6  
ATOM 8428  N N    . SER A 1 6   ? -13.078 6.241   -25.945 1.00 0.00 ? 6   SER A N    6  
ATOM 8429  C CA   . SER A 1 6   ? -14.048 6.463   -27.011 1.00 0.00 ? 6   SER A CA   6  
ATOM 8430  C C    . SER A 1 6   ? -15.456 6.610   -26.442 1.00 0.00 ? 6   SER A C    6  
ATOM 8431  O O    . SER A 1 6   ? -16.182 7.543   -26.784 1.00 0.00 ? 6   SER A O    6  
ATOM 8432  C CB   . SER A 1 6   ? -14.008 5.309   -28.014 1.00 0.00 ? 6   SER A CB   6  
ATOM 8433  O OG   . SER A 1 6   ? -12.752 5.244   -28.667 1.00 0.00 ? 6   SER A OG   6  
ATOM 8434  H H    . SER A 1 6   ? -12.725 5.338   -25.799 1.00 0.00 ? 6   SER A H    6  
ATOM 8435  H HA   . SER A 1 6   ? -13.780 7.379   -27.517 1.00 0.00 ? 6   SER A HA   6  
ATOM 8436  H HB2  . SER A 1 6   ? -14.179 4.378   -27.495 1.00 0.00 ? 6   SER A HB2  6  
ATOM 8437  H HB3  . SER A 1 6   ? -14.779 5.455   -28.757 1.00 0.00 ? 6   SER A HB3  6  
ATOM 8438  H HG   . SER A 1 6   ? -12.647 4.381   -29.074 1.00 0.00 ? 6   SER A HG   6  
ATOM 8439  N N    . GLY A 1 7   ? -15.835 5.680   -25.571 1.00 0.00 ? 7   GLY A N    6  
ATOM 8440  C CA   . GLY A 1 7   ? -17.155 5.722   -24.969 1.00 0.00 ? 7   GLY A CA   6  
ATOM 8441  C C    . GLY A 1 7   ? -18.163 4.874   -25.719 1.00 0.00 ? 7   GLY A C    6  
ATOM 8442  O O    . GLY A 1 7   ? -19.008 5.400   -26.443 1.00 0.00 ? 7   GLY A O    6  
ATOM 8443  H H    . GLY A 1 7   ? -15.214 4.959   -25.336 1.00 0.00 ? 7   GLY A H    6  
ATOM 8444  H HA2  . GLY A 1 7   ? -17.086 5.365   -23.952 1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8445  H HA3  . GLY A 1 7   ? -17.500 6.745   -24.958 1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8446  N N    . GLU A 1 8   ? -18.072 3.559   -25.548 1.00 0.00 ? 8   GLU A N    6  
ATOM 8447  C CA   . GLU A 1 8   ? -18.982 2.638   -26.217 1.00 0.00 ? 8   GLU A CA   6  
ATOM 8448  C C    . GLU A 1 8   ? -19.693 1.743   -25.206 1.00 0.00 ? 8   GLU A C    6  
ATOM 8449  O O    . GLU A 1 8   ? -19.054 0.983   -24.478 1.00 0.00 ? 8   GLU A O    6  
ATOM 8450  C CB   . GLU A 1 8   ? -18.221 1.778   -27.228 1.00 0.00 ? 8   GLU A CB   6  
ATOM 8451  C CG   . GLU A 1 8   ? -18.108 2.412   -28.605 1.00 0.00 ? 8   GLU A CG   6  
ATOM 8452  C CD   . GLU A 1 8   ? -16.957 1.848   -29.415 1.00 0.00 ? 8   GLU A CD   6  
ATOM 8453  O OE1  . GLU A 1 8   ? -15.894 1.569   -28.822 1.00 0.00 ? 8   GLU A OE1  6  
ATOM 8454  O OE2  . GLU A 1 8   ? -17.120 1.686   -30.642 1.00 0.00 ? 8   GLU A OE2  6  
ATOM 8455  H H    . GLU A 1 8   ? -17.377 3.200   -24.958 1.00 0.00 ? 8   GLU A H    6  
ATOM 8456  H HA   . GLU A 1 8   ? -19.721 3.224   -26.742 1.00 0.00 ? 8   GLU A HA   6  
ATOM 8457  H HB2  . GLU A 1 8   ? -17.223 1.601   -26.853 1.00 0.00 ? 8   GLU A HB2  6  
ATOM 8458  H HB3  . GLU A 1 8   ? -18.729 0.831   -27.332 1.00 0.00 ? 8   GLU A HB3  6  
ATOM 8459  H HG2  . GLU A 1 8   ? -19.027 2.237   -29.144 1.00 0.00 ? 8   GLU A HG2  6  
ATOM 8460  H HG3  . GLU A 1 8   ? -17.959 3.475   -28.486 1.00 0.00 ? 8   GLU A HG3  6  
ATOM 8461  N N    . ILE A 1 9   ? -21.017 1.841   -25.166 1.00 0.00 ? 9   ILE A N    6  
ATOM 8462  C CA   . ILE A 1 9   ? -21.815 1.041   -24.245 1.00 0.00 ? 9   ILE A CA   6  
ATOM 8463  C C    . ILE A 1 9   ? -21.692 -0.446  -24.560 1.00 0.00 ? 9   ILE A C    6  
ATOM 8464  O O    . ILE A 1 9   ? -21.758 -0.852  -25.720 1.00 0.00 ? 9   ILE A O    6  
ATOM 8465  C CB   . ILE A 1 9   ? -23.301 1.443   -24.291 1.00 0.00 ? 9   ILE A CB   6  
ATOM 8466  C CG1  . ILE A 1 9   ? -23.464 2.918   -23.919 1.00 0.00 ? 9   ILE A CG1  6  
ATOM 8467  C CG2  . ILE A 1 9   ? -24.117 0.562   -23.357 1.00 0.00 ? 9   ILE A CG2  6  
ATOM 8468  C CD1  . ILE A 1 9   ? -23.193 3.864   -25.067 1.00 0.00 ? 9   ILE A CD1  6  
ATOM 8469  H H    . ILE A 1 9   ? -21.469 2.465   -25.772 1.00 0.00 ? 9   ILE A H    6  
ATOM 8470  H HA   . ILE A 1 9   ? -21.445 1.217   -23.245 1.00 0.00 ? 9   ILE A HA   6  
ATOM 8471  H HB   . ILE A 1 9   ? -23.661 1.291   -25.297 1.00 0.00 ? 9   ILE A HB   6  
ATOM 8472  H HG12 . ILE A 1 9   ? -24.474 3.088   -23.581 1.00 0.00 ? 9   ILE A HG12 6  
ATOM 8473  H HG13 . ILE A 1 9   ? -22.776 3.158   -23.121 1.00 0.00 ? 9   ILE A HG13 6  
ATOM 8474  H HG21 . ILE A 1 9   ? -23.451 -0.046  -22.762 1.00 0.00 ? 9   ILE A HG21 6  
ATOM 8475  H HG22 . ILE A 1 9   ? -24.713 1.183   -22.706 1.00 0.00 ? 9   ILE A HG22 6  
ATOM 8476  H HG23 . ILE A 1 9   ? -24.765 -0.077  -23.938 1.00 0.00 ? 9   ILE A HG23 6  
ATOM 8477  H HD11 . ILE A 1 9   ? -23.930 4.654   -25.065 1.00 0.00 ? 9   ILE A HD11 6  
ATOM 8478  H HD12 . ILE A 1 9   ? -22.207 4.290   -24.959 1.00 0.00 ? 9   ILE A HD12 6  
ATOM 8479  H HD13 . ILE A 1 9   ? -23.251 3.323   -26.001 1.00 0.00 ? 9   ILE A HD13 6  
ATOM 8480  N N    . GLU A 1 10  ? -21.515 -1.254  -23.519 1.00 0.00 ? 10  GLU A N    6  
ATOM 8481  C CA   . GLU A 1 10  ? -21.385 -2.697  -23.686 1.00 0.00 ? 10  GLU A CA   6  
ATOM 8482  C C    . GLU A 1 10  ? -21.952 -3.437  -22.479 1.00 0.00 ? 10  GLU A C    6  
ATOM 8483  O O    . GLU A 1 10  ? -22.146 -2.852  -21.413 1.00 0.00 ? 10  GLU A O    6  
ATOM 8484  C CB   . GLU A 1 10  ? -19.917 -3.078  -23.889 1.00 0.00 ? 10  GLU A CB   6  
ATOM 8485  C CG   . GLU A 1 10  ? -19.485 -3.084  -25.345 1.00 0.00 ? 10  GLU A CG   6  
ATOM 8486  C CD   . GLU A 1 10  ? -17.983 -2.957  -25.509 1.00 0.00 ? 10  GLU A CD   6  
ATOM 8487  O OE1  . GLU A 1 10  ? -17.247 -3.432  -24.619 1.00 0.00 ? 10  GLU A OE1  6  
ATOM 8488  O OE2  . GLU A 1 10  ? -17.543 -2.382  -26.526 1.00 0.00 ? 10  GLU A OE2  6  
ATOM 8489  H H    . GLU A 1 10  ? -21.471 -0.871  -22.619 1.00 0.00 ? 10  GLU A H    6  
ATOM 8490  H HA   . GLU A 1 10  ? -21.945 -2.981  -24.564 1.00 0.00 ? 10  GLU A HA   6  
ATOM 8491  H HB2  . GLU A 1 10  ? -19.297 -2.374  -23.353 1.00 0.00 ? 10  GLU A HB2  6  
ATOM 8492  H HB3  . GLU A 1 10  ? -19.756 -4.066  -23.483 1.00 0.00 ? 10  GLU A HB3  6  
ATOM 8493  H HG2  . GLU A 1 10  ? -19.803 -4.012  -25.798 1.00 0.00 ? 10  GLU A HG2  6  
ATOM 8494  H HG3  . GLU A 1 10  ? -19.959 -2.257  -25.852 1.00 0.00 ? 10  GLU A HG3  6  
ATOM 8495  N N    . ILE A 1 11  ? -22.217 -4.728  -22.654 1.00 0.00 ? 11  ILE A N    6  
ATOM 8496  C CA   . ILE A 1 11  ? -22.762 -5.548  -21.580 1.00 0.00 ? 11  ILE A CA   6  
ATOM 8497  C C    . ILE A 1 11  ? -21.708 -5.830  -20.515 1.00 0.00 ? 11  ILE A C    6  
ATOM 8498  O O    . ILE A 1 11  ? -22.019 -5.919  -19.327 1.00 0.00 ? 11  ILE A O    6  
ATOM 8499  C CB   . ILE A 1 11  ? -23.306 -6.887  -22.115 1.00 0.00 ? 11  ILE A CB   6  
ATOM 8500  C CG1  . ILE A 1 11  ? -24.023 -6.674  -23.449 1.00 0.00 ? 11  ILE A CG1  6  
ATOM 8501  C CG2  . ILE A 1 11  ? -24.243 -7.521  -21.098 1.00 0.00 ? 11  ILE A CG2  6  
ATOM 8502  C CD1  . ILE A 1 11  ? -24.960 -5.486  -23.449 1.00 0.00 ? 11  ILE A CD1  6  
ATOM 8503  H H    . ILE A 1 11  ? -22.041 -5.137  -23.527 1.00 0.00 ? 11  ILE A H    6  
ATOM 8504  H HA   . ILE A 1 11  ? -23.579 -5.005  -21.128 1.00 0.00 ? 11  ILE A HA   6  
ATOM 8505  H HB   . ILE A 1 11  ? -22.471 -7.554  -22.265 1.00 0.00 ? 11  ILE A HB   6  
ATOM 8506  H HG12 . ILE A 1 11  ? -23.290 -6.517  -24.224 1.00 0.00 ? 11  ILE A HG12 6  
ATOM 8507  H HG13 . ILE A 1 11  ? -24.603 -7.555  -23.682 1.00 0.00 ? 11  ILE A HG13 6  
ATOM 8508  H HG21 . ILE A 1 11  ? -23.824 -7.418  -20.108 1.00 0.00 ? 11  ILE A HG21 6  
ATOM 8509  H HG22 . ILE A 1 11  ? -25.202 -7.026  -21.135 1.00 0.00 ? 11  ILE A HG22 6  
ATOM 8510  H HG23 . ILE A 1 11  ? -24.369 -8.568  -21.328 1.00 0.00 ? 11  ILE A HG23 6  
ATOM 8511  H HD11 . ILE A 1 11  ? -25.874 -5.748  -23.961 1.00 0.00 ? 11  ILE A HD11 6  
ATOM 8512  H HD12 . ILE A 1 11  ? -25.185 -5.204  -22.432 1.00 0.00 ? 11  ILE A HD12 6  
ATOM 8513  H HD13 . ILE A 1 11  ? -24.489 -4.657  -23.957 1.00 0.00 ? 11  ILE A HD13 6  
ATOM 8514  N N    . CYS A 1 12  ? -20.459 -5.968  -20.948 1.00 0.00 ? 12  CYS A N    6  
ATOM 8515  C CA   . CYS A 1 12  ? -19.358 -6.239  -20.031 1.00 0.00 ? 12  CYS A CA   6  
ATOM 8516  C C    . CYS A 1 12  ? -19.542 -5.481  -18.721 1.00 0.00 ? 12  CYS A C    6  
ATOM 8517  O O    . CYS A 1 12  ? -19.909 -4.305  -18.701 1.00 0.00 ? 12  CYS A O    6  
ATOM 8518  C CB   . CYS A 1 12  ? -18.025 -5.853  -20.675 1.00 0.00 ? 12  CYS A CB   6  
ATOM 8519  S SG   . CYS A 1 12  ? -16.595 -6.052  -19.586 1.00 0.00 ? 12  CYS A SG   6  
ATOM 8520  H H    . CYS A 1 12  ? -20.274 -5.887  -21.907 1.00 0.00 ? 12  CYS A H    6  
ATOM 8521  H HA   . CYS A 1 12  ? -19.354 -7.298  -19.823 1.00 0.00 ? 12  CYS A HA   6  
ATOM 8522  H HB2  . CYS A 1 12  ? -17.862 -6.470  -21.546 1.00 0.00 ? 12  CYS A HB2  6  
ATOM 8523  H HB3  . CYS A 1 12  ? -18.067 -4.817  -20.978 1.00 0.00 ? 12  CYS A HB3  6  
ATOM 8524  H HG   . CYS A 1 12  ? -15.764 -5.046  -19.815 1.00 0.00 ? 12  CYS A HG   6  
ATOM 8525  N N    . PRO A 1 13  ? -19.283 -6.167  -17.598 1.00 0.00 ? 13  PRO A N    6  
ATOM 8526  C CA   . PRO A 1 13  ? -19.415 -5.579  -16.262 1.00 0.00 ? 13  PRO A CA   6  
ATOM 8527  C C    . PRO A 1 13  ? -18.345 -4.529  -15.983 1.00 0.00 ? 13  PRO A C    6  
ATOM 8528  O O    . PRO A 1 13  ? -17.680 -4.046  -16.899 1.00 0.00 ? 13  PRO A O    6  
ATOM 8529  C CB   . PRO A 1 13  ? -19.244 -6.779  -15.327 1.00 0.00 ? 13  PRO A CB   6  
ATOM 8530  C CG   . PRO A 1 13  ? -18.437 -7.757  -16.110 1.00 0.00 ? 13  PRO A CG   6  
ATOM 8531  C CD   . PRO A 1 13  ? -18.842 -7.571  -17.547 1.00 0.00 ? 13  PRO A CD   6  
ATOM 8532  H HA   . PRO A 1 13  ? -20.393 -5.143  -16.115 1.00 0.00 ? 13  PRO A HA   6  
ATOM 8533  H HB2  . PRO A 1 13  ? -18.728 -6.469  -14.430 1.00 0.00 ? 13  PRO A HB2  6  
ATOM 8534  H HB3  . PRO A 1 13  ? -20.212 -7.182  -15.071 1.00 0.00 ? 13  PRO A HB3  6  
ATOM 8535  H HG2  . PRO A 1 13  ? -17.386 -7.548  -15.987 1.00 0.00 ? 13  PRO A HG2  6  
ATOM 8536  H HG3  . PRO A 1 13  ? -18.662 -8.762  -15.785 1.00 0.00 ? 13  PRO A HG3  6  
ATOM 8537  H HD2  . PRO A 1 13  ? -17.998 -7.734  -18.201 1.00 0.00 ? 13  PRO A HD2  6  
ATOM 8538  H HD3  . PRO A 1 13  ? -19.652 -8.239  -17.800 1.00 0.00 ? 13  PRO A HD3  6  
ATOM 8539  N N    . LYS A 1 14  ? -18.183 -4.180  -14.711 1.00 0.00 ? 14  LYS A N    6  
ATOM 8540  C CA   . LYS A 1 14  ? -17.192 -3.189  -14.310 1.00 0.00 ? 14  LYS A CA   6  
ATOM 8541  C C    . LYS A 1 14  ? -15.915 -3.332  -15.131 1.00 0.00 ? 14  LYS A C    6  
ATOM 8542  O O    . LYS A 1 14  ? -15.591 -4.420  -15.609 1.00 0.00 ? 14  LYS A O    6  
ATOM 8543  C CB   . LYS A 1 14  ? -16.872 -3.332  -12.820 1.00 0.00 ? 14  LYS A CB   6  
ATOM 8544  C CG   . LYS A 1 14  ? -18.000 -2.879  -11.909 1.00 0.00 ? 14  LYS A CG   6  
ATOM 8545  C CD   . LYS A 1 14  ? -18.984 -4.005  -11.639 1.00 0.00 ? 14  LYS A CD   6  
ATOM 8546  C CE   . LYS A 1 14  ? -19.686 -3.822  -10.302 1.00 0.00 ? 14  LYS A CE   6  
ATOM 8547  N NZ   . LYS A 1 14  ? -20.093 -5.124  -9.706  1.00 0.00 ? 14  LYS A NZ   6  
ATOM 8548  H H    . LYS A 1 14  ? -18.743 -4.601  -14.025 1.00 0.00 ? 14  LYS A H    6  
ATOM 8549  H HA   . LYS A 1 14  ? -17.612 -2.210  -14.487 1.00 0.00 ? 14  LYS A HA   6  
ATOM 8550  H HB2  . LYS A 1 14  ? -16.660 -4.369  -12.608 1.00 0.00 ? 14  LYS A HB2  6  
ATOM 8551  H HB3  . LYS A 1 14  ? -15.996 -2.741  -12.594 1.00 0.00 ? 14  LYS A HB3  6  
ATOM 8552  H HG2  . LYS A 1 14  ? -17.581 -2.548  -10.970 1.00 0.00 ? 14  LYS A HG2  6  
ATOM 8553  H HG3  . LYS A 1 14  ? -18.524 -2.060  -12.381 1.00 0.00 ? 14  LYS A HG3  6  
ATOM 8554  H HD2  . LYS A 1 14  ? -19.726 -4.019  -12.423 1.00 0.00 ? 14  LYS A HD2  6  
ATOM 8555  H HD3  . LYS A 1 14  ? -18.449 -4.944  -11.629 1.00 0.00 ? 14  LYS A HD3  6  
ATOM 8556  H HE2  . LYS A 1 14  ? -19.015 -3.319  -9.623  1.00 0.00 ? 14  LYS A HE2  6  
ATOM 8557  H HE3  . LYS A 1 14  ? -20.566 -3.214  -10.453 1.00 0.00 ? 14  LYS A HE3  6  
ATOM 8558  H HZ1  . LYS A 1 14  ? -19.278 -5.771  -9.672  1.00 0.00 ? 14  LYS A HZ1  6  
ATOM 8559  H HZ2  . LYS A 1 14  ? -20.843 -5.560  -10.278 1.00 0.00 ? 14  LYS A HZ2  6  
ATOM 8560  H HZ3  . LYS A 1 14  ? -20.448 -4.980  -8.739  1.00 0.00 ? 14  LYS A HZ3  6  
ATOM 8561  N N    . VAL A 1 15  ? -15.192 -2.228  -15.290 1.00 0.00 ? 15  VAL A N    6  
ATOM 8562  C CA   . VAL A 1 15  ? -13.948 -2.232  -16.052 1.00 0.00 ? 15  VAL A CA   6  
ATOM 8563  C C    . VAL A 1 15  ? -12.765 -1.844  -15.173 1.00 0.00 ? 15  VAL A C    6  
ATOM 8564  O O    . VAL A 1 15  ? -12.867 -0.948  -14.334 1.00 0.00 ? 15  VAL A O    6  
ATOM 8565  C CB   . VAL A 1 15  ? -14.022 -1.268  -17.251 1.00 0.00 ? 15  VAL A CB   6  
ATOM 8566  C CG1  . VAL A 1 15  ? -15.116 -1.698  -18.216 1.00 0.00 ? 15  VAL A CG1  6  
ATOM 8567  C CG2  . VAL A 1 15  ? -14.250 0.158   -16.774 1.00 0.00 ? 15  VAL A CG2  6  
ATOM 8568  H H    . VAL A 1 15  ? -15.501 -1.391  -14.885 1.00 0.00 ? 15  VAL A H    6  
ATOM 8569  H HA   . VAL A 1 15  ? -13.791 -3.232  -16.430 1.00 0.00 ? 15  VAL A HA   6  
ATOM 8570  H HB   . VAL A 1 15  ? -13.077 -1.304  -17.774 1.00 0.00 ? 15  VAL A HB   6  
ATOM 8571  H HG11 . VAL A 1 15  ? -16.062 -1.288  -17.893 1.00 0.00 ? 15  VAL A HG11 6  
ATOM 8572  H HG12 . VAL A 1 15  ? -14.885 -1.337  -19.207 1.00 0.00 ? 15  VAL A HG12 6  
ATOM 8573  H HG13 . VAL A 1 15  ? -15.179 -2.777  -18.231 1.00 0.00 ? 15  VAL A HG13 6  
ATOM 8574  H HG21 . VAL A 1 15  ? -14.575 0.767   -17.605 1.00 0.00 ? 15  VAL A HG21 6  
ATOM 8575  H HG22 . VAL A 1 15  ? -15.010 0.164   -16.006 1.00 0.00 ? 15  VAL A HG22 6  
ATOM 8576  H HG23 . VAL A 1 15  ? -13.330 0.556   -16.373 1.00 0.00 ? 15  VAL A HG23 6  
ATOM 8577  N N    . THR A 1 16  ? -11.639 -2.524  -15.371 1.00 0.00 ? 16  THR A N    6  
ATOM 8578  C CA   . THR A 1 16  ? -10.435 -2.251  -14.596 1.00 0.00 ? 16  THR A CA   6  
ATOM 8579  C C    . THR A 1 16  ? -9.620  -1.126  -15.225 1.00 0.00 ? 16  THR A C    6  
ATOM 8580  O O    . THR A 1 16  ? -9.506  -1.040  -16.447 1.00 0.00 ? 16  THR A O    6  
ATOM 8581  C CB   . THR A 1 16  ? -9.550  -3.505  -14.474 1.00 0.00 ? 16  THR A CB   6  
ATOM 8582  O OG1  . THR A 1 16  ? -9.229  -4.007  -15.777 1.00 0.00 ? 16  THR A OG1  6  
ATOM 8583  C CG2  . THR A 1 16  ? -10.251 -4.586  -13.667 1.00 0.00 ? 16  THR A CG2  6  
ATOM 8584  H H    . THR A 1 16  ? -11.621 -3.226  -16.054 1.00 0.00 ? 16  THR A H    6  
ATOM 8585  H HA   . THR A 1 16  ? -10.738 -1.951  -13.604 1.00 0.00 ? 16  THR A HA   6  
ATOM 8586  H HB   . THR A 1 16  ? -8.635  -3.233  -13.967 1.00 0.00 ? 16  THR A HB   6  
ATOM 8587  H HG1  . THR A 1 16  ? -9.795  -3.587  -16.430 1.00 0.00 ? 16  THR A HG1  6  
ATOM 8588  H HG21 . THR A 1 16  ? -11.039 -5.026  -14.261 1.00 0.00 ? 16  THR A HG21 6  
ATOM 8589  H HG22 . THR A 1 16  ? -10.674 -4.151  -12.773 1.00 0.00 ? 16  THR A HG22 6  
ATOM 8590  H HG23 . THR A 1 16  ? -9.539  -5.350  -13.393 1.00 0.00 ? 16  THR A HG23 6  
ATOM 8591  N N    . GLN A 1 17  ? -9.056  -0.268  -14.382 1.00 0.00 ? 17  GLN A N    6  
ATOM 8592  C CA   . GLN A 1 17  ? -8.251  0.852   -14.857 1.00 0.00 ? 17  GLN A CA   6  
ATOM 8593  C C    . GLN A 1 17  ? -6.888  0.871   -14.173 1.00 0.00 ? 17  GLN A C    6  
ATOM 8594  O O    . GLN A 1 17  ? -6.798  0.848   -12.945 1.00 0.00 ? 17  GLN A O    6  
ATOM 8595  C CB   . GLN A 1 17  ? -8.980  2.173   -14.606 1.00 0.00 ? 17  GLN A CB   6  
ATOM 8596  C CG   . GLN A 1 17  ? -9.311  2.417   -13.143 1.00 0.00 ? 17  GLN A CG   6  
ATOM 8597  C CD   . GLN A 1 17  ? -9.925  3.782   -12.903 1.00 0.00 ? 17  GLN A CD   6  
ATOM 8598  O OE1  . GLN A 1 17  ? -9.862  4.663   -13.761 1.00 0.00 ? 17  GLN A OE1  6  
ATOM 8599  N NE2  . GLN A 1 17  ? -10.524 3.965   -11.732 1.00 0.00 ? 17  GLN A NE2  6  
ATOM 8600  H H    . GLN A 1 17  ? -9.184  -0.390  -13.419 1.00 0.00 ? 17  GLN A H    6  
ATOM 8601  H HA   . GLN A 1 17  ? -8.105  0.727   -15.919 1.00 0.00 ? 17  GLN A HA   6  
ATOM 8602  H HB2  . GLN A 1 17  ? -8.358  2.985   -14.953 1.00 0.00 ? 17  GLN A HB2  6  
ATOM 8603  H HB3  . GLN A 1 17  ? -9.903  2.173   -15.166 1.00 0.00 ? 17  GLN A HB3  6  
ATOM 8604  H HG2  . GLN A 1 17  ? -10.010 1.663   -12.814 1.00 0.00 ? 17  GLN A HG2  6  
ATOM 8605  H HG3  . GLN A 1 17  ? -8.402  2.341   -12.564 1.00 0.00 ? 17  GLN A HG3  6  
ATOM 8606  H HE21 . GLN A 1 17  ? -10.535 3.219   -11.097 1.00 0.00 ? 17  GLN A HE21 6  
ATOM 8607  H HE22 . GLN A 1 17  ? -10.929 4.838   -11.551 1.00 0.00 ? 17  GLN A HE22 6  
ATOM 8608  N N    . SER A 1 18  ? -5.830  0.913   -14.975 1.00 0.00 ? 18  SER A N    6  
ATOM 8609  C CA   . SER A 1 18  ? -4.470  0.931   -14.447 1.00 0.00 ? 18  SER A CA   6  
ATOM 8610  C C    . SER A 1 18  ? -3.999  2.362   -14.209 1.00 0.00 ? 18  SER A C    6  
ATOM 8611  O O    . SER A 1 18  ? -3.897  3.157   -15.145 1.00 0.00 ? 18  SER A O    6  
ATOM 8612  C CB   . SER A 1 18  ? -3.517  0.221   -15.411 1.00 0.00 ? 18  SER A CB   6  
ATOM 8613  O OG   . SER A 1 18  ? -2.385  -0.286  -14.726 1.00 0.00 ? 18  SER A OG   6  
ATOM 8614  H H    . SER A 1 18  ? -5.966  0.929   -15.946 1.00 0.00 ? 18  SER A H    6  
ATOM 8615  H HA   . SER A 1 18  ? -4.474  0.404   -13.505 1.00 0.00 ? 18  SER A HA   6  
ATOM 8616  H HB2  . SER A 1 18  ? -4.033  -0.600  -15.885 1.00 0.00 ? 18  SER A HB2  6  
ATOM 8617  H HB3  . SER A 1 18  ? -3.184  0.921   -16.164 1.00 0.00 ? 18  SER A HB3  6  
ATOM 8618  H HG   . SER A 1 18  ? -2.670  -0.898  -14.044 1.00 0.00 ? 18  SER A HG   6  
ATOM 8619  N N    . ILE A 1 19  ? -3.713  2.683   -12.952 1.00 0.00 ? 19  ILE A N    6  
ATOM 8620  C CA   . ILE A 1 19  ? -3.252  4.017   -12.591 1.00 0.00 ? 19  ILE A CA   6  
ATOM 8621  C C    . ILE A 1 19  ? -1.732  4.060   -12.471 1.00 0.00 ? 19  ILE A C    6  
ATOM 8622  O O    . ILE A 1 19  ? -1.164  3.607   -11.477 1.00 0.00 ? 19  ILE A O    6  
ATOM 8623  C CB   . ILE A 1 19  ? -3.873  4.487   -11.262 1.00 0.00 ? 19  ILE A CB   6  
ATOM 8624  C CG1  . ILE A 1 19  ? -5.352  4.827   -11.458 1.00 0.00 ? 19  ILE A CG1  6  
ATOM 8625  C CG2  . ILE A 1 19  ? -3.115  5.690   -10.719 1.00 0.00 ? 19  ILE A CG2  6  
ATOM 8626  C CD1  . ILE A 1 19  ? -6.275  3.645   -11.261 1.00 0.00 ? 19  ILE A CD1  6  
ATOM 8627  H H    . ILE A 1 19  ? -3.815  2.006   -12.251 1.00 0.00 ? 19  ILE A H    6  
ATOM 8628  H HA   . ILE A 1 19  ? -3.560  4.699   -13.371 1.00 0.00 ? 19  ILE A HA   6  
ATOM 8629  H HB   . ILE A 1 19  ? -3.787  3.685   -10.546 1.00 0.00 ? 19  ILE A HB   6  
ATOM 8630  H HG12 . ILE A 1 19  ? -5.637  5.590   -10.751 1.00 0.00 ? 19  ILE A HG12 6  
ATOM 8631  H HG13 . ILE A 1 19  ? -5.498  5.200   -12.462 1.00 0.00 ? 19  ILE A HG13 6  
ATOM 8632  H HG21 . ILE A 1 19  ? -3.789  6.312   -10.149 1.00 0.00 ? 19  ILE A HG21 6  
ATOM 8633  H HG22 . ILE A 1 19  ? -2.313  5.351   -10.081 1.00 0.00 ? 19  ILE A HG22 6  
ATOM 8634  H HG23 . ILE A 1 19  ? -2.707  6.259   -11.540 1.00 0.00 ? 19  ILE A HG23 6  
ATOM 8635  H HD11 . ILE A 1 19  ? -6.576  3.258   -12.224 1.00 0.00 ? 19  ILE A HD11 6  
ATOM 8636  H HD12 . ILE A 1 19  ? -5.761  2.874   -10.707 1.00 0.00 ? 19  ILE A HD12 6  
ATOM 8637  H HD13 . ILE A 1 19  ? -7.151  3.960   -10.712 1.00 0.00 ? 19  ILE A HD13 6  
ATOM 8638  N N    . HIS A 1 20  ? -1.079  4.608   -13.491 1.00 0.00 ? 20  HIS A N    6  
ATOM 8639  C CA   . HIS A 1 20  ? 0.376   4.713   -13.499 1.00 0.00 ? 20  HIS A CA   6  
ATOM 8640  C C    . HIS A 1 20  ? 0.825   6.081   -12.997 1.00 0.00 ? 20  HIS A C    6  
ATOM 8641  O O    . HIS A 1 20  ? 0.738   7.077   -13.716 1.00 0.00 ? 20  HIS A O    6  
ATOM 8642  C CB   . HIS A 1 20  ? 0.917   4.471   -14.909 1.00 0.00 ? 20  HIS A CB   6  
ATOM 8643  C CG   . HIS A 1 20  ? 0.024   4.994   -15.991 1.00 0.00 ? 20  HIS A CG   6  
ATOM 8644  N ND1  . HIS A 1 20  ? -0.783  4.182   -16.759 1.00 0.00 ? 20  HIS A ND1  6  
ATOM 8645  C CD2  . HIS A 1 20  ? -0.187  6.256   -16.432 1.00 0.00 ? 20  HIS A CD2  6  
ATOM 8646  C CE1  . HIS A 1 20  ? -1.451  4.921   -17.626 1.00 0.00 ? 20  HIS A CE1  6  
ATOM 8647  N NE2  . HIS A 1 20  ? -1.108  6.184   -17.448 1.00 0.00 ? 20  HIS A NE2  6  
ATOM 8648  H H    . HIS A 1 20  ? -1.587  4.951   -14.255 1.00 0.00 ? 20  HIS A H    6  
ATOM 8649  H HA   . HIS A 1 20  ? 0.767   3.954   -12.838 1.00 0.00 ? 20  HIS A HA   6  
ATOM 8650  H HB2  . HIS A 1 20  ? 1.877   4.957   -15.007 1.00 0.00 ? 20  HIS A HB2  6  
ATOM 8651  H HB3  . HIS A 1 20  ? 1.040   3.409   -15.063 1.00 0.00 ? 20  HIS A HB3  6  
ATOM 8652  H HD1  . HIS A 1 20  ? -0.855  3.208   -16.681 1.00 0.00 ? 20  HIS A HD1  6  
ATOM 8653  H HD2  . HIS A 1 20  ? 0.282   7.155   -16.055 1.00 0.00 ? 20  HIS A HD2  6  
ATOM 8654  H HE1  . HIS A 1 20  ? -2.158  4.557   -18.356 1.00 0.00 ? 20  HIS A HE1  6  
ATOM 8655  H HE2  . HIS A 1 20  ? -1.390  6.931   -18.016 1.00 0.00 ? 20  HIS A HE2  6  
ATOM 8656  N N    . ILE A 1 21  ? 1.305   6.123   -11.758 1.00 0.00 ? 21  ILE A N    6  
ATOM 8657  C CA   . ILE A 1 21  ? 1.767   7.369   -11.160 1.00 0.00 ? 21  ILE A CA   6  
ATOM 8658  C C    . ILE A 1 21  ? 3.282   7.506   -11.278 1.00 0.00 ? 21  ILE A C    6  
ATOM 8659  O O    . ILE A 1 21  ? 4.007   6.513   -11.259 1.00 0.00 ? 21  ILE A O    6  
ATOM 8660  C CB   . ILE A 1 21  ? 1.368   7.464   -9.676  1.00 0.00 ? 21  ILE A CB   6  
ATOM 8661  C CG1  . ILE A 1 21  ? -0.154  7.415   -9.530  1.00 0.00 ? 21  ILE A CG1  6  
ATOM 8662  C CG2  . ILE A 1 21  ? 1.924   8.738   -9.058  1.00 0.00 ? 21  ILE A CG2  6  
ATOM 8663  C CD1  . ILE A 1 21  ? -0.623  7.411   -8.092  1.00 0.00 ? 21  ILE A CD1  6  
ATOM 8664  H H    . ILE A 1 21  ? 1.349   5.296   -11.234 1.00 0.00 ? 21  ILE A H    6  
ATOM 8665  H HA   . ILE A 1 21  ? 1.300   8.187   -11.691 1.00 0.00 ? 21  ILE A HA   6  
ATOM 8666  H HB   . ILE A 1 21  ? 1.800   6.622   -9.156  1.00 0.00 ? 21  ILE A HB   6  
ATOM 8667  H HG12 . ILE A 1 21  ? -0.584  8.276   -10.016 1.00 0.00 ? 21  ILE A HG12 6  
ATOM 8668  H HG13 . ILE A 1 21  ? -0.524  6.517   -10.003 1.00 0.00 ? 21  ILE A HG13 6  
ATOM 8669  H HG21 . ILE A 1 21  ? 1.672   8.769   -8.008  1.00 0.00 ? 21  ILE A HG21 6  
ATOM 8670  H HG22 . ILE A 1 21  ? 2.998   8.753   -9.170  1.00 0.00 ? 21  ILE A HG22 6  
ATOM 8671  H HG23 . ILE A 1 21  ? 1.498   9.596   -9.556  1.00 0.00 ? 21  ILE A HG23 6  
ATOM 8672  H HD11 . ILE A 1 21  ? -1.673  7.158   -8.056  1.00 0.00 ? 21  ILE A HD11 6  
ATOM 8673  H HD12 . ILE A 1 21  ? -0.057  6.684   -7.530  1.00 0.00 ? 21  ILE A HD12 6  
ATOM 8674  H HD13 . ILE A 1 21  ? -0.476  8.391   -7.663  1.00 0.00 ? 21  ILE A HD13 6  
ATOM 8675  N N    . GLU A 1 22  ? 3.751   8.744   -11.398 1.00 0.00 ? 22  GLU A N    6  
ATOM 8676  C CA   . GLU A 1 22  ? 5.179   9.011   -11.517 1.00 0.00 ? 22  GLU A CA   6  
ATOM 8677  C C    . GLU A 1 22  ? 5.524   10.389  -10.960 1.00 0.00 ? 22  GLU A C    6  
ATOM 8678  O O    . GLU A 1 22  ? 4.931   11.395  -11.348 1.00 0.00 ? 22  GLU A O    6  
ATOM 8679  C CB   . GLU A 1 22  ? 5.618   8.916   -12.980 1.00 0.00 ? 22  GLU A CB   6  
ATOM 8680  C CG   . GLU A 1 22  ? 5.518   7.514   -13.556 1.00 0.00 ? 22  GLU A CG   6  
ATOM 8681  C CD   . GLU A 1 22  ? 5.897   7.457   -15.023 1.00 0.00 ? 22  GLU A CD   6  
ATOM 8682  O OE1  . GLU A 1 22  ? 5.042   7.791   -15.870 1.00 0.00 ? 22  GLU A OE1  6  
ATOM 8683  O OE2  . GLU A 1 22  ? 7.048   7.079   -15.324 1.00 0.00 ? 22  GLU A OE2  6  
ATOM 8684  H H    . GLU A 1 22  ? 3.122   9.496   -11.406 1.00 0.00 ? 22  GLU A H    6  
ATOM 8685  H HA   . GLU A 1 22  ? 5.705   8.262   -10.944 1.00 0.00 ? 22  GLU A HA   6  
ATOM 8686  H HB2  . GLU A 1 22  ? 4.997   9.572   -13.573 1.00 0.00 ? 22  GLU A HB2  6  
ATOM 8687  H HB3  . GLU A 1 22  ? 6.645   9.242   -13.057 1.00 0.00 ? 22  GLU A HB3  6  
ATOM 8688  H HG2  . GLU A 1 22  ? 6.181   6.864   -13.004 1.00 0.00 ? 22  GLU A HG2  6  
ATOM 8689  H HG3  . GLU A 1 22  ? 4.502   7.165   -13.447 1.00 0.00 ? 22  GLU A HG3  6  
ATOM 8690  N N    . LYS A 1 23  ? 6.488   10.426  -10.045 1.00 0.00 ? 23  LYS A N    6  
ATOM 8691  C CA   . LYS A 1 23  ? 6.914   11.679  -9.433  1.00 0.00 ? 23  LYS A CA   6  
ATOM 8692  C C    . LYS A 1 23  ? 8.298   12.085  -9.931  1.00 0.00 ? 23  LYS A C    6  
ATOM 8693  O O    . LYS A 1 23  ? 9.056   11.254  -10.431 1.00 0.00 ? 23  LYS A O    6  
ATOM 8694  C CB   . LYS A 1 23  ? 6.928   11.547  -7.909  1.00 0.00 ? 23  LYS A CB   6  
ATOM 8695  C CG   . LYS A 1 23  ? 5.557   11.703  -7.273  1.00 0.00 ? 23  LYS A CG   6  
ATOM 8696  C CD   . LYS A 1 23  ? 5.656   12.286  -5.873  1.00 0.00 ? 23  LYS A CD   6  
ATOM 8697  C CE   . LYS A 1 23  ? 4.409   13.078  -5.510  1.00 0.00 ? 23  LYS A CE   6  
ATOM 8698  N NZ   . LYS A 1 23  ? 4.234   14.269  -6.386  1.00 0.00 ? 23  LYS A NZ   6  
ATOM 8699  H H    . LYS A 1 23  ? 6.924   9.590   -9.776  1.00 0.00 ? 23  LYS A H    6  
ATOM 8700  H HA   . LYS A 1 23  ? 6.205   12.444  -9.714  1.00 0.00 ? 23  LYS A HA   6  
ATOM 8701  H HB2  . LYS A 1 23  ? 7.314   10.573  -7.647  1.00 0.00 ? 23  LYS A HB2  6  
ATOM 8702  H HB3  . LYS A 1 23  ? 7.580   12.306  -7.500  1.00 0.00 ? 23  LYS A HB3  6  
ATOM 8703  H HG2  . LYS A 1 23  ? 4.959   12.363  -7.884  1.00 0.00 ? 23  LYS A HG2  6  
ATOM 8704  H HG3  . LYS A 1 23  ? 5.084   10.733  -7.217  1.00 0.00 ? 23  LYS A HG3  6  
ATOM 8705  H HD2  . LYS A 1 23  ? 5.775   11.480  -5.164  1.00 0.00 ? 23  LYS A HD2  6  
ATOM 8706  H HD3  . LYS A 1 23  ? 6.514   12.940  -5.824  1.00 0.00 ? 23  LYS A HD3  6  
ATOM 8707  H HE2  . LYS A 1 23  ? 3.548   12.436  -5.613  1.00 0.00 ? 23  LYS A HE2  6  
ATOM 8708  H HE3  . LYS A 1 23  ? 4.492   13.405  -4.484  1.00 0.00 ? 23  LYS A HE3  6  
ATOM 8709  H HZ1  . LYS A 1 23  ? 3.239   14.354  -6.679  1.00 0.00 ? 23  LYS A HZ1  6  
ATOM 8710  H HZ2  . LYS A 1 23  ? 4.827   14.178  -7.235  1.00 0.00 ? 23  LYS A HZ2  6  
ATOM 8711  H HZ3  . LYS A 1 23  ? 4.508   15.132  -5.875  1.00 0.00 ? 23  LYS A HZ3  6  
ATOM 8712  N N    . SER A 1 24  ? 8.620   13.367  -9.791  1.00 0.00 ? 24  SER A N    6  
ATOM 8713  C CA   . SER A 1 24  ? 9.911   13.883  -10.229 1.00 0.00 ? 24  SER A CA   6  
ATOM 8714  C C    . SER A 1 24  ? 11.019  13.461  -9.268  1.00 0.00 ? 24  SER A C    6  
ATOM 8715  O O    . SER A 1 24  ? 11.905  12.685  -9.628  1.00 0.00 ? 24  SER A O    6  
ATOM 8716  C CB   . SER A 1 24  ? 9.866   15.409  -10.333 1.00 0.00 ? 24  SER A CB   6  
ATOM 8717  O OG   . SER A 1 24  ? 8.834   15.829  -11.209 1.00 0.00 ? 24  SER A OG   6  
ATOM 8718  H H    . SER A 1 24  ? 7.972   13.981  -9.385  1.00 0.00 ? 24  SER A H    6  
ATOM 8719  H HA   . SER A 1 24  ? 10.120  13.470  -11.204 1.00 0.00 ? 24  SER A HA   6  
ATOM 8720  H HB2  . SER A 1 24  ? 9.685   15.829  -9.356  1.00 0.00 ? 24  SER A HB2  6  
ATOM 8721  H HB3  . SER A 1 24  ? 10.812  15.769  -10.711 1.00 0.00 ? 24  SER A HB3  6  
ATOM 8722  H HG   . SER A 1 24  ? 9.164   16.525  -11.782 1.00 0.00 ? 24  SER A HG   6  
ATOM 8723  N N    . ASP A 1 25  ? 10.962  13.977  -8.046  1.00 0.00 ? 25  ASP A N    6  
ATOM 8724  C CA   . ASP A 1 25  ? 11.959  13.653  -7.032  1.00 0.00 ? 25  ASP A CA   6  
ATOM 8725  C C    . ASP A 1 25  ? 11.290  13.258  -5.719  1.00 0.00 ? 25  ASP A C    6  
ATOM 8726  O O    . ASP A 1 25  ? 10.860  14.115  -4.945  1.00 0.00 ? 25  ASP A O    6  
ATOM 8727  C CB   . ASP A 1 25  ? 12.892  14.844  -6.805  1.00 0.00 ? 25  ASP A CB   6  
ATOM 8728  C CG   . ASP A 1 25  ? 14.012  14.525  -5.834  1.00 0.00 ? 25  ASP A CG   6  
ATOM 8729  O OD1  . ASP A 1 25  ? 14.574  13.414  -5.922  1.00 0.00 ? 25  ASP A OD1  6  
ATOM 8730  O OD2  . ASP A 1 25  ? 14.325  15.387  -4.986  1.00 0.00 ? 25  ASP A OD2  6  
ATOM 8731  H H    . ASP A 1 25  ? 10.231  14.590  -7.819  1.00 0.00 ? 25  ASP A H    6  
ATOM 8732  H HA   . ASP A 1 25  ? 12.539  12.817  -7.392  1.00 0.00 ? 25  ASP A HA   6  
ATOM 8733  H HB2  . ASP A 1 25  ? 13.330  15.134  -7.749  1.00 0.00 ? 25  ASP A HB2  6  
ATOM 8734  H HB3  . ASP A 1 25  ? 12.320  15.670  -6.409  1.00 0.00 ? 25  ASP A HB3  6  
ATOM 8735  N N    . THR A 1 26  ? 11.204  11.954  -5.473  1.00 0.00 ? 26  THR A N    6  
ATOM 8736  C CA   . THR A 1 26  ? 10.586  11.445  -4.255  1.00 0.00 ? 26  THR A CA   6  
ATOM 8737  C C    . THR A 1 26  ? 11.193  12.095  -3.017  1.00 0.00 ? 26  THR A C    6  
ATOM 8738  O O    . THR A 1 26  ? 10.533  12.227  -1.987  1.00 0.00 ? 26  THR A O    6  
ATOM 8739  C CB   . THR A 1 26  ? 10.738  9.916   -4.145  1.00 0.00 ? 26  THR A CB   6  
ATOM 8740  O OG1  . THR A 1 26  ? 12.095  9.539   -4.403  1.00 0.00 ? 26  THR A OG1  6  
ATOM 8741  C CG2  . THR A 1 26  ? 9.815   9.209   -5.125  1.00 0.00 ? 26  THR A CG2  6  
ATOM 8742  H H    . THR A 1 26  ? 11.565  11.321  -6.128  1.00 0.00 ? 26  THR A H    6  
ATOM 8743  H HA   . THR A 1 26  ? 9.532   11.680  -4.293  1.00 0.00 ? 26  THR A HA   6  
ATOM 8744  H HB   . THR A 1 26  ? 10.473  9.615   -3.142  1.00 0.00 ? 26  THR A HB   6  
ATOM 8745  H HG1  . THR A 1 26  ? 12.334  9.795   -5.297  1.00 0.00 ? 26  THR A HG1  6  
ATOM 8746  H HG21 . THR A 1 26  ? 10.398  8.575   -5.776  1.00 0.00 ? 26  THR A HG21 6  
ATOM 8747  H HG22 . THR A 1 26  ? 9.287   9.943   -5.716  1.00 0.00 ? 26  THR A HG22 6  
ATOM 8748  H HG23 . THR A 1 26  ? 9.104   8.607   -4.580  1.00 0.00 ? 26  THR A HG23 6  
ATOM 8749  N N    . ALA A 1 27  ? 12.454  12.501  -3.125  1.00 0.00 ? 27  ALA A N    6  
ATOM 8750  C CA   . ALA A 1 27  ? 13.149  13.140  -2.015  1.00 0.00 ? 27  ALA A CA   6  
ATOM 8751  C C    . ALA A 1 27  ? 12.254  14.162  -1.323  1.00 0.00 ? 27  ALA A C    6  
ATOM 8752  O O    . ALA A 1 27  ? 12.211  14.234  -0.095  1.00 0.00 ? 27  ALA A O    6  
ATOM 8753  C CB   . ALA A 1 27  ? 14.429  13.802  -2.504  1.00 0.00 ? 27  ALA A CB   6  
ATOM 8754  H H    . ALA A 1 27  ? 12.928  12.368  -3.973  1.00 0.00 ? 27  ALA A H    6  
ATOM 8755  H HA   . ALA A 1 27  ? 13.419  12.372  -1.304  1.00 0.00 ? 27  ALA A HA   6  
ATOM 8756  H HB1  . ALA A 1 27  ? 14.721  13.365  -3.448  1.00 0.00 ? 27  ALA A HB1  6  
ATOM 8757  H HB2  . ALA A 1 27  ? 14.260  14.860  -2.633  1.00 0.00 ? 27  ALA A HB2  6  
ATOM 8758  H HB3  . ALA A 1 27  ? 15.214  13.647  -1.778  1.00 0.00 ? 27  ALA A HB3  6  
ATOM 8759  N N    . ALA A 1 28  ? 11.541  14.953  -2.119  1.00 0.00 ? 28  ALA A N    6  
ATOM 8760  C CA   . ALA A 1 28  ? 10.646  15.970  -1.582  1.00 0.00 ? 28  ALA A CA   6  
ATOM 8761  C C    . ALA A 1 28  ? 9.192   15.655  -1.917  1.00 0.00 ? 28  ALA A C    6  
ATOM 8762  O O    . ALA A 1 28  ? 8.370   15.450  -1.024  1.00 0.00 ? 28  ALA A O    6  
ATOM 8763  C CB   . ALA A 1 28  ? 11.027  17.343  -2.116  1.00 0.00 ? 28  ALA A CB   6  
ATOM 8764  H H    . ALA A 1 28  ? 11.618  14.848  -3.090  1.00 0.00 ? 28  ALA A H    6  
ATOM 8765  H HA   . ALA A 1 28  ? 10.763  15.984  -0.507  1.00 0.00 ? 28  ALA A HA   6  
ATOM 8766  H HB1  . ALA A 1 28  ? 11.545  17.897  -1.346  1.00 0.00 ? 28  ALA A HB1  6  
ATOM 8767  H HB2  . ALA A 1 28  ? 11.673  17.229  -2.974  1.00 0.00 ? 28  ALA A HB2  6  
ATOM 8768  H HB3  . ALA A 1 28  ? 10.134  17.877  -2.405  1.00 0.00 ? 28  ALA A HB3  6  
ATOM 8769  N N    . ASP A 1 29  ? 8.883   15.618  -3.208  1.00 0.00 ? 29  ASP A N    6  
ATOM 8770  C CA   . ASP A 1 29  ? 7.527   15.327  -3.661  1.00 0.00 ? 29  ASP A CA   6  
ATOM 8771  C C    . ASP A 1 29  ? 7.140   13.889  -3.330  1.00 0.00 ? 29  ASP A C    6  
ATOM 8772  O O    . ASP A 1 29  ? 7.797   12.942  -3.762  1.00 0.00 ? 29  ASP A O    6  
ATOM 8773  C CB   . ASP A 1 29  ? 7.408   15.566  -5.167  1.00 0.00 ? 29  ASP A CB   6  
ATOM 8774  C CG   . ASP A 1 29  ? 8.205   16.771  -5.627  1.00 0.00 ? 29  ASP A CG   6  
ATOM 8775  O OD1  . ASP A 1 29  ? 9.424   16.623  -5.854  1.00 0.00 ? 29  ASP A OD1  6  
ATOM 8776  O OD2  . ASP A 1 29  ? 7.610   17.861  -5.760  1.00 0.00 ? 29  ASP A OD2  6  
ATOM 8777  H H    . ASP A 1 29  ? 9.583   15.790  -3.873  1.00 0.00 ? 29  ASP A H    6  
ATOM 8778  H HA   . ASP A 1 29  ? 6.855   15.996  -3.146  1.00 0.00 ? 29  ASP A HA   6  
ATOM 8779  H HB2  . ASP A 1 29  ? 7.771   14.695  -5.693  1.00 0.00 ? 29  ASP A HB2  6  
ATOM 8780  H HB3  . ASP A 1 29  ? 6.370   15.726  -5.418  1.00 0.00 ? 29  ASP A HB3  6  
ATOM 8781  N N    . THR A 1 30  ? 6.069   13.733  -2.558  1.00 0.00 ? 30  THR A N    6  
ATOM 8782  C CA   . THR A 1 30  ? 5.596   12.412  -2.166  1.00 0.00 ? 30  THR A CA   6  
ATOM 8783  C C    . THR A 1 30  ? 4.113   12.245  -2.475  1.00 0.00 ? 30  THR A C    6  
ATOM 8784  O O    . THR A 1 30  ? 3.314   13.152  -2.240  1.00 0.00 ? 30  THR A O    6  
ATOM 8785  C CB   . THR A 1 30  ? 5.828   12.154  -0.665  1.00 0.00 ? 30  THR A CB   6  
ATOM 8786  O OG1  . THR A 1 30  ? 4.836   11.250  -0.164  1.00 0.00 ? 30  THR A OG1  6  
ATOM 8787  C CG2  . THR A 1 30  ? 5.778   13.456  0.122   1.00 0.00 ? 30  THR A CG2  6  
ATOM 8788  H H    . THR A 1 30  ? 5.588   14.527  -2.244  1.00 0.00 ? 30  THR A H    6  
ATOM 8789  H HA   . THR A 1 30  ? 6.156   11.677  -2.726  1.00 0.00 ? 30  THR A HA   6  
ATOM 8790  H HB   . THR A 1 30  ? 6.805   11.711  -0.537  1.00 0.00 ? 30  THR A HB   6  
ATOM 8791  H HG1  . THR A 1 30  ? 4.804   11.309  0.794   1.00 0.00 ? 30  THR A HG1  6  
ATOM 8792  H HG21 . THR A 1 30  ? 6.081   13.272  1.142   1.00 0.00 ? 30  THR A HG21 6  
ATOM 8793  H HG22 . THR A 1 30  ? 4.771   13.845  0.110   1.00 0.00 ? 30  THR A HG22 6  
ATOM 8794  H HG23 . THR A 1 30  ? 6.446   14.173  -0.329  1.00 0.00 ? 30  THR A HG23 6  
ATOM 8795  N N    . TYR A 1 31  ? 3.751   11.081  -3.003  1.00 0.00 ? 31  TYR A N    6  
ATOM 8796  C CA   . TYR A 1 31  ? 2.363   10.796  -3.346  1.00 0.00 ? 31  TYR A CA   6  
ATOM 8797  C C    . TYR A 1 31  ? 1.409   11.460  -2.357  1.00 0.00 ? 31  TYR A C    6  
ATOM 8798  O O    . TYR A 1 31  ? 0.731   12.431  -2.687  1.00 0.00 ? 31  TYR A O    6  
ATOM 8799  C CB   . TYR A 1 31  ? 2.121   9.286   -3.370  1.00 0.00 ? 31  TYR A CB   6  
ATOM 8800  C CG   . TYR A 1 31  ? 3.005   8.546   -4.348  1.00 0.00 ? 31  TYR A CG   6  
ATOM 8801  C CD1  . TYR A 1 31  ? 3.213   9.032   -5.632  1.00 0.00 ? 31  TYR A CD1  6  
ATOM 8802  C CD2  . TYR A 1 31  ? 3.634   7.361   -3.986  1.00 0.00 ? 31  TYR A CD2  6  
ATOM 8803  C CE1  . TYR A 1 31  ? 4.020   8.359   -6.529  1.00 0.00 ? 31  TYR A CE1  6  
ATOM 8804  C CE2  . TYR A 1 31  ? 4.444   6.682   -4.876  1.00 0.00 ? 31  TYR A CE2  6  
ATOM 8805  C CZ   . TYR A 1 31  ? 4.633   7.185   -6.146  1.00 0.00 ? 31  TYR A CZ   6  
ATOM 8806  O OH   . TYR A 1 31  ? 5.439   6.512   -7.036  1.00 0.00 ? 31  TYR A OH   6  
ATOM 8807  H H    . TYR A 1 31  ? 4.433   10.397  -3.167  1.00 0.00 ? 31  TYR A H    6  
ATOM 8808  H HA   . TYR A 1 31  ? 2.176   11.196  -4.332  1.00 0.00 ? 31  TYR A HA   6  
ATOM 8809  H HB2  . TYR A 1 31  ? 2.306   8.883   -2.386  1.00 0.00 ? 31  TYR A HB2  6  
ATOM 8810  H HB3  . TYR A 1 31  ? 1.093   9.097   -3.643  1.00 0.00 ? 31  TYR A HB3  6  
ATOM 8811  H HD1  . TYR A 1 31  ? 2.731   9.953   -5.929  1.00 0.00 ? 31  TYR A HD1  6  
ATOM 8812  H HD2  . TYR A 1 31  ? 3.484   6.970   -2.990  1.00 0.00 ? 31  TYR A HD2  6  
ATOM 8813  H HE1  . TYR A 1 31  ? 4.168   8.753   -7.524  1.00 0.00 ? 31  TYR A HE1  6  
ATOM 8814  H HE2  . TYR A 1 31  ? 4.925   5.762   -4.577  1.00 0.00 ? 31  TYR A HE2  6  
ATOM 8815  H HH   . TYR A 1 31  ? 5.054   6.560   -7.915  1.00 0.00 ? 31  TYR A HH   6  
ATOM 8816  N N    . GLY A 1 32  ? 1.365   10.927  -1.139  1.00 0.00 ? 32  GLY A N    6  
ATOM 8817  C CA   . GLY A 1 32  ? 0.493   11.479  -0.119  1.00 0.00 ? 32  GLY A CA   6  
ATOM 8818  C C    . GLY A 1 32  ? -0.629  10.533  0.259   1.00 0.00 ? 32  GLY A C    6  
ATOM 8819  O O    . GLY A 1 32  ? -1.323  10.746  1.254   1.00 0.00 ? 32  GLY A O    6  
ATOM 8820  H H    . GLY A 1 32  ? 1.929   10.152  -0.932  1.00 0.00 ? 32  GLY A H    6  
ATOM 8821  H HA2  . GLY A 1 32  ? 1.079   11.696  0.761   1.00 0.00 ? 32  GLY A HA2  6  
ATOM 8822  H HA3  . GLY A 1 32  ? 0.064   12.399  -0.489  1.00 0.00 ? 32  GLY A HA3  6  
ATOM 8823  N N    . PHE A 1 33  ? -0.811  9.485   -0.538  1.00 0.00 ? 33  PHE A N    6  
ATOM 8824  C CA   . PHE A 1 33  ? -1.859  8.504   -0.283  1.00 0.00 ? 33  PHE A CA   6  
ATOM 8825  C C    . PHE A 1 33  ? -1.280  7.240   0.347   1.00 0.00 ? 33  PHE A C    6  
ATOM 8826  O O    . PHE A 1 33  ? -0.247  6.733   -0.090  1.00 0.00 ? 33  PHE A O    6  
ATOM 8827  C CB   . PHE A 1 33  ? -2.585  8.152   -1.583  1.00 0.00 ? 33  PHE A CB   6  
ATOM 8828  C CG   . PHE A 1 33  ? -1.976  6.991   -2.315  1.00 0.00 ? 33  PHE A CG   6  
ATOM 8829  C CD1  . PHE A 1 33  ? -0.654  7.032   -2.729  1.00 0.00 ? 33  PHE A CD1  6  
ATOM 8830  C CD2  . PHE A 1 33  ? -2.724  5.858   -2.589  1.00 0.00 ? 33  PHE A CD2  6  
ATOM 8831  C CE1  . PHE A 1 33  ? -0.091  5.965   -3.403  1.00 0.00 ? 33  PHE A CE1  6  
ATOM 8832  C CE2  . PHE A 1 33  ? -2.166  4.787   -3.263  1.00 0.00 ? 33  PHE A CE2  6  
ATOM 8833  C CZ   . PHE A 1 33  ? -0.848  4.841   -3.669  1.00 0.00 ? 33  PHE A CZ   6  
ATOM 8834  H H    . PHE A 1 33  ? -0.226  9.369   -1.316  1.00 0.00 ? 33  PHE A H    6  
ATOM 8835  H HA   . PHE A 1 33  ? -2.564  8.944   0.405   1.00 0.00 ? 33  PHE A HA   6  
ATOM 8836  H HB2  . PHE A 1 33  ? -3.611  7.900   -1.358  1.00 0.00 ? 33  PHE A HB2  6  
ATOM 8837  H HB3  . PHE A 1 33  ? -2.565  9.008   -2.241  1.00 0.00 ? 33  PHE A HB3  6  
ATOM 8838  H HD1  . PHE A 1 33  ? -0.060  7.910   -2.520  1.00 0.00 ? 33  PHE A HD1  6  
ATOM 8839  H HD2  . PHE A 1 33  ? -3.757  5.815   -2.271  1.00 0.00 ? 33  PHE A HD2  6  
ATOM 8840  H HE1  . PHE A 1 33  ? 0.941   6.009   -3.719  1.00 0.00 ? 33  PHE A HE1  6  
ATOM 8841  H HE2  . PHE A 1 33  ? -2.761  3.910   -3.469  1.00 0.00 ? 33  PHE A HE2  6  
ATOM 8842  H HZ   . PHE A 1 33  ? -0.410  4.006   -4.196  1.00 0.00 ? 33  PHE A HZ   6  
ATOM 8843  N N    . SER A 1 34  ? -1.954  6.737   1.377   1.00 0.00 ? 34  SER A N    6  
ATOM 8844  C CA   . SER A 1 34  ? -1.505  5.536   2.070   1.00 0.00 ? 34  SER A CA   6  
ATOM 8845  C C    . SER A 1 34  ? -2.408  4.351   1.744   1.00 0.00 ? 34  SER A C    6  
ATOM 8846  O O    . SER A 1 34  ? -3.509  4.520   1.218   1.00 0.00 ? 34  SER A O    6  
ATOM 8847  C CB   . SER A 1 34  ? -1.481  5.773   3.582   1.00 0.00 ? 34  SER A CB   6  
ATOM 8848  O OG   . SER A 1 34  ? -0.685  4.801   4.238   1.00 0.00 ? 34  SER A OG   6  
ATOM 8849  H H    . SER A 1 34  ? -2.771  7.187   1.678   1.00 0.00 ? 34  SER A H    6  
ATOM 8850  H HA   . SER A 1 34  ? -0.503  5.313   1.733   1.00 0.00 ? 34  SER A HA   6  
ATOM 8851  H HB2  . SER A 1 34  ? -1.071  6.751   3.784   1.00 0.00 ? 34  SER A HB2  6  
ATOM 8852  H HB3  . SER A 1 34  ? -2.488  5.717   3.968   1.00 0.00 ? 34  SER A HB3  6  
ATOM 8853  H HG   . SER A 1 34  ? -1.215  4.344   4.895   1.00 0.00 ? 34  SER A HG   6  
ATOM 8854  N N    . LEU A 1 35  ? -1.936  3.150   2.060   1.00 0.00 ? 35  LEU A N    6  
ATOM 8855  C CA   . LEU A 1 35  ? -2.700  1.935   1.802   1.00 0.00 ? 35  LEU A CA   6  
ATOM 8856  C C    . LEU A 1 35  ? -3.002  1.195   3.101   1.00 0.00 ? 35  LEU A C    6  
ATOM 8857  O O    . LEU A 1 35  ? -2.104  0.933   3.901   1.00 0.00 ? 35  LEU A O    6  
ATOM 8858  C CB   . LEU A 1 35  ? -1.931  1.019   0.847   1.00 0.00 ? 35  LEU A CB   6  
ATOM 8859  C CG   . LEU A 1 35  ? -2.012  1.378   -0.637  1.00 0.00 ? 35  LEU A CG   6  
ATOM 8860  C CD1  . LEU A 1 35  ? -0.932  0.650   -1.422  1.00 0.00 ? 35  LEU A CD1  6  
ATOM 8861  C CD2  . LEU A 1 35  ? -3.390  1.047   -1.191  1.00 0.00 ? 35  LEU A CD2  6  
ATOM 8862  H H    . LEU A 1 35  ? -1.052  3.078   2.477   1.00 0.00 ? 35  LEU A H    6  
ATOM 8863  H HA   . LEU A 1 35  ? -3.633  2.222   1.340   1.00 0.00 ? 35  LEU A HA   6  
ATOM 8864  H HB2  . LEU A 1 35  ? -0.892  1.038   1.136   1.00 0.00 ? 35  LEU A HB2  6  
ATOM 8865  H HB3  . LEU A 1 35  ? -2.318  0.017   0.968   1.00 0.00 ? 35  LEU A HB3  6  
ATOM 8866  H HG   . LEU A 1 35  ? -1.850  2.440   -0.754  1.00 0.00 ? 35  LEU A HG   6  
ATOM 8867  H HD11 . LEU A 1 35  ? 0.017   0.767   -0.921  1.00 0.00 ? 35  LEU A HD11 6  
ATOM 8868  H HD12 . LEU A 1 35  ? -0.868  1.065   -2.416  1.00 0.00 ? 35  LEU A HD12 6  
ATOM 8869  H HD13 . LEU A 1 35  ? -1.179  -0.400  -1.486  1.00 0.00 ? 35  LEU A HD13 6  
ATOM 8870  H HD21 . LEU A 1 35  ? -3.474  -0.020  -1.336  1.00 0.00 ? 35  LEU A HD21 6  
ATOM 8871  H HD22 . LEU A 1 35  ? -3.527  1.550   -2.138  1.00 0.00 ? 35  LEU A HD22 6  
ATOM 8872  H HD23 . LEU A 1 35  ? -4.147  1.377   -0.495  1.00 0.00 ? 35  LEU A HD23 6  
ATOM 8873  N N    . SER A 1 36  ? -4.272  0.858   3.303   1.00 0.00 ? 36  SER A N    6  
ATOM 8874  C CA   . SER A 1 36  ? -4.693  0.150   4.505   1.00 0.00 ? 36  SER A CA   6  
ATOM 8875  C C    . SER A 1 36  ? -4.948  -1.325  4.206   1.00 0.00 ? 36  SER A C    6  
ATOM 8876  O O    . SER A 1 36  ? -5.667  -1.663  3.266   1.00 0.00 ? 36  SER A O    6  
ATOM 8877  C CB   . SER A 1 36  ? -5.957  0.790   5.084   1.00 0.00 ? 36  SER A CB   6  
ATOM 8878  O OG   . SER A 1 36  ? -7.052  0.650   4.196   1.00 0.00 ? 36  SER A OG   6  
ATOM 8879  H H    . SER A 1 36  ? -4.942  1.095   2.627   1.00 0.00 ? 36  SER A H    6  
ATOM 8880  H HA   . SER A 1 36  ? -3.897  0.225   5.231   1.00 0.00 ? 36  SER A HA   6  
ATOM 8881  H HB2  . SER A 1 36  ? -6.203  0.312   6.020   1.00 0.00 ? 36  SER A HB2  6  
ATOM 8882  H HB3  . SER A 1 36  ? -5.778  1.842   5.254   1.00 0.00 ? 36  SER A HB3  6  
ATOM 8883  H HG   . SER A 1 36  ? -7.043  -0.230  3.812   1.00 0.00 ? 36  SER A HG   6  
ATOM 8884  N N    . SER A 1 37  ? -4.354  -2.197  5.013   1.00 0.00 ? 37  SER A N    6  
ATOM 8885  C CA   . SER A 1 37  ? -4.512  -3.636  4.834   1.00 0.00 ? 37  SER A CA   6  
ATOM 8886  C C    . SER A 1 37  ? -5.660  -4.166  5.688   1.00 0.00 ? 37  SER A C    6  
ATOM 8887  O O    . SER A 1 37  ? -5.762  -3.855  6.875   1.00 0.00 ? 37  SER A O    6  
ATOM 8888  C CB   . SER A 1 37  ? -3.215  -4.362  5.194   1.00 0.00 ? 37  SER A CB   6  
ATOM 8889  O OG   . SER A 1 37  ? -2.084  -3.560  4.903   1.00 0.00 ? 37  SER A OG   6  
ATOM 8890  H H    . SER A 1 37  ? -3.793  -1.865  5.746   1.00 0.00 ? 37  SER A H    6  
ATOM 8891  H HA   . SER A 1 37  ? -4.739  -3.817  3.794   1.00 0.00 ? 37  SER A HA   6  
ATOM 8892  H HB2  . SER A 1 37  ? -3.216  -4.593  6.248   1.00 0.00 ? 37  SER A HB2  6  
ATOM 8893  H HB3  . SER A 1 37  ? -3.148  -5.278  4.625   1.00 0.00 ? 37  SER A HB3  6  
ATOM 8894  H HG   . SER A 1 37  ? -1.399  -3.722  5.557   1.00 0.00 ? 37  SER A HG   6  
ATOM 8895  N N    . VAL A 1 38  ? -6.522  -4.971  5.075   1.00 0.00 ? 38  VAL A N    6  
ATOM 8896  C CA   . VAL A 1 38  ? -7.662  -5.547  5.778   1.00 0.00 ? 38  VAL A CA   6  
ATOM 8897  C C    . VAL A 1 38  ? -7.815  -7.029  5.455   1.00 0.00 ? 38  VAL A C    6  
ATOM 8898  O O    . VAL A 1 38  ? -7.729  -7.434  4.296   1.00 0.00 ? 38  VAL A O    6  
ATOM 8899  C CB   . VAL A 1 38  ? -8.970  -4.817  5.419   1.00 0.00 ? 38  VAL A CB   6  
ATOM 8900  C CG1  . VAL A 1 38  ? -10.099 -5.260  6.338   1.00 0.00 ? 38  VAL A CG1  6  
ATOM 8901  C CG2  . VAL A 1 38  ? -8.775  -3.310  5.490   1.00 0.00 ? 38  VAL A CG2  6  
ATOM 8902  H H    . VAL A 1 38  ? -6.388  -5.183  4.128   1.00 0.00 ? 38  VAL A H    6  
ATOM 8903  H HA   . VAL A 1 38  ? -7.492  -5.435  6.839   1.00 0.00 ? 38  VAL A HA   6  
ATOM 8904  H HB   . VAL A 1 38  ? -9.238  -5.077  4.406   1.00 0.00 ? 38  VAL A HB   6  
ATOM 8905  H HG11 . VAL A 1 38  ? -9.694  -5.521  7.305   1.00 0.00 ? 38  VAL A HG11 6  
ATOM 8906  H HG12 . VAL A 1 38  ? -10.810 -4.455  6.449   1.00 0.00 ? 38  VAL A HG12 6  
ATOM 8907  H HG13 . VAL A 1 38  ? -10.593 -6.121  5.911   1.00 0.00 ? 38  VAL A HG13 6  
ATOM 8908  H HG21 . VAL A 1 38  ? -9.497  -2.824  4.850   1.00 0.00 ? 38  VAL A HG21 6  
ATOM 8909  H HG22 . VAL A 1 38  ? -8.915  -2.976  6.508   1.00 0.00 ? 38  VAL A HG22 6  
ATOM 8910  H HG23 . VAL A 1 38  ? -7.777  -3.060  5.163   1.00 0.00 ? 38  VAL A HG23 6  
ATOM 8911  N N    . GLU A 1 39  ? -8.044  -7.834  6.488   1.00 0.00 ? 39  GLU A N    6  
ATOM 8912  C CA   . GLU A 1 39  ? -8.209  -9.272  6.314   1.00 0.00 ? 39  GLU A CA   6  
ATOM 8913  C C    . GLU A 1 39  ? -9.621  -9.708  6.695   1.00 0.00 ? 39  GLU A C    6  
ATOM 8914  O O    . GLU A 1 39  ? -10.096 -9.416  7.792   1.00 0.00 ? 39  GLU A O    6  
ATOM 8915  C CB   . GLU A 1 39  ? -7.183  -10.032 7.157   1.00 0.00 ? 39  GLU A CB   6  
ATOM 8916  C CG   . GLU A 1 39  ? -6.775  -11.368 6.561   1.00 0.00 ? 39  GLU A CG   6  
ATOM 8917  C CD   . GLU A 1 39  ? -6.386  -12.384 7.618   1.00 0.00 ? 39  GLU A CD   6  
ATOM 8918  O OE1  . GLU A 1 39  ? -7.155  -12.559 8.585   1.00 0.00 ? 39  GLU A OE1  6  
ATOM 8919  O OE2  . GLU A 1 39  ? -5.311  -13.004 7.476   1.00 0.00 ? 39  GLU A OE2  6  
ATOM 8920  H H    . GLU A 1 39  ? -8.103  -7.452  7.389   1.00 0.00 ? 39  GLU A H    6  
ATOM 8921  H HA   . GLU A 1 39  ? -8.044  -9.501  5.271   1.00 0.00 ? 39  GLU A HA   6  
ATOM 8922  H HB2  . GLU A 1 39  ? -6.298  -9.422  7.262   1.00 0.00 ? 39  GLU A HB2  6  
ATOM 8923  H HB3  . GLU A 1 39  ? -7.603  -10.212 8.136   1.00 0.00 ? 39  GLU A HB3  6  
ATOM 8924  H HG2  . GLU A 1 39  ? -7.603  -11.763 5.993   1.00 0.00 ? 39  GLU A HG2  6  
ATOM 8925  H HG3  . GLU A 1 39  ? -5.931  -11.212 5.905   1.00 0.00 ? 39  GLU A HG3  6  
ATOM 8926  N N    . GLU A 1 40  ? -10.285 -10.408 5.780   1.00 0.00 ? 40  GLU A N    6  
ATOM 8927  C CA   . GLU A 1 40  ? -11.643 -10.883 6.021   1.00 0.00 ? 40  GLU A CA   6  
ATOM 8928  C C    . GLU A 1 40  ? -11.799 -12.333 5.572   1.00 0.00 ? 40  GLU A C    6  
ATOM 8929  O O    . GLU A 1 40  ? -11.744 -12.635 4.380   1.00 0.00 ? 40  GLU A O    6  
ATOM 8930  C CB   . GLU A 1 40  ? -12.653 -9.999  5.287   1.00 0.00 ? 40  GLU A CB   6  
ATOM 8931  C CG   . GLU A 1 40  ? -12.759 -8.594  5.856   1.00 0.00 ? 40  GLU A CG   6  
ATOM 8932  C CD   . GLU A 1 40  ? -13.630 -8.531  7.095   1.00 0.00 ? 40  GLU A CD   6  
ATOM 8933  O OE1  . GLU A 1 40  ? -14.846 -8.794  6.979   1.00 0.00 ? 40  GLU A OE1  6  
ATOM 8934  O OE2  . GLU A 1 40  ? -13.098 -8.217  8.180   1.00 0.00 ? 40  GLU A OE2  6  
ATOM 8935  H H    . GLU A 1 40  ? -9.852  -10.609 4.924   1.00 0.00 ? 40  GLU A H    6  
ATOM 8936  H HA   . GLU A 1 40  ? -11.831 -10.825 7.082   1.00 0.00 ? 40  GLU A HA   6  
ATOM 8937  H HB2  . GLU A 1 40  ? -12.362 -9.924  4.249   1.00 0.00 ? 40  GLU A HB2  6  
ATOM 8938  H HB3  . GLU A 1 40  ? -13.627 -10.462 5.345   1.00 0.00 ? 40  GLU A HB3  6  
ATOM 8939  H HG2  . GLU A 1 40  ? -11.769 -8.248  6.113   1.00 0.00 ? 40  GLU A HG2  6  
ATOM 8940  H HG3  . GLU A 1 40  ? -13.182 -7.945  5.103   1.00 0.00 ? 40  GLU A HG3  6  
ATOM 8941  N N    . ASP A 1 41  ? -11.994 -13.226 6.536   1.00 0.00 ? 41  ASP A N    6  
ATOM 8942  C CA   . ASP A 1 41  ? -12.159 -14.645 6.241   1.00 0.00 ? 41  ASP A CA   6  
ATOM 8943  C C    . ASP A 1 41  ? -10.919 -15.205 5.552   1.00 0.00 ? 41  ASP A C    6  
ATOM 8944  O O    . ASP A 1 41  ? -11.019 -16.031 4.646   1.00 0.00 ? 41  ASP A O    6  
ATOM 8945  C CB   . ASP A 1 41  ? -13.390 -14.865 5.360   1.00 0.00 ? 41  ASP A CB   6  
ATOM 8946  C CG   . ASP A 1 41  ? -14.687 -14.611 6.104   1.00 0.00 ? 41  ASP A CG   6  
ATOM 8947  O OD1  . ASP A 1 41  ? -15.118 -15.502 6.865   1.00 0.00 ? 41  ASP A OD1  6  
ATOM 8948  O OD2  . ASP A 1 41  ? -15.271 -13.521 5.923   1.00 0.00 ? 41  ASP A OD2  6  
ATOM 8949  H H    . ASP A 1 41  ? -12.029 -12.924 7.468   1.00 0.00 ? 41  ASP A H    6  
ATOM 8950  H HA   . ASP A 1 41  ? -12.301 -15.164 7.177   1.00 0.00 ? 41  ASP A HA   6  
ATOM 8951  H HB2  . ASP A 1 41  ? -13.344 -14.194 4.515   1.00 0.00 ? 41  ASP A HB2  6  
ATOM 8952  H HB3  . ASP A 1 41  ? -13.393 -15.885 5.006   1.00 0.00 ? 41  ASP A HB3  6  
ATOM 8953  N N    . GLY A 1 42  ? -9.748  -14.748 5.989   1.00 0.00 ? 42  GLY A N    6  
ATOM 8954  C CA   . GLY A 1 42  ? -8.505  -15.214 5.402   1.00 0.00 ? 42  GLY A CA   6  
ATOM 8955  C C    . GLY A 1 42  ? -8.160  -14.483 4.120   1.00 0.00 ? 42  GLY A C    6  
ATOM 8956  O O    . GLY A 1 42  ? -7.064  -14.643 3.582   1.00 0.00 ? 42  GLY A O    6  
ATOM 8957  H H    . GLY A 1 42  ? -9.729  -14.090 6.715   1.00 0.00 ? 42  GLY A H    6  
ATOM 8958  H HA2  . GLY A 1 42  ? -7.707  -15.067 6.114   1.00 0.00 ? 42  GLY A HA2  6  
ATOM 8959  H HA3  . GLY A 1 42  ? -8.594  -16.269 5.189   1.00 0.00 ? 42  GLY A HA3  6  
ATOM 8960  N N    . ILE A 1 43  ? -9.097  -13.680 3.627   1.00 0.00 ? 43  ILE A N    6  
ATOM 8961  C CA   . ILE A 1 43  ? -8.887  -12.923 2.400   1.00 0.00 ? 43  ILE A CA   6  
ATOM 8962  C C    . ILE A 1 43  ? -8.310  -11.543 2.697   1.00 0.00 ? 43  ILE A C    6  
ATOM 8963  O O    . ILE A 1 43  ? -9.011  -10.660 3.191   1.00 0.00 ? 43  ILE A O    6  
ATOM 8964  C CB   . ILE A 1 43  ? -10.197 -12.760 1.607   1.00 0.00 ? 43  ILE A CB   6  
ATOM 8965  C CG1  . ILE A 1 43  ? -10.799 -14.130 1.287   1.00 0.00 ? 43  ILE A CG1  6  
ATOM 8966  C CG2  . ILE A 1 43  ? -9.948  -11.973 0.329   1.00 0.00 ? 43  ILE A CG2  6  
ATOM 8967  C CD1  . ILE A 1 43  ? -12.287 -14.087 1.016   1.00 0.00 ? 43  ILE A CD1  6  
ATOM 8968  H H    . ILE A 1 43  ? -9.951  -13.595 4.101   1.00 0.00 ? 43  ILE A H    6  
ATOM 8969  H HA   . ILE A 1 43  ? -8.184  -13.471 1.788   1.00 0.00 ? 43  ILE A HA   6  
ATOM 8970  H HB   . ILE A 1 43  ? -10.892 -12.202 2.215   1.00 0.00 ? 43  ILE A HB   6  
ATOM 8971  H HG12 . ILE A 1 43  ? -10.314 -14.534 0.413   1.00 0.00 ? 43  ILE A HG12 6  
ATOM 8972  H HG13 . ILE A 1 43  ? -10.632 -14.792 2.124   1.00 0.00 ? 43  ILE A HG13 6  
ATOM 8973  H HG21 . ILE A 1 43  ? -9.548  -12.633 -0.428  1.00 0.00 ? 43  ILE A HG21 6  
ATOM 8974  H HG22 . ILE A 1 43  ? -10.878 -11.550 -0.020  1.00 0.00 ? 43  ILE A HG22 6  
ATOM 8975  H HG23 . ILE A 1 43  ? -9.242  -11.181 0.525   1.00 0.00 ? 43  ILE A HG23 6  
ATOM 8976  H HD11 . ILE A 1 43  ? -12.718 -15.056 1.220   1.00 0.00 ? 43  ILE A HD11 6  
ATOM 8977  H HD12 . ILE A 1 43  ? -12.748 -13.346 1.650   1.00 0.00 ? 43  ILE A HD12 6  
ATOM 8978  H HD13 . ILE A 1 43  ? -12.456 -13.830 -0.020  1.00 0.00 ? 43  ILE A HD13 6  
ATOM 8979  N N    . ARG A 1 44  ? -7.029  -11.365 2.391   1.00 0.00 ? 44  ARG A N    6  
ATOM 8980  C CA   . ARG A 1 44  ? -6.358  -10.092 2.625   1.00 0.00 ? 44  ARG A CA   6  
ATOM 8981  C C    . ARG A 1 44  ? -6.449  -9.195  1.394   1.00 0.00 ? 44  ARG A C    6  
ATOM 8982  O O    . ARG A 1 44  ? -6.370  -9.670  0.261   1.00 0.00 ? 44  ARG A O    6  
ATOM 8983  C CB   . ARG A 1 44  ? -4.891  -10.324 2.993   1.00 0.00 ? 44  ARG A CB   6  
ATOM 8984  C CG   . ARG A 1 44  ? -4.317  -9.257  3.911   1.00 0.00 ? 44  ARG A CG   6  
ATOM 8985  C CD   . ARG A 1 44  ? -2.817  -9.102  3.715   1.00 0.00 ? 44  ARG A CD   6  
ATOM 8986  N NE   . ARG A 1 44  ? -2.163  -8.559  4.902   1.00 0.00 ? 44  ARG A NE   6  
ATOM 8987  C CZ   . ARG A 1 44  ? -0.845  -8.526  5.065   1.00 0.00 ? 44  ARG A CZ   6  
ATOM 8988  N NH1  . ARG A 1 44  ? -0.045  -9.002  4.122   1.00 0.00 ? 44  ARG A NH1  6  
ATOM 8989  N NH2  . ARG A 1 44  ? -0.325  -8.015  6.174   1.00 0.00 ? 44  ARG A NH2  6  
ATOM 8990  H H    . ARG A 1 44  ? -6.523  -12.107 2.000   1.00 0.00 ? 44  ARG A H    6  
ATOM 8991  H HA   . ARG A 1 44  ? -6.854  -9.602  3.450   1.00 0.00 ? 44  ARG A HA   6  
ATOM 8992  H HB2  . ARG A 1 44  ? -4.803  -11.279 3.489   1.00 0.00 ? 44  ARG A HB2  6  
ATOM 8993  H HB3  . ARG A 1 44  ? -4.305  -10.343 2.087   1.00 0.00 ? 44  ARG A HB3  6  
ATOM 8994  H HG2  . ARG A 1 44  ? -4.796  -8.313  3.694   1.00 0.00 ? 44  ARG A HG2  6  
ATOM 8995  H HG3  . ARG A 1 44  ? -4.511  -9.535  4.936   1.00 0.00 ? 44  ARG A HG3  6  
ATOM 8996  H HD2  . ARG A 1 44  ? -2.394  -10.071 3.494   1.00 0.00 ? 44  ARG A HD2  6  
ATOM 8997  H HD3  . ARG A 1 44  ? -2.643  -8.436  2.882   1.00 0.00 ? 44  ARG A HD3  6  
ATOM 8998  H HE   . ARG A 1 44  ? -2.736  -8.201  5.612   1.00 0.00 ? 44  ARG A HE   6  
ATOM 8999  H HH11 . ARG A 1 44  ? -0.434  -9.387  3.285   1.00 0.00 ? 44  ARG A HH11 6  
ATOM 9000  H HH12 . ARG A 1 44  ? 0.947   -8.975  4.246   1.00 0.00 ? 44  ARG A HH12 6  
ATOM 9001  H HH21 . ARG A 1 44  ? -0.926  -7.655  6.888   1.00 0.00 ? 44  ARG A HH21 6  
ATOM 9002  H HH22 . ARG A 1 44  ? 0.666   -7.991  6.296   1.00 0.00 ? 44  ARG A HH22 6  
ATOM 9003  N N    . ARG A 1 45  ? -6.616  -7.897  1.625   1.00 0.00 ? 45  ARG A N    6  
ATOM 9004  C CA   . ARG A 1 45  ? -6.719  -6.934  0.535   1.00 0.00 ? 45  ARG A CA   6  
ATOM 9005  C C    . ARG A 1 45  ? -6.293  -5.543  0.995   1.00 0.00 ? 45  ARG A C    6  
ATOM 9006  O O    . ARG A 1 45  ? -6.208  -5.274  2.194   1.00 0.00 ? 45  ARG A O    6  
ATOM 9007  C CB   . ARG A 1 45  ? -8.152  -6.889  0.000   1.00 0.00 ? 45  ARG A CB   6  
ATOM 9008  C CG   . ARG A 1 45  ? -8.572  -8.158  -0.724  1.00 0.00 ? 45  ARG A CG   6  
ATOM 9009  C CD   . ARG A 1 45  ? -9.963  -8.024  -1.322  1.00 0.00 ? 45  ARG A CD   6  
ATOM 9010  N NE   . ARG A 1 45  ? -10.359 -9.219  -2.062  1.00 0.00 ? 45  ARG A NE   6  
ATOM 9011  C CZ   . ARG A 1 45  ? -9.901  -9.520  -3.272  1.00 0.00 ? 45  ARG A CZ   6  
ATOM 9012  N NH1  . ARG A 1 45  ? -9.036  -8.716  -3.876  1.00 0.00 ? 45  ARG A NH1  6  
ATOM 9013  N NH2  . ARG A 1 45  ? -10.308 -10.626 -3.881  1.00 0.00 ? 45  ARG A NH2  6  
ATOM 9014  H H    . ARG A 1 45  ? -6.671  -7.579  2.550   1.00 0.00 ? 45  ARG A H    6  
ATOM 9015  H HA   . ARG A 1 45  ? -6.059  -7.256  -0.257  1.00 0.00 ? 45  ARG A HA   6  
ATOM 9016  H HB2  . ARG A 1 45  ? -8.828  -6.733  0.827   1.00 0.00 ? 45  ARG A HB2  6  
ATOM 9017  H HB3  . ARG A 1 45  ? -8.240  -6.062  -0.689  1.00 0.00 ? 45  ARG A HB3  6  
ATOM 9018  H HG2  . ARG A 1 45  ? -7.868  -8.358  -1.518  1.00 0.00 ? 45  ARG A HG2  6  
ATOM 9019  H HG3  . ARG A 1 45  ? -8.569  -8.979  -0.022  1.00 0.00 ? 45  ARG A HG3  6  
ATOM 9020  H HD2  . ARG A 1 45  ? -10.670 -7.856  -0.523  1.00 0.00 ? 45  ARG A HD2  6  
ATOM 9021  H HD3  . ARG A 1 45  ? -9.971  -7.177  -1.993  1.00 0.00 ? 45  ARG A HD3  6  
ATOM 9022  H HE   . ARG A 1 45  ? -10.997 -9.827  -1.634  1.00 0.00 ? 45  ARG A HE   6  
ATOM 9023  H HH11 . ARG A 1 45  ? -8.727  -7.883  -3.419  1.00 0.00 ? 45  ARG A HH11 6  
ATOM 9024  H HH12 . ARG A 1 45  ? -8.692  -8.946  -4.787  1.00 0.00 ? 45  ARG A HH12 6  
ATOM 9025  H HH21 . ARG A 1 45  ? -10.960 -11.234 -3.429  1.00 0.00 ? 45  ARG A HH21 6  
ATOM 9026  H HH22 . ARG A 1 45  ? -9.964  -10.851 -4.792  1.00 0.00 ? 45  ARG A HH22 6  
ATOM 9027  N N    . LEU A 1 46  ? -6.025  -4.664  0.036   1.00 0.00 ? 46  LEU A N    6  
ATOM 9028  C CA   . LEU A 1 46  ? -5.607  -3.301  0.343   1.00 0.00 ? 46  LEU A CA   6  
ATOM 9029  C C    . LEU A 1 46  ? -6.676  -2.296  -0.077  1.00 0.00 ? 46  LEU A C    6  
ATOM 9030  O O    . LEU A 1 46  ? -7.479  -2.565  -0.970  1.00 0.00 ? 46  LEU A O    6  
ATOM 9031  C CB   . LEU A 1 46  ? -4.287  -2.981  -0.360  1.00 0.00 ? 46  LEU A CB   6  
ATOM 9032  C CG   . LEU A 1 46  ? -3.014  -3.366  0.395   1.00 0.00 ? 46  LEU A CG   6  
ATOM 9033  C CD1  . LEU A 1 46  ? -2.851  -2.507  1.640   1.00 0.00 ? 46  LEU A CD1  6  
ATOM 9034  C CD2  . LEU A 1 46  ? -3.039  -4.842  0.763   1.00 0.00 ? 46  LEU A CD2  6  
ATOM 9035  H H    . LEU A 1 46  ? -6.111  -4.937  -0.901  1.00 0.00 ? 46  LEU A H    6  
ATOM 9036  H HA   . LEU A 1 46  ? -5.464  -3.230  1.411   1.00 0.00 ? 46  LEU A HA   6  
ATOM 9037  H HB2  . LEU A 1 46  ? -4.281  -3.502  -1.305  1.00 0.00 ? 46  LEU A HB2  6  
ATOM 9038  H HB3  . LEU A 1 46  ? -4.258  -1.915  -0.538  1.00 0.00 ? 46  LEU A HB3  6  
ATOM 9039  H HG   . LEU A 1 46  ? -2.158  -3.193  -0.243  1.00 0.00 ? 46  LEU A HG   6  
ATOM 9040  H HD11 . LEU A 1 46  ? -1.933  -1.944  1.571   1.00 0.00 ? 46  LEU A HD11 6  
ATOM 9041  H HD12 . LEU A 1 46  ? -2.820  -3.142  2.513   1.00 0.00 ? 46  LEU A HD12 6  
ATOM 9042  H HD13 . LEU A 1 46  ? -3.687  -1.827  1.720   1.00 0.00 ? 46  LEU A HD13 6  
ATOM 9043  H HD21 . LEU A 1 46  ? -3.380  -4.953  1.782   1.00 0.00 ? 46  LEU A HD21 6  
ATOM 9044  H HD22 . LEU A 1 46  ? -2.043  -5.253  0.670   1.00 0.00 ? 46  LEU A HD22 6  
ATOM 9045  H HD23 . LEU A 1 46  ? -3.709  -5.368  0.099   1.00 0.00 ? 46  LEU A HD23 6  
ATOM 9046  N N    . TYR A 1 47  ? -6.678  -1.137  0.573   1.00 0.00 ? 47  TYR A N    6  
ATOM 9047  C CA   . TYR A 1 47  ? -7.648  -0.092  0.267   1.00 0.00 ? 47  TYR A CA   6  
ATOM 9048  C C    . TYR A 1 47  ? -7.055  1.291   0.517   1.00 0.00 ? 47  TYR A C    6  
ATOM 9049  O O    . TYR A 1 47  ? -6.211  1.468   1.395   1.00 0.00 ? 47  TYR A O    6  
ATOM 9050  C CB   . TYR A 1 47  ? -8.911  -0.277  1.110   1.00 0.00 ? 47  TYR A CB   6  
ATOM 9051  C CG   . TYR A 1 47  ? -9.537  -1.647  0.970   1.00 0.00 ? 47  TYR A CG   6  
ATOM 9052  C CD1  . TYR A 1 47  ? -10.460 -1.911  -0.034  1.00 0.00 ? 47  TYR A CD1  6  
ATOM 9053  C CD2  . TYR A 1 47  ? -9.204  -2.676  1.842   1.00 0.00 ? 47  TYR A CD2  6  
ATOM 9054  C CE1  . TYR A 1 47  ? -11.035 -3.161  -0.165  1.00 0.00 ? 47  TYR A CE1  6  
ATOM 9055  C CE2  . TYR A 1 47  ? -9.773  -3.929  1.717   1.00 0.00 ? 47  TYR A CE2  6  
ATOM 9056  C CZ   . TYR A 1 47  ? -10.688 -4.166  0.712   1.00 0.00 ? 47  TYR A CZ   6  
ATOM 9057  O OH   . TYR A 1 47  ? -11.257 -5.413  0.584   1.00 0.00 ? 47  TYR A OH   6  
ATOM 9058  H H    . TYR A 1 47  ? -6.013  -0.981  1.275   1.00 0.00 ? 47  TYR A H    6  
ATOM 9059  H HA   . TYR A 1 47  ? -7.909  -0.176  -0.778  1.00 0.00 ? 47  TYR A HA   6  
ATOM 9060  H HB2  . TYR A 1 47  ? -8.666  -0.130  2.150   1.00 0.00 ? 47  TYR A HB2  6  
ATOM 9061  H HB3  . TYR A 1 47  ? -9.646  0.456   0.811   1.00 0.00 ? 47  TYR A HB3  6  
ATOM 9062  H HD1  . TYR A 1 47  ? -10.729 -1.121  -0.721  1.00 0.00 ? 47  TYR A HD1  6  
ATOM 9063  H HD2  . TYR A 1 47  ? -8.488  -2.488  2.628   1.00 0.00 ? 47  TYR A HD2  6  
ATOM 9064  H HE1  . TYR A 1 47  ? -11.751 -3.346  -0.952  1.00 0.00 ? 47  TYR A HE1  6  
ATOM 9065  H HE2  . TYR A 1 47  ? -9.502  -4.717  2.405   1.00 0.00 ? 47  TYR A HE2  6  
ATOM 9066  H HH   . TYR A 1 47  ? -11.270 -5.848  1.440   1.00 0.00 ? 47  TYR A HH   6  
ATOM 9067  N N    . VAL A 1 48  ? -7.504  2.270   -0.262  1.00 0.00 ? 48  VAL A N    6  
ATOM 9068  C CA   . VAL A 1 48  ? -7.021  3.639   -0.126  1.00 0.00 ? 48  VAL A CA   6  
ATOM 9069  C C    . VAL A 1 48  ? -7.655  4.328   1.077   1.00 0.00 ? 48  VAL A C    6  
ATOM 9070  O O    . VAL A 1 48  ? -8.812  4.745   1.028   1.00 0.00 ? 48  VAL A O    6  
ATOM 9071  C CB   . VAL A 1 48  ? -7.314  4.466   -1.392  1.00 0.00 ? 48  VAL A CB   6  
ATOM 9072  C CG1  . VAL A 1 48  ? -6.605  5.810   -1.327  1.00 0.00 ? 48  VAL A CG1  6  
ATOM 9073  C CG2  . VAL A 1 48  ? -6.902  3.697   -2.638  1.00 0.00 ? 48  VAL A CG2  6  
ATOM 9074  H H    . VAL A 1 48  ? -8.178  2.067   -0.944  1.00 0.00 ? 48  VAL A H    6  
ATOM 9075  H HA   . VAL A 1 48  ? -5.950  3.602   0.015   1.00 0.00 ? 48  VAL A HA   6  
ATOM 9076  H HB   . VAL A 1 48  ? -8.377  4.647   -1.441  1.00 0.00 ? 48  VAL A HB   6  
ATOM 9077  H HG11 . VAL A 1 48  ? -5.811  5.764   -0.596  1.00 0.00 ? 48  VAL A HG11 6  
ATOM 9078  H HG12 . VAL A 1 48  ? -6.191  6.047   -2.296  1.00 0.00 ? 48  VAL A HG12 6  
ATOM 9079  H HG13 . VAL A 1 48  ? -7.312  6.576   -1.040  1.00 0.00 ? 48  VAL A HG13 6  
ATOM 9080  H HG21 . VAL A 1 48  ? -7.303  2.695   -2.591  1.00 0.00 ? 48  VAL A HG21 6  
ATOM 9081  H HG22 . VAL A 1 48  ? -7.286  4.198   -3.514  1.00 0.00 ? 48  VAL A HG22 6  
ATOM 9082  H HG23 . VAL A 1 48  ? -5.824  3.651   -2.693  1.00 0.00 ? 48  VAL A HG23 6  
ATOM 9083  N N    . ASN A 1 49  ? -6.889  4.446   2.157   1.00 0.00 ? 49  ASN A N    6  
ATOM 9084  C CA   . ASN A 1 49  ? -7.376  5.086   3.373   1.00 0.00 ? 49  ASN A CA   6  
ATOM 9085  C C    . ASN A 1 49  ? -7.520  6.592   3.176   1.00 0.00 ? 49  ASN A C    6  
ATOM 9086  O O    . ASN A 1 49  ? -8.556  7.174   3.497   1.00 0.00 ? 49  ASN A O    6  
ATOM 9087  C CB   . ASN A 1 49  ? -6.427  4.801   4.539   1.00 0.00 ? 49  ASN A CB   6  
ATOM 9088  C CG   . ASN A 1 49  ? -6.507  5.861   5.621   1.00 0.00 ? 49  ASN A CG   6  
ATOM 9089  O OD1  . ASN A 1 49  ? -7.506  5.962   6.333   1.00 0.00 ? 49  ASN A OD1  6  
ATOM 9090  N ND2  . ASN A 1 49  ? -5.451  6.656   5.750   1.00 0.00 ? 49  ASN A ND2  6  
ATOM 9091  H H    . ASN A 1 49  ? -5.975  4.094   2.135   1.00 0.00 ? 49  ASN A H    6  
ATOM 9092  H HA   . ASN A 1 49  ? -8.346  4.670   3.601   1.00 0.00 ? 49  ASN A HA   6  
ATOM 9093  H HB2  . ASN A 1 49  ? -6.681  3.847   4.977   1.00 0.00 ? 49  ASN A HB2  6  
ATOM 9094  H HB3  . ASN A 1 49  ? -5.413  4.765   4.170   1.00 0.00 ? 49  ASN A HB3  6  
ATOM 9095  H HD21 . ASN A 1 49  ? -4.690  6.517   5.147   1.00 0.00 ? 49  ASN A HD21 6  
ATOM 9096  H HD22 . ASN A 1 49  ? -5.476  7.349   6.442   1.00 0.00 ? 49  ASN A HD22 6  
ATOM 9097  N N    . SER A 1 50  ? -6.474  7.216   2.645   1.00 0.00 ? 50  SER A N    6  
ATOM 9098  C CA   . SER A 1 50  ? -6.482  8.655   2.407   1.00 0.00 ? 50  SER A CA   6  
ATOM 9099  C C    . SER A 1 50  ? -5.788  8.992   1.091   1.00 0.00 ? 50  SER A C    6  
ATOM 9100  O O    . SER A 1 50  ? -4.901  8.267   0.640   1.00 0.00 ? 50  SER A O    6  
ATOM 9101  C CB   . SER A 1 50  ? -5.796  9.388   3.562   1.00 0.00 ? 50  SER A CB   6  
ATOM 9102  O OG   . SER A 1 50  ? -6.337  10.686  3.735   1.00 0.00 ? 50  SER A OG   6  
ATOM 9103  H H    . SER A 1 50  ? -5.676  6.697   2.410   1.00 0.00 ? 50  SER A H    6  
ATOM 9104  H HA   . SER A 1 50  ? -7.512  8.975   2.350   1.00 0.00 ? 50  SER A HA   6  
ATOM 9105  H HB2  . SER A 1 50  ? -5.935  8.828   4.474   1.00 0.00 ? 50  SER A HB2  6  
ATOM 9106  H HB3  . SER A 1 50  ? -4.740  9.476   3.351   1.00 0.00 ? 50  SER A HB3  6  
ATOM 9107  H HG   . SER A 1 50  ? -6.289  10.932  4.662   1.00 0.00 ? 50  SER A HG   6  
ATOM 9108  N N    . VAL A 1 51  ? -6.198  10.099  0.480   1.00 0.00 ? 51  VAL A N    6  
ATOM 9109  C CA   . VAL A 1 51  ? -5.615  10.534  -0.784  1.00 0.00 ? 51  VAL A CA   6  
ATOM 9110  C C    . VAL A 1 51  ? -5.152  11.985  -0.705  1.00 0.00 ? 51  VAL A C    6  
ATOM 9111  O O    . VAL A 1 51  ? -5.675  12.773  0.084   1.00 0.00 ? 51  VAL A O    6  
ATOM 9112  C CB   . VAL A 1 51  ? -6.619  10.390  -1.944  1.00 0.00 ? 51  VAL A CB   6  
ATOM 9113  C CG1  . VAL A 1 51  ? -6.065  11.024  -3.211  1.00 0.00 ? 51  VAL A CG1  6  
ATOM 9114  C CG2  . VAL A 1 51  ? -6.958  8.925   -2.175  1.00 0.00 ? 51  VAL A CG2  6  
ATOM 9115  H H    . VAL A 1 51  ? -6.908  10.636  0.889   1.00 0.00 ? 51  VAL A H    6  
ATOM 9116  H HA   . VAL A 1 51  ? -4.762  9.905   -0.993  1.00 0.00 ? 51  VAL A HA   6  
ATOM 9117  H HB   . VAL A 1 51  ? -7.526  10.910  -1.674  1.00 0.00 ? 51  VAL A HB   6  
ATOM 9118  H HG11 . VAL A 1 51  ? -5.025  10.755  -3.323  1.00 0.00 ? 51  VAL A HG11 6  
ATOM 9119  H HG12 . VAL A 1 51  ? -6.624  10.669  -4.065  1.00 0.00 ? 51  VAL A HG12 6  
ATOM 9120  H HG13 . VAL A 1 51  ? -6.153  12.098  -3.144  1.00 0.00 ? 51  VAL A HG13 6  
ATOM 9121  H HG21 . VAL A 1 51  ? -8.001  8.758   -1.951  1.00 0.00 ? 51  VAL A HG21 6  
ATOM 9122  H HG22 . VAL A 1 51  ? -6.766  8.669   -3.207  1.00 0.00 ? 51  VAL A HG22 6  
ATOM 9123  H HG23 . VAL A 1 51  ? -6.348  8.308   -1.532  1.00 0.00 ? 51  VAL A HG23 6  
ATOM 9124  N N    . LYS A 1 52  ? -4.168  12.331  -1.527  1.00 0.00 ? 52  LYS A N    6  
ATOM 9125  C CA   . LYS A 1 52  ? -3.634  13.688  -1.553  1.00 0.00 ? 52  LYS A CA   6  
ATOM 9126  C C    . LYS A 1 52  ? -4.539  14.614  -2.360  1.00 0.00 ? 52  LYS A C    6  
ATOM 9127  O O    . LYS A 1 52  ? -5.169  14.191  -3.329  1.00 0.00 ? 52  LYS A O    6  
ATOM 9128  C CB   . LYS A 1 52  ? -2.224  13.692  -2.147  1.00 0.00 ? 52  LYS A CB   6  
ATOM 9129  C CG   . LYS A 1 52  ? -1.689  15.084  -2.436  1.00 0.00 ? 52  LYS A CG   6  
ATOM 9130  C CD   . LYS A 1 52  ? -0.336  15.029  -3.126  1.00 0.00 ? 52  LYS A CD   6  
ATOM 9131  C CE   . LYS A 1 52  ? 0.803   15.022  -2.118  1.00 0.00 ? 52  LYS A CE   6  
ATOM 9132  N NZ   . LYS A 1 52  ? 1.145   16.396  -1.657  1.00 0.00 ? 52  LYS A NZ   6  
ATOM 9133  H H    . LYS A 1 52  ? -3.792  11.658  -2.133  1.00 0.00 ? 52  LYS A H    6  
ATOM 9134  H HA   . LYS A 1 52  ? -3.588  14.046  -0.536  1.00 0.00 ? 52  LYS A HA   6  
ATOM 9135  H HB2  . LYS A 1 52  ? -1.553  13.208  -1.453  1.00 0.00 ? 52  LYS A HB2  6  
ATOM 9136  H HB3  . LYS A 1 52  ? -2.234  13.134  -3.072  1.00 0.00 ? 52  LYS A HB3  6  
ATOM 9137  H HG2  . LYS A 1 52  ? -2.387  15.602  -3.077  1.00 0.00 ? 52  LYS A HG2  6  
ATOM 9138  H HG3  . LYS A 1 52  ? -1.587  15.621  -1.504  1.00 0.00 ? 52  LYS A HG3  6  
ATOM 9139  H HD2  . LYS A 1 52  ? -0.281  14.130  -3.721  1.00 0.00 ? 52  LYS A HD2  6  
ATOM 9140  H HD3  . LYS A 1 52  ? -0.233  15.894  -3.766  1.00 0.00 ? 52  LYS A HD3  6  
ATOM 9141  H HE2  . LYS A 1 52  ? 0.509   14.429  -1.266  1.00 0.00 ? 52  LYS A HE2  6  
ATOM 9142  H HE3  . LYS A 1 52  ? 1.673   14.580  -2.581  1.00 0.00 ? 52  LYS A HE3  6  
ATOM 9143  H HZ1  . LYS A 1 52  ? 0.639   17.101  -2.230  1.00 0.00 ? 52  LYS A HZ1  6  
ATOM 9144  H HZ2  . LYS A 1 52  ? 2.167   16.560  -1.749  1.00 0.00 ? 52  LYS A HZ2  6  
ATOM 9145  H HZ3  . LYS A 1 52  ? 0.874   16.517  -0.660  1.00 0.00 ? 52  LYS A HZ3  6  
ATOM 9146  N N    . GLU A 1 53  ? -4.597  15.878  -1.954  1.00 0.00 ? 53  GLU A N    6  
ATOM 9147  C CA   . GLU A 1 53  ? -5.425  16.863  -2.641  1.00 0.00 ? 53  GLU A CA   6  
ATOM 9148  C C    . GLU A 1 53  ? -4.717  17.398  -3.882  1.00 0.00 ? 53  GLU A C    6  
ATOM 9149  O O    . GLU A 1 53  ? -3.547  17.779  -3.829  1.00 0.00 ? 53  GLU A O    6  
ATOM 9150  C CB   . GLU A 1 53  ? -5.770  18.019  -1.699  1.00 0.00 ? 53  GLU A CB   6  
ATOM 9151  C CG   . GLU A 1 53  ? -7.050  17.800  -0.911  1.00 0.00 ? 53  GLU A CG   6  
ATOM 9152  C CD   . GLU A 1 53  ? -7.065  18.562  0.400   1.00 0.00 ? 53  GLU A CD   6  
ATOM 9153  O OE1  . GLU A 1 53  ? -6.108  18.409  1.187   1.00 0.00 ? 53  GLU A OE1  6  
ATOM 9154  O OE2  . GLU A 1 53  ? -8.035  19.311  0.639   1.00 0.00 ? 53  GLU A OE2  6  
ATOM 9155  H H    . GLU A 1 53  ? -4.072  16.155  -1.175  1.00 0.00 ? 53  GLU A H    6  
ATOM 9156  H HA   . GLU A 1 53  ? -6.338  16.374  -2.945  1.00 0.00 ? 53  GLU A HA   6  
ATOM 9157  H HB2  . GLU A 1 53  ? -4.958  18.151  -0.999  1.00 0.00 ? 53  GLU A HB2  6  
ATOM 9158  H HB3  . GLU A 1 53  ? -5.880  18.921  -2.282  1.00 0.00 ? 53  GLU A HB3  6  
ATOM 9159  H HG2  . GLU A 1 53  ? -7.887  18.128  -1.509  1.00 0.00 ? 53  GLU A HG2  6  
ATOM 9160  H HG3  . GLU A 1 53  ? -7.152  16.746  -0.699  1.00 0.00 ? 53  GLU A HG3  6  
ATOM 9161  N N    . THR A 1 54  ? -5.435  17.424  -5.001  1.00 0.00 ? 54  THR A N    6  
ATOM 9162  C CA   . THR A 1 54  ? -4.877  17.910  -6.257  1.00 0.00 ? 54  THR A CA   6  
ATOM 9163  C C    . THR A 1 54  ? -3.547  17.231  -6.567  1.00 0.00 ? 54  THR A C    6  
ATOM 9164  O O    . THR A 1 54  ? -2.642  17.845  -7.130  1.00 0.00 ? 54  THR A O    6  
ATOM 9165  C CB   . THR A 1 54  ? -4.666  19.435  -6.225  1.00 0.00 ? 54  THR A CB   6  
ATOM 9166  O OG1  . THR A 1 54  ? -3.676  19.773  -5.247  1.00 0.00 ? 54  THR A OG1  6  
ATOM 9167  C CG2  . THR A 1 54  ? -5.968  20.154  -5.904  1.00 0.00 ? 54  THR A CG2  6  
ATOM 9168  H H    . THR A 1 54  ? -6.362  17.107  -4.980  1.00 0.00 ? 54  THR A H    6  
ATOM 9169  H HA   . THR A 1 54  ? -5.579  17.681  -7.045  1.00 0.00 ? 54  THR A HA   6  
ATOM 9170  H HB   . THR A 1 54  ? -4.324  19.757  -7.198  1.00 0.00 ? 54  THR A HB   6  
ATOM 9171  H HG1  . THR A 1 54  ? -3.052  19.048  -5.160  1.00 0.00 ? 54  THR A HG1  6  
ATOM 9172  H HG21 . THR A 1 54  ? -6.649  20.055  -6.737  1.00 0.00 ? 54  THR A HG21 6  
ATOM 9173  H HG22 . THR A 1 54  ? -5.767  21.200  -5.727  1.00 0.00 ? 54  THR A HG22 6  
ATOM 9174  H HG23 . THR A 1 54  ? -6.412  19.718  -5.023  1.00 0.00 ? 54  THR A HG23 6  
ATOM 9175  N N    . GLY A 1 55  ? -3.436  15.959  -6.195  1.00 0.00 ? 55  GLY A N    6  
ATOM 9176  C CA   . GLY A 1 55  ? -2.214  15.218  -6.443  1.00 0.00 ? 55  GLY A CA   6  
ATOM 9177  C C    . GLY A 1 55  ? -2.266  14.428  -7.735  1.00 0.00 ? 55  GLY A C    6  
ATOM 9178  O O    . GLY A 1 55  ? -3.132  14.661  -8.580  1.00 0.00 ? 55  GLY A O    6  
ATOM 9179  H H    . GLY A 1 55  ? -4.191  15.521  -5.750  1.00 0.00 ? 55  GLY A H    6  
ATOM 9180  H HA2  . GLY A 1 55  ? -1.388  15.912  -6.491  1.00 0.00 ? 55  GLY A HA2  6  
ATOM 9181  H HA3  . GLY A 1 55  ? -2.048  14.534  -5.623  1.00 0.00 ? 55  GLY A HA3  6  
ATOM 9182  N N    . LEU A 1 56  ? -1.337  13.491  -7.892  1.00 0.00 ? 56  LEU A N    6  
ATOM 9183  C CA   . LEU A 1 56  ? -1.280  12.664  -9.092  1.00 0.00 ? 56  LEU A CA   6  
ATOM 9184  C C    . LEU A 1 56  ? -2.295  11.528  -9.020  1.00 0.00 ? 56  LEU A C    6  
ATOM 9185  O O    . LEU A 1 56  ? -3.160  11.398  -9.885  1.00 0.00 ? 56  LEU A O    6  
ATOM 9186  C CB   . LEU A 1 56  ? 0.128   12.094  -9.276  1.00 0.00 ? 56  LEU A CB   6  
ATOM 9187  C CG   . LEU A 1 56  ? 1.281   13.081  -9.091  1.00 0.00 ? 56  LEU A CG   6  
ATOM 9188  C CD1  . LEU A 1 56  ? 2.522   12.364  -8.584  1.00 0.00 ? 56  LEU A CD1  6  
ATOM 9189  C CD2  . LEU A 1 56  ? 1.577   13.806  -10.396 1.00 0.00 ? 56  LEU A CD2  6  
ATOM 9190  H H    . LEU A 1 56  ? -0.674  13.351  -7.184  1.00 0.00 ? 56  LEU A H    6  
ATOM 9191  H HA   . LEU A 1 56  ? -1.519  13.291  -9.938  1.00 0.00 ? 56  LEU A HA   6  
ATOM 9192  H HB2  . LEU A 1 56  ? 0.258   11.297  -8.561  1.00 0.00 ? 56  LEU A HB2  6  
ATOM 9193  H HB3  . LEU A 1 56  ? 0.193   11.692  -10.277 1.00 0.00 ? 56  LEU A HB3  6  
ATOM 9194  H HG   . LEU A 1 56  ? 0.999   13.820  -8.353  1.00 0.00 ? 56  LEU A HG   6  
ATOM 9195  H HD11 . LEU A 1 56  ? 2.661   12.582  -7.536  1.00 0.00 ? 56  LEU A HD11 6  
ATOM 9196  H HD12 . LEU A 1 56  ? 3.385   12.700  -9.140  1.00 0.00 ? 56  LEU A HD12 6  
ATOM 9197  H HD13 . LEU A 1 56  ? 2.401   11.298  -8.717  1.00 0.00 ? 56  LEU A HD13 6  
ATOM 9198  H HD21 . LEU A 1 56  ? 1.046   14.746  -10.413 1.00 0.00 ? 56  LEU A HD21 6  
ATOM 9199  H HD22 . LEU A 1 56  ? 1.256   13.196  -11.227 1.00 0.00 ? 56  LEU A HD22 6  
ATOM 9200  H HD23 . LEU A 1 56  ? 2.639   13.990  -10.472 1.00 0.00 ? 56  LEU A HD23 6  
ATOM 9201  N N    . ALA A 1 57  ? -2.184  10.708  -7.979  1.00 0.00 ? 57  ALA A N    6  
ATOM 9202  C CA   . ALA A 1 57  ? -3.095  9.585   -7.791  1.00 0.00 ? 57  ALA A CA   6  
ATOM 9203  C C    . ALA A 1 57  ? -4.525  9.972   -8.152  1.00 0.00 ? 57  ALA A C    6  
ATOM 9204  O O    . ALA A 1 57  ? -5.115  9.414   -9.076  1.00 0.00 ? 57  ALA A O    6  
ATOM 9205  C CB   . ALA A 1 57  ? -3.027  9.085   -6.356  1.00 0.00 ? 57  ALA A CB   6  
ATOM 9206  H H    . ALA A 1 57  ? -1.474  10.862  -7.322  1.00 0.00 ? 57  ALA A H    6  
ATOM 9207  H HA   . ALA A 1 57  ? -2.775  8.783   -8.441  1.00 0.00 ? 57  ALA A HA   6  
ATOM 9208  H HB1  . ALA A 1 57  ? -2.709  9.891   -5.710  1.00 0.00 ? 57  ALA A HB1  6  
ATOM 9209  H HB2  . ALA A 1 57  ? -4.003  8.740   -6.048  1.00 0.00 ? 57  ALA A HB2  6  
ATOM 9210  H HB3  . ALA A 1 57  ? -2.320  8.272   -6.291  1.00 0.00 ? 57  ALA A HB3  6  
ATOM 9211  N N    . SER A 1 58  ? -5.077  10.931  -7.415  1.00 0.00 ? 58  SER A N    6  
ATOM 9212  C CA   . SER A 1 58  ? -6.441  11.389  -7.654  1.00 0.00 ? 58  SER A CA   6  
ATOM 9213  C C    . SER A 1 58  ? -6.678  11.634  -9.141  1.00 0.00 ? 58  SER A C    6  
ATOM 9214  O O    . SER A 1 58  ? -7.630  11.114  -9.724  1.00 0.00 ? 58  SER A O    6  
ATOM 9215  C CB   . SER A 1 58  ? -6.717  12.670  -6.864  1.00 0.00 ? 58  SER A CB   6  
ATOM 9216  O OG   . SER A 1 58  ? -5.770  13.677  -7.178  1.00 0.00 ? 58  SER A OG   6  
ATOM 9217  H H    . SER A 1 58  ? -4.556  11.337  -6.691  1.00 0.00 ? 58  SER A H    6  
ATOM 9218  H HA   . SER A 1 58  ? -7.115  10.616  -7.316  1.00 0.00 ? 58  SER A HA   6  
ATOM 9219  H HB2  . SER A 1 58  ? -7.704  13.033  -7.106  1.00 0.00 ? 58  SER A HB2  6  
ATOM 9220  H HB3  . SER A 1 58  ? -6.660  12.457  -5.807  1.00 0.00 ? 58  SER A HB3  6  
ATOM 9221  H HG   . SER A 1 58  ? -6.212  14.405  -7.621  1.00 0.00 ? 58  SER A HG   6  
ATOM 9222  N N    . LYS A 1 59  ? -5.806  12.430  -9.750  1.00 0.00 ? 59  LYS A N    6  
ATOM 9223  C CA   . LYS A 1 59  ? -5.918  12.744  -11.169 1.00 0.00 ? 59  LYS A CA   6  
ATOM 9224  C C    . LYS A 1 59  ? -6.060  11.473  -11.999 1.00 0.00 ? 59  LYS A C    6  
ATOM 9225  O O    . LYS A 1 59  ? -7.048  11.291  -12.711 1.00 0.00 ? 59  LYS A O    6  
ATOM 9226  C CB   . LYS A 1 59  ? -4.693  13.535  -11.635 1.00 0.00 ? 59  LYS A CB   6  
ATOM 9227  C CG   . LYS A 1 59  ? -4.718  14.996  -11.219 1.00 0.00 ? 59  LYS A CG   6  
ATOM 9228  C CD   . LYS A 1 59  ? -3.496  15.742  -11.729 1.00 0.00 ? 59  LYS A CD   6  
ATOM 9229  C CE   . LYS A 1 59  ? -3.574  15.979  -13.229 1.00 0.00 ? 59  LYS A CE   6  
ATOM 9230  N NZ   . LYS A 1 59  ? -4.569  17.032  -13.573 1.00 0.00 ? 59  LYS A NZ   6  
ATOM 9231  H H    . LYS A 1 59  ? -5.068  12.815  -9.232  1.00 0.00 ? 59  LYS A H    6  
ATOM 9232  H HA   . LYS A 1 59  ? -6.801  13.350  -11.307 1.00 0.00 ? 59  LYS A HA   6  
ATOM 9233  H HB2  . LYS A 1 59  ? -3.806  13.080  -11.221 1.00 0.00 ? 59  LYS A HB2  6  
ATOM 9234  H HB3  . LYS A 1 59  ? -4.640  13.491  -12.714 1.00 0.00 ? 59  LYS A HB3  6  
ATOM 9235  H HG2  . LYS A 1 59  ? -5.605  15.461  -11.623 1.00 0.00 ? 59  LYS A HG2  6  
ATOM 9236  H HG3  . LYS A 1 59  ? -4.739  15.053  -10.140 1.00 0.00 ? 59  LYS A HG3  6  
ATOM 9237  H HD2  . LYS A 1 59  ? -3.433  16.697  -11.228 1.00 0.00 ? 59  LYS A HD2  6  
ATOM 9238  H HD3  . LYS A 1 59  ? -2.613  15.159  -11.510 1.00 0.00 ? 59  LYS A HD3  6  
ATOM 9239  H HE2  . LYS A 1 59  ? -2.602  16.286  -13.583 1.00 0.00 ? 59  LYS A HE2  6  
ATOM 9240  H HE3  . LYS A 1 59  ? -3.858  15.056  -13.712 1.00 0.00 ? 59  LYS A HE3  6  
ATOM 9241  H HZ1  . LYS A 1 59  ? -4.172  17.974  -13.383 1.00 0.00 ? 59  LYS A HZ1  6  
ATOM 9242  H HZ2  . LYS A 1 59  ? -5.431  16.910  -13.004 1.00 0.00 ? 59  LYS A HZ2  6  
ATOM 9243  H HZ3  . LYS A 1 59  ? -4.821  16.971  -14.581 1.00 0.00 ? 59  LYS A HZ3  6  
ATOM 9244  N N    . LYS A 1 60  ? -5.068  10.594  -11.902 1.00 0.00 ? 60  LYS A N    6  
ATOM 9245  C CA   . LYS A 1 60  ? -5.084  9.337   -12.641 1.00 0.00 ? 60  LYS A CA   6  
ATOM 9246  C C    . LYS A 1 60  ? -6.448  8.662   -12.538 1.00 0.00 ? 60  LYS A C    6  
ATOM 9247  O O    . LYS A 1 60  ? -7.112  8.425   -13.546 1.00 0.00 ? 60  LYS A O    6  
ATOM 9248  C CB   . LYS A 1 60  ? -3.997  8.398   -12.113 1.00 0.00 ? 60  LYS A CB   6  
ATOM 9249  C CG   . LYS A 1 60  ? -2.643  8.605   -12.769 1.00 0.00 ? 60  LYS A CG   6  
ATOM 9250  C CD   . LYS A 1 60  ? -2.183  10.049  -12.656 1.00 0.00 ? 60  LYS A CD   6  
ATOM 9251  C CE   . LYS A 1 60  ? -0.739  10.211  -13.106 1.00 0.00 ? 60  LYS A CE   6  
ATOM 9252  N NZ   . LYS A 1 60  ? -0.637  10.426  -14.576 1.00 0.00 ? 60  LYS A NZ   6  
ATOM 9253  H H    . LYS A 1 60  ? -4.307  10.795  -11.317 1.00 0.00 ? 60  LYS A H    6  
ATOM 9254  H HA   . LYS A 1 60  ? -4.883  9.559   -13.678 1.00 0.00 ? 60  LYS A HA   6  
ATOM 9255  H HB2  . LYS A 1 60  ? -3.886  8.556   -11.050 1.00 0.00 ? 60  LYS A HB2  6  
ATOM 9256  H HB3  . LYS A 1 60  ? -4.305  7.377   -12.286 1.00 0.00 ? 60  LYS A HB3  6  
ATOM 9257  H HG2  . LYS A 1 60  ? -1.917  7.969   -12.285 1.00 0.00 ? 60  LYS A HG2  6  
ATOM 9258  H HG3  . LYS A 1 60  ? -2.715  8.340   -13.814 1.00 0.00 ? 60  LYS A HG3  6  
ATOM 9259  H HD2  . LYS A 1 60  ? -2.813  10.668  -13.277 1.00 0.00 ? 60  LYS A HD2  6  
ATOM 9260  H HD3  . LYS A 1 60  ? -2.268  10.365  -11.626 1.00 0.00 ? 60  LYS A HD3  6  
ATOM 9261  H HE2  . LYS A 1 60  ? -0.310  11.060  -12.596 1.00 0.00 ? 60  LYS A HE2  6  
ATOM 9262  H HE3  . LYS A 1 60  ? -0.192  9.318   -12.842 1.00 0.00 ? 60  LYS A HE3  6  
ATOM 9263  H HZ1  . LYS A 1 60  ? 0.089   11.141  -14.783 1.00 0.00 ? 60  LYS A HZ1  6  
ATOM 9264  H HZ2  . LYS A 1 60  ? -1.549  10.755  -14.953 1.00 0.00 ? 60  LYS A HZ2  6  
ATOM 9265  H HZ3  . LYS A 1 60  ? -0.378  9.537   -15.050 1.00 0.00 ? 60  LYS A HZ3  6  
ATOM 9266  N N    . GLY A 1 61  ? -6.860  8.355   -11.311 1.00 0.00 ? 61  GLY A N    6  
ATOM 9267  C CA   . GLY A 1 61  ? -8.144  7.712   -11.100 1.00 0.00 ? 61  GLY A CA   6  
ATOM 9268  C C    . GLY A 1 61  ? -8.230  7.019   -9.754  1.00 0.00 ? 61  GLY A C    6  
ATOM 9269  O O    . GLY A 1 61  ? -8.801  5.933   -9.642  1.00 0.00 ? 61  GLY A O    6  
ATOM 9270  H H    . GLY A 1 61  ? -6.288  8.568   -10.544 1.00 0.00 ? 61  GLY A H    6  
ATOM 9271  H HA2  . GLY A 1 61  ? -8.922  8.457   -11.160 1.00 0.00 ? 61  GLY A HA2  6  
ATOM 9272  H HA3  . GLY A 1 61  ? -8.299  6.980   -11.879 1.00 0.00 ? 61  GLY A HA3  6  
ATOM 9273  N N    . LEU A 1 62  ? -7.662  7.647   -8.730  1.00 0.00 ? 62  LEU A N    6  
ATOM 9274  C CA   . LEU A 1 62  ? -7.676  7.083   -7.385  1.00 0.00 ? 62  LEU A CA   6  
ATOM 9275  C C    . LEU A 1 62  ? -8.592  7.887   -6.467  1.00 0.00 ? 62  LEU A C    6  
ATOM 9276  O O    . LEU A 1 62  ? -8.962  9.020   -6.778  1.00 0.00 ? 62  LEU A O    6  
ATOM 9277  C CB   . LEU A 1 62  ? -6.259  7.052   -6.809  1.00 0.00 ? 62  LEU A CB   6  
ATOM 9278  C CG   . LEU A 1 62  ? -5.453  5.781   -7.080  1.00 0.00 ? 62  LEU A CG   6  
ATOM 9279  C CD1  . LEU A 1 62  ? -3.989  5.992   -6.726  1.00 0.00 ? 62  LEU A CD1  6  
ATOM 9280  C CD2  . LEU A 1 62  ? -6.028  4.608   -6.300  1.00 0.00 ? 62  LEU A CD2  6  
ATOM 9281  H H    . LEU A 1 62  ? -7.223  8.509   -8.881  1.00 0.00 ? 62  LEU A H    6  
ATOM 9282  H HA   . LEU A 1 62  ? -8.051  6.073   -7.452  1.00 0.00 ? 62  LEU A HA   6  
ATOM 9283  H HB2  . LEU A 1 62  ? -5.714  7.884   -7.227  1.00 0.00 ? 62  LEU A HB2  6  
ATOM 9284  H HB3  . LEU A 1 62  ? -6.335  7.174   -5.738  1.00 0.00 ? 62  LEU A HB3  6  
ATOM 9285  H HG   . LEU A 1 62  ? -5.510  5.544   -8.134  1.00 0.00 ? 62  LEU A HG   6  
ATOM 9286  H HD11 . LEU A 1 62  ? -3.568  5.065   -6.369  1.00 0.00 ? 62  LEU A HD11 6  
ATOM 9287  H HD12 . LEU A 1 62  ? -3.910  6.744   -5.956  1.00 0.00 ? 62  LEU A HD12 6  
ATOM 9288  H HD13 . LEU A 1 62  ? -3.450  6.319   -7.604  1.00 0.00 ? 62  LEU A HD13 6  
ATOM 9289  H HD21 . LEU A 1 62  ? -6.428  3.880   -6.990  1.00 0.00 ? 62  LEU A HD21 6  
ATOM 9290  H HD22 . LEU A 1 62  ? -6.816  4.960   -5.651  1.00 0.00 ? 62  LEU A HD22 6  
ATOM 9291  H HD23 . LEU A 1 62  ? -5.248  4.152   -5.708  1.00 0.00 ? 62  LEU A HD23 6  
ATOM 9292  N N    . LYS A 1 63  ? -8.953  7.295   -5.334  1.00 0.00 ? 63  LYS A N    6  
ATOM 9293  C CA   . LYS A 1 63  ? -9.822  7.956   -4.368  1.00 0.00 ? 63  LYS A CA   6  
ATOM 9294  C C    . LYS A 1 63  ? -9.618  7.382   -2.970  1.00 0.00 ? 63  LYS A C    6  
ATOM 9295  O O    . LYS A 1 63  ? -8.914  6.388   -2.793  1.00 0.00 ? 63  LYS A O    6  
ATOM 9296  C CB   . LYS A 1 63  ? -11.288 7.806   -4.784  1.00 0.00 ? 63  LYS A CB   6  
ATOM 9297  C CG   . LYS A 1 63  ? -12.240 8.671   -3.977  1.00 0.00 ? 63  LYS A CG   6  
ATOM 9298  C CD   . LYS A 1 63  ? -13.582 8.823   -4.674  1.00 0.00 ? 63  LYS A CD   6  
ATOM 9299  C CE   . LYS A 1 63  ? -13.529 9.887   -5.760  1.00 0.00 ? 63  LYS A CE   6  
ATOM 9300  N NZ   . LYS A 1 63  ? -14.878 10.175  -6.320  1.00 0.00 ? 63  LYS A NZ   6  
ATOM 9301  H H    . LYS A 1 63  ? -8.625  6.391   -5.142  1.00 0.00 ? 63  LYS A H    6  
ATOM 9302  H HA   . LYS A 1 63  ? -9.567  9.005   -4.354  1.00 0.00 ? 63  LYS A HA   6  
ATOM 9303  H HB2  . LYS A 1 63  ? -11.383 8.076   -5.825  1.00 0.00 ? 63  LYS A HB2  6  
ATOM 9304  H HB3  . LYS A 1 63  ? -11.580 6.773   -4.660  1.00 0.00 ? 63  LYS A HB3  6  
ATOM 9305  H HG2  . LYS A 1 63  ? -12.398 8.214   -3.012  1.00 0.00 ? 63  LYS A HG2  6  
ATOM 9306  H HG3  . LYS A 1 63  ? -11.800 9.650   -3.847  1.00 0.00 ? 63  LYS A HG3  6  
ATOM 9307  H HD2  . LYS A 1 63  ? -13.853 7.879   -5.124  1.00 0.00 ? 63  LYS A HD2  6  
ATOM 9308  H HD3  . LYS A 1 63  ? -14.328 9.103   -3.944  1.00 0.00 ? 63  LYS A HD3  6  
ATOM 9309  H HE2  . LYS A 1 63  ? -13.122 10.793  -5.338  1.00 0.00 ? 63  LYS A HE2  6  
ATOM 9310  H HE3  . LYS A 1 63  ? -12.885 9.539   -6.555  1.00 0.00 ? 63  LYS A HE3  6  
ATOM 9311  H HZ1  . LYS A 1 63  ? -15.040 11.202  -6.351  1.00 0.00 ? 63  LYS A HZ1  6  
ATOM 9312  H HZ2  . LYS A 1 63  ? -15.612 9.738   -5.727  1.00 0.00 ? 63  LYS A HZ2  6  
ATOM 9313  H HZ3  . LYS A 1 63  ? -14.954 9.794   -7.285  1.00 0.00 ? 63  LYS A HZ3  6  
ATOM 9314  N N    . ALA A 1 64  ? -10.241 8.012   -1.979  1.00 0.00 ? 64  ALA A N    6  
ATOM 9315  C CA   . ALA A 1 64  ? -10.130 7.561   -0.598  1.00 0.00 ? 64  ALA A CA   6  
ATOM 9316  C C    . ALA A 1 64  ? -11.121 6.440   -0.305  1.00 0.00 ? 64  ALA A C    6  
ATOM 9317  O O    . ALA A 1 64  ? -11.467 6.190   0.849   1.00 0.00 ? 64  ALA A O    6  
ATOM 9318  C CB   . ALA A 1 64  ? -10.350 8.726   0.357   1.00 0.00 ? 64  ALA A CB   6  
ATOM 9319  H H    . ALA A 1 64  ? -10.788 8.799   -2.183  1.00 0.00 ? 64  ALA A H    6  
ATOM 9320  H HA   . ALA A 1 64  ? -9.126  7.190   -0.447  1.00 0.00 ? 64  ALA A HA   6  
ATOM 9321  H HB1  . ALA A 1 64  ? -9.885  9.614   -0.046  1.00 0.00 ? 64  ALA A HB1  6  
ATOM 9322  H HB2  . ALA A 1 64  ? -11.410 8.897   0.477   1.00 0.00 ? 64  ALA A HB2  6  
ATOM 9323  H HB3  . ALA A 1 64  ? -9.912  8.493   1.316   1.00 0.00 ? 64  ALA A HB3  6  
ATOM 9324  N N    . GLY A 1 65  ? -11.575 5.768   -1.358  1.00 0.00 ? 65  GLY A N    6  
ATOM 9325  C CA   . GLY A 1 65  ? -12.523 4.681   -1.193  1.00 0.00 ? 65  GLY A CA   6  
ATOM 9326  C C    . GLY A 1 65  ? -12.440 3.664   -2.313  1.00 0.00 ? 65  GLY A C    6  
ATOM 9327  O O    . GLY A 1 65  ? -13.462 3.167   -2.787  1.00 0.00 ? 65  GLY A O    6  
ATOM 9328  H H    . GLY A 1 65  ? -11.264 6.011   -2.255  1.00 0.00 ? 65  GLY A H    6  
ATOM 9329  H HA2  . GLY A 1 65  ? -12.325 4.185   -0.254  1.00 0.00 ? 65  GLY A HA2  6  
ATOM 9330  H HA3  . GLY A 1 65  ? -13.522 5.091   -1.168  1.00 0.00 ? 65  GLY A HA3  6  
ATOM 9331  N N    . ASP A 1 66  ? -11.220 3.353   -2.739  1.00 0.00 ? 66  ASP A N    6  
ATOM 9332  C CA   . ASP A 1 66  ? -11.007 2.388   -3.811  1.00 0.00 ? 66  ASP A CA   6  
ATOM 9333  C C    . ASP A 1 66  ? -10.254 1.164   -3.300  1.00 0.00 ? 66  ASP A C    6  
ATOM 9334  O O    . ASP A 1 66  ? -9.596  1.219   -2.261  1.00 0.00 ? 66  ASP A O    6  
ATOM 9335  C CB   . ASP A 1 66  ? -10.234 3.035   -4.962  1.00 0.00 ? 66  ASP A CB   6  
ATOM 9336  C CG   . ASP A 1 66  ? -10.583 2.429   -6.307  1.00 0.00 ? 66  ASP A CG   6  
ATOM 9337  O OD1  . ASP A 1 66  ? -11.125 1.304   -6.327  1.00 0.00 ? 66  ASP A OD1  6  
ATOM 9338  O OD2  . ASP A 1 66  ? -10.315 3.079   -7.339  1.00 0.00 ? 66  ASP A OD2  6  
ATOM 9339  H H    . ASP A 1 66  ? -10.444 3.783   -2.321  1.00 0.00 ? 66  ASP A H    6  
ATOM 9340  H HA   . ASP A 1 66  ? -11.975 2.074   -4.172  1.00 0.00 ? 66  ASP A HA   6  
ATOM 9341  H HB2  . ASP A 1 66  ? -10.463 4.090   -4.993  1.00 0.00 ? 66  ASP A HB2  6  
ATOM 9342  H HB3  . ASP A 1 66  ? -9.175  2.905   -4.793  1.00 0.00 ? 66  ASP A HB3  6  
ATOM 9343  N N    . GLU A 1 67  ? -10.355 0.062   -4.036  1.00 0.00 ? 67  GLU A N    6  
ATOM 9344  C CA   . GLU A 1 67  ? -9.685  -1.175  -3.655  1.00 0.00 ? 67  GLU A CA   6  
ATOM 9345  C C    . GLU A 1 67  ? -8.602  -1.541  -4.666  1.00 0.00 ? 67  GLU A C    6  
ATOM 9346  O O    . GLU A 1 67  ? -8.874  -1.679  -5.859  1.00 0.00 ? 67  GLU A O    6  
ATOM 9347  C CB   . GLU A 1 67  ? -10.698 -2.316  -3.540  1.00 0.00 ? 67  GLU A CB   6  
ATOM 9348  C CG   . GLU A 1 67  ? -10.057 -3.684  -3.379  1.00 0.00 ? 67  GLU A CG   6  
ATOM 9349  C CD   . GLU A 1 67  ? -9.438  -4.195  -4.666  1.00 0.00 ? 67  GLU A CD   6  
ATOM 9350  O OE1  . GLU A 1 67  ? -9.962  -3.859  -5.749  1.00 0.00 ? 67  GLU A OE1  6  
ATOM 9351  O OE2  . GLU A 1 67  ? -8.431  -4.929  -4.590  1.00 0.00 ? 67  GLU A OE2  6  
ATOM 9352  H H    . GLU A 1 67  ? -10.894 0.082   -4.854  1.00 0.00 ? 67  GLU A H    6  
ATOM 9353  H HA   . GLU A 1 67  ? -9.223  -1.018  -2.692  1.00 0.00 ? 67  GLU A HA   6  
ATOM 9354  H HB2  . GLU A 1 67  ? -11.331 -2.134  -2.685  1.00 0.00 ? 67  GLU A HB2  6  
ATOM 9355  H HB3  . GLU A 1 67  ? -11.307 -2.330  -4.432  1.00 0.00 ? 67  GLU A HB3  6  
ATOM 9356  H HG2  . GLU A 1 67  ? -9.285  -3.620  -2.627  1.00 0.00 ? 67  GLU A HG2  6  
ATOM 9357  H HG3  . GLU A 1 67  ? -10.813 -4.386  -3.057  1.00 0.00 ? 67  GLU A HG3  6  
ATOM 9358  N N    . ILE A 1 68  ? -7.375  -1.695  -4.180  1.00 0.00 ? 68  ILE A N    6  
ATOM 9359  C CA   . ILE A 1 68  ? -6.252  -2.045  -5.041  1.00 0.00 ? 68  ILE A CA   6  
ATOM 9360  C C    . ILE A 1 68  ? -6.163  -3.554  -5.243  1.00 0.00 ? 68  ILE A C    6  
ATOM 9361  O O    . ILE A 1 68  ? -5.774  -4.291  -4.336  1.00 0.00 ? 68  ILE A O    6  
ATOM 9362  C CB   . ILE A 1 68  ? -4.918  -1.537  -4.461  1.00 0.00 ? 68  ILE A CB   6  
ATOM 9363  C CG1  . ILE A 1 68  ? -4.851  -0.011  -4.540  1.00 0.00 ? 68  ILE A CG1  6  
ATOM 9364  C CG2  . ILE A 1 68  ? -3.746  -2.164  -5.200  1.00 0.00 ? 68  ILE A CG2  6  
ATOM 9365  C CD1  . ILE A 1 68  ? -6.074  0.678   -3.979  1.00 0.00 ? 68  ILE A CD1  6  
ATOM 9366  H H    . ILE A 1 68  ? -7.221  -1.571  -3.221  1.00 0.00 ? 68  ILE A H    6  
ATOM 9367  H HA   . ILE A 1 68  ? -6.407  -1.572  -6.000  1.00 0.00 ? 68  ILE A HA   6  
ATOM 9368  H HB   . ILE A 1 68  ? -4.863  -1.840  -3.426  1.00 0.00 ? 68  ILE A HB   6  
ATOM 9369  H HG12 . ILE A 1 68  ? -3.993  0.335   -3.986  1.00 0.00 ? 68  ILE A HG12 6  
ATOM 9370  H HG13 . ILE A 1 68  ? -4.748  0.284   -5.575  1.00 0.00 ? 68  ILE A HG13 6  
ATOM 9371  H HG21 . ILE A 1 68  ? -3.758  -1.844  -6.232  1.00 0.00 ? 68  ILE A HG21 6  
ATOM 9372  H HG22 . ILE A 1 68  ? -2.821  -1.852  -4.738  1.00 0.00 ? 68  ILE A HG22 6  
ATOM 9373  H HG23 . ILE A 1 68  ? -3.826  -3.240  -5.156  1.00 0.00 ? 68  ILE A HG23 6  
ATOM 9374  H HD11 . ILE A 1 68  ? -6.411  0.153   -3.097  1.00 0.00 ? 68  ILE A HD11 6  
ATOM 9375  H HD12 . ILE A 1 68  ? -5.828  1.697   -3.720  1.00 0.00 ? 68  ILE A HD12 6  
ATOM 9376  H HD13 . ILE A 1 68  ? -6.861  0.676   -4.720  1.00 0.00 ? 68  ILE A HD13 6  
ATOM 9377  N N    . LEU A 1 69  ? -6.525  -4.007  -6.438  1.00 0.00 ? 69  LEU A N    6  
ATOM 9378  C CA   . LEU A 1 69  ? -6.485  -5.429  -6.762  1.00 0.00 ? 69  LEU A CA   6  
ATOM 9379  C C    . LEU A 1 69  ? -5.046  -5.924  -6.862  1.00 0.00 ? 69  LEU A C    6  
ATOM 9380  O O    . LEU A 1 69  ? -4.650  -6.855  -6.161  1.00 0.00 ? 69  LEU A O    6  
ATOM 9381  C CB   . LEU A 1 69  ? -7.221  -5.694  -8.077  1.00 0.00 ? 69  LEU A CB   6  
ATOM 9382  C CG   . LEU A 1 69  ? -8.661  -5.186  -8.154  1.00 0.00 ? 69  LEU A CG   6  
ATOM 9383  C CD1  . LEU A 1 69  ? -9.062  -4.936  -9.600  1.00 0.00 ? 69  LEU A CD1  6  
ATOM 9384  C CD2  . LEU A 1 69  ? -9.612  -6.177  -7.499  1.00 0.00 ? 69  LEU A CD2  6  
ATOM 9385  H H    . LEU A 1 69  ? -6.826  -3.371  -7.120  1.00 0.00 ? 69  LEU A H    6  
ATOM 9386  H HA   . LEU A 1 69  ? -6.983  -5.964  -5.966  1.00 0.00 ? 69  LEU A HA   6  
ATOM 9387  H HB2  . LEU A 1 69  ? -6.661  -5.222  -8.869  1.00 0.00 ? 69  LEU A HB2  6  
ATOM 9388  H HB3  . LEU A 1 69  ? -7.236  -6.763  -8.236  1.00 0.00 ? 69  LEU A HB3  6  
ATOM 9389  H HG   . LEU A 1 69  ? -8.735  -4.248  -7.621  1.00 0.00 ? 69  LEU A HG   6  
ATOM 9390  H HD11 . LEU A 1 69  ? -8.637  -4.002  -9.935  1.00 0.00 ? 69  LEU A HD11 6  
ATOM 9391  H HD12 . LEU A 1 69  ? -10.138 -4.889  -9.672  1.00 0.00 ? 69  LEU A HD12 6  
ATOM 9392  H HD13 . LEU A 1 69  ? -8.696  -5.742  -10.219 1.00 0.00 ? 69  LEU A HD13 6  
ATOM 9393  H HD21 . LEU A 1 69  ? -10.608 -6.034  -7.892  1.00 0.00 ? 69  LEU A HD21 6  
ATOM 9394  H HD22 . LEU A 1 69  ? -9.620  -6.016  -6.431  1.00 0.00 ? 69  LEU A HD22 6  
ATOM 9395  H HD23 . LEU A 1 69  ? -9.283  -7.184  -7.709  1.00 0.00 ? 69  LEU A HD23 6  
ATOM 9396  N N    . GLU A 1 70  ? -4.269  -5.295  -7.737  1.00 0.00 ? 70  GLU A N    6  
ATOM 9397  C CA   . GLU A 1 70  ? -2.873  -5.672  -7.927  1.00 0.00 ? 70  GLU A CA   6  
ATOM 9398  C C    . GLU A 1 70  ? -1.974  -4.439  -7.945  1.00 0.00 ? 70  GLU A C    6  
ATOM 9399  O O    . GLU A 1 70  ? -2.410  -3.345  -8.305  1.00 0.00 ? 70  GLU A O    6  
ATOM 9400  C CB   . GLU A 1 70  ? -2.706  -6.457  -9.230  1.00 0.00 ? 70  GLU A CB   6  
ATOM 9401  C CG   . GLU A 1 70  ? -3.001  -7.941  -9.088  1.00 0.00 ? 70  GLU A CG   6  
ATOM 9402  C CD   . GLU A 1 70  ? -3.178  -8.630  -10.427 1.00 0.00 ? 70  GLU A CD   6  
ATOM 9403  O OE1  . GLU A 1 70  ? -2.185  -8.732  -11.178 1.00 0.00 ? 70  GLU A OE1  6  
ATOM 9404  O OE2  . GLU A 1 70  ? -4.309  -9.068  -10.724 1.00 0.00 ? 70  GLU A OE2  6  
ATOM 9405  H H    . GLU A 1 70  ? -4.642  -4.560  -8.267  1.00 0.00 ? 70  GLU A H    6  
ATOM 9406  H HA   . GLU A 1 70  ? -2.584  -6.301  -7.099  1.00 0.00 ? 70  GLU A HA   6  
ATOM 9407  H HB2  . GLU A 1 70  ? -3.376  -6.047  -9.972  1.00 0.00 ? 70  GLU A HB2  6  
ATOM 9408  H HB3  . GLU A 1 70  ? -1.689  -6.344  -9.576  1.00 0.00 ? 70  GLU A HB3  6  
ATOM 9409  H HG2  . GLU A 1 70  ? -2.180  -8.409  -8.566  1.00 0.00 ? 70  GLU A HG2  6  
ATOM 9410  H HG3  . GLU A 1 70  ? -3.908  -8.062  -8.514  1.00 0.00 ? 70  GLU A HG3  6  
ATOM 9411  N N    . ILE A 1 71  ? -0.718  -4.624  -7.553  1.00 0.00 ? 71  ILE A N    6  
ATOM 9412  C CA   . ILE A 1 71  ? 0.242   -3.528  -7.524  1.00 0.00 ? 71  ILE A CA   6  
ATOM 9413  C C    . ILE A 1 71  ? 1.473   -3.853  -8.363  1.00 0.00 ? 71  ILE A C    6  
ATOM 9414  O O    . ILE A 1 71  ? 2.344   -4.611  -7.938  1.00 0.00 ? 71  ILE A O    6  
ATOM 9415  C CB   . ILE A 1 71  ? 0.686   -3.206  -6.085  1.00 0.00 ? 71  ILE A CB   6  
ATOM 9416  C CG1  . ILE A 1 71  ? -0.506  -2.723  -5.257  1.00 0.00 ? 71  ILE A CG1  6  
ATOM 9417  C CG2  . ILE A 1 71  ? 1.791   -2.160  -6.093  1.00 0.00 ? 71  ILE A CG2  6  
ATOM 9418  C CD1  . ILE A 1 71  ? -0.181  -2.516  -3.794  1.00 0.00 ? 71  ILE A CD1  6  
ATOM 9419  H H    . ILE A 1 71  ? -0.430  -5.519  -7.277  1.00 0.00 ? 71  ILE A H    6  
ATOM 9420  H HA   . ILE A 1 71  ? -0.239  -2.652  -7.936  1.00 0.00 ? 71  ILE A HA   6  
ATOM 9421  H HB   . ILE A 1 71  ? 1.081   -4.108  -5.643  1.00 0.00 ? 71  ILE A HB   6  
ATOM 9422  H HG12 . ILE A 1 71  ? -0.855  -1.783  -5.654  1.00 0.00 ? 71  ILE A HG12 6  
ATOM 9423  H HG13 . ILE A 1 71  ? -1.299  -3.453  -5.321  1.00 0.00 ? 71  ILE A HG13 6  
ATOM 9424  H HG21 . ILE A 1 71  ? 1.656   -1.487  -5.259  1.00 0.00 ? 71  ILE A HG21 6  
ATOM 9425  H HG22 . ILE A 1 71  ? 2.750   -2.649  -6.008  1.00 0.00 ? 71  ILE A HG22 6  
ATOM 9426  H HG23 . ILE A 1 71  ? 1.752   -1.601  -7.016  1.00 0.00 ? 71  ILE A HG23 6  
ATOM 9427  H HD11 . ILE A 1 71  ? -0.697  -3.258  -3.202  1.00 0.00 ? 71  ILE A HD11 6  
ATOM 9428  H HD12 . ILE A 1 71  ? 0.884   -2.612  -3.644  1.00 0.00 ? 71  ILE A HD12 6  
ATOM 9429  H HD13 . ILE A 1 71  ? -0.500  -1.529  -3.490  1.00 0.00 ? 71  ILE A HD13 6  
ATOM 9430  N N    . ASN A 1 72  ? 1.539   -3.273  -9.557  1.00 0.00 ? 72  ASN A N    6  
ATOM 9431  C CA   . ASN A 1 72  ? 2.665   -3.500  -10.456 1.00 0.00 ? 72  ASN A CA   6  
ATOM 9432  C C    . ASN A 1 72  ? 2.792   -4.980  -10.806 1.00 0.00 ? 72  ASN A C    6  
ATOM 9433  O O    . ASN A 1 72  ? 3.895   -5.522  -10.862 1.00 0.00 ? 72  ASN A O    6  
ATOM 9434  C CB   . ASN A 1 72  ? 3.963   -3.002  -9.818  1.00 0.00 ? 72  ASN A CB   6  
ATOM 9435  C CG   . ASN A 1 72  ? 4.113   -1.496  -9.912  1.00 0.00 ? 72  ASN A CG   6  
ATOM 9436  O OD1  . ASN A 1 72  ? 3.617   -0.869  -10.849 1.00 0.00 ? 72  ASN A OD1  6  
ATOM 9437  N ND2  . ASN A 1 72  ? 4.800   -0.908  -8.940  1.00 0.00 ? 72  ASN A ND2  6  
ATOM 9438  H H    . ASN A 1 72  ? 0.814   -2.678  -9.841  1.00 0.00 ? 72  ASN A H    6  
ATOM 9439  H HA   . ASN A 1 72  ? 2.483   -2.943  -11.363 1.00 0.00 ? 72  ASN A HA   6  
ATOM 9440  H HB2  . ASN A 1 72  ? 3.974   -3.281  -8.774  1.00 0.00 ? 72  ASN A HB2  6  
ATOM 9441  H HB3  . ASN A 1 72  ? 4.803   -3.461  -10.318 1.00 0.00 ? 72  ASN A HB3  6  
ATOM 9442  H HD21 . ASN A 1 72  ? 5.166   -1.470  -8.226  1.00 0.00 ? 72  ASN A HD21 6  
ATOM 9443  H HD22 . ASN A 1 72  ? 4.911   0.065   -8.976  1.00 0.00 ? 72  ASN A HD22 6  
ATOM 9444  N N    . ASN A 1 73  ? 1.655   -5.627  -11.039 1.00 0.00 ? 73  ASN A N    6  
ATOM 9445  C CA   . ASN A 1 73  ? 1.639   -7.044  -11.383 1.00 0.00 ? 73  ASN A CA   6  
ATOM 9446  C C    . ASN A 1 73  ? 1.968   -7.903  -10.166 1.00 0.00 ? 73  ASN A C    6  
ATOM 9447  O O    . ASN A 1 73  ? 2.547   -8.982  -10.293 1.00 0.00 ? 73  ASN A O    6  
ATOM 9448  C CB   . ASN A 1 73  ? 2.637   -7.329  -12.507 1.00 0.00 ? 73  ASN A CB   6  
ATOM 9449  C CG   . ASN A 1 73  ? 2.617   -6.260  -13.583 1.00 0.00 ? 73  ASN A CG   6  
ATOM 9450  O OD1  . ASN A 1 73  ? 1.699   -6.205  -14.402 1.00 0.00 ? 73  ASN A OD1  6  
ATOM 9451  N ND2  . ASN A 1 73  ? 3.632   -5.405  -13.586 1.00 0.00 ? 73  ASN A ND2  6  
ATOM 9452  H H    . ASN A 1 73  ? 0.806   -5.140  -10.979 1.00 0.00 ? 73  ASN A H    6  
ATOM 9453  H HA   . ASN A 1 73  ? 0.645   -7.291  -11.725 1.00 0.00 ? 73  ASN A HA   6  
ATOM 9454  H HB2  . ASN A 1 73  ? 3.633   -7.376  -12.092 1.00 0.00 ? 73  ASN A HB2  6  
ATOM 9455  H HB3  . ASN A 1 73  ? 2.396   -8.278  -12.963 1.00 0.00 ? 73  ASN A HB3  6  
ATOM 9456  H HD21 . ASN A 1 73  ? 4.328   -5.509  -12.903 1.00 0.00 ? 73  ASN A HD21 6  
ATOM 9457  H HD22 . ASN A 1 73  ? 3.644   -4.703  -14.270 1.00 0.00 ? 73  ASN A HD22 6  
ATOM 9458  N N    . ARG A 1 74  ? 1.593   -7.417  -8.987  1.00 0.00 ? 74  ARG A N    6  
ATOM 9459  C CA   . ARG A 1 74  ? 1.849   -8.140  -7.747  1.00 0.00 ? 74  ARG A CA   6  
ATOM 9460  C C    . ARG A 1 74  ? 0.565   -8.306  -6.940  1.00 0.00 ? 74  ARG A C    6  
ATOM 9461  O O    . ARG A 1 74  ? -0.253  -7.389  -6.860  1.00 0.00 ? 74  ARG A O    6  
ATOM 9462  C CB   . ARG A 1 74  ? 2.898   -7.404  -6.910  1.00 0.00 ? 74  ARG A CB   6  
ATOM 9463  C CG   . ARG A 1 74  ? 4.241   -7.260  -7.607  1.00 0.00 ? 74  ARG A CG   6  
ATOM 9464  C CD   . ARG A 1 74  ? 5.133   -8.465  -7.352  1.00 0.00 ? 74  ARG A CD   6  
ATOM 9465  N NE   . ARG A 1 74  ? 4.937   -9.513  -8.350  1.00 0.00 ? 74  ARG A NE   6  
ATOM 9466  C CZ   . ARG A 1 74  ? 5.636   -10.642 -8.378  1.00 0.00 ? 74  ARG A CZ   6  
ATOM 9467  N NH1  . ARG A 1 74  ? 6.572   -10.868 -7.466  1.00 0.00 ? 74  ARG A NH1  6  
ATOM 9468  N NH2  . ARG A 1 74  ? 5.400   -11.548 -9.318  1.00 0.00 ? 74  ARG A NH2  6  
ATOM 9469  H H    . ARG A 1 74  ? 1.135   -6.551  -8.950  1.00 0.00 ? 74  ARG A H    6  
ATOM 9470  H HA   . ARG A 1 74  ? 2.227   -9.117  -8.004  1.00 0.00 ? 74  ARG A HA   6  
ATOM 9471  H HB2  . ARG A 1 74  ? 2.529   -6.416  -6.679  1.00 0.00 ? 74  ARG A HB2  6  
ATOM 9472  H HB3  . ARG A 1 74  ? 3.051   -7.947  -5.990  1.00 0.00 ? 74  ARG A HB3  6  
ATOM 9473  H HG2  . ARG A 1 74  ? 4.076   -7.168  -8.671  1.00 0.00 ? 74  ARG A HG2  6  
ATOM 9474  H HG3  . ARG A 1 74  ? 4.734   -6.373  -7.238  1.00 0.00 ? 74  ARG A HG3  6  
ATOM 9475  H HD2  . ARG A 1 74  ? 6.164   -8.145  -7.378  1.00 0.00 ? 74  ARG A HD2  6  
ATOM 9476  H HD3  . ARG A 1 74  ? 4.905   -8.864  -6.375  1.00 0.00 ? 74  ARG A HD3  6  
ATOM 9477  H HE   . ARG A 1 74  ? 4.250   -9.366  -9.033  1.00 0.00 ? 74  ARG A HE   6  
ATOM 9478  H HH11 . ARG A 1 74  ? 6.752   -10.188 -6.756  1.00 0.00 ? 74  ARG A HH11 6  
ATOM 9479  H HH12 . ARG A 1 74  ? 7.097   -11.720 -7.488  1.00 0.00 ? 74  ARG A HH12 6  
ATOM 9480  H HH21 . ARG A 1 74  ? 4.695   -11.381 -10.006 1.00 0.00 ? 74  ARG A HH21 6  
ATOM 9481  H HH22 . ARG A 1 74  ? 5.926   -12.397 -9.338  1.00 0.00 ? 74  ARG A HH22 6  
ATOM 9482  N N    . ALA A 1 75  ? 0.394   -9.481  -6.344  1.00 0.00 ? 75  ALA A N    6  
ATOM 9483  C CA   . ALA A 1 75  ? -0.789  -9.767  -5.543  1.00 0.00 ? 75  ALA A CA   6  
ATOM 9484  C C    . ALA A 1 75  ? -0.767  -8.986  -4.233  1.00 0.00 ? 75  ALA A C    6  
ATOM 9485  O O    . ALA A 1 75  ? 0.078   -9.225  -3.371  1.00 0.00 ? 75  ALA A O    6  
ATOM 9486  C CB   . ALA A 1 75  ? -0.892  -11.260 -5.267  1.00 0.00 ? 75  ALA A CB   6  
ATOM 9487  H H    . ALA A 1 75  ? 1.081   -10.172 -6.445  1.00 0.00 ? 75  ALA A H    6  
ATOM 9488  H HA   . ALA A 1 75  ? -1.658  -9.470  -6.112  1.00 0.00 ? 75  ALA A HA   6  
ATOM 9489  H HB1  . ALA A 1 75  ? -1.153  -11.417 -4.230  1.00 0.00 ? 75  ALA A HB1  6  
ATOM 9490  H HB2  . ALA A 1 75  ? -1.655  -11.691 -5.899  1.00 0.00 ? 75  ALA A HB2  6  
ATOM 9491  H HB3  . ALA A 1 75  ? 0.057   -11.731 -5.475  1.00 0.00 ? 75  ALA A HB3  6  
ATOM 9492  N N    . ALA A 1 76  ? -1.701  -8.052  -4.091  1.00 0.00 ? 76  ALA A N    6  
ATOM 9493  C CA   . ALA A 1 76  ? -1.789  -7.236  -2.886  1.00 0.00 ? 76  ALA A CA   6  
ATOM 9494  C C    . ALA A 1 76  ? -1.555  -8.078  -1.636  1.00 0.00 ? 76  ALA A C    6  
ATOM 9495  O O    . ALA A 1 76  ? -0.793  -7.691  -0.749  1.00 0.00 ? 76  ALA A O    6  
ATOM 9496  C CB   . ALA A 1 76  ? -3.143  -6.546  -2.814  1.00 0.00 ? 76  ALA A CB   6  
ATOM 9497  H H    . ALA A 1 76  ? -2.348  -7.908  -4.813  1.00 0.00 ? 76  ALA A H    6  
ATOM 9498  H HA   . ALA A 1 76  ? -1.026  -6.474  -2.943  1.00 0.00 ? 76  ALA A HA   6  
ATOM 9499  H HB1  . ALA A 1 76  ? -3.395  -6.146  -3.785  1.00 0.00 ? 76  ALA A HB1  6  
ATOM 9500  H HB2  . ALA A 1 76  ? -3.895  -7.259  -2.511  1.00 0.00 ? 76  ALA A HB2  6  
ATOM 9501  H HB3  . ALA A 1 76  ? -3.099  -5.742  -2.094  1.00 0.00 ? 76  ALA A HB3  6  
ATOM 9502  N N    . ASP A 1 77  ? -2.215  -9.229  -1.571  1.00 0.00 ? 77  ASP A N    6  
ATOM 9503  C CA   . ASP A 1 77  ? -2.078  -10.125 -0.429  1.00 0.00 ? 77  ASP A CA   6  
ATOM 9504  C C    . ASP A 1 77  ? -0.655  -10.667 -0.331  1.00 0.00 ? 77  ASP A C    6  
ATOM 9505  O O    . ASP A 1 77  ? -0.143  -10.901 0.764   1.00 0.00 ? 77  ASP A O    6  
ATOM 9506  C CB   . ASP A 1 77  ? -3.071  -11.283 -0.540  1.00 0.00 ? 77  ASP A CB   6  
ATOM 9507  C CG   . ASP A 1 77  ? -2.912  -12.060 -1.833  1.00 0.00 ? 77  ASP A CG   6  
ATOM 9508  O OD1  . ASP A 1 77  ? -1.933  -12.827 -1.947  1.00 0.00 ? 77  ASP A OD1  6  
ATOM 9509  O OD2  . ASP A 1 77  ? -3.766  -11.901 -2.730  1.00 0.00 ? 77  ASP A OD2  6  
ATOM 9510  H H    . ASP A 1 77  ? -2.807  -9.483  -2.310  1.00 0.00 ? 77  ASP A H    6  
ATOM 9511  H HA   . ASP A 1 77  ? -2.297  -9.560  0.464   1.00 0.00 ? 77  ASP A HA   6  
ATOM 9512  H HB2  . ASP A 1 77  ? -2.917  -11.962 0.287   1.00 0.00 ? 77  ASP A HB2  6  
ATOM 9513  H HB3  . ASP A 1 77  ? -4.076  -10.892 -0.498  1.00 0.00 ? 77  ASP A HB3  6  
ATOM 9514  N N    . ALA A 1 78  ? -0.022  -10.865 -1.482  1.00 0.00 ? 78  ALA A N    6  
ATOM 9515  C CA   . ALA A 1 78  ? 1.342   -11.378 -1.526  1.00 0.00 ? 78  ALA A CA   6  
ATOM 9516  C C    . ALA A 1 78  ? 2.329   -10.362 -0.962  1.00 0.00 ? 78  ALA A C    6  
ATOM 9517  O O    . ALA A 1 78  ? 3.414   -10.724 -0.505  1.00 0.00 ? 78  ALA A O    6  
ATOM 9518  C CB   . ALA A 1 78  ? 1.721   -11.749 -2.952  1.00 0.00 ? 78  ALA A CB   6  
ATOM 9519  H H    . ALA A 1 78  ? -0.482  -10.660 -2.322  1.00 0.00 ? 78  ALA A H    6  
ATOM 9520  H HA   . ALA A 1 78  ? 1.380   -12.275 -0.925  1.00 0.00 ? 78  ALA A HA   6  
ATOM 9521  H HB1  . ALA A 1 78  ? 2.396   -12.593 -2.937  1.00 0.00 ? 78  ALA A HB1  6  
ATOM 9522  H HB2  . ALA A 1 78  ? 0.830   -12.011 -3.505  1.00 0.00 ? 78  ALA A HB2  6  
ATOM 9523  H HB3  . ALA A 1 78  ? 2.205   -10.909 -3.426  1.00 0.00 ? 78  ALA A HB3  6  
ATOM 9524  N N    . LEU A 1 79  ? 1.947   -9.091  -0.997  1.00 0.00 ? 79  LEU A N    6  
ATOM 9525  C CA   . LEU A 1 79  ? 2.799   -8.021  -0.489  1.00 0.00 ? 79  LEU A CA   6  
ATOM 9526  C C    . LEU A 1 79  ? 2.561   -7.796  1.001   1.00 0.00 ? 79  LEU A C    6  
ATOM 9527  O O    . LEU A 1 79  ? 1.430   -7.884  1.479   1.00 0.00 ? 79  LEU A O    6  
ATOM 9528  C CB   . LEU A 1 79  ? 2.540   -6.726  -1.260  1.00 0.00 ? 79  LEU A CB   6  
ATOM 9529  C CG   . LEU A 1 79  ? 2.674   -6.812  -2.781  1.00 0.00 ? 79  LEU A CG   6  
ATOM 9530  C CD1  . LEU A 1 79  ? 1.887   -5.696  -3.451  1.00 0.00 ? 79  LEU A CD1  6  
ATOM 9531  C CD2  . LEU A 1 79  ? 4.138   -6.756  -3.192  1.00 0.00 ? 79  LEU A CD2  6  
ATOM 9532  H H    . LEU A 1 79  ? 1.071   -8.864  -1.372  1.00 0.00 ? 79  LEU A H    6  
ATOM 9533  H HA   . LEU A 1 79  ? 3.827   -8.319  -0.636  1.00 0.00 ? 79  LEU A HA   6  
ATOM 9534  H HB2  . LEU A 1 79  ? 1.535   -6.402  -1.035  1.00 0.00 ? 79  LEU A HB2  6  
ATOM 9535  H HB3  . LEU A 1 79  ? 3.243   -5.985  -0.907  1.00 0.00 ? 79  LEU A HB3  6  
ATOM 9536  H HG   . LEU A 1 79  ? 2.267   -7.756  -3.119  1.00 0.00 ? 79  LEU A HG   6  
ATOM 9537  H HD11 . LEU A 1 79  ? 2.522   -4.832  -3.574  1.00 0.00 ? 79  LEU A HD11 6  
ATOM 9538  H HD12 . LEU A 1 79  ? 1.039   -5.435  -2.835  1.00 0.00 ? 79  LEU A HD12 6  
ATOM 9539  H HD13 . LEU A 1 79  ? 1.541   -6.030  -4.418  1.00 0.00 ? 79  LEU A HD13 6  
ATOM 9540  H HD21 . LEU A 1 79  ? 4.360   -5.780  -3.598  1.00 0.00 ? 79  LEU A HD21 6  
ATOM 9541  H HD22 . LEU A 1 79  ? 4.331   -7.510  -3.941  1.00 0.00 ? 79  LEU A HD22 6  
ATOM 9542  H HD23 . LEU A 1 79  ? 4.761   -6.937  -2.328  1.00 0.00 ? 79  LEU A HD23 6  
ATOM 9543  N N    . ASN A 1 80  ? 3.633   -7.502  1.729   1.00 0.00 ? 80  ASN A N    6  
ATOM 9544  C CA   . ASN A 1 80  ? 3.540   -7.262  3.164   1.00 0.00 ? 80  ASN A CA   6  
ATOM 9545  C C    . ASN A 1 80  ? 3.847   -5.804  3.493   1.00 0.00 ? 80  ASN A C    6  
ATOM 9546  O O    . ASN A 1 80  ? 4.495   -5.105  2.714   1.00 0.00 ? 80  ASN A O    6  
ATOM 9547  C CB   . ASN A 1 80  ? 4.503   -8.180  3.919   1.00 0.00 ? 80  ASN A CB   6  
ATOM 9548  C CG   . ASN A 1 80  ? 4.393   -8.021  5.424   1.00 0.00 ? 80  ASN A CG   6  
ATOM 9549  O OD1  . ASN A 1 80  ? 3.457   -8.524  6.045   1.00 0.00 ? 80  ASN A OD1  6  
ATOM 9550  N ND2  . ASN A 1 80  ? 5.352   -7.319  6.016   1.00 0.00 ? 80  ASN A ND2  6  
ATOM 9551  H H    . ASN A 1 80  ? 4.508   -7.446  1.291   1.00 0.00 ? 80  ASN A H    6  
ATOM 9552  H HA   . ASN A 1 80  ? 2.529   -7.483  3.472   1.00 0.00 ? 80  ASN A HA   6  
ATOM 9553  H HB2  . ASN A 1 80  ? 4.282   -9.207  3.668   1.00 0.00 ? 80  ASN A HB2  6  
ATOM 9554  H HB3  . ASN A 1 80  ? 5.516   -7.951  3.624   1.00 0.00 ? 80  ASN A HB3  6  
ATOM 9555  H HD21 . ASN A 1 80  ? 6.067   -6.948  5.457   1.00 0.00 ? 80  ASN A HD21 6  
ATOM 9556  H HD22 . ASN A 1 80  ? 5.306   -7.201  6.987   1.00 0.00 ? 80  ASN A HD22 6  
ATOM 9557  N N    . SER A 1 81  ? 3.378   -5.352  4.651   1.00 0.00 ? 81  SER A N    6  
ATOM 9558  C CA   . SER A 1 81  ? 3.599   -3.977  5.082   1.00 0.00 ? 81  SER A CA   6  
ATOM 9559  C C    . SER A 1 81  ? 4.965   -3.477  4.621   1.00 0.00 ? 81  SER A C    6  
ATOM 9560  O O    . SER A 1 81  ? 5.083   -2.383  4.069   1.00 0.00 ? 81  SER A O    6  
ATOM 9561  C CB   . SER A 1 81  ? 3.493   -3.874  6.605   1.00 0.00 ? 81  SER A CB   6  
ATOM 9562  O OG   . SER A 1 81  ? 3.610   -2.528  7.034   1.00 0.00 ? 81  SER A OG   6  
ATOM 9563  H H    . SER A 1 81  ? 2.868   -5.959  5.229   1.00 0.00 ? 81  SER A H    6  
ATOM 9564  H HA   . SER A 1 81  ? 2.833   -3.362  4.634   1.00 0.00 ? 81  SER A HA   6  
ATOM 9565  H HB2  . SER A 1 81  ? 2.536   -4.258  6.923   1.00 0.00 ? 81  SER A HB2  6  
ATOM 9566  H HB3  . SER A 1 81  ? 4.283   -4.454  7.058   1.00 0.00 ? 81  SER A HB3  6  
ATOM 9567  H HG   . SER A 1 81  ? 4.371   -2.123  6.612   1.00 0.00 ? 81  SER A HG   6  
ATOM 9568  N N    . SER A 1 82  ? 5.994   -4.286  4.853   1.00 0.00 ? 82  SER A N    6  
ATOM 9569  C CA   . SER A 1 82  ? 7.352   -3.925  4.465   1.00 0.00 ? 82  SER A CA   6  
ATOM 9570  C C    . SER A 1 82  ? 7.415   -3.551  2.988   1.00 0.00 ? 82  SER A C    6  
ATOM 9571  O O    . SER A 1 82  ? 7.632   -2.391  2.638   1.00 0.00 ? 82  SER A O    6  
ATOM 9572  C CB   . SER A 1 82  ? 8.311   -5.082  4.751   1.00 0.00 ? 82  SER A CB   6  
ATOM 9573  O OG   . SER A 1 82  ? 9.649   -4.625  4.842   1.00 0.00 ? 82  SER A OG   6  
ATOM 9574  H H    . SER A 1 82  ? 5.835   -5.145  5.297   1.00 0.00 ? 82  SER A H    6  
ATOM 9575  H HA   . SER A 1 82  ? 7.649   -3.070  5.054   1.00 0.00 ? 82  SER A HA   6  
ATOM 9576  H HB2  . SER A 1 82  ? 8.039   -5.550  5.685   1.00 0.00 ? 82  SER A HB2  6  
ATOM 9577  H HB3  . SER A 1 82  ? 8.244   -5.807  3.953   1.00 0.00 ? 82  SER A HB3  6  
ATOM 9578  H HG   . SER A 1 82  ? 9.660   -3.735  5.201   1.00 0.00 ? 82  SER A HG   6  
ATOM 9579  N N    . MET A 1 83  ? 7.222   -4.543  2.124   1.00 0.00 ? 83  MET A N    6  
ATOM 9580  C CA   . MET A 1 83  ? 7.255   -4.318  0.683   1.00 0.00 ? 83  MET A CA   6  
ATOM 9581  C C    . MET A 1 83  ? 6.457   -3.074  0.309   1.00 0.00 ? 83  MET A C    6  
ATOM 9582  O O    . MET A 1 83  ? 6.964   -2.180  -0.371  1.00 0.00 ? 83  MET A O    6  
ATOM 9583  C CB   . MET A 1 83  ? 6.700   -5.536  -0.057  1.00 0.00 ? 83  MET A CB   6  
ATOM 9584  C CG   . MET A 1 83  ? 7.598   -6.760  0.028   1.00 0.00 ? 83  MET A CG   6  
ATOM 9585  S SD   . MET A 1 83  ? 6.728   -8.289  -0.369  1.00 0.00 ? 83  MET A SD   6  
ATOM 9586  C CE   . MET A 1 83  ? 6.800   -9.139  1.206   1.00 0.00 ? 83  MET A CE   6  
ATOM 9587  H H    . MET A 1 83  ? 7.053   -5.447  2.463   1.00 0.00 ? 83  MET A H    6  
ATOM 9588  H HA   . MET A 1 83  ? 8.285   -4.171  0.395   1.00 0.00 ? 83  MET A HA   6  
ATOM 9589  H HB2  . MET A 1 83  ? 5.739   -5.792  0.364   1.00 0.00 ? 83  MET A HB2  6  
ATOM 9590  H HB3  . MET A 1 83  ? 6.572   -5.283  -1.099  1.00 0.00 ? 83  MET A HB3  6  
ATOM 9591  H HG2  . MET A 1 83  ? 8.417   -6.639  -0.665  1.00 0.00 ? 83  MET A HG2  6  
ATOM 9592  H HG3  . MET A 1 83  ? 7.987   -6.834  1.033   1.00 0.00 ? 83  MET A HG3  6  
ATOM 9593  H HE1  . MET A 1 83  ? 5.851   -9.615  1.403   1.00 0.00 ? 83  MET A HE1  6  
ATOM 9594  H HE2  . MET A 1 83  ? 7.579   -9.886  1.176   1.00 0.00 ? 83  MET A HE2  6  
ATOM 9595  H HE3  . MET A 1 83  ? 7.014   -8.426  1.990   1.00 0.00 ? 83  MET A HE3  6  
ATOM 9596  N N    . LEU A 1 84  ? 5.206   -3.022  0.754   1.00 0.00 ? 84  LEU A N    6  
ATOM 9597  C CA   . LEU A 1 84  ? 4.337   -1.886  0.465   1.00 0.00 ? 84  LEU A CA   6  
ATOM 9598  C C    . LEU A 1 84  ? 5.092   -0.570  0.623   1.00 0.00 ? 84  LEU A C    6  
ATOM 9599  O O    . LEU A 1 84  ? 5.153   0.238   -0.305  1.00 0.00 ? 84  LEU A O    6  
ATOM 9600  C CB   . LEU A 1 84  ? 3.119   -1.903  1.390   1.00 0.00 ? 84  LEU A CB   6  
ATOM 9601  C CG   . LEU A 1 84  ? 1.973   -2.826  0.974   1.00 0.00 ? 84  LEU A CG   6  
ATOM 9602  C CD1  . LEU A 1 84  ? 0.986   -3.000  2.118   1.00 0.00 ? 84  LEU A CD1  6  
ATOM 9603  C CD2  . LEU A 1 84  ? 1.271   -2.282  -0.261  1.00 0.00 ? 84  LEU A CD2  6  
ATOM 9604  H H    . LEU A 1 84  ? 4.858   -3.764  1.291   1.00 0.00 ? 84  LEU A H    6  
ATOM 9605  H HA   . LEU A 1 84  ? 4.004   -1.976  -0.558  1.00 0.00 ? 84  LEU A HA   6  
ATOM 9606  H HB2  . LEU A 1 84  ? 3.452   -2.210  2.370   1.00 0.00 ? 84  LEU A HB2  6  
ATOM 9607  H HB3  . LEU A 1 84  ? 2.731   -0.896  1.443   1.00 0.00 ? 84  LEU A HB3  6  
ATOM 9608  H HG   . LEU A 1 84  ? 2.375   -3.800  0.730   1.00 0.00 ? 84  LEU A HG   6  
ATOM 9609  H HD11 . LEU A 1 84  ? 0.230   -3.716  1.834   1.00 0.00 ? 84  LEU A HD11 6  
ATOM 9610  H HD12 . LEU A 1 84  ? 0.519   -2.051  2.337   1.00 0.00 ? 84  LEU A HD12 6  
ATOM 9611  H HD13 . LEU A 1 84  ? 1.509   -3.355  2.994   1.00 0.00 ? 84  LEU A HD13 6  
ATOM 9612  H HD21 . LEU A 1 84  ? 0.215   -2.182  -0.060  1.00 0.00 ? 84  LEU A HD21 6  
ATOM 9613  H HD22 . LEU A 1 84  ? 1.417   -2.963  -1.087  1.00 0.00 ? 84  LEU A HD22 6  
ATOM 9614  H HD23 . LEU A 1 84  ? 1.683   -1.316  -0.513  1.00 0.00 ? 84  LEU A HD23 6  
ATOM 9615  N N    . LYS A 1 85  ? 5.666   -0.360  1.802   1.00 0.00 ? 85  LYS A N    6  
ATOM 9616  C CA   . LYS A 1 85  ? 6.420   0.856   2.081   1.00 0.00 ? 85  LYS A CA   6  
ATOM 9617  C C    . LYS A 1 85  ? 7.432   1.135   0.975   1.00 0.00 ? 85  LYS A C    6  
ATOM 9618  O O    . LYS A 1 85  ? 7.427   2.210   0.373   1.00 0.00 ? 85  LYS A O    6  
ATOM 9619  C CB   . LYS A 1 85  ? 7.139   0.737   3.427   1.00 0.00 ? 85  LYS A CB   6  
ATOM 9620  C CG   . LYS A 1 85  ? 7.623   2.068   3.977   1.00 0.00 ? 85  LYS A CG   6  
ATOM 9621  C CD   . LYS A 1 85  ? 8.406   1.886   5.267   1.00 0.00 ? 85  LYS A CD   6  
ATOM 9622  C CE   . LYS A 1 85  ? 7.482   1.645   6.451   1.00 0.00 ? 85  LYS A CE   6  
ATOM 9623  N NZ   . LYS A 1 85  ? 8.242   1.444   7.715   1.00 0.00 ? 85  LYS A NZ   6  
ATOM 9624  H H    . LYS A 1 85  ? 5.582   -1.042  2.502   1.00 0.00 ? 85  LYS A H    6  
ATOM 9625  H HA   . LYS A 1 85  ? 5.720   1.677   2.128   1.00 0.00 ? 85  LYS A HA   6  
ATOM 9626  H HB2  . LYS A 1 85  ? 6.463   0.299   4.146   1.00 0.00 ? 85  LYS A HB2  6  
ATOM 9627  H HB3  . LYS A 1 85  ? 7.995   0.088   3.308   1.00 0.00 ? 85  LYS A HB3  6  
ATOM 9628  H HG2  . LYS A 1 85  ? 8.262   2.539   3.245   1.00 0.00 ? 85  LYS A HG2  6  
ATOM 9629  H HG3  . LYS A 1 85  ? 6.768   2.699   4.172   1.00 0.00 ? 85  LYS A HG3  6  
ATOM 9630  H HD2  . LYS A 1 85  ? 9.066   1.038   5.161   1.00 0.00 ? 85  LYS A HD2  6  
ATOM 9631  H HD3  . LYS A 1 85  ? 8.989   2.777   5.452   1.00 0.00 ? 85  LYS A HD3  6  
ATOM 9632  H HE2  . LYS A 1 85  ? 6.832   2.498   6.563   1.00 0.00 ? 85  LYS A HE2  6  
ATOM 9633  H HE3  . LYS A 1 85  ? 6.889   0.764   6.253   1.00 0.00 ? 85  LYS A HE3  6  
ATOM 9634  H HZ1  . LYS A 1 85  ? 8.088   0.480   8.075   1.00 0.00 ? 85  LYS A HZ1  6  
ATOM 9635  H HZ2  . LYS A 1 85  ? 7.925   2.125   8.434   1.00 0.00 ? 85  LYS A HZ2  6  
ATOM 9636  H HZ3  . LYS A 1 85  ? 9.259   1.582   7.547   1.00 0.00 ? 85  LYS A HZ3  6  
ATOM 9637  N N    . ASP A 1 86  ? 8.296   0.162   0.710   1.00 0.00 ? 86  ASP A N    6  
ATOM 9638  C CA   . ASP A 1 86  ? 9.312   0.302   -0.326  1.00 0.00 ? 86  ASP A CA   6  
ATOM 9639  C C    . ASP A 1 86  ? 8.687   0.755   -1.642  1.00 0.00 ? 86  ASP A C    6  
ATOM 9640  O O    . ASP A 1 86  ? 9.244   1.595   -2.350  1.00 0.00 ? 86  ASP A O    6  
ATOM 9641  C CB   . ASP A 1 86  ? 10.052  -1.021  -0.528  1.00 0.00 ? 86  ASP A CB   6  
ATOM 9642  C CG   . ASP A 1 86  ? 11.255  -0.879  -1.439  1.00 0.00 ? 86  ASP A CG   6  
ATOM 9643  O OD1  . ASP A 1 86  ? 11.072  -0.923  -2.673  1.00 0.00 ? 86  ASP A OD1  6  
ATOM 9644  O OD2  . ASP A 1 86  ? 12.380  -0.725  -0.918  1.00 0.00 ? 86  ASP A OD2  6  
ATOM 9645  H H    . ASP A 1 86  ? 8.249   -0.672  1.224   1.00 0.00 ? 86  ASP A H    6  
ATOM 9646  H HA   . ASP A 1 86  ? 10.017  1.052   -0.001  1.00 0.00 ? 86  ASP A HA   6  
ATOM 9647  H HB2  . ASP A 1 86  ? 10.391  -1.386  0.431   1.00 0.00 ? 86  ASP A HB2  6  
ATOM 9648  H HB3  . ASP A 1 86  ? 9.376   -1.742  -0.963  1.00 0.00 ? 86  ASP A HB3  6  
ATOM 9649  N N    . PHE A 1 87  ? 7.527   0.192   -1.965  1.00 0.00 ? 87  PHE A N    6  
ATOM 9650  C CA   . PHE A 1 87  ? 6.827   0.536   -3.197  1.00 0.00 ? 87  PHE A CA   6  
ATOM 9651  C C    . PHE A 1 87  ? 6.426   2.008   -3.202  1.00 0.00 ? 87  PHE A C    6  
ATOM 9652  O O    . PHE A 1 87  ? 6.534   2.690   -4.222  1.00 0.00 ? 87  PHE A O    6  
ATOM 9653  C CB   . PHE A 1 87  ? 5.586   -0.343  -3.366  1.00 0.00 ? 87  PHE A CB   6  
ATOM 9654  C CG   . PHE A 1 87  ? 5.854   -1.622  -4.106  1.00 0.00 ? 87  PHE A CG   6  
ATOM 9655  C CD1  . PHE A 1 87  ? 6.887   -2.459  -3.716  1.00 0.00 ? 87  PHE A CD1  6  
ATOM 9656  C CD2  . PHE A 1 87  ? 5.073   -1.988  -5.190  1.00 0.00 ? 87  PHE A CD2  6  
ATOM 9657  C CE1  . PHE A 1 87  ? 7.137   -3.637  -4.396  1.00 0.00 ? 87  PHE A CE1  6  
ATOM 9658  C CE2  . PHE A 1 87  ? 5.317   -3.164  -5.873  1.00 0.00 ? 87  PHE A CE2  6  
ATOM 9659  C CZ   . PHE A 1 87  ? 6.350   -3.990  -5.475  1.00 0.00 ? 87  PHE A CZ   6  
ATOM 9660  H H    . PHE A 1 87  ? 7.133   -0.471  -1.360  1.00 0.00 ? 87  PHE A H    6  
ATOM 9661  H HA   . PHE A 1 87  ? 7.500   0.356   -4.021  1.00 0.00 ? 87  PHE A HA   6  
ATOM 9662  H HB2  . PHE A 1 87  ? 5.200   -0.599  -2.391  1.00 0.00 ? 87  PHE A HB2  6  
ATOM 9663  H HB3  . PHE A 1 87  ? 4.836   0.208   -3.913  1.00 0.00 ? 87  PHE A HB3  6  
ATOM 9664  H HD1  . PHE A 1 87  ? 7.503   -2.185  -2.872  1.00 0.00 ? 87  PHE A HD1  6  
ATOM 9665  H HD2  . PHE A 1 87  ? 4.264   -1.342  -5.502  1.00 0.00 ? 87  PHE A HD2  6  
ATOM 9666  H HE1  . PHE A 1 87  ? 7.944   -4.281  -4.082  1.00 0.00 ? 87  PHE A HE1  6  
ATOM 9667  H HE2  . PHE A 1 87  ? 4.700   -3.437  -6.716  1.00 0.00 ? 87  PHE A HE2  6  
ATOM 9668  H HZ   . PHE A 1 87  ? 6.543   -4.910  -6.008  1.00 0.00 ? 87  PHE A HZ   6  
ATOM 9669  N N    . LEU A 1 88  ? 5.961   2.492   -2.055  1.00 0.00 ? 88  LEU A N    6  
ATOM 9670  C CA   . LEU A 1 88  ? 5.543   3.884   -1.925  1.00 0.00 ? 88  LEU A CA   6  
ATOM 9671  C C    . LEU A 1 88  ? 6.751   4.812   -1.855  1.00 0.00 ? 88  LEU A C    6  
ATOM 9672  O O    . LEU A 1 88  ? 6.632   6.019   -2.063  1.00 0.00 ? 88  LEU A O    6  
ATOM 9673  C CB   . LEU A 1 88  ? 4.675   4.062   -0.678  1.00 0.00 ? 88  LEU A CB   6  
ATOM 9674  C CG   . LEU A 1 88  ? 3.329   3.338   -0.688  1.00 0.00 ? 88  LEU A CG   6  
ATOM 9675  C CD1  . LEU A 1 88  ? 2.734   3.296   0.711   1.00 0.00 ? 88  LEU A CD1  6  
ATOM 9676  C CD2  . LEU A 1 88  ? 2.368   4.011   -1.657  1.00 0.00 ? 88  LEU A CD2  6  
ATOM 9677  H H    . LEU A 1 88  ? 5.898   1.901   -1.276  1.00 0.00 ? 88  LEU A H    6  
ATOM 9678  H HA   . LEU A 1 88  ? 4.960   4.137   -2.798  1.00 0.00 ? 88  LEU A HA   6  
ATOM 9679  H HB2  . LEU A 1 88  ? 5.238   3.701   0.170   1.00 0.00 ? 88  LEU A HB2  6  
ATOM 9680  H HB3  . LEU A 1 88  ? 4.483   5.118   -0.557  1.00 0.00 ? 88  LEU A HB3  6  
ATOM 9681  H HG   . LEU A 1 88  ? 3.477   2.318   -1.017  1.00 0.00 ? 88  LEU A HG   6  
ATOM 9682  H HD11 . LEU A 1 88  ? 1.854   3.920   0.747   1.00 0.00 ? 88  LEU A HD11 6  
ATOM 9683  H HD12 . LEU A 1 88  ? 3.462   3.658   1.422   1.00 0.00 ? 88  LEU A HD12 6  
ATOM 9684  H HD13 . LEU A 1 88  ? 2.466   2.279   0.958   1.00 0.00 ? 88  LEU A HD13 6  
ATOM 9685  H HD21 . LEU A 1 88  ? 1.693   4.651   -1.108  1.00 0.00 ? 88  LEU A HD21 6  
ATOM 9686  H HD22 . LEU A 1 88  ? 1.801   3.257   -2.184  1.00 0.00 ? 88  LEU A HD22 6  
ATOM 9687  H HD23 . LEU A 1 88  ? 2.928   4.603   -2.366  1.00 0.00 ? 88  LEU A HD23 6  
ATOM 9688  N N    . SER A 1 89  ? 7.914   4.239   -1.561  1.00 0.00 ? 89  SER A N    6  
ATOM 9689  C CA   . SER A 1 89  ? 9.145   5.015   -1.462  1.00 0.00 ? 89  SER A CA   6  
ATOM 9690  C C    . SER A 1 89  ? 9.708   5.321   -2.846  1.00 0.00 ? 89  SER A C    6  
ATOM 9691  O O    . SER A 1 89  ? 10.725  6.001   -2.978  1.00 0.00 ? 89  SER A O    6  
ATOM 9692  C CB   . SER A 1 89  ? 10.184  4.259   -0.632  1.00 0.00 ? 89  SER A CB   6  
ATOM 9693  O OG   . SER A 1 89  ? 11.282  5.093   -0.307  1.00 0.00 ? 89  SER A OG   6  
ATOM 9694  H H    . SER A 1 89  ? 7.945   3.272   -1.405  1.00 0.00 ? 89  SER A H    6  
ATOM 9695  H HA   . SER A 1 89  ? 8.911   5.946   -0.967  1.00 0.00 ? 89  SER A HA   6  
ATOM 9696  H HB2  . SER A 1 89  ? 9.728   3.912   0.283   1.00 0.00 ? 89  SER A HB2  6  
ATOM 9697  H HB3  . SER A 1 89  ? 10.545  3.412   -1.198  1.00 0.00 ? 89  SER A HB3  6  
ATOM 9698  H HG   . SER A 1 89  ? 12.090  4.574   -0.307  1.00 0.00 ? 89  SER A HG   6  
ATOM 9699  N N    . GLN A 1 90  ? 9.037   4.813   -3.876  1.00 0.00 ? 90  GLN A N    6  
ATOM 9700  C CA   . GLN A 1 90  ? 9.471   5.031   -5.251  1.00 0.00 ? 90  GLN A CA   6  
ATOM 9701  C C    . GLN A 1 90  ? 8.644   6.128   -5.915  1.00 0.00 ? 90  GLN A C    6  
ATOM 9702  O O    . GLN A 1 90  ? 7.476   6.341   -5.590  1.00 0.00 ? 90  GLN A O    6  
ATOM 9703  C CB   . GLN A 1 90  ? 9.359   3.735   -6.055  1.00 0.00 ? 90  GLN A CB   6  
ATOM 9704  C CG   . GLN A 1 90  ? 9.956   2.528   -5.349  1.00 0.00 ? 90  GLN A CG   6  
ATOM 9705  C CD   . GLN A 1 90  ? 11.460  2.634   -5.183  1.00 0.00 ? 90  GLN A CD   6  
ATOM 9706  O OE1  . GLN A 1 90  ? 12.119  3.409   -5.877  1.00 0.00 ? 90  GLN A OE1  6  
ATOM 9707  N NE2  . GLN A 1 90  ? 12.010  1.855   -4.259  1.00 0.00 ? 90  GLN A NE2  6  
ATOM 9708  H H    . GLN A 1 90  ? 8.234   4.280   -3.707  1.00 0.00 ? 90  GLN A H    6  
ATOM 9709  H HA   . GLN A 1 90  ? 10.504  5.342   -5.227  1.00 0.00 ? 90  GLN A HA   6  
ATOM 9710  H HB2  . GLN A 1 90  ? 8.316   3.533   -6.247  1.00 0.00 ? 90  GLN A HB2  6  
ATOM 9711  H HB3  . GLN A 1 90  ? 9.872   3.864   -6.996  1.00 0.00 ? 90  GLN A HB3  6  
ATOM 9712  H HG2  . GLN A 1 90  ? 9.507   2.440   -4.371  1.00 0.00 ? 90  GLN A HG2  6  
ATOM 9713  H HG3  . GLN A 1 90  ? 9.734   1.643   -5.927  1.00 0.00 ? 90  GLN A HG3  6  
ATOM 9714  H HE21 . GLN A 1 90  ? 11.422  1.261   -3.745  1.00 0.00 ? 90  GLN A HE21 6  
ATOM 9715  H HE22 . GLN A 1 90  ? 12.979  1.902   -4.131  1.00 0.00 ? 90  GLN A HE22 6  
ATOM 9716  N N    . PRO A 1 91  ? 9.263   6.841   -6.867  1.00 0.00 ? 91  PRO A N    6  
ATOM 9717  C CA   . PRO A 1 91  ? 8.603   7.928   -7.597  1.00 0.00 ? 91  PRO A CA   6  
ATOM 9718  C C    . PRO A 1 91  ? 7.522   7.417   -8.544  1.00 0.00 ? 91  PRO A C    6  
ATOM 9719  O O    . PRO A 1 91  ? 6.537   8.107   -8.806  1.00 0.00 ? 91  PRO A O    6  
ATOM 9720  C CB   . PRO A 1 91  ? 9.745   8.570   -8.387  1.00 0.00 ? 91  PRO A CB   6  
ATOM 9721  C CG   . PRO A 1 91  ? 10.752  7.484   -8.547  1.00 0.00 ? 91  PRO A CG   6  
ATOM 9722  C CD   . PRO A 1 91  ? 10.654  6.642   -7.306  1.00 0.00 ? 91  PRO A CD   6  
ATOM 9723  H HA   . PRO A 1 91  ? 8.175   8.656   -6.923  1.00 0.00 ? 91  PRO A HA   6  
ATOM 9724  H HB2  . PRO A 1 91  ? 9.377   8.913   -9.344  1.00 0.00 ? 91  PRO A HB2  6  
ATOM 9725  H HB3  . PRO A 1 91  ? 10.149  9.403   -7.831  1.00 0.00 ? 91  PRO A HB3  6  
ATOM 9726  H HG2  . PRO A 1 91  ? 10.520  6.894   -9.421  1.00 0.00 ? 91  PRO A HG2  6  
ATOM 9727  H HG3  . PRO A 1 91  ? 11.741  7.910   -8.633  1.00 0.00 ? 91  PRO A HG3  6  
ATOM 9728  H HD2  . PRO A 1 91  ? 10.840  5.604   -7.539  1.00 0.00 ? 91  PRO A HD2  6  
ATOM 9729  H HD3  . PRO A 1 91  ? 11.348  6.992   -6.556  1.00 0.00 ? 91  PRO A HD3  6  
ATOM 9730  N N    . SER A 1 92  ? 7.712   6.205   -9.053  1.00 0.00 ? 92  SER A N    6  
ATOM 9731  C CA   . SER A 1 92  ? 6.755   5.603   -9.974  1.00 0.00 ? 92  SER A CA   6  
ATOM 9732  C C    . SER A 1 92  ? 6.098   4.375   -9.350  1.00 0.00 ? 92  SER A C    6  
ATOM 9733  O O    . SER A 1 92  ? 6.720   3.655   -8.567  1.00 0.00 ? 92  SER A O    6  
ATOM 9734  C CB   . SER A 1 92  ? 7.447   5.216   -11.282 1.00 0.00 ? 92  SER A CB   6  
ATOM 9735  O OG   . SER A 1 92  ? 8.271   4.077   -11.105 1.00 0.00 ? 92  SER A OG   6  
ATOM 9736  H H    . SER A 1 92  ? 8.518   5.704   -8.806  1.00 0.00 ? 92  SER A H    6  
ATOM 9737  H HA   . SER A 1 92  ? 5.991   6.337   -10.184 1.00 0.00 ? 92  SER A HA   6  
ATOM 9738  H HB2  . SER A 1 92  ? 6.701   4.992   -12.029 1.00 0.00 ? 92  SER A HB2  6  
ATOM 9739  H HB3  . SER A 1 92  ? 8.059   6.040   -11.620 1.00 0.00 ? 92  SER A HB3  6  
ATOM 9740  H HG   . SER A 1 92  ? 9.085   4.190   -11.602 1.00 0.00 ? 92  SER A HG   6  
ATOM 9741  N N    . LEU A 1 93  ? 4.839   4.143   -9.701  1.00 0.00 ? 93  LEU A N    6  
ATOM 9742  C CA   . LEU A 1 93  ? 4.096   3.002   -9.176  1.00 0.00 ? 93  LEU A CA   6  
ATOM 9743  C C    . LEU A 1 93  ? 2.902   2.674   -10.067 1.00 0.00 ? 93  LEU A C    6  
ATOM 9744  O O    . LEU A 1 93  ? 2.352   3.549   -10.733 1.00 0.00 ? 93  LEU A O    6  
ATOM 9745  C CB   . LEU A 1 93  ? 3.620   3.290   -7.752  1.00 0.00 ? 93  LEU A CB   6  
ATOM 9746  C CG   . LEU A 1 93  ? 4.600   2.937   -6.632  1.00 0.00 ? 93  LEU A CG   6  
ATOM 9747  C CD1  . LEU A 1 93  ? 3.911   3.002   -5.279  1.00 0.00 ? 93  LEU A CD1  6  
ATOM 9748  C CD2  . LEU A 1 93  ? 5.199   1.557   -6.863  1.00 0.00 ? 93  LEU A CD2  6  
ATOM 9749  H H    . LEU A 1 93  ? 4.397   4.752   -10.329 1.00 0.00 ? 93  LEU A H    6  
ATOM 9750  H HA   . LEU A 1 93  ? 4.762   2.152   -9.160  1.00 0.00 ? 93  LEU A HA   6  
ATOM 9751  H HB2  . LEU A 1 93  ? 3.405   4.345   -7.682  1.00 0.00 ? 93  LEU A HB2  6  
ATOM 9752  H HB3  . LEU A 1 93  ? 2.712   2.728   -7.587  1.00 0.00 ? 93  LEU A HB3  6  
ATOM 9753  H HG   . LEU A 1 93  ? 5.408   3.656   -6.629  1.00 0.00 ? 93  LEU A HG   6  
ATOM 9754  H HD11 . LEU A 1 93  ? 4.370   2.293   -4.606  1.00 0.00 ? 93  LEU A HD11 6  
ATOM 9755  H HD12 . LEU A 1 93  ? 2.864   2.761   -5.396  1.00 0.00 ? 93  LEU A HD12 6  
ATOM 9756  H HD13 . LEU A 1 93  ? 4.007   3.998   -4.873  1.00 0.00 ? 93  LEU A HD13 6  
ATOM 9757  H HD21 . LEU A 1 93  ? 6.050   1.640   -7.522  1.00 0.00 ? 93  LEU A HD21 6  
ATOM 9758  H HD22 . LEU A 1 93  ? 4.456   0.914   -7.313  1.00 0.00 ? 93  LEU A HD22 6  
ATOM 9759  H HD23 . LEU A 1 93  ? 5.513   1.139   -5.919  1.00 0.00 ? 93  LEU A HD23 6  
ATOM 9760  N N    . GLY A 1 94  ? 2.504   1.405   -10.071 1.00 0.00 ? 94  GLY A N    6  
ATOM 9761  C CA   . GLY A 1 94  ? 1.376   0.983   -10.881 1.00 0.00 ? 94  GLY A CA   6  
ATOM 9762  C C    . GLY A 1 94  ? 0.329   0.241   -10.075 1.00 0.00 ? 94  GLY A C    6  
ATOM 9763  O O    . GLY A 1 94  ? 0.620   -0.788  -9.463  1.00 0.00 ? 94  GLY A O    6  
ATOM 9764  H H    . GLY A 1 94  ? 2.981   0.750   -9.519  1.00 0.00 ? 94  GLY A H    6  
ATOM 9765  H HA2  . GLY A 1 94  ? 0.921   1.855   -11.327 1.00 0.00 ? 94  GLY A HA2  6  
ATOM 9766  H HA3  . GLY A 1 94  ? 1.735   0.335   -11.667 1.00 0.00 ? 94  GLY A HA3  6  
ATOM 9767  N N    . LEU A 1 95  ? -0.893  0.762   -10.073 1.00 0.00 ? 95  LEU A N    6  
ATOM 9768  C CA   . LEU A 1 95  ? -1.987  0.142   -9.334  1.00 0.00 ? 95  LEU A CA   6  
ATOM 9769  C C    . LEU A 1 95  ? -3.091  -0.318  -10.281 1.00 0.00 ? 95  LEU A C    6  
ATOM 9770  O O    . LEU A 1 95  ? -3.162  0.122   -11.429 1.00 0.00 ? 95  LEU A O    6  
ATOM 9771  C CB   . LEU A 1 95  ? -2.556  1.124   -8.308  1.00 0.00 ? 95  LEU A CB   6  
ATOM 9772  C CG   . LEU A 1 95  ? -1.539  1.794   -7.385  1.00 0.00 ? 95  LEU A CG   6  
ATOM 9773  C CD1  . LEU A 1 95  ? -2.142  3.029   -6.733  1.00 0.00 ? 95  LEU A CD1  6  
ATOM 9774  C CD2  . LEU A 1 95  ? -1.051  0.815   -6.327  1.00 0.00 ? 95  LEU A CD2  6  
ATOM 9775  H H    . LEU A 1 95  ? -1.064  1.583   -10.579 1.00 0.00 ? 95  LEU A H    6  
ATOM 9776  H HA   . LEU A 1 95  ? -1.592  -0.719  -8.816  1.00 0.00 ? 95  LEU A HA   6  
ATOM 9777  H HB2  . LEU A 1 95  ? -3.076  1.901   -8.847  1.00 0.00 ? 95  LEU A HB2  6  
ATOM 9778  H HB3  . LEU A 1 95  ? -3.260  0.584   -7.690  1.00 0.00 ? 95  LEU A HB3  6  
ATOM 9779  H HG   . LEU A 1 95  ? -0.685  2.110   -7.969  1.00 0.00 ? 95  LEU A HG   6  
ATOM 9780  H HD11 . LEU A 1 95  ? -1.405  3.817   -6.704  1.00 0.00 ? 95  LEU A HD11 6  
ATOM 9781  H HD12 . LEU A 1 95  ? -2.452  2.789   -5.726  1.00 0.00 ? 95  LEU A HD12 6  
ATOM 9782  H HD13 . LEU A 1 95  ? -2.998  3.356   -7.304  1.00 0.00 ? 95  LEU A HD13 6  
ATOM 9783  H HD21 . LEU A 1 95  ? -0.046  0.501   -6.564  1.00 0.00 ? 95  LEU A HD21 6  
ATOM 9784  H HD22 . LEU A 1 95  ? -1.702  -0.047  -6.308  1.00 0.00 ? 95  LEU A HD22 6  
ATOM 9785  H HD23 . LEU A 1 95  ? -1.060  1.295   -5.360  1.00 0.00 ? 95  LEU A HD23 6  
ATOM 9786  N N    . LEU A 1 96  ? -3.952  -1.204  -9.792  1.00 0.00 ? 96  LEU A N    6  
ATOM 9787  C CA   . LEU A 1 96  ? -5.054  -1.723  -10.594 1.00 0.00 ? 96  LEU A CA   6  
ATOM 9788  C C    . LEU A 1 96  ? -6.356  -1.715  -9.799  1.00 0.00 ? 96  LEU A C    6  
ATOM 9789  O O    . LEU A 1 96  ? -6.612  -2.614  -8.998  1.00 0.00 ? 96  LEU A O    6  
ATOM 9790  C CB   . LEU A 1 96  ? -4.742  -3.143  -11.069 1.00 0.00 ? 96  LEU A CB   6  
ATOM 9791  C CG   . LEU A 1 96  ? -5.791  -3.795  -11.970 1.00 0.00 ? 96  LEU A CG   6  
ATOM 9792  C CD1  . LEU A 1 96  ? -5.885  -3.061  -13.298 1.00 0.00 ? 96  LEU A CD1  6  
ATOM 9793  C CD2  . LEU A 1 96  ? -5.464  -5.265  -12.192 1.00 0.00 ? 96  LEU A CD2  6  
ATOM 9794  H H    . LEU A 1 96  ? -3.844  -1.517  -8.870  1.00 0.00 ? 96  LEU A H    6  
ATOM 9795  H HA   . LEU A 1 96  ? -5.169  -1.081  -11.455 1.00 0.00 ? 96  LEU A HA   6  
ATOM 9796  H HB2  . LEU A 1 96  ? -3.811  -3.111  -11.614 1.00 0.00 ? 96  LEU A HB2  6  
ATOM 9797  H HB3  . LEU A 1 96  ? -4.623  -3.765  -10.193 1.00 0.00 ? 96  LEU A HB3  6  
ATOM 9798  H HG   . LEU A 1 96  ? -6.757  -3.736  -11.488 1.00 0.00 ? 96  LEU A HG   6  
ATOM 9799  H HD11 . LEU A 1 96  ? -6.447  -2.150  -13.167 1.00 0.00 ? 96  LEU A HD11 6  
ATOM 9800  H HD12 . LEU A 1 96  ? -6.382  -3.690  -14.022 1.00 0.00 ? 96  LEU A HD12 6  
ATOM 9801  H HD13 . LEU A 1 96  ? -4.891  -2.825  -13.650 1.00 0.00 ? 96  LEU A HD13 6  
ATOM 9802  H HD21 . LEU A 1 96  ? -5.994  -5.624  -13.061 1.00 0.00 ? 96  LEU A HD21 6  
ATOM 9803  H HD22 . LEU A 1 96  ? -5.765  -5.835  -11.325 1.00 0.00 ? 96  LEU A HD22 6  
ATOM 9804  H HD23 . LEU A 1 96  ? -4.401  -5.377  -12.346 1.00 0.00 ? 96  LEU A HD23 6  
ATOM 9805  N N    . VAL A 1 97  ? -7.177  -0.694  -10.027 1.00 0.00 ? 97  VAL A N    6  
ATOM 9806  C CA   . VAL A 1 97  ? -8.454  -0.571  -9.335  1.00 0.00 ? 97  VAL A CA   6  
ATOM 9807  C C    . VAL A 1 97  ? -9.621  -0.741  -10.300 1.00 0.00 ? 97  VAL A C    6  
ATOM 9808  O O    . VAL A 1 97  ? -9.515  -0.413  -11.482 1.00 0.00 ? 97  VAL A O    6  
ATOM 9809  C CB   . VAL A 1 97  ? -8.581  0.792   -8.629  1.00 0.00 ? 97  VAL A CB   6  
ATOM 9810  C CG1  . VAL A 1 97  ? -7.588  0.893   -7.481  1.00 0.00 ? 97  VAL A CG1  6  
ATOM 9811  C CG2  . VAL A 1 97  ? -8.378  1.926   -9.622  1.00 0.00 ? 97  VAL A CG2  6  
ATOM 9812  H H    . VAL A 1 97  ? -6.917  -0.008  -10.677 1.00 0.00 ? 97  VAL A H    6  
ATOM 9813  H HA   . VAL A 1 97  ? -8.504  -1.347  -8.584  1.00 0.00 ? 97  VAL A HA   6  
ATOM 9814  H HB   . VAL A 1 97  ? -9.578  0.872   -8.222  1.00 0.00 ? 97  VAL A HB   6  
ATOM 9815  H HG11 . VAL A 1 97  ? -6.604  0.619   -7.831  1.00 0.00 ? 97  VAL A HG11 6  
ATOM 9816  H HG12 . VAL A 1 97  ? -7.570  1.907   -7.108  1.00 0.00 ? 97  VAL A HG12 6  
ATOM 9817  H HG13 . VAL A 1 97  ? -7.887  0.224   -6.687  1.00 0.00 ? 97  VAL A HG13 6  
ATOM 9818  H HG21 . VAL A 1 97  ? -7.326  2.163   -9.687  1.00 0.00 ? 97  VAL A HG21 6  
ATOM 9819  H HG22 . VAL A 1 97  ? -8.739  1.624   -10.594 1.00 0.00 ? 97  VAL A HG22 6  
ATOM 9820  H HG23 . VAL A 1 97  ? -8.923  2.797   -9.291  1.00 0.00 ? 97  VAL A HG23 6  
ATOM 9821  N N    . ARG A 1 98  ? -10.735 -1.257  -9.789  1.00 0.00 ? 98  ARG A N    6  
ATOM 9822  C CA   . ARG A 1 98  ? -11.923 -1.471  -10.607 1.00 0.00 ? 98  ARG A CA   6  
ATOM 9823  C C    . ARG A 1 98  ? -12.829 -0.244  -10.582 1.00 0.00 ? 98  ARG A C    6  
ATOM 9824  O O    . ARG A 1 98  ? -12.982 0.408   -9.548  1.00 0.00 ? 98  ARG A O    6  
ATOM 9825  C CB   . ARG A 1 98  ? -12.693 -2.698  -10.113 1.00 0.00 ? 98  ARG A CB   6  
ATOM 9826  C CG   . ARG A 1 98  ? -13.527 -3.368  -11.193 1.00 0.00 ? 98  ARG A CG   6  
ATOM 9827  C CD   . ARG A 1 98  ? -13.804 -4.825  -10.858 1.00 0.00 ? 98  ARG A CD   6  
ATOM 9828  N NE   . ARG A 1 98  ? -13.957 -5.643  -12.058 1.00 0.00 ? 98  ARG A NE   6  
ATOM 9829  C CZ   . ARG A 1 98  ? -14.365 -6.907  -12.039 1.00 0.00 ? 98  ARG A CZ   6  
ATOM 9830  N NH1  . ARG A 1 98  ? -14.660 -7.495  -10.888 1.00 0.00 ? 98  ARG A NH1  6  
ATOM 9831  N NH2  . ARG A 1 98  ? -14.480 -7.586  -13.173 1.00 0.00 ? 98  ARG A NH2  6  
ATOM 9832  H H    . ARG A 1 98  ? -10.758 -1.499  -8.840  1.00 0.00 ? 98  ARG A H    6  
ATOM 9833  H HA   . ARG A 1 98  ? -11.600 -1.645  -11.622 1.00 0.00 ? 98  ARG A HA   6  
ATOM 9834  H HB2  . ARG A 1 98  ? -11.988 -3.422  -9.733  1.00 0.00 ? 98  ARG A HB2  6  
ATOM 9835  H HB3  . ARG A 1 98  ? -13.353 -2.395  -9.314  1.00 0.00 ? 98  ARG A HB3  6  
ATOM 9836  H HG2  . ARG A 1 98  ? -14.468 -2.846  -11.283 1.00 0.00 ? 98  ARG A HG2  6  
ATOM 9837  H HG3  . ARG A 1 98  ? -12.993 -3.318  -12.130 1.00 0.00 ? 98  ARG A HG3  6  
ATOM 9838  H HD2  . ARG A 1 98  ? -12.980 -5.210  -10.275 1.00 0.00 ? 98  ARG A HD2  6  
ATOM 9839  H HD3  . ARG A 1 98  ? -14.712 -4.881  -10.277 1.00 0.00 ? 98  ARG A HD3  6  
ATOM 9840  H HE   . ARG A 1 98  ? -13.745 -5.229  -12.920 1.00 0.00 ? 98  ARG A HE   6  
ATOM 9841  H HH11 . ARG A 1 98  ? -14.575 -6.986  -10.031 1.00 0.00 ? 98  ARG A HH11 6  
ATOM 9842  H HH12 . ARG A 1 98  ? -14.968 -8.446  -10.876 1.00 0.00 ? 98  ARG A HH12 6  
ATOM 9843  H HH21 . ARG A 1 98  ? -14.259 -7.146  -14.043 1.00 0.00 ? 98  ARG A HH21 6  
ATOM 9844  H HH22 . ARG A 1 98  ? -14.787 -8.537  -13.158 1.00 0.00 ? 98  ARG A HH22 6  
ATOM 9845  N N    . THR A 1 99  ? -13.429 0.066   -11.727 1.00 0.00 ? 99  THR A N    6  
ATOM 9846  C CA   . THR A 1 99  ? -14.318 1.215   -11.837 1.00 0.00 ? 99  THR A CA   6  
ATOM 9847  C C    . THR A 1 99  ? -15.579 0.862   -12.618 1.00 0.00 ? 99  THR A C    6  
ATOM 9848  O O    . THR A 1 99  ? -15.577 -0.060  -13.436 1.00 0.00 ? 99  THR A O    6  
ATOM 9849  C CB   . THR A 1 99  ? -13.619 2.403   -12.524 1.00 0.00 ? 99  THR A CB   6  
ATOM 9850  O OG1  . THR A 1 99  ? -14.205 3.635   -12.089 1.00 0.00 ? 99  THR A OG1  6  
ATOM 9851  C CG2  . THR A 1 99  ? -13.724 2.292   -14.038 1.00 0.00 ? 99  THR A CG2  6  
ATOM 9852  H H    . THR A 1 99  ? -13.267 -0.492  -12.516 1.00 0.00 ? 99  THR A H    6  
ATOM 9853  H HA   . THR A 1 99  ? -14.598 1.517   -10.839 1.00 0.00 ? 99  THR A HA   6  
ATOM 9854  H HB   . THR A 1 99  ? -12.574 2.394   -12.250 1.00 0.00 ? 99  THR A HB   6  
ATOM 9855  H HG1  . THR A 1 99  ? -15.099 3.472   -11.779 1.00 0.00 ? 99  THR A HG1  6  
ATOM 9856  H HG21 . THR A 1 99  ? -13.653 1.254   -14.329 1.00 0.00 ? 99  THR A HG21 6  
ATOM 9857  H HG22 . THR A 1 99  ? -12.922 2.850   -14.497 1.00 0.00 ? 99  THR A HG22 6  
ATOM 9858  H HG23 . THR A 1 99  ? -14.673 2.692   -14.362 1.00 0.00 ? 99  THR A HG23 6  
ATOM 9859  N N    . TYR A 1 100 ? -16.654 1.599   -12.363 1.00 0.00 ? 100 TYR A N    6  
ATOM 9860  C CA   . TYR A 1 100 ? -17.922 1.362   -13.041 1.00 0.00 ? 100 TYR A CA   6  
ATOM 9861  C C    . TYR A 1 100 ? -18.040 2.225   -14.293 1.00 0.00 ? 100 TYR A C    6  
ATOM 9862  O O    . TYR A 1 100 ? -17.801 3.433   -14.271 1.00 0.00 ? 100 TYR A O    6  
ATOM 9863  C CB   . TYR A 1 100 ? -19.091 1.650   -12.097 1.00 0.00 ? 100 TYR A CB   6  
ATOM 9864  C CG   . TYR A 1 100 ? -18.774 1.385   -10.643 1.00 0.00 ? 100 TYR A CG   6  
ATOM 9865  C CD1  . TYR A 1 100 ? -18.416 0.114   -10.210 1.00 0.00 ? 100 TYR A CD1  6  
ATOM 9866  C CD2  . TYR A 1 100 ? -18.834 2.404   -9.701  1.00 0.00 ? 100 TYR A CD2  6  
ATOM 9867  C CE1  . TYR A 1 100 ? -18.126 -0.134  -8.882  1.00 0.00 ? 100 TYR A CE1  6  
ATOM 9868  C CE2  . TYR A 1 100 ? -18.545 2.167   -8.371  1.00 0.00 ? 100 TYR A CE2  6  
ATOM 9869  C CZ   . TYR A 1 100 ? -18.191 0.896   -7.967  1.00 0.00 ? 100 TYR A CZ   6  
ATOM 9870  O OH   . TYR A 1 100 ? -17.904 0.655   -6.643  1.00 0.00 ? 100 TYR A OH   6  
ATOM 9871  H H    . TYR A 1 100 ? -16.593 2.319   -11.701 1.00 0.00 ? 100 TYR A H    6  
ATOM 9872  H HA   . TYR A 1 100 ? -17.954 0.321   -13.331 1.00 0.00 ? 100 TYR A HA   6  
ATOM 9873  H HB2  . TYR A 1 100 ? -19.373 2.687   -12.191 1.00 0.00 ? 100 TYR A HB2  6  
ATOM 9874  H HB3  . TYR A 1 100 ? -19.930 1.027   -12.373 1.00 0.00 ? 100 TYR A HB3  6  
ATOM 9875  H HD1  . TYR A 1 100 ? -18.365 -0.691  -10.930 1.00 0.00 ? 100 TYR A HD1  6  
ATOM 9876  H HD2  . TYR A 1 100 ? -19.112 3.398   -10.021 1.00 0.00 ? 100 TYR A HD2  6  
ATOM 9877  H HE1  . TYR A 1 100 ? -17.849 -1.128  -8.565  1.00 0.00 ? 100 TYR A HE1  6  
ATOM 9878  H HE2  . TYR A 1 100 ? -18.597 2.972   -7.654  1.00 0.00 ? 100 TYR A HE2  6  
ATOM 9879  H HH   . TYR A 1 100 ? -16.993 0.363   -6.562  1.00 0.00 ? 100 TYR A HH   6  
ATOM 9880  N N    . PRO A 1 101 ? -18.420 1.593   -15.413 1.00 0.00 ? 101 PRO A N    6  
ATOM 9881  C CA   . PRO A 1 101 ? -18.580 2.283   -16.697 1.00 0.00 ? 101 PRO A CA   6  
ATOM 9882  C C    . PRO A 1 101 ? -19.781 3.222   -16.704 1.00 0.00 ? 101 PRO A C    6  
ATOM 9883  O O    . PRO A 1 101 ? -20.858 2.870   -16.224 1.00 0.00 ? 101 PRO A O    6  
ATOM 9884  C CB   . PRO A 1 101 ? -18.791 1.138   -17.691 1.00 0.00 ? 101 PRO A CB   6  
ATOM 9885  C CG   . PRO A 1 101 ? -19.348 0.024   -16.874 1.00 0.00 ? 101 PRO A CG   6  
ATOM 9886  C CD   . PRO A 1 101 ? -18.722 0.155   -15.513 1.00 0.00 ? 101 PRO A CD   6  
ATOM 9887  H HA   . PRO A 1 101 ? -17.691 2.835   -16.964 1.00 0.00 ? 101 PRO A HA   6  
ATOM 9888  H HB2  . PRO A 1 101 ? -19.483 1.449   -18.461 1.00 0.00 ? 101 PRO A HB2  6  
ATOM 9889  H HB3  . PRO A 1 101 ? -17.846 0.866   -18.137 1.00 0.00 ? 101 PRO A HB3  6  
ATOM 9890  H HG2  . PRO A 1 101 ? -20.421 0.122   -16.804 1.00 0.00 ? 101 PRO A HG2  6  
ATOM 9891  H HG3  . PRO A 1 101 ? -19.085 -0.924  -17.318 1.00 0.00 ? 101 PRO A HG3  6  
ATOM 9892  H HD2  . PRO A 1 101 ? -19.420 -0.147  -14.746 1.00 0.00 ? 101 PRO A HD2  6  
ATOM 9893  H HD3  . PRO A 1 101 ? -17.818 -0.433  -15.456 1.00 0.00 ? 101 PRO A HD3  6  
ATOM 9894  N N    . GLU A 1 102 ? -19.588 4.418   -17.251 1.00 0.00 ? 102 GLU A N    6  
ATOM 9895  C CA   . GLU A 1 102 ? -20.657 5.407   -17.320 1.00 0.00 ? 102 GLU A CA   6  
ATOM 9896  C C    . GLU A 1 102 ? -21.231 5.492   -18.731 1.00 0.00 ? 102 GLU A C    6  
ATOM 9897  O O    . GLU A 1 102 ? -20.711 4.876   -19.663 1.00 0.00 ? 102 GLU A O    6  
ATOM 9898  C CB   . GLU A 1 102 ? -20.140 6.780   -16.885 1.00 0.00 ? 102 GLU A CB   6  
ATOM 9899  C CG   . GLU A 1 102 ? -19.965 6.916   -15.381 1.00 0.00 ? 102 GLU A CG   6  
ATOM 9900  C CD   . GLU A 1 102 ? -20.091 8.351   -14.907 1.00 0.00 ? 102 GLU A CD   6  
ATOM 9901  O OE1  . GLU A 1 102 ? -19.595 9.254   -15.613 1.00 0.00 ? 102 GLU A OE1  6  
ATOM 9902  O OE2  . GLU A 1 102 ? -20.684 8.571   -13.830 1.00 0.00 ? 102 GLU A OE2  6  
ATOM 9903  H H    . GLU A 1 102 ? -18.707 4.640   -17.617 1.00 0.00 ? 102 GLU A H    6  
ATOM 9904  H HA   . GLU A 1 102 ? -21.440 5.097   -16.644 1.00 0.00 ? 102 GLU A HA   6  
ATOM 9905  H HB2  . GLU A 1 102 ? -19.185 6.958   -17.356 1.00 0.00 ? 102 GLU A HB2  6  
ATOM 9906  H HB3  . GLU A 1 102 ? -20.839 7.535   -17.214 1.00 0.00 ? 102 GLU A HB3  6  
ATOM 9907  H HG2  . GLU A 1 102 ? -20.720 6.323   -14.888 1.00 0.00 ? 102 GLU A HG2  6  
ATOM 9908  H HG3  . GLU A 1 102 ? -18.986 6.547   -15.111 1.00 0.00 ? 102 GLU A HG3  6  
ATOM 9909  N N    . LEU A 1 103 ? -22.306 6.257   -18.881 1.00 0.00 ? 103 LEU A N    6  
ATOM 9910  C CA   . LEU A 1 103 ? -22.953 6.423   -20.179 1.00 0.00 ? 103 LEU A CA   6  
ATOM 9911  C C    . LEU A 1 103 ? -22.300 7.550   -20.972 1.00 0.00 ? 103 LEU A C    6  
ATOM 9912  O O    . LEU A 1 103 ? -22.055 8.633   -20.442 1.00 0.00 ? 103 LEU A O    6  
ATOM 9913  C CB   . LEU A 1 103 ? -24.444 6.710   -19.995 1.00 0.00 ? 103 LEU A CB   6  
ATOM 9914  C CG   . LEU A 1 103 ? -25.362 5.488   -19.948 1.00 0.00 ? 103 LEU A CG   6  
ATOM 9915  C CD1  . LEU A 1 103 ? -25.810 5.102   -21.349 1.00 0.00 ? 103 LEU A CD1  6  
ATOM 9916  C CD2  . LEU A 1 103 ? -24.661 4.320   -19.269 1.00 0.00 ? 103 LEU A CD2  6  
ATOM 9917  H H    . LEU A 1 103 ? -22.675 6.723   -18.102 1.00 0.00 ? 103 LEU A H    6  
ATOM 9918  H HA   . LEU A 1 103 ? -22.837 5.499   -20.726 1.00 0.00 ? 103 LEU A HA   6  
ATOM 9919  H HB2  . LEU A 1 103 ? -24.565 7.250   -19.068 1.00 0.00 ? 103 LEU A HB2  6  
ATOM 9920  H HB3  . LEU A 1 103 ? -24.764 7.334   -20.817 1.00 0.00 ? 103 LEU A HB3  6  
ATOM 9921  H HG   . LEU A 1 103 ? -26.244 5.730   -19.371 1.00 0.00 ? 103 LEU A HG   6  
ATOM 9922  H HD11 . LEU A 1 103 ? -25.134 5.531   -22.073 1.00 0.00 ? 103 LEU A HD11 6  
ATOM 9923  H HD12 . LEU A 1 103 ? -26.808 5.475   -21.523 1.00 0.00 ? 103 LEU A HD12 6  
ATOM 9924  H HD13 . LEU A 1 103 ? -25.806 4.026   -21.445 1.00 0.00 ? 103 LEU A HD13 6  
ATOM 9925  H HD21 . LEU A 1 103 ? -24.135 3.737   -20.011 1.00 0.00 ? 103 LEU A HD21 6  
ATOM 9926  H HD22 . LEU A 1 103 ? -25.393 3.698   -18.776 1.00 0.00 ? 103 LEU A HD22 6  
ATOM 9927  H HD23 . LEU A 1 103 ? -23.957 4.696   -18.541 1.00 0.00 ? 103 LEU A HD23 6  
ATOM 9928  N N    . GLU A 1 104 ? -22.024 7.288   -22.246 1.00 0.00 ? 104 GLU A N    6  
ATOM 9929  C CA   . GLU A 1 104 ? -21.401 8.282   -23.112 1.00 0.00 ? 104 GLU A CA   6  
ATOM 9930  C C    . GLU A 1 104 ? -20.407 9.137   -22.332 1.00 0.00 ? 104 GLU A C    6  
ATOM 9931  O O    . GLU A 1 104 ? -20.321 10.347  -22.536 1.00 0.00 ? 104 GLU A O    6  
ATOM 9932  C CB   . GLU A 1 104 ? -22.467 9.174   -23.750 1.00 0.00 ? 104 GLU A CB   6  
ATOM 9933  C CG   . GLU A 1 104 ? -23.189 10.067  -22.755 1.00 0.00 ? 104 GLU A CG   6  
ATOM 9934  C CD   . GLU A 1 104 ? -24.417 9.405   -22.161 1.00 0.00 ? 104 GLU A CD   6  
ATOM 9935  O OE1  . GLU A 1 104 ? -24.933 8.450   -22.777 1.00 0.00 ? 104 GLU A OE1  6  
ATOM 9936  O OE2  . GLU A 1 104 ? -24.861 9.843   -21.079 1.00 0.00 ? 104 GLU A OE2  6  
ATOM 9937  H H    . GLU A 1 104 ? -22.243 6.405   -22.611 1.00 0.00 ? 104 GLU A H    6  
ATOM 9938  H HA   . GLU A 1 104 ? -20.871 7.756   -23.892 1.00 0.00 ? 104 GLU A HA   6  
ATOM 9939  H HB2  . GLU A 1 104 ? -21.997 9.803   -24.492 1.00 0.00 ? 104 GLU A HB2  6  
ATOM 9940  H HB3  . GLU A 1 104 ? -23.200 8.547   -24.236 1.00 0.00 ? 104 GLU A HB3  6  
ATOM 9941  H HG2  . GLU A 1 104 ? -22.509 10.314  -21.953 1.00 0.00 ? 104 GLU A HG2  6  
ATOM 9942  H HG3  . GLU A 1 104 ? -23.494 10.973  -23.259 1.00 0.00 ? 104 GLU A HG3  6  
ATOM 9943  N N    . GLU A 1 105 ? -19.659 8.498   -21.438 1.00 0.00 ? 105 GLU A N    6  
ATOM 9944  C CA   . GLU A 1 105 ? -18.672 9.200   -20.626 1.00 0.00 ? 105 GLU A CA   6  
ATOM 9945  C C    . GLU A 1 105 ? -17.633 9.887   -21.507 1.00 0.00 ? 105 GLU A C    6  
ATOM 9946  O O    . GLU A 1 105 ? -17.626 9.717   -22.725 1.00 0.00 ? 105 GLU A O    6  
ATOM 9947  C CB   . GLU A 1 105 ? -17.982 8.228   -19.668 1.00 0.00 ? 105 GLU A CB   6  
ATOM 9948  C CG   . GLU A 1 105 ? -16.986 7.304   -20.350 1.00 0.00 ? 105 GLU A CG   6  
ATOM 9949  C CD   . GLU A 1 105 ? -17.624 6.019   -20.840 1.00 0.00 ? 105 GLU A CD   6  
ATOM 9950  O OE1  . GLU A 1 105 ? -17.742 5.071   -20.037 1.00 0.00 ? 105 GLU A OE1  6  
ATOM 9951  O OE2  . GLU A 1 105 ? -18.005 5.962   -22.028 1.00 0.00 ? 105 GLU A OE2  6  
ATOM 9952  H H    . GLU A 1 105 ? -19.774 7.532   -21.321 1.00 0.00 ? 105 GLU A H    6  
ATOM 9953  H HA   . GLU A 1 105 ? -19.191 9.951   -20.050 1.00 0.00 ? 105 GLU A HA   6  
ATOM 9954  H HB2  . GLU A 1 105 ? -17.457 8.795   -18.914 1.00 0.00 ? 105 GLU A HB2  6  
ATOM 9955  H HB3  . GLU A 1 105 ? -18.734 7.619   -19.188 1.00 0.00 ? 105 GLU A HB3  6  
ATOM 9956  H HG2  . GLU A 1 105 ? -16.557 7.820   -21.196 1.00 0.00 ? 105 GLU A HG2  6  
ATOM 9957  H HG3  . GLU A 1 105 ? -16.204 7.056   -19.648 1.00 0.00 ? 105 GLU A HG3  6  
ATOM 9958  N N    . GLY A 1 106 ? -16.756 10.666  -20.880 1.00 0.00 ? 106 GLY A N    6  
ATOM 9959  C CA   . GLY A 1 106 ? -15.724 11.368  -21.622 1.00 0.00 ? 106 GLY A CA   6  
ATOM 9960  C C    . GLY A 1 106 ? -16.071 12.824  -21.860 1.00 0.00 ? 106 GLY A C    6  
ATOM 9961  O O    . GLY A 1 106 ? -15.489 13.717  -21.244 1.00 0.00 ? 106 GLY A O    6  
ATOM 9962  H H    . GLY A 1 106 ? -16.809 10.764  -19.907 1.00 0.00 ? 106 GLY A H    6  
ATOM 9963  H HA2  . GLY A 1 106 ? -14.799 11.315  -21.068 1.00 0.00 ? 106 GLY A HA2  6  
ATOM 9964  H HA3  . GLY A 1 106 ? -15.590 10.882  -22.577 1.00 0.00 ? 106 GLY A HA3  6  
ATOM 9965  N N    . VAL A 1 107 ? -17.021 13.066  -22.757 1.00 0.00 ? 107 VAL A N    6  
ATOM 9966  C CA   . VAL A 1 107 ? -17.444 14.424  -23.076 1.00 0.00 ? 107 VAL A CA   6  
ATOM 9967  C C    . VAL A 1 107 ? -18.287 15.015  -21.952 1.00 0.00 ? 107 VAL A C    6  
ATOM 9968  O O    . VAL A 1 107 ? -18.889 14.285  -21.165 1.00 0.00 ? 107 VAL A O    6  
ATOM 9969  C CB   . VAL A 1 107 ? -18.252 14.468  -24.387 1.00 0.00 ? 107 VAL A CB   6  
ATOM 9970  C CG1  . VAL A 1 107 ? -17.423 13.933  -25.544 1.00 0.00 ? 107 VAL A CG1  6  
ATOM 9971  C CG2  . VAL A 1 107 ? -19.547 13.682  -24.240 1.00 0.00 ? 107 VAL A CG2  6  
ATOM 9972  H H    . VAL A 1 107 ? -17.448 12.313  -23.216 1.00 0.00 ? 107 VAL A H    6  
ATOM 9973  H HA   . VAL A 1 107 ? -16.558 15.029  -23.204 1.00 0.00 ? 107 VAL A HA   6  
ATOM 9974  H HB   . VAL A 1 107 ? -18.503 15.497  -24.597 1.00 0.00 ? 107 VAL A HB   6  
ATOM 9975  H HG11 . VAL A 1 107 ? -16.899 14.750  -26.019 1.00 0.00 ? 107 VAL A HG11 6  
ATOM 9976  H HG12 . VAL A 1 107 ? -16.708 13.214  -25.172 1.00 0.00 ? 107 VAL A HG12 6  
ATOM 9977  H HG13 . VAL A 1 107 ? -18.073 13.457  -26.263 1.00 0.00 ? 107 VAL A HG13 6  
ATOM 9978  H HG21 . VAL A 1 107 ? -19.322 12.677  -23.914 1.00 0.00 ? 107 VAL A HG21 6  
ATOM 9979  H HG22 . VAL A 1 107 ? -20.180 14.164  -23.509 1.00 0.00 ? 107 VAL A HG22 6  
ATOM 9980  H HG23 . VAL A 1 107 ? -20.057 13.647  -25.191 1.00 0.00 ? 107 VAL A HG23 6  
ATOM 9981  N N    . GLU A 1 108 ? -18.326 16.342  -21.883 1.00 0.00 ? 108 GLU A N    6  
ATOM 9982  C CA   . GLU A 1 108 ? -19.096 17.031  -20.854 1.00 0.00 ? 108 GLU A CA   6  
ATOM 9983  C C    . GLU A 1 108 ? -20.582 17.042  -21.202 1.00 0.00 ? 108 GLU A C    6  
ATOM 9984  O O    . GLU A 1 108 ? -20.955 17.107  -22.373 1.00 0.00 ? 108 GLU A O    6  
ATOM 9985  C CB   . GLU A 1 108 ? -18.591 18.465  -20.682 1.00 0.00 ? 108 GLU A CB   6  
ATOM 9986  C CG   . GLU A 1 108 ? -19.103 19.144  -19.423 1.00 0.00 ? 108 GLU A CG   6  
ATOM 9987  C CD   . GLU A 1 108 ? -18.366 18.693  -18.176 1.00 0.00 ? 108 GLU A CD   6  
ATOM 9988  O OE1  . GLU A 1 108 ? -17.168 18.359  -18.285 1.00 0.00 ? 108 GLU A OE1  6  
ATOM 9989  O OE2  . GLU A 1 108 ? -18.987 18.675  -17.093 1.00 0.00 ? 108 GLU A OE2  6  
ATOM 9990  H H    . GLU A 1 108 ? -17.825 16.870  -22.539 1.00 0.00 ? 108 GLU A H    6  
ATOM 9991  H HA   . GLU A 1 108 ? -18.960 16.498  -19.926 1.00 0.00 ? 108 GLU A HA   6  
ATOM 9992  H HB2  . GLU A 1 108 ? -17.511 18.452  -20.646 1.00 0.00 ? 108 GLU A HB2  6  
ATOM 9993  H HB3  . GLU A 1 108 ? -18.906 19.049  -21.534 1.00 0.00 ? 108 GLU A HB3  6  
ATOM 9994  H HG2  . GLU A 1 108 ? -18.980 20.211  -19.529 1.00 0.00 ? 108 GLU A HG2  6  
ATOM 9995  H HG3  . GLU A 1 108 ? -20.152 18.914  -19.306 1.00 0.00 ? 108 GLU A HG3  6  
ATOM 9996  N N    . SER A 1 109 ? -21.424 16.977  -20.176 1.00 0.00 ? 109 SER A N    6  
ATOM 9997  C CA   . SER A 1 109 ? -22.869 16.975  -20.373 1.00 0.00 ? 109 SER A CA   6  
ATOM 9998  C C    . SER A 1 109 ? -23.595 17.302  -19.071 1.00 0.00 ? 109 SER A C    6  
ATOM 9999  O O    . SER A 1 109 ? -23.073 17.070  -17.981 1.00 0.00 ? 109 SER A O    6  
ATOM 10000 C CB   . SER A 1 109 ? -23.331 15.615  -20.900 1.00 0.00 ? 109 SER A CB   6  
ATOM 10001 O OG   . SER A 1 109 ? -22.944 14.570  -20.025 1.00 0.00 ? 109 SER A OG   6  
ATOM 10002 H H    . SER A 1 109 ? -21.065 16.927  -19.266 1.00 0.00 ? 109 SER A H    6  
ATOM 10003 H HA   . SER A 1 109 ? -23.106 17.734  -21.103 1.00 0.00 ? 109 SER A HA   6  
ATOM 10004 H HB2  . SER A 1 109 ? -24.407 15.613  -20.989 1.00 0.00 ? 109 SER A HB2  6  
ATOM 10005 H HB3  . SER A 1 109 ? -22.889 15.439  -21.870 1.00 0.00 ? 109 SER A HB3  6  
ATOM 10006 H HG   . SER A 1 109 ? -22.016 14.366  -20.161 1.00 0.00 ? 109 SER A HG   6  
ATOM 10007 N N    . GLY A 1 110 ? -24.803 17.843  -19.194 1.00 0.00 ? 110 GLY A N    6  
ATOM 10008 C CA   . GLY A 1 110 ? -25.582 18.193  -18.021 1.00 0.00 ? 110 GLY A CA   6  
ATOM 10009 C C    . GLY A 1 110 ? -27.071 18.225  -18.302 1.00 0.00 ? 110 GLY A C    6  
ATOM 10010 O O    . GLY A 1 110 ? -27.657 19.281  -18.543 1.00 0.00 ? 110 GLY A O    6  
ATOM 10011 H H    . GLY A 1 110 ? -25.169 18.005  -20.089 1.00 0.00 ? 110 GLY A H    6  
ATOM 10012 H HA2  . GLY A 1 110 ? -25.388 17.469  -17.244 1.00 0.00 ? 110 GLY A HA2  6  
ATOM 10013 H HA3  . GLY A 1 110 ? -25.272 19.169  -17.675 1.00 0.00 ? 110 GLY A HA3  6  
ATOM 10014 N N    . PRO A 1 111 ? -27.708 17.045  -18.274 1.00 0.00 ? 111 PRO A N    6  
ATOM 10015 C CA   . PRO A 1 111 ? -29.146 16.915  -18.527 1.00 0.00 ? 111 PRO A CA   6  
ATOM 10016 C C    . PRO A 1 111 ? -29.988 17.506  -17.401 1.00 0.00 ? 111 PRO A C    6  
ATOM 10017 O O    . PRO A 1 111 ? -30.196 16.869  -16.368 1.00 0.00 ? 111 PRO A O    6  
ATOM 10018 C CB   . PRO A 1 111 ? -29.356 15.401  -18.613 1.00 0.00 ? 111 PRO A CB   6  
ATOM 10019 C CG   . PRO A 1 111 ? -28.242 14.818  -17.813 1.00 0.00 ? 111 PRO A CG   6  
ATOM 10020 C CD   . PRO A 1 111 ? -27.073 15.746  -17.994 1.00 0.00 ? 111 PRO A CD   6  
ATOM 10021 H HA   . PRO A 1 111 ? -29.427 17.373  -19.464 1.00 0.00 ? 111 PRO A HA   6  
ATOM 10022 H HB2  . PRO A 1 111 ? -30.320 15.144  -18.196 1.00 0.00 ? 111 PRO A HB2  6  
ATOM 10023 H HB3  . PRO A 1 111 ? -29.308 15.085  -19.644 1.00 0.00 ? 111 PRO A HB3  6  
ATOM 10024 H HG2  . PRO A 1 111 ? -28.524 14.769  -16.772 1.00 0.00 ? 111 PRO A HG2  6  
ATOM 10025 H HG3  . PRO A 1 111 ? -28.000 13.834  -18.185 1.00 0.00 ? 111 PRO A HG3  6  
ATOM 10026 H HD2  . PRO A 1 111 ? -26.484 15.792  -17.089 1.00 0.00 ? 111 PRO A HD2  6  
ATOM 10027 H HD3  . PRO A 1 111 ? -26.464 15.428  -18.827 1.00 0.00 ? 111 PRO A HD3  6  
ATOM 10028 N N    . SER A 1 112 ? -30.470 18.727  -17.608 1.00 0.00 ? 112 SER A N    6  
ATOM 10029 C CA   . SER A 1 112 ? -31.287 19.406  -16.609 1.00 0.00 ? 112 SER A CA   6  
ATOM 10030 C C    . SER A 1 112 ? -32.167 20.470  -17.258 1.00 0.00 ? 112 SER A C    6  
ATOM 10031 O O    . SER A 1 112 ? -31.677 21.503  -17.713 1.00 0.00 ? 112 SER A O    6  
ATOM 10032 C CB   . SER A 1 112 ? -30.398 20.046  -15.541 1.00 0.00 ? 112 SER A CB   6  
ATOM 10033 O OG   . SER A 1 112 ? -31.153 20.883  -14.683 1.00 0.00 ? 112 SER A OG   6  
ATOM 10034 H H    . SER A 1 112 ? -30.270 19.184  -18.452 1.00 0.00 ? 112 SER A H    6  
ATOM 10035 H HA   . SER A 1 112 ? -31.921 18.667  -16.142 1.00 0.00 ? 112 SER A HA   6  
ATOM 10036 H HB2  . SER A 1 112 ? -29.934 19.270  -14.950 1.00 0.00 ? 112 SER A HB2  6  
ATOM 10037 H HB3  . SER A 1 112 ? -29.633 20.638  -16.021 1.00 0.00 ? 112 SER A HB3  6  
ATOM 10038 H HG   . SER A 1 112 ? -32.048 20.544  -14.610 1.00 0.00 ? 112 SER A HG   6  
ATOM 10039 N N    . SER A 1 113 ? -33.470 20.209  -17.297 1.00 0.00 ? 113 SER A N    6  
ATOM 10040 C CA   . SER A 1 113 ? -34.419 21.141  -17.893 1.00 0.00 ? 113 SER A CA   6  
ATOM 10041 C C    . SER A 1 113 ? -34.270 22.532  -17.284 1.00 0.00 ? 113 SER A C    6  
ATOM 10042 O O    . SER A 1 113 ? -33.859 22.677  -16.134 1.00 0.00 ? 113 SER A O    6  
ATOM 10043 C CB   . SER A 1 113 ? -35.851 20.638  -17.700 1.00 0.00 ? 113 SER A CB   6  
ATOM 10044 O OG   . SER A 1 113 ? -36.781 21.484  -18.353 1.00 0.00 ? 113 SER A OG   6  
ATOM 10045 H H    . SER A 1 113 ? -33.800 19.367  -16.917 1.00 0.00 ? 113 SER A H    6  
ATOM 10046 H HA   . SER A 1 113 ? -34.207 21.199  -18.950 1.00 0.00 ? 113 SER A HA   6  
ATOM 10047 H HB2  . SER A 1 113 ? -35.938 19.643  -18.109 1.00 0.00 ? 113 SER A HB2  6  
ATOM 10048 H HB3  . SER A 1 113 ? -36.082 20.615  -16.644 1.00 0.00 ? 113 SER A HB3  6  
ATOM 10049 H HG   . SER A 1 113 ? -37.577 21.557  -17.820 1.00 0.00 ? 113 SER A HG   6  
ATOM 10050 N N    . GLY A 1 114 ? -34.608 23.553  -18.066 1.00 0.00 ? 114 GLY A N    6  
ATOM 10051 C CA   . GLY A 1 114 ? -34.505 24.919  -17.588 1.00 0.00 ? 114 GLY A CA   6  
ATOM 10052 C C    . GLY A 1 114 ? -33.139 25.523  -17.846 1.00 0.00 ? 114 GLY A C    6  
ATOM 10053 O O    . GLY A 1 114 ? -32.203 25.308  -17.077 1.00 0.00 ? 114 GLY A O    6  
ATOM 10054 H H    . GLY A 1 114 ? -34.930 23.377  -18.975 1.00 0.00 ? 114 GLY A H    6  
ATOM 10055 H HA2  . GLY A 1 114 ? -35.253 25.520  -18.084 1.00 0.00 ? 114 GLY A HA2  6  
ATOM 10056 H HA3  . GLY A 1 114 ? -34.696 24.931  -16.524 1.00 0.00 ? 114 GLY A HA3  6  
ATOM 10057 N N    . GLY A 1 1   ? -2.669  -14.658 -36.234 1.00 0.00 ? 1   GLY A N    7  
ATOM 10058 C CA   . GLY A 1 1   ? -2.781  -14.045 -34.923 1.00 0.00 ? 1   GLY A CA   7  
ATOM 10059 C C    . GLY A 1 1   ? -4.220  -13.793 -34.522 1.00 0.00 ? 1   GLY A C    7  
ATOM 10060 O O    . GLY A 1 1   ? -5.124  -13.852 -35.356 1.00 0.00 ? 1   GLY A O    7  
ATOM 10061 H H1   . GLY A 1 1   ? -1.938  -14.399 -36.833 1.00 0.00 ? 1   GLY A H1   7  
ATOM 10062 H HA2  . GLY A 1 1   ? -2.323  -14.696 -34.193 1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10063 H HA3  . GLY A 1 1   ? -2.252  -13.103 -34.933 1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10064 N N    . SER A 1 2   ? -4.436  -13.514 -33.240 1.00 0.00 ? 2   SER A N    7  
ATOM 10065 C CA   . SER A 1 2   ? -5.777  -13.257 -32.728 1.00 0.00 ? 2   SER A CA   7  
ATOM 10066 C C    . SER A 1 2   ? -5.736  -12.262 -31.573 1.00 0.00 ? 2   SER A C    7  
ATOM 10067 O O    . SER A 1 2   ? -4.713  -12.111 -30.905 1.00 0.00 ? 2   SER A O    7  
ATOM 10068 C CB   . SER A 1 2   ? -6.428  -14.563 -32.269 1.00 0.00 ? 2   SER A CB   7  
ATOM 10069 O OG   . SER A 1 2   ? -6.714  -15.406 -33.372 1.00 0.00 ? 2   SER A OG   7  
ATOM 10070 H H    . SER A 1 2   ? -3.674  -13.482 -32.624 1.00 0.00 ? 2   SER A H    7  
ATOM 10071 H HA   . SER A 1 2   ? -6.363  -12.836 -33.531 1.00 0.00 ? 2   SER A HA   7  
ATOM 10072 H HB2  . SER A 1 2   ? -5.758  -15.081 -31.600 1.00 0.00 ? 2   SER A HB2  7  
ATOM 10073 H HB3  . SER A 1 2   ? -7.351  -14.340 -31.753 1.00 0.00 ? 2   SER A HB3  7  
ATOM 10074 H HG   . SER A 1 2   ? -7.592  -15.209 -33.707 1.00 0.00 ? 2   SER A HG   7  
ATOM 10075 N N    . SER A 1 3   ? -6.857  -11.586 -31.343 1.00 0.00 ? 3   SER A N    7  
ATOM 10076 C CA   . SER A 1 3   ? -6.950  -10.601 -30.271 1.00 0.00 ? 3   SER A CA   7  
ATOM 10077 C C    . SER A 1 3   ? -8.398  -10.416 -29.828 1.00 0.00 ? 3   SER A C    7  
ATOM 10078 O O    . SER A 1 3   ? -9.329  -10.829 -30.519 1.00 0.00 ? 3   SER A O    7  
ATOM 10079 C CB   . SER A 1 3   ? -6.370  -9.262  -30.729 1.00 0.00 ? 3   SER A CB   7  
ATOM 10080 O OG   . SER A 1 3   ? -6.090  -8.423  -29.621 1.00 0.00 ? 3   SER A OG   7  
ATOM 10081 H H    . SER A 1 3   ? -7.639  -11.751 -31.910 1.00 0.00 ? 3   SER A H    7  
ATOM 10082 H HA   . SER A 1 3   ? -6.374  -10.967 -29.435 1.00 0.00 ? 3   SER A HA   7  
ATOM 10083 H HB2  . SER A 1 3   ? -5.454  -9.436  -31.273 1.00 0.00 ? 3   SER A HB2  7  
ATOM 10084 H HB3  . SER A 1 3   ? -7.082  -8.765  -31.371 1.00 0.00 ? 3   SER A HB3  7  
ATOM 10085 H HG   . SER A 1 3   ? -5.912  -7.532  -29.931 1.00 0.00 ? 3   SER A HG   7  
ATOM 10086 N N    . GLY A 1 4   ? -8.580  -9.792  -28.668 1.00 0.00 ? 4   GLY A N    7  
ATOM 10087 C CA   . GLY A 1 4   ? -9.917  -9.562  -28.151 1.00 0.00 ? 4   GLY A CA   7  
ATOM 10088 C C    . GLY A 1 4   ? -10.173 -8.102  -27.835 1.00 0.00 ? 4   GLY A C    7  
ATOM 10089 O O    . GLY A 1 4   ? -9.421  -7.226  -28.262 1.00 0.00 ? 4   GLY A O    7  
ATOM 10090 H H    . GLY A 1 4   ? -7.801  -9.484  -28.160 1.00 0.00 ? 4   GLY A H    7  
ATOM 10091 H HA2  . GLY A 1 4   ? -10.637 -9.893  -28.885 1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10092 H HA3  . GLY A 1 4   ? -10.045 -10.142 -27.249 1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10093 N N    . SER A 1 5   ? -11.240 -7.839  -27.087 1.00 0.00 ? 5   SER A N    7  
ATOM 10094 C CA   . SER A 1 5   ? -11.597 -6.474  -26.719 1.00 0.00 ? 5   SER A CA   7  
ATOM 10095 C C    . SER A 1 5   ? -12.413 -6.455  -25.429 1.00 0.00 ? 5   SER A C    7  
ATOM 10096 O O    . SER A 1 5   ? -12.876 -7.494  -24.959 1.00 0.00 ? 5   SER A O    7  
ATOM 10097 C CB   . SER A 1 5   ? -12.389 -5.810  -27.846 1.00 0.00 ? 5   SER A CB   7  
ATOM 10098 O OG   . SER A 1 5   ? -13.739 -6.243  -27.845 1.00 0.00 ? 5   SER A OG   7  
ATOM 10099 H H    . SER A 1 5   ? -11.801 -8.581  -26.777 1.00 0.00 ? 5   SER A H    7  
ATOM 10100 H HA   . SER A 1 5   ? -10.682 -5.923  -26.560 1.00 0.00 ? 5   SER A HA   7  
ATOM 10101 H HB2  . SER A 1 5   ? -12.368 -4.739  -27.716 1.00 0.00 ? 5   SER A HB2  7  
ATOM 10102 H HB3  . SER A 1 5   ? -11.942 -6.066  -28.796 1.00 0.00 ? 5   SER A HB3  7  
ATOM 10103 H HG   . SER A 1 5   ? -14.040 -6.355  -28.750 1.00 0.00 ? 5   SER A HG   7  
ATOM 10104 N N    . SER A 1 6   ? -12.584 -5.265  -24.862 1.00 0.00 ? 6   SER A N    7  
ATOM 10105 C CA   . SER A 1 6   ? -13.340 -5.109  -23.625 1.00 0.00 ? 6   SER A CA   7  
ATOM 10106 C C    . SER A 1 6   ? -14.816 -4.861  -23.918 1.00 0.00 ? 6   SER A C    7  
ATOM 10107 O O    . SER A 1 6   ? -15.693 -5.468  -23.306 1.00 0.00 ? 6   SER A O    7  
ATOM 10108 C CB   . SER A 1 6   ? -12.772 -3.955  -22.797 1.00 0.00 ? 6   SER A CB   7  
ATOM 10109 O OG   . SER A 1 6   ? -12.760 -2.750  -23.543 1.00 0.00 ? 6   SER A OG   7  
ATOM 10110 H H    . SER A 1 6   ? -12.190 -4.473  -25.285 1.00 0.00 ? 6   SER A H    7  
ATOM 10111 H HA   . SER A 1 6   ? -13.246 -6.025  -23.062 1.00 0.00 ? 6   SER A HA   7  
ATOM 10112 H HB2  . SER A 1 6   ? -13.379 -3.814  -21.917 1.00 0.00 ? 6   SER A HB2  7  
ATOM 10113 H HB3  . SER A 1 6   ? -11.760 -4.192  -22.502 1.00 0.00 ? 6   SER A HB3  7  
ATOM 10114 H HG   . SER A 1 6   ? -13.199 -2.059  -23.041 1.00 0.00 ? 6   SER A HG   7  
ATOM 10115 N N    . GLY A 1 7   ? -15.083 -3.962  -24.861 1.00 0.00 ? 7   GLY A N    7  
ATOM 10116 C CA   . GLY A 1 7   ? -16.454 -3.648  -25.220 1.00 0.00 ? 7   GLY A CA   7  
ATOM 10117 C C    . GLY A 1 7   ? -16.923 -2.336  -24.623 1.00 0.00 ? 7   GLY A C    7  
ATOM 10118 O O    . GLY A 1 7   ? -16.112 -1.473  -24.289 1.00 0.00 ? 7   GLY A O    7  
ATOM 10119 H H    . GLY A 1 7   ? -14.343 -3.508  -25.317 1.00 0.00 ? 7   GLY A H    7  
ATOM 10120 H HA2  . GLY A 1 7   ? -16.528 -3.589  -26.296 1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10121 H HA3  . GLY A 1 7   ? -17.097 -4.441  -24.868 1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10122 N N    . GLU A 1 8   ? -18.238 -2.185  -24.490 1.00 0.00 ? 8   GLU A N    7  
ATOM 10123 C CA   . GLU A 1 8   ? -18.813 -0.967  -23.931 1.00 0.00 ? 8   GLU A CA   7  
ATOM 10124 C C    . GLU A 1 8   ? -20.185 -1.243  -23.322 1.00 0.00 ? 8   GLU A C    7  
ATOM 10125 O O    . GLU A 1 8   ? -21.042 -1.862  -23.953 1.00 0.00 ? 8   GLU A O    7  
ATOM 10126 C CB   . GLU A 1 8   ? -18.930 0.110   -25.012 1.00 0.00 ? 8   GLU A CB   7  
ATOM 10127 C CG   . GLU A 1 8   ? -19.774 -0.311  -26.203 1.00 0.00 ? 8   GLU A CG   7  
ATOM 10128 C CD   . GLU A 1 8   ? -20.120 0.851   -27.113 1.00 0.00 ? 8   GLU A CD   7  
ATOM 10129 O OE1  . GLU A 1 8   ? -20.735 1.823   -26.627 1.00 0.00 ? 8   GLU A OE1  7  
ATOM 10130 O OE2  . GLU A 1 8   ? -19.776 0.788   -28.312 1.00 0.00 ? 8   GLU A OE2  7  
ATOM 10131 H H    . GLU A 1 8   ? -18.834 -2.909  -24.775 1.00 0.00 ? 8   GLU A H    7  
ATOM 10132 H HA   . GLU A 1 8   ? -18.152 -0.614  -23.154 1.00 0.00 ? 8   GLU A HA   7  
ATOM 10133 H HB2  . GLU A 1 8   ? -19.374 0.993   -24.576 1.00 0.00 ? 8   GLU A HB2  7  
ATOM 10134 H HB3  . GLU A 1 8   ? -17.940 0.355   -25.367 1.00 0.00 ? 8   GLU A HB3  7  
ATOM 10135 H HG2  . GLU A 1 8   ? -19.225 -1.045  -26.775 1.00 0.00 ? 8   GLU A HG2  7  
ATOM 10136 H HG3  . GLU A 1 8   ? -20.691 -0.752  -25.840 1.00 0.00 ? 8   GLU A HG3  7  
ATOM 10137 N N    . ILE A 1 9   ? -20.383 -0.781  -22.093 1.00 0.00 ? 9   ILE A N    7  
ATOM 10138 C CA   . ILE A 1 9   ? -21.650 -0.977  -21.398 1.00 0.00 ? 9   ILE A CA   7  
ATOM 10139 C C    . ILE A 1 9   ? -22.257 -2.335  -21.736 1.00 0.00 ? 9   ILE A C    7  
ATOM 10140 O O    . ILE A 1 9   ? -23.468 -2.455  -21.919 1.00 0.00 ? 9   ILE A O    7  
ATOM 10141 C CB   . ILE A 1 9   ? -22.663 0.128   -21.752 1.00 0.00 ? 9   ILE A CB   7  
ATOM 10142 C CG1  . ILE A 1 9   ? -21.964 1.487   -21.824 1.00 0.00 ? 9   ILE A CG1  7  
ATOM 10143 C CG2  . ILE A 1 9   ? -23.790 0.159   -20.731 1.00 0.00 ? 9   ILE A CG2  7  
ATOM 10144 C CD1  . ILE A 1 9   ? -21.417 1.813   -23.196 1.00 0.00 ? 9   ILE A CD1  7  
ATOM 10145 H H    . ILE A 1 9   ? -19.661 -0.296  -21.642 1.00 0.00 ? 9   ILE A H    7  
ATOM 10146 H HA   . ILE A 1 9   ? -21.457 -0.935  -20.336 1.00 0.00 ? 9   ILE A HA   7  
ATOM 10147 H HB   . ILE A 1 9   ? -23.089 -0.101  -22.716 1.00 0.00 ? 9   ILE A HB   7  
ATOM 10148 H HG12 . ILE A 1 9   ? -22.665 2.260   -21.554 1.00 0.00 ? 9   ILE A HG12 7  
ATOM 10149 H HG13 . ILE A 1 9   ? -21.138 1.496   -21.126 1.00 0.00 ? 9   ILE A HG13 7  
ATOM 10150 H HG21 . ILE A 1 9   ? -23.489 -0.383  -19.846 1.00 0.00 ? 9   ILE A HG21 7  
ATOM 10151 H HG22 . ILE A 1 9   ? -24.008 1.183   -20.467 1.00 0.00 ? 9   ILE A HG22 7  
ATOM 10152 H HG23 . ILE A 1 9   ? -24.671 -0.300  -21.152 1.00 0.00 ? 9   ILE A HG23 7  
ATOM 10153 H HD11 . ILE A 1 9   ? -21.616 0.991   -23.868 1.00 0.00 ? 9   ILE A HD11 7  
ATOM 10154 H HD12 . ILE A 1 9   ? -21.892 2.708   -23.570 1.00 0.00 ? 9   ILE A HD12 7  
ATOM 10155 H HD13 . ILE A 1 9   ? -20.350 1.973   -23.130 1.00 0.00 ? 9   ILE A HD13 7  
ATOM 10156 N N    . GLU A 1 10  ? -21.407 -3.354  -21.815 1.00 0.00 ? 10  GLU A N    7  
ATOM 10157 C CA   . GLU A 1 10  ? -21.861 -4.704  -22.129 1.00 0.00 ? 10  GLU A CA   7  
ATOM 10158 C C    . GLU A 1 10  ? -22.234 -5.462  -20.858 1.00 0.00 ? 10  GLU A C    7  
ATOM 10159 O O    . GLU A 1 10  ? -21.786 -5.118  -19.764 1.00 0.00 ? 10  GLU A O    7  
ATOM 10160 C CB   . GLU A 1 10  ? -20.775 -5.466  -22.891 1.00 0.00 ? 10  GLU A CB   7  
ATOM 10161 C CG   . GLU A 1 10  ? -21.274 -6.742  -23.547 1.00 0.00 ? 10  GLU A CG   7  
ATOM 10162 C CD   . GLU A 1 10  ? -22.284 -6.476  -24.647 1.00 0.00 ? 10  GLU A CD   7  
ATOM 10163 O OE1  . GLU A 1 10  ? -21.859 -6.250  -25.799 1.00 0.00 ? 10  GLU A OE1  7  
ATOM 10164 O OE2  . GLU A 1 10  ? -23.498 -6.495  -24.355 1.00 0.00 ? 10  GLU A OE2  7  
ATOM 10165 H H    . GLU A 1 10  ? -20.453 -3.194  -21.658 1.00 0.00 ? 10  GLU A H    7  
ATOM 10166 H HA   . GLU A 1 10  ? -22.736 -4.622  -22.755 1.00 0.00 ? 10  GLU A HA   7  
ATOM 10167 H HB2  . GLU A 1 10  ? -20.372 -4.823  -23.660 1.00 0.00 ? 10  GLU A HB2  7  
ATOM 10168 H HB3  . GLU A 1 10  ? -19.985 -5.726  -22.202 1.00 0.00 ? 10  GLU A HB3  7  
ATOM 10169 H HG2  . GLU A 1 10  ? -20.431 -7.267  -23.973 1.00 0.00 ? 10  GLU A HG2  7  
ATOM 10170 H HG3  . GLU A 1 10  ? -21.739 -7.362  -22.794 1.00 0.00 ? 10  GLU A HG3  7  
ATOM 10171 N N    . ILE A 1 11  ? -23.056 -6.494  -21.013 1.00 0.00 ? 11  ILE A N    7  
ATOM 10172 C CA   . ILE A 1 11  ? -23.489 -7.301  -19.879 1.00 0.00 ? 11  ILE A CA   7  
ATOM 10173 C C    . ILE A 1 11  ? -22.345 -7.529  -18.897 1.00 0.00 ? 11  ILE A C    7  
ATOM 10174 O O    . ILE A 1 11  ? -22.519 -7.405  -17.684 1.00 0.00 ? 11  ILE A O    7  
ATOM 10175 C CB   . ILE A 1 11  ? -24.039 -8.665  -20.336 1.00 0.00 ? 11  ILE A CB   7  
ATOM 10176 C CG1  . ILE A 1 11  ? -25.226 -8.471  -21.281 1.00 0.00 ? 11  ILE A CG1  7  
ATOM 10177 C CG2  . ILE A 1 11  ? -24.445 -9.503  -19.132 1.00 0.00 ? 11  ILE A CG2  7  
ATOM 10178 C CD1  . ILE A 1 11  ? -25.415 -9.613  -22.256 1.00 0.00 ? 11  ILE A CD1  7  
ATOM 10179 H H    . ILE A 1 11  ? -23.379 -6.718  -21.910 1.00 0.00 ? 11  ILE A H    7  
ATOM 10180 H HA   . ILE A 1 11  ? -24.282 -6.767  -19.373 1.00 0.00 ? 11  ILE A HA   7  
ATOM 10181 H HB   . ILE A 1 11  ? -23.253 -9.188  -20.859 1.00 0.00 ? 11  ILE A HB   7  
ATOM 10182 H HG12 . ILE A 1 11  ? -26.129 -8.378  -20.701 1.00 0.00 ? 11  ILE A HG12 7  
ATOM 10183 H HG13 . ILE A 1 11  ? -25.076 -7.567  -21.854 1.00 0.00 ? 11  ILE A HG13 7  
ATOM 10184 H HG21 . ILE A 1 11  ? -24.341 -10.551 -19.372 1.00 0.00 ? 11  ILE A HG21 7  
ATOM 10185 H HG22 . ILE A 1 11  ? -23.808 -9.261  -18.295 1.00 0.00 ? 11  ILE A HG22 7  
ATOM 10186 H HG23 . ILE A 1 11  ? -25.472 -9.292  -18.877 1.00 0.00 ? 11  ILE A HG23 7  
ATOM 10187 H HD11 . ILE A 1 11  ? -25.322 -10.552 -21.732 1.00 0.00 ? 11  ILE A HD11 7  
ATOM 10188 H HD12 . ILE A 1 11  ? -26.395 -9.545  -22.704 1.00 0.00 ? 11  ILE A HD12 7  
ATOM 10189 H HD13 . ILE A 1 11  ? -24.662 -9.556  -23.028 1.00 0.00 ? 11  ILE A HD13 7  
ATOM 10190 N N    . CYS A 1 12  ? -21.174 -7.862  -19.430 1.00 0.00 ? 12  CYS A N    7  
ATOM 10191 C CA   . CYS A 1 12  ? -19.999 -8.107  -18.601 1.00 0.00 ? 12  CYS A CA   7  
ATOM 10192 C C    . CYS A 1 12  ? -19.910 -7.088  -17.470 1.00 0.00 ? 12  CYS A C    7  
ATOM 10193 O O    . CYS A 1 12  ? -20.333 -5.939  -17.601 1.00 0.00 ? 12  CYS A O    7  
ATOM 10194 C CB   . CYS A 1 12  ? -18.730 -8.055  -19.452 1.00 0.00 ? 12  CYS A CB   7  
ATOM 10195 S SG   . CYS A 1 12  ? -18.693 -9.263  -20.797 1.00 0.00 ? 12  CYS A SG   7  
ATOM 10196 H H    . CYS A 1 12  ? -21.098 -7.946  -20.403 1.00 0.00 ? 12  CYS A H    7  
ATOM 10197 H HA   . CYS A 1 12  ? -20.096 -9.094  -18.173 1.00 0.00 ? 12  CYS A HA   7  
ATOM 10198 H HB2  . CYS A 1 12  ? -18.639 -7.073  -19.891 1.00 0.00 ? 12  CYS A HB2  7  
ATOM 10199 H HB3  . CYS A 1 12  ? -17.874 -8.240  -18.819 1.00 0.00 ? 12  CYS A HB3  7  
ATOM 10200 H HG   . CYS A 1 12  ? -19.737 -9.036  -21.578 1.00 0.00 ? 12  CYS A HG   7  
ATOM 10201 N N    . PRO A 1 13  ? -19.348 -7.517  -16.329 1.00 0.00 ? 13  PRO A N    7  
ATOM 10202 C CA   . PRO A 1 13  ? -19.192 -6.658  -15.152 1.00 0.00 ? 13  PRO A CA   7  
ATOM 10203 C C    . PRO A 1 13  ? -18.152 -5.563  -15.368 1.00 0.00 ? 13  PRO A C    7  
ATOM 10204 O O    . PRO A 1 13  ? -17.680 -5.352  -16.485 1.00 0.00 ? 13  PRO A O    7  
ATOM 10205 C CB   . PRO A 1 13  ? -18.728 -7.629  -14.063 1.00 0.00 ? 13  PRO A CB   7  
ATOM 10206 C CG   . PRO A 1 13  ? -18.075 -8.744  -14.804 1.00 0.00 ? 13  PRO A CG   7  
ATOM 10207 C CD   . PRO A 1 13  ? -18.823 -8.873  -16.102 1.00 0.00 ? 13  PRO A CD   7  
ATOM 10208 H HA   . PRO A 1 13  ? -20.130 -6.209  -14.861 1.00 0.00 ? 13  PRO A HA   7  
ATOM 10209 H HB2  . PRO A 1 13  ? -18.032 -7.129  -13.405 1.00 0.00 ? 13  PRO A HB2  7  
ATOM 10210 H HB3  . PRO A 1 13  ? -19.581 -7.976  -13.499 1.00 0.00 ? 13  PRO A HB3  7  
ATOM 10211 H HG2  . PRO A 1 13  ? -17.039 -8.505  -14.990 1.00 0.00 ? 13  PRO A HG2  7  
ATOM 10212 H HG3  . PRO A 1 13  ? -18.154 -9.658  -14.234 1.00 0.00 ? 13  PRO A HG3  7  
ATOM 10213 H HD2  . PRO A 1 13  ? -18.152 -9.165  -16.896 1.00 0.00 ? 13  PRO A HD2  7  
ATOM 10214 H HD3  . PRO A 1 13  ? -19.628 -9.587  -16.004 1.00 0.00 ? 13  PRO A HD3  7  
ATOM 10215 N N    . LYS A 1 14  ? -17.798 -4.870  -14.291 1.00 0.00 ? 14  LYS A N    7  
ATOM 10216 C CA   . LYS A 1 14  ? -16.812 -3.798  -14.361 1.00 0.00 ? 14  LYS A CA   7  
ATOM 10217 C C    . LYS A 1 14  ? -15.544 -4.269  -15.066 1.00 0.00 ? 14  LYS A C    7  
ATOM 10218 O O    . LYS A 1 14  ? -15.459 -5.413  -15.513 1.00 0.00 ? 14  LYS A O    7  
ATOM 10219 C CB   . LYS A 1 14  ? -16.470 -3.299  -12.955 1.00 0.00 ? 14  LYS A CB   7  
ATOM 10220 C CG   . LYS A 1 14  ? -17.436 -2.250  -12.430 1.00 0.00 ? 14  LYS A CG   7  
ATOM 10221 C CD   . LYS A 1 14  ? -18.638 -2.888  -11.754 1.00 0.00 ? 14  LYS A CD   7  
ATOM 10222 C CE   . LYS A 1 14  ? -19.768 -3.134  -12.742 1.00 0.00 ? 14  LYS A CE   7  
ATOM 10223 N NZ   . LYS A 1 14  ? -20.621 -4.284  -12.335 1.00 0.00 ? 14  LYS A NZ   7  
ATOM 10224 H H    . LYS A 1 14  ? -18.209 -5.085  -13.427 1.00 0.00 ? 14  LYS A H    7  
ATOM 10225 H HA   . LYS A 1 14  ? -17.244 -2.986  -14.927 1.00 0.00 ? 14  LYS A HA   7  
ATOM 10226 H HB2  . LYS A 1 14  ? -16.479 -4.139  -12.276 1.00 0.00 ? 14  LYS A HB2  7  
ATOM 10227 H HB3  . LYS A 1 14  ? -15.479 -2.870  -12.970 1.00 0.00 ? 14  LYS A HB3  7  
ATOM 10228 H HG2  . LYS A 1 14  ? -16.922 -1.627  -11.714 1.00 0.00 ? 14  LYS A HG2  7  
ATOM 10229 H HG3  . LYS A 1 14  ? -17.778 -1.644  -13.257 1.00 0.00 ? 14  LYS A HG3  7  
ATOM 10230 H HD2  . LYS A 1 14  ? -18.339 -3.832  -11.324 1.00 0.00 ? 14  LYS A HD2  7  
ATOM 10231 H HD3  . LYS A 1 14  ? -18.991 -2.230  -10.973 1.00 0.00 ? 14  LYS A HD3  7  
ATOM 10232 H HE2  . LYS A 1 14  ? -20.379 -2.246  -12.798 1.00 0.00 ? 14  LYS A HE2  7  
ATOM 10233 H HE3  . LYS A 1 14  ? -19.341 -3.338  -13.713 1.00 0.00 ? 14  LYS A HE3  7  
ATOM 10234 H HZ1  . LYS A 1 14  ? -20.566 -4.422  -11.305 1.00 0.00 ? 14  LYS A HZ1  7  
ATOM 10235 H HZ2  . LYS A 1 14  ? -20.298 -5.153  -12.807 1.00 0.00 ? 14  LYS A HZ2  7  
ATOM 10236 H HZ3  . LYS A 1 14  ? -21.611 -4.107  -12.598 1.00 0.00 ? 14  LYS A HZ3  7  
ATOM 10237 N N    . VAL A 1 15  ? -14.560 -3.381  -15.162 1.00 0.00 ? 15  VAL A N    7  
ATOM 10238 C CA   . VAL A 1 15  ? -13.296 -3.707  -15.811 1.00 0.00 ? 15  VAL A CA   7  
ATOM 10239 C C    . VAL A 1 15  ? -12.112 -3.233  -14.977 1.00 0.00 ? 15  VAL A C    7  
ATOM 10240 O O    . VAL A 1 15  ? -12.244 -2.338  -14.142 1.00 0.00 ? 15  VAL A O    7  
ATOM 10241 C CB   . VAL A 1 15  ? -13.206 -3.077  -17.214 1.00 0.00 ? 15  VAL A CB   7  
ATOM 10242 C CG1  . VAL A 1 15  ? -14.313 -3.610  -18.111 1.00 0.00 ? 15  VAL A CG1  7  
ATOM 10243 C CG2  . VAL A 1 15  ? -13.268 -1.560  -17.121 1.00 0.00 ? 15  VAL A CG2  7  
ATOM 10244 H H    . VAL A 1 15  ? -14.688 -2.485  -14.787 1.00 0.00 ? 15  VAL A H    7  
ATOM 10245 H HA   . VAL A 1 15  ? -13.243 -4.781  -15.918 1.00 0.00 ? 15  VAL A HA   7  
ATOM 10246 H HB   . VAL A 1 15  ? -12.257 -3.352  -17.650 1.00 0.00 ? 15  VAL A HB   7  
ATOM 10247 H HG11 . VAL A 1 15  ? -14.302 -4.690  -18.093 1.00 0.00 ? 15  VAL A HG11 7  
ATOM 10248 H HG12 . VAL A 1 15  ? -15.269 -3.253  -17.755 1.00 0.00 ? 15  VAL A HG12 7  
ATOM 10249 H HG13 . VAL A 1 15  ? -14.154 -3.266  -19.122 1.00 0.00 ? 15  VAL A HG13 7  
ATOM 10250 H HG21 . VAL A 1 15  ? -12.458 -1.205  -16.501 1.00 0.00 ? 15  VAL A HG21 7  
ATOM 10251 H HG22 . VAL A 1 15  ? -13.177 -1.135  -18.110 1.00 0.00 ? 15  VAL A HG22 7  
ATOM 10252 H HG23 . VAL A 1 15  ? -14.211 -1.264  -16.688 1.00 0.00 ? 15  VAL A HG23 7  
ATOM 10253 N N    . THR A 1 16  ? -10.952 -3.840  -15.207 1.00 0.00 ? 16  THR A N    7  
ATOM 10254 C CA   . THR A 1 16  ? -9.743  -3.481  -14.477 1.00 0.00 ? 16  THR A CA   7  
ATOM 10255 C C    . THR A 1 16  ? -9.005  -2.337  -15.163 1.00 0.00 ? 16  THR A C    7  
ATOM 10256 O O    . THR A 1 16  ? -8.886  -2.310  -16.387 1.00 0.00 ? 16  THR A O    7  
ATOM 10257 C CB   . THR A 1 16  ? -8.790  -4.684  -14.342 1.00 0.00 ? 16  THR A CB   7  
ATOM 10258 O OG1  . THR A 1 16  ? -8.655  -5.346  -15.605 1.00 0.00 ? 16  THR A OG1  7  
ATOM 10259 C CG2  . THR A 1 16  ? -9.303  -5.667  -13.301 1.00 0.00 ? 16  THR A CG2  7  
ATOM 10260 H H    . THR A 1 16  ? -10.910 -4.547  -15.885 1.00 0.00 ? 16  THR A H    7  
ATOM 10261 H HA   . THR A 1 16  ? -10.033 -3.166  -13.485 1.00 0.00 ? 16  THR A HA   7  
ATOM 10262 H HB   . THR A 1 16  ? -7.821  -4.323  -14.028 1.00 0.00 ? 16  THR A HB   7  
ATOM 10263 H HG1  . THR A 1 16  ? -8.107  -4.815  -16.188 1.00 0.00 ? 16  THR A HG1  7  
ATOM 10264 H HG21 . THR A 1 16  ? -9.990  -6.359  -13.766 1.00 0.00 ? 16  THR A HG21 7  
ATOM 10265 H HG22 . THR A 1 16  ? -9.812  -5.127  -12.516 1.00 0.00 ? 16  THR A HG22 7  
ATOM 10266 H HG23 . THR A 1 16  ? -8.472  -6.213  -12.881 1.00 0.00 ? 16  THR A HG23 7  
ATOM 10267 N N    . GLN A 1 17  ? -8.510  -1.396  -14.365 1.00 0.00 ? 17  GLN A N    7  
ATOM 10268 C CA   . GLN A 1 17  ? -7.783  -0.249  -14.897 1.00 0.00 ? 17  GLN A CA   7  
ATOM 10269 C C    . GLN A 1 17  ? -6.410  -0.126  -14.246 1.00 0.00 ? 17  GLN A C    7  
ATOM 10270 O O    . GLN A 1 17  ? -6.291  -0.117  -13.021 1.00 0.00 ? 17  GLN A O    7  
ATOM 10271 C CB   . GLN A 1 17  ? -8.583  1.035   -14.676 1.00 0.00 ? 17  GLN A CB   7  
ATOM 10272 C CG   . GLN A 1 17  ? -8.028  2.235   -15.427 1.00 0.00 ? 17  GLN A CG   7  
ATOM 10273 C CD   . GLN A 1 17  ? -8.672  3.539   -15.001 1.00 0.00 ? 17  GLN A CD   7  
ATOM 10274 O OE1  . GLN A 1 17  ? -8.742  3.852   -13.812 1.00 0.00 ? 17  GLN A OE1  7  
ATOM 10275 N NE2  . GLN A 1 17  ? -9.147  4.310   -15.973 1.00 0.00 ? 17  GLN A NE2  7  
ATOM 10276 H H    . GLN A 1 17  ? -8.637  -1.474  -13.397 1.00 0.00 ? 17  GLN A H    7  
ATOM 10277 H HA   . GLN A 1 17  ? -7.653  -0.403  -15.958 1.00 0.00 ? 17  GLN A HA   7  
ATOM 10278 H HB2  . GLN A 1 17  ? -9.600  0.873   -15.001 1.00 0.00 ? 17  GLN A HB2  7  
ATOM 10279 H HB3  . GLN A 1 17  ? -8.584  1.268   -13.621 1.00 0.00 ? 17  GLN A HB3  7  
ATOM 10280 H HG2  . GLN A 1 17  ? -6.966  2.299   -15.243 1.00 0.00 ? 17  GLN A HG2  7  
ATOM 10281 H HG3  . GLN A 1 17  ? -8.201  2.093   -16.484 1.00 0.00 ? 17  GLN A HG3  7  
ATOM 10282 H HE21 . GLN A 1 17  ? -9.057  3.996   -16.898 1.00 0.00 ? 17  GLN A HE21 7  
ATOM 10283 H HE22 . GLN A 1 17  ? -9.569  5.158   -15.726 1.00 0.00 ? 17  GLN A HE22 7  
ATOM 10284 N N    . SER A 1 18  ? -5.374  -0.031  -15.074 1.00 0.00 ? 18  SER A N    7  
ATOM 10285 C CA   . SER A 1 18  ? -4.008  0.088   -14.579 1.00 0.00 ? 18  SER A CA   7  
ATOM 10286 C C    . SER A 1 18  ? -3.578  1.551   -14.515 1.00 0.00 ? 18  SER A C    7  
ATOM 10287 O O    . SER A 1 18  ? -3.210  2.145   -15.529 1.00 0.00 ? 18  SER A O    7  
ATOM 10288 C CB   . SER A 1 18  ? -3.048  -0.699  -15.474 1.00 0.00 ? 18  SER A CB   7  
ATOM 10289 O OG   . SER A 1 18  ? -3.033  -0.174  -16.790 1.00 0.00 ? 18  SER A OG   7  
ATOM 10290 H H    . SER A 1 18  ? -5.533  -0.044  -16.042 1.00 0.00 ? 18  SER A H    7  
ATOM 10291 H HA   . SER A 1 18  ? -3.979  -0.327  -13.583 1.00 0.00 ? 18  SER A HA   7  
ATOM 10292 H HB2  . SER A 1 18  ? -2.051  -0.642  -15.065 1.00 0.00 ? 18  SER A HB2  7  
ATOM 10293 H HB3  . SER A 1 18  ? -3.363  -1.731  -15.514 1.00 0.00 ? 18  SER A HB3  7  
ATOM 10294 H HG   . SER A 1 18  ? -3.624  -0.686  -17.346 1.00 0.00 ? 18  SER A HG   7  
ATOM 10295 N N    . ILE A 1 19  ? -3.630  2.124   -13.318 1.00 0.00 ? 19  ILE A N    7  
ATOM 10296 C CA   . ILE A 1 19  ? -3.245  3.516   -13.121 1.00 0.00 ? 19  ILE A CA   7  
ATOM 10297 C C    . ILE A 1 19  ? -1.790  3.628   -12.681 1.00 0.00 ? 19  ILE A C    7  
ATOM 10298 O O    . ILE A 1 19  ? -1.423  3.181   -11.593 1.00 0.00 ? 19  ILE A O    7  
ATOM 10299 C CB   . ILE A 1 19  ? -4.141  4.205   -12.074 1.00 0.00 ? 19  ILE A CB   7  
ATOM 10300 C CG1  . ILE A 1 19  ? -5.568  4.346   -12.606 1.00 0.00 ? 19  ILE A CG1  7  
ATOM 10301 C CG2  . ILE A 1 19  ? -3.571  5.566   -11.703 1.00 0.00 ? 19  ILE A CG2  7  
ATOM 10302 C CD1  . ILE A 1 19  ? -6.623  4.317   -11.522 1.00 0.00 ? 19  ILE A CD1  7  
ATOM 10303 H H    . ILE A 1 19  ? -3.932  1.598   -12.549 1.00 0.00 ? 19  ILE A H    7  
ATOM 10304 H HA   . ILE A 1 19  ? -3.365  4.031   -14.063 1.00 0.00 ? 19  ILE A HA   7  
ATOM 10305 H HB   . ILE A 1 19  ? -4.154  3.593   -11.186 1.00 0.00 ? 19  ILE A HB   7  
ATOM 10306 H HG12 . ILE A 1 19  ? -5.659  5.284   -13.132 1.00 0.00 ? 19  ILE A HG12 7  
ATOM 10307 H HG13 . ILE A 1 19  ? -5.772  3.534   -13.289 1.00 0.00 ? 19  ILE A HG13 7  
ATOM 10308 H HG21 . ILE A 1 19  ? -3.304  5.571   -10.657 1.00 0.00 ? 19  ILE A HG21 7  
ATOM 10309 H HG22 . ILE A 1 19  ? -2.692  5.762   -12.299 1.00 0.00 ? 19  ILE A HG22 7  
ATOM 10310 H HG23 . ILE A 1 19  ? -4.311  6.329   -11.889 1.00 0.00 ? 19  ILE A HG23 7  
ATOM 10311 H HD11 . ILE A 1 19  ? -6.688  3.322   -11.109 1.00 0.00 ? 19  ILE A HD11 7  
ATOM 10312 H HD12 . ILE A 1 19  ? -6.357  5.015   -10.742 1.00 0.00 ? 19  ILE A HD12 7  
ATOM 10313 H HD13 . ILE A 1 19  ? -7.579  4.594   -11.943 1.00 0.00 ? 19  ILE A HD13 7  
ATOM 10314 N N    . HIS A 1 20  ? -0.964  4.228   -13.532 1.00 0.00 ? 20  HIS A N    7  
ATOM 10315 C CA   . HIS A 1 20  ? 0.453   4.400   -13.230 1.00 0.00 ? 20  HIS A CA   7  
ATOM 10316 C C    . HIS A 1 20  ? 0.750   5.840   -12.821 1.00 0.00 ? 20  HIS A C    7  
ATOM 10317 O O    . HIS A 1 20  ? 0.565   6.769   -13.609 1.00 0.00 ? 20  HIS A O    7  
ATOM 10318 C CB   . HIS A 1 20  ? 1.305   4.015   -14.439 1.00 0.00 ? 20  HIS A CB   7  
ATOM 10319 C CG   . HIS A 1 20  ? 1.556   5.152   -15.381 1.00 0.00 ? 20  HIS A CG   7  
ATOM 10320 N ND1  . HIS A 1 20  ? 0.562   5.739   -16.134 1.00 0.00 ? 20  HIS A ND1  7  
ATOM 10321 C CD2  . HIS A 1 20  ? 2.698   5.811   -15.689 1.00 0.00 ? 20  HIS A CD2  7  
ATOM 10322 C CE1  . HIS A 1 20  ? 1.081   6.709   -16.866 1.00 0.00 ? 20  HIS A CE1  7  
ATOM 10323 N NE2  . HIS A 1 20  ? 2.376   6.773   -16.614 1.00 0.00 ? 20  HIS A NE2  7  
ATOM 10324 H H    . HIS A 1 20  ? -1.315  4.562   -14.383 1.00 0.00 ? 20  HIS A H    7  
ATOM 10325 H HA   . HIS A 1 20  ? 0.698   3.748   -12.405 1.00 0.00 ? 20  HIS A HA   7  
ATOM 10326 H HB2  . HIS A 1 20  ? 2.262   3.652   -14.096 1.00 0.00 ? 20  HIS A HB2  7  
ATOM 10327 H HB3  . HIS A 1 20  ? 0.804   3.232   -14.989 1.00 0.00 ? 20  HIS A HB3  7  
ATOM 10328 H HD1  . HIS A 1 20  ? -0.384  5.483   -16.134 1.00 0.00 ? 20  HIS A HD1  7  
ATOM 10329 H HD2  . HIS A 1 20  ? 3.681   5.616   -15.284 1.00 0.00 ? 20  HIS A HD2  7  
ATOM 10330 H HE1  . HIS A 1 20  ? 0.540   7.342   -17.553 1.00 0.00 ? 20  HIS A HE1  7  
ATOM 10331 H HE2  . HIS A 1 20  ? 3.014   7.348   -17.085 1.00 0.00 ? 20  HIS A HE2  7  
ATOM 10332 N N    . ILE A 1 21  ? 1.209   6.018   -11.587 1.00 0.00 ? 21  ILE A N    7  
ATOM 10333 C CA   . ILE A 1 21  ? 1.531   7.344   -11.076 1.00 0.00 ? 21  ILE A CA   7  
ATOM 10334 C C    . ILE A 1 21  ? 3.033   7.602   -11.123 1.00 0.00 ? 21  ILE A C    7  
ATOM 10335 O O    . ILE A 1 21  ? 3.823   6.825   -10.586 1.00 0.00 ? 21  ILE A O    7  
ATOM 10336 C CB   . ILE A 1 21  ? 1.036   7.525   -9.629  1.00 0.00 ? 21  ILE A CB   7  
ATOM 10337 C CG1  . ILE A 1 21  ? -0.414  7.052   -9.500  1.00 0.00 ? 21  ILE A CG1  7  
ATOM 10338 C CG2  . ILE A 1 21  ? 1.163   8.980   -9.204  1.00 0.00 ? 21  ILE A CG2  7  
ATOM 10339 C CD1  . ILE A 1 21  ? -0.786  6.620   -8.099  1.00 0.00 ? 21  ILE A CD1  7  
ATOM 10340 H H    . ILE A 1 21  ? 1.335   5.238   -11.008 1.00 0.00 ? 21  ILE A H    7  
ATOM 10341 H HA   . ILE A 1 21  ? 1.032   8.072   -11.700 1.00 0.00 ? 21  ILE A HA   7  
ATOM 10342 H HB   . ILE A 1 21  ? 1.660   6.930   -8.981  1.00 0.00 ? 21  ILE A HB   7  
ATOM 10343 H HG12 . ILE A 1 21  ? -1.075  7.854   -9.786  1.00 0.00 ? 21  ILE A HG12 7  
ATOM 10344 H HG13 . ILE A 1 21  ? -0.569  6.210   -10.160 1.00 0.00 ? 21  ILE A HG13 7  
ATOM 10345 H HG21 . ILE A 1 21  ? 0.432   9.575   -9.732  1.00 0.00 ? 21  ILE A HG21 7  
ATOM 10346 H HG22 . ILE A 1 21  ? 0.990   9.061   -8.141  1.00 0.00 ? 21  ILE A HG22 7  
ATOM 10347 H HG23 . ILE A 1 21  ? 2.155   9.338   -9.436  1.00 0.00 ? 21  ILE A HG23 7  
ATOM 10348 H HD11 . ILE A 1 21  ? -1.796  6.933   -7.881  1.00 0.00 ? 21  ILE A HD11 7  
ATOM 10349 H HD12 . ILE A 1 21  ? -0.717  5.545   -8.023  1.00 0.00 ? 21  ILE A HD12 7  
ATOM 10350 H HD13 . ILE A 1 21  ? -0.108  7.075   -7.390  1.00 0.00 ? 21  ILE A HD13 7  
ATOM 10351 N N    . GLU A 1 22  ? 3.421   8.698   -11.767 1.00 0.00 ? 22  GLU A N    7  
ATOM 10352 C CA   . GLU A 1 22  ? 4.829   9.058   -11.883 1.00 0.00 ? 22  GLU A CA   7  
ATOM 10353 C C    . GLU A 1 22  ? 5.120   10.360  -11.142 1.00 0.00 ? 22  GLU A C    7  
ATOM 10354 O O    . GLU A 1 22  ? 4.384   11.339  -11.270 1.00 0.00 ? 22  GLU A O    7  
ATOM 10355 C CB   . GLU A 1 22  ? 5.223   9.197   -13.355 1.00 0.00 ? 22  GLU A CB   7  
ATOM 10356 C CG   . GLU A 1 22  ? 5.641   7.886   -13.999 1.00 0.00 ? 22  GLU A CG   7  
ATOM 10357 C CD   . GLU A 1 22  ? 5.976   8.039   -15.470 1.00 0.00 ? 22  GLU A CD   7  
ATOM 10358 O OE1  . GLU A 1 22  ? 5.049   7.948   -16.303 1.00 0.00 ? 22  GLU A OE1  7  
ATOM 10359 O OE2  . GLU A 1 22  ? 7.165   8.250   -15.789 1.00 0.00 ? 22  GLU A OE2  7  
ATOM 10360 H H    . GLU A 1 22  ? 2.744   9.278   -12.175 1.00 0.00 ? 22  GLU A H    7  
ATOM 10361 H HA   . GLU A 1 22  ? 5.411   8.266   -11.437 1.00 0.00 ? 22  GLU A HA   7  
ATOM 10362 H HB2  . GLU A 1 22  ? 4.383   9.593   -13.905 1.00 0.00 ? 22  GLU A HB2  7  
ATOM 10363 H HB3  . GLU A 1 22  ? 6.049   9.889   -13.430 1.00 0.00 ? 22  GLU A HB3  7  
ATOM 10364 H HG2  . GLU A 1 22  ? 6.512   7.508   -13.485 1.00 0.00 ? 22  GLU A HG2  7  
ATOM 10365 H HG3  . GLU A 1 22  ? 4.832   7.177   -13.901 1.00 0.00 ? 22  GLU A HG3  7  
ATOM 10366 N N    . LYS A 1 23  ? 6.199   10.364  -10.366 1.00 0.00 ? 23  LYS A N    7  
ATOM 10367 C CA   . LYS A 1 23  ? 6.590   11.544  -9.605  1.00 0.00 ? 23  LYS A CA   7  
ATOM 10368 C C    . LYS A 1 23  ? 7.807   12.217  -10.231 1.00 0.00 ? 23  LYS A C    7  
ATOM 10369 O O    . LYS A 1 23  ? 8.403   11.692  -11.171 1.00 0.00 ? 23  LYS A O    7  
ATOM 10370 C CB   . LYS A 1 23  ? 6.895   11.162  -8.154  1.00 0.00 ? 23  LYS A CB   7  
ATOM 10371 C CG   . LYS A 1 23  ? 5.742   10.465  -7.453  1.00 0.00 ? 23  LYS A CG   7  
ATOM 10372 C CD   . LYS A 1 23  ? 5.738   10.756  -5.962  1.00 0.00 ? 23  LYS A CD   7  
ATOM 10373 C CE   . LYS A 1 23  ? 4.893   11.978  -5.634  1.00 0.00 ? 23  LYS A CE   7  
ATOM 10374 N NZ   . LYS A 1 23  ? 5.622   13.247  -5.910  1.00 0.00 ? 23  LYS A NZ   7  
ATOM 10375 H H    . LYS A 1 23  ? 6.746   9.552   -10.305 1.00 0.00 ? 23  LYS A H    7  
ATOM 10376 H HA   . LYS A 1 23  ? 5.763   12.237  -9.619  1.00 0.00 ? 23  LYS A HA   7  
ATOM 10377 H HB2  . LYS A 1 23  ? 7.749   10.501  -8.141  1.00 0.00 ? 23  LYS A HB2  7  
ATOM 10378 H HB3  . LYS A 1 23  ? 7.136   12.059  -7.602  1.00 0.00 ? 23  LYS A HB3  7  
ATOM 10379 H HG2  . LYS A 1 23  ? 4.812   10.812  -7.879  1.00 0.00 ? 23  LYS A HG2  7  
ATOM 10380 H HG3  . LYS A 1 23  ? 5.833   9.399   -7.602  1.00 0.00 ? 23  LYS A HG3  7  
ATOM 10381 H HD2  . LYS A 1 23  ? 5.335   9.903   -5.438  1.00 0.00 ? 23  LYS A HD2  7  
ATOM 10382 H HD3  . LYS A 1 23  ? 6.754   10.934  -5.636  1.00 0.00 ? 23  LYS A HD3  7  
ATOM 10383 H HE2  . LYS A 1 23  ? 3.997   11.950  -6.234  1.00 0.00 ? 23  LYS A HE2  7  
ATOM 10384 H HE3  . LYS A 1 23  ? 4.627   11.945  -4.588  1.00 0.00 ? 23  LYS A HE3  7  
ATOM 10385 H HZ1  . LYS A 1 23  ? 6.632   13.052  -6.064  1.00 0.00 ? 23  LYS A HZ1  7  
ATOM 10386 H HZ2  . LYS A 1 23  ? 5.526   13.896  -5.104  1.00 0.00 ? 23  LYS A HZ2  7  
ATOM 10387 H HZ3  . LYS A 1 23  ? 5.235   13.705  -6.759  1.00 0.00 ? 23  LYS A HZ3  7  
ATOM 10388 N N    . SER A 1 24  ? 8.171   13.381  -9.703  1.00 0.00 ? 24  SER A N    7  
ATOM 10389 C CA   . SER A 1 24  ? 9.315   14.127  -10.212 1.00 0.00 ? 24  SER A CA   7  
ATOM 10390 C C    . SER A 1 24  ? 10.565  13.833  -9.388  1.00 0.00 ? 24  SER A C    7  
ATOM 10391 O O    . SER A 1 24  ? 11.594  13.423  -9.926  1.00 0.00 ? 24  SER A O    7  
ATOM 10392 C CB   . SER A 1 24  ? 9.021   15.628  -10.195 1.00 0.00 ? 24  SER A CB   7  
ATOM 10393 O OG   . SER A 1 24  ? 10.183  16.379  -10.501 1.00 0.00 ? 24  SER A OG   7  
ATOM 10394 H H    . SER A 1 24  ? 7.655   13.748  -8.954  1.00 0.00 ? 24  SER A H    7  
ATOM 10395 H HA   . SER A 1 24  ? 9.488   13.814  -11.231 1.00 0.00 ? 24  SER A HA   7  
ATOM 10396 H HB2  . SER A 1 24  ? 8.260   15.852  -10.927 1.00 0.00 ? 24  SER A HB2  7  
ATOM 10397 H HB3  . SER A 1 24  ? 8.671   15.913  -9.213  1.00 0.00 ? 24  SER A HB3  7  
ATOM 10398 H HG   . SER A 1 24  ? 9.961   17.072  -11.128 1.00 0.00 ? 24  SER A HG   7  
ATOM 10399 N N    . ASP A 1 25  ? 10.468  14.046  -8.081  1.00 0.00 ? 25  ASP A N    7  
ATOM 10400 C CA   . ASP A 1 25  ? 11.590  13.804  -7.181  1.00 0.00 ? 25  ASP A CA   7  
ATOM 10401 C C    . ASP A 1 25  ? 11.204  12.814  -6.086  1.00 0.00 ? 25  ASP A C    7  
ATOM 10402 O O    . ASP A 1 25  ? 10.632  13.193  -5.064  1.00 0.00 ? 25  ASP A O    7  
ATOM 10403 C CB   . ASP A 1 25  ? 12.062  15.117  -6.555  1.00 0.00 ? 25  ASP A CB   7  
ATOM 10404 C CG   . ASP A 1 25  ? 13.502  15.049  -6.086  1.00 0.00 ? 25  ASP A CG   7  
ATOM 10405 O OD1  . ASP A 1 25  ? 13.945  13.952  -5.684  1.00 0.00 ? 25  ASP A OD1  7  
ATOM 10406 O OD2  . ASP A 1 25  ? 14.187  16.093  -6.121  1.00 0.00 ? 25  ASP A OD2  7  
ATOM 10407 H H    . ASP A 1 25  ? 9.621   14.374  -7.712  1.00 0.00 ? 25  ASP A H    7  
ATOM 10408 H HA   . ASP A 1 25  ? 12.396  13.382  -7.762  1.00 0.00 ? 25  ASP A HA   7  
ATOM 10409 H HB2  . ASP A 1 25  ? 11.978  15.907  -7.286  1.00 0.00 ? 25  ASP A HB2  7  
ATOM 10410 H HB3  . ASP A 1 25  ? 11.436  15.349  -5.706  1.00 0.00 ? 25  ASP A HB3  7  
ATOM 10411 N N    . THR A 1 26  ? 11.520  11.541  -6.308  1.00 0.00 ? 26  THR A N    7  
ATOM 10412 C CA   . THR A 1 26  ? 11.204  10.496  -5.342  1.00 0.00 ? 26  THR A CA   7  
ATOM 10413 C C    . THR A 1 26  ? 11.464  10.969  -3.916  1.00 0.00 ? 26  THR A C    7  
ATOM 10414 O O    . THR A 1 26  ? 10.778  10.556  -2.981  1.00 0.00 ? 26  THR A O    7  
ATOM 10415 C CB   . THR A 1 26  ? 12.027  9.221   -5.605  1.00 0.00 ? 26  THR A CB   7  
ATOM 10416 O OG1  . THR A 1 26  ? 11.573  8.161   -4.756  1.00 0.00 ? 26  THR A OG1  7  
ATOM 10417 C CG2  . THR A 1 26  ? 13.508  9.473   -5.363  1.00 0.00 ? 26  THR A CG2  7  
ATOM 10418 H H    . THR A 1 26  ? 11.975  11.301  -7.141  1.00 0.00 ? 26  THR A H    7  
ATOM 10419 H HA   . THR A 1 26  ? 10.157  10.252  -5.445  1.00 0.00 ? 26  THR A HA   7  
ATOM 10420 H HB   . THR A 1 26  ? 11.890  8.930   -6.637  1.00 0.00 ? 26  THR A HB   7  
ATOM 10421 H HG1  . THR A 1 26  ? 12.248  7.963   -4.102  1.00 0.00 ? 26  THR A HG1  7  
ATOM 10422 H HG21 . THR A 1 26  ? 13.726  9.353   -4.312  1.00 0.00 ? 26  THR A HG21 7  
ATOM 10423 H HG22 . THR A 1 26  ? 13.757  10.477  -5.671  1.00 0.00 ? 26  THR A HG22 7  
ATOM 10424 H HG23 . THR A 1 26  ? 14.091  8.766   -5.935  1.00 0.00 ? 26  THR A HG23 7  
ATOM 10425 N N    . ALA A 1 27  ? 12.457  11.837  -3.757  1.00 0.00 ? 27  ALA A N    7  
ATOM 10426 C CA   . ALA A 1 27  ? 12.804  12.368  -2.444  1.00 0.00 ? 27  ALA A CA   7  
ATOM 10427 C C    . ALA A 1 27  ? 11.960  13.592  -2.106  1.00 0.00 ? 27  ALA A C    7  
ATOM 10428 O O    . ALA A 1 27  ? 11.084  13.535  -1.244  1.00 0.00 ? 27  ALA A O    7  
ATOM 10429 C CB   . ALA A 1 27  ? 14.285  12.714  -2.390  1.00 0.00 ? 27  ALA A CB   7  
ATOM 10430 H H    . ALA A 1 27  ? 12.967  12.129  -4.541  1.00 0.00 ? 27  ALA A H    7  
ATOM 10431 H HA   . ALA A 1 27  ? 12.613  11.598  -1.711  1.00 0.00 ? 27  ALA A HA   7  
ATOM 10432 H HB1  . ALA A 1 27  ? 14.550  13.002  -1.383  1.00 0.00 ? 27  ALA A HB1  7  
ATOM 10433 H HB2  . ALA A 1 27  ? 14.867  11.853  -2.684  1.00 0.00 ? 27  ALA A HB2  7  
ATOM 10434 H HB3  . ALA A 1 27  ? 14.488  13.533  -3.064  1.00 0.00 ? 27  ALA A HB3  7  
ATOM 10435 N N    . ALA A 1 28  ? 12.231  14.699  -2.791  1.00 0.00 ? 28  ALA A N    7  
ATOM 10436 C CA   . ALA A 1 28  ? 11.495  15.937  -2.564  1.00 0.00 ? 28  ALA A CA   7  
ATOM 10437 C C    . ALA A 1 28  ? 9.992   15.683  -2.526  1.00 0.00 ? 28  ALA A C    7  
ATOM 10438 O O    . ALA A 1 28  ? 9.362   15.784  -1.473  1.00 0.00 ? 28  ALA A O    7  
ATOM 10439 C CB   . ALA A 1 28  ? 11.833  16.957  -3.641  1.00 0.00 ? 28  ALA A CB   7  
ATOM 10440 H H    . ALA A 1 28  ? 12.941  14.682  -3.466  1.00 0.00 ? 28  ALA A H    7  
ATOM 10441 H HA   . ALA A 1 28  ? 11.806  16.340  -1.611  1.00 0.00 ? 28  ALA A HA   7  
ATOM 10442 H HB1  . ALA A 1 28  ? 12.703  16.625  -4.189  1.00 0.00 ? 28  ALA A HB1  7  
ATOM 10443 H HB2  . ALA A 1 28  ? 10.997  17.057  -4.317  1.00 0.00 ? 28  ALA A HB2  7  
ATOM 10444 H HB3  . ALA A 1 28  ? 12.040  17.911  -3.180  1.00 0.00 ? 28  ALA A HB3  7  
ATOM 10445 N N    . ASP A 1 29  ? 9.423   15.353  -3.681  1.00 0.00 ? 29  ASP A N    7  
ATOM 10446 C CA   . ASP A 1 29  ? 7.993   15.084  -3.780  1.00 0.00 ? 29  ASP A CA   7  
ATOM 10447 C C    . ASP A 1 29  ? 7.693   13.621  -3.470  1.00 0.00 ? 29  ASP A C    7  
ATOM 10448 O O    . ASP A 1 29  ? 8.407   12.722  -3.915  1.00 0.00 ? 29  ASP A O    7  
ATOM 10449 C CB   . ASP A 1 29  ? 7.481   15.439  -5.177  1.00 0.00 ? 29  ASP A CB   7  
ATOM 10450 C CG   . ASP A 1 29  ? 8.138   16.686  -5.735  1.00 0.00 ? 29  ASP A CG   7  
ATOM 10451 O OD1  . ASP A 1 29  ? 9.355   16.642  -6.012  1.00 0.00 ? 29  ASP A OD1  7  
ATOM 10452 O OD2  . ASP A 1 29  ? 7.436   17.707  -5.893  1.00 0.00 ? 29  ASP A OD2  7  
ATOM 10453 H H    . ASP A 1 29  ? 9.979   15.289  -4.486  1.00 0.00 ? 29  ASP A H    7  
ATOM 10454 H HA   . ASP A 1 29  ? 7.488   15.704  -3.054  1.00 0.00 ? 29  ASP A HA   7  
ATOM 10455 H HB2  . ASP A 1 29  ? 7.685   14.617  -5.847  1.00 0.00 ? 29  ASP A HB2  7  
ATOM 10456 H HB3  . ASP A 1 29  ? 6.415   15.605  -5.131  1.00 0.00 ? 29  ASP A HB3  7  
ATOM 10457 N N    . THR A 1 30  ? 6.631   13.389  -2.704  1.00 0.00 ? 30  THR A N    7  
ATOM 10458 C CA   . THR A 1 30  ? 6.238   12.036  -2.333  1.00 0.00 ? 30  THR A CA   7  
ATOM 10459 C C    . THR A 1 30  ? 4.723   11.921  -2.198  1.00 0.00 ? 30  THR A C    7  
ATOM 10460 O O    . THR A 1 30  ? 4.070   12.811  -1.653  1.00 0.00 ? 30  THR A O    7  
ATOM 10461 C CB   . THR A 1 30  ? 6.894   11.603  -1.009  1.00 0.00 ? 30  THR A CB   7  
ATOM 10462 O OG1  . THR A 1 30  ? 6.700   12.613  -0.012  1.00 0.00 ? 30  THR A OG1  7  
ATOM 10463 C CG2  . THR A 1 30  ? 8.382   11.351  -1.199  1.00 0.00 ? 30  THR A CG2  7  
ATOM 10464 H H    . THR A 1 30  ? 6.102   14.148  -2.381  1.00 0.00 ? 30  THR A H    7  
ATOM 10465 H HA   . THR A 1 30  ? 6.571   11.366  -3.112  1.00 0.00 ? 30  THR A HA   7  
ATOM 10466 H HB   . THR A 1 30  ? 6.428   10.686  -0.677  1.00 0.00 ? 30  THR A HB   7  
ATOM 10467 H HG1  . THR A 1 30  ? 6.906   13.474  -0.385  1.00 0.00 ? 30  THR A HG1  7  
ATOM 10468 H HG21 . THR A 1 30  ? 8.569   11.052  -2.220  1.00 0.00 ? 30  THR A HG21 7  
ATOM 10469 H HG22 . THR A 1 30  ? 8.703   10.567  -0.530  1.00 0.00 ? 30  THR A HG22 7  
ATOM 10470 H HG23 . THR A 1 30  ? 8.930   12.255  -0.983  1.00 0.00 ? 30  THR A HG23 7  
ATOM 10471 N N    . TYR A 1 31  ? 4.171   10.821  -2.697  1.00 0.00 ? 31  TYR A N    7  
ATOM 10472 C CA   . TYR A 1 31  ? 2.733   10.592  -2.633  1.00 0.00 ? 31  TYR A CA   7  
ATOM 10473 C C    . TYR A 1 31  ? 2.187   10.935  -1.250  1.00 0.00 ? 31  TYR A C    7  
ATOM 10474 O O    . TYR A 1 31  ? 2.946   11.130  -0.302  1.00 0.00 ? 31  TYR A O    7  
ATOM 10475 C CB   . TYR A 1 31  ? 2.412   9.135   -2.973  1.00 0.00 ? 31  TYR A CB   7  
ATOM 10476 C CG   . TYR A 1 31  ? 3.161   8.616   -4.181  1.00 0.00 ? 31  TYR A CG   7  
ATOM 10477 C CD1  . TYR A 1 31  ? 2.892   9.106   -5.453  1.00 0.00 ? 31  TYR A CD1  7  
ATOM 10478 C CD2  . TYR A 1 31  ? 4.137   7.637   -4.048  1.00 0.00 ? 31  TYR A CD2  7  
ATOM 10479 C CE1  . TYR A 1 31  ? 3.572   8.634   -6.558  1.00 0.00 ? 31  TYR A CE1  7  
ATOM 10480 C CE2  . TYR A 1 31  ? 4.824   7.160   -5.148  1.00 0.00 ? 31  TYR A CE2  7  
ATOM 10481 C CZ   . TYR A 1 31  ? 4.538   7.662   -6.401  1.00 0.00 ? 31  TYR A CZ   7  
ATOM 10482 O OH   . TYR A 1 31  ? 5.219   7.190   -7.500  1.00 0.00 ? 31  TYR A OH   7  
ATOM 10483 H H    . TYR A 1 31  ? 4.744   10.148  -3.120  1.00 0.00 ? 31  TYR A H    7  
ATOM 10484 H HA   . TYR A 1 31  ? 2.262   11.233  -3.363  1.00 0.00 ? 31  TYR A HA   7  
ATOM 10485 H HB2  . TYR A 1 31  ? 2.669   8.511   -2.132  1.00 0.00 ? 31  TYR A HB2  7  
ATOM 10486 H HB3  . TYR A 1 31  ? 1.355   9.044   -3.174  1.00 0.00 ? 31  TYR A HB3  7  
ATOM 10487 H HD1  . TYR A 1 31  ? 2.135   9.868   -5.572  1.00 0.00 ? 31  TYR A HD1  7  
ATOM 10488 H HD2  . TYR A 1 31  ? 4.359   7.246   -3.066  1.00 0.00 ? 31  TYR A HD2  7  
ATOM 10489 H HE1  . TYR A 1 31  ? 3.349   9.027   -7.539  1.00 0.00 ? 31  TYR A HE1  7  
ATOM 10490 H HE2  . TYR A 1 31  ? 5.580   6.399   -5.026  1.00 0.00 ? 31  TYR A HE2  7  
ATOM 10491 H HH   . TYR A 1 31  ? 4.594   6.832   -8.134  1.00 0.00 ? 31  TYR A HH   7  
ATOM 10492 N N    . GLY A 1 32  ? 0.863   11.005  -1.144  1.00 0.00 ? 32  GLY A N    7  
ATOM 10493 C CA   . GLY A 1 32  ? 0.237   11.324  0.125   1.00 0.00 ? 32  GLY A CA   7  
ATOM 10494 C C    . GLY A 1 32  ? -1.012  10.503  0.378   1.00 0.00 ? 32  GLY A C    7  
ATOM 10495 O O    . GLY A 1 32  ? -1.912  10.934  1.099   1.00 0.00 ? 32  GLY A O    7  
ATOM 10496 H H    . GLY A 1 32  ? 0.308   10.839  -1.935  1.00 0.00 ? 32  GLY A H    7  
ATOM 10497 H HA2  . GLY A 1 32  ? 0.944   11.138  0.920   1.00 0.00 ? 32  GLY A HA2  7  
ATOM 10498 H HA3  . GLY A 1 32  ? -0.028  12.371  0.130   1.00 0.00 ? 32  GLY A HA3  7  
ATOM 10499 N N    . PHE A 1 33  ? -1.069  9.317   -0.219  1.00 0.00 ? 33  PHE A N    7  
ATOM 10500 C CA   . PHE A 1 33  ? -2.219  8.434   -0.057  1.00 0.00 ? 33  PHE A CA   7  
ATOM 10501 C C    . PHE A 1 33  ? -1.846  7.199   0.759   1.00 0.00 ? 33  PHE A C    7  
ATOM 10502 O O    . PHE A 1 33  ? -0.842  6.541   0.485   1.00 0.00 ? 33  PHE A O    7  
ATOM 10503 C CB   . PHE A 1 33  ? -2.760  8.011   -1.424  1.00 0.00 ? 33  PHE A CB   7  
ATOM 10504 C CG   . PHE A 1 33  ? -2.043  6.831   -2.015  1.00 0.00 ? 33  PHE A CG   7  
ATOM 10505 C CD1  . PHE A 1 33  ? -0.720  6.937   -2.415  1.00 0.00 ? 33  PHE A CD1  7  
ATOM 10506 C CD2  . PHE A 1 33  ? -2.691  5.616   -2.169  1.00 0.00 ? 33  PHE A CD2  7  
ATOM 10507 C CE1  . PHE A 1 33  ? -0.058  5.853   -2.959  1.00 0.00 ? 33  PHE A CE1  7  
ATOM 10508 C CE2  . PHE A 1 33  ? -2.033  4.528   -2.713  1.00 0.00 ? 33  PHE A CE2  7  
ATOM 10509 C CZ   . PHE A 1 33  ? -0.715  4.647   -3.107  1.00 0.00 ? 33  PHE A CZ   7  
ATOM 10510 H H    . PHE A 1 33  ? -0.320  9.028   -0.782  1.00 0.00 ? 33  PHE A H    7  
ATOM 10511 H HA   . PHE A 1 33  ? -2.984  8.982   0.470   1.00 0.00 ? 33  PHE A HA   7  
ATOM 10512 H HB2  . PHE A 1 33  ? -3.803  7.749   -1.325  1.00 0.00 ? 33  PHE A HB2  7  
ATOM 10513 H HB3  . PHE A 1 33  ? -2.665  8.838   -2.112  1.00 0.00 ? 33  PHE A HB3  7  
ATOM 10514 H HD1  . PHE A 1 33  ? -0.205  7.879   -2.299  1.00 0.00 ? 33  PHE A HD1  7  
ATOM 10515 H HD2  . PHE A 1 33  ? -3.722  5.523   -1.860  1.00 0.00 ? 33  PHE A HD2  7  
ATOM 10516 H HE1  . PHE A 1 33  ? 0.972   5.948   -3.266  1.00 0.00 ? 33  PHE A HE1  7  
ATOM 10517 H HE2  . PHE A 1 33  ? -2.550  3.587   -2.827  1.00 0.00 ? 33  PHE A HE2  7  
ATOM 10518 H HZ   . PHE A 1 33  ? -0.200  3.798   -3.532  1.00 0.00 ? 33  PHE A HZ   7  
ATOM 10519 N N    . SER A 1 34  ? -2.662  6.892   1.762   1.00 0.00 ? 34  SER A N    7  
ATOM 10520 C CA   . SER A 1 34  ? -2.416  5.740   2.621   1.00 0.00 ? 34  SER A CA   7  
ATOM 10521 C C    . SER A 1 34  ? -3.266  4.549   2.188   1.00 0.00 ? 34  SER A C    7  
ATOM 10522 O O    . SER A 1 34  ? -4.279  4.709   1.506   1.00 0.00 ? 34  SER A O    7  
ATOM 10523 C CB   . SER A 1 34  ? -2.716  6.091   4.080   1.00 0.00 ? 34  SER A CB   7  
ATOM 10524 O OG   . SER A 1 34  ? -1.977  7.228   4.492   1.00 0.00 ? 34  SER A OG   7  
ATOM 10525 H H    . SER A 1 34  ? -3.446  7.456   1.930   1.00 0.00 ? 34  SER A H    7  
ATOM 10526 H HA   . SER A 1 34  ? -1.374  5.474   2.530   1.00 0.00 ? 34  SER A HA   7  
ATOM 10527 H HB2  . SER A 1 34  ? -3.768  6.303   4.188   1.00 0.00 ? 34  SER A HB2  7  
ATOM 10528 H HB3  . SER A 1 34  ? -2.450  5.255   4.710   1.00 0.00 ? 34  SER A HB3  7  
ATOM 10529 H HG   . SER A 1 34  ? -1.124  7.233   4.051   1.00 0.00 ? 34  SER A HG   7  
ATOM 10530 N N    . LEU A 1 35  ? -2.847  3.354   2.590   1.00 0.00 ? 35  LEU A N    7  
ATOM 10531 C CA   . LEU A 1 35  ? -3.569  2.134   2.245   1.00 0.00 ? 35  LEU A CA   7  
ATOM 10532 C C    . LEU A 1 35  ? -3.893  1.321   3.494   1.00 0.00 ? 35  LEU A C    7  
ATOM 10533 O O    . LEU A 1 35  ? -3.021  1.067   4.325   1.00 0.00 ? 35  LEU A O    7  
ATOM 10534 C CB   . LEU A 1 35  ? -2.745  1.289   1.272   1.00 0.00 ? 35  LEU A CB   7  
ATOM 10535 C CG   . LEU A 1 35  ? -2.568  1.865   -0.134  1.00 0.00 ? 35  LEU A CG   7  
ATOM 10536 C CD1  . LEU A 1 35  ? -1.518  1.080   -0.904  1.00 0.00 ? 35  LEU A CD1  7  
ATOM 10537 C CD2  . LEU A 1 35  ? -3.893  1.862   -0.882  1.00 0.00 ? 35  LEU A CD2  7  
ATOM 10538 H H    . LEU A 1 35  ? -2.033  3.289   3.132   1.00 0.00 ? 35  LEU A H    7  
ATOM 10539 H HA   . LEU A 1 35  ? -4.494  2.420   1.767   1.00 0.00 ? 35  LEU A HA   7  
ATOM 10540 H HB2  . LEU A 1 35  ? -1.764  1.154   1.700   1.00 0.00 ? 35  LEU A HB2  7  
ATOM 10541 H HB3  . LEU A 1 35  ? -3.230  0.327   1.178   1.00 0.00 ? 35  LEU A HB3  7  
ATOM 10542 H HG   . LEU A 1 35  ? -2.229  2.889   -0.056  1.00 0.00 ? 35  LEU A HG   7  
ATOM 10543 H HD11 . LEU A 1 35  ? -1.747  1.110   -1.958  1.00 0.00 ? 35  LEU A HD11 7  
ATOM 10544 H HD12 . LEU A 1 35  ? -1.514  0.055   -0.565  1.00 0.00 ? 35  LEU A HD12 7  
ATOM 10545 H HD13 . LEU A 1 35  ? -0.545  1.518   -0.733  1.00 0.00 ? 35  LEU A HD13 7  
ATOM 10546 H HD21 . LEU A 1 35  ? -4.037  0.901   -1.354  1.00 0.00 ? 35  LEU A HD21 7  
ATOM 10547 H HD22 . LEU A 1 35  ? -3.882  2.636   -1.636  1.00 0.00 ? 35  LEU A HD22 7  
ATOM 10548 H HD23 . LEU A 1 35  ? -4.699  2.047   -0.188  1.00 0.00 ? 35  LEU A HD23 7  
ATOM 10549 N N    . SER A 1 36  ? -5.152  0.914   3.619   1.00 0.00 ? 36  SER A N    7  
ATOM 10550 C CA   . SER A 1 36  ? -5.592  0.131   4.768   1.00 0.00 ? 36  SER A CA   7  
ATOM 10551 C C    . SER A 1 36  ? -5.783  -1.334  4.385   1.00 0.00 ? 36  SER A C    7  
ATOM 10552 O O    . SER A 1 36  ? -6.396  -1.645  3.364   1.00 0.00 ? 36  SER A O    7  
ATOM 10553 C CB   . SER A 1 36  ? -6.897  0.698   5.329   1.00 0.00 ? 36  SER A CB   7  
ATOM 10554 O OG   . SER A 1 36  ? -8.006  0.300   4.542   1.00 0.00 ? 36  SER A OG   7  
ATOM 10555 H H    . SER A 1 36  ? -5.801  1.149   2.923   1.00 0.00 ? 36  SER A H    7  
ATOM 10556 H HA   . SER A 1 36  ? -4.825  0.195   5.526   1.00 0.00 ? 36  SER A HA   7  
ATOM 10557 H HB2  . SER A 1 36  ? -7.039  0.338   6.337   1.00 0.00 ? 36  SER A HB2  7  
ATOM 10558 H HB3  . SER A 1 36  ? -6.844  1.777   5.336   1.00 0.00 ? 36  SER A HB3  7  
ATOM 10559 H HG   . SER A 1 36  ? -8.673  -0.098  5.106   1.00 0.00 ? 36  SER A HG   7  
ATOM 10560 N N    . SER A 1 37  ? -5.254  -2.229  5.213   1.00 0.00 ? 37  SER A N    7  
ATOM 10561 C CA   . SER A 1 37  ? -5.363  -3.661  4.961   1.00 0.00 ? 37  SER A CA   7  
ATOM 10562 C C    . SER A 1 37  ? -6.454  -4.284  5.826   1.00 0.00 ? 37  SER A C    7  
ATOM 10563 O O    . SER A 1 37  ? -6.584  -3.964  7.008   1.00 0.00 ? 37  SER A O    7  
ATOM 10564 C CB   . SER A 1 37  ? -4.025  -4.351  5.233   1.00 0.00 ? 37  SER A CB   7  
ATOM 10565 O OG   . SER A 1 37  ? -3.584  -4.106  6.557   1.00 0.00 ? 37  SER A OG   7  
ATOM 10566 H H    . SER A 1 37  ? -4.777  -1.919  6.011   1.00 0.00 ? 37  SER A H    7  
ATOM 10567 H HA   . SER A 1 37  ? -5.623  -3.796  3.922   1.00 0.00 ? 37  SER A HA   7  
ATOM 10568 H HB2  . SER A 1 37  ? -4.137  -5.416  5.095   1.00 0.00 ? 37  SER A HB2  7  
ATOM 10569 H HB3  . SER A 1 37  ? -3.282  -3.975  4.543   1.00 0.00 ? 37  SER A HB3  7  
ATOM 10570 H HG   . SER A 1 37  ? -2.634  -3.972  6.559   1.00 0.00 ? 37  SER A HG   7  
ATOM 10571 N N    . VAL A 1 38  ? -7.238  -5.176  5.228   1.00 0.00 ? 38  VAL A N    7  
ATOM 10572 C CA   . VAL A 1 38  ? -8.318  -5.845  5.943   1.00 0.00 ? 38  VAL A CA   7  
ATOM 10573 C C    . VAL A 1 38  ? -8.410  -7.315  5.548   1.00 0.00 ? 38  VAL A C    7  
ATOM 10574 O O    . VAL A 1 38  ? -8.468  -7.647  4.365   1.00 0.00 ? 38  VAL A O    7  
ATOM 10575 C CB   . VAL A 1 38  ? -9.674  -5.167  5.674   1.00 0.00 ? 38  VAL A CB   7  
ATOM 10576 C CG1  . VAL A 1 38  ? -10.785 -5.872  6.437   1.00 0.00 ? 38  VAL A CG1  7  
ATOM 10577 C CG2  . VAL A 1 38  ? -9.615  -3.693  6.045   1.00 0.00 ? 38  VAL A CG2  7  
ATOM 10578 H H    . VAL A 1 38  ? -7.086  -5.389  4.284   1.00 0.00 ? 38  VAL A H    7  
ATOM 10579 H HA   . VAL A 1 38  ? -8.110  -5.779  7.001   1.00 0.00 ? 38  VAL A HA   7  
ATOM 10580 H HB   . VAL A 1 38  ? -9.889  -5.243  4.618   1.00 0.00 ? 38  VAL A HB   7  
ATOM 10581 H HG11 . VAL A 1 38  ? -10.365 -6.388  7.288   1.00 0.00 ? 38  VAL A HG11 7  
ATOM 10582 H HG12 . VAL A 1 38  ? -11.508 -5.145  6.776   1.00 0.00 ? 38  VAL A HG12 7  
ATOM 10583 H HG13 . VAL A 1 38  ? -11.270 -6.586  5.788   1.00 0.00 ? 38  VAL A HG13 7  
ATOM 10584 H HG21 . VAL A 1 38  ? -8.691  -3.268  5.681   1.00 0.00 ? 38  VAL A HG21 7  
ATOM 10585 H HG22 . VAL A 1 38  ? -10.450 -3.174  5.596   1.00 0.00 ? 38  VAL A HG22 7  
ATOM 10586 H HG23 . VAL A 1 38  ? -9.662  -3.589  7.118   1.00 0.00 ? 38  VAL A HG23 7  
ATOM 10587 N N    . GLU A 1 39  ? -8.424  -8.191  6.548   1.00 0.00 ? 39  GLU A N    7  
ATOM 10588 C CA   . GLU A 1 39  ? -8.509  -9.626  6.304   1.00 0.00 ? 39  GLU A CA   7  
ATOM 10589 C C    . GLU A 1 39  ? -9.946  -10.119 6.450   1.00 0.00 ? 39  GLU A C    7  
ATOM 10590 O O    . GLU A 1 39  ? -10.515 -10.087 7.541   1.00 0.00 ? 39  GLU A O    7  
ATOM 10591 C CB   . GLU A 1 39  ? -7.597  -10.385 7.271   1.00 0.00 ? 39  GLU A CB   7  
ATOM 10592 C CG   . GLU A 1 39  ? -7.053  -11.684 6.701   1.00 0.00 ? 39  GLU A CG   7  
ATOM 10593 C CD   . GLU A 1 39  ? -6.717  -12.698 7.778   1.00 0.00 ? 39  GLU A CD   7  
ATOM 10594 O OE1  . GLU A 1 39  ? -7.322  -12.629 8.868   1.00 0.00 ? 39  GLU A OE1  7  
ATOM 10595 O OE2  . GLU A 1 39  ? -5.848  -13.560 7.529   1.00 0.00 ? 39  GLU A OE2  7  
ATOM 10596 H H    . GLU A 1 39  ? -8.375  -7.865  7.471   1.00 0.00 ? 39  GLU A H    7  
ATOM 10597 H HA   . GLU A 1 39  ? -8.179  -9.811  5.293   1.00 0.00 ? 39  GLU A HA   7  
ATOM 10598 H HB2  . GLU A 1 39  ? -6.762  -9.752  7.531   1.00 0.00 ? 39  GLU A HB2  7  
ATOM 10599 H HB3  . GLU A 1 39  ? -8.155  -10.615 8.167   1.00 0.00 ? 39  GLU A HB3  7  
ATOM 10600 H HG2  . GLU A 1 39  ? -7.795  -12.113 6.044   1.00 0.00 ? 39  GLU A HG2  7  
ATOM 10601 H HG3  . GLU A 1 39  ? -6.157  -11.468 6.138   1.00 0.00 ? 39  GLU A HG3  7  
ATOM 10602 N N    . GLU A 1 40  ? -10.525 -10.573 5.343   1.00 0.00 ? 40  GLU A N    7  
ATOM 10603 C CA   . GLU A 1 40  ? -11.895 -11.070 5.348   1.00 0.00 ? 40  GLU A CA   7  
ATOM 10604 C C    . GLU A 1 40  ? -11.922 -12.592 5.240   1.00 0.00 ? 40  GLU A C    7  
ATOM 10605 O O    . GLU A 1 40  ? -11.816 -13.150 4.148   1.00 0.00 ? 40  GLU A O    7  
ATOM 10606 C CB   . GLU A 1 40  ? -12.689 -10.453 4.195   1.00 0.00 ? 40  GLU A CB   7  
ATOM 10607 C CG   . GLU A 1 40  ? -13.053 -8.995  4.418   1.00 0.00 ? 40  GLU A CG   7  
ATOM 10608 C CD   . GLU A 1 40  ? -13.751 -8.764  5.744   1.00 0.00 ? 40  GLU A CD   7  
ATOM 10609 O OE1  . GLU A 1 40  ? -14.595 -9.602  6.123   1.00 0.00 ? 40  GLU A OE1  7  
ATOM 10610 O OE2  . GLU A 1 40  ? -13.453 -7.746  6.403   1.00 0.00 ? 40  GLU A OE2  7  
ATOM 10611 H H    . GLU A 1 40  ? -10.019 -10.572 4.504   1.00 0.00 ? 40  GLU A H    7  
ATOM 10612 H HA   . GLU A 1 40  ? -12.351 -10.780 6.282   1.00 0.00 ? 40  GLU A HA   7  
ATOM 10613 H HB2  . GLU A 1 40  ? -12.102 -10.522 3.291   1.00 0.00 ? 40  GLU A HB2  7  
ATOM 10614 H HB3  . GLU A 1 40  ? -13.603 -11.013 4.063   1.00 0.00 ? 40  GLU A HB3  7  
ATOM 10615 H HG2  . GLU A 1 40  ? -12.149 -8.404  4.397   1.00 0.00 ? 40  GLU A HG2  7  
ATOM 10616 H HG3  . GLU A 1 40  ? -13.709 -8.674  3.622   1.00 0.00 ? 40  GLU A HG3  7  
ATOM 10617 N N    . ASP A 1 41  ? -12.063 -13.257 6.382   1.00 0.00 ? 41  ASP A N    7  
ATOM 10618 C CA   . ASP A 1 41  ? -12.104 -14.715 6.417   1.00 0.00 ? 41  ASP A CA   7  
ATOM 10619 C C    . ASP A 1 41  ? -10.816 -15.308 5.857   1.00 0.00 ? 41  ASP A C    7  
ATOM 10620 O O    . ASP A 1 41  ? -10.837 -16.334 5.178   1.00 0.00 ? 41  ASP A O    7  
ATOM 10621 C CB   . ASP A 1 41  ? -13.306 -15.232 5.625   1.00 0.00 ? 41  ASP A CB   7  
ATOM 10622 C CG   . ASP A 1 41  ? -14.627 -14.879 6.279   1.00 0.00 ? 41  ASP A CG   7  
ATOM 10623 O OD1  . ASP A 1 41  ? -15.000 -13.687 6.259   1.00 0.00 ? 41  ASP A OD1  7  
ATOM 10624 O OD2  . ASP A 1 41  ? -15.288 -15.795 6.811   1.00 0.00 ? 41  ASP A OD2  7  
ATOM 10625 H H    . ASP A 1 41  ? -12.143 -12.756 7.220   1.00 0.00 ? 41  ASP A H    7  
ATOM 10626 H HA   . ASP A 1 41  ? -12.207 -15.018 7.448   1.00 0.00 ? 41  ASP A HA   7  
ATOM 10627 H HB2  . ASP A 1 41  ? -13.289 -14.799 4.635   1.00 0.00 ? 41  ASP A HB2  7  
ATOM 10628 H HB3  . ASP A 1 41  ? -13.240 -16.307 5.544   1.00 0.00 ? 41  ASP A HB3  7  
ATOM 10629 N N    . GLY A 1 42  ? -9.694  -14.655 6.146   1.00 0.00 ? 42  GLY A N    7  
ATOM 10630 C CA   . GLY A 1 42  ? -8.412  -15.132 5.663   1.00 0.00 ? 42  GLY A CA   7  
ATOM 10631 C C    . GLY A 1 42  ? -7.966  -14.419 4.402   1.00 0.00 ? 42  GLY A C    7  
ATOM 10632 O O    . GLY A 1 42  ? -6.768  -14.281 4.150   1.00 0.00 ? 42  GLY A O    7  
ATOM 10633 H H    . GLY A 1 42  ? -9.738  -13.842 6.692   1.00 0.00 ? 42  GLY A H    7  
ATOM 10634 H HA2  . GLY A 1 42  ? -7.670  -14.980 6.432   1.00 0.00 ? 42  GLY A HA2  7  
ATOM 10635 H HA3  . GLY A 1 42  ? -8.489  -16.190 5.456   1.00 0.00 ? 42  GLY A HA3  7  
ATOM 10636 N N    . ILE A 1 43  ? -8.930  -13.966 3.607   1.00 0.00 ? 43  ILE A N    7  
ATOM 10637 C CA   . ILE A 1 43  ? -8.629  -13.264 2.366   1.00 0.00 ? 43  ILE A CA   7  
ATOM 10638 C C    . ILE A 1 43  ? -8.263  -11.808 2.633   1.00 0.00 ? 43  ILE A C    7  
ATOM 10639 O O    . ILE A 1 43  ? -9.133  -10.976 2.891   1.00 0.00 ? 43  ILE A O    7  
ATOM 10640 C CB   . ILE A 1 43  ? -9.819  -13.312 1.390   1.00 0.00 ? 43  ILE A CB   7  
ATOM 10641 C CG1  . ILE A 1 43  ? -10.155 -14.761 1.031   1.00 0.00 ? 43  ILE A CG1  7  
ATOM 10642 C CG2  . ILE A 1 43  ? -9.508  -12.509 0.135   1.00 0.00 ? 43  ILE A CG2  7  
ATOM 10643 C CD1  . ILE A 1 43  ? -11.451 -14.910 0.266   1.00 0.00 ? 43  ILE A CD1  7  
ATOM 10644 H H    . ILE A 1 43  ? -9.865  -14.107 3.863   1.00 0.00 ? 43  ILE A H    7  
ATOM 10645 H HA   . ILE A 1 43  ? -7.787  -13.756 1.900   1.00 0.00 ? 43  ILE A HA   7  
ATOM 10646 H HB   . ILE A 1 43  ? -10.672 -12.862 1.874   1.00 0.00 ? 43  ILE A HB   7  
ATOM 10647 H HG12 . ILE A 1 43  ? -9.363  -15.168 0.422   1.00 0.00 ? 43  ILE A HG12 7  
ATOM 10648 H HG13 . ILE A 1 43  ? -10.237 -15.339 1.941   1.00 0.00 ? 43  ILE A HG13 7  
ATOM 10649 H HG21 . ILE A 1 43  ? -9.960  -12.989 -0.720  1.00 0.00 ? 43  ILE A HG21 7  
ATOM 10650 H HG22 . ILE A 1 43  ? -9.906  -11.511 0.240   1.00 0.00 ? 43  ILE A HG22 7  
ATOM 10651 H HG23 . ILE A 1 43  ? -8.439  -12.458 -0.004  1.00 0.00 ? 43  ILE A HG23 7  
ATOM 10652 H HD11 . ILE A 1 43  ? -11.789 -15.934 0.326   1.00 0.00 ? 43  ILE A HD11 7  
ATOM 10653 H HD12 . ILE A 1 43  ? -12.198 -14.258 0.692   1.00 0.00 ? 43  ILE A HD12 7  
ATOM 10654 H HD13 . ILE A 1 43  ? -11.290 -14.645 -0.769  1.00 0.00 ? 43  ILE A HD13 7  
ATOM 10655 N N    . ARG A 1 44  ? -6.971  -11.507 2.566   1.00 0.00 ? 44  ARG A N    7  
ATOM 10656 C CA   . ARG A 1 44  ? -6.489  -10.150 2.800   1.00 0.00 ? 44  ARG A CA   7  
ATOM 10657 C C    . ARG A 1 44  ? -6.903  -9.223  1.661   1.00 0.00 ? 44  ARG A C    7  
ATOM 10658 O O    . ARG A 1 44  ? -7.003  -9.645  0.509   1.00 0.00 ? 44  ARG A O    7  
ATOM 10659 C CB   . ARG A 1 44  ? -4.967  -10.145 2.948   1.00 0.00 ? 44  ARG A CB   7  
ATOM 10660 C CG   . ARG A 1 44  ? -4.447  -9.040  3.853   1.00 0.00 ? 44  ARG A CG   7  
ATOM 10661 C CD   . ARG A 1 44  ? -3.054  -8.591  3.440   1.00 0.00 ? 44  ARG A CD   7  
ATOM 10662 N NE   . ARG A 1 44  ? -2.331  -7.964  4.543   1.00 0.00 ? 44  ARG A NE   7  
ATOM 10663 C CZ   . ARG A 1 44  ? -1.760  -8.646  5.530   1.00 0.00 ? 44  ARG A CZ   7  
ATOM 10664 N NH1  . ARG A 1 44  ? -1.827  -9.970  5.550   1.00 0.00 ? 44  ARG A NH1  7  
ATOM 10665 N NH2  . ARG A 1 44  ? -1.120  -8.003  6.498   1.00 0.00 ? 44  ARG A NH2  7  
ATOM 10666 H H    . ARG A 1 44  ? -6.325  -12.213 2.356   1.00 0.00 ? 44  ARG A H    7  
ATOM 10667 H HA   . ARG A 1 44  ? -6.933  -9.794  3.718   1.00 0.00 ? 44  ARG A HA   7  
ATOM 10668 H HB2  . ARG A 1 44  ? -4.653  -11.094 3.360   1.00 0.00 ? 44  ARG A HB2  7  
ATOM 10669 H HB3  . ARG A 1 44  ? -4.523  -10.021 1.972   1.00 0.00 ? 44  ARG A HB3  7  
ATOM 10670 H HG2  . ARG A 1 44  ? -5.117  -8.195  3.795   1.00 0.00 ? 44  ARG A HG2  7  
ATOM 10671 H HG3  . ARG A 1 44  ? -4.412  -9.405  4.868   1.00 0.00 ? 44  ARG A HG3  7  
ATOM 10672 H HD2  . ARG A 1 44  ? -2.498  -9.453  3.102   1.00 0.00 ? 44  ARG A HD2  7  
ATOM 10673 H HD3  . ARG A 1 44  ? -3.144  -7.882  2.631   1.00 0.00 ? 44  ARG A HD3  7  
ATOM 10674 H HE   . ARG A 1 44  ? -2.270  -6.986  4.548   1.00 0.00 ? 44  ARG A HE   7  
ATOM 10675 H HH11 . ARG A 1 44  ? -2.307  -10.457 4.821   1.00 0.00 ? 44  ARG A HH11 7  
ATOM 10676 H HH12 . ARG A 1 44  ? -1.395  -10.481 6.294   1.00 0.00 ? 44  ARG A HH12 7  
ATOM 10677 H HH21 . ARG A 1 44  ? -1.068  -7.005  6.486   1.00 0.00 ? 44  ARG A HH21 7  
ATOM 10678 H HH22 . ARG A 1 44  ? -0.691  -8.517  7.240   1.00 0.00 ? 44  ARG A HH22 7  
ATOM 10679 N N    . ARG A 1 45  ? -7.143  -7.958  1.992   1.00 0.00 ? 45  ARG A N    7  
ATOM 10680 C CA   . ARG A 1 45  ? -7.548  -6.972  0.998   1.00 0.00 ? 45  ARG A CA   7  
ATOM 10681 C C    . ARG A 1 45  ? -7.008  -5.589  1.353   1.00 0.00 ? 45  ARG A C    7  
ATOM 10682 O O    . ARG A 1 45  ? -6.679  -5.317  2.508   1.00 0.00 ? 45  ARG A O    7  
ATOM 10683 C CB   . ARG A 1 45  ? -9.073  -6.922  0.889   1.00 0.00 ? 45  ARG A CB   7  
ATOM 10684 C CG   . ARG A 1 45  ? -9.675  -8.143  0.212   1.00 0.00 ? 45  ARG A CG   7  
ATOM 10685 C CD   . ARG A 1 45  ? -9.446  -8.116  -1.291  1.00 0.00 ? 45  ARG A CD   7  
ATOM 10686 N NE   . ARG A 1 45  ? -9.571  -9.444  -1.887  1.00 0.00 ? 45  ARG A NE   7  
ATOM 10687 C CZ   . ARG A 1 45  ? -9.838  -9.650  -3.172  1.00 0.00 ? 45  ARG A CZ   7  
ATOM 10688 N NH1  . ARG A 1 45  ? -10.008 -8.621  -3.991  1.00 0.00 ? 45  ARG A NH1  7  
ATOM 10689 N NH2  . ARG A 1 45  ? -9.936  -10.888 -3.640  1.00 0.00 ? 45  ARG A NH2  7  
ATOM 10690 H H    . ARG A 1 45  ? -7.046  -7.682  2.928   1.00 0.00 ? 45  ARG A H    7  
ATOM 10691 H HA   . ARG A 1 45  ? -7.137  -7.272  0.046   1.00 0.00 ? 45  ARG A HA   7  
ATOM 10692 H HB2  . ARG A 1 45  ? -9.491  -6.846  1.882   1.00 0.00 ? 45  ARG A HB2  7  
ATOM 10693 H HB3  . ARG A 1 45  ? -9.353  -6.048  0.321   1.00 0.00 ? 45  ARG A HB3  7  
ATOM 10694 H HG2  . ARG A 1 45  ? -9.216  -9.032  0.619   1.00 0.00 ? 45  ARG A HG2  7  
ATOM 10695 H HG3  . ARG A 1 45  ? -10.737 -8.163  0.406   1.00 0.00 ? 45  ARG A HG3  7  
ATOM 10696 H HD2  . ARG A 1 45  ? -10.176 -7.460  -1.741  1.00 0.00 ? 45  ARG A HD2  7  
ATOM 10697 H HD3  . ARG A 1 45  ? -8.454  -7.736  -1.484  1.00 0.00 ? 45  ARG A HD3  7  
ATOM 10698 H HE   . ARG A 1 45  ? -9.449  -10.218 -1.300  1.00 0.00 ? 45  ARG A HE   7  
ATOM 10699 H HH11 . ARG A 1 45  ? -9.934  -7.687  -3.641  1.00 0.00 ? 45  ARG A HH11 7  
ATOM 10700 H HH12 . ARG A 1 45  ? -10.208 -8.779  -4.958  1.00 0.00 ? 45  ARG A HH12 7  
ATOM 10701 H HH21 . ARG A 1 45  ? -9.808  -11.666 -3.026  1.00 0.00 ? 45  ARG A HH21 7  
ATOM 10702 H HH22 . ARG A 1 45  ? -10.137 -11.042 -4.607  1.00 0.00 ? 45  ARG A HH22 7  
ATOM 10703 N N    . LEU A 1 46  ? -6.918  -4.721  0.352   1.00 0.00 ? 46  LEU A N    7  
ATOM 10704 C CA   . LEU A 1 46  ? -6.417  -3.366  0.557   1.00 0.00 ? 46  LEU A CA   7  
ATOM 10705 C C    . LEU A 1 46  ? -7.449  -2.332  0.120   1.00 0.00 ? 46  LEU A C    7  
ATOM 10706 O O    . LEU A 1 46  ? -8.247  -2.579  -0.785  1.00 0.00 ? 46  LEU A O    7  
ATOM 10707 C CB   . LEU A 1 46  ? -5.113  -3.160  -0.217  1.00 0.00 ? 46  LEU A CB   7  
ATOM 10708 C CG   . LEU A 1 46  ? -3.849  -3.716  0.439   1.00 0.00 ? 46  LEU A CG   7  
ATOM 10709 C CD1  . LEU A 1 46  ? -3.473  -2.890  1.660   1.00 0.00 ? 46  LEU A CD1  7  
ATOM 10710 C CD2  . LEU A 1 46  ? -4.043  -5.176  0.820   1.00 0.00 ? 46  LEU A CD2  7  
ATOM 10711 H H    . LEU A 1 46  ? -7.195  -4.995  -0.547  1.00 0.00 ? 46  LEU A H    7  
ATOM 10712 H HA   . LEU A 1 46  ? -6.224  -3.241  1.612   1.00 0.00 ? 46  LEU A HA   7  
ATOM 10713 H HB2  . LEU A 1 46  ? -5.222  -3.635  -1.180  1.00 0.00 ? 46  LEU A HB2  7  
ATOM 10714 H HB3  . LEU A 1 46  ? -4.976  -2.097  -0.355  1.00 0.00 ? 46  LEU A HB3  7  
ATOM 10715 H HG   . LEU A 1 46  ? -3.031  -3.660  -0.266  1.00 0.00 ? 46  LEU A HG   7  
ATOM 10716 H HD11 . LEU A 1 46  ? -4.346  -2.369  2.024   1.00 0.00 ? 46  LEU A HD11 7  
ATOM 10717 H HD12 . LEU A 1 46  ? -2.713  -2.173  1.389   1.00 0.00 ? 46  LEU A HD12 7  
ATOM 10718 H HD13 . LEU A 1 46  ? -3.094  -3.542  2.433   1.00 0.00 ? 46  LEU A HD13 7  
ATOM 10719 H HD21 . LEU A 1 46  ? -3.098  -5.695  0.752   1.00 0.00 ? 46  LEU A HD21 7  
ATOM 10720 H HD22 . LEU A 1 46  ? -4.753  -5.633  0.146   1.00 0.00 ? 46  LEU A HD22 7  
ATOM 10721 H HD23 . LEU A 1 46  ? -4.416  -5.238  1.832   1.00 0.00 ? 46  LEU A HD23 7  
ATOM 10722 N N    . TYR A 1 47  ? -7.427  -1.172  0.767   1.00 0.00 ? 47  TYR A N    7  
ATOM 10723 C CA   . TYR A 1 47  ? -8.361  -0.099  0.446   1.00 0.00 ? 47  TYR A CA   7  
ATOM 10724 C C    . TYR A 1 47  ? -7.744  1.265   0.736   1.00 0.00 ? 47  TYR A C    7  
ATOM 10725 O O    . TYR A 1 47  ? -7.180  1.491   1.806   1.00 0.00 ? 47  TYR A O    7  
ATOM 10726 C CB   . TYR A 1 47  ? -9.656  -0.266  1.244   1.00 0.00 ? 47  TYR A CB   7  
ATOM 10727 C CG   . TYR A 1 47  ? -10.264 -1.645  1.130   1.00 0.00 ? 47  TYR A CG   7  
ATOM 10728 C CD1  . TYR A 1 47  ? -11.088 -1.977  0.061   1.00 0.00 ? 47  TYR A CD1  7  
ATOM 10729 C CD2  . TYR A 1 47  ? -10.015 -2.618  2.091   1.00 0.00 ? 47  TYR A CD2  7  
ATOM 10730 C CE1  . TYR A 1 47  ? -11.647 -3.235  -0.047  1.00 0.00 ? 47  TYR A CE1  7  
ATOM 10731 C CE2  . TYR A 1 47  ? -10.568 -3.880  1.991   1.00 0.00 ? 47  TYR A CE2  7  
ATOM 10732 C CZ   . TYR A 1 47  ? -11.384 -4.183  0.920   1.00 0.00 ? 47  TYR A CZ   7  
ATOM 10733 O OH   . TYR A 1 47  ? -11.937 -5.439  0.816   1.00 0.00 ? 47  TYR A OH   7  
ATOM 10734 H H    . TYR A 1 47  ? -6.768  -1.034  1.479   1.00 0.00 ? 47  TYR A H    7  
ATOM 10735 H HA   . TYR A 1 47  ? -8.590  -0.163  -0.608  1.00 0.00 ? 47  TYR A HA   7  
ATOM 10736 H HB2  . TYR A 1 47  ? -9.454  -0.079  2.288   1.00 0.00 ? 47  TYR A HB2  7  
ATOM 10737 H HB3  . TYR A 1 47  ? -10.384 0.449   0.890   1.00 0.00 ? 47  TYR A HB3  7  
ATOM 10738 H HD1  . TYR A 1 47  ? -11.291 -1.232  -0.695  1.00 0.00 ? 47  TYR A HD1  7  
ATOM 10739 H HD2  . TYR A 1 47  ? -9.376  -2.377  2.928   1.00 0.00 ? 47  TYR A HD2  7  
ATOM 10740 H HE1  . TYR A 1 47  ? -12.285 -3.474  -0.885  1.00 0.00 ? 47  TYR A HE1  7  
ATOM 10741 H HE2  . TYR A 1 47  ? -10.363 -4.622  2.747   1.00 0.00 ? 47  TYR A HE2  7  
ATOM 10742 H HH   . TYR A 1 47  ? -12.144 -5.771  1.692   1.00 0.00 ? 47  TYR A HH   7  
ATOM 10743 N N    . VAL A 1 48  ? -7.856  2.174   -0.228  1.00 0.00 ? 48  VAL A N    7  
ATOM 10744 C CA   . VAL A 1 48  ? -7.312  3.519   -0.078  1.00 0.00 ? 48  VAL A CA   7  
ATOM 10745 C C    . VAL A 1 48  ? -7.972  4.253   1.084   1.00 0.00 ? 48  VAL A C    7  
ATOM 10746 O O    . VAL A 1 48  ? -9.143  4.623   1.012   1.00 0.00 ? 48  VAL A O    7  
ATOM 10747 C CB   . VAL A 1 48  ? -7.496  4.345   -1.364  1.00 0.00 ? 48  VAL A CB   7  
ATOM 10748 C CG1  . VAL A 1 48  ? -6.860  5.719   -1.212  1.00 0.00 ? 48  VAL A CG1  7  
ATOM 10749 C CG2  . VAL A 1 48  ? -6.911  3.608   -2.560  1.00 0.00 ? 48  VAL A CG2  7  
ATOM 10750 H H    . VAL A 1 48  ? -8.317  1.935   -1.059  1.00 0.00 ? 48  VAL A H    7  
ATOM 10751 H HA   . VAL A 1 48  ? -6.253  3.430   0.120   1.00 0.00 ? 48  VAL A HA   7  
ATOM 10752 H HB   . VAL A 1 48  ? -8.554  4.480   -1.534  1.00 0.00 ? 48  VAL A HB   7  
ATOM 10753 H HG11 . VAL A 1 48  ? -7.248  6.198   -0.325  1.00 0.00 ? 48  VAL A HG11 7  
ATOM 10754 H HG12 . VAL A 1 48  ? -5.789  5.613   -1.126  1.00 0.00 ? 48  VAL A HG12 7  
ATOM 10755 H HG13 . VAL A 1 48  ? -7.094  6.322   -2.077  1.00 0.00 ? 48  VAL A HG13 7  
ATOM 10756 H HG21 . VAL A 1 48  ? -5.862  3.419   -2.386  1.00 0.00 ? 48  VAL A HG21 7  
ATOM 10757 H HG22 . VAL A 1 48  ? -7.429  2.669   -2.693  1.00 0.00 ? 48  VAL A HG22 7  
ATOM 10758 H HG23 . VAL A 1 48  ? -7.027  4.211   -3.447  1.00 0.00 ? 48  VAL A HG23 7  
ATOM 10759 N N    . ASN A 1 49  ? -7.212  4.459   2.154   1.00 0.00 ? 49  ASN A N    7  
ATOM 10760 C CA   . ASN A 1 49  ? -7.723  5.150   3.333   1.00 0.00 ? 49  ASN A CA   7  
ATOM 10761 C C    . ASN A 1 49  ? -7.756  6.658   3.108   1.00 0.00 ? 49  ASN A C    7  
ATOM 10762 O O    . ASN A 1 49  ? -8.753  7.318   3.400   1.00 0.00 ? 49  ASN A O    7  
ATOM 10763 C CB   . ASN A 1 49  ? -6.862  4.823   4.555   1.00 0.00 ? 49  ASN A CB   7  
ATOM 10764 C CG   . ASN A 1 49  ? -6.924  5.908   5.612   1.00 0.00 ? 49  ASN A CG   7  
ATOM 10765 O OD1  . ASN A 1 49  ? -8.003  6.383   5.968   1.00 0.00 ? 49  ASN A OD1  7  
ATOM 10766 N ND2  . ASN A 1 49  ? -5.763  6.306   6.120   1.00 0.00 ? 49  ASN A ND2  7  
ATOM 10767 H H    . ASN A 1 49  ? -6.285  4.140   2.152   1.00 0.00 ? 49  ASN A H    7  
ATOM 10768 H HA   . ASN A 1 49  ? -8.730  4.802   3.510   1.00 0.00 ? 49  ASN A HA   7  
ATOM 10769 H HB2  . ASN A 1 49  ? -7.208  3.899   4.994   1.00 0.00 ? 49  ASN A HB2  7  
ATOM 10770 H HB3  . ASN A 1 49  ? -5.835  4.707   4.243   1.00 0.00 ? 49  ASN A HB3  7  
ATOM 10771 H HD21 . ASN A 1 49  ? -4.943  5.883   5.789   1.00 0.00 ? 49  ASN A HD21 7  
ATOM 10772 H HD22 . ASN A 1 49  ? -5.774  7.005   6.806   1.00 0.00 ? 49  ASN A HD22 7  
ATOM 10773 N N    . SER A 1 50  ? -6.658  7.197   2.587   1.00 0.00 ? 50  SER A N    7  
ATOM 10774 C CA   . SER A 1 50  ? -6.559  8.629   2.326   1.00 0.00 ? 50  SER A CA   7  
ATOM 10775 C C    . SER A 1 50  ? -5.851  8.891   1.001   1.00 0.00 ? 50  SER A C    7  
ATOM 10776 O O    . SER A 1 50  ? -5.079  8.061   0.521   1.00 0.00 ? 50  SER A O    7  
ATOM 10777 C CB   . SER A 1 50  ? -5.811  9.326   3.464   1.00 0.00 ? 50  SER A CB   7  
ATOM 10778 O OG   . SER A 1 50  ? -6.143  10.702  3.525   1.00 0.00 ? 50  SER A OG   7  
ATOM 10779 H H    . SER A 1 50  ? -5.896  6.619   2.376   1.00 0.00 ? 50  SER A H    7  
ATOM 10780 H HA   . SER A 1 50  ? -7.562  9.025   2.270   1.00 0.00 ? 50  SER A HA   7  
ATOM 10781 H HB2  . SER A 1 50  ? -6.075  8.862   4.403   1.00 0.00 ? 50  SER A HB2  7  
ATOM 10782 H HB3  . SER A 1 50  ? -4.747  9.231   3.303   1.00 0.00 ? 50  SER A HB3  7  
ATOM 10783 H HG   . SER A 1 50  ? -6.908  10.822  4.093   1.00 0.00 ? 50  SER A HG   7  
ATOM 10784 N N    . VAL A 1 51  ? -6.119  10.054  0.414   1.00 0.00 ? 51  VAL A N    7  
ATOM 10785 C CA   . VAL A 1 51  ? -5.508  10.428  -0.856  1.00 0.00 ? 51  VAL A CA   7  
ATOM 10786 C C    . VAL A 1 51  ? -4.943  11.843  -0.797  1.00 0.00 ? 51  VAL A C    7  
ATOM 10787 O O    . VAL A 1 51  ? -5.551  12.743  -0.219  1.00 0.00 ? 51  VAL A O    7  
ATOM 10788 C CB   . VAL A 1 51  ? -6.519  10.338  -2.014  1.00 0.00 ? 51  VAL A CB   7  
ATOM 10789 C CG1  . VAL A 1 51  ? -5.862  10.730  -3.328  1.00 0.00 ? 51  VAL A CG1  7  
ATOM 10790 C CG2  . VAL A 1 51  ? -7.109  8.938   -2.099  1.00 0.00 ? 51  VAL A CG2  7  
ATOM 10791 H H    . VAL A 1 51  ? -6.743  10.674  0.845   1.00 0.00 ? 51  VAL A H    7  
ATOM 10792 H HA   . VAL A 1 51  ? -4.702  9.737   -1.055  1.00 0.00 ? 51  VAL A HA   7  
ATOM 10793 H HB   . VAL A 1 51  ? -7.323  11.033  -1.818  1.00 0.00 ? 51  VAL A HB   7  
ATOM 10794 H HG11 . VAL A 1 51  ? -6.447  11.502  -3.807  1.00 0.00 ? 51  VAL A HG11 7  
ATOM 10795 H HG12 . VAL A 1 51  ? -4.865  11.099  -3.137  1.00 0.00 ? 51  VAL A HG12 7  
ATOM 10796 H HG13 . VAL A 1 51  ? -5.809  9.867   -3.975  1.00 0.00 ? 51  VAL A HG13 7  
ATOM 10797 H HG21 . VAL A 1 51  ? -8.011  8.892   -1.508  1.00 0.00 ? 51  VAL A HG21 7  
ATOM 10798 H HG22 . VAL A 1 51  ? -7.340  8.707   -3.129  1.00 0.00 ? 51  VAL A HG22 7  
ATOM 10799 H HG23 . VAL A 1 51  ? -6.393  8.223   -1.722  1.00 0.00 ? 51  VAL A HG23 7  
ATOM 10800 N N    . LYS A 1 52  ? -3.774  12.032  -1.401  1.00 0.00 ? 52  LYS A N    7  
ATOM 10801 C CA   . LYS A 1 52  ? -3.126  13.338  -1.420  1.00 0.00 ? 52  LYS A CA   7  
ATOM 10802 C C    . LYS A 1 52  ? -4.008  14.373  -2.111  1.00 0.00 ? 52  LYS A C    7  
ATOM 10803 O O    . LYS A 1 52  ? -4.501  14.144  -3.215  1.00 0.00 ? 52  LYS A O    7  
ATOM 10804 C CB   . LYS A 1 52  ? -1.774  13.248  -2.132  1.00 0.00 ? 52  LYS A CB   7  
ATOM 10805 C CG   . LYS A 1 52  ? -1.029  14.571  -2.192  1.00 0.00 ? 52  LYS A CG   7  
ATOM 10806 C CD   . LYS A 1 52  ? 0.476   14.363  -2.208  1.00 0.00 ? 52  LYS A CD   7  
ATOM 10807 C CE   . LYS A 1 52  ? 0.959   13.898  -3.574  1.00 0.00 ? 52  LYS A CE   7  
ATOM 10808 N NZ   . LYS A 1 52  ? 0.833   14.968  -4.601  1.00 0.00 ? 52  LYS A NZ   7  
ATOM 10809 H H    . LYS A 1 52  ? -3.338  11.275  -1.845  1.00 0.00 ? 52  LYS A H    7  
ATOM 10810 H HA   . LYS A 1 52  ? -2.965  13.644  -0.398  1.00 0.00 ? 52  LYS A HA   7  
ATOM 10811 H HB2  . LYS A 1 52  ? -1.154  12.533  -1.612  1.00 0.00 ? 52  LYS A HB2  7  
ATOM 10812 H HB3  . LYS A 1 52  ? -1.935  12.904  -3.143  1.00 0.00 ? 52  LYS A HB3  7  
ATOM 10813 H HG2  . LYS A 1 52  ? -1.319  15.096  -3.089  1.00 0.00 ? 52  LYS A HG2  7  
ATOM 10814 H HG3  . LYS A 1 52  ? -1.292  15.161  -1.326  1.00 0.00 ? 52  LYS A HG3  7  
ATOM 10815 H HD2  . LYS A 1 52  ? 0.963   15.296  -1.966  1.00 0.00 ? 52  LYS A HD2  7  
ATOM 10816 H HD3  . LYS A 1 52  ? 0.736   13.617  -1.471  1.00 0.00 ? 52  LYS A HD3  7  
ATOM 10817 H HE2  . LYS A 1 52  ? 1.996   13.607  -3.494  1.00 0.00 ? 52  LYS A HE2  7  
ATOM 10818 H HE3  . LYS A 1 52  ? 0.369   13.046  -3.879  1.00 0.00 ? 52  LYS A HE3  7  
ATOM 10819 H HZ1  . LYS A 1 52  ? 1.770   15.366  -4.819  1.00 0.00 ? 52  LYS A HZ1  7  
ATOM 10820 H HZ2  . LYS A 1 52  ? 0.219   15.730  -4.250  1.00 0.00 ? 52  LYS A HZ2  7  
ATOM 10821 H HZ3  . LYS A 1 52  ? 0.422   14.580  -5.473  1.00 0.00 ? 52  LYS A HZ3  7  
ATOM 10822 N N    . GLU A 1 53  ? -4.200  15.513  -1.454  1.00 0.00 ? 53  GLU A N    7  
ATOM 10823 C CA   . GLU A 1 53  ? -5.022  16.583  -2.007  1.00 0.00 ? 53  GLU A CA   7  
ATOM 10824 C C    . GLU A 1 53  ? -4.305  17.280  -3.159  1.00 0.00 ? 53  GLU A C    7  
ATOM 10825 O O    . GLU A 1 53  ? -3.137  17.653  -3.045  1.00 0.00 ? 53  GLU A O    7  
ATOM 10826 C CB   . GLU A 1 53  ? -5.372  17.601  -0.919  1.00 0.00 ? 53  GLU A CB   7  
ATOM 10827 C CG   . GLU A 1 53  ? -6.660  17.283  -0.179  1.00 0.00 ? 53  GLU A CG   7  
ATOM 10828 C CD   . GLU A 1 53  ? -6.701  15.857  0.335   1.00 0.00 ? 53  GLU A CD   7  
ATOM 10829 O OE1  . GLU A 1 53  ? -6.638  14.925  -0.494  1.00 0.00 ? 53  GLU A OE1  7  
ATOM 10830 O OE2  . GLU A 1 53  ? -6.795  15.674  1.567   1.00 0.00 ? 53  GLU A OE2  7  
ATOM 10831 H H    . GLU A 1 53  ? -3.780  15.637  -0.577  1.00 0.00 ? 53  GLU A H    7  
ATOM 10832 H HA   . GLU A 1 53  ? -5.934  16.142  -2.380  1.00 0.00 ? 53  GLU A HA   7  
ATOM 10833 H HB2  . GLU A 1 53  ? -4.566  17.633  -0.200  1.00 0.00 ? 53  GLU A HB2  7  
ATOM 10834 H HB3  . GLU A 1 53  ? -5.474  18.575  -1.375  1.00 0.00 ? 53  GLU A HB3  7  
ATOM 10835 H HG2  . GLU A 1 53  ? -6.753  17.955  0.661   1.00 0.00 ? 53  GLU A HG2  7  
ATOM 10836 H HG3  . GLU A 1 53  ? -7.492  17.432  -0.851  1.00 0.00 ? 53  GLU A HG3  7  
ATOM 10837 N N    . THR A 1 54  ? -5.014  17.452  -4.271  1.00 0.00 ? 54  THR A N    7  
ATOM 10838 C CA   . THR A 1 54  ? -4.446  18.102  -5.446  1.00 0.00 ? 54  THR A CA   7  
ATOM 10839 C C    . THR A 1 54  ? -3.087  17.509  -5.799  1.00 0.00 ? 54  THR A C    7  
ATOM 10840 O O    . THR A 1 54  ? -2.209  18.205  -6.308  1.00 0.00 ? 54  THR A O    7  
ATOM 10841 C CB   . THR A 1 54  ? -4.291  19.619  -5.229  1.00 0.00 ? 54  THR A CB   7  
ATOM 10842 O OG1  . THR A 1 54  ? -3.366  19.870  -4.165  1.00 0.00 ? 54  THR A OG1  7  
ATOM 10843 C CG2  . THR A 1 54  ? -5.633  20.259  -4.903  1.00 0.00 ? 54  THR A CG2  7  
ATOM 10844 H H    . THR A 1 54  ? -5.940  17.134  -4.301  1.00 0.00 ? 54  THR A H    7  
ATOM 10845 H HA   . THR A 1 54  ? -5.123  17.945  -6.273  1.00 0.00 ? 54  THR A HA   7  
ATOM 10846 H HB   . THR A 1 54  ? -3.910  20.061  -6.139  1.00 0.00 ? 54  THR A HB   7  
ATOM 10847 H HG1  . THR A 1 54  ? -2.564  20.257  -4.524  1.00 0.00 ? 54  THR A HG1  7  
ATOM 10848 H HG21 . THR A 1 54  ? -6.278  20.202  -5.767  1.00 0.00 ? 54  THR A HG21 7  
ATOM 10849 H HG22 . THR A 1 54  ? -5.482  21.293  -4.633  1.00 0.00 ? 54  THR A HG22 7  
ATOM 10850 H HG23 . THR A 1 54  ? -6.090  19.734  -4.078  1.00 0.00 ? 54  THR A HG23 7  
ATOM 10851 N N    . GLY A 1 55  ? -2.919  16.219  -5.526  1.00 0.00 ? 55  GLY A N    7  
ATOM 10852 C CA   . GLY A 1 55  ? -1.664  15.555  -5.822  1.00 0.00 ? 55  GLY A CA   7  
ATOM 10853 C C    . GLY A 1 55  ? -1.667  14.891  -7.185  1.00 0.00 ? 55  GLY A C    7  
ATOM 10854 O O    . GLY A 1 55  ? -2.239  15.418  -8.140  1.00 0.00 ? 55  GLY A O    7  
ATOM 10855 H H    . GLY A 1 55  ? -3.655  15.714  -5.119  1.00 0.00 ? 55  GLY A H    7  
ATOM 10856 H HA2  . GLY A 1 55  ? -0.867  16.283  -5.790  1.00 0.00 ? 55  GLY A HA2  7  
ATOM 10857 H HA3  . GLY A 1 55  ? -1.481  14.802  -5.069  1.00 0.00 ? 55  GLY A HA3  7  
ATOM 10858 N N    . LEU A 1 56  ? -1.025  13.731  -7.277  1.00 0.00 ? 56  LEU A N    7  
ATOM 10859 C CA   . LEU A 1 56  ? -0.954  12.994  -8.534  1.00 0.00 ? 56  LEU A CA   7  
ATOM 10860 C C    . LEU A 1 56  ? -2.051  11.937  -8.608  1.00 0.00 ? 56  LEU A C    7  
ATOM 10861 O O    . LEU A 1 56  ? -2.802  11.875  -9.581  1.00 0.00 ? 56  LEU A O    7  
ATOM 10862 C CB   . LEU A 1 56  ? 0.418   12.334  -8.685  1.00 0.00 ? 56  LEU A CB   7  
ATOM 10863 C CG   . LEU A 1 56  ? 1.614   13.283  -8.764  1.00 0.00 ? 56  LEU A CG   7  
ATOM 10864 C CD1  . LEU A 1 56  ? 2.912   12.497  -8.872  1.00 0.00 ? 56  LEU A CD1  7  
ATOM 10865 C CD2  . LEU A 1 56  ? 1.464   14.233  -9.943  1.00 0.00 ? 56  LEU A CD2  7  
ATOM 10866 H H    . LEU A 1 56  ? -0.588  13.361  -6.483  1.00 0.00 ? 56  LEU A H    7  
ATOM 10867 H HA   . LEU A 1 56  ? -1.095  13.699  -9.340  1.00 0.00 ? 56  LEU A HA   7  
ATOM 10868 H HB2  . LEU A 1 56  ? 0.566   11.685  -7.836  1.00 0.00 ? 56  LEU A HB2  7  
ATOM 10869 H HB3  . LEU A 1 56  ? 0.402   11.743  -9.590  1.00 0.00 ? 56  LEU A HB3  7  
ATOM 10870 H HG   . LEU A 1 56  ? 1.657   13.874  -7.860  1.00 0.00 ? 56  LEU A HG   7  
ATOM 10871 H HD11 . LEU A 1 56  ? 3.741   13.183  -8.960  1.00 0.00 ? 56  LEU A HD11 7  
ATOM 10872 H HD12 . LEU A 1 56  ? 2.876   11.861  -9.744  1.00 0.00 ? 56  LEU A HD12 7  
ATOM 10873 H HD13 . LEU A 1 56  ? 3.039   11.889  -7.988  1.00 0.00 ? 56  LEU A HD13 7  
ATOM 10874 H HD21 . LEU A 1 56  ? 2.428   14.385  -10.407 1.00 0.00 ? 56  LEU A HD21 7  
ATOM 10875 H HD22 . LEU A 1 56  ? 1.079   15.181  -9.595  1.00 0.00 ? 56  LEU A HD22 7  
ATOM 10876 H HD23 . LEU A 1 56  ? 0.780   13.808  -10.663 1.00 0.00 ? 56  LEU A HD23 7  
ATOM 10877 N N    . ALA A 1 57  ? -2.138  11.108  -7.573  1.00 0.00 ? 57  ALA A N    7  
ATOM 10878 C CA   . ALA A 1 57  ? -3.145  10.056  -7.519  1.00 0.00 ? 57  ALA A CA   7  
ATOM 10879 C C    . ALA A 1 57  ? -4.553  10.643  -7.533  1.00 0.00 ? 57  ALA A C    7  
ATOM 10880 O O    . ALA A 1 57  ? -5.481  10.042  -8.074  1.00 0.00 ? 57  ALA A O    7  
ATOM 10881 C CB   . ALA A 1 57  ? -2.943  9.195   -6.281  1.00 0.00 ? 57  ALA A CB   7  
ATOM 10882 H H    . ALA A 1 57  ? -1.510  11.208  -6.827  1.00 0.00 ? 57  ALA A H    7  
ATOM 10883 H HA   . ALA A 1 57  ? -3.019  9.428   -8.389  1.00 0.00 ? 57  ALA A HA   7  
ATOM 10884 H HB1  . ALA A 1 57  ? -2.418  8.291   -6.554  1.00 0.00 ? 57  ALA A HB1  7  
ATOM 10885 H HB2  . ALA A 1 57  ? -2.363  9.742   -5.553  1.00 0.00 ? 57  ALA A HB2  7  
ATOM 10886 H HB3  . ALA A 1 57  ? -3.904  8.940   -5.859  1.00 0.00 ? 57  ALA A HB3  7  
ATOM 10887 N N    . SER A 1 58  ? -4.704  11.820  -6.935  1.00 0.00 ? 58  SER A N    7  
ATOM 10888 C CA   . SER A 1 58  ? -6.000  12.486  -6.875  1.00 0.00 ? 58  SER A CA   7  
ATOM 10889 C C    . SER A 1 58  ? -6.439  12.947  -8.262  1.00 0.00 ? 58  SER A C    7  
ATOM 10890 O O    . SER A 1 58  ? -7.614  12.855  -8.617  1.00 0.00 ? 58  SER A O    7  
ATOM 10891 C CB   . SER A 1 58  ? -5.939  13.683  -5.924  1.00 0.00 ? 58  SER A CB   7  
ATOM 10892 O OG   . SER A 1 58  ? -4.778  14.461  -6.157  1.00 0.00 ? 58  SER A OG   7  
ATOM 10893 H H    . SER A 1 58  ? -3.926  12.250  -6.521  1.00 0.00 ? 58  SER A H    7  
ATOM 10894 H HA   . SER A 1 58  ? -6.721  11.775  -6.499  1.00 0.00 ? 58  SER A HA   7  
ATOM 10895 H HB2  . SER A 1 58  ? -6.809  14.303  -6.073  1.00 0.00 ? 58  SER A HB2  7  
ATOM 10896 H HB3  . SER A 1 58  ? -5.921  13.328  -4.903  1.00 0.00 ? 58  SER A HB3  7  
ATOM 10897 H HG   . SER A 1 58  ? -4.990  15.182  -6.755  1.00 0.00 ? 58  SER A HG   7  
ATOM 10898 N N    . LYS A 1 59  ? -5.485  13.443  -9.043  1.00 0.00 ? 59  LYS A N    7  
ATOM 10899 C CA   . LYS A 1 59  ? -5.770  13.917  -10.392 1.00 0.00 ? 59  LYS A CA   7  
ATOM 10900 C C    . LYS A 1 59  ? -5.779  12.759  -11.385 1.00 0.00 ? 59  LYS A C    7  
ATOM 10901 O O    . LYS A 1 59  ? -6.479  12.801  -12.397 1.00 0.00 ? 59  LYS A O    7  
ATOM 10902 C CB   . LYS A 1 59  ? -4.734  14.960  -10.817 1.00 0.00 ? 59  LYS A CB   7  
ATOM 10903 C CG   . LYS A 1 59  ? -3.330  14.399  -10.959 1.00 0.00 ? 59  LYS A CG   7  
ATOM 10904 C CD   . LYS A 1 59  ? -2.471  15.268  -11.863 1.00 0.00 ? 59  LYS A CD   7  
ATOM 10905 C CE   . LYS A 1 59  ? -2.016  16.533  -11.152 1.00 0.00 ? 59  LYS A CE   7  
ATOM 10906 N NZ   . LYS A 1 59  ? -0.897  17.202  -11.872 1.00 0.00 ? 59  LYS A NZ   7  
ATOM 10907 H H    . LYS A 1 59  ? -4.566  13.490  -8.703  1.00 0.00 ? 59  LYS A H    7  
ATOM 10908 H HA   . LYS A 1 59  ? -6.747  14.375  -10.383 1.00 0.00 ? 59  LYS A HA   7  
ATOM 10909 H HB2  . LYS A 1 59  ? -5.030  15.377  -11.768 1.00 0.00 ? 59  LYS A HB2  7  
ATOM 10910 H HB3  . LYS A 1 59  ? -4.711  15.749  -10.079 1.00 0.00 ? 59  LYS A HB3  7  
ATOM 10911 H HG2  . LYS A 1 59  ? -2.871  14.352  -9.982  1.00 0.00 ? 59  LYS A HG2  7  
ATOM 10912 H HG3  . LYS A 1 59  ? -3.389  13.406  -11.379 1.00 0.00 ? 59  LYS A HG3  7  
ATOM 10913 H HD2  . LYS A 1 59  ? -1.600  14.706  -12.166 1.00 0.00 ? 59  LYS A HD2  7  
ATOM 10914 H HD3  . LYS A 1 59  ? -3.047  15.542  -12.736 1.00 0.00 ? 59  LYS A HD3  7  
ATOM 10915 H HE2  . LYS A 1 59  ? -2.850  17.215  -11.089 1.00 0.00 ? 59  LYS A HE2  7  
ATOM 10916 H HE3  . LYS A 1 59  ? -1.688  16.273  -10.157 1.00 0.00 ? 59  LYS A HE3  7  
ATOM 10917 H HZ1  . LYS A 1 59  ? -1.265  17.969  -12.470 1.00 0.00 ? 59  LYS A HZ1  7  
ATOM 10918 H HZ2  . LYS A 1 59  ? -0.400  16.516  -12.476 1.00 0.00 ? 59  LYS A HZ2  7  
ATOM 10919 H HZ3  . LYS A 1 59  ? -0.221  17.601  -11.191 1.00 0.00 ? 59  LYS A HZ3  7  
ATOM 10920 N N    . LYS A 1 60  ? -4.999  11.726  -11.089 1.00 0.00 ? 60  LYS A N    7  
ATOM 10921 C CA   . LYS A 1 60  ? -4.918  10.554  -11.953 1.00 0.00 ? 60  LYS A CA   7  
ATOM 10922 C C    . LYS A 1 60  ? -6.269  9.851   -12.044 1.00 0.00 ? 60  LYS A C    7  
ATOM 10923 O O    . LYS A 1 60  ? -6.835  9.709   -13.127 1.00 0.00 ? 60  LYS A O    7  
ATOM 10924 C CB   . LYS A 1 60  ? -3.858  9.582   -11.432 1.00 0.00 ? 60  LYS A CB   7  
ATOM 10925 C CG   . LYS A 1 60  ? -2.439  9.972   -11.805 1.00 0.00 ? 60  LYS A CG   7  
ATOM 10926 C CD   . LYS A 1 60  ? -2.189  9.810   -13.295 1.00 0.00 ? 60  LYS A CD   7  
ATOM 10927 C CE   . LYS A 1 60  ? -1.611  8.440   -13.617 1.00 0.00 ? 60  LYS A CE   7  
ATOM 10928 N NZ   . LYS A 1 60  ? -2.677  7.445   -13.918 1.00 0.00 ? 60  LYS A NZ   7  
ATOM 10929 H H    . LYS A 1 60  ? -4.464  11.751  -10.267 1.00 0.00 ? 60  LYS A H    7  
ATOM 10930 H HA   . LYS A 1 60  ? -4.634  10.889  -12.939 1.00 0.00 ? 60  LYS A HA   7  
ATOM 10931 H HB2  . LYS A 1 60  ? -3.926  9.537   -10.355 1.00 0.00 ? 60  LYS A HB2  7  
ATOM 10932 H HB3  . LYS A 1 60  ? -4.058  8.600   -11.837 1.00 0.00 ? 60  LYS A HB3  7  
ATOM 10933 H HG2  . LYS A 1 60  ? -2.276  11.004  -11.534 1.00 0.00 ? 60  LYS A HG2  7  
ATOM 10934 H HG3  . LYS A 1 60  ? -1.748  9.342   -11.262 1.00 0.00 ? 60  LYS A HG3  7  
ATOM 10935 H HD2  . LYS A 1 60  ? -3.123  9.927   -13.823 1.00 0.00 ? 60  LYS A HD2  7  
ATOM 10936 H HD3  . LYS A 1 60  ? -1.492  10.570  -13.619 1.00 0.00 ? 60  LYS A HD3  7  
ATOM 10937 H HE2  . LYS A 1 60  ? -0.962  8.530   -14.475 1.00 0.00 ? 60  LYS A HE2  7  
ATOM 10938 H HE3  . LYS A 1 60  ? -1.039  8.096   -12.768 1.00 0.00 ? 60  LYS A HE3  7  
ATOM 10939 H HZ1  . LYS A 1 60  ? -3.375  7.425   -13.146 1.00 0.00 ? 60  LYS A HZ1  7  
ATOM 10940 H HZ2  . LYS A 1 60  ? -2.263  6.497   -14.020 1.00 0.00 ? 60  LYS A HZ2  7  
ATOM 10941 H HZ3  . LYS A 1 60  ? -3.162  7.697   -14.803 1.00 0.00 ? 60  LYS A HZ3  7  
ATOM 10942 N N    . GLY A 1 61  ? -6.781  9.413   -10.897 1.00 0.00 ? 61  GLY A N    7  
ATOM 10943 C CA   . GLY A 1 61  ? -8.061  8.731   -10.869 1.00 0.00 ? 61  GLY A CA   7  
ATOM 10944 C C    . GLY A 1 61  ? -8.199  7.804   -9.678  1.00 0.00 ? 61  GLY A C    7  
ATOM 10945 O O    . GLY A 1 61  ? -8.608  6.651   -9.822  1.00 0.00 ? 61  GLY A O    7  
ATOM 10946 H H    . GLY A 1 61  ? -6.285  9.554   -10.064 1.00 0.00 ? 61  GLY A H    7  
ATOM 10947 H HA2  . GLY A 1 61  ? -8.849  9.468   -10.832 1.00 0.00 ? 61  GLY A HA2  7  
ATOM 10948 H HA3  . GLY A 1 61  ? -8.167  8.152   -11.775 1.00 0.00 ? 61  GLY A HA3  7  
ATOM 10949 N N    . LEU A 1 62  ? -7.856  8.307   -8.497  1.00 0.00 ? 62  LEU A N    7  
ATOM 10950 C CA   . LEU A 1 62  ? -7.942  7.515   -7.274  1.00 0.00 ? 62  LEU A CA   7  
ATOM 10951 C C    . LEU A 1 62  ? -8.934  8.133   -6.294  1.00 0.00 ? 62  LEU A C    7  
ATOM 10952 O O    . LEU A 1 62  ? -9.487  9.204   -6.546  1.00 0.00 ? 62  LEU A O    7  
ATOM 10953 C CB   . LEU A 1 62  ? -6.564  7.401   -6.620  1.00 0.00 ? 62  LEU A CB   7  
ATOM 10954 C CG   . LEU A 1 62  ? -5.698  6.227   -7.078  1.00 0.00 ? 62  LEU A CG   7  
ATOM 10955 C CD1  . LEU A 1 62  ? -4.223  6.584   -6.985  1.00 0.00 ? 62  LEU A CD1  7  
ATOM 10956 C CD2  . LEU A 1 62  ? -6.002  4.986   -6.251  1.00 0.00 ? 62  LEU A CD2  7  
ATOM 10957 H H    . LEU A 1 62  ? -7.538  9.232   -8.445  1.00 0.00 ? 62  LEU A H    7  
ATOM 10958 H HA   . LEU A 1 62  ? -8.287  6.528   -7.543  1.00 0.00 ? 62  LEU A HA   7  
ATOM 10959 H HB2  . LEU A 1 62  ? -6.023  8.312   -6.827  1.00 0.00 ? 62  LEU A HB2  7  
ATOM 10960 H HB3  . LEU A 1 62  ? -6.712  7.308   -5.553  1.00 0.00 ? 62  LEU A HB3  7  
ATOM 10961 H HG   . LEU A 1 62  ? -5.923  6.005   -8.112  1.00 0.00 ? 62  LEU A HG   7  
ATOM 10962 H HD11 . LEU A 1 62  ? -4.032  7.480   -7.557  1.00 0.00 ? 62  LEU A HD11 7  
ATOM 10963 H HD12 . LEU A 1 62  ? -3.630  5.772   -7.380  1.00 0.00 ? 62  LEU A HD12 7  
ATOM 10964 H HD13 . LEU A 1 62  ? -3.958  6.753   -5.952  1.00 0.00 ? 62  LEU A HD13 7  
ATOM 10965 H HD21 . LEU A 1 62  ? -5.132  4.723   -5.667  1.00 0.00 ? 62  LEU A HD21 7  
ATOM 10966 H HD22 . LEU A 1 62  ? -6.254  4.168   -6.910  1.00 0.00 ? 62  LEU A HD22 7  
ATOM 10967 H HD23 . LEU A 1 62  ? -6.832  5.188   -5.592  1.00 0.00 ? 62  LEU A HD23 7  
ATOM 10968 N N    . LYS A 1 63  ? -9.153  7.452   -5.175  1.00 0.00 ? 63  LYS A N    7  
ATOM 10969 C CA   . LYS A 1 63  ? -10.075 7.935   -4.153  1.00 0.00 ? 63  LYS A CA   7  
ATOM 10970 C C    . LYS A 1 63  ? -9.826  7.235   -2.821  1.00 0.00 ? 63  LYS A C    7  
ATOM 10971 O O    . LYS A 1 63  ? -9.214  6.169   -2.774  1.00 0.00 ? 63  LYS A O    7  
ATOM 10972 C CB   . LYS A 1 63  ? -11.523 7.710   -4.597  1.00 0.00 ? 63  LYS A CB   7  
ATOM 10973 C CG   . LYS A 1 63  ? -12.546 8.039   -3.524  1.00 0.00 ? 63  LYS A CG   7  
ATOM 10974 C CD   . LYS A 1 63  ? -12.526 9.517   -3.169  1.00 0.00 ? 63  LYS A CD   7  
ATOM 10975 C CE   . LYS A 1 63  ? -13.435 10.322  -4.085  1.00 0.00 ? 63  LYS A CE   7  
ATOM 10976 N NZ   . LYS A 1 63  ? -12.747 10.708  -5.348  1.00 0.00 ? 63  LYS A NZ   7  
ATOM 10977 H H    . LYS A 1 63  ? -8.682  6.605   -5.031  1.00 0.00 ? 63  LYS A H    7  
ATOM 10978 H HA   . LYS A 1 63  ? -9.907  8.994   -4.027  1.00 0.00 ? 63  LYS A HA   7  
ATOM 10979 H HB2  . LYS A 1 63  ? -11.723 8.330   -5.458  1.00 0.00 ? 63  LYS A HB2  7  
ATOM 10980 H HB3  . LYS A 1 63  ? -11.644 6.673   -4.874  1.00 0.00 ? 63  LYS A HB3  7  
ATOM 10981 H HG2  . LYS A 1 63  ? -13.530 7.780   -3.885  1.00 0.00 ? 63  LYS A HG2  7  
ATOM 10982 H HG3  . LYS A 1 63  ? -12.323 7.462   -2.637  1.00 0.00 ? 63  LYS A HG3  7  
ATOM 10983 H HD2  . LYS A 1 63  ? -12.862 9.638   -2.150  1.00 0.00 ? 63  LYS A HD2  7  
ATOM 10984 H HD3  . LYS A 1 63  ? -11.515 9.887   -3.263  1.00 0.00 ? 63  LYS A HD3  7  
ATOM 10985 H HE2  . LYS A 1 63  ? -14.302 9.726   -4.325  1.00 0.00 ? 63  LYS A HE2  7  
ATOM 10986 H HE3  . LYS A 1 63  ? -13.745 11.217  -3.566  1.00 0.00 ? 63  LYS A HE3  7  
ATOM 10987 H HZ1  . LYS A 1 63  ? -12.707 11.745  -5.430  1.00 0.00 ? 63  LYS A HZ1  7  
ATOM 10988 H HZ2  . LYS A 1 63  ? -13.263 10.327  -6.167  1.00 0.00 ? 63  LYS A HZ2  7  
ATOM 10989 H HZ3  . LYS A 1 63  ? -11.778 10.332  -5.357  1.00 0.00 ? 63  LYS A HZ3  7  
ATOM 10990 N N    . ALA A 1 64  ? -10.306 7.842   -1.740  1.00 0.00 ? 64  ALA A N    7  
ATOM 10991 C CA   . ALA A 1 64  ? -10.138 7.275   -0.408  1.00 0.00 ? 64  ALA A CA   7  
ATOM 10992 C C    . ALA A 1 64  ? -11.201 6.220   -0.123  1.00 0.00 ? 64  ALA A C    7  
ATOM 10993 O O    . ALA A 1 64  ? -11.528 5.950   1.033   1.00 0.00 ? 64  ALA A O    7  
ATOM 10994 C CB   . ALA A 1 64  ? -10.187 8.374   0.643   1.00 0.00 ? 64  ALA A CB   7  
ATOM 10995 H H    . ALA A 1 64  ? -10.785 8.691   -1.842  1.00 0.00 ? 64  ALA A H    7  
ATOM 10996 H HA   . ALA A 1 64  ? -9.163  6.811   -0.363  1.00 0.00 ? 64  ALA A HA   7  
ATOM 10997 H HB1  . ALA A 1 64  ? -11.184 8.789   0.683   1.00 0.00 ? 64  ALA A HB1  7  
ATOM 10998 H HB2  . ALA A 1 64  ? -9.929  7.962   1.607   1.00 0.00 ? 64  ALA A HB2  7  
ATOM 10999 H HB3  . ALA A 1 64  ? -9.484  9.152   0.384   1.00 0.00 ? 64  ALA A HB3  7  
ATOM 11000 N N    . GLY A 1 65  ? -11.739 5.626   -1.184  1.00 0.00 ? 65  GLY A N    7  
ATOM 11001 C CA   . GLY A 1 65  ? -12.761 4.607   -1.025  1.00 0.00 ? 65  GLY A CA   7  
ATOM 11002 C C    . GLY A 1 65  ? -12.719 3.568   -2.128  1.00 0.00 ? 65  GLY A C    7  
ATOM 11003 O O    . GLY A 1 65  ? -13.758 3.066   -2.556  1.00 0.00 ? 65  GLY A O    7  
ATOM 11004 H H    . GLY A 1 65  ? -11.440 5.882   -2.081  1.00 0.00 ? 65  GLY A H    7  
ATOM 11005 H HA2  . GLY A 1 65  ? -12.618 4.115   -0.075  1.00 0.00 ? 65  GLY A HA2  7  
ATOM 11006 H HA3  . GLY A 1 65  ? -13.730 5.083   -1.031  1.00 0.00 ? 65  GLY A HA3  7  
ATOM 11007 N N    . ASP A 1 66  ? -11.516 3.246   -2.590  1.00 0.00 ? 66  ASP A N    7  
ATOM 11008 C CA   . ASP A 1 66  ? -11.343 2.260   -3.651  1.00 0.00 ? 66  ASP A CA   7  
ATOM 11009 C C    . ASP A 1 66  ? -10.439 1.121   -3.192  1.00 0.00 ? 66  ASP A C    7  
ATOM 11010 O O    . ASP A 1 66  ? -9.491  1.335   -2.437  1.00 0.00 ? 66  ASP A O    7  
ATOM 11011 C CB   . ASP A 1 66  ? -10.758 2.921   -4.900  1.00 0.00 ? 66  ASP A CB   7  
ATOM 11012 C CG   . ASP A 1 66  ? -11.198 2.236   -6.178  1.00 0.00 ? 66  ASP A CG   7  
ATOM 11013 O OD1  . ASP A 1 66  ? -11.070 0.996   -6.261  1.00 0.00 ? 66  ASP A OD1  7  
ATOM 11014 O OD2  . ASP A 1 66  ? -11.671 2.938   -7.096  1.00 0.00 ? 66  ASP A OD2  7  
ATOM 11015 H H    . ASP A 1 66  ? -10.725 3.681   -2.208  1.00 0.00 ? 66  ASP A H    7  
ATOM 11016 H HA   . ASP A 1 66  ? -12.315 1.857   -3.891  1.00 0.00 ? 66  ASP A HA   7  
ATOM 11017 H HB2  . ASP A 1 66  ? -11.078 3.952   -4.938  1.00 0.00 ? 66  ASP A HB2  7  
ATOM 11018 H HB3  . ASP A 1 66  ? -9.679  2.885   -4.846  1.00 0.00 ? 66  ASP A HB3  7  
ATOM 11019 N N    . GLU A 1 67  ? -10.741 -0.089  -3.651  1.00 0.00 ? 67  GLU A N    7  
ATOM 11020 C CA   . GLU A 1 67  ? -9.956  -1.262  -3.285  1.00 0.00 ? 67  GLU A CA   7  
ATOM 11021 C C    . GLU A 1 67  ? -8.867  -1.533  -4.320  1.00 0.00 ? 67  GLU A C    7  
ATOM 11022 O O    . GLU A 1 67  ? -9.099  -1.420  -5.524  1.00 0.00 ? 67  GLU A O    7  
ATOM 11023 C CB   . GLU A 1 67  ? -10.862 -2.488  -3.150  1.00 0.00 ? 67  GLU A CB   7  
ATOM 11024 C CG   . GLU A 1 67  ? -11.541 -2.890  -4.448  1.00 0.00 ? 67  GLU A CG   7  
ATOM 11025 C CD   . GLU A 1 67  ? -12.685 -3.861  -4.232  1.00 0.00 ? 67  GLU A CD   7  
ATOM 11026 O OE1  . GLU A 1 67  ? -13.655 -3.491  -3.538  1.00 0.00 ? 67  GLU A OE1  7  
ATOM 11027 O OE2  . GLU A 1 67  ? -12.611 -4.991  -4.759  1.00 0.00 ? 67  GLU A OE2  7  
ATOM 11028 H H    . GLU A 1 67  ? -11.509 -0.196  -4.250  1.00 0.00 ? 67  GLU A H    7  
ATOM 11029 H HA   . GLU A 1 67  ? -9.489  -1.065  -2.332  1.00 0.00 ? 67  GLU A HA   7  
ATOM 11030 H HB2  . GLU A 1 67  ? -10.269 -3.322  -2.804  1.00 0.00 ? 67  GLU A HB2  7  
ATOM 11031 H HB3  . GLU A 1 67  ? -11.628 -2.275  -2.419  1.00 0.00 ? 67  GLU A HB3  7  
ATOM 11032 H HG2  . GLU A 1 67  ? -11.928 -2.002  -4.927  1.00 0.00 ? 67  GLU A HG2  7  
ATOM 11033 H HG3  . GLU A 1 67  ? -10.810 -3.355  -5.093  1.00 0.00 ? 67  GLU A HG3  7  
ATOM 11034 N N    . ILE A 1 68  ? -7.680  -1.890  -3.841  1.00 0.00 ? 68  ILE A N    7  
ATOM 11035 C CA   . ILE A 1 68  ? -6.556  -2.177  -4.724  1.00 0.00 ? 68  ILE A CA   7  
ATOM 11036 C C    . ILE A 1 68  ? -6.493  -3.661  -5.069  1.00 0.00 ? 68  ILE A C    7  
ATOM 11037 O O    . ILE A 1 68  ? -6.353  -4.509  -4.186  1.00 0.00 ? 68  ILE A O    7  
ATOM 11038 C CB   . ILE A 1 68  ? -5.219  -1.752  -4.089  1.00 0.00 ? 68  ILE A CB   7  
ATOM 11039 C CG1  . ILE A 1 68  ? -5.255  -0.268  -3.718  1.00 0.00 ? 68  ILE A CG1  7  
ATOM 11040 C CG2  . ILE A 1 68  ? -4.067  -2.037  -5.041  1.00 0.00 ? 68  ILE A CG2  7  
ATOM 11041 C CD1  . ILE A 1 68  ? -5.317  0.653   -4.917  1.00 0.00 ? 68  ILE A CD1  7  
ATOM 11042 H H    . ILE A 1 68  ? -7.558  -1.963  -2.872  1.00 0.00 ? 68  ILE A H    7  
ATOM 11043 H HA   . ILE A 1 68  ? -6.695  -1.613  -5.635  1.00 0.00 ? 68  ILE A HA   7  
ATOM 11044 H HB   . ILE A 1 68  ? -5.069  -2.336  -3.194  1.00 0.00 ? 68  ILE A HB   7  
ATOM 11045 H HG12 . ILE A 1 68  ? -6.124  -0.076  -3.109  1.00 0.00 ? 68  ILE A HG12 7  
ATOM 11046 H HG13 . ILE A 1 68  ? -4.365  -0.023  -3.156  1.00 0.00 ? 68  ILE A HG13 7  
ATOM 11047 H HG21 . ILE A 1 68  ? -3.857  -1.155  -5.628  1.00 0.00 ? 68  ILE A HG21 7  
ATOM 11048 H HG22 . ILE A 1 68  ? -3.189  -2.307  -4.472  1.00 0.00 ? 68  ILE A HG22 7  
ATOM 11049 H HG23 . ILE A 1 68  ? -4.335  -2.852  -5.697  1.00 0.00 ? 68  ILE A HG23 7  
ATOM 11050 H HD11 . ILE A 1 68  ? -4.400  1.219   -4.984  1.00 0.00 ? 68  ILE A HD11 7  
ATOM 11051 H HD12 . ILE A 1 68  ? -5.447  0.069   -5.815  1.00 0.00 ? 68  ILE A HD12 7  
ATOM 11052 H HD13 . ILE A 1 68  ? -6.150  1.333   -4.806  1.00 0.00 ? 68  ILE A HD13 7  
ATOM 11053 N N    . LEU A 1 69  ? -6.595  -3.969  -6.357  1.00 0.00 ? 69  LEU A N    7  
ATOM 11054 C CA   . LEU A 1 69  ? -6.547  -5.351  -6.819  1.00 0.00 ? 69  LEU A CA   7  
ATOM 11055 C C    . LEU A 1 69  ? -5.107  -5.843  -6.920  1.00 0.00 ? 69  LEU A C    7  
ATOM 11056 O O    . LEU A 1 69  ? -4.762  -6.897  -6.387  1.00 0.00 ? 69  LEU A O    7  
ATOM 11057 C CB   . LEU A 1 69  ? -7.238  -5.479  -8.178  1.00 0.00 ? 69  LEU A CB   7  
ATOM 11058 C CG   . LEU A 1 69  ? -8.736  -5.171  -8.202  1.00 0.00 ? 69  LEU A CG   7  
ATOM 11059 C CD1  . LEU A 1 69  ? -9.179  -4.786  -9.604  1.00 0.00 ? 69  LEU A CD1  7  
ATOM 11060 C CD2  . LEU A 1 69  ? -9.534  -6.364  -7.697  1.00 0.00 ? 69  LEU A CD2  7  
ATOM 11061 H H    . LEU A 1 69  ? -6.705  -3.250  -7.013  1.00 0.00 ? 69  LEU A H    7  
ATOM 11062 H HA   . LEU A 1 69  ? -7.073  -5.960  -6.099  1.00 0.00 ? 69  LEU A HA   7  
ATOM 11063 H HB2  . LEU A 1 69  ? -6.751  -4.801  -8.862  1.00 0.00 ? 69  LEU A HB2  7  
ATOM 11064 H HB3  . LEU A 1 69  ? -7.103  -6.495  -8.523  1.00 0.00 ? 69  LEU A HB3  7  
ATOM 11065 H HG   . LEU A 1 69  ? -8.935  -4.333  -7.548  1.00 0.00 ? 69  LEU A HG   7  
ATOM 11066 H HD11 . LEU A 1 69  ? -8.790  -5.500  -10.314 1.00 0.00 ? 69  LEU A HD11 7  
ATOM 11067 H HD12 . LEU A 1 69  ? -8.805  -3.801  -9.843  1.00 0.00 ? 69  LEU A HD12 7  
ATOM 11068 H HD13 . LEU A 1 69  ? -10.259 -4.782  -9.652  1.00 0.00 ? 69  LEU A HD13 7  
ATOM 11069 H HD21 . LEU A 1 69  ? -10.503 -6.030  -7.356  1.00 0.00 ? 69  LEU A HD21 7  
ATOM 11070 H HD22 . LEU A 1 69  ? -9.005  -6.830  -6.877  1.00 0.00 ? 69  LEU A HD22 7  
ATOM 11071 H HD23 . LEU A 1 69  ? -9.659  -7.078  -8.497  1.00 0.00 ? 69  LEU A HD23 7  
ATOM 11072 N N    . GLU A 1 70  ? -4.270  -5.070  -7.606  1.00 0.00 ? 70  GLU A N    7  
ATOM 11073 C CA   . GLU A 1 70  ? -2.867  -5.427  -7.775  1.00 0.00 ? 70  GLU A CA   7  
ATOM 11074 C C    . GLU A 1 70  ? -1.993  -4.178  -7.850  1.00 0.00 ? 70  GLU A C    7  
ATOM 11075 O O    . GLU A 1 70  ? -2.496  -3.065  -8.005  1.00 0.00 ? 70  GLU A O    7  
ATOM 11076 C CB   . GLU A 1 70  ? -2.680  -6.270  -9.038  1.00 0.00 ? 70  GLU A CB   7  
ATOM 11077 C CG   . GLU A 1 70  ? -3.156  -7.705  -8.888  1.00 0.00 ? 70  GLU A CG   7  
ATOM 11078 C CD   . GLU A 1 70  ? -3.330  -8.405  -10.222 1.00 0.00 ? 70  GLU A CD   7  
ATOM 11079 O OE1  . GLU A 1 70  ? -2.643  -8.015  -11.190 1.00 0.00 ? 70  GLU A OE1  7  
ATOM 11080 O OE2  . GLU A 1 70  ? -4.153  -9.340  -10.300 1.00 0.00 ? 70  GLU A OE2  7  
ATOM 11081 H H    . GLU A 1 70  ? -4.605  -4.242  -8.009  1.00 0.00 ? 70  GLU A H    7  
ATOM 11082 H HA   . GLU A 1 70  ? -2.567  -6.010  -6.917  1.00 0.00 ? 70  GLU A HA   7  
ATOM 11083 H HB2  . GLU A 1 70  ? -3.230  -5.812  -9.847  1.00 0.00 ? 70  GLU A HB2  7  
ATOM 11084 H HB3  . GLU A 1 70  ? -1.631  -6.286  -9.293  1.00 0.00 ? 70  GLU A HB3  7  
ATOM 11085 H HG2  . GLU A 1 70  ? -2.431  -8.252  -8.305  1.00 0.00 ? 70  GLU A HG2  7  
ATOM 11086 H HG3  . GLU A 1 70  ? -4.105  -7.704  -8.372  1.00 0.00 ? 70  GLU A HG3  7  
ATOM 11087 N N    . ILE A 1 71  ? -0.683  -4.372  -7.739  1.00 0.00 ? 71  ILE A N    7  
ATOM 11088 C CA   . ILE A 1 71  ? 0.260   -3.263  -7.795  1.00 0.00 ? 71  ILE A CA   7  
ATOM 11089 C C    . ILE A 1 71  ? 1.520   -3.650  -8.562  1.00 0.00 ? 71  ILE A C    7  
ATOM 11090 O O    . ILE A 1 71  ? 2.368   -4.383  -8.054  1.00 0.00 ? 71  ILE A O    7  
ATOM 11091 C CB   . ILE A 1 71  ? 0.657   -2.790  -6.384  1.00 0.00 ? 71  ILE A CB   7  
ATOM 11092 C CG1  . ILE A 1 71  ? -0.574  -2.292  -5.624  1.00 0.00 ? 71  ILE A CG1  7  
ATOM 11093 C CG2  . ILE A 1 71  ? 1.712   -1.696  -6.469  1.00 0.00 ? 71  ILE A CG2  7  
ATOM 11094 C CD1  . ILE A 1 71  ? -0.306  -2.001  -4.164  1.00 0.00 ? 71  ILE A CD1  7  
ATOM 11095 H H    . ILE A 1 71  ? -0.343  -5.283  -7.617  1.00 0.00 ? 71  ILE A H    7  
ATOM 11096 H HA   . ILE A 1 71  ? -0.221  -2.441  -8.306  1.00 0.00 ? 71  ILE A HA   7  
ATOM 11097 H HB   . ILE A 1 71  ? 1.084   -3.628  -5.854  1.00 0.00 ? 71  ILE A HB   7  
ATOM 11098 H HG12 . ILE A 1 71  ? -0.929  -1.383  -6.083  1.00 0.00 ? 71  ILE A HG12 7  
ATOM 11099 H HG13 . ILE A 1 71  ? -1.348  -3.043  -5.677  1.00 0.00 ? 71  ILE A HG13 7  
ATOM 11100 H HG21 . ILE A 1 71  ? 2.472   -1.984  -7.180  1.00 0.00 ? 71  ILE A HG21 7  
ATOM 11101 H HG22 . ILE A 1 71  ? 1.250   -0.775  -6.790  1.00 0.00 ? 71  ILE A HG22 7  
ATOM 11102 H HG23 . ILE A 1 71  ? 2.163   -1.554  -5.498  1.00 0.00 ? 71  ILE A HG23 7  
ATOM 11103 H HD11 . ILE A 1 71  ? -0.835  -1.106  -3.872  1.00 0.00 ? 71  ILE A HD11 7  
ATOM 11104 H HD12 . ILE A 1 71  ? -0.643  -2.832  -3.563  1.00 0.00 ? 71  ILE A HD12 7  
ATOM 11105 H HD13 . ILE A 1 71  ? 0.754   -1.856  -4.014  1.00 0.00 ? 71  ILE A HD13 7  
ATOM 11106 N N    . ASN A 1 72  ? 1.636   -3.151  -9.788  1.00 0.00 ? 72  ASN A N    7  
ATOM 11107 C CA   . ASN A 1 72  ? 2.794   -3.443  -10.626 1.00 0.00 ? 72  ASN A CA   7  
ATOM 11108 C C    . ASN A 1 72  ? 2.919   -4.943  -10.876 1.00 0.00 ? 72  ASN A C    7  
ATOM 11109 O O    . ASN A 1 72  ? 3.995   -5.520  -10.726 1.00 0.00 ? 72  ASN A O    7  
ATOM 11110 C CB   . ASN A 1 72  ? 4.071   -2.916  -9.969  1.00 0.00 ? 72  ASN A CB   7  
ATOM 11111 C CG   . ASN A 1 72  ? 4.264   -1.428  -10.193 1.00 0.00 ? 72  ASN A CG   7  
ATOM 11112 O OD1  . ASN A 1 72  ? 3.717   -0.854  -11.134 1.00 0.00 ? 72  ASN A OD1  7  
ATOM 11113 N ND2  . ASN A 1 72  ? 5.046   -0.797  -9.325  1.00 0.00 ? 72  ASN A ND2  7  
ATOM 11114 H H    . ASN A 1 72  ? 0.927   -2.572  -10.138 1.00 0.00 ? 72  ASN A H    7  
ATOM 11115 H HA   . ASN A 1 72  ? 2.653   -2.943  -11.572 1.00 0.00 ? 72  ASN A HA   7  
ATOM 11116 H HB2  . ASN A 1 72  ? 4.023   -3.097  -8.905  1.00 0.00 ? 72  ASN A HB2  7  
ATOM 11117 H HB3  . ASN A 1 72  ? 4.922   -3.437  -10.381 1.00 0.00 ? 72  ASN A HB3  7  
ATOM 11118 H HD21 . ASN A 1 72  ? 5.449   -1.318  -8.599  1.00 0.00 ? 72  ASN A HD21 7  
ATOM 11119 H HD22 . ASN A 1 72  ? 5.187   0.165   -9.445  1.00 0.00 ? 72  ASN A HD22 7  
ATOM 11120 N N    . ASN A 1 73  ? 1.810   -5.568  -11.258 1.00 0.00 ? 73  ASN A N    7  
ATOM 11121 C CA   . ASN A 1 73  ? 1.796   -7.001  -11.529 1.00 0.00 ? 73  ASN A CA   7  
ATOM 11122 C C    . ASN A 1 73  ? 2.147   -7.796  -10.275 1.00 0.00 ? 73  ASN A C    7  
ATOM 11123 O O    . ASN A 1 73  ? 2.953   -8.725  -10.322 1.00 0.00 ? 73  ASN A O    7  
ATOM 11124 C CB   . ASN A 1 73  ? 2.778   -7.339  -12.652 1.00 0.00 ? 73  ASN A CB   7  
ATOM 11125 C CG   . ASN A 1 73  ? 2.157   -7.193  -14.028 1.00 0.00 ? 73  ASN A CG   7  
ATOM 11126 O OD1  . ASN A 1 73  ? 2.408   -6.216  -14.734 1.00 0.00 ? 73  ASN A OD1  7  
ATOM 11127 N ND2  . ASN A 1 73  ? 1.340   -8.166  -14.415 1.00 0.00 ? 73  ASN A ND2  7  
ATOM 11128 H H    . ASN A 1 73  ? 0.982   -5.054  -11.361 1.00 0.00 ? 73  ASN A H    7  
ATOM 11129 H HA   . ASN A 1 73  ? 0.798   -7.269  -11.844 1.00 0.00 ? 73  ASN A HA   7  
ATOM 11130 H HB2  . ASN A 1 73  ? 3.628   -6.675  -12.590 1.00 0.00 ? 73  ASN A HB2  7  
ATOM 11131 H HB3  . ASN A 1 73  ? 3.114   -8.359  -12.535 1.00 0.00 ? 73  ASN A HB3  7  
ATOM 11132 H HD21 . ASN A 1 73  ? 1.186   -8.913  -13.800 1.00 0.00 ? 73  ASN A HD21 7  
ATOM 11133 H HD22 . ASN A 1 73  ? 0.925   -8.097  -15.300 1.00 0.00 ? 73  ASN A HD22 7  
ATOM 11134 N N    . ARG A 1 74  ? 1.535   -7.424  -9.155  1.00 0.00 ? 74  ARG A N    7  
ATOM 11135 C CA   . ARG A 1 74  ? 1.784   -8.101  -7.888  1.00 0.00 ? 74  ARG A CA   7  
ATOM 11136 C C    . ARG A 1 74  ? 0.511   -8.168  -7.049  1.00 0.00 ? 74  ARG A C    7  
ATOM 11137 O O    . ARG A 1 74  ? -0.251  -7.204  -6.982  1.00 0.00 ? 74  ARG A O    7  
ATOM 11138 C CB   . ARG A 1 74  ? 2.885   -7.381  -7.108  1.00 0.00 ? 74  ARG A CB   7  
ATOM 11139 C CG   . ARG A 1 74  ? 4.267   -7.539  -7.718  1.00 0.00 ? 74  ARG A CG   7  
ATOM 11140 C CD   . ARG A 1 74  ? 4.922   -8.841  -7.286  1.00 0.00 ? 74  ARG A CD   7  
ATOM 11141 N NE   . ARG A 1 74  ? 6.107   -9.149  -8.083  1.00 0.00 ? 74  ARG A NE   7  
ATOM 11142 C CZ   . ARG A 1 74  ? 6.602   -10.374 -8.218  1.00 0.00 ? 74  ARG A CZ   7  
ATOM 11143 N NH1  . ARG A 1 74  ? 6.019   -11.400 -7.614  1.00 0.00 ? 74  ARG A NH1  7  
ATOM 11144 N NH2  . ARG A 1 74  ? 7.684   -10.575 -8.961  1.00 0.00 ? 74  ARG A NH2  7  
ATOM 11145 H H    . ARG A 1 74  ? 0.903   -6.676  -9.181  1.00 0.00 ? 74  ARG A H    7  
ATOM 11146 H HA   . ARG A 1 74  ? 2.109   -9.107  -8.108  1.00 0.00 ? 74  ARG A HA   7  
ATOM 11147 H HB2  . ARG A 1 74  ? 2.651   -6.327  -7.068  1.00 0.00 ? 74  ARG A HB2  7  
ATOM 11148 H HB3  . ARG A 1 74  ? 2.912   -7.773  -6.102  1.00 0.00 ? 74  ARG A HB3  7  
ATOM 11149 H HG2  . ARG A 1 74  ? 4.178   -7.534  -8.795  1.00 0.00 ? 74  ARG A HG2  7  
ATOM 11150 H HG3  . ARG A 1 74  ? 4.886   -6.712  -7.403  1.00 0.00 ? 74  ARG A HG3  7  
ATOM 11151 H HD2  . ARG A 1 74  ? 5.210   -8.757  -6.249  1.00 0.00 ? 74  ARG A HD2  7  
ATOM 11152 H HD3  . ARG A 1 74  ? 4.206   -9.642  -7.396  1.00 0.00 ? 74  ARG A HD3  7  
ATOM 11153 H HE   . ARG A 1 74  ? 6.553   -8.406  -8.538  1.00 0.00 ? 74  ARG A HE   7  
ATOM 11154 H HH11 . ARG A 1 74  ? 5.203   -11.252 -7.055  1.00 0.00 ? 74  ARG A HH11 7  
ATOM 11155 H HH12 . ARG A 1 74  ? 6.394   -12.322 -7.719  1.00 0.00 ? 74  ARG A HH12 7  
ATOM 11156 H HH21 . ARG A 1 74  ? 8.126   -9.804  -9.418  1.00 0.00 ? 74  ARG A HH21 7  
ATOM 11157 H HH22 . ARG A 1 74  ? 8.056   -11.497 -9.062  1.00 0.00 ? 74  ARG A HH22 7  
ATOM 11158 N N    . ALA A 1 75  ? 0.288   -9.313  -6.412  1.00 0.00 ? 75  ALA A N    7  
ATOM 11159 C CA   . ALA A 1 75  ? -0.891  -9.505  -5.576  1.00 0.00 ? 75  ALA A CA   7  
ATOM 11160 C C    . ALA A 1 75  ? -0.806  -8.666  -4.306  1.00 0.00 ? 75  ALA A C    7  
ATOM 11161 O O    . ALA A 1 75  ? 0.161   -8.764  -3.550  1.00 0.00 ? 75  ALA A O    7  
ATOM 11162 C CB   . ALA A 1 75  ? -1.058  -10.977 -5.230  1.00 0.00 ? 75  ALA A CB   7  
ATOM 11163 H H    . ALA A 1 75  ? 0.933   -10.045 -6.505  1.00 0.00 ? 75  ALA A H    7  
ATOM 11164 H HA   . ALA A 1 75  ? -1.756  -9.194  -6.144  1.00 0.00 ? 75  ALA A HA   7  
ATOM 11165 H HB1  . ALA A 1 75  ? -0.084  -11.430 -5.112  1.00 0.00 ? 75  ALA A HB1  7  
ATOM 11166 H HB2  . ALA A 1 75  ? -1.612  -11.069 -4.308  1.00 0.00 ? 75  ALA A HB2  7  
ATOM 11167 H HB3  . ALA A 1 75  ? -1.594  -11.475 -6.024  1.00 0.00 ? 75  ALA A HB3  7  
ATOM 11168 N N    . ALA A 1 76  ? -1.823  -7.842  -4.077  1.00 0.00 ? 76  ALA A N    7  
ATOM 11169 C CA   . ALA A 1 76  ? -1.863  -6.988  -2.896  1.00 0.00 ? 76  ALA A CA   7  
ATOM 11170 C C    . ALA A 1 76  ? -1.473  -7.764  -1.643  1.00 0.00 ? 76  ALA A C    7  
ATOM 11171 O O    . ALA A 1 76  ? -0.480  -7.447  -0.989  1.00 0.00 ? 76  ALA A O    7  
ATOM 11172 C CB   . ALA A 1 76  ? -3.248  -6.378  -2.733  1.00 0.00 ? 76  ALA A CB   7  
ATOM 11173 H H    . ALA A 1 76  ? -2.565  -7.809  -4.716  1.00 0.00 ? 76  ALA A H    7  
ATOM 11174 H HA   . ALA A 1 76  ? -1.157  -6.183  -3.043  1.00 0.00 ? 76  ALA A HA   7  
ATOM 11175 H HB1  . ALA A 1 76  ? -3.992  -7.079  -3.082  1.00 0.00 ? 76  ALA A HB1  7  
ATOM 11176 H HB2  . ALA A 1 76  ? -3.422  -6.156  -1.691  1.00 0.00 ? 76  ALA A HB2  7  
ATOM 11177 H HB3  . ALA A 1 76  ? -3.311  -5.469  -3.311  1.00 0.00 ? 76  ALA A HB3  7  
ATOM 11178 N N    . ASP A 1 77  ? -2.262  -8.781  -1.314  1.00 0.00 ? 77  ASP A N    7  
ATOM 11179 C CA   . ASP A 1 77  ? -1.999  -9.604  -0.139  1.00 0.00 ? 77  ASP A CA   7  
ATOM 11180 C C    . ASP A 1 77  ? -0.524  -9.985  -0.061  1.00 0.00 ? 77  ASP A C    7  
ATOM 11181 O O    . ASP A 1 77  ? 0.087   -9.929  1.006   1.00 0.00 ? 77  ASP A O    7  
ATOM 11182 C CB   . ASP A 1 77  ? -2.863  -10.865 -0.168  1.00 0.00 ? 77  ASP A CB   7  
ATOM 11183 C CG   . ASP A 1 77  ? -2.300  -11.973 0.699   1.00 0.00 ? 77  ASP A CG   7  
ATOM 11184 O OD1  . ASP A 1 77  ? -2.595  -11.984 1.912   1.00 0.00 ? 77  ASP A OD1  7  
ATOM 11185 O OD2  . ASP A 1 77  ? -1.564  -12.829 0.165   1.00 0.00 ? 77  ASP A OD2  7  
ATOM 11186 H H    . ASP A 1 77  ? -3.039  -8.985  -1.876  1.00 0.00 ? 77  ASP A H    7  
ATOM 11187 H HA   . ASP A 1 77  ? -2.254  -9.024  0.735   1.00 0.00 ? 77  ASP A HA   7  
ATOM 11188 H HB2  . ASP A 1 77  ? -3.854  -10.623 0.188   1.00 0.00 ? 77  ASP A HB2  7  
ATOM 11189 H HB3  . ASP A 1 77  ? -2.929  -11.225 -1.184  1.00 0.00 ? 77  ASP A HB3  7  
ATOM 11190 N N    . ALA A 1 78  ? 0.043   -10.373 -1.199  1.00 0.00 ? 78  ALA A N    7  
ATOM 11191 C CA   . ALA A 1 78  ? 1.446   -10.763 -1.261  1.00 0.00 ? 78  ALA A CA   7  
ATOM 11192 C C    . ALA A 1 78  ? 2.350   -9.638  -0.767  1.00 0.00 ? 78  ALA A C    7  
ATOM 11193 O O    . ALA A 1 78  ? 3.343   -9.882  -0.081  1.00 0.00 ? 78  ALA A O    7  
ATOM 11194 C CB   . ALA A 1 78  ? 1.822   -11.161 -2.680  1.00 0.00 ? 78  ALA A CB   7  
ATOM 11195 H H    . ALA A 1 78  ? -0.496  -10.397 -2.017  1.00 0.00 ? 78  ALA A H    7  
ATOM 11196 H HA   . ALA A 1 78  ? 1.581   -11.625 -0.623  1.00 0.00 ? 78  ALA A HA   7  
ATOM 11197 H HB1  . ALA A 1 78  ? 2.440   -12.046 -2.653  1.00 0.00 ? 78  ALA A HB1  7  
ATOM 11198 H HB2  . ALA A 1 78  ? 0.925   -11.365 -3.246  1.00 0.00 ? 78  ALA A HB2  7  
ATOM 11199 H HB3  . ALA A 1 78  ? 2.367   -10.354 -3.147  1.00 0.00 ? 78  ALA A HB3  7  
ATOM 11200 N N    . LEU A 1 79  ? 2.000   -8.406  -1.121  1.00 0.00 ? 79  LEU A N    7  
ATOM 11201 C CA   . LEU A 1 79  ? 2.781   -7.243  -0.715  1.00 0.00 ? 79  LEU A CA   7  
ATOM 11202 C C    . LEU A 1 79  ? 2.565   -6.931  0.763   1.00 0.00 ? 79  LEU A C    7  
ATOM 11203 O O    . LEU A 1 79  ? 1.447   -6.648  1.191   1.00 0.00 ? 79  LEU A O    7  
ATOM 11204 C CB   . LEU A 1 79  ? 2.403   -6.028  -1.564  1.00 0.00 ? 79  LEU A CB   7  
ATOM 11205 C CG   . LEU A 1 79  ? 2.564   -6.191  -3.076  1.00 0.00 ? 79  LEU A CG   7  
ATOM 11206 C CD1  . LEU A 1 79  ? 1.708   -5.174  -3.816  1.00 0.00 ? 79  LEU A CD1  7  
ATOM 11207 C CD2  . LEU A 1 79  ? 4.026   -6.051  -3.475  1.00 0.00 ? 79  LEU A CD2  7  
ATOM 11208 H H    . LEU A 1 79  ? 1.198   -8.275  -1.668  1.00 0.00 ? 79  LEU A H    7  
ATOM 11209 H HA   . LEU A 1 79  ? 3.824   -7.472  -0.873  1.00 0.00 ? 79  LEU A HA   7  
ATOM 11210 H HB2  . LEU A 1 79  ? 1.368   -5.795  -1.365  1.00 0.00 ? 79  LEU A HB2  7  
ATOM 11211 H HB3  . LEU A 1 79  ? 3.024   -5.201  -1.251  1.00 0.00 ? 79  LEU A HB3  7  
ATOM 11212 H HG   . LEU A 1 79  ? 2.231   -7.179  -3.363  1.00 0.00 ? 79  LEU A HG   7  
ATOM 11213 H HD11 . LEU A 1 79  ? 1.904   -5.242  -4.876  1.00 0.00 ? 79  LEU A HD11 7  
ATOM 11214 H HD12 . LEU A 1 79  ? 1.948   -4.180  -3.469  1.00 0.00 ? 79  LEU A HD12 7  
ATOM 11215 H HD13 . LEU A 1 79  ? 0.664   -5.378  -3.629  1.00 0.00 ? 79  LEU A HD13 7  
ATOM 11216 H HD21 . LEU A 1 79  ? 4.441   -7.030  -3.665  1.00 0.00 ? 79  LEU A HD21 7  
ATOM 11217 H HD22 . LEU A 1 79  ? 4.574   -5.577  -2.674  1.00 0.00 ? 79  LEU A HD22 7  
ATOM 11218 H HD23 . LEU A 1 79  ? 4.099   -5.449  -4.368  1.00 0.00 ? 79  LEU A HD23 7  
ATOM 11219 N N    . ASN A 1 80  ? 3.644   -6.983  1.537   1.00 0.00 ? 80  ASN A N    7  
ATOM 11220 C CA   . ASN A 1 80  ? 3.573   -6.705  2.967   1.00 0.00 ? 80  ASN A CA   7  
ATOM 11221 C C    . ASN A 1 80  ? 4.079   -5.298  3.273   1.00 0.00 ? 80  ASN A C    7  
ATOM 11222 O O    . ASN A 1 80  ? 4.690   -4.649  2.424   1.00 0.00 ? 80  ASN A O    7  
ATOM 11223 C CB   . ASN A 1 80  ? 4.391   -7.734  3.749   1.00 0.00 ? 80  ASN A CB   7  
ATOM 11224 C CG   . ASN A 1 80  ? 5.830   -7.808  3.279   1.00 0.00 ? 80  ASN A CG   7  
ATOM 11225 O OD1  . ASN A 1 80  ? 6.239   -7.074  2.379   1.00 0.00 ? 80  ASN A OD1  7  
ATOM 11226 N ND2  . ASN A 1 80  ? 6.606   -8.698  3.886   1.00 0.00 ? 80  ASN A ND2  7  
ATOM 11227 H H    . ASN A 1 80  ? 4.509   -7.215  1.138   1.00 0.00 ? 80  ASN A H    7  
ATOM 11228 H HA   . ASN A 1 80  ? 2.539   -6.776  3.267   1.00 0.00 ? 80  ASN A HA   7  
ATOM 11229 H HB2  . ASN A 1 80  ? 4.388   -7.467  4.796   1.00 0.00 ? 80  ASN A HB2  7  
ATOM 11230 H HB3  . ASN A 1 80  ? 3.941   -8.709  3.630   1.00 0.00 ? 80  ASN A HB3  7  
ATOM 11231 H HD21 . ASN A 1 80  ? 6.212   -9.250  4.594   1.00 0.00 ? 80  ASN A HD21 7  
ATOM 11232 H HD22 . ASN A 1 80  ? 7.542   -8.766  3.602   1.00 0.00 ? 80  ASN A HD22 7  
ATOM 11233 N N    . SER A 1 81  ? 3.820   -4.834  4.491   1.00 0.00 ? 81  SER A N    7  
ATOM 11234 C CA   . SER A 1 81  ? 4.246   -3.504  4.909   1.00 0.00 ? 81  SER A CA   7  
ATOM 11235 C C    . SER A 1 81  ? 5.624   -3.172  4.344   1.00 0.00 ? 81  SER A C    7  
ATOM 11236 O O    . SER A 1 81  ? 5.859   -2.064  3.862   1.00 0.00 ? 81  SER A O    7  
ATOM 11237 C CB   . SER A 1 81  ? 4.272   -3.409  6.436   1.00 0.00 ? 81  SER A CB   7  
ATOM 11238 O OG   . SER A 1 81  ? 5.206   -4.321  6.987   1.00 0.00 ? 81  SER A OG   7  
ATOM 11239 H H    . SER A 1 81  ? 3.328   -5.400  5.123   1.00 0.00 ? 81  SER A H    7  
ATOM 11240 H HA   . SER A 1 81  ? 3.531   -2.791  4.525   1.00 0.00 ? 81  SER A HA   7  
ATOM 11241 H HB2  . SER A 1 81  ? 4.549   -2.408  6.727   1.00 0.00 ? 81  SER A HB2  7  
ATOM 11242 H HB3  . SER A 1 81  ? 3.290   -3.639  6.825   1.00 0.00 ? 81  SER A HB3  7  
ATOM 11243 H HG   . SER A 1 81  ? 4.740   -4.991  7.493   1.00 0.00 ? 81  SER A HG   7  
ATOM 11244 N N    . SER A 1 82  ? 6.531   -4.141  4.408   1.00 0.00 ? 82  SER A N    7  
ATOM 11245 C CA   . SER A 1 82  ? 7.887   -3.952  3.906   1.00 0.00 ? 82  SER A CA   7  
ATOM 11246 C C    . SER A 1 82  ? 7.871   -3.548  2.435   1.00 0.00 ? 82  SER A C    7  
ATOM 11247 O O    . SER A 1 82  ? 8.323   -2.461  2.074   1.00 0.00 ? 82  SER A O    7  
ATOM 11248 C CB   . SER A 1 82  ? 8.703   -5.234  4.086   1.00 0.00 ? 82  SER A CB   7  
ATOM 11249 O OG   . SER A 1 82  ? 10.090  -4.951  4.149   1.00 0.00 ? 82  SER A OG   7  
ATOM 11250 H H    . SER A 1 82  ? 6.283   -5.003  4.804   1.00 0.00 ? 82  SER A H    7  
ATOM 11251 H HA   . SER A 1 82  ? 8.346   -3.161  4.480   1.00 0.00 ? 82  SER A HA   7  
ATOM 11252 H HB2  . SER A 1 82  ? 8.405   -5.722  5.001   1.00 0.00 ? 82  SER A HB2  7  
ATOM 11253 H HB3  . SER A 1 82  ? 8.520   -5.894  3.250   1.00 0.00 ? 82  SER A HB3  7  
ATOM 11254 H HG   . SER A 1 82  ? 10.230  -4.147  4.654   1.00 0.00 ? 82  SER A HG   7  
ATOM 11255 N N    . MET A 1 83  ? 7.348   -4.430  1.591   1.00 0.00 ? 83  MET A N    7  
ATOM 11256 C CA   . MET A 1 83  ? 7.271   -4.165  0.159   1.00 0.00 ? 83  MET A CA   7  
ATOM 11257 C C    . MET A 1 83  ? 6.548   -2.850  -0.112  1.00 0.00 ? 83  MET A C    7  
ATOM 11258 O O    . MET A 1 83  ? 7.018   -2.021  -0.893  1.00 0.00 ? 83  MET A O    7  
ATOM 11259 C CB   . MET A 1 83  ? 6.554   -5.312  -0.556  1.00 0.00 ? 83  MET A CB   7  
ATOM 11260 C CG   . MET A 1 83  ? 7.433   -6.531  -0.784  1.00 0.00 ? 83  MET A CG   7  
ATOM 11261 S SD   . MET A 1 83  ? 6.485   -8.060  -0.898  1.00 0.00 ? 83  MET A SD   7  
ATOM 11262 C CE   . MET A 1 83  ? 7.176   -8.990  0.467   1.00 0.00 ? 83  MET A CE   7  
ATOM 11263 H H    . MET A 1 83  ? 7.003   -5.280  1.939   1.00 0.00 ? 83  MET A H    7  
ATOM 11264 H HA   . MET A 1 83  ? 8.280   -4.093  -0.218  1.00 0.00 ? 83  MET A HA   7  
ATOM 11265 H HB2  . MET A 1 83  ? 5.703   -5.614  0.037   1.00 0.00 ? 83  MET A HB2  7  
ATOM 11266 H HB3  . MET A 1 83  ? 6.207   -4.961  -1.516  1.00 0.00 ? 83  MET A HB3  7  
ATOM 11267 H HG2  . MET A 1 83  ? 7.983   -6.395  -1.704  1.00 0.00 ? 83  MET A HG2  7  
ATOM 11268 H HG3  . MET A 1 83  ? 8.128   -6.614  0.039   1.00 0.00 ? 83  MET A HG3  7  
ATOM 11269 H HE1  . MET A 1 83  ? 7.947   -8.406  0.947   1.00 0.00 ? 83  MET A HE1  7  
ATOM 11270 H HE2  . MET A 1 83  ? 6.397   -9.214  1.181   1.00 0.00 ? 83  MET A HE2  7  
ATOM 11271 H HE3  . MET A 1 83  ? 7.601   -9.912  0.096   1.00 0.00 ? 83  MET A HE3  7  
ATOM 11272 N N    . LEU A 1 84  ? 5.404   -2.664  0.536   1.00 0.00 ? 84  LEU A N    7  
ATOM 11273 C CA   . LEU A 1 84  ? 4.616   -1.449  0.364   1.00 0.00 ? 84  LEU A CA   7  
ATOM 11274 C C    . LEU A 1 84  ? 5.486   -0.207  0.532   1.00 0.00 ? 84  LEU A C    7  
ATOM 11275 O O    . LEU A 1 84  ? 5.568   0.633   -0.365  1.00 0.00 ? 84  LEU A O    7  
ATOM 11276 C CB   . LEU A 1 84  ? 3.463   -1.418  1.369   1.00 0.00 ? 84  LEU A CB   7  
ATOM 11277 C CG   . LEU A 1 84  ? 2.247   -2.278  1.023   1.00 0.00 ? 84  LEU A CG   7  
ATOM 11278 C CD1  . LEU A 1 84  ? 1.293   -2.353  2.205   1.00 0.00 ? 84  LEU A CD1  7  
ATOM 11279 C CD2  . LEU A 1 84  ? 1.536   -1.726  -0.204  1.00 0.00 ? 84  LEU A CD2  7  
ATOM 11280 H H    . LEU A 1 84  ? 5.080   -3.360  1.145   1.00 0.00 ? 84  LEU A H    7  
ATOM 11281 H HA   . LEU A 1 84  ? 4.209   -1.456  -0.637  1.00 0.00 ? 84  LEU A HA   7  
ATOM 11282 H HB2  . LEU A 1 84  ? 3.846   -1.755  2.321   1.00 0.00 ? 84  LEU A HB2  7  
ATOM 11283 H HB3  . LEU A 1 84  ? 3.131   -0.393  1.459   1.00 0.00 ? 84  LEU A HB3  7  
ATOM 11284 H HG   . LEU A 1 84  ? 2.577   -3.282  0.797   1.00 0.00 ? 84  LEU A HG   7  
ATOM 11285 H HD11 . LEU A 1 84  ? 1.728   -1.845  3.052   1.00 0.00 ? 84  LEU A HD11 7  
ATOM 11286 H HD12 . LEU A 1 84  ? 1.114   -3.388  2.458   1.00 0.00 ? 84  LEU A HD12 7  
ATOM 11287 H HD13 . LEU A 1 84  ? 0.357   -1.880  1.943   1.00 0.00 ? 84  LEU A HD13 7  
ATOM 11288 H HD21 . LEU A 1 84  ? 1.445   -0.654  -0.115  1.00 0.00 ? 84  LEU A HD21 7  
ATOM 11289 H HD22 . LEU A 1 84  ? 0.553   -2.167  -0.279  1.00 0.00 ? 84  LEU A HD22 7  
ATOM 11290 H HD23 . LEU A 1 84  ? 2.107   -1.967  -1.089  1.00 0.00 ? 84  LEU A HD23 7  
ATOM 11291 N N    . LYS A 1 85  ? 6.136   -0.098  1.685   1.00 0.00 ? 85  LYS A N    7  
ATOM 11292 C CA   . LYS A 1 85  ? 7.003   1.038   1.971   1.00 0.00 ? 85  LYS A CA   7  
ATOM 11293 C C    . LYS A 1 85  ? 7.913   1.340   0.785   1.00 0.00 ? 85  LYS A C    7  
ATOM 11294 O O    . LYS A 1 85  ? 7.987   2.478   0.321   1.00 0.00 ? 85  LYS A O    7  
ATOM 11295 C CB   . LYS A 1 85  ? 7.847   0.761   3.217   1.00 0.00 ? 85  LYS A CB   7  
ATOM 11296 C CG   . LYS A 1 85  ? 7.077   0.907   4.518   1.00 0.00 ? 85  LYS A CG   7  
ATOM 11297 C CD   . LYS A 1 85  ? 7.875   0.382   5.700   1.00 0.00 ? 85  LYS A CD   7  
ATOM 11298 C CE   . LYS A 1 85  ? 8.836   1.433   6.234   1.00 0.00 ? 85  LYS A CE   7  
ATOM 11299 N NZ   . LYS A 1 85  ? 8.118   2.564   6.884   1.00 0.00 ? 85  LYS A NZ   7  
ATOM 11300 H H    . LYS A 1 85  ? 6.030   -0.801  2.361   1.00 0.00 ? 85  LYS A H    7  
ATOM 11301 H HA   . LYS A 1 85  ? 6.375   1.897   2.155   1.00 0.00 ? 85  LYS A HA   7  
ATOM 11302 H HB2  . LYS A 1 85  ? 8.230   -0.247  3.161   1.00 0.00 ? 85  LYS A HB2  7  
ATOM 11303 H HB3  . LYS A 1 85  ? 8.678   1.452   3.236   1.00 0.00 ? 85  LYS A HB3  7  
ATOM 11304 H HG2  . LYS A 1 85  ? 6.858   1.952   4.681   1.00 0.00 ? 85  LYS A HG2  7  
ATOM 11305 H HG3  . LYS A 1 85  ? 6.153   0.351   4.443   1.00 0.00 ? 85  LYS A HG3  7  
ATOM 11306 H HD2  . LYS A 1 85  ? 7.192   0.102   6.489   1.00 0.00 ? 85  LYS A HD2  7  
ATOM 11307 H HD3  . LYS A 1 85  ? 8.440   -0.484  5.386   1.00 0.00 ? 85  LYS A HD3  7  
ATOM 11308 H HE2  . LYS A 1 85  ? 9.489   0.969   6.958   1.00 0.00 ? 85  LYS A HE2  7  
ATOM 11309 H HE3  . LYS A 1 85  ? 9.424   1.815   5.412   1.00 0.00 ? 85  LYS A HE3  7  
ATOM 11310 H HZ1  . LYS A 1 85  ? 7.396   2.945   6.239   1.00 0.00 ? 85  LYS A HZ1  7  
ATOM 11311 H HZ2  . LYS A 1 85  ? 8.788   3.322   7.124   1.00 0.00 ? 85  LYS A HZ2  7  
ATOM 11312 H HZ3  . LYS A 1 85  ? 7.652   2.238   7.755   1.00 0.00 ? 85  LYS A HZ3  7  
ATOM 11313 N N    . ASP A 1 86  ? 8.602   0.314   0.297   1.00 0.00 ? 86  ASP A N    7  
ATOM 11314 C CA   . ASP A 1 86  ? 9.505   0.469   -0.837  1.00 0.00 ? 86  ASP A CA   7  
ATOM 11315 C C    . ASP A 1 86  ? 8.754   0.978   -2.063  1.00 0.00 ? 86  ASP A C    7  
ATOM 11316 O O    . ASP A 1 86  ? 9.184   1.930   -2.716  1.00 0.00 ? 86  ASP A O    7  
ATOM 11317 C CB   . ASP A 1 86  ? 10.188  -0.861  -1.158  1.00 0.00 ? 86  ASP A CB   7  
ATOM 11318 C CG   . ASP A 1 86  ? 11.202  -0.736  -2.278  1.00 0.00 ? 86  ASP A CG   7  
ATOM 11319 O OD1  . ASP A 1 86  ? 12.062  0.167   -2.202  1.00 0.00 ? 86  ASP A OD1  7  
ATOM 11320 O OD2  . ASP A 1 86  ? 11.137  -1.541  -3.230  1.00 0.00 ? 86  ASP A OD2  7  
ATOM 11321 H H    . ASP A 1 86  ? 8.500   -0.569  0.710   1.00 0.00 ? 86  ASP A H    7  
ATOM 11322 H HA   . ASP A 1 86  ? 10.258  1.193   -0.565  1.00 0.00 ? 86  ASP A HA   7  
ATOM 11323 H HB2  . ASP A 1 86  ? 10.698  -1.219  -0.275  1.00 0.00 ? 86  ASP A HB2  7  
ATOM 11324 H HB3  . ASP A 1 86  ? 9.439   -1.581  -1.454  1.00 0.00 ? 86  ASP A HB3  7  
ATOM 11325 N N    . PHE A 1 87  ? 7.632   0.338   -2.372  1.00 0.00 ? 87  PHE A N    7  
ATOM 11326 C CA   . PHE A 1 87  ? 6.822   0.725   -3.522  1.00 0.00 ? 87  PHE A CA   7  
ATOM 11327 C C    . PHE A 1 87  ? 6.465   2.207   -3.462  1.00 0.00 ? 87  PHE A C    7  
ATOM 11328 O O    . PHE A 1 87  ? 6.682   2.949   -4.421  1.00 0.00 ? 87  PHE A O    7  
ATOM 11329 C CB   . PHE A 1 87  ? 5.546   -0.117  -3.580  1.00 0.00 ? 87  PHE A CB   7  
ATOM 11330 C CG   . PHE A 1 87  ? 5.716   -1.416  -4.315  1.00 0.00 ? 87  PHE A CG   7  
ATOM 11331 C CD1  . PHE A 1 87  ? 6.709   -2.309  -3.947  1.00 0.00 ? 87  PHE A CD1  7  
ATOM 11332 C CD2  . PHE A 1 87  ? 4.884   -1.743  -5.373  1.00 0.00 ? 87  PHE A CD2  7  
ATOM 11333 C CE1  . PHE A 1 87  ? 6.869   -3.505  -4.623  1.00 0.00 ? 87  PHE A CE1  7  
ATOM 11334 C CE2  . PHE A 1 87  ? 5.038   -2.937  -6.052  1.00 0.00 ? 87  PHE A CE2  7  
ATOM 11335 C CZ   . PHE A 1 87  ? 6.032   -3.819  -5.675  1.00 0.00 ? 87  PHE A CZ   7  
ATOM 11336 H H    . PHE A 1 87  ? 7.341   -0.414  -1.814  1.00 0.00 ? 87  PHE A H    7  
ATOM 11337 H HA   . PHE A 1 87  ? 7.404   0.542   -4.412  1.00 0.00 ? 87  PHE A HA   7  
ATOM 11338 H HB2  . PHE A 1 87  ? 5.228   -0.345  -2.574  1.00 0.00 ? 87  PHE A HB2  7  
ATOM 11339 H HB3  . PHE A 1 87  ? 4.773   0.449   -4.077  1.00 0.00 ? 87  PHE A HB3  7  
ATOM 11340 H HD1  . PHE A 1 87  ? 7.364   -2.065  -3.124  1.00 0.00 ? 87  PHE A HD1  7  
ATOM 11341 H HD2  . PHE A 1 87  ? 4.105   -1.053  -5.668  1.00 0.00 ? 87  PHE A HD2  7  
ATOM 11342 H HE1  . PHE A 1 87  ? 7.646   -4.193  -4.327  1.00 0.00 ? 87  PHE A HE1  7  
ATOM 11343 H HE2  . PHE A 1 87  ? 4.382   -3.179  -6.874  1.00 0.00 ? 87  PHE A HE2  7  
ATOM 11344 H HZ   . PHE A 1 87  ? 6.155   -4.752  -6.205  1.00 0.00 ? 87  PHE A HZ   7  
ATOM 11345 N N    . LEU A 1 88  ? 5.916   2.631   -2.329  1.00 0.00 ? 88  LEU A N    7  
ATOM 11346 C CA   . LEU A 1 88  ? 5.528   4.025   -2.142  1.00 0.00 ? 88  LEU A CA   7  
ATOM 11347 C C    . LEU A 1 88  ? 6.730   4.951   -2.301  1.00 0.00 ? 88  LEU A C    7  
ATOM 11348 O O    . LEU A 1 88  ? 6.621   6.031   -2.882  1.00 0.00 ? 88  LEU A O    7  
ATOM 11349 C CB   . LEU A 1 88  ? 4.900   4.219   -0.761  1.00 0.00 ? 88  LEU A CB   7  
ATOM 11350 C CG   . LEU A 1 88  ? 3.609   3.443   -0.496  1.00 0.00 ? 88  LEU A CG   7  
ATOM 11351 C CD1  . LEU A 1 88  ? 3.360   3.318   0.999   1.00 0.00 ? 88  LEU A CD1  7  
ATOM 11352 C CD2  . LEU A 1 88  ? 2.430   4.118   -1.181  1.00 0.00 ? 88  LEU A CD2  7  
ATOM 11353 H H    . LEU A 1 88  ? 5.768   1.993   -1.600  1.00 0.00 ? 88  LEU A H    7  
ATOM 11354 H HA   . LEU A 1 88  ? 4.798   4.270   -2.899  1.00 0.00 ? 88  LEU A HA   7  
ATOM 11355 H HB2  . LEU A 1 88  ? 5.625   3.917   -0.022  1.00 0.00 ? 88  LEU A HB2  7  
ATOM 11356 H HB3  . LEU A 1 88  ? 4.684   5.272   -0.642  1.00 0.00 ? 88  LEU A HB3  7  
ATOM 11357 H HG   . LEU A 1 88  ? 3.707   2.445   -0.902  1.00 0.00 ? 88  LEU A HG   7  
ATOM 11358 H HD11 . LEU A 1 88  ? 4.283   3.480   1.533   1.00 0.00 ? 88  LEU A HD11 7  
ATOM 11359 H HD12 . LEU A 1 88  ? 2.985   2.329   1.220   1.00 0.00 ? 88  LEU A HD12 7  
ATOM 11360 H HD13 . LEU A 1 88  ? 2.632   4.055   1.305   1.00 0.00 ? 88  LEU A HD13 7  
ATOM 11361 H HD21 . LEU A 1 88  ? 1.553   4.028   -0.558  1.00 0.00 ? 88  LEU A HD21 7  
ATOM 11362 H HD22 . LEU A 1 88  ? 2.246   3.641   -2.133  1.00 0.00 ? 88  LEU A HD22 7  
ATOM 11363 H HD23 . LEU A 1 88  ? 2.655   5.162   -1.338  1.00 0.00 ? 88  LEU A HD23 7  
ATOM 11364 N N    . SER A 1 89  ? 7.875   4.520   -1.784  1.00 0.00 ? 89  SER A N    7  
ATOM 11365 C CA   . SER A 1 89  ? 9.098   5.311   -1.867  1.00 0.00 ? 89  SER A CA   7  
ATOM 11366 C C    . SER A 1 89  ? 9.465   5.591   -3.321  1.00 0.00 ? 89  SER A C    7  
ATOM 11367 O O    . SER A 1 89  ? 9.913   6.687   -3.658  1.00 0.00 ? 89  SER A O    7  
ATOM 11368 C CB   . SER A 1 89  ? 10.249  4.584   -1.168  1.00 0.00 ? 89  SER A CB   7  
ATOM 11369 O OG   . SER A 1 89  ? 11.287  5.486   -0.825  1.00 0.00 ? 89  SER A OG   7  
ATOM 11370 H H    . SER A 1 89  ? 7.898   3.650   -1.333  1.00 0.00 ? 89  SER A H    7  
ATOM 11371 H HA   . SER A 1 89  ? 8.919   6.250   -1.365  1.00 0.00 ? 89  SER A HA   7  
ATOM 11372 H HB2  . SER A 1 89  ? 9.882   4.116   -0.268  1.00 0.00 ? 89  SER A HB2  7  
ATOM 11373 H HB3  . SER A 1 89  ? 10.648  3.829   -1.830  1.00 0.00 ? 89  SER A HB3  7  
ATOM 11374 H HG   . SER A 1 89  ? 12.099  5.220   -1.261  1.00 0.00 ? 89  SER A HG   7  
ATOM 11375 N N    . GLN A 1 90  ? 9.273   4.592   -4.176  1.00 0.00 ? 90  GLN A N    7  
ATOM 11376 C CA   . GLN A 1 90  ? 9.585   4.731   -5.594  1.00 0.00 ? 90  GLN A CA   7  
ATOM 11377 C C    . GLN A 1 90  ? 8.825   5.902   -6.207  1.00 0.00 ? 90  GLN A C    7  
ATOM 11378 O O    . GLN A 1 90  ? 7.688   6.197   -5.838  1.00 0.00 ? 90  GLN A O    7  
ATOM 11379 C CB   . GLN A 1 90  ? 9.244   3.440   -6.341  1.00 0.00 ? 90  GLN A CB   7  
ATOM 11380 C CG   . GLN A 1 90  ? 10.003  2.225   -5.833  1.00 0.00 ? 90  GLN A CG   7  
ATOM 11381 C CD   . GLN A 1 90  ? 10.113  1.128   -6.874  1.00 0.00 ? 90  GLN A CD   7  
ATOM 11382 O OE1  . GLN A 1 90  ? 10.087  1.393   -8.076  1.00 0.00 ? 90  GLN A OE1  7  
ATOM 11383 N NE2  . GLN A 1 90  ? 10.238  -0.112  -6.416  1.00 0.00 ? 90  GLN A NE2  7  
ATOM 11384 H H    . GLN A 1 90  ? 8.913   3.743   -3.847  1.00 0.00 ? 90  GLN A H    7  
ATOM 11385 H HA   . GLN A 1 90  ? 10.644  4.919   -5.683  1.00 0.00 ? 90  GLN A HA   7  
ATOM 11386 H HB2  . GLN A 1 90  ? 8.187   3.247   -6.238  1.00 0.00 ? 90  GLN A HB2  7  
ATOM 11387 H HB3  . GLN A 1 90  ? 9.478   3.571   -7.387  1.00 0.00 ? 90  GLN A HB3  7  
ATOM 11388 H HG2  . GLN A 1 90  ? 10.999  2.531   -5.548  1.00 0.00 ? 90  GLN A HG2  7  
ATOM 11389 H HG3  . GLN A 1 90  ? 9.488   1.831   -4.969  1.00 0.00 ? 90  GLN A HG3  7  
ATOM 11390 H HE21 . GLN A 1 90  ? 10.251  -0.248  -5.445  1.00 0.00 ? 90  GLN A HE21 7  
ATOM 11391 H HE22 . GLN A 1 90  ? 10.311  -0.841  -7.067  1.00 0.00 ? 90  GLN A HE22 7  
ATOM 11392 N N    . PRO A 1 91  ? 9.466   6.588   -7.165  1.00 0.00 ? 91  PRO A N    7  
ATOM 11393 C CA   . PRO A 1 91  ? 8.869   7.738   -7.850  1.00 0.00 ? 91  PRO A CA   7  
ATOM 11394 C C    . PRO A 1 91  ? 7.721   7.334   -8.769  1.00 0.00 ? 91  PRO A C    7  
ATOM 11395 O O    . PRO A 1 91  ? 6.862   8.151   -9.101  1.00 0.00 ? 91  PRO A O    7  
ATOM 11396 C CB   . PRO A 1 91  ? 10.032  8.309   -8.665  1.00 0.00 ? 91  PRO A CB   7  
ATOM 11397 C CG   . PRO A 1 91  ? 10.946  7.152   -8.881  1.00 0.00 ? 91  PRO A CG   7  
ATOM 11398 C CD   . PRO A 1 91  ? 10.823  6.292   -7.655  1.00 0.00 ? 91  PRO A CD   7  
ATOM 11399 H HA   . PRO A 1 91  ? 8.521   8.481   -7.147  1.00 0.00 ? 91  PRO A HA   7  
ATOM 11400 H HB2  . PRO A 1 91  ? 9.660   8.701   -9.601  1.00 0.00 ? 91  PRO A HB2  7  
ATOM 11401 H HB3  . PRO A 1 91  ? 10.516  9.095   -8.106  1.00 0.00 ? 91  PRO A HB3  7  
ATOM 11402 H HG2  . PRO A 1 91  ? 10.640  6.602   -9.758  1.00 0.00 ? 91  PRO A HG2  7  
ATOM 11403 H HG3  . PRO A 1 91  ? 11.961  7.503   -8.992  1.00 0.00 ? 91  PRO A HG3  7  
ATOM 11404 H HD2  . PRO A 1 91  ? 10.920  5.248   -7.915  1.00 0.00 ? 91  PRO A HD2  7  
ATOM 11405 H HD3  . PRO A 1 91  ? 11.565  6.571   -6.922  1.00 0.00 ? 91  PRO A HD3  7  
ATOM 11406 N N    . SER A 1 92  ? 7.714   6.069   -9.178  1.00 0.00 ? 92  SER A N    7  
ATOM 11407 C CA   . SER A 1 92  ? 6.674   5.558   -10.063 1.00 0.00 ? 92  SER A CA   7  
ATOM 11408 C C    . SER A 1 92  ? 5.981   4.348   -9.444  1.00 0.00 ? 92  SER A C    7  
ATOM 11409 O O    . SER A 1 92  ? 6.610   3.540   -8.759  1.00 0.00 ? 92  SER A O    7  
ATOM 11410 C CB   . SER A 1 92  ? 7.269   5.180   -11.420 1.00 0.00 ? 92  SER A CB   7  
ATOM 11411 O OG   . SER A 1 92  ? 7.916   3.921   -11.361 1.00 0.00 ? 92  SER A OG   7  
ATOM 11412 H H    . SER A 1 92  ? 8.427   5.467   -8.879  1.00 0.00 ? 92  SER A H    7  
ATOM 11413 H HA   . SER A 1 92  ? 5.944   6.342   -10.205 1.00 0.00 ? 92  SER A HA   7  
ATOM 11414 H HB2  . SER A 1 92  ? 6.480   5.132   -12.156 1.00 0.00 ? 92  SER A HB2  7  
ATOM 11415 H HB3  . SER A 1 92  ? 7.990   5.929   -11.715 1.00 0.00 ? 92  SER A HB3  7  
ATOM 11416 H HG   . SER A 1 92  ? 7.359   3.255   -11.769 1.00 0.00 ? 92  SER A HG   7  
ATOM 11417 N N    . LEU A 1 93  ? 4.681   4.228   -9.690  1.00 0.00 ? 93  LEU A N    7  
ATOM 11418 C CA   . LEU A 1 93  ? 3.900   3.117   -9.157  1.00 0.00 ? 93  LEU A CA   7  
ATOM 11419 C C    . LEU A 1 93  ? 2.771   2.739   -10.110 1.00 0.00 ? 93  LEU A C    7  
ATOM 11420 O O    . LEU A 1 93  ? 2.271   3.576   -10.860 1.00 0.00 ? 93  LEU A O    7  
ATOM 11421 C CB   . LEU A 1 93  ? 3.327   3.481   -7.787  1.00 0.00 ? 93  LEU A CB   7  
ATOM 11422 C CG   . LEU A 1 93  ? 4.256   3.269   -6.592  1.00 0.00 ? 93  LEU A CG   7  
ATOM 11423 C CD1  . LEU A 1 93  ? 3.678   3.916   -5.344  1.00 0.00 ? 93  LEU A CD1  7  
ATOM 11424 C CD2  . LEU A 1 93  ? 4.499   1.784   -6.361  1.00 0.00 ? 93  LEU A CD2  7  
ATOM 11425 H H    . LEU A 1 93  ? 4.234   4.903   -10.242 1.00 0.00 ? 93  LEU A H    7  
ATOM 11426 H HA   . LEU A 1 93  ? 4.562   2.270   -9.048  1.00 0.00 ? 93  LEU A HA   7  
ATOM 11427 H HB2  . LEU A 1 93  ? 3.051   4.524   -7.810  1.00 0.00 ? 93  LEU A HB2  7  
ATOM 11428 H HB3  . LEU A 1 93  ? 2.442   2.880   -7.630  1.00 0.00 ? 93  LEU A HB3  7  
ATOM 11429 H HG   . LEU A 1 93  ? 5.210   3.736   -6.798  1.00 0.00 ? 93  LEU A HG   7  
ATOM 11430 H HD11 . LEU A 1 93  ? 3.964   3.343   -4.475  1.00 0.00 ? 93  LEU A HD11 7  
ATOM 11431 H HD12 . LEU A 1 93  ? 2.601   3.943   -5.418  1.00 0.00 ? 93  LEU A HD12 7  
ATOM 11432 H HD13 . LEU A 1 93  ? 4.057   4.924   -5.252  1.00 0.00 ? 93  LEU A HD13 7  
ATOM 11433 H HD21 . LEU A 1 93  ? 5.310   1.657   -5.660  1.00 0.00 ? 93  LEU A HD21 7  
ATOM 11434 H HD22 . LEU A 1 93  ? 4.756   1.312   -7.299  1.00 0.00 ? 93  LEU A HD22 7  
ATOM 11435 H HD23 . LEU A 1 93  ? 3.603   1.331   -5.963  1.00 0.00 ? 93  LEU A HD23 7  
ATOM 11436 N N    . GLY A 1 94  ? 2.372   1.471   -10.074 1.00 0.00 ? 94  GLY A N    7  
ATOM 11437 C CA   . GLY A 1 94  ? 1.303   1.005   -10.937 1.00 0.00 ? 94  GLY A CA   7  
ATOM 11438 C C    . GLY A 1 94  ? 0.209   0.288   -10.170 1.00 0.00 ? 94  GLY A C    7  
ATOM 11439 O O    . GLY A 1 94  ? 0.371   -0.869  -9.778  1.00 0.00 ? 94  GLY A O    7  
ATOM 11440 H H    . GLY A 1 94  ? 2.807   0.847   -9.455  1.00 0.00 ? 94  GLY A H    7  
ATOM 11441 H HA2  . GLY A 1 94  ? 0.873   1.852   -11.449 1.00 0.00 ? 94  GLY A HA2  7  
ATOM 11442 H HA3  . GLY A 1 94  ? 1.717   0.327   -11.669 1.00 0.00 ? 94  GLY A HA3  7  
ATOM 11443 N N    . LEU A 1 95  ? -0.907  0.974   -9.954  1.00 0.00 ? 95  LEU A N    7  
ATOM 11444 C CA   . LEU A 1 95  ? -2.032  0.396   -9.227  1.00 0.00 ? 95  LEU A CA   7  
ATOM 11445 C C    . LEU A 1 95  ? -3.072  -0.167  -10.191 1.00 0.00 ? 95  LEU A C    7  
ATOM 11446 O O    . LEU A 1 95  ? -3.124  0.218   -11.360 1.00 0.00 ? 95  LEU A O    7  
ATOM 11447 C CB   . LEU A 1 95  ? -2.676  1.450   -8.324  1.00 0.00 ? 95  LEU A CB   7  
ATOM 11448 C CG   . LEU A 1 95  ? -1.755  2.103   -7.293  1.00 0.00 ? 95  LEU A CG   7  
ATOM 11449 C CD1  . LEU A 1 95  ? -2.477  3.230   -6.570  1.00 0.00 ? 95  LEU A CD1  7  
ATOM 11450 C CD2  . LEU A 1 95  ? -1.247  1.068   -6.299  1.00 0.00 ? 95  LEU A CD2  7  
ATOM 11451 H H    . LEU A 1 95  ? -0.978  1.891   -10.291 1.00 0.00 ? 95  LEU A H    7  
ATOM 11452 H HA   . LEU A 1 95  ? -1.653  -0.408  -8.615  1.00 0.00 ? 95  LEU A HA   7  
ATOM 11453 H HB2  . LEU A 1 95  ? -3.071  2.230   -8.955  1.00 0.00 ? 95  LEU A HB2  7  
ATOM 11454 H HB3  . LEU A 1 95  ? -3.487  0.975   -7.790  1.00 0.00 ? 95  LEU A HB3  7  
ATOM 11455 H HG   . LEU A 1 95  ? -0.900  2.528   -7.801  1.00 0.00 ? 95  LEU A HG   7  
ATOM 11456 H HD11 . LEU A 1 95  ? -2.879  3.922   -7.294  1.00 0.00 ? 95  LEU A HD11 7  
ATOM 11457 H HD12 . LEU A 1 95  ? -1.783  3.746   -5.924  1.00 0.00 ? 95  LEU A HD12 7  
ATOM 11458 H HD13 . LEU A 1 95  ? -3.282  2.819   -5.978  1.00 0.00 ? 95  LEU A HD13 7  
ATOM 11459 H HD21 . LEU A 1 95  ? -0.385  0.567   -6.712  1.00 0.00 ? 95  LEU A HD21 7  
ATOM 11460 H HD22 . LEU A 1 95  ? -2.026  0.344   -6.105  1.00 0.00 ? 95  LEU A HD22 7  
ATOM 11461 H HD23 . LEU A 1 95  ? -0.973  1.559   -5.377  1.00 0.00 ? 95  LEU A HD23 7  
ATOM 11462 N N    . LEU A 1 96  ? -3.899  -1.080  -9.693  1.00 0.00 ? 96  LEU A N    7  
ATOM 11463 C CA   . LEU A 1 96  ? -4.939  -1.696  -10.509 1.00 0.00 ? 96  LEU A CA   7  
ATOM 11464 C C    . LEU A 1 96  ? -6.272  -1.717  -9.767  1.00 0.00 ? 96  LEU A C    7  
ATOM 11465 O O    . LEU A 1 96  ? -6.509  -2.579  -8.921  1.00 0.00 ? 96  LEU A O    7  
ATOM 11466 C CB   . LEU A 1 96  ? -4.535  -3.119  -10.897 1.00 0.00 ? 96  LEU A CB   7  
ATOM 11467 C CG   . LEU A 1 96  ? -5.524  -3.880  -11.782 1.00 0.00 ? 96  LEU A CG   7  
ATOM 11468 C CD1  . LEU A 1 96  ? -5.342  -3.492  -13.241 1.00 0.00 ? 96  LEU A CD1  7  
ATOM 11469 C CD2  . LEU A 1 96  ? -5.354  -5.381  -11.602 1.00 0.00 ? 96  LEU A CD2  7  
ATOM 11470 H H    . LEU A 1 96  ? -3.808  -1.347  -8.755  1.00 0.00 ? 96  LEU A H    7  
ATOM 11471 H HA   . LEU A 1 96  ? -5.050  -1.105  -11.406 1.00 0.00 ? 96  LEU A HA   7  
ATOM 11472 H HB2  . LEU A 1 96  ? -3.595  -3.064  -11.424 1.00 0.00 ? 96  LEU A HB2  7  
ATOM 11473 H HB3  . LEU A 1 96  ? -4.403  -3.684  -9.985  1.00 0.00 ? 96  LEU A HB3  7  
ATOM 11474 H HG   . LEU A 1 96  ? -6.532  -3.619  -11.491 1.00 0.00 ? 96  LEU A HG   7  
ATOM 11475 H HD11 . LEU A 1 96  ? -5.829  -4.221  -13.870 1.00 0.00 ? 96  LEU A HD11 7  
ATOM 11476 H HD12 . LEU A 1 96  ? -4.289  -3.459  -13.476 1.00 0.00 ? 96  LEU A HD12 7  
ATOM 11477 H HD13 . LEU A 1 96  ? -5.779  -2.519  -13.412 1.00 0.00 ? 96  LEU A HD13 7  
ATOM 11478 H HD21 . LEU A 1 96  ? -5.746  -5.675  -10.639 1.00 0.00 ? 96  LEU A HD21 7  
ATOM 11479 H HD22 . LEU A 1 96  ? -4.305  -5.634  -11.655 1.00 0.00 ? 96  LEU A HD22 7  
ATOM 11480 H HD23 . LEU A 1 96  ? -5.890  -5.900  -12.382 1.00 0.00 ? 96  LEU A HD23 7  
ATOM 11481 N N    . VAL A 1 97  ? -7.140  -0.764  -10.092 1.00 0.00 ? 97  VAL A N    7  
ATOM 11482 C CA   . VAL A 1 97  ? -8.450  -0.675  -9.459  1.00 0.00 ? 97  VAL A CA   7  
ATOM 11483 C C    . VAL A 1 97  ? -9.561  -1.021  -10.444 1.00 0.00 ? 97  VAL A C    7  
ATOM 11484 O O    . VAL A 1 97  ? -9.359  -0.993  -11.658 1.00 0.00 ? 97  VAL A O    7  
ATOM 11485 C CB   . VAL A 1 97  ? -8.704  0.733   -8.890  1.00 0.00 ? 97  VAL A CB   7  
ATOM 11486 C CG1  . VAL A 1 97  ? -7.799  0.998   -7.696  1.00 0.00 ? 97  VAL A CG1  7  
ATOM 11487 C CG2  . VAL A 1 97  ? -8.502  1.787   -9.967  1.00 0.00 ? 97  VAL A CG2  7  
ATOM 11488 H H    . VAL A 1 97  ? -6.893  -0.105  -10.774 1.00 0.00 ? 97  VAL A H    7  
ATOM 11489 H HA   . VAL A 1 97  ? -8.474  -1.381  -8.641  1.00 0.00 ? 97  VAL A HA   7  
ATOM 11490 H HB   . VAL A 1 97  ? -9.729  0.784   -8.554  1.00 0.00 ? 97  VAL A HB   7  
ATOM 11491 H HG11 . VAL A 1 97  ? -8.105  1.912   -7.209  1.00 0.00 ? 97  VAL A HG11 7  
ATOM 11492 H HG12 . VAL A 1 97  ? -7.871  0.176   -7.000  1.00 0.00 ? 97  VAL A HG12 7  
ATOM 11493 H HG13 . VAL A 1 97  ? -6.778  1.096   -8.034  1.00 0.00 ? 97  VAL A HG13 7  
ATOM 11494 H HG21 . VAL A 1 97  ? -9.438  2.292   -10.157 1.00 0.00 ? 97  VAL A HG21 7  
ATOM 11495 H HG22 . VAL A 1 97  ? -7.767  2.506   -9.635  1.00 0.00 ? 97  VAL A HG22 7  
ATOM 11496 H HG23 . VAL A 1 97  ? -8.157  1.314   -10.875 1.00 0.00 ? 97  VAL A HG23 7  
ATOM 11497 N N    . ARG A 1 98  ? -10.734 -1.348  -9.913  1.00 0.00 ? 98  ARG A N    7  
ATOM 11498 C CA   . ARG A 1 98  ? -11.878 -1.701  -10.746 1.00 0.00 ? 98  ARG A CA   7  
ATOM 11499 C C    . ARG A 1 98  ? -12.720 -0.468  -11.063 1.00 0.00 ? 98  ARG A C    7  
ATOM 11500 O O    . ARG A 1 98  ? -12.912 0.402   -10.214 1.00 0.00 ? 98  ARG A O    7  
ATOM 11501 C CB   . ARG A 1 98  ? -12.740 -2.753  -10.046 1.00 0.00 ? 98  ARG A CB   7  
ATOM 11502 C CG   . ARG A 1 98  ? -13.468 -3.680  -11.006 1.00 0.00 ? 98  ARG A CG   7  
ATOM 11503 C CD   . ARG A 1 98  ? -13.716 -5.045  -10.382 1.00 0.00 ? 98  ARG A CD   7  
ATOM 11504 N NE   . ARG A 1 98  ? -14.702 -5.818  -11.132 1.00 0.00 ? 98  ARG A NE   7  
ATOM 11505 C CZ   . ARG A 1 98  ? -15.084 -7.045  -10.796 1.00 0.00 ? 98  ARG A CZ   7  
ATOM 11506 N NH1  . ARG A 1 98  ? -14.565 -7.636  -9.729  1.00 0.00 ? 98  ARG A NH1  7  
ATOM 11507 N NH2  . ARG A 1 98  ? -15.986 -7.685  -11.529 1.00 0.00 ? 98  ARG A NH2  7  
ATOM 11508 H H    . ARG A 1 98  ? -10.834 -1.353  -8.938  1.00 0.00 ? 98  ARG A H    7  
ATOM 11509 H HA   . ARG A 1 98  ? -11.501 -2.113  -11.670 1.00 0.00 ? 98  ARG A HA   7  
ATOM 11510 H HB2  . ARG A 1 98  ? -12.108 -3.355  -9.410  1.00 0.00 ? 98  ARG A HB2  7  
ATOM 11511 H HB3  . ARG A 1 98  ? -13.476 -2.251  -9.437  1.00 0.00 ? 98  ARG A HB3  7  
ATOM 11512 H HG2  . ARG A 1 98  ? -14.417 -3.239  -11.269 1.00 0.00 ? 98  ARG A HG2  7  
ATOM 11513 H HG3  . ARG A 1 98  ? -12.868 -3.805  -11.896 1.00 0.00 ? 98  ARG A HG3  7  
ATOM 11514 H HD2  . ARG A 1 98  ? -12.785 -5.591  -10.361 1.00 0.00 ? 98  ARG A HD2  7  
ATOM 11515 H HD3  . ARG A 1 98  ? -14.074 -4.904  -9.373  1.00 0.00 ? 98  ARG A HD3  7  
ATOM 11516 H HE   . ARG A 1 98  ? -15.099 -5.401  -11.925 1.00 0.00 ? 98  ARG A HE   7  
ATOM 11517 H HH11 . ARG A 1 98  ? -13.885 -7.156  -9.174  1.00 0.00 ? 98  ARG A HH11 7  
ATOM 11518 H HH12 . ARG A 1 98  ? -14.854 -8.559  -9.477  1.00 0.00 ? 98  ARG A HH12 7  
ATOM 11519 H HH21 . ARG A 1 98  ? -16.380 -7.243  -12.335 1.00 0.00 ? 98  ARG A HH21 7  
ATOM 11520 H HH22 . ARG A 1 98  ? -16.273 -8.608  -11.276 1.00 0.00 ? 98  ARG A HH22 7  
ATOM 11521 N N    . THR A 1 99  ? -13.220 -0.400  -12.294 1.00 0.00 ? 99  THR A N    7  
ATOM 11522 C CA   . THR A 1 99  ? -14.039 0.726   -12.725 1.00 0.00 ? 99  THR A CA   7  
ATOM 11523 C C    . THR A 1 99  ? -15.147 0.270   -13.667 1.00 0.00 ? 99  THR A C    7  
ATOM 11524 O O    . THR A 1 99  ? -15.096 -0.832  -14.214 1.00 0.00 ? 99  THR A O    7  
ATOM 11525 C CB   . THR A 1 99  ? -13.190 1.800   -13.430 1.00 0.00 ? 99  THR A CB   7  
ATOM 11526 O OG1  . THR A 1 99  ? -13.912 3.036   -13.485 1.00 0.00 ? 99  THR A OG1  7  
ATOM 11527 C CG2  . THR A 1 99  ? -12.821 1.360   -14.838 1.00 0.00 ? 99  THR A CG2  7  
ATOM 11528 H H    . THR A 1 99  ? -13.031 -1.125  -12.926 1.00 0.00 ? 99  THR A H    7  
ATOM 11529 H HA   . THR A 1 99  ? -14.485 1.169   -11.846 1.00 0.00 ? 99  THR A HA   7  
ATOM 11530 H HB   . THR A 1 99  ? -12.281 1.948   -12.865 1.00 0.00 ? 99  THR A HB   7  
ATOM 11531 H HG1  . THR A 1 99  ? -14.247 3.250   -12.611 1.00 0.00 ? 99  THR A HG1  7  
ATOM 11532 H HG21 . THR A 1 99  ? -11.878 1.806   -15.120 1.00 0.00 ? 99  THR A HG21 7  
ATOM 11533 H HG22 . THR A 1 99  ? -13.589 1.677   -15.528 1.00 0.00 ? 99  THR A HG22 7  
ATOM 11534 H HG23 . THR A 1 99  ? -12.732 0.284   -14.867 1.00 0.00 ? 99  THR A HG23 7  
ATOM 11535 N N    . TYR A 1 100 ? -16.147 1.124   -13.853 1.00 0.00 ? 100 TYR A N    7  
ATOM 11536 C CA   . TYR A 1 100 ? -17.269 0.809   -14.728 1.00 0.00 ? 100 TYR A CA   7  
ATOM 11537 C C    . TYR A 1 100 ? -16.976 1.233   -16.164 1.00 0.00 ? 100 TYR A C    7  
ATOM 11538 O O    . TYR A 1 100 ? -16.521 2.345   -16.430 1.00 0.00 ? 100 TYR A O    7  
ATOM 11539 C CB   . TYR A 1 100 ? -18.541 1.497   -14.231 1.00 0.00 ? 100 TYR A CB   7  
ATOM 11540 C CG   . TYR A 1 100 ? -18.692 1.477   -12.727 1.00 0.00 ? 100 TYR A CG   7  
ATOM 11541 C CD1  . TYR A 1 100 ? -18.073 2.434   -11.933 1.00 0.00 ? 100 TYR A CD1  7  
ATOM 11542 C CD2  . TYR A 1 1