data_2D8X
# 
_entry.id   2D8X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D8X         
RCSB  RCSB025134   
WWPDB D_1000025134 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hss001001107.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D8X 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-08 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, X.R.'                                              1 
'Hayashi, F.'                                            2 
'Yokoyama, S.'                                           3 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 
# 
_citation.id                        primary 
_citation.title                     
;Solution structure of the second LIM domain of particularly interesting new 
Cys-His protein (PINCH)
;
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Qin, X.R.'    1 
primary 'Hayashi, F.'  2 
primary 'Yokoyama, S.' 3 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein PINCH' 7559.577 1 ? ? 'LIM domain' ? 
2 non-polymer syn 'ZINC ION'      65.409   2 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Particularly interesting new Cys-His protein, LIM and senescent cell antigen-like domains 1
 ,PINCH protein
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKASGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hss001001107.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  CYS n 
1 9  HIS n 
1 10 GLN n 
1 11 CYS n 
1 12 GLY n 
1 13 GLU n 
1 14 PHE n 
1 15 ILE n 
1 16 ILE n 
1 17 GLY n 
1 18 ARG n 
1 19 VAL n 
1 20 ILE n 
1 21 LYS n 
1 22 ALA n 
1 23 MET n 
1 24 ASN n 
1 25 ASN n 
1 26 SER n 
1 27 TRP n 
1 28 HIS n 
1 29 PRO n 
1 30 GLU n 
1 31 CYS n 
1 32 PHE n 
1 33 ARG n 
1 34 CYS n 
1 35 ASP n 
1 36 LEU n 
1 37 CYS n 
1 38 GLN n 
1 39 GLU n 
1 40 VAL n 
1 41 LEU n 
1 42 ALA n 
1 43 ASP n 
1 44 ILE n 
1 45 GLY n 
1 46 PHE n 
1 47 VAL n 
1 48 LYS n 
1 49 ASN n 
1 50 ALA n 
1 51 GLY n 
1 52 ARG n 
1 53 HIS n 
1 54 LEU n 
1 55 CYS n 
1 56 ARG n 
1 57 PRO n 
1 58 CYS n 
1 59 HIS n 
1 60 ASN n 
1 61 ARG n 
1 62 GLU n 
1 63 LYS n 
1 64 ALA n 
1 65 SER n 
1 66 GLY n 
1 67 PRO n 
1 68 SER n 
1 69 SER n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 LIMS1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050302-42 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PINC_HUMAN 
_struct_ref.pdbx_db_accession          P48059 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   CHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKA 
_struct_ref.pdbx_align_begin           70 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2D8X 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P48059 
_struct_ref_seq.db_align_beg                  70 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  126 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2D8X GLY A 1  ? UNP P48059 ? ? 'CLONING ARTIFACT' 1  1  
1 2D8X SER A 2  ? UNP P48059 ? ? 'CLONING ARTIFACT' 2  2  
1 2D8X SER A 3  ? UNP P48059 ? ? 'CLONING ARTIFACT' 3  3  
1 2D8X GLY A 4  ? UNP P48059 ? ? 'CLONING ARTIFACT' 4  4  
1 2D8X SER A 5  ? UNP P48059 ? ? 'CLONING ARTIFACT' 5  5  
1 2D8X SER A 6  ? UNP P48059 ? ? 'CLONING ARTIFACT' 6  6  
1 2D8X GLY A 7  ? UNP P48059 ? ? 'CLONING ARTIFACT' 7  7  
1 2D8X SER A 65 ? UNP P48059 ? ? 'CLONING ARTIFACT' 65 8  
1 2D8X GLY A 66 ? UNP P48059 ? ? 'CLONING ARTIFACT' 66 9  
1 2D8X PRO A 67 ? UNP P48059 ? ? 'CLONING ARTIFACT' 67 10 
1 2D8X SER A 68 ? UNP P48059 ? ? 'CLONING ARTIFACT' 68 11 
1 2D8X SER A 69 ? UNP P48059 ? ? 'CLONING ARTIFACT' 69 12 
1 2D8X GLY A 70 ? UNP P48059 ? ? 'CLONING ARTIFACT' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.29mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2+1mM IDA; 90%H2O; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2D8X 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2D8X 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2D8X 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9296   'Kobayashi, N'  4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2D8X 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2D8X 
_struct.title                     
'Solution structure of the second LIM domain of particularly interesting new Cys-His protein (PINCH)' 
_struct.pdbx_descriptor           'Protein PINCH' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D8X 
_struct_keywords.pdbx_keywords   'Structural protein, Cell cycle' 
_struct_keywords.text            
;LIM domain; PINCH protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein, Cell cycle
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       CYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        55 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ALA 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        64 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        CYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         55 
_struct_conf.end_auth_comp_id        ALA 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         64 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 28 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.054 ? 
metalc2 metalc ? ? A CYS 8  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 8  A ZN 201 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc3 metalc ? ? A CYS 11 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 201 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc4 metalc ? ? A CYS 31 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc5 metalc ? ? A CYS 58 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 401 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc6 metalc ? ? A CYS 34 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc7 metalc ? ? A CYS 37 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc8 metalc ? ? A CYS 55 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.243 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 20 ? ALA A 22 ? ILE A 20 ALA A 22 
A 2 ASN A 25 ? TRP A 27 ? ASN A 25 TRP A 27 
B 1 VAL A 47 ? ASN A 49 ? VAL A 47 ASN A 49 
B 2 ARG A 52 ? LEU A 54 ? ARG A 52 LEU A 54 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 22 ? N ALA A 22 O ASN A 25 ? O ASN A 25 
B 1 2 N VAL A 47 ? N VAL A 47 O LEU A 54 ? O LEU A 54 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 8  ? CYS A 8  . ? 1_555 ? 
2 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 
3 AC1 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 
4 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 
5 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 
6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 
7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 
8 AC2 4 CYS A 58 ? CYS A 58 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2D8X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D8X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -29.807 -9.075  2.279   1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -29.081 -9.342  1.051   1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -27.655 -8.829  1.098   1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -26.770 -9.485  1.646   1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -29.315 -8.886  3.106   1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -29.064 -10.408 0.881   1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -29.597 -8.865  0.231   1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -27.432 -7.653  0.519   1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -26.103 -7.055  0.491   1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -26.193 -5.532  0.446   1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -27.224 -4.972  0.074   1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -25.315 -7.567  -0.716  1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -25.093 -8.963  -0.626  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -28.180 -7.178  0.098   1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -25.589 -7.346  1.395   1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -25.870 -7.360  -1.619  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -24.360 -7.064  -0.758  1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -24.916 -9.317  -1.500  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -25.106 -4.870  0.826   1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -25.062 -3.412  0.833   1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -23.847 -2.902  0.064   1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -22.706 -3.191  0.421   1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -25.027 -2.889  2.270   1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -23.910 -3.405  2.974   1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -24.315 -5.374  1.112   1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -25.957 -3.051  0.349   1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -24.962 -1.811  2.257   1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -25.930 -3.189  2.782   1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -23.192 -2.768  2.947   1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -24.103 -2.139  -0.995  1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -23.022 -1.600  -1.799  1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -22.400 -2.641  -2.709  1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -22.442 -3.836  -2.415  1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -25.033 -1.941  -1.233  1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -23.406 -0.792  -2.404  1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -22.258 -1.212  -1.141  1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -21.824 -2.188  -3.817  1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -21.196 -3.090  -4.776  1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -19.681 -3.107  -4.595  1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -19.070 -4.169  -4.485  1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -21.546 -2.673  -6.206  1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -22.930 -2.837  -6.461  1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -21.824 -1.224  -3.996  1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -21.579 -4.084  -4.596  1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -21.287 -1.635  -6.348  1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -20.988 -3.282  -6.902  1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -23.412 -2.082  -6.116  1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -19.082 -1.920  -4.565  1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -17.639 -1.797  -4.401  1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -17.301 -0.828  -3.273  1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -17.369 0.389   -3.442  1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -16.995 -1.322  -5.706  1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -17.029 -2.340  -6.691  1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -19.625 -1.109  -4.659  1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -17.249 -2.772  -4.152  1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -17.530 -0.462  -6.076  1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -15.966 -1.053  -5.518  1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -17.515 -2.027  -7.458  1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -16.936 -1.378  -2.118  1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -16.594 -0.549  -0.977  1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -15.132 -0.666  -0.594  1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -14.508 -1.706  -0.806  1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -16.900 -2.354  -2.041  1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -16.811 0.481   -1.216  1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -17.199 -0.848  -0.134  1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . CYS A 1 8  ? -14.582 0.404   -0.030  1.00 0.00 ? 8   CYS A N    1  
ATOM   67    C  CA   . CYS A 1 8  ? -13.184 0.419   0.382   1.00 0.00 ? 8   CYS A CA   1  
ATOM   68    C  C    . CYS A 1 8  ? -12.934 -0.593  1.496   1.00 0.00 ? 8   CYS A C    1  
ATOM   69    O  O    . CYS A 1 8  ? -13.782 -0.797  2.366   1.00 0.00 ? 8   CYS A O    1  
ATOM   70    C  CB   . CYS A 1 8  ? -12.783 1.819   0.850   1.00 0.00 ? 8   CYS A CB   1  
ATOM   71    S  SG   . CYS A 1 8  ? -11.235 1.868   1.809   1.00 0.00 ? 8   CYS A SG   1  
ATOM   72    H  H    . CYS A 1 8  ? -15.131 1.205   0.113   1.00 0.00 ? 8   CYS A H    1  
ATOM   73    H  HA   . CYS A 1 8  ? -12.583 0.150   -0.473  1.00 0.00 ? 8   CYS A HA   1  
ATOM   74    H  HB2  . CYS A 1 8  ? -12.654 2.456   -0.013  1.00 0.00 ? 8   CYS A HB2  1  
ATOM   75    H  HB3  . CYS A 1 8  ? -13.569 2.221   1.473   1.00 0.00 ? 8   CYS A HB3  1  
ATOM   76    N  N    . HIS A 1 9  ? -11.764 -1.223  1.465   1.00 0.00 ? 9   HIS A N    1  
ATOM   77    C  CA   . HIS A 1 9  ? -11.402 -2.214  2.472   1.00 0.00 ? 9   HIS A CA   1  
ATOM   78    C  C    . HIS A 1 9  ? -10.650 -1.562  3.629   1.00 0.00 ? 9   HIS A C    1  
ATOM   79    O  O    . HIS A 1 9  ? -10.837 -1.931  4.788   1.00 0.00 ? 9   HIS A O    1  
ATOM   80    C  CB   . HIS A 1 9  ? -10.545 -3.316  1.849   1.00 0.00 ? 9   HIS A CB   1  
ATOM   81    C  CG   . HIS A 1 9  ? -10.464 -4.556  2.685   1.00 0.00 ? 9   HIS A CG   1  
ATOM   82    N  ND1  . HIS A 1 9  ? -11.573 -5.174  3.224   1.00 0.00 ? 9   HIS A ND1  1  
ATOM   83    C  CD2  . HIS A 1 9  ? -9.398  -5.295  3.072   1.00 0.00 ? 9   HIS A CD2  1  
ATOM   84    C  CE1  . HIS A 1 9  ? -11.193 -6.238  3.908   1.00 0.00 ? 9   HIS A CE1  1  
ATOM   85    N  NE2  . HIS A 1 9  ? -9.877  -6.335  3.831   1.00 0.00 ? 9   HIS A NE2  1  
ATOM   86    H  H    . HIS A 1 9  ? -11.130 -1.018  0.747   1.00 0.00 ? 9   HIS A H    1  
ATOM   87    H  HA   . HIS A 1 9  ? -12.313 -2.650  2.852   1.00 0.00 ? 9   HIS A HA   1  
ATOM   88    H  HB2  . HIS A 1 9  ? -10.962 -3.589  0.891   1.00 0.00 ? 9   HIS A HB2  1  
ATOM   89    H  HB3  . HIS A 1 9  ? -9.540  -2.945  1.707   1.00 0.00 ? 9   HIS A HB3  1  
ATOM   90    H  HD1  . HIS A 1 9  ? -12.501 -4.876  3.122   1.00 0.00 ? 9   HIS A HD1  1  
ATOM   91    H  HD2  . HIS A 1 9  ? -8.362  -5.104  2.830   1.00 0.00 ? 9   HIS A HD2  1  
ATOM   92    H  HE1  . HIS A 1 9  ? -11.845 -6.915  4.440   1.00 0.00 ? 9   HIS A HE1  1  
ATOM   93    H  HE2  . HIS A 1 9  ? -9.330  -6.984  4.319   1.00 0.00 ? 9   HIS A HE2  1  
ATOM   94    N  N    . GLN A 1 10 ? -9.801  -0.592  3.305   1.00 0.00 ? 10  GLN A N    1  
ATOM   95    C  CA   . GLN A 1 10 ? -9.021  0.110   4.318   1.00 0.00 ? 10  GLN A CA   1  
ATOM   96    C  C    . GLN A 1 10 ? -9.911  0.569   5.469   1.00 0.00 ? 10  GLN A C    1  
ATOM   97    O  O    . GLN A 1 10 ? -9.861  0.012   6.566   1.00 0.00 ? 10  GLN A O    1  
ATOM   98    C  CB   . GLN A 1 10 ? -8.307  1.312   3.699   1.00 0.00 ? 10  GLN A CB   1  
ATOM   99    C  CG   . GLN A 1 10 ? -7.551  2.158   4.711   1.00 0.00 ? 10  GLN A CG   1  
ATOM   100   C  CD   . GLN A 1 10 ? -6.296  1.477   5.220   1.00 0.00 ? 10  GLN A CD   1  
ATOM   101   O  OE1  . GLN A 1 10 ? -5.665  0.698   4.505   1.00 0.00 ? 10  GLN A OE1  1  
ATOM   102   N  NE2  . GLN A 1 10 ? -5.926  1.768   6.462   1.00 0.00 ? 10  GLN A NE2  1  
ATOM   103   H  H    . GLN A 1 10 ? -9.697  -0.343  2.364   1.00 0.00 ? 10  GLN A H    1  
ATOM   104   H  HA   . GLN A 1 10 ? -8.283  -0.577  4.702   1.00 0.00 ? 10  GLN A HA   1  
ATOM   105   H  HB2  . GLN A 1 10 ? -7.603  0.957   2.962   1.00 0.00 ? 10  GLN A HB2  1  
ATOM   106   H  HB3  . GLN A 1 10 ? -9.039  1.940   3.213   1.00 0.00 ? 10  GLN A HB3  1  
ATOM   107   H  HG2  . GLN A 1 10 ? -7.272  3.091   4.245   1.00 0.00 ? 10  GLN A HG2  1  
ATOM   108   H  HG3  . GLN A 1 10 ? -8.201  2.357   5.551   1.00 0.00 ? 10  GLN A HG3  1  
ATOM   109   H  HE21 . GLN A 1 10 ? -6.478  2.397   6.973   1.00 0.00 ? 10  GLN A HE21 1  
ATOM   110   H  HE22 . GLN A 1 10 ? -5.120  1.342   6.817   1.00 0.00 ? 10  GLN A HE22 1  
ATOM   111   N  N    . CYS A 1 11 ? -10.724 1.588   5.212   1.00 0.00 ? 11  CYS A N    1  
ATOM   112   C  CA   . CYS A 1 11 ? -11.624 2.123   6.225   1.00 0.00 ? 11  CYS A CA   1  
ATOM   113   C  C    . CYS A 1 11 ? -12.946 1.362   6.235   1.00 0.00 ? 11  CYS A C    1  
ATOM   114   O  O    . CYS A 1 11 ? -13.479 1.035   7.295   1.00 0.00 ? 11  CYS A O    1  
ATOM   115   C  CB   . CYS A 1 11 ? -11.882 3.610   5.975   1.00 0.00 ? 11  CYS A CB   1  
ATOM   116   S  SG   . CYS A 1 11 ? -12.721 3.964   4.397   1.00 0.00 ? 11  CYS A SG   1  
ATOM   117   H  H    . CYS A 1 11 ? -10.718 1.991   4.317   1.00 0.00 ? 11  CYS A H    1  
ATOM   118   H  HA   . CYS A 1 11 ? -11.148 2.006   7.187   1.00 0.00 ? 11  CYS A HA   1  
ATOM   119   H  HB2  . CYS A 1 11 ? -12.501 3.999   6.770   1.00 0.00 ? 11  CYS A HB2  1  
ATOM   120   H  HB3  . CYS A 1 11 ? -10.938 4.136   5.971   1.00 0.00 ? 11  CYS A HB3  1  
ATOM   121   N  N    . GLY A 1 12 ? -13.471 1.081   5.046   1.00 0.00 ? 12  GLY A N    1  
ATOM   122   C  CA   . GLY A 1 12 ? -14.726 0.360   4.940   1.00 0.00 ? 12  GLY A CA   1  
ATOM   123   C  C    . GLY A 1 12 ? -15.794 1.159   4.220   1.00 0.00 ? 12  GLY A C    1  
ATOM   124   O  O    . GLY A 1 12 ? -16.587 0.603   3.461   1.00 0.00 ? 12  GLY A O    1  
ATOM   125   H  H    . GLY A 1 12 ? -13.002 1.366   4.234   1.00 0.00 ? 12  GLY A H    1  
ATOM   126   H  HA2  . GLY A 1 12 ? -14.555 -0.560  4.402   1.00 0.00 ? 12  GLY A HA2  1  
ATOM   127   H  HA3  . GLY A 1 12 ? -15.077 0.125   5.934   1.00 0.00 ? 12  GLY A HA3  1  
ATOM   128   N  N    . GLU A 1 13 ? -15.816 2.466   4.460   1.00 0.00 ? 13  GLU A N    1  
ATOM   129   C  CA   . GLU A 1 13 ? -16.797 3.342   3.830   1.00 0.00 ? 13  GLU A CA   1  
ATOM   130   C  C    . GLU A 1 13 ? -16.919 3.039   2.339   1.00 0.00 ? 13  GLU A C    1  
ATOM   131   O  O    . GLU A 1 13 ? -15.969 2.572   1.710   1.00 0.00 ? 13  GLU A O    1  
ATOM   132   C  CB   . GLU A 1 13 ? -16.411 4.808   4.034   1.00 0.00 ? 13  GLU A CB   1  
ATOM   133   C  CG   . GLU A 1 13 ? -16.250 5.198   5.494   1.00 0.00 ? 13  GLU A CG   1  
ATOM   134   C  CD   . GLU A 1 13 ? -17.576 5.286   6.224   1.00 0.00 ? 13  GLU A CD   1  
ATOM   135   O  OE1  . GLU A 1 13 ? -18.402 6.144   5.849   1.00 0.00 ? 13  GLU A OE1  1  
ATOM   136   O  OE2  . GLU A 1 13 ? -17.787 4.498   7.169   1.00 0.00 ? 13  GLU A OE2  1  
ATOM   137   H  H    . GLU A 1 13 ? -15.157 2.851   5.075   1.00 0.00 ? 13  GLU A H    1  
ATOM   138   H  HA   . GLU A 1 13 ? -17.752 3.162   4.300   1.00 0.00 ? 13  GLU A HA   1  
ATOM   139   H  HB2  . GLU A 1 13 ? -15.476 4.996   3.527   1.00 0.00 ? 13  GLU A HB2  1  
ATOM   140   H  HB3  . GLU A 1 13 ? -17.177 5.433   3.599   1.00 0.00 ? 13  GLU A HB3  1  
ATOM   141   H  HG2  . GLU A 1 13 ? -15.635 4.458   5.984   1.00 0.00 ? 13  GLU A HG2  1  
ATOM   142   H  HG3  . GLU A 1 13 ? -15.763 6.160   5.544   1.00 0.00 ? 13  GLU A HG3  1  
ATOM   143   N  N    . PHE A 1 14 ? -18.094 3.308   1.780   1.00 0.00 ? 14  PHE A N    1  
ATOM   144   C  CA   . PHE A 1 14 ? -18.341 3.064   0.364   1.00 0.00 ? 14  PHE A CA   1  
ATOM   145   C  C    . PHE A 1 14 ? -17.666 4.127   -0.497  1.00 0.00 ? 14  PHE A C    1  
ATOM   146   O  O    . PHE A 1 14 ? -17.690 5.314   -0.169  1.00 0.00 ? 14  PHE A O    1  
ATOM   147   C  CB   . PHE A 1 14 ? -19.845 3.043   0.084   1.00 0.00 ? 14  PHE A CB   1  
ATOM   148   C  CG   . PHE A 1 14 ? -20.200 2.427   -1.240  1.00 0.00 ? 14  PHE A CG   1  
ATOM   149   C  CD1  . PHE A 1 14 ? -19.956 1.085   -1.482  1.00 0.00 ? 14  PHE A CD1  1  
ATOM   150   C  CD2  . PHE A 1 14 ? -20.777 3.191   -2.242  1.00 0.00 ? 14  PHE A CD2  1  
ATOM   151   C  CE1  . PHE A 1 14 ? -20.281 0.516   -2.699  1.00 0.00 ? 14  PHE A CE1  1  
ATOM   152   C  CE2  . PHE A 1 14 ? -21.104 2.627   -3.461  1.00 0.00 ? 14  PHE A CE2  1  
ATOM   153   C  CZ   . PHE A 1 14 ? -20.856 1.288   -3.689  1.00 0.00 ? 14  PHE A CZ   1  
ATOM   154   H  H    . PHE A 1 14 ? -18.812 3.680   2.334   1.00 0.00 ? 14  PHE A H    1  
ATOM   155   H  HA   . PHE A 1 14 ? -17.924 2.100   0.117   1.00 0.00 ? 14  PHE A HA   1  
ATOM   156   H  HB2  . PHE A 1 14 ? -20.341 2.475   0.856   1.00 0.00 ? 14  PHE A HB2  1  
ATOM   157   H  HB3  . PHE A 1 14 ? -20.219 4.056   0.091   1.00 0.00 ? 14  PHE A HB3  1  
ATOM   158   H  HD1  . PHE A 1 14 ? -19.507 0.480   -0.708  1.00 0.00 ? 14  PHE A HD1  1  
ATOM   159   H  HD2  . PHE A 1 14 ? -20.971 4.239   -2.064  1.00 0.00 ? 14  PHE A HD2  1  
ATOM   160   H  HE1  . PHE A 1 14 ? -20.087 -0.531  -2.875  1.00 0.00 ? 14  PHE A HE1  1  
ATOM   161   H  HE2  . PHE A 1 14 ? -21.554 3.234   -4.233  1.00 0.00 ? 14  PHE A HE2  1  
ATOM   162   H  HZ   . PHE A 1 14 ? -21.111 0.846   -4.641  1.00 0.00 ? 14  PHE A HZ   1  
ATOM   163   N  N    . ILE A 1 15 ? -17.065 3.692   -1.600  1.00 0.00 ? 15  ILE A N    1  
ATOM   164   C  CA   . ILE A 1 15 ? -16.384 4.606   -2.509  1.00 0.00 ? 15  ILE A CA   1  
ATOM   165   C  C    . ILE A 1 15 ? -17.357 5.204   -3.519  1.00 0.00 ? 15  ILE A C    1  
ATOM   166   O  O    . ILE A 1 15 ? -18.110 4.481   -4.173  1.00 0.00 ? 15  ILE A O    1  
ATOM   167   C  CB   . ILE A 1 15 ? -15.244 3.901   -3.266  1.00 0.00 ? 15  ILE A CB   1  
ATOM   168   C  CG1  . ILE A 1 15 ? -14.404 3.061   -2.302  1.00 0.00 ? 15  ILE A CG1  1  
ATOM   169   C  CG2  . ILE A 1 15 ? -14.374 4.922   -3.984  1.00 0.00 ? 15  ILE A CG2  1  
ATOM   170   C  CD1  . ILE A 1 15 ? -13.624 1.958   -2.982  1.00 0.00 ? 15  ILE A CD1  1  
ATOM   171   H  H    . ILE A 1 15 ? -17.081 2.735   -1.807  1.00 0.00 ? 15  ILE A H    1  
ATOM   172   H  HA   . ILE A 1 15 ? -15.957 5.405   -1.920  1.00 0.00 ? 15  ILE A HA   1  
ATOM   173   H  HB   . ILE A 1 15 ? -15.683 3.252   -4.009  1.00 0.00 ? 15  ILE A HB   1  
ATOM   174   H  HG12 . ILE A 1 15 ? -13.699 3.702   -1.797  1.00 0.00 ? 15  ILE A HG12 1  
ATOM   175   H  HG13 . ILE A 1 15 ? -15.057 2.605   -1.571  1.00 0.00 ? 15  ILE A HG13 1  
ATOM   176   H  HG21 . ILE A 1 15 ? -14.908 5.313   -4.838  1.00 0.00 ? 15  ILE A HG21 1  
ATOM   177   H  HG22 . ILE A 1 15 ? -14.136 5.729   -3.309  1.00 0.00 ? 15  ILE A HG22 1  
ATOM   178   H  HG23 . ILE A 1 15 ? -13.462 4.448   -4.316  1.00 0.00 ? 15  ILE A HG23 1  
ATOM   179   H  HD11 . ILE A 1 15 ? -14.241 1.075   -3.059  1.00 0.00 ? 15  ILE A HD11 1  
ATOM   180   H  HD12 . ILE A 1 15 ? -13.330 2.280   -3.970  1.00 0.00 ? 15  ILE A HD12 1  
ATOM   181   H  HD13 . ILE A 1 15 ? -12.742 1.730   -2.401  1.00 0.00 ? 15  ILE A HD13 1  
ATOM   182   N  N    . ILE A 1 16 ? -17.335 6.526   -3.642  1.00 0.00 ? 16  ILE A N    1  
ATOM   183   C  CA   . ILE A 1 16 ? -18.214 7.221   -4.576  1.00 0.00 ? 16  ILE A CA   1  
ATOM   184   C  C    . ILE A 1 16 ? -17.423 8.158   -5.482  1.00 0.00 ? 16  ILE A C    1  
ATOM   185   O  O    . ILE A 1 16 ? -16.871 9.159   -5.027  1.00 0.00 ? 16  ILE A O    1  
ATOM   186   C  CB   . ILE A 1 16 ? -19.294 8.031   -3.835  1.00 0.00 ? 16  ILE A CB   1  
ATOM   187   C  CG1  . ILE A 1 16 ? -19.965 7.169   -2.764  1.00 0.00 ? 16  ILE A CG1  1  
ATOM   188   C  CG2  . ILE A 1 16 ? -20.325 8.562   -4.819  1.00 0.00 ? 16  ILE A CG2  1  
ATOM   189   C  CD1  . ILE A 1 16 ? -20.925 7.938   -1.884  1.00 0.00 ? 16  ILE A CD1  1  
ATOM   190   H  H    . ILE A 1 16 ? -16.713 7.048   -3.094  1.00 0.00 ? 16  ILE A H    1  
ATOM   191   H  HA   . ILE A 1 16 ? -18.706 6.477   -5.186  1.00 0.00 ? 16  ILE A HA   1  
ATOM   192   H  HB   . ILE A 1 16 ? -18.817 8.875   -3.361  1.00 0.00 ? 16  ILE A HB   1  
ATOM   193   H  HG12 . ILE A 1 16 ? -20.518 6.377   -3.244  1.00 0.00 ? 16  ILE A HG12 1  
ATOM   194   H  HG13 . ILE A 1 16 ? -19.204 6.738   -2.130  1.00 0.00 ? 16  ILE A HG13 1  
ATOM   195   H  HG21 . ILE A 1 16 ? -20.154 8.125   -5.792  1.00 0.00 ? 16  ILE A HG21 1  
ATOM   196   H  HG22 . ILE A 1 16 ? -21.316 8.301   -4.478  1.00 0.00 ? 16  ILE A HG22 1  
ATOM   197   H  HG23 . ILE A 1 16 ? -20.239 9.636   -4.887  1.00 0.00 ? 16  ILE A HG23 1  
ATOM   198   H  HD11 . ILE A 1 16 ? -21.813 7.346   -1.716  1.00 0.00 ? 16  ILE A HD11 1  
ATOM   199   H  HD12 . ILE A 1 16 ? -20.452 8.155   -0.938  1.00 0.00 ? 16  ILE A HD12 1  
ATOM   200   H  HD13 . ILE A 1 16 ? -21.197 8.864   -2.370  1.00 0.00 ? 16  ILE A HD13 1  
ATOM   201   N  N    . GLY A 1 17 ? -17.374 7.826   -6.769  1.00 0.00 ? 17  GLY A N    1  
ATOM   202   C  CA   . GLY A 1 17 ? -16.650 8.649   -7.720  1.00 0.00 ? 17  GLY A CA   1  
ATOM   203   C  C    . GLY A 1 17 ? -15.415 7.958   -8.263  1.00 0.00 ? 17  GLY A C    1  
ATOM   204   O  O    . GLY A 1 17 ? -15.397 7.520   -9.414  1.00 0.00 ? 17  GLY A O    1  
ATOM   205   H  H    . GLY A 1 17 ? -17.833 7.017   -7.075  1.00 0.00 ? 17  GLY A H    1  
ATOM   206   H  HA2  . GLY A 1 17 ? -17.306 8.892   -8.542  1.00 0.00 ? 17  GLY A HA2  1  
ATOM   207   H  HA3  . GLY A 1 17 ? -16.349 9.564   -7.230  1.00 0.00 ? 17  GLY A HA3  1  
ATOM   208   N  N    . ARG A 1 18 ? -14.381 7.860   -7.435  1.00 0.00 ? 18  ARG A N    1  
ATOM   209   C  CA   . ARG A 1 18 ? -13.135 7.219   -7.840  1.00 0.00 ? 18  ARG A CA   1  
ATOM   210   C  C    . ARG A 1 18 ? -12.875 5.964   -7.012  1.00 0.00 ? 18  ARG A C    1  
ATOM   211   O  O    . ARG A 1 18 ? -12.782 6.025   -5.786  1.00 0.00 ? 18  ARG A O    1  
ATOM   212   C  CB   . ARG A 1 18 ? -11.965 8.192   -7.693  1.00 0.00 ? 18  ARG A CB   1  
ATOM   213   C  CG   . ARG A 1 18 ? -10.605 7.512   -7.675  1.00 0.00 ? 18  ARG A CG   1  
ATOM   214   C  CD   . ARG A 1 18 ? -9.513  8.437   -8.187  1.00 0.00 ? 18  ARG A CD   1  
ATOM   215   N  NE   . ARG A 1 18 ? -8.430  7.700   -8.833  1.00 0.00 ? 18  ARG A NE   1  
ATOM   216   C  CZ   . ARG A 1 18 ? -8.468  7.297   -10.098 1.00 0.00 ? 18  ARG A CZ   1  
ATOM   217   N  NH1  . ARG A 1 18 ? -9.529  7.558   -10.849 1.00 0.00 ? 18  ARG A NH1  1  
ATOM   218   N  NH2  . ARG A 1 18 ? -7.443  6.631   -10.615 1.00 0.00 ? 18  ARG A NH2  1  
ATOM   219   H  H    . ARG A 1 18 ? -14.456 8.228   -6.530  1.00 0.00 ? 18  ARG A H    1  
ATOM   220   H  HA   . ARG A 1 18 ? -13.230 6.937   -8.878  1.00 0.00 ? 18  ARG A HA   1  
ATOM   221   H  HB2  . ARG A 1 18 ? -11.983 8.888   -8.519  1.00 0.00 ? 18  ARG A HB2  1  
ATOM   222   H  HB3  . ARG A 1 18 ? -12.081 8.740   -6.770  1.00 0.00 ? 18  ARG A HB3  1  
ATOM   223   H  HG2  . ARG A 1 18 ? -10.371 7.223   -6.661  1.00 0.00 ? 18  ARG A HG2  1  
ATOM   224   H  HG3  . ARG A 1 18 ? -10.645 6.634   -8.302  1.00 0.00 ? 18  ARG A HG3  1  
ATOM   225   H  HD2  . ARG A 1 18 ? -9.945  9.122   -8.901  1.00 0.00 ? 18  ARG A HD2  1  
ATOM   226   H  HD3  . ARG A 1 18 ? -9.110  8.993   -7.353  1.00 0.00 ? 18  ARG A HD3  1  
ATOM   227   H  HE   . ARG A 1 18 ? -7.636  7.496   -8.296  1.00 0.00 ? 18  ARG A HE   1  
ATOM   228   H  HH11 . ARG A 1 18 ? -10.302 8.061   -10.462 1.00 0.00 ? 18  ARG A HH11 1  
ATOM   229   H  HH12 . ARG A 1 18 ? -9.555  7.255   -11.801 1.00 0.00 ? 18  ARG A HH12 1  
ATOM   230   H  HH21 . ARG A 1 18 ? -6.641  6.432   -10.052 1.00 0.00 ? 18  ARG A HH21 1  
ATOM   231   H  HH22 . ARG A 1 18 ? -7.473  6.328   -11.566 1.00 0.00 ? 18  ARG A HH22 1  
ATOM   232   N  N    . VAL A 1 19 ? -12.759 4.827   -7.690  1.00 0.00 ? 19  VAL A N    1  
ATOM   233   C  CA   . VAL A 1 19 ? -12.509 3.558   -7.017  1.00 0.00 ? 19  VAL A CA   1  
ATOM   234   C  C    . VAL A 1 19 ? -11.142 2.997   -7.393  1.00 0.00 ? 19  VAL A C    1  
ATOM   235   O  O    . VAL A 1 19 ? -10.900 2.646   -8.548  1.00 0.00 ? 19  VAL A O    1  
ATOM   236   C  CB   . VAL A 1 19 ? -13.591 2.517   -7.362  1.00 0.00 ? 19  VAL A CB   1  
ATOM   237   C  CG1  . VAL A 1 19 ? -13.064 1.107   -7.146  1.00 0.00 ? 19  VAL A CG1  1  
ATOM   238   C  CG2  . VAL A 1 19 ? -14.845 2.759   -6.536  1.00 0.00 ? 19  VAL A CG2  1  
ATOM   239   H  H    . VAL A 1 19 ? -12.843 4.842   -8.666  1.00 0.00 ? 19  VAL A H    1  
ATOM   240   H  HA   . VAL A 1 19 ? -12.535 3.734   -5.952  1.00 0.00 ? 19  VAL A HA   1  
ATOM   241   H  HB   . VAL A 1 19 ? -13.847 2.626   -8.406  1.00 0.00 ? 19  VAL A HB   1  
ATOM   242   H  HG11 . VAL A 1 19 ? -12.317 0.884   -7.894  1.00 0.00 ? 19  VAL A HG11 1  
ATOM   243   H  HG12 . VAL A 1 19 ? -12.623 1.033   -6.163  1.00 0.00 ? 19  VAL A HG12 1  
ATOM   244   H  HG13 . VAL A 1 19 ? -13.878 0.402   -7.230  1.00 0.00 ? 19  VAL A HG13 1  
ATOM   245   H  HG21 . VAL A 1 19 ? -14.752 3.696   -6.008  1.00 0.00 ? 19  VAL A HG21 1  
ATOM   246   H  HG22 . VAL A 1 19 ? -15.705 2.796   -7.188  1.00 0.00 ? 19  VAL A HG22 1  
ATOM   247   H  HG23 . VAL A 1 19 ? -14.968 1.956   -5.824  1.00 0.00 ? 19  VAL A HG23 1  
ATOM   248   N  N    . ILE A 1 20 ? -10.252 2.915   -6.409  1.00 0.00 ? 20  ILE A N    1  
ATOM   249   C  CA   . ILE A 1 20 ? -8.909  2.395   -6.636  1.00 0.00 ? 20  ILE A CA   1  
ATOM   250   C  C    . ILE A 1 20 ? -8.874  0.878   -6.482  1.00 0.00 ? 20  ILE A C    1  
ATOM   251   O  O    . ILE A 1 20 ? -8.924  0.355   -5.368  1.00 0.00 ? 20  ILE A O    1  
ATOM   252   C  CB   . ILE A 1 20 ? -7.891  3.022   -5.666  1.00 0.00 ? 20  ILE A CB   1  
ATOM   253   C  CG1  . ILE A 1 20 ? -8.098  4.536   -5.584  1.00 0.00 ? 20  ILE A CG1  1  
ATOM   254   C  CG2  . ILE A 1 20 ? -6.471  2.699   -6.106  1.00 0.00 ? 20  ILE A CG2  1  
ATOM   255   C  CD1  . ILE A 1 20 ? -7.806  5.257   -6.882  1.00 0.00 ? 20  ILE A CD1  1  
ATOM   256   H  H    . ILE A 1 20 ? -10.505 3.210   -5.510  1.00 0.00 ? 20  ILE A H    1  
ATOM   257   H  HA   . ILE A 1 20 ? -8.620  2.650   -7.645  1.00 0.00 ? 20  ILE A HA   1  
ATOM   258   H  HB   . ILE A 1 20 ? -8.046  2.592   -4.689  1.00 0.00 ? 20  ILE A HB   1  
ATOM   259   H  HG12 . ILE A 1 20 ? -9.122  4.740   -5.316  1.00 0.00 ? 20  ILE A HG12 1  
ATOM   260   H  HG13 . ILE A 1 20 ? -7.444  4.941   -4.825  1.00 0.00 ? 20  ILE A HG13 1  
ATOM   261   H  HG21 . ILE A 1 20 ? -6.343  1.627   -6.148  1.00 0.00 ? 20  ILE A HG21 1  
ATOM   262   H  HG22 . ILE A 1 20 ? -6.293  3.120   -7.084  1.00 0.00 ? 20  ILE A HG22 1  
ATOM   263   H  HG23 . ILE A 1 20 ? -5.771  3.119   -5.400  1.00 0.00 ? 20  ILE A HG23 1  
ATOM   264   H  HD11 . ILE A 1 20 ? -8.089  6.295   -6.790  1.00 0.00 ? 20  ILE A HD11 1  
ATOM   265   H  HD12 . ILE A 1 20 ? -6.752  5.187   -7.104  1.00 0.00 ? 20  ILE A HD12 1  
ATOM   266   H  HD13 . ILE A 1 20 ? -8.373  4.801   -7.682  1.00 0.00 ? 20  ILE A HD13 1  
ATOM   267   N  N    . LYS A 1 21 ? -8.786  0.176   -7.607  1.00 0.00 ? 21  LYS A N    1  
ATOM   268   C  CA   . LYS A 1 21 ? -8.740  -1.281  -7.598  1.00 0.00 ? 21  LYS A CA   1  
ATOM   269   C  C    . LYS A 1 21 ? -7.328  -1.779  -7.305  1.00 0.00 ? 21  LYS A C    1  
ATOM   270   O  O    . LYS A 1 21 ? -6.393  -1.497  -8.052  1.00 0.00 ? 21  LYS A O    1  
ATOM   271   C  CB   . LYS A 1 21 ? -9.219  -1.835  -8.942  1.00 0.00 ? 21  LYS A CB   1  
ATOM   272   C  CG   . LYS A 1 21 ? -10.720 -1.725  -9.145  1.00 0.00 ? 21  LYS A CG   1  
ATOM   273   C  CD   . LYS A 1 21 ? -11.442 -2.967  -8.651  1.00 0.00 ? 21  LYS A CD   1  
ATOM   274   C  CE   . LYS A 1 21 ? -11.909 -2.805  -7.212  1.00 0.00 ? 21  LYS A CE   1  
ATOM   275   N  NZ   . LYS A 1 21 ? -12.724 -3.966  -6.760  1.00 0.00 ? 21  LYS A NZ   1  
ATOM   276   H  H    . LYS A 1 21 ? -8.750  0.651   -8.464  1.00 0.00 ? 21  LYS A H    1  
ATOM   277   H  HA   . LYS A 1 21 ? -9.401  -1.629  -6.819  1.00 0.00 ? 21  LYS A HA   1  
ATOM   278   H  HB2  . LYS A 1 21 ? -8.728  -1.292  -9.737  1.00 0.00 ? 21  LYS A HB2  1  
ATOM   279   H  HB3  . LYS A 1 21 ? -8.943  -2.877  -9.007  1.00 0.00 ? 21  LYS A HB3  1  
ATOM   280   H  HG2  . LYS A 1 21 ? -11.086 -0.868  -8.600  1.00 0.00 ? 21  LYS A HG2  1  
ATOM   281   H  HG3  . LYS A 1 21 ? -10.923 -1.597  -10.199 1.00 0.00 ? 21  LYS A HG3  1  
ATOM   282   H  HD2  . LYS A 1 21 ? -12.302 -3.147  -9.278  1.00 0.00 ? 21  LYS A HD2  1  
ATOM   283   H  HD3  . LYS A 1 21 ? -10.769 -3.811  -8.709  1.00 0.00 ? 21  LYS A HD3  1  
ATOM   284   H  HE2  . LYS A 1 21 ? -11.043 -2.714  -6.575  1.00 0.00 ? 21  LYS A HE2  1  
ATOM   285   H  HE3  . LYS A 1 21 ? -12.505 -1.907  -7.140  1.00 0.00 ? 21  LYS A HE3  1  
ATOM   286   H  HZ1  . LYS A 1 21 ? -12.196 -4.851  -6.903  1.00 0.00 ? 21  LYS A HZ1  1  
ATOM   287   H  HZ2  . LYS A 1 21 ? -13.610 -4.013  -7.301  1.00 0.00 ? 21  LYS A HZ2  1  
ATOM   288   H  HZ3  . LYS A 1 21 ? -12.952 -3.871  -5.750  1.00 0.00 ? 21  LYS A HZ3  1  
ATOM   289   N  N    . ALA A 1 22 ? -7.183  -2.523  -6.213  1.00 0.00 ? 22  ALA A N    1  
ATOM   290   C  CA   . ALA A 1 22 ? -5.887  -3.063  -5.823  1.00 0.00 ? 22  ALA A CA   1  
ATOM   291   C  C    . ALA A 1 22 ? -6.048  -4.292  -4.935  1.00 0.00 ? 22  ALA A C    1  
ATOM   292   O  O    . ALA A 1 22 ? -7.118  -4.526  -4.373  1.00 0.00 ? 22  ALA A O    1  
ATOM   293   C  CB   . ALA A 1 22 ? -5.064  -1.999  -5.112  1.00 0.00 ? 22  ALA A CB   1  
ATOM   294   H  H    . ALA A 1 22 ? -7.967  -2.713  -5.657  1.00 0.00 ? 22  ALA A H    1  
ATOM   295   H  HA   . ALA A 1 22 ? -5.360  -3.348  -6.723  1.00 0.00 ? 22  ALA A HA   1  
ATOM   296   H  HB1  . ALA A 1 22 ? -4.892  -1.170  -5.782  1.00 0.00 ? 22  ALA A HB1  1  
ATOM   297   H  HB2  . ALA A 1 22 ? -5.599  -1.654  -4.240  1.00 0.00 ? 22  ALA A HB2  1  
ATOM   298   H  HB3  . ALA A 1 22 ? -4.116  -2.420  -4.809  1.00 0.00 ? 22  ALA A HB3  1  
ATOM   299   N  N    . MET A 1 23 ? -4.980  -5.073  -4.813  1.00 0.00 ? 23  MET A N    1  
ATOM   300   C  CA   . MET A 1 23 ? -5.005  -6.278  -3.992  1.00 0.00 ? 23  MET A CA   1  
ATOM   301   C  C    . MET A 1 23 ? -6.313  -7.039  -4.182  1.00 0.00 ? 23  MET A C    1  
ATOM   302   O  O    . MET A 1 23 ? -6.802  -7.690  -3.260  1.00 0.00 ? 23  MET A O    1  
ATOM   303   C  CB   . MET A 1 23 ? -4.819  -5.919  -2.517  1.00 0.00 ? 23  MET A CB   1  
ATOM   304   C  CG   . MET A 1 23 ? -3.629  -5.010  -2.257  1.00 0.00 ? 23  MET A CG   1  
ATOM   305   S  SD   . MET A 1 23 ? -3.321  -4.753  -0.499  1.00 0.00 ? 23  MET A SD   1  
ATOM   306   C  CE   . MET A 1 23 ? -1.767  -5.620  -0.297  1.00 0.00 ? 23  MET A CE   1  
ATOM   307   H  H    . MET A 1 23 ? -4.155  -4.834  -5.286  1.00 0.00 ? 23  MET A H    1  
ATOM   308   H  HA   . MET A 1 23 ? -4.186  -6.909  -4.306  1.00 0.00 ? 23  MET A HA   1  
ATOM   309   H  HB2  . MET A 1 23 ? -5.709  -5.420  -2.165  1.00 0.00 ? 23  MET A HB2  1  
ATOM   310   H  HB3  . MET A 1 23 ? -4.679  -6.829  -1.952  1.00 0.00 ? 23  MET A HB3  1  
ATOM   311   H  HG2  . MET A 1 23 ? -2.750  -5.454  -2.700  1.00 0.00 ? 23  MET A HG2  1  
ATOM   312   H  HG3  . MET A 1 23 ? -3.817  -4.053  -2.720  1.00 0.00 ? 23  MET A HG3  1  
ATOM   313   H  HE1  . MET A 1 23 ? -0.949  -4.951  -0.517  1.00 0.00 ? 23  MET A HE1  1  
ATOM   314   H  HE2  . MET A 1 23 ? -1.682  -5.971  0.721   1.00 0.00 ? 23  MET A HE2  1  
ATOM   315   H  HE3  . MET A 1 23 ? -1.735  -6.463  -0.973  1.00 0.00 ? 23  MET A HE3  1  
ATOM   316   N  N    . ASN A 1 24 ? -6.875  -6.951  -5.383  1.00 0.00 ? 24  ASN A N    1  
ATOM   317   C  CA   . ASN A 1 24 ? -8.127  -7.630  -5.693  1.00 0.00 ? 24  ASN A CA   1  
ATOM   318   C  C    . ASN A 1 24 ? -9.268  -7.085  -4.838  1.00 0.00 ? 24  ASN A C    1  
ATOM   319   O  O    . ASN A 1 24 ? -10.088 -7.844  -4.323  1.00 0.00 ? 24  ASN A O    1  
ATOM   320   C  CB   . ASN A 1 24 ? -7.983  -9.137  -5.470  1.00 0.00 ? 24  ASN A CB   1  
ATOM   321   C  CG   . ASN A 1 24 ? -6.958  -9.763  -6.396  1.00 0.00 ? 24  ASN A CG   1  
ATOM   322   O  OD1  . ASN A 1 24 ? -5.897  -10.206 -5.957  1.00 0.00 ? 24  ASN A OD1  1  
ATOM   323   N  ND2  . ASN A 1 24 ? -7.272  -9.803  -7.686  1.00 0.00 ? 24  ASN A ND2  1  
ATOM   324   H  H    . ASN A 1 24 ? -6.437  -6.416  -6.078  1.00 0.00 ? 24  ASN A H    1  
ATOM   325   H  HA   . ASN A 1 24 ? -8.354  -7.450  -6.733  1.00 0.00 ? 24  ASN A HA   1  
ATOM   326   H  HB2  . ASN A 1 24 ? -7.674  -9.316  -4.450  1.00 0.00 ? 24  ASN A HB2  1  
ATOM   327   H  HB3  . ASN A 1 24 ? -8.936  -9.614  -5.642  1.00 0.00 ? 24  ASN A HB3  1  
ATOM   328   H  HD21 . ASN A 1 24 ? -8.136  -9.431  -7.964  1.00 0.00 ? 24  ASN A HD21 1  
ATOM   329   H  HD22 . ASN A 1 24 ? -6.628  -10.203 -8.306  1.00 0.00 ? 24  ASN A HD22 1  
ATOM   330   N  N    . ASN A 1 25 ? -9.312  -5.765  -4.693  1.00 0.00 ? 25  ASN A N    1  
ATOM   331   C  CA   . ASN A 1 25 ? -10.352 -5.118  -3.901  1.00 0.00 ? 25  ASN A CA   1  
ATOM   332   C  C    . ASN A 1 25 ? -10.395 -3.619  -4.181  1.00 0.00 ? 25  ASN A C    1  
ATOM   333   O  O    . ASN A 1 25 ? -9.432  -3.044  -4.690  1.00 0.00 ? 25  ASN A O    1  
ATOM   334   C  CB   . ASN A 1 25 ? -10.113 -5.363  -2.410  1.00 0.00 ? 25  ASN A CB   1  
ATOM   335   C  CG   . ASN A 1 25 ? -10.433 -6.787  -2.000  1.00 0.00 ? 25  ASN A CG   1  
ATOM   336   O  OD1  . ASN A 1 25 ? -11.479 -7.328  -2.359  1.00 0.00 ? 25  ASN A OD1  1  
ATOM   337   N  ND2  . ASN A 1 25 ? -9.531  -7.402  -1.244  1.00 0.00 ? 25  ASN A ND2  1  
ATOM   338   H  H    . ASN A 1 25 ? -8.630  -5.213  -5.129  1.00 0.00 ? 25  ASN A H    1  
ATOM   339   H  HA   . ASN A 1 25 ? -11.300 -5.552  -4.181  1.00 0.00 ? 25  ASN A HA   1  
ATOM   340   H  HB2  . ASN A 1 25 ? -9.075  -5.168  -2.181  1.00 0.00 ? 25  ASN A HB2  1  
ATOM   341   H  HB3  . ASN A 1 25 ? -10.736 -4.694  -1.837  1.00 0.00 ? 25  ASN A HB3  1  
ATOM   342   H  HD21 . ASN A 1 25 ? -8.721  -6.909  -0.996  1.00 0.00 ? 25  ASN A HD21 1  
ATOM   343   H  HD22 . ASN A 1 25 ? -9.712  -8.324  -0.965  1.00 0.00 ? 25  ASN A HD22 1  
ATOM   344   N  N    . SER A 1 26 ? -11.518 -2.991  -3.845  1.00 0.00 ? 26  SER A N    1  
ATOM   345   C  CA   . SER A 1 26 ? -11.688 -1.560  -4.063  1.00 0.00 ? 26  SER A CA   1  
ATOM   346   C  C    . SER A 1 26 ? -11.210 -0.765  -2.852  1.00 0.00 ? 26  SER A C    1  
ATOM   347   O  O    . SER A 1 26 ? -11.363 -1.201  -1.710  1.00 0.00 ? 26  SER A O    1  
ATOM   348   C  CB   . SER A 1 26 ? -13.155 -1.237  -4.352  1.00 0.00 ? 26  SER A CB   1  
ATOM   349   O  OG   . SER A 1 26 ? -14.002 -1.774  -3.350  1.00 0.00 ? 26  SER A OG   1  
ATOM   350   H  H    . SER A 1 26 ? -12.250 -3.505  -3.444  1.00 0.00 ? 26  SER A H    1  
ATOM   351   H  HA   . SER A 1 26 ? -11.092 -1.281  -4.919  1.00 0.00 ? 26  SER A HA   1  
ATOM   352   H  HB2  . SER A 1 26 ? -13.287 -0.166  -4.381  1.00 0.00 ? 26  SER A HB2  1  
ATOM   353   H  HB3  . SER A 1 26 ? -13.433 -1.661  -5.306  1.00 0.00 ? 26  SER A HB3  1  
ATOM   354   H  HG   . SER A 1 26 ? -14.200 -1.096  -2.701  1.00 0.00 ? 26  SER A HG   1  
ATOM   355   N  N    . TRP A 1 27 ? -10.630 0.402   -3.109  1.00 0.00 ? 27  TRP A N    1  
ATOM   356   C  CA   . TRP A 1 27 ? -10.129 1.258   -2.040  1.00 0.00 ? 27  TRP A CA   1  
ATOM   357   C  C    . TRP A 1 27 ? -10.261 2.730   -2.414  1.00 0.00 ? 27  TRP A C    1  
ATOM   358   O  O    . TRP A 1 27 ? -10.619 3.063   -3.545  1.00 0.00 ? 27  TRP A O    1  
ATOM   359   C  CB   . TRP A 1 27 ? -8.668  0.925   -1.735  1.00 0.00 ? 27  TRP A CB   1  
ATOM   360   C  CG   . TRP A 1 27 ? -8.376  -0.545  -1.756  1.00 0.00 ? 27  TRP A CG   1  
ATOM   361   C  CD1  . TRP A 1 27 ? -8.577  -1.405  -2.798  1.00 0.00 ? 27  TRP A CD1  1  
ATOM   362   C  CD2  . TRP A 1 27 ? -7.833  -1.326  -0.687  1.00 0.00 ? 27  TRP A CD2  1  
ATOM   363   N  NE1  . TRP A 1 27 ? -8.192  -2.674  -2.441  1.00 0.00 ? 27  TRP A NE1  1  
ATOM   364   C  CE2  . TRP A 1 27 ? -7.731  -2.653  -1.151  1.00 0.00 ? 27  TRP A CE2  1  
ATOM   365   C  CE3  . TRP A 1 27 ? -7.421  -1.035  0.616   1.00 0.00 ? 27  TRP A CE3  1  
ATOM   366   C  CZ2  . TRP A 1 27 ? -7.235  -3.683  -0.356  1.00 0.00 ? 27  TRP A CZ2  1  
ATOM   367   C  CZ3  . TRP A 1 27 ? -6.930  -2.059  1.404   1.00 0.00 ? 27  TRP A CZ3  1  
ATOM   368   C  CH2  . TRP A 1 27 ? -6.839  -3.369  0.916   1.00 0.00 ? 27  TRP A CH2  1  
ATOM   369   H  H    . TRP A 1 27 ? -10.537 0.695   -4.040  1.00 0.00 ? 27  TRP A H    1  
ATOM   370   H  HA   . TRP A 1 27 ? -10.724 1.068   -1.158  1.00 0.00 ? 27  TRP A HA   1  
ATOM   371   H  HB2  . TRP A 1 27 ? -8.036  1.401   -2.469  1.00 0.00 ? 27  TRP A HB2  1  
ATOM   372   H  HB3  . TRP A 1 27 ? -8.419  1.301   -0.753  1.00 0.00 ? 27  TRP A HB3  1  
ATOM   373   H  HD1  . TRP A 1 27 ? -8.983  -1.116  -3.756  1.00 0.00 ? 27  TRP A HD1  1  
ATOM   374   H  HE1  . TRP A 1 27 ? -8.238  -3.466  -3.017  1.00 0.00 ? 27  TRP A HE1  1  
ATOM   375   H  HE3  . TRP A 1 27 ? -7.483  -0.032  1.010   1.00 0.00 ? 27  TRP A HE3  1  
ATOM   376   H  HZ2  . TRP A 1 27 ? -7.158  -4.698  -0.718  1.00 0.00 ? 27  TRP A HZ2  1  
ATOM   377   H  HZ3  . TRP A 1 27 ? -6.607  -1.853  2.414   1.00 0.00 ? 27  TRP A HZ3  1  
ATOM   378   H  HH2  . TRP A 1 27 ? -6.449  -4.137  1.566   1.00 0.00 ? 27  TRP A HH2  1  
ATOM   379   N  N    . HIS A 1 28 ? -9.969  3.608   -1.460  1.00 0.00 ? 28  HIS A N    1  
ATOM   380   C  CA   . HIS A 1 28 ? -10.055 5.045   -1.691  1.00 0.00 ? 28  HIS A CA   1  
ATOM   381   C  C    . HIS A 1 28 ? -8.727  5.593   -2.206  1.00 0.00 ? 28  HIS A C    1  
ATOM   382   O  O    . HIS A 1 28 ? -7.665  5.002   -2.007  1.00 0.00 ? 28  HIS A O    1  
ATOM   383   C  CB   . HIS A 1 28 ? -10.452 5.768   -0.403  1.00 0.00 ? 28  HIS A CB   1  
ATOM   384   C  CG   . HIS A 1 28 ? -11.908 5.646   -0.073  1.00 0.00 ? 28  HIS A CG   1  
ATOM   385   N  ND1  . HIS A 1 28 ? -12.369 5.099   1.106   1.00 0.00 ? 28  HIS A ND1  1  
ATOM   386   C  CD2  . HIS A 1 28 ? -13.008 6.006   -0.774  1.00 0.00 ? 28  HIS A CD2  1  
ATOM   387   C  CE1  . HIS A 1 28 ? -13.689 5.126   1.114   1.00 0.00 ? 28  HIS A CE1  1  
ATOM   388   N  NE2  . HIS A 1 28 ? -14.102 5.672   -0.015  1.00 0.00 ? 28  HIS A NE2  1  
ATOM   389   H  H    . HIS A 1 28 ? -9.690  3.281   -0.579  1.00 0.00 ? 28  HIS A H    1  
ATOM   390   H  HA   . HIS A 1 28 ? -10.814 5.217   -2.439  1.00 0.00 ? 28  HIS A HA   1  
ATOM   391   H  HB2  . HIS A 1 28 ? -9.889  5.355   0.421   1.00 0.00 ? 28  HIS A HB2  1  
ATOM   392   H  HB3  . HIS A 1 28 ? -10.220 6.819   -0.501  1.00 0.00 ? 28  HIS A HB3  1  
ATOM   393   H  HD2  . HIS A 1 28 ? -13.023 6.470   -1.751  1.00 0.00 ? 28  HIS A HD2  1  
ATOM   394   H  HE1  . HIS A 1 28 ? -14.324 4.764   1.909   1.00 0.00 ? 28  HIS A HE1  1  
ATOM   395   H  HE2  . HIS A 1 28 ? -15.037 5.736   -0.303  1.00 0.00 ? 28  HIS A HE2  1  
ATOM   396   N  N    . PRO A 1 29 ? -8.786  6.748   -2.886  1.00 0.00 ? 29  PRO A N    1  
ATOM   397   C  CA   . PRO A 1 29 ? -7.597  7.399   -3.444  1.00 0.00 ? 29  PRO A CA   1  
ATOM   398   C  C    . PRO A 1 29 ? -6.686  7.969   -2.361  1.00 0.00 ? 29  PRO A C    1  
ATOM   399   O  O    . PRO A 1 29 ? -5.624  8.516   -2.656  1.00 0.00 ? 29  PRO A O    1  
ATOM   400   C  CB   . PRO A 1 29 ? -8.179  8.526   -4.300  1.00 0.00 ? 29  PRO A CB   1  
ATOM   401   C  CG   . PRO A 1 29 ? -9.507  8.818   -3.690  1.00 0.00 ? 29  PRO A CG   1  
ATOM   402   C  CD   . PRO A 1 29 ? -10.017 7.507   -3.161  1.00 0.00 ? 29  PRO A CD   1  
ATOM   403   H  HA   . PRO A 1 29 ? -7.032  6.724   -4.070  1.00 0.00 ? 29  PRO A HA   1  
ATOM   404   H  HB2  . PRO A 1 29 ? -7.527  9.387   -4.259  1.00 0.00 ? 29  PRO A HB2  1  
ATOM   405   H  HB3  . PRO A 1 29 ? -8.280  8.192   -5.322  1.00 0.00 ? 29  PRO A HB3  1  
ATOM   406   H  HG2  . PRO A 1 29 ? -9.393  9.529   -2.885  1.00 0.00 ? 29  PRO A HG2  1  
ATOM   407   H  HG3  . PRO A 1 29 ? -10.179 9.206   -4.442  1.00 0.00 ? 29  PRO A HG3  1  
ATOM   408   H  HD2  . PRO A 1 29 ? -10.586 7.660   -2.256  1.00 0.00 ? 29  PRO A HD2  1  
ATOM   409   H  HD3  . PRO A 1 29 ? -10.618 7.007   -3.906  1.00 0.00 ? 29  PRO A HD3  1  
ATOM   410   N  N    . GLU A 1 30 ? -7.109  7.835   -1.108  1.00 0.00 ? 30  GLU A N    1  
ATOM   411   C  CA   . GLU A 1 30 ? -6.330  8.338   0.018   1.00 0.00 ? 30  GLU A CA   1  
ATOM   412   C  C    . GLU A 1 30 ? -6.034  7.222   1.016   1.00 0.00 ? 30  GLU A C    1  
ATOM   413   O  O    . GLU A 1 30 ? -5.085  7.307   1.796   1.00 0.00 ? 30  GLU A O    1  
ATOM   414   C  CB   . GLU A 1 30 ? -7.077  9.476   0.716   1.00 0.00 ? 30  GLU A CB   1  
ATOM   415   C  CG   . GLU A 1 30 ? -8.312  9.019   1.475   1.00 0.00 ? 30  GLU A CG   1  
ATOM   416   C  CD   . GLU A 1 30 ? -8.889  10.107  2.359   1.00 0.00 ? 30  GLU A CD   1  
ATOM   417   O  OE1  . GLU A 1 30 ? -8.825  11.290  1.963   1.00 0.00 ? 30  GLU A OE1  1  
ATOM   418   O  OE2  . GLU A 1 30 ? -9.406  9.775   3.446   1.00 0.00 ? 30  GLU A OE2  1  
ATOM   419   H  H    . GLU A 1 30 ? -7.964  7.389   -0.936  1.00 0.00 ? 30  GLU A H    1  
ATOM   420   H  HA   . GLU A 1 30 ? -5.396  8.716   -0.368  1.00 0.00 ? 30  GLU A HA   1  
ATOM   421   H  HB2  . GLU A 1 30 ? -6.407  9.956   1.414   1.00 0.00 ? 30  GLU A HB2  1  
ATOM   422   H  HB3  . GLU A 1 30 ? -7.384  10.197  -0.027  1.00 0.00 ? 30  GLU A HB3  1  
ATOM   423   H  HG2  . GLU A 1 30 ? -9.065  8.718   0.763   1.00 0.00 ? 30  GLU A HG2  1  
ATOM   424   H  HG3  . GLU A 1 30 ? -8.046  8.175   2.094   1.00 0.00 ? 30  GLU A HG3  1  
ATOM   425   N  N    . CYS A 1 31 ? -6.853  6.176   0.985   1.00 0.00 ? 31  CYS A N    1  
ATOM   426   C  CA   . CYS A 1 31 ? -6.681  5.043   1.886   1.00 0.00 ? 31  CYS A CA   1  
ATOM   427   C  C    . CYS A 1 31 ? -5.523  4.158   1.433   1.00 0.00 ? 31  CYS A C    1  
ATOM   428   O  O    . CYS A 1 31 ? -4.579  3.919   2.186   1.00 0.00 ? 31  CYS A O    1  
ATOM   429   C  CB   . CYS A 1 31 ? -7.969  4.220   1.955   1.00 0.00 ? 31  CYS A CB   1  
ATOM   430   S  SG   . CYS A 1 31 ? -9.239  4.918   3.059   1.00 0.00 ? 31  CYS A SG   1  
ATOM   431   H  H    . CYS A 1 31 ? -7.591  6.165   0.339   1.00 0.00 ? 31  CYS A H    1  
ATOM   432   H  HA   . CYS A 1 31 ? -6.459  5.431   2.868   1.00 0.00 ? 31  CYS A HA   1  
ATOM   433   H  HB2  . CYS A 1 31 ? -8.397  4.151   0.965   1.00 0.00 ? 31  CYS A HB2  1  
ATOM   434   H  HB3  . CYS A 1 31 ? -7.734  3.227   2.309   1.00 0.00 ? 31  CYS A HB3  1  
ATOM   435   N  N    . PHE A 1 32 ? -5.602  3.676   0.197   1.00 0.00 ? 32  PHE A N    1  
ATOM   436   C  CA   . PHE A 1 32 ? -4.561  2.818   -0.357  1.00 0.00 ? 32  PHE A CA   1  
ATOM   437   C  C    . PHE A 1 32 ? -3.211  3.527   -0.351  1.00 0.00 ? 32  PHE A C    1  
ATOM   438   O  O    . PHE A 1 32 ? -2.820  4.150   -1.338  1.00 0.00 ? 32  PHE A O    1  
ATOM   439   C  CB   . PHE A 1 32 ? -4.923  2.397   -1.782  1.00 0.00 ? 32  PHE A CB   1  
ATOM   440   C  CG   . PHE A 1 32 ? -4.189  1.173   -2.251  1.00 0.00 ? 32  PHE A CG   1  
ATOM   441   C  CD1  . PHE A 1 32 ? -4.187  0.016   -1.487  1.00 0.00 ? 32  PHE A CD1  1  
ATOM   442   C  CD2  . PHE A 1 32 ? -3.502  1.178   -3.454  1.00 0.00 ? 32  PHE A CD2  1  
ATOM   443   C  CE1  . PHE A 1 32 ? -3.512  -1.112  -1.916  1.00 0.00 ? 32  PHE A CE1  1  
ATOM   444   C  CE2  . PHE A 1 32 ? -2.826  0.053   -3.887  1.00 0.00 ? 32  PHE A CE2  1  
ATOM   445   C  CZ   . PHE A 1 32 ? -2.832  -1.093  -3.117  1.00 0.00 ? 32  PHE A CZ   1  
ATOM   446   H  H    . PHE A 1 32 ? -6.379  3.903   -0.355  1.00 0.00 ? 32  PHE A H    1  
ATOM   447   H  HA   . PHE A 1 32 ? -4.495  1.937   0.263   1.00 0.00 ? 32  PHE A HA   1  
ATOM   448   H  HB2  . PHE A 1 32 ? -5.981  2.188   -1.831  1.00 0.00 ? 32  PHE A HB2  1  
ATOM   449   H  HB3  . PHE A 1 32 ? -4.688  3.205   -2.459  1.00 0.00 ? 32  PHE A HB3  1  
ATOM   450   H  HD1  . PHE A 1 32 ? -4.720  0.000   -0.548  1.00 0.00 ? 32  PHE A HD1  1  
ATOM   451   H  HD2  . PHE A 1 32 ? -3.497  2.075   -4.057  1.00 0.00 ? 32  PHE A HD2  1  
ATOM   452   H  HE1  . PHE A 1 32 ? -3.519  -2.007  -1.312  1.00 0.00 ? 32  PHE A HE1  1  
ATOM   453   H  HE2  . PHE A 1 32 ? -2.295  0.071   -4.827  1.00 0.00 ? 32  PHE A HE2  1  
ATOM   454   H  HZ   . PHE A 1 32 ? -2.304  -1.973  -3.454  1.00 0.00 ? 32  PHE A HZ   1  
ATOM   455   N  N    . ARG A 1 33 ? -2.502  3.428   0.769   1.00 0.00 ? 33  ARG A N    1  
ATOM   456   C  CA   . ARG A 1 33 ? -1.196  4.062   0.906   1.00 0.00 ? 33  ARG A CA   1  
ATOM   457   C  C    . ARG A 1 33 ? -0.113  3.022   1.181   1.00 0.00 ? 33  ARG A C    1  
ATOM   458   O  O    . ARG A 1 33 ? -0.410  1.873   1.510   1.00 0.00 ? 33  ARG A O    1  
ATOM   459   C  CB   . ARG A 1 33 ? -1.222  5.097   2.032   1.00 0.00 ? 33  ARG A CB   1  
ATOM   460   C  CG   . ARG A 1 33 ? -2.281  6.171   1.847   1.00 0.00 ? 33  ARG A CG   1  
ATOM   461   C  CD   . ARG A 1 33 ? -2.225  7.206   2.960   1.00 0.00 ? 33  ARG A CD   1  
ATOM   462   N  NE   . ARG A 1 33 ? -1.341  8.320   2.627   1.00 0.00 ? 33  ARG A NE   1  
ATOM   463   C  CZ   . ARG A 1 33 ? -0.826  9.145   3.532   1.00 0.00 ? 33  ARG A CZ   1  
ATOM   464   N  NH1  . ARG A 1 33 ? -1.106  8.982   4.818   1.00 0.00 ? 33  ARG A NH1  1  
ATOM   465   N  NH2  . ARG A 1 33 ? -0.030  10.136  3.151   1.00 0.00 ? 33  ARG A NH2  1  
ATOM   466   H  H    . ARG A 1 33 ? -2.866  2.918   1.523   1.00 0.00 ? 33  ARG A H    1  
ATOM   467   H  HA   . ARG A 1 33 ? -0.971  4.561   -0.025  1.00 0.00 ? 33  ARG A HA   1  
ATOM   468   H  HB2  . ARG A 1 33 ? -1.414  4.590   2.966   1.00 0.00 ? 33  ARG A HB2  1  
ATOM   469   H  HB3  . ARG A 1 33 ? -0.257  5.578   2.084   1.00 0.00 ? 33  ARG A HB3  1  
ATOM   470   H  HG2  . ARG A 1 33 ? -2.117  6.666   0.902   1.00 0.00 ? 33  ARG A HG2  1  
ATOM   471   H  HG3  . ARG A 1 33 ? -3.256  5.706   1.848   1.00 0.00 ? 33  ARG A HG3  1  
ATOM   472   H  HD2  . ARG A 1 33 ? -3.221  7.587   3.129   1.00 0.00 ? 33  ARG A HD2  1  
ATOM   473   H  HD3  . ARG A 1 33 ? -1.865  6.728   3.859   1.00 0.00 ? 33  ARG A HD3  1  
ATOM   474   H  HE   . ARG A 1 33 ? -1.122  8.459   1.683   1.00 0.00 ? 33  ARG A HE   1  
ATOM   475   H  HH11 . ARG A 1 33 ? -1.704  8.235   5.108   1.00 0.00 ? 33  ARG A HH11 1  
ATOM   476   H  HH12 . ARG A 1 33 ? -0.715  9.604   5.497   1.00 0.00 ? 33  ARG A HH12 1  
ATOM   477   H  HH21 . ARG A 1 33 ? 0.183   10.262  2.183   1.00 0.00 ? 33  ARG A HH21 1  
ATOM   478   H  HH22 . ARG A 1 33 ? 0.357   10.756  3.833   1.00 0.00 ? 33  ARG A HH22 1  
ATOM   479   N  N    . CYS A 1 34 ? 1.143   3.433   1.043   1.00 0.00 ? 34  CYS A N    1  
ATOM   480   C  CA   . CYS A 1 34 ? 2.270   2.538   1.275   1.00 0.00 ? 34  CYS A CA   1  
ATOM   481   C  C    . CYS A 1 34 ? 2.233   1.973   2.692   1.00 0.00 ? 34  CYS A C    1  
ATOM   482   O  O    . CYS A 1 34 ? 1.513   2.477   3.554   1.00 0.00 ? 34  CYS A O    1  
ATOM   483   C  CB   . CYS A 1 34 ? 3.590   3.276   1.044   1.00 0.00 ? 34  CYS A CB   1  
ATOM   484   S  SG   . CYS A 1 34 ? 5.036   2.180   0.880   1.00 0.00 ? 34  CYS A SG   1  
ATOM   485   H  H    . CYS A 1 34 ? 1.316   4.361   0.778   1.00 0.00 ? 34  CYS A H    1  
ATOM   486   H  HA   . CYS A 1 34 ? 2.196   1.722   0.573   1.00 0.00 ? 34  CYS A HA   1  
ATOM   487   H  HB2  . CYS A 1 34 ? 3.514   3.857   0.136   1.00 0.00 ? 34  CYS A HB2  1  
ATOM   488   H  HB3  . CYS A 1 34 ? 3.773   3.941   1.875   1.00 0.00 ? 34  CYS A HB3  1  
ATOM   489   N  N    . ASP A 1 35 ? 3.013   0.923   2.925   1.00 0.00 ? 35  ASP A N    1  
ATOM   490   C  CA   . ASP A 1 35 ? 3.071   0.289   4.237   1.00 0.00 ? 35  ASP A CA   1  
ATOM   491   C  C    . ASP A 1 35 ? 4.349   0.679   4.973   1.00 0.00 ? 35  ASP A C    1  
ATOM   492   O  O    . ASP A 1 35 ? 4.599   0.223   6.090   1.00 0.00 ? 35  ASP A O    1  
ATOM   493   C  CB   . ASP A 1 35 ? 2.992   -1.232  4.096   1.00 0.00 ? 35  ASP A CB   1  
ATOM   494   C  CG   . ASP A 1 35 ? 2.758   -1.925  5.424   1.00 0.00 ? 35  ASP A CG   1  
ATOM   495   O  OD1  . ASP A 1 35 ? 1.594   -1.964  5.876   1.00 0.00 ? 35  ASP A OD1  1  
ATOM   496   O  OD2  . ASP A 1 35 ? 3.738   -2.428  6.011   1.00 0.00 ? 35  ASP A OD2  1  
ATOM   497   H  H    . ASP A 1 35 ? 3.564   0.566   2.197   1.00 0.00 ? 35  ASP A H    1  
ATOM   498   H  HA   . ASP A 1 35 ? 2.223   0.633   4.809   1.00 0.00 ? 35  ASP A HA   1  
ATOM   499   H  HB2  . ASP A 1 35 ? 2.178   -1.483  3.432   1.00 0.00 ? 35  ASP A HB2  1  
ATOM   500   H  HB3  . ASP A 1 35 ? 3.919   -1.597  3.679   1.00 0.00 ? 35  ASP A HB3  1  
ATOM   501   N  N    . LEU A 1 36 ? 5.156   1.523   4.340   1.00 0.00 ? 36  LEU A N    1  
ATOM   502   C  CA   . LEU A 1 36 ? 6.410   1.974   4.933   1.00 0.00 ? 36  LEU A CA   1  
ATOM   503   C  C    . LEU A 1 36 ? 6.463   3.496   5.004   1.00 0.00 ? 36  LEU A C    1  
ATOM   504   O  O    . LEU A 1 36 ? 7.042   4.066   5.930   1.00 0.00 ? 36  LEU A O    1  
ATOM   505   C  CB   . LEU A 1 36 ? 7.598   1.447   4.126   1.00 0.00 ? 36  LEU A CB   1  
ATOM   506   C  CG   . LEU A 1 36 ? 7.831   -0.063  4.181   1.00 0.00 ? 36  LEU A CG   1  
ATOM   507   C  CD1  . LEU A 1 36 ? 8.461   -0.554  2.887   1.00 0.00 ? 36  LEU A CD1  1  
ATOM   508   C  CD2  . LEU A 1 36 ? 8.705   -0.425  5.373   1.00 0.00 ? 36  LEU A CD2  1  
ATOM   509   H  H    . LEU A 1 36 ? 4.904   1.852   3.452   1.00 0.00 ? 36  LEU A H    1  
ATOM   510   H  HA   . LEU A 1 36 ? 6.463   1.577   5.936   1.00 0.00 ? 36  LEU A HA   1  
ATOM   511   H  HB2  . LEU A 1 36 ? 7.442   1.720   3.093   1.00 0.00 ? 36  LEU A HB2  1  
ATOM   512   H  HB3  . LEU A 1 36 ? 8.490   1.934   4.495   1.00 0.00 ? 36  LEU A HB3  1  
ATOM   513   H  HG   . LEU A 1 36 ? 6.879   -0.563  4.299   1.00 0.00 ? 36  LEU A HG   1  
ATOM   514   H  HD11 . LEU A 1 36 ? 7.778   -0.385  2.068   1.00 0.00 ? 36  LEU A HD11 1  
ATOM   515   H  HD12 . LEU A 1 36 ? 8.673   -1.609  2.967   1.00 0.00 ? 36  LEU A HD12 1  
ATOM   516   H  HD13 . LEU A 1 36 ? 9.380   -0.015  2.707   1.00 0.00 ? 36  LEU A HD13 1  
ATOM   517   H  HD21 . LEU A 1 36 ? 9.745   -0.316  5.102   1.00 0.00 ? 36  LEU A HD21 1  
ATOM   518   H  HD22 . LEU A 1 36 ? 8.514   -1.448  5.662   1.00 0.00 ? 36  LEU A HD22 1  
ATOM   519   H  HD23 . LEU A 1 36 ? 8.477   0.232   6.199   1.00 0.00 ? 36  LEU A HD23 1  
ATOM   520   N  N    . CYS A 1 37 ? 5.855   4.151   4.020   1.00 0.00 ? 37  CYS A N    1  
ATOM   521   C  CA   . CYS A 1 37 ? 5.830   5.607   3.971   1.00 0.00 ? 37  CYS A CA   1  
ATOM   522   C  C    . CYS A 1 37 ? 4.397   6.125   3.900   1.00 0.00 ? 37  CYS A C    1  
ATOM   523   O  O    . CYS A 1 37 ? 4.159   7.332   3.954   1.00 0.00 ? 37  CYS A O    1  
ATOM   524   C  CB   . CYS A 1 37 ? 6.626   6.111   2.765   1.00 0.00 ? 37  CYS A CB   1  
ATOM   525   S  SG   . CYS A 1 37 ? 5.862   5.725   1.156   1.00 0.00 ? 37  CYS A SG   1  
ATOM   526   H  H    . CYS A 1 37 ? 5.411   3.641   3.310   1.00 0.00 ? 37  CYS A H    1  
ATOM   527   H  HA   . CYS A 1 37 ? 6.290   5.978   4.874   1.00 0.00 ? 37  CYS A HA   1  
ATOM   528   H  HB2  . CYS A 1 37 ? 6.725   7.184   2.831   1.00 0.00 ? 37  CYS A HB2  1  
ATOM   529   H  HB3  . CYS A 1 37 ? 7.608   5.662   2.779   1.00 0.00 ? 37  CYS A HB3  1  
ATOM   530   N  N    . GLN A 1 38 ? 3.446   5.204   3.778   1.00 0.00 ? 38  GLN A N    1  
ATOM   531   C  CA   . GLN A 1 38 ? 2.036   5.568   3.699   1.00 0.00 ? 38  GLN A CA   1  
ATOM   532   C  C    . GLN A 1 38 ? 1.799   6.590   2.592   1.00 0.00 ? 38  GLN A C    1  
ATOM   533   O  O    . GLN A 1 38 ? 1.173   7.626   2.815   1.00 0.00 ? 38  GLN A O    1  
ATOM   534   C  CB   . GLN A 1 38 ? 1.557   6.130   5.039   1.00 0.00 ? 38  GLN A CB   1  
ATOM   535   C  CG   . GLN A 1 38 ? 1.805   5.197   6.214   1.00 0.00 ? 38  GLN A CG   1  
ATOM   536   C  CD   . GLN A 1 38 ? 0.629   4.282   6.490   1.00 0.00 ? 38  GLN A CD   1  
ATOM   537   O  OE1  . GLN A 1 38 ? -0.506  4.737   6.632   1.00 0.00 ? 38  GLN A OE1  1  
ATOM   538   N  NE2  . GLN A 1 38 ? 0.895   2.983   6.570   1.00 0.00 ? 38  GLN A NE2  1  
ATOM   539   H  H    . GLN A 1 38 ? 3.699   4.259   3.740   1.00 0.00 ? 38  GLN A H    1  
ATOM   540   H  HA   . GLN A 1 38 ? 1.475   4.674   3.473   1.00 0.00 ? 38  GLN A HA   1  
ATOM   541   H  HB2  . GLN A 1 38 ? 2.071   7.060   5.231   1.00 0.00 ? 38  GLN A HB2  1  
ATOM   542   H  HB3  . GLN A 1 38 ? 0.496   6.321   4.977   1.00 0.00 ? 38  GLN A HB3  1  
ATOM   543   H  HG2  . GLN A 1 38 ? 2.671   4.589   5.997   1.00 0.00 ? 38  GLN A HG2  1  
ATOM   544   H  HG3  . GLN A 1 38 ? 1.996   5.792   7.095   1.00 0.00 ? 38  GLN A HG3  1  
ATOM   545   H  HE21 . GLN A 1 38 ? 1.824   2.693   6.448   1.00 0.00 ? 38  GLN A HE21 1  
ATOM   546   H  HE22 . GLN A 1 38 ? 0.154   2.369   6.749   1.00 0.00 ? 38  GLN A HE22 1  
ATOM   547   N  N    . GLU A 1 39 ? 2.303   6.291   1.399   1.00 0.00 ? 39  GLU A N    1  
ATOM   548   C  CA   . GLU A 1 39 ? 2.146   7.185   0.258   1.00 0.00 ? 39  GLU A CA   1  
ATOM   549   C  C    . GLU A 1 39 ? 1.024   6.705   -0.658  1.00 0.00 ? 39  GLU A C    1  
ATOM   550   O  O    . GLU A 1 39 ? 0.981   5.538   -1.048  1.00 0.00 ? 39  GLU A O    1  
ATOM   551   C  CB   . GLU A 1 39 ? 3.456   7.280   -0.527  1.00 0.00 ? 39  GLU A CB   1  
ATOM   552   C  CG   . GLU A 1 39 ? 3.309   7.968   -1.874  1.00 0.00 ? 39  GLU A CG   1  
ATOM   553   C  CD   . GLU A 1 39 ? 4.603   8.599   -2.351  1.00 0.00 ? 39  GLU A CD   1  
ATOM   554   O  OE1  . GLU A 1 39 ? 5.590   7.858   -2.539  1.00 0.00 ? 39  GLU A OE1  1  
ATOM   555   O  OE2  . GLU A 1 39 ? 4.629   9.834   -2.536  1.00 0.00 ? 39  GLU A OE2  1  
ATOM   556   H  H    . GLU A 1 39 ? 2.793   5.450   1.284   1.00 0.00 ? 39  GLU A H    1  
ATOM   557   H  HA   . GLU A 1 39 ? 1.892   8.164   0.636   1.00 0.00 ? 39  GLU A HA   1  
ATOM   558   H  HB2  . GLU A 1 39 ? 4.175   7.832   0.060   1.00 0.00 ? 39  GLU A HB2  1  
ATOM   559   H  HB3  . GLU A 1 39 ? 3.833   6.282   -0.696  1.00 0.00 ? 39  GLU A HB3  1  
ATOM   560   H  HG2  . GLU A 1 39 ? 2.992   7.239   -2.604  1.00 0.00 ? 39  GLU A HG2  1  
ATOM   561   H  HG3  . GLU A 1 39 ? 2.559   8.740   -1.789  1.00 0.00 ? 39  GLU A HG3  1  
ATOM   562   N  N    . VAL A 1 40 ? 0.117   7.615   -0.999  1.00 0.00 ? 40  VAL A N    1  
ATOM   563   C  CA   . VAL A 1 40 ? -1.006  7.286   -1.869  1.00 0.00 ? 40  VAL A CA   1  
ATOM   564   C  C    . VAL A 1 40 ? -0.540  6.516   -3.099  1.00 0.00 ? 40  VAL A C    1  
ATOM   565   O  O    . VAL A 1 40 ? 0.190   7.046   -3.938  1.00 0.00 ? 40  VAL A O    1  
ATOM   566   C  CB   . VAL A 1 40 ? -1.753  8.554   -2.324  1.00 0.00 ? 40  VAL A CB   1  
ATOM   567   C  CG1  . VAL A 1 40 ? -2.955  8.187   -3.182  1.00 0.00 ? 40  VAL A CG1  1  
ATOM   568   C  CG2  . VAL A 1 40 ? -2.179  9.382   -1.121  1.00 0.00 ? 40  VAL A CG2  1  
ATOM   569   H  H    . VAL A 1 40 ? 0.204   8.529   -0.656  1.00 0.00 ? 40  VAL A H    1  
ATOM   570   H  HA   . VAL A 1 40 ? -1.694  6.670   -1.309  1.00 0.00 ? 40  VAL A HA   1  
ATOM   571   H  HB   . VAL A 1 40 ? -1.079  9.149   -2.923  1.00 0.00 ? 40  VAL A HB   1  
ATOM   572   H  HG11 . VAL A 1 40 ? -3.512  9.081   -3.421  1.00 0.00 ? 40  VAL A HG11 1  
ATOM   573   H  HG12 . VAL A 1 40 ? -2.616  7.717   -4.094  1.00 0.00 ? 40  VAL A HG12 1  
ATOM   574   H  HG13 . VAL A 1 40 ? -3.589  7.503   -2.638  1.00 0.00 ? 40  VAL A HG13 1  
ATOM   575   H  HG21 . VAL A 1 40 ? -1.305  9.672   -0.557  1.00 0.00 ? 40  VAL A HG21 1  
ATOM   576   H  HG22 . VAL A 1 40 ? -2.700  10.266  -1.458  1.00 0.00 ? 40  VAL A HG22 1  
ATOM   577   H  HG23 . VAL A 1 40 ? -2.835  8.795   -0.494  1.00 0.00 ? 40  VAL A HG23 1  
ATOM   578   N  N    . LEU A 1 41 ? -0.966  5.262   -3.201  1.00 0.00 ? 41  LEU A N    1  
ATOM   579   C  CA   . LEU A 1 41 ? -0.593  4.416   -4.330  1.00 0.00 ? 41  LEU A CA   1  
ATOM   580   C  C    . LEU A 1 41 ? -1.761  4.253   -5.298  1.00 0.00 ? 41  LEU A C    1  
ATOM   581   O  O    . LEU A 1 41 ? -2.084  3.142   -5.715  1.00 0.00 ? 41  LEU A O    1  
ATOM   582   C  CB   . LEU A 1 41 ? -0.132  3.045   -3.835  1.00 0.00 ? 41  LEU A CB   1  
ATOM   583   C  CG   . LEU A 1 41 ? 0.499   3.011   -2.442  1.00 0.00 ? 41  LEU A CG   1  
ATOM   584   C  CD1  . LEU A 1 41 ? 0.331   1.637   -1.813  1.00 0.00 ? 41  LEU A CD1  1  
ATOM   585   C  CD2  . LEU A 1 41 ? 1.970   3.391   -2.513  1.00 0.00 ? 41  LEU A CD2  1  
ATOM   586   H  H    . LEU A 1 41 ? -1.545  4.895   -2.502  1.00 0.00 ? 41  LEU A H    1  
ATOM   587   H  HA   . LEU A 1 41 ? 0.224   4.896   -4.848  1.00 0.00 ? 41  LEU A HA   1  
ATOM   588   H  HB2  . LEU A 1 41 ? -0.990  2.391   -3.825  1.00 0.00 ? 41  LEU A HB2  1  
ATOM   589   H  HB3  . LEU A 1 41 ? 0.598   2.668   -4.538  1.00 0.00 ? 41  LEU A HB3  1  
ATOM   590   H  HG   . LEU A 1 41 ? -0.003  3.730   -1.809  1.00 0.00 ? 41  LEU A HG   1  
ATOM   591   H  HD11 . LEU A 1 41 ? -0.351  1.703   -0.979  1.00 0.00 ? 41  LEU A HD11 1  
ATOM   592   H  HD12 . LEU A 1 41 ? 1.290   1.280   -1.467  1.00 0.00 ? 41  LEU A HD12 1  
ATOM   593   H  HD13 . LEU A 1 41 ? -0.064  0.950   -2.548  1.00 0.00 ? 41  LEU A HD13 1  
ATOM   594   H  HD21 . LEU A 1 41 ? 2.061   4.418   -2.836  1.00 0.00 ? 41  LEU A HD21 1  
ATOM   595   H  HD22 . LEU A 1 41 ? 2.475   2.747   -3.218  1.00 0.00 ? 41  LEU A HD22 1  
ATOM   596   H  HD23 . LEU A 1 41 ? 2.419   3.279   -1.537  1.00 0.00 ? 41  LEU A HD23 1  
ATOM   597   N  N    . ALA A 1 42 ? -2.389  5.370   -5.652  1.00 0.00 ? 42  ALA A N    1  
ATOM   598   C  CA   . ALA A 1 42 ? -3.518  5.351   -6.574  1.00 0.00 ? 42  ALA A CA   1  
ATOM   599   C  C    . ALA A 1 42 ? -3.067  5.648   -8.000  1.00 0.00 ? 42  ALA A C    1  
ATOM   600   O  O    . ALA A 1 42 ? -3.375  4.899   -8.927  1.00 0.00 ? 42  ALA A O    1  
ATOM   601   C  CB   . ALA A 1 42 ? -4.576  6.353   -6.133  1.00 0.00 ? 42  ALA A CB   1  
ATOM   602   H  H    . ALA A 1 42 ? -2.085  6.226   -5.286  1.00 0.00 ? 42  ALA A H    1  
ATOM   603   H  HA   . ALA A 1 42 ? -3.957  4.364   -6.544  1.00 0.00 ? 42  ALA A HA   1  
ATOM   604   H  HB1  . ALA A 1 42 ? -4.094  7.213   -5.692  1.00 0.00 ? 42  ALA A HB1  1  
ATOM   605   H  HB2  . ALA A 1 42 ? -5.155  6.664   -6.989  1.00 0.00 ? 42  ALA A HB2  1  
ATOM   606   H  HB3  . ALA A 1 42 ? -5.226  5.892   -5.405  1.00 0.00 ? 42  ALA A HB3  1  
ATOM   607   N  N    . ASP A 1 43 ? -2.338  6.746   -8.168  1.00 0.00 ? 43  ASP A N    1  
ATOM   608   C  CA   . ASP A 1 43 ? -1.844  7.141   -9.482  1.00 0.00 ? 43  ASP A CA   1  
ATOM   609   C  C    . ASP A 1 43 ? -0.418  6.644   -9.700  1.00 0.00 ? 43  ASP A C    1  
ATOM   610   O  O    . ASP A 1 43 ? -0.101  6.078   -10.746 1.00 0.00 ? 43  ASP A O    1  
ATOM   611   C  CB   . ASP A 1 43 ? -1.895  8.663   -9.633  1.00 0.00 ? 43  ASP A CB   1  
ATOM   612   C  CG   . ASP A 1 43 ? -3.275  9.226   -9.354  1.00 0.00 ? 43  ASP A CG   1  
ATOM   613   O  OD1  . ASP A 1 43 ? -3.883  8.831   -8.337  1.00 0.00 ? 43  ASP A OD1  1  
ATOM   614   O  OD2  . ASP A 1 43 ? -3.746  10.062  -10.153 1.00 0.00 ? 43  ASP A OD2  1  
ATOM   615   H  H    . ASP A 1 43 ? -2.125  7.302   -7.390  1.00 0.00 ? 43  ASP A H    1  
ATOM   616   H  HA   . ASP A 1 43 ? -2.485  6.694   -10.226 1.00 0.00 ? 43  ASP A HA   1  
ATOM   617   H  HB2  . ASP A 1 43 ? -1.197  9.110   -8.939  1.00 0.00 ? 43  ASP A HB2  1  
ATOM   618   H  HB3  . ASP A 1 43 ? -1.614  8.928   -10.641 1.00 0.00 ? 43  ASP A HB3  1  
ATOM   619   N  N    . ILE A 1 44 ? 0.436   6.860   -8.705  1.00 0.00 ? 44  ILE A N    1  
ATOM   620   C  CA   . ILE A 1 44 ? 1.828   6.433   -8.788  1.00 0.00 ? 44  ILE A CA   1  
ATOM   621   C  C    . ILE A 1 44 ? 1.931   4.917   -8.912  1.00 0.00 ? 44  ILE A C    1  
ATOM   622   O  O    . ILE A 1 44 ? 2.900   4.393   -9.459  1.00 0.00 ? 44  ILE A O    1  
ATOM   623   C  CB   . ILE A 1 44 ? 2.632   6.893   -7.558  1.00 0.00 ? 44  ILE A CB   1  
ATOM   624   C  CG1  . ILE A 1 44 ? 2.074   6.248   -6.287  1.00 0.00 ? 44  ILE A CG1  1  
ATOM   625   C  CG2  . ILE A 1 44 ? 2.606   8.410   -7.444  1.00 0.00 ? 44  ILE A CG2  1  
ATOM   626   C  CD1  . ILE A 1 44 ? 2.932   6.483   -5.064  1.00 0.00 ? 44  ILE A CD1  1  
ATOM   627   H  H    . ILE A 1 44 ? 0.123   7.316   -7.896  1.00 0.00 ? 44  ILE A H    1  
ATOM   628   H  HA   . ILE A 1 44 ? 2.263   6.886   -9.667  1.00 0.00 ? 44  ILE A HA   1  
ATOM   629   H  HB   . ILE A 1 44 ? 3.657   6.583   -7.690  1.00 0.00 ? 44  ILE A HB   1  
ATOM   630   H  HG12 . ILE A 1 44 ? 1.094   6.652   -6.087  1.00 0.00 ? 44  ILE A HG12 1  
ATOM   631   H  HG13 . ILE A 1 44 ? 1.995   5.181   -6.438  1.00 0.00 ? 44  ILE A HG13 1  
ATOM   632   H  HG21 . ILE A 1 44 ? 2.918   8.846   -8.382  1.00 0.00 ? 44  ILE A HG21 1  
ATOM   633   H  HG22 . ILE A 1 44 ? 1.603   8.736   -7.214  1.00 0.00 ? 44  ILE A HG22 1  
ATOM   634   H  HG23 . ILE A 1 44 ? 3.277   8.724   -6.659  1.00 0.00 ? 44  ILE A HG23 1  
ATOM   635   H  HD11 . ILE A 1 44 ? 3.136   7.539   -4.964  1.00 0.00 ? 44  ILE A HD11 1  
ATOM   636   H  HD12 . ILE A 1 44 ? 2.412   6.132   -4.186  1.00 0.00 ? 44  ILE A HD12 1  
ATOM   637   H  HD13 . ILE A 1 44 ? 3.864   5.946   -5.169  1.00 0.00 ? 44  ILE A HD13 1  
ATOM   638   N  N    . GLY A 1 45 ? 0.923   4.216   -8.400  1.00 0.00 ? 45  GLY A N    1  
ATOM   639   C  CA   . GLY A 1 45 ? 0.919   2.766   -8.465  1.00 0.00 ? 45  GLY A CA   1  
ATOM   640   C  C    . GLY A 1 45 ? 1.446   2.128   -7.195  1.00 0.00 ? 45  GLY A C    1  
ATOM   641   O  O    . GLY A 1 45 ? 1.994   2.811   -6.329  1.00 0.00 ? 45  GLY A O    1  
ATOM   642   H  H    . GLY A 1 45 ? 0.177   4.688   -7.975  1.00 0.00 ? 45  GLY A H    1  
ATOM   643   H  HA2  . GLY A 1 45 ? -0.092  2.427   -8.634  1.00 0.00 ? 45  GLY A HA2  1  
ATOM   644   H  HA3  . GLY A 1 45 ? 1.537   2.453   -9.294  1.00 0.00 ? 45  GLY A HA3  1  
ATOM   645   N  N    . PHE A 1 46 ? 1.278   0.815   -7.081  1.00 0.00 ? 46  PHE A N    1  
ATOM   646   C  CA   . PHE A 1 46 ? 1.738   0.084   -5.906  1.00 0.00 ? 46  PHE A CA   1  
ATOM   647   C  C    . PHE A 1 46 ? 2.485   -1.183  -6.311  1.00 0.00 ? 46  PHE A C    1  
ATOM   648   O  O    . PHE A 1 46 ? 2.480   -1.574  -7.478  1.00 0.00 ? 46  PHE A O    1  
ATOM   649   C  CB   . PHE A 1 46 ? 0.553   -0.275  -5.006  1.00 0.00 ? 46  PHE A CB   1  
ATOM   650   C  CG   . PHE A 1 46 ? -0.394  -1.262  -5.626  1.00 0.00 ? 46  PHE A CG   1  
ATOM   651   C  CD1  . PHE A 1 46 ? -1.214  -0.888  -6.678  1.00 0.00 ? 46  PHE A CD1  1  
ATOM   652   C  CD2  . PHE A 1 46 ? -0.464  -2.564  -5.157  1.00 0.00 ? 46  PHE A CD2  1  
ATOM   653   C  CE1  . PHE A 1 46 ? -2.086  -1.794  -7.252  1.00 0.00 ? 46  PHE A CE1  1  
ATOM   654   C  CE2  . PHE A 1 46 ? -1.333  -3.474  -5.727  1.00 0.00 ? 46  PHE A CE2  1  
ATOM   655   C  CZ   . PHE A 1 46 ? -2.147  -3.088  -6.775  1.00 0.00 ? 46  PHE A CZ   1  
ATOM   656   H  H    . PHE A 1 46 ? 0.833   0.325   -7.804  1.00 0.00 ? 46  PHE A H    1  
ATOM   657   H  HA   . PHE A 1 46 ? 2.412   0.726   -5.360  1.00 0.00 ? 46  PHE A HA   1  
ATOM   658   H  HB2  . PHE A 1 46 ? 0.925   -0.704  -4.088  1.00 0.00 ? 46  PHE A HB2  1  
ATOM   659   H  HB3  . PHE A 1 46 ? -0.002  0.623   -4.780  1.00 0.00 ? 46  PHE A HB3  1  
ATOM   660   H  HD1  . PHE A 1 46 ? -1.168  0.125   -7.052  1.00 0.00 ? 46  PHE A HD1  1  
ATOM   661   H  HD2  . PHE A 1 46 ? 0.171   -2.867  -4.337  1.00 0.00 ? 46  PHE A HD2  1  
ATOM   662   H  HE1  . PHE A 1 46 ? -2.721  -1.489  -8.071  1.00 0.00 ? 46  PHE A HE1  1  
ATOM   663   H  HE2  . PHE A 1 46 ? -1.379  -4.486  -5.352  1.00 0.00 ? 46  PHE A HE2  1  
ATOM   664   H  HZ   . PHE A 1 46 ? -2.827  -3.798  -7.222  1.00 0.00 ? 46  PHE A HZ   1  
ATOM   665   N  N    . VAL A 1 47 ? 3.128   -1.821  -5.338  1.00 0.00 ? 47  VAL A N    1  
ATOM   666   C  CA   . VAL A 1 47 ? 3.879   -3.044  -5.592  1.00 0.00 ? 47  VAL A CA   1  
ATOM   667   C  C    . VAL A 1 47 ? 3.582   -4.101  -4.535  1.00 0.00 ? 47  VAL A C    1  
ATOM   668   O  O    . VAL A 1 47 ? 3.949   -3.951  -3.369  1.00 0.00 ? 47  VAL A O    1  
ATOM   669   C  CB   . VAL A 1 47 ? 5.396   -2.775  -5.620  1.00 0.00 ? 47  VAL A CB   1  
ATOM   670   C  CG1  . VAL A 1 47 ? 6.154   -4.031  -6.021  1.00 0.00 ? 47  VAL A CG1  1  
ATOM   671   C  CG2  . VAL A 1 47 ? 5.715   -1.626  -6.564  1.00 0.00 ? 47  VAL A CG2  1  
ATOM   672   H  H    . VAL A 1 47 ? 3.095   -1.460  -4.427  1.00 0.00 ? 47  VAL A H    1  
ATOM   673   H  HA   . VAL A 1 47 ? 3.584   -3.423  -6.559  1.00 0.00 ? 47  VAL A HA   1  
ATOM   674   H  HB   . VAL A 1 47 ? 5.710   -2.494  -4.625  1.00 0.00 ? 47  VAL A HB   1  
ATOM   675   H  HG11 . VAL A 1 47 ? 5.450   -4.800  -6.307  1.00 0.00 ? 47  VAL A HG11 1  
ATOM   676   H  HG12 . VAL A 1 47 ? 6.805   -3.809  -6.854  1.00 0.00 ? 47  VAL A HG12 1  
ATOM   677   H  HG13 . VAL A 1 47 ? 6.743   -4.378  -5.185  1.00 0.00 ? 47  VAL A HG13 1  
ATOM   678   H  HG21 . VAL A 1 47 ? 6.271   -2.000  -7.410  1.00 0.00 ? 47  VAL A HG21 1  
ATOM   679   H  HG22 . VAL A 1 47 ? 4.795   -1.176  -6.908  1.00 0.00 ? 47  VAL A HG22 1  
ATOM   680   H  HG23 . VAL A 1 47 ? 6.305   -0.886  -6.044  1.00 0.00 ? 47  VAL A HG23 1  
ATOM   681   N  N    . LYS A 1 48 ? 2.913   -5.173  -4.949  1.00 0.00 ? 48  LYS A N    1  
ATOM   682   C  CA   . LYS A 1 48 ? 2.566   -6.258  -4.040  1.00 0.00 ? 48  LYS A CA   1  
ATOM   683   C  C    . LYS A 1 48 ? 3.817   -6.989  -3.563  1.00 0.00 ? 48  LYS A C    1  
ATOM   684   O  O    . LYS A 1 48 ? 4.575   -7.531  -4.367  1.00 0.00 ? 48  LYS A O    1  
ATOM   685   C  CB   . LYS A 1 48 ? 1.618   -7.243  -4.726  1.00 0.00 ? 48  LYS A CB   1  
ATOM   686   C  CG   . LYS A 1 48 ? 0.149   -6.932  -4.497  1.00 0.00 ? 48  LYS A CG   1  
ATOM   687   C  CD   . LYS A 1 48 ? -0.270  -7.238  -3.069  1.00 0.00 ? 48  LYS A CD   1  
ATOM   688   C  CE   . LYS A 1 48 ? -0.369  -8.737  -2.826  1.00 0.00 ? 48  LYS A CE   1  
ATOM   689   N  NZ   . LYS A 1 48 ? 0.955   -9.336  -2.504  1.00 0.00 ? 48  LYS A NZ   1  
ATOM   690   H  H    . LYS A 1 48 ? 2.648   -5.235  -5.891  1.00 0.00 ? 48  LYS A H    1  
ATOM   691   H  HA   . LYS A 1 48 ? 2.068   -5.828  -3.184  1.00 0.00 ? 48  LYS A HA   1  
ATOM   692   H  HB2  . LYS A 1 48 ? 1.806   -7.224  -5.790  1.00 0.00 ? 48  LYS A HB2  1  
ATOM   693   H  HB3  . LYS A 1 48 ? 1.817   -8.237  -4.352  1.00 0.00 ? 48  LYS A HB3  1  
ATOM   694   H  HG2  . LYS A 1 48 ? -0.024  -5.885  -4.694  1.00 0.00 ? 48  LYS A HG2  1  
ATOM   695   H  HG3  . LYS A 1 48 ? -0.446  -7.531  -5.173  1.00 0.00 ? 48  LYS A HG3  1  
ATOM   696   H  HD2  . LYS A 1 48 ? 0.462   -6.824  -2.391  1.00 0.00 ? 48  LYS A HD2  1  
ATOM   697   H  HD3  . LYS A 1 48 ? -1.234  -6.787  -2.881  1.00 0.00 ? 48  LYS A HD3  1  
ATOM   698   H  HE2  . LYS A 1 48 ? -1.044  -8.911  -2.002  1.00 0.00 ? 48  LYS A HE2  1  
ATOM   699   H  HE3  . LYS A 1 48 ? -0.761  -9.207  -3.716  1.00 0.00 ? 48  LYS A HE3  1  
ATOM   700   H  HZ1  . LYS A 1 48 ? 0.856   -10.027 -1.732  1.00 0.00 ? 48  LYS A HZ1  1  
ATOM   701   H  HZ2  . LYS A 1 48 ? 1.620   -8.594  -2.205  1.00 0.00 ? 48  LYS A HZ2  1  
ATOM   702   H  HZ3  . LYS A 1 48 ? 1.343   -9.818  -3.339  1.00 0.00 ? 48  LYS A HZ3  1  
ATOM   703   N  N    . ASN A 1 49 ? 4.027   -7.001  -2.251  1.00 0.00 ? 49  ASN A N    1  
ATOM   704   C  CA   . ASN A 1 49 ? 5.186   -7.667  -1.667  1.00 0.00 ? 49  ASN A CA   1  
ATOM   705   C  C    . ASN A 1 49 ? 4.885   -8.138  -0.248  1.00 0.00 ? 49  ASN A C    1  
ATOM   706   O  O    . ASN A 1 49 ? 4.365   -7.381  0.571   1.00 0.00 ? 49  ASN A O    1  
ATOM   707   C  CB   . ASN A 1 49 ? 6.391   -6.725  -1.660  1.00 0.00 ? 49  ASN A CB   1  
ATOM   708   C  CG   . ASN A 1 49 ? 7.707   -7.469  -1.775  1.00 0.00 ? 49  ASN A CG   1  
ATOM   709   O  OD1  . ASN A 1 49 ? 7.740   -8.640  -2.154  1.00 0.00 ? 49  ASN A OD1  1  
ATOM   710   N  ND2  . ASN A 1 49 ? 8.801   -6.791  -1.446  1.00 0.00 ? 49  ASN A ND2  1  
ATOM   711   H  H    . ASN A 1 49 ? 3.387   -6.551  -1.660  1.00 0.00 ? 49  ASN A H    1  
ATOM   712   H  HA   . ASN A 1 49 ? 5.416   -8.527  -2.278  1.00 0.00 ? 49  ASN A HA   1  
ATOM   713   H  HB2  . ASN A 1 49 ? 6.312   -6.042  -2.493  1.00 0.00 ? 49  ASN A HB2  1  
ATOM   714   H  HB3  . ASN A 1 49 ? 6.395   -6.162  -0.738  1.00 0.00 ? 49  ASN A HB3  1  
ATOM   715   H  HD21 . ASN A 1 49 ? 8.699   -5.862  -1.152  1.00 0.00 ? 49  ASN A HD21 1  
ATOM   716   H  HD22 . ASN A 1 49 ? 9.665   -7.248  -1.512  1.00 0.00 ? 49  ASN A HD22 1  
ATOM   717   N  N    . ALA A 1 50 ? 5.217   -9.393  0.036   1.00 0.00 ? 50  ALA A N    1  
ATOM   718   C  CA   . ALA A 1 50 ? 4.986   -9.964  1.357   1.00 0.00 ? 50  ALA A CA   1  
ATOM   719   C  C    . ALA A 1 50 ? 3.561   -9.695  1.830   1.00 0.00 ? 50  ALA A C    1  
ATOM   720   O  O    . ALA A 1 50 ? 3.311   -9.547  3.025   1.00 0.00 ? 50  ALA A O    1  
ATOM   721   C  CB   . ALA A 1 50 ? 5.990   -9.408  2.356   1.00 0.00 ? 50  ALA A CB   1  
ATOM   722   H  H    . ALA A 1 50 ? 5.629   -9.947  -0.659  1.00 0.00 ? 50  ALA A H    1  
ATOM   723   H  HA   . ALA A 1 50 ? 5.136   -11.032 1.290   1.00 0.00 ? 50  ALA A HA   1  
ATOM   724   H  HB1  . ALA A 1 50 ? 5.473   -8.797  3.082   1.00 0.00 ? 50  ALA A HB1  1  
ATOM   725   H  HB2  . ALA A 1 50 ? 6.486   -10.224 2.860   1.00 0.00 ? 50  ALA A HB2  1  
ATOM   726   H  HB3  . ALA A 1 50 ? 6.721   -8.808  1.835   1.00 0.00 ? 50  ALA A HB3  1  
ATOM   727   N  N    . GLY A 1 51 ? 2.630   -9.631  0.883   1.00 0.00 ? 51  GLY A N    1  
ATOM   728   C  CA   . GLY A 1 51 ? 1.242   -9.378  1.223   1.00 0.00 ? 51  GLY A CA   1  
ATOM   729   C  C    . GLY A 1 51 ? 1.020   -7.972  1.745   1.00 0.00 ? 51  GLY A C    1  
ATOM   730   O  O    . GLY A 1 51 ? 0.121   -7.738  2.553   1.00 0.00 ? 51  GLY A O    1  
ATOM   731   H  H    . GLY A 1 51 ? 2.888   -9.757  -0.054  1.00 0.00 ? 51  GLY A H    1  
ATOM   732   H  HA2  . GLY A 1 51 ? 0.635   -9.524  0.343   1.00 0.00 ? 51  GLY A HA2  1  
ATOM   733   H  HA3  . GLY A 1 51 ? 0.935   -10.083 1.981   1.00 0.00 ? 51  GLY A HA3  1  
ATOM   734   N  N    . ARG A 1 52 ? 1.841   -7.035  1.283   1.00 0.00 ? 52  ARG A N    1  
ATOM   735   C  CA   . ARG A 1 52 ? 1.732   -5.645  1.711   1.00 0.00 ? 52  ARG A CA   1  
ATOM   736   C  C    . ARG A 1 52 ? 1.844   -4.699  0.519   1.00 0.00 ? 52  ARG A C    1  
ATOM   737   O  O    . ARG A 1 52 ? 2.608   -4.947  -0.414  1.00 0.00 ? 52  ARG A O    1  
ATOM   738   C  CB   . ARG A 1 52 ? 2.817   -5.319  2.738   1.00 0.00 ? 52  ARG A CB   1  
ATOM   739   C  CG   . ARG A 1 52 ? 2.752   -6.181  3.988   1.00 0.00 ? 52  ARG A CG   1  
ATOM   740   C  CD   . ARG A 1 52 ? 4.013   -6.043  4.826   1.00 0.00 ? 52  ARG A CD   1  
ATOM   741   N  NE   . ARG A 1 52 ? 4.145   -7.125  5.799   1.00 0.00 ? 52  ARG A NE   1  
ATOM   742   C  CZ   . ARG A 1 52 ? 4.923   -7.056  6.873   1.00 0.00 ? 52  ARG A CZ   1  
ATOM   743   N  NH1  . ARG A 1 52 ? 5.636   -5.964  7.111   1.00 0.00 ? 52  ARG A NH1  1  
ATOM   744   N  NH2  . ARG A 1 52 ? 4.990   -8.082  7.712   1.00 0.00 ? 52  ARG A NH2  1  
ATOM   745   H  H    . ARG A 1 52 ? 2.538   -7.284  0.640   1.00 0.00 ? 52  ARG A H    1  
ATOM   746   H  HA   . ARG A 1 52 ? 0.763   -5.515  2.169   1.00 0.00 ? 52  ARG A HA   1  
ATOM   747   H  HB2  . ARG A 1 52 ? 3.785   -5.461  2.280   1.00 0.00 ? 52  ARG A HB2  1  
ATOM   748   H  HB3  . ARG A 1 52 ? 2.716   -4.285  3.034   1.00 0.00 ? 52  ARG A HB3  1  
ATOM   749   H  HG2  . ARG A 1 52 ? 1.903   -5.874  4.582   1.00 0.00 ? 52  ARG A HG2  1  
ATOM   750   H  HG3  . ARG A 1 52 ? 2.635   -7.214  3.696   1.00 0.00 ? 52  ARG A HG3  1  
ATOM   751   H  HD2  . ARG A 1 52 ? 4.870   -6.057  4.169   1.00 0.00 ? 52  ARG A HD2  1  
ATOM   752   H  HD3  . ARG A 1 52 ? 3.978   -5.101  5.352   1.00 0.00 ? 52  ARG A HD3  1  
ATOM   753   H  HE   . ARG A 1 52 ? 3.627   -7.941  5.643   1.00 0.00 ? 52  ARG A HE   1  
ATOM   754   H  HH11 . ARG A 1 52 ? 5.587   -5.189  6.481   1.00 0.00 ? 52  ARG A HH11 1  
ATOM   755   H  HH12 . ARG A 1 52 ? 6.221   -5.915  7.921   1.00 0.00 ? 52  ARG A HH12 1  
ATOM   756   H  HH21 . ARG A 1 52 ? 4.454   -8.907  7.536   1.00 0.00 ? 52  ARG A HH21 1  
ATOM   757   H  HH22 . ARG A 1 52 ? 5.576   -8.030  8.520   1.00 0.00 ? 52  ARG A HH22 1  
ATOM   758   N  N    . HIS A 1 53 ? 1.076   -3.615  0.556   1.00 0.00 ? 53  HIS A N    1  
ATOM   759   C  CA   . HIS A 1 53 ? 1.088   -2.632  -0.521  1.00 0.00 ? 53  HIS A CA   1  
ATOM   760   C  C    . HIS A 1 53 ? 2.176   -1.586  -0.290  1.00 0.00 ? 53  HIS A C    1  
ATOM   761   O  O    . HIS A 1 53 ? 2.102   -0.798  0.654   1.00 0.00 ? 53  HIS A O    1  
ATOM   762   C  CB   . HIS A 1 53 ? -0.275  -1.950  -0.634  1.00 0.00 ? 53  HIS A CB   1  
ATOM   763   C  CG   . HIS A 1 53 ? -0.751  -1.346  0.652   1.00 0.00 ? 53  HIS A CG   1  
ATOM   764   N  ND1  . HIS A 1 53 ? -0.021  -1.394  1.821   1.00 0.00 ? 53  HIS A ND1  1  
ATOM   765   C  CD2  . HIS A 1 53 ? -1.890  -0.677  0.948   1.00 0.00 ? 53  HIS A CD2  1  
ATOM   766   C  CE1  . HIS A 1 53 ? -0.692  -0.781  2.781   1.00 0.00 ? 53  HIS A CE1  1  
ATOM   767   N  NE2  . HIS A 1 53 ? -1.829  -0.337  2.277   1.00 0.00 ? 53  HIS A NE2  1  
ATOM   768   H  H    . HIS A 1 53 ? 0.487   -3.473  1.326   1.00 0.00 ? 53  HIS A H    1  
ATOM   769   H  HA   . HIS A 1 53 ? 1.298   -3.152  -1.443  1.00 0.00 ? 53  HIS A HA   1  
ATOM   770   H  HB2  . HIS A 1 53 ? -0.216  -1.160  -1.368  1.00 0.00 ? 53  HIS A HB2  1  
ATOM   771   H  HB3  . HIS A 1 53 ? -1.009  -2.676  -0.951  1.00 0.00 ? 53  HIS A HB3  1  
ATOM   772   H  HD1  . HIS A 1 53 ? 0.856   -1.815  1.931   1.00 0.00 ? 53  HIS A HD1  1  
ATOM   773   H  HD2  . HIS A 1 53 ? -2.698  -0.452  0.266   1.00 0.00 ? 53  HIS A HD2  1  
ATOM   774   H  HE1  . HIS A 1 53 ? -0.366  -0.663  3.803   1.00 0.00 ? 53  HIS A HE1  1  
ATOM   775   H  HE2  . HIS A 1 53 ? -2.550  0.079   2.793   1.00 0.00 ? 53  HIS A HE2  1  
ATOM   776   N  N    . LEU A 1 54 ? 3.183   -1.586  -1.155  1.00 0.00 ? 54  LEU A N    1  
ATOM   777   C  CA   . LEU A 1 54 ? 4.287   -0.639  -1.045  1.00 0.00 ? 54  LEU A CA   1  
ATOM   778   C  C    . LEU A 1 54 ? 4.462   0.146   -2.341  1.00 0.00 ? 54  LEU A C    1  
ATOM   779   O  O    . LEU A 1 54 ? 3.905   -0.215  -3.378  1.00 0.00 ? 54  LEU A O    1  
ATOM   780   C  CB   . LEU A 1 54 ? 5.584   -1.373  -0.701  1.00 0.00 ? 54  LEU A CB   1  
ATOM   781   C  CG   . LEU A 1 54 ? 5.431   -2.664  0.104   1.00 0.00 ? 54  LEU A CG   1  
ATOM   782   C  CD1  . LEU A 1 54 ? 6.723   -3.465  0.079   1.00 0.00 ? 54  LEU A CD1  1  
ATOM   783   C  CD2  . LEU A 1 54 ? 5.020   -2.355  1.536   1.00 0.00 ? 54  LEU A CD2  1  
ATOM   784   H  H    . LEU A 1 54 ? 3.187   -2.239  -1.886  1.00 0.00 ? 54  LEU A H    1  
ATOM   785   H  HA   . LEU A 1 54 ? 4.052   0.052   -0.249  1.00 0.00 ? 54  LEU A HA   1  
ATOM   786   H  HB2  . LEU A 1 54 ? 6.081   -1.618  -1.627  1.00 0.00 ? 54  LEU A HB2  1  
ATOM   787   H  HB3  . LEU A 1 54 ? 6.204   -0.697  -0.129  1.00 0.00 ? 54  LEU A HB3  1  
ATOM   788   H  HG   . LEU A 1 54 ? 4.655   -3.270  -0.344  1.00 0.00 ? 54  LEU A HG   1  
ATOM   789   H  HD11 . LEU A 1 54 ? 7.042   -3.603  -0.943  1.00 0.00 ? 54  LEU A HD11 1  
ATOM   790   H  HD12 . LEU A 1 54 ? 6.559   -4.429  0.538   1.00 0.00 ? 54  LEU A HD12 1  
ATOM   791   H  HD13 . LEU A 1 54 ? 7.487   -2.932  0.626   1.00 0.00 ? 54  LEU A HD13 1  
ATOM   792   H  HD21 . LEU A 1 54 ? 5.892   -2.075  2.107   1.00 0.00 ? 54  LEU A HD21 1  
ATOM   793   H  HD22 . LEU A 1 54 ? 4.566   -3.231  1.977   1.00 0.00 ? 54  LEU A HD22 1  
ATOM   794   H  HD23 . LEU A 1 54 ? 4.310   -1.541  1.539   1.00 0.00 ? 54  LEU A HD23 1  
ATOM   795   N  N    . CYS A 1 55 ? 5.241   1.221   -2.275  1.00 0.00 ? 55  CYS A N    1  
ATOM   796   C  CA   . CYS A 1 55 ? 5.492   2.057   -3.443  1.00 0.00 ? 55  CYS A CA   1  
ATOM   797   C  C    . CYS A 1 55 ? 6.853   1.741   -4.055  1.00 0.00 ? 55  CYS A C    1  
ATOM   798   O  O    . CYS A 1 55 ? 7.792   1.372   -3.349  1.00 0.00 ? 55  CYS A O    1  
ATOM   799   C  CB   . CYS A 1 55 ? 5.422   3.537   -3.061  1.00 0.00 ? 55  CYS A CB   1  
ATOM   800   S  SG   . CYS A 1 55 ? 6.779   4.090   -1.978  1.00 0.00 ? 55  CYS A SG   1  
ATOM   801   H  H    . CYS A 1 55 ? 5.657   1.458   -1.419  1.00 0.00 ? 55  CYS A H    1  
ATOM   802   H  HA   . CYS A 1 55 ? 4.725   1.846   -4.173  1.00 0.00 ? 55  CYS A HA   1  
ATOM   803   H  HB2  . CYS A 1 55 ? 5.456   4.135   -3.960  1.00 0.00 ? 55  CYS A HB2  1  
ATOM   804   H  HB3  . CYS A 1 55 ? 4.492   3.725   -2.545  1.00 0.00 ? 55  CYS A HB3  1  
ATOM   805   N  N    . ARG A 1 56 ? 6.952   1.890   -5.372  1.00 0.00 ? 56  ARG A N    1  
ATOM   806   C  CA   . ARG A 1 56 ? 8.198   1.620   -6.080  1.00 0.00 ? 56  ARG A CA   1  
ATOM   807   C  C    . ARG A 1 56 ? 9.403   2.008   -5.227  1.00 0.00 ? 56  ARG A C    1  
ATOM   808   O  O    . ARG A 1 56 ? 10.317  1.215   -5.003  1.00 0.00 ? 56  ARG A O    1  
ATOM   809   C  CB   . ARG A 1 56 ? 8.231   2.383   -7.406  1.00 0.00 ? 56  ARG A CB   1  
ATOM   810   C  CG   . ARG A 1 56 ? 7.877   1.526   -8.610  1.00 0.00 ? 56  ARG A CG   1  
ATOM   811   C  CD   . ARG A 1 56 ? 9.044   0.647   -9.032  1.00 0.00 ? 56  ARG A CD   1  
ATOM   812   N  NE   . ARG A 1 56 ? 10.020  1.382   -9.832  1.00 0.00 ? 56  ARG A NE   1  
ATOM   813   C  CZ   . ARG A 1 56 ? 10.873  0.799   -10.667 1.00 0.00 ? 56  ARG A CZ   1  
ATOM   814   N  NH1  . ARG A 1 56 ? 10.870  -0.519  -10.811 1.00 0.00 ? 56  ARG A NH1  1  
ATOM   815   N  NH2  . ARG A 1 56 ? 11.732  1.535   -11.361 1.00 0.00 ? 56  ARG A NH2  1  
ATOM   816   H  H    . ARG A 1 56 ? 6.169   2.188   -5.880  1.00 0.00 ? 56  ARG A H    1  
ATOM   817   H  HA   . ARG A 1 56 ? 8.242   0.561   -6.283  1.00 0.00 ? 56  ARG A HA   1  
ATOM   818   H  HB2  . ARG A 1 56 ? 7.529   3.201   -7.355  1.00 0.00 ? 56  ARG A HB2  1  
ATOM   819   H  HB3  . ARG A 1 56 ? 9.224   2.780   -7.554  1.00 0.00 ? 56  ARG A HB3  1  
ATOM   820   H  HG2  . ARG A 1 56 ? 7.038   0.893   -8.356  1.00 0.00 ? 56  ARG A HG2  1  
ATOM   821   H  HG3  . ARG A 1 56 ? 7.607   2.171   -9.432  1.00 0.00 ? 56  ARG A HG3  1  
ATOM   822   H  HD2  . ARG A 1 56 ? 9.531   0.269   -8.146  1.00 0.00 ? 56  ARG A HD2  1  
ATOM   823   H  HD3  . ARG A 1 56 ? 8.663   -0.179  -9.613  1.00 0.00 ? 56  ARG A HD3  1  
ATOM   824   H  HE   . ARG A 1 56 ? 10.040  2.357   -9.742  1.00 0.00 ? 56  ARG A HE   1  
ATOM   825   H  HH11 . ARG A 1 56 ? 10.224  -1.076  -10.289 1.00 0.00 ? 56  ARG A HH11 1  
ATOM   826   H  HH12 . ARG A 1 56 ? 11.513  -0.955  -11.441 1.00 0.00 ? 56  ARG A HH12 1  
ATOM   827   H  HH21 . ARG A 1 56 ? 11.737  2.529   -11.256 1.00 0.00 ? 56  ARG A HH21 1  
ATOM   828   H  HH22 . ARG A 1 56 ? 12.373  1.096   -11.989 1.00 0.00 ? 56  ARG A HH22 1  
ATOM   829   N  N    . PRO A 1 57 ? 9.405   3.258   -4.740  1.00 0.00 ? 57  PRO A N    1  
ATOM   830   C  CA   . PRO A 1 57 ? 10.491  3.780   -3.905  1.00 0.00 ? 57  PRO A CA   1  
ATOM   831   C  C    . PRO A 1 57 ? 10.867  2.823   -2.779  1.00 0.00 ? 57  PRO A C    1  
ATOM   832   O  O    . PRO A 1 57 ? 11.977  2.292   -2.746  1.00 0.00 ? 57  PRO A O    1  
ATOM   833   C  CB   . PRO A 1 57 ? 9.909   5.075   -3.335  1.00 0.00 ? 57  PRO A CB   1  
ATOM   834   C  CG   . PRO A 1 57 ? 8.887   5.502   -4.331  1.00 0.00 ? 57  PRO A CG   1  
ATOM   835   C  CD   . PRO A 1 57 ? 8.348   4.258   -4.967  1.00 0.00 ? 57  PRO A CD   1  
ATOM   836   H  HA   . PRO A 1 57 ? 11.370  4.006   -4.492  1.00 0.00 ? 57  PRO A HA   1  
ATOM   837   H  HB2  . PRO A 1 57 ? 9.463   4.878   -2.370  1.00 0.00 ? 57  PRO A HB2  1  
ATOM   838   H  HB3  . PRO A 1 57 ? 10.692  5.812   -3.232  1.00 0.00 ? 57  PRO A HB3  1  
ATOM   839   H  HG2  . PRO A 1 57 ? 8.090   6.035   -3.835  1.00 0.00 ? 57  PRO A HG2  1  
ATOM   840   H  HG3  . PRO A 1 57 ? 9.347   6.128   -5.082  1.00 0.00 ? 57  PRO A HG3  1  
ATOM   841   H  HD2  . PRO A 1 57 ? 7.428   3.962   -4.486  1.00 0.00 ? 57  PRO A HD2  1  
ATOM   842   H  HD3  . PRO A 1 57 ? 8.190   4.418   -6.023  1.00 0.00 ? 57  PRO A HD3  1  
ATOM   843   N  N    . CYS A 1 58 ? 9.935   2.607   -1.856  1.00 0.00 ? 58  CYS A N    1  
ATOM   844   C  CA   . CYS A 1 58 ? 10.168  1.714   -0.728  1.00 0.00 ? 58  CYS A CA   1  
ATOM   845   C  C    . CYS A 1 58 ? 10.471  0.298   -1.208  1.00 0.00 ? 58  CYS A C    1  
ATOM   846   O  O    . CYS A 1 58 ? 11.582  -0.204  -1.033  1.00 0.00 ? 58  CYS A O    1  
ATOM   847   C  CB   . CYS A 1 58 ? 8.950   1.701   0.198   1.00 0.00 ? 58  CYS A CB   1  
ATOM   848   S  SG   . CYS A 1 58 ? 8.558   3.321   0.934   1.00 0.00 ? 58  CYS A SG   1  
ATOM   849   H  H    . CYS A 1 58 ? 9.069   3.060   -1.937  1.00 0.00 ? 58  CYS A H    1  
ATOM   850   H  HA   . CYS A 1 58 ? 11.021  2.086   -0.181  1.00 0.00 ? 58  CYS A HA   1  
ATOM   851   H  HB2  . CYS A 1 58 ? 8.085   1.378   -0.362  1.00 0.00 ? 58  CYS A HB2  1  
ATOM   852   H  HB3  . CYS A 1 58 ? 9.129   1.007   1.006   1.00 0.00 ? 58  CYS A HB3  1  
ATOM   853   N  N    . HIS A 1 59 ? 9.476   -0.341  -1.815  1.00 0.00 ? 59  HIS A N    1  
ATOM   854   C  CA   . HIS A 1 59 ? 9.636   -1.699  -2.321  1.00 0.00 ? 59  HIS A CA   1  
ATOM   855   C  C    . HIS A 1 59 ? 11.038  -1.907  -2.886  1.00 0.00 ? 59  HIS A C    1  
ATOM   856   O  O    . HIS A 1 59 ? 11.692  -2.907  -2.595  1.00 0.00 ? 59  HIS A O    1  
ATOM   857   C  CB   . HIS A 1 59 ? 8.591   -1.991  -3.399  1.00 0.00 ? 59  HIS A CB   1  
ATOM   858   C  CG   . HIS A 1 59 ? 8.996   -3.075  -4.349  1.00 0.00 ? 59  HIS A CG   1  
ATOM   859   N  ND1  . HIS A 1 59 ? 9.298   -4.358  -3.942  1.00 0.00 ? 59  HIS A ND1  1  
ATOM   860   C  CD2  . HIS A 1 59 ? 9.147   -3.064  -5.694  1.00 0.00 ? 59  HIS A CD2  1  
ATOM   861   C  CE1  . HIS A 1 59 ? 9.619   -5.087  -4.995  1.00 0.00 ? 59  HIS A CE1  1  
ATOM   862   N  NE2  . HIS A 1 59 ? 9.534   -4.326  -6.071  1.00 0.00 ? 59  HIS A NE2  1  
ATOM   863   H  H    . HIS A 1 59 ? 8.614   0.112   -1.924  1.00 0.00 ? 59  HIS A H    1  
ATOM   864   H  HA   . HIS A 1 59 ? 9.489   -2.380  -1.497  1.00 0.00 ? 59  HIS A HA   1  
ATOM   865   H  HB2  . HIS A 1 59 ? 7.669   -2.293  -2.924  1.00 0.00 ? 59  HIS A HB2  1  
ATOM   866   H  HB3  . HIS A 1 59 ? 8.416   -1.093  -3.974  1.00 0.00 ? 59  HIS A HB3  1  
ATOM   867   H  HD1  . HIS A 1 59 ? 9.282   -4.684  -3.018  1.00 0.00 ? 59  HIS A HD1  1  
ATOM   868   H  HD2  . HIS A 1 59 ? 8.991   -2.218  -6.350  1.00 0.00 ? 59  HIS A HD2  1  
ATOM   869   H  HE1  . HIS A 1 59 ? 9.901   -6.129  -4.981  1.00 0.00 ? 59  HIS A HE1  1  
ATOM   870   H  HE2  . HIS A 1 59 ? 9.801   -4.594  -6.975  1.00 0.00 ? 59  HIS A HE2  1  
ATOM   871   N  N    . ASN A 1 60 ? 11.491  -0.956  -3.696  1.00 0.00 ? 60  ASN A N    1  
ATOM   872   C  CA   . ASN A 1 60 ? 12.815  -1.035  -4.303  1.00 0.00 ? 60  ASN A CA   1  
ATOM   873   C  C    . ASN A 1 60 ? 13.903  -1.059  -3.234  1.00 0.00 ? 60  ASN A C    1  
ATOM   874   O  O    . ASN A 1 60 ? 14.879  -1.800  -3.345  1.00 0.00 ? 60  ASN A O    1  
ATOM   875   C  CB   . ASN A 1 60 ? 13.038  0.148   -5.247  1.00 0.00 ? 60  ASN A CB   1  
ATOM   876   C  CG   . ASN A 1 60 ? 12.448  -0.091  -6.623  1.00 0.00 ? 60  ASN A CG   1  
ATOM   877   O  OD1  . ASN A 1 60 ? 12.561  -1.184  -7.178  1.00 0.00 ? 60  ASN A OD1  1  
ATOM   878   N  ND2  . ASN A 1 60 ? 11.814  0.934   -7.181  1.00 0.00 ? 60  ASN A ND2  1  
ATOM   879   H  H    . ASN A 1 60 ? 10.922  -0.182  -3.891  1.00 0.00 ? 60  ASN A H    1  
ATOM   880   H  HA   . ASN A 1 60 ? 12.864  -1.952  -4.871  1.00 0.00 ? 60  ASN A HA   1  
ATOM   881   H  HB2  . ASN A 1 60 ? 12.574  1.029   -4.826  1.00 0.00 ? 60  ASN A HB2  1  
ATOM   882   H  HB3  . ASN A 1 60 ? 14.098  0.321   -5.354  1.00 0.00 ? 60  ASN A HB3  1  
ATOM   883   H  HD21 . ASN A 1 60 ? 11.763  1.775   -6.681  1.00 0.00 ? 60  ASN A HD21 1  
ATOM   884   H  HD22 . ASN A 1 60 ? 11.422  0.807   -8.071  1.00 0.00 ? 60  ASN A HD22 1  
ATOM   885   N  N    . ARG A 1 61 ? 13.726  -0.245  -2.199  1.00 0.00 ? 61  ARG A N    1  
ATOM   886   C  CA   . ARG A 1 61 ? 14.692  -0.172  -1.110  1.00 0.00 ? 61  ARG A CA   1  
ATOM   887   C  C    . ARG A 1 61 ? 14.734  -1.484  -0.331  1.00 0.00 ? 61  ARG A C    1  
ATOM   888   O  O    . ARG A 1 61 ? 15.799  -1.932  0.090   1.00 0.00 ? 61  ARG A O    1  
ATOM   889   C  CB   . ARG A 1 61 ? 14.345  0.982   -0.167  1.00 0.00 ? 61  ARG A CB   1  
ATOM   890   C  CG   . ARG A 1 61 ? 14.475  2.353   -0.810  1.00 0.00 ? 61  ARG A CG   1  
ATOM   891   C  CD   . ARG A 1 61 ? 13.913  3.445   0.088   1.00 0.00 ? 61  ARG A CD   1  
ATOM   892   N  NE   . ARG A 1 61 ? 14.865  3.849   1.119   1.00 0.00 ? 61  ARG A NE   1  
ATOM   893   C  CZ   . ARG A 1 61 ? 14.559  4.664   2.122   1.00 0.00 ? 61  ARG A CZ   1  
ATOM   894   N  NH1  . ARG A 1 61 ? 13.334  5.159   2.229   1.00 0.00 ? 61  ARG A NH1  1  
ATOM   895   N  NH2  . ARG A 1 61 ? 15.481  4.986   3.021   1.00 0.00 ? 61  ARG A NH2  1  
ATOM   896   H  H    . ARG A 1 61 ? 12.927  0.322   -2.167  1.00 0.00 ? 61  ARG A H    1  
ATOM   897   H  HA   . ARG A 1 61 ? 15.666  0.008   -1.541  1.00 0.00 ? 61  ARG A HA   1  
ATOM   898   H  HB2  . ARG A 1 61 ? 13.326  0.862   0.170   1.00 0.00 ? 61  ARG A HB2  1  
ATOM   899   H  HB3  . ARG A 1 61 ? 15.005  0.945   0.686   1.00 0.00 ? 61  ARG A HB3  1  
ATOM   900   H  HG2  . ARG A 1 61 ? 15.519  2.557   -0.995  1.00 0.00 ? 61  ARG A HG2  1  
ATOM   901   H  HG3  . ARG A 1 61 ? 13.935  2.355   -1.745  1.00 0.00 ? 61  ARG A HG3  1  
ATOM   902   H  HD2  . ARG A 1 61 ? 13.670  4.303   -0.521  1.00 0.00 ? 61  ARG A HD2  1  
ATOM   903   H  HD3  . ARG A 1 61 ? 13.017  3.075   0.563   1.00 0.00 ? 61  ARG A HD3  1  
ATOM   904   H  HE   . ARG A 1 61 ? 15.777  3.495   1.059   1.00 0.00 ? 61  ARG A HE   1  
ATOM   905   H  HH11 . ARG A 1 61 ? 12.638  4.917   1.554   1.00 0.00 ? 61  ARG A HH11 1  
ATOM   906   H  HH12 . ARG A 1 61 ? 13.106  5.771   2.986   1.00 0.00 ? 61  ARG A HH12 1  
ATOM   907   H  HH21 . ARG A 1 61 ? 16.405  4.615   2.944   1.00 0.00 ? 61  ARG A HH21 1  
ATOM   908   H  HH22 . ARG A 1 61 ? 15.250  5.599   3.776   1.00 0.00 ? 61  ARG A HH22 1  
ATOM   909   N  N    . GLU A 1 62 ? 13.567  -2.092  -0.144  1.00 0.00 ? 62  GLU A N    1  
ATOM   910   C  CA   . GLU A 1 62 ? 13.471  -3.351  0.585   1.00 0.00 ? 62  GLU A CA   1  
ATOM   911   C  C    . GLU A 1 62 ? 13.995  -4.510  -0.259  1.00 0.00 ? 62  GLU A C    1  
ATOM   912   O  O    . GLU A 1 62 ? 14.986  -5.151  0.092   1.00 0.00 ? 62  GLU A O    1  
ATOM   913   C  CB   . GLU A 1 62 ? 12.021  -3.620  0.995   1.00 0.00 ? 62  GLU A CB   1  
ATOM   914   C  CG   . GLU A 1 62 ? 11.310  -2.398  1.552   1.00 0.00 ? 62  GLU A CG   1  
ATOM   915   C  CD   . GLU A 1 62 ? 11.586  -2.184  3.027   1.00 0.00 ? 62  GLU A CD   1  
ATOM   916   O  OE1  . GLU A 1 62 ? 10.978  -2.895  3.854   1.00 0.00 ? 62  GLU A OE1  1  
ATOM   917   O  OE2  . GLU A 1 62 ? 12.410  -1.305  3.355   1.00 0.00 ? 62  GLU A OE2  1  
ATOM   918   H  H    . GLU A 1 62 ? 12.752  -1.685  -0.504  1.00 0.00 ? 62  GLU A H    1  
ATOM   919   H  HA   . GLU A 1 62 ? 14.077  -3.267  1.474   1.00 0.00 ? 62  GLU A HA   1  
ATOM   920   H  HB2  . GLU A 1 62 ? 11.474  -3.967  0.131   1.00 0.00 ? 62  GLU A HB2  1  
ATOM   921   H  HB3  . GLU A 1 62 ? 12.011  -4.391  1.751   1.00 0.00 ? 62  GLU A HB3  1  
ATOM   922   H  HG2  . GLU A 1 62 ? 11.643  -1.525  1.009   1.00 0.00 ? 62  GLU A HG2  1  
ATOM   923   H  HG3  . GLU A 1 62 ? 10.246  -2.522  1.413   1.00 0.00 ? 62  GLU A HG3  1  
ATOM   924   N  N    . LYS A 1 63 ? 13.322  -4.774  -1.374  1.00 0.00 ? 63  LYS A N    1  
ATOM   925   C  CA   . LYS A 1 63 ? 13.718  -5.854  -2.270  1.00 0.00 ? 63  LYS A CA   1  
ATOM   926   C  C    . LYS A 1 63 ? 15.185  -5.723  -2.665  1.00 0.00 ? 63  LYS A C    1  
ATOM   927   O  O    . LYS A 1 63 ? 15.853  -6.717  -2.946  1.00 0.00 ? 63  LYS A O    1  
ATOM   928   C  CB   . LYS A 1 63 ? 12.839  -5.853  -3.523  1.00 0.00 ? 63  LYS A CB   1  
ATOM   929   C  CG   . LYS A 1 63 ? 13.229  -4.792  -4.538  1.00 0.00 ? 63  LYS A CG   1  
ATOM   930   C  CD   . LYS A 1 63 ? 12.769  -5.164  -5.938  1.00 0.00 ? 63  LYS A CD   1  
ATOM   931   C  CE   . LYS A 1 63 ? 13.719  -4.628  -6.997  1.00 0.00 ? 63  LYS A CE   1  
ATOM   932   N  NZ   . LYS A 1 63 ? 13.436  -5.207  -8.340  1.00 0.00 ? 63  LYS A NZ   1  
ATOM   933   H  H    . LYS A 1 63 ? 12.540  -4.227  -1.600  1.00 0.00 ? 63  LYS A H    1  
ATOM   934   H  HA   . LYS A 1 63 ? 13.581  -6.787  -1.745  1.00 0.00 ? 63  LYS A HA   1  
ATOM   935   H  HB2  . LYS A 1 63 ? 12.910  -6.820  -3.998  1.00 0.00 ? 63  LYS A HB2  1  
ATOM   936   H  HB3  . LYS A 1 63 ? 11.814  -5.680  -3.229  1.00 0.00 ? 63  LYS A HB3  1  
ATOM   937   H  HG2  . LYS A 1 63 ? 12.773  -3.854  -4.258  1.00 0.00 ? 63  LYS A HG2  1  
ATOM   938   H  HG3  . LYS A 1 63 ? 14.304  -4.685  -4.539  1.00 0.00 ? 63  LYS A HG3  1  
ATOM   939   H  HD2  . LYS A 1 63 ? 12.726  -6.240  -6.019  1.00 0.00 ? 63  LYS A HD2  1  
ATOM   940   H  HD3  . LYS A 1 63 ? 11.785  -4.749  -6.106  1.00 0.00 ? 63  LYS A HD3  1  
ATOM   941   H  HE2  . LYS A 1 63 ? 13.613  -3.555  -7.048  1.00 0.00 ? 63  LYS A HE2  1  
ATOM   942   H  HE3  . LYS A 1 63 ? 14.731  -4.877  -6.714  1.00 0.00 ? 63  LYS A HE3  1  
ATOM   943   H  HZ1  . LYS A 1 63 ? 12.409  -5.263  -8.495  1.00 0.00 ? 63  LYS A HZ1  1  
ATOM   944   H  HZ2  . LYS A 1 63 ? 13.837  -6.164  -8.408  1.00 0.00 ? 63  LYS A HZ2  1  
ATOM   945   H  HZ3  . LYS A 1 63 ? 13.856  -4.612  -9.082  1.00 0.00 ? 63  LYS A HZ3  1  
ATOM   946   N  N    . ALA A 1 64 ? 15.681  -4.489  -2.683  1.00 0.00 ? 64  ALA A N    1  
ATOM   947   C  CA   . ALA A 1 64 ? 17.070  -4.229  -3.040  1.00 0.00 ? 64  ALA A CA   1  
ATOM   948   C  C    . ALA A 1 64 ? 17.990  -5.312  -2.488  1.00 0.00 ? 64  ALA A C    1  
ATOM   949   O  O    . ALA A 1 64 ? 18.204  -5.402  -1.279  1.00 0.00 ? 64  ALA A O    1  
ATOM   950   C  CB   . ALA A 1 64 ? 17.498  -2.861  -2.532  1.00 0.00 ? 64  ALA A CB   1  
ATOM   951   H  H    . ALA A 1 64 ? 15.098  -3.737  -2.449  1.00 0.00 ? 64  ALA A H    1  
ATOM   952   H  HA   . ALA A 1 64 ? 17.142  -4.225  -4.118  1.00 0.00 ? 64  ALA A HA   1  
ATOM   953   H  HB1  . ALA A 1 64 ? 18.300  -2.977  -1.818  1.00 0.00 ? 64  ALA A HB1  1  
ATOM   954   H  HB2  . ALA A 1 64 ? 17.838  -2.259  -3.362  1.00 0.00 ? 64  ALA A HB2  1  
ATOM   955   H  HB3  . ALA A 1 64 ? 16.659  -2.376  -2.055  1.00 0.00 ? 64  ALA A HB3  1  
ATOM   956   N  N    . SER A 1 65 ? 18.533  -6.133  -3.382  1.00 0.00 ? 65  SER A N    1  
ATOM   957   C  CA   . SER A 1 65 ? 19.428  -7.213  -2.983  1.00 0.00 ? 65  SER A CA   1  
ATOM   958   C  C    . SER A 1 65 ? 20.729  -6.658  -2.412  1.00 0.00 ? 65  SER A C    1  
ATOM   959   O  O    . SER A 1 65 ? 21.341  -5.762  -2.991  1.00 0.00 ? 65  SER A O    1  
ATOM   960   C  CB   . SER A 1 65 ? 19.728  -8.122  -4.177  1.00 0.00 ? 65  SER A CB   1  
ATOM   961   O  OG   . SER A 1 65 ? 18.738  -9.127  -4.315  1.00 0.00 ? 65  SER A OG   1  
ATOM   962   H  H    . SER A 1 65 ? 18.324  -6.011  -4.332  1.00 0.00 ? 65  SER A H    1  
ATOM   963   H  HA   . SER A 1 65 ? 18.930  -7.791  -2.218  1.00 0.00 ? 65  SER A HA   1  
ATOM   964   H  HB2  . SER A 1 65 ? 19.751  -7.531  -5.079  1.00 0.00 ? 65  SER A HB2  1  
ATOM   965   H  HB3  . SER A 1 65 ? 20.688  -8.597  -4.032  1.00 0.00 ? 65  SER A HB3  1  
ATOM   966   H  HG   . SER A 1 65 ? 18.461  -9.180  -5.232  1.00 0.00 ? 65  SER A HG   1  
ATOM   967   N  N    . GLY A 1 66 ? 21.146  -7.199  -1.271  1.00 0.00 ? 66  GLY A N    1  
ATOM   968   C  CA   . GLY A 1 66 ? 22.371  -6.746  -0.639  1.00 0.00 ? 66  GLY A CA   1  
ATOM   969   C  C    . GLY A 1 66 ? 23.431  -6.351  -1.648  1.00 0.00 ? 66  GLY A C    1  
ATOM   970   O  O    . GLY A 1 66 ? 23.481  -6.869  -2.764  1.00 0.00 ? 66  GLY A O    1  
ATOM   971   H  H    . GLY A 1 66 ? 20.616  -7.911  -0.854  1.00 0.00 ? 66  GLY A H    1  
ATOM   972   H  HA2  . GLY A 1 66 ? 22.148  -5.894  -0.015  1.00 0.00 ? 66  GLY A HA2  1  
ATOM   973   H  HA3  . GLY A 1 66 ? 22.759  -7.542  -0.021  1.00 0.00 ? 66  GLY A HA3  1  
ATOM   974   N  N    . PRO A 1 67 ? 24.303  -5.410  -1.258  1.00 0.00 ? 67  PRO A N    1  
ATOM   975   C  CA   . PRO A 1 67 ? 25.383  -4.923  -2.122  1.00 0.00 ? 67  PRO A CA   1  
ATOM   976   C  C    . PRO A 1 67 ? 26.466  -5.973  -2.344  1.00 0.00 ? 67  PRO A C    1  
ATOM   977   O  O    . PRO A 1 67 ? 27.144  -5.972  -3.371  1.00 0.00 ? 67  PRO A O    1  
ATOM   978   C  CB   . PRO A 1 67 ? 25.947  -3.729  -1.347  1.00 0.00 ? 67  PRO A CB   1  
ATOM   979   C  CG   . PRO A 1 67 ? 25.614  -4.010  0.077   1.00 0.00 ? 67  PRO A CG   1  
ATOM   980   C  CD   . PRO A 1 67 ? 24.303  -4.748  0.058   1.00 0.00 ? 67  PRO A CD   1  
ATOM   981   H  HA   . PRO A 1 67 ? 25.006  -4.589  -3.077  1.00 0.00 ? 67  PRO A HA   1  
ATOM   982   H  HB2  . PRO A 1 67 ? 27.015  -3.670  -1.500  1.00 0.00 ? 67  PRO A HB2  1  
ATOM   983   H  HB3  . PRO A 1 67 ? 25.478  -2.819  -1.690  1.00 0.00 ? 67  PRO A HB3  1  
ATOM   984   H  HG2  . PRO A 1 67 ? 26.383  -4.624  0.520   1.00 0.00 ? 67  PRO A HG2  1  
ATOM   985   H  HG3  . PRO A 1 67 ? 25.513  -3.082  0.620   1.00 0.00 ? 67  PRO A HG3  1  
ATOM   986   H  HD2  . PRO A 1 67 ? 24.268  -5.476  0.855   1.00 0.00 ? 67  PRO A HD2  1  
ATOM   987   H  HD3  . PRO A 1 67 ? 23.479  -4.055  0.141   1.00 0.00 ? 67  PRO A HD3  1  
ATOM   988   N  N    . SER A 1 68 ? 26.622  -6.870  -1.375  1.00 0.00 ? 68  SER A N    1  
ATOM   989   C  CA   . SER A 1 68 ? 27.625  -7.924  -1.464  1.00 0.00 ? 68  SER A CA   1  
ATOM   990   C  C    . SER A 1 68 ? 27.029  -9.192  -2.069  1.00 0.00 ? 68  SER A C    1  
ATOM   991   O  O    . SER A 1 68 ? 26.407  -9.993  -1.371  1.00 0.00 ? 68  SER A O    1  
ATOM   992   C  CB   . SER A 1 68 ? 28.200  -8.228  -0.079  1.00 0.00 ? 68  SER A CB   1  
ATOM   993   O  OG   . SER A 1 68 ? 29.326  -7.413  0.196   1.00 0.00 ? 68  SER A OG   1  
ATOM   994   H  H    . SER A 1 68 ? 26.050  -6.819  -0.580  1.00 0.00 ? 68  SER A H    1  
ATOM   995   H  HA   . SER A 1 68 ? 28.420  -7.573  -2.105  1.00 0.00 ? 68  SER A HA   1  
ATOM   996   H  HB2  . SER A 1 68 ? 27.445  -8.043  0.670   1.00 0.00 ? 68  SER A HB2  1  
ATOM   997   H  HB3  . SER A 1 68 ? 28.502  -9.265  -0.037  1.00 0.00 ? 68  SER A HB3  1  
ATOM   998   H  HG   . SER A 1 68 ? 30.130  -7.919  0.057   1.00 0.00 ? 68  SER A HG   1  
ATOM   999   N  N    . SER A 1 69 ? 27.224  -9.366  -3.372  1.00 0.00 ? 69  SER A N    1  
ATOM   1000  C  CA   . SER A 1 69 ? 26.703  -10.533 -4.073  1.00 0.00 ? 69  SER A CA   1  
ATOM   1001  C  C    . SER A 1 69 ? 27.808  -11.234 -4.858  1.00 0.00 ? 69  SER A C    1  
ATOM   1002  O  O    . SER A 1 69 ? 28.322  -10.699 -5.839  1.00 0.00 ? 69  SER A O    1  
ATOM   1003  C  CB   . SER A 1 69 ? 25.571  -10.124 -5.018  1.00 0.00 ? 69  SER A CB   1  
ATOM   1004  O  OG   . SER A 1 69 ? 25.123  -11.228 -5.786  1.00 0.00 ? 69  SER A OG   1  
ATOM   1005  H  H    . SER A 1 69 ? 27.728  -8.692  -3.874  1.00 0.00 ? 69  SER A H    1  
ATOM   1006  H  HA   . SER A 1 69 ? 26.313  -11.218 -3.334  1.00 0.00 ? 69  SER A HA   1  
ATOM   1007  H  HB2  . SER A 1 69 ? 24.743  -9.744  -4.440  1.00 0.00 ? 69  SER A HB2  1  
ATOM   1008  H  HB3  . SER A 1 69 ? 25.926  -9.355  -5.688  1.00 0.00 ? 69  SER A HB3  1  
ATOM   1009  H  HG   . SER A 1 69 ? 24.320  -11.583 -5.398  1.00 0.00 ? 69  SER A HG   1  
ATOM   1010  N  N    . GLY A 1 70 ? 28.168  -12.436 -4.418  1.00 0.00 ? 70  GLY A N    1  
ATOM   1011  C  CA   . GLY A 1 70 ? 29.209  -13.191 -5.090  1.00 0.00 ? 70  GLY A CA   1  
ATOM   1012  C  C    . GLY A 1 70 ? 28.832  -13.561 -6.510  1.00 0.00 ? 70  GLY A C    1  
ATOM   1013  O  O    . GLY A 1 70 ? 28.169  -14.578 -6.709  1.00 0.00 ? 70  GLY A O    1  
ATOM   1014  H  H    . GLY A 1 70 ? 27.722  -12.813 -3.630  1.00 0.00 ? 70  GLY A H    1  
ATOM   1015  H  HA2  . GLY A 1 70 ? 30.112  -12.598 -5.110  1.00 0.00 ? 70  GLY A HA2  1  
ATOM   1016  H  HA3  . GLY A 1 70 ? 29.398  -14.096 -4.532  1.00 0.00 ? 70  GLY A HA3  1  
HETATM 1017  ZN ZN   . ZN  B 2 .  ? -11.285 4.107   2.541   1.00 0.00 ? 201 ZN  A ZN   1  
HETATM 1018  ZN ZN   . ZN  C 2 .  ? 6.671   3.720   0.232   1.00 0.00 ? 401 ZN  A ZN   1  
ATOM   1019  N  N    . GLY A 1 1  ? -24.672 -11.132 -9.591  1.00 0.00 ? 1   GLY A N    2  
ATOM   1020  C  CA   . GLY A 1 1  ? -26.050 -10.838 -9.939  1.00 0.00 ? 1   GLY A CA   2  
ATOM   1021  C  C    . GLY A 1 1  ? -26.403 -9.380  -9.725  1.00 0.00 ? 1   GLY A C    2  
ATOM   1022  O  O    . GLY A 1 1  ? -26.534 -8.619  -10.684 1.00 0.00 ? 1   GLY A O    2  
ATOM   1023  H  H1   . GLY A 1 1  ? -24.454 -11.456 -8.692  1.00 0.00 ? 1   GLY A H1   2  
ATOM   1024  H  HA2  . GLY A 1 1  ? -26.208 -11.088 -10.978 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   1025  H  HA3  . GLY A 1 1  ? -26.700 -11.447 -9.329  1.00 0.00 ? 1   GLY A HA3  2  
ATOM   1026  N  N    . SER A 1 2  ? -26.560 -8.989  -8.465  1.00 0.00 ? 2   SER A N    2  
ATOM   1027  C  CA   . SER A 1 2  ? -26.906 -7.613  -8.128  1.00 0.00 ? 2   SER A CA   2  
ATOM   1028  C  C    . SER A 1 2  ? -25.808 -6.652  -8.572  1.00 0.00 ? 2   SER A C    2  
ATOM   1029  O  O    . SER A 1 2  ? -24.753 -7.074  -9.046  1.00 0.00 ? 2   SER A O    2  
ATOM   1030  C  CB   . SER A 1 2  ? -27.141 -7.477  -6.622  1.00 0.00 ? 2   SER A CB   2  
ATOM   1031  O  OG   . SER A 1 2  ? -28.499 -7.711  -6.294  1.00 0.00 ? 2   SER A OG   2  
ATOM   1032  H  H    . SER A 1 2  ? -26.443 -9.643  -7.744  1.00 0.00 ? 2   SER A H    2  
ATOM   1033  H  HA   . SER A 1 2  ? -27.819 -7.364  -8.650  1.00 0.00 ? 2   SER A HA   2  
ATOM   1034  H  HB2  . SER A 1 2  ? -26.528 -8.195  -6.099  1.00 0.00 ? 2   SER A HB2  2  
ATOM   1035  H  HB3  . SER A 1 2  ? -26.873 -6.479  -6.308  1.00 0.00 ? 2   SER A HB3  2  
ATOM   1036  H  HG   . SER A 1 2  ? -28.846 -8.415  -6.848  1.00 0.00 ? 2   SER A HG   2  
ATOM   1037  N  N    . SER A 1 3  ? -26.064 -5.357  -8.416  1.00 0.00 ? 3   SER A N    2  
ATOM   1038  C  CA   . SER A 1 3  ? -25.099 -4.335  -8.804  1.00 0.00 ? 3   SER A CA   2  
ATOM   1039  C  C    . SER A 1 3  ? -23.726 -4.629  -8.207  1.00 0.00 ? 3   SER A C    2  
ATOM   1040  O  O    . SER A 1 3  ? -23.614 -5.057  -7.059  1.00 0.00 ? 3   SER A O    2  
ATOM   1041  C  CB   . SER A 1 3  ? -25.578 -2.954  -8.352  1.00 0.00 ? 3   SER A CB   2  
ATOM   1042  O  OG   . SER A 1 3  ? -25.116 -1.942  -9.229  1.00 0.00 ? 3   SER A OG   2  
ATOM   1043  H  H    . SER A 1 3  ? -26.923 -5.083  -8.032  1.00 0.00 ? 3   SER A H    2  
ATOM   1044  H  HA   . SER A 1 3  ? -25.020 -4.345  -9.880  1.00 0.00 ? 3   SER A HA   2  
ATOM   1045  H  HB2  . SER A 1 3  ? -26.657 -2.937  -8.339  1.00 0.00 ? 3   SER A HB2  2  
ATOM   1046  H  HB3  . SER A 1 3  ? -25.203 -2.753  -7.359  1.00 0.00 ? 3   SER A HB3  2  
ATOM   1047  H  HG   . SER A 1 3  ? -24.169 -1.830  -9.119  1.00 0.00 ? 3   SER A HG   2  
ATOM   1048  N  N    . GLY A 1 4  ? -22.682 -4.397  -8.997  1.00 0.00 ? 4   GLY A N    2  
ATOM   1049  C  CA   . GLY A 1 4  ? -21.330 -4.642  -8.531  1.00 0.00 ? 4   GLY A CA   2  
ATOM   1050  C  C    . GLY A 1 4  ? -20.907 -3.676  -7.443  1.00 0.00 ? 4   GLY A C    2  
ATOM   1051  O  O    . GLY A 1 4  ? -20.301 -2.641  -7.722  1.00 0.00 ? 4   GLY A O    2  
ATOM   1052  H  H    . GLY A 1 4  ? -22.831 -4.055  -9.904  1.00 0.00 ? 4   GLY A H    2  
ATOM   1053  H  HA2  . GLY A 1 4  ? -21.270 -5.650  -8.147  1.00 0.00 ? 4   GLY A HA2  2  
ATOM   1054  H  HA3  . GLY A 1 4  ? -20.651 -4.546  -9.365  1.00 0.00 ? 4   GLY A HA3  2  
ATOM   1055  N  N    . SER A 1 5  ? -21.228 -4.012  -6.197  1.00 0.00 ? 5   SER A N    2  
ATOM   1056  C  CA   . SER A 1 5  ? -20.882 -3.163  -5.063  1.00 0.00 ? 5   SER A CA   2  
ATOM   1057  C  C    . SER A 1 5  ? -19.373 -3.142  -4.840  1.00 0.00 ? 5   SER A C    2  
ATOM   1058  O  O    . SER A 1 5  ? -18.734 -4.190  -4.744  1.00 0.00 ? 5   SER A O    2  
ATOM   1059  C  CB   . SER A 1 5  ? -21.589 -3.654  -3.798  1.00 0.00 ? 5   SER A CB   2  
ATOM   1060  O  OG   . SER A 1 5  ? -22.926 -3.185  -3.746  1.00 0.00 ? 5   SER A OG   2  
ATOM   1061  H  H    . SER A 1 5  ? -21.711 -4.850  -6.038  1.00 0.00 ? 5   SER A H    2  
ATOM   1062  H  HA   . SER A 1 5  ? -21.216 -2.161  -5.286  1.00 0.00 ? 5   SER A HA   2  
ATOM   1063  H  HB2  . SER A 1 5  ? -21.598 -4.733  -3.789  1.00 0.00 ? 5   SER A HB2  2  
ATOM   1064  H  HB3  . SER A 1 5  ? -21.059 -3.291  -2.929  1.00 0.00 ? 5   SER A HB3  2  
ATOM   1065  H  HG   . SER A 1 5  ? -23.509 -3.837  -4.142  1.00 0.00 ? 5   SER A HG   2  
ATOM   1066  N  N    . SER A 1 6  ? -18.810 -1.941  -4.760  1.00 0.00 ? 6   SER A N    2  
ATOM   1067  C  CA   . SER A 1 6  ? -17.375 -1.781  -4.553  1.00 0.00 ? 6   SER A CA   2  
ATOM   1068  C  C    . SER A 1 6  ? -17.096 -0.793  -3.425  1.00 0.00 ? 6   SER A C    2  
ATOM   1069  O  O    . SER A 1 6  ? -17.169 0.421   -3.616  1.00 0.00 ? 6   SER A O    2  
ATOM   1070  C  CB   . SER A 1 6  ? -16.702 -1.306  -5.842  1.00 0.00 ? 6   SER A CB   2  
ATOM   1071  O  OG   . SER A 1 6  ? -16.738 -2.313  -6.838  1.00 0.00 ? 6   SER A OG   2  
ATOM   1072  H  H    . SER A 1 6  ? -19.373 -1.143  -4.845  1.00 0.00 ? 6   SER A H    2  
ATOM   1073  H  HA   . SER A 1 6  ? -16.971 -2.744  -4.280  1.00 0.00 ? 6   SER A HA   2  
ATOM   1074  H  HB2  . SER A 1 6  ? -17.217 -0.432  -6.213  1.00 0.00 ? 6   SER A HB2  2  
ATOM   1075  H  HB3  . SER A 1 6  ? -15.672 -1.056  -5.636  1.00 0.00 ? 6   SER A HB3  2  
ATOM   1076  H  HG   . SER A 1 6  ? -16.268 -3.090  -6.525  1.00 0.00 ? 6   SER A HG   2  
ATOM   1077  N  N    . GLY A 1 7  ? -16.776 -1.322  -2.248  1.00 0.00 ? 7   GLY A N    2  
ATOM   1078  C  CA   . GLY A 1 7  ? -16.490 -0.473  -1.106  1.00 0.00 ? 7   GLY A CA   2  
ATOM   1079  C  C    . GLY A 1 7  ? -15.044 -0.565  -0.663  1.00 0.00 ? 7   GLY A C    2  
ATOM   1080  O  O    . GLY A 1 7  ? -14.407 -1.609  -0.807  1.00 0.00 ? 7   GLY A O    2  
ATOM   1081  H  H    . GLY A 1 7  ? -16.733 -2.297  -2.155  1.00 0.00 ? 7   GLY A H    2  
ATOM   1082  H  HA2  . GLY A 1 7  ? -16.712 0.551   -1.368  1.00 0.00 ? 7   GLY A HA2  2  
ATOM   1083  H  HA3  . GLY A 1 7  ? -17.126 -0.769  -0.285  1.00 0.00 ? 7   GLY A HA3  2  
ATOM   1084  N  N    . CYS A 1 8  ? -14.522 0.531   -0.123  1.00 0.00 ? 8   CYS A N    2  
ATOM   1085  C  CA   . CYS A 1 8  ? -13.140 0.572   0.341   1.00 0.00 ? 8   CYS A CA   2  
ATOM   1086  C  C    . CYS A 1 8  ? -12.923 -0.410  1.489   1.00 0.00 ? 8   CYS A C    2  
ATOM   1087  O  O    . CYS A 1 8  ? -13.781 -0.566  2.358   1.00 0.00 ? 8   CYS A O    2  
ATOM   1088  C  CB   . CYS A 1 8  ? -12.772 1.987   0.790   1.00 0.00 ? 8   CYS A CB   2  
ATOM   1089  S  SG   . CYS A 1 8  ? -11.206 2.091   1.714   1.00 0.00 ? 8   CYS A SG   2  
ATOM   1090  H  H    . CYS A 1 8  ? -15.079 1.333   -0.034  1.00 0.00 ? 8   CYS A H    2  
ATOM   1091  H  HA   . CYS A 1 8  ? -12.504 0.289   -0.484  1.00 0.00 ? 8   CYS A HA   2  
ATOM   1092  H  HB2  . CYS A 1 8  ? -12.682 2.621   -0.080  1.00 0.00 ? 8   CYS A HB2  2  
ATOM   1093  H  HB3  . CYS A 1 8  ? -13.556 2.370   1.427   1.00 0.00 ? 8   CYS A HB3  2  
ATOM   1094  N  N    . HIS A 1 9  ? -11.769 -1.070  1.485   1.00 0.00 ? 9   HIS A N    2  
ATOM   1095  C  CA   . HIS A 1 9  ? -11.438 -2.037  2.526   1.00 0.00 ? 9   HIS A CA   2  
ATOM   1096  C  C    . HIS A 1 9  ? -10.708 -1.361  3.683   1.00 0.00 ? 9   HIS A C    2  
ATOM   1097  O  O    . HIS A 1 9  ? -10.931 -1.691  4.847   1.00 0.00 ? 9   HIS A O    2  
ATOM   1098  C  CB   . HIS A 1 9  ? -10.576 -3.162  1.952   1.00 0.00 ? 9   HIS A CB   2  
ATOM   1099  C  CG   . HIS A 1 9  ? -10.453 -4.346  2.861   1.00 0.00 ? 9   HIS A CG   2  
ATOM   1100  N  ND1  . HIS A 1 9  ? -11.542 -5.043  3.339   1.00 0.00 ? 9   HIS A ND1  2  
ATOM   1101  C  CD2  . HIS A 1 9  ? -9.361  -4.956  3.377   1.00 0.00 ? 9   HIS A CD2  2  
ATOM   1102  C  CE1  . HIS A 1 9  ? -11.125 -6.030  4.112   1.00 0.00 ? 9   HIS A CE1  2  
ATOM   1103  N  NE2  . HIS A 1 9  ? -9.805  -5.999  4.151   1.00 0.00 ? 9   HIS A NE2  2  
ATOM   1104  H  H    . HIS A 1 9  ? -11.125 -0.903  0.766   1.00 0.00 ? 9   HIS A H    2  
ATOM   1105  H  HA   . HIS A 1 9  ? -12.361 -2.456  2.896   1.00 0.00 ? 9   HIS A HA   2  
ATOM   1106  H  HB2  . HIS A 1 9  ? -11.011 -3.501  1.023   1.00 0.00 ? 9   HIS A HB2  2  
ATOM   1107  H  HB3  . HIS A 1 9  ? -9.582  -2.784  1.761   1.00 0.00 ? 9   HIS A HB3  2  
ATOM   1108  H  HD1  . HIS A 1 9  ? -12.481 -4.844  3.143   1.00 0.00 ? 9   HIS A HD1  2  
ATOM   1109  H  HD2  . HIS A 1 9  ? -8.330  -4.675  3.212   1.00 0.00 ? 9   HIS A HD2  2  
ATOM   1110  H  HE1  . HIS A 1 9  ? -11.755 -6.742  4.624   1.00 0.00 ? 9   HIS A HE1  2  
ATOM   1111  H  HE2  . HIS A 1 9  ? -9.244  -6.567  4.719   1.00 0.00 ? 9   HIS A HE2  2  
ATOM   1112  N  N    . GLN A 1 10 ? -9.835  -0.414  3.353   1.00 0.00 ? 10  GLN A N    2  
ATOM   1113  C  CA   . GLN A 1 10 ? -9.071  0.307   4.365   1.00 0.00 ? 10  GLN A CA   2  
ATOM   1114  C  C    . GLN A 1 10 ? -9.978  0.779   5.496   1.00 0.00 ? 10  GLN A C    2  
ATOM   1115  O  O    . GLN A 1 10 ? -9.916  0.263   6.612   1.00 0.00 ? 10  GLN A O    2  
ATOM   1116  C  CB   . GLN A 1 10 ? -8.354  1.503   3.736   1.00 0.00 ? 10  GLN A CB   2  
ATOM   1117  C  CG   . GLN A 1 10 ? -7.453  2.250   4.707   1.00 0.00 ? 10  GLN A CG   2  
ATOM   1118  C  CD   . GLN A 1 10 ? -6.142  1.531   4.958   1.00 0.00 ? 10  GLN A CD   2  
ATOM   1119  O  OE1  . GLN A 1 10 ? -6.113  0.466   5.576   1.00 0.00 ? 10  GLN A OE1  2  
ATOM   1120  N  NE2  . GLN A 1 10 ? -5.047  2.109   4.478   1.00 0.00 ? 10  GLN A NE2  2  
ATOM   1121  H  H    . GLN A 1 10 ? -9.701  -0.196  2.407   1.00 0.00 ? 10  GLN A H    2  
ATOM   1122  H  HA   . GLN A 1 10 ? -8.335  -0.371  4.769   1.00 0.00 ? 10  GLN A HA   2  
ATOM   1123  H  HB2  . GLN A 1 10 ? -7.749  1.153   2.913   1.00 0.00 ? 10  GLN A HB2  2  
ATOM   1124  H  HB3  . GLN A 1 10 ? -9.093  2.194   3.361   1.00 0.00 ? 10  GLN A HB3  2  
ATOM   1125  H  HG2  . GLN A 1 10 ? -7.237  3.226   4.299   1.00 0.00 ? 10  GLN A HG2  2  
ATOM   1126  H  HG3  . GLN A 1 10 ? -7.972  2.361   5.647   1.00 0.00 ? 10  GLN A HG3  2  
ATOM   1127  H  HE21 . GLN A 1 10 ? -5.146  2.958   3.997   1.00 0.00 ? 10  GLN A HE21 2  
ATOM   1128  H  HE22 . GLN A 1 10 ? -4.187  1.667   4.627   1.00 0.00 ? 10  GLN A HE22 2  
ATOM   1129  N  N    . CYS A 1 11 ? -10.819 1.765   5.202   1.00 0.00 ? 11  CYS A N    2  
ATOM   1130  C  CA   . CYS A 1 11 ? -11.738 2.309   6.194   1.00 0.00 ? 11  CYS A CA   2  
ATOM   1131  C  C    . CYS A 1 11 ? -13.045 1.523   6.213   1.00 0.00 ? 11  CYS A C    2  
ATOM   1132  O  O    . CYS A 1 11 ? -13.590 1.229   7.276   1.00 0.00 ? 11  CYS A O    2  
ATOM   1133  C  CB   . CYS A 1 11 ? -12.021 3.784   5.902   1.00 0.00 ? 11  CYS A CB   2  
ATOM   1134  S  SG   . CYS A 1 11 ? -12.834 4.082   4.299   1.00 0.00 ? 11  CYS A SG   2  
ATOM   1135  H  H    . CYS A 1 11 ? -10.821 2.136   4.294   1.00 0.00 ? 11  CYS A H    2  
ATOM   1136  H  HA   . CYS A 1 11 ? -11.268 2.226   7.162   1.00 0.00 ? 11  CYS A HA   2  
ATOM   1137  H  HB2  . CYS A 1 11 ? -12.666 4.178   6.675   1.00 0.00 ? 11  CYS A HB2  2  
ATOM   1138  H  HB3  . CYS A 1 11 ? -11.089 4.329   5.906   1.00 0.00 ? 11  CYS A HB3  2  
ATOM   1139  N  N    . GLY A 1 12 ? -13.544 1.184   5.028   1.00 0.00 ? 12  GLY A N    2  
ATOM   1140  C  CA   . GLY A 1 12 ? -14.783 0.435   4.930   1.00 0.00 ? 12  GLY A CA   2  
ATOM   1141  C  C    . GLY A 1 12 ? -15.863 1.195   4.187   1.00 0.00 ? 12  GLY A C    2  
ATOM   1142  O  O    . GLY A 1 12 ? -16.633 0.607   3.428   1.00 0.00 ? 12  GLY A O    2  
ATOM   1143  H  H    . GLY A 1 12 ? -13.066 1.445   4.213   1.00 0.00 ? 12  GLY A H    2  
ATOM   1144  H  HA2  . GLY A 1 12 ? -14.589 -0.494  4.414   1.00 0.00 ? 12  GLY A HA2  2  
ATOM   1145  H  HA3  . GLY A 1 12 ? -15.135 0.214   5.927   1.00 0.00 ? 12  GLY A HA3  2  
ATOM   1146  N  N    . GLU A 1 13 ? -15.921 2.505   4.406   1.00 0.00 ? 13  GLU A N    2  
ATOM   1147  C  CA   . GLU A 1 13 ? -16.917 3.345   3.752   1.00 0.00 ? 13  GLU A CA   2  
ATOM   1148  C  C    . GLU A 1 13 ? -17.016 3.015   2.266   1.00 0.00 ? 13  GLU A C    2  
ATOM   1149  O  O    . GLU A 1 13 ? -16.053 2.549   1.656   1.00 0.00 ? 13  GLU A O    2  
ATOM   1150  C  CB   . GLU A 1 13 ? -16.569 4.824   3.936   1.00 0.00 ? 13  GLU A CB   2  
ATOM   1151  C  CG   . GLU A 1 13 ? -16.427 5.240   5.390   1.00 0.00 ? 13  GLU A CG   2  
ATOM   1152  C  CD   . GLU A 1 13 ? -17.761 5.317   6.108   1.00 0.00 ? 13  GLU A CD   2  
ATOM   1153  O  OE1  . GLU A 1 13 ? -18.460 4.285   6.175   1.00 0.00 ? 13  GLU A OE1  2  
ATOM   1154  O  OE2  . GLU A 1 13 ? -18.105 6.411   6.602   1.00 0.00 ? 13  GLU A OE2  2  
ATOM   1155  H  H    . GLU A 1 13 ? -15.279 2.915   5.022   1.00 0.00 ? 13  GLU A H    2  
ATOM   1156  H  HA   . GLU A 1 13 ? -17.872 3.149   4.216   1.00 0.00 ? 13  GLU A HA   2  
ATOM   1157  H  HB2  . GLU A 1 13 ? -15.636 5.027   3.432   1.00 0.00 ? 13  GLU A HB2  2  
ATOM   1158  H  HB3  . GLU A 1 13 ? -17.348 5.422   3.487   1.00 0.00 ? 13  GLU A HB3  2  
ATOM   1159  H  HG2  . GLU A 1 13 ? -15.804 4.519   5.898   1.00 0.00 ? 13  GLU A HG2  2  
ATOM   1160  H  HG3  . GLU A 1 13 ? -15.957 6.211   5.429   1.00 0.00 ? 13  GLU A HG3  2  
ATOM   1161  N  N    . PHE A 1 14 ? -18.187 3.260   1.688   1.00 0.00 ? 14  PHE A N    2  
ATOM   1162  C  CA   . PHE A 1 14 ? -18.414 2.988   0.273   1.00 0.00 ? 14  PHE A CA   2  
ATOM   1163  C  C    . PHE A 1 14 ? -17.770 4.063   -0.597  1.00 0.00 ? 14  PHE A C    2  
ATOM   1164  O  O    . PHE A 1 14 ? -17.830 5.252   -0.280  1.00 0.00 ? 14  PHE A O    2  
ATOM   1165  C  CB   . PHE A 1 14 ? -19.914 2.909   -0.019  1.00 0.00 ? 14  PHE A CB   2  
ATOM   1166  C  CG   . PHE A 1 14 ? -20.240 2.169   -1.285  1.00 0.00 ? 14  PHE A CG   2  
ATOM   1167  C  CD1  . PHE A 1 14 ? -19.981 0.812   -1.396  1.00 0.00 ? 14  PHE A CD1  2  
ATOM   1168  C  CD2  . PHE A 1 14 ? -20.805 2.830   -2.363  1.00 0.00 ? 14  PHE A CD2  2  
ATOM   1169  C  CE1  . PHE A 1 14 ? -20.280 0.129   -2.559  1.00 0.00 ? 14  PHE A CE1  2  
ATOM   1170  C  CE2  . PHE A 1 14 ? -21.106 2.152   -3.530  1.00 0.00 ? 14  PHE A CE2  2  
ATOM   1171  C  CZ   . PHE A 1 14 ? -20.844 0.799   -3.627  1.00 0.00 ? 14  PHE A CZ   2  
ATOM   1172  H  H    . PHE A 1 14 ? -18.917 3.632   2.226   1.00 0.00 ? 14  PHE A H    2  
ATOM   1173  H  HA   . PHE A 1 14 ? -17.960 2.036   0.043   1.00 0.00 ? 14  PHE A HA   2  
ATOM   1174  H  HB2  . PHE A 1 14 ? -20.406 2.402   0.797   1.00 0.00 ? 14  PHE A HB2  2  
ATOM   1175  H  HB3  . PHE A 1 14 ? -20.309 3.910   -0.107  1.00 0.00 ? 14  PHE A HB3  2  
ATOM   1176  H  HD1  . PHE A 1 14 ? -19.541 0.286   -0.561  1.00 0.00 ? 14  PHE A HD1  2  
ATOM   1177  H  HD2  . PHE A 1 14 ? -21.011 3.888   -2.288  1.00 0.00 ? 14  PHE A HD2  2  
ATOM   1178  H  HE1  . PHE A 1 14 ? -20.074 -0.928  -2.633  1.00 0.00 ? 14  PHE A HE1  2  
ATOM   1179  H  HE2  . PHE A 1 14 ? -21.547 2.679   -4.362  1.00 0.00 ? 14  PHE A HE2  2  
ATOM   1180  H  HZ   . PHE A 1 14 ? -21.077 0.268   -4.538  1.00 0.00 ? 14  PHE A HZ   2  
ATOM   1181  N  N    . ILE A 1 15 ? -17.155 3.637   -1.695  1.00 0.00 ? 15  ILE A N    2  
ATOM   1182  C  CA   . ILE A 1 15 ? -16.501 4.563   -2.612  1.00 0.00 ? 15  ILE A CA   2  
ATOM   1183  C  C    . ILE A 1 15 ? -17.483 5.094   -3.650  1.00 0.00 ? 15  ILE A C    2  
ATOM   1184  O  O    . ILE A 1 15 ? -18.203 4.325   -4.288  1.00 0.00 ? 15  ILE A O    2  
ATOM   1185  C  CB   . ILE A 1 15 ? -15.316 3.896   -3.335  1.00 0.00 ? 15  ILE A CB   2  
ATOM   1186  C  CG1  . ILE A 1 15 ? -14.448 3.128   -2.337  1.00 0.00 ? 15  ILE A CG1  2  
ATOM   1187  C  CG2  . ILE A 1 15 ? -14.490 4.940   -4.071  1.00 0.00 ? 15  ILE A CG2  2  
ATOM   1188  C  CD1  . ILE A 1 15 ? -13.632 2.023   -2.970  1.00 0.00 ? 15  ILE A CD1  2  
ATOM   1189  H  H    . ILE A 1 15 ? -17.141 2.678   -1.894  1.00 0.00 ? 15  ILE A H    2  
ATOM   1190  H  HA   . ILE A 1 15 ? -16.122 5.393   -2.032  1.00 0.00 ? 15  ILE A HA   2  
ATOM   1191  H  HB   . ILE A 1 15 ? -15.711 3.205   -4.064  1.00 0.00 ? 15  ILE A HB   2  
ATOM   1192  H  HG12 . ILE A 1 15 ? -13.763 3.814   -1.862  1.00 0.00 ? 15  ILE A HG12 2  
ATOM   1193  H  HG13 . ILE A 1 15 ? -15.084 2.684   -1.585  1.00 0.00 ? 15  ILE A HG13 2  
ATOM   1194  H  HG21 . ILE A 1 15 ? -13.555 4.502   -4.387  1.00 0.00 ? 15  ILE A HG21 2  
ATOM   1195  H  HG22 . ILE A 1 15 ? -15.035 5.285   -4.937  1.00 0.00 ? 15  ILE A HG22 2  
ATOM   1196  H  HG23 . ILE A 1 15 ? -14.293 5.773   -3.414  1.00 0.00 ? 15  ILE A HG23 2  
ATOM   1197  H  HD11 . ILE A 1 15 ? -13.385 2.294   -3.986  1.00 0.00 ? 15  ILE A HD11 2  
ATOM   1198  H  HD12 . ILE A 1 15 ? -12.725 1.875   -2.405  1.00 0.00 ? 15  ILE A HD12 2  
ATOM   1199  H  HD13 . ILE A 1 15 ? -14.208 1.108   -2.973  1.00 0.00 ? 15  ILE A HD13 2  
ATOM   1200  N  N    . ILE A 1 16 ? -17.505 6.412   -3.816  1.00 0.00 ? 16  ILE A N    2  
ATOM   1201  C  CA   . ILE A 1 16 ? -18.397 7.045   -4.780  1.00 0.00 ? 16  ILE A CA   2  
ATOM   1202  C  C    . ILE A 1 16 ? -17.634 8.004   -5.687  1.00 0.00 ? 16  ILE A C    2  
ATOM   1203  O  O    . ILE A 1 16 ? -17.189 9.065   -5.252  1.00 0.00 ? 16  ILE A O    2  
ATOM   1204  C  CB   . ILE A 1 16 ? -19.531 7.815   -4.077  1.00 0.00 ? 16  ILE A CB   2  
ATOM   1205  C  CG1  . ILE A 1 16 ? -20.218 6.921   -3.042  1.00 0.00 ? 16  ILE A CG1  2  
ATOM   1206  C  CG2  . ILE A 1 16 ? -20.538 8.323   -5.098  1.00 0.00 ? 16  ILE A CG2  2  
ATOM   1207  C  CD1  . ILE A 1 16 ? -21.242 7.649   -2.200  1.00 0.00 ? 16  ILE A CD1  2  
ATOM   1208  H  H    . ILE A 1 16 ? -16.908 6.972   -3.278  1.00 0.00 ? 16  ILE A H    2  
ATOM   1209  H  HA   . ILE A 1 16 ? -18.838 6.267   -5.386  1.00 0.00 ? 16  ILE A HA   2  
ATOM   1210  H  HB   . ILE A 1 16 ? -19.100 8.668   -3.576  1.00 0.00 ? 16  ILE A HB   2  
ATOM   1211  H  HG12 . ILE A 1 16 ? -20.720 6.113   -3.550  1.00 0.00 ? 16  ILE A HG12 2  
ATOM   1212  H  HG13 . ILE A 1 16 ? -19.470 6.513   -2.377  1.00 0.00 ? 16  ILE A HG13 2  
ATOM   1213  H  HG21 . ILE A 1 16 ? -21.403 7.675   -5.103  1.00 0.00 ? 16  ILE A HG21 2  
ATOM   1214  H  HG22 . ILE A 1 16 ? -20.842 9.325   -4.835  1.00 0.00 ? 16  ILE A HG22 2  
ATOM   1215  H  HG23 . ILE A 1 16 ? -20.086 8.328   -6.078  1.00 0.00 ? 16  ILE A HG23 2  
ATOM   1216  H  HD11 . ILE A 1 16 ? -20.772 8.018   -1.300  1.00 0.00 ? 16  ILE A HD11 2  
ATOM   1217  H  HD12 . ILE A 1 16 ? -21.647 8.477   -2.761  1.00 0.00 ? 16  ILE A HD12 2  
ATOM   1218  H  HD13 . ILE A 1 16 ? -22.039 6.969   -1.935  1.00 0.00 ? 16  ILE A HD13 2  
ATOM   1219  N  N    . GLY A 1 17 ? -17.487 7.623   -6.953  1.00 0.00 ? 17  GLY A N    2  
ATOM   1220  C  CA   . GLY A 1 17 ? -16.779 8.461   -7.902  1.00 0.00 ? 17  GLY A CA   2  
ATOM   1221  C  C    . GLY A 1 17 ? -15.516 7.805   -8.425  1.00 0.00 ? 17  GLY A C    2  
ATOM   1222  O  O    . GLY A 1 17 ? -15.468 7.363   -9.573  1.00 0.00 ? 17  GLY A O    2  
ATOM   1223  H  H    . GLY A 1 17 ? -17.864 6.766   -7.244  1.00 0.00 ? 17  GLY A H    2  
ATOM   1224  H  HA2  . GLY A 1 17 ? -17.433 8.675   -8.735  1.00 0.00 ? 17  GLY A HA2  2  
ATOM   1225  H  HA3  . GLY A 1 17 ? -16.514 9.390   -7.418  1.00 0.00 ? 17  GLY A HA3  2  
ATOM   1226  N  N    . ARG A 1 18 ? -14.491 7.743   -7.582  1.00 0.00 ? 18  ARG A N    2  
ATOM   1227  C  CA   . ARG A 1 18 ? -13.221 7.139   -7.966  1.00 0.00 ? 18  ARG A CA   2  
ATOM   1228  C  C    . ARG A 1 18 ? -12.918 5.916   -7.105  1.00 0.00 ? 18  ARG A C    2  
ATOM   1229  O  O    . ARG A 1 18 ? -12.792 6.019   -5.885  1.00 0.00 ? 18  ARG A O    2  
ATOM   1230  C  CB   . ARG A 1 18 ? -12.088 8.159   -7.839  1.00 0.00 ? 18  ARG A CB   2  
ATOM   1231  C  CG   . ARG A 1 18 ? -10.705 7.531   -7.798  1.00 0.00 ? 18  ARG A CG   2  
ATOM   1232  C  CD   . ARG A 1 18 ? -9.636  8.504   -8.272  1.00 0.00 ? 18  ARG A CD   2  
ATOM   1233  N  NE   . ARG A 1 18 ? -8.522  7.820   -8.923  1.00 0.00 ? 18  ARG A NE   2  
ATOM   1234  C  CZ   . ARG A 1 18 ? -8.456  7.604   -10.232 1.00 0.00 ? 18  ARG A CZ   2  
ATOM   1235  N  NH1  . ARG A 1 18 ? -9.435  8.018   -11.025 1.00 0.00 ? 18  ARG A NH1  2  
ATOM   1236  N  NH2  . ARG A 1 18 ? -7.410  6.974   -10.750 1.00 0.00 ? 18  ARG A NH2  2  
ATOM   1237  H  H    . ARG A 1 18 ? -14.591 8.113   -6.679  1.00 0.00 ? 18  ARG A H    2  
ATOM   1238  H  HA   . ARG A 1 18 ? -13.300 6.829   -8.997  1.00 0.00 ? 18  ARG A HA   2  
ATOM   1239  H  HB2  . ARG A 1 18 ? -12.128 8.832   -8.683  1.00 0.00 ? 18  ARG A HB2  2  
ATOM   1240  H  HB3  . ARG A 1 18 ? -12.229 8.725   -6.931  1.00 0.00 ? 18  ARG A HB3  2  
ATOM   1241  H  HG2  . ARG A 1 18 ? -10.483 7.236   -6.783  1.00 0.00 ? 18  ARG A HG2  2  
ATOM   1242  H  HG3  . ARG A 1 18 ? -10.696 6.661   -8.437  1.00 0.00 ? 18  ARG A HG3  2  
ATOM   1243  H  HD2  . ARG A 1 18 ? -10.082 9.193   -8.973  1.00 0.00 ? 18  ARG A HD2  2  
ATOM   1244  H  HD3  . ARG A 1 18 ? -9.262  9.050   -7.419  1.00 0.00 ? 18  ARG A HD3  2  
ATOM   1245  H  HE   . ARG A 1 18 ? -7.788  7.506   -8.355  1.00 0.00 ? 18  ARG A HE   2  
ATOM   1246  H  HH11 . ARG A 1 18 ? -10.224 8.494   -10.638 1.00 0.00 ? 18  ARG A HH11 2  
ATOM   1247  H  HH12 . ARG A 1 18 ? -9.382  7.855   -12.011 1.00 0.00 ? 18  ARG A HH12 2  
ATOM   1248  H  HH21 . ARG A 1 18 ? -6.670  6.661   -10.155 1.00 0.00 ? 18  ARG A HH21 2  
ATOM   1249  H  HH22 . ARG A 1 18 ? -7.361  6.812   -11.735 1.00 0.00 ? 18  ARG A HH22 2  
ATOM   1250  N  N    . VAL A 1 19 ? -12.802 4.760   -7.750  1.00 0.00 ? 19  VAL A N    2  
ATOM   1251  C  CA   . VAL A 1 19 ? -12.513 3.517   -7.044  1.00 0.00 ? 19  VAL A CA   2  
ATOM   1252  C  C    . VAL A 1 19 ? -11.134 2.983   -7.414  1.00 0.00 ? 19  VAL A C    2  
ATOM   1253  O  O    . VAL A 1 19 ? -10.869 2.668   -8.575  1.00 0.00 ? 19  VAL A O    2  
ATOM   1254  C  CB   . VAL A 1 19 ? -13.568 2.438   -7.352  1.00 0.00 ? 19  VAL A CB   2  
ATOM   1255  C  CG1  . VAL A 1 19 ? -13.019 1.052   -7.051  1.00 0.00 ? 19  VAL A CG1  2  
ATOM   1256  C  CG2  . VAL A 1 19 ? -14.842 2.699   -6.562  1.00 0.00 ? 19  VAL A CG2  2  
ATOM   1257  H  H    . VAL A 1 19 ? -12.912 4.742   -8.723  1.00 0.00 ? 19  VAL A H    2  
ATOM   1258  H  HA   . VAL A 1 19 ? -12.537 3.722   -5.984  1.00 0.00 ? 19  VAL A HA   2  
ATOM   1259  H  HB   . VAL A 1 19 ? -13.807 2.486   -8.404  1.00 0.00 ? 19  VAL A HB   2  
ATOM   1260  H  HG11 . VAL A 1 19 ? -13.770 0.310   -7.280  1.00 0.00 ? 19  VAL A HG11 2  
ATOM   1261  H  HG12 . VAL A 1 19 ? -12.140 0.875   -7.653  1.00 0.00 ? 19  VAL A HG12 2  
ATOM   1262  H  HG13 . VAL A 1 19 ? -12.759 0.988   -6.004  1.00 0.00 ? 19  VAL A HG13 2  
ATOM   1263  H  HG21 . VAL A 1 19 ? -14.968 1.926   -5.818  1.00 0.00 ? 19  VAL A HG21 2  
ATOM   1264  H  HG22 . VAL A 1 19 ? -14.773 3.660   -6.073  1.00 0.00 ? 19  VAL A HG22 2  
ATOM   1265  H  HG23 . VAL A 1 19 ? -15.689 2.696   -7.232  1.00 0.00 ? 19  VAL A HG23 2  
ATOM   1266  N  N    . ILE A 1 20 ? -10.258 2.882   -6.419  1.00 0.00 ? 20  ILE A N    2  
ATOM   1267  C  CA   . ILE A 1 20 ? -8.906  2.384   -6.640  1.00 0.00 ? 20  ILE A CA   2  
ATOM   1268  C  C    . ILE A 1 20 ? -8.835  0.875   -6.432  1.00 0.00 ? 20  ILE A C    2  
ATOM   1269  O  O    . ILE A 1 20 ? -8.930  0.387   -5.305  1.00 0.00 ? 20  ILE A O    2  
ATOM   1270  C  CB   . ILE A 1 20 ? -7.894  3.069   -5.702  1.00 0.00 ? 20  ILE A CB   2  
ATOM   1271  C  CG1  . ILE A 1 20 ? -8.127  4.581   -5.682  1.00 0.00 ? 20  ILE A CG1  2  
ATOM   1272  C  CG2  . ILE A 1 20 ? -6.471  2.752   -6.137  1.00 0.00 ? 20  ILE A CG2  2  
ATOM   1273  C  CD1  . ILE A 1 20 ? -7.896  5.246   -7.020  1.00 0.00 ? 20  ILE A CD1  2  
ATOM   1274  H  H    . ILE A 1 20 ? -10.528 3.148   -5.516  1.00 0.00 ? 20  ILE A H    2  
ATOM   1275  H  HA   . ILE A 1 20 ? -8.631  2.609   -7.660  1.00 0.00 ? 20  ILE A HA   2  
ATOM   1276  H  HB   . ILE A 1 20 ? -8.036  2.676   -4.707  1.00 0.00 ? 20  ILE A HB   2  
ATOM   1277  H  HG12 . ILE A 1 20 ? -9.145  4.778   -5.385  1.00 0.00 ? 20  ILE A HG12 2  
ATOM   1278  H  HG13 . ILE A 1 20 ? -7.454  5.031   -4.966  1.00 0.00 ? 20  ILE A HG13 2  
ATOM   1279  H  HG21 . ILE A 1 20 ? -6.189  3.407   -6.949  1.00 0.00 ? 20  ILE A HG21 2  
ATOM   1280  H  HG22 . ILE A 1 20 ? -5.799  2.902   -5.306  1.00 0.00 ? 20  ILE A HG22 2  
ATOM   1281  H  HG23 . ILE A 1 20 ? -6.415  1.726   -6.466  1.00 0.00 ? 20  ILE A HG23 2  
ATOM   1282  H  HD11 . ILE A 1 20 ? -8.379  4.672   -7.797  1.00 0.00 ? 20  ILE A HD11 2  
ATOM   1283  H  HD12 . ILE A 1 20 ? -8.305  6.245   -7.002  1.00 0.00 ? 20  ILE A HD12 2  
ATOM   1284  H  HD13 . ILE A 1 20 ? -6.834  5.296   -7.218  1.00 0.00 ? 20  ILE A HD13 2  
ATOM   1285  N  N    . LYS A 1 21 ? -8.665  0.140   -7.525  1.00 0.00 ? 21  LYS A N    2  
ATOM   1286  C  CA   . LYS A 1 21 ? -8.578  -1.314  -7.464  1.00 0.00 ? 21  LYS A CA   2  
ATOM   1287  C  C    . LYS A 1 21 ? -7.159  -1.760  -7.128  1.00 0.00 ? 21  LYS A C    2  
ATOM   1288  O  O    . LYS A 1 21 ? -6.220  -1.491  -7.877  1.00 0.00 ? 21  LYS A O    2  
ATOM   1289  C  CB   . LYS A 1 21 ? -9.015  -1.928  -8.796  1.00 0.00 ? 21  LYS A CB   2  
ATOM   1290  C  CG   . LYS A 1 21 ? -10.519 -1.915  -9.007  1.00 0.00 ? 21  LYS A CG   2  
ATOM   1291  C  CD   . LYS A 1 21 ? -11.169 -3.178  -8.466  1.00 0.00 ? 21  LYS A CD   2  
ATOM   1292  C  CE   . LYS A 1 21 ? -12.611 -2.928  -8.049  1.00 0.00 ? 21  LYS A CE   2  
ATOM   1293  N  NZ   . LYS A 1 21 ? -13.216 -4.125  -7.402  1.00 0.00 ? 21  LYS A NZ   2  
ATOM   1294  H  H    . LYS A 1 21 ? -8.596  0.587   -8.395  1.00 0.00 ? 21  LYS A H    2  
ATOM   1295  H  HA   . LYS A 1 21 ? -9.243  -1.654  -6.685  1.00 0.00 ? 21  LYS A HA   2  
ATOM   1296  H  HB2  . LYS A 1 21 ? -8.555  -1.376  -9.602  1.00 0.00 ? 21  LYS A HB2  2  
ATOM   1297  H  HB3  . LYS A 1 21 ? -8.676  -2.954  -8.834  1.00 0.00 ? 21  LYS A HB3  2  
ATOM   1298  H  HG2  . LYS A 1 21 ? -10.938 -1.061  -8.496  1.00 0.00 ? 21  LYS A HG2  2  
ATOM   1299  H  HG3  . LYS A 1 21 ? -10.724 -1.841  -10.065 1.00 0.00 ? 21  LYS A HG3  2  
ATOM   1300  H  HD2  . LYS A 1 21 ? -11.155 -3.937  -9.233  1.00 0.00 ? 21  LYS A HD2  2  
ATOM   1301  H  HD3  . LYS A 1 21 ? -10.610 -3.521  -7.607  1.00 0.00 ? 21  LYS A HD3  2  
ATOM   1302  H  HE2  . LYS A 1 21 ? -12.633 -2.103  -7.354  1.00 0.00 ? 21  LYS A HE2  2  
ATOM   1303  H  HE3  . LYS A 1 21 ? -13.186 -2.675  -8.927  1.00 0.00 ? 21  LYS A HE3  2  
ATOM   1304  H  HZ1  . LYS A 1 21 ? -13.691 -4.715  -8.114  1.00 0.00 ? 21  LYS A HZ1  2  
ATOM   1305  H  HZ2  . LYS A 1 21 ? -13.915 -3.830  -6.690  1.00 0.00 ? 21  LYS A HZ2  2  
ATOM   1306  H  HZ3  . LYS A 1 21 ? -12.479 -4.690  -6.934  1.00 0.00 ? 21  LYS A HZ3  2  
ATOM   1307  N  N    . ALA A 1 22 ? -7.010  -2.445  -5.998  1.00 0.00 ? 22  ALA A N    2  
ATOM   1308  C  CA   . ALA A 1 22 ? -5.706  -2.931  -5.566  1.00 0.00 ? 22  ALA A CA   2  
ATOM   1309  C  C    . ALA A 1 22 ? -5.847  -4.143  -4.652  1.00 0.00 ? 22  ALA A C    2  
ATOM   1310  O  O    . ALA A 1 22 ? -6.939  -4.444  -4.170  1.00 0.00 ? 22  ALA A O    2  
ATOM   1311  C  CB   . ALA A 1 22 ? -4.936  -1.823  -4.861  1.00 0.00 ? 22  ALA A CB   2  
ATOM   1312  H  H    . ALA A 1 22 ? -7.796  -2.628  -5.444  1.00 0.00 ? 22  ALA A H    2  
ATOM   1313  H  HA   . ALA A 1 22 ? -5.148  -3.219  -6.446  1.00 0.00 ? 22  ALA A HA   2  
ATOM   1314  H  HB1  . ALA A 1 22 ? -4.159  -2.258  -4.251  1.00 0.00 ? 22  ALA A HB1  2  
ATOM   1315  H  HB2  . ALA A 1 22 ? -4.494  -1.169  -5.597  1.00 0.00 ? 22  ALA A HB2  2  
ATOM   1316  H  HB3  . ALA A 1 22 ? -5.611  -1.258  -4.236  1.00 0.00 ? 22  ALA A HB3  2  
ATOM   1317  N  N    . MET A 1 23 ? -4.737  -4.835  -4.418  1.00 0.00 ? 23  MET A N    2  
ATOM   1318  C  CA   . MET A 1 23 ? -4.739  -6.015  -3.561  1.00 0.00 ? 23  MET A CA   2  
ATOM   1319  C  C    . MET A 1 23 ? -5.988  -6.858  -3.798  1.00 0.00 ? 23  MET A C    2  
ATOM   1320  O  O    . MET A 1 23 ? -6.440  -7.577  -2.908  1.00 0.00 ? 23  MET A O    2  
ATOM   1321  C  CB   . MET A 1 23 ? -4.659  -5.602  -2.089  1.00 0.00 ? 23  MET A CB   2  
ATOM   1322  C  CG   . MET A 1 23 ? -3.443  -4.751  -1.761  1.00 0.00 ? 23  MET A CG   2  
ATOM   1323  S  SD   . MET A 1 23 ? -3.096  -4.688  0.007   1.00 0.00 ? 23  MET A SD   2  
ATOM   1324  C  CE   . MET A 1 23 ? -1.629  -5.711  0.100   1.00 0.00 ? 23  MET A CE   2  
ATOM   1325  H  H    . MET A 1 23 ? -3.897  -4.546  -4.831  1.00 0.00 ? 23  MET A H    2  
ATOM   1326  H  HA   . MET A 1 23 ? -3.868  -6.604  -3.807  1.00 0.00 ? 23  MET A HA   2  
ATOM   1327  H  HB2  . MET A 1 23 ? -5.545  -5.039  -1.838  1.00 0.00 ? 23  MET A HB2  2  
ATOM   1328  H  HB3  . MET A 1 23 ? -4.623  -6.493  -1.479  1.00 0.00 ? 23  MET A HB3  2  
ATOM   1329  H  HG2  . MET A 1 23 ? -2.584  -5.165  -2.268  1.00 0.00 ? 23  MET A HG2  2  
ATOM   1330  H  HG3  . MET A 1 23 ? -3.618  -3.747  -2.116  1.00 0.00 ? 23  MET A HG3  2  
ATOM   1331  H  HE1  . MET A 1 23 ? -1.810  -6.648  -0.406  1.00 0.00 ? 23  MET A HE1  2  
ATOM   1332  H  HE2  . MET A 1 23 ? -0.803  -5.200  -0.373  1.00 0.00 ? 23  MET A HE2  2  
ATOM   1333  H  HE3  . MET A 1 23 ? -1.389  -5.902  1.136   1.00 0.00 ? 23  MET A HE3  2  
ATOM   1334  N  N    . ASN A 1 24 ? -6.539  -6.763  -5.003  1.00 0.00 ? 24  ASN A N    2  
ATOM   1335  C  CA   . ASN A 1 24 ? -7.737  -7.517  -5.357  1.00 0.00 ? 24  ASN A CA   2  
ATOM   1336  C  C    . ASN A 1 24 ? -8.948  -7.010  -4.580  1.00 0.00 ? 24  ASN A C    2  
ATOM   1337  O  O    . ASN A 1 24 ? -9.736  -7.796  -4.056  1.00 0.00 ? 24  ASN A O    2  
ATOM   1338  C  CB   . ASN A 1 24 ? -7.527  -9.007  -5.080  1.00 0.00 ? 24  ASN A CB   2  
ATOM   1339  C  CG   . ASN A 1 24 ? -8.615  -9.868  -5.693  1.00 0.00 ? 24  ASN A CG   2  
ATOM   1340  O  OD1  . ASN A 1 24 ? -9.702  -9.383  -6.007  1.00 0.00 ? 24  ASN A OD1  2  
ATOM   1341  N  ND2  . ASN A 1 24 ? -8.326  -11.152 -5.866  1.00 0.00 ? 24  ASN A ND2  2  
ATOM   1342  H  H    . ASN A 1 24 ? -6.132  -6.173  -5.671  1.00 0.00 ? 24  ASN A H    2  
ATOM   1343  H  HA   . ASN A 1 24 ? -7.917  -7.378  -6.412  1.00 0.00 ? 24  ASN A HA   2  
ATOM   1344  H  HB2  . ASN A 1 24 ? -6.577  -9.313  -5.493  1.00 0.00 ? 24  ASN A HB2  2  
ATOM   1345  H  HB3  . ASN A 1 24 ? -7.521  -9.172  -4.013  1.00 0.00 ? 24  ASN A HB3  2  
ATOM   1346  H  HD21 . ASN A 1 24 ? -7.439  -11.468 -5.593  1.00 0.00 ? 24  ASN A HD21 2  
ATOM   1347  H  HD22 . ASN A 1 24 ? -9.010  -11.731 -6.262  1.00 0.00 ? 24  ASN A HD22 2  
ATOM   1348  N  N    . ASN A 1 25 ? -9.089  -5.690  -4.510  1.00 0.00 ? 25  ASN A N    2  
ATOM   1349  C  CA   . ASN A 1 25 ? -10.204 -5.077  -3.797  1.00 0.00 ? 25  ASN A CA   2  
ATOM   1350  C  C    . ASN A 1 25 ? -10.290 -3.585  -4.102  1.00 0.00 ? 25  ASN A C    2  
ATOM   1351  O  O    . ASN A 1 25 ? -9.353  -2.995  -4.639  1.00 0.00 ? 25  ASN A O    2  
ATOM   1352  C  CB   . ASN A 1 25 ? -10.053 -5.293  -2.290  1.00 0.00 ? 25  ASN A CB   2  
ATOM   1353  C  CG   . ASN A 1 25 ? -10.462 -6.690  -1.862  1.00 0.00 ? 25  ASN A CG   2  
ATOM   1354  O  OD1  . ASN A 1 25 ? -11.512 -7.191  -2.263  1.00 0.00 ? 25  ASN A OD1  2  
ATOM   1355  N  ND2  . ASN A 1 25 ? -9.630  -7.324  -1.044  1.00 0.00 ? 25  ASN A ND2  2  
ATOM   1356  H  H    . ASN A 1 25 ? -8.428  -5.114  -4.947  1.00 0.00 ? 25  ASN A H    2  
ATOM   1357  H  HA   . ASN A 1 25 ? -11.113 -5.554  -4.131  1.00 0.00 ? 25  ASN A HA   2  
ATOM   1358  H  HB2  . ASN A 1 25 ? -9.020  -5.140  -2.012  1.00 0.00 ? 25  ASN A HB2  2  
ATOM   1359  H  HB3  . ASN A 1 25 ? -10.672 -4.580  -1.766  1.00 0.00 ? 25  ASN A HB3  2  
ATOM   1360  H  HD21 . ASN A 1 25 ? -8.812  -6.863  -0.766  1.00 0.00 ? 25  ASN A HD21 2  
ATOM   1361  H  HD22 . ASN A 1 25 ? -9.869  -8.229  -0.752  1.00 0.00 ? 25  ASN A HD22 2  
ATOM   1362  N  N    . SER A 1 26 ? -11.421 -2.980  -3.754  1.00 0.00 ? 26  SER A N    2  
ATOM   1363  C  CA   . SER A 1 26 ? -11.632 -1.557  -3.993  1.00 0.00 ? 26  SER A CA   2  
ATOM   1364  C  C    . SER A 1 26 ? -11.160 -0.730  -2.801  1.00 0.00 ? 26  SER A C    2  
ATOM   1365  O  O    . SER A 1 26 ? -11.280 -1.154  -1.652  1.00 0.00 ? 26  SER A O    2  
ATOM   1366  C  CB   . SER A 1 26 ? -13.111 -1.277  -4.269  1.00 0.00 ? 26  SER A CB   2  
ATOM   1367  O  OG   . SER A 1 26 ? -13.930 -1.808  -3.241  1.00 0.00 ? 26  SER A OG   2  
ATOM   1368  H  H    . SER A 1 26 ? -12.132 -3.504  -3.329  1.00 0.00 ? 26  SER A H    2  
ATOM   1369  H  HA   . SER A 1 26 ? -11.054 -1.277  -4.862  1.00 0.00 ? 26  SER A HA   2  
ATOM   1370  H  HB2  . SER A 1 26 ? -13.269 -0.211  -4.324  1.00 0.00 ? 26  SER A HB2  2  
ATOM   1371  H  HB3  . SER A 1 26 ? -13.391 -1.733  -5.208  1.00 0.00 ? 26  SER A HB3  2  
ATOM   1372  H  HG   . SER A 1 26 ? -14.783 -2.054  -3.606  1.00 0.00 ? 26  SER A HG   2  
ATOM   1373  N  N    . TRP A 1 27 ? -10.623 0.452   -3.085  1.00 0.00 ? 27  TRP A N    2  
ATOM   1374  C  CA   . TRP A 1 27 ? -10.133 1.339   -2.036  1.00 0.00 ? 27  TRP A CA   2  
ATOM   1375  C  C    . TRP A 1 27 ? -10.275 2.800   -2.449  1.00 0.00 ? 27  TRP A C    2  
ATOM   1376  O  O    . TRP A 1 27 ? -10.625 3.101   -3.591  1.00 0.00 ? 27  TRP A O    2  
ATOM   1377  C  CB   . TRP A 1 27 ? -8.670  1.026   -1.718  1.00 0.00 ? 27  TRP A CB   2  
ATOM   1378  C  CG   . TRP A 1 27 ? -8.371  -0.442  -1.683  1.00 0.00 ? 27  TRP A CG   2  
ATOM   1379  C  CD1  . TRP A 1 27 ? -8.532  -1.336  -2.703  1.00 0.00 ? 27  TRP A CD1  2  
ATOM   1380  C  CD2  . TRP A 1 27 ? -7.861  -1.187  -0.571  1.00 0.00 ? 27  TRP A CD2  2  
ATOM   1381  N  NE1  . TRP A 1 27 ? -8.153  -2.591  -2.292  1.00 0.00 ? 27  TRP A NE1  2  
ATOM   1382  C  CE2  . TRP A 1 27 ? -7.736  -2.526  -0.988  1.00 0.00 ? 27  TRP A CE2  2  
ATOM   1383  C  CE3  . TRP A 1 27 ? -7.495  -0.851  0.735   1.00 0.00 ? 27  TRP A CE3  2  
ATOM   1384  C  CZ2  . TRP A 1 27 ? -7.263  -3.527  -0.145  1.00 0.00 ? 27  TRP A CZ2  2  
ATOM   1385  C  CZ3  . TRP A 1 27 ? -7.026  -1.847  1.572   1.00 0.00 ? 27  TRP A CZ3  2  
ATOM   1386  C  CH2  . TRP A 1 27 ? -6.913  -3.171  1.129   1.00 0.00 ? 27  TRP A CH2  2  
ATOM   1387  H  H    . TRP A 1 27 ? -10.555 0.734   -4.021  1.00 0.00 ? 27  TRP A H    2  
ATOM   1388  H  HA   . TRP A 1 27 ? -10.729 1.167   -1.152  1.00 0.00 ? 27  TRP A HA   2  
ATOM   1389  H  HB2  . TRP A 1 27 ? -8.040  1.476   -2.470  1.00 0.00 ? 27  TRP A HB2  2  
ATOM   1390  H  HB3  . TRP A 1 27 ? -8.423  1.441   -0.751  1.00 0.00 ? 27  TRP A HB3  2  
ATOM   1391  H  HD1  . TRP A 1 27 ? -8.905  -1.080  -3.682  1.00 0.00 ? 27  TRP A HD1  2  
ATOM   1392  H  HE1  . TRP A 1 27 ? -8.175  -3.401  -2.844  1.00 0.00 ? 27  TRP A HE1  2  
ATOM   1393  H  HE3  . TRP A 1 27 ? -7.575  0.164   1.095   1.00 0.00 ? 27  TRP A HE3  2  
ATOM   1394  H  HZ2  . TRP A 1 27 ? -7.169  -4.553  -0.471  1.00 0.00 ? 27  TRP A HZ2  2  
ATOM   1395  H  HZ3  . TRP A 1 27 ? -6.739  -1.607  2.585   1.00 0.00 ? 27  TRP A HZ3  2  
ATOM   1396  H  HH2  . TRP A 1 27 ? -6.542  -3.916  1.817   1.00 0.00 ? 27  TRP A HH2  2  
ATOM   1397  N  N    . HIS A 1 28 ? -10.000 3.704   -1.514  1.00 0.00 ? 28  HIS A N    2  
ATOM   1398  C  CA   . HIS A 1 28 ? -10.097 5.135   -1.783  1.00 0.00 ? 28  HIS A CA   2  
ATOM   1399  C  C    . HIS A 1 28 ? -8.768  5.683   -2.293  1.00 0.00 ? 28  HIS A C    2  
ATOM   1400  O  O    . HIS A 1 28 ? -7.704  5.104   -2.071  1.00 0.00 ? 28  HIS A O    2  
ATOM   1401  C  CB   . HIS A 1 28 ? -10.520 5.885   -0.519  1.00 0.00 ? 28  HIS A CB   2  
ATOM   1402  C  CG   . HIS A 1 28 ? -11.976 5.744   -0.198  1.00 0.00 ? 28  HIS A CG   2  
ATOM   1403  N  ND1  . HIS A 1 28 ? -12.437 5.277   1.015   1.00 0.00 ? 28  HIS A ND1  2  
ATOM   1404  C  CD2  . HIS A 1 28 ? -13.076 6.013   -0.939  1.00 0.00 ? 28  HIS A CD2  2  
ATOM   1405  C  CE1  . HIS A 1 28 ? -13.758 5.263   1.005   1.00 0.00 ? 28  HIS A CE1  2  
ATOM   1406  N  NE2  . HIS A 1 28 ? -14.171 5.706   -0.169  1.00 0.00 ? 28  HIS A NE2  2  
ATOM   1407  H  H    . HIS A 1 28 ? -9.726  3.402   -0.624  1.00 0.00 ? 28  HIS A H    2  
ATOM   1408  H  HA   . HIS A 1 28 ? -10.848 5.279   -2.545  1.00 0.00 ? 28  HIS A HA   2  
ATOM   1409  H  HB2  . HIS A 1 28 ? -9.957  5.506   0.321   1.00 0.00 ? 28  HIS A HB2  2  
ATOM   1410  H  HB3  . HIS A 1 28 ? -10.307 6.936   -0.644  1.00 0.00 ? 28  HIS A HB3  2  
ATOM   1411  H  HD2  . HIS A 1 28 ? -13.091 6.397   -1.949  1.00 0.00 ? 28  HIS A HD2  2  
ATOM   1412  H  HE1  . HIS A 1 28 ? -14.393 4.945   1.818   1.00 0.00 ? 28  HIS A HE1  2  
ATOM   1413  H  HE2  . HIS A 1 28 ? -15.102 5.717   -0.472  1.00 0.00 ? 28  HIS A HE2  2  
ATOM   1414  N  N    . PRO A 1 29 ? -8.828  6.824   -2.994  1.00 0.00 ? 29  PRO A N    2  
ATOM   1415  C  CA   . PRO A 1 29 ? -7.638  7.475   -3.551  1.00 0.00 ? 29  PRO A CA   2  
ATOM   1416  C  C    . PRO A 1 29 ? -6.744  8.072   -2.469  1.00 0.00 ? 29  PRO A C    2  
ATOM   1417  O  O    . PRO A 1 29 ? -5.696  8.645   -2.764  1.00 0.00 ? 29  PRO A O    2  
ATOM   1418  C  CB   . PRO A 1 29 ? -8.219  8.582   -4.434  1.00 0.00 ? 29  PRO A CB   2  
ATOM   1419  C  CG   . PRO A 1 29 ? -9.555  8.874   -3.845  1.00 0.00 ? 29  PRO A CG   2  
ATOM   1420  C  CD   . PRO A 1 29 ? -10.062 7.569   -3.297  1.00 0.00 ? 29  PRO A CD   2  
ATOM   1421  H  HA   . PRO A 1 29 ? -7.060  6.793   -4.158  1.00 0.00 ? 29  PRO A HA   2  
ATOM   1422  H  HB2  . PRO A 1 29 ? -7.574  9.448   -4.402  1.00 0.00 ? 29  PRO A HB2  2  
ATOM   1423  H  HB3  . PRO A 1 29 ? -8.305  8.228   -5.451  1.00 0.00 ? 29  PRO A HB3  2  
ATOM   1424  H  HG2  . PRO A 1 29 ? -9.456  9.600   -3.052  1.00 0.00 ? 29  PRO A HG2  2  
ATOM   1425  H  HG3  . PRO A 1 29 ? -10.222 9.242   -4.611  1.00 0.00 ? 29  PRO A HG3  2  
ATOM   1426  H  HD2  . PRO A 1 29 ? -10.642 7.734   -2.402  1.00 0.00 ? 29  PRO A HD2  2  
ATOM   1427  H  HD3  . PRO A 1 29 ? -10.650 7.051   -4.040  1.00 0.00 ? 29  PRO A HD3  2  
ATOM   1428  N  N    . GLU A 1 30 ? -7.165  7.932   -1.216  1.00 0.00 ? 30  GLU A N    2  
ATOM   1429  C  CA   . GLU A 1 30 ? -6.402  8.459   -0.091  1.00 0.00 ? 30  GLU A CA   2  
ATOM   1430  C  C    . GLU A 1 30 ? -6.106  7.361   0.928   1.00 0.00 ? 30  GLU A C    2  
ATOM   1431  O  O    . GLU A 1 30 ? -5.119  7.428   1.661   1.00 0.00 ? 30  GLU A O    2  
ATOM   1432  C  CB   . GLU A 1 30 ? -7.165  9.601   0.582   1.00 0.00 ? 30  GLU A CB   2  
ATOM   1433  C  CG   . GLU A 1 30 ? -8.437  9.155   1.283   1.00 0.00 ? 30  GLU A CG   2  
ATOM   1434  C  CD   . GLU A 1 30 ? -8.873  10.118  2.370   1.00 0.00 ? 30  GLU A CD   2  
ATOM   1435  O  OE1  . GLU A 1 30 ? -8.235  10.128  3.444   1.00 0.00 ? 30  GLU A OE1  2  
ATOM   1436  O  OE2  . GLU A 1 30 ? -9.852  10.860  2.148   1.00 0.00 ? 30  GLU A OE2  2  
ATOM   1437  H  H    . GLU A 1 30 ? -8.009  7.465   -1.044  1.00 0.00 ? 30  GLU A H    2  
ATOM   1438  H  HA   . GLU A 1 30 ? -5.467  8.839   -0.473  1.00 0.00 ? 30  GLU A HA   2  
ATOM   1439  H  HB2  . GLU A 1 30 ? -6.520  10.068  1.313   1.00 0.00 ? 30  GLU A HB2  2  
ATOM   1440  H  HB3  . GLU A 1 30 ? -7.430  10.331  -0.168  1.00 0.00 ? 30  GLU A HB3  2  
ATOM   1441  H  HG2  . GLU A 1 30 ? -9.228  9.079   0.552   1.00 0.00 ? 30  GLU A HG2  2  
ATOM   1442  H  HG3  . GLU A 1 30 ? -8.265  8.185   1.729   1.00 0.00 ? 30  GLU A HG3  2  
ATOM   1443  N  N    . CYS A 1 31 ? -6.969  6.351   0.967   1.00 0.00 ? 31  CYS A N    2  
ATOM   1444  C  CA   . CYS A 1 31 ? -6.803  5.239   1.895   1.00 0.00 ? 31  CYS A CA   2  
ATOM   1445  C  C    . CYS A 1 31 ? -5.664  4.326   1.452   1.00 0.00 ? 31  CYS A C    2  
ATOM   1446  O  O    . CYS A 1 31 ? -4.753  4.030   2.226   1.00 0.00 ? 31  CYS A O    2  
ATOM   1447  C  CB   . CYS A 1 31 ? -8.102  4.437   2.000   1.00 0.00 ? 31  CYS A CB   2  
ATOM   1448  S  SG   . CYS A 1 31 ? -9.377  5.220   3.039   1.00 0.00 ? 31  CYS A SG   2  
ATOM   1449  H  H    . CYS A 1 31 ? -7.737  6.354   0.357   1.00 0.00 ? 31  CYS A H    2  
ATOM   1450  H  HA   . CYS A 1 31 ? -6.564  5.648   2.864   1.00 0.00 ? 31  CYS A HA   2  
ATOM   1451  H  HB2  . CYS A 1 31 ? -8.518  4.310   1.011   1.00 0.00 ? 31  CYS A HB2  2  
ATOM   1452  H  HB3  . CYS A 1 31 ? -7.884  3.467   2.421   1.00 0.00 ? 31  CYS A HB3  2  
ATOM   1453  N  N    . PHE A 1 32 ? -5.720  3.883   0.200   1.00 0.00 ? 32  PHE A N    2  
ATOM   1454  C  CA   . PHE A 1 32 ? -4.694  3.004   -0.347  1.00 0.00 ? 32  PHE A CA   2  
ATOM   1455  C  C    . PHE A 1 32 ? -3.327  3.681   -0.321  1.00 0.00 ? 32  PHE A C    2  
ATOM   1456  O  O    . PHE A 1 32 ? -2.955  4.389   -1.256  1.00 0.00 ? 32  PHE A O    2  
ATOM   1457  C  CB   . PHE A 1 32 ? -5.048  2.601   -1.780  1.00 0.00 ? 32  PHE A CB   2  
ATOM   1458  C  CG   . PHE A 1 32 ? -4.223  1.460   -2.304  1.00 0.00 ? 32  PHE A CG   2  
ATOM   1459  C  CD1  . PHE A 1 32 ? -4.272  0.216   -1.697  1.00 0.00 ? 32  PHE A CD1  2  
ATOM   1460  C  CD2  . PHE A 1 32 ? -3.398  1.633   -3.403  1.00 0.00 ? 32  PHE A CD2  2  
ATOM   1461  C  CE1  . PHE A 1 32 ? -3.513  -0.835  -2.176  1.00 0.00 ? 32  PHE A CE1  2  
ATOM   1462  C  CE2  . PHE A 1 32 ? -2.636  0.586   -3.888  1.00 0.00 ? 32  PHE A CE2  2  
ATOM   1463  C  CZ   . PHE A 1 32 ? -2.695  -0.650  -3.274  1.00 0.00 ? 32  PHE A CZ   2  
ATOM   1464  H  H    . PHE A 1 32 ? -6.471  4.154   -0.369  1.00 0.00 ? 32  PHE A H    2  
ATOM   1465  H  HA   . PHE A 1 32 ? -4.656  2.118   0.268   1.00 0.00 ? 32  PHE A HA   2  
ATOM   1466  H  HB2  . PHE A 1 32 ? -6.085  2.303   -1.817  1.00 0.00 ? 32  PHE A HB2  2  
ATOM   1467  H  HB3  . PHE A 1 32 ? -4.898  3.448   -2.432  1.00 0.00 ? 32  PHE A HB3  2  
ATOM   1468  H  HD1  . PHE A 1 32 ? -4.912  0.069   -0.839  1.00 0.00 ? 32  PHE A HD1  2  
ATOM   1469  H  HD2  . PHE A 1 32 ? -3.352  2.600   -3.885  1.00 0.00 ? 32  PHE A HD2  2  
ATOM   1470  H  HE1  . PHE A 1 32 ? -3.561  -1.800  -1.694  1.00 0.00 ? 32  PHE A HE1  2  
ATOM   1471  H  HE2  . PHE A 1 32 ? -1.998  0.734   -4.746  1.00 0.00 ? 32  PHE A HE2  2  
ATOM   1472  H  HZ   . PHE A 1 32 ? -2.100  -1.469  -3.650  1.00 0.00 ? 32  PHE A HZ   2  
ATOM   1473  N  N    . ARG A 1 33 ? -2.584  3.458   0.758   1.00 0.00 ? 33  ARG A N    2  
ATOM   1474  C  CA   . ARG A 1 33 ? -1.259  4.047   0.909   1.00 0.00 ? 33  ARG A CA   2  
ATOM   1475  C  C    . ARG A 1 33 ? -0.208  2.968   1.149   1.00 0.00 ? 33  ARG A C    2  
ATOM   1476  O  O    . ARG A 1 33 ? -0.538  1.800   1.357   1.00 0.00 ? 33  ARG A O    2  
ATOM   1477  C  CB   . ARG A 1 33 ? -1.251  5.049   2.065   1.00 0.00 ? 33  ARG A CB   2  
ATOM   1478  C  CG   . ARG A 1 33 ? -2.327  6.117   1.954   1.00 0.00 ? 33  ARG A CG   2  
ATOM   1479  C  CD   . ARG A 1 33 ? -2.141  7.206   2.998   1.00 0.00 ? 33  ARG A CD   2  
ATOM   1480  N  NE   . ARG A 1 33 ? -1.337  8.316   2.494   1.00 0.00 ? 33  ARG A NE   2  
ATOM   1481  C  CZ   . ARG A 1 33 ? -0.707  9.183   3.279   1.00 0.00 ? 33  ARG A CZ   2  
ATOM   1482  N  NH1  . ARG A 1 33 ? -0.787  9.069   4.597   1.00 0.00 ? 33  ARG A NH1  2  
ATOM   1483  N  NH2  . ARG A 1 33 ? 0.005   10.167  2.745   1.00 0.00 ? 33  ARG A NH2  2  
ATOM   1484  H  H    . ARG A 1 33 ? -2.935  2.884   1.471   1.00 0.00 ? 33  ARG A H    2  
ATOM   1485  H  HA   . ARG A 1 33 ? -1.021  4.567   -0.007  1.00 0.00 ? 33  ARG A HA   2  
ATOM   1486  H  HB2  . ARG A 1 33 ? -1.401  4.513   2.991   1.00 0.00 ? 33  ARG A HB2  2  
ATOM   1487  H  HB3  . ARG A 1 33 ? -0.290  5.539   2.094   1.00 0.00 ? 33  ARG A HB3  2  
ATOM   1488  H  HG2  . ARG A 1 33 ? -2.278  6.563   0.971   1.00 0.00 ? 33  ARG A HG2  2  
ATOM   1489  H  HG3  . ARG A 1 33 ? -3.294  5.656   2.094   1.00 0.00 ? 33  ARG A HG3  2  
ATOM   1490  H  HD2  . ARG A 1 33 ? -3.112  7.580   3.286   1.00 0.00 ? 33  ARG A HD2  2  
ATOM   1491  H  HD3  . ARG A 1 33 ? -1.650  6.780   3.860   1.00 0.00 ? 33  ARG A HD3  2  
ATOM   1492  H  HE   . ARG A 1 33 ? -1.265  8.419   1.522   1.00 0.00 ? 33  ARG A HE   2  
ATOM   1493  H  HH11 . ARG A 1 33 ? -1.322  8.328   5.002   1.00 0.00 ? 33  ARG A HH11 2  
ATOM   1494  H  HH12 . ARG A 1 33 ? -0.311  9.722   5.186   1.00 0.00 ? 33  ARG A HH12 2  
ATOM   1495  H  HH21 . ARG A 1 33 ? 0.068   10.256  1.751   1.00 0.00 ? 33  ARG A HH21 2  
ATOM   1496  H  HH22 . ARG A 1 33 ? 0.479   10.819  3.336   1.00 0.00 ? 33  ARG A HH22 2  
ATOM   1497  N  N    . CYS A 1 34 ? 1.060   3.366   1.119   1.00 0.00 ? 34  CYS A N    2  
ATOM   1498  C  CA   . CYS A 1 34 ? 2.160   2.434   1.333   1.00 0.00 ? 34  CYS A CA   2  
ATOM   1499  C  C    . CYS A 1 34 ? 2.107   1.843   2.739   1.00 0.00 ? 34  CYS A C    2  
ATOM   1500  O  O    . CYS A 1 34 ? 1.360   2.317   3.595   1.00 0.00 ? 34  CYS A O    2  
ATOM   1501  C  CB   . CYS A 1 34 ? 3.501   3.137   1.114   1.00 0.00 ? 34  CYS A CB   2  
ATOM   1502  S  SG   . CYS A 1 34 ? 4.912   2.002   0.917   1.00 0.00 ? 34  CYS A SG   2  
ATOM   1503  H  H    . CYS A 1 34 ? 1.260   4.311   0.949   1.00 0.00 ? 34  CYS A H    2  
ATOM   1504  H  HA   . CYS A 1 34 ? 2.062   1.634   0.615   1.00 0.00 ? 34  CYS A HA   2  
ATOM   1505  H  HB2  . CYS A 1 34 ? 3.440   3.743   0.222   1.00 0.00 ? 34  CYS A HB2  2  
ATOM   1506  H  HB3  . CYS A 1 34 ? 3.707   3.775   1.962   1.00 0.00 ? 34  CYS A HB3  2  
ATOM   1507  N  N    . ASP A 1 35 ? 2.904   0.805   2.968   1.00 0.00 ? 35  ASP A N    2  
ATOM   1508  C  CA   . ASP A 1 35 ? 2.949   0.149   4.270   1.00 0.00 ? 35  ASP A CA   2  
ATOM   1509  C  C    . ASP A 1 35 ? 4.226   0.516   5.019   1.00 0.00 ? 35  ASP A C    2  
ATOM   1510  O  O    . ASP A 1 35 ? 4.420   0.118   6.169   1.00 0.00 ? 35  ASP A O    2  
ATOM   1511  C  CB   . ASP A 1 35 ? 2.860   -1.369  4.103   1.00 0.00 ? 35  ASP A CB   2  
ATOM   1512  C  CG   . ASP A 1 35 ? 2.792   -2.094  5.432   1.00 0.00 ? 35  ASP A CG   2  
ATOM   1513  O  OD1  . ASP A 1 35 ? 1.725   -2.048  6.080   1.00 0.00 ? 35  ASP A OD1  2  
ATOM   1514  O  OD2  . ASP A 1 35 ? 3.806   -2.709  5.824   1.00 0.00 ? 35  ASP A OD2  2  
ATOM   1515  H  H    . ASP A 1 35 ? 3.476   0.473   2.245   1.00 0.00 ? 35  ASP A H    2  
ATOM   1516  H  HA   . ASP A 1 35 ? 2.100   0.489   4.842   1.00 0.00 ? 35  ASP A HA   2  
ATOM   1517  H  HB2  . ASP A 1 35 ? 1.972   -1.611  3.537   1.00 0.00 ? 35  ASP A HB2  2  
ATOM   1518  H  HB3  . ASP A 1 35 ? 3.730   -1.717  3.566   1.00 0.00 ? 35  ASP A HB3  2  
ATOM   1519  N  N    . LEU A 1 36 ? 5.094   1.277   4.362   1.00 0.00 ? 36  LEU A N    2  
ATOM   1520  C  CA   . LEU A 1 36 ? 6.354   1.697   4.965   1.00 0.00 ? 36  LEU A CA   2  
ATOM   1521  C  C    . LEU A 1 36 ? 6.421   3.217   5.081   1.00 0.00 ? 36  LEU A C    2  
ATOM   1522  O  O    . LEU A 1 36 ? 6.995   3.753   6.030   1.00 0.00 ? 36  LEU A O    2  
ATOM   1523  C  CB   . LEU A 1 36 ? 7.534   1.185   4.139   1.00 0.00 ? 36  LEU A CB   2  
ATOM   1524  C  CG   . LEU A 1 36 ? 7.729   -0.332  4.115   1.00 0.00 ? 36  LEU A CG   2  
ATOM   1525  C  CD1  . LEU A 1 36 ? 8.353   -0.769  2.799   1.00 0.00 ? 36  LEU A CD1  2  
ATOM   1526  C  CD2  . LEU A 1 36 ? 8.588   -0.777  5.289   1.00 0.00 ? 36  LEU A CD2  2  
ATOM   1527  H  H    . LEU A 1 36 ? 4.884   1.563   3.449   1.00 0.00 ? 36  LEU A H    2  
ATOM   1528  H  HA   . LEU A 1 36 ? 6.405   1.270   5.955   1.00 0.00 ? 36  LEU A HA   2  
ATOM   1529  H  HB2  . LEU A 1 36 ? 7.394   1.516   3.121   1.00 0.00 ? 36  LEU A HB2  2  
ATOM   1530  H  HB3  . LEU A 1 36 ? 8.435   1.629   4.539   1.00 0.00 ? 36  LEU A HB3  2  
ATOM   1531  H  HG   . LEU A 1 36 ? 6.765   -0.813  4.203   1.00 0.00 ? 36  LEU A HG   2  
ATOM   1532  H  HD11 . LEU A 1 36 ? 8.361   -1.847  2.745   1.00 0.00 ? 36  LEU A HD11 2  
ATOM   1533  H  HD12 . LEU A 1 36 ? 9.366   -0.398  2.740   1.00 0.00 ? 36  LEU A HD12 2  
ATOM   1534  H  HD13 . LEU A 1 36 ? 7.776   -0.371  1.977   1.00 0.00 ? 36  LEU A HD13 2  
ATOM   1535  H  HD21 . LEU A 1 36 ? 8.085   -1.570  5.823   1.00 0.00 ? 36  LEU A HD21 2  
ATOM   1536  H  HD22 . LEU A 1 36 ? 8.749   0.059   5.955   1.00 0.00 ? 36  LEU A HD22 2  
ATOM   1537  H  HD23 . LEU A 1 36 ? 9.539   -1.136  4.924   1.00 0.00 ? 36  LEU A HD23 2  
ATOM   1538  N  N    . CYS A 1 37 ? 5.830   3.906   4.111   1.00 0.00 ? 37  CYS A N    2  
ATOM   1539  C  CA   . CYS A 1 37 ? 5.820   5.364   4.105   1.00 0.00 ? 37  CYS A CA   2  
ATOM   1540  C  C    . CYS A 1 37 ? 4.394   5.898   4.012   1.00 0.00 ? 37  CYS A C    2  
ATOM   1541  O  O    . CYS A 1 37 ? 4.169   7.107   4.070   1.00 0.00 ? 37  CYS A O    2  
ATOM   1542  C  CB   . CYS A 1 37 ? 6.653   5.895   2.936   1.00 0.00 ? 37  CYS A CB   2  
ATOM   1543  S  SG   . CYS A 1 37 ? 5.927   5.569   1.297   1.00 0.00 ? 37  CYS A SG   2  
ATOM   1544  H  H    . CYS A 1 37 ? 5.388   3.422   3.381   1.00 0.00 ? 37  CYS A H    2  
ATOM   1545  H  HA   . CYS A 1 37 ? 6.259   5.703   5.031   1.00 0.00 ? 37  CYS A HA   2  
ATOM   1546  H  HB2  . CYS A 1 37 ? 6.763   6.965   3.039   1.00 0.00 ? 37  CYS A HB2  2  
ATOM   1547  H  HB3  . CYS A 1 37 ? 7.629   5.434   2.961   1.00 0.00 ? 37  CYS A HB3  2  
ATOM   1548  N  N    . GLN A 1 38 ? 3.436   4.989   3.867   1.00 0.00 ? 38  GLN A N    2  
ATOM   1549  C  CA   . GLN A 1 38 ? 2.032   5.369   3.765   1.00 0.00 ? 38  GLN A CA   2  
ATOM   1550  C  C    . GLN A 1 38 ? 1.833   6.437   2.695   1.00 0.00 ? 38  GLN A C    2  
ATOM   1551  O  O    . GLN A 1 38 ? 1.251   7.490   2.956   1.00 0.00 ? 38  GLN A O    2  
ATOM   1552  C  CB   . GLN A 1 38 ? 1.521   5.880   5.114   1.00 0.00 ? 38  GLN A CB   2  
ATOM   1553  C  CG   . GLN A 1 38 ? 1.718   4.893   6.253   1.00 0.00 ? 38  GLN A CG   2  
ATOM   1554  C  CD   . GLN A 1 38 ? 0.523   3.982   6.449   1.00 0.00 ? 38  GLN A CD   2  
ATOM   1555  O  OE1  . GLN A 1 38 ? -0.604  4.446   6.627   1.00 0.00 ? 38  GLN A OE1  2  
ATOM   1556  N  NE2  . GLN A 1 38 ? 0.762   2.676   6.417   1.00 0.00 ? 38  GLN A NE2  2  
ATOM   1557  H  H    . GLN A 1 38 ? 3.678   4.041   3.827   1.00 0.00 ? 38  GLN A H    2  
ATOM   1558  H  HA   . GLN A 1 38 ? 1.470   4.490   3.488   1.00 0.00 ? 38  GLN A HA   2  
ATOM   1559  H  HB2  . GLN A 1 38 ? 2.044   6.792   5.361   1.00 0.00 ? 38  GLN A HB2  2  
ATOM   1560  H  HB3  . GLN A 1 38 ? 0.465   6.092   5.029   1.00 0.00 ? 38  GLN A HB3  2  
ATOM   1561  H  HG2  . GLN A 1 38 ? 2.584   4.284   6.039   1.00 0.00 ? 38  GLN A HG2  2  
ATOM   1562  H  HG3  . GLN A 1 38 ? 1.885   5.446   7.166   1.00 0.00 ? 38  GLN A HG3  2  
ATOM   1563  H  HE21 . GLN A 1 38 ? 1.685   2.378   6.272   1.00 0.00 ? 38  GLN A HE21 2  
ATOM   1564  H  HE22 . GLN A 1 38 ? 0.008   2.064   6.542   1.00 0.00 ? 38  GLN A HE22 2  
ATOM   1565  N  N    . GLU A 1 39 ? 2.320   6.159   1.490   1.00 0.00 ? 39  GLU A N    2  
ATOM   1566  C  CA   . GLU A 1 39 ? 2.197   7.097   0.381   1.00 0.00 ? 39  GLU A CA   2  
ATOM   1567  C  C    . GLU A 1 39 ? 1.082   6.672   -0.570  1.00 0.00 ? 39  GLU A C    2  
ATOM   1568  O  O    . GLU A 1 39 ? 1.038   5.527   -1.020  1.00 0.00 ? 39  GLU A O    2  
ATOM   1569  C  CB   . GLU A 1 39 ? 3.520   7.199   -0.380  1.00 0.00 ? 39  GLU A CB   2  
ATOM   1570  C  CG   . GLU A 1 39 ? 3.416   7.975   -1.682  1.00 0.00 ? 39  GLU A CG   2  
ATOM   1571  C  CD   . GLU A 1 39 ? 4.748   8.542   -2.132  1.00 0.00 ? 39  GLU A CD   2  
ATOM   1572  O  OE1  . GLU A 1 39 ? 5.565   8.904   -1.260  1.00 0.00 ? 39  GLU A OE1  2  
ATOM   1573  O  OE2  . GLU A 1 39 ? 4.974   8.623   -3.358  1.00 0.00 ? 39  GLU A OE2  2  
ATOM   1574  H  H    . GLU A 1 39 ? 2.774   5.303   1.344   1.00 0.00 ? 39  GLU A H    2  
ATOM   1575  H  HA   . GLU A 1 39 ? 1.953   8.065   0.792   1.00 0.00 ? 39  GLU A HA   2  
ATOM   1576  H  HB2  . GLU A 1 39 ? 4.248   7.689   0.250   1.00 0.00 ? 39  GLU A HB2  2  
ATOM   1577  H  HB3  . GLU A 1 39 ? 3.868   6.202   -0.607  1.00 0.00 ? 39  GLU A HB3  2  
ATOM   1578  H  HG2  . GLU A 1 39 ? 3.045   7.315   -2.451  1.00 0.00 ? 39  GLU A HG2  2  
ATOM   1579  H  HG3  . GLU A 1 39 ? 2.722   8.792   -1.545  1.00 0.00 ? 39  GLU A HG3  2  
ATOM   1580  N  N    . VAL A 1 40 ? 0.182   7.602   -0.871  1.00 0.00 ? 40  VAL A N    2  
ATOM   1581  C  CA   . VAL A 1 40 ? -0.933  7.325   -1.769  1.00 0.00 ? 40  VAL A CA   2  
ATOM   1582  C  C    . VAL A 1 40 ? -0.475  6.528   -2.985  1.00 0.00 ? 40  VAL A C    2  
ATOM   1583  O  O    . VAL A 1 40 ? 0.277   7.029   -3.822  1.00 0.00 ? 40  VAL A O    2  
ATOM   1584  C  CB   . VAL A 1 40 ? -1.607  8.626   -2.245  1.00 0.00 ? 40  VAL A CB   2  
ATOM   1585  C  CG1  . VAL A 1 40 ? -2.782  8.315   -3.160  1.00 0.00 ? 40  VAL A CG1  2  
ATOM   1586  C  CG2  . VAL A 1 40 ? -2.054  9.460   -1.055  1.00 0.00 ? 40  VAL A CG2  2  
ATOM   1587  H  H    . VAL A 1 40 ? 0.270   8.497   -0.481  1.00 0.00 ? 40  VAL A H    2  
ATOM   1588  H  HA   . VAL A 1 40 ? -1.664  6.745   -1.224  1.00 0.00 ? 40  VAL A HA   2  
ATOM   1589  H  HB   . VAL A 1 40 ? -0.883  9.197   -2.807  1.00 0.00 ? 40  VAL A HB   2  
ATOM   1590  H  HG11 . VAL A 1 40 ? -3.067  9.209   -3.695  1.00 0.00 ? 40  VAL A HG11 2  
ATOM   1591  H  HG12 . VAL A 1 40 ? -2.496  7.547   -3.865  1.00 0.00 ? 40  VAL A HG12 2  
ATOM   1592  H  HG13 . VAL A 1 40 ? -3.617  7.969   -2.569  1.00 0.00 ? 40  VAL A HG13 2  
ATOM   1593  H  HG21 . VAL A 1 40 ? -2.802  8.917   -0.496  1.00 0.00 ? 40  VAL A HG21 2  
ATOM   1594  H  HG22 . VAL A 1 40 ? -1.206  9.664   -0.418  1.00 0.00 ? 40  VAL A HG22 2  
ATOM   1595  H  HG23 . VAL A 1 40 ? -2.472  10.392  -1.405  1.00 0.00 ? 40  VAL A HG23 2  
ATOM   1596  N  N    . LEU A 1 41 ? -0.933  5.285   -3.077  1.00 0.00 ? 41  LEU A N    2  
ATOM   1597  C  CA   . LEU A 1 41 ? -0.571  4.417   -4.192  1.00 0.00 ? 41  LEU A CA   2  
ATOM   1598  C  C    . LEU A 1 41 ? -1.714  4.315   -5.197  1.00 0.00 ? 41  LEU A C    2  
ATOM   1599  O  O    . LEU A 1 41 ? -2.080  3.222   -5.628  1.00 0.00 ? 41  LEU A O    2  
ATOM   1600  C  CB   . LEU A 1 41 ? -0.201  3.023   -3.681  1.00 0.00 ? 41  LEU A CB   2  
ATOM   1601  C  CG   . LEU A 1 41 ? 0.464   2.968   -2.305  1.00 0.00 ? 41  LEU A CG   2  
ATOM   1602  C  CD1  . LEU A 1 41 ? 0.283   1.594   -1.679  1.00 0.00 ? 41  LEU A CD1  2  
ATOM   1603  C  CD2  . LEU A 1 41 ? 1.941   3.317   -2.412  1.00 0.00 ? 41  LEU A CD2  2  
ATOM   1604  H  H    . LEU A 1 41 ? -1.529  4.941   -2.380  1.00 0.00 ? 41  LEU A H    2  
ATOM   1605  H  HA   . LEU A 1 41 ? 0.287   4.850   -4.684  1.00 0.00 ? 41  LEU A HA   2  
ATOM   1606  H  HB2  . LEU A 1 41 ? -1.106  2.438   -3.634  1.00 0.00 ? 41  LEU A HB2  2  
ATOM   1607  H  HB3  . LEU A 1 41 ? 0.477   2.579   -4.395  1.00 0.00 ? 41  LEU A HB3  2  
ATOM   1608  H  HG   . LEU A 1 41 ? -0.006  3.694   -1.656  1.00 0.00 ? 41  LEU A HG   2  
ATOM   1609  H  HD11 . LEU A 1 41 ? -0.460  1.649   -0.898  1.00 0.00 ? 41  LEU A HD11 2  
ATOM   1610  H  HD12 . LEU A 1 41 ? 1.222   1.263   -1.261  1.00 0.00 ? 41  LEU A HD12 2  
ATOM   1611  H  HD13 . LEU A 1 41 ? -0.039  0.894   -2.436  1.00 0.00 ? 41  LEU A HD13 2  
ATOM   1612  H  HD21 . LEU A 1 41 ? 2.366   3.393   -1.422  1.00 0.00 ? 41  LEU A HD21 2  
ATOM   1613  H  HD22 . LEU A 1 41 ? 2.051   4.263   -2.924  1.00 0.00 ? 41  LEU A HD22 2  
ATOM   1614  H  HD23 . LEU A 1 41 ? 2.454   2.546   -2.966  1.00 0.00 ? 41  LEU A HD23 2  
ATOM   1615  N  N    . ALA A 1 42 ? -2.273  5.463   -5.568  1.00 0.00 ? 42  ALA A N    2  
ATOM   1616  C  CA   . ALA A 1 42 ? -3.371  5.503   -6.525  1.00 0.00 ? 42  ALA A CA   2  
ATOM   1617  C  C    . ALA A 1 42 ? -2.871  5.864   -7.920  1.00 0.00 ? 42  ALA A C    2  
ATOM   1618  O  O    . ALA A 1 42 ? -3.145  5.157   -8.890  1.00 0.00 ? 42  ALA A O    2  
ATOM   1619  C  CB   . ALA A 1 42 ? -4.431  6.495   -6.070  1.00 0.00 ? 42  ALA A CB   2  
ATOM   1620  H  H    . ALA A 1 42 ? -1.937  6.302   -5.190  1.00 0.00 ? 42  ALA A H    2  
ATOM   1621  H  HA   . ALA A 1 42 ? -3.821  4.521   -6.558  1.00 0.00 ? 42  ALA A HA   2  
ATOM   1622  H  HB1  . ALA A 1 42 ? -5.264  5.957   -5.640  1.00 0.00 ? 42  ALA A HB1  2  
ATOM   1623  H  HB2  . ALA A 1 42 ? -4.010  7.158   -5.330  1.00 0.00 ? 42  ALA A HB2  2  
ATOM   1624  H  HB3  . ALA A 1 42 ? -4.773  7.070   -6.917  1.00 0.00 ? 42  ALA A HB3  2  
ATOM   1625  N  N    . ASP A 1 43 ? -2.137  6.968   -8.013  1.00 0.00 ? 43  ASP A N    2  
ATOM   1626  C  CA   . ASP A 1 43 ? -1.598  7.422   -9.289  1.00 0.00 ? 43  ASP A CA   2  
ATOM   1627  C  C    . ASP A 1 43 ? -0.194  6.869   -9.515  1.00 0.00 ? 43  ASP A C    2  
ATOM   1628  O  O    . ASP A 1 43 ? 0.159   6.482   -10.629 1.00 0.00 ? 43  ASP A O    2  
ATOM   1629  C  CB   . ASP A 1 43 ? -1.572  8.951   -9.341  1.00 0.00 ? 43  ASP A CB   2  
ATOM   1630  C  CG   . ASP A 1 43 ? -1.723  9.485   -10.752 1.00 0.00 ? 43  ASP A CG   2  
ATOM   1631  O  OD1  . ASP A 1 43 ? -2.875  9.618   -11.216 1.00 0.00 ? 43  ASP A OD1  2  
ATOM   1632  O  OD2  . ASP A 1 43 ? -0.689  9.771   -11.391 1.00 0.00 ? 43  ASP A OD2  2  
ATOM   1633  H  H    . ASP A 1 43 ? -1.953  7.489   -7.203  1.00 0.00 ? 43  ASP A H    2  
ATOM   1634  H  HA   . ASP A 1 43 ? -2.245  7.056   -10.072 1.00 0.00 ? 43  ASP A HA   2  
ATOM   1635  H  HB2  . ASP A 1 43 ? -2.382  9.339   -8.740  1.00 0.00 ? 43  ASP A HB2  2  
ATOM   1636  H  HB3  . ASP A 1 43 ? -0.632  9.302   -8.941  1.00 0.00 ? 43  ASP A HB3  2  
ATOM   1637  N  N    . ILE A 1 44 ? 0.601   6.836   -8.450  1.00 0.00 ? 44  ILE A N    2  
ATOM   1638  C  CA   . ILE A 1 44 ? 1.965   6.331   -8.533  1.00 0.00 ? 44  ILE A CA   2  
ATOM   1639  C  C    . ILE A 1 44 ? 1.982   4.812   -8.670  1.00 0.00 ? 44  ILE A C    2  
ATOM   1640  O  O    . ILE A 1 44 ? 2.915   4.239   -9.230  1.00 0.00 ? 44  ILE A O    2  
ATOM   1641  C  CB   . ILE A 1 44 ? 2.790   6.732   -7.295  1.00 0.00 ? 44  ILE A CB   2  
ATOM   1642  C  CG1  . ILE A 1 44 ? 2.162   6.151   -6.027  1.00 0.00 ? 44  ILE A CG1  2  
ATOM   1643  C  CG2  . ILE A 1 44 ? 2.893   8.247   -7.196  1.00 0.00 ? 44  ILE A CG2  2  
ATOM   1644  C  CD1  . ILE A 1 44 ? 3.124   6.059   -4.863  1.00 0.00 ? 44  ILE A CD1  2  
ATOM   1645  H  H    . ILE A 1 44 ? 0.262   7.159   -7.590  1.00 0.00 ? 44  ILE A H    2  
ATOM   1646  H  HA   . ILE A 1 44 ? 2.430   6.766   -9.406  1.00 0.00 ? 44  ILE A HA   2  
ATOM   1647  H  HB   . ILE A 1 44 ? 3.786   6.334   -7.410  1.00 0.00 ? 44  ILE A HB   2  
ATOM   1648  H  HG12 . ILE A 1 44 ? 1.335   6.774   -5.724  1.00 0.00 ? 44  ILE A HG12 2  
ATOM   1649  H  HG13 . ILE A 1 44 ? 1.799   5.156   -6.237  1.00 0.00 ? 44  ILE A HG13 2  
ATOM   1650  H  HG21 . ILE A 1 44 ? 3.922   8.527   -7.028  1.00 0.00 ? 44  ILE A HG21 2  
ATOM   1651  H  HG22 . ILE A 1 44 ? 2.545   8.692   -8.116  1.00 0.00 ? 44  ILE A HG22 2  
ATOM   1652  H  HG23 . ILE A 1 44 ? 2.286   8.596   -6.374  1.00 0.00 ? 44  ILE A HG23 2  
ATOM   1653  H  HD11 . ILE A 1 44 ? 3.802   6.900   -4.889  1.00 0.00 ? 44  ILE A HD11 2  
ATOM   1654  H  HD12 . ILE A 1 44 ? 2.572   6.069   -3.936  1.00 0.00 ? 44  ILE A HD12 2  
ATOM   1655  H  HD13 . ILE A 1 44 ? 3.689   5.141   -4.935  1.00 0.00 ? 44  ILE A HD13 2  
ATOM   1656  N  N    . GLY A 1 45 ? 0.940   4.166   -8.156  1.00 0.00 ? 45  GLY A N    2  
ATOM   1657  C  CA   . GLY A 1 45 ? 0.853   2.719   -8.233  1.00 0.00 ? 45  GLY A CA   2  
ATOM   1658  C  C    . GLY A 1 45 ? 1.443   2.037   -7.014  1.00 0.00 ? 45  GLY A C    2  
ATOM   1659  O  O    . GLY A 1 45 ? 2.140   2.667   -6.218  1.00 0.00 ? 45  GLY A O    2  
ATOM   1660  H  H    . GLY A 1 45 ? 0.224   4.675   -7.721  1.00 0.00 ? 45  GLY A H    2  
ATOM   1661  H  HA2  . GLY A 1 45 ? -0.185  2.436   -8.324  1.00 0.00 ? 45  GLY A HA2  2  
ATOM   1662  H  HA3  . GLY A 1 45 ? 1.385   2.384   -9.111  1.00 0.00 ? 45  GLY A HA3  2  
ATOM   1663  N  N    . PHE A 1 46 ? 1.162   0.747   -6.866  1.00 0.00 ? 46  PHE A N    2  
ATOM   1664  C  CA   . PHE A 1 46 ? 1.667   -0.021  -5.733  1.00 0.00 ? 46  PHE A CA   2  
ATOM   1665  C  C    . PHE A 1 46 ? 2.383   -1.282  -6.207  1.00 0.00 ? 46  PHE A C    2  
ATOM   1666  O  O    . PHE A 1 46 ? 2.345   -1.624  -7.390  1.00 0.00 ? 46  PHE A O    2  
ATOM   1667  C  CB   . PHE A 1 46 ? 0.521   -0.394  -4.791  1.00 0.00 ? 46  PHE A CB   2  
ATOM   1668  C  CG   . PHE A 1 46 ? -0.475  -1.337  -5.403  1.00 0.00 ? 46  PHE A CG   2  
ATOM   1669  C  CD1  . PHE A 1 46 ? -1.397  -0.884  -6.334  1.00 0.00 ? 46  PHE A CD1  2  
ATOM   1670  C  CD2  . PHE A 1 46 ? -0.491  -2.676  -5.048  1.00 0.00 ? 46  PHE A CD2  2  
ATOM   1671  C  CE1  . PHE A 1 46 ? -2.315  -1.749  -6.899  1.00 0.00 ? 46  PHE A CE1  2  
ATOM   1672  C  CE2  . PHE A 1 46 ? -1.406  -3.545  -5.610  1.00 0.00 ? 46  PHE A CE2  2  
ATOM   1673  C  CZ   . PHE A 1 46 ? -2.320  -3.081  -6.536  1.00 0.00 ? 46  PHE A CZ   2  
ATOM   1674  H  H    . PHE A 1 46 ? 0.600   0.300   -7.534  1.00 0.00 ? 46  PHE A H    2  
ATOM   1675  H  HA   . PHE A 1 46 ? 2.371   0.600   -5.201  1.00 0.00 ? 46  PHE A HA   2  
ATOM   1676  H  HB2  . PHE A 1 46 ? 0.928   -0.868  -3.911  1.00 0.00 ? 46  PHE A HB2  2  
ATOM   1677  H  HB3  . PHE A 1 46 ? -0.004  0.504   -4.501  1.00 0.00 ? 46  PHE A HB3  2  
ATOM   1678  H  HD1  . PHE A 1 46 ? -1.393  0.159   -6.619  1.00 0.00 ? 46  PHE A HD1  2  
ATOM   1679  H  HD2  . PHE A 1 46 ? 0.222   -3.040  -4.323  1.00 0.00 ? 46  PHE A HD2  2  
ATOM   1680  H  HE1  . PHE A 1 46 ? -3.027  -1.382  -7.623  1.00 0.00 ? 46  PHE A HE1  2  
ATOM   1681  H  HE2  . PHE A 1 46 ? -1.409  -4.587  -5.324  1.00 0.00 ? 46  PHE A HE2  2  
ATOM   1682  H  HZ   . PHE A 1 46 ? -3.036  -3.759  -6.977  1.00 0.00 ? 46  PHE A HZ   2  
ATOM   1683  N  N    . VAL A 1 47 ? 3.034   -1.971  -5.276  1.00 0.00 ? 47  VAL A N    2  
ATOM   1684  C  CA   . VAL A 1 47 ? 3.759   -3.195  -5.597  1.00 0.00 ? 47  VAL A CA   2  
ATOM   1685  C  C    . VAL A 1 47 ? 3.514   -4.270  -4.544  1.00 0.00 ? 47  VAL A C    2  
ATOM   1686  O  O    . VAL A 1 47 ? 4.054   -4.208  -3.439  1.00 0.00 ? 47  VAL A O    2  
ATOM   1687  C  CB   . VAL A 1 47 ? 5.273   -2.938  -5.710  1.00 0.00 ? 47  VAL A CB   2  
ATOM   1688  C  CG1  . VAL A 1 47 ? 5.996   -4.197  -6.163  1.00 0.00 ? 47  VAL A CG1  2  
ATOM   1689  C  CG2  . VAL A 1 47 ? 5.548   -1.784  -6.662  1.00 0.00 ? 47  VAL A CG2  2  
ATOM   1690  H  H    . VAL A 1 47 ? 3.028   -1.648  -4.351  1.00 0.00 ? 47  VAL A H    2  
ATOM   1691  H  HA   . VAL A 1 47 ? 3.403   -3.553  -6.552  1.00 0.00 ? 47  VAL A HA   2  
ATOM   1692  H  HB   . VAL A 1 47 ? 5.646   -2.667  -4.733  1.00 0.00 ? 47  VAL A HB   2  
ATOM   1693  H  HG11 . VAL A 1 47 ? 6.671   -4.523  -5.386  1.00 0.00 ? 47  VAL A HG11 2  
ATOM   1694  H  HG12 . VAL A 1 47 ? 5.274   -4.975  -6.364  1.00 0.00 ? 47  VAL A HG12 2  
ATOM   1695  H  HG13 . VAL A 1 47 ? 6.558   -3.986  -7.061  1.00 0.00 ? 47  VAL A HG13 2  
ATOM   1696  H  HG21 . VAL A 1 47 ? 6.470   -1.298  -6.381  1.00 0.00 ? 47  VAL A HG21 2  
ATOM   1697  H  HG22 . VAL A 1 47 ? 5.632   -2.161  -7.671  1.00 0.00 ? 47  VAL A HG22 2  
ATOM   1698  H  HG23 . VAL A 1 47 ? 4.736   -1.073  -6.611  1.00 0.00 ? 47  VAL A HG23 2  
ATOM   1699  N  N    . LYS A 1 48 ? 2.696   -5.258  -4.894  1.00 0.00 ? 48  LYS A N    2  
ATOM   1700  C  CA   . LYS A 1 48 ? 2.380   -6.350  -3.981  1.00 0.00 ? 48  LYS A CA   2  
ATOM   1701  C  C    . LYS A 1 48 ? 3.651   -7.048  -3.507  1.00 0.00 ? 48  LYS A C    2  
ATOM   1702  O  O    . LYS A 1 48 ? 4.368   -7.655  -4.300  1.00 0.00 ? 48  LYS A O    2  
ATOM   1703  C  CB   . LYS A 1 48 ? 1.454   -7.359  -4.663  1.00 0.00 ? 48  LYS A CB   2  
ATOM   1704  C  CG   . LYS A 1 48 ? -0.022  -7.088  -4.426  1.00 0.00 ? 48  LYS A CG   2  
ATOM   1705  C  CD   . LYS A 1 48 ? -0.424  -7.406  -2.995  1.00 0.00 ? 48  LYS A CD   2  
ATOM   1706  C  CE   . LYS A 1 48 ? -0.737  -8.884  -2.820  1.00 0.00 ? 48  LYS A CE   2  
ATOM   1707  N  NZ   . LYS A 1 48 ? -2.100  -9.225  -3.315  1.00 0.00 ? 48  LYS A NZ   2  
ATOM   1708  H  H    . LYS A 1 48 ? 2.296   -5.252  -5.789  1.00 0.00 ? 48  LYS A H    2  
ATOM   1709  H  HA   . LYS A 1 48 ? 1.874   -5.930  -3.125  1.00 0.00 ? 48  LYS A HA   2  
ATOM   1710  H  HB2  . LYS A 1 48 ? 1.637   -7.336  -5.727  1.00 0.00 ? 48  LYS A HB2  2  
ATOM   1711  H  HB3  . LYS A 1 48 ? 1.681   -8.348  -4.289  1.00 0.00 ? 48  LYS A HB3  2  
ATOM   1712  H  HG2  . LYS A 1 48 ? -0.223  -6.045  -4.621  1.00 0.00 ? 48  LYS A HG2  2  
ATOM   1713  H  HG3  . LYS A 1 48 ? -0.604  -7.701  -5.099  1.00 0.00 ? 48  LYS A HG3  2  
ATOM   1714  H  HD2  . LYS A 1 48 ? 0.387   -7.141  -2.334  1.00 0.00 ? 48  LYS A HD2  2  
ATOM   1715  H  HD3  . LYS A 1 48 ? -1.302  -6.828  -2.741  1.00 0.00 ? 48  LYS A HD3  2  
ATOM   1716  H  HE2  . LYS A 1 48 ? -0.009  -9.460  -3.369  1.00 0.00 ? 48  LYS A HE2  2  
ATOM   1717  H  HE3  . LYS A 1 48 ? -0.673  -9.130  -1.770  1.00 0.00 ? 48  LYS A HE3  2  
ATOM   1718  H  HZ1  . LYS A 1 48 ? -2.720  -8.392  -3.256  1.00 0.00 ? 48  LYS A HZ1  2  
ATOM   1719  H  HZ2  . LYS A 1 48 ? -2.508  -9.988  -2.739  1.00 0.00 ? 48  LYS A HZ2  2  
ATOM   1720  H  HZ3  . LYS A 1 48 ? -2.052  -9.539  -4.305  1.00 0.00 ? 48  LYS A HZ3  2  
ATOM   1721  N  N    . ASN A 1 49 ? 3.921   -6.958  -2.209  1.00 0.00 ? 49  ASN A N    2  
ATOM   1722  C  CA   . ASN A 1 49 ? 5.105   -7.583  -1.630  1.00 0.00 ? 49  ASN A CA   2  
ATOM   1723  C  C    . ASN A 1 49 ? 4.813   -8.104  -0.226  1.00 0.00 ? 49  ASN A C    2  
ATOM   1724  O  O    . ASN A 1 49 ? 4.192   -7.418  0.585   1.00 0.00 ? 49  ASN A O    2  
ATOM   1725  C  CB   . ASN A 1 49 ? 6.263   -6.584  -1.585  1.00 0.00 ? 49  ASN A CB   2  
ATOM   1726  C  CG   . ASN A 1 49 ? 7.616   -7.269  -1.575  1.00 0.00 ? 49  ASN A CG   2  
ATOM   1727  O  OD1  . ASN A 1 49 ? 7.783   -8.349  -2.142  1.00 0.00 ? 49  ASN A OD1  2  
ATOM   1728  N  ND2  . ASN A 1 49 ? 8.592   -6.642  -0.928  1.00 0.00 ? 49  ASN A ND2  2  
ATOM   1729  H  H    . ASN A 1 49 ? 3.310   -6.460  -1.627  1.00 0.00 ? 49  ASN A H    2  
ATOM   1730  H  HA   . ASN A 1 49 ? 5.382   -8.414  -2.260  1.00 0.00 ? 49  ASN A HA   2  
ATOM   1731  H  HB2  . ASN A 1 49 ? 6.212   -5.944  -2.454  1.00 0.00 ? 49  ASN A HB2  2  
ATOM   1732  H  HB3  . ASN A 1 49 ? 6.178   -5.982  -0.693  1.00 0.00 ? 49  ASN A HB3  2  
ATOM   1733  H  HD21 . ASN A 1 49 ? 8.387   -5.784  -0.499  1.00 0.00 ? 49  ASN A HD21 2  
ATOM   1734  H  HD22 . ASN A 1 49 ? 9.477   -7.061  -0.906  1.00 0.00 ? 49  ASN A HD22 2  
ATOM   1735  N  N    . ALA A 1 50 ? 5.267   -9.321  0.053   1.00 0.00 ? 50  ALA A N    2  
ATOM   1736  C  CA   . ALA A 1 50 ? 5.057   -9.934  1.359   1.00 0.00 ? 50  ALA A CA   2  
ATOM   1737  C  C    . ALA A 1 50 ? 3.627   -9.720  1.843   1.00 0.00 ? 50  ALA A C    2  
ATOM   1738  O  O    . ALA A 1 50 ? 3.381   -9.566  3.038   1.00 0.00 ? 50  ALA A O    2  
ATOM   1739  C  CB   . ALA A 1 50 ? 6.047   -9.373  2.370   1.00 0.00 ? 50  ALA A CB   2  
ATOM   1740  H  H    . ALA A 1 50 ? 5.755   -9.819  -0.635  1.00 0.00 ? 50  ALA A H    2  
ATOM   1741  H  HA   . ALA A 1 50 ? 5.240   -10.994 1.264   1.00 0.00 ? 50  ALA A HA   2  
ATOM   1742  H  HB1  . ALA A 1 50 ? 6.247   -10.117 3.127   1.00 0.00 ? 50  ALA A HB1  2  
ATOM   1743  H  HB2  . ALA A 1 50 ? 6.967   -9.114  1.867   1.00 0.00 ? 50  ALA A HB2  2  
ATOM   1744  H  HB3  . ALA A 1 50 ? 5.628   -8.492  2.832   1.00 0.00 ? 50  ALA A HB3  2  
ATOM   1745  N  N    . GLY A 1 51 ? 2.685   -9.711  0.904   1.00 0.00 ? 51  GLY A N    2  
ATOM   1746  C  CA   . GLY A 1 51 ? 1.290   -9.515  1.254   1.00 0.00 ? 51  GLY A CA   2  
ATOM   1747  C  C    . GLY A 1 51 ? 1.015   -8.119  1.777   1.00 0.00 ? 51  GLY A C    2  
ATOM   1748  O  O    . GLY A 1 51 ? 0.170   -7.932  2.653   1.00 0.00 ? 51  GLY A O    2  
ATOM   1749  H  H    . GLY A 1 51 ? 2.939   -9.839  -0.034  1.00 0.00 ? 51  GLY A H    2  
ATOM   1750  H  HA2  . GLY A 1 51 ? 0.683   -9.687  0.379   1.00 0.00 ? 51  GLY A HA2  2  
ATOM   1751  H  HA3  . GLY A 1 51 ? 1.018   -10.231 2.016   1.00 0.00 ? 51  GLY A HA3  2  
ATOM   1752  N  N    . ARG A 1 52 ? 1.730   -7.136  1.239   1.00 0.00 ? 52  ARG A N    2  
ATOM   1753  C  CA   . ARG A 1 52 ? 1.560   -5.750  1.658   1.00 0.00 ? 52  ARG A CA   2  
ATOM   1754  C  C    . ARG A 1 52 ? 1.677   -4.803  0.467   1.00 0.00 ? 52  ARG A C    2  
ATOM   1755  O  O    . ARG A 1 52 ? 2.479   -5.027  -0.440  1.00 0.00 ? 52  ARG A O    2  
ATOM   1756  C  CB   . ARG A 1 52 ? 2.601   -5.384  2.718   1.00 0.00 ? 52  ARG A CB   2  
ATOM   1757  C  CG   . ARG A 1 52 ? 2.545   -6.265  3.956   1.00 0.00 ? 52  ARG A CG   2  
ATOM   1758  C  CD   . ARG A 1 52 ? 3.796   -6.111  4.806   1.00 0.00 ? 52  ARG A CD   2  
ATOM   1759  N  NE   . ARG A 1 52 ? 3.959   -7.217  5.746   1.00 0.00 ? 52  ARG A NE   2  
ATOM   1760  C  CZ   . ARG A 1 52 ? 4.658   -7.128  6.872   1.00 0.00 ? 52  ARG A CZ   2  
ATOM   1761  N  NH1  . ARG A 1 52 ? 5.257   -5.990  7.196   1.00 0.00 ? 52  ARG A NH1  2  
ATOM   1762  N  NH2  . ARG A 1 52 ? 4.760   -8.179  7.676   1.00 0.00 ? 52  ARG A NH2  2  
ATOM   1763  H  H    . ARG A 1 52 ? 2.388   -7.348  0.544   1.00 0.00 ? 52  ARG A H    2  
ATOM   1764  H  HA   . ARG A 1 52 ? 0.574   -5.651  2.086   1.00 0.00 ? 52  ARG A HA   2  
ATOM   1765  H  HB2  . ARG A 1 52 ? 3.586   -5.474  2.285   1.00 0.00 ? 52  ARG A HB2  2  
ATOM   1766  H  HB3  . ARG A 1 52 ? 2.442   -4.361  3.023   1.00 0.00 ? 52  ARG A HB3  2  
ATOM   1767  H  HG2  . ARG A 1 52 ? 1.685   -5.985  4.547   1.00 0.00 ? 52  ARG A HG2  2  
ATOM   1768  H  HG3  . ARG A 1 52 ? 2.453   -7.296  3.649   1.00 0.00 ? 52  ARG A HG3  2  
ATOM   1769  H  HD2  . ARG A 1 52 ? 4.656   -6.076  4.154   1.00 0.00 ? 52  ARG A HD2  2  
ATOM   1770  H  HD3  . ARG A 1 52 ? 3.727   -5.187  5.360   1.00 0.00 ? 52  ARG A HD3  2  
ATOM   1771  H  HE   . ARG A 1 52 ? 3.525   -8.067  5.526   1.00 0.00 ? 52  ARG A HE   2  
ATOM   1772  H  HH11 . ARG A 1 52 ? 5.181   -5.197  6.592   1.00 0.00 ? 52  ARG A HH11 2  
ATOM   1773  H  HH12 . ARG A 1 52 ? 5.782   -5.926  8.045   1.00 0.00 ? 52  ARG A HH12 2  
ATOM   1774  H  HH21 . ARG A 1 52 ? 4.310   -9.038  7.435   1.00 0.00 ? 52  ARG A HH21 2  
ATOM   1775  H  HH22 . ARG A 1 52 ? 5.287   -8.111  8.523   1.00 0.00 ? 52  ARG A HH22 2  
ATOM   1776  N  N    . HIS A 1 53 ? 0.871   -3.746  0.477   1.00 0.00 ? 53  HIS A N    2  
ATOM   1777  C  CA   . HIS A 1 53 ? 0.885   -2.765  -0.602  1.00 0.00 ? 53  HIS A CA   2  
ATOM   1778  C  C    . HIS A 1 53 ? 1.956   -1.706  -0.361  1.00 0.00 ? 53  HIS A C    2  
ATOM   1779  O  O    . HIS A 1 53 ? 1.825   -0.867  0.531   1.00 0.00 ? 53  HIS A O    2  
ATOM   1780  C  CB   . HIS A 1 53 ? -0.486  -2.100  -0.732  1.00 0.00 ? 53  HIS A CB   2  
ATOM   1781  C  CG   . HIS A 1 53 ? -1.063  -1.657  0.577   1.00 0.00 ? 53  HIS A CG   2  
ATOM   1782  N  ND1  . HIS A 1 53 ? -2.359  -1.205  0.714   1.00 0.00 ? 53  HIS A ND1  2  
ATOM   1783  C  CD2  . HIS A 1 53 ? -0.514  -1.601  1.813   1.00 0.00 ? 53  HIS A CD2  2  
ATOM   1784  C  CE1  . HIS A 1 53 ? -2.581  -0.888  1.977   1.00 0.00 ? 53  HIS A CE1  2  
ATOM   1785  N  NE2  . HIS A 1 53 ? -1.478  -1.120  2.665   1.00 0.00 ? 53  HIS A NE2  2  
ATOM   1786  H  H    . HIS A 1 53 ? 0.254   -3.623  1.228   1.00 0.00 ? 53  HIS A H    2  
ATOM   1787  H  HA   . HIS A 1 53 ? 1.111   -3.286  -1.521  1.00 0.00 ? 53  HIS A HA   2  
ATOM   1788  H  HB2  . HIS A 1 53 ? -0.398  -1.230  -1.366  1.00 0.00 ? 53  HIS A HB2  2  
ATOM   1789  H  HB3  . HIS A 1 53 ? -1.177  -2.799  -1.181  1.00 0.00 ? 53  HIS A HB3  2  
ATOM   1790  H  HD1  . HIS A 1 53 ? -3.017  -1.126  -0.008  1.00 0.00 ? 53  HIS A HD1  2  
ATOM   1791  H  HD2  . HIS A 1 53 ? 0.495   -1.882  2.080   1.00 0.00 ? 53  HIS A HD2  2  
ATOM   1792  H  HE1  . HIS A 1 53 ? -3.507  -0.505  2.379   1.00 0.00 ? 53  HIS A HE1  2  
ATOM   1793  H  HE2  . HIS A 1 53 ? -1.342  -0.890  3.608   1.00 0.00 ? 53  HIS A HE2  2  
ATOM   1794  N  N    . LEU A 1 54 ? 3.017   -1.752  -1.160  1.00 0.00 ? 54  LEU A N    2  
ATOM   1795  C  CA   . LEU A 1 54 ? 4.112   -0.797  -1.033  1.00 0.00 ? 54  LEU A CA   2  
ATOM   1796  C  C    . LEU A 1 54 ? 4.262   0.032   -2.305  1.00 0.00 ? 54  LEU A C    2  
ATOM   1797  O  O    . LEU A 1 54 ? 3.653   -0.271  -3.331  1.00 0.00 ? 54  LEU A O    2  
ATOM   1798  C  CB   . LEU A 1 54 ? 5.421   -1.529  -0.731  1.00 0.00 ? 54  LEU A CB   2  
ATOM   1799  C  CG   . LEU A 1 54 ? 5.311   -2.750  0.183   1.00 0.00 ? 54  LEU A CG   2  
ATOM   1800  C  CD1  . LEU A 1 54 ? 6.606   -3.548  0.165   1.00 0.00 ? 54  LEU A CD1  2  
ATOM   1801  C  CD2  . LEU A 1 54 ? 4.964   -2.325  1.602   1.00 0.00 ? 54  LEU A CD2  2  
ATOM   1802  H  H    . LEU A 1 54 ? 3.065   -2.444  -1.852  1.00 0.00 ? 54  LEU A H    2  
ATOM   1803  H  HA   . LEU A 1 54 ? 3.881   -0.135  -0.212  1.00 0.00 ? 54  LEU A HA   2  
ATOM   1804  H  HB2  . LEU A 1 54 ? 5.841   -1.855  -1.669  1.00 0.00 ? 54  LEU A HB2  2  
ATOM   1805  H  HB3  . LEU A 1 54 ? 6.093   -0.824  -0.263  1.00 0.00 ? 54  LEU A HB3  2  
ATOM   1806  H  HG   . LEU A 1 54 ? 4.519   -3.392  -0.178  1.00 0.00 ? 54  LEU A HG   2  
ATOM   1807  H  HD11 . LEU A 1 54 ? 6.450   -4.497  0.655   1.00 0.00 ? 54  LEU A HD11 2  
ATOM   1808  H  HD12 . LEU A 1 54 ? 7.375   -2.997  0.685   1.00 0.00 ? 54  LEU A HD12 2  
ATOM   1809  H  HD13 . LEU A 1 54 ? 6.911   -3.716  -0.857  1.00 0.00 ? 54  LEU A HD13 2  
ATOM   1810  H  HD21 . LEU A 1 54 ? 4.360   -1.430  1.572   1.00 0.00 ? 54  LEU A HD21 2  
ATOM   1811  H  HD22 . LEU A 1 54 ? 5.873   -2.127  2.151   1.00 0.00 ? 54  LEU A HD22 2  
ATOM   1812  H  HD23 . LEU A 1 54 ? 4.412   -3.115  2.090   1.00 0.00 ? 54  LEU A HD23 2  
ATOM   1813  N  N    . CYS A 1 55 ? 5.077   1.078   -2.230  1.00 0.00 ? 55  CYS A N    2  
ATOM   1814  C  CA   . CYS A 1 55 ? 5.310   1.951   -3.375  1.00 0.00 ? 55  CYS A CA   2  
ATOM   1815  C  C    . CYS A 1 55 ? 6.657   1.649   -4.024  1.00 0.00 ? 55  CYS A C    2  
ATOM   1816  O  O    . CYS A 1 55 ? 7.606   1.245   -3.351  1.00 0.00 ? 55  CYS A O    2  
ATOM   1817  C  CB   . CYS A 1 55 ? 5.256   3.418   -2.944  1.00 0.00 ? 55  CYS A CB   2  
ATOM   1818  S  SG   . CYS A 1 55 ? 6.646   3.933   -1.885  1.00 0.00 ? 55  CYS A SG   2  
ATOM   1819  H  H    . CYS A 1 55 ? 5.535   1.269   -1.384  1.00 0.00 ? 55  CYS A H    2  
ATOM   1820  H  HA   . CYS A 1 55 ? 4.528   1.768   -4.096  1.00 0.00 ? 55  CYS A HA   2  
ATOM   1821  H  HB2  . CYS A 1 55 ? 5.264   4.044   -3.824  1.00 0.00 ? 55  CYS A HB2  2  
ATOM   1822  H  HB3  . CYS A 1 55 ? 4.342   3.590   -2.395  1.00 0.00 ? 55  CYS A HB3  2  
ATOM   1823  N  N    . ARG A 1 56 ? 6.734   1.848   -5.336  1.00 0.00 ? 56  ARG A N    2  
ATOM   1824  C  CA   . ARG A 1 56 ? 7.964   1.597   -6.076  1.00 0.00 ? 56  ARG A CA   2  
ATOM   1825  C  C    . ARG A 1 56 ? 9.186   1.986   -5.249  1.00 0.00 ? 56  ARG A C    2  
ATOM   1826  O  O    . ARG A 1 56 ? 10.120  1.204   -5.071  1.00 0.00 ? 56  ARG A O    2  
ATOM   1827  C  CB   . ARG A 1 56 ? 7.959   2.374   -7.394  1.00 0.00 ? 56  ARG A CB   2  
ATOM   1828  C  CG   . ARG A 1 56 ? 7.533   1.540   -8.591  1.00 0.00 ? 56  ARG A CG   2  
ATOM   1829  C  CD   . ARG A 1 56 ? 7.904   2.216   -9.902  1.00 0.00 ? 56  ARG A CD   2  
ATOM   1830  N  NE   . ARG A 1 56 ? 7.411   3.590   -9.967  1.00 0.00 ? 56  ARG A NE   2  
ATOM   1831  C  CZ   . ARG A 1 56 ? 7.948   4.527   -10.741 1.00 0.00 ? 56  ARG A CZ   2  
ATOM   1832  N  NH1  . ARG A 1 56 ? 8.988   4.239   -11.511 1.00 0.00 ? 56  ARG A NH1  2  
ATOM   1833  N  NH2  . ARG A 1 56 ? 7.443   5.754   -10.746 1.00 0.00 ? 56  ARG A NH2  2  
ATOM   1834  H  H    . ARG A 1 56 ? 5.944   2.171   -5.817  1.00 0.00 ? 56  ARG A H    2  
ATOM   1835  H  HA   . ARG A 1 56 ? 8.012   0.540   -6.292  1.00 0.00 ? 56  ARG A HA   2  
ATOM   1836  H  HB2  . ARG A 1 56 ? 7.279   3.208   -7.304  1.00 0.00 ? 56  ARG A HB2  2  
ATOM   1837  H  HB3  . ARG A 1 56 ? 8.954   2.749   -7.580  1.00 0.00 ? 56  ARG A HB3  2  
ATOM   1838  H  HG2  . ARG A 1 56 ? 8.025   0.580   -8.543  1.00 0.00 ? 56  ARG A HG2  2  
ATOM   1839  H  HG3  . ARG A 1 56 ? 6.463   1.400   -8.558  1.00 0.00 ? 56  ARG A HG3  2  
ATOM   1840  H  HD2  . ARG A 1 56 ? 8.979   2.225   -9.995  1.00 0.00 ? 56  ARG A HD2  2  
ATOM   1841  H  HD3  . ARG A 1 56 ? 7.476   1.651   -10.716 1.00 0.00 ? 56  ARG A HD3  2  
ATOM   1842  H  HE   . ARG A 1 56 ? 6.643   3.824   -9.406  1.00 0.00 ? 56  ARG A HE   2  
ATOM   1843  H  HH11 . ARG A 1 56 ? 9.370   3.315   -11.511 1.00 0.00 ? 56  ARG A HH11 2  
ATOM   1844  H  HH12 . ARG A 1 56 ? 9.389   4.946   -12.094 1.00 0.00 ? 56  ARG A HH12 2  
ATOM   1845  H  HH21 . ARG A 1 56 ? 6.659   5.974   -10.167 1.00 0.00 ? 56  ARG A HH21 2  
ATOM   1846  H  HH22 . ARG A 1 56 ? 7.848   6.458   -11.328 1.00 0.00 ? 56  ARG A HH22 2  
ATOM   1847  N  N    . PRO A 1 57 ? 9.180   3.223   -4.731  1.00 0.00 ? 57  PRO A N    2  
ATOM   1848  C  CA   . PRO A 1 57 ? 10.281  3.744   -3.914  1.00 0.00 ? 57  PRO A CA   2  
ATOM   1849  C  C    . PRO A 1 57 ? 10.706  2.767   -2.823  1.00 0.00 ? 57  PRO A C    2  
ATOM   1850  O  O    . PRO A 1 57 ? 11.851  2.316   -2.791  1.00 0.00 ? 57  PRO A O    2  
ATOM   1851  C  CB   . PRO A 1 57 ? 9.692   5.014   -3.295  1.00 0.00 ? 57  PRO A CB   2  
ATOM   1852  C  CG   . PRO A 1 57 ? 8.635   5.447   -4.250  1.00 0.00 ? 57  PRO A CG   2  
ATOM   1853  C  CD   . PRO A 1 57 ? 8.100   4.209   -4.902  1.00 0.00 ? 57  PRO A CD   2  
ATOM   1854  H  HA   . PRO A 1 57 ? 11.137  4.001   -4.520  1.00 0.00 ? 57  PRO A HA   2  
ATOM   1855  H  HB2  . PRO A 1 57 ? 9.277   4.785   -2.323  1.00 0.00 ? 57  PRO A HB2  2  
ATOM   1856  H  HB3  . PRO A 1 57 ? 10.464  5.762   -3.195  1.00 0.00 ? 57  PRO A HB3  2  
ATOM   1857  H  HG2  . PRO A 1 57 ? 7.843   5.952   -3.718  1.00 0.00 ? 57  PRO A HG2  2  
ATOM   1858  H  HG3  . PRO A 1 57 ? 9.061   6.099   -4.999  1.00 0.00 ? 57  PRO A HG3  2  
ATOM   1859  H  HD2  . PRO A 1 57 ? 7.199   3.884   -4.403  1.00 0.00 ? 57  PRO A HD2  2  
ATOM   1860  H  HD3  . PRO A 1 57 ? 7.908   4.392   -5.949  1.00 0.00 ? 57  PRO A HD3  2  
ATOM   1861  N  N    . CYS A 1 58 ? 9.776   2.443   -1.930  1.00 0.00 ? 58  CYS A N    2  
ATOM   1862  C  CA   . CYS A 1 58 ? 10.054  1.519   -0.837  1.00 0.00 ? 58  CYS A CA   2  
ATOM   1863  C  C    . CYS A 1 58 ? 10.383  0.128   -1.371  1.00 0.00 ? 58  CYS A C    2  
ATOM   1864  O  O    . CYS A 1 58 ? 11.515  -0.341  -1.256  1.00 0.00 ? 58  CYS A O    2  
ATOM   1865  C  CB   . CYS A 1 58 ? 8.856   1.443   0.111   1.00 0.00 ? 58  CYS A CB   2  
ATOM   1866  S  SG   . CYS A 1 58 ? 8.473   3.013   0.952   1.00 0.00 ? 58  CYS A SG   2  
ATOM   1867  H  H    . CYS A 1 58 ? 8.880   2.835   -2.008  1.00 0.00 ? 58  CYS A H    2  
ATOM   1868  H  HA   . CYS A 1 58 ? 10.908  1.894   -0.295  1.00 0.00 ? 58  CYS A HA   2  
ATOM   1869  H  HB2  . CYS A 1 58 ? 7.980   1.150   -0.450  1.00 0.00 ? 58  CYS A HB2  2  
ATOM   1870  H  HB3  . CYS A 1 58 ? 9.054   0.702   0.871   1.00 0.00 ? 58  CYS A HB3  2  
ATOM   1871  N  N    . HIS A 1 59 ? 9.385   -0.527  -1.956  1.00 0.00 ? 59  HIS A N    2  
ATOM   1872  C  CA   . HIS A 1 59 ? 9.568   -1.864  -2.509  1.00 0.00 ? 59  HIS A CA   2  
ATOM   1873  C  C    . HIS A 1 59 ? 10.931  -1.992  -3.182  1.00 0.00 ? 59  HIS A C    2  
ATOM   1874  O  O    . HIS A 1 59 ? 11.510  -3.076  -3.232  1.00 0.00 ? 59  HIS A O    2  
ATOM   1875  C  CB   . HIS A 1 59 ? 8.459   -2.179  -3.514  1.00 0.00 ? 59  HIS A CB   2  
ATOM   1876  C  CG   . HIS A 1 59 ? 8.649   -3.483  -4.226  1.00 0.00 ? 59  HIS A CG   2  
ATOM   1877  N  ND1  . HIS A 1 59 ? 8.558   -4.706  -3.594  1.00 0.00 ? 59  HIS A ND1  2  
ATOM   1878  C  CD2  . HIS A 1 59 ? 8.925   -3.751  -5.524  1.00 0.00 ? 59  HIS A CD2  2  
ATOM   1879  C  CE1  . HIS A 1 59 ? 8.772   -5.669  -4.472  1.00 0.00 ? 59  HIS A CE1  2  
ATOM   1880  N  NE2  . HIS A 1 59 ? 8.996   -5.117  -5.651  1.00 0.00 ? 59  HIS A NE2  2  
ATOM   1881  H  H    . HIS A 1 59 ? 8.505   -0.100  -2.018  1.00 0.00 ? 59  HIS A H    2  
ATOM   1882  H  HA   . HIS A 1 59 ? 9.514   -2.570  -1.694  1.00 0.00 ? 59  HIS A HA   2  
ATOM   1883  H  HB2  . HIS A 1 59 ? 7.513   -2.220  -2.995  1.00 0.00 ? 59  HIS A HB2  2  
ATOM   1884  H  HB3  . HIS A 1 59 ? 8.423   -1.396  -4.258  1.00 0.00 ? 59  HIS A HB3  2  
ATOM   1885  H  HD1  . HIS A 1 59 ? 8.367   -4.846  -2.644  1.00 0.00 ? 59  HIS A HD1  2  
ATOM   1886  H  HD2  . HIS A 1 59 ? 9.064   -3.026  -6.313  1.00 0.00 ? 59  HIS A HD2  2  
ATOM   1887  H  HE1  . HIS A 1 59 ? 8.763   -6.729  -4.263  1.00 0.00 ? 59  HIS A HE1  2  
ATOM   1888  H  HE2  . HIS A 1 59 ? 9.267   -5.601  -6.458  1.00 0.00 ? 59  HIS A HE2  2  
ATOM   1889  N  N    . ASN A 1 60 ? 11.438  -0.877  -3.698  1.00 0.00 ? 60  ASN A N    2  
ATOM   1890  C  CA   . ASN A 1 60 ? 12.733  -0.865  -4.368  1.00 0.00 ? 60  ASN A CA   2  
ATOM   1891  C  C    . ASN A 1 60 ? 13.872  -0.863  -3.353  1.00 0.00 ? 60  ASN A C    2  
ATOM   1892  O  O    . ASN A 1 60 ? 14.872  -1.560  -3.525  1.00 0.00 ? 60  ASN A O    2  
ATOM   1893  C  CB   . ASN A 1 60 ? 12.847  0.357   -5.281  1.00 0.00 ? 60  ASN A CB   2  
ATOM   1894  C  CG   . ASN A 1 60 ? 12.284  0.100   -6.665  1.00 0.00 ? 60  ASN A CG   2  
ATOM   1895  O  OD1  . ASN A 1 60 ? 12.585  -0.917  -7.291  1.00 0.00 ? 60  ASN A OD1  2  
ATOM   1896  N  ND2  . ASN A 1 60 ? 11.461  1.022   -7.150  1.00 0.00 ? 60  ASN A ND2  2  
ATOM   1897  H  H    . ASN A 1 60 ? 10.930  -0.042  -3.626  1.00 0.00 ? 60  ASN A H    2  
ATOM   1898  H  HA   . ASN A 1 60 ? 12.804  -1.759  -4.969  1.00 0.00 ? 60  ASN A HA   2  
ATOM   1899  H  HB2  . ASN A 1 60 ? 12.303  1.180   -4.840  1.00 0.00 ? 60  ASN A HB2  2  
ATOM   1900  H  HB3  . ASN A 1 60 ? 13.887  0.630   -5.380  1.00 0.00 ? 60  ASN A HB3  2  
ATOM   1901  H  HD21 . ASN A 1 60 ? 11.266  1.807   -6.596  1.00 0.00 ? 60  ASN A HD21 2  
ATOM   1902  H  HD22 . ASN A 1 60 ? 11.082  0.881   -8.043  1.00 0.00 ? 60  ASN A HD22 2  
ATOM   1903  N  N    . ARG A 1 61 ? 13.712  -0.075  -2.295  1.00 0.00 ? 61  ARG A N    2  
ATOM   1904  C  CA   . ARG A 1 61 ? 14.726  0.019   -1.252  1.00 0.00 ? 61  ARG A CA   2  
ATOM   1905  C  C    . ARG A 1 61 ? 14.947  -1.336  -0.585  1.00 0.00 ? 61  ARG A C    2  
ATOM   1906  O  O    . ARG A 1 61 ? 16.058  -1.658  -0.165  1.00 0.00 ? 61  ARG A O    2  
ATOM   1907  C  CB   . ARG A 1 61 ? 14.316  1.054   -0.203  1.00 0.00 ? 61  ARG A CB   2  
ATOM   1908  C  CG   . ARG A 1 61 ? 13.526  0.468   0.956   1.00 0.00 ? 61  ARG A CG   2  
ATOM   1909  C  CD   . ARG A 1 61 ? 12.920  1.559   1.825   1.00 0.00 ? 61  ARG A CD   2  
ATOM   1910  N  NE   . ARG A 1 61 ? 13.814  1.955   2.909   1.00 0.00 ? 61  ARG A NE   2  
ATOM   1911  C  CZ   . ARG A 1 61 ? 13.771  3.144   3.500   1.00 0.00 ? 61  ARG A CZ   2  
ATOM   1912  N  NH1  . ARG A 1 61 ? 12.882  4.048   3.113   1.00 0.00 ? 61  ARG A NH1  2  
ATOM   1913  N  NH2  . ARG A 1 61 ? 14.619  3.430   4.480   1.00 0.00 ? 61  ARG A NH2  2  
ATOM   1914  H  H    . ARG A 1 61 ? 12.893  0.457   -2.214  1.00 0.00 ? 61  ARG A H    2  
ATOM   1915  H  HA   . ARG A 1 61 ? 15.650  0.334   -1.714  1.00 0.00 ? 61  ARG A HA   2  
ATOM   1916  H  HB2  . ARG A 1 61 ? 15.207  1.518   0.196   1.00 0.00 ? 61  ARG A HB2  2  
ATOM   1917  H  HB3  . ARG A 1 61 ? 13.709  1.809   -0.679  1.00 0.00 ? 61  ARG A HB3  2  
ATOM   1918  H  HG2  . ARG A 1 61 ? 12.730  -0.147  0.562   1.00 0.00 ? 61  ARG A HG2  2  
ATOM   1919  H  HG3  . ARG A 1 61 ? 14.186  -0.137  1.559   1.00 0.00 ? 61  ARG A HG3  2  
ATOM   1920  H  HD2  . ARG A 1 61 ? 12.715  2.420   1.207   1.00 0.00 ? 61  ARG A HD2  2  
ATOM   1921  H  HD3  . ARG A 1 61 ? 11.997  1.191   2.248   1.00 0.00 ? 61  ARG A HD3  2  
ATOM   1922  H  HE   . ARG A 1 61 ? 14.479  1.302   3.210   1.00 0.00 ? 61  ARG A HE   2  
ATOM   1923  H  HH11 . ARG A 1 61 ? 12.241  3.835   2.376   1.00 0.00 ? 61  ARG A HH11 2  
ATOM   1924  H  HH12 . ARG A 1 61 ? 12.851  4.942   3.560   1.00 0.00 ? 61  ARG A HH12 2  
ATOM   1925  H  HH21 . ARG A 1 61 ? 15.290  2.751   4.774   1.00 0.00 ? 61  ARG A HH21 2  
ATOM   1926  H  HH22 . ARG A 1 61 ? 14.586  4.325   4.923   1.00 0.00 ? 61  ARG A HH22 2  
ATOM   1927  N  N    . GLU A 1 62 ? 13.881  -2.125  -0.492  1.00 0.00 ? 62  GLU A N    2  
ATOM   1928  C  CA   . GLU A 1 62 ? 13.959  -3.444  0.125   1.00 0.00 ? 62  GLU A CA   2  
ATOM   1929  C  C    . GLU A 1 62 ? 14.633  -4.443  -0.811  1.00 0.00 ? 62  GLU A C    2  
ATOM   1930  O  O    . GLU A 1 62 ? 15.738  -4.915  -0.543  1.00 0.00 ? 62  GLU A O    2  
ATOM   1931  C  CB   . GLU A 1 62 ? 12.560  -3.940  0.498   1.00 0.00 ? 62  GLU A CB   2  
ATOM   1932  C  CG   . GLU A 1 62 ? 11.687  -2.875  1.138   1.00 0.00 ? 62  GLU A CG   2  
ATOM   1933  C  CD   . GLU A 1 62 ? 11.969  -2.700  2.617   1.00 0.00 ? 62  GLU A CD   2  
ATOM   1934  O  OE1  . GLU A 1 62 ? 11.827  -3.686  3.370   1.00 0.00 ? 62  GLU A OE1  2  
ATOM   1935  O  OE2  . GLU A 1 62 ? 12.331  -1.575  3.023   1.00 0.00 ? 62  GLU A OE2  2  
ATOM   1936  H  H    . GLU A 1 62 ? 13.022  -1.812  -0.845  1.00 0.00 ? 62  GLU A H    2  
ATOM   1937  H  HA   . GLU A 1 62 ? 14.551  -3.355  1.024   1.00 0.00 ? 62  GLU A HA   2  
ATOM   1938  H  HB2  . GLU A 1 62 ? 12.067  -4.293  -0.395  1.00 0.00 ? 62  GLU A HB2  2  
ATOM   1939  H  HB3  . GLU A 1 62 ? 12.657  -4.761  1.193   1.00 0.00 ? 62  GLU A HB3  2  
ATOM   1940  H  HG2  . GLU A 1 62 ? 11.865  -1.934  0.639   1.00 0.00 ? 62  GLU A HG2  2  
ATOM   1941  H  HG3  . GLU A 1 62 ? 10.651  -3.155  1.014   1.00 0.00 ? 62  GLU A HG3  2  
ATOM   1942  N  N    . LYS A 1 63 ? 13.959  -4.762  -1.910  1.00 0.00 ? 63  LYS A N    2  
ATOM   1943  C  CA   . LYS A 1 63 ? 14.490  -5.705  -2.888  1.00 0.00 ? 63  LYS A CA   2  
ATOM   1944  C  C    . LYS A 1 63 ? 15.932  -5.361  -3.246  1.00 0.00 ? 63  LYS A C    2  
ATOM   1945  O  O    . LYS A 1 63 ? 16.738  -6.246  -3.534  1.00 0.00 ? 63  LYS A O    2  
ATOM   1946  C  CB   . LYS A 1 63 ? 13.625  -5.704  -4.150  1.00 0.00 ? 63  LYS A CB   2  
ATOM   1947  C  CG   . LYS A 1 63 ? 13.676  -4.396  -4.921  1.00 0.00 ? 63  LYS A CG   2  
ATOM   1948  C  CD   . LYS A 1 63 ? 12.560  -4.311  -5.949  1.00 0.00 ? 63  LYS A CD   2  
ATOM   1949  C  CE   . LYS A 1 63 ? 12.833  -5.212  -7.143  1.00 0.00 ? 63  LYS A CE   2  
ATOM   1950  N  NZ   . LYS A 1 63 ? 13.976  -4.720  -7.960  1.00 0.00 ? 63  LYS A NZ   2  
ATOM   1951  H  H    . LYS A 1 63 ? 13.082  -4.353  -2.069  1.00 0.00 ? 63  LYS A H    2  
ATOM   1952  H  HA   . LYS A 1 63 ? 14.466  -6.690  -2.446  1.00 0.00 ? 63  LYS A HA   2  
ATOM   1953  H  HB2  . LYS A 1 63 ? 13.962  -6.496  -4.803  1.00 0.00 ? 63  LYS A HB2  2  
ATOM   1954  H  HB3  . LYS A 1 63 ? 12.599  -5.892  -3.869  1.00 0.00 ? 63  LYS A HB3  2  
ATOM   1955  H  HG2  . LYS A 1 63 ? 13.574  -3.575  -4.227  1.00 0.00 ? 63  LYS A HG2  2  
ATOM   1956  H  HG3  . LYS A 1 63 ? 14.627  -4.324  -5.429  1.00 0.00 ? 63  LYS A HG3  2  
ATOM   1957  H  HD2  . LYS A 1 63 ? 11.633  -4.616  -5.487  1.00 0.00 ? 63  LYS A HD2  2  
ATOM   1958  H  HD3  . LYS A 1 63 ? 12.475  -3.289  -6.291  1.00 0.00 ? 63  LYS A HD3  2  
ATOM   1959  H  HE2  . LYS A 1 63 ? 13.059  -6.205  -6.785  1.00 0.00 ? 63  LYS A HE2  2  
ATOM   1960  H  HE3  . LYS A 1 63 ? 11.948  -5.246  -7.761  1.00 0.00 ? 63  LYS A HE3  2  
ATOM   1961  H  HZ1  . LYS A 1 63 ? 14.665  -4.231  -7.352  1.00 0.00 ? 63  LYS A HZ1  2  
ATOM   1962  H  HZ2  . LYS A 1 63 ? 13.638  -4.055  -8.685  1.00 0.00 ? 63  LYS A HZ2  2  
ATOM   1963  H  HZ3  . LYS A 1 63 ? 14.450  -5.517  -8.430  1.00 0.00 ? 63  LYS A HZ3  2  
ATOM   1964  N  N    . ALA A 1 64 ? 16.251  -4.071  -3.225  1.00 0.00 ? 64  ALA A N    2  
ATOM   1965  C  CA   . ALA A 1 64 ? 17.598  -3.612  -3.544  1.00 0.00 ? 64  ALA A CA   2  
ATOM   1966  C  C    . ALA A 1 64 ? 18.645  -4.619  -3.082  1.00 0.00 ? 64  ALA A C    2  
ATOM   1967  O  O    . ALA A 1 64 ? 19.451  -5.101  -3.879  1.00 0.00 ? 64  ALA A O    2  
ATOM   1968  C  CB   . ALA A 1 64 ? 17.855  -2.252  -2.912  1.00 0.00 ? 64  ALA A CB   2  
ATOM   1969  H  H    . ALA A 1 64 ? 15.566  -3.413  -2.987  1.00 0.00 ? 64  ALA A H    2  
ATOM   1970  H  HA   . ALA A 1 64 ? 17.667  -3.502  -4.617  1.00 0.00 ? 64  ALA A HA   2  
ATOM   1971  H  HB1  . ALA A 1 64 ? 18.204  -1.565  -3.669  1.00 0.00 ? 64  ALA A HB1  2  
ATOM   1972  H  HB2  . ALA A 1 64 ? 16.940  -1.878  -2.479  1.00 0.00 ? 64  ALA A HB2  2  
ATOM   1973  H  HB3  . ALA A 1 64 ? 18.605  -2.350  -2.141  1.00 0.00 ? 64  ALA A HB3  2  
ATOM   1974  N  N    . SER A 1 65 ? 18.629  -4.933  -1.791  1.00 0.00 ? 65  SER A N    2  
ATOM   1975  C  CA   . SER A 1 65 ? 19.581  -5.880  -1.222  1.00 0.00 ? 65  SER A CA   2  
ATOM   1976  C  C    . SER A 1 65 ? 18.930  -7.242  -1.006  1.00 0.00 ? 65  SER A C    2  
ATOM   1977  O  O    . SER A 1 65 ? 17.774  -7.331  -0.593  1.00 0.00 ? 65  SER A O    2  
ATOM   1978  C  CB   . SER A 1 65 ? 20.131  -5.349  0.103   1.00 0.00 ? 65  SER A CB   2  
ATOM   1979  O  OG   . SER A 1 65 ? 21.004  -4.252  -0.109  1.00 0.00 ? 65  SER A OG   2  
ATOM   1980  H  H    . SER A 1 65 ? 17.963  -4.515  -1.206  1.00 0.00 ? 65  SER A H    2  
ATOM   1981  H  HA   . SER A 1 65 ? 20.397  -5.991  -1.922  1.00 0.00 ? 65  SER A HA   2  
ATOM   1982  H  HB2  . SER A 1 65 ? 19.312  -5.025  0.726   1.00 0.00 ? 65  SER A HB2  2  
ATOM   1983  H  HB3  . SER A 1 65 ? 20.676  -6.135  0.604   1.00 0.00 ? 65  SER A HB3  2  
ATOM   1984  H  HG   . SER A 1 65 ? 21.307  -3.916  0.737   1.00 0.00 ? 65  SER A HG   2  
ATOM   1985  N  N    . GLY A 1 66 ? 19.681  -8.302  -1.288  1.00 0.00 ? 66  GLY A N    2  
ATOM   1986  C  CA   . GLY A 1 66 ? 19.161  -9.646  -1.119  1.00 0.00 ? 66  GLY A CA   2  
ATOM   1987  C  C    . GLY A 1 66 ? 19.537  -10.562 -2.267  1.00 0.00 ? 66  GLY A C    2  
ATOM   1988  O  O    . GLY A 1 66 ? 20.286  -10.187 -3.169  1.00 0.00 ? 66  GLY A O    2  
ATOM   1989  H  H    . GLY A 1 66 ? 20.596  -8.170  -1.614  1.00 0.00 ? 66  GLY A H    2  
ATOM   1990  H  HA2  . GLY A 1 66 ? 19.550  -10.059 -0.201  1.00 0.00 ? 66  GLY A HA2  2  
ATOM   1991  H  HA3  . GLY A 1 66 ? 18.084  -9.597  -1.052  1.00 0.00 ? 66  GLY A HA3  2  
ATOM   1992  N  N    . PRO A 1 67 ? 19.011  -11.796 -2.242  1.00 0.00 ? 67  PRO A N    2  
ATOM   1993  C  CA   . PRO A 1 67 ? 19.283  -12.794 -3.280  1.00 0.00 ? 67  PRO A CA   2  
ATOM   1994  C  C    . PRO A 1 67 ? 18.631  -12.437 -4.612  1.00 0.00 ? 67  PRO A C    2  
ATOM   1995  O  O    . PRO A 1 67 ? 18.737  -13.183 -5.585  1.00 0.00 ? 67  PRO A O    2  
ATOM   1996  C  CB   . PRO A 1 67 ? 18.669  -14.075 -2.710  1.00 0.00 ? 67  PRO A CB   2  
ATOM   1997  C  CG   . PRO A 1 67 ? 17.607  -13.604 -1.778  1.00 0.00 ? 67  PRO A CG   2  
ATOM   1998  C  CD   . PRO A 1 67 ? 18.109  -12.311 -1.197  1.00 0.00 ? 67  PRO A CD   2  
ATOM   1999  H  HA   . PRO A 1 67 ? 20.344  -12.935 -3.426  1.00 0.00 ? 67  PRO A HA   2  
ATOM   2000  H  HB2  . PRO A 1 67 ? 18.255  -14.667 -3.515  1.00 0.00 ? 67  PRO A HB2  2  
ATOM   2001  H  HB3  . PRO A 1 67 ? 19.427  -14.642 -2.191  1.00 0.00 ? 67  PRO A HB3  2  
ATOM   2002  H  HG2  . PRO A 1 67 ? 16.688  -13.439 -2.320  1.00 0.00 ? 67  PRO A HG2  2  
ATOM   2003  H  HG3  . PRO A 1 67 ? 17.457  -14.332 -0.995  1.00 0.00 ? 67  PRO A HG3  2  
ATOM   2004  H  HD2  . PRO A 1 67 ? 17.289  -11.630 -1.026  1.00 0.00 ? 67  PRO A HD2  2  
ATOM   2005  H  HD3  . PRO A 1 67 ? 18.648  -12.494 -0.279  1.00 0.00 ? 67  PRO A HD3  2  
ATOM   2006  N  N    . SER A 1 68 ? 17.957  -11.292 -4.648  1.00 0.00 ? 68  SER A N    2  
ATOM   2007  C  CA   . SER A 1 68 ? 17.285  -10.838 -5.860  1.00 0.00 ? 68  SER A CA   2  
ATOM   2008  C  C    . SER A 1 68 ? 18.141  -11.116 -7.092  1.00 0.00 ? 68  SER A C    2  
ATOM   2009  O  O    . SER A 1 68 ? 17.688  -11.746 -8.047  1.00 0.00 ? 68  SER A O    2  
ATOM   2010  C  CB   . SER A 1 68 ? 16.975  -9.343  -5.767  1.00 0.00 ? 68  SER A CB   2  
ATOM   2011  O  OG   . SER A 1 68 ? 15.813  -9.016  -6.510  1.00 0.00 ? 68  SER A OG   2  
ATOM   2012  H  H    . SER A 1 68 ? 17.909  -10.741 -3.839  1.00 0.00 ? 68  SER A H    2  
ATOM   2013  H  HA   . SER A 1 68 ? 16.358  -11.385 -5.949  1.00 0.00 ? 68  SER A HA   2  
ATOM   2014  H  HB2  . SER A 1 68 ? 16.813  -9.075  -4.734  1.00 0.00 ? 68  SER A HB2  2  
ATOM   2015  H  HB3  . SER A 1 68 ? 17.809  -8.780  -6.159  1.00 0.00 ? 68  SER A HB3  2  
ATOM   2016  H  HG   . SER A 1 68 ? 15.827  -9.485  -7.348  1.00 0.00 ? 68  SER A HG   2  
ATOM   2017  N  N    . SER A 1 69 ? 19.382  -10.640 -7.062  1.00 0.00 ? 69  SER A N    2  
ATOM   2018  C  CA   . SER A 1 69 ? 20.302  -10.833 -8.177  1.00 0.00 ? 69  SER A CA   2  
ATOM   2019  C  C    . SER A 1 69 ? 19.780  -10.148 -9.436  1.00 0.00 ? 69  SER A C    2  
ATOM   2020  O  O    . SER A 1 69 ? 19.827  -10.712 -10.528 1.00 0.00 ? 69  SER A O    2  
ATOM   2021  C  CB   . SER A 1 69 ? 20.508  -12.325 -8.443  1.00 0.00 ? 69  SER A CB   2  
ATOM   2022  O  OG   . SER A 1 69 ? 21.450  -12.533 -9.482  1.00 0.00 ? 69  SER A OG   2  
ATOM   2023  H  H    . SER A 1 69 ? 19.685  -10.146 -6.271  1.00 0.00 ? 69  SER A H    2  
ATOM   2024  H  HA   . SER A 1 69 ? 21.249  -10.390 -7.906  1.00 0.00 ? 69  SER A HA   2  
ATOM   2025  H  HB2  . SER A 1 69 ? 20.871  -12.802 -7.545  1.00 0.00 ? 69  SER A HB2  2  
ATOM   2026  H  HB3  . SER A 1 69 ? 19.567  -12.770 -8.732  1.00 0.00 ? 69  SER A HB3  2  
ATOM   2027  H  HG   . SER A 1 69 ? 21.088  -13.148 -10.124 1.00 0.00 ? 69  SER A HG   2  
ATOM   2028  N  N    . GLY A 1 70 ? 19.281  -8.926  -9.274  1.00 0.00 ? 70  GLY A N    2  
ATOM   2029  C  CA   . GLY A 1 70 ? 18.757  -8.183  -10.405 1.00 0.00 ? 70  GLY A CA   2  
ATOM   2030  C  C    . GLY A 1 70 ? 19.539  -6.913  -10.677 1.00 0.00 ? 70  GLY A C    2  
ATOM   2031  O  O    . GLY A 1 70 ? 19.873  -6.652  -11.832 1.00 0.00 ? 70  GLY A O    2  
ATOM   2032  H  H    . GLY A 1 70 ? 19.269  -8.526  -8.379  1.00 0.00 ? 70  GLY A H    2  
ATOM   2033  H  HA2  . GLY A 1 70 ? 18.793  -8.811  -11.283 1.00 0.00 ? 70  GLY A HA2  2  
ATOM   2034  H  HA3  . GLY A 1 70 ? 17.728  -7.922  -10.204 1.00 0.00 ? 70  GLY A HA3  2  
HETATM 2035  ZN ZN   . ZN  B 2 .  ? -11.360 4.318   2.482   1.00 0.00 ? 201 ZN  A ZN   2  
HETATM 2036  ZN ZN   . ZN  C 2 .  ? 6.593   3.537   0.320   1.00 0.00 ? 401 ZN  A ZN   2  
ATOM   2037  N  N    . GLY A 1 1  ? -27.579 -1.883  -14.523 1.00 0.00 ? 1   GLY A N    3  
ATOM   2038  C  CA   . GLY A 1 1  ? -26.729 -1.689  -13.362 1.00 0.00 ? 1   GLY A CA   3  
ATOM   2039  C  C    . GLY A 1 1  ? -25.743 -2.824  -13.170 1.00 0.00 ? 1   GLY A C    3  
ATOM   2040  O  O    . GLY A 1 1  ? -25.431 -3.551  -14.113 1.00 0.00 ? 1   GLY A O    3  
ATOM   2041  H  H1   . GLY A 1 1  ? -27.176 -2.030  -15.404 1.00 0.00 ? 1   GLY A H1   3  
ATOM   2042  H  HA2  . GLY A 1 1  ? -26.181 -0.766  -13.481 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   2043  H  HA3  . GLY A 1 1  ? -27.351 -1.616  -12.483 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   2044  N  N    . SER A 1 2  ? -25.249 -2.976  -11.945 1.00 0.00 ? 2   SER A N    3  
ATOM   2045  C  CA   . SER A 1 2  ? -24.288 -4.027  -11.633 1.00 0.00 ? 2   SER A CA   3  
ATOM   2046  C  C    . SER A 1 2  ? -24.643 -4.714  -10.318 1.00 0.00 ? 2   SER A C    3  
ATOM   2047  O  O    . SER A 1 2  ? -25.092 -4.071  -9.370  1.00 0.00 ? 2   SER A O    3  
ATOM   2048  C  CB   . SER A 1 2  ? -22.874 -3.447  -11.554 1.00 0.00 ? 2   SER A CB   3  
ATOM   2049  O  OG   . SER A 1 2  ? -21.935 -4.443  -11.187 1.00 0.00 ? 2   SER A OG   3  
ATOM   2050  H  H    . SER A 1 2  ? -25.536 -2.364  -11.235 1.00 0.00 ? 2   SER A H    3  
ATOM   2051  H  HA   . SER A 1 2  ? -24.325 -4.756  -12.429 1.00 0.00 ? 2   SER A HA   3  
ATOM   2052  H  HB2  . SER A 1 2  ? -22.598 -3.046  -12.517 1.00 0.00 ? 2   SER A HB2  3  
ATOM   2053  H  HB3  . SER A 1 2  ? -22.852 -2.659  -10.815 1.00 0.00 ? 2   SER A HB3  3  
ATOM   2054  H  HG   . SER A 1 2  ? -22.391 -5.275  -11.041 1.00 0.00 ? 2   SER A HG   3  
ATOM   2055  N  N    . SER A 1 3  ? -24.437 -6.027  -10.270 1.00 0.00 ? 3   SER A N    3  
ATOM   2056  C  CA   . SER A 1 3  ? -24.738 -6.804  -9.073  1.00 0.00 ? 3   SER A CA   3  
ATOM   2057  C  C    . SER A 1 3  ? -23.496 -6.963  -8.202  1.00 0.00 ? 3   SER A C    3  
ATOM   2058  O  O    . SER A 1 3  ? -22.766 -7.947  -8.315  1.00 0.00 ? 3   SER A O    3  
ATOM   2059  C  CB   . SER A 1 3  ? -25.285 -8.180  -9.458  1.00 0.00 ? 3   SER A CB   3  
ATOM   2060  O  OG   . SER A 1 3  ? -25.351 -9.036  -8.330  1.00 0.00 ? 3   SER A OG   3  
ATOM   2061  H  H    . SER A 1 3  ? -24.076 -6.483  -11.059 1.00 0.00 ? 3   SER A H    3  
ATOM   2062  H  HA   . SER A 1 3  ? -25.491 -6.271  -8.513  1.00 0.00 ? 3   SER A HA   3  
ATOM   2063  H  HB2  . SER A 1 3  ? -26.277 -8.069  -9.869  1.00 0.00 ? 3   SER A HB2  3  
ATOM   2064  H  HB3  . SER A 1 3  ? -24.637 -8.628  -10.197 1.00 0.00 ? 3   SER A HB3  3  
ATOM   2065  H  HG   . SER A 1 3  ? -26.259 -9.320  -8.196  1.00 0.00 ? 3   SER A HG   3  
ATOM   2066  N  N    . GLY A 1 4  ? -23.262 -5.985  -7.331  1.00 0.00 ? 4   GLY A N    3  
ATOM   2067  C  CA   . GLY A 1 4  ? -22.108 -6.035  -6.453  1.00 0.00 ? 4   GLY A CA   3  
ATOM   2068  C  C    . GLY A 1 4  ? -21.730 -4.669  -5.916  1.00 0.00 ? 4   GLY A C    3  
ATOM   2069  O  O    . GLY A 1 4  ? -21.643 -3.700  -6.670  1.00 0.00 ? 4   GLY A O    3  
ATOM   2070  H  H    . GLY A 1 4  ? -23.879 -5.225  -7.285  1.00 0.00 ? 4   GLY A H    3  
ATOM   2071  H  HA2  . GLY A 1 4  ? -22.330 -6.688  -5.622  1.00 0.00 ? 4   GLY A HA2  3  
ATOM   2072  H  HA3  . GLY A 1 4  ? -21.270 -6.438  -7.001  1.00 0.00 ? 4   GLY A HA3  3  
ATOM   2073  N  N    . SER A 1 5  ? -21.505 -4.590  -4.608  1.00 0.00 ? 5   SER A N    3  
ATOM   2074  C  CA   . SER A 1 5  ? -21.139 -3.331  -3.970  1.00 0.00 ? 5   SER A CA   3  
ATOM   2075  C  C    . SER A 1 5  ? -19.623 -3.192  -3.872  1.00 0.00 ? 5   SER A C    3  
ATOM   2076  O  O    . SER A 1 5  ? -18.947 -4.044  -3.296  1.00 0.00 ? 5   SER A O    3  
ATOM   2077  C  CB   . SER A 1 5  ? -21.762 -3.241  -2.576  1.00 0.00 ? 5   SER A CB   3  
ATOM   2078  O  OG   . SER A 1 5  ? -23.166 -3.431  -2.631  1.00 0.00 ? 5   SER A OG   3  
ATOM   2079  H  H    . SER A 1 5  ? -21.591 -5.397  -4.059  1.00 0.00 ? 5   SER A H    3  
ATOM   2080  H  HA   . SER A 1 5  ? -21.524 -2.526  -4.579  1.00 0.00 ? 5   SER A HA   3  
ATOM   2081  H  HB2  . SER A 1 5  ? -21.333 -4.003  -1.943  1.00 0.00 ? 5   SER A HB2  3  
ATOM   2082  H  HB3  . SER A 1 5  ? -21.559 -2.267  -2.155  1.00 0.00 ? 5   SER A HB3  3  
ATOM   2083  H  HG   . SER A 1 5  ? -23.540 -3.309  -1.755  1.00 0.00 ? 5   SER A HG   3  
ATOM   2084  N  N    . SER A 1 6  ? -19.096 -2.111  -4.439  1.00 0.00 ? 6   SER A N    3  
ATOM   2085  C  CA   . SER A 1 6  ? -17.660 -1.861  -4.419  1.00 0.00 ? 6   SER A CA   3  
ATOM   2086  C  C    . SER A 1 6  ? -17.305 -0.814  -3.368  1.00 0.00 ? 6   SER A C    3  
ATOM   2087  O  O    . SER A 1 6  ? -17.313 0.385   -3.643  1.00 0.00 ? 6   SER A O    3  
ATOM   2088  C  CB   . SER A 1 6  ? -17.182 -1.399  -5.798  1.00 0.00 ? 6   SER A CB   3  
ATOM   2089  O  OG   . SER A 1 6  ? -16.929 -2.505  -6.647  1.00 0.00 ? 6   SER A OG   3  
ATOM   2090  H  H    . SER A 1 6  ? -19.688 -1.468  -4.883  1.00 0.00 ? 6   SER A H    3  
ATOM   2091  H  HA   . SER A 1 6  ? -17.165 -2.788  -4.169  1.00 0.00 ? 6   SER A HA   3  
ATOM   2092  H  HB2  . SER A 1 6  ? -17.942 -0.780  -6.250  1.00 0.00 ? 6   SER A HB2  3  
ATOM   2093  H  HB3  . SER A 1 6  ? -16.271 -0.829  -5.687  1.00 0.00 ? 6   SER A HB3  3  
ATOM   2094  H  HG   . SER A 1 6  ? -17.624 -2.568  -7.307  1.00 0.00 ? 6   SER A HG   3  
ATOM   2095  N  N    . GLY A 1 7  ? -16.993 -1.277  -2.162  1.00 0.00 ? 7   GLY A N    3  
ATOM   2096  C  CA   . GLY A 1 7  ? -16.639 -0.369  -1.087  1.00 0.00 ? 7   GLY A CA   3  
ATOM   2097  C  C    . GLY A 1 7  ? -15.183 -0.487  -0.683  1.00 0.00 ? 7   GLY A C    3  
ATOM   2098  O  O    . GLY A 1 7  ? -14.571 -1.544  -0.841  1.00 0.00 ? 7   GLY A O    3  
ATOM   2099  H  H    . GLY A 1 7  ? -17.003 -2.244  -2.000  1.00 0.00 ? 7   GLY A H    3  
ATOM   2100  H  HA2  . GLY A 1 7  ? -16.832 0.644   -1.408  1.00 0.00 ? 7   GLY A HA2  3  
ATOM   2101  H  HA3  . GLY A 1 7  ? -17.258 -0.587  -0.229  1.00 0.00 ? 7   GLY A HA3  3  
ATOM   2102  N  N    . CYS A 1 8  ? -14.625 0.600   -0.161  1.00 0.00 ? 8   CYS A N    3  
ATOM   2103  C  CA   . CYS A 1 8  ? -13.231 0.615   0.265   1.00 0.00 ? 8   CYS A CA   3  
ATOM   2104  C  C    . CYS A 1 8  ? -13.004 -0.357  1.419   1.00 0.00 ? 8   CYS A C    3  
ATOM   2105  O  O    . CYS A 1 8  ? -13.864 -0.520  2.286   1.00 0.00 ? 8   CYS A O    3  
ATOM   2106  C  CB   . CYS A 1 8  ? -12.819 2.028   0.685   1.00 0.00 ? 8   CYS A CB   3  
ATOM   2107  S  SG   . CYS A 1 8  ? -11.307 2.091   1.699   1.00 0.00 ? 8   CYS A SG   3  
ATOM   2108  H  H    . CYS A 1 8  ? -15.164 1.413   -0.061  1.00 0.00 ? 8   CYS A H    3  
ATOM   2109  H  HA   . CYS A 1 8  ? -12.624 0.307   -0.573  1.00 0.00 ? 8   CYS A HA   3  
ATOM   2110  H  HB2  . CYS A 1 8  ? -12.645 2.622   -0.201  1.00 0.00 ? 8   CYS A HB2  3  
ATOM   2111  H  HB3  . CYS A 1 8  ? -13.619 2.472   1.258   1.00 0.00 ? 8   CYS A HB3  3  
ATOM   2112  N  N    . HIS A 1 9  ? -11.841 -1.000  1.425   1.00 0.00 ? 9   HIS A N    3  
ATOM   2113  C  CA   . HIS A 1 9  ? -11.500 -1.955  2.473   1.00 0.00 ? 9   HIS A CA   3  
ATOM   2114  C  C    . HIS A 1 9  ? -10.773 -1.264  3.622   1.00 0.00 ? 9   HIS A C    3  
ATOM   2115  O  O    . HIS A 1 9  ? -10.993 -1.585  4.790   1.00 0.00 ? 9   HIS A O    3  
ATOM   2116  C  CB   . HIS A 1 9  ? -10.632 -3.078  1.906   1.00 0.00 ? 9   HIS A CB   3  
ATOM   2117  C  CG   . HIS A 1 9  ? -10.527 -4.268  2.809   1.00 0.00 ? 9   HIS A CG   3  
ATOM   2118  N  ND1  . HIS A 1 9  ? -11.617 -4.837  3.433   1.00 0.00 ? 9   HIS A ND1  3  
ATOM   2119  C  CD2  . HIS A 1 9  ? -9.453  -4.999  3.190   1.00 0.00 ? 9   HIS A CD2  3  
ATOM   2120  C  CE1  . HIS A 1 9  ? -11.218 -5.865  4.161   1.00 0.00 ? 9   HIS A CE1  3  
ATOM   2121  N  NE2  . HIS A 1 9  ? -9.909  -5.985  4.030   1.00 0.00 ? 9   HIS A NE2  3  
ATOM   2122  H  H    . HIS A 1 9  ? -11.196 -0.827  0.707   1.00 0.00 ? 9   HIS A H    3  
ATOM   2123  H  HA   . HIS A 1 9  ? -12.420 -2.378  2.848   1.00 0.00 ? 9   HIS A HA   3  
ATOM   2124  H  HB2  . HIS A 1 9  ? -11.051 -3.410  0.968   1.00 0.00 ? 9   HIS A HB2  3  
ATOM   2125  H  HB3  . HIS A 1 9  ? -9.633  -2.701  1.736   1.00 0.00 ? 9   HIS A HB3  3  
ATOM   2126  H  HD1  . HIS A 1 9  ? -12.545 -4.532  3.356   1.00 0.00 ? 9   HIS A HD1  3  
ATOM   2127  H  HD2  . HIS A 1 9  ? -8.427  -4.837  2.890   1.00 0.00 ? 9   HIS A HD2  3  
ATOM   2128  H  HE1  . HIS A 1 9  ? -11.853 -6.500  4.760   1.00 0.00 ? 9   HIS A HE1  3  
ATOM   2129  H  HE2  . HIS A 1 9  ? -9.347  -6.613  4.530   1.00 0.00 ? 9   HIS A HE2  3  
ATOM   2130  N  N    . GLN A 1 10 ? -9.906  -0.315  3.283   1.00 0.00 ? 10  GLN A N    3  
ATOM   2131  C  CA   . GLN A 1 10 ? -9.145  0.419   4.287   1.00 0.00 ? 10  GLN A CA   3  
ATOM   2132  C  C    . GLN A 1 10 ? -10.051 0.886   5.422   1.00 0.00 ? 10  GLN A C    3  
ATOM   2133  O  O    . GLN A 1 10 ? -9.973  0.378   6.541   1.00 0.00 ? 10  GLN A O    3  
ATOM   2134  C  CB   . GLN A 1 10 ? -8.446  1.621   3.649   1.00 0.00 ? 10  GLN A CB   3  
ATOM   2135  C  CG   . GLN A 1 10 ? -7.634  2.445   4.635   1.00 0.00 ? 10  GLN A CG   3  
ATOM   2136  C  CD   . GLN A 1 10 ? -6.248  1.876   4.868   1.00 0.00 ? 10  GLN A CD   3  
ATOM   2137  O  OE1  . GLN A 1 10 ? -5.779  1.024   4.113   1.00 0.00 ? 10  GLN A OE1  3  
ATOM   2138  N  NE2  . GLN A 1 10 ? -5.584  2.345   5.918   1.00 0.00 ? 10  GLN A NE2  3  
ATOM   2139  H  H    . GLN A 1 10 ? -9.774  -0.105  2.335   1.00 0.00 ? 10  GLN A H    3  
ATOM   2140  H  HA   . GLN A 1 10 ? -8.398  -0.248  4.690   1.00 0.00 ? 10  GLN A HA   3  
ATOM   2141  H  HB2  . GLN A 1 10 ? -7.782  1.267   2.875   1.00 0.00 ? 10  GLN A HB2  3  
ATOM   2142  H  HB3  . GLN A 1 10 ? -9.193  2.263   3.206   1.00 0.00 ? 10  GLN A HB3  3  
ATOM   2143  H  HG2  . GLN A 1 10 ? -7.533  3.449   4.248   1.00 0.00 ? 10  GLN A HG2  3  
ATOM   2144  H  HG3  . GLN A 1 10 ? -8.159  2.475   5.578   1.00 0.00 ? 10  GLN A HG3  3  
ATOM   2145  H  HE21 . GLN A 1 10 ? -6.022  3.023   6.477   1.00 0.00 ? 10  GLN A HE21 3  
ATOM   2146  H  HE22 . GLN A 1 10 ? -4.687  1.994   6.094   1.00 0.00 ? 10  GLN A HE22 3  
ATOM   2147  N  N    . CYS A 1 11 ? -10.910 1.856   5.126   1.00 0.00 ? 11  CYS A N    3  
ATOM   2148  C  CA   . CYS A 1 11 ? -11.830 2.392   6.121   1.00 0.00 ? 11  CYS A CA   3  
ATOM   2149  C  C    . CYS A 1 11 ? -13.139 1.607   6.131   1.00 0.00 ? 11  CYS A C    3  
ATOM   2150  O  O    . CYS A 1 11 ? -13.667 1.273   7.191   1.00 0.00 ? 11  CYS A O    3  
ATOM   2151  C  CB   . CYS A 1 11 ? -12.112 3.870   5.842   1.00 0.00 ? 11  CYS A CB   3  
ATOM   2152  S  SG   . CYS A 1 11 ? -12.895 4.186   4.228   1.00 0.00 ? 11  CYS A SG   3  
ATOM   2153  H  H    . CYS A 1 11 ? -10.925 2.220   4.216   1.00 0.00 ? 11  CYS A H    3  
ATOM   2154  H  HA   . CYS A 1 11 ? -11.363 2.300   7.090   1.00 0.00 ? 11  CYS A HA   3  
ATOM   2155  H  HB2  . CYS A 1 11 ? -12.771 4.254   6.607   1.00 0.00 ? 11  CYS A HB2  3  
ATOM   2156  H  HB3  . CYS A 1 11 ? -11.181 4.417   5.869   1.00 0.00 ? 11  CYS A HB3  3  
ATOM   2157  N  N    . GLY A 1 12 ? -13.657 1.315   4.941   1.00 0.00 ? 12  GLY A N    3  
ATOM   2158  C  CA   . GLY A 1 12 ? -14.898 0.572   4.835   1.00 0.00 ? 12  GLY A CA   3  
ATOM   2159  C  C    . GLY A 1 12 ? -15.980 1.350   4.112   1.00 0.00 ? 12  GLY A C    3  
ATOM   2160  O  O    . GLY A 1 12 ? -16.761 0.778   3.352   1.00 0.00 ? 12  GLY A O    3  
ATOM   2161  H  H    . GLY A 1 12 ? -13.191 1.607   4.130   1.00 0.00 ? 12  GLY A H    3  
ATOM   2162  H  HA2  . GLY A 1 12 ? -14.711 -0.347  4.299   1.00 0.00 ? 12  GLY A HA2  3  
ATOM   2163  H  HA3  . GLY A 1 12 ? -15.247 0.332   5.829   1.00 0.00 ? 12  GLY A HA3  3  
ATOM   2164  N  N    . GLU A 1 13 ? -16.026 2.657   4.349   1.00 0.00 ? 13  GLU A N    3  
ATOM   2165  C  CA   . GLU A 1 13 ? -17.022 3.513   3.716   1.00 0.00 ? 13  GLU A CA   3  
ATOM   2166  C  C    . GLU A 1 13 ? -17.123 3.217   2.222   1.00 0.00 ? 13  GLU A C    3  
ATOM   2167  O  O    . GLU A 1 13 ? -16.150 2.800   1.593   1.00 0.00 ? 13  GLU A O    3  
ATOM   2168  C  CB   . GLU A 1 13 ? -16.671 4.987   3.932   1.00 0.00 ? 13  GLU A CB   3  
ATOM   2169  C  CG   . GLU A 1 13 ? -16.519 5.367   5.395   1.00 0.00 ? 13  GLU A CG   3  
ATOM   2170  C  CD   . GLU A 1 13 ? -17.852 5.582   6.084   1.00 0.00 ? 13  GLU A CD   3  
ATOM   2171  O  OE1  . GLU A 1 13 ? -18.461 6.653   5.877   1.00 0.00 ? 13  GLU A OE1  3  
ATOM   2172  O  OE2  . GLU A 1 13 ? -18.287 4.680   6.831   1.00 0.00 ? 13  GLU A OE2  3  
ATOM   2173  H  H    . GLU A 1 13 ? -15.375 3.054   4.965   1.00 0.00 ? 13  GLU A H    3  
ATOM   2174  H  HA   . GLU A 1 13 ? -17.976 3.308   4.176   1.00 0.00 ? 13  GLU A HA   3  
ATOM   2175  H  HB2  . GLU A 1 13 ? -15.742 5.202   3.427   1.00 0.00 ? 13  GLU A HB2  3  
ATOM   2176  H  HB3  . GLU A 1 13 ? -17.453 5.596   3.503   1.00 0.00 ? 13  GLU A HB3  3  
ATOM   2177  H  HG2  . GLU A 1 13 ? -15.990 4.577   5.907   1.00 0.00 ? 13  GLU A HG2  3  
ATOM   2178  H  HG3  . GLU A 1 13 ? -15.946 6.281   5.459   1.00 0.00 ? 13  GLU A HG3  3  
ATOM   2179  N  N    . PHE A 1 14 ? -18.307 3.436   1.660   1.00 0.00 ? 14  PHE A N    3  
ATOM   2180  C  CA   . PHE A 1 14 ? -18.537 3.192   0.241   1.00 0.00 ? 14  PHE A CA   3  
ATOM   2181  C  C    . PHE A 1 14 ? -17.815 4.230   -0.613  1.00 0.00 ? 14  PHE A C    3  
ATOM   2182  O  O    . PHE A 1 14 ? -17.802 5.417   -0.287  1.00 0.00 ? 14  PHE A O    3  
ATOM   2183  C  CB   . PHE A 1 14 ? -20.035 3.215   -0.066  1.00 0.00 ? 14  PHE A CB   3  
ATOM   2184  C  CG   . PHE A 1 14 ? -20.384 2.616   -1.398  1.00 0.00 ? 14  PHE A CG   3  
ATOM   2185  C  CD1  . PHE A 1 14 ? -20.140 1.276   -1.656  1.00 0.00 ? 14  PHE A CD1  3  
ATOM   2186  C  CD2  . PHE A 1 14 ? -20.956 3.392   -2.393  1.00 0.00 ? 14  PHE A CD2  3  
ATOM   2187  C  CE1  . PHE A 1 14 ? -20.458 0.723   -2.881  1.00 0.00 ? 14  PHE A CE1  3  
ATOM   2188  C  CE2  . PHE A 1 14 ? -21.277 2.844   -3.621  1.00 0.00 ? 14  PHE A CE2  3  
ATOM   2189  C  CZ   . PHE A 1 14 ? -21.029 1.507   -3.865  1.00 0.00 ? 14  PHE A CZ   3  
ATOM   2190  H  H    . PHE A 1 14 ? -19.044 3.769   2.214   1.00 0.00 ? 14  PHE A H    3  
ATOM   2191  H  HA   . PHE A 1 14 ? -18.145 2.214   0.006   1.00 0.00 ? 14  PHE A HA   3  
ATOM   2192  H  HB2  . PHE A 1 14 ? -20.560 2.657   0.695   1.00 0.00 ? 14  PHE A HB2  3  
ATOM   2193  H  HB3  . PHE A 1 14 ? -20.381 4.238   -0.060  1.00 0.00 ? 14  PHE A HB3  3  
ATOM   2194  H  HD1  . PHE A 1 14 ? -19.695 0.661   -0.887  1.00 0.00 ? 14  PHE A HD1  3  
ATOM   2195  H  HD2  . PHE A 1 14 ? -21.151 4.438   -2.203  1.00 0.00 ? 14  PHE A HD2  3  
ATOM   2196  H  HE1  . PHE A 1 14 ? -20.264 -0.322  -3.069  1.00 0.00 ? 14  PHE A HE1  3  
ATOM   2197  H  HE2  . PHE A 1 14 ? -21.723 3.460   -4.388  1.00 0.00 ? 14  PHE A HE2  3  
ATOM   2198  H  HZ   . PHE A 1 14 ? -21.279 1.077   -4.823  1.00 0.00 ? 14  PHE A HZ   3  
ATOM   2199  N  N    . ILE A 1 15 ? -17.216 3.773   -1.708  1.00 0.00 ? 15  ILE A N    3  
ATOM   2200  C  CA   . ILE A 1 15 ? -16.493 4.661   -2.609  1.00 0.00 ? 15  ILE A CA   3  
ATOM   2201  C  C    . ILE A 1 15 ? -17.424 5.251   -3.663  1.00 0.00 ? 15  ILE A C    3  
ATOM   2202  O  O    . ILE A 1 15 ? -18.202 4.532   -4.291  1.00 0.00 ? 15  ILE A O    3  
ATOM   2203  C  CB   . ILE A 1 15 ? -15.336 3.928   -3.314  1.00 0.00 ? 15  ILE A CB   3  
ATOM   2204  C  CG1  . ILE A 1 15 ? -14.521 3.123   -2.300  1.00 0.00 ? 15  ILE A CG1  3  
ATOM   2205  C  CG2  . ILE A 1 15 ? -14.448 4.922   -4.047  1.00 0.00 ? 15  ILE A CG2  3  
ATOM   2206  C  CD1  . ILE A 1 15 ? -13.710 2.010   -2.925  1.00 0.00 ? 15  ILE A CD1  3  
ATOM   2207  H  H    . ILE A 1 15 ? -17.262 2.817   -1.914  1.00 0.00 ? 15  ILE A H    3  
ATOM   2208  H  HA   . ILE A 1 15 ? -16.077 5.466   -2.021  1.00 0.00 ? 15  ILE A HA   3  
ATOM   2209  H  HB   . ILE A 1 15 ? -15.758 3.254   -4.043  1.00 0.00 ? 15  ILE A HB   3  
ATOM   2210  H  HG12 . ILE A 1 15 ? -13.838 3.784   -1.791  1.00 0.00 ? 15  ILE A HG12 3  
ATOM   2211  H  HG13 . ILE A 1 15 ? -15.193 2.680   -1.579  1.00 0.00 ? 15  ILE A HG13 3  
ATOM   2212  H  HG21 . ILE A 1 15 ? -13.982 5.584   -3.332  1.00 0.00 ? 15  ILE A HG21 3  
ATOM   2213  H  HG22 . ILE A 1 15 ? -13.684 4.388   -4.592  1.00 0.00 ? 15  ILE A HG22 3  
ATOM   2214  H  HG23 . ILE A 1 15 ? -15.045 5.500   -4.736  1.00 0.00 ? 15  ILE A HG23 3  
ATOM   2215  H  HD11 . ILE A 1 15 ? -13.454 2.276   -3.940  1.00 0.00 ? 15  ILE A HD11 3  
ATOM   2216  H  HD12 . ILE A 1 15 ? -12.807 1.857   -2.354  1.00 0.00 ? 15  ILE A HD12 3  
ATOM   2217  H  HD13 . ILE A 1 15 ? -14.292 1.099   -2.929  1.00 0.00 ? 15  ILE A HD13 3  
ATOM   2218  N  N    . ILE A 1 16 ? -17.336 6.563   -3.854  1.00 0.00 ? 16  ILE A N    3  
ATOM   2219  C  CA   . ILE A 1 16 ? -18.168 7.249   -4.835  1.00 0.00 ? 16  ILE A CA   3  
ATOM   2220  C  C    . ILE A 1 16 ? -17.332 8.165   -5.721  1.00 0.00 ? 16  ILE A C    3  
ATOM   2221  O  O    . ILE A 1 16 ? -16.740 9.134   -5.248  1.00 0.00 ? 16  ILE A O    3  
ATOM   2222  C  CB   . ILE A 1 16 ? -19.272 8.081   -4.154  1.00 0.00 ? 16  ILE A CB   3  
ATOM   2223  C  CG1  . ILE A 1 16 ? -19.978 7.249   -3.080  1.00 0.00 ? 16  ILE A CG1  3  
ATOM   2224  C  CG2  . ILE A 1 16 ? -20.271 8.581   -5.186  1.00 0.00 ? 16  ILE A CG2  3  
ATOM   2225  C  CD1  . ILE A 1 16 ? -20.963 8.044   -2.252  1.00 0.00 ? 16  ILE A CD1  3  
ATOM   2226  H  H    . ILE A 1 16 ? -16.697 7.082   -3.324  1.00 0.00 ? 16  ILE A H    3  
ATOM   2227  H  HA   . ILE A 1 16 ? -18.640 6.500   -5.453  1.00 0.00 ? 16  ILE A HA   3  
ATOM   2228  H  HB   . ILE A 1 16 ? -18.810 8.938   -3.689  1.00 0.00 ? 16  ILE A HB   3  
ATOM   2229  H  HG12 . ILE A 1 16 ? -20.517 6.444   -3.554  1.00 0.00 ? 16  ILE A HG12 3  
ATOM   2230  H  HG13 . ILE A 1 16 ? -19.237 6.837   -2.411  1.00 0.00 ? 16  ILE A HG13 3  
ATOM   2231  H  HG21 . ILE A 1 16 ? -19.851 8.473   -6.175  1.00 0.00 ? 16  ILE A HG21 3  
ATOM   2232  H  HG22 . ILE A 1 16 ? -21.180 8.003   -5.116  1.00 0.00 ? 16  ILE A HG22 3  
ATOM   2233  H  HG23 . ILE A 1 16 ? -20.490 9.622   -5.000  1.00 0.00 ? 16  ILE A HG23 3  
ATOM   2234  H  HD11 . ILE A 1 16 ? -21.475 8.754   -2.884  1.00 0.00 ? 16  ILE A HD11 3  
ATOM   2235  H  HD12 . ILE A 1 16 ? -21.682 7.374   -1.806  1.00 0.00 ? 16  ILE A HD12 3  
ATOM   2236  H  HD13 . ILE A 1 16 ? -20.433 8.573   -1.473  1.00 0.00 ? 16  ILE A HD13 3  
ATOM   2237  N  N    . GLY A 1 17 ? -17.289 7.852   -7.013  1.00 0.00 ? 17  GLY A N    3  
ATOM   2238  C  CA   . GLY A 1 17 ? -16.523 8.657   -7.947  1.00 0.00 ? 17  GLY A CA   3  
ATOM   2239  C  C    . GLY A 1 17 ? -15.287 7.941   -8.452  1.00 0.00 ? 17  GLY A C    3  
ATOM   2240  O  O    . GLY A 1 17 ? -15.264 7.447   -9.579  1.00 0.00 ? 17  GLY A O    3  
ATOM   2241  H  H    . GLY A 1 17 ? -17.781 7.067   -7.334  1.00 0.00 ? 17  GLY A H    3  
ATOM   2242  H  HA2  . GLY A 1 17 ? -17.151 8.907   -8.789  1.00 0.00 ? 17  GLY A HA2  3  
ATOM   2243  H  HA3  . GLY A 1 17 ? -16.220 9.569   -7.453  1.00 0.00 ? 17  GLY A HA3  3  
ATOM   2244  N  N    . ARG A 1 18 ? -14.254 7.886   -7.617  1.00 0.00 ? 18  ARG A N    3  
ATOM   2245  C  CA   . ARG A 1 18 ? -13.007 7.228   -7.987  1.00 0.00 ? 18  ARG A CA   3  
ATOM   2246  C  C    . ARG A 1 18 ? -12.759 6.002   -7.112  1.00 0.00 ? 18  ARG A C    3  
ATOM   2247  O  O    . ARG A 1 18 ? -12.708 6.101   -5.886  1.00 0.00 ? 18  ARG A O    3  
ATOM   2248  C  CB   . ARG A 1 18 ? -11.834 8.202   -7.861  1.00 0.00 ? 18  ARG A CB   3  
ATOM   2249  C  CG   . ARG A 1 18 ? -10.477 7.519   -7.818  1.00 0.00 ? 18  ARG A CG   3  
ATOM   2250  C  CD   . ARG A 1 18 ? -9.385  8.415   -8.382  1.00 0.00 ? 18  ARG A CD   3  
ATOM   2251  N  NE   . ARG A 1 18 ? -8.307  7.643   -8.995  1.00 0.00 ? 18  ARG A NE   3  
ATOM   2252  C  CZ   . ARG A 1 18 ? -7.382  8.174   -9.788  1.00 0.00 ? 18  ARG A CZ   3  
ATOM   2253  N  NH1  . ARG A 1 18 ? -7.403  9.471   -10.060 1.00 0.00 ? 18  ARG A NH1  3  
ATOM   2254  N  NH2  . ARG A 1 18 ? -6.434  7.406   -10.309 1.00 0.00 ? 18  ARG A NH2  3  
ATOM   2255  H  H    . ARG A 1 18 ? -14.332 8.299   -6.732  1.00 0.00 ? 18  ARG A H    3  
ATOM   2256  H  HA   . ARG A 1 18 ? -13.091 6.911   -9.015  1.00 0.00 ? 18  ARG A HA   3  
ATOM   2257  H  HB2  . ARG A 1 18 ? -11.847 8.874   -8.707  1.00 0.00 ? 18  ARG A HB2  3  
ATOM   2258  H  HB3  . ARG A 1 18 ? -11.954 8.775   -6.954  1.00 0.00 ? 18  ARG A HB3  3  
ATOM   2259  H  HG2  . ARG A 1 18 ? -10.237 7.281   -6.792  1.00 0.00 ? 18  ARG A HG2  3  
ATOM   2260  H  HG3  . ARG A 1 18 ? -10.523 6.611   -8.400  1.00 0.00 ? 18  ARG A HG3  3  
ATOM   2261  H  HD2  . ARG A 1 18 ? -9.819  9.064   -9.127  1.00 0.00 ? 18  ARG A HD2  3  
ATOM   2262  H  HD3  . ARG A 1 18 ? -8.976  9.010   -7.579  1.00 0.00 ? 18  ARG A HD3  3  
ATOM   2263  H  HE   . ARG A 1 18 ? -8.273  6.682   -8.807  1.00 0.00 ? 18  ARG A HE   3  
ATOM   2264  H  HH11 . ARG A 1 18 ? -8.116  10.052  -9.668  1.00 0.00 ? 18  ARG A HH11 3  
ATOM   2265  H  HH12 . ARG A 1 18 ? -6.705  9.868   -10.656 1.00 0.00 ? 18  ARG A HH12 3  
ATOM   2266  H  HH21 . ARG A 1 18 ? -6.414  6.428   -10.105 1.00 0.00 ? 18  ARG A HH21 3  
ATOM   2267  H  HH22 . ARG A 1 18 ? -5.738  7.806   -10.905 1.00 0.00 ? 18  ARG A HH22 3  
ATOM   2268  N  N    . VAL A 1 19 ? -12.606 4.847   -7.752  1.00 0.00 ? 19  VAL A N    3  
ATOM   2269  C  CA   . VAL A 1 19 ? -12.363 3.601   -7.033  1.00 0.00 ? 19  VAL A CA   3  
ATOM   2270  C  C    . VAL A 1 19 ? -11.007 3.011   -7.399  1.00 0.00 ? 19  VAL A C    3  
ATOM   2271  O  O    . VAL A 1 19 ? -10.756 2.678   -8.558  1.00 0.00 ? 19  VAL A O    3  
ATOM   2272  C  CB   . VAL A 1 19 ? -13.460 2.561   -7.327  1.00 0.00 ? 19  VAL A CB   3  
ATOM   2273  C  CG1  . VAL A 1 19 ? -12.967 1.159   -7.001  1.00 0.00 ? 19  VAL A CG1  3  
ATOM   2274  C  CG2  . VAL A 1 19 ? -14.725 2.885   -6.546  1.00 0.00 ? 19  VAL A CG2  3  
ATOM   2275  H  H    . VAL A 1 19 ? -12.657 4.831   -8.730  1.00 0.00 ? 19  VAL A H    3  
ATOM   2276  H  HA   . VAL A 1 19 ? -12.377 3.819   -5.975  1.00 0.00 ? 19  VAL A HA   3  
ATOM   2277  H  HB   . VAL A 1 19 ? -13.693 2.601   -8.381  1.00 0.00 ? 19  VAL A HB   3  
ATOM   2278  H  HG11 . VAL A 1 19 ? -12.113 0.925   -7.620  1.00 0.00 ? 19  VAL A HG11 3  
ATOM   2279  H  HG12 . VAL A 1 19 ? -12.684 1.109   -5.960  1.00 0.00 ? 19  VAL A HG12 3  
ATOM   2280  H  HG13 . VAL A 1 19 ? -13.756 0.447   -7.194  1.00 0.00 ? 19  VAL A HG13 3  
ATOM   2281  H  HG21 . VAL A 1 19 ? -14.776 2.258   -5.669  1.00 0.00 ? 19  VAL A HG21 3  
ATOM   2282  H  HG22 . VAL A 1 19 ? -14.707 3.923   -6.246  1.00 0.00 ? 19  VAL A HG22 3  
ATOM   2283  H  HG23 . VAL A 1 19 ? -15.589 2.706   -7.168  1.00 0.00 ? 19  VAL A HG23 3  
ATOM   2284  N  N    . ILE A 1 20 ? -10.135 2.884   -6.405  1.00 0.00 ? 20  ILE A N    3  
ATOM   2285  C  CA   . ILE A 1 20 ? -8.803  2.332   -6.622  1.00 0.00 ? 20  ILE A CA   3  
ATOM   2286  C  C    . ILE A 1 20 ? -8.801  0.817   -6.447  1.00 0.00 ? 20  ILE A C    3  
ATOM   2287  O  O    . ILE A 1 20 ? -8.859  0.311   -5.326  1.00 0.00 ? 20  ILE A O    3  
ATOM   2288  C  CB   . ILE A 1 20 ? -7.773  2.951   -5.660  1.00 0.00 ? 20  ILE A CB   3  
ATOM   2289  C  CG1  . ILE A 1 20 ? -7.974  4.465   -5.568  1.00 0.00 ? 20  ILE A CG1  3  
ATOM   2290  C  CG2  . ILE A 1 20 ? -6.359  2.625   -6.117  1.00 0.00 ? 20  ILE A CG2  3  
ATOM   2291  C  CD1  . ILE A 1 20 ? -7.837  5.174   -6.897  1.00 0.00 ? 20  ILE A CD1  3  
ATOM   2292  H  H    . ILE A 1 20 ? -10.393 3.167   -5.503  1.00 0.00 ? 20  ILE A H    3  
ATOM   2293  H  HA   . ILE A 1 20 ? -8.507  2.566   -7.635  1.00 0.00 ? 20  ILE A HA   3  
ATOM   2294  H  HB   . ILE A 1 20 ? -7.919  2.515   -4.683  1.00 0.00 ? 20  ILE A HB   3  
ATOM   2295  H  HG12 . ILE A 1 20 ? -8.961  4.668   -5.184  1.00 0.00 ? 20  ILE A HG12 3  
ATOM   2296  H  HG13 . ILE A 1 20 ? -7.237  4.877   -4.893  1.00 0.00 ? 20  ILE A HG13 3  
ATOM   2297  H  HG21 . ILE A 1 20 ? -5.780  2.275   -5.275  1.00 0.00 ? 20  ILE A HG21 3  
ATOM   2298  H  HG22 . ILE A 1 20 ? -6.394  1.855   -6.873  1.00 0.00 ? 20  ILE A HG22 3  
ATOM   2299  H  HG23 . ILE A 1 20 ? -5.899  3.512   -6.526  1.00 0.00 ? 20  ILE A HG23 3  
ATOM   2300  H  HD11 . ILE A 1 20 ? -6.803  5.163   -7.207  1.00 0.00 ? 20  ILE A HD11 3  
ATOM   2301  H  HD12 . ILE A 1 20 ? -8.442  4.672   -7.637  1.00 0.00 ? 20  ILE A HD12 3  
ATOM   2302  H  HD13 . ILE A 1 20 ? -8.170  6.197   -6.794  1.00 0.00 ? 20  ILE A HD13 3  
ATOM   2303  N  N    . LYS A 1 21 ? -8.732  0.098   -7.562  1.00 0.00 ? 21  LYS A N    3  
ATOM   2304  C  CA   . LYS A 1 21 ? -8.719  -1.360  -7.533  1.00 0.00 ? 21  LYS A CA   3  
ATOM   2305  C  C    . LYS A 1 21 ? -7.321  -1.885  -7.221  1.00 0.00 ? 21  LYS A C    3  
ATOM   2306  O  O    . LYS A 1 21 ? -6.382  -1.670  -7.987  1.00 0.00 ? 21  LYS A O    3  
ATOM   2307  C  CB   . LYS A 1 21 ? -9.199  -1.922  -8.872  1.00 0.00 ? 21  LYS A CB   3  
ATOM   2308  C  CG   . LYS A 1 21 ? -10.704 -1.838  -9.063  1.00 0.00 ? 21  LYS A CG   3  
ATOM   2309  C  CD   . LYS A 1 21 ? -11.402 -3.082  -8.541  1.00 0.00 ? 21  LYS A CD   3  
ATOM   2310  C  CE   . LYS A 1 21 ? -12.828 -2.779  -8.106  1.00 0.00 ? 21  LYS A CE   3  
ATOM   2311  N  NZ   . LYS A 1 21 ? -13.589 -4.021  -7.795  1.00 0.00 ? 21  LYS A NZ   3  
ATOM   2312  H  H    . LYS A 1 21 ? -8.688  0.559   -8.426  1.00 0.00 ? 21  LYS A H    3  
ATOM   2313  H  HA   . LYS A 1 21 ? -9.393  -1.683  -6.754  1.00 0.00 ? 21  LYS A HA   3  
ATOM   2314  H  HB2  . LYS A 1 21 ? -8.724  -1.371  -9.671  1.00 0.00 ? 21  LYS A HB2  3  
ATOM   2315  H  HB3  . LYS A 1 21 ? -8.906  -2.960  -8.940  1.00 0.00 ? 21  LYS A HB3  3  
ATOM   2316  H  HG2  . LYS A 1 21 ? -11.077 -0.977  -8.529  1.00 0.00 ? 21  LYS A HG2  3  
ATOM   2317  H  HG3  . LYS A 1 21 ? -10.918 -1.731  -10.117 1.00 0.00 ? 21  LYS A HG3  3  
ATOM   2318  H  HD2  . LYS A 1 21 ? -11.427 -3.826  -9.323  1.00 0.00 ? 21  LYS A HD2  3  
ATOM   2319  H  HD3  . LYS A 1 21 ? -10.851 -3.465  -7.694  1.00 0.00 ? 21  LYS A HD3  3  
ATOM   2320  H  HE2  . LYS A 1 21 ? -12.798 -2.156  -7.225  1.00 0.00 ? 21  LYS A HE2  3  
ATOM   2321  H  HE3  . LYS A 1 21 ? -13.329 -2.250  -8.904  1.00 0.00 ? 21  LYS A HE3  3  
ATOM   2322  H  HZ1  . LYS A 1 21 ? -13.014 -4.652  -7.201  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM   2323  H  HZ2  . LYS A 1 21 ? -13.833 -4.519  -8.674  1.00 0.00 ? 21  LYS A HZ2  3  
ATOM   2324  H  HZ3  . LYS A 1 21 ? -14.465 -3.786  -7.287  1.00 0.00 ? 21  LYS A HZ3  3  
ATOM   2325  N  N    . ALA A 1 22 ? -7.191  -2.576  -6.093  1.00 0.00 ? 22  ALA A N    3  
ATOM   2326  C  CA   . ALA A 1 22 ? -5.908  -3.134  -5.683  1.00 0.00 ? 22  ALA A CA   3  
ATOM   2327  C  C    . ALA A 1 22 ? -6.102  -4.335  -4.763  1.00 0.00 ? 22  ALA A C    3  
ATOM   2328  O  O    . ALA A 1 22 ? -7.187  -4.547  -4.223  1.00 0.00 ? 22  ALA A O    3  
ATOM   2329  C  CB   . ALA A 1 22 ? -5.065  -2.071  -4.995  1.00 0.00 ? 22  ALA A CB   3  
ATOM   2330  H  H    . ALA A 1 22 ? -7.976  -2.713  -5.524  1.00 0.00 ? 22  ALA A H    3  
ATOM   2331  H  HA   . ALA A 1 22 ? -5.384  -3.455  -6.571  1.00 0.00 ? 22  ALA A HA   3  
ATOM   2332  H  HB1  . ALA A 1 22 ? -5.714  -1.330  -4.550  1.00 0.00 ? 22  ALA A HB1  3  
ATOM   2333  H  HB2  . ALA A 1 22 ? -4.463  -2.530  -4.226  1.00 0.00 ? 22  ALA A HB2  3  
ATOM   2334  H  HB3  . ALA A 1 22 ? -4.422  -1.596  -5.721  1.00 0.00 ? 22  ALA A HB3  3  
ATOM   2335  N  N    . MET A 1 23 ? -5.042  -5.118  -4.589  1.00 0.00 ? 23  MET A N    3  
ATOM   2336  C  CA   . MET A 1 23 ? -5.096  -6.298  -3.733  1.00 0.00 ? 23  MET A CA   3  
ATOM   2337  C  C    . MET A 1 23 ? -6.414  -7.043  -3.918  1.00 0.00 ? 23  MET A C    3  
ATOM   2338  O  O    . MET A 1 23 ? -6.934  -7.645  -2.979  1.00 0.00 ? 23  MET A O    3  
ATOM   2339  C  CB   . MET A 1 23 ? -4.924  -5.898  -2.266  1.00 0.00 ? 23  MET A CB   3  
ATOM   2340  C  CG   . MET A 1 23 ? -3.712  -5.016  -2.015  1.00 0.00 ? 23  MET A CG   3  
ATOM   2341  S  SD   . MET A 1 23 ? -2.168  -5.795  -2.525  1.00 0.00 ? 23  MET A SD   3  
ATOM   2342  C  CE   . MET A 1 23 ? -1.392  -6.080  -0.936  1.00 0.00 ? 23  MET A CE   3  
ATOM   2343  H  H    . MET A 1 23 ? -4.203  -4.897  -5.046  1.00 0.00 ? 23  MET A H    3  
ATOM   2344  H  HA   . MET A 1 23 ? -4.284  -6.950  -4.017  1.00 0.00 ? 23  MET A HA   3  
ATOM   2345  H  HB2  . MET A 1 23 ? -5.805  -5.363  -1.945  1.00 0.00 ? 23  MET A HB2  3  
ATOM   2346  H  HB3  . MET A 1 23 ? -4.819  -6.794  -1.672  1.00 0.00 ? 23  MET A HB3  3  
ATOM   2347  H  HG2  . MET A 1 23 ? -3.832  -4.096  -2.567  1.00 0.00 ? 23  MET A HG2  3  
ATOM   2348  H  HG3  . MET A 1 23 ? -3.657  -4.796  -0.959  1.00 0.00 ? 23  MET A HG3  3  
ATOM   2349  H  HE1  . MET A 1 23 ? -0.824  -5.206  -0.650  1.00 0.00 ? 23  MET A HE1  3  
ATOM   2350  H  HE2  . MET A 1 23 ? -2.152  -6.274  -0.194  1.00 0.00 ? 23  MET A HE2  3  
ATOM   2351  H  HE3  . MET A 1 23 ? -0.730  -6.931  -1.006  1.00 0.00 ? 23  MET A HE3  3  
ATOM   2352  N  N    . ASN A 1 24 ? -6.949  -6.998  -5.134  1.00 0.00 ? 24  ASN A N    3  
ATOM   2353  C  CA   . ASN A 1 24 ? -8.207  -7.669  -5.441  1.00 0.00 ? 24  ASN A CA   3  
ATOM   2354  C  C    . ASN A 1 24 ? -9.349  -7.089  -4.611  1.00 0.00 ? 24  ASN A C    3  
ATOM   2355  O  O    . ASN A 1 24 ? -10.174 -7.826  -4.072  1.00 0.00 ? 24  ASN A O    3  
ATOM   2356  C  CB   . ASN A 1 24 ? -8.084  -9.172  -5.181  1.00 0.00 ? 24  ASN A CB   3  
ATOM   2357  C  CG   . ASN A 1 24 ? -7.345  -9.892  -6.292  1.00 0.00 ? 24  ASN A CG   3  
ATOM   2358  O  OD1  . ASN A 1 24 ? -7.824  -9.967  -7.424  1.00 0.00 ? 24  ASN A OD1  3  
ATOM   2359  N  ND2  . ASN A 1 24 ? -6.172  -10.426 -5.972  1.00 0.00 ? 24  ASN A ND2  3  
ATOM   2360  H  H    . ASN A 1 24 ? -6.487  -6.502  -5.842  1.00 0.00 ? 24  ASN A H    3  
ATOM   2361  H  HA   . ASN A 1 24 ? -8.421  -7.510  -6.487  1.00 0.00 ? 24  ASN A HA   3  
ATOM   2362  H  HB2  . ASN A 1 24 ? -7.547  -9.328  -4.257  1.00 0.00 ? 24  ASN A HB2  3  
ATOM   2363  H  HB3  . ASN A 1 24 ? -9.072  -9.598  -5.094  1.00 0.00 ? 24  ASN A HB3  3  
ATOM   2364  H  HD21 . ASN A 1 24 ? -5.854  -10.327 -5.051  1.00 0.00 ? 24  ASN A HD21 3  
ATOM   2365  H  HD22 . ASN A 1 24 ? -5.673  -10.897 -6.672  1.00 0.00 ? 24  ASN A HD22 3  
ATOM   2366  N  N    . ASN A 1 25 ? -9.390  -5.765  -4.514  1.00 0.00 ? 25  ASN A N    3  
ATOM   2367  C  CA   . ASN A 1 25 ? -10.430 -5.086  -3.751  1.00 0.00 ? 25  ASN A CA   3  
ATOM   2368  C  C    . ASN A 1 25 ? -10.460 -3.596  -4.077  1.00 0.00 ? 25  ASN A C    3  
ATOM   2369  O  O    . ASN A 1 25 ? -9.491  -3.044  -4.599  1.00 0.00 ? 25  ASN A O    3  
ATOM   2370  C  CB   . ASN A 1 25 ? -10.204 -5.286  -2.251  1.00 0.00 ? 25  ASN A CB   3  
ATOM   2371  C  CG   . ASN A 1 25 ? -10.591 -6.678  -1.789  1.00 0.00 ? 25  ASN A CG   3  
ATOM   2372  O  OD1  . ASN A 1 25 ? -11.761 -7.058  -1.839  1.00 0.00 ? 25  ASN A OD1  3  
ATOM   2373  N  ND2  . ASN A 1 25 ? -9.607  -7.446  -1.336  1.00 0.00 ? 25  ASN A ND2  3  
ATOM   2374  H  H    . ASN A 1 25 ? -8.704  -5.230  -4.967  1.00 0.00 ? 25  ASN A H    3  
ATOM   2375  H  HA   . ASN A 1 25 ? -11.379 -5.521  -4.024  1.00 0.00 ? 25  ASN A HA   3  
ATOM   2376  H  HB2  . ASN A 1 25 ? -9.159  -5.132  -2.027  1.00 0.00 ? 25  ASN A HB2  3  
ATOM   2377  H  HB3  . ASN A 1 25 ? -10.796 -4.568  -1.704  1.00 0.00 ? 25  ASN A HB3  3  
ATOM   2378  H  HD21 . ASN A 1 25 ? -8.699  -7.077  -1.324  1.00 0.00 ? 25  ASN A HD21 3  
ATOM   2379  H  HD22 . ASN A 1 25 ? -9.829  -8.350  -1.031  1.00 0.00 ? 25  ASN A HD22 3  
ATOM   2380  N  N    . SER A 1 26 ? -11.579 -2.949  -3.765  1.00 0.00 ? 26  SER A N    3  
ATOM   2381  C  CA   . SER A 1 26 ? -11.736 -1.523  -4.028  1.00 0.00 ? 26  SER A CA   3  
ATOM   2382  C  C    . SER A 1 26 ? -11.247 -0.696  -2.843  1.00 0.00 ? 26  SER A C    3  
ATOM   2383  O  O    . SER A 1 26 ? -11.349 -1.119  -1.692  1.00 0.00 ? 26  SER A O    3  
ATOM   2384  C  CB   . SER A 1 26 ? -13.202 -1.197  -4.322  1.00 0.00 ? 26  SER A CB   3  
ATOM   2385  O  OG   . SER A 1 26 ? -14.054 -1.735  -3.327  1.00 0.00 ? 26  SER A OG   3  
ATOM   2386  H  H    . SER A 1 26 ? -12.317 -3.444  -3.351  1.00 0.00 ? 26  SER A H    3  
ATOM   2387  H  HA   . SER A 1 26 ? -11.140 -1.278  -4.894  1.00 0.00 ? 26  SER A HA   3  
ATOM   2388  H  HB2  . SER A 1 26 ? -13.331 -0.125  -4.349  1.00 0.00 ? 26  SER A HB2  3  
ATOM   2389  H  HB3  . SER A 1 26 ? -13.475 -1.616  -5.280  1.00 0.00 ? 26  SER A HB3  3  
ATOM   2390  H  HG   . SER A 1 26 ? -13.783 -1.413  -2.464  1.00 0.00 ? 26  SER A HG   3  
ATOM   2391  N  N    . TRP A 1 27 ? -10.716 0.486   -3.135  1.00 0.00 ? 27  TRP A N    3  
ATOM   2392  C  CA   . TRP A 1 27 ? -10.210 1.374   -2.094  1.00 0.00 ? 27  TRP A CA   3  
ATOM   2393  C  C    . TRP A 1 27 ? -10.340 2.834   -2.515  1.00 0.00 ? 27  TRP A C    3  
ATOM   2394  O  O    . TRP A 1 27 ? -10.665 3.133   -3.664  1.00 0.00 ? 27  TRP A O    3  
ATOM   2395  C  CB   . TRP A 1 27 ? -8.749  1.049   -1.783  1.00 0.00 ? 27  TRP A CB   3  
ATOM   2396  C  CG   . TRP A 1 27 ? -8.473  -0.422  -1.700  1.00 0.00 ? 27  TRP A CG   3  
ATOM   2397  C  CD1  . TRP A 1 27 ? -8.643  -1.345  -2.691  1.00 0.00 ? 27  TRP A CD1  3  
ATOM   2398  C  CD2  . TRP A 1 27 ? -7.980  -1.138  -0.562  1.00 0.00 ? 27  TRP A CD2  3  
ATOM   2399  N  NE1  . TRP A 1 27 ? -8.285  -2.593  -2.239  1.00 0.00 ? 27  TRP A NE1  3  
ATOM   2400  C  CE2  . TRP A 1 27 ? -7.875  -2.492  -0.936  1.00 0.00 ? 27  TRP A CE2  3  
ATOM   2401  C  CE3  . TRP A 1 27 ? -7.616  -0.768  0.735   1.00 0.00 ? 27  TRP A CE3  3  
ATOM   2402  C  CZ2  . TRP A 1 27 ? -7.421  -3.474  -0.058  1.00 0.00 ? 27  TRP A CZ2  3  
ATOM   2403  C  CZ3  . TRP A 1 27 ? -7.167  -1.743  1.605   1.00 0.00 ? 27  TRP A CZ3  3  
ATOM   2404  C  CH2  . TRP A 1 27 ? -7.072  -3.082  1.206   1.00 0.00 ? 27  TRP A CH2  3  
ATOM   2405  H  H    . TRP A 1 27 ? -10.662 0.768   -4.072  1.00 0.00 ? 27  TRP A H    3  
ATOM   2406  H  HA   . TRP A 1 27 ? -10.803 1.214   -1.206  1.00 0.00 ? 27  TRP A HA   3  
ATOM   2407  H  HB2  . TRP A 1 27 ? -8.121  1.462   -2.558  1.00 0.00 ? 27  TRP A HB2  3  
ATOM   2408  H  HB3  . TRP A 1 27 ? -8.483  1.493   -0.834  1.00 0.00 ? 27  TRP A HB3  3  
ATOM   2409  H  HD1  . TRP A 1 27 ? -9.007  -1.115  -3.681  1.00 0.00 ? 27  TRP A HD1  3  
ATOM   2410  H  HE1  . TRP A 1 27 ? -8.318  -3.419  -2.765  1.00 0.00 ? 27  TRP A HE1  3  
ATOM   2411  H  HE3  . TRP A 1 27 ? -7.682  0.260   1.062   1.00 0.00 ? 27  TRP A HE3  3  
ATOM   2412  H  HZ2  . TRP A 1 27 ? -7.342  -4.510  -0.351  1.00 0.00 ? 27  TRP A HZ2  3  
ATOM   2413  H  HZ3  . TRP A 1 27 ? -6.881  -1.475  2.612   1.00 0.00 ? 27  TRP A HZ3  3  
ATOM   2414  H  HH2  . TRP A 1 27 ? -6.716  -3.810  1.918   1.00 0.00 ? 27  TRP A HH2  3  
ATOM   2415  N  N    . HIS A 1 28 ? -10.084 3.741   -1.577  1.00 0.00 ? 28  HIS A N    3  
ATOM   2416  C  CA   . HIS A 1 28 ? -10.172 5.171   -1.851  1.00 0.00 ? 28  HIS A CA   3  
ATOM   2417  C  C    . HIS A 1 28 ? -8.850  5.701   -2.396  1.00 0.00 ? 28  HIS A C    3  
ATOM   2418  O  O    . HIS A 1 28 ? -7.787  5.115   -2.194  1.00 0.00 ? 28  HIS A O    3  
ATOM   2419  C  CB   . HIS A 1 28 ? -10.557 5.932   -0.583  1.00 0.00 ? 28  HIS A CB   3  
ATOM   2420  C  CG   . HIS A 1 28 ? -12.013 5.836   -0.244  1.00 0.00 ? 28  HIS A CG   3  
ATOM   2421  N  ND1  . HIS A 1 28 ? -12.477 5.290   0.934   1.00 0.00 ? 28  HIS A ND1  3  
ATOM   2422  C  CD2  . HIS A 1 28 ? -13.110 6.222   -0.936  1.00 0.00 ? 28  HIS A CD2  3  
ATOM   2423  C  CE1  . HIS A 1 28 ? -13.797 5.342   0.951   1.00 0.00 ? 28  HIS A CE1  3  
ATOM   2424  N  NE2  . HIS A 1 28 ? -14.206 5.904   -0.172  1.00 0.00 ? 28  HIS A NE2  3  
ATOM   2425  H  H    . HIS A 1 28 ? -9.830  3.441   -0.679  1.00 0.00 ? 28  HIS A H    3  
ATOM   2426  H  HA   . HIS A 1 28 ? -10.940 5.319   -2.596  1.00 0.00 ? 28  HIS A HA   3  
ATOM   2427  H  HB2  . HIS A 1 28 ? -9.996  5.536   0.251   1.00 0.00 ? 28  HIS A HB2  3  
ATOM   2428  H  HB3  . HIS A 1 28 ? -10.313 6.978   -0.710  1.00 0.00 ? 28  HIS A HB3  3  
ATOM   2429  H  HD2  . HIS A 1 28 ? -13.122 6.692   -1.909  1.00 0.00 ? 28  HIS A HD2  3  
ATOM   2430  H  HE1  . HIS A 1 28 ? -14.433 4.987   1.747   1.00 0.00 ? 28  HIS A HE1  3  
ATOM   2431  H  HE2  . HIS A 1 28 ? -15.140 5.987   -0.454  1.00 0.00 ? 28  HIS A HE2  3  
ATOM   2432  N  N    . PRO A 1 29 ? -8.915  6.838   -3.106  1.00 0.00 ? 29  PRO A N    3  
ATOM   2433  C  CA   . PRO A 1 29 ? -7.732  7.472   -3.695  1.00 0.00 ? 29  PRO A CA   3  
ATOM   2434  C  C    . PRO A 1 29 ? -6.808  8.069   -2.639  1.00 0.00 ? 29  PRO A C    3  
ATOM   2435  O  O    . PRO A 1 29 ? -5.756  8.620   -2.963  1.00 0.00 ? 29  PRO A O    3  
ATOM   2436  C  CB   . PRO A 1 29 ? -8.323  8.576   -4.575  1.00 0.00 ? 29  PRO A CB   3  
ATOM   2437  C  CG   . PRO A 1 29 ? -9.643  8.887   -3.958  1.00 0.00 ? 29  PRO A CG   3  
ATOM   2438  C  CD   . PRO A 1 29 ? -10.149 7.591   -3.388  1.00 0.00 ? 29  PRO A CD   3  
ATOM   2439  H  HA   . PRO A 1 29 ? -7.175  6.780   -4.309  1.00 0.00 ? 29  PRO A HA   3  
ATOM   2440  H  HB2  . PRO A 1 29 ? -7.669  9.437   -4.565  1.00 0.00 ? 29  PRO A HB2  3  
ATOM   2441  H  HB3  . PRO A 1 29 ? -8.436  8.215   -5.586  1.00 0.00 ? 29  PRO A HB3  3  
ATOM   2442  H  HG2  . PRO A 1 29 ? -9.518  9.619   -3.174  1.00 0.00 ? 29  PRO A HG2  3  
ATOM   2443  H  HG3  . PRO A 1 29 ? -10.323 9.255   -4.712  1.00 0.00 ? 29  PRO A HG3  3  
ATOM   2444  H  HD2  . PRO A 1 29 ? -10.707 7.770   -2.481  1.00 0.00 ? 29  PRO A HD2  3  
ATOM   2445  H  HD3  . PRO A 1 29 ? -10.759 7.073   -4.112  1.00 0.00 ? 29  PRO A HD3  3  
ATOM   2446  N  N    . GLU A 1 30 ? -7.209  7.956   -1.377  1.00 0.00 ? 30  GLU A N    3  
ATOM   2447  C  CA   . GLU A 1 30 ? -6.415  8.486   -0.274  1.00 0.00 ? 30  GLU A CA   3  
ATOM   2448  C  C    . GLU A 1 30 ? -6.101  7.394   0.744   1.00 0.00 ? 30  GLU A C    3  
ATOM   2449  O  O    . GLU A 1 30 ? -5.056  7.418   1.395   1.00 0.00 ? 30  GLU A O    3  
ATOM   2450  C  CB   . GLU A 1 30 ? -7.156  9.637   0.409   1.00 0.00 ? 30  GLU A CB   3  
ATOM   2451  C  CG   . GLU A 1 30 ? -8.394  9.197   1.172   1.00 0.00 ? 30  GLU A CG   3  
ATOM   2452  C  CD   . GLU A 1 30 ? -9.142  10.361  1.793   1.00 0.00 ? 30  GLU A CD   3  
ATOM   2453  O  OE1  . GLU A 1 30 ? -8.498  11.391  2.084   1.00 0.00 ? 30  GLU A OE1  3  
ATOM   2454  O  OE2  . GLU A 1 30 ? -10.369 10.242  1.989   1.00 0.00 ? 30  GLU A OE2  3  
ATOM   2455  H  H    . GLU A 1 30 ? -8.057  7.506   -1.183  1.00 0.00 ? 30  GLU A H    3  
ATOM   2456  H  HA   . GLU A 1 30 ? -5.488  8.859   -0.682  1.00 0.00 ? 30  GLU A HA   3  
ATOM   2457  H  HB2  . GLU A 1 30 ? -6.484  10.121  1.103   1.00 0.00 ? 30  GLU A HB2  3  
ATOM   2458  H  HB3  . GLU A 1 30 ? -7.458  10.352  -0.343  1.00 0.00 ? 30  GLU A HB3  3  
ATOM   2459  H  HG2  . GLU A 1 30 ? -9.058  8.685   0.491   1.00 0.00 ? 30  GLU A HG2  3  
ATOM   2460  H  HG3  . GLU A 1 30 ? -8.095  8.519   1.958   1.00 0.00 ? 30  GLU A HG3  3  
ATOM   2461  N  N    . CYS A 1 31 ? -7.013  6.437   0.877   1.00 0.00 ? 31  CYS A N    3  
ATOM   2462  C  CA   . CYS A 1 31 ? -6.835  5.335   1.815   1.00 0.00 ? 31  CYS A CA   3  
ATOM   2463  C  C    . CYS A 1 31 ? -5.654  4.459   1.409   1.00 0.00 ? 31  CYS A C    3  
ATOM   2464  O  O    . CYS A 1 31 ? -4.685  4.320   2.156   1.00 0.00 ? 31  CYS A O    3  
ATOM   2465  C  CB   . CYS A 1 31 ? -8.109  4.491   1.890   1.00 0.00 ? 31  CYS A CB   3  
ATOM   2466  S  SG   . CYS A 1 31 ? -9.410  5.199   2.950   1.00 0.00 ? 31  CYS A SG   3  
ATOM   2467  H  H    . CYS A 1 31 ? -7.826  6.472   0.330   1.00 0.00 ? 31  CYS A H    3  
ATOM   2468  H  HA   . CYS A 1 31 ? -6.637  5.757   2.789   1.00 0.00 ? 31  CYS A HA   3  
ATOM   2469  H  HB2  . CYS A 1 31 ? -8.518  4.383   0.896   1.00 0.00 ? 31  CYS A HB2  3  
ATOM   2470  H  HB3  . CYS A 1 31 ? -7.862  3.514   2.279   1.00 0.00 ? 31  CYS A HB3  3  
ATOM   2471  N  N    . PHE A 1 32 ? -5.741  3.872   0.220   1.00 0.00 ? 32  PHE A N    3  
ATOM   2472  C  CA   . PHE A 1 32 ? -4.680  3.009   -0.286  1.00 0.00 ? 32  PHE A CA   3  
ATOM   2473  C  C    . PHE A 1 32 ? -3.325  3.705   -0.200  1.00 0.00 ? 32  PHE A C    3  
ATOM   2474  O  O    . PHE A 1 32 ? -2.963  4.492   -1.074  1.00 0.00 ? 32  PHE A O    3  
ATOM   2475  C  CB   . PHE A 1 32 ? -4.968  2.606   -1.733  1.00 0.00 ? 32  PHE A CB   3  
ATOM   2476  C  CG   . PHE A 1 32 ? -4.152  1.437   -2.204  1.00 0.00 ? 32  PHE A CG   3  
ATOM   2477  C  CD1  . PHE A 1 32 ? -4.211  0.222   -1.541  1.00 0.00 ? 32  PHE A CD1  3  
ATOM   2478  C  CD2  . PHE A 1 32 ? -3.325  1.553   -3.311  1.00 0.00 ? 32  PHE A CD2  3  
ATOM   2479  C  CE1  . PHE A 1 32 ? -3.460  -0.856  -1.972  1.00 0.00 ? 32  PHE A CE1  3  
ATOM   2480  C  CE2  . PHE A 1 32 ? -2.572  0.479   -3.746  1.00 0.00 ? 32  PHE A CE2  3  
ATOM   2481  C  CZ   . PHE A 1 32 ? -2.640  -0.727  -3.077  1.00 0.00 ? 32  PHE A CZ   3  
ATOM   2482  H  H    . PHE A 1 32 ? -6.539  4.021   -0.329  1.00 0.00 ? 32  PHE A H    3  
ATOM   2483  H  HA   . PHE A 1 32 ? -4.655  2.121   0.328   1.00 0.00 ? 32  PHE A HA   3  
ATOM   2484  H  HB2  . PHE A 1 32 ? -6.011  2.340   -1.825  1.00 0.00 ? 32  PHE A HB2  3  
ATOM   2485  H  HB3  . PHE A 1 32 ? -4.756  3.443   -2.381  1.00 0.00 ? 32  PHE A HB3  3  
ATOM   2486  H  HD1  . PHE A 1 32 ? -4.852  0.119   -0.678  1.00 0.00 ? 32  PHE A HD1  3  
ATOM   2487  H  HD2  . PHE A 1 32 ? -3.272  2.496   -3.835  1.00 0.00 ? 32  PHE A HD2  3  
ATOM   2488  H  HE1  . PHE A 1 32 ? -3.515  -1.797  -1.447  1.00 0.00 ? 32  PHE A HE1  3  
ATOM   2489  H  HE2  . PHE A 1 32 ? -1.932  0.583   -4.610  1.00 0.00 ? 32  PHE A HE2  3  
ATOM   2490  H  HZ   . PHE A 1 32 ? -2.052  -1.567  -3.415  1.00 0.00 ? 32  PHE A HZ   3  
ATOM   2491  N  N    . ARG A 1 33 ? -2.581  3.410   0.861   1.00 0.00 ? 33  ARG A N    3  
ATOM   2492  C  CA   . ARG A 1 33 ? -1.267  4.008   1.064   1.00 0.00 ? 33  ARG A CA   3  
ATOM   2493  C  C    . ARG A 1 33 ? -0.205  2.931   1.263   1.00 0.00 ? 33  ARG A C    3  
ATOM   2494  O  O    . ARG A 1 33 ? -0.523  1.766   1.504   1.00 0.00 ? 33  ARG A O    3  
ATOM   2495  C  CB   . ARG A 1 33 ? -1.291  4.947   2.271   1.00 0.00 ? 33  ARG A CB   3  
ATOM   2496  C  CG   . ARG A 1 33 ? -2.108  6.208   2.046   1.00 0.00 ? 33  ARG A CG   3  
ATOM   2497  C  CD   . ARG A 1 33 ? -1.790  7.271   3.086   1.00 0.00 ? 33  ARG A CD   3  
ATOM   2498  N  NE   . ARG A 1 33 ? -1.955  8.622   2.557   1.00 0.00 ? 33  ARG A NE   3  
ATOM   2499  C  CZ   . ARG A 1 33 ? -3.084  9.316   2.652   1.00 0.00 ? 33  ARG A CZ   3  
ATOM   2500  N  NH1  . ARG A 1 33 ? -4.141  8.789   3.254   1.00 0.00 ? 33  ARG A NH1  3  
ATOM   2501  N  NH2  . ARG A 1 33 ? -3.156  10.540  2.146   1.00 0.00 ? 33  ARG A NH2  3  
ATOM   2502  H  H    . ARG A 1 33 ? -2.925  2.775   1.525   1.00 0.00 ? 33  ARG A H    3  
ATOM   2503  H  HA   . ARG A 1 33 ? -1.023  4.579   0.180   1.00 0.00 ? 33  ARG A HA   3  
ATOM   2504  H  HB2  . ARG A 1 33 ? -1.711  4.418   3.115   1.00 0.00 ? 33  ARG A HB2  3  
ATOM   2505  H  HB3  . ARG A 1 33 ? -0.278  5.237   2.506   1.00 0.00 ? 33  ARG A HB3  3  
ATOM   2506  H  HG2  . ARG A 1 33 ? -1.883  6.602   1.066   1.00 0.00 ? 33  ARG A HG2  3  
ATOM   2507  H  HG3  . ARG A 1 33 ? -3.158  5.962   2.105   1.00 0.00 ? 33  ARG A HG3  3  
ATOM   2508  H  HD2  . ARG A 1 33 ? -2.454  7.141   3.928   1.00 0.00 ? 33  ARG A HD2  3  
ATOM   2509  H  HD3  . ARG A 1 33 ? -0.768  7.143   3.411   1.00 0.00 ? 33  ARG A HD3  3  
ATOM   2510  H  HE   . ARG A 1 33 ? -1.186  9.031   2.109   1.00 0.00 ? 33  ARG A HE   3  
ATOM   2511  H  HH11 . ARG A 1 33 ? -4.089  7.867   3.637   1.00 0.00 ? 33  ARG A HH11 3  
ATOM   2512  H  HH12 . ARG A 1 33 ? -4.990  9.314   3.325   1.00 0.00 ? 33  ARG A HH12 3  
ATOM   2513  H  HH21 . ARG A 1 33 ? -2.361  10.941  1.692   1.00 0.00 ? 33  ARG A HH21 3  
ATOM   2514  H  HH22 . ARG A 1 33 ? -4.006  11.061  2.218   1.00 0.00 ? 33  ARG A HH22 3  
ATOM   2515  N  N    . CYS A 1 34 ? 1.059   3.329   1.162   1.00 0.00 ? 34  CYS A N    3  
ATOM   2516  C  CA   . CYS A 1 34 ? 2.170   2.399   1.330   1.00 0.00 ? 34  CYS A CA   3  
ATOM   2517  C  C    . CYS A 1 34 ? 2.152   1.778   2.724   1.00 0.00 ? 34  CYS A C    3  
ATOM   2518  O  O    . CYS A 1 34 ? 1.553   2.323   3.651   1.00 0.00 ? 34  CYS A O    3  
ATOM   2519  C  CB   . CYS A 1 34 ? 3.501   3.115   1.096   1.00 0.00 ? 34  CYS A CB   3  
ATOM   2520  S  SG   . CYS A 1 34 ? 4.932   1.996   0.958   1.00 0.00 ? 34  CYS A SG   3  
ATOM   2521  H  H    . CYS A 1 34 ? 1.250   4.271   0.969   1.00 0.00 ? 34  CYS A H    3  
ATOM   2522  H  HA   . CYS A 1 34 ? 2.059   1.614   0.598   1.00 0.00 ? 34  CYS A HA   3  
ATOM   2523  H  HB2  . CYS A 1 34 ? 3.439   3.683   0.179   1.00 0.00 ? 34  CYS A HB2  3  
ATOM   2524  H  HB3  . CYS A 1 34 ? 3.689   3.789   1.918   1.00 0.00 ? 34  CYS A HB3  3  
ATOM   2525  N  N    . ASP A 1 35 ? 2.813   0.634   2.863   1.00 0.00 ? 35  ASP A N    3  
ATOM   2526  C  CA   . ASP A 1 35 ? 2.875   -0.062  4.144   1.00 0.00 ? 35  ASP A CA   3  
ATOM   2527  C  C    . ASP A 1 35 ? 4.217   0.178   4.828   1.00 0.00 ? 35  ASP A C    3  
ATOM   2528  O  O    . ASP A 1 35 ? 4.567   -0.508  5.789   1.00 0.00 ? 35  ASP A O    3  
ATOM   2529  C  CB   . ASP A 1 35 ? 2.651   -1.562  3.944   1.00 0.00 ? 35  ASP A CB   3  
ATOM   2530  C  CG   . ASP A 1 35 ? 1.996   -2.214  5.146   1.00 0.00 ? 35  ASP A CG   3  
ATOM   2531  O  OD1  . ASP A 1 35 ? 0.871   -1.807  5.503   1.00 0.00 ? 35  ASP A OD1  3  
ATOM   2532  O  OD2  . ASP A 1 35 ? 2.609   -3.133  5.729   1.00 0.00 ? 35  ASP A OD2  3  
ATOM   2533  H  H    . ASP A 1 35 ? 3.270   0.248   2.087   1.00 0.00 ? 35  ASP A H    3  
ATOM   2534  H  HA   . ASP A 1 35 ? 2.089   0.329   4.772   1.00 0.00 ? 35  ASP A HA   3  
ATOM   2535  H  HB2  . ASP A 1 35 ? 2.014   -1.714  3.085   1.00 0.00 ? 35  ASP A HB2  3  
ATOM   2536  H  HB3  . ASP A 1 35 ? 3.603   -2.042  3.771   1.00 0.00 ? 35  ASP A HB3  3  
ATOM   2537  N  N    . LEU A 1 36 ? 4.964   1.155   4.326   1.00 0.00 ? 36  LEU A N    3  
ATOM   2538  C  CA   . LEU A 1 36 ? 6.269   1.485   4.889   1.00 0.00 ? 36  LEU A CA   3  
ATOM   2539  C  C    . LEU A 1 36 ? 6.395   2.987   5.126   1.00 0.00 ? 36  LEU A C    3  
ATOM   2540  O  O    . LEU A 1 36 ? 7.006   3.423   6.102   1.00 0.00 ? 36  LEU A O    3  
ATOM   2541  C  CB   . LEU A 1 36 ? 7.384   1.009   3.956   1.00 0.00 ? 36  LEU A CB   3  
ATOM   2542  C  CG   . LEU A 1 36 ? 7.553   -0.505  3.829   1.00 0.00 ? 36  LEU A CG   3  
ATOM   2543  C  CD1  . LEU A 1 36 ? 8.194   -0.862  2.497   1.00 0.00 ? 36  LEU A CD1  3  
ATOM   2544  C  CD2  . LEU A 1 36 ? 8.381   -1.048  4.984   1.00 0.00 ? 36  LEU A CD2  3  
ATOM   2545  H  H    . LEU A 1 36 ? 4.632   1.666   3.560   1.00 0.00 ? 36  LEU A H    3  
ATOM   2546  H  HA   . LEU A 1 36 ? 6.361   0.974   5.836   1.00 0.00 ? 36  LEU A HA   3  
ATOM   2547  H  HB2  . LEU A 1 36 ? 7.181   1.403   2.971   1.00 0.00 ? 36  LEU A HB2  3  
ATOM   2548  H  HB3  . LEU A 1 36 ? 8.316   1.418   4.320   1.00 0.00 ? 36  LEU A HB3  3  
ATOM   2549  H  HG   . LEU A 1 36 ? 6.579   -0.974  3.866   1.00 0.00 ? 36  LEU A HG   3  
ATOM   2550  H  HD11 . LEU A 1 36 ? 7.665   -0.365  1.698   1.00 0.00 ? 36  LEU A HD11 3  
ATOM   2551  H  HD12 . LEU A 1 36 ? 8.148   -1.930  2.350   1.00 0.00 ? 36  LEU A HD12 3  
ATOM   2552  H  HD13 . LEU A 1 36 ? 9.227   -0.543  2.499   1.00 0.00 ? 36  LEU A HD13 3  
ATOM   2553  H  HD21 . LEU A 1 36 ? 7.980   -0.680  5.918   1.00 0.00 ? 36  LEU A HD21 3  
ATOM   2554  H  HD22 . LEU A 1 36 ? 9.405   -0.720  4.878   1.00 0.00 ? 36  LEU A HD22 3  
ATOM   2555  H  HD23 . LEU A 1 36 ? 8.345   -2.127  4.977   1.00 0.00 ? 36  LEU A HD23 3  
ATOM   2556  N  N    . CYS A 1 37 ? 5.812   3.773   4.228   1.00 0.00 ? 37  CYS A N    3  
ATOM   2557  C  CA   . CYS A 1 37 ? 5.857   5.226   4.339   1.00 0.00 ? 37  CYS A CA   3  
ATOM   2558  C  C    . CYS A 1 37 ? 4.450   5.815   4.343   1.00 0.00 ? 37  CYS A C    3  
ATOM   2559  O  O    . CYS A 1 37 ? 4.261   6.995   4.639   1.00 0.00 ? 37  CYS A O    3  
ATOM   2560  C  CB   . CYS A 1 37 ? 6.668   5.822   3.187   1.00 0.00 ? 37  CYS A CB   3  
ATOM   2561  S  SG   . CYS A 1 37 ? 5.933   5.551   1.542   1.00 0.00 ? 37  CYS A SG   3  
ATOM   2562  H  H    . CYS A 1 37 ? 5.340   3.367   3.471   1.00 0.00 ? 37  CYS A H    3  
ATOM   2563  H  HA   . CYS A 1 37 ? 6.340   5.473   5.273   1.00 0.00 ? 37  CYS A HA   3  
ATOM   2564  H  HB2  . CYS A 1 37 ? 6.757   6.889   3.334   1.00 0.00 ? 37  CYS A HB2  3  
ATOM   2565  H  HB3  . CYS A 1 37 ? 7.654   5.381   3.184   1.00 0.00 ? 37  CYS A HB3  3  
ATOM   2566  N  N    . GLN A 1 38 ? 3.466   4.985   4.013   1.00 0.00 ? 38  GLN A N    3  
ATOM   2567  C  CA   . GLN A 1 38 ? 2.076   5.424   3.979   1.00 0.00 ? 38  GLN A CA   3  
ATOM   2568  C  C    . GLN A 1 38 ? 1.866   6.483   2.902   1.00 0.00 ? 38  GLN A C    3  
ATOM   2569  O  O    . GLN A 1 38 ? 1.370   7.574   3.180   1.00 0.00 ? 38  GLN A O    3  
ATOM   2570  C  CB   . GLN A 1 38 ? 1.659   5.977   5.343   1.00 0.00 ? 38  GLN A CB   3  
ATOM   2571  C  CG   . GLN A 1 38 ? 1.897   5.009   6.490   1.00 0.00 ? 38  GLN A CG   3  
ATOM   2572  C  CD   . GLN A 1 38 ? 0.694   4.130   6.771   1.00 0.00 ? 38  GLN A CD   3  
ATOM   2573  O  OE1  . GLN A 1 38 ? -0.244  4.542   7.454   1.00 0.00 ? 38  GLN A OE1  3  
ATOM   2574  N  NE2  . GLN A 1 38 ? 0.715   2.911   6.244   1.00 0.00 ? 38  GLN A NE2  3  
ATOM   2575  H  H    . GLN A 1 38 ? 3.680   4.056   3.788   1.00 0.00 ? 38  GLN A H    3  
ATOM   2576  H  HA   . GLN A 1 38 ? 1.463   4.566   3.746   1.00 0.00 ? 38  GLN A HA   3  
ATOM   2577  H  HB2  . GLN A 1 38 ? 2.220   6.879   5.539   1.00 0.00 ? 38  GLN A HB2  3  
ATOM   2578  H  HB3  . GLN A 1 38 ? 0.607   6.216   5.315   1.00 0.00 ? 38  GLN A HB3  3  
ATOM   2579  H  HG2  . GLN A 1 38 ? 2.736   4.376   6.242   1.00 0.00 ? 38  GLN A HG2  3  
ATOM   2580  H  HG3  . GLN A 1 38 ? 2.126   5.576   7.381   1.00 0.00 ? 38  GLN A HG3  3  
ATOM   2581  H  HE21 . GLN A 1 38 ? 1.497   2.651   5.712   1.00 0.00 ? 38  GLN A HE21 3  
ATOM   2582  H  HE22 . GLN A 1 38 ? -0.049  2.322   6.410   1.00 0.00 ? 38  GLN A HE22 3  
ATOM   2583  N  N    . GLU A 1 39 ? 2.248   6.153   1.672   1.00 0.00 ? 39  GLU A N    3  
ATOM   2584  C  CA   . GLU A 1 39 ? 2.102   7.078   0.554   1.00 0.00 ? 39  GLU A CA   3  
ATOM   2585  C  C    . GLU A 1 39 ? 0.996   6.618   -0.392  1.00 0.00 ? 39  GLU A C    3  
ATOM   2586  O  O    . GLU A 1 39 ? 0.936   5.449   -0.774  1.00 0.00 ? 39  GLU A O    3  
ATOM   2587  C  CB   . GLU A 1 39 ? 3.422   7.201   -0.210  1.00 0.00 ? 39  GLU A CB   3  
ATOM   2588  C  CG   . GLU A 1 39 ? 3.289   7.915   -1.545  1.00 0.00 ? 39  GLU A CG   3  
ATOM   2589  C  CD   . GLU A 1 39 ? 4.587   8.555   -1.997  1.00 0.00 ? 39  GLU A CD   3  
ATOM   2590  O  OE1  . GLU A 1 39 ? 5.057   9.490   -1.315  1.00 0.00 ? 39  GLU A OE1  3  
ATOM   2591  O  OE2  . GLU A 1 39 ? 5.133   8.120   -3.032  1.00 0.00 ? 39  GLU A OE2  3  
ATOM   2592  H  H    . GLU A 1 39 ? 2.637   5.268   1.513   1.00 0.00 ? 39  GLU A H    3  
ATOM   2593  H  HA   . GLU A 1 39 ? 1.837   8.044   0.955   1.00 0.00 ? 39  GLU A HA   3  
ATOM   2594  H  HB2  . GLU A 1 39 ? 4.127   7.748   0.399   1.00 0.00 ? 39  GLU A HB2  3  
ATOM   2595  H  HB3  . GLU A 1 39 ? 3.812   6.211   -0.393  1.00 0.00 ? 39  GLU A HB3  3  
ATOM   2596  H  HG2  . GLU A 1 39 ? 2.979   7.200   -2.292  1.00 0.00 ? 39  GLU A HG2  3  
ATOM   2597  H  HG3  . GLU A 1 39 ? 2.537   8.686   -1.453  1.00 0.00 ? 39  GLU A HG3  3  
ATOM   2598  N  N    . VAL A 1 40 ? 0.121   7.546   -0.765  1.00 0.00 ? 40  VAL A N    3  
ATOM   2599  C  CA   . VAL A 1 40 ? -0.983  7.238   -1.666  1.00 0.00 ? 40  VAL A CA   3  
ATOM   2600  C  C    . VAL A 1 40 ? -0.500  6.445   -2.876  1.00 0.00 ? 40  VAL A C    3  
ATOM   2601  O  O    . VAL A 1 40 ? 0.279   6.944   -3.688  1.00 0.00 ? 40  VAL A O    3  
ATOM   2602  C  CB   . VAL A 1 40 ? -1.685  8.519   -2.153  1.00 0.00 ? 40  VAL A CB   3  
ATOM   2603  C  CG1  . VAL A 1 40 ? -2.829  8.177   -3.095  1.00 0.00 ? 40  VAL A CG1  3  
ATOM   2604  C  CG2  . VAL A 1 40 ? -2.184  9.335   -0.970  1.00 0.00 ? 40  VAL A CG2  3  
ATOM   2605  H  H    . VAL A 1 40 ? 0.221   8.460   -0.428  1.00 0.00 ? 40  VAL A H    3  
ATOM   2606  H  HA   . VAL A 1 40 ? -1.702  6.643   -1.122  1.00 0.00 ? 40  VAL A HA   3  
ATOM   2607  H  HB   . VAL A 1 40 ? -0.967  9.115   -2.697  1.00 0.00 ? 40  VAL A HB   3  
ATOM   2608  H  HG11 . VAL A 1 40 ? -2.434  7.951   -4.074  1.00 0.00 ? 40  VAL A HG11 3  
ATOM   2609  H  HG12 . VAL A 1 40 ? -3.364  7.319   -2.715  1.00 0.00 ? 40  VAL A HG12 3  
ATOM   2610  H  HG13 . VAL A 1 40 ? -3.502  9.019   -3.165  1.00 0.00 ? 40  VAL A HG13 3  
ATOM   2611  H  HG21 . VAL A 1 40 ? -2.500  10.309  -1.313  1.00 0.00 ? 40  VAL A HG21 3  
ATOM   2612  H  HG22 . VAL A 1 40 ? -3.018  8.828   -0.508  1.00 0.00 ? 40  VAL A HG22 3  
ATOM   2613  H  HG23 . VAL A 1 40 ? -1.388  9.448   -0.249  1.00 0.00 ? 40  VAL A HG23 3  
ATOM   2614  N  N    . LEU A 1 41 ? -0.969  5.207   -2.990  1.00 0.00 ? 41  LEU A N    3  
ATOM   2615  C  CA   . LEU A 1 41 ? -0.586  4.344   -4.102  1.00 0.00 ? 41  LEU A CA   3  
ATOM   2616  C  C    . LEU A 1 41 ? -1.713  4.240   -5.124  1.00 0.00 ? 41  LEU A C    3  
ATOM   2617  O  O    . LEU A 1 41 ? -1.902  3.197   -5.750  1.00 0.00 ? 41  LEU A O    3  
ATOM   2618  C  CB   . LEU A 1 41 ? -0.217  2.951   -3.588  1.00 0.00 ? 41  LEU A CB   3  
ATOM   2619  C  CG   . LEU A 1 41 ? 0.487   2.900   -2.231  1.00 0.00 ? 41  LEU A CG   3  
ATOM   2620  C  CD1  . LEU A 1 41 ? 0.351   1.518   -1.611  1.00 0.00 ? 41  LEU A CD1  3  
ATOM   2621  C  CD2  . LEU A 1 41 ? 1.953   3.280   -2.377  1.00 0.00 ? 41  LEU A CD2  3  
ATOM   2622  H  H    . LEU A 1 41 ? -1.587  4.865   -2.311  1.00 0.00 ? 41  LEU A H    3  
ATOM   2623  H  HA   . LEU A 1 41 ? 0.278   4.782   -4.579  1.00 0.00 ? 41  LEU A HA   3  
ATOM   2624  H  HB2  . LEU A 1 41 ? -1.127  2.376   -3.509  1.00 0.00 ? 41  LEU A HB2  3  
ATOM   2625  H  HB3  . LEU A 1 41 ? 0.434   2.492   -4.318  1.00 0.00 ? 41  LEU A HB3  3  
ATOM   2626  H  HG   . LEU A 1 41 ? 0.021   3.612   -1.564  1.00 0.00 ? 41  LEU A HG   3  
ATOM   2627  H  HD11 . LEU A 1 41 ? 1.315   1.187   -1.257  1.00 0.00 ? 41  LEU A HD11 3  
ATOM   2628  H  HD12 . LEU A 1 41 ? -0.018  0.825   -2.353  1.00 0.00 ? 41  LEU A HD12 3  
ATOM   2629  H  HD13 . LEU A 1 41 ? -0.342  1.562   -0.783  1.00 0.00 ? 41  LEU A HD13 3  
ATOM   2630  H  HD21 . LEU A 1 41 ? 2.484   3.018   -1.474  1.00 0.00 ? 41  LEU A HD21 3  
ATOM   2631  H  HD22 . LEU A 1 41 ? 2.034   4.344   -2.547  1.00 0.00 ? 41  LEU A HD22 3  
ATOM   2632  H  HD23 . LEU A 1 41 ? 2.381   2.748   -3.214  1.00 0.00 ? 41  LEU A HD23 3  
ATOM   2633  N  N    . ALA A 1 42 ? -2.457  5.328   -5.289  1.00 0.00 ? 42  ALA A N    3  
ATOM   2634  C  CA   . ALA A 1 42 ? -3.563  5.360   -6.238  1.00 0.00 ? 42  ALA A CA   3  
ATOM   2635  C  C    . ALA A 1 42 ? -3.060  5.593   -7.659  1.00 0.00 ? 42  ALA A C    3  
ATOM   2636  O  O    . ALA A 1 42 ? -3.363  4.821   -8.569  1.00 0.00 ? 42  ALA A O    3  
ATOM   2637  C  CB   . ALA A 1 42 ? -4.563  6.439   -5.847  1.00 0.00 ? 42  ALA A CB   3  
ATOM   2638  H  H    . ALA A 1 42 ? -2.257  6.129   -4.761  1.00 0.00 ? 42  ALA A H    3  
ATOM   2639  H  HA   . ALA A 1 42 ? -4.066  4.405   -6.197  1.00 0.00 ? 42  ALA A HA   3  
ATOM   2640  H  HB1  . ALA A 1 42 ? -5.149  6.097   -5.006  1.00 0.00 ? 42  ALA A HB1  3  
ATOM   2641  H  HB2  . ALA A 1 42 ? -4.033  7.339   -5.575  1.00 0.00 ? 42  ALA A HB2  3  
ATOM   2642  H  HB3  . ALA A 1 42 ? -5.216  6.643   -6.682  1.00 0.00 ? 42  ALA A HB3  3  
ATOM   2643  N  N    . ASP A 1 43 ? -2.291  6.661   -7.842  1.00 0.00 ? 43  ASP A N    3  
ATOM   2644  C  CA   . ASP A 1 43 ? -1.746  6.995   -9.153  1.00 0.00 ? 43  ASP A CA   3  
ATOM   2645  C  C    . ASP A 1 43 ? -0.411  6.292   -9.381  1.00 0.00 ? 43  ASP A C    3  
ATOM   2646  O  O    . ASP A 1 43 ? -0.236  5.575   -10.366 1.00 0.00 ? 43  ASP A O    3  
ATOM   2647  C  CB   . ASP A 1 43 ? -1.569  8.508   -9.285  1.00 0.00 ? 43  ASP A CB   3  
ATOM   2648  C  CG   . ASP A 1 43 ? -1.716  8.986   -10.716 1.00 0.00 ? 43  ASP A CG   3  
ATOM   2649  O  OD1  . ASP A 1 43 ? -2.520  8.388   -11.462 1.00 0.00 ? 43  ASP A OD1  3  
ATOM   2650  O  OD2  . ASP A 1 43 ? -1.028  9.958   -11.090 1.00 0.00 ? 43  ASP A OD2  3  
ATOM   2651  H  H    . ASP A 1 43 ? -2.085  7.238   -7.077  1.00 0.00 ? 43  ASP A H    3  
ATOM   2652  H  HA   . ASP A 1 43 ? -2.448  6.657   -9.900  1.00 0.00 ? 43  ASP A HA   3  
ATOM   2653  H  HB2  . ASP A 1 43 ? -2.315  9.005   -8.681  1.00 0.00 ? 43  ASP A HB2  3  
ATOM   2654  H  HB3  . ASP A 1 43 ? -0.585  8.781   -8.932  1.00 0.00 ? 43  ASP A HB3  3  
ATOM   2655  N  N    . ILE A 1 44 ? 0.528   6.505   -8.465  1.00 0.00 ? 44  ILE A N    3  
ATOM   2656  C  CA   . ILE A 1 44 ? 1.847   5.892   -8.566  1.00 0.00 ? 44  ILE A CA   3  
ATOM   2657  C  C    . ILE A 1 44 ? 1.750   4.371   -8.532  1.00 0.00 ? 44  ILE A C    3  
ATOM   2658  O  O    . ILE A 1 44 ? 2.685   3.670   -8.918  1.00 0.00 ? 44  ILE A O    3  
ATOM   2659  C  CB   . ILE A 1 44 ? 2.775   6.362   -7.431  1.00 0.00 ? 44  ILE A CB   3  
ATOM   2660  C  CG1  . ILE A 1 44 ? 2.246   5.880   -6.078  1.00 0.00 ? 44  ILE A CG1  3  
ATOM   2661  C  CG2  . ILE A 1 44 ? 2.904   7.878   -7.445  1.00 0.00 ? 44  ILE A CG2  3  
ATOM   2662  C  CD1  . ILE A 1 44 ? 3.328   5.704   -5.035  1.00 0.00 ? 44  ILE A CD1  3  
ATOM   2663  H  H    . ILE A 1 44 ? 0.329   7.087   -7.702  1.00 0.00 ? 44  ILE A H    3  
ATOM   2664  H  HA   . ILE A 1 44 ? 2.282   6.194   -9.508  1.00 0.00 ? 44  ILE A HA   3  
ATOM   2665  H  HB   . ILE A 1 44 ? 3.754   5.940   -7.598  1.00 0.00 ? 44  ILE A HB   3  
ATOM   2666  H  HG12 . ILE A 1 44 ? 1.535   6.597   -5.700  1.00 0.00 ? 44  ILE A HG12 3  
ATOM   2667  H  HG13 . ILE A 1 44 ? 1.754   4.927   -6.211  1.00 0.00 ? 44  ILE A HG13 3  
ATOM   2668  H  HG21 . ILE A 1 44 ? 2.436   8.288   -6.561  1.00 0.00 ? 44  ILE A HG21 3  
ATOM   2669  H  HG22 . ILE A 1 44 ? 3.949   8.150   -7.457  1.00 0.00 ? 44  ILE A HG22 3  
ATOM   2670  H  HG23 . ILE A 1 44 ? 2.418   8.273   -8.325  1.00 0.00 ? 44  ILE A HG23 3  
ATOM   2671  H  HD11 . ILE A 1 44 ? 4.273   5.520   -5.523  1.00 0.00 ? 44  ILE A HD11 3  
ATOM   2672  H  HD12 . ILE A 1 44 ? 3.399   6.598   -4.435  1.00 0.00 ? 44  ILE A HD12 3  
ATOM   2673  H  HD13 . ILE A 1 44 ? 3.082   4.864   -4.401  1.00 0.00 ? 44  ILE A HD13 3  
ATOM   2674  N  N    . GLY A 1 45 ? 0.611   3.866   -8.068  1.00 0.00 ? 45  GLY A N    3  
ATOM   2675  C  CA   . GLY A 1 45 ? 0.412   2.430   -7.994  1.00 0.00 ? 45  GLY A CA   3  
ATOM   2676  C  C    . GLY A 1 45 ? 1.140   1.804   -6.821  1.00 0.00 ? 45  GLY A C    3  
ATOM   2677  O  O    . GLY A 1 45 ? 1.849   2.489   -6.084  1.00 0.00 ? 45  GLY A O    3  
ATOM   2678  H  H    . GLY A 1 45 ? -0.100  4.473   -7.774  1.00 0.00 ? 45  GLY A H    3  
ATOM   2679  H  HA2  . GLY A 1 45 ? -0.645  2.229   -7.898  1.00 0.00 ? 45  GLY A HA2  3  
ATOM   2680  H  HA3  . GLY A 1 45 ? 0.772   1.981   -8.908  1.00 0.00 ? 45  GLY A HA3  3  
ATOM   2681  N  N    . PHE A 1 46 ? 0.963   0.499   -6.646  1.00 0.00 ? 46  PHE A N    3  
ATOM   2682  C  CA   . PHE A 1 46 ? 1.607   -0.220  -5.552  1.00 0.00 ? 46  PHE A CA   3  
ATOM   2683  C  C    . PHE A 1 46 ? 2.429   -1.392  -6.081  1.00 0.00 ? 46  PHE A C    3  
ATOM   2684  O  O    . PHE A 1 46 ? 2.358   -1.732  -7.262  1.00 0.00 ? 46  PHE A O    3  
ATOM   2685  C  CB   . PHE A 1 46 ? 0.559   -0.725  -4.559  1.00 0.00 ? 46  PHE A CB   3  
ATOM   2686  C  CG   . PHE A 1 46 ? -0.367  -1.756  -5.137  1.00 0.00 ? 46  PHE A CG   3  
ATOM   2687  C  CD1  . PHE A 1 46 ? -1.360  -1.391  -6.032  1.00 0.00 ? 46  PHE A CD1  3  
ATOM   2688  C  CD2  . PHE A 1 46 ? -0.245  -3.091  -4.784  1.00 0.00 ? 46  PHE A CD2  3  
ATOM   2689  C  CE1  . PHE A 1 46 ? -2.213  -2.338  -6.566  1.00 0.00 ? 46  PHE A CE1  3  
ATOM   2690  C  CE2  . PHE A 1 46 ? -1.096  -4.042  -5.315  1.00 0.00 ? 46  PHE A CE2  3  
ATOM   2691  C  CZ   . PHE A 1 46 ? -2.082  -3.665  -6.206  1.00 0.00 ? 46  PHE A CZ   3  
ATOM   2692  H  H    . PHE A 1 46 ? 0.386   0.007   -7.267  1.00 0.00 ? 46  PHE A H    3  
ATOM   2693  H  HA   . PHE A 1 46 ? 2.267   0.469   -5.048  1.00 0.00 ? 46  PHE A HA   3  
ATOM   2694  H  HB2  . PHE A 1 46 ? 1.060   -1.167  -3.711  1.00 0.00 ? 46  PHE A HB2  3  
ATOM   2695  H  HB3  . PHE A 1 46 ? -0.039  0.109   -4.223  1.00 0.00 ? 46  PHE A HB3  3  
ATOM   2696  H  HD1  . PHE A 1 46 ? -1.464  -0.353  -6.314  1.00 0.00 ? 46  PHE A HD1  3  
ATOM   2697  H  HD2  . PHE A 1 46 ? 0.524   -3.387  -4.086  1.00 0.00 ? 46  PHE A HD2  3  
ATOM   2698  H  HE1  . PHE A 1 46 ? -2.983  -2.040  -7.262  1.00 0.00 ? 46  PHE A HE1  3  
ATOM   2699  H  HE2  . PHE A 1 46 ? -0.991  -5.079  -5.032  1.00 0.00 ? 46  PHE A HE2  3  
ATOM   2700  H  HZ   . PHE A 1 46 ? -2.747  -4.407  -6.623  1.00 0.00 ? 46  PHE A HZ   3  
ATOM   2701  N  N    . VAL A 1 47 ? 3.211   -2.005  -5.197  1.00 0.00 ? 47  VAL A N    3  
ATOM   2702  C  CA   . VAL A 1 47 ? 4.046   -3.139  -5.573  1.00 0.00 ? 47  VAL A CA   3  
ATOM   2703  C  C    . VAL A 1 47 ? 3.920   -4.274  -4.563  1.00 0.00 ? 47  VAL A C    3  
ATOM   2704  O  O    . VAL A 1 47 ? 4.550   -4.252  -3.506  1.00 0.00 ? 47  VAL A O    3  
ATOM   2705  C  CB   . VAL A 1 47 ? 5.527   -2.731  -5.688  1.00 0.00 ? 47  VAL A CB   3  
ATOM   2706  C  CG1  . VAL A 1 47 ? 6.363   -3.893  -6.204  1.00 0.00 ? 47  VAL A CG1  3  
ATOM   2707  C  CG2  . VAL A 1 47 ? 5.676   -1.515  -6.590  1.00 0.00 ? 47  VAL A CG2  3  
ATOM   2708  H  H    . VAL A 1 47 ? 3.225   -1.687  -4.270  1.00 0.00 ? 47  VAL A H    3  
ATOM   2709  H  HA   . VAL A 1 47 ? 3.716   -3.491  -6.540  1.00 0.00 ? 47  VAL A HA   3  
ATOM   2710  H  HB   . VAL A 1 47 ? 5.885   -2.469  -4.703  1.00 0.00 ? 47  VAL A HB   3  
ATOM   2711  H  HG11 . VAL A 1 47 ? 6.915   -3.579  -7.078  1.00 0.00 ? 47  VAL A HG11 3  
ATOM   2712  H  HG12 . VAL A 1 47 ? 7.053   -4.209  -5.435  1.00 0.00 ? 47  VAL A HG12 3  
ATOM   2713  H  HG13 . VAL A 1 47 ? 5.713   -4.715  -6.465  1.00 0.00 ? 47  VAL A HG13 3  
ATOM   2714  H  HG21 . VAL A 1 47 ? 4.708   -1.063  -6.746  1.00 0.00 ? 47  VAL A HG21 3  
ATOM   2715  H  HG22 . VAL A 1 47 ? 6.337   -0.799  -6.123  1.00 0.00 ? 47  VAL A HG22 3  
ATOM   2716  H  HG23 . VAL A 1 47 ? 6.089   -1.819  -7.540  1.00 0.00 ? 47  VAL A HG23 3  
ATOM   2717  N  N    . LYS A 1 48 ? 3.101   -5.266  -4.896  1.00 0.00 ? 48  LYS A N    3  
ATOM   2718  C  CA   . LYS A 1 48 ? 2.892   -6.412  -4.019  1.00 0.00 ? 48  LYS A CA   3  
ATOM   2719  C  C    . LYS A 1 48 ? 4.213   -6.893  -3.428  1.00 0.00 ? 48  LYS A C    3  
ATOM   2720  O  O    . LYS A 1 48 ? 5.215   -7.006  -4.133  1.00 0.00 ? 48  LYS A O    3  
ATOM   2721  C  CB   . LYS A 1 48 ? 2.220   -7.552  -4.788  1.00 0.00 ? 48  LYS A CB   3  
ATOM   2722  C  CG   . LYS A 1 48 ? 0.704   -7.537  -4.696  1.00 0.00 ? 48  LYS A CG   3  
ATOM   2723  C  CD   . LYS A 1 48 ? 0.219   -8.146  -3.392  1.00 0.00 ? 48  LYS A CD   3  
ATOM   2724  C  CE   . LYS A 1 48 ? 0.353   -9.661  -3.399  1.00 0.00 ? 48  LYS A CE   3  
ATOM   2725  N  NZ   . LYS A 1 48 ? -0.743  -10.311 -4.170  1.00 0.00 ? 48  LYS A NZ   3  
ATOM   2726  H  H    . LYS A 1 48 ? 2.626   -5.226  -5.753  1.00 0.00 ? 48  LYS A H    3  
ATOM   2727  H  HA   . LYS A 1 48 ? 2.243   -6.101  -3.215  1.00 0.00 ? 48  LYS A HA   3  
ATOM   2728  H  HB2  . LYS A 1 48 ? 2.498   -7.480  -5.830  1.00 0.00 ? 48  LYS A HB2  3  
ATOM   2729  H  HB3  . LYS A 1 48 ? 2.575   -8.494  -4.394  1.00 0.00 ? 48  LYS A HB3  3  
ATOM   2730  H  HG2  . LYS A 1 48 ? 0.359   -6.516  -4.755  1.00 0.00 ? 48  LYS A HG2  3  
ATOM   2731  H  HG3  . LYS A 1 48 ? 0.297   -8.105  -5.521  1.00 0.00 ? 48  LYS A HG3  3  
ATOM   2732  H  HD2  . LYS A 1 48 ? 0.807   -7.748  -2.578  1.00 0.00 ? 48  LYS A HD2  3  
ATOM   2733  H  HD3  . LYS A 1 48 ? -0.821  -7.886  -3.248  1.00 0.00 ? 48  LYS A HD3  3  
ATOM   2734  H  HE2  . LYS A 1 48 ? 1.300   -9.923  -3.846  1.00 0.00 ? 48  LYS A HE2  3  
ATOM   2735  H  HE3  . LYS A 1 48 ? 0.325   -10.017 -2.380  1.00 0.00 ? 48  LYS A HE3  3  
ATOM   2736  H  HZ1  . LYS A 1 48 ? -1.406  -9.592  -4.523  1.00 0.00 ? 48  LYS A HZ1  3  
ATOM   2737  H  HZ2  . LYS A 1 48 ? -1.261  -10.976 -3.562  1.00 0.00 ? 48  LYS A HZ2  3  
ATOM   2738  H  HZ3  . LYS A 1 48 ? -0.350  -10.832 -4.980  1.00 0.00 ? 48  LYS A HZ3  3  
ATOM   2739  N  N    . ASN A 1 49 ? 4.206   -7.175  -2.129  1.00 0.00 ? 49  ASN A N    3  
ATOM   2740  C  CA   . ASN A 1 49 ? 5.404   -7.645  -1.443  1.00 0.00 ? 49  ASN A CA   3  
ATOM   2741  C  C    . ASN A 1 49 ? 5.063   -8.178  -0.055  1.00 0.00 ? 49  ASN A C    3  
ATOM   2742  O  O    . ASN A 1 49 ? 4.448   -7.483  0.754   1.00 0.00 ? 49  ASN A O    3  
ATOM   2743  C  CB   . ASN A 1 49 ? 6.429   -6.515  -1.330  1.00 0.00 ? 49  ASN A CB   3  
ATOM   2744  C  CG   . ASN A 1 49 ? 7.727   -6.972  -0.693  1.00 0.00 ? 49  ASN A CG   3  
ATOM   2745  O  OD1  . ASN A 1 49 ? 7.872   -8.136  -0.320  1.00 0.00 ? 49  ASN A OD1  3  
ATOM   2746  N  ND2  . ASN A 1 49 ? 8.679   -6.055  -0.565  1.00 0.00 ? 49  ASN A ND2  3  
ATOM   2747  H  H    . ASN A 1 49 ? 3.376   -7.065  -1.620  1.00 0.00 ? 49  ASN A H    3  
ATOM   2748  H  HA   . ASN A 1 49 ? 5.829   -8.446  -2.029  1.00 0.00 ? 49  ASN A HA   3  
ATOM   2749  H  HB2  . ASN A 1 49 ? 6.649   -6.137  -2.318  1.00 0.00 ? 49  ASN A HB2  3  
ATOM   2750  H  HB3  . ASN A 1 49 ? 6.015   -5.719  -0.729  1.00 0.00 ? 49  ASN A HB3  3  
ATOM   2751  H  HD21 . ASN A 1 49 ? 8.493   -5.147  -0.885  1.00 0.00 ? 49  ASN A HD21 3  
ATOM   2752  H  HD22 . ASN A 1 49 ? 9.528   -6.324  -0.157  1.00 0.00 ? 49  ASN A HD22 3  
ATOM   2753  N  N    . ALA A 1 50 ? 5.467   -9.415  0.215   1.00 0.00 ? 50  ALA A N    3  
ATOM   2754  C  CA   . ALA A 1 50 ? 5.206   -10.040 1.505   1.00 0.00 ? 50  ALA A CA   3  
ATOM   2755  C  C    . ALA A 1 50 ? 3.771   -9.791  1.956   1.00 0.00 ? 50  ALA A C    3  
ATOM   2756  O  O    . ALA A 1 50 ? 3.513   -9.547  3.134   1.00 0.00 ? 50  ALA A O    3  
ATOM   2757  C  CB   . ALA A 1 50 ? 6.186   -9.523  2.549   1.00 0.00 ? 50  ALA A CB   3  
ATOM   2758  H  H    . ALA A 1 50 ? 5.953   -9.919  -0.471  1.00 0.00 ? 50  ALA A H    3  
ATOM   2759  H  HA   . ALA A 1 50 ? 5.361   -11.104 1.398   1.00 0.00 ? 50  ALA A HA   3  
ATOM   2760  H  HB1  . ALA A 1 50 ? 5.885   -9.870  3.527   1.00 0.00 ? 50  ALA A HB1  3  
ATOM   2761  H  HB2  . ALA A 1 50 ? 7.176   -9.890  2.326   1.00 0.00 ? 50  ALA A HB2  3  
ATOM   2762  H  HB3  . ALA A 1 50 ? 6.190   -8.444  2.536   1.00 0.00 ? 50  ALA A HB3  3  
ATOM   2763  N  N    . GLY A 1 51 ? 2.839   -9.855  1.009   1.00 0.00 ? 51  GLY A N    3  
ATOM   2764  C  CA   . GLY A 1 51 ? 1.441   -9.634  1.329   1.00 0.00 ? 51  GLY A CA   3  
ATOM   2765  C  C    . GLY A 1 51 ? 1.166   -8.212  1.777   1.00 0.00 ? 51  GLY A C    3  
ATOM   2766  O  O    . GLY A 1 51 ? 0.266   -7.971  2.581   1.00 0.00 ? 51  GLY A O    3  
ATOM   2767  H  H    . GLY A 1 51 ? 3.103   -10.054 0.087   1.00 0.00 ? 51  GLY A H    3  
ATOM   2768  H  HA2  . GLY A 1 51 ? 0.845   -9.846  0.454   1.00 0.00 ? 51  GLY A HA2  3  
ATOM   2769  H  HA3  . GLY A 1 51 ? 1.153   -10.310 2.121   1.00 0.00 ? 51  GLY A HA3  3  
ATOM   2770  N  N    . ARG A 1 52 ? 1.945   -7.269  1.257   1.00 0.00 ? 52  ARG A N    3  
ATOM   2771  C  CA   . ARG A 1 52 ? 1.783   -5.864  1.611   1.00 0.00 ? 52  ARG A CA   3  
ATOM   2772  C  C    . ARG A 1 52 ? 1.946   -4.972  0.384   1.00 0.00 ? 52  ARG A C    3  
ATOM   2773  O  O    . ARG A 1 52 ? 2.745   -5.263  -0.507  1.00 0.00 ? 52  ARG A O    3  
ATOM   2774  C  CB   . ARG A 1 52 ? 2.799   -5.465  2.683   1.00 0.00 ? 52  ARG A CB   3  
ATOM   2775  C  CG   . ARG A 1 52 ? 2.723   -6.316  3.940   1.00 0.00 ? 52  ARG A CG   3  
ATOM   2776  C  CD   . ARG A 1 52 ? 3.976   -6.167  4.790   1.00 0.00 ? 52  ARG A CD   3  
ATOM   2777  N  NE   . ARG A 1 52 ? 4.085   -7.222  5.793   1.00 0.00 ? 52  ARG A NE   3  
ATOM   2778  C  CZ   . ARG A 1 52 ? 4.775   -7.095  6.921   1.00 0.00 ? 52  ARG A CZ   3  
ATOM   2779  N  NH1  . ARG A 1 52 ? 5.413   -5.964  7.188   1.00 0.00 ? 52  ARG A NH1  3  
ATOM   2780  N  NH2  . ARG A 1 52 ? 4.827   -8.100  7.786   1.00 0.00 ? 52  ARG A NH2  3  
ATOM   2781  H  H    . ARG A 1 52 ? 2.646   -7.524  0.621   1.00 0.00 ? 52  ARG A H    3  
ATOM   2782  H  HA   . ARG A 1 52 ? 0.786   -5.734  2.006   1.00 0.00 ? 52  ARG A HA   3  
ATOM   2783  H  HB2  . ARG A 1 52 ? 3.794   -5.558  2.272   1.00 0.00 ? 52  ARG A HB2  3  
ATOM   2784  H  HB3  . ARG A 1 52 ? 2.627   -4.436  2.960   1.00 0.00 ? 52  ARG A HB3  3  
ATOM   2785  H  HG2  . ARG A 1 52 ? 1.868   -6.007  4.522   1.00 0.00 ? 52  ARG A HG2  3  
ATOM   2786  H  HG3  . ARG A 1 52 ? 2.613   -7.352  3.656   1.00 0.00 ? 52  ARG A HG3  3  
ATOM   2787  H  HD2  . ARG A 1 52 ? 4.840   -6.207  4.144   1.00 0.00 ? 52  ARG A HD2  3  
ATOM   2788  H  HD3  . ARG A 1 52 ? 3.943   -5.210  5.289   1.00 0.00 ? 52  ARG A HD3  3  
ATOM   2789  H  HE   . ARG A 1 52 ? 3.621   -8.067  5.617   1.00 0.00 ? 52  ARG A HE   3  
ATOM   2790  H  HH11 . ARG A 1 52 ? 5.374   -5.204  6.539   1.00 0.00 ? 52  ARG A HH11 3  
ATOM   2791  H  HH12 . ARG A 1 52 ? 5.931   -5.870  8.039   1.00 0.00 ? 52  ARG A HH12 3  
ATOM   2792  H  HH21 . ARG A 1 52 ? 4.347   -8.955  7.588   1.00 0.00 ? 52  ARG A HH21 3  
ATOM   2793  H  HH22 . ARG A 1 52 ? 5.347   -8.004  8.634   1.00 0.00 ? 52  ARG A HH22 3  
ATOM   2794  N  N    . HIS A 1 53 ? 1.183   -3.884  0.343   1.00 0.00 ? 53  HIS A N    3  
ATOM   2795  C  CA   . HIS A 1 53 ? 1.243   -2.949  -0.775  1.00 0.00 ? 53  HIS A CA   3  
ATOM   2796  C  C    . HIS A 1 53 ? 2.224   -1.818  -0.485  1.00 0.00 ? 53  HIS A C    3  
ATOM   2797  O  O    . HIS A 1 53 ? 1.974   -0.970  0.374   1.00 0.00 ? 53  HIS A O    3  
ATOM   2798  C  CB   . HIS A 1 53 ? -0.145  -2.376  -1.062  1.00 0.00 ? 53  HIS A CB   3  
ATOM   2799  C  CG   . HIS A 1 53 ? -0.996  -2.224  0.161   1.00 0.00 ? 53  HIS A CG   3  
ATOM   2800  N  ND1  . HIS A 1 53 ? -2.276  -2.726  0.255   1.00 0.00 ? 53  HIS A ND1  3  
ATOM   2801  C  CD2  . HIS A 1 53 ? -0.741  -1.623  1.347   1.00 0.00 ? 53  HIS A CD2  3  
ATOM   2802  C  CE1  . HIS A 1 53 ? -2.774  -2.438  1.444   1.00 0.00 ? 53  HIS A CE1  3  
ATOM   2803  N  NE2  . HIS A 1 53 ? -1.862  -1.770  2.127   1.00 0.00 ? 53  HIS A NE2  3  
ATOM   2804  H  H    . HIS A 1 53 ? 0.565   -3.706  1.083   1.00 0.00 ? 53  HIS A H    3  
ATOM   2805  H  HA   . HIS A 1 53 ? 1.585   -3.492  -1.643  1.00 0.00 ? 53  HIS A HA   3  
ATOM   2806  H  HB2  . HIS A 1 53 ? -0.038  -1.401  -1.514  1.00 0.00 ? 53  HIS A HB2  3  
ATOM   2807  H  HB3  . HIS A 1 53 ? -0.663  -3.031  -1.748  1.00 0.00 ? 53  HIS A HB3  3  
ATOM   2808  H  HD1  . HIS A 1 53 ? -2.751  -3.218  -0.447  1.00 0.00 ? 53  HIS A HD1  3  
ATOM   2809  H  HD2  . HIS A 1 53 ? 0.173   -1.120  1.628   1.00 0.00 ? 53  HIS A HD2  3  
ATOM   2810  H  HE1  . HIS A 1 53 ? -3.758  -2.705  1.799   1.00 0.00 ? 53  HIS A HE1  3  
ATOM   2811  H  HE2  . HIS A 1 53 ? -2.002  -1.362  3.006   1.00 0.00 ? 53  HIS A HE2  3  
ATOM   2812  N  N    . LEU A 1 54 ? 3.340   -1.810  -1.204  1.00 0.00 ? 54  LEU A N    3  
ATOM   2813  C  CA   . LEU A 1 54 ? 4.360   -0.783  -1.024  1.00 0.00 ? 54  LEU A CA   3  
ATOM   2814  C  C    . LEU A 1 54 ? 4.478   0.092   -2.268  1.00 0.00 ? 54  LEU A C    3  
ATOM   2815  O  O    . LEU A 1 54 ? 3.880   -0.199  -3.304  1.00 0.00 ? 54  LEU A O    3  
ATOM   2816  C  CB   . LEU A 1 54 ? 5.711   -1.427  -0.710  1.00 0.00 ? 54  LEU A CB   3  
ATOM   2817  C  CG   . LEU A 1 54 ? 5.663   -2.746  0.061   1.00 0.00 ? 54  LEU A CG   3  
ATOM   2818  C  CD1  . LEU A 1 54 ? 7.017   -3.437  0.023   1.00 0.00 ? 54  LEU A CD1  3  
ATOM   2819  C  CD2  . LEU A 1 54 ? 5.224   -2.508  1.499   1.00 0.00 ? 54  LEU A CD2  3  
ATOM   2820  H  H    . LEU A 1 54 ? 3.483   -2.511  -1.873  1.00 0.00 ? 54  LEU A H    3  
ATOM   2821  H  HA   . LEU A 1 54 ? 4.063   -0.164  -0.190  1.00 0.00 ? 54  LEU A HA   3  
ATOM   2822  H  HB2  . LEU A 1 54 ? 6.216   -1.610  -1.646  1.00 0.00 ? 54  LEU A HB2  3  
ATOM   2823  H  HB3  . LEU A 1 54 ? 6.285   -0.722  -0.126  1.00 0.00 ? 54  LEU A HB3  3  
ATOM   2824  H  HG   . LEU A 1 54 ? 4.941   -3.402  -0.405  1.00 0.00 ? 54  LEU A HG   3  
ATOM   2825  H  HD11 . LEU A 1 54 ? 7.342   -3.535  -1.002  1.00 0.00 ? 54  LEU A HD11 3  
ATOM   2826  H  HD12 . LEU A 1 54 ? 6.934   -4.417  0.470   1.00 0.00 ? 54  LEU A HD12 3  
ATOM   2827  H  HD13 . LEU A 1 54 ? 7.737   -2.850  0.575   1.00 0.00 ? 54  LEU A HD13 3  
ATOM   2828  H  HD21 . LEU A 1 54 ? 4.522   -1.688  1.529   1.00 0.00 ? 54  LEU A HD21 3  
ATOM   2829  H  HD22 . LEU A 1 54 ? 6.087   -2.264  2.103   1.00 0.00 ? 54  LEU A HD22 3  
ATOM   2830  H  HD23 . LEU A 1 54 ? 4.754   -3.400  1.885   1.00 0.00 ? 54  LEU A HD23 3  
ATOM   2831  N  N    . CYS A 1 55 ? 5.254   1.165   -2.159  1.00 0.00 ? 55  CYS A N    3  
ATOM   2832  C  CA   . CYS A 1 55 ? 5.452   2.083   -3.275  1.00 0.00 ? 55  CYS A CA   3  
ATOM   2833  C  C    . CYS A 1 55 ? 6.812   1.856   -3.930  1.00 0.00 ? 55  CYS A C    3  
ATOM   2834  O  O    . CYS A 1 55 ? 7.770   1.451   -3.271  1.00 0.00 ? 55  CYS A O    3  
ATOM   2835  C  CB   . CYS A 1 55 ? 5.339   3.532   -2.797  1.00 0.00 ? 55  CYS A CB   3  
ATOM   2836  S  SG   . CYS A 1 55 ? 6.694   4.061   -1.699  1.00 0.00 ? 55  CYS A SG   3  
ATOM   2837  H  H    . CYS A 1 55 ? 5.705   1.345   -1.307  1.00 0.00 ? 55  CYS A H    3  
ATOM   2838  H  HA   . CYS A 1 55 ? 4.679   1.892   -4.003  1.00 0.00 ? 55  CYS A HA   3  
ATOM   2839  H  HB2  . CYS A 1 55 ? 5.339   4.187   -3.656  1.00 0.00 ? 55  CYS A HB2  3  
ATOM   2840  H  HB3  . CYS A 1 55 ? 4.412   3.654   -2.257  1.00 0.00 ? 55  CYS A HB3  3  
ATOM   2841  N  N    . ARG A 1 56 ? 6.887   2.120   -5.230  1.00 0.00 ? 56  ARG A N    3  
ATOM   2842  C  CA   . ARG A 1 56 ? 8.128   1.945   -5.975  1.00 0.00 ? 56  ARG A CA   3  
ATOM   2843  C  C    . ARG A 1 56 ? 9.335   2.307   -5.114  1.00 0.00 ? 56  ARG A C    3  
ATOM   2844  O  O    . ARG A 1 56 ? 10.278  1.530   -4.967  1.00 0.00 ? 56  ARG A O    3  
ATOM   2845  C  CB   . ARG A 1 56 ? 8.114   2.804   -7.240  1.00 0.00 ? 56  ARG A CB   3  
ATOM   2846  C  CG   . ARG A 1 56 ? 7.745   2.032   -8.497  1.00 0.00 ? 56  ARG A CG   3  
ATOM   2847  C  CD   . ARG A 1 56 ? 6.262   1.698   -8.530  1.00 0.00 ? 56  ARG A CD   3  
ATOM   2848  N  NE   . ARG A 1 56 ? 5.445   2.867   -8.844  1.00 0.00 ? 56  ARG A NE   3  
ATOM   2849  C  CZ   . ARG A 1 56 ? 5.418   3.446   -10.040 1.00 0.00 ? 56  ARG A CZ   3  
ATOM   2850  N  NH1  . ARG A 1 56 ? 6.158   2.965   -11.029 1.00 0.00 ? 56  ARG A NH1  3  
ATOM   2851  N  NH2  . ARG A 1 56 ? 4.648   4.506   -10.248 1.00 0.00 ? 56  ARG A NH2  3  
ATOM   2852  H  H    . ARG A 1 56 ? 6.089   2.440   -5.700  1.00 0.00 ? 56  ARG A H    3  
ATOM   2853  H  HA   . ARG A 1 56 ? 8.201   0.905   -6.257  1.00 0.00 ? 56  ARG A HA   3  
ATOM   2854  H  HB2  . ARG A 1 56 ? 7.398   3.602   -7.112  1.00 0.00 ? 56  ARG A HB2  3  
ATOM   2855  H  HB3  . ARG A 1 56 ? 9.096   3.231   -7.382  1.00 0.00 ? 56  ARG A HB3  3  
ATOM   2856  H  HG2  . ARG A 1 56 ? 7.987   2.633   -9.361  1.00 0.00 ? 56  ARG A HG2  3  
ATOM   2857  H  HG3  . ARG A 1 56 ? 8.313   1.114   -8.524  1.00 0.00 ? 56  ARG A HG3  3  
ATOM   2858  H  HD2  . ARG A 1 56 ? 6.094   0.941   -9.282  1.00 0.00 ? 56  ARG A HD2  3  
ATOM   2859  H  HD3  . ARG A 1 56 ? 5.971   1.316   -7.563  1.00 0.00 ? 56  ARG A HD3  3  
ATOM   2860  H  HE   . ARG A 1 56 ? 4.890   3.239   -8.127  1.00 0.00 ? 56  ARG A HE   3  
ATOM   2861  H  HH11 . ARG A 1 56 ? 6.738   2.166   -10.875 1.00 0.00 ? 56  ARG A HH11 3  
ATOM   2862  H  HH12 . ARG A 1 56 ? 6.135   3.402   -11.929 1.00 0.00 ? 56  ARG A HH12 3  
ATOM   2863  H  HH21 . ARG A 1 56 ? 4.088   4.871   -9.504  1.00 0.00 ? 56  ARG A HH21 3  
ATOM   2864  H  HH22 . ARG A 1 56 ? 4.628   4.941   -11.148 1.00 0.00 ? 56  ARG A HH22 3  
ATOM   2865  N  N    . PRO A 1 57 ? 9.305   3.515   -4.532  1.00 0.00 ? 57  PRO A N    3  
ATOM   2866  C  CA   . PRO A 1 57 ? 10.389  4.008   -3.676  1.00 0.00 ? 57  PRO A CA   3  
ATOM   2867  C  C    . PRO A 1 57 ? 10.816  2.981   -2.633  1.00 0.00 ? 57  PRO A C    3  
ATOM   2868  O  O    . PRO A 1 57 ? 11.962  2.529   -2.626  1.00 0.00 ? 57  PRO A O    3  
ATOM   2869  C  CB   . PRO A 1 57 ? 9.775   5.235   -2.998  1.00 0.00 ? 57  PRO A CB   3  
ATOM   2870  C  CG   . PRO A 1 57 ? 8.721   5.702   -3.942  1.00 0.00 ? 57  PRO A CG   3  
ATOM   2871  C  CD   . PRO A 1 57 ? 8.212   4.492   -4.664  1.00 0.00 ? 57  PRO A CD   3  
ATOM   2872  H  HA   . PRO A 1 57 ? 11.248  4.308   -4.258  1.00 0.00 ? 57  PRO A HA   3  
ATOM   2873  H  HB2  . PRO A 1 57 ? 9.353   4.949   -2.045  1.00 0.00 ? 57  PRO A HB2  3  
ATOM   2874  H  HB3  . PRO A 1 57 ? 10.535  5.987   -2.851  1.00 0.00 ? 57  PRO A HB3  3  
ATOM   2875  H  HG2  . PRO A 1 57 ? 7.916   6.167   -3.394  1.00 0.00 ? 57  PRO A HG2  3  
ATOM   2876  H  HG3  . PRO A 1 57 ? 9.146   6.398   -4.650  1.00 0.00 ? 57  PRO A HG3  3  
ATOM   2877  H  HD2  . PRO A 1 57 ? 7.311   4.129   -4.193  1.00 0.00 ? 57  PRO A HD2  3  
ATOM   2878  H  HD3  . PRO A 1 57 ? 8.029   4.727   -5.702  1.00 0.00 ? 57  PRO A HD3  3  
ATOM   2879  N  N    . CYS A 1 58 ? 9.889   2.616   -1.754  1.00 0.00 ? 58  CYS A N    3  
ATOM   2880  C  CA   . CYS A 1 58 ? 10.169  1.642   -0.706  1.00 0.00 ? 58  CYS A CA   3  
ATOM   2881  C  C    . CYS A 1 58 ? 10.548  0.291   -1.306  1.00 0.00 ? 58  CYS A C    3  
ATOM   2882  O  O    . CYS A 1 58 ? 11.685  -0.163  -1.175  1.00 0.00 ? 58  CYS A O    3  
ATOM   2883  C  CB   . CYS A 1 58 ? 8.954   1.483   0.210   1.00 0.00 ? 58  CYS A CB   3  
ATOM   2884  S  SG   . CYS A 1 58 ? 8.493   3.003   1.102   1.00 0.00 ? 58  CYS A SG   3  
ATOM   2885  H  H    . CYS A 1 58 ? 8.993   3.011   -1.811  1.00 0.00 ? 58  CYS A H    3  
ATOM   2886  H  HA   . CYS A 1 58 ? 11.002  2.010   -0.125  1.00 0.00 ? 58  CYS A HA   3  
ATOM   2887  H  HB2  . CYS A 1 58 ? 8.103   1.180   -0.383  1.00 0.00 ? 58  CYS A HB2  3  
ATOM   2888  H  HB3  . CYS A 1 58 ? 9.164   0.720   0.945   1.00 0.00 ? 58  CYS A HB3  3  
ATOM   2889  N  N    . HIS A 1 59 ? 9.586   -0.348  -1.966  1.00 0.00 ? 59  HIS A N    3  
ATOM   2890  C  CA   . HIS A 1 59 ? 9.818   -1.647  -2.587  1.00 0.00 ? 59  HIS A CA   3  
ATOM   2891  C  C    . HIS A 1 59 ? 11.200  -1.701  -3.233  1.00 0.00 ? 59  HIS A C    3  
ATOM   2892  O  O    . HIS A 1 59 ? 11.945  -2.662  -3.046  1.00 0.00 ? 59  HIS A O    3  
ATOM   2893  C  CB   . HIS A 1 59 ? 8.742   -1.935  -3.634  1.00 0.00 ? 59  HIS A CB   3  
ATOM   2894  C  CG   . HIS A 1 59 ? 8.959   -3.214  -4.381  1.00 0.00 ? 59  HIS A CG   3  
ATOM   2895  N  ND1  . HIS A 1 59 ? 8.718   -4.456  -3.832  1.00 0.00 ? 59  HIS A ND1  3  
ATOM   2896  C  CD2  . HIS A 1 59 ? 9.397   -3.440  -5.642  1.00 0.00 ? 59  HIS A CD2  3  
ATOM   2897  C  CE1  . HIS A 1 59 ? 9.000   -5.391  -4.723  1.00 0.00 ? 59  HIS A CE1  3  
ATOM   2898  N  NE2  . HIS A 1 59 ? 9.413   -4.800  -5.830  1.00 0.00 ? 59  HIS A NE2  3  
ATOM   2899  H  H    . HIS A 1 59 ? 8.700   0.065   -2.036  1.00 0.00 ? 59  HIS A H    3  
ATOM   2900  H  HA   . HIS A 1 59 ? 9.766   -2.398  -1.814  1.00 0.00 ? 59  HIS A HA   3  
ATOM   2901  H  HB2  . HIS A 1 59 ? 7.781   -1.996  -3.145  1.00 0.00 ? 59  HIS A HB2  3  
ATOM   2902  H  HB3  . HIS A 1 59 ? 8.723   -1.129  -4.353  1.00 0.00 ? 59  HIS A HB3  3  
ATOM   2903  H  HD1  . HIS A 1 59 ? 8.392   -4.627  -2.925  1.00 0.00 ? 59  HIS A HD1  3  
ATOM   2904  H  HD2  . HIS A 1 59 ? 9.681   -2.690  -6.366  1.00 0.00 ? 59  HIS A HD2  3  
ATOM   2905  H  HE1  . HIS A 1 59 ? 8.908   -6.456  -4.572  1.00 0.00 ? 59  HIS A HE1  3  
ATOM   2906  H  HE2  . HIS A 1 59 ? 9.767   -5.263  -6.617  1.00 0.00 ? 59  HIS A HE2  3  
ATOM   2907  N  N    . ASN A 1 60 ? 11.533  -0.664  -3.994  1.00 0.00 ? 60  ASN A N    3  
ATOM   2908  C  CA   . ASN A 1 60 ? 12.824  -0.595  -4.668  1.00 0.00 ? 60  ASN A CA   3  
ATOM   2909  C  C    . ASN A 1 60 ? 13.967  -0.605  -3.658  1.00 0.00 ? 60  ASN A C    3  
ATOM   2910  O  O    . ASN A 1 60 ? 15.019  -1.197  -3.901  1.00 0.00 ? 60  ASN A O    3  
ATOM   2911  C  CB   . ASN A 1 60 ? 12.905  0.665   -5.533  1.00 0.00 ? 60  ASN A CB   3  
ATOM   2912  C  CG   . ASN A 1 60 ? 12.160  0.515   -6.845  1.00 0.00 ? 60  ASN A CG   3  
ATOM   2913  O  OD1  . ASN A 1 60 ? 12.327  -0.476  -7.556  1.00 0.00 ? 60  ASN A OD1  3  
ATOM   2914  N  ND2  . ASN A 1 60 ? 11.333  1.501   -7.172  1.00 0.00 ? 60  ASN A ND2  3  
ATOM   2915  H  H    . ASN A 1 60 ? 10.896  0.072   -4.105  1.00 0.00 ? 60  ASN A H    3  
ATOM   2916  H  HA   . ASN A 1 60 ? 12.913  -1.463  -5.304  1.00 0.00 ? 60  ASN A HA   3  
ATOM   2917  H  HB2  . ASN A 1 60 ? 12.474  1.495   -4.990  1.00 0.00 ? 60  ASN A HB2  3  
ATOM   2918  H  HB3  . ASN A 1 60 ? 13.940  0.881   -5.749  1.00 0.00 ? 60  ASN A HB3  3  
ATOM   2919  H  HD21 . ASN A 1 60 ? 11.251  2.260   -6.558  1.00 0.00 ? 60  ASN A HD21 3  
ATOM   2920  H  HD22 . ASN A 1 60 ? 10.839  1.429   -8.015  1.00 0.00 ? 60  ASN A HD22 3  
ATOM   2921  N  N    . ARG A 1 61 ? 13.753  0.053   -2.523  1.00 0.00 ? 61  ARG A N    3  
ATOM   2922  C  CA   . ARG A 1 61 ? 14.765  0.119   -1.476  1.00 0.00 ? 61  ARG A CA   3  
ATOM   2923  C  C    . ARG A 1 61 ? 15.030  -1.263  -0.887  1.00 0.00 ? 61  ARG A C    3  
ATOM   2924  O  O    . ARG A 1 61 ? 16.181  -1.657  -0.699  1.00 0.00 ? 61  ARG A O    3  
ATOM   2925  C  CB   . ARG A 1 61 ? 14.322  1.079   -0.370  1.00 0.00 ? 61  ARG A CB   3  
ATOM   2926  C  CG   . ARG A 1 61 ? 14.394  2.544   -0.770  1.00 0.00 ? 61  ARG A CG   3  
ATOM   2927  C  CD   . ARG A 1 61 ? 13.624  3.425   0.201   1.00 0.00 ? 61  ARG A CD   3  
ATOM   2928  N  NE   . ARG A 1 61 ? 13.870  4.845   -0.035  1.00 0.00 ? 61  ARG A NE   3  
ATOM   2929  C  CZ   . ARG A 1 61 ? 13.617  5.793   0.860   1.00 0.00 ? 61  ARG A CZ   3  
ATOM   2930  N  NH1  . ARG A 1 61 ? 13.112  5.475   2.044   1.00 0.00 ? 61  ARG A NH1  3  
ATOM   2931  N  NH2  . ARG A 1 61 ? 13.869  7.064   0.571   1.00 0.00 ? 61  ARG A NH2  3  
ATOM   2932  H  H    . ARG A 1 61 ? 12.894  0.505   -2.387  1.00 0.00 ? 61  ARG A H    3  
ATOM   2933  H  HA   . ARG A 1 61 ? 15.677  0.490   -1.919  1.00 0.00 ? 61  ARG A HA   3  
ATOM   2934  H  HB2  . ARG A 1 61 ? 13.301  0.853   -0.099  1.00 0.00 ? 61  ARG A HB2  3  
ATOM   2935  H  HB3  . ARG A 1 61 ? 14.956  0.933   0.492   1.00 0.00 ? 61  ARG A HB3  3  
ATOM   2936  H  HG2  . ARG A 1 61 ? 15.428  2.855   -0.778  1.00 0.00 ? 61  ARG A HG2  3  
ATOM   2937  H  HG3  . ARG A 1 61 ? 13.974  2.658   -1.758  1.00 0.00 ? 61  ARG A HG3  3  
ATOM   2938  H  HD2  . ARG A 1 61 ? 12.568  3.229   0.084   1.00 0.00 ? 61  ARG A HD2  3  
ATOM   2939  H  HD3  . ARG A 1 61 ? 13.926  3.179   1.207   1.00 0.00 ? 61  ARG A HD3  3  
ATOM   2940  H  HE   . ARG A 1 61 ? 14.243  5.103   -0.903  1.00 0.00 ? 61  ARG A HE   3  
ATOM   2941  H  HH11 . ARG A 1 61 ? 12.922  4.518   2.264   1.00 0.00 ? 61  ARG A HH11 3  
ATOM   2942  H  HH12 . ARG A 1 61 ? 12.923  6.191   2.716   1.00 0.00 ? 61  ARG A HH12 3  
ATOM   2943  H  HH21 . ARG A 1 61 ? 14.249  7.308   -0.320  1.00 0.00 ? 61  ARG A HH21 3  
ATOM   2944  H  HH22 . ARG A 1 61 ? 13.677  7.777   1.245   1.00 0.00 ? 61  ARG A HH22 3  
ATOM   2945  N  N    . GLU A 1 62 ? 13.958  -1.994  -0.599  1.00 0.00 ? 62  GLU A N    3  
ATOM   2946  C  CA   . GLU A 1 62 ? 14.076  -3.332  -0.031  1.00 0.00 ? 62  GLU A CA   3  
ATOM   2947  C  C    . GLU A 1 62 ? 14.626  -4.314  -1.062  1.00 0.00 ? 62  GLU A C    3  
ATOM   2948  O  O    . GLU A 1 62 ? 15.689  -4.904  -0.870  1.00 0.00 ? 62  GLU A O    3  
ATOM   2949  C  CB   . GLU A 1 62 ? 12.717  -3.816  0.477   1.00 0.00 ? 62  GLU A CB   3  
ATOM   2950  C  CG   . GLU A 1 62 ? 11.959  -2.771  1.278   1.00 0.00 ? 62  GLU A CG   3  
ATOM   2951  C  CD   . GLU A 1 62 ? 12.276  -2.827  2.759   1.00 0.00 ? 62  GLU A CD   3  
ATOM   2952  O  OE1  . GLU A 1 62 ? 12.164  -3.922  3.350   1.00 0.00 ? 62  GLU A OE1  3  
ATOM   2953  O  OE2  . GLU A 1 62 ? 12.637  -1.776  3.328   1.00 0.00 ? 62  GLU A OE2  3  
ATOM   2954  H  H    . GLU A 1 62 ? 13.067  -1.625  -0.772  1.00 0.00 ? 62  GLU A H    3  
ATOM   2955  H  HA   . GLU A 1 62 ? 14.763  -3.280  0.800   1.00 0.00 ? 62  GLU A HA   3  
ATOM   2956  H  HB2  . GLU A 1 62 ? 12.110  -4.102  -0.370  1.00 0.00 ? 62  GLU A HB2  3  
ATOM   2957  H  HB3  . GLU A 1 62 ? 12.869  -4.681  1.107   1.00 0.00 ? 62  GLU A HB3  3  
ATOM   2958  H  HG2  . GLU A 1 62 ? 12.221  -1.792  0.906   1.00 0.00 ? 62  GLU A HG2  3  
ATOM   2959  H  HG3  . GLU A 1 62 ? 10.899  -2.933  1.145   1.00 0.00 ? 62  GLU A HG3  3  
ATOM   2960  N  N    . LYS A 1 63 ? 13.892  -4.486  -2.156  1.00 0.00 ? 63  LYS A N    3  
ATOM   2961  C  CA   . LYS A 1 63 ? 14.304  -5.395  -3.219  1.00 0.00 ? 63  LYS A CA   3  
ATOM   2962  C  C    . LYS A 1 63 ? 15.746  -5.126  -3.637  1.00 0.00 ? 63  LYS A C    3  
ATOM   2963  O  O    . LYS A 1 63 ? 16.497  -6.052  -3.940  1.00 0.00 ? 63  LYS A O    3  
ATOM   2964  C  CB   . LYS A 1 63 ? 13.376  -5.253  -4.428  1.00 0.00 ? 63  LYS A CB   3  
ATOM   2965  C  CG   . LYS A 1 63 ? 13.714  -4.070  -5.319  1.00 0.00 ? 63  LYS A CG   3  
ATOM   2966  C  CD   . LYS A 1 63 ? 12.678  -3.884  -6.414  1.00 0.00 ? 63  LYS A CD   3  
ATOM   2967  C  CE   . LYS A 1 63 ? 12.912  -4.843  -7.572  1.00 0.00 ? 63  LYS A CE   3  
ATOM   2968  N  NZ   . LYS A 1 63 ? 13.882  -4.293  -8.559  1.00 0.00 ? 63  LYS A NZ   3  
ATOM   2969  H  H    . LYS A 1 63 ? 13.053  -3.988  -2.252  1.00 0.00 ? 63  LYS A H    3  
ATOM   2970  H  HA   . LYS A 1 63 ? 14.234  -6.403  -2.839  1.00 0.00 ? 63  LYS A HA   3  
ATOM   2971  H  HB2  . LYS A 1 63 ? 13.438  -6.154  -5.021  1.00 0.00 ? 63  LYS A HB2  3  
ATOM   2972  H  HB3  . LYS A 1 63 ? 12.362  -5.134  -4.076  1.00 0.00 ? 63  LYS A HB3  3  
ATOM   2973  H  HG2  . LYS A 1 63 ? 13.749  -3.176  -4.715  1.00 0.00 ? 63  LYS A HG2  3  
ATOM   2974  H  HG3  . LYS A 1 63 ? 14.680  -4.238  -5.773  1.00 0.00 ? 63  LYS A HG3  3  
ATOM   2975  H  HD2  . LYS A 1 63 ? 11.696  -4.066  -6.004  1.00 0.00 ? 63  LYS A HD2  3  
ATOM   2976  H  HD3  . LYS A 1 63 ? 12.734  -2.869  -6.782  1.00 0.00 ? 63  LYS A HD3  3  
ATOM   2977  H  HE2  . LYS A 1 63 ? 13.297  -5.772  -7.180  1.00 0.00 ? 63  LYS A HE2  3  
ATOM   2978  H  HE3  . LYS A 1 63 ? 11.970  -5.024  -8.068  1.00 0.00 ? 63  LYS A HE3  3  
ATOM   2979  H  HZ1  . LYS A 1 63 ? 14.625  -4.994  -8.757  1.00 0.00 ? 63  LYS A HZ1  3  
ATOM   2980  H  HZ2  . LYS A 1 63 ? 14.326  -3.432  -8.183  1.00 0.00 ? 63  LYS A HZ2  3  
ATOM   2981  H  HZ3  . LYS A 1 63 ? 13.395  -4.060  -9.448  1.00 0.00 ? 63  LYS A HZ3  3  
ATOM   2982  N  N    . ALA A 1 64 ? 16.125  -3.852  -3.651  1.00 0.00 ? 64  ALA A N    3  
ATOM   2983  C  CA   . ALA A 1 64 ? 17.478  -3.462  -4.028  1.00 0.00 ? 64  ALA A CA   3  
ATOM   2984  C  C    . ALA A 1 64 ? 18.494  -4.512  -3.593  1.00 0.00 ? 64  ALA A C    3  
ATOM   2985  O  O    . ALA A 1 64 ? 18.622  -4.811  -2.405  1.00 0.00 ? 64  ALA A O    3  
ATOM   2986  C  CB   . ALA A 1 64 ? 17.824  -2.108  -3.426  1.00 0.00 ? 64  ALA A CB   3  
ATOM   2987  H  H    . ALA A 1 64 ? 15.480  -3.159  -3.399  1.00 0.00 ? 64  ALA A H    3  
ATOM   2988  H  HA   . ALA A 1 64 ? 17.510  -3.369  -5.104  1.00 0.00 ? 64  ALA A HA   3  
ATOM   2989  H  HB1  . ALA A 1 64 ? 17.067  -1.831  -2.707  1.00 0.00 ? 64  ALA A HB1  3  
ATOM   2990  H  HB2  . ALA A 1 64 ? 18.784  -2.168  -2.935  1.00 0.00 ? 64  ALA A HB2  3  
ATOM   2991  H  HB3  . ALA A 1 64 ? 17.866  -1.366  -4.209  1.00 0.00 ? 64  ALA A HB3  3  
ATOM   2992  N  N    . SER A 1 65 ? 19.214  -5.070  -4.561  1.00 0.00 ? 65  SER A N    3  
ATOM   2993  C  CA   . SER A 1 65 ? 20.216  -6.091  -4.278  1.00 0.00 ? 65  SER A CA   3  
ATOM   2994  C  C    . SER A 1 65 ? 19.562  -7.357  -3.731  1.00 0.00 ? 65  SER A C    3  
ATOM   2995  O  O    . SER A 1 65 ? 20.070  -7.978  -2.799  1.00 0.00 ? 65  SER A O    3  
ATOM   2996  C  CB   . SER A 1 65 ? 21.245  -5.562  -3.277  1.00 0.00 ? 65  SER A CB   3  
ATOM   2997  O  OG   . SER A 1 65 ? 22.270  -6.513  -3.048  1.00 0.00 ? 65  SER A OG   3  
ATOM   2998  H  H    . SER A 1 65 ? 19.065  -4.790  -5.488  1.00 0.00 ? 65  SER A H    3  
ATOM   2999  H  HA   . SER A 1 65 ? 20.717  -6.330  -5.204  1.00 0.00 ? 65  SER A HA   3  
ATOM   3000  H  HB2  . SER A 1 65 ? 21.689  -4.658  -3.665  1.00 0.00 ? 65  SER A HB2  3  
ATOM   3001  H  HB3  . SER A 1 65 ? 20.753  -5.347  -2.339  1.00 0.00 ? 65  SER A HB3  3  
ATOM   3002  H  HG   . SER A 1 65 ? 22.320  -7.115  -3.794  1.00 0.00 ? 65  SER A HG   3  
ATOM   3003  N  N    . GLY A 1 66 ? 18.431  -7.732  -4.320  1.00 0.00 ? 66  GLY A N    3  
ATOM   3004  C  CA   . GLY A 1 66 ? 17.725  -8.922  -3.880  1.00 0.00 ? 66  GLY A CA   3  
ATOM   3005  C  C    . GLY A 1 66 ? 18.078  -10.144 -4.705  1.00 0.00 ? 66  GLY A C    3  
ATOM   3006  O  O    . GLY A 1 66 ? 18.743  -10.052 -5.737  1.00 0.00 ? 66  GLY A O    3  
ATOM   3007  H  H    . GLY A 1 66 ? 18.072  -7.198  -5.059  1.00 0.00 ? 66  GLY A H    3  
ATOM   3008  H  HA2  . GLY A 1 66 ? 17.974  -9.113  -2.847  1.00 0.00 ? 66  GLY A HA2  3  
ATOM   3009  H  HA3  . GLY A 1 66 ? 16.662  -8.745  -3.957  1.00 0.00 ? 66  GLY A HA3  3  
ATOM   3010  N  N    . PRO A 1 67 ? 17.627  -11.321 -4.247  1.00 0.00 ? 67  PRO A N    3  
ATOM   3011  C  CA   . PRO A 1 67 ? 17.888  -12.590 -4.934  1.00 0.00 ? 67  PRO A CA   3  
ATOM   3012  C  C    . PRO A 1 67 ? 17.130  -12.701 -6.253  1.00 0.00 ? 67  PRO A C    3  
ATOM   3013  O  O    . PRO A 1 67 ? 16.440  -11.768 -6.664  1.00 0.00 ? 67  PRO A O    3  
ATOM   3014  C  CB   . PRO A 1 67 ? 17.388  -13.641 -3.940  1.00 0.00 ? 67  PRO A CB   3  
ATOM   3015  C  CG   . PRO A 1 67 ? 16.365  -12.932 -3.122  1.00 0.00 ? 67  PRO A CG   3  
ATOM   3016  C  CD   . PRO A 1 67 ? 16.828  -11.505 -3.024  1.00 0.00 ? 67  PRO A CD   3  
ATOM   3017  H  HA   . PRO A 1 67 ? 18.943  -12.734 -5.114  1.00 0.00 ? 67  PRO A HA   3  
ATOM   3018  H  HB2  . PRO A 1 67 ? 16.958  -14.474 -4.479  1.00 0.00 ? 67  PRO A HB2  3  
ATOM   3019  H  HB3  . PRO A 1 67 ? 18.211  -13.985 -3.332  1.00 0.00 ? 67  PRO A HB3  3  
ATOM   3020  H  HG2  . PRO A 1 67 ? 15.404  -12.982 -3.612  1.00 0.00 ? 67  PRO A HG2  3  
ATOM   3021  H  HG3  . PRO A 1 67 ? 16.309  -13.376 -2.139  1.00 0.00 ? 67  PRO A HG3  3  
ATOM   3022  H  HD2  . PRO A 1 67 ? 15.982  -10.834 -3.011  1.00 0.00 ? 67  PRO A HD2  3  
ATOM   3023  H  HD3  . PRO A 1 67 ? 17.436  -11.366 -2.143  1.00 0.00 ? 67  PRO A HD3  3  
ATOM   3024  N  N    . SER A 1 68 ? 17.263  -13.848 -6.912  1.00 0.00 ? 68  SER A N    3  
ATOM   3025  C  CA   . SER A 1 68 ? 16.594  -14.080 -8.186  1.00 0.00 ? 68  SER A CA   3  
ATOM   3026  C  C    . SER A 1 68 ? 15.145  -13.605 -8.133  1.00 0.00 ? 68  SER A C    3  
ATOM   3027  O  O    . SER A 1 68 ? 14.412  -13.917 -7.194  1.00 0.00 ? 68  SER A O    3  
ATOM   3028  C  CB   . SER A 1 68 ? 16.642  -15.565 -8.549  1.00 0.00 ? 68  SER A CB   3  
ATOM   3029  O  OG   . SER A 1 68 ? 16.093  -16.361 -7.514  1.00 0.00 ? 68  SER A OG   3  
ATOM   3030  H  H    . SER A 1 68 ? 17.828  -14.554 -6.532  1.00 0.00 ? 68  SER A H    3  
ATOM   3031  H  HA   . SER A 1 68 ? 17.118  -13.515 -8.943  1.00 0.00 ? 68  SER A HA   3  
ATOM   3032  H  HB2  . SER A 1 68 ? 16.076  -15.731 -9.453  1.00 0.00 ? 68  SER A HB2  3  
ATOM   3033  H  HB3  . SER A 1 68 ? 17.669  -15.860 -8.708  1.00 0.00 ? 68  SER A HB3  3  
ATOM   3034  H  HG   . SER A 1 68 ? 15.712  -17.158 -7.890  1.00 0.00 ? 68  SER A HG   3  
ATOM   3035  N  N    . SER A 1 69 ? 14.739  -12.848 -9.147  1.00 0.00 ? 69  SER A N    3  
ATOM   3036  C  CA   . SER A 1 69 ? 13.379  -12.325 -9.215  1.00 0.00 ? 69  SER A CA   3  
ATOM   3037  C  C    . SER A 1 69 ? 12.900  -12.245 -10.661 1.00 0.00 ? 69  SER A C    3  
ATOM   3038  O  O    . SER A 1 69 ? 13.664  -12.488 -11.595 1.00 0.00 ? 69  SER A O    3  
ATOM   3039  C  CB   . SER A 1 69 ? 13.309  -10.942 -8.565  1.00 0.00 ? 69  SER A CB   3  
ATOM   3040  O  OG   . SER A 1 69 ? 13.817  -9.944  -9.433  1.00 0.00 ? 69  SER A OG   3  
ATOM   3041  H  H    . SER A 1 69 ? 15.371  -12.633 -9.866  1.00 0.00 ? 69  SER A H    3  
ATOM   3042  H  HA   . SER A 1 69 ? 12.737  -13.002 -8.672  1.00 0.00 ? 69  SER A HA   3  
ATOM   3043  H  HB2  . SER A 1 69 ? 12.281  -10.709 -8.332  1.00 0.00 ? 69  SER A HB2  3  
ATOM   3044  H  HB3  . SER A 1 69 ? 13.893  -10.944 -7.656  1.00 0.00 ? 69  SER A HB3  3  
ATOM   3045  H  HG   . SER A 1 69 ? 13.161  -9.736  -10.102 1.00 0.00 ? 69  SER A HG   3  
ATOM   3046  N  N    . GLY A 1 70 ? 11.627  -11.903 -10.838 1.00 0.00 ? 70  GLY A N    3  
ATOM   3047  C  CA   . GLY A 1 70 ? 11.066  -11.797 -12.172 1.00 0.00 ? 70  GLY A CA   3  
ATOM   3048  C  C    . GLY A 1 70 ? 12.038  -11.187 -13.163 1.00 0.00 ? 70  GLY A C    3  
ATOM   3049  O  O    . GLY A 1 70 ? 11.802  -11.278 -14.367 1.00 0.00 ? 70  GLY A O    3  
ATOM   3050  H  H    . GLY A 1 70 ? 11.065  -11.721 -10.056 1.00 0.00 ? 70  GLY A H    3  
ATOM   3051  H  HA2  . GLY A 1 70 ? 10.790  -12.783 -12.515 1.00 0.00 ? 70  GLY A HA2  3  
ATOM   3052  H  HA3  . GLY A 1 70 ? 10.180  -11.181 -12.130 1.00 0.00 ? 70  GLY A HA3  3  
HETATM 3053  ZN ZN   . ZN  B 2 .  ? -11.420 4.338   2.420   1.00 0.00 ? 201 ZN  A ZN   3  
HETATM 3054  ZN ZN   . ZN  C 2 .  ? 6.624   3.565   0.488   1.00 0.00 ? 401 ZN  A ZN   3  
ATOM   3055  N  N    . GLY A 1 1  ? -23.407 -11.908 -0.900  1.00 0.00 ? 1   GLY A N    4  
ATOM   3056  C  CA   . GLY A 1 1  ? -24.124 -11.211 -1.952  1.00 0.00 ? 1   GLY A CA   4  
ATOM   3057  C  C    . GLY A 1 1  ? -23.203 -10.710 -3.047  1.00 0.00 ? 1   GLY A C    4  
ATOM   3058  O  O    . GLY A 1 1  ? -23.269 -11.177 -4.184  1.00 0.00 ? 1   GLY A O    4  
ATOM   3059  H  H1   . GLY A 1 1  ? -23.587 -12.857 -0.732  1.00 0.00 ? 1   GLY A H1   4  
ATOM   3060  H  HA2  . GLY A 1 1  ? -24.849 -11.884 -2.385  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   3061  H  HA3  . GLY A 1 1  ? -24.643 -10.368 -1.520  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   3062  N  N    . SER A 1 2  ? -22.344 -9.756  -2.705  1.00 0.00 ? 2   SER A N    4  
ATOM   3063  C  CA   . SER A 1 2  ? -21.409 -9.187  -3.669  1.00 0.00 ? 2   SER A CA   4  
ATOM   3064  C  C    . SER A 1 2  ? -22.105 -8.900  -4.996  1.00 0.00 ? 2   SER A C    4  
ATOM   3065  O  O    . SER A 1 2  ? -21.552 -9.151  -6.066  1.00 0.00 ? 2   SER A O    4  
ATOM   3066  C  CB   . SER A 1 2  ? -20.232 -10.137 -3.892  1.00 0.00 ? 2   SER A CB   4  
ATOM   3067  O  OG   . SER A 1 2  ? -20.654 -11.333 -4.526  1.00 0.00 ? 2   SER A OG   4  
ATOM   3068  H  H    . SER A 1 2  ? -22.340 -9.425  -1.782  1.00 0.00 ? 2   SER A H    4  
ATOM   3069  H  HA   . SER A 1 2  ? -21.039 -8.257  -3.262  1.00 0.00 ? 2   SER A HA   4  
ATOM   3070  H  HB2  . SER A 1 2  ? -19.496 -9.654  -4.517  1.00 0.00 ? 2   SER A HB2  4  
ATOM   3071  H  HB3  . SER A 1 2  ? -19.788 -10.386 -2.939  1.00 0.00 ? 2   SER A HB3  4  
ATOM   3072  H  HG   . SER A 1 2  ? -19.948 -11.667 -5.083  1.00 0.00 ? 2   SER A HG   4  
ATOM   3073  N  N    . SER A 1 3  ? -23.323 -8.374  -4.917  1.00 0.00 ? 3   SER A N    4  
ATOM   3074  C  CA   . SER A 1 3  ? -24.098 -8.057  -6.111  1.00 0.00 ? 3   SER A CA   4  
ATOM   3075  C  C    . SER A 1 3  ? -23.793 -6.643  -6.596  1.00 0.00 ? 3   SER A C    4  
ATOM   3076  O  O    . SER A 1 3  ? -24.375 -5.671  -6.117  1.00 0.00 ? 3   SER A O    4  
ATOM   3077  C  CB   . SER A 1 3  ? -25.595 -8.198  -5.826  1.00 0.00 ? 3   SER A CB   4  
ATOM   3078  O  OG   . SER A 1 3  ? -25.918 -9.524  -5.445  1.00 0.00 ? 3   SER A OG   4  
ATOM   3079  H  H    . SER A 1 3  ? -23.711 -8.197  -4.034  1.00 0.00 ? 3   SER A H    4  
ATOM   3080  H  HA   . SER A 1 3  ? -23.819 -8.758  -6.883  1.00 0.00 ? 3   SER A HA   4  
ATOM   3081  H  HB2  . SER A 1 3  ? -25.871 -7.529  -5.025  1.00 0.00 ? 3   SER A HB2  4  
ATOM   3082  H  HB3  . SER A 1 3  ? -26.153 -7.945  -6.715  1.00 0.00 ? 3   SER A HB3  4  
ATOM   3083  H  HG   . SER A 1 3  ? -26.328 -9.518  -4.577  1.00 0.00 ? 3   SER A HG   4  
ATOM   3084  N  N    . GLY A 1 4  ? -22.875 -6.537  -7.552  1.00 0.00 ? 4   GLY A N    4  
ATOM   3085  C  CA   . GLY A 1 4  ? -22.507 -5.240  -8.088  1.00 0.00 ? 4   GLY A CA   4  
ATOM   3086  C  C    . GLY A 1 4  ? -22.254 -4.214  -7.001  1.00 0.00 ? 4   GLY A C    4  
ATOM   3087  O  O    . GLY A 1 4  ? -22.895 -3.163  -6.968  1.00 0.00 ? 4   GLY A O    4  
ATOM   3088  H  H    . GLY A 1 4  ? -22.444 -7.348  -7.897  1.00 0.00 ? 4   GLY A H    4  
ATOM   3089  H  HA2  . GLY A 1 4  ? -21.612 -5.348  -8.681  1.00 0.00 ? 4   GLY A HA2  4  
ATOM   3090  H  HA3  . GLY A 1 4  ? -23.307 -4.885  -8.722  1.00 0.00 ? 4   GLY A HA3  4  
ATOM   3091  N  N    . SER A 1 5  ? -21.320 -4.520  -6.107  1.00 0.00 ? 5   SER A N    4  
ATOM   3092  C  CA   . SER A 1 5  ? -20.988 -3.619  -5.009  1.00 0.00 ? 5   SER A CA   4  
ATOM   3093  C  C    . SER A 1 5  ? -19.502 -3.272  -5.021  1.00 0.00 ? 5   SER A C    4  
ATOM   3094  O  O    . SER A 1 5  ? -18.679 -4.036  -5.526  1.00 0.00 ? 5   SER A O    4  
ATOM   3095  C  CB   . SER A 1 5  ? -21.364 -4.254  -3.669  1.00 0.00 ? 5   SER A CB   4  
ATOM   3096  O  OG   . SER A 1 5  ? -20.919 -3.457  -2.585  1.00 0.00 ? 5   SER A OG   4  
ATOM   3097  H  H    . SER A 1 5  ? -20.844 -5.373  -6.186  1.00 0.00 ? 5   SER A H    4  
ATOM   3098  H  HA   . SER A 1 5  ? -21.558 -2.712  -5.141  1.00 0.00 ? 5   SER A HA   4  
ATOM   3099  H  HB2  . SER A 1 5  ? -22.437 -4.354  -3.609  1.00 0.00 ? 5   SER A HB2  4  
ATOM   3100  H  HB3  . SER A 1 5  ? -20.906 -5.230  -3.595  1.00 0.00 ? 5   SER A HB3  4  
ATOM   3101  H  HG   . SER A 1 5  ? -21.266 -3.812  -1.763  1.00 0.00 ? 5   SER A HG   4  
ATOM   3102  N  N    . SER A 1 6  ? -19.166 -2.115  -4.461  1.00 0.00 ? 6   SER A N    4  
ATOM   3103  C  CA   . SER A 1 6  ? -17.781 -1.663  -4.410  1.00 0.00 ? 6   SER A CA   4  
ATOM   3104  C  C    . SER A 1 6  ? -17.546 -0.766  -3.199  1.00 0.00 ? 6   SER A C    4  
ATOM   3105  O  O    . SER A 1 6  ? -18.019 0.369   -3.152  1.00 0.00 ? 6   SER A O    4  
ATOM   3106  C  CB   . SER A 1 6  ? -17.419 -0.912  -5.693  1.00 0.00 ? 6   SER A CB   4  
ATOM   3107  O  OG   . SER A 1 6  ? -18.388 0.077   -5.995  1.00 0.00 ? 6   SER A OG   4  
ATOM   3108  H  H    . SER A 1 6  ? -19.868 -1.549  -4.075  1.00 0.00 ? 6   SER A H    4  
ATOM   3109  H  HA   . SER A 1 6  ? -17.151 -2.536  -4.325  1.00 0.00 ? 6   SER A HA   4  
ATOM   3110  H  HB2  . SER A 1 6  ? -16.460 -0.434  -5.569  1.00 0.00 ? 6   SER A HB2  4  
ATOM   3111  H  HB3  . SER A 1 6  ? -17.369 -1.613  -6.515  1.00 0.00 ? 6   SER A HB3  4  
ATOM   3112  H  HG   . SER A 1 6  ? -18.103 0.581   -6.761  1.00 0.00 ? 6   SER A HG   4  
ATOM   3113  N  N    . GLY A 1 7  ? -16.810 -1.284  -2.220  1.00 0.00 ? 7   GLY A N    4  
ATOM   3114  C  CA   . GLY A 1 7  ? -16.524 -0.517  -1.021  1.00 0.00 ? 7   GLY A CA   4  
ATOM   3115  C  C    . GLY A 1 7  ? -15.069 -0.610  -0.607  1.00 0.00 ? 7   GLY A C    4  
ATOM   3116  O  O    . GLY A 1 7  ? -14.445 -1.663  -0.737  1.00 0.00 ? 7   GLY A O    4  
ATOM   3117  H  H    . GLY A 1 7  ? -16.458 -2.194  -2.313  1.00 0.00 ? 7   GLY A H    4  
ATOM   3118  H  HA2  . GLY A 1 7  ? -16.771 0.518   -1.202  1.00 0.00 ? 7   GLY A HA2  4  
ATOM   3119  H  HA3  . GLY A 1 7  ? -17.140 -0.889  -0.215  1.00 0.00 ? 7   GLY A HA3  4  
ATOM   3120  N  N    . CYS A 1 8  ? -14.526 0.495   -0.108  1.00 0.00 ? 8   CYS A N    4  
ATOM   3121  C  CA   . CYS A 1 8  ? -13.135 0.536   0.325   1.00 0.00 ? 8   CYS A CA   4  
ATOM   3122  C  C    . CYS A 1 8  ? -12.897 -0.428  1.484   1.00 0.00 ? 8   CYS A C    4  
ATOM   3123  O  O    . CYS A 1 8  ? -13.751 -0.588  2.357   1.00 0.00 ? 8   CYS A O    4  
ATOM   3124  C  CB   . CYS A 1 8  ? -12.750 1.957   0.742   1.00 0.00 ? 8   CYS A CB   4  
ATOM   3125  S  SG   . CYS A 1 8  ? -11.223 2.054   1.730   1.00 0.00 ? 8   CYS A SG   4  
ATOM   3126  H  H    . CYS A 1 8  ? -15.075 1.305   -0.029  1.00 0.00 ? 8   CYS A H    4  
ATOM   3127  H  HA   . CYS A 1 8  ? -12.519 0.236   -0.509  1.00 0.00 ? 8   CYS A HA   4  
ATOM   3128  H  HB2  . CYS A 1 8  ? -12.606 2.558   -0.144  1.00 0.00 ? 8   CYS A HB2  4  
ATOM   3129  H  HB3  . CYS A 1 8  ? -13.551 2.381   1.331   1.00 0.00 ? 8   CYS A HB3  4  
ATOM   3130  N  N    . HIS A 1 9  ? -11.732 -1.067  1.485   1.00 0.00 ? 9   HIS A N    4  
ATOM   3131  C  CA   . HIS A 1 9  ? -11.381 -2.015  2.537   1.00 0.00 ? 9   HIS A CA   4  
ATOM   3132  C  C    . HIS A 1 9  ? -10.668 -1.310  3.687   1.00 0.00 ? 9   HIS A C    4  
ATOM   3133  O  O    . HIS A 1 9  ? -10.899 -1.621  4.856   1.00 0.00 ? 9   HIS A O    4  
ATOM   3134  C  CB   . HIS A 1 9  ? -10.493 -3.126  1.976   1.00 0.00 ? 9   HIS A CB   4  
ATOM   3135  C  CG   . HIS A 1 9  ? -10.305 -4.275  2.918   1.00 0.00 ? 9   HIS A CG   4  
ATOM   3136  N  ND1  . HIS A 1 9  ? -11.336 -4.826  3.649   1.00 0.00 ? 9   HIS A ND1  4  
ATOM   3137  C  CD2  . HIS A 1 9  ? -9.196  -4.979  3.245   1.00 0.00 ? 9   HIS A CD2  4  
ATOM   3138  C  CE1  . HIS A 1 9  ? -10.869 -5.818  4.386   1.00 0.00 ? 9   HIS A CE1  4  
ATOM   3139  N  NE2  . HIS A 1 9  ? -9.573  -5.932  4.159   1.00 0.00 ? 9   HIS A NE2  4  
ATOM   3140  H  H    . HIS A 1 9  ? -11.093 -0.897  0.762   1.00 0.00 ? 9   HIS A H    4  
ATOM   3141  H  HA   . HIS A 1 9  ? -12.295 -2.450  2.910   1.00 0.00 ? 9   HIS A HA   4  
ATOM   3142  H  HB2  . HIS A 1 9  ? -10.938 -3.510  1.070   1.00 0.00 ? 9   HIS A HB2  4  
ATOM   3143  H  HB3  . HIS A 1 9  ? -9.518  -2.719  1.748   1.00 0.00 ? 9   HIS A HB3  4  
ATOM   3144  H  HD1  . HIS A 1 9  ? -12.270 -4.532  3.631   1.00 0.00 ? 9   HIS A HD1  4  
ATOM   3145  H  HD2  . HIS A 1 9  ? -8.198  -4.821  2.859   1.00 0.00 ? 9   HIS A HD2  4  
ATOM   3146  H  HE1  . HIS A 1 9  ? -11.448 -6.432  5.060   1.00 0.00 ? 9   HIS A HE1  4  
ATOM   3147  H  HE2  . HIS A 1 9  ? -8.967  -6.532  4.640   1.00 0.00 ? 9   HIS A HE2  4  
ATOM   3148  N  N    . GLN A 1 10 ? -9.801  -0.362  3.348   1.00 0.00 ? 10  GLN A N    4  
ATOM   3149  C  CA   . GLN A 1 10 ? -9.054  0.385   4.353   1.00 0.00 ? 10  GLN A CA   4  
ATOM   3150  C  C    . GLN A 1 10 ? -9.972  0.855   5.476   1.00 0.00 ? 10  GLN A C    4  
ATOM   3151  O  O    . GLN A 1 10 ? -9.937  0.322   6.586   1.00 0.00 ? 10  GLN A O    4  
ATOM   3152  C  CB   . GLN A 1 10 ? -8.356  1.586   3.712   1.00 0.00 ? 10  GLN A CB   4  
ATOM   3153  C  CG   . GLN A 1 10 ? -7.610  2.459   4.709   1.00 0.00 ? 10  GLN A CG   4  
ATOM   3154  C  CD   . GLN A 1 10 ? -6.265  1.880   5.100   1.00 0.00 ? 10  GLN A CD   4  
ATOM   3155  O  OE1  . GLN A 1 10 ? -5.221  2.331   4.628   1.00 0.00 ? 10  GLN A OE1  4  
ATOM   3156  N  NE2  . GLN A 1 10 ? -6.283  0.874   5.967   1.00 0.00 ? 10  GLN A NE2  4  
ATOM   3157  H  H    . GLN A 1 10 ? -9.660  -0.160  2.400   1.00 0.00 ? 10  GLN A H    4  
ATOM   3158  H  HA   . GLN A 1 10 ? -8.307  -0.274  4.768   1.00 0.00 ? 10  GLN A HA   4  
ATOM   3159  H  HB2  . GLN A 1 10 ? -7.648  1.228   2.980   1.00 0.00 ? 10  GLN A HB2  4  
ATOM   3160  H  HB3  . GLN A 1 10 ? -9.097  2.196   3.217   1.00 0.00 ? 10  GLN A HB3  4  
ATOM   3161  H  HG2  . GLN A 1 10 ? -7.451  3.432   4.267   1.00 0.00 ? 10  GLN A HG2  4  
ATOM   3162  H  HG3  . GLN A 1 10 ? -8.214  2.563   5.598   1.00 0.00 ? 10  GLN A HG3  4  
ATOM   3163  H  HE21 . GLN A 1 10 ? -7.152  0.566   6.300   1.00 0.00 ? 10  GLN A HE21 4  
ATOM   3164  H  HE22 . GLN A 1 10 ? -5.428  0.481   6.237   1.00 0.00 ? 10  GLN A HE22 4  
ATOM   3165  N  N    . CYS A 1 11 ? -10.794 1.857   5.182   1.00 0.00 ? 11  CYS A N    4  
ATOM   3166  C  CA   . CYS A 1 11 ? -11.722 2.400   6.166   1.00 0.00 ? 11  CYS A CA   4  
ATOM   3167  C  C    . CYS A 1 11 ? -13.020 1.598   6.190   1.00 0.00 ? 11  CYS A C    4  
ATOM   3168  O  O    . CYS A 1 11 ? -13.566 1.312   7.255   1.00 0.00 ? 11  CYS A O    4  
ATOM   3169  C  CB   . CYS A 1 11 ? -12.022 3.868   5.859   1.00 0.00 ? 11  CYS A CB   4  
ATOM   3170  S  SG   . CYS A 1 11 ? -12.833 4.141   4.251   1.00 0.00 ? 11  CYS A SG   4  
ATOM   3171  H  H    . CYS A 1 11 ? -10.776 2.241   4.279   1.00 0.00 ? 11  CYS A H    4  
ATOM   3172  H  HA   . CYS A 1 11 ? -11.254 2.333   7.136   1.00 0.00 ? 11  CYS A HA   4  
ATOM   3173  H  HB2  . CYS A 1 11 ? -12.674 4.263   6.625   1.00 0.00 ? 11  CYS A HB2  4  
ATOM   3174  H  HB3  . CYS A 1 11 ? -11.097 4.425   5.859   1.00 0.00 ? 11  CYS A HB3  4  
ATOM   3175  N  N    . GLY A 1 12 ? -13.510 1.239   5.007   1.00 0.00 ? 12  GLY A N    4  
ATOM   3176  C  CA   . GLY A 1 12 ? -14.740 0.474   4.915   1.00 0.00 ? 12  GLY A CA   4  
ATOM   3177  C  C    . GLY A 1 12 ? -15.830 1.217   4.170   1.00 0.00 ? 12  GLY A C    4  
ATOM   3178  O  O    . GLY A 1 12 ? -16.601 0.615   3.423   1.00 0.00 ? 12  GLY A O    4  
ATOM   3179  H  H    . GLY A 1 12 ? -13.032 1.495   4.191   1.00 0.00 ? 12  GLY A H    4  
ATOM   3180  H  HA2  . GLY A 1 12 ? -14.536 -0.454  4.402   1.00 0.00 ? 12  GLY A HA2  4  
ATOM   3181  H  HA3  . GLY A 1 12 ? -15.088 0.252   5.913   1.00 0.00 ? 12  GLY A HA3  4  
ATOM   3182  N  N    . GLU A 1 13 ? -15.896 2.529   4.375   1.00 0.00 ? 13  GLU A N    4  
ATOM   3183  C  CA   . GLU A 1 13 ? -16.903 3.354   3.718   1.00 0.00 ? 13  GLU A CA   4  
ATOM   3184  C  C    . GLU A 1 13 ? -17.007 3.009   2.235   1.00 0.00 ? 13  GLU A C    4  
ATOM   3185  O  O    . GLU A 1 13 ? -16.044 2.543   1.626   1.00 0.00 ? 13  GLU A O    4  
ATOM   3186  C  CB   . GLU A 1 13 ? -16.567 4.838   3.885   1.00 0.00 ? 13  GLU A CB   4  
ATOM   3187  C  CG   . GLU A 1 13 ? -16.429 5.271   5.335   1.00 0.00 ? 13  GLU A CG   4  
ATOM   3188  C  CD   . GLU A 1 13 ? -17.767 5.556   5.989   1.00 0.00 ? 13  GLU A CD   4  
ATOM   3189  O  OE1  . GLU A 1 13 ? -18.779 4.973   5.548   1.00 0.00 ? 13  GLU A OE1  4  
ATOM   3190  O  OE2  . GLU A 1 13 ? -17.801 6.362   6.942   1.00 0.00 ? 13  GLU A OE2  4  
ATOM   3191  H  H    . GLU A 1 13 ? -15.253 2.951   4.982   1.00 0.00 ? 13  GLU A H    4  
ATOM   3192  H  HA   . GLU A 1 13 ? -17.854 3.155   4.189   1.00 0.00 ? 13  GLU A HA   4  
ATOM   3193  H  HB2  . GLU A 1 13 ? -15.635 5.043   3.379   1.00 0.00 ? 13  GLU A HB2  4  
ATOM   3194  H  HB3  . GLU A 1 13 ? -17.350 5.425   3.430   1.00 0.00 ? 13  GLU A HB3  4  
ATOM   3195  H  HG2  . GLU A 1 13 ? -15.936 4.484   5.887   1.00 0.00 ? 13  GLU A HG2  4  
ATOM   3196  H  HG3  . GLU A 1 13 ? -15.827 6.167   5.374   1.00 0.00 ? 13  GLU A HG3  4  
ATOM   3197  N  N    . PHE A 1 14 ? -18.182 3.241   1.661   1.00 0.00 ? 14  PHE A N    4  
ATOM   3198  C  CA   . PHE A 1 14 ? -18.414 2.954   0.250   1.00 0.00 ? 14  PHE A CA   4  
ATOM   3199  C  C    . PHE A 1 14 ? -17.762 4.013   -0.635  1.00 0.00 ? 14  PHE A C    4  
ATOM   3200  O  O    . PHE A 1 14 ? -17.843 5.208   -0.351  1.00 0.00 ? 14  PHE A O    4  
ATOM   3201  C  CB   . PHE A 1 14 ? -19.915 2.885   -0.039  1.00 0.00 ? 14  PHE A CB   4  
ATOM   3202  C  CG   . PHE A 1 14 ? -20.247 2.160   -1.312  1.00 0.00 ? 14  PHE A CG   4  
ATOM   3203  C  CD1  . PHE A 1 14 ? -20.410 0.784   -1.318  1.00 0.00 ? 14  PHE A CD1  4  
ATOM   3204  C  CD2  . PHE A 1 14 ? -20.398 2.854   -2.501  1.00 0.00 ? 14  PHE A CD2  4  
ATOM   3205  C  CE1  . PHE A 1 14 ? -20.716 0.114   -2.488  1.00 0.00 ? 14  PHE A CE1  4  
ATOM   3206  C  CE2  . PHE A 1 14 ? -20.704 2.190   -3.674  1.00 0.00 ? 14  PHE A CE2  4  
ATOM   3207  C  CZ   . PHE A 1 14 ? -20.864 0.818   -3.667  1.00 0.00 ? 14  PHE A CZ   4  
ATOM   3208  H  H    . PHE A 1 14 ? -18.912 3.614   2.199   1.00 0.00 ? 14  PHE A H    4  
ATOM   3209  H  HA   . PHE A 1 14 ? -17.969 1.995   0.030   1.00 0.00 ? 14  PHE A HA   4  
ATOM   3210  H  HB2  . PHE A 1 14 ? -20.407 2.371   0.773   1.00 0.00 ? 14  PHE A HB2  4  
ATOM   3211  H  HB3  . PHE A 1 14 ? -20.306 3.888   -0.115  1.00 0.00 ? 14  PHE A HB3  4  
ATOM   3212  H  HD1  . PHE A 1 14 ? -20.296 0.232   -0.397  1.00 0.00 ? 14  PHE A HD1  4  
ATOM   3213  H  HD2  . PHE A 1 14 ? -20.273 3.928   -2.508  1.00 0.00 ? 14  PHE A HD2  4  
ATOM   3214  H  HE1  . PHE A 1 14 ? -20.841 -0.958  -2.480  1.00 0.00 ? 14  PHE A HE1  4  
ATOM   3215  H  HE2  . PHE A 1 14 ? -20.819 2.744   -4.594  1.00 0.00 ? 14  PHE A HE2  4  
ATOM   3216  H  HZ   . PHE A 1 14 ? -21.102 0.297   -4.583  1.00 0.00 ? 14  PHE A HZ   4  
ATOM   3217  N  N    . ILE A 1 15 ? -17.117 3.564   -1.707  1.00 0.00 ? 15  ILE A N    4  
ATOM   3218  C  CA   . ILE A 1 15 ? -16.452 4.472   -2.633  1.00 0.00 ? 15  ILE A CA   4  
ATOM   3219  C  C    . ILE A 1 15 ? -17.427 5.000   -3.680  1.00 0.00 ? 15  ILE A C    4  
ATOM   3220  O  O    . ILE A 1 15 ? -18.192 4.236   -4.271  1.00 0.00 ? 15  ILE A O    4  
ATOM   3221  C  CB   . ILE A 1 15 ? -15.272 3.786   -3.345  1.00 0.00 ? 15  ILE A CB   4  
ATOM   3222  C  CG1  . ILE A 1 15 ? -14.415 3.019   -2.336  1.00 0.00 ? 15  ILE A CG1  4  
ATOM   3223  C  CG2  . ILE A 1 15 ? -14.432 4.813   -4.089  1.00 0.00 ? 15  ILE A CG2  4  
ATOM   3224  C  CD1  . ILE A 1 15 ? -13.561 1.940   -2.965  1.00 0.00 ? 15  ILE A CD1  4  
ATOM   3225  H  H    . ILE A 1 15 ? -17.088 2.600   -1.879  1.00 0.00 ? 15  ILE A H    4  
ATOM   3226  H  HA   . ILE A 1 15 ? -16.067 5.306   -2.063  1.00 0.00 ? 15  ILE A HA   4  
ATOM   3227  H  HB   . ILE A 1 15 ? -15.672 3.091   -4.068  1.00 0.00 ? 15  ILE A HB   4  
ATOM   3228  H  HG12 . ILE A 1 15 ? -13.758 3.710   -1.832  1.00 0.00 ? 15  ILE A HG12 4  
ATOM   3229  H  HG13 . ILE A 1 15 ? -15.062 2.549   -1.610  1.00 0.00 ? 15  ILE A HG13 4  
ATOM   3230  H  HG21 . ILE A 1 15 ? -15.008 5.227   -4.904  1.00 0.00 ? 15  ILE A HG21 4  
ATOM   3231  H  HG22 . ILE A 1 15 ? -14.149 5.604   -3.412  1.00 0.00 ? 15  ILE A HG22 4  
ATOM   3232  H  HG23 . ILE A 1 15 ? -13.545 4.338   -4.481  1.00 0.00 ? 15  ILE A HG23 4  
ATOM   3233  H  HD11 . ILE A 1 15 ? -14.098 1.004   -2.956  1.00 0.00 ? 15  ILE A HD11 4  
ATOM   3234  H  HD12 . ILE A 1 15 ? -13.328 2.213   -3.983  1.00 0.00 ? 15  ILE A HD12 4  
ATOM   3235  H  HD13 . ILE A 1 15 ? -12.644 1.834   -2.402  1.00 0.00 ? 15  ILE A HD13 4  
ATOM   3236  N  N    . ILE A 1 16 ? -17.392 6.308   -3.907  1.00 0.00 ? 16  ILE A N    4  
ATOM   3237  C  CA   . ILE A 1 16 ? -18.270 6.937   -4.886  1.00 0.00 ? 16  ILE A CA   4  
ATOM   3238  C  C    . ILE A 1 16 ? -17.492 7.878   -5.799  1.00 0.00 ? 16  ILE A C    4  
ATOM   3239  O  O    . ILE A 1 16 ? -16.947 8.886   -5.350  1.00 0.00 ? 16  ILE A O    4  
ATOM   3240  C  CB   . ILE A 1 16 ? -19.404 7.724   -4.202  1.00 0.00 ? 16  ILE A CB   4  
ATOM   3241  C  CG1  . ILE A 1 16 ? -20.084 6.861   -3.138  1.00 0.00 ? 16  ILE A CG1  4  
ATOM   3242  C  CG2  . ILE A 1 16 ? -20.416 8.199   -5.233  1.00 0.00 ? 16  ILE A CG2  4  
ATOM   3243  C  CD1  . ILE A 1 16 ? -21.129 7.603   -2.334  1.00 0.00 ? 16  ILE A CD1  4  
ATOM   3244  H  H    . ILE A 1 16 ? -16.761 6.864   -3.405  1.00 0.00 ? 16  ILE A H    4  
ATOM   3245  H  HA   . ILE A 1 16 ? -18.714 6.155   -5.486  1.00 0.00 ? 16  ILE A HA   4  
ATOM   3246  H  HB   . ILE A 1 16 ? -18.973 8.594   -3.729  1.00 0.00 ? 16  ILE A HB   4  
ATOM   3247  H  HG12 . ILE A 1 16 ? -20.568 6.024   -3.617  1.00 0.00 ? 16  ILE A HG12 4  
ATOM   3248  H  HG13 . ILE A 1 16 ? -19.335 6.493   -2.451  1.00 0.00 ? 16  ILE A HG13 4  
ATOM   3249  H  HG21 . ILE A 1 16 ? -20.447 9.279   -5.237  1.00 0.00 ? 16  ILE A HG21 4  
ATOM   3250  H  HG22 . ILE A 1 16 ? -20.126 7.845   -6.211  1.00 0.00 ? 16  ILE A HG22 4  
ATOM   3251  H  HG23 . ILE A 1 16 ? -21.393 7.812   -4.984  1.00 0.00 ? 16  ILE A HG23 4  
ATOM   3252  H  HD11 . ILE A 1 16 ? -20.711 7.894   -1.381  1.00 0.00 ? 16  ILE A HD11 4  
ATOM   3253  H  HD12 . ILE A 1 16 ? -21.441 8.484   -2.875  1.00 0.00 ? 16  ILE A HD12 4  
ATOM   3254  H  HD13 . ILE A 1 16 ? -21.981 6.960   -2.171  1.00 0.00 ? 16  ILE A HD13 4  
ATOM   3255  N  N    . GLY A 1 17 ? -17.445 7.543   -7.085  1.00 0.00 ? 17  GLY A N    4  
ATOM   3256  C  CA   . GLY A 1 17 ? -16.733 8.370   -8.041  1.00 0.00 ? 17  GLY A CA   4  
ATOM   3257  C  C    . GLY A 1 17 ? -15.455 7.718   -8.532  1.00 0.00 ? 17  GLY A C    4  
ATOM   3258  O  O    . GLY A 1 17 ? -15.377 7.273   -9.677  1.00 0.00 ? 17  GLY A O    4  
ATOM   3259  H  H    . GLY A 1 17 ? -17.899 6.728   -7.386  1.00 0.00 ? 17  GLY A H    4  
ATOM   3260  H  HA2  . GLY A 1 17 ? -17.376 8.558   -8.888  1.00 0.00 ? 17  GLY A HA2  4  
ATOM   3261  H  HA3  . GLY A 1 17 ? -16.486 9.311   -7.573  1.00 0.00 ? 17  GLY A HA3  4  
ATOM   3262  N  N    . ARG A 1 18 ? -14.450 7.663   -7.664  1.00 0.00 ? 18  ARG A N    4  
ATOM   3263  C  CA   . ARG A 1 18 ? -13.168 7.064   -8.016  1.00 0.00 ? 18  ARG A CA   4  
ATOM   3264  C  C    . ARG A 1 18 ? -12.874 5.852   -7.136  1.00 0.00 ? 18  ARG A C    4  
ATOM   3265  O  O    . ARG A 1 18 ? -12.815 5.961   -5.912  1.00 0.00 ? 18  ARG A O    4  
ATOM   3266  C  CB   . ARG A 1 18 ? -12.045 8.092   -7.877  1.00 0.00 ? 18  ARG A CB   4  
ATOM   3267  C  CG   . ARG A 1 18 ? -10.657 7.475   -7.818  1.00 0.00 ? 18  ARG A CG   4  
ATOM   3268  C  CD   . ARG A 1 18 ? -9.601  8.426   -8.358  1.00 0.00 ? 18  ARG A CD   4  
ATOM   3269  N  NE   . ARG A 1 18 ? -8.387  7.722   -8.764  1.00 0.00 ? 18  ARG A NE   4  
ATOM   3270  C  CZ   . ARG A 1 18 ? -7.284  8.337   -9.177  1.00 0.00 ? 18  ARG A CZ   4  
ATOM   3271  N  NH1  . ARG A 1 18 ? -7.242  9.661   -9.237  1.00 0.00 ? 18  ARG A NH1  4  
ATOM   3272  N  NH2  . ARG A 1 18 ? -6.220  7.627   -9.529  1.00 0.00 ? 18  ARG A NH2  4  
ATOM   3273  H  H    . ARG A 1 18 ? -14.573 8.035   -6.765  1.00 0.00 ? 18  ARG A H    4  
ATOM   3274  H  HA   . ARG A 1 18 ? -13.224 6.741   -9.045  1.00 0.00 ? 18  ARG A HA   4  
ATOM   3275  H  HB2  . ARG A 1 18 ? -12.080 8.763   -8.723  1.00 0.00 ? 18  ARG A HB2  4  
ATOM   3276  H  HB3  . ARG A 1 18 ? -12.202 8.659   -6.972  1.00 0.00 ? 18  ARG A HB3  4  
ATOM   3277  H  HG2  . ARG A 1 18 ? -10.422 7.239   -6.791  1.00 0.00 ? 18  ARG A HG2  4  
ATOM   3278  H  HG3  . ARG A 1 18 ? -10.651 6.570   -8.408  1.00 0.00 ? 18  ARG A HG3  4  
ATOM   3279  H  HD2  . ARG A 1 18 ? -10.006 8.946   -9.213  1.00 0.00 ? 18  ARG A HD2  4  
ATOM   3280  H  HD3  . ARG A 1 18 ? -9.351  9.140   -7.588  1.00 0.00 ? 18  ARG A HD3  4  
ATOM   3281  H  HE   . ARG A 1 18 ? -8.396  6.743   -8.727  1.00 0.00 ? 18  ARG A HE   4  
ATOM   3282  H  HH11 . ARG A 1 18 ? -8.042  10.198  -8.971  1.00 0.00 ? 18  ARG A HH11 4  
ATOM   3283  H  HH12 . ARG A 1 18 ? -6.410  10.121  -9.547  1.00 0.00 ? 18  ARG A HH12 4  
ATOM   3284  H  HH21 . ARG A 1 18 ? -6.248  6.629   -9.485  1.00 0.00 ? 18  ARG A HH21 4  
ATOM   3285  H  HH22 . ARG A 1 18 ? -5.391  8.091   -9.840  1.00 0.00 ? 18  ARG A HH22 4  
ATOM   3286  N  N    . VAL A 1 19 ? -12.692 4.698   -7.770  1.00 0.00 ? 19  VAL A N    4  
ATOM   3287  C  CA   . VAL A 1 19 ? -12.404 3.466   -7.045  1.00 0.00 ? 19  VAL A CA   4  
ATOM   3288  C  C    . VAL A 1 19 ? -11.028 2.920   -7.413  1.00 0.00 ? 19  VAL A C    4  
ATOM   3289  O  O    . VAL A 1 19 ? -10.773 2.583   -8.569  1.00 0.00 ? 19  VAL A O    4  
ATOM   3290  C  CB   . VAL A 1 19 ? -13.465 2.386   -7.330  1.00 0.00 ? 19  VAL A CB   4  
ATOM   3291  C  CG1  . VAL A 1 19 ? -12.921 1.003   -7.003  1.00 0.00 ? 19  VAL A CG1  4  
ATOM   3292  C  CG2  . VAL A 1 19 ? -14.735 2.668   -6.542  1.00 0.00 ? 19  VAL A CG2  4  
ATOM   3293  H  H    . VAL A 1 19 ? -12.751 4.674   -8.747  1.00 0.00 ? 19  VAL A H    4  
ATOM   3294  H  HA   . VAL A 1 19 ? -12.421 3.688   -5.988  1.00 0.00 ? 19  VAL A HA   4  
ATOM   3295  H  HB   . VAL A 1 19 ? -13.705 2.414   -8.382  1.00 0.00 ? 19  VAL A HB   4  
ATOM   3296  H  HG11 . VAL A 1 19 ? -12.064 0.797   -7.628  1.00 0.00 ? 19  VAL A HG11 4  
ATOM   3297  H  HG12 . VAL A 1 19 ? -12.628 0.968   -5.964  1.00 0.00 ? 19  VAL A HG12 4  
ATOM   3298  H  HG13 . VAL A 1 19 ? -13.686 0.263   -7.187  1.00 0.00 ? 19  VAL A HG13 4  
ATOM   3299  H  HG21 . VAL A 1 19 ? -15.594 2.505   -7.176  1.00 0.00 ? 19  VAL A HG21 4  
ATOM   3300  H  HG22 . VAL A 1 19 ? -14.786 2.005   -5.691  1.00 0.00 ? 19  VAL A HG22 4  
ATOM   3301  H  HG23 . VAL A 1 19 ? -14.728 3.692   -6.201  1.00 0.00 ? 19  VAL A HG23 4  
ATOM   3302  N  N    . ILE A 1 20 ? -10.147 2.837   -6.423  1.00 0.00 ? 20  ILE A N    4  
ATOM   3303  C  CA   . ILE A 1 20 ? -8.797  2.331   -6.642  1.00 0.00 ? 20  ILE A CA   4  
ATOM   3304  C  C    . ILE A 1 20 ? -8.740  0.819   -6.456  1.00 0.00 ? 20  ILE A C    4  
ATOM   3305  O  O    . ILE A 1 20 ? -8.765  0.319   -5.331  1.00 0.00 ? 20  ILE A O    4  
ATOM   3306  C  CB   . ILE A 1 20 ? -7.786  2.993   -5.688  1.00 0.00 ? 20  ILE A CB   4  
ATOM   3307  C  CG1  . ILE A 1 20 ? -8.025  4.503   -5.623  1.00 0.00 ? 20  ILE A CG1  4  
ATOM   3308  C  CG2  . ILE A 1 20 ? -6.362  2.696   -6.136  1.00 0.00 ? 20  ILE A CG2  4  
ATOM   3309  C  CD1  . ILE A 1 20 ? -7.712  5.221   -6.917  1.00 0.00 ? 20  ILE A CD1  4  
ATOM   3310  H  H    . ILE A 1 20 ? -10.410 3.122   -5.523  1.00 0.00 ? 20  ILE A H    4  
ATOM   3311  H  HA   . ILE A 1 20 ? -8.514  2.569   -7.657  1.00 0.00 ? 20  ILE A HA   4  
ATOM   3312  H  HB   . ILE A 1 20 ? -7.923  2.571   -4.704  1.00 0.00 ? 20  ILE A HB   4  
ATOM   3313  H  HG12 . ILE A 1 20 ? -9.061  4.687   -5.384  1.00 0.00 ? 20  ILE A HG12 4  
ATOM   3314  H  HG13 . ILE A 1 20 ? -7.402  4.925   -4.849  1.00 0.00 ? 20  ILE A HG13 4  
ATOM   3315  H  HG21 . ILE A 1 20 ? -5.695  3.445   -5.735  1.00 0.00 ? 20  ILE A HG21 4  
ATOM   3316  H  HG22 . ILE A 1 20 ? -6.068  1.722   -5.775  1.00 0.00 ? 20  ILE A HG22 4  
ATOM   3317  H  HG23 . ILE A 1 20 ? -6.314  2.711   -7.214  1.00 0.00 ? 20  ILE A HG23 4  
ATOM   3318  H  HD11 . ILE A 1 20 ? -8.248  4.751   -7.729  1.00 0.00 ? 20  ILE A HD11 4  
ATOM   3319  H  HD12 . ILE A 1 20 ? -8.012  6.255   -6.837  1.00 0.00 ? 20  ILE A HD12 4  
ATOM   3320  H  HD13 . ILE A 1 20 ? -6.650  5.168   -7.110  1.00 0.00 ? 20  ILE A HD13 4  
ATOM   3321  N  N    . LYS A 1 21 ? -8.661  0.094   -7.567  1.00 0.00 ? 21  LYS A N    4  
ATOM   3322  C  CA   . LYS A 1 21 ? -8.597  -1.362  -7.528  1.00 0.00 ? 21  LYS A CA   4  
ATOM   3323  C  C    . LYS A 1 21 ? -7.178  -1.836  -7.231  1.00 0.00 ? 21  LYS A C    4  
ATOM   3324  O  O    . LYS A 1 21 ? -6.257  -1.595  -8.010  1.00 0.00 ? 21  LYS A O    4  
ATOM   3325  C  CB   . LYS A 1 21 ? -9.074  -1.950  -8.858  1.00 0.00 ? 21  LYS A CB   4  
ATOM   3326  C  CG   . LYS A 1 21 ? -10.583 -1.915  -9.032  1.00 0.00 ? 21  LYS A CG   4  
ATOM   3327  C  CD   . LYS A 1 21 ? -11.234 -3.184  -8.507  1.00 0.00 ? 21  LYS A CD   4  
ATOM   3328  C  CE   . LYS A 1 21 ? -12.682 -2.944  -8.110  1.00 0.00 ? 21  LYS A CE   4  
ATOM   3329  N  NZ   . LYS A 1 21 ? -13.615 -3.174  -9.248  1.00 0.00 ? 21  LYS A NZ   4  
ATOM   3330  H  H    . LYS A 1 21 ? -8.645  0.550   -8.435  1.00 0.00 ? 21  LYS A H    4  
ATOM   3331  H  HA   . LYS A 1 21 ? -9.250  -1.702  -6.739  1.00 0.00 ? 21  LYS A HA   4  
ATOM   3332  H  HB2  . LYS A 1 21 ? -8.627  -1.390  -9.667  1.00 0.00 ? 21  LYS A HB2  4  
ATOM   3333  H  HB3  . LYS A 1 21 ? -8.749  -2.978  -8.921  1.00 0.00 ? 21  LYS A HB3  4  
ATOM   3334  H  HG2  . LYS A 1 21 ? -10.980 -1.069  -8.491  1.00 0.00 ? 21  LYS A HG2  4  
ATOM   3335  H  HG3  . LYS A 1 21 ? -10.813 -1.813  -10.083 1.00 0.00 ? 21  LYS A HG3  4  
ATOM   3336  H  HD2  . LYS A 1 21 ? -11.204 -3.940  -9.277  1.00 0.00 ? 21  LYS A HD2  4  
ATOM   3337  H  HD3  . LYS A 1 21 ? -10.685 -3.528  -7.641  1.00 0.00 ? 21  LYS A HD3  4  
ATOM   3338  H  HE2  . LYS A 1 21 ? -12.937 -3.616  -7.305  1.00 0.00 ? 21  LYS A HE2  4  
ATOM   3339  H  HE3  . LYS A 1 21 ? -12.785 -1.923  -7.772  1.00 0.00 ? 21  LYS A HE3  4  
ATOM   3340  H  HZ1  . LYS A 1 21 ? -13.107 -3.076  -10.150 1.00 0.00 ? 21  LYS A HZ1  4  
ATOM   3341  H  HZ2  . LYS A 1 21 ? -14.388 -2.480  -9.222  1.00 0.00 ? 21  LYS A HZ2  4  
ATOM   3342  H  HZ3  . LYS A 1 21 ? -14.019 -4.131  -9.191  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM   3343  N  N    . ALA A 1 22 ? -7.011  -2.514  -6.100  1.00 0.00 ? 22  ALA A N    4  
ATOM   3344  C  CA   . ALA A 1 22 ? -5.705  -3.025  -5.702  1.00 0.00 ? 22  ALA A CA   4  
ATOM   3345  C  C    . ALA A 1 22 ? -5.845  -4.202  -4.742  1.00 0.00 ? 22  ALA A C    4  
ATOM   3346  O  O    . ALA A 1 22 ? -6.929  -4.465  -4.223  1.00 0.00 ? 22  ALA A O    4  
ATOM   3347  C  CB   . ALA A 1 22 ? -4.876  -1.918  -5.066  1.00 0.00 ? 22  ALA A CB   4  
ATOM   3348  H  H    . ALA A 1 22 ? -7.784  -2.674  -5.520  1.00 0.00 ? 22  ALA A H    4  
ATOM   3349  H  HA   . ALA A 1 22 ? -5.191  -3.358  -6.592  1.00 0.00 ? 22  ALA A HA   4  
ATOM   3350  H  HB1  . ALA A 1 22 ? -5.293  -1.667  -4.101  1.00 0.00 ? 22  ALA A HB1  4  
ATOM   3351  H  HB2  . ALA A 1 22 ? -3.859  -2.257  -4.942  1.00 0.00 ? 22  ALA A HB2  4  
ATOM   3352  H  HB3  . ALA A 1 22 ? -4.892  -1.046  -5.702  1.00 0.00 ? 22  ALA A HB3  4  
ATOM   3353  N  N    . MET A 1 23 ? -4.742  -4.906  -4.513  1.00 0.00 ? 23  MET A N    4  
ATOM   3354  C  CA   . MET A 1 23 ? -4.743  -6.056  -3.615  1.00 0.00 ? 23  MET A CA   4  
ATOM   3355  C  C    . MET A 1 23 ? -6.012  -6.883  -3.792  1.00 0.00 ? 23  MET A C    4  
ATOM   3356  O  O    . MET A 1 23 ? -6.483  -7.523  -2.853  1.00 0.00 ? 23  MET A O    4  
ATOM   3357  C  CB   . MET A 1 23 ? -4.621  -5.594  -2.161  1.00 0.00 ? 23  MET A CB   4  
ATOM   3358  C  CG   . MET A 1 23 ? -3.435  -4.675  -1.913  1.00 0.00 ? 23  MET A CG   4  
ATOM   3359  S  SD   . MET A 1 23 ? -2.908  -4.672  -0.189  1.00 0.00 ? 23  MET A SD   4  
ATOM   3360  C  CE   . MET A 1 23 ? -1.415  -5.657  -0.290  1.00 0.00 ? 23  MET A CE   4  
ATOM   3361  H  H    . MET A 1 23 ? -3.907  -4.648  -4.956  1.00 0.00 ? 23  MET A H    4  
ATOM   3362  H  HA   . MET A 1 23 ? -3.890  -6.669  -3.861  1.00 0.00 ? 23  MET A HA   4  
ATOM   3363  H  HB2  . MET A 1 23 ? -5.521  -5.066  -1.886  1.00 0.00 ? 23  MET A HB2  4  
ATOM   3364  H  HB3  . MET A 1 23 ? -4.514  -6.462  -1.528  1.00 0.00 ? 23  MET A HB3  4  
ATOM   3365  H  HG2  . MET A 1 23 ? -2.608  -5.002  -2.526  1.00 0.00 ? 23  MET A HG2  4  
ATOM   3366  H  HG3  . MET A 1 23 ? -3.712  -3.670  -2.193  1.00 0.00 ? 23  MET A HG3  4  
ATOM   3367  H  HE1  . MET A 1 23 ? -1.562  -6.464  -0.992  1.00 0.00 ? 23  MET A HE1  4  
ATOM   3368  H  HE2  . MET A 1 23 ? -0.596  -5.035  -0.622  1.00 0.00 ? 23  MET A HE2  4  
ATOM   3369  H  HE3  . MET A 1 23 ? -1.186  -6.064  0.684   1.00 0.00 ? 23  MET A HE3  4  
ATOM   3370  N  N    . ASN A 1 24 ? -6.561  -6.865  -5.003  1.00 0.00 ? 24  ASN A N    4  
ATOM   3371  C  CA   . ASN A 1 24 ? -7.776  -7.613  -5.303  1.00 0.00 ? 24  ASN A CA   4  
ATOM   3372  C  C    . ASN A 1 24 ? -8.958  -7.074  -4.503  1.00 0.00 ? 24  ASN A C    4  
ATOM   3373  O  O    . ASN A 1 24 ? -9.743  -7.839  -3.945  1.00 0.00 ? 24  ASN A O    4  
ATOM   3374  C  CB   . ASN A 1 24 ? -7.573  -9.099  -4.996  1.00 0.00 ? 24  ASN A CB   4  
ATOM   3375  C  CG   . ASN A 1 24 ? -6.429  -9.702  -5.788  1.00 0.00 ? 24  ASN A CG   4  
ATOM   3376  O  OD1  . ASN A 1 24 ? -6.311  -9.483  -6.994  1.00 0.00 ? 24  ASN A OD1  4  
ATOM   3377  N  ND2  . ASN A 1 24 ? -5.579  -10.465 -5.111  1.00 0.00 ? 24  ASN A ND2  4  
ATOM   3378  H  H    . ASN A 1 24 ? -6.139  -6.335  -5.711  1.00 0.00 ? 24  ASN A H    4  
ATOM   3379  H  HA   . ASN A 1 24 ? -7.985  -7.497  -6.355  1.00 0.00 ? 24  ASN A HA   4  
ATOM   3380  H  HB2  . ASN A 1 24 ? -7.359  -9.217  -3.944  1.00 0.00 ? 24  ASN A HB2  4  
ATOM   3381  H  HB3  . ASN A 1 24 ? -8.478  -9.637  -5.238  1.00 0.00 ? 24  ASN A HB3  4  
ATOM   3382  H  HD21 . ASN A 1 24 ? -5.736  -10.595 -4.152  1.00 0.00 ? 24  ASN A HD21 4  
ATOM   3383  H  HD22 . ASN A 1 24 ? -4.830  -10.867 -5.598  1.00 0.00 ? 24  ASN A HD22 4  
ATOM   3384  N  N    . ASN A 1 25 ? -9.078  -5.751  -4.453  1.00 0.00 ? 25  ASN A N    4  
ATOM   3385  C  CA   . ASN A 1 25 ? -10.164 -5.109  -3.721  1.00 0.00 ? 25  ASN A CA   4  
ATOM   3386  C  C    . ASN A 1 25 ? -10.235 -3.621  -4.049  1.00 0.00 ? 25  ASN A C    4  
ATOM   3387  O  O    . ASN A 1 25 ? -9.282  -3.044  -4.574  1.00 0.00 ? 25  ASN A O    4  
ATOM   3388  C  CB   . ASN A 1 25 ? -9.977  -5.303  -2.215  1.00 0.00 ? 25  ASN A CB   4  
ATOM   3389  C  CG   . ASN A 1 25 ? -10.369 -6.695  -1.759  1.00 0.00 ? 25  ASN A CG   4  
ATOM   3390  O  OD1  . ASN A 1 25 ? -11.553 -7.017  -1.659  1.00 0.00 ? 25  ASN A OD1  4  
ATOM   3391  N  ND2  . ASN A 1 25 ? -9.374  -7.528  -1.477  1.00 0.00 ? 25  ASN A ND2  4  
ATOM   3392  H  H    . ASN A 1 25 ? -8.420  -5.194  -4.918  1.00 0.00 ? 25  ASN A H    4  
ATOM   3393  H  HA   . ASN A 1 25 ? -11.089 -5.577  -4.024  1.00 0.00 ? 25  ASN A HA   4  
ATOM   3394  H  HB2  . ASN A 1 25 ? -8.939  -5.142  -1.964  1.00 0.00 ? 25  ASN A HB2  4  
ATOM   3395  H  HB3  . ASN A 1 25 ? -10.587 -4.586  -1.687  1.00 0.00 ? 25  ASN A HB3  4  
ATOM   3396  H  HD21 . ASN A 1 25 ? -8.455  -7.202  -1.579  1.00 0.00 ? 25  ASN A HD21 4  
ATOM   3397  H  HD22 . ASN A 1 25 ? -9.599  -8.434  -1.180  1.00 0.00 ? 25  ASN A HD22 4  
ATOM   3398  N  N    . SER A 1 26 ? -11.370 -3.005  -3.735  1.00 0.00 ? 26  SER A N    4  
ATOM   3399  C  CA   . SER A 1 26 ? -11.567 -1.584  -3.998  1.00 0.00 ? 26  SER A CA   4  
ATOM   3400  C  C    . SER A 1 26 ? -11.110 -0.743  -2.811  1.00 0.00 ? 26  SER A C    4  
ATOM   3401  O  O    . SER A 1 26 ? -11.252 -1.149  -1.657  1.00 0.00 ? 26  SER A O    4  
ATOM   3402  C  CB   . SER A 1 26 ? -13.039 -1.300  -4.303  1.00 0.00 ? 26  SER A CB   4  
ATOM   3403  O  OG   . SER A 1 26 ? -13.880 -1.824  -3.289  1.00 0.00 ? 26  SER A OG   4  
ATOM   3404  H  H    . SER A 1 26 ? -12.093 -3.519  -3.318  1.00 0.00 ? 26  SER A H    4  
ATOM   3405  H  HA   . SER A 1 26 ? -10.973 -1.322  -4.861  1.00 0.00 ? 26  SER A HA   4  
ATOM   3406  H  HB2  . SER A 1 26 ? -13.192 -0.233  -4.365  1.00 0.00 ? 26  SER A HB2  4  
ATOM   3407  H  HB3  . SER A 1 26 ? -13.304 -1.757  -5.245  1.00 0.00 ? 26  SER A HB3  4  
ATOM   3408  H  HG   . SER A 1 26 ? -14.443 -2.507  -3.661  1.00 0.00 ? 26  SER A HG   4  
ATOM   3409  N  N    . TRP A 1 27 ? -10.561 0.431   -3.102  1.00 0.00 ? 27  TRP A N    4  
ATOM   3410  C  CA   . TRP A 1 27 ? -10.082 1.330   -2.059  1.00 0.00 ? 27  TRP A CA   4  
ATOM   3411  C  C    . TRP A 1 27 ? -10.228 2.786   -2.487  1.00 0.00 ? 27  TRP A C    4  
ATOM   3412  O  O    . TRP A 1 27 ? -10.555 3.075   -3.638  1.00 0.00 ? 27  TRP A O    4  
ATOM   3413  C  CB   . TRP A 1 27 ? -8.620  1.027   -1.727  1.00 0.00 ? 27  TRP A CB   4  
ATOM   3414  C  CG   . TRP A 1 27 ? -8.312  -0.439  -1.684  1.00 0.00 ? 27  TRP A CG   4  
ATOM   3415  C  CD1  . TRP A 1 27 ? -8.488  -1.343  -2.693  1.00 0.00 ? 27  TRP A CD1  4  
ATOM   3416  C  CD2  . TRP A 1 27 ? -7.777  -1.171  -0.576  1.00 0.00 ? 27  TRP A CD2  4  
ATOM   3417  N  NE1  . TRP A 1 27 ? -8.094  -2.593  -2.278  1.00 0.00 ? 27  TRP A NE1  4  
ATOM   3418  C  CE2  . TRP A 1 27 ? -7.653  -2.513  -0.983  1.00 0.00 ? 27  TRP A CE2  4  
ATOM   3419  C  CE3  . TRP A 1 27 ? -7.389  -0.822  0.720   1.00 0.00 ? 27  TRP A CE3  4  
ATOM   3420  C  CZ2  . TRP A 1 27 ? -7.159  -3.504  -0.140  1.00 0.00 ? 27  TRP A CZ2  4  
ATOM   3421  C  CZ3  . TRP A 1 27 ? -6.898  -1.807  1.556   1.00 0.00 ? 27  TRP A CZ3  4  
ATOM   3422  C  CH2  . TRP A 1 27 ? -6.786  -3.135  1.124   1.00 0.00 ? 27  TRP A CH2  4  
ATOM   3423  H  H    . TRP A 1 27 ? -10.475 0.699   -4.041  1.00 0.00 ? 27  TRP A H    4  
ATOM   3424  H  HA   . TRP A 1 27 ? -10.684 1.164   -1.177  1.00 0.00 ? 27  TRP A HA   4  
ATOM   3425  H  HB2  . TRP A 1 27 ? -7.986  1.479   -2.475  1.00 0.00 ? 27  TRP A HB2  4  
ATOM   3426  H  HB3  . TRP A 1 27 ? -8.384  1.446   -0.759  1.00 0.00 ? 27  TRP A HB3  4  
ATOM   3427  H  HD1  . TRP A 1 27 ? -8.882  -1.098  -3.667  1.00 0.00 ? 27  TRP A HD1  4  
ATOM   3428  H  HE1  . TRP A 1 27 ? -8.123  -3.408  -2.822  1.00 0.00 ? 27  TRP A HE1  4  
ATOM   3429  H  HE3  . TRP A 1 27 ? -7.467  0.196   1.072   1.00 0.00 ? 27  TRP A HE3  4  
ATOM   3430  H  HZ2  . TRP A 1 27 ? -7.066  -4.532  -0.459  1.00 0.00 ? 27  TRP A HZ2  4  
ATOM   3431  H  HZ3  . TRP A 1 27 ? -6.593  -1.556  2.562   1.00 0.00 ? 27  TRP A HZ3  4  
ATOM   3432  H  HH2  . TRP A 1 27 ? -6.398  -3.871  1.811   1.00 0.00 ? 27  TRP A HH2  4  
ATOM   3433  N  N    . HIS A 1 28 ? -9.982  3.701   -1.554  1.00 0.00 ? 28  HIS A N    4  
ATOM   3434  C  CA   . HIS A 1 28 ? -10.085 5.128   -1.836  1.00 0.00 ? 28  HIS A CA   4  
ATOM   3435  C  C    . HIS A 1 28 ? -8.760  5.676   -2.357  1.00 0.00 ? 28  HIS A C    4  
ATOM   3436  O  O    . HIS A 1 28 ? -7.693  5.101   -2.138  1.00 0.00 ? 28  HIS A O    4  
ATOM   3437  C  CB   . HIS A 1 28 ? -10.505 5.889   -0.578  1.00 0.00 ? 28  HIS A CB   4  
ATOM   3438  C  CG   . HIS A 1 28 ? -11.961 5.751   -0.253  1.00 0.00 ? 28  HIS A CG   4  
ATOM   3439  N  ND1  . HIS A 1 28 ? -12.420 5.243   0.944   1.00 0.00 ? 28  HIS A ND1  4  
ATOM   3440  C  CD2  . HIS A 1 28 ? -13.063 6.061   -0.976  1.00 0.00 ? 28  HIS A CD2  4  
ATOM   3441  C  CE1  . HIS A 1 28 ? -13.741 5.244   0.942   1.00 0.00 ? 28  HIS A CE1  4  
ATOM   3442  N  NE2  . HIS A 1 28 ? -14.156 5.736   -0.211  1.00 0.00 ? 28  HIS A NE2  4  
ATOM   3443  H  H    . HIS A 1 28 ? -9.725  3.408   -0.654  1.00 0.00 ? 28  HIS A H    4  
ATOM   3444  H  HA   . HIS A 1 28 ? -10.840 5.262   -2.596  1.00 0.00 ? 28  HIS A HA   4  
ATOM   3445  H  HB2  . HIS A 1 28 ? -9.941  5.517   0.265   1.00 0.00 ? 28  HIS A HB2  4  
ATOM   3446  H  HB3  . HIS A 1 28 ? -10.292 6.940   -0.712  1.00 0.00 ? 28  HIS A HB3  4  
ATOM   3447  H  HD2  . HIS A 1 28 ? -13.079 6.484   -1.970  1.00 0.00 ? 28  HIS A HD2  4  
ATOM   3448  H  HE1  . HIS A 1 28 ? -14.375 4.902   1.747   1.00 0.00 ? 28  HIS A HE1  4  
ATOM   3449  H  HE2  . HIS A 1 28 ? -15.089 5.769   -0.508  1.00 0.00 ? 28  HIS A HE2  4  
ATOM   3450  N  N    . PRO A 1 29 ? -8.827  6.813   -3.065  1.00 0.00 ? 29  PRO A N    4  
ATOM   3451  C  CA   . PRO A 1 29 ? -7.642  7.463   -3.632  1.00 0.00 ? 29  PRO A CA   4  
ATOM   3452  C  C    . PRO A 1 29 ? -6.743  8.069   -2.559  1.00 0.00 ? 29  PRO A C    4  
ATOM   3453  O  O    . PRO A 1 29 ? -5.702  8.648   -2.865  1.00 0.00 ? 29  PRO A O    4  
ATOM   3454  C  CB   . PRO A 1 29 ? -8.231  8.563   -4.519  1.00 0.00 ? 29  PRO A CB   4  
ATOM   3455  C  CG   . PRO A 1 29 ? -9.565  8.856   -3.924  1.00 0.00 ? 29  PRO A CG   4  
ATOM   3456  C  CD   . PRO A 1 29 ? -10.064 7.553   -3.365  1.00 0.00 ? 29  PRO A CD   4  
ATOM   3457  H  HA   . PRO A 1 29 ? -7.066  6.779   -4.239  1.00 0.00 ? 29  PRO A HA   4  
ATOM   3458  H  HB2  . PRO A 1 29 ? -7.587  9.431   -4.496  1.00 0.00 ? 29  PRO A HB2  4  
ATOM   3459  H  HB3  . PRO A 1 29 ? -8.322  8.203   -5.533  1.00 0.00 ? 29  PRO A HB3  4  
ATOM   3460  H  HG2  . PRO A 1 29 ? -9.462  9.587   -3.136  1.00 0.00 ? 29  PRO A HG2  4  
ATOM   3461  H  HG3  . PRO A 1 29 ? -10.236 9.218   -4.688  1.00 0.00 ? 29  PRO A HG3  4  
ATOM   3462  H  HD2  . PRO A 1 29 ? -10.640 7.723   -2.467  1.00 0.00 ? 29  PRO A HD2  4  
ATOM   3463  H  HD3  . PRO A 1 29 ? -10.656 7.029   -4.101  1.00 0.00 ? 29  PRO A HD3  4  
ATOM   3464  N  N    . GLU A 1 30 ? -7.153  7.929   -1.303  1.00 0.00 ? 30  GLU A N    4  
ATOM   3465  C  CA   . GLU A 1 30 ? -6.384  8.464   -0.185  1.00 0.00 ? 30  GLU A CA   4  
ATOM   3466  C  C    . GLU A 1 30 ? -6.092  7.375   0.844   1.00 0.00 ? 30  GLU A C    4  
ATOM   3467  O  O    . GLU A 1 30 ? -5.112  7.453   1.586   1.00 0.00 ? 30  GLU A O    4  
ATOM   3468  C  CB   . GLU A 1 30 ? -7.139  9.618   0.477   1.00 0.00 ? 30  GLU A CB   4  
ATOM   3469  C  CG   . GLU A 1 30 ? -8.424  9.189   1.165   1.00 0.00 ? 30  GLU A CG   4  
ATOM   3470  C  CD   . GLU A 1 30 ? -8.920  10.214  2.167   1.00 0.00 ? 30  GLU A CD   4  
ATOM   3471  O  OE1  . GLU A 1 30 ? -8.618  11.413  1.988   1.00 0.00 ? 30  GLU A OE1  4  
ATOM   3472  O  OE2  . GLU A 1 30 ? -9.609  9.817   3.129   1.00 0.00 ? 30  GLU A OE2  4  
ATOM   3473  H  H    . GLU A 1 30 ? -7.993  7.457   -1.123  1.00 0.00 ? 30  GLU A H    4  
ATOM   3474  H  HA   . GLU A 1 30 ? -5.448  8.834   -0.574  1.00 0.00 ? 30  GLU A HA   4  
ATOM   3475  H  HB2  . GLU A 1 30 ? -6.496  10.077  1.214   1.00 0.00 ? 30  GLU A HB2  4  
ATOM   3476  H  HB3  . GLU A 1 30 ? -7.386  10.350  -0.277  1.00 0.00 ? 30  GLU A HB3  4  
ATOM   3477  H  HG2  . GLU A 1 30 ? -9.187  9.044   0.415   1.00 0.00 ? 30  GLU A HG2  4  
ATOM   3478  H  HG3  . GLU A 1 30 ? -8.248  8.258   1.682   1.00 0.00 ? 30  GLU A HG3  4  
ATOM   3479  N  N    . CYS A 1 31 ? -6.949  6.361   0.883   1.00 0.00 ? 31  CYS A N    4  
ATOM   3480  C  CA   . CYS A 1 31 ? -6.786  5.257   1.821   1.00 0.00 ? 31  CYS A CA   4  
ATOM   3481  C  C    . CYS A 1 31 ? -5.630  4.353   1.401   1.00 0.00 ? 31  CYS A C    4  
ATOM   3482  O  O    . CYS A 1 31 ? -4.710  4.102   2.179   1.00 0.00 ? 31  CYS A O    4  
ATOM   3483  C  CB   . CYS A 1 31 ? -8.077  4.442   1.912   1.00 0.00 ? 31  CYS A CB   4  
ATOM   3484  S  SG   . CYS A 1 31 ? -9.358  5.194   2.967   1.00 0.00 ? 31  CYS A SG   4  
ATOM   3485  H  H    . CYS A 1 31 ? -7.711  6.355   0.266   1.00 0.00 ? 31  CYS A H    4  
ATOM   3486  H  HA   . CYS A 1 31 ? -6.565  5.675   2.791   1.00 0.00 ? 31  CYS A HA   4  
ATOM   3487  H  HB2  . CYS A 1 31 ? -8.493  4.329   0.921   1.00 0.00 ? 31  CYS A HB2  4  
ATOM   3488  H  HB3  . CYS A 1 31 ? -7.851  3.466   2.314   1.00 0.00 ? 31  CYS A HB3  4  
ATOM   3489  N  N    . PHE A 1 32 ? -5.685  3.867   0.165   1.00 0.00 ? 32  PHE A N    4  
ATOM   3490  C  CA   . PHE A 1 32 ? -4.644  2.991   -0.359  1.00 0.00 ? 32  PHE A CA   4  
ATOM   3491  C  C    . PHE A 1 32 ? -3.283  3.682   -0.326  1.00 0.00 ? 32  PHE A C    4  
ATOM   3492  O  O    . PHE A 1 32 ? -2.907  4.380   -1.267  1.00 0.00 ? 32  PHE A O    4  
ATOM   3493  C  CB   . PHE A 1 32 ? -4.977  2.567   -1.790  1.00 0.00 ? 32  PHE A CB   4  
ATOM   3494  C  CG   . PHE A 1 32 ? -4.344  1.265   -2.193  1.00 0.00 ? 32  PHE A CG   4  
ATOM   3495  C  CD1  . PHE A 1 32 ? -4.581  0.110   -1.466  1.00 0.00 ? 32  PHE A CD1  4  
ATOM   3496  C  CD2  . PHE A 1 32 ? -3.512  1.197   -3.299  1.00 0.00 ? 32  PHE A CD2  4  
ATOM   3497  C  CE1  . PHE A 1 32 ? -3.999  -1.088  -1.834  1.00 0.00 ? 32  PHE A CE1  4  
ATOM   3498  C  CE2  . PHE A 1 32 ? -2.927  0.002   -3.672  1.00 0.00 ? 32  PHE A CE2  4  
ATOM   3499  C  CZ   . PHE A 1 32 ? -3.172  -1.143  -2.939  1.00 0.00 ? 32  PHE A CZ   4  
ATOM   3500  H  H    . PHE A 1 32 ? -6.444  4.104   -0.408  1.00 0.00 ? 32  PHE A H    4  
ATOM   3501  H  HA   . PHE A 1 32 ? -4.604  2.114   0.268   1.00 0.00 ? 32  PHE A HA   4  
ATOM   3502  H  HB2  . PHE A 1 32 ? -6.047  2.458   -1.886  1.00 0.00 ? 32  PHE A HB2  4  
ATOM   3503  H  HB3  . PHE A 1 32 ? -4.635  3.329   -2.473  1.00 0.00 ? 32  PHE A HB3  4  
ATOM   3504  H  HD1  . PHE A 1 32 ? -5.229  0.151   -0.602  1.00 0.00 ? 32  PHE A HD1  4  
ATOM   3505  H  HD2  . PHE A 1 32 ? -3.320  2.093   -3.873  1.00 0.00 ? 32  PHE A HD2  4  
ATOM   3506  H  HE1  . PHE A 1 32 ? -4.192  -1.982  -1.259  1.00 0.00 ? 32  PHE A HE1  4  
ATOM   3507  H  HE2  . PHE A 1 32 ? -2.281  -0.037  -4.536  1.00 0.00 ? 32  PHE A HE2  4  
ATOM   3508  H  HZ   . PHE A 1 32 ? -2.716  -2.078  -3.228  1.00 0.00 ? 32  PHE A HZ   4  
ATOM   3509  N  N    . ARG A 1 33 ? -2.552  3.483   0.766   1.00 0.00 ? 33  ARG A N    4  
ATOM   3510  C  CA   . ARG A 1 33 ? -1.234  4.087   0.924   1.00 0.00 ? 33  ARG A CA   4  
ATOM   3511  C  C    . ARG A 1 33 ? -0.178  3.023   1.207   1.00 0.00 ? 33  ARG A C    4  
ATOM   3512  O  O    . ARG A 1 33 ? -0.504  1.883   1.538   1.00 0.00 ? 33  ARG A O    4  
ATOM   3513  C  CB   . ARG A 1 33 ? -1.254  5.116   2.056   1.00 0.00 ? 33  ARG A CB   4  
ATOM   3514  C  CG   . ARG A 1 33 ? -2.303  6.201   1.874   1.00 0.00 ? 33  ARG A CG   4  
ATOM   3515  C  CD   . ARG A 1 33 ? -2.155  7.299   2.916   1.00 0.00 ? 33  ARG A CD   4  
ATOM   3516  N  NE   . ARG A 1 33 ? -1.324  8.400   2.436   1.00 0.00 ? 33  ARG A NE   4  
ATOM   3517  C  CZ   . ARG A 1 33 ? -0.712  9.263   3.240   1.00 0.00 ? 33  ARG A CZ   4  
ATOM   3518  N  NH1  . ARG A 1 33 ? -0.837  9.153   4.555   1.00 0.00 ? 33  ARG A NH1  4  
ATOM   3519  N  NH2  . ARG A 1 33 ? 0.027   10.238  2.728   1.00 0.00 ? 33  ARG A NH2  4  
ATOM   3520  H  H    . ARG A 1 33 ? -2.906  2.916   1.482   1.00 0.00 ? 33  ARG A H    4  
ATOM   3521  H  HA   . ARG A 1 33 ? -0.986  4.587   -0.001  1.00 0.00 ? 33  ARG A HA   4  
ATOM   3522  H  HB2  . ARG A 1 33 ? -1.454  4.606   2.987   1.00 0.00 ? 33  ARG A HB2  4  
ATOM   3523  H  HB3  . ARG A 1 33 ? -0.285  5.588   2.114   1.00 0.00 ? 33  ARG A HB3  4  
ATOM   3524  H  HG2  . ARG A 1 33 ? -2.192  6.635   0.892   1.00 0.00 ? 33  ARG A HG2  4  
ATOM   3525  H  HG3  . ARG A 1 33 ? -3.284  5.759   1.967   1.00 0.00 ? 33  ARG A HG3  4  
ATOM   3526  H  HD2  . ARG A 1 33 ? -3.135  7.680   3.160   1.00 0.00 ? 33  ARG A HD2  4  
ATOM   3527  H  HD3  . ARG A 1 33 ? -1.702  6.877   3.801   1.00 0.00 ? 33  ARG A HD3  4  
ATOM   3528  H  HE   . ARG A 1 33 ? -1.218  8.500   1.468   1.00 0.00 ? 33  ARG A HE   4  
ATOM   3529  H  HH11 . ARG A 1 33 ? -1.393  8.418   4.944   1.00 0.00 ? 33  ARG A HH11 4  
ATOM   3530  H  HH12 . ARG A 1 33 ? -0.375  9.803   5.158   1.00 0.00 ? 33  ARG A HH12 4  
ATOM   3531  H  HH21 . ARG A 1 33 ? 0.124   10.324  1.737   1.00 0.00 ? 33  ARG A HH21 4  
ATOM   3532  H  HH22 . ARG A 1 33 ? 0.487   10.888  3.333   1.00 0.00 ? 33  ARG A HH22 4  
ATOM   3533  N  N    . CYS A 1 34 ? 1.088   3.404   1.074   1.00 0.00 ? 34  CYS A N    4  
ATOM   3534  C  CA   . CYS A 1 34 ? 2.193   2.484   1.315   1.00 0.00 ? 34  CYS A CA   4  
ATOM   3535  C  C    . CYS A 1 34 ? 2.111   1.891   2.719   1.00 0.00 ? 34  CYS A C    4  
ATOM   3536  O  O    . CYS A 1 34 ? 1.349   2.365   3.561   1.00 0.00 ? 34  CYS A O    4  
ATOM   3537  C  CB   . CYS A 1 34 ? 3.531   3.201   1.129   1.00 0.00 ? 34  CYS A CB   4  
ATOM   3538  S  SG   . CYS A 1 34 ? 4.962   2.082   0.989   1.00 0.00 ? 34  CYS A SG   4  
ATOM   3539  H  H    . CYS A 1 34 ? 1.285   4.327   0.807   1.00 0.00 ? 34  CYS A H    4  
ATOM   3540  H  HA   . CYS A 1 34 ? 2.121   1.683   0.595   1.00 0.00 ? 34  CYS A HA   4  
ATOM   3541  H  HB2  . CYS A 1 34 ? 3.491   3.795   0.228   1.00 0.00 ? 34  CYS A HB2  4  
ATOM   3542  H  HB3  . CYS A 1 34 ? 3.703   3.851   1.974   1.00 0.00 ? 34  CYS A HB3  4  
ATOM   3543  N  N    . ASP A 1 35 ? 2.903   0.852   2.963   1.00 0.00 ? 35  ASP A N    4  
ATOM   3544  C  CA   . ASP A 1 35 ? 2.922   0.195   4.265   1.00 0.00 ? 35  ASP A CA   4  
ATOM   3545  C  C    . ASP A 1 35 ? 4.192   0.546   5.032   1.00 0.00 ? 35  ASP A C    4  
ATOM   3546  O  O    . ASP A 1 35 ? 4.383   0.113   6.169   1.00 0.00 ? 35  ASP A O    4  
ATOM   3547  C  CB   . ASP A 1 35 ? 2.815   -1.321  4.096   1.00 0.00 ? 35  ASP A CB   4  
ATOM   3548  C  CG   . ASP A 1 35 ? 2.767   -2.050  5.425   1.00 0.00 ? 35  ASP A CG   4  
ATOM   3549  O  OD1  . ASP A 1 35 ? 1.835   -1.786  6.213   1.00 0.00 ? 35  ASP A OD1  4  
ATOM   3550  O  OD2  . ASP A 1 35 ? 3.661   -2.885  5.676   1.00 0.00 ? 35  ASP A OD2  4  
ATOM   3551  H  H    . ASP A 1 35 ? 3.489   0.520   2.251   1.00 0.00 ? 35  ASP A H    4  
ATOM   3552  H  HA   . ASP A 1 35 ? 2.069   0.546   4.826   1.00 0.00 ? 35  ASP A HA   4  
ATOM   3553  H  HB2  . ASP A 1 35 ? 1.915   -1.554  3.546   1.00 0.00 ? 35  ASP A HB2  4  
ATOM   3554  H  HB3  . ASP A 1 35 ? 3.672   -1.676  3.542   1.00 0.00 ? 35  ASP A HB3  4  
ATOM   3555  N  N    . LEU A 1 36 ? 5.059   1.332   4.403   1.00 0.00 ? 36  LEU A N    4  
ATOM   3556  C  CA   . LEU A 1 36 ? 6.313   1.741   5.026   1.00 0.00 ? 36  LEU A CA   4  
ATOM   3557  C  C    . LEU A 1 36 ? 6.375   3.257   5.183   1.00 0.00 ? 36  LEU A C    4  
ATOM   3558  O  O    . LEU A 1 36 ? 6.937   3.769   6.151   1.00 0.00 ? 36  LEU A O    4  
ATOM   3559  C  CB   . LEU A 1 36 ? 7.501   1.254   4.194   1.00 0.00 ? 36  LEU A CB   4  
ATOM   3560  C  CG   . LEU A 1 36 ? 7.704   -0.260  4.135   1.00 0.00 ? 36  LEU A CG   4  
ATOM   3561  C  CD1  . LEU A 1 36 ? 8.464   -0.648  2.876   1.00 0.00 ? 36  LEU A CD1  4  
ATOM   3562  C  CD2  . LEU A 1 36 ? 8.438   -0.749  5.375   1.00 0.00 ? 36  LEU A CD2  4  
ATOM   3563  H  H    . LEU A 1 36 ? 4.852   1.645   3.498   1.00 0.00 ? 36  LEU A H    4  
ATOM   3564  H  HA   . LEU A 1 36 ? 6.360   1.287   6.005   1.00 0.00 ? 36  LEU A HA   4  
ATOM   3565  H  HB2  . LEU A 1 36 ? 7.365   1.609   3.184   1.00 0.00 ? 36  LEU A HB2  4  
ATOM   3566  H  HB3  . LEU A 1 36 ? 8.397   1.693   4.610   1.00 0.00 ? 36  LEU A HB3  4  
ATOM   3567  H  HG   . LEU A 1 36 ? 6.738   -0.745  4.104   1.00 0.00 ? 36  LEU A HG   4  
ATOM   3568  H  HD11 . LEU A 1 36 ? 8.722   -1.695  2.920   1.00 0.00 ? 36  LEU A HD11 4  
ATOM   3569  H  HD12 . LEU A 1 36 ? 9.365   -0.058  2.803   1.00 0.00 ? 36  LEU A HD12 4  
ATOM   3570  H  HD13 . LEU A 1 36 ? 7.844   -0.465  2.010   1.00 0.00 ? 36  LEU A HD13 4  
ATOM   3571  H  HD21 . LEU A 1 36 ? 9.445   -1.034  5.108   1.00 0.00 ? 36  LEU A HD21 4  
ATOM   3572  H  HD22 . LEU A 1 36 ? 7.920   -1.602  5.787   1.00 0.00 ? 36  LEU A HD22 4  
ATOM   3573  H  HD23 . LEU A 1 36 ? 8.471   0.043   6.109   1.00 0.00 ? 36  LEU A HD23 4  
ATOM   3574  N  N    . CYS A 1 37 ? 5.790   3.970   4.226   1.00 0.00 ? 37  CYS A N    4  
ATOM   3575  C  CA   . CYS A 1 37 ? 5.776   5.427   4.257   1.00 0.00 ? 37  CYS A CA   4  
ATOM   3576  C  C    . CYS A 1 37 ? 4.349   5.959   4.163   1.00 0.00 ? 37  CYS A C    4  
ATOM   3577  O  O    . CYS A 1 37 ? 4.115   7.161   4.287   1.00 0.00 ? 37  CYS A O    4  
ATOM   3578  C  CB   . CYS A 1 37 ? 6.619   5.991   3.112   1.00 0.00 ? 37  CYS A CB   4  
ATOM   3579  S  SG   . CYS A 1 37 ? 5.941   5.658   1.455   1.00 0.00 ? 37  CYS A SG   4  
ATOM   3580  H  H    . CYS A 1 37 ? 5.358   3.504   3.479   1.00 0.00 ? 37  CYS A H    4  
ATOM   3581  H  HA   . CYS A 1 37 ? 6.203   5.743   5.197   1.00 0.00 ? 37  CYS A HA   4  
ATOM   3582  H  HB2  . CYS A 1 37 ? 6.695   7.063   3.226   1.00 0.00 ? 37  CYS A HB2  4  
ATOM   3583  H  HB3  . CYS A 1 37 ? 7.608   5.559   3.157   1.00 0.00 ? 37  CYS A HB3  4  
ATOM   3584  N  N    . GLN A 1 38 ? 3.399   5.055   3.943   1.00 0.00 ? 38  GLN A N    4  
ATOM   3585  C  CA   . GLN A 1 38 ? 1.996   5.434   3.832   1.00 0.00 ? 38  GLN A CA   4  
ATOM   3586  C  C    . GLN A 1 38 ? 1.805   6.509   2.766   1.00 0.00 ? 38  GLN A C    4  
ATOM   3587  O  O    . GLN A 1 38 ? 1.248   7.572   3.037   1.00 0.00 ? 38  GLN A O    4  
ATOM   3588  C  CB   . GLN A 1 38 ? 1.473   5.936   5.179   1.00 0.00 ? 38  GLN A CB   4  
ATOM   3589  C  CG   . GLN A 1 38 ? 1.659   4.941   6.313   1.00 0.00 ? 38  GLN A CG   4  
ATOM   3590  C  CD   . GLN A 1 38 ? 0.464   4.024   6.486   1.00 0.00 ? 38  GLN A CD   4  
ATOM   3591  O  OE1  . GLN A 1 38 ? -0.668  4.482   6.642   1.00 0.00 ? 38  GLN A OE1  4  
ATOM   3592  N  NE2  . GLN A 1 38 ? 0.711   2.719   6.460   1.00 0.00 ? 38  GLN A NE2  4  
ATOM   3593  H  H    . GLN A 1 38 ? 3.649   4.113   3.854   1.00 0.00 ? 38  GLN A H    4  
ATOM   3594  H  HA   . GLN A 1 38 ? 1.438   4.556   3.544   1.00 0.00 ? 38  GLN A HA   4  
ATOM   3595  H  HB2  . GLN A 1 38 ? 1.994   6.846   5.437   1.00 0.00 ? 38  GLN A HB2  4  
ATOM   3596  H  HB3  . GLN A 1 38 ? 0.418   6.149   5.085   1.00 0.00 ? 38  GLN A HB3  4  
ATOM   3597  H  HG2  . GLN A 1 38 ? 2.530   4.337   6.105   1.00 0.00 ? 38  GLN A HG2  4  
ATOM   3598  H  HG3  . GLN A 1 38 ? 1.812   5.487   7.232   1.00 0.00 ? 38  GLN A HG3  4  
ATOM   3599  H  HE21 . GLN A 1 38 ? 1.638   2.426   6.334   1.00 0.00 ? 38  GLN A HE21 4  
ATOM   3600  H  HE22 . GLN A 1 38 ? -0.042  2.104   6.571   1.00 0.00 ? 38  GLN A HE22 4  
ATOM   3601  N  N    . GLU A 1 39 ? 2.271   6.223   1.555   1.00 0.00 ? 39  GLU A N    4  
ATOM   3602  C  CA   . GLU A 1 39 ? 2.152   7.167   0.449   1.00 0.00 ? 39  GLU A CA   4  
ATOM   3603  C  C    . GLU A 1 39 ? 1.065   6.727   -0.527  1.00 0.00 ? 39  GLU A C    4  
ATOM   3604  O  O    . GLU A 1 39 ? 1.024   5.571   -0.949  1.00 0.00 ? 39  GLU A O    4  
ATOM   3605  C  CB   . GLU A 1 39 ? 3.489   7.298   -0.284  1.00 0.00 ? 39  GLU A CB   4  
ATOM   3606  C  CG   . GLU A 1 39 ? 3.396   8.084   -1.581  1.00 0.00 ? 39  GLU A CG   4  
ATOM   3607  C  CD   . GLU A 1 39 ? 4.736   8.637   -2.026  1.00 0.00 ? 39  GLU A CD   4  
ATOM   3608  O  OE1  . GLU A 1 39 ? 5.750   7.920   -1.883  1.00 0.00 ? 39  GLU A OE1  4  
ATOM   3609  O  OE2  . GLU A 1 39 ? 4.773   9.785   -2.516  1.00 0.00 ? 39  GLU A OE2  4  
ATOM   3610  H  H    . GLU A 1 39 ? 2.706   5.358   1.401   1.00 0.00 ? 39  GLU A H    4  
ATOM   3611  H  HA   . GLU A 1 39 ? 1.882   8.128   0.861   1.00 0.00 ? 39  GLU A HA   4  
ATOM   3612  H  HB2  . GLU A 1 39 ? 4.195   7.795   0.365   1.00 0.00 ? 39  GLU A HB2  4  
ATOM   3613  H  HB3  . GLU A 1 39 ? 3.858   6.309   -0.513  1.00 0.00 ? 39  GLU A HB3  4  
ATOM   3614  H  HG2  . GLU A 1 39 ? 3.018   7.433   -2.356  1.00 0.00 ? 39  GLU A HG2  4  
ATOM   3615  H  HG3  . GLU A 1 39 ? 2.712   8.908   -1.440  1.00 0.00 ? 39  GLU A HG3  4  
ATOM   3616  N  N    . VAL A 1 40 ? 0.184   7.658   -0.881  1.00 0.00 ? 40  VAL A N    4  
ATOM   3617  C  CA   . VAL A 1 40 ? -0.904  7.368   -1.807  1.00 0.00 ? 40  VAL A CA   4  
ATOM   3618  C  C    . VAL A 1 40 ? -0.413  6.542   -2.991  1.00 0.00 ? 40  VAL A C    4  
ATOM   3619  O  O    . VAL A 1 40 ? 0.387   7.013   -3.800  1.00 0.00 ? 40  VAL A O    4  
ATOM   3620  C  CB   . VAL A 1 40 ? -1.554  8.662   -2.332  1.00 0.00 ? 40  VAL A CB   4  
ATOM   3621  C  CG1  . VAL A 1 40 ? -2.671  8.338   -3.312  1.00 0.00 ? 40  VAL A CG1  4  
ATOM   3622  C  CG2  . VAL A 1 40 ? -2.075  9.503   -1.176  1.00 0.00 ? 40  VAL A CG2  4  
ATOM   3623  H  H    . VAL A 1 40 ? 0.268   8.561   -0.510  1.00 0.00 ? 40  VAL A H    4  
ATOM   3624  H  HA   . VAL A 1 40 ? -1.655  6.803   -1.274  1.00 0.00 ? 40  VAL A HA   4  
ATOM   3625  H  HB   . VAL A 1 40 ? -0.801  9.232   -2.855  1.00 0.00 ? 40  VAL A HB   4  
ATOM   3626  H  HG11 . VAL A 1 40 ? -2.338  8.546   -4.318  1.00 0.00 ? 40  VAL A HG11 4  
ATOM   3627  H  HG12 . VAL A 1 40 ? -2.935  7.294   -3.227  1.00 0.00 ? 40  VAL A HG12 4  
ATOM   3628  H  HG13 . VAL A 1 40 ? -3.535  8.947   -3.087  1.00 0.00 ? 40  VAL A HG13 4  
ATOM   3629  H  HG21 . VAL A 1 40 ? -2.329  10.489  -1.536  1.00 0.00 ? 40  VAL A HG21 4  
ATOM   3630  H  HG22 . VAL A 1 40 ? -2.953  9.035   -0.757  1.00 0.00 ? 40  VAL A HG22 4  
ATOM   3631  H  HG23 . VAL A 1 40 ? -1.312  9.582   -0.416  1.00 0.00 ? 40  VAL A HG23 4  
ATOM   3632  N  N    . LEU A 1 41 ? -0.897  5.309   -3.086  1.00 0.00 ? 41  LEU A N    4  
ATOM   3633  C  CA   . LEU A 1 41 ? -0.507  4.416   -4.172  1.00 0.00 ? 41  LEU A CA   4  
ATOM   3634  C  C    . LEU A 1 41 ? -1.603  4.336   -5.231  1.00 0.00 ? 41  LEU A C    4  
ATOM   3635  O  O    . LEU A 1 41 ? -1.822  3.286   -5.833  1.00 0.00 ? 41  LEU A O    4  
ATOM   3636  C  CB   . LEU A 1 41 ? -0.206  3.019   -3.627  1.00 0.00 ? 41  LEU A CB   4  
ATOM   3637  C  CG   . LEU A 1 41 ? 0.329   2.958   -2.196  1.00 0.00 ? 41  LEU A CG   4  
ATOM   3638  C  CD1  . LEU A 1 41 ? -0.041  1.635   -1.544  1.00 0.00 ? 41  LEU A CD1  4  
ATOM   3639  C  CD2  . LEU A 1 41 ? 1.838   3.159   -2.181  1.00 0.00 ? 41  LEU A CD2  4  
ATOM   3640  H  H    . LEU A 1 41 ? -1.531  4.990   -2.411  1.00 0.00 ? 41  LEU A H    4  
ATOM   3641  H  HA   . LEU A 1 41 ? 0.387   4.817   -4.627  1.00 0.00 ? 41  LEU A HA   4  
ATOM   3642  H  HB2  . LEU A 1 41 ? -1.119  2.446   -3.663  1.00 0.00 ? 41  LEU A HB2  4  
ATOM   3643  H  HB3  . LEU A 1 41 ? 0.529   2.563   -4.276  1.00 0.00 ? 41  LEU A HB3  4  
ATOM   3644  H  HG   . LEU A 1 41 ? -0.121  3.752   -1.616  1.00 0.00 ? 41  LEU A HG   4  
ATOM   3645  H  HD11 . LEU A 1 41 ? 0.833   1.208   -1.075  1.00 0.00 ? 41  LEU A HD11 4  
ATOM   3646  H  HD12 . LEU A 1 41 ? -0.414  0.955   -2.296  1.00 0.00 ? 41  LEU A HD12 4  
ATOM   3647  H  HD13 . LEU A 1 41 ? -0.805  1.802   -0.799  1.00 0.00 ? 41  LEU A HD13 4  
ATOM   3648  H  HD21 . LEU A 1 41 ? 2.293   2.515   -2.920  1.00 0.00 ? 41  LEU A HD21 4  
ATOM   3649  H  HD22 . LEU A 1 41 ? 2.224   2.913   -1.203  1.00 0.00 ? 41  LEU A HD22 4  
ATOM   3650  H  HD23 . LEU A 1 41 ? 2.066   4.189   -2.411  1.00 0.00 ? 41  LEU A HD23 4  
ATOM   3651  N  N    . ALA A 1 42 ? -2.286  5.454   -5.453  1.00 0.00 ? 42  ALA A N    4  
ATOM   3652  C  CA   . ALA A 1 42 ? -3.356  5.511   -6.441  1.00 0.00 ? 42  ALA A CA   4  
ATOM   3653  C  C    . ALA A 1 42 ? -2.811  5.869   -7.820  1.00 0.00 ? 42  ALA A C    4  
ATOM   3654  O  O    . ALA A 1 42 ? -2.959  5.105   -8.774  1.00 0.00 ? 42  ALA A O    4  
ATOM   3655  C  CB   . ALA A 1 42 ? -4.416  6.516   -6.014  1.00 0.00 ? 42  ALA A CB   4  
ATOM   3656  H  H    . ALA A 1 42 ? -2.065  6.259   -4.941  1.00 0.00 ? 42  ALA A H    4  
ATOM   3657  H  HA   . ALA A 1 42 ? -3.818  4.536   -6.490  1.00 0.00 ? 42  ALA A HA   4  
ATOM   3658  H  HB1  . ALA A 1 42 ? -4.801  6.240   -5.043  1.00 0.00 ? 42  ALA A HB1  4  
ATOM   3659  H  HB2  . ALA A 1 42 ? -3.978  7.501   -5.963  1.00 0.00 ? 42  ALA A HB2  4  
ATOM   3660  H  HB3  . ALA A 1 42 ? -5.222  6.516   -6.733  1.00 0.00 ? 42  ALA A HB3  4  
ATOM   3661  N  N    . ASP A 1 43 ? -2.182  7.035   -7.918  1.00 0.00 ? 43  ASP A N    4  
ATOM   3662  C  CA   . ASP A 1 43 ? -1.614  7.493   -9.181  1.00 0.00 ? 43  ASP A CA   4  
ATOM   3663  C  C    . ASP A 1 43 ? -0.259  6.841   -9.436  1.00 0.00 ? 43  ASP A C    4  
ATOM   3664  O  O    . ASP A 1 43 ? 0.003   6.340   -10.530 1.00 0.00 ? 43  ASP A O    4  
ATOM   3665  C  CB   . ASP A 1 43 ? -1.469  9.016   -9.175  1.00 0.00 ? 43  ASP A CB   4  
ATOM   3666  C  CG   . ASP A 1 43 ? -2.806  9.725   -9.097  1.00 0.00 ? 43  ASP A CG   4  
ATOM   3667  O  OD1  . ASP A 1 43 ? -3.663  9.473   -9.970  1.00 0.00 ? 43  ASP A OD1  4  
ATOM   3668  O  OD2  . ASP A 1 43 ? -2.996  10.533  -8.164  1.00 0.00 ? 43  ASP A OD2  4  
ATOM   3669  H  H    . ASP A 1 43 ? -2.096  7.600   -7.122  1.00 0.00 ? 43  ASP A H    4  
ATOM   3670  H  HA   . ASP A 1 43 ? -2.291  7.209   -9.971  1.00 0.00 ? 43  ASP A HA   4  
ATOM   3671  H  HB2  . ASP A 1 43 ? -0.875  9.312   -8.322  1.00 0.00 ? 43  ASP A HB2  4  
ATOM   3672  H  HB3  . ASP A 1 43 ? -0.969  9.326   -10.081 1.00 0.00 ? 43  ASP A HB3  4  
ATOM   3673  N  N    . ILE A 1 44 ? 0.598   6.853   -8.421  1.00 0.00 ? 44  ILE A N    4  
ATOM   3674  C  CA   . ILE A 1 44 ? 1.926   6.262   -8.536  1.00 0.00 ? 44  ILE A CA   4  
ATOM   3675  C  C    . ILE A 1 44 ? 1.848   4.740   -8.584  1.00 0.00 ? 44  ILE A C    4  
ATOM   3676  O  O    . ILE A 1 44 ? 2.734   4.080   -9.126  1.00 0.00 ? 44  ILE A O    4  
ATOM   3677  C  CB   . ILE A 1 44 ? 2.832   6.682   -7.363  1.00 0.00 ? 44  ILE A CB   4  
ATOM   3678  C  CG1  . ILE A 1 44 ? 2.328   6.068   -6.056  1.00 0.00 ? 44  ILE A CG1  4  
ATOM   3679  C  CG2  . ILE A 1 44 ? 2.890   8.199   -7.255  1.00 0.00 ? 44  ILE A CG2  4  
ATOM   3680  C  CD1  . ILE A 1 44 ? 3.330   6.148   -4.925  1.00 0.00 ? 44  ILE A CD1  4  
ATOM   3681  H  H    . ILE A 1 44 ? 0.331   7.267   -7.574  1.00 0.00 ? 44  ILE A H    4  
ATOM   3682  H  HA   . ILE A 1 44 ? 2.370   6.619   -9.454  1.00 0.00 ? 44  ILE A HA   4  
ATOM   3683  H  HB   . ILE A 1 44 ? 3.830   6.321   -7.562  1.00 0.00 ? 44  ILE A HB   4  
ATOM   3684  H  HG12 . ILE A 1 44 ? 1.435   6.585   -5.743  1.00 0.00 ? 44  ILE A HG12 4  
ATOM   3685  H  HG13 . ILE A 1 44 ? 2.097   5.026   -6.222  1.00 0.00 ? 44  ILE A HG13 4  
ATOM   3686  H  HG21 . ILE A 1 44 ? 2.401   8.639   -8.112  1.00 0.00 ? 44  ILE A HG21 4  
ATOM   3687  H  HG22 . ILE A 1 44 ? 2.388   8.514   -6.353  1.00 0.00 ? 44  ILE A HG22 4  
ATOM   3688  H  HG23 . ILE A 1 44 ? 3.921   8.519   -7.225  1.00 0.00 ? 44  ILE A HG23 4  
ATOM   3689  H  HD11 . ILE A 1 44 ? 3.109   7.006   -4.307  1.00 0.00 ? 44  ILE A HD11 4  
ATOM   3690  H  HD12 . ILE A 1 44 ? 3.274   5.250   -4.329  1.00 0.00 ? 44  ILE A HD12 4  
ATOM   3691  H  HD13 . ILE A 1 44 ? 4.326   6.248   -5.333  1.00 0.00 ? 44  ILE A HD13 4  
ATOM   3692  N  N    . GLY A 1 45 ? 0.781   4.189   -8.014  1.00 0.00 ? 45  GLY A N    4  
ATOM   3693  C  CA   . GLY A 1 45 ? 0.606   2.748   -8.004  1.00 0.00 ? 45  GLY A CA   4  
ATOM   3694  C  C    . GLY A 1 45 ? 1.304   2.087   -6.832  1.00 0.00 ? 45  GLY A C    4  
ATOM   3695  O  O    . GLY A 1 45 ? 2.070   2.730   -6.114  1.00 0.00 ? 45  GLY A O    4  
ATOM   3696  H  H    . GLY A 1 45 ? 0.107   4.765   -7.597  1.00 0.00 ? 45  GLY A H    4  
ATOM   3697  H  HA2  . GLY A 1 45 ? -0.449  2.525   -7.954  1.00 0.00 ? 45  GLY A HA2  4  
ATOM   3698  H  HA3  . GLY A 1 45 ? 1.007   2.342   -8.922  1.00 0.00 ? 45  GLY A HA3  4  
ATOM   3699  N  N    . PHE A 1 46 ? 1.039   0.800   -6.637  1.00 0.00 ? 46  PHE A N    4  
ATOM   3700  C  CA   . PHE A 1 46 ? 1.645   0.052   -5.542  1.00 0.00 ? 46  PHE A CA   4  
ATOM   3701  C  C    . PHE A 1 46 ? 2.363   -1.190  -6.063  1.00 0.00 ? 46  PHE A C    4  
ATOM   3702  O  O    . PHE A 1 46 ? 2.257   -1.533  -7.240  1.00 0.00 ? 46  PHE A O    4  
ATOM   3703  C  CB   . PHE A 1 46 ? 0.580   -0.352  -4.520  1.00 0.00 ? 46  PHE A CB   4  
ATOM   3704  C  CG   . PHE A 1 46 ? -0.225  -1.550  -4.935  1.00 0.00 ? 46  PHE A CG   4  
ATOM   3705  C  CD1  . PHE A 1 46 ? -1.058  -1.493  -6.040  1.00 0.00 ? 46  PHE A CD1  4  
ATOM   3706  C  CD2  . PHE A 1 46 ? -0.148  -2.734  -4.220  1.00 0.00 ? 46  PHE A CD2  4  
ATOM   3707  C  CE1  . PHE A 1 46 ? -1.800  -2.594  -6.425  1.00 0.00 ? 46  PHE A CE1  4  
ATOM   3708  C  CE2  . PHE A 1 46 ? -0.886  -3.839  -4.600  1.00 0.00 ? 46  PHE A CE2  4  
ATOM   3709  C  CZ   . PHE A 1 46 ? -1.714  -3.768  -5.704  1.00 0.00 ? 46  PHE A CZ   4  
ATOM   3710  H  H    . PHE A 1 46 ? 0.420   0.342   -7.243  1.00 0.00 ? 46  PHE A H    4  
ATOM   3711  H  HA   . PHE A 1 46 ? 2.367   0.695   -5.061  1.00 0.00 ? 46  PHE A HA   4  
ATOM   3712  H  HB2  . PHE A 1 46 ? 1.061   -0.584  -3.582  1.00 0.00 ? 46  PHE A HB2  4  
ATOM   3713  H  HB3  . PHE A 1 46 ? -0.101  0.473   -4.376  1.00 0.00 ? 46  PHE A HB3  4  
ATOM   3714  H  HD1  . PHE A 1 46 ? -1.126  -0.574  -6.606  1.00 0.00 ? 46  PHE A HD1  4  
ATOM   3715  H  HD2  . PHE A 1 46 ? 0.499   -2.791  -3.356  1.00 0.00 ? 46  PHE A HD2  4  
ATOM   3716  H  HE1  . PHE A 1 46 ? -2.446  -2.535  -7.288  1.00 0.00 ? 46  PHE A HE1  4  
ATOM   3717  H  HE2  . PHE A 1 46 ? -0.818  -4.756  -4.034  1.00 0.00 ? 46  PHE A HE2  4  
ATOM   3718  H  HZ   . PHE A 1 46 ? -2.292  -4.630  -6.003  1.00 0.00 ? 46  PHE A HZ   4  
ATOM   3719  N  N    . VAL A 1 47 ? 3.094   -1.859  -5.177  1.00 0.00 ? 47  VAL A N    4  
ATOM   3720  C  CA   . VAL A 1 47 ? 3.829   -3.063  -5.546  1.00 0.00 ? 47  VAL A CA   4  
ATOM   3721  C  C    . VAL A 1 47 ? 3.594   -4.181  -4.537  1.00 0.00 ? 47  VAL A C    4  
ATOM   3722  O  O    . VAL A 1 47 ? 4.021   -4.094  -3.385  1.00 0.00 ? 47  VAL A O    4  
ATOM   3723  C  CB   . VAL A 1 47 ? 5.341   -2.788  -5.648  1.00 0.00 ? 47  VAL A CB   4  
ATOM   3724  C  CG1  . VAL A 1 47 ? 6.083   -4.038  -6.095  1.00 0.00 ? 47  VAL A CG1  4  
ATOM   3725  C  CG2  . VAL A 1 47 ? 5.609   -1.631  -6.599  1.00 0.00 ? 47  VAL A CG2  4  
ATOM   3726  H  H    . VAL A 1 47 ? 3.139   -1.536  -4.253  1.00 0.00 ? 47  VAL A H    4  
ATOM   3727  H  HA   . VAL A 1 47 ? 3.477   -3.385  -6.515  1.00 0.00 ? 47  VAL A HA   4  
ATOM   3728  H  HB   . VAL A 1 47 ? 5.703   -2.512  -4.668  1.00 0.00 ? 47  VAL A HB   4  
ATOM   3729  H  HG11 . VAL A 1 47 ? 5.371   -4.824  -6.300  1.00 0.00 ? 47  VAL A HG11 4  
ATOM   3730  H  HG12 . VAL A 1 47 ? 6.649   -3.822  -6.988  1.00 0.00 ? 47  VAL A HG12 4  
ATOM   3731  H  HG13 . VAL A 1 47 ? 6.754   -4.358  -5.311  1.00 0.00 ? 47  VAL A HG13 4  
ATOM   3732  H  HG21 . VAL A 1 47 ? 4.696   -1.075  -6.754  1.00 0.00 ? 47  VAL A HG21 4  
ATOM   3733  H  HG22 . VAL A 1 47 ? 6.358   -0.980  -6.172  1.00 0.00 ? 47  VAL A HG22 4  
ATOM   3734  H  HG23 . VAL A 1 47 ? 5.962   -2.015  -7.544  1.00 0.00 ? 47  VAL A HG23 4  
ATOM   3735  N  N    . LYS A 1 48 ? 2.912   -5.233  -4.976  1.00 0.00 ? 48  LYS A N    4  
ATOM   3736  C  CA   . LYS A 1 48 ? 2.621   -6.372  -4.113  1.00 0.00 ? 48  LYS A CA   4  
ATOM   3737  C  C    . LYS A 1 48 ? 3.907   -6.980  -3.562  1.00 0.00 ? 48  LYS A C    4  
ATOM   3738  O  O    . LYS A 1 48 ? 4.801   -7.355  -4.319  1.00 0.00 ? 48  LYS A O    4  
ATOM   3739  C  CB   . LYS A 1 48 ? 1.832   -7.433  -4.883  1.00 0.00 ? 48  LYS A CB   4  
ATOM   3740  C  CG   . LYS A 1 48 ? 0.326   -7.292  -4.743  1.00 0.00 ? 48  LYS A CG   4  
ATOM   3741  C  CD   . LYS A 1 48 ? -0.135  -7.607  -3.330  1.00 0.00 ? 48  LYS A CD   4  
ATOM   3742  C  CE   . LYS A 1 48 ? -0.373  -9.097  -3.141  1.00 0.00 ? 48  LYS A CE   4  
ATOM   3743  N  NZ   . LYS A 1 48 ? -1.724  -9.508  -3.615  1.00 0.00 ? 48  LYS A NZ   4  
ATOM   3744  H  H    . LYS A 1 48 ? 2.598   -5.245  -5.905  1.00 0.00 ? 48  LYS A H    4  
ATOM   3745  H  HA   . LYS A 1 48 ? 2.022   -6.018  -3.288  1.00 0.00 ? 48  LYS A HA   4  
ATOM   3746  H  HB2  . LYS A 1 48 ? 2.083   -7.361  -5.931  1.00 0.00 ? 48  LYS A HB2  4  
ATOM   3747  H  HB3  . LYS A 1 48 ? 2.116   -8.410  -4.520  1.00 0.00 ? 48  LYS A HB3  4  
ATOM   3748  H  HG2  . LYS A 1 48 ? 0.044   -6.277  -4.984  1.00 0.00 ? 48  LYS A HG2  4  
ATOM   3749  H  HG3  . LYS A 1 48 ? -0.156  -7.973  -5.430  1.00 0.00 ? 48  LYS A HG3  4  
ATOM   3750  H  HD2  . LYS A 1 48 ? 0.624   -7.284  -2.632  1.00 0.00 ? 48  LYS A HD2  4  
ATOM   3751  H  HD3  . LYS A 1 48 ? -1.056  -7.076  -3.134  1.00 0.00 ? 48  LYS A HD3  4  
ATOM   3752  H  HE2  . LYS A 1 48 ? 0.375   -9.642  -3.697  1.00 0.00 ? 48  LYS A HE2  4  
ATOM   3753  H  HE3  . LYS A 1 48 ? -0.283  -9.333  -2.091  1.00 0.00 ? 48  LYS A HE3  4  
ATOM   3754  H  HZ1  . LYS A 1 48 ? -1.656  -10.384 -4.171  1.00 0.00 ? 48  LYS A HZ1  4  
ATOM   3755  H  HZ2  . LYS A 1 48 ? -2.134  -8.762  -4.213  1.00 0.00 ? 48  LYS A HZ2  4  
ATOM   3756  H  HZ3  . LYS A 1 48 ? -2.353  -9.672  -2.804  1.00 0.00 ? 48  LYS A HZ3  4  
ATOM   3757  N  N    . ASN A 1 49 ? 3.991   -7.076  -2.239  1.00 0.00 ? 49  ASN A N    4  
ATOM   3758  C  CA   . ASN A 1 49 ? 5.167   -7.640  -1.587  1.00 0.00 ? 49  ASN A CA   4  
ATOM   3759  C  C    . ASN A 1 49 ? 4.825   -8.143  -0.188  1.00 0.00 ? 49  ASN A C    4  
ATOM   3760  O  O    . ASN A 1 49 ? 4.187   -7.441  0.596   1.00 0.00 ? 49  ASN A O    4  
ATOM   3761  C  CB   . ASN A 1 49 ? 6.282   -6.594  -1.507  1.00 0.00 ? 49  ASN A CB   4  
ATOM   3762  C  CG   . ASN A 1 49 ? 7.647   -7.220  -1.292  1.00 0.00 ? 49  ASN A CG   4  
ATOM   3763  O  OD1  . ASN A 1 49 ? 7.782   -8.443  -1.256  1.00 0.00 ? 49  ASN A OD1  4  
ATOM   3764  N  ND2  . ASN A 1 49 ? 8.666   -6.381  -1.147  1.00 0.00 ? 49  ASN A ND2  4  
ATOM   3765  H  H    . ASN A 1 49 ? 3.245   -6.759  -1.688  1.00 0.00 ? 49  ASN A H    4  
ATOM   3766  H  HA   . ASN A 1 49 ? 5.509   -8.472  -2.183  1.00 0.00 ? 49  ASN A HA   4  
ATOM   3767  H  HB2  . ASN A 1 49 ? 6.307   -6.032  -2.429  1.00 0.00 ? 49  ASN A HB2  4  
ATOM   3768  H  HB3  . ASN A 1 49 ? 6.080   -5.923  -0.686  1.00 0.00 ? 49  ASN A HB3  4  
ATOM   3769  H  HD21 . ASN A 1 49 ? 8.483   -5.419  -1.187  1.00 0.00 ? 49  ASN A HD21 4  
ATOM   3770  H  HD22 . ASN A 1 49 ? 9.559   -6.758  -1.008  1.00 0.00 ? 49  ASN A HD22 4  
ATOM   3771  N  N    . ALA A 1 50 ? 5.254   -9.363  0.117   1.00 0.00 ? 50  ALA A N    4  
ATOM   3772  C  CA   . ALA A 1 50 ? 4.996   -9.959  1.422   1.00 0.00 ? 50  ALA A CA   4  
ATOM   3773  C  C    . ALA A 1 50 ? 3.555   -9.718  1.860   1.00 0.00 ? 50  ALA A C    4  
ATOM   3774  O  O    . ALA A 1 50 ? 3.276   -9.556  3.048   1.00 0.00 ? 50  ALA A O    4  
ATOM   3775  C  CB   . ALA A 1 50 ? 5.964   -9.405  2.457   1.00 0.00 ? 50  ALA A CB   4  
ATOM   3776  H  H    . ALA A 1 50 ? 5.758   -9.873  -0.550  1.00 0.00 ? 50  ALA A H    4  
ATOM   3777  H  HA   . ALA A 1 50 ? 5.164   -11.024 1.342   1.00 0.00 ? 50  ALA A HA   4  
ATOM   3778  H  HB1  . ALA A 1 50 ? 6.011   -10.077 3.301   1.00 0.00 ? 50  ALA A HB1  4  
ATOM   3779  H  HB2  . ALA A 1 50 ? 6.946   -9.310  2.017   1.00 0.00 ? 50  ALA A HB2  4  
ATOM   3780  H  HB3  . ALA A 1 50 ? 5.622   -8.435  2.786   1.00 0.00 ? 50  ALA A HB3  4  
ATOM   3781  N  N    . GLY A 1 51 ? 2.643   -9.695  0.893   1.00 0.00 ? 51  GLY A N    4  
ATOM   3782  C  CA   . GLY A 1 51 ? 1.242   -9.472  1.200   1.00 0.00 ? 51  GLY A CA   4  
ATOM   3783  C  C    . GLY A 1 51 ? 0.980   -8.076  1.729   1.00 0.00 ? 51  GLY A C    4  
ATOM   3784  O  O    . GLY A 1 51 ? 0.118   -7.882  2.587   1.00 0.00 ? 51  GLY A O    4  
ATOM   3785  H  H    . GLY A 1 51 ? 2.924   -9.830  -0.036  1.00 0.00 ? 51  GLY A H    4  
ATOM   3786  H  HA2  . GLY A 1 51 ? 0.661   -9.622  0.302   1.00 0.00 ? 51  GLY A HA2  4  
ATOM   3787  H  HA3  . GLY A 1 51 ? 0.930   -10.191 1.943   1.00 0.00 ? 51  GLY A HA3  4  
ATOM   3788  N  N    . ARG A 1 52 ? 1.724   -7.101  1.217   1.00 0.00 ? 52  ARG A N    4  
ATOM   3789  C  CA   . ARG A 1 52 ? 1.569   -5.716  1.645   1.00 0.00 ? 52  ARG A CA   4  
ATOM   3790  C  C    . ARG A 1 52 ? 1.717   -4.762  0.464   1.00 0.00 ? 52  ARG A C    4  
ATOM   3791  O  O    . ARG A 1 52 ? 2.560   -4.966  -0.410  1.00 0.00 ? 52  ARG A O    4  
ATOM   3792  C  CB   . ARG A 1 52 ? 2.600   -5.375  2.723   1.00 0.00 ? 52  ARG A CB   4  
ATOM   3793  C  CG   . ARG A 1 52 ? 2.529   -6.279  3.942   1.00 0.00 ? 52  ARG A CG   4  
ATOM   3794  C  CD   . ARG A 1 52 ? 3.795   -6.187  4.779   1.00 0.00 ? 52  ARG A CD   4  
ATOM   3795  N  NE   . ARG A 1 52 ? 3.908   -7.294  5.725   1.00 0.00 ? 52  ARG A NE   4  
ATOM   3796  C  CZ   . ARG A 1 52 ? 4.660   -7.252  6.819   1.00 0.00 ? 52  ARG A CZ   4  
ATOM   3797  N  NH1  . ARG A 1 52 ? 5.361   -6.164  7.105   1.00 0.00 ? 52  ARG A NH1  4  
ATOM   3798  N  NH2  . ARG A 1 52 ? 4.711   -8.301  7.631   1.00 0.00 ? 52  ARG A NH2  4  
ATOM   3799  H  H    . ARG A 1 52 ? 2.394   -7.319  0.536   1.00 0.00 ? 52  ARG A H    4  
ATOM   3800  H  HA   . ARG A 1 52 ? 0.578   -5.606  2.060   1.00 0.00 ? 52  ARG A HA   4  
ATOM   3801  H  HB2  . ARG A 1 52 ? 3.590   -5.459  2.298   1.00 0.00 ? 52  ARG A HB2  4  
ATOM   3802  H  HB3  . ARG A 1 52 ? 2.441   -4.358  3.046   1.00 0.00 ? 52  ARG A HB3  4  
ATOM   3803  H  HG2  . ARG A 1 52 ? 1.686   -5.983  4.550   1.00 0.00 ? 52  ARG A HG2  4  
ATOM   3804  H  HG3  . ARG A 1 52 ? 2.397   -7.300  3.615   1.00 0.00 ? 52  ARG A HG3  4  
ATOM   3805  H  HD2  . ARG A 1 52 ? 4.649   -6.202  4.119   1.00 0.00 ? 52  ARG A HD2  4  
ATOM   3806  H  HD3  . ARG A 1 52 ? 3.780   -5.257  5.328   1.00 0.00 ? 52  ARG A HD3  4  
ATOM   3807  H  HE   . ARG A 1 52 ? 3.399   -8.109  5.533   1.00 0.00 ? 52  ARG A HE   4  
ATOM   3808  H  HH11 . ARG A 1 52 ? 5.323   -5.372  6.496   1.00 0.00 ? 52  ARG A HH11 4  
ATOM   3809  H  HH12 . ARG A 1 52 ? 5.925   -6.134  7.930   1.00 0.00 ? 52  ARG A HH12 4  
ATOM   3810  H  HH21 . ARG A 1 52 ? 4.184   -9.123  7.419   1.00 0.00 ? 52  ARG A HH21 4  
ATOM   3811  H  HH22 . ARG A 1 52 ? 5.277   -8.268  8.454   1.00 0.00 ? 52  ARG A HH22 4  
ATOM   3812  N  N    . HIS A 1 53 ? 0.892   -3.720  0.445   1.00 0.00 ? 53  HIS A N    4  
ATOM   3813  C  CA   . HIS A 1 53 ? 0.931   -2.734  -0.629  1.00 0.00 ? 53  HIS A CA   4  
ATOM   3814  C  C    . HIS A 1 53 ? 1.987   -1.669  -0.351  1.00 0.00 ? 53  HIS A C    4  
ATOM   3815  O  O    . HIS A 1 53 ? 1.835   -0.852  0.559   1.00 0.00 ? 53  HIS A O    4  
ATOM   3816  C  CB   . HIS A 1 53 ? -0.440  -2.078  -0.798  1.00 0.00 ? 53  HIS A CB   4  
ATOM   3817  C  CG   . HIS A 1 53 ? -0.918  -1.366  0.429   1.00 0.00 ? 53  HIS A CG   4  
ATOM   3818  N  ND1  . HIS A 1 53 ? -1.994  -0.504  0.428   1.00 0.00 ? 53  HIS A ND1  4  
ATOM   3819  C  CD2  . HIS A 1 53 ? -0.461  -1.393  1.703   1.00 0.00 ? 53  HIS A CD2  4  
ATOM   3820  C  CE1  . HIS A 1 53 ? -2.178  -0.030  1.647   1.00 0.00 ? 53  HIS A CE1  4  
ATOM   3821  N  NE2  . HIS A 1 53 ? -1.261  -0.554  2.440   1.00 0.00 ? 53  HIS A NE2  4  
ATOM   3822  H  H    . HIS A 1 53 ? 0.242   -3.612  1.170   1.00 0.00 ? 53  HIS A H    4  
ATOM   3823  H  HA   . HIS A 1 53 ? 1.189   -3.248  -1.543  1.00 0.00 ? 53  HIS A HA   4  
ATOM   3824  H  HB2  . HIS A 1 53 ? -0.390  -1.357  -1.601  1.00 0.00 ? 53  HIS A HB2  4  
ATOM   3825  H  HB3  . HIS A 1 53 ? -1.167  -2.838  -1.047  1.00 0.00 ? 53  HIS A HB3  4  
ATOM   3826  H  HD1  . HIS A 1 53 ? -2.541  -0.272  -0.351  1.00 0.00 ? 53  HIS A HD1  4  
ATOM   3827  H  HD2  . HIS A 1 53 ? 0.377   -1.967  2.072   1.00 0.00 ? 53  HIS A HD2  4  
ATOM   3828  H  HE1  . HIS A 1 53 ? -2.947  0.667   1.946   1.00 0.00 ? 53  HIS A HE1  4  
ATOM   3829  H  HE2  . HIS A 1 53 ? -1.117  -0.307  3.377   1.00 0.00 ? 53  HIS A HE2  4  
ATOM   3830  N  N    . LEU A 1 54 ? 3.057   -1.682  -1.138  1.00 0.00 ? 54  LEU A N    4  
ATOM   3831  C  CA   . LEU A 1 54 ? 4.139   -0.718  -0.976  1.00 0.00 ? 54  LEU A CA   4  
ATOM   3832  C  C    . LEU A 1 54 ? 4.282   0.155   -2.219  1.00 0.00 ? 54  LEU A C    4  
ATOM   3833  O  O    . LEU A 1 54 ? 3.635   -0.088  -3.239  1.00 0.00 ? 54  LEU A O    4  
ATOM   3834  C  CB   . LEU A 1 54 ? 5.456   -1.442  -0.693  1.00 0.00 ? 54  LEU A CB   4  
ATOM   3835  C  CG   . LEU A 1 54 ? 5.350   -2.739  0.110   1.00 0.00 ? 54  LEU A CG   4  
ATOM   3836  C  CD1  . LEU A 1 54 ? 6.656   -3.515  0.046   1.00 0.00 ? 54  LEU A CD1  4  
ATOM   3837  C  CD2  . LEU A 1 54 ? 4.974   -2.442  1.555   1.00 0.00 ? 54  LEU A CD2  4  
ATOM   3838  H  H    . LEU A 1 54 ? 3.121   -2.357  -1.846  1.00 0.00 ? 54  LEU A H    4  
ATOM   3839  H  HA   . LEU A 1 54 ? 3.896   -0.086  -0.134  1.00 0.00 ? 54  LEU A HA   4  
ATOM   3840  H  HB2  . LEU A 1 54 ? 5.914   -1.678  -1.641  1.00 0.00 ? 54  LEU A HB2  4  
ATOM   3841  H  HB3  . LEU A 1 54 ? 6.094   -0.764  -0.145  1.00 0.00 ? 54  LEU A HB3  4  
ATOM   3842  H  HG   . LEU A 1 54 ? 4.573   -3.358  -0.318  1.00 0.00 ? 54  LEU A HG   4  
ATOM   3843  H  HD11 . LEU A 1 54 ? 6.903   -3.719  -0.985  1.00 0.00 ? 54  LEU A HD11 4  
ATOM   3844  H  HD12 . LEU A 1 54 ? 6.547   -4.447  0.581   1.00 0.00 ? 54  LEU A HD12 4  
ATOM   3845  H  HD13 . LEU A 1 54 ? 7.444   -2.931  0.497   1.00 0.00 ? 54  LEU A HD13 4  
ATOM   3846  H  HD21 . LEU A 1 54 ? 5.871   -2.284  2.134   1.00 0.00 ? 54  LEU A HD21 4  
ATOM   3847  H  HD22 . LEU A 1 54 ? 4.425   -3.278  1.963   1.00 0.00 ? 54  LEU A HD22 4  
ATOM   3848  H  HD23 . LEU A 1 54 ? 4.360   -1.555  1.592   1.00 0.00 ? 54  LEU A HD23 4  
ATOM   3849  N  N    . CYS A 1 55 ? 5.135   1.169   -2.129  1.00 0.00 ? 55  CYS A N    4  
ATOM   3850  C  CA   . CYS A 1 55 ? 5.365   2.077   -3.246  1.00 0.00 ? 55  CYS A CA   4  
ATOM   3851  C  C    . CYS A 1 55 ? 6.710   1.794   -3.908  1.00 0.00 ? 55  CYS A C    4  
ATOM   3852  O  O    . CYS A 1 55 ? 7.664   1.379   -3.249  1.00 0.00 ? 55  CYS A O    4  
ATOM   3853  C  CB   . CYS A 1 55 ? 5.315   3.530   -2.768  1.00 0.00 ? 55  CYS A CB   4  
ATOM   3854  S  SG   . CYS A 1 55 ? 6.717   4.013   -1.709  1.00 0.00 ? 55  CYS A SG   4  
ATOM   3855  H  H    . CYS A 1 55 ? 5.622   1.312   -1.289  1.00 0.00 ? 55  CYS A H    4  
ATOM   3856  H  HA   . CYS A 1 55 ? 4.581   1.918   -3.970  1.00 0.00 ? 55  CYS A HA   4  
ATOM   3857  H  HB2  . CYS A 1 55 ? 5.314   4.184   -3.628  1.00 0.00 ? 55  CYS A HB2  4  
ATOM   3858  H  HB3  . CYS A 1 55 ? 4.408   3.685   -2.204  1.00 0.00 ? 55  CYS A HB3  4  
ATOM   3859  N  N    . ARG A 1 56 ? 6.779   2.022   -5.216  1.00 0.00 ? 56  ARG A N    4  
ATOM   3860  C  CA   . ARG A 1 56 ? 8.006   1.790   -5.968  1.00 0.00 ? 56  ARG A CA   4  
ATOM   3861  C  C    . ARG A 1 56 ? 9.232   2.141   -5.130  1.00 0.00 ? 56  ARG A C    4  
ATOM   3862  O  O    . ARG A 1 56 ? 10.156  1.342   -4.973  1.00 0.00 ? 56  ARG A O    4  
ATOM   3863  C  CB   . ARG A 1 56 ? 8.003   2.615   -7.256  1.00 0.00 ? 56  ARG A CB   4  
ATOM   3864  C  CG   . ARG A 1 56 ? 7.609   1.818   -8.489  1.00 0.00 ? 56  ARG A CG   4  
ATOM   3865  C  CD   . ARG A 1 56 ? 8.343   2.309   -9.728  1.00 0.00 ? 56  ARG A CD   4  
ATOM   3866  N  NE   . ARG A 1 56 ? 9.583   1.573   -9.957  1.00 0.00 ? 56  ARG A NE   4  
ATOM   3867  C  CZ   . ARG A 1 56 ? 10.637  2.085   -10.583 1.00 0.00 ? 56  ARG A CZ   4  
ATOM   3868  N  NH1  . ARG A 1 56 ? 10.601  3.329   -11.039 1.00 0.00 ? 56  ARG A NH1  4  
ATOM   3869  N  NH2  . ARG A 1 56 ? 11.730  1.352   -10.754 1.00 0.00 ? 56  ARG A NH2  4  
ATOM   3870  H  H    . ARG A 1 56 ? 5.985   2.352   -5.686  1.00 0.00 ? 56  ARG A H    4  
ATOM   3871  H  HA   . ARG A 1 56 ? 8.047   0.742   -6.223  1.00 0.00 ? 56  ARG A HA   4  
ATOM   3872  H  HB2  . ARG A 1 56 ? 7.306   3.433   -7.145  1.00 0.00 ? 56  ARG A HB2  4  
ATOM   3873  H  HB3  . ARG A 1 56 ? 8.993   3.017   -7.415  1.00 0.00 ? 56  ARG A HB3  4  
ATOM   3874  H  HG2  . ARG A 1 56 ? 7.854   0.779   -8.328  1.00 0.00 ? 56  ARG A HG2  4  
ATOM   3875  H  HG3  . ARG A 1 56 ? 6.546   1.920   -8.647  1.00 0.00 ? 56  ARG A HG3  4  
ATOM   3876  H  HD2  . ARG A 1 56 ? 7.698   2.185   -10.585 1.00 0.00 ? 56  ARG A HD2  4  
ATOM   3877  H  HD3  . ARG A 1 56 ? 8.575   3.356   -9.601  1.00 0.00 ? 56  ARG A HD3  4  
ATOM   3878  H  HE   . ARG A 1 56 ? 9.631   0.651   -9.628  1.00 0.00 ? 56  ARG A HE   4  
ATOM   3879  H  HH11 . ARG A 1 56 ? 9.779   3.884   -10.911 1.00 0.00 ? 56  ARG A HH11 4  
ATOM   3880  H  HH12 . ARG A 1 56 ? 11.396  3.713   -11.509 1.00 0.00 ? 56  ARG A HH12 4  
ATOM   3881  H  HH21 . ARG A 1 56 ? 11.760  0.413   -10.411 1.00 0.00 ? 56  ARG A HH21 4  
ATOM   3882  H  HH22 . ARG A 1 56 ? 12.522  1.738   -11.225 1.00 0.00 ? 56  ARG A HH22 4  
ATOM   3883  N  N    . PRO A 1 57 ? 9.242   3.363   -4.579  1.00 0.00 ? 57  PRO A N    4  
ATOM   3884  C  CA   . PRO A 1 57 ? 10.348  3.848   -3.747  1.00 0.00 ? 57  PRO A CA   4  
ATOM   3885  C  C    . PRO A 1 57 ? 10.760  2.836   -2.683  1.00 0.00 ? 57  PRO A C    4  
ATOM   3886  O  O    . PRO A 1 57 ? 11.867  2.299   -2.717  1.00 0.00 ? 57  PRO A O    4  
ATOM   3887  C  CB   . PRO A 1 57 ? 9.776   5.108   -3.094  1.00 0.00 ? 57  PRO A CB   4  
ATOM   3888  C  CG   . PRO A 1 57 ? 8.725   5.580   -4.039  1.00 0.00 ? 57  PRO A CG   4  
ATOM   3889  C  CD   . PRO A 1 57 ? 8.175   4.367   -4.724  1.00 0.00 ? 57  PRO A CD   4  
ATOM   3890  H  HA   . PRO A 1 57 ? 11.209  4.109   -4.345  1.00 0.00 ? 57  PRO A HA   4  
ATOM   3891  H  HB2  . PRO A 1 57 ? 9.358   4.858   -2.129  1.00 0.00 ? 57  PRO A HB2  4  
ATOM   3892  H  HB3  . PRO A 1 57 ? 10.558  5.843   -2.974  1.00 0.00 ? 57  PRO A HB3  4  
ATOM   3893  H  HG2  . PRO A 1 57 ? 7.939   6.081   -3.493  1.00 0.00 ? 57  PRO A HG2  4  
ATOM   3894  H  HG3  . PRO A 1 57 ? 9.161   6.246   -4.768  1.00 0.00 ? 57  PRO A HG3  4  
ATOM   3895  H  HD2  . PRO A 1 57 ? 7.269   4.041   -4.234  1.00 0.00 ? 57  PRO A HD2  4  
ATOM   3896  H  HD3  . PRO A 1 57 ? 7.987   4.581   -5.766  1.00 0.00 ? 57  PRO A HD3  4  
ATOM   3897  N  N    . CYS A 1 58 ? 9.861   2.579   -1.738  1.00 0.00 ? 58  CYS A N    4  
ATOM   3898  C  CA   . CYS A 1 58 ? 10.130  1.632   -0.664  1.00 0.00 ? 58  CYS A CA   4  
ATOM   3899  C  C    . CYS A 1 58 ? 10.483  0.258   -1.225  1.00 0.00 ? 58  CYS A C    4  
ATOM   3900  O  O    . CYS A 1 58 ? 11.618  -0.204  -1.099  1.00 0.00 ? 58  CYS A O    4  
ATOM   3901  C  CB   . CYS A 1 58 ? 8.916   1.520   0.261   1.00 0.00 ? 58  CYS A CB   4  
ATOM   3902  S  SG   . CYS A 1 58 ? 8.517   3.058   1.153   1.00 0.00 ? 58  CYS A SG   4  
ATOM   3903  H  H    . CYS A 1 58 ? 8.995   3.039   -1.765  1.00 0.00 ? 58  CYS A H    4  
ATOM   3904  H  HA   . CYS A 1 58 ? 10.970  2.002   -0.097  1.00 0.00 ? 58  CYS A HA   4  
ATOM   3905  H  HB2  . CYS A 1 58 ? 8.051   1.247   -0.324  1.00 0.00 ? 58  CYS A HB2  4  
ATOM   3906  H  HB3  . CYS A 1 58 ? 9.103   0.752   0.997   1.00 0.00 ? 58  CYS A HB3  4  
ATOM   3907  N  N    . HIS A 1 59 ? 9.503   -0.391  -1.847  1.00 0.00 ? 59  HIS A N    4  
ATOM   3908  C  CA   . HIS A 1 59 ? 9.710   -1.712  -2.429  1.00 0.00 ? 59  HIS A CA   4  
ATOM   3909  C  C    . HIS A 1 59 ? 11.093  -1.815  -3.066  1.00 0.00 ? 59  HIS A C    4  
ATOM   3910  O  O    . HIS A 1 59 ? 11.823  -2.777  -2.835  1.00 0.00 ? 59  HIS A O    4  
ATOM   3911  C  CB   . HIS A 1 59 ? 8.632   -2.008  -3.472  1.00 0.00 ? 59  HIS A CB   4  
ATOM   3912  C  CG   . HIS A 1 59 ? 8.929   -3.209  -4.316  1.00 0.00 ? 59  HIS A CG   4  
ATOM   3913  N  ND1  . HIS A 1 59 ? 9.063   -4.479  -3.796  1.00 0.00 ? 59  HIS A ND1  4  
ATOM   3914  C  CD2  . HIS A 1 59 ? 9.115   -3.329  -5.652  1.00 0.00 ? 59  HIS A CD2  4  
ATOM   3915  C  CE1  . HIS A 1 59 ? 9.320   -5.328  -4.775  1.00 0.00 ? 59  HIS A CE1  4  
ATOM   3916  N  NE2  . HIS A 1 59 ? 9.357   -4.655  -5.911  1.00 0.00 ? 59  HIS A NE2  4  
ATOM   3917  H  H    . HIS A 1 59 ? 8.621   0.029   -1.916  1.00 0.00 ? 59  HIS A H    4  
ATOM   3918  H  HA   . HIS A 1 59 ? 9.639   -2.440  -1.635  1.00 0.00 ? 59  HIS A HA   4  
ATOM   3919  H  HB2  . HIS A 1 59 ? 7.692   -2.179  -2.970  1.00 0.00 ? 59  HIS A HB2  4  
ATOM   3920  H  HB3  . HIS A 1 59 ? 8.534   -1.156  -4.130  1.00 0.00 ? 59  HIS A HB3  4  
ATOM   3921  H  HD1  . HIS A 1 59 ? 8.982   -4.722  -2.851  1.00 0.00 ? 59  HIS A HD1  4  
ATOM   3922  H  HD2  . HIS A 1 59 ? 9.081   -2.530  -6.379  1.00 0.00 ? 59  HIS A HD2  4  
ATOM   3923  H  HE1  . HIS A 1 59 ? 9.474   -6.391  -4.666  1.00 0.00 ? 59  HIS A HE1  4  
ATOM   3924  H  HE2  . HIS A 1 59 ? 9.614   -5.029  -6.780  1.00 0.00 ? 59  HIS A HE2  4  
ATOM   3925  N  N    . ASN A 1 60 ? 11.445  -0.815  -3.869  1.00 0.00 ? 60  ASN A N    4  
ATOM   3926  C  CA   . ASN A 1 60 ? 12.740  -0.794  -4.540  1.00 0.00 ? 60  ASN A CA   4  
ATOM   3927  C  C    . ASN A 1 60 ? 13.876  -0.957  -3.535  1.00 0.00 ? 60  ASN A C    4  
ATOM   3928  O  O    . ASN A 1 60 ? 14.842  -1.678  -3.787  1.00 0.00 ? 60  ASN A O    4  
ATOM   3929  C  CB   . ASN A 1 60 ? 12.914  0.513   -5.316  1.00 0.00 ? 60  ASN A CB   4  
ATOM   3930  C  CG   . ASN A 1 60 ? 12.404  0.412   -6.741  1.00 0.00 ? 60  ASN A CG   4  
ATOM   3931  O  OD1  . ASN A 1 60 ? 12.820  -0.463  -7.500  1.00 0.00 ? 60  ASN A OD1  4  
ATOM   3932  N  ND2  . ASN A 1 60 ? 11.497  1.310   -7.110  1.00 0.00 ? 60  ASN A ND2  4  
ATOM   3933  H  H    . ASN A 1 60 ? 10.819  -0.075  -4.014  1.00 0.00 ? 60  ASN A H    4  
ATOM   3934  H  HA   . ASN A 1 60 ? 12.766  -1.620  -5.234  1.00 0.00 ? 60  ASN A HA   4  
ATOM   3935  H  HB2  . ASN A 1 60 ? 12.367  1.298   -4.814  1.00 0.00 ? 60  ASN A HB2  4  
ATOM   3936  H  HB3  . ASN A 1 60 ? 13.961  0.771   -5.345  1.00 0.00 ? 60  ASN A HB3  4  
ATOM   3937  H  HD21 . ASN A 1 60 ? 11.212  1.978   -6.451  1.00 0.00 ? 60  ASN A HD21 4  
ATOM   3938  H  HD22 . ASN A 1 60 ? 11.150  1.267   -8.025  1.00 0.00 ? 60  ASN A HD22 4  
ATOM   3939  N  N    . ARG A 1 61 ? 13.753  -0.284  -2.396  1.00 0.00 ? 61  ARG A N    4  
ATOM   3940  C  CA   . ARG A 1 61 ? 14.770  -0.354  -1.354  1.00 0.00 ? 61  ARG A CA   4  
ATOM   3941  C  C    . ARG A 1 61 ? 14.898  -1.775  -0.814  1.00 0.00 ? 61  ARG A C    4  
ATOM   3942  O  O    . ARG A 1 61 ? 16.004  -2.267  -0.594  1.00 0.00 ? 61  ARG A O    4  
ATOM   3943  C  CB   . ARG A 1 61 ? 14.428  0.607   -0.214  1.00 0.00 ? 61  ARG A CB   4  
ATOM   3944  C  CG   . ARG A 1 61 ? 14.777  2.056   -0.513  1.00 0.00 ? 61  ARG A CG   4  
ATOM   3945  C  CD   . ARG A 1 61 ? 14.464  2.960   0.669   1.00 0.00 ? 61  ARG A CD   4  
ATOM   3946  N  NE   . ARG A 1 61 ? 14.425  4.369   0.286   1.00 0.00 ? 61  ARG A NE   4  
ATOM   3947  C  CZ   . ARG A 1 61 ? 14.634  5.368   1.135   1.00 0.00 ? 61  ARG A CZ   4  
ATOM   3948  N  NH1  . ARG A 1 61 ? 14.898  5.115   2.410   1.00 0.00 ? 61  ARG A NH1  4  
ATOM   3949  N  NH2  . ARG A 1 61 ? 14.582  6.624   0.711   1.00 0.00 ? 61  ARG A NH2  4  
ATOM   3950  H  H    . ARG A 1 61 ? 12.960  0.274   -2.254  1.00 0.00 ? 61  ARG A H    4  
ATOM   3951  H  HA   . ARG A 1 61 ? 15.713  -0.060  -1.790  1.00 0.00 ? 61  ARG A HA   4  
ATOM   3952  H  HB2  . ARG A 1 61 ? 13.368  0.549   -0.015  1.00 0.00 ? 61  ARG A HB2  4  
ATOM   3953  H  HB3  . ARG A 1 61 ? 14.969  0.305   0.670   1.00 0.00 ? 61  ARG A HB3  4  
ATOM   3954  H  HG2  . ARG A 1 61 ? 15.832  2.124   -0.735  1.00 0.00 ? 61  ARG A HG2  4  
ATOM   3955  H  HG3  . ARG A 1 61 ? 14.205  2.385   -1.368  1.00 0.00 ? 61  ARG A HG3  4  
ATOM   3956  H  HD2  . ARG A 1 61 ? 13.503  2.680   1.075   1.00 0.00 ? 61  ARG A HD2  4  
ATOM   3957  H  HD3  . ARG A 1 61 ? 15.226  2.823   1.422   1.00 0.00 ? 61  ARG A HD3  4  
ATOM   3958  H  HE   . ARG A 1 61 ? 14.231  4.579   -0.651  1.00 0.00 ? 61  ARG A HE   4  
ATOM   3959  H  HH11 . ARG A 1 61 ? 14.939  4.169   2.733   1.00 0.00 ? 61  ARG A HH11 4  
ATOM   3960  H  HH12 . ARG A 1 61 ? 15.057  5.869   3.047   1.00 0.00 ? 61  ARG A HH12 4  
ATOM   3961  H  HH21 . ARG A 1 61 ? 14.383  6.819   -0.249  1.00 0.00 ? 61  ARG A HH21 4  
ATOM   3962  H  HH22 . ARG A 1 61 ? 14.740  7.375   1.351   1.00 0.00 ? 61  ARG A HH22 4  
ATOM   3963  N  N    . GLU A 1 62 ? 13.759  -2.428  -0.604  1.00 0.00 ? 62  GLU A N    4  
ATOM   3964  C  CA   . GLU A 1 62 ? 13.746  -3.792  -0.088  1.00 0.00 ? 62  GLU A CA   4  
ATOM   3965  C  C    . GLU A 1 62 ? 14.229  -4.778  -1.147  1.00 0.00 ? 62  GLU A C    4  
ATOM   3966  O  O    . GLU A 1 62 ? 15.228  -5.473  -0.956  1.00 0.00 ? 62  GLU A O    4  
ATOM   3967  C  CB   . GLU A 1 62 ? 12.338  -4.172  0.374   1.00 0.00 ? 62  GLU A CB   4  
ATOM   3968  C  CG   . GLU A 1 62 ? 11.578  -3.025  1.019   1.00 0.00 ? 62  GLU A CG   4  
ATOM   3969  C  CD   . GLU A 1 62 ? 10.575  -3.499  2.053   1.00 0.00 ? 62  GLU A CD   4  
ATOM   3970  O  OE1  . GLU A 1 62 ? 10.963  -3.646  3.231   1.00 0.00 ? 62  GLU A OE1  4  
ATOM   3971  O  OE2  . GLU A 1 62 ? 9.403   -3.722  1.685   1.00 0.00 ? 62  GLU A OE2  4  
ATOM   3972  H  H    . GLU A 1 62 ? 12.909  -1.982  -0.799  1.00 0.00 ? 62  GLU A H    4  
ATOM   3973  H  HA   . GLU A 1 62 ? 14.415  -3.834  0.757   1.00 0.00 ? 62  GLU A HA   4  
ATOM   3974  H  HB2  . GLU A 1 62 ? 11.772  -4.517  -0.480  1.00 0.00 ? 62  GLU A HB2  4  
ATOM   3975  H  HB3  . GLU A 1 62 ? 12.412  -4.976  1.092   1.00 0.00 ? 62  GLU A HB3  4  
ATOM   3976  H  HG2  . GLU A 1 62 ? 12.286  -2.368  1.501   1.00 0.00 ? 62  GLU A HG2  4  
ATOM   3977  H  HG3  . GLU A 1 62 ? 11.050  -2.482  0.249   1.00 0.00 ? 62  GLU A HG3  4  
ATOM   3978  N  N    . LYS A 1 63 ? 13.513  -4.835  -2.265  1.00 0.00 ? 63  LYS A N    4  
ATOM   3979  C  CA   . LYS A 1 63 ? 13.868  -5.735  -3.356  1.00 0.00 ? 63  LYS A CA   4  
ATOM   3980  C  C    . LYS A 1 63 ? 15.334  -5.570  -3.744  1.00 0.00 ? 63  LYS A C    4  
ATOM   3981  O  O    . LYS A 1 63 ? 15.994  -6.531  -4.135  1.00 0.00 ? 63  LYS A O    4  
ATOM   3982  C  CB   . LYS A 1 63 ? 12.975  -5.473  -4.571  1.00 0.00 ? 63  LYS A CB   4  
ATOM   3983  C  CG   . LYS A 1 63 ? 13.075  -4.054  -5.105  1.00 0.00 ? 63  LYS A CG   4  
ATOM   3984  C  CD   . LYS A 1 63 ? 14.124  -3.942  -6.198  1.00 0.00 ? 63  LYS A CD   4  
ATOM   3985  C  CE   . LYS A 1 63 ? 13.648  -4.580  -7.494  1.00 0.00 ? 63  LYS A CE   4  
ATOM   3986  N  NZ   . LYS A 1 63 ? 14.642  -4.416  -8.591  1.00 0.00 ? 63  LYS A NZ   4  
ATOM   3987  H  H    . LYS A 1 63 ? 12.727  -4.257  -2.359  1.00 0.00 ? 63  LYS A H    4  
ATOM   3988  H  HA   . LYS A 1 63 ? 13.710  -6.747  -3.016  1.00 0.00 ? 63  LYS A HA   4  
ATOM   3989  H  HB2  . LYS A 1 63 ? 13.255  -6.153  -5.362  1.00 0.00 ? 63  LYS A HB2  4  
ATOM   3990  H  HB3  . LYS A 1 63 ? 11.947  -5.660  -4.295  1.00 0.00 ? 63  LYS A HB3  4  
ATOM   3991  H  HG2  . LYS A 1 63 ? 12.117  -3.763  -5.509  1.00 0.00 ? 63  LYS A HG2  4  
ATOM   3992  H  HG3  . LYS A 1 63 ? 13.342  -3.392  -4.293  1.00 0.00 ? 63  LYS A HG3  4  
ATOM   3993  H  HD2  . LYS A 1 63 ? 14.332  -2.898  -6.379  1.00 0.00 ? 63  LYS A HD2  4  
ATOM   3994  H  HD3  . LYS A 1 63 ? 15.026  -4.440  -5.872  1.00 0.00 ? 63  LYS A HD3  4  
ATOM   3995  H  HE2  . LYS A 1 63 ? 13.484  -5.632  -7.323  1.00 0.00 ? 63  LYS A HE2  4  
ATOM   3996  H  HE3  . LYS A 1 63 ? 12.719  -4.114  -7.789  1.00 0.00 ? 63  LYS A HE3  4  
ATOM   3997  H  HZ1  . LYS A 1 63 ? 15.109  -3.489  -8.514  1.00 0.00 ? 63  LYS A HZ1  4  
ATOM   3998  H  HZ2  . LYS A 1 63 ? 14.169  -4.476  -9.515  1.00 0.00 ? 63  LYS A HZ2  4  
ATOM   3999  H  HZ3  . LYS A 1 63 ? 15.364  -5.162  -8.533  1.00 0.00 ? 63  LYS A HZ3  4  
ATOM   4000  N  N    . ALA A 1 64 ? 15.836  -4.344  -3.632  1.00 0.00 ? 64  ALA A N    4  
ATOM   4001  C  CA   . ALA A 1 64 ? 17.224  -4.054  -3.968  1.00 0.00 ? 64  ALA A CA   4  
ATOM   4002  C  C    . ALA A 1 64 ? 18.147  -5.174  -3.501  1.00 0.00 ? 64  ALA A C    4  
ATOM   4003  O  O    . ALA A 1 64 ? 18.865  -5.774  -4.301  1.00 0.00 ? 64  ALA A O    4  
ATOM   4004  C  CB   . ALA A 1 64 ? 17.649  -2.728  -3.355  1.00 0.00 ? 64  ALA A CB   4  
ATOM   4005  H  H    . ALA A 1 64 ? 15.259  -3.619  -3.315  1.00 0.00 ? 64  ALA A H    4  
ATOM   4006  H  HA   . ALA A 1 64 ? 17.296  -3.966  -5.042  1.00 0.00 ? 64  ALA A HA   4  
ATOM   4007  H  HB1  . ALA A 1 64 ? 17.664  -1.966  -4.122  1.00 0.00 ? 64  ALA A HB1  4  
ATOM   4008  H  HB2  . ALA A 1 64 ? 16.949  -2.448  -2.582  1.00 0.00 ? 64  ALA A HB2  4  
ATOM   4009  H  HB3  . ALA A 1 64 ? 18.636  -2.828  -2.929  1.00 0.00 ? 64  ALA A HB3  4  
ATOM   4010  N  N    . SER A 1 65 ? 18.124  -5.451  -2.201  1.00 0.00 ? 65  SER A N    4  
ATOM   4011  C  CA   . SER A 1 65 ? 18.963  -6.497  -1.627  1.00 0.00 ? 65  SER A CA   4  
ATOM   4012  C  C    . SER A 1 65 ? 18.453  -7.879  -2.021  1.00 0.00 ? 65  SER A C    4  
ATOM   4013  O  O    . SER A 1 65 ? 17.253  -8.083  -2.199  1.00 0.00 ? 65  SER A O    4  
ATOM   4014  C  CB   . SER A 1 65 ? 19.002  -6.369  -0.103  1.00 0.00 ? 65  SER A CB   4  
ATOM   4015  O  OG   . SER A 1 65 ? 20.148  -7.007  0.433   1.00 0.00 ? 65  SER A OG   4  
ATOM   4016  H  H    . SER A 1 65 ? 17.531  -4.937  -1.614  1.00 0.00 ? 65  SER A H    4  
ATOM   4017  H  HA   . SER A 1 65 ? 19.963  -6.371  -2.016  1.00 0.00 ? 65  SER A HA   4  
ATOM   4018  H  HB2  . SER A 1 65 ? 19.027  -5.325  0.168   1.00 0.00 ? 65  SER A HB2  4  
ATOM   4019  H  HB3  . SER A 1 65 ? 18.119  -6.829  0.316   1.00 0.00 ? 65  SER A HB3  4  
ATOM   4020  H  HG   . SER A 1 65 ? 20.064  -7.958  0.329   1.00 0.00 ? 65  SER A HG   4  
ATOM   4021  N  N    . GLY A 1 66 ? 19.375  -8.828  -2.155  1.00 0.00 ? 66  GLY A N    4  
ATOM   4022  C  CA   . GLY A 1 66 ? 19.000  -10.180 -2.526  1.00 0.00 ? 66  GLY A CA   4  
ATOM   4023  C  C    . GLY A 1 66 ? 20.203  -11.077 -2.740  1.00 0.00 ? 66  GLY A C    4  
ATOM   4024  O  O    . GLY A 1 66 ? 21.350  -10.670 -2.550  1.00 0.00 ? 66  GLY A O    4  
ATOM   4025  H  H    . GLY A 1 66 ? 20.318  -8.608  -2.000  1.00 0.00 ? 66  GLY A H    4  
ATOM   4026  H  HA2  . GLY A 1 66 ? 18.386  -10.599 -1.744  1.00 0.00 ? 66  GLY A HA2  4  
ATOM   4027  H  HA3  . GLY A 1 66 ? 18.426  -10.143 -3.440  1.00 0.00 ? 66  GLY A HA3  4  
ATOM   4028  N  N    . PRO A 1 67 ? 19.948  -12.330 -3.144  1.00 0.00 ? 67  PRO A N    4  
ATOM   4029  C  CA   . PRO A 1 67 ? 21.006  -13.314 -3.391  1.00 0.00 ? 67  PRO A CA   4  
ATOM   4030  C  C    . PRO A 1 67 ? 21.830  -12.979 -4.630  1.00 0.00 ? 67  PRO A C    4  
ATOM   4031  O  O    . PRO A 1 67 ? 21.283  -12.755 -5.710  1.00 0.00 ? 67  PRO A O    4  
ATOM   4032  C  CB   . PRO A 1 67 ? 20.235  -14.620 -3.599  1.00 0.00 ? 67  PRO A CB   4  
ATOM   4033  C  CG   . PRO A 1 67 ? 18.888  -14.193 -4.072  1.00 0.00 ? 67  PRO A CG   4  
ATOM   4034  C  CD   . PRO A 1 67 ? 18.605  -12.883 -3.390  1.00 0.00 ? 67  PRO A CD   4  
ATOM   4035  H  HA   . PRO A 1 67 ? 21.663  -13.413 -2.539  1.00 0.00 ? 67  PRO A HA   4  
ATOM   4036  H  HB2  . PRO A 1 67 ? 20.741  -15.225 -4.338  1.00 0.00 ? 67  PRO A HB2  4  
ATOM   4037  H  HB3  . PRO A 1 67 ? 20.173  -15.158 -2.666  1.00 0.00 ? 67  PRO A HB3  4  
ATOM   4038  H  HG2  . PRO A 1 67 ? 18.899  -14.063 -5.144  1.00 0.00 ? 67  PRO A HG2  4  
ATOM   4039  H  HG3  . PRO A 1 67 ? 18.150  -14.930 -3.790  1.00 0.00 ? 67  PRO A HG3  4  
ATOM   4040  H  HD2  . PRO A 1 67 ? 18.034  -12.236 -4.039  1.00 0.00 ? 67  PRO A HD2  4  
ATOM   4041  H  HD3  . PRO A 1 67 ? 18.080  -13.048 -2.460  1.00 0.00 ? 67  PRO A HD3  4  
ATOM   4042  N  N    . SER A 1 68 ? 23.149  -12.946 -4.466  1.00 0.00 ? 68  SER A N    4  
ATOM   4043  C  CA   . SER A 1 68 ? 24.049  -12.635 -5.570  1.00 0.00 ? 68  SER A CA   4  
ATOM   4044  C  C    . SER A 1 68 ? 23.704  -13.466 -6.803  1.00 0.00 ? 68  SER A C    4  
ATOM   4045  O  O    . SER A 1 68 ? 23.638  -14.693 -6.739  1.00 0.00 ? 68  SER A O    4  
ATOM   4046  C  CB   . SER A 1 68 ? 25.501  -12.889 -5.160  1.00 0.00 ? 68  SER A CB   4  
ATOM   4047  O  OG   . SER A 1 68 ? 25.696  -14.243 -4.789  1.00 0.00 ? 68  SER A OG   4  
ATOM   4048  H  H    . SER A 1 68 ? 23.525  -13.133 -3.580  1.00 0.00 ? 68  SER A H    4  
ATOM   4049  H  HA   . SER A 1 68 ? 23.930  -11.589 -5.811  1.00 0.00 ? 68  SER A HA   4  
ATOM   4050  H  HB2  . SER A 1 68 ? 26.152  -12.659 -5.990  1.00 0.00 ? 68  SER A HB2  4  
ATOM   4051  H  HB3  . SER A 1 68 ? 25.750  -12.257 -4.320  1.00 0.00 ? 68  SER A HB3  4  
ATOM   4052  H  HG   . SER A 1 68 ? 26.380  -14.295 -4.117  1.00 0.00 ? 68  SER A HG   4  
ATOM   4053  N  N    . SER A 1 69 ? 23.484  -12.786 -7.924  1.00 0.00 ? 69  SER A N    4  
ATOM   4054  C  CA   . SER A 1 69 ? 23.142  -13.460 -9.171  1.00 0.00 ? 69  SER A CA   4  
ATOM   4055  C  C    . SER A 1 69 ? 24.394  -13.755 -9.991  1.00 0.00 ? 69  SER A C    4  
ATOM   4056  O  O    . SER A 1 69 ? 25.265  -12.900 -10.145 1.00 0.00 ? 69  SER A O    4  
ATOM   4057  C  CB   . SER A 1 69 ? 22.173  -12.603 -9.989  1.00 0.00 ? 69  SER A CB   4  
ATOM   4058  O  OG   . SER A 1 69 ? 22.067  -13.082 -11.319 1.00 0.00 ? 69  SER A OG   4  
ATOM   4059  H  H    . SER A 1 69 ? 23.551  -11.808 -7.911  1.00 0.00 ? 69  SER A H    4  
ATOM   4060  H  HA   . SER A 1 69 ? 22.660  -14.394 -8.922  1.00 0.00 ? 69  SER A HA   4  
ATOM   4061  H  HB2  . SER A 1 69 ? 21.197  -12.631 -9.530  1.00 0.00 ? 69  SER A HB2  4  
ATOM   4062  H  HB3  . SER A 1 69 ? 22.531  -11.584 -10.013 1.00 0.00 ? 69  SER A HB3  4  
ATOM   4063  H  HG   . SER A 1 69 ? 21.171  -12.949 -11.636 1.00 0.00 ? 69  SER A HG   4  
ATOM   4064  N  N    . GLY A 1 70 ? 24.477  -14.974 -10.515 1.00 0.00 ? 70  GLY A N    4  
ATOM   4065  C  CA   . GLY A 1 70 ? 25.626  -15.362 -11.313 1.00 0.00 ? 70  GLY A CA   4  
ATOM   4066  C  C    . GLY A 1 70 ? 25.254  -15.687 -12.746 1.00 0.00 ? 70  GLY A C    4  
ATOM   4067  O  O    . GLY A 1 70 ? 25.440  -16.826 -13.169 1.00 0.00 ? 70  GLY A O    4  
ATOM   4068  H  H    . GLY A 1 70 ? 23.752  -15.615 -10.360 1.00 0.00 ? 70  GLY A H    4  
ATOM   4069  H  HA2  . GLY A 1 70 ? 26.341  -14.553 -11.312 1.00 0.00 ? 70  GLY A HA2  4  
ATOM   4070  H  HA3  . GLY A 1 70 ? 26.082  -16.233 -10.866 1.00 0.00 ? 70  GLY A HA3  4  
HETATM 4071  ZN ZN   . ZN  B 2 .  ? -11.355 4.305   2.429   1.00 0.00 ? 201 ZN  A ZN   4  
HETATM 4072  ZN ZN   . ZN  C 2 .  ? 6.658   3.632   0.498   1.00 0.00 ? 401 ZN  A ZN   4  
ATOM   4073  N  N    . GLY A 1 1  ? -17.510 -6.570  5.546   1.00 0.00 ? 1   GLY A N    5  
ATOM   4074  C  CA   . GLY A 1 1  ? -18.527 -5.628  5.117   1.00 0.00 ? 1   GLY A CA   5  
ATOM   4075  C  C    . GLY A 1 1  ? -18.690 -5.598  3.610   1.00 0.00 ? 1   GLY A C    5  
ATOM   4076  O  O    . GLY A 1 1  ? -18.487 -4.562  2.977   1.00 0.00 ? 1   GLY A O    5  
ATOM   4077  H  H1   . GLY A 1 1  ? -16.690 -6.676  5.020   1.00 0.00 ? 1   GLY A H1   5  
ATOM   4078  H  HA2  . GLY A 1 1  ? -19.470 -5.904  5.565   1.00 0.00 ? 1   GLY A HA2  5  
ATOM   4079  H  HA3  . GLY A 1 1  ? -18.253 -4.640  5.457   1.00 0.00 ? 1   GLY A HA3  5  
ATOM   4080  N  N    . SER A 1 2  ? -19.058 -6.738  3.034   1.00 0.00 ? 2   SER A N    5  
ATOM   4081  C  CA   . SER A 1 2  ? -19.243 -6.840  1.591   1.00 0.00 ? 2   SER A CA   5  
ATOM   4082  C  C    . SER A 1 2  ? -20.647 -6.400  1.191   1.00 0.00 ? 2   SER A C    5  
ATOM   4083  O  O    . SER A 1 2  ? -20.818 -5.531  0.335   1.00 0.00 ? 2   SER A O    5  
ATOM   4084  C  CB   . SER A 1 2  ? -18.993 -8.275  1.123   1.00 0.00 ? 2   SER A CB   5  
ATOM   4085  O  OG   . SER A 1 2  ? -17.648 -8.659  1.350   1.00 0.00 ? 2   SER A OG   5  
ATOM   4086  H  H    . SER A 1 2  ? -19.205 -7.530  3.592   1.00 0.00 ? 2   SER A H    5  
ATOM   4087  H  HA   . SER A 1 2  ? -18.525 -6.187  1.118   1.00 0.00 ? 2   SER A HA   5  
ATOM   4088  H  HB2  . SER A 1 2  ? -19.643 -8.946  1.666   1.00 0.00 ? 2   SER A HB2  5  
ATOM   4089  H  HB3  . SER A 1 2  ? -19.202 -8.348  0.066   1.00 0.00 ? 2   SER A HB3  5  
ATOM   4090  H  HG   . SER A 1 2  ? -17.315 -8.212  2.132   1.00 0.00 ? 2   SER A HG   5  
ATOM   4091  N  N    . SER A 1 3  ? -21.651 -7.006  1.816   1.00 0.00 ? 3   SER A N    5  
ATOM   4092  C  CA   . SER A 1 3  ? -23.042 -6.680  1.524   1.00 0.00 ? 3   SER A CA   5  
ATOM   4093  C  C    . SER A 1 3  ? -23.266 -6.554  0.020   1.00 0.00 ? 3   SER A C    5  
ATOM   4094  O  O    . SER A 1 3  ? -23.956 -5.647  -0.442  1.00 0.00 ? 3   SER A O    5  
ATOM   4095  C  CB   . SER A 1 3  ? -23.441 -5.378  2.221   1.00 0.00 ? 3   SER A CB   5  
ATOM   4096  O  OG   . SER A 1 3  ? -24.829 -5.130  2.083   1.00 0.00 ? 3   SER A OG   5  
ATOM   4097  H  H    . SER A 1 3  ? -21.451 -7.691  2.489   1.00 0.00 ? 3   SER A H    5  
ATOM   4098  H  HA   . SER A 1 3  ? -23.657 -7.484  1.902   1.00 0.00 ? 3   SER A HA   5  
ATOM   4099  H  HB2  . SER A 1 3  ? -23.203 -5.448  3.272   1.00 0.00 ? 3   SER A HB2  5  
ATOM   4100  H  HB3  . SER A 1 3  ? -22.894 -4.556  1.782   1.00 0.00 ? 3   SER A HB3  5  
ATOM   4101  H  HG   . SER A 1 3  ? -25.297 -5.964  2.003   1.00 0.00 ? 3   SER A HG   5  
ATOM   4102  N  N    . GLY A 1 4  ? -22.676 -7.473  -0.739  1.00 0.00 ? 4   GLY A N    5  
ATOM   4103  C  CA   . GLY A 1 4  ? -22.822 -7.448  -2.183  1.00 0.00 ? 4   GLY A CA   5  
ATOM   4104  C  C    . GLY A 1 4  ? -22.642 -6.057  -2.759  1.00 0.00 ? 4   GLY A C    5  
ATOM   4105  O  O    . GLY A 1 4  ? -23.597 -5.452  -3.247  1.00 0.00 ? 4   GLY A O    5  
ATOM   4106  H  H    . GLY A 1 4  ? -22.137 -8.173  -0.315  1.00 0.00 ? 4   GLY A H    5  
ATOM   4107  H  HA2  . GLY A 1 4  ? -22.086 -8.105  -2.620  1.00 0.00 ? 4   GLY A HA2  5  
ATOM   4108  H  HA3  . GLY A 1 4  ? -23.808 -7.806  -2.439  1.00 0.00 ? 4   GLY A HA3  5  
ATOM   4109  N  N    . SER A 1 5  ? -21.415 -5.549  -2.703  1.00 0.00 ? 5   SER A N    5  
ATOM   4110  C  CA   . SER A 1 5  ? -21.114 -4.219  -3.219  1.00 0.00 ? 5   SER A CA   5  
ATOM   4111  C  C    . SER A 1 5  ? -19.614 -3.947  -3.178  1.00 0.00 ? 5   SER A C    5  
ATOM   4112  O  O    . SER A 1 5  ? -18.852 -4.699  -2.570  1.00 0.00 ? 5   SER A O    5  
ATOM   4113  C  CB   . SER A 1 5  ? -21.859 -3.155  -2.410  1.00 0.00 ? 5   SER A CB   5  
ATOM   4114  O  OG   . SER A 1 5  ? -21.150 -2.822  -1.229  1.00 0.00 ? 5   SER A OG   5  
ATOM   4115  H  H    . SER A 1 5  ? -20.696 -6.081  -2.302  1.00 0.00 ? 5   SER A H    5  
ATOM   4116  H  HA   . SER A 1 5  ? -21.448 -4.178  -4.245  1.00 0.00 ? 5   SER A HA   5  
ATOM   4117  H  HB2  . SER A 1 5  ? -21.973 -2.265  -3.010  1.00 0.00 ? 5   SER A HB2  5  
ATOM   4118  H  HB3  . SER A 1 5  ? -22.834 -3.531  -2.137  1.00 0.00 ? 5   SER A HB3  5  
ATOM   4119  H  HG   . SER A 1 5  ? -21.289 -1.895  -1.022  1.00 0.00 ? 5   SER A HG   5  
ATOM   4120  N  N    . SER A 1 6  ? -19.197 -2.866  -3.829  1.00 0.00 ? 6   SER A N    5  
ATOM   4121  C  CA   . SER A 1 6  ? -17.787 -2.495  -3.872  1.00 0.00 ? 6   SER A CA   5  
ATOM   4122  C  C    . SER A 1 6  ? -17.487 -1.383  -2.871  1.00 0.00 ? 6   SER A C    5  
ATOM   4123  O  O    . SER A 1 6  ? -17.892 -0.236  -3.061  1.00 0.00 ? 6   SER A O    5  
ATOM   4124  C  CB   . SER A 1 6  ? -17.398 -2.047  -5.282  1.00 0.00 ? 6   SER A CB   5  
ATOM   4125  O  OG   . SER A 1 6  ? -17.286 -3.156  -6.157  1.00 0.00 ? 6   SER A OG   5  
ATOM   4126  H  H    . SER A 1 6  ? -19.853 -2.306  -4.295  1.00 0.00 ? 6   SER A H    5  
ATOM   4127  H  HA   . SER A 1 6  ? -17.207 -3.367  -3.607  1.00 0.00 ? 6   SER A HA   5  
ATOM   4128  H  HB2  . SER A 1 6  ? -18.152 -1.377  -5.665  1.00 0.00 ? 6   SER A HB2  5  
ATOM   4129  H  HB3  . SER A 1 6  ? -16.446 -1.536  -5.244  1.00 0.00 ? 6   SER A HB3  5  
ATOM   4130  H  HG   . SER A 1 6  ? -18.025 -3.753  -6.013  1.00 0.00 ? 6   SER A HG   5  
ATOM   4131  N  N    . GLY A 1 7  ? -16.775 -1.731  -1.804  1.00 0.00 ? 7   GLY A N    5  
ATOM   4132  C  CA   . GLY A 1 7  ? -16.433 -0.752  -0.789  1.00 0.00 ? 7   GLY A CA   5  
ATOM   4133  C  C    . GLY A 1 7  ? -14.965 -0.793  -0.415  1.00 0.00 ? 7   GLY A C    5  
ATOM   4134  O  O    . GLY A 1 7  ? -14.317 -1.834  -0.528  1.00 0.00 ? 7   GLY A O    5  
ATOM   4135  H  H    . GLY A 1 7  ? -16.480 -2.660  -1.705  1.00 0.00 ? 7   GLY A H    5  
ATOM   4136  H  HA2  . GLY A 1 7  ? -16.672 0.233   -1.160  1.00 0.00 ? 7   GLY A HA2  5  
ATOM   4137  H  HA3  . GLY A 1 7  ? -17.023 -0.946  0.095   1.00 0.00 ? 7   GLY A HA3  5  
ATOM   4138  N  N    . CYS A 1 8  ? -14.437 0.342   0.031   1.00 0.00 ? 8   CYS A N    5  
ATOM   4139  C  CA   . CYS A 1 8  ? -13.036 0.433   0.421   1.00 0.00 ? 8   CYS A CA   5  
ATOM   4140  C  C    . CYS A 1 8  ? -12.727 -0.523  1.569   1.00 0.00 ? 8   CYS A C    5  
ATOM   4141  O  O    . CYS A 1 8  ? -13.550 -0.723  2.463   1.00 0.00 ? 8   CYS A O    5  
ATOM   4142  C  CB   . CYS A 1 8  ? -12.690 1.867   0.829   1.00 0.00 ? 8   CYS A CB   5  
ATOM   4143  S  SG   . CYS A 1 8  ? -11.118 2.023   1.736   1.00 0.00 ? 8   CYS A SG   5  
ATOM   4144  H  H    . CYS A 1 8  ? -15.005 1.139   0.099   1.00 0.00 ? 8   CYS A H    5  
ATOM   4145  H  HA   . CYS A 1 8  ? -12.435 0.157   -0.433  1.00 0.00 ? 8   CYS A HA   5  
ATOM   4146  H  HB2  . CYS A 1 8  ? -12.619 2.479   -0.058  1.00 0.00 ? 8   CYS A HB2  5  
ATOM   4147  H  HB3  . CYS A 1 8  ? -13.476 2.251   1.463   1.00 0.00 ? 8   CYS A HB3  5  
ATOM   4148  N  N    . HIS A 1 9  ? -11.535 -1.111  1.538   1.00 0.00 ? 9   HIS A N    5  
ATOM   4149  C  CA   . HIS A 1 9  ? -11.117 -2.046  2.576   1.00 0.00 ? 9   HIS A CA   5  
ATOM   4150  C  C    . HIS A 1 9  ? -10.364 -1.322  3.688   1.00 0.00 ? 9   HIS A C    5  
ATOM   4151  O  O    . HIS A 1 9  ? -10.494 -1.664  4.863   1.00 0.00 ? 9   HIS A O    5  
ATOM   4152  C  CB   . HIS A 1 9  ? -10.236 -3.144  1.979   1.00 0.00 ? 9   HIS A CB   5  
ATOM   4153  C  CG   . HIS A 1 9  ? -9.970  -4.277  2.921   1.00 0.00 ? 9   HIS A CG   5  
ATOM   4154  N  ND1  . HIS A 1 9  ? -10.953 -4.863  3.691   1.00 0.00 ? 9   HIS A ND1  5  
ATOM   4155  C  CD2  . HIS A 1 9  ? -8.823  -4.935  3.214   1.00 0.00 ? 9   HIS A CD2  5  
ATOM   4156  C  CE1  . HIS A 1 9  ? -10.422 -5.830  4.417   1.00 0.00 ? 9   HIS A CE1  5  
ATOM   4157  N  NE2  . HIS A 1 9  ? -9.131  -5.894  4.147   1.00 0.00 ? 9   HIS A NE2  5  
ATOM   4158  H  H    . HIS A 1 9  ? -10.923 -0.912  0.799   1.00 0.00 ? 9   HIS A H    5  
ATOM   4159  H  HA   . HIS A 1 9  ? -12.004 -2.497  2.994   1.00 0.00 ? 9   HIS A HA   5  
ATOM   4160  H  HB2  . HIS A 1 9  ? -10.720 -3.548  1.102   1.00 0.00 ? 9   HIS A HB2  5  
ATOM   4161  H  HB3  . HIS A 1 9  ? -9.284  -2.718  1.694   1.00 0.00 ? 9   HIS A HB3  5  
ATOM   4162  H  HD1  . HIS A 1 9  ? -11.898 -4.606  3.703   1.00 0.00 ? 9   HIS A HD1  5  
ATOM   4163  H  HD2  . HIS A 1 9  ? -7.847  -4.740  2.793   1.00 0.00 ? 9   HIS A HD2  5  
ATOM   4164  H  HE1  . HIS A 1 9  ? -10.953 -6.461  5.114   1.00 0.00 ? 9   HIS A HE1  5  
ATOM   4165  H  HE2  . HIS A 1 9  ? -8.486  -6.467  4.610   1.00 0.00 ? 9   HIS A HE2  5  
ATOM   4166  N  N    . GLN A 1 10 ? -9.577  -0.321  3.308   1.00 0.00 ? 10  GLN A N    5  
ATOM   4167  C  CA   . GLN A 1 10 ? -8.802  0.450   4.274   1.00 0.00 ? 10  GLN A CA   5  
ATOM   4168  C  C    . GLN A 1 10 ? -9.683  0.920   5.427   1.00 0.00 ? 10  GLN A C    5  
ATOM   4169  O  O    . GLN A 1 10 ? -9.545  0.453   6.558   1.00 0.00 ? 10  GLN A O    5  
ATOM   4170  C  CB   . GLN A 1 10 ? -8.150  1.653   3.592   1.00 0.00 ? 10  GLN A CB   5  
ATOM   4171  C  CG   . GLN A 1 10 ? -7.332  2.519   4.537   1.00 0.00 ? 10  GLN A CG   5  
ATOM   4172  C  CD   . GLN A 1 10 ? -5.969  1.928   4.837   1.00 0.00 ? 10  GLN A CD   5  
ATOM   4173  O  OE1  . GLN A 1 10 ? -4.999  2.178   4.121   1.00 0.00 ? 10  GLN A OE1  5  
ATOM   4174  N  NE2  . GLN A 1 10 ? -5.887  1.139   5.902   1.00 0.00 ? 10  GLN A NE2  5  
ATOM   4175  H  H    . GLN A 1 10 ? -9.515  -0.096  2.357   1.00 0.00 ? 10  GLN A H    5  
ATOM   4176  H  HA   . GLN A 1 10 ? -8.029  -0.192  4.667   1.00 0.00 ? 10  GLN A HA   5  
ATOM   4177  H  HB2  . GLN A 1 10 ? -7.498  1.298   2.808   1.00 0.00 ? 10  GLN A HB2  5  
ATOM   4178  H  HB3  . GLN A 1 10 ? -8.923  2.268   3.154   1.00 0.00 ? 10  GLN A HB3  5  
ATOM   4179  H  HG2  . GLN A 1 10 ? -7.194  3.491   4.086   1.00 0.00 ? 10  GLN A HG2  5  
ATOM   4180  H  HG3  . GLN A 1 10 ? -7.874  2.627   5.464   1.00 0.00 ? 10  GLN A HG3  5  
ATOM   4181  H  HE21 . GLN A 1 10 ? -6.702  0.983   6.425   1.00 0.00 ? 10  GLN A HE21 5  
ATOM   4182  H  HE22 . GLN A 1 10 ? -5.019  0.743   6.119   1.00 0.00 ? 10  GLN A HE22 5  
ATOM   4183  N  N    . CYS A 1 11 ? -10.588 1.847   5.133   1.00 0.00 ? 11  CYS A N    5  
ATOM   4184  C  CA   . CYS A 1 11 ? -11.492 2.382   6.145   1.00 0.00 ? 11  CYS A CA   5  
ATOM   4185  C  C    . CYS A 1 11 ? -12.784 1.573   6.203   1.00 0.00 ? 11  CYS A C    5  
ATOM   4186  O  O    . CYS A 1 11 ? -13.250 1.204   7.280   1.00 0.00 ? 11  CYS A O    5  
ATOM   4187  C  CB   . CYS A 1 11 ? -11.809 3.850   5.851   1.00 0.00 ? 11  CYS A CB   5  
ATOM   4188  S  SG   . CYS A 1 11 ? -12.681 4.120   4.275   1.00 0.00 ? 11  CYS A SG   5  
ATOM   4189  H  H    . CYS A 1 11 ? -10.651 2.181   4.213   1.00 0.00 ? 11  CYS A H    5  
ATOM   4190  H  HA   . CYS A 1 11 ? -10.996 2.315   7.102   1.00 0.00 ? 11  CYS A HA   5  
ATOM   4191  H  HB2  . CYS A 1 11 ? -12.433 4.240   6.642   1.00 0.00 ? 11  CYS A HB2  5  
ATOM   4192  H  HB3  . CYS A 1 11 ? -10.886 4.410   5.818   1.00 0.00 ? 11  CYS A HB3  5  
ATOM   4193  N  N    . GLY A 1 12 ? -13.358 1.300   5.035   1.00 0.00 ? 12  GLY A N    5  
ATOM   4194  C  CA   . GLY A 1 12 ? -14.590 0.536   4.975   1.00 0.00 ? 12  GLY A CA   5  
ATOM   4195  C  C    . GLY A 1 12 ? -15.698 1.278   4.253   1.00 0.00 ? 12  GLY A C    5  
ATOM   4196  O  O    . GLY A 1 12 ? -16.512 0.670   3.560   1.00 0.00 ? 12  GLY A O    5  
ATOM   4197  H  H    . GLY A 1 12 ? -12.941 1.620   4.208   1.00 0.00 ? 12  GLY A H    5  
ATOM   4198  H  HA2  . GLY A 1 12 ? -14.400 -0.394  4.460   1.00 0.00 ? 12  GLY A HA2  5  
ATOM   4199  H  HA3  . GLY A 1 12 ? -14.915 0.319   5.981   1.00 0.00 ? 12  GLY A HA3  5  
ATOM   4200  N  N    . GLU A 1 13 ? -15.729 2.597   4.418   1.00 0.00 ? 13  GLU A N    5  
ATOM   4201  C  CA   . GLU A 1 13 ? -16.747 3.422   3.778   1.00 0.00 ? 13  GLU A CA   5  
ATOM   4202  C  C    . GLU A 1 13 ? -16.871 3.082   2.296   1.00 0.00 ? 13  GLU A C    5  
ATOM   4203  O  O    . GLU A 1 13 ? -15.909 2.640   1.667   1.00 0.00 ? 13  GLU A O    5  
ATOM   4204  C  CB   . GLU A 1 13 ? -16.412 4.906   3.946   1.00 0.00 ? 13  GLU A CB   5  
ATOM   4205  C  CG   . GLU A 1 13 ? -16.224 5.327   5.394   1.00 0.00 ? 13  GLU A CG   5  
ATOM   4206  C  CD   . GLU A 1 13 ? -17.538 5.629   6.089   1.00 0.00 ? 13  GLU A CD   5  
ATOM   4207  O  OE1  . GLU A 1 13 ? -18.028 6.771   5.960   1.00 0.00 ? 13  GLU A OE1  5  
ATOM   4208  O  OE2  . GLU A 1 13 ? -18.075 4.725   6.763   1.00 0.00 ? 13  GLU A OE2  5  
ATOM   4209  H  H    . GLU A 1 13 ? -15.052 3.025   4.983   1.00 0.00 ? 13  GLU A H    5  
ATOM   4210  H  HA   . GLU A 1 13 ? -17.690 3.219   4.262   1.00 0.00 ? 13  GLU A HA   5  
ATOM   4211  H  HB2  . GLU A 1 13 ? -15.500 5.120   3.409   1.00 0.00 ? 13  GLU A HB2  5  
ATOM   4212  H  HB3  . GLU A 1 13 ? -17.215 5.493   3.524   1.00 0.00 ? 13  GLU A HB3  5  
ATOM   4213  H  HG2  . GLU A 1 13 ? -15.728 4.529   5.927   1.00 0.00 ? 13  GLU A HG2  5  
ATOM   4214  H  HG3  . GLU A 1 13 ? -15.608 6.214   5.421   1.00 0.00 ? 13  GLU A HG3  5  
ATOM   4215  N  N    . PHE A 1 14 ? -18.061 3.292   1.744   1.00 0.00 ? 14  PHE A N    5  
ATOM   4216  C  CA   . PHE A 1 14 ? -18.312 3.007   0.336   1.00 0.00 ? 14  PHE A CA   5  
ATOM   4217  C  C    . PHE A 1 14 ? -17.640 4.045   -0.557  1.00 0.00 ? 14  PHE A C    5  
ATOM   4218  O  O    . PHE A 1 14 ? -17.640 5.237   -0.250  1.00 0.00 ? 14  PHE A O    5  
ATOM   4219  C  CB   . PHE A 1 14 ? -19.817 2.978   0.061   1.00 0.00 ? 14  PHE A CB   5  
ATOM   4220  C  CG   . PHE A 1 14 ? -20.177 2.304   -1.233  1.00 0.00 ? 14  PHE A CG   5  
ATOM   4221  C  CD1  . PHE A 1 14 ? -20.118 0.924   -1.350  1.00 0.00 ? 14  PHE A CD1  5  
ATOM   4222  C  CD2  . PHE A 1 14 ? -20.574 3.049   -2.331  1.00 0.00 ? 14  PHE A CD2  5  
ATOM   4223  C  CE1  . PHE A 1 14 ? -20.447 0.302   -2.539  1.00 0.00 ? 14  PHE A CE1  5  
ATOM   4224  C  CE2  . PHE A 1 14 ? -20.905 2.432   -3.523  1.00 0.00 ? 14  PHE A CE2  5  
ATOM   4225  C  CZ   . PHE A 1 14 ? -20.842 1.056   -3.626  1.00 0.00 ? 14  PHE A CZ   5  
ATOM   4226  H  H    . PHE A 1 14 ? -18.789 3.647   2.298   1.00 0.00 ? 14  PHE A H    5  
ATOM   4227  H  HA   . PHE A 1 14 ? -17.896 2.036   0.116   1.00 0.00 ? 14  PHE A HA   5  
ATOM   4228  H  HB2  . PHE A 1 14 ? -20.312 2.446   0.859   1.00 0.00 ? 14  PHE A HB2  5  
ATOM   4229  H  HB3  . PHE A 1 14 ? -20.188 3.991   0.023   1.00 0.00 ? 14  PHE A HB3  5  
ATOM   4230  H  HD1  . PHE A 1 14 ? -19.810 0.332   -0.501  1.00 0.00 ? 14  PHE A HD1  5  
ATOM   4231  H  HD2  . PHE A 1 14 ? -20.624 4.126   -2.250  1.00 0.00 ? 14  PHE A HD2  5  
ATOM   4232  H  HE1  . PHE A 1 14 ? -20.398 -0.774  -2.618  1.00 0.00 ? 14  PHE A HE1  5  
ATOM   4233  H  HE2  . PHE A 1 14 ? -21.214 3.026   -4.370  1.00 0.00 ? 14  PHE A HE2  5  
ATOM   4234  H  HZ   . PHE A 1 14 ? -21.100 0.572   -4.557  1.00 0.00 ? 14  PHE A HZ   5  
ATOM   4235  N  N    . ILE A 1 15 ? -17.068 3.582   -1.664  1.00 0.00 ? 15  ILE A N    5  
ATOM   4236  C  CA   . ILE A 1 15 ? -16.393 4.470   -2.602  1.00 0.00 ? 15  ILE A CA   5  
ATOM   4237  C  C    . ILE A 1 15 ? -17.367 5.019   -3.638  1.00 0.00 ? 15  ILE A C    5  
ATOM   4238  O  O    . ILE A 1 15 ? -18.120 4.266   -4.257  1.00 0.00 ? 15  ILE A O    5  
ATOM   4239  C  CB   . ILE A 1 15 ? -15.241 3.750   -3.328  1.00 0.00 ? 15  ILE A CB   5  
ATOM   4240  C  CG1  . ILE A 1 15 ? -14.403 2.947   -2.331  1.00 0.00 ? 15  ILE A CG1  5  
ATOM   4241  C  CG2  . ILE A 1 15 ? -14.371 4.756   -4.069  1.00 0.00 ? 15  ILE A CG2  5  
ATOM   4242  C  CD1  . ILE A 1 15 ? -13.630 1.813   -2.967  1.00 0.00 ? 15  ILE A CD1  5  
ATOM   4243  H  H    . ILE A 1 15 ? -17.101 2.622   -1.854  1.00 0.00 ? 15  ILE A H    5  
ATOM   4244  H  HA   . ILE A 1 15 ? -15.978 5.295   -2.041  1.00 0.00 ? 15  ILE A HA   5  
ATOM   4245  H  HB   . ILE A 1 15 ? -15.668 3.076   -4.055  1.00 0.00 ? 15  ILE A HB   5  
ATOM   4246  H  HG12 . ILE A 1 15 ? -13.694 3.604   -1.853  1.00 0.00 ? 15  ILE A HG12 5  
ATOM   4247  H  HG13 . ILE A 1 15 ? -15.057 2.524   -1.582  1.00 0.00 ? 15  ILE A HG13 5  
ATOM   4248  H  HG21 . ILE A 1 15 ? -13.486 4.261   -4.441  1.00 0.00 ? 15  ILE A HG21 5  
ATOM   4249  H  HG22 . ILE A 1 15 ? -14.926 5.170   -4.897  1.00 0.00 ? 15  ILE A HG22 5  
ATOM   4250  H  HG23 . ILE A 1 15 ? -14.084 5.549   -3.395  1.00 0.00 ? 15  ILE A HG23 5  
ATOM   4251  H  HD11 . ILE A 1 15 ? -13.350 2.087   -3.974  1.00 0.00 ? 15  ILE A HD11 5  
ATOM   4252  H  HD12 . ILE A 1 15 ? -12.741 1.613   -2.388  1.00 0.00 ? 15  ILE A HD12 5  
ATOM   4253  H  HD13 . ILE A 1 15 ? -14.248 0.927   -2.995  1.00 0.00 ? 15  ILE A HD13 5  
ATOM   4254  N  N    . ILE A 1 16 ? -17.347 6.334   -3.824  1.00 0.00 ? 16  ILE A N    5  
ATOM   4255  C  CA   . ILE A 1 16 ? -18.227 6.984   -4.787  1.00 0.00 ? 16  ILE A CA   5  
ATOM   4256  C  C    . ILE A 1 16 ? -17.445 7.923   -5.700  1.00 0.00 ? 16  ILE A C    5  
ATOM   4257  O  O    . ILE A 1 16 ? -16.873 8.913   -5.246  1.00 0.00 ? 16  ILE A O    5  
ATOM   4258  C  CB   . ILE A 1 16 ? -19.342 7.779   -4.084  1.00 0.00 ? 16  ILE A CB   5  
ATOM   4259  C  CG1  . ILE A 1 16 ? -20.010 6.921   -3.008  1.00 0.00 ? 16  ILE A CG1  5  
ATOM   4260  C  CG2  . ILE A 1 16 ? -20.369 8.262   -5.098  1.00 0.00 ? 16  ILE A CG2  5  
ATOM   4261  C  CD1  . ILE A 1 16 ? -21.008 7.681   -2.162  1.00 0.00 ? 16  ILE A CD1  5  
ATOM   4262  H  H    . ILE A 1 16 ? -16.725 6.881   -3.300  1.00 0.00 ? 16  ILE A H    5  
ATOM   4263  H  HA   . ILE A 1 16 ? -18.687 6.213   -5.390  1.00 0.00 ? 16  ILE A HA   5  
ATOM   4264  H  HB   . ILE A 1 16 ? -18.897 8.646   -3.619  1.00 0.00 ? 16  ILE A HB   5  
ATOM   4265  H  HG12 . ILE A 1 16 ? -20.532 6.104   -3.481  1.00 0.00 ? 16  ILE A HG12 5  
ATOM   4266  H  HG13 . ILE A 1 16 ? -19.250 6.525   -2.350  1.00 0.00 ? 16  ILE A HG13 5  
ATOM   4267  H  HG21 . ILE A 1 16 ? -21.329 8.367   -4.615  1.00 0.00 ? 16  ILE A HG21 5  
ATOM   4268  H  HG22 . ILE A 1 16 ? -20.060 9.217   -5.496  1.00 0.00 ? 16  ILE A HG22 5  
ATOM   4269  H  HG23 . ILE A 1 16 ? -20.446 7.545   -5.901  1.00 0.00 ? 16  ILE A HG23 5  
ATOM   4270  H  HD11 . ILE A 1 16 ? -21.049 8.709   -2.490  1.00 0.00 ? 16  ILE A HD11 5  
ATOM   4271  H  HD12 . ILE A 1 16 ? -21.984 7.230   -2.263  1.00 0.00 ? 16  ILE A HD12 5  
ATOM   4272  H  HD13 . ILE A 1 16 ? -20.701 7.647   -1.126  1.00 0.00 ? 16  ILE A HD13 5  
ATOM   4273  N  N    . GLY A 1 17 ? -17.427 7.605   -6.991  1.00 0.00 ? 17  GLY A N    5  
ATOM   4274  C  CA   . GLY A 1 17 ? -16.714 8.432   -7.948  1.00 0.00 ? 17  GLY A CA   5  
ATOM   4275  C  C    . GLY A 1 17 ? -15.472 7.752   -8.489  1.00 0.00 ? 17  GLY A C    5  
ATOM   4276  O  O    . GLY A 1 17 ? -15.456 7.291   -9.630  1.00 0.00 ? 17  GLY A O    5  
ATOM   4277  H  H    . GLY A 1 17 ? -17.901 6.804   -7.296  1.00 0.00 ? 17  GLY A H    5  
ATOM   4278  H  HA2  . GLY A 1 17 ? -17.375 8.661   -8.771  1.00 0.00 ? 17  GLY A HA2  5  
ATOM   4279  H  HA3  . GLY A 1 17 ? -16.425 9.353   -7.465  1.00 0.00 ? 17  GLY A HA3  5  
ATOM   4280  N  N    . ARG A 1 18 ? -14.428 7.692   -7.668  1.00 0.00 ? 18  ARG A N    5  
ATOM   4281  C  CA   . ARG A 1 18 ? -13.175 7.066   -8.072  1.00 0.00 ? 18  ARG A CA   5  
ATOM   4282  C  C    . ARG A 1 18 ? -12.870 5.848   -7.205  1.00 0.00 ? 18  ARG A C    5  
ATOM   4283  O  O    . ARG A 1 18 ? -12.746 5.957   -5.985  1.00 0.00 ? 18  ARG A O    5  
ATOM   4284  C  CB   . ARG A 1 18 ? -12.025 8.072   -7.979  1.00 0.00 ? 18  ARG A CB   5  
ATOM   4285  C  CG   . ARG A 1 18 ? -10.649 7.426   -7.986  1.00 0.00 ? 18  ARG A CG   5  
ATOM   4286  C  CD   . ARG A 1 18 ? -9.605  8.346   -8.599  1.00 0.00 ? 18  ARG A CD   5  
ATOM   4287  N  NE   . ARG A 1 18 ? -8.534  7.600   -9.253  1.00 0.00 ? 18  ARG A NE   5  
ATOM   4288  C  CZ   . ARG A 1 18 ? -7.764  8.106   -10.210 1.00 0.00 ? 18  ARG A CZ   5  
ATOM   4289  N  NH1  . ARG A 1 18 ? -7.945  9.354   -10.620 1.00 0.00 ? 18  ARG A NH1  5  
ATOM   4290  N  NH2  . ARG A 1 18 ? -6.810  7.364   -10.757 1.00 0.00 ? 18  ARG A NH2  5  
ATOM   4291  H  H    . ARG A 1 18 ? -14.502 8.077   -6.770  1.00 0.00 ? 18  ARG A H    5  
ATOM   4292  H  HA   . ARG A 1 18 ? -13.279 6.746   -9.098  1.00 0.00 ? 18  ARG A HA   5  
ATOM   4293  H  HB2  . ARG A 1 18 ? -12.085 8.748   -8.820  1.00 0.00 ? 18  ARG A HB2  5  
ATOM   4294  H  HB3  . ARG A 1 18 ? -12.130 8.636   -7.065  1.00 0.00 ? 18  ARG A HB3  5  
ATOM   4295  H  HG2  . ARG A 1 18 ? -10.363 7.201   -6.969  1.00 0.00 ? 18  ARG A HG2  5  
ATOM   4296  H  HG3  . ARG A 1 18 ? -10.693 6.513   -8.560  1.00 0.00 ? 18  ARG A HG3  5  
ATOM   4297  H  HD2  . ARG A 1 18 ? -10.087 8.980   -9.328  1.00 0.00 ? 18  ARG A HD2  5  
ATOM   4298  H  HD3  . ARG A 1 18 ? -9.180  8.957   -7.816  1.00 0.00 ? 18  ARG A HD3  5  
ATOM   4299  H  HE   . ARG A 1 18 ? -8.383  6.676   -8.965  1.00 0.00 ? 18  ARG A HE   5  
ATOM   4300  H  HH11 . ARG A 1 18 ? -8.662  9.916   -10.208 1.00 0.00 ? 18  ARG A HH11 5  
ATOM   4301  H  HH12 . ARG A 1 18 ? -7.362  9.733   -11.339 1.00 0.00 ? 18  ARG A HH12 5  
ATOM   4302  H  HH21 . ARG A 1 18 ? -6.671  6.423   -10.450 1.00 0.00 ? 18  ARG A HH21 5  
ATOM   4303  H  HH22 . ARG A 1 18 ? -6.231  7.746   -11.477 1.00 0.00 ? 18  ARG A HH22 5  
ATOM   4304  N  N    . VAL A 1 19 ? -12.752 4.688   -7.843  1.00 0.00 ? 19  VAL A N    5  
ATOM   4305  C  CA   . VAL A 1 19 ? -12.462 3.450   -7.130  1.00 0.00 ? 19  VAL A CA   5  
ATOM   4306  C  C    . VAL A 1 19 ? -11.084 2.913   -7.499  1.00 0.00 ? 19  VAL A C    5  
ATOM   4307  O  O    . VAL A 1 19 ? -10.819 2.599   -8.660  1.00 0.00 ? 19  VAL A O    5  
ATOM   4308  C  CB   . VAL A 1 19 ? -13.518 2.370   -7.429  1.00 0.00 ? 19  VAL A CB   5  
ATOM   4309  C  CG1  . VAL A 1 19 ? -12.971 0.986   -7.114  1.00 0.00 ? 19  VAL A CG1  5  
ATOM   4310  C  CG2  . VAL A 1 19 ? -14.793 2.639   -6.643  1.00 0.00 ? 19  VAL A CG2  5  
ATOM   4311  H  H    . VAL A 1 19 ? -12.862 4.665   -8.816  1.00 0.00 ? 19  VAL A H    5  
ATOM   4312  H  HA   . VAL A 1 19 ? -12.484 3.661   -6.071  1.00 0.00 ? 19  VAL A HA   5  
ATOM   4313  H  HB   . VAL A 1 19 ? -13.755 2.408   -8.482  1.00 0.00 ? 19  VAL A HB   5  
ATOM   4314  H  HG11 . VAL A 1 19 ? -12.087 0.805   -7.708  1.00 0.00 ? 19  VAL A HG11 5  
ATOM   4315  H  HG12 . VAL A 1 19 ? -12.720 0.928   -6.066  1.00 0.00 ? 19  VAL A HG12 5  
ATOM   4316  H  HG13 . VAL A 1 19 ? -13.718 0.242   -7.348  1.00 0.00 ? 19  VAL A HG13 5  
ATOM   4317  H  HG21 . VAL A 1 19 ? -14.704 3.584   -6.128  1.00 0.00 ? 19  VAL A HG21 5  
ATOM   4318  H  HG22 . VAL A 1 19 ? -15.633 2.677   -7.322  1.00 0.00 ? 19  VAL A HG22 5  
ATOM   4319  H  HG23 . VAL A 1 19 ? -14.947 1.849   -5.924  1.00 0.00 ? 19  VAL A HG23 5  
ATOM   4320  N  N    . ILE A 1 20 ? -10.209 2.810   -6.504  1.00 0.00 ? 20  ILE A N    5  
ATOM   4321  C  CA   . ILE A 1 20 ? -8.858  2.310   -6.724  1.00 0.00 ? 20  ILE A CA   5  
ATOM   4322  C  C    . ILE A 1 20 ? -8.792  0.799   -6.527  1.00 0.00 ? 20  ILE A C    5  
ATOM   4323  O  O    . ILE A 1 20 ? -8.774  0.309   -5.397  1.00 0.00 ? 20  ILE A O    5  
ATOM   4324  C  CB   . ILE A 1 20 ? -7.847  2.984   -5.778  1.00 0.00 ? 20  ILE A CB   5  
ATOM   4325  C  CG1  . ILE A 1 20 ? -8.098  4.492   -5.719  1.00 0.00 ? 20  ILE A CG1  5  
ATOM   4326  C  CG2  . ILE A 1 20 ? -6.423  2.696   -6.232  1.00 0.00 ? 20  ILE A CG2  5  
ATOM   4327  C  CD1  . ILE A 1 20 ? -7.903  5.190   -7.048  1.00 0.00 ? 20  ILE A CD1  5  
ATOM   4328  H  H    . ILE A 1 20 ? -10.479 3.076   -5.601  1.00 0.00 ? 20  ILE A H    5  
ATOM   4329  H  HA   . ILE A 1 20 ? -8.579  2.542   -7.742  1.00 0.00 ? 20  ILE A HA   5  
ATOM   4330  H  HB   . ILE A 1 20 ? -7.976  2.566   -4.792  1.00 0.00 ? 20  ILE A HB   5  
ATOM   4331  H  HG12 . ILE A 1 20 ? -9.112  4.670   -5.398  1.00 0.00 ? 20  ILE A HG12 5  
ATOM   4332  H  HG13 . ILE A 1 20 ? -7.416  4.936   -5.008  1.00 0.00 ? 20  ILE A HG13 5  
ATOM   4333  H  HG21 . ILE A 1 20 ? -5.778  3.506   -5.927  1.00 0.00 ? 20  ILE A HG21 5  
ATOM   4334  H  HG22 . ILE A 1 20 ? -6.082  1.776   -5.782  1.00 0.00 ? 20  ILE A HG22 5  
ATOM   4335  H  HG23 . ILE A 1 20 ? -6.400  2.602   -7.307  1.00 0.00 ? 20  ILE A HG23 5  
ATOM   4336  H  HD11 . ILE A 1 20 ? -8.186  6.228   -6.955  1.00 0.00 ? 20  ILE A HD11 5  
ATOM   4337  H  HD12 . ILE A 1 20 ? -6.866  5.123   -7.341  1.00 0.00 ? 20  ILE A HD12 5  
ATOM   4338  H  HD13 . ILE A 1 20 ? -8.520  4.715   -7.797  1.00 0.00 ? 20  ILE A HD13 5  
ATOM   4339  N  N    . LYS A 1 21 ? -8.755  0.064   -7.633  1.00 0.00 ? 21  LYS A N    5  
ATOM   4340  C  CA   . LYS A 1 21 ? -8.687  -1.391  -7.584  1.00 0.00 ? 21  LYS A CA   5  
ATOM   4341  C  C    . LYS A 1 21 ? -7.266  -1.861  -7.292  1.00 0.00 ? 21  LYS A C    5  
ATOM   4342  O  O    . LYS A 1 21 ? -6.352  -1.633  -8.085  1.00 0.00 ? 21  LYS A O    5  
ATOM   4343  C  CB   . LYS A 1 21 ? -9.172  -1.990  -8.906  1.00 0.00 ? 21  LYS A CB   5  
ATOM   4344  C  CG   . LYS A 1 21 ? -10.676 -1.902  -9.098  1.00 0.00 ? 21  LYS A CG   5  
ATOM   4345  C  CD   . LYS A 1 21 ? -11.380 -3.139  -8.566  1.00 0.00 ? 21  LYS A CD   5  
ATOM   4346  C  CE   . LYS A 1 21 ? -11.844 -2.942  -7.131  1.00 0.00 ? 21  LYS A CE   5  
ATOM   4347  N  NZ   . LYS A 1 21 ? -12.614 -4.114  -6.630  1.00 0.00 ? 21  LYS A NZ   5  
ATOM   4348  H  H    . LYS A 1 21 ? -8.772  0.513   -8.505  1.00 0.00 ? 21  LYS A H    5  
ATOM   4349  H  HA   . LYS A 1 21 ? -9.335  -1.726  -6.788  1.00 0.00 ? 21  LYS A HA   5  
ATOM   4350  H  HB2  . LYS A 1 21 ? -8.695  -1.466  -9.721  1.00 0.00 ? 21  LYS A HB2  5  
ATOM   4351  H  HB3  . LYS A 1 21 ? -8.886  -3.031  -8.942  1.00 0.00 ? 21  LYS A HB3  5  
ATOM   4352  H  HG2  . LYS A 1 21 ? -11.048 -1.035  -8.572  1.00 0.00 ? 21  LYS A HG2  5  
ATOM   4353  H  HG3  . LYS A 1 21 ? -10.890 -1.803  -10.153 1.00 0.00 ? 21  LYS A HG3  5  
ATOM   4354  H  HD2  . LYS A 1 21 ? -12.240 -3.348  -9.184  1.00 0.00 ? 21  LYS A HD2  5  
ATOM   4355  H  HD3  . LYS A 1 21 ? -10.696 -3.975  -8.602  1.00 0.00 ? 21  LYS A HD3  5  
ATOM   4356  H  HE2  . LYS A 1 21 ? -10.979 -2.796  -6.503  1.00 0.00 ? 21  LYS A HE2  5  
ATOM   4357  H  HE3  . LYS A 1 21 ? -12.472 -2.064  -7.087  1.00 0.00 ? 21  LYS A HE3  5  
ATOM   4358  H  HZ1  . LYS A 1 21 ? -12.046 -4.646  -5.940  1.00 0.00 ? 21  LYS A HZ1  5  
ATOM   4359  H  HZ2  . LYS A 1 21 ? -12.857 -4.745  -7.420  1.00 0.00 ? 21  LYS A HZ2  5  
ATOM   4360  H  HZ3  . LYS A 1 21 ? -13.491 -3.797  -6.171  1.00 0.00 ? 21  LYS A HZ3  5  
ATOM   4361  N  N    . ALA A 1 22 ? -7.087  -2.518  -6.151  1.00 0.00 ? 22  ALA A N    5  
ATOM   4362  C  CA   . ALA A 1 22 ? -5.777  -3.022  -5.757  1.00 0.00 ? 22  ALA A CA   5  
ATOM   4363  C  C    . ALA A 1 22 ? -5.908  -4.210  -4.810  1.00 0.00 ? 22  ALA A C    5  
ATOM   4364  O  O    . ALA A 1 22 ? -6.989  -4.484  -4.290  1.00 0.00 ? 22  ALA A O    5  
ATOM   4365  C  CB   . ALA A 1 22 ? -4.959  -1.916  -5.108  1.00 0.00 ? 22  ALA A CB   5  
ATOM   4366  H  H    . ALA A 1 22 ? -7.854  -2.668  -5.560  1.00 0.00 ? 22  ALA A H    5  
ATOM   4367  H  HA   . ALA A 1 22 ? -5.260  -3.342  -6.650  1.00 0.00 ? 22  ALA A HA   5  
ATOM   4368  H  HB1  . ALA A 1 22 ? -4.297  -1.480  -5.843  1.00 0.00 ? 22  ALA A HB1  5  
ATOM   4369  H  HB2  . ALA A 1 22 ? -5.622  -1.155  -4.725  1.00 0.00 ? 22  ALA A HB2  5  
ATOM   4370  H  HB3  . ALA A 1 22 ? -4.376  -2.327  -4.298  1.00 0.00 ? 22  ALA A HB3  5  
ATOM   4371  N  N    . MET A 1 23 ? -4.801  -4.913  -4.593  1.00 0.00 ? 23  MET A N    5  
ATOM   4372  C  CA   . MET A 1 23 ? -4.794  -6.072  -3.708  1.00 0.00 ? 23  MET A CA   5  
ATOM   4373  C  C    . MET A 1 23 ? -6.074  -6.886  -3.867  1.00 0.00 ? 23  MET A C    5  
ATOM   4374  O  O    . MET A 1 23 ? -6.560  -7.489  -2.911  1.00 0.00 ? 23  MET A O    5  
ATOM   4375  C  CB   . MET A 1 23 ? -4.635  -5.628  -2.252  1.00 0.00 ? 23  MET A CB   5  
ATOM   4376  C  CG   . MET A 1 23 ? -3.421  -4.745  -2.015  1.00 0.00 ? 23  MET A CG   5  
ATOM   4377  S  SD   . MET A 1 23 ? -2.958  -4.654  -0.275  1.00 0.00 ? 23  MET A SD   5  
ATOM   4378  C  CE   . MET A 1 23 ? -1.467  -5.646  -0.269  1.00 0.00 ? 23  MET A CE   5  
ATOM   4379  H  H    . MET A 1 23 ? -3.970  -4.645  -5.037  1.00 0.00 ? 23  MET A H    5  
ATOM   4380  H  HA   . MET A 1 23 ? -3.952  -6.690  -3.980  1.00 0.00 ? 23  MET A HA   5  
ATOM   4381  H  HB2  . MET A 1 23 ? -5.517  -5.078  -1.958  1.00 0.00 ? 23  MET A HB2  5  
ATOM   4382  H  HB3  . MET A 1 23 ? -4.542  -6.505  -1.629  1.00 0.00 ? 23  MET A HB3  5  
ATOM   4383  H  HG2  . MET A 1 23 ? -2.588  -5.143  -2.574  1.00 0.00 ? 23  MET A HG2  5  
ATOM   4384  H  HG3  . MET A 1 23 ? -3.644  -3.748  -2.367  1.00 0.00 ? 23  MET A HG3  5  
ATOM   4385  H  HE1  . MET A 1 23 ? -1.604  -6.506  -0.909  1.00 0.00 ? 23  MET A HE1  5  
ATOM   4386  H  HE2  . MET A 1 23 ? -0.640  -5.055  -0.633  1.00 0.00 ? 23  MET A HE2  5  
ATOM   4387  H  HE3  . MET A 1 23 ? -1.259  -5.977  0.738   1.00 0.00 ? 23  MET A HE3  5  
ATOM   4388  N  N    . ASN A 1 24 ? -6.616  -6.897  -5.081  1.00 0.00 ? 24  ASN A N    5  
ATOM   4389  C  CA   . ASN A 1 24 ? -7.841  -7.636  -5.364  1.00 0.00 ? 24  ASN A CA   5  
ATOM   4390  C  C    . ASN A 1 24 ? -9.005  -7.096  -4.540  1.00 0.00 ? 24  ASN A C    5  
ATOM   4391  O  O    . ASN A 1 24 ? -9.776  -7.859  -3.961  1.00 0.00 ? 24  ASN A O    5  
ATOM   4392  C  CB   . ASN A 1 24 ? -7.642  -9.125  -5.071  1.00 0.00 ? 24  ASN A CB   5  
ATOM   4393  C  CG   . ASN A 1 24 ? -6.808  -9.817  -6.132  1.00 0.00 ? 24  ASN A CG   5  
ATOM   4394  O  OD1  . ASN A 1 24 ? -5.599  -9.606  -6.223  1.00 0.00 ? 24  ASN A OD1  5  
ATOM   4395  N  ND2  . ASN A 1 24 ? -7.454  -10.648 -6.942  1.00 0.00 ? 24  ASN A ND2  5  
ATOM   4396  H  H    . ASN A 1 24 ? -6.182  -6.397  -5.803  1.00 0.00 ? 24  ASN A H    5  
ATOM   4397  H  HA   . ASN A 1 24 ? -8.068  -7.512  -6.412  1.00 0.00 ? 24  ASN A HA   5  
ATOM   4398  H  HB2  . ASN A 1 24 ? -7.141  -9.235  -4.120  1.00 0.00 ? 24  ASN A HB2  5  
ATOM   4399  H  HB3  . ASN A 1 24 ? -8.606  -9.609  -5.024  1.00 0.00 ? 24  ASN A HB3  5  
ATOM   4400  H  HD21 . ASN A 1 24 ? -8.418  -10.767 -6.812  1.00 0.00 ? 24  ASN A HD21 5  
ATOM   4401  H  HD22 . ASN A 1 24 ? -6.939  -11.109 -7.637  1.00 0.00 ? 24  ASN A HD22 5  
ATOM   4402  N  N    . ASN A 1 25 ? -9.126  -5.773  -4.494  1.00 0.00 ? 25  ASN A N    5  
ATOM   4403  C  CA   . ASN A 1 25 ? -10.197 -5.129  -3.741  1.00 0.00 ? 25  ASN A CA   5  
ATOM   4404  C  C    . ASN A 1 25 ? -10.280 -3.643  -4.076  1.00 0.00 ? 25  ASN A C    5  
ATOM   4405  O  O    . ASN A 1 25 ? -9.341  -3.067  -4.626  1.00 0.00 ? 25  ASN A O    5  
ATOM   4406  C  CB   . ASN A 1 25 ? -9.974  -5.313  -2.239  1.00 0.00 ? 25  ASN A CB   5  
ATOM   4407  C  CG   . ASN A 1 25 ? -10.403 -6.685  -1.754  1.00 0.00 ? 25  ASN A CG   5  
ATOM   4408  O  OD1  . ASN A 1 25 ? -11.554 -7.085  -1.929  1.00 0.00 ? 25  ASN A OD1  5  
ATOM   4409  N  ND2  . ASN A 1 25 ? -9.477  -7.412  -1.141  1.00 0.00 ? 25  ASN A ND2  5  
ATOM   4410  H  H    . ASN A 1 25 ? -8.480  -5.216  -4.977  1.00 0.00 ? 25  ASN A H    5  
ATOM   4411  H  HA   . ASN A 1 25 ? -11.127 -5.602  -4.019  1.00 0.00 ? 25  ASN A HA   5  
ATOM   4412  H  HB2  . ASN A 1 25 ? -8.924  -5.188  -2.019  1.00 0.00 ? 25  ASN A HB2  5  
ATOM   4413  H  HB3  . ASN A 1 25 ? -10.542 -4.568  -1.702  1.00 0.00 ? 25  ASN A HB3  5  
ATOM   4414  H  HD21 . ASN A 1 25 ? -8.581  -7.029  -1.037  1.00 0.00 ? 25  ASN A HD21 5  
ATOM   4415  H  HD22 . ASN A 1 25 ? -9.727  -8.303  -0.819  1.00 0.00 ? 25  ASN A HD22 5  
ATOM   4416  N  N    . SER A 1 26 ? -11.410 -3.029  -3.740  1.00 0.00 ? 26  SER A N    5  
ATOM   4417  C  CA   . SER A 1 26 ? -11.617 -1.610  -4.008  1.00 0.00 ? 26  SER A CA   5  
ATOM   4418  C  C    . SER A 1 26 ? -11.127 -0.760  -2.840  1.00 0.00 ? 26  SER A C    5  
ATOM   4419  O  O    . SER A 1 26 ? -11.214 -1.167  -1.682  1.00 0.00 ? 26  SER A O    5  
ATOM   4420  C  CB   . SER A 1 26 ? -13.098 -1.330  -4.271  1.00 0.00 ? 26  SER A CB   5  
ATOM   4421  O  OG   . SER A 1 26 ? -13.911 -1.884  -3.250  1.00 0.00 ? 26  SER A OG   5  
ATOM   4422  H  H    . SER A 1 26 ? -12.121 -3.542  -3.304  1.00 0.00 ? 26  SER A H    5  
ATOM   4423  H  HA   . SER A 1 26 ? -11.049 -1.353  -4.889  1.00 0.00 ? 26  SER A HA   5  
ATOM   4424  H  HB2  . SER A 1 26 ? -13.260 -0.264  -4.304  1.00 0.00 ? 26  SER A HB2  5  
ATOM   4425  H  HB3  . SER A 1 26 ? -13.381 -1.767  -5.217  1.00 0.00 ? 26  SER A HB3  5  
ATOM   4426  H  HG   . SER A 1 26 ? -14.472 -1.199  -2.881  1.00 0.00 ? 26  SER A HG   5  
ATOM   4427  N  N    . TRP A 1 27 ? -10.611 0.423   -3.154  1.00 0.00 ? 27  TRP A N    5  
ATOM   4428  C  CA   . TRP A 1 27 ? -10.106 1.332   -2.131  1.00 0.00 ? 27  TRP A CA   5  
ATOM   4429  C  C    . TRP A 1 27 ? -10.283 2.785   -2.559  1.00 0.00 ? 27  TRP A C    5  
ATOM   4430  O  O    . TRP A 1 27 ? -10.667 3.066   -3.695  1.00 0.00 ? 27  TRP A O    5  
ATOM   4431  C  CB   . TRP A 1 27 ? -8.630  1.047   -1.849  1.00 0.00 ? 27  TRP A CB   5  
ATOM   4432  C  CG   . TRP A 1 27 ? -8.309  -0.416  -1.790  1.00 0.00 ? 27  TRP A CG   5  
ATOM   4433  C  CD1  . TRP A 1 27 ? -8.499  -1.338  -2.779  1.00 0.00 ? 27  TRP A CD1  5  
ATOM   4434  C  CD2  . TRP A 1 27 ? -7.743  -1.125  -0.682  1.00 0.00 ? 27  TRP A CD2  5  
ATOM   4435  N  NE1  . TRP A 1 27 ? -8.086  -2.577  -2.353  1.00 0.00 ? 27  TRP A NE1  5  
ATOM   4436  C  CE2  . TRP A 1 27 ? -7.617  -2.473  -1.070  1.00 0.00 ? 27  TRP A CE2  5  
ATOM   4437  C  CE3  . TRP A 1 27 ? -7.329  -0.752  0.600   1.00 0.00 ? 27  TRP A CE3  5  
ATOM   4438  C  CZ2  . TRP A 1 27 ? -7.095  -3.446  -0.222  1.00 0.00 ? 27  TRP A CZ2  5  
ATOM   4439  C  CZ3  . TRP A 1 27 ? -6.812  -1.719  1.441   1.00 0.00 ? 27  TRP A CZ3  5  
ATOM   4440  C  CH2  . TRP A 1 27 ? -6.698  -3.053  1.027   1.00 0.00 ? 27  TRP A CH2  5  
ATOM   4441  H  H    . TRP A 1 27 ? -10.568 0.692   -4.096  1.00 0.00 ? 27  TRP A H    5  
ATOM   4442  H  HA   . TRP A 1 27 ? -10.675 1.163   -1.229  1.00 0.00 ? 27  TRP A HA   5  
ATOM   4443  H  HB2  . TRP A 1 27 ? -8.029  1.488   -2.630  1.00 0.00 ? 27  TRP A HB2  5  
ATOM   4444  H  HB3  . TRP A 1 27 ? -8.361  1.487   -0.900  1.00 0.00 ? 27  TRP A HB3  5  
ATOM   4445  H  HD1  . TRP A 1 27 ? -8.916  -1.112  -3.749  1.00 0.00 ? 27  TRP A HD1  5  
ATOM   4446  H  HE1  . TRP A 1 27 ? -8.119  -3.401  -2.883  1.00 0.00 ? 27  TRP A HE1  5  
ATOM   4447  H  HE3  . TRP A 1 27 ? -7.409  0.271   0.937   1.00 0.00 ? 27  TRP A HE3  5  
ATOM   4448  H  HZ2  . TRP A 1 27 ? -7.000  -4.478  -0.526  1.00 0.00 ? 27  TRP A HZ2  5  
ATOM   4449  H  HZ3  . TRP A 1 27 ? -6.487  -1.449  2.435   1.00 0.00 ? 27  TRP A HZ3  5  
ATOM   4450  H  HH2  . TRP A 1 27 ? -6.289  -3.774  1.717   1.00 0.00 ? 27  TRP A HH2  5  
ATOM   4451  N  N    . HIS A 1 28 ? -10.000 3.706   -1.643  1.00 0.00 ? 28  HIS A N    5  
ATOM   4452  C  CA   . HIS A 1 28 ? -10.128 5.131   -1.926  1.00 0.00 ? 28  HIS A CA   5  
ATOM   4453  C  C    . HIS A 1 28 ? -8.825  5.692   -2.489  1.00 0.00 ? 28  HIS A C    5  
ATOM   4454  O  O    . HIS A 1 28 ? -7.745  5.132   -2.295  1.00 0.00 ? 28  HIS A O    5  
ATOM   4455  C  CB   . HIS A 1 28 ? -10.519 5.892   -0.659  1.00 0.00 ? 28  HIS A CB   5  
ATOM   4456  C  CG   . HIS A 1 28 ? -11.961 5.733   -0.287  1.00 0.00 ? 28  HIS A CG   5  
ATOM   4457  N  ND1  . HIS A 1 28 ? -12.373 5.177   0.906   1.00 0.00 ? 28  HIS A ND1  5  
ATOM   4458  C  CD2  . HIS A 1 28 ? -13.090 6.063   -0.957  1.00 0.00 ? 28  HIS A CD2  5  
ATOM   4459  C  CE1  . HIS A 1 28 ? -13.694 5.170   0.952   1.00 0.00 ? 28  HIS A CE1  5  
ATOM   4460  N  NE2  . HIS A 1 28 ? -14.153 5.703   -0.166  1.00 0.00 ? 28  HIS A NE2  5  
ATOM   4461  H  H    . HIS A 1 28 ? -9.699  3.420   -0.755  1.00 0.00 ? 28  HIS A H    5  
ATOM   4462  H  HA   . HIS A 1 28 ? -10.906 5.254   -2.664  1.00 0.00 ? 28  HIS A HA   5  
ATOM   4463  H  HB2  . HIS A 1 28 ? -9.922  5.534   0.166   1.00 0.00 ? 28  HIS A HB2  5  
ATOM   4464  H  HB3  . HIS A 1 28 ? -10.327 6.945   -0.806  1.00 0.00 ? 28  HIS A HB3  5  
ATOM   4465  H  HD2  . HIS A 1 28 ? -13.145 6.523   -1.934  1.00 0.00 ? 28  HIS A HD2  5  
ATOM   4466  H  HE1  . HIS A 1 28 ? -14.296 4.794   1.766   1.00 0.00 ? 28  HIS A HE1  5  
ATOM   4467  H  HE2  . HIS A 1 28 ? -15.097 5.741   -0.426  1.00 0.00 ? 28  HIS A HE2  5  
ATOM   4468  N  N    . PRO A 1 29 ? -8.926  6.823   -3.202  1.00 0.00 ? 29  PRO A N    5  
ATOM   4469  C  CA   . PRO A 1 29 ? -7.765  7.483   -3.807  1.00 0.00 ? 29  PRO A CA   5  
ATOM   4470  C  C    . PRO A 1 29 ? -6.845  8.108   -2.764  1.00 0.00 ? 29  PRO A C    5  
ATOM   4471  O  O    . PRO A 1 29 ? -5.813  8.687   -3.102  1.00 0.00 ? 29  PRO A O    5  
ATOM   4472  C  CB   . PRO A 1 29 ? -8.393  8.569   -4.685  1.00 0.00 ? 29  PRO A CB   5  
ATOM   4473  C  CG   . PRO A 1 29 ? -9.713  8.850   -4.054  1.00 0.00 ? 29  PRO A CG   5  
ATOM   4474  C  CD   . PRO A 1 29 ? -10.180 7.544   -3.473  1.00 0.00 ? 29  PRO A CD   5  
ATOM   4475  H  HA   . PRO A 1 29 ? -7.198  6.802   -4.424  1.00 0.00 ? 29  PRO A HA   5  
ATOM   4476  H  HB2  . PRO A 1 29 ? -7.760  9.445   -4.686  1.00 0.00 ? 29  PRO A HB2  5  
ATOM   4477  H  HB3  . PRO A 1 29 ? -8.508  8.200   -5.693  1.00 0.00 ? 29  PRO A HB3  5  
ATOM   4478  H  HG2  . PRO A 1 29 ? -9.598  9.588   -3.275  1.00 0.00 ? 29  PRO A HG2  5  
ATOM   4479  H  HG3  . PRO A 1 29 ? -10.410 9.198   -4.802  1.00 0.00 ? 29  PRO A HG3  5  
ATOM   4480  H  HD2  . PRO A 1 29 ? -10.732 7.714   -2.560  1.00 0.00 ? 29  PRO A HD2  5  
ATOM   4481  H  HD3  . PRO A 1 29 ? -10.786 7.008   -4.189  1.00 0.00 ? 29  PRO A HD3  5  
ATOM   4482  N  N    . GLU A 1 30 ? -7.225  7.984   -1.496  1.00 0.00 ? 30  GLU A N    5  
ATOM   4483  C  CA   . GLU A 1 30 ? -6.432  8.538   -0.404  1.00 0.00 ? 30  GLU A CA   5  
ATOM   4484  C  C    . GLU A 1 30 ? -6.075  7.456   0.612   1.00 0.00 ? 30  GLU A C    5  
ATOM   4485  O  O    . GLU A 1 30 ? -5.042  7.530   1.276   1.00 0.00 ? 30  GLU A O    5  
ATOM   4486  C  CB   . GLU A 1 30 ? -7.195  9.670   0.286   1.00 0.00 ? 30  GLU A CB   5  
ATOM   4487  C  CG   . GLU A 1 30 ? -8.436  9.204   1.028   1.00 0.00 ? 30  GLU A CG   5  
ATOM   4488  C  CD   . GLU A 1 30 ? -9.071  10.307  1.853   1.00 0.00 ? 30  GLU A CD   5  
ATOM   4489  O  OE1  . GLU A 1 30 ? -8.696  10.453  3.035   1.00 0.00 ? 30  GLU A OE1  5  
ATOM   4490  O  OE2  . GLU A 1 30 ? -9.943  11.022  1.317   1.00 0.00 ? 30  GLU A OE2  5  
ATOM   4491  H  H    . GLU A 1 30 ? -8.058  7.511   -1.290  1.00 0.00 ? 30  GLU A H    5  
ATOM   4492  H  HA   . GLU A 1 30 ? -5.520  8.934   -0.825  1.00 0.00 ? 30  GLU A HA   5  
ATOM   4493  H  HB2  . GLU A 1 30 ? -6.536  10.152  0.994   1.00 0.00 ? 30  GLU A HB2  5  
ATOM   4494  H  HB3  . GLU A 1 30 ? -7.496  10.391  -0.459  1.00 0.00 ? 30  GLU A HB3  5  
ATOM   4495  H  HG2  . GLU A 1 30 ? -9.159  8.852   0.308   1.00 0.00 ? 30  GLU A HG2  5  
ATOM   4496  H  HG3  . GLU A 1 30 ? -8.162  8.393   1.688   1.00 0.00 ? 30  GLU A HG3  5  
ATOM   4497  N  N    . CYS A 1 31 ? -6.939  6.453   0.727   1.00 0.00 ? 31  CYS A N    5  
ATOM   4498  C  CA   . CYS A 1 31 ? -6.718  5.356   1.661   1.00 0.00 ? 31  CYS A CA   5  
ATOM   4499  C  C    . CYS A 1 31 ? -5.540  4.493   1.218   1.00 0.00 ? 31  CYS A C    5  
ATOM   4500  O  O    . CYS A 1 31 ? -4.539  4.380   1.925   1.00 0.00 ? 31  CYS A O    5  
ATOM   4501  C  CB   . CYS A 1 31 ? -7.979  4.497   1.779   1.00 0.00 ? 31  CYS A CB   5  
ATOM   4502  S  SG   . CYS A 1 31 ? -9.250  5.190   2.885   1.00 0.00 ? 31  CYS A SG   5  
ATOM   4503  H  H    . CYS A 1 31 ? -7.746  6.450   0.169   1.00 0.00 ? 31  CYS A H    5  
ATOM   4504  H  HA   . CYS A 1 31 ? -6.492  5.783   2.627   1.00 0.00 ? 31  CYS A HA   5  
ATOM   4505  H  HB2  . CYS A 1 31 ? -8.422  4.385   0.800   1.00 0.00 ? 31  CYS A HB2  5  
ATOM   4506  H  HB3  . CYS A 1 31 ? -7.707  3.523   2.159   1.00 0.00 ? 31  CYS A HB3  5  
ATOM   4507  N  N    . PHE A 1 32 ? -5.669  3.885   0.043   1.00 0.00 ? 32  PHE A N    5  
ATOM   4508  C  CA   . PHE A 1 32 ? -4.616  3.031   -0.495  1.00 0.00 ? 32  PHE A CA   5  
ATOM   4509  C  C    . PHE A 1 32 ? -3.256  3.717   -0.396  1.00 0.00 ? 32  PHE A C    5  
ATOM   4510  O  O    . PHE A 1 32 ? -2.839  4.427   -1.311  1.00 0.00 ? 32  PHE A O    5  
ATOM   4511  C  CB   . PHE A 1 32 ? -4.915  2.674   -1.952  1.00 0.00 ? 32  PHE A CB   5  
ATOM   4512  C  CG   . PHE A 1 32 ? -4.165  1.468   -2.440  1.00 0.00 ? 32  PHE A CG   5  
ATOM   4513  C  CD1  . PHE A 1 32 ? -4.331  0.237   -1.825  1.00 0.00 ? 32  PHE A CD1  5  
ATOM   4514  C  CD2  . PHE A 1 32 ? -3.293  1.564   -3.512  1.00 0.00 ? 32  PHE A CD2  5  
ATOM   4515  C  CE1  . PHE A 1 32 ? -3.641  -0.874  -2.271  1.00 0.00 ? 32  PHE A CE1  5  
ATOM   4516  C  CE2  . PHE A 1 32 ? -2.601  0.456   -3.963  1.00 0.00 ? 32  PHE A CE2  5  
ATOM   4517  C  CZ   . PHE A 1 32 ? -2.776  -0.765  -3.342  1.00 0.00 ? 32  PHE A CZ   5  
ATOM   4518  H  H    . PHE A 1 32 ? -6.491  4.014   -0.474  1.00 0.00 ? 32  PHE A H    5  
ATOM   4519  H  HA   . PHE A 1 32 ? -4.593  2.126   0.092   1.00 0.00 ? 32  PHE A HA   5  
ATOM   4520  H  HB2  . PHE A 1 32 ? -5.970  2.472   -2.056  1.00 0.00 ? 32  PHE A HB2  5  
ATOM   4521  H  HB3  . PHE A 1 32 ? -4.649  3.509   -2.582  1.00 0.00 ? 32  PHE A HB3  5  
ATOM   4522  H  HD1  . PHE A 1 32 ? -5.008  0.149   -0.988  1.00 0.00 ? 32  PHE A HD1  5  
ATOM   4523  H  HD2  . PHE A 1 32 ? -3.156  2.520   -3.999  1.00 0.00 ? 32  PHE A HD2  5  
ATOM   4524  H  HE1  . PHE A 1 32 ? -3.780  -1.828  -1.784  1.00 0.00 ? 32  PHE A HE1  5  
ATOM   4525  H  HE2  . PHE A 1 32 ? -1.925  0.546   -4.801  1.00 0.00 ? 32  PHE A HE2  5  
ATOM   4526  H  HZ   . PHE A 1 32 ? -2.235  -1.631  -3.692  1.00 0.00 ? 32  PHE A HZ   5  
ATOM   4527  N  N    . ARG A 1 33 ? -2.571  3.499   0.721   1.00 0.00 ? 33  ARG A N    5  
ATOM   4528  C  CA   . ARG A 1 33 ? -1.259  4.096   0.941   1.00 0.00 ? 33  ARG A CA   5  
ATOM   4529  C  C    . ARG A 1 33 ? -0.203  3.020   1.174   1.00 0.00 ? 33  ARG A C    5  
ATOM   4530  O  O    . ARG A 1 33 ? -0.529  1.857   1.417   1.00 0.00 ? 33  ARG A O    5  
ATOM   4531  C  CB   . ARG A 1 33 ? -1.303  5.049   2.137   1.00 0.00 ? 33  ARG A CB   5  
ATOM   4532  C  CG   . ARG A 1 33 ? -2.107  6.314   1.880   1.00 0.00 ? 33  ARG A CG   5  
ATOM   4533  C  CD   . ARG A 1 33 ? -1.767  7.404   2.884   1.00 0.00 ? 33  ARG A CD   5  
ATOM   4534  N  NE   . ARG A 1 33 ? -1.945  8.740   2.322   1.00 0.00 ? 33  ARG A NE   5  
ATOM   4535  C  CZ   . ARG A 1 33 ? -3.066  9.443   2.438   1.00 0.00 ? 33  ARG A CZ   5  
ATOM   4536  N  NH1  . ARG A 1 33 ? -4.103  8.939   3.092   1.00 0.00 ? 33  ARG A NH1  5  
ATOM   4537  N  NH2  . ARG A 1 33 ? -3.151  10.653  1.899   1.00 0.00 ? 33  ARG A NH2  5  
ATOM   4538  H  H    . ARG A 1 33 ? -2.956  2.924   1.415   1.00 0.00 ? 33  ARG A H    5  
ATOM   4539  H  HA   . ARG A 1 33 ? -0.996  4.656   0.056   1.00 0.00 ? 33  ARG A HA   5  
ATOM   4540  H  HB2  . ARG A 1 33 ? -1.745  4.534   2.978   1.00 0.00 ? 33  ARG A HB2  5  
ATOM   4541  H  HB3  . ARG A 1 33 ? -0.294  5.336   2.391   1.00 0.00 ? 33  ARG A HB3  5  
ATOM   4542  H  HG2  . ARG A 1 33 ? -1.885  6.674   0.886   1.00 0.00 ? 33  ARG A HG2  5  
ATOM   4543  H  HG3  . ARG A 1 33 ? -3.158  6.082   1.954   1.00 0.00 ? 33  ARG A HG3  5  
ATOM   4544  H  HD2  . ARG A 1 33 ? -2.412  7.297   3.743   1.00 0.00 ? 33  ARG A HD2  5  
ATOM   4545  H  HD3  . ARG A 1 33 ? -0.738  7.285   3.189   1.00 0.00 ? 33  ARG A HD3  5  
ATOM   4546  H  HE   . ARG A 1 33 ? -1.190  9.131   1.835   1.00 0.00 ? 33  ARG A HE   5  
ATOM   4547  H  HH11 . ARG A 1 33 ? -4.042  8.029   3.500   1.00 0.00 ? 33  ARG A HH11 5  
ATOM   4548  H  HH12 . ARG A 1 33 ? -4.946  9.471   3.179   1.00 0.00 ? 33  ARG A HH12 5  
ATOM   4549  H  HH21 . ARG A 1 33 ? -2.370  11.036  1.405   1.00 0.00 ? 33  ARG A HH21 5  
ATOM   4550  H  HH22 . ARG A 1 33 ? -3.995  11.181  1.987   1.00 0.00 ? 33  ARG A HH22 5  
ATOM   4551  N  N    . CYS A 1 34 ? 1.064   3.414   1.097   1.00 0.00 ? 34  CYS A N    5  
ATOM   4552  C  CA   . CYS A 1 34 ? 2.168   2.484   1.298   1.00 0.00 ? 34  CYS A CA   5  
ATOM   4553  C  C    . CYS A 1 34 ? 2.125   1.883   2.700   1.00 0.00 ? 34  CYS A C    5  
ATOM   4554  O  O    . CYS A 1 34 ? 1.551   2.467   3.620   1.00 0.00 ? 34  CYS A O    5  
ATOM   4555  C  CB   . CYS A 1 34 ? 3.506   3.192   1.075   1.00 0.00 ? 34  CYS A CB   5  
ATOM   4556  S  SG   . CYS A 1 34 ? 4.930   2.065   0.937   1.00 0.00 ? 34  CYS A SG   5  
ATOM   4557  H  H    . CYS A 1 34 ? 1.261   4.354   0.900   1.00 0.00 ? 34  CYS A H    5  
ATOM   4558  H  HA   . CYS A 1 34 ? 2.067   1.688   0.576   1.00 0.00 ? 34  CYS A HA   5  
ATOM   4559  H  HB2  . CYS A 1 34 ? 3.452   3.766   0.162   1.00 0.00 ? 34  CYS A HB2  5  
ATOM   4560  H  HB3  . CYS A 1 34 ? 3.693   3.859   1.903   1.00 0.00 ? 34  CYS A HB3  5  
ATOM   4561  N  N    . ASP A 1 35 ? 2.737   0.715   2.856   1.00 0.00 ? 35  ASP A N    5  
ATOM   4562  C  CA   . ASP A 1 35 ? 2.771   0.035   4.146   1.00 0.00 ? 35  ASP A CA   5  
ATOM   4563  C  C    . ASP A 1 35 ? 4.102   0.274   4.852   1.00 0.00 ? 35  ASP A C    5  
ATOM   4564  O  O    . ASP A 1 35 ? 4.421   -0.389  5.840   1.00 0.00 ? 35  ASP A O    5  
ATOM   4565  C  CB   . ASP A 1 35 ? 2.539   -1.465  3.962   1.00 0.00 ? 35  ASP A CB   5  
ATOM   4566  C  CG   . ASP A 1 35 ? 1.856   -2.097  5.159   1.00 0.00 ? 35  ASP A CG   5  
ATOM   4567  O  OD1  . ASP A 1 35 ? 2.286   -1.824  6.299   1.00 0.00 ? 35  ASP A OD1  5  
ATOM   4568  O  OD2  . ASP A 1 35 ? 0.892   -2.864  4.956   1.00 0.00 ? 35  ASP A OD2  5  
ATOM   4569  H  H    . ASP A 1 35 ? 3.178   0.299   2.085   1.00 0.00 ? 35  ASP A H    5  
ATOM   4570  H  HA   . ASP A 1 35 ? 1.977   0.440   4.755   1.00 0.00 ? 35  ASP A HA   5  
ATOM   4571  H  HB2  . ASP A 1 35 ? 1.918   -1.623  3.092   1.00 0.00 ? 35  ASP A HB2  5  
ATOM   4572  H  HB3  . ASP A 1 35 ? 3.491   -1.954  3.814   1.00 0.00 ? 35  ASP A HB3  5  
ATOM   4573  N  N    . LEU A 1 36 ? 4.876   1.224   4.338   1.00 0.00 ? 36  LEU A N    5  
ATOM   4574  C  CA   . LEU A 1 36 ? 6.174   1.550   4.918   1.00 0.00 ? 36  LEU A CA   5  
ATOM   4575  C  C    . LEU A 1 36 ? 6.329   3.058   5.092   1.00 0.00 ? 36  LEU A C    5  
ATOM   4576  O  O    . LEU A 1 36 ? 6.939   3.523   6.055   1.00 0.00 ? 36  LEU A O    5  
ATOM   4577  C  CB   . LEU A 1 36 ? 7.300   1.009   4.036   1.00 0.00 ? 36  LEU A CB   5  
ATOM   4578  C  CG   . LEU A 1 36 ? 7.447   -0.513  3.994   1.00 0.00 ? 36  LEU A CG   5  
ATOM   4579  C  CD1  . LEU A 1 36 ? 8.065   -0.954  2.676   1.00 0.00 ? 36  LEU A CD1  5  
ATOM   4580  C  CD2  . LEU A 1 36 ? 8.285   -1.000  5.167   1.00 0.00 ? 36  LEU A CD2  5  
ATOM   4581  H  H    . LEU A 1 36 ? 4.568   1.718   3.550   1.00 0.00 ? 36  LEU A H    5  
ATOM   4582  H  HA   . LEU A 1 36 ? 6.230   1.081   5.889   1.00 0.00 ? 36  LEU A HA   5  
ATOM   4583  H  HB2  . LEU A 1 36 ? 7.124   1.351   3.028   1.00 0.00 ? 36  LEU A HB2  5  
ATOM   4584  H  HB3  . LEU A 1 36 ? 8.231   1.422   4.397   1.00 0.00 ? 36  LEU A HB3  5  
ATOM   4585  H  HG   . LEU A 1 36 ? 6.468   -0.965  4.071   1.00 0.00 ? 36  LEU A HG   5  
ATOM   4586  H  HD11 . LEU A 1 36 ? 7.909   -2.013  2.542   1.00 0.00 ? 36  LEU A HD11 5  
ATOM   4587  H  HD12 . LEU A 1 36 ? 9.124   -0.744  2.687   1.00 0.00 ? 36  LEU A HD12 5  
ATOM   4588  H  HD13 . LEU A 1 36 ? 7.600   -0.415  1.863   1.00 0.00 ? 36  LEU A HD13 5  
ATOM   4589  H  HD21 . LEU A 1 36 ? 8.342   -2.078  5.145   1.00 0.00 ? 36  LEU A HD21 5  
ATOM   4590  H  HD22 . LEU A 1 36 ? 7.827   -0.683  6.093   1.00 0.00 ? 36  LEU A HD22 5  
ATOM   4591  H  HD23 . LEU A 1 36 ? 9.279   -0.585  5.096   1.00 0.00 ? 36  LEU A HD23 5  
ATOM   4592  N  N    . CYS A 1 37 ? 5.772   3.817   4.154   1.00 0.00 ? 37  CYS A N    5  
ATOM   4593  C  CA   . CYS A 1 37 ? 5.846   5.272   4.204   1.00 0.00 ? 37  CYS A CA   5  
ATOM   4594  C  C    . CYS A 1 37 ? 4.451   5.889   4.172   1.00 0.00 ? 37  CYS A C    5  
ATOM   4595  O  O    . CYS A 1 37 ? 4.290   7.094   4.365   1.00 0.00 ? 37  CYS A O    5  
ATOM   4596  C  CB   . CYS A 1 37 ? 6.676   5.801   3.032   1.00 0.00 ? 37  CYS A CB   5  
ATOM   4597  S  SG   . CYS A 1 37 ? 5.904   5.551   1.401   1.00 0.00 ? 37  CYS A SG   5  
ATOM   4598  H  H    . CYS A 1 37 ? 5.298   3.387   3.410   1.00 0.00 ? 37  CYS A H    5  
ATOM   4599  H  HA   . CYS A 1 37 ? 6.328   5.549   5.129   1.00 0.00 ? 37  CYS A HA   5  
ATOM   4600  H  HB2  . CYS A 1 37 ? 6.832   6.862   3.162   1.00 0.00 ? 37  CYS A HB2  5  
ATOM   4601  H  HB3  . CYS A 1 37 ? 7.633   5.300   3.024   1.00 0.00 ? 37  CYS A HB3  5  
ATOM   4602  N  N    . GLN A 1 38 ? 3.446   5.054   3.928   1.00 0.00 ? 38  GLN A N    5  
ATOM   4603  C  CA   . GLN A 1 38 ? 2.065   5.518   3.871   1.00 0.00 ? 38  GLN A CA   5  
ATOM   4604  C  C    . GLN A 1 38 ? 1.892   6.584   2.794   1.00 0.00 ? 38  GLN A C    5  
ATOM   4605  O  O    . GLN A 1 38 ? 1.416   7.685   3.069   1.00 0.00 ? 38  GLN A O    5  
ATOM   4606  C  CB   . GLN A 1 38 ? 1.635   6.075   5.230   1.00 0.00 ? 38  GLN A CB   5  
ATOM   4607  C  CG   . GLN A 1 38 ? 1.863   5.110   6.382   1.00 0.00 ? 38  GLN A CG   5  
ATOM   4608  C  CD   . GLN A 1 38 ? 0.660   4.229   6.653   1.00 0.00 ? 38  GLN A CD   5  
ATOM   4609  O  OE1  . GLN A 1 38 ? -0.316  4.663   7.267   1.00 0.00 ? 38  GLN A OE1  5  
ATOM   4610  N  NE2  . GLN A 1 38 ? 0.722   2.984   6.195   1.00 0.00 ? 38  GLN A NE2  5  
ATOM   4611  H  H    . GLN A 1 38 ? 3.637   4.105   3.783   1.00 0.00 ? 38  GLN A H    5  
ATOM   4612  H  HA   . GLN A 1 38 ? 1.441   4.672   3.626   1.00 0.00 ? 38  GLN A HA   5  
ATOM   4613  H  HB2  . GLN A 1 38 ? 2.192   6.978   5.428   1.00 0.00 ? 38  GLN A HB2  5  
ATOM   4614  H  HB3  . GLN A 1 38 ? 0.582   6.313   5.191   1.00 0.00 ? 38  GLN A HB3  5  
ATOM   4615  H  HG2  . GLN A 1 38 ? 2.706   4.478   6.144   1.00 0.00 ? 38  GLN A HG2  5  
ATOM   4616  H  HG3  . GLN A 1 38 ? 2.082   5.680   7.273   1.00 0.00 ? 38  GLN A HG3  5  
ATOM   4617  H  HE21 . GLN A 1 38 ? 1.531   2.708   5.716   1.00 0.00 ? 38  GLN A HE21 5  
ATOM   4618  H  HE22 . GLN A 1 38 ? -0.042  2.393   6.357   1.00 0.00 ? 38  GLN A HE22 5  
ATOM   4619  N  N    . GLU A 1 39 ? 2.284   6.249   1.569   1.00 0.00 ? 39  GLU A N    5  
ATOM   4620  C  CA   . GLU A 1 39 ? 2.174   7.179   0.451   1.00 0.00 ? 39  GLU A CA   5  
ATOM   4621  C  C    . GLU A 1 39 ? 1.067   6.749   -0.507  1.00 0.00 ? 39  GLU A C    5  
ATOM   4622  O  O    . GLU A 1 39 ? 1.018   5.597   -0.939  1.00 0.00 ? 39  GLU A O    5  
ATOM   4623  C  CB   . GLU A 1 39 ? 3.505   7.272   -0.298  1.00 0.00 ? 39  GLU A CB   5  
ATOM   4624  C  CG   . GLU A 1 39 ? 3.402   7.985   -1.635  1.00 0.00 ? 39  GLU A CG   5  
ATOM   4625  C  CD   . GLU A 1 39 ? 4.699   8.660   -2.037  1.00 0.00 ? 39  GLU A CD   5  
ATOM   4626  O  OE1  . GLU A 1 39 ? 5.444   9.100   -1.137  1.00 0.00 ? 39  GLU A OE1  5  
ATOM   4627  O  OE2  . GLU A 1 39 ? 4.970   8.747   -3.254  1.00 0.00 ? 39  GLU A OE2  5  
ATOM   4628  H  H    . GLU A 1 39 ? 2.657   5.356   1.413   1.00 0.00 ? 39  GLU A H    5  
ATOM   4629  H  HA   . GLU A 1 39 ? 1.928   8.151   0.852   1.00 0.00 ? 39  GLU A HA   5  
ATOM   4630  H  HB2  . GLU A 1 39 ? 4.214   7.805   0.318   1.00 0.00 ? 39  GLU A HB2  5  
ATOM   4631  H  HB3  . GLU A 1 39 ? 3.874   6.273   -0.474  1.00 0.00 ? 39  GLU A HB3  5  
ATOM   4632  H  HG2  . GLU A 1 39 ? 3.139   7.264   -2.394  1.00 0.00 ? 39  GLU A HG2  5  
ATOM   4633  H  HG3  . GLU A 1 39 ? 2.628   8.736   -1.570  1.00 0.00 ? 39  GLU A HG3  5  
ATOM   4634  N  N    . VAL A 1 40 ? 0.180   7.683   -0.836  1.00 0.00 ? 40  VAL A N    5  
ATOM   4635  C  CA   . VAL A 1 40 ? -0.926  7.402   -1.744  1.00 0.00 ? 40  VAL A CA   5  
ATOM   4636  C  C    . VAL A 1 40 ? -0.449  6.626   -2.967  1.00 0.00 ? 40  VAL A C    5  
ATOM   4637  O  O    . VAL A 1 40 ? 0.279   7.157   -3.807  1.00 0.00 ? 40  VAL A O    5  
ATOM   4638  C  CB   . VAL A 1 40 ? -1.615  8.699   -2.208  1.00 0.00 ? 40  VAL A CB   5  
ATOM   4639  C  CG1  . VAL A 1 40 ? -2.766  8.384   -3.151  1.00 0.00 ? 40  VAL A CG1  5  
ATOM   4640  C  CG2  . VAL A 1 40 ? -2.100  9.502   -1.010  1.00 0.00 ? 40  VAL A CG2  5  
ATOM   4641  H  H    . VAL A 1 40 ? 0.272   8.583   -0.460  1.00 0.00 ? 40  VAL A H    5  
ATOM   4642  H  HA   . VAL A 1 40 ? -1.651  6.804   -1.211  1.00 0.00 ? 40  VAL A HA   5  
ATOM   4643  H  HB   . VAL A 1 40 ? -0.891  9.294   -2.745  1.00 0.00 ? 40  VAL A HB   5  
ATOM   4644  H  HG11 . VAL A 1 40 ? -3.384  7.611   -2.718  1.00 0.00 ? 40  VAL A HG11 5  
ATOM   4645  H  HG12 . VAL A 1 40 ? -3.357  9.274   -3.307  1.00 0.00 ? 40  VAL A HG12 5  
ATOM   4646  H  HG13 . VAL A 1 40 ? -2.373  8.042   -4.097  1.00 0.00 ? 40  VAL A HG13 5  
ATOM   4647  H  HG21 . VAL A 1 40 ? -2.901  8.969   -0.521  1.00 0.00 ? 40  VAL A HG21 5  
ATOM   4648  H  HG22 . VAL A 1 40 ? -1.284  9.641   -0.315  1.00 0.00 ? 40  VAL A HG22 5  
ATOM   4649  H  HG23 . VAL A 1 40 ? -2.457  10.465  -1.343  1.00 0.00 ? 40  VAL A HG23 5  
ATOM   4650  N  N    . LEU A 1 41 ? -0.864  5.368   -3.061  1.00 0.00 ? 41  LEU A N    5  
ATOM   4651  C  CA   . LEU A 1 41 ? -0.480  4.518   -4.183  1.00 0.00 ? 41  LEU A CA   5  
ATOM   4652  C  C    . LEU A 1 41 ? -1.597  4.449   -5.220  1.00 0.00 ? 41  LEU A C    5  
ATOM   4653  O  O    . LEU A 1 41 ? -1.845  3.397   -5.809  1.00 0.00 ? 41  LEU A O    5  
ATOM   4654  C  CB   . LEU A 1 41 ? -0.139  3.111   -3.689  1.00 0.00 ? 41  LEU A CB   5  
ATOM   4655  C  CG   . LEU A 1 41 ? 0.406   3.014   -2.264  1.00 0.00 ? 41  LEU A CG   5  
ATOM   4656  C  CD1  . LEU A 1 41 ? 0.063   1.665   -1.652  1.00 0.00 ? 41  LEU A CD1  5  
ATOM   4657  C  CD2  . LEU A 1 41 ? 1.911   3.240   -2.252  1.00 0.00 ? 41  LEU A CD2  5  
ATOM   4658  H  H    . LEU A 1 41 ? -1.442  5.001   -2.361  1.00 0.00 ? 41  LEU A H    5  
ATOM   4659  H  HA   . LEU A 1 41 ? 0.395   4.952   -4.643  1.00 0.00 ? 41  LEU A HA   5  
ATOM   4660  H  HB2  . LEU A 1 41 ? -1.038  2.516   -3.741  1.00 0.00 ? 41  LEU A HB2  5  
ATOM   4661  H  HB3  . LEU A 1 41 ? 0.603   2.698   -4.357  1.00 0.00 ? 41  LEU A HB3  5  
ATOM   4662  H  HG   . LEU A 1 41 ? -0.053  3.782   -1.657  1.00 0.00 ? 41  LEU A HG   5  
ATOM   4663  H  HD11 . LEU A 1 41 ? -0.201  0.971   -2.436  1.00 0.00 ? 41  LEU A HD11 5  
ATOM   4664  H  HD12 . LEU A 1 41 ? -0.771  1.778   -0.975  1.00 0.00 ? 41  LEU A HD12 5  
ATOM   4665  H  HD13 . LEU A 1 41 ? 0.917   1.288   -1.109  1.00 0.00 ? 41  LEU A HD13 5  
ATOM   4666  H  HD21 . LEU A 1 41 ? 2.362   2.695   -3.067  1.00 0.00 ? 41  LEU A HD21 5  
ATOM   4667  H  HD22 . LEU A 1 41 ? 2.320   2.890   -1.315  1.00 0.00 ? 41  LEU A HD22 5  
ATOM   4668  H  HD23 . LEU A 1 41 ? 2.117   4.294   -2.365  1.00 0.00 ? 41  LEU A HD23 5  
ATOM   4669  N  N    . ALA A 1 42 ? -2.265  5.576   -5.440  1.00 0.00 ? 42  ALA A N    5  
ATOM   4670  C  CA   . ALA A 1 42 ? -3.351  5.644   -6.409  1.00 0.00 ? 42  ALA A CA   5  
ATOM   4671  C  C    . ALA A 1 42 ? -2.822  5.949   -7.807  1.00 0.00 ? 42  ALA A C    5  
ATOM   4672  O  O    . ALA A 1 42 ? -3.078  5.204   -8.753  1.00 0.00 ? 42  ALA A O    5  
ATOM   4673  C  CB   . ALA A 1 42 ? -4.369  6.694   -5.988  1.00 0.00 ? 42  ALA A CB   5  
ATOM   4674  H  H    . ALA A 1 42 ? -2.020  6.382   -4.939  1.00 0.00 ? 42  ALA A H    5  
ATOM   4675  H  HA   . ALA A 1 42 ? -3.846  4.684   -6.424  1.00 0.00 ? 42  ALA A HA   5  
ATOM   4676  H  HB1  . ALA A 1 42 ? -3.952  7.679   -6.138  1.00 0.00 ? 42  ALA A HB1  5  
ATOM   4677  H  HB2  . ALA A 1 42 ? -5.263  6.587   -6.584  1.00 0.00 ? 42  ALA A HB2  5  
ATOM   4678  H  HB3  . ALA A 1 42 ? -4.613  6.561   -4.945  1.00 0.00 ? 42  ALA A HB3  5  
ATOM   4679  N  N    . ASP A 1 43 ? -2.084  7.046   -7.929  1.00 0.00 ? 43  ASP A N    5  
ATOM   4680  C  CA   . ASP A 1 43 ? -1.518  7.449   -9.211  1.00 0.00 ? 43  ASP A CA   5  
ATOM   4681  C  C    . ASP A 1 43 ? -0.129  6.849   -9.404  1.00 0.00 ? 43  ASP A C    5  
ATOM   4682  O  O    . ASP A 1 43 ? 0.145   6.207   -10.419 1.00 0.00 ? 43  ASP A O    5  
ATOM   4683  C  CB   . ASP A 1 43 ? -1.447  8.973   -9.305  1.00 0.00 ? 43  ASP A CB   5  
ATOM   4684  C  CG   . ASP A 1 43 ? -1.546  9.470   -10.734 1.00 0.00 ? 43  ASP A CG   5  
ATOM   4685  O  OD1  . ASP A 1 43 ? -0.587  9.257   -11.504 1.00 0.00 ? 43  ASP A OD1  5  
ATOM   4686  O  OD2  . ASP A 1 43 ? -2.583  10.074  -11.082 1.00 0.00 ? 43  ASP A OD2  5  
ATOM   4687  H  H    . ASP A 1 43 ? -1.914  7.599   -7.137  1.00 0.00 ? 43  ASP A H    5  
ATOM   4688  H  HA   . ASP A 1 43 ? -2.167  7.079   -9.990  1.00 0.00 ? 43  ASP A HA   5  
ATOM   4689  H  HB2  . ASP A 1 43 ? -2.261  9.401   -8.738  1.00 0.00 ? 43  ASP A HB2  5  
ATOM   4690  H  HB3  . ASP A 1 43 ? -0.508  9.310   -8.890  1.00 0.00 ? 43  ASP A HB3  5  
ATOM   4691  N  N    . ILE A 1 44 ? 0.744   7.064   -8.426  1.00 0.00 ? 44  ILE A N    5  
ATOM   4692  C  CA   . ILE A 1 44 ? 2.105   6.545   -8.489  1.00 0.00 ? 44  ILE A CA   5  
ATOM   4693  C  C    . ILE A 1 44 ? 2.108   5.025   -8.612  1.00 0.00 ? 44  ILE A C    5  
ATOM   4694  O  O    . ILE A 1 44 ? 3.052   4.437   -9.138  1.00 0.00 ? 44  ILE A O    5  
ATOM   4695  C  CB   . ILE A 1 44 ? 2.919   6.950   -7.246  1.00 0.00 ? 44  ILE A CB   5  
ATOM   4696  C  CG1  . ILE A 1 44 ? 2.317   6.322   -5.987  1.00 0.00 ? 44  ILE A CG1  5  
ATOM   4697  C  CG2  . ILE A 1 44 ? 2.970   8.465   -7.116  1.00 0.00 ? 44  ILE A CG2  5  
ATOM   4698  C  CD1  . ILE A 1 44 ? 3.227   6.393   -4.781  1.00 0.00 ? 44  ILE A CD1  5  
ATOM   4699  H  H    . ILE A 1 44 ? 0.466   7.583   -7.643  1.00 0.00 ? 44  ILE A H    5  
ATOM   4700  H  HA   . ILE A 1 44 ? 2.582   6.968   -9.361  1.00 0.00 ? 44  ILE A HA   5  
ATOM   4701  H  HB   . ILE A 1 44 ? 3.929   6.589   -7.372  1.00 0.00 ? 44  ILE A HB   5  
ATOM   4702  H  HG12 . ILE A 1 44 ? 1.400   6.833   -5.741  1.00 0.00 ? 44  ILE A HG12 5  
ATOM   4703  H  HG13 . ILE A 1 44 ? 2.103   5.281   -6.181  1.00 0.00 ? 44  ILE A HG13 5  
ATOM   4704  H  HG21 . ILE A 1 44 ? 3.985   8.775   -6.912  1.00 0.00 ? 44  ILE A HG21 5  
ATOM   4705  H  HG22 . ILE A 1 44 ? 2.636   8.916   -8.038  1.00 0.00 ? 44  ILE A HG22 5  
ATOM   4706  H  HG23 . ILE A 1 44 ? 2.328   8.779   -6.307  1.00 0.00 ? 44  ILE A HG23 5  
ATOM   4707  H  HD11 . ILE A 1 44 ? 3.546   7.414   -4.630  1.00 0.00 ? 44  ILE A HD11 5  
ATOM   4708  H  HD12 . ILE A 1 44 ? 2.696   6.047   -3.908  1.00 0.00 ? 44  ILE A HD12 5  
ATOM   4709  H  HD13 . ILE A 1 44 ? 4.093   5.768   -4.947  1.00 0.00 ? 44  ILE A HD13 5  
ATOM   4710  N  N    . GLY A 1 45 ? 1.044   4.395   -8.125  1.00 0.00 ? 45  GLY A N    5  
ATOM   4711  C  CA   . GLY A 1 45 ? 0.943   2.949   -8.192  1.00 0.00 ? 45  GLY A CA   5  
ATOM   4712  C  C    . GLY A 1 45 ? 1.619   2.265   -7.019  1.00 0.00 ? 45  GLY A C    5  
ATOM   4713  O  O    . GLY A 1 45 ? 2.502   2.839   -6.382  1.00 0.00 ? 45  GLY A O    5  
ATOM   4714  H  H    . GLY A 1 45 ? 0.321   4.916   -7.716  1.00 0.00 ? 45  GLY A H    5  
ATOM   4715  H  HA2  . GLY A 1 45 ? -0.101  2.671   -8.204  1.00 0.00 ? 45  GLY A HA2  5  
ATOM   4716  H  HA3  . GLY A 1 45 ? 1.406   2.609   -9.106  1.00 0.00 ? 45  GLY A HA3  5  
ATOM   4717  N  N    . PHE A 1 46 ? 1.201   1.037   -6.732  1.00 0.00 ? 46  PHE A N    5  
ATOM   4718  C  CA   . PHE A 1 46 ? 1.771   0.275   -5.626  1.00 0.00 ? 46  PHE A CA   5  
ATOM   4719  C  C    . PHE A 1 46 ? 2.437   -1.001  -6.130  1.00 0.00 ? 46  PHE A C    5  
ATOM   4720  O  O    . PHE A 1 46 ? 2.380   -1.317  -7.319  1.00 0.00 ? 46  PHE A O    5  
ATOM   4721  C  CB   . PHE A 1 46 ? 0.684   -0.071  -4.605  1.00 0.00 ? 46  PHE A CB   5  
ATOM   4722  C  CG   . PHE A 1 46 ? -0.157  -1.250  -5.003  1.00 0.00 ? 46  PHE A CG   5  
ATOM   4723  C  CD1  . PHE A 1 46 ? -1.006  -1.175  -6.096  1.00 0.00 ? 46  PHE A CD1  5  
ATOM   4724  C  CD2  . PHE A 1 46 ? -0.100  -2.433  -4.284  1.00 0.00 ? 46  PHE A CD2  5  
ATOM   4725  C  CE1  . PHE A 1 46 ? -1.782  -2.258  -6.465  1.00 0.00 ? 46  PHE A CE1  5  
ATOM   4726  C  CE2  . PHE A 1 46 ? -0.873  -3.519  -4.649  1.00 0.00 ? 46  PHE A CE2  5  
ATOM   4727  C  CZ   . PHE A 1 46 ? -1.716  -3.431  -5.740  1.00 0.00 ? 46  PHE A CZ   5  
ATOM   4728  H  H    . PHE A 1 46 ? 0.493   0.633   -7.276  1.00 0.00 ? 46  PHE A H    5  
ATOM   4729  H  HA   . PHE A 1 46 ? 2.517   0.892   -5.149  1.00 0.00 ? 46  PHE A HA   5  
ATOM   4730  H  HB2  . PHE A 1 46 ? 1.150   -0.301  -3.659  1.00 0.00 ? 46  PHE A HB2  5  
ATOM   4731  H  HB3  . PHE A 1 46 ? 0.031   0.779   -4.484  1.00 0.00 ? 46  PHE A HB3  5  
ATOM   4732  H  HD1  . PHE A 1 46 ? -1.059  -0.256  -6.664  1.00 0.00 ? 46  PHE A HD1  5  
ATOM   4733  H  HD2  . PHE A 1 46 ? 0.558   -2.504  -3.431  1.00 0.00 ? 46  PHE A HD2  5  
ATOM   4734  H  HE1  . PHE A 1 46 ? -2.440  -2.185  -7.318  1.00 0.00 ? 46  PHE A HE1  5  
ATOM   4735  H  HE2  . PHE A 1 46 ? -0.820  -4.436  -4.080  1.00 0.00 ? 46  PHE A HE2  5  
ATOM   4736  H  HZ   . PHE A 1 46 ? -2.320  -4.279  -6.027  1.00 0.00 ? 46  PHE A HZ   5  
ATOM   4737  N  N    . VAL A 1 47 ? 3.069   -1.732  -5.218  1.00 0.00 ? 47  VAL A N    5  
ATOM   4738  C  CA   . VAL A 1 47 ? 3.746   -2.975  -5.568  1.00 0.00 ? 47  VAL A CA   5  
ATOM   4739  C  C    . VAL A 1 47 ? 3.435   -4.074  -4.559  1.00 0.00 ? 47  VAL A C    5  
ATOM   4740  O  O    . VAL A 1 47 ? 3.722   -3.940  -3.369  1.00 0.00 ? 47  VAL A O    5  
ATOM   4741  C  CB   . VAL A 1 47 ? 5.272   -2.781  -5.645  1.00 0.00 ? 47  VAL A CB   5  
ATOM   4742  C  CG1  . VAL A 1 47 ? 5.951   -4.060  -6.110  1.00 0.00 ? 47  VAL A CG1  5  
ATOM   4743  C  CG2  . VAL A 1 47 ? 5.615   -1.620  -6.567  1.00 0.00 ? 47  VAL A CG2  5  
ATOM   4744  H  H    . VAL A 1 47 ? 3.079   -1.429  -4.286  1.00 0.00 ? 47  VAL A H    5  
ATOM   4745  H  HA   . VAL A 1 47 ? 3.394   -3.284  -6.542  1.00 0.00 ? 47  VAL A HA   5  
ATOM   4746  H  HB   . VAL A 1 47 ? 5.635   -2.546  -4.655  1.00 0.00 ? 47  VAL A HB   5  
ATOM   4747  H  HG11 . VAL A 1 47 ? 5.220   -4.708  -6.572  1.00 0.00 ? 47  VAL A HG11 5  
ATOM   4748  H  HG12 . VAL A 1 47 ? 6.723   -3.819  -6.825  1.00 0.00 ? 47  VAL A HG12 5  
ATOM   4749  H  HG13 . VAL A 1 47 ? 6.390   -4.563  -5.261  1.00 0.00 ? 47  VAL A HG13 5  
ATOM   4750  H  HG21 . VAL A 1 47 ? 4.712   -1.085  -6.822  1.00 0.00 ? 47  VAL A HG21 5  
ATOM   4751  H  HG22 . VAL A 1 47 ? 6.300   -0.951  -6.065  1.00 0.00 ? 47  VAL A HG22 5  
ATOM   4752  H  HG23 . VAL A 1 47 ? 6.077   -1.999  -7.466  1.00 0.00 ? 47  VAL A HG23 5  
ATOM   4753  N  N    . LYS A 1 48 ? 2.845   -5.163  -5.041  1.00 0.00 ? 48  LYS A N    5  
ATOM   4754  C  CA   . LYS A 1 48 ? 2.496   -6.289  -4.183  1.00 0.00 ? 48  LYS A CA   5  
ATOM   4755  C  C    . LYS A 1 48 ? 3.749   -6.978  -3.653  1.00 0.00 ? 48  LYS A C    5  
ATOM   4756  O  O    . LYS A 1 48 ? 4.501   -7.587  -4.412  1.00 0.00 ? 48  LYS A O    5  
ATOM   4757  C  CB   . LYS A 1 48 ? 1.633   -7.293  -4.950  1.00 0.00 ? 48  LYS A CB   5  
ATOM   4758  C  CG   . LYS A 1 48 ? 0.141   -7.058  -4.795  1.00 0.00 ? 48  LYS A CG   5  
ATOM   4759  C  CD   . LYS A 1 48 ? -0.329  -7.371  -3.384  1.00 0.00 ? 48  LYS A CD   5  
ATOM   4760  C  CE   . LYS A 1 48 ? -0.464  -8.870  -3.162  1.00 0.00 ? 48  LYS A CE   5  
ATOM   4761  N  NZ   . LYS A 1 48 ? -1.639  -9.434  -3.881  1.00 0.00 ? 48  LYS A NZ   5  
ATOM   4762  H  H    . LYS A 1 48 ? 2.641   -5.211  -5.999  1.00 0.00 ? 48  LYS A H    5  
ATOM   4763  H  HA   . LYS A 1 48 ? 1.930   -5.905  -3.347  1.00 0.00 ? 48  LYS A HA   5  
ATOM   4764  H  HB2  . LYS A 1 48 ? 1.879   -7.233  -6.000  1.00 0.00 ? 48  LYS A HB2  5  
ATOM   4765  H  HB3  . LYS A 1 48 ? 1.858   -8.288  -4.593  1.00 0.00 ? 48  LYS A HB3  5  
ATOM   4766  H  HG2  . LYS A 1 48 ? -0.075  -6.022  -5.013  1.00 0.00 ? 48  LYS A HG2  5  
ATOM   4767  H  HG3  . LYS A 1 48 ? -0.389  -7.692  -5.491  1.00 0.00 ? 48  LYS A HG3  5  
ATOM   4768  H  HD2  . LYS A 1 48 ? 0.387   -6.977  -2.679  1.00 0.00 ? 48  LYS A HD2  5  
ATOM   4769  H  HD3  . LYS A 1 48 ? -1.291  -6.904  -3.223  1.00 0.00 ? 48  LYS A HD3  5  
ATOM   4770  H  HE2  . LYS A 1 48 ? 0.432   -9.355  -3.518  1.00 0.00 ? 48  LYS A HE2  5  
ATOM   4771  H  HE3  . LYS A 1 48 ? -0.577  -9.055  -2.104  1.00 0.00 ? 48  LYS A HE3  5  
ATOM   4772  H  HZ1  . LYS A 1 48 ? -1.506  -10.454 -4.037  1.00 0.00 ? 48  LYS A HZ1  5  
ATOM   4773  H  HZ2  . LYS A 1 48 ? -1.752  -8.966  -4.803  1.00 0.00 ? 48  LYS A HZ2  5  
ATOM   4774  H  HZ3  . LYS A 1 48 ? -2.504  -9.290  -3.322  1.00 0.00 ? 48  LYS A HZ3  5  
ATOM   4775  N  N    . ASN A 1 49 ? 3.965   -6.879  -2.345  1.00 0.00 ? 49  ASN A N    5  
ATOM   4776  C  CA   . ASN A 1 49 ? 5.127   -7.495  -1.714  1.00 0.00 ? 49  ASN A CA   5  
ATOM   4777  C  C    . ASN A 1 49 ? 4.779   -8.010  -0.320  1.00 0.00 ? 49  ASN A C    5  
ATOM   4778  O  O    . ASN A 1 49 ? 4.115   -7.326  0.458   1.00 0.00 ? 49  ASN A O    5  
ATOM   4779  C  CB   . ASN A 1 49 ? 6.277   -6.490  -1.626  1.00 0.00 ? 49  ASN A CB   5  
ATOM   4780  C  CG   . ASN A 1 49 ? 7.636   -7.161  -1.693  1.00 0.00 ? 49  ASN A CG   5  
ATOM   4781  O  OD1  . ASN A 1 49 ? 7.813   -8.163  -2.385  1.00 0.00 ? 49  ASN A OD1  5  
ATOM   4782  N  ND2  . ASN A 1 49 ? 8.604   -6.608  -0.971  1.00 0.00 ? 49  ASN A ND2  5  
ATOM   4783  H  H    . ASN A 1 49 ? 3.329   -6.380  -1.791  1.00 0.00 ? 49  ASN A H    5  
ATOM   4784  H  HA   . ASN A 1 49 ? 5.434   -8.328  -2.327  1.00 0.00 ? 49  ASN A HA   5  
ATOM   4785  H  HB2  . ASN A 1 49 ? 6.201   -5.792  -2.447  1.00 0.00 ? 49  ASN A HB2  5  
ATOM   4786  H  HB3  . ASN A 1 49 ? 6.207   -5.952  -0.693  1.00 0.00 ? 49  ASN A HB3  5  
ATOM   4787  H  HD21 . ASN A 1 49 ? 8.391   -5.810  -0.443  1.00 0.00 ? 49  ASN A HD21 5  
ATOM   4788  H  HD22 . ASN A 1 49 ? 9.493   -7.021  -0.996  1.00 0.00 ? 49  ASN A HD22 5  
ATOM   4789  N  N    . ALA A 1 50 ? 5.233   -9.221  -0.013  1.00 0.00 ? 50  ALA A N    5  
ATOM   4790  C  CA   . ALA A 1 50 ? 4.973   -9.827  1.287   1.00 0.00 ? 50  ALA A CA   5  
ATOM   4791  C  C    . ALA A 1 50 ? 3.531   -9.593  1.723   1.00 0.00 ? 50  ALA A C    5  
ATOM   4792  O  O    . ALA A 1 50 ? 3.253   -9.401  2.906   1.00 0.00 ? 50  ALA A O    5  
ATOM   4793  C  CB   . ALA A 1 50 ? 5.937   -9.277  2.328   1.00 0.00 ? 50  ALA A CB   5  
ATOM   4794  H  H    . ALA A 1 50 ? 5.757   -9.717  -0.675  1.00 0.00 ? 50  ALA A H    5  
ATOM   4795  H  HA   . ALA A 1 50 ? 5.144   -10.890 1.200   1.00 0.00 ? 50  ALA A HA   5  
ATOM   4796  H  HB1  . ALA A 1 50 ? 5.896   -8.198  2.322   1.00 0.00 ? 50  ALA A HB1  5  
ATOM   4797  H  HB2  . ALA A 1 50 ? 5.658   -9.643  3.305   1.00 0.00 ? 50  ALA A HB2  5  
ATOM   4798  H  HB3  . ALA A 1 50 ? 6.941   -9.600  2.095   1.00 0.00 ? 50  ALA A HB3  5  
ATOM   4799  N  N    . GLY A 1 51 ? 2.616   -9.609  0.759   1.00 0.00 ? 51  GLY A N    5  
ATOM   4800  C  CA   . GLY A 1 51 ? 1.213   -9.397  1.064   1.00 0.00 ? 51  GLY A CA   5  
ATOM   4801  C  C    . GLY A 1 51 ? 0.943   -8.011  1.614   1.00 0.00 ? 51  GLY A C    5  
ATOM   4802  O  O    . GLY A 1 51 ? 0.103   -7.839  2.497   1.00 0.00 ? 51  GLY A O    5  
ATOM   4803  H  H    . GLY A 1 51 ? 2.895   -9.767  -0.167  1.00 0.00 ? 51  GLY A H    5  
ATOM   4804  H  HA2  . GLY A 1 51 ? 0.635   -9.534  0.162   1.00 0.00 ? 51  GLY A HA2  5  
ATOM   4805  H  HA3  . GLY A 1 51 ? 0.900   -10.129 1.794   1.00 0.00 ? 51  GLY A HA3  5  
ATOM   4806  N  N    . ARG A 1 52 ? 1.658   -7.019  1.093   1.00 0.00 ? 52  ARG A N    5  
ATOM   4807  C  CA   . ARG A 1 52 ? 1.493   -5.641  1.540   1.00 0.00 ? 52  ARG A CA   5  
ATOM   4808  C  C    . ARG A 1 52 ? 1.626   -4.670  0.371   1.00 0.00 ? 52  ARG A C    5  
ATOM   4809  O  O    . ARG A 1 52 ? 2.467   -4.854  -0.510  1.00 0.00 ? 52  ARG A O    5  
ATOM   4810  C  CB   . ARG A 1 52 ? 2.527   -5.305  2.616   1.00 0.00 ? 52  ARG A CB   5  
ATOM   4811  C  CG   . ARG A 1 52 ? 2.474   -6.228  3.822   1.00 0.00 ? 52  ARG A CG   5  
ATOM   4812  C  CD   . ARG A 1 52 ? 3.719   -6.090  4.685   1.00 0.00 ? 52  ARG A CD   5  
ATOM   4813  N  NE   . ARG A 1 52 ? 3.884   -7.222  5.593   1.00 0.00 ? 52  ARG A NE   5  
ATOM   4814  C  CZ   . ARG A 1 52 ? 4.572   -7.160  6.728   1.00 0.00 ? 52  ARG A CZ   5  
ATOM   4815  N  NH1  . ARG A 1 52 ? 5.155   -6.026  7.092   1.00 0.00 ? 52  ARG A NH1  5  
ATOM   4816  N  NH2  . ARG A 1 52 ? 4.676   -8.233  7.501   1.00 0.00 ? 52  ARG A NH2  5  
ATOM   4817  H  H    . ARG A 1 52 ? 2.313   -7.219  0.392   1.00 0.00 ? 52  ARG A H    5  
ATOM   4818  H  HA   . ARG A 1 52 ? 0.504   -5.545  1.962   1.00 0.00 ? 52  ARG A HA   5  
ATOM   4819  H  HB2  . ARG A 1 52 ? 3.515   -5.370  2.183   1.00 0.00 ? 52  ARG A HB2  5  
ATOM   4820  H  HB3  . ARG A 1 52 ? 2.359   -4.294  2.956   1.00 0.00 ? 52  ARG A HB3  5  
ATOM   4821  H  HG2  . ARG A 1 52 ? 1.608   -5.979  4.417   1.00 0.00 ? 52  ARG A HG2  5  
ATOM   4822  H  HG3  . ARG A 1 52 ? 2.396   -7.249  3.479   1.00 0.00 ? 52  ARG A HG3  5  
ATOM   4823  H  HD2  . ARG A 1 52 ? 4.583   -6.030  4.040   1.00 0.00 ? 52  ARG A HD2  5  
ATOM   4824  H  HD3  . ARG A 1 52 ? 3.640   -5.183  5.265   1.00 0.00 ? 52  ARG A HD3  5  
ATOM   4825  H  HE   . ARG A 1 52 ? 3.462   -8.070  5.343   1.00 0.00 ? 52  ARG A HE   5  
ATOM   4826  H  HH11 . ARG A 1 52 ? 5.076   -5.216  6.512   1.00 0.00 ? 52  ARG A HH11 5  
ATOM   4827  H  HH12 . ARG A 1 52 ? 5.671   -5.982  7.948   1.00 0.00 ? 52  ARG A HH12 5  
ATOM   4828  H  HH21 . ARG A 1 52 ? 4.238   -9.089  7.230   1.00 0.00 ? 52  ARG A HH21 5  
ATOM   4829  H  HH22 . ARG A 1 52 ? 5.194   -8.185  8.355   1.00 0.00 ? 52  ARG A HH22 5  
ATOM   4830  N  N    . HIS A 1 53 ? 0.791   -3.636  0.368   1.00 0.00 ? 53  HIS A N    5  
ATOM   4831  C  CA   . HIS A 1 53 ? 0.815   -2.636  -0.693  1.00 0.00 ? 53  HIS A CA   5  
ATOM   4832  C  C    . HIS A 1 53 ? 1.860   -1.563  -0.405  1.00 0.00 ? 53  HIS A C    5  
ATOM   4833  O  O    . HIS A 1 53 ? 1.703   -0.759  0.515   1.00 0.00 ? 53  HIS A O    5  
ATOM   4834  C  CB   . HIS A 1 53 ? -0.564  -1.993  -0.848  1.00 0.00 ? 53  HIS A CB   5  
ATOM   4835  C  CG   . HIS A 1 53 ? -1.040  -1.292  0.387   1.00 0.00 ? 53  HIS A CG   5  
ATOM   4836  N  ND1  . HIS A 1 53 ? -2.115  -0.428  0.395   1.00 0.00 ? 53  HIS A ND1  5  
ATOM   4837  C  CD2  . HIS A 1 53 ? -0.582  -1.332  1.660   1.00 0.00 ? 53  HIS A CD2  5  
ATOM   4838  C  CE1  . HIS A 1 53 ? -2.296  0.034   1.619   1.00 0.00 ? 53  HIS A CE1  5  
ATOM   4839  N  NE2  . HIS A 1 53 ? -1.379  -0.500  2.406   1.00 0.00 ? 53  HIS A NE2  5  
ATOM   4840  H  H    . HIS A 1 53 ? 0.143   -3.544  1.098   1.00 0.00 ? 53  HIS A H    5  
ATOM   4841  H  HA   . HIS A 1 53 ? 1.075   -3.136  -1.614  1.00 0.00 ? 53  HIS A HA   5  
ATOM   4842  H  HB2  . HIS A 1 53 ? -0.527  -1.268  -1.647  1.00 0.00 ? 53  HIS A HB2  5  
ATOM   4843  H  HB3  . HIS A 1 53 ? -1.285  -2.759  -1.095  1.00 0.00 ? 53  HIS A HB3  5  
ATOM   4844  H  HD1  . HIS A 1 53 ? -2.662  -0.189  -0.382  1.00 0.00 ? 53  HIS A HD1  5  
ATOM   4845  H  HD2  . HIS A 1 53 ? 0.256   -1.911  2.023   1.00 0.00 ? 53  HIS A HD2  5  
ATOM   4846  H  HE1  . HIS A 1 53 ? -3.064  0.729   1.925   1.00 0.00 ? 53  HIS A HE1  5  
ATOM   4847  H  HE2  . HIS A 1 53 ? -1.234  -0.261  3.345   1.00 0.00 ? 53  HIS A HE2  5  
ATOM   4848  N  N    . LEU A 1 54 ? 2.928   -1.557  -1.196  1.00 0.00 ? 54  LEU A N    5  
ATOM   4849  C  CA   . LEU A 1 54 ? 4.000   -0.583  -1.025  1.00 0.00 ? 54  LEU A CA   5  
ATOM   4850  C  C    . LEU A 1 54 ? 4.185   0.250   -2.290  1.00 0.00 ? 54  LEU A C    5  
ATOM   4851  O  O    . LEU A 1 54 ? 3.537   0.006   -3.308  1.00 0.00 ? 54  LEU A O    5  
ATOM   4852  C  CB   . LEU A 1 54 ? 5.309   -1.292  -0.672  1.00 0.00 ? 54  LEU A CB   5  
ATOM   4853  C  CG   . LEU A 1 54 ? 5.175   -2.584  0.135   1.00 0.00 ? 54  LEU A CG   5  
ATOM   4854  C  CD1  . LEU A 1 54 ? 6.491   -3.346  0.145   1.00 0.00 ? 54  LEU A CD1  5  
ATOM   4855  C  CD2  . LEU A 1 54 ? 4.721   -2.282  1.555   1.00 0.00 ? 54  LEU A CD2  5  
ATOM   4856  H  H    . LEU A 1 54 ? 2.997   -2.222  -1.911  1.00 0.00 ? 54  LEU A H    5  
ATOM   4857  H  HA   . LEU A 1 54 ? 3.725   0.074   -0.213  1.00 0.00 ? 54  LEU A HA   5  
ATOM   4858  H  HB2  . LEU A 1 54 ? 5.816   -1.529  -1.594  1.00 0.00 ? 54  LEU A HB2  5  
ATOM   4859  H  HB3  . LEU A 1 54 ? 5.912   -0.603  -0.098  1.00 0.00 ? 54  LEU A HB3  5  
ATOM   4860  H  HG   . LEU A 1 54 ? 4.428   -3.215  -0.329  1.00 0.00 ? 54  LEU A HG   5  
ATOM   4861  H  HD11 . LEU A 1 54 ? 7.189   -2.850  0.803   1.00 0.00 ? 54  LEU A HD11 5  
ATOM   4862  H  HD12 . LEU A 1 54 ? 6.898   -3.375  -0.855  1.00 0.00 ? 54  LEU A HD12 5  
ATOM   4863  H  HD13 . LEU A 1 54 ? 6.321   -4.354  0.493   1.00 0.00 ? 54  LEU A HD13 5  
ATOM   4864  H  HD21 . LEU A 1 54 ? 4.158   -1.360  1.564   1.00 0.00 ? 54  LEU A HD21 5  
ATOM   4865  H  HD22 . LEU A 1 54 ? 5.585   -2.181  2.196   1.00 0.00 ? 54  LEU A HD22 5  
ATOM   4866  H  HD23 . LEU A 1 54 ? 4.098   -3.088  1.914   1.00 0.00 ? 54  LEU A HD23 5  
ATOM   4867  N  N    . CYS A 1 55 ? 5.076   1.234   -2.219  1.00 0.00 ? 55  CYS A N    5  
ATOM   4868  C  CA   . CYS A 1 55 ? 5.349   2.103   -3.357  1.00 0.00 ? 55  CYS A CA   5  
ATOM   4869  C  C    . CYS A 1 55 ? 6.709   1.784   -3.971  1.00 0.00 ? 55  CYS A C    5  
ATOM   4870  O  O    . CYS A 1 55 ? 7.639   1.385   -3.270  1.00 0.00 ? 55  CYS A O    5  
ATOM   4871  C  CB   . CYS A 1 55 ? 5.302   3.571   -2.928  1.00 0.00 ? 55  CYS A CB   5  
ATOM   4872  S  SG   . CYS A 1 55 ? 6.676   4.073   -1.843  1.00 0.00 ? 55  CYS A SG   5  
ATOM   4873  H  H    . CYS A 1 55 ? 5.561   1.380   -1.379  1.00 0.00 ? 55  CYS A H    5  
ATOM   4874  H  HA   . CYS A 1 55 ? 4.584   1.929   -4.098  1.00 0.00 ? 55  CYS A HA   5  
ATOM   4875  H  HB2  . CYS A 1 55 ? 5.334   4.196   -3.809  1.00 0.00 ? 55  CYS A HB2  5  
ATOM   4876  H  HB3  . CYS A 1 55 ? 4.380   3.753   -2.397  1.00 0.00 ? 55  CYS A HB3  5  
ATOM   4877  N  N    . ARG A 1 56 ? 6.817   1.963   -5.283  1.00 0.00 ? 56  ARG A N    5  
ATOM   4878  C  CA   . ARG A 1 56 ? 8.062   1.694   -5.991  1.00 0.00 ? 56  ARG A CA   5  
ATOM   4879  C  C    . ARG A 1 56 ? 9.267   2.073   -5.135  1.00 0.00 ? 56  ARG A C    5  
ATOM   4880  O  O    . ARG A 1 56 ? 10.186  1.280   -4.927  1.00 0.00 ? 56  ARG A O    5  
ATOM   4881  C  CB   . ARG A 1 56 ? 8.099   2.464   -7.313  1.00 0.00 ? 56  ARG A CB   5  
ATOM   4882  C  CG   . ARG A 1 56 ? 7.722   1.621   -8.520  1.00 0.00 ? 56  ARG A CG   5  
ATOM   4883  C  CD   . ARG A 1 56 ? 8.107   2.307   -9.821  1.00 0.00 ? 56  ARG A CD   5  
ATOM   4884  N  NE   . ARG A 1 56 ? 7.190   3.392   -10.160 1.00 0.00 ? 56  ARG A NE   5  
ATOM   4885  C  CZ   . ARG A 1 56 ? 7.513   4.406   -10.954 1.00 0.00 ? 56  ARG A CZ   5  
ATOM   4886  N  NH1  . ARG A 1 56 ? 8.724   4.475   -11.488 1.00 0.00 ? 56  ARG A NH1  5  
ATOM   4887  N  NH2  . ARG A 1 56 ? 6.623   5.355   -11.216 1.00 0.00 ? 56  ARG A NH2  5  
ATOM   4888  H  H    . ARG A 1 56 ? 6.040   2.284   -5.787  1.00 0.00 ? 56  ARG A H    5  
ATOM   4889  H  HA   . ARG A 1 56 ? 8.103   0.636   -6.200  1.00 0.00 ? 56  ARG A HA   5  
ATOM   4890  H  HB2  . ARG A 1 56 ? 7.411   3.294   -7.252  1.00 0.00 ? 56  ARG A HB2  5  
ATOM   4891  H  HB3  . ARG A 1 56 ? 9.098   2.846   -7.465  1.00 0.00 ? 56  ARG A HB3  5  
ATOM   4892  H  HG2  . ARG A 1 56 ? 8.236   0.673   -8.460  1.00 0.00 ? 56  ARG A HG2  5  
ATOM   4893  H  HG3  . ARG A 1 56 ? 6.655   1.456   -8.512  1.00 0.00 ? 56  ARG A HG3  5  
ATOM   4894  H  HD2  . ARG A 1 56 ? 9.104   2.711   -9.718  1.00 0.00 ? 56  ARG A HD2  5  
ATOM   4895  H  HD3  . ARG A 1 56 ? 8.096   1.576   -10.615 1.00 0.00 ? 56  ARG A HD3  5  
ATOM   4896  H  HE   . ARG A 1 56 ? 6.289   3.361   -9.777  1.00 0.00 ? 56  ARG A HE   5  
ATOM   4897  H  HH11 . ARG A 1 56 ? 9.397   3.761   -11.293 1.00 0.00 ? 56  ARG A HH11 5  
ATOM   4898  H  HH12 . ARG A 1 56 ? 8.965   5.240   -12.087 1.00 0.00 ? 56  ARG A HH12 5  
ATOM   4899  H  HH21 . ARG A 1 56 ? 5.708   5.306   -10.816 1.00 0.00 ? 56  ARG A HH21 5  
ATOM   4900  H  HH22 . ARG A 1 56 ? 6.867   6.118   -11.814 1.00 0.00 ? 56  ARG A HH22 5  
ATOM   4901  N  N    . PRO A 1 57 ? 9.266   3.315   -4.628  1.00 0.00 ? 57  PRO A N    5  
ATOM   4902  C  CA   . PRO A 1 57 ? 10.352  3.827   -3.787  1.00 0.00 ? 57  PRO A CA   5  
ATOM   4903  C  C    . PRO A 1 57 ? 10.734  2.854   -2.677  1.00 0.00 ? 57  PRO A C    5  
ATOM   4904  O  O    . PRO A 1 57 ? 11.878  2.405   -2.598  1.00 0.00 ? 57  PRO A O    5  
ATOM   4905  C  CB   . PRO A 1 57 ? 9.765   5.111   -3.194  1.00 0.00 ? 57  PRO A CB   5  
ATOM   4906  C  CG   . PRO A 1 57 ? 8.739   5.550   -4.180  1.00 0.00 ? 57  PRO A CG   5  
ATOM   4907  C  CD   . PRO A 1 57 ? 8.204   4.314   -4.836  1.00 0.00 ? 57  PRO A CD   5  
ATOM   4908  H  HA   . PRO A 1 57 ? 11.227  4.067   -4.372  1.00 0.00 ? 57  PRO A HA   5  
ATOM   4909  H  HB2  . PRO A 1 57 ? 9.322   4.896   -2.231  1.00 0.00 ? 57  PRO A HB2  5  
ATOM   4910  H  HB3  . PRO A 1 57 ? 10.545  5.849   -3.080  1.00 0.00 ? 57  PRO A HB3  5  
ATOM   4911  H  HG2  . PRO A 1 57 ? 7.941   6.070   -3.674  1.00 0.00 ? 57  PRO A HG2  5  
ATOM   4912  H  HG3  . PRO A 1 57 ? 9.194   6.189   -4.922  1.00 0.00 ? 57  PRO A HG3  5  
ATOM   4913  H  HD2  . PRO A 1 57 ? 7.286   4.006   -4.358  1.00 0.00 ? 57  PRO A HD2  5  
ATOM   4914  H  HD3  . PRO A 1 57 ? 8.042   4.490   -5.889  1.00 0.00 ? 57  PRO A HD3  5  
ATOM   4915  N  N    . CYS A 1 58 ? 9.770   2.531   -1.821  1.00 0.00 ? 58  CYS A N    5  
ATOM   4916  C  CA   . CYS A 1 58 ? 10.006  1.611   -0.715  1.00 0.00 ? 58  CYS A CA   5  
ATOM   4917  C  C    . CYS A 1 58 ? 10.286  0.202   -1.230  1.00 0.00 ? 58  CYS A C    5  
ATOM   4918  O  O    . CYS A 1 58 ? 11.403  -0.302  -1.115  1.00 0.00 ? 58  CYS A O    5  
ATOM   4919  C  CB   . CYS A 1 58 ? 8.799   1.592   0.225   1.00 0.00 ? 58  CYS A CB   5  
ATOM   4920  S  SG   . CYS A 1 58 ? 8.458   3.190   1.030   1.00 0.00 ? 58  CYS A SG   5  
ATOM   4921  H  H    . CYS A 1 58 ? 8.878   2.922   -1.936  1.00 0.00 ? 58  CYS A H    5  
ATOM   4922  H  HA   . CYS A 1 58 ? 10.870  1.960   -0.171  1.00 0.00 ? 58  CYS A HA   5  
ATOM   4923  H  HB2  . CYS A 1 58 ? 7.919   1.313   -0.336  1.00 0.00 ? 58  CYS A HB2  5  
ATOM   4924  H  HB3  . CYS A 1 58 ? 8.970   0.861   1.002   1.00 0.00 ? 58  CYS A HB3  5  
ATOM   4925  N  N    . HIS A 1 59 ? 9.263   -0.428  -1.799  1.00 0.00 ? 59  HIS A N    5  
ATOM   4926  C  CA   . HIS A 1 59 ? 9.399   -1.779  -2.333  1.00 0.00 ? 59  HIS A CA   5  
ATOM   4927  C  C    . HIS A 1 59 ? 10.775  -1.979  -2.960  1.00 0.00 ? 59  HIS A C    5  
ATOM   4928  O  O    . HIS A 1 59 ? 11.343  -3.069  -2.899  1.00 0.00 ? 59  HIS A O    5  
ATOM   4929  C  CB   . HIS A 1 59 ? 8.309   -2.052  -3.369  1.00 0.00 ? 59  HIS A CB   5  
ATOM   4930  C  CG   . HIS A 1 59 ? 8.640   -3.173  -4.306  1.00 0.00 ? 59  HIS A CG   5  
ATOM   4931  N  ND1  . HIS A 1 59 ? 8.658   -4.496  -3.920  1.00 0.00 ? 59  HIS A ND1  5  
ATOM   4932  C  CD2  . HIS A 1 59 ? 8.966   -3.161  -5.620  1.00 0.00 ? 59  HIS A CD2  5  
ATOM   4933  C  CE1  . HIS A 1 59 ? 8.982   -5.250  -4.955  1.00 0.00 ? 59  HIS A CE1  5  
ATOM   4934  N  NE2  . HIS A 1 59 ? 9.174   -4.464  -5.999  1.00 0.00 ? 59  HIS A NE2  5  
ATOM   4935  H  H    . HIS A 1 59 ? 8.397   0.026   -1.862  1.00 0.00 ? 59  HIS A H    5  
ATOM   4936  H  HA   . HIS A 1 59 ? 9.286   -2.472  -1.514  1.00 0.00 ? 59  HIS A HA   5  
ATOM   4937  H  HB2  . HIS A 1 59 ? 7.392   -2.308  -2.859  1.00 0.00 ? 59  HIS A HB2  5  
ATOM   4938  H  HB3  . HIS A 1 59 ? 8.150   -1.161  -3.959  1.00 0.00 ? 59  HIS A HB3  5  
ATOM   4939  H  HD1  . HIS A 1 59 ? 8.463   -4.833  -3.021  1.00 0.00 ? 59  HIS A HD1  5  
ATOM   4940  H  HD2  . HIS A 1 59 ? 9.049   -2.289  -6.253  1.00 0.00 ? 59  HIS A HD2  5  
ATOM   4941  H  HE1  . HIS A 1 59 ? 9.074   -6.326  -4.950  1.00 0.00 ? 59  HIS A HE1  5  
ATOM   4942  H  HE2  . HIS A 1 59 ? 9.507   -4.758  -6.873  1.00 0.00 ? 59  HIS A HE2  5  
ATOM   4943  N  N    . ASN A 1 60 ? 11.305  -0.920  -3.565  1.00 0.00 ? 60  ASN A N    5  
ATOM   4944  C  CA   . ASN A 1 60 ? 12.614  -0.981  -4.204  1.00 0.00 ? 60  ASN A CA   5  
ATOM   4945  C  C    . ASN A 1 60 ? 13.721  -1.123  -3.165  1.00 0.00 ? 60  ASN A C    5  
ATOM   4946  O  O    . ASN A 1 60 ? 14.633  -1.936  -3.321  1.00 0.00 ? 60  ASN A O    5  
ATOM   4947  C  CB   . ASN A 1 60 ? 12.850  0.273   -5.049  1.00 0.00 ? 60  ASN A CB   5  
ATOM   4948  C  CG   . ASN A 1 60 ? 12.343  0.117   -6.470  1.00 0.00 ? 60  ASN A CG   5  
ATOM   4949  O  OD1  . ASN A 1 60 ? 12.645  -0.868  -7.144  1.00 0.00 ? 60  ASN A OD1  5  
ATOM   4950  N  ND2  . ASN A 1 60 ? 11.569  1.092   -6.932  1.00 0.00 ? 60  ASN A ND2  5  
ATOM   4951  H  H    . ASN A 1 60 ? 10.803  -0.078  -3.581  1.00 0.00 ? 60  ASN A H    5  
ATOM   4952  H  HA   . ASN A 1 60 ? 12.628  -1.846  -4.849  1.00 0.00 ? 60  ASN A HA   5  
ATOM   4953  H  HB2  . ASN A 1 60 ? 12.337  1.108   -4.594  1.00 0.00 ? 60  ASN A HB2  5  
ATOM   4954  H  HB3  . ASN A 1 60 ? 13.909  0.482   -5.084  1.00 0.00 ? 60  ASN A HB3  5  
ATOM   4955  H  HD21 . ASN A 1 60 ? 11.371  1.847   -6.339  1.00 0.00 ? 60  ASN A HD21 5  
ATOM   4956  H  HD22 . ASN A 1 60 ? 11.227  1.016   -7.847  1.00 0.00 ? 60  ASN A HD22 5  
ATOM   4957  N  N    . ARG A 1 61 ? 13.635  -0.328  -2.104  1.00 0.00 ? 61  ARG A N    5  
ATOM   4958  C  CA   . ARG A 1 61 ? 14.630  -0.365  -1.039  1.00 0.00 ? 61  ARG A CA   5  
ATOM   4959  C  C    . ARG A 1 61 ? 14.730  -1.763  -0.436  1.00 0.00 ? 61  ARG A C    5  
ATOM   4960  O  O    . ARG A 1 61 ? 15.807  -2.198  -0.029  1.00 0.00 ? 61  ARG A O    5  
ATOM   4961  C  CB   . ARG A 1 61 ? 14.278  0.648   0.052   1.00 0.00 ? 61  ARG A CB   5  
ATOM   4962  C  CG   . ARG A 1 61 ? 13.423  0.070   1.168   1.00 0.00 ? 61  ARG A CG   5  
ATOM   4963  C  CD   . ARG A 1 61 ? 12.912  1.157   2.099   1.00 0.00 ? 61  ARG A CD   5  
ATOM   4964  N  NE   . ARG A 1 61 ? 12.519  0.623   3.401   1.00 0.00 ? 61  ARG A NE   5  
ATOM   4965  C  CZ   . ARG A 1 61 ? 12.192  1.385   4.439   1.00 0.00 ? 61  ARG A CZ   5  
ATOM   4966  N  NH1  . ARG A 1 61 ? 12.211  2.706   4.329   1.00 0.00 ? 61  ARG A NH1  5  
ATOM   4967  N  NH2  . ARG A 1 61 ? 11.846  0.824   5.591   1.00 0.00 ? 61  ARG A NH2  5  
ATOM   4968  H  H    . ARG A 1 61 ? 12.886  0.300   -2.036  1.00 0.00 ? 61  ARG A H    5  
ATOM   4969  H  HA   . ARG A 1 61 ? 15.586  -0.101  -1.467  1.00 0.00 ? 61  ARG A HA   5  
ATOM   4970  H  HB2  . ARG A 1 61 ? 15.193  1.024   0.488   1.00 0.00 ? 61  ARG A HB2  5  
ATOM   4971  H  HB3  . ARG A 1 61 ? 13.739  1.469   -0.396  1.00 0.00 ? 61  ARG A HB3  5  
ATOM   4972  H  HG2  . ARG A 1 61 ? 12.578  -0.442  0.732   1.00 0.00 ? 61  ARG A HG2  5  
ATOM   4973  H  HG3  . ARG A 1 61 ? 14.016  -0.630  1.737   1.00 0.00 ? 61  ARG A HG3  5  
ATOM   4974  H  HD2  . ARG A 1 61 ? 13.694  1.888   2.242   1.00 0.00 ? 61  ARG A HD2  5  
ATOM   4975  H  HD3  . ARG A 1 61 ? 12.056  1.631   1.642   1.00 0.00 ? 61  ARG A HD3  5  
ATOM   4976  H  HE   . ARG A 1 61 ? 12.498  -0.350  3.504   1.00 0.00 ? 61  ARG A HE   5  
ATOM   4977  H  HH11 . ARG A 1 61 ? 12.471  3.131   3.462   1.00 0.00 ? 61  ARG A HH11 5  
ATOM   4978  H  HH12 . ARG A 1 61 ? 11.963  3.277   5.112   1.00 0.00 ? 61  ARG A HH12 5  
ATOM   4979  H  HH21 . ARG A 1 61 ? 11.830  -0.171  5.678   1.00 0.00 ? 61  ARG A HH21 5  
ATOM   4980  H  HH22 . ARG A 1 61 ? 11.600  1.398   6.372   1.00 0.00 ? 61  ARG A HH22 5  
ATOM   4981  N  N    . GLU A 1 62 ? 13.600  -2.461  -0.383  1.00 0.00 ? 62  GLU A N    5  
ATOM   4982  C  CA   . GLU A 1 62 ? 13.561  -3.809  0.171   1.00 0.00 ? 62  GLU A CA   5  
ATOM   4983  C  C    . GLU A 1 62 ? 14.161  -4.817  -0.806  1.00 0.00 ? 62  GLU A C    5  
ATOM   4984  O  O    . GLU A 1 62 ? 15.231  -5.374  -0.563  1.00 0.00 ? 62  GLU A O    5  
ATOM   4985  C  CB   . GLU A 1 62 ? 12.122  -4.205  0.509   1.00 0.00 ? 62  GLU A CB   5  
ATOM   4986  C  CG   . GLU A 1 62 ? 11.339  -3.109  1.212   1.00 0.00 ? 62  GLU A CG   5  
ATOM   4987  C  CD   . GLU A 1 62 ? 11.674  -3.008  2.687   1.00 0.00 ? 62  GLU A CD   5  
ATOM   4988  O  OE1  . GLU A 1 62 ? 12.863  -2.811  3.013   1.00 0.00 ? 62  GLU A OE1  5  
ATOM   4989  O  OE2  . GLU A 1 62 ? 10.747  -3.126  3.516   1.00 0.00 ? 62  GLU A OE2  5  
ATOM   4990  H  H    . GLU A 1 62 ? 12.774  -2.060  -0.724  1.00 0.00 ? 62  GLU A H    5  
ATOM   4991  H  HA   . GLU A 1 62 ? 14.148  -3.813  1.077   1.00 0.00 ? 62  GLU A HA   5  
ATOM   4992  H  HB2  . GLU A 1 62 ? 11.607  -4.457  -0.406  1.00 0.00 ? 62  GLU A HB2  5  
ATOM   4993  H  HB3  . GLU A 1 62 ? 12.142  -5.073  1.151   1.00 0.00 ? 62  GLU A HB3  5  
ATOM   4994  H  HG2  . GLU A 1 62 ? 11.566  -2.164  0.742   1.00 0.00 ? 62  GLU A HG2  5  
ATOM   4995  H  HG3  . GLU A 1 62 ? 10.284  -3.316  1.110   1.00 0.00 ? 62  GLU A HG3  5  
ATOM   4996  N  N    . LYS A 1 63 ? 13.463  -5.046  -1.913  1.00 0.00 ? 63  LYS A N    5  
ATOM   4997  C  CA   . LYS A 1 63 ? 13.924  -5.985  -2.929  1.00 0.00 ? 63  LYS A CA   5  
ATOM   4998  C  C    . LYS A 1 63 ? 15.383  -5.723  -3.289  1.00 0.00 ? 63  LYS A C    5  
ATOM   4999  O  O    . LYS A 1 63 ? 16.113  -6.639  -3.665  1.00 0.00 ? 63  LYS A O    5  
ATOM   5000  C  CB   . LYS A 1 63 ? 13.052  -5.881  -4.182  1.00 0.00 ? 63  LYS A CB   5  
ATOM   5001  C  CG   . LYS A 1 63 ? 12.983  -4.479  -4.762  1.00 0.00 ? 63  LYS A CG   5  
ATOM   5002  C  CD   . LYS A 1 63 ? 14.053  -4.260  -5.819  1.00 0.00 ? 63  LYS A CD   5  
ATOM   5003  C  CE   . LYS A 1 63 ? 13.671  -4.909  -7.141  1.00 0.00 ? 63  LYS A CE   5  
ATOM   5004  N  NZ   . LYS A 1 63 ? 14.858  -5.134  -8.011  1.00 0.00 ? 63  LYS A NZ   5  
ATOM   5005  H  H    . LYS A 1 63 ? 12.616  -4.571  -2.051  1.00 0.00 ? 63  LYS A H    5  
ATOM   5006  H  HA   . LYS A 1 63 ? 13.839  -6.981  -2.523  1.00 0.00 ? 63  LYS A HA   5  
ATOM   5007  H  HB2  . LYS A 1 63 ? 13.449  -6.542  -4.938  1.00 0.00 ? 63  LYS A HB2  5  
ATOM   5008  H  HB3  . LYS A 1 63 ? 12.048  -6.195  -3.934  1.00 0.00 ? 63  LYS A HB3  5  
ATOM   5009  H  HG2  . LYS A 1 63 ? 12.013  -4.332  -5.212  1.00 0.00 ? 63  LYS A HG2  5  
ATOM   5010  H  HG3  . LYS A 1 63 ? 13.125  -3.763  -3.965  1.00 0.00 ? 63  LYS A HG3  5  
ATOM   5011  H  HD2  . LYS A 1 63 ? 14.180  -3.199  -5.976  1.00 0.00 ? 63  LYS A HD2  5  
ATOM   5012  H  HD3  . LYS A 1 63 ? 14.983  -4.689  -5.472  1.00 0.00 ? 63  LYS A HD3  5  
ATOM   5013  H  HE2  . LYS A 1 63 ? 13.200  -5.859  -6.938  1.00 0.00 ? 63  LYS A HE2  5  
ATOM   5014  H  HE3  . LYS A 1 63 ? 12.975  -4.264  -7.655  1.00 0.00 ? 63  LYS A HE3  5  
ATOM   5015  H  HZ1  . LYS A 1 63 ? 15.351  -4.234  -8.182  1.00 0.00 ? 63  LYS A HZ1  5  
ATOM   5016  H  HZ2  . LYS A 1 63 ? 14.561  -5.531  -8.925  1.00 0.00 ? 63  LYS A HZ2  5  
ATOM   5017  H  HZ3  . LYS A 1 63 ? 15.517  -5.796  -7.554  1.00 0.00 ? 63  LYS A HZ3  5  
ATOM   5018  N  N    . ALA A 1 64 ? 15.801  -4.467  -3.170  1.00 0.00 ? 64  ALA A N    5  
ATOM   5019  C  CA   . ALA A 1 64 ? 17.173  -4.086  -3.480  1.00 0.00 ? 64  ALA A CA   5  
ATOM   5020  C  C    . ALA A 1 64 ? 18.147  -5.203  -3.122  1.00 0.00 ? 64  ALA A C    5  
ATOM   5021  O  O    . ALA A 1 64 ? 18.151  -5.699  -1.995  1.00 0.00 ? 64  ALA A O    5  
ATOM   5022  C  CB   . ALA A 1 64 ? 17.544  -2.805  -2.747  1.00 0.00 ? 64  ALA A CB   5  
ATOM   5023  H  H    . ALA A 1 64 ? 15.172  -3.780  -2.865  1.00 0.00 ? 64  ALA A H    5  
ATOM   5024  H  HA   . ALA A 1 64 ? 17.235  -3.894  -4.542  1.00 0.00 ? 64  ALA A HA   5  
ATOM   5025  H  HB1  . ALA A 1 64 ? 18.502  -2.453  -3.101  1.00 0.00 ? 64  ALA A HB1  5  
ATOM   5026  H  HB2  . ALA A 1 64 ? 16.792  -2.053  -2.933  1.00 0.00 ? 64  ALA A HB2  5  
ATOM   5027  H  HB3  . ALA A 1 64 ? 17.602  -3.001  -1.687  1.00 0.00 ? 64  ALA A HB3  5  
ATOM   5028  N  N    . SER A 1 65 ? 18.972  -5.595  -4.088  1.00 0.00 ? 65  SER A N    5  
ATOM   5029  C  CA   . SER A 1 65 ? 19.948  -6.658  -3.876  1.00 0.00 ? 65  SER A CA   5  
ATOM   5030  C  C    . SER A 1 65 ? 19.271  -7.921  -3.352  1.00 0.00 ? 65  SER A C    5  
ATOM   5031  O  O    . SER A 1 65 ? 19.786  -8.589  -2.457  1.00 0.00 ? 65  SER A O    5  
ATOM   5032  C  CB   . SER A 1 65 ? 21.027  -6.199  -2.893  1.00 0.00 ? 65  SER A CB   5  
ATOM   5033  O  OG   . SER A 1 65 ? 21.994  -5.390  -3.539  1.00 0.00 ? 65  SER A OG   5  
ATOM   5034  H  H    . SER A 1 65 ? 18.920  -5.161  -4.965  1.00 0.00 ? 65  SER A H    5  
ATOM   5035  H  HA   . SER A 1 65 ? 20.409  -6.879  -4.826  1.00 0.00 ? 65  SER A HA   5  
ATOM   5036  H  HB2  . SER A 1 65 ? 20.569  -5.627  -2.100  1.00 0.00 ? 65  SER A HB2  5  
ATOM   5037  H  HB3  . SER A 1 65 ? 21.520  -7.065  -2.474  1.00 0.00 ? 65  SER A HB3  5  
ATOM   5038  H  HG   . SER A 1 65 ? 22.743  -5.932  -3.800  1.00 0.00 ? 65  SER A HG   5  
ATOM   5039  N  N    . GLY A 1 66 ? 18.111  -8.241  -3.917  1.00 0.00 ? 66  GLY A N    5  
ATOM   5040  C  CA   . GLY A 1 66 ? 17.380  -9.422  -3.496  1.00 0.00 ? 66  GLY A CA   5  
ATOM   5041  C  C    . GLY A 1 66 ? 16.670  -9.222  -2.172  1.00 0.00 ? 66  GLY A C    5  
ATOM   5042  O  O    . GLY A 1 66 ? 17.152  -8.519  -1.284  1.00 0.00 ? 66  GLY A O    5  
ATOM   5043  H  H    . GLY A 1 66 ? 17.748  -7.670  -4.627  1.00 0.00 ? 66  GLY A H    5  
ATOM   5044  H  HA2  . GLY A 1 66 ? 16.650  -9.669  -4.251  1.00 0.00 ? 66  GLY A HA2  5  
ATOM   5045  H  HA3  . GLY A 1 66 ? 18.074  -10.244 -3.398  1.00 0.00 ? 66  GLY A HA3  5  
ATOM   5046  N  N    . PRO A 1 67 ? 15.494  -9.850  -2.026  1.00 0.00 ? 67  PRO A N    5  
ATOM   5047  C  CA   . PRO A 1 67 ? 14.690  -9.752  -0.804  1.00 0.00 ? 67  PRO A CA   5  
ATOM   5048  C  C    . PRO A 1 67 ? 15.333  -10.477 0.373   1.00 0.00 ? 67  PRO A C    5  
ATOM   5049  O  O    . PRO A 1 67 ? 14.982  -10.238 1.528   1.00 0.00 ? 67  PRO A O    5  
ATOM   5050  C  CB   . PRO A 1 67 ? 13.372  -10.427 -1.192  1.00 0.00 ? 67  PRO A CB   5  
ATOM   5051  C  CG   . PRO A 1 67 ? 13.735  -11.364 -2.292  1.00 0.00 ? 67  PRO A CG   5  
ATOM   5052  C  CD   . PRO A 1 67 ? 14.858  -10.705 -3.043  1.00 0.00 ? 67  PRO A CD   5  
ATOM   5053  H  HA   . PRO A 1 67 ? 14.503  -8.723  -0.534  1.00 0.00 ? 67  PRO A HA   5  
ATOM   5054  H  HB2  . PRO A 1 67 ? 12.970  -10.955 -0.338  1.00 0.00 ? 67  PRO A HB2  5  
ATOM   5055  H  HB3  . PRO A 1 67 ? 12.666  -9.682  -1.526  1.00 0.00 ? 67  PRO A HB3  5  
ATOM   5056  H  HG2  . PRO A 1 67 ? 14.062  -12.306 -1.879  1.00 0.00 ? 67  PRO A HG2  5  
ATOM   5057  H  HG3  . PRO A 1 67 ? 12.886  -11.512 -2.942  1.00 0.00 ? 67  PRO A HG3  5  
ATOM   5058  H  HD2  . PRO A 1 67 ? 15.552  -11.446 -3.412  1.00 0.00 ? 67  PRO A HD2  5  
ATOM   5059  H  HD3  . PRO A 1 67 ? 14.470  -10.110 -3.857  1.00 0.00 ? 67  PRO A HD3  5  
ATOM   5060  N  N    . SER A 1 68 ? 16.278  -11.362 0.072   1.00 0.00 ? 68  SER A N    5  
ATOM   5061  C  CA   . SER A 1 68 ? 16.969  -12.124 1.106   1.00 0.00 ? 68  SER A CA   5  
ATOM   5062  C  C    . SER A 1 68 ? 18.336  -12.590 0.615   1.00 0.00 ? 68  SER A C    5  
ATOM   5063  O  O    . SER A 1 68 ? 18.458  -13.161 -0.468  1.00 0.00 ? 68  SER A O    5  
ATOM   5064  C  CB   . SER A 1 68 ? 16.128  -13.330 1.528   1.00 0.00 ? 68  SER A CB   5  
ATOM   5065  O  OG   . SER A 1 68 ? 16.035  -14.279 0.479   1.00 0.00 ? 68  SER A OG   5  
ATOM   5066  H  H    . SER A 1 68 ? 16.514  -11.508 -0.868  1.00 0.00 ? 68  SER A H    5  
ATOM   5067  H  HA   . SER A 1 68 ? 17.107  -11.476 1.959   1.00 0.00 ? 68  SER A HA   5  
ATOM   5068  H  HB2  . SER A 1 68 ? 16.584  -13.802 2.384   1.00 0.00 ? 68  SER A HB2  5  
ATOM   5069  H  HB3  . SER A 1 68 ? 15.132  -12.999 1.786   1.00 0.00 ? 68  SER A HB3  5  
ATOM   5070  H  HG   . SER A 1 68 ? 15.246  -14.812 0.598   1.00 0.00 ? 68  SER A HG   5  
ATOM   5071  N  N    . SER A 1 69 ? 19.363  -12.341 1.421   1.00 0.00 ? 69  SER A N    5  
ATOM   5072  C  CA   . SER A 1 69 ? 20.724  -12.731 1.069   1.00 0.00 ? 69  SER A CA   5  
ATOM   5073  C  C    . SER A 1 69 ? 20.767  -14.179 0.590   1.00 0.00 ? 69  SER A C    5  
ATOM   5074  O  O    . SER A 1 69 ? 21.156  -14.459 -0.543  1.00 0.00 ? 69  SER A O    5  
ATOM   5075  C  CB   . SER A 1 69 ? 21.656  -12.550 2.268   1.00 0.00 ? 69  SER A CB   5  
ATOM   5076  O  OG   . SER A 1 69 ? 21.787  -11.181 2.610   1.00 0.00 ? 69  SER A OG   5  
ATOM   5077  H  H    . SER A 1 69 ? 19.203  -11.882 2.272   1.00 0.00 ? 69  SER A H    5  
ATOM   5078  H  HA   . SER A 1 69 ? 21.055  -12.089 0.266   1.00 0.00 ? 69  SER A HA   5  
ATOM   5079  H  HB2  . SER A 1 69 ? 21.254  -13.083 3.117   1.00 0.00 ? 69  SER A HB2  5  
ATOM   5080  H  HB3  . SER A 1 69 ? 22.632  -12.944 2.025   1.00 0.00 ? 69  SER A HB3  5  
ATOM   5081  H  HG   . SER A 1 69 ? 20.963  -10.864 2.986   1.00 0.00 ? 69  SER A HG   5  
ATOM   5082  N  N    . GLY A 1 70 ? 20.364  -15.097 1.464   1.00 0.00 ? 70  GLY A N    5  
ATOM   5083  C  CA   . GLY A 1 70 ? 20.365  -16.505 1.114   1.00 0.00 ? 70  GLY A CA   5  
ATOM   5084  C  C    . GLY A 1 70 ? 21.765  -17.071 0.991   1.00 0.00 ? 70  GLY A C    5  
ATOM   5085  O  O    . GLY A 1 70 ? 22.716  -16.416 1.415   1.00 0.00 ? 70  GLY A O    5  
ATOM   5086  H  H    . GLY A 1 70 ? 20.064  -14.815 2.354   1.00 0.00 ? 70  GLY A H    5  
ATOM   5087  H  HA2  . GLY A 1 70 ? 19.831  -17.054 1.875   1.00 0.00 ? 70  GLY A HA2  5  
ATOM   5088  H  HA3  . GLY A 1 70 ? 19.855  -16.629 0.170   1.00 0.00 ? 70  GLY A HA3  5  
HETATM 5089  ZN ZN   . ZN  B 2 .  ? -11.275 4.284   2.398   1.00 0.00 ? 201 ZN  A ZN   5  
HETATM 5090  ZN ZN   . ZN  C 2 .  ? 6.617   3.578   0.344   1.00 0.00 ? 401 ZN  A ZN   5  
ATOM   5091  N  N    . GLY A 1 1  ? -30.840 -2.998  1.236   1.00 0.00 ? 1   GLY A N    6  
ATOM   5092  C  CA   . GLY A 1 1  ? -30.665 -1.648  1.740   1.00 0.00 ? 1   GLY A CA   6  
ATOM   5093  C  C    . GLY A 1 1  ? -29.221 -1.337  2.076   1.00 0.00 ? 1   GLY A C    6  
ATOM   5094  O  O    . GLY A 1 1  ? -28.645 -0.384  1.549   1.00 0.00 ? 1   GLY A O    6  
ATOM   5095  H  H1   . GLY A 1 1  ? -31.419 -3.159  0.462   1.00 0.00 ? 1   GLY A H1   6  
ATOM   5096  H  HA2  . GLY A 1 1  ? -31.009 -0.949  0.991   1.00 0.00 ? 1   GLY A HA2  6  
ATOM   5097  H  HA3  . GLY A 1 1  ? -31.264 -1.529  2.631   1.00 0.00 ? 1   GLY A HA3  6  
ATOM   5098  N  N    . SER A 1 2  ? -28.633 -2.140  2.957   1.00 0.00 ? 2   SER A N    6  
ATOM   5099  C  CA   . SER A 1 2  ? -27.248 -1.942  3.367   1.00 0.00 ? 2   SER A CA   6  
ATOM   5100  C  C    . SER A 1 2  ? -26.304 -2.791  2.521   1.00 0.00 ? 2   SER A C    6  
ATOM   5101  O  O    . SER A 1 2  ? -25.369 -3.402  3.038   1.00 0.00 ? 2   SER A O    6  
ATOM   5102  C  CB   . SER A 1 2  ? -27.077 -2.289  4.847   1.00 0.00 ? 2   SER A CB   6  
ATOM   5103  O  OG   . SER A 1 2  ? -25.820 -1.851  5.332   1.00 0.00 ? 2   SER A OG   6  
ATOM   5104  H  H    . SER A 1 2  ? -29.145 -2.882  3.342   1.00 0.00 ? 2   SER A H    6  
ATOM   5105  H  HA   . SER A 1 2  ? -27.005 -0.900  3.220   1.00 0.00 ? 2   SER A HA   6  
ATOM   5106  H  HB2  . SER A 1 2  ? -27.857 -1.811  5.419   1.00 0.00 ? 2   SER A HB2  6  
ATOM   5107  H  HB3  . SER A 1 2  ? -27.144 -3.361  4.972   1.00 0.00 ? 2   SER A HB3  6  
ATOM   5108  H  HG   . SER A 1 2  ? -25.121 -2.357  4.913   1.00 0.00 ? 2   SER A HG   6  
ATOM   5109  N  N    . SER A 1 3  ? -26.557 -2.824  1.217   1.00 0.00 ? 3   SER A N    6  
ATOM   5110  C  CA   . SER A 1 3  ? -25.733 -3.601  0.298   1.00 0.00 ? 3   SER A CA   6  
ATOM   5111  C  C    . SER A 1 3  ? -25.390 -2.787  -0.946  1.00 0.00 ? 3   SER A C    6  
ATOM   5112  O  O    . SER A 1 3  ? -26.276 -2.326  -1.663  1.00 0.00 ? 3   SER A O    6  
ATOM   5113  C  CB   . SER A 1 3  ? -26.455 -4.888  -0.104  1.00 0.00 ? 3   SER A CB   6  
ATOM   5114  O  OG   . SER A 1 3  ? -25.600 -5.744  -0.842  1.00 0.00 ? 3   SER A OG   6  
ATOM   5115  H  H    . SER A 1 3  ? -27.317 -2.316  0.864   1.00 0.00 ? 3   SER A H    6  
ATOM   5116  H  HA   . SER A 1 3  ? -24.817 -3.858  0.810   1.00 0.00 ? 3   SER A HA   6  
ATOM   5117  H  HB2  . SER A 1 3  ? -26.784 -5.406  0.784   1.00 0.00 ? 3   SER A HB2  6  
ATOM   5118  H  HB3  . SER A 1 3  ? -27.312 -4.641  -0.715  1.00 0.00 ? 3   SER A HB3  6  
ATOM   5119  H  HG   . SER A 1 3  ? -25.012 -5.217  -1.388  1.00 0.00 ? 3   SER A HG   6  
ATOM   5120  N  N    . GLY A 1 4  ? -24.095 -2.615  -1.194  1.00 0.00 ? 4   GLY A N    6  
ATOM   5121  C  CA   . GLY A 1 4  ? -23.656 -1.856  -2.351  1.00 0.00 ? 4   GLY A CA   6  
ATOM   5122  C  C    . GLY A 1 4  ? -23.029 -2.734  -3.416  1.00 0.00 ? 4   GLY A C    6  
ATOM   5123  O  O    . GLY A 1 4  ? -23.359 -3.914  -3.531  1.00 0.00 ? 4   GLY A O    6  
ATOM   5124  H  H    . GLY A 1 4  ? -23.432 -3.006  -0.587  1.00 0.00 ? 4   GLY A H    6  
ATOM   5125  H  HA2  . GLY A 1 4  ? -24.507 -1.345  -2.776  1.00 0.00 ? 4   GLY A HA2  6  
ATOM   5126  H  HA3  . GLY A 1 4  ? -22.931 -1.122  -2.032  1.00 0.00 ? 4   GLY A HA3  6  
ATOM   5127  N  N    . SER A 1 5  ? -22.122 -2.156  -4.197  1.00 0.00 ? 5   SER A N    6  
ATOM   5128  C  CA   . SER A 1 5  ? -21.450 -2.892  -5.262  1.00 0.00 ? 5   SER A CA   6  
ATOM   5129  C  C    . SER A 1 5  ? -19.948 -2.966  -5.007  1.00 0.00 ? 5   SER A C    6  
ATOM   5130  O  O    . SER A 1 5  ? -19.324 -4.008  -5.206  1.00 0.00 ? 5   SER A O    6  
ATOM   5131  C  CB   . SER A 1 5  ? -21.717 -2.230  -6.615  1.00 0.00 ? 5   SER A CB   6  
ATOM   5132  O  OG   . SER A 1 5  ? -21.381 -0.854  -6.585  1.00 0.00 ? 5   SER A OG   6  
ATOM   5133  H  H    . SER A 1 5  ? -21.901 -1.211  -4.056  1.00 0.00 ? 5   SER A H    6  
ATOM   5134  H  HA   . SER A 1 5  ? -21.851 -3.895  -5.276  1.00 0.00 ? 5   SER A HA   6  
ATOM   5135  H  HB2  . SER A 1 5  ? -21.123 -2.717  -7.374  1.00 0.00 ? 5   SER A HB2  6  
ATOM   5136  H  HB3  . SER A 1 5  ? -22.765 -2.328  -6.860  1.00 0.00 ? 5   SER A HB3  6  
ATOM   5137  H  HG   . SER A 1 5  ? -21.238 -0.540  -7.481  1.00 0.00 ? 5   SER A HG   6  
ATOM   5138  N  N    . SER A 1 6  ? -19.373 -1.852  -4.565  1.00 0.00 ? 6   SER A N    6  
ATOM   5139  C  CA   . SER A 1 6  ? -17.943 -1.788  -4.286  1.00 0.00 ? 6   SER A CA   6  
ATOM   5140  C  C    . SER A 1 6  ? -17.659 -0.846  -3.120  1.00 0.00 ? 6   SER A C    6  
ATOM   5141  O  O    . SER A 1 6  ? -18.102 0.302   -3.112  1.00 0.00 ? 6   SER A O    6  
ATOM   5142  C  CB   . SER A 1 6  ? -17.180 -1.324  -5.529  1.00 0.00 ? 6   SER A CB   6  
ATOM   5143  O  OG   . SER A 1 6  ? -15.866 -1.856  -5.548  1.00 0.00 ? 6   SER A OG   6  
ATOM   5144  H  H    . SER A 1 6  ? -19.924 -1.053  -4.427  1.00 0.00 ? 6   SER A H    6  
ATOM   5145  H  HA   . SER A 1 6  ? -17.612 -2.781  -4.021  1.00 0.00 ? 6   SER A HA   6  
ATOM   5146  H  HB2  . SER A 1 6  ? -17.702 -1.655  -6.413  1.00 0.00 ? 6   SER A HB2  6  
ATOM   5147  H  HB3  . SER A 1 6  ? -17.119 -0.245  -5.529  1.00 0.00 ? 6   SER A HB3  6  
ATOM   5148  H  HG   . SER A 1 6  ? -15.231 -1.138  -5.608  1.00 0.00 ? 6   SER A HG   6  
ATOM   5149  N  N    . GLY A 1 7  ? -16.916 -1.342  -2.135  1.00 0.00 ? 7   GLY A N    6  
ATOM   5150  C  CA   . GLY A 1 7  ? -16.585 -0.533  -0.977  1.00 0.00 ? 7   GLY A CA   6  
ATOM   5151  C  C    . GLY A 1 7  ? -15.120 -0.633  -0.599  1.00 0.00 ? 7   GLY A C    6  
ATOM   5152  O  O    . GLY A 1 7  ? -14.485 -1.665  -0.816  1.00 0.00 ? 7   GLY A O    6  
ATOM   5153  H  H    . GLY A 1 7  ? -16.590 -2.264  -2.195  1.00 0.00 ? 7   GLY A H    6  
ATOM   5154  H  HA2  . GLY A 1 7  ? -16.820 0.499   -1.192  1.00 0.00 ? 7   GLY A HA2  6  
ATOM   5155  H  HA3  . GLY A 1 7  ? -17.183 -0.861  -0.140  1.00 0.00 ? 7   GLY A HA3  6  
ATOM   5156  N  N    . CYS A 1 8  ? -14.582 0.442   -0.034  1.00 0.00 ? 8   CYS A N    6  
ATOM   5157  C  CA   . CYS A 1 8  ? -13.182 0.473   0.373   1.00 0.00 ? 8   CYS A CA   6  
ATOM   5158  C  C    . CYS A 1 8  ? -12.929 -0.495  1.526   1.00 0.00 ? 8   CYS A C    6  
ATOM   5159  O  O    . CYS A 1 8  ? -13.773 -0.663  2.407   1.00 0.00 ? 8   CYS A O    6  
ATOM   5160  C  CB   . CYS A 1 8  ? -12.780 1.890   0.786   1.00 0.00 ? 8   CYS A CB   6  
ATOM   5161  S  SG   . CYS A 1 8  ? -11.250 1.972   1.772   1.00 0.00 ? 8   CYS A SG   6  
ATOM   5162  H  H    . CYS A 1 8  ? -15.139 1.236   0.114   1.00 0.00 ? 8   CYS A H    6  
ATOM   5163  H  HA   . CYS A 1 8  ? -12.584 0.170   -0.472  1.00 0.00 ? 8   CYS A HA   6  
ATOM   5164  H  HB2  . CYS A 1 8  ? -12.630 2.487   -0.102  1.00 0.00 ? 8   CYS A HB2  6  
ATOM   5165  H  HB3  . CYS A 1 8  ? -13.575 2.325   1.375   1.00 0.00 ? 8   CYS A HB3  6  
ATOM   5166  N  N    . HIS A 1 9  ? -11.761 -1.130  1.513   1.00 0.00 ? 9   HIS A N    6  
ATOM   5167  C  CA   . HIS A 1 9  ? -11.396 -2.081  2.557   1.00 0.00 ? 9   HIS A CA   6  
ATOM   5168  C  C    . HIS A 1 9  ? -10.642 -1.385  3.686   1.00 0.00 ? 9   HIS A C    6  
ATOM   5169  O  O    . HIS A 1 9  ? -10.831 -1.705  4.859   1.00 0.00 ? 9   HIS A O    6  
ATOM   5170  C  CB   . HIS A 1 9  ? -10.541 -3.206  1.974   1.00 0.00 ? 9   HIS A CB   6  
ATOM   5171  C  CG   . HIS A 1 9  ? -10.379 -4.374  2.898   1.00 0.00 ? 9   HIS A CG   6  
ATOM   5172  N  ND1  . HIS A 1 9  ? -11.432 -4.948  3.578   1.00 0.00 ? 9   HIS A ND1  6  
ATOM   5173  C  CD2  . HIS A 1 9  ? -9.277  -5.078  3.250   1.00 0.00 ? 9   HIS A CD2  6  
ATOM   5174  C  CE1  . HIS A 1 9  ? -10.986 -5.952  4.310   1.00 0.00 ? 9   HIS A CE1  6  
ATOM   5175  N  NE2  . HIS A 1 9  ? -9.681  -6.053  4.129   1.00 0.00 ? 9   HIS A NE2  6  
ATOM   5176  H  H    . HIS A 1 9  ? -11.130 -0.954  0.784   1.00 0.00 ? 9   HIS A H    6  
ATOM   5177  H  HA   . HIS A 1 9  ? -12.307 -2.502  2.955   1.00 0.00 ? 9   HIS A HA   6  
ATOM   5178  H  HB2  . HIS A 1 9  ? -11.000 -3.564  1.065   1.00 0.00 ? 9   HIS A HB2  6  
ATOM   5179  H  HB3  . HIS A 1 9  ? -9.557  -2.822  1.748   1.00 0.00 ? 9   HIS A HB3  6  
ATOM   5180  H  HD1  . HIS A 1 9  ? -12.367 -4.660  3.532   1.00 0.00 ? 9   HIS A HD1  6  
ATOM   5181  H  HD2  . HIS A 1 9  ? -8.268  -4.905  2.905   1.00 0.00 ? 9   HIS A HD2  6  
ATOM   5182  H  HE1  . HIS A 1 9  ? -11.585 -6.585  4.949   1.00 0.00 ? 9   HIS A HE1  6  
ATOM   5183  H  HE2  . HIS A 1 9  ? -9.089  -6.660  4.619   1.00 0.00 ? 9   HIS A HE2  6  
ATOM   5184  N  N    . GLN A 1 10 ? -9.789  -0.433  3.323   1.00 0.00 ? 10  GLN A N    6  
ATOM   5185  C  CA   . GLN A 1 10 ? -9.007  0.307   4.306   1.00 0.00 ? 10  GLN A CA   6  
ATOM   5186  C  C    . GLN A 1 10 ? -9.890  0.796   5.448   1.00 0.00 ? 10  GLN A C    6  
ATOM   5187  O  O    . GLN A 1 10 ? -9.821  0.282   6.565   1.00 0.00 ? 10  GLN A O    6  
ATOM   5188  C  CB   . GLN A 1 10 ? -8.305  1.494   3.643   1.00 0.00 ? 10  GLN A CB   6  
ATOM   5189  C  CG   . GLN A 1 10 ? -7.506  2.348   4.613   1.00 0.00 ? 10  GLN A CG   6  
ATOM   5190  C  CD   . GLN A 1 10 ? -6.224  1.675   5.063   1.00 0.00 ? 10  GLN A CD   6  
ATOM   5191  O  OE1  . GLN A 1 10 ? -6.243  0.777   5.906   1.00 0.00 ? 10  GLN A OE1  6  
ATOM   5192  N  NE2  . GLN A 1 10 ? -5.100  2.107   4.503   1.00 0.00 ? 10  GLN A NE2  6  
ATOM   5193  H  H    . GLN A 1 10 ? -9.684  -0.223  2.372   1.00 0.00 ? 10  GLN A H    6  
ATOM   5194  H  HA   . GLN A 1 10 ? -8.260  -0.363  4.706   1.00 0.00 ? 10  GLN A HA   6  
ATOM   5195  H  HB2  . GLN A 1 10 ? -7.632  1.121   2.885   1.00 0.00 ? 10  GLN A HB2  6  
ATOM   5196  H  HB3  . GLN A 1 10 ? -9.050  2.121   3.175   1.00 0.00 ? 10  GLN A HB3  6  
ATOM   5197  H  HG2  . GLN A 1 10 ? -7.254  3.280   4.130   1.00 0.00 ? 10  GLN A HG2  6  
ATOM   5198  H  HG3  . GLN A 1 10 ? -8.115  2.548   5.482   1.00 0.00 ? 10  GLN A HG3  6  
ATOM   5199  H  HE21 . GLN A 1 10 ? -5.161  2.827   3.840   1.00 0.00 ? 10  GLN A HE21 6  
ATOM   5200  H  HE22 . GLN A 1 10 ? -4.257  1.690   4.776   1.00 0.00 ? 10  GLN A HE22 6  
ATOM   5201  N  N    . CYS A 1 11 ? -10.721 1.794   5.162   1.00 0.00 ? 11  CYS A N    6  
ATOM   5202  C  CA   . CYS A 1 11 ? -11.618 2.354   6.165   1.00 0.00 ? 11  CYS A CA   6  
ATOM   5203  C  C    . CYS A 1 11 ? -12.936 1.586   6.206   1.00 0.00 ? 11  CYS A C    6  
ATOM   5204  O  O    . CYS A 1 11 ? -13.449 1.270   7.278   1.00 0.00 ? 11  CYS A O    6  
ATOM   5205  C  CB   . CYS A 1 11 ? -11.885 3.832   5.871   1.00 0.00 ? 11  CYS A CB   6  
ATOM   5206  S  SG   . CYS A 1 11 ? -12.755 4.132   4.299   1.00 0.00 ? 11  CYS A SG   6  
ATOM   5207  H  H    . CYS A 1 11 ? -10.730 2.162   4.253   1.00 0.00 ? 11  CYS A H    6  
ATOM   5208  H  HA   . CYS A 1 11 ? -11.136 2.269   7.127   1.00 0.00 ? 11  CYS A HA   6  
ATOM   5209  H  HB2  . CYS A 1 11 ? -12.491 4.245   6.665   1.00 0.00 ? 11  CYS A HB2  6  
ATOM   5210  H  HB3  . CYS A 1 11 ? -10.943 4.359   5.833   1.00 0.00 ? 11  CYS A HB3  6  
ATOM   5211  N  N    . GLY A 1 12 ? -13.478 1.289   5.029   1.00 0.00 ? 12  GLY A N    6  
ATOM   5212  C  CA   . GLY A 1 12 ? -14.731 0.561   4.952   1.00 0.00 ? 12  GLY A CA   6  
ATOM   5213  C  C    . GLY A 1 12 ? -15.811 1.339   4.227   1.00 0.00 ? 12  GLY A C    6  
ATOM   5214  O  O    . GLY A 1 12 ? -16.646 0.757   3.535   1.00 0.00 ? 12  GLY A O    6  
ATOM   5215  H  H    . GLY A 1 12 ? -13.024 1.567   4.206   1.00 0.00 ? 12  GLY A H    6  
ATOM   5216  H  HA2  . GLY A 1 12 ? -14.562 -0.370  4.432   1.00 0.00 ? 12  GLY A HA2  6  
ATOM   5217  H  HA3  . GLY A 1 12 ? -15.071 0.345   5.954   1.00 0.00 ? 12  GLY A HA3  6  
ATOM   5218  N  N    . GLU A 1 13 ? -15.796 2.659   4.388   1.00 0.00 ? 13  GLU A N    6  
ATOM   5219  C  CA   . GLU A 1 13 ? -16.784 3.517   3.745   1.00 0.00 ? 13  GLU A CA   6  
ATOM   5220  C  C    . GLU A 1 13 ? -16.907 3.188   2.260   1.00 0.00 ? 13  GLU A C    6  
ATOM   5221  O  O    . GLU A 1 13 ? -15.958 2.710   1.638   1.00 0.00 ? 13  GLU A O    6  
ATOM   5222  C  CB   . GLU A 1 13 ? -16.405 4.989   3.922   1.00 0.00 ? 13  GLU A CB   6  
ATOM   5223  C  CG   . GLU A 1 13 ? -16.247 5.406   5.374   1.00 0.00 ? 13  GLU A CG   6  
ATOM   5224  C  CD   . GLU A 1 13 ? -17.574 5.509   6.100   1.00 0.00 ? 13  GLU A CD   6  
ATOM   5225  O  OE1  . GLU A 1 13 ? -18.240 6.558   5.972   1.00 0.00 ? 13  GLU A OE1  6  
ATOM   5226  O  OE2  . GLU A 1 13 ? -17.947 4.542   6.796   1.00 0.00 ? 13  GLU A OE2  6  
ATOM   5227  H  H    . GLU A 1 13 ? -15.105 3.064   4.952   1.00 0.00 ? 13  GLU A H    6  
ATOM   5228  H  HA   . GLU A 1 13 ? -17.737 3.341   4.220   1.00 0.00 ? 13  GLU A HA   6  
ATOM   5229  H  HB2  . GLU A 1 13 ? -15.471 5.173   3.412   1.00 0.00 ? 13  GLU A HB2  6  
ATOM   5230  H  HB3  . GLU A 1 13 ? -17.175 5.602   3.475   1.00 0.00 ? 13  GLU A HB3  6  
ATOM   5231  H  HG2  . GLU A 1 13 ? -15.633 4.676   5.880   1.00 0.00 ? 13  GLU A HG2  6  
ATOM   5232  H  HG3  . GLU A 1 13 ? -15.760 6.370   5.408   1.00 0.00 ? 13  GLU A HG3  6  
ATOM   5233  N  N    . PHE A 1 14 ? -18.083 3.446   1.698   1.00 0.00 ? 14  PHE A N    6  
ATOM   5234  C  CA   . PHE A 1 14 ? -18.332 3.176   0.287   1.00 0.00 ? 14  PHE A CA   6  
ATOM   5235  C  C    . PHE A 1 14 ? -17.619 4.196   -0.596  1.00 0.00 ? 14  PHE A C    6  
ATOM   5236  O  O    . PHE A 1 14 ? -17.564 5.382   -0.272  1.00 0.00 ? 14  PHE A O    6  
ATOM   5237  C  CB   . PHE A 1 14 ? -19.835 3.197   -0.001  1.00 0.00 ? 14  PHE A CB   6  
ATOM   5238  C  CG   . PHE A 1 14 ? -20.206 2.539   -1.299  1.00 0.00 ? 14  PHE A CG   6  
ATOM   5239  C  CD1  . PHE A 1 14 ? -20.290 1.159   -1.393  1.00 0.00 ? 14  PHE A CD1  6  
ATOM   5240  C  CD2  . PHE A 1 14 ? -20.470 3.300   -2.426  1.00 0.00 ? 14  PHE A CD2  6  
ATOM   5241  C  CE1  . PHE A 1 14 ? -20.630 0.551   -2.587  1.00 0.00 ? 14  PHE A CE1  6  
ATOM   5242  C  CE2  . PHE A 1 14 ? -20.812 2.698   -3.623  1.00 0.00 ? 14  PHE A CE2  6  
ATOM   5243  C  CZ   . PHE A 1 14 ? -20.893 1.322   -3.702  1.00 0.00 ? 14  PHE A CZ   6  
ATOM   5244  H  H    . PHE A 1 14 ? -18.801 3.827   2.246   1.00 0.00 ? 14  PHE A H    6  
ATOM   5245  H  HA   . PHE A 1 14 ? -17.945 2.193   0.065   1.00 0.00 ? 14  PHE A HA   6  
ATOM   5246  H  HB2  . PHE A 1 14 ? -20.353 2.680   0.792   1.00 0.00 ? 14  PHE A HB2  6  
ATOM   5247  H  HB3  . PHE A 1 14 ? -20.172 4.221   -0.038  1.00 0.00 ? 14  PHE A HB3  6  
ATOM   5248  H  HD1  . PHE A 1 14 ? -20.086 0.555   -0.521  1.00 0.00 ? 14  PHE A HD1  6  
ATOM   5249  H  HD2  . PHE A 1 14 ? -20.408 4.378   -2.365  1.00 0.00 ? 14  PHE A HD2  6  
ATOM   5250  H  HE1  . PHE A 1 14 ? -20.693 -0.525  -2.646  1.00 0.00 ? 14  PHE A HE1  6  
ATOM   5251  H  HE2  . PHE A 1 14 ? -21.016 3.304   -4.493  1.00 0.00 ? 14  PHE A HE2  6  
ATOM   5252  H  HZ   . PHE A 1 14 ? -21.158 0.849   -4.636  1.00 0.00 ? 14  PHE A HZ   6  
ATOM   5253  N  N    . ILE A 1 15 ? -17.075 3.725   -1.713  1.00 0.00 ? 15  ILE A N    6  
ATOM   5254  C  CA   . ILE A 1 15 ? -16.367 4.595   -2.643  1.00 0.00 ? 15  ILE A CA   6  
ATOM   5255  C  C    . ILE A 1 15 ? -17.319 5.185   -3.678  1.00 0.00 ? 15  ILE A C    6  
ATOM   5256  O  O    . ILE A 1 15 ? -18.073 4.459   -4.327  1.00 0.00 ? 15  ILE A O    6  
ATOM   5257  C  CB   . ILE A 1 15 ? -15.238 3.841   -3.371  1.00 0.00 ? 15  ILE A CB   6  
ATOM   5258  C  CG1  . ILE A 1 15 ? -14.410 3.029   -2.372  1.00 0.00 ? 15  ILE A CG1  6  
ATOM   5259  C  CG2  . ILE A 1 15 ? -14.353 4.818   -4.131  1.00 0.00 ? 15  ILE A CG2  6  
ATOM   5260  C  CD1  . ILE A 1 15 ? -13.622 1.908   -3.011  1.00 0.00 ? 15  ILE A CD1  6  
ATOM   5261  H  H    . ILE A 1 15 ? -17.153 2.769   -1.917  1.00 0.00 ? 15  ILE A H    6  
ATOM   5262  H  HA   . ILE A 1 15 ? -15.926 5.401   -2.075  1.00 0.00 ? 15  ILE A HA   6  
ATOM   5263  H  HB   . ILE A 1 15 ? -15.687 3.169   -4.086  1.00 0.00 ? 15  ILE A HB   6  
ATOM   5264  H  HG12 . ILE A 1 15 ? -13.712 3.685   -1.877  1.00 0.00 ? 15  ILE A HG12 6  
ATOM   5265  H  HG13 . ILE A 1 15 ? -15.072 2.594   -1.638  1.00 0.00 ? 15  ILE A HG13 6  
ATOM   5266  H  HG21 . ILE A 1 15 ? -13.463 4.308   -4.471  1.00 0.00 ? 15  ILE A HG21 6  
ATOM   5267  H  HG22 . ILE A 1 15 ? -14.892 5.204   -4.982  1.00 0.00 ? 15  ILE A HG22 6  
ATOM   5268  H  HG23 . ILE A 1 15 ? -14.074 5.633   -3.480  1.00 0.00 ? 15  ILE A HG23 6  
ATOM   5269  H  HD11 . ILE A 1 15 ? -14.237 1.022   -3.069  1.00 0.00 ? 15  ILE A HD11 6  
ATOM   5270  H  HD12 . ILE A 1 15 ? -13.317 2.201   -4.004  1.00 0.00 ? 15  ILE A HD12 6  
ATOM   5271  H  HD13 . ILE A 1 15 ? -12.746 1.698   -2.414  1.00 0.00 ? 15  ILE A HD13 6  
ATOM   5272  N  N    . ILE A 1 16 ? -17.277 6.504   -3.828  1.00 0.00 ? 16  ILE A N    6  
ATOM   5273  C  CA   . ILE A 1 16 ? -18.134 7.191   -4.787  1.00 0.00 ? 16  ILE A CA   6  
ATOM   5274  C  C    . ILE A 1 16 ? -17.317 8.093   -5.707  1.00 0.00 ? 16  ILE A C    6  
ATOM   5275  O  O    . ILE A 1 16 ? -16.741 9.087   -5.267  1.00 0.00 ? 16  ILE A O    6  
ATOM   5276  C  CB   . ILE A 1 16 ? -19.207 8.037   -4.077  1.00 0.00 ? 16  ILE A CB   6  
ATOM   5277  C  CG1  . ILE A 1 16 ? -19.925 7.203   -3.014  1.00 0.00 ? 16  ILE A CG1  6  
ATOM   5278  C  CG2  . ILE A 1 16 ? -20.202 8.587   -5.088  1.00 0.00 ? 16  ILE A CG2  6  
ATOM   5279  C  CD1  . ILE A 1 16 ? -20.881 8.006   -2.160  1.00 0.00 ? 16  ILE A CD1  6  
ATOM   5280  H  H    . ILE A 1 16 ? -16.655 7.028   -3.282  1.00 0.00 ? 16  ILE A H    6  
ATOM   5281  H  HA   . ILE A 1 16 ? -18.632 6.441   -5.385  1.00 0.00 ? 16  ILE A HA   6  
ATOM   5282  H  HB   . ILE A 1 16 ? -18.718 8.872   -3.600  1.00 0.00 ? 16  ILE A HB   6  
ATOM   5283  H  HG12 . ILE A 1 16 ? -20.489 6.422   -3.499  1.00 0.00 ? 16  ILE A HG12 6  
ATOM   5284  H  HG13 . ILE A 1 16 ? -19.189 6.757   -2.360  1.00 0.00 ? 16  ILE A HG13 6  
ATOM   5285  H  HG21 . ILE A 1 16 ? -19.805 8.467   -6.086  1.00 0.00 ? 16  ILE A HG21 6  
ATOM   5286  H  HG22 . ILE A 1 16 ? -21.134 8.047   -5.006  1.00 0.00 ? 16  ILE A HG22 6  
ATOM   5287  H  HG23 . ILE A 1 16 ? -20.374 9.634   -4.892  1.00 0.00 ? 16  ILE A HG23 6  
ATOM   5288  H  HD11 . ILE A 1 16 ? -21.168 8.904   -2.687  1.00 0.00 ? 16  ILE A HD11 6  
ATOM   5289  H  HD12 . ILE A 1 16 ? -21.759 7.415   -1.949  1.00 0.00 ? 16  ILE A HD12 6  
ATOM   5290  H  HD13 . ILE A 1 16 ? -20.396 8.274   -1.232  1.00 0.00 ? 16  ILE A HD13 6  
ATOM   5291  N  N    . GLY A 1 17 ? -17.274 7.739   -6.988  1.00 0.00 ? 17  GLY A N    6  
ATOM   5292  C  CA   . GLY A 1 17 ? -16.527 8.527   -7.950  1.00 0.00 ? 17  GLY A CA   6  
ATOM   5293  C  C    . GLY A 1 17 ? -15.314 7.793   -8.484  1.00 0.00 ? 17  GLY A C    6  
ATOM   5294  O  O    . GLY A 1 17 ? -15.316 7.320   -9.621  1.00 0.00 ? 17  GLY A O    6  
ATOM   5295  H  H    . GLY A 1 17 ? -17.753 6.936   -7.281  1.00 0.00 ? 17  GLY A H    6  
ATOM   5296  H  HA2  . GLY A 1 17 ? -17.177 8.777   -8.776  1.00 0.00 ? 17  GLY A HA2  6  
ATOM   5297  H  HA3  . GLY A 1 17 ? -16.200 9.440   -7.474  1.00 0.00 ? 17  GLY A HA3  6  
ATOM   5298  N  N    . ARG A 1 18 ? -14.273 7.698   -7.664  1.00 0.00 ? 18  ARG A N    6  
ATOM   5299  C  CA   . ARG A 1 18 ? -13.045 7.019   -8.061  1.00 0.00 ? 18  ARG A CA   6  
ATOM   5300  C  C    . ARG A 1 18 ? -12.798 5.790   -7.192  1.00 0.00 ? 18  ARG A C    6  
ATOM   5301  O  O    . ARG A 1 18 ? -12.709 5.890   -5.968  1.00 0.00 ? 18  ARG A O    6  
ATOM   5302  C  CB   . ARG A 1 18 ? -11.854 7.974   -7.964  1.00 0.00 ? 18  ARG A CB   6  
ATOM   5303  C  CG   . ARG A 1 18 ? -10.508 7.269   -7.959  1.00 0.00 ? 18  ARG A CG   6  
ATOM   5304  C  CD   . ARG A 1 18 ? -9.422  8.136   -8.578  1.00 0.00 ? 18  ARG A CD   6  
ATOM   5305  N  NE   . ARG A 1 18 ? -8.377  7.336   -9.211  1.00 0.00 ? 18  ARG A NE   6  
ATOM   5306  C  CZ   . ARG A 1 18 ? -7.537  7.813   -10.123 1.00 0.00 ? 18  ARG A CZ   6  
ATOM   5307  N  NH1  . ARG A 1 18 ? -7.620  9.080   -10.506 1.00 0.00 ? 18  ARG A NH1  6  
ATOM   5308  N  NH2  . ARG A 1 18 ? -6.613  7.023   -10.653 1.00 0.00 ? 18  ARG A NH2  6  
ATOM   5309  H  H    . ARG A 1 18 ? -14.331 8.095   -6.770  1.00 0.00 ? 18  ARG A H    6  
ATOM   5310  H  HA   . ARG A 1 18 ? -13.159 6.702   -9.087  1.00 0.00 ? 18  ARG A HA   6  
ATOM   5311  H  HB2  . ARG A 1 18 ? -11.879 8.648   -8.807  1.00 0.00 ? 18  ARG A HB2  6  
ATOM   5312  H  HB3  . ARG A 1 18 ? -11.940 8.546   -7.053  1.00 0.00 ? 18  ARG A HB3  6  
ATOM   5313  H  HG2  . ARG A 1 18 ? -10.234 7.043   -6.939  1.00 0.00 ? 18  ARG A HG2  6  
ATOM   5314  H  HG3  . ARG A 1 18 ? -10.590 6.352   -8.524  1.00 0.00 ? 18  ARG A HG3  6  
ATOM   5315  H  HD2  . ARG A 1 18 ? -9.872  8.776   -9.322  1.00 0.00 ? 18  ARG A HD2  6  
ATOM   5316  H  HD3  . ARG A 1 18 ? -8.979  8.742   -7.802  1.00 0.00 ? 18  ARG A HD3  6  
ATOM   5317  H  HE   . ARG A 1 18 ? -8.299  6.397   -8.942  1.00 0.00 ? 18  ARG A HE   6  
ATOM   5318  H  HH11 . ARG A 1 18 ? -8.315  9.678   -10.108 1.00 0.00 ? 18  ARG A HH11 6  
ATOM   5319  H  HH12 . ARG A 1 18 ? -6.986  9.437   -11.192 1.00 0.00 ? 18  ARG A HH12 6  
ATOM   5320  H  HH21 . ARG A 1 18 ? -6.548  6.068   -10.366 1.00 0.00 ? 18  ARG A HH21 6  
ATOM   5321  H  HH22 . ARG A 1 18 ? -5.982  7.383   -11.339 1.00 0.00 ? 18  ARG A HH22 6  
ATOM   5322  N  N    . VAL A 1 19 ? -12.689 4.630   -7.832  1.00 0.00 ? 19  VAL A N    6  
ATOM   5323  C  CA   . VAL A 1 19 ? -12.452 3.382   -7.117  1.00 0.00 ? 19  VAL A CA   6  
ATOM   5324  C  C    . VAL A 1 19 ? -11.088 2.798   -7.469  1.00 0.00 ? 19  VAL A C    6  
ATOM   5325  O  O    . VAL A 1 19 ? -10.836 2.432   -8.618  1.00 0.00 ? 19  VAL A O    6  
ATOM   5326  C  CB   . VAL A 1 19 ? -13.541 2.339   -7.432  1.00 0.00 ? 19  VAL A CB   6  
ATOM   5327  C  CG1  . VAL A 1 19 ? -13.030 0.933   -7.157  1.00 0.00 ? 19  VAL A CG1  6  
ATOM   5328  C  CG2  . VAL A 1 19 ? -14.800 2.624   -6.626  1.00 0.00 ? 19  VAL A CG2  6  
ATOM   5329  H  H    . VAL A 1 19 ? -12.770 4.614   -8.808  1.00 0.00 ? 19  VAL A H    6  
ATOM   5330  H  HA   . VAL A 1 19 ? -12.480 3.592   -6.058  1.00 0.00 ? 19  VAL A HA   6  
ATOM   5331  H  HB   . VAL A 1 19 ? -13.787 2.410   -8.481  1.00 0.00 ? 19  VAL A HB   6  
ATOM   5332  H  HG11 . VAL A 1 19 ? -12.693 0.866   -6.133  1.00 0.00 ? 19  VAL A HG11 6  
ATOM   5333  H  HG12 . VAL A 1 19 ? -13.826 0.221   -7.323  1.00 0.00 ? 19  VAL A HG12 6  
ATOM   5334  H  HG13 . VAL A 1 19 ? -12.206 0.714   -7.821  1.00 0.00 ? 19  VAL A HG13 6  
ATOM   5335  H  HG21 . VAL A 1 19 ? -14.920 1.865   -5.868  1.00 0.00 ? 19  VAL A HG21 6  
ATOM   5336  H  HG22 . VAL A 1 19 ? -14.714 3.593   -6.155  1.00 0.00 ? 19  VAL A HG22 6  
ATOM   5337  H  HG23 . VAL A 1 19 ? -15.657 2.618   -7.282  1.00 0.00 ? 19  VAL A HG23 6  
ATOM   5338  N  N    . ILE A 1 20 ? -10.212 2.713   -6.474  1.00 0.00 ? 20  ILE A N    6  
ATOM   5339  C  CA   . ILE A 1 20 ? -8.875  2.171   -6.678  1.00 0.00 ? 20  ILE A CA   6  
ATOM   5340  C  C    . ILE A 1 20 ? -8.857  0.660   -6.479  1.00 0.00 ? 20  ILE A C    6  
ATOM   5341  O  O    . ILE A 1 20 ? -8.993  0.168   -5.359  1.00 0.00 ? 20  ILE A O    6  
ATOM   5342  C  CB   . ILE A 1 20 ? -7.854  2.816   -5.721  1.00 0.00 ? 20  ILE A CB   6  
ATOM   5343  C  CG1  . ILE A 1 20 ? -8.062  4.331   -5.665  1.00 0.00 ? 20  ILE A CG1  6  
ATOM   5344  C  CG2  . ILE A 1 20 ? -6.435  2.487   -6.160  1.00 0.00 ? 20  ILE A CG2  6  
ATOM   5345  C  CD1  . ILE A 1 20 ? -7.789  5.028   -6.979  1.00 0.00 ? 20  ILE A CD1  6  
ATOM   5346  H  H    . ILE A 1 20 ? -10.472 3.021   -5.581  1.00 0.00 ? 20  ILE A H    6  
ATOM   5347  H  HA   . ILE A 1 20 ? -8.577  2.394   -7.693  1.00 0.00 ? 20  ILE A HA   6  
ATOM   5348  H  HB   . ILE A 1 20 ? -8.006  2.402   -4.737  1.00 0.00 ? 20  ILE A HB   6  
ATOM   5349  H  HG12 . ILE A 1 20 ? -9.083  4.538   -5.386  1.00 0.00 ? 20  ILE A HG12 6  
ATOM   5350  H  HG13 . ILE A 1 20 ? -7.399  4.750   -4.922  1.00 0.00 ? 20  ILE A HG13 6  
ATOM   5351  H  HG21 . ILE A 1 20 ? -6.465  1.909   -7.072  1.00 0.00 ? 20  ILE A HG21 6  
ATOM   5352  H  HG22 . ILE A 1 20 ? -5.891  3.403   -6.334  1.00 0.00 ? 20  ILE A HG22 6  
ATOM   5353  H  HG23 . ILE A 1 20 ? -5.943  1.915   -5.388  1.00 0.00 ? 20  ILE A HG23 6  
ATOM   5354  H  HD11 . ILE A 1 20 ? -6.730  4.997   -7.190  1.00 0.00 ? 20  ILE A HD11 6  
ATOM   5355  H  HD12 . ILE A 1 20 ? -8.330  4.531   -7.770  1.00 0.00 ? 20  ILE A HD12 6  
ATOM   5356  H  HD13 . ILE A 1 20 ? -8.111  6.058   -6.914  1.00 0.00 ? 20  ILE A HD13 6  
ATOM   5357  N  N    . LYS A 1 21 ? -8.686  -0.074  -7.574  1.00 0.00 ? 21  LYS A N    6  
ATOM   5358  C  CA   . LYS A 1 21 ? -8.647  -1.530  -7.521  1.00 0.00 ? 21  LYS A CA   6  
ATOM   5359  C  C    . LYS A 1 21 ? -7.240  -2.025  -7.202  1.00 0.00 ? 21  LYS A C    6  
ATOM   5360  O  O    . LYS A 1 21 ? -6.300  -1.783  -7.958  1.00 0.00 ? 21  LYS A O    6  
ATOM   5361  C  CB   . LYS A 1 21 ? -9.118  -2.122  -8.851  1.00 0.00 ? 21  LYS A CB   6  
ATOM   5362  C  CG   . LYS A 1 21 ? -10.625 -2.076  -9.038  1.00 0.00 ? 21  LYS A CG   6  
ATOM   5363  C  CD   . LYS A 1 21 ? -11.293 -3.330  -8.500  1.00 0.00 ? 21  LYS A CD   6  
ATOM   5364  C  CE   . LYS A 1 21 ? -12.735 -3.063  -8.097  1.00 0.00 ? 21  LYS A CE   6  
ATOM   5365  N  NZ   . LYS A 1 21 ? -13.675 -3.262  -9.235  1.00 0.00 ? 21  LYS A NZ   6  
ATOM   5366  H  H    . LYS A 1 21 ? -8.584  0.376   -8.439  1.00 0.00 ? 21  LYS A H    6  
ATOM   5367  H  HA   . LYS A 1 21 ? -9.316  -1.852  -6.737  1.00 0.00 ? 21  LYS A HA   6  
ATOM   5368  H  HB2  . LYS A 1 21 ? -8.659  -1.572  -9.659  1.00 0.00 ? 21  LYS A HB2  6  
ATOM   5369  H  HB3  . LYS A 1 21 ? -8.802  -3.154  -8.904  1.00 0.00 ? 21  LYS A HB3  6  
ATOM   5370  H  HG2  . LYS A 1 21 ? -11.017 -1.218  -8.513  1.00 0.00 ? 21  LYS A HG2  6  
ATOM   5371  H  HG3  . LYS A 1 21 ? -10.845 -1.986  -10.093 1.00 0.00 ? 21  LYS A HG3  6  
ATOM   5372  H  HD2  . LYS A 1 21 ? -11.279 -4.091  -9.265  1.00 0.00 ? 21  LYS A HD2  6  
ATOM   5373  H  HD3  . LYS A 1 21 ? -10.745 -3.676  -7.635  1.00 0.00 ? 21  LYS A HD3  6  
ATOM   5374  H  HE2  . LYS A 1 21 ? -13.003 -3.739  -7.299  1.00 0.00 ? 21  LYS A HE2  6  
ATOM   5375  H  HE3  . LYS A 1 21 ? -12.815 -2.045  -7.748  1.00 0.00 ? 21  LYS A HE3  6  
ATOM   5376  H  HZ1  . LYS A 1 21 ? -13.208 -3.013  -10.131 1.00 0.00 ? 21  LYS A HZ1  6  
ATOM   5377  H  HZ2  . LYS A 1 21 ? -14.513 -2.658  -9.116  1.00 0.00 ? 21  LYS A HZ2  6  
ATOM   5378  H  HZ3  . LYS A 1 21 ? -13.978 -4.255  -9.279  1.00 0.00 ? 21  LYS A HZ3  6  
ATOM   5379  N  N    . ALA A 1 22 ? -7.103  -2.722  -6.078  1.00 0.00 ? 22  ALA A N    6  
ATOM   5380  C  CA   . ALA A 1 22 ? -5.812  -3.254  -5.662  1.00 0.00 ? 22  ALA A CA   6  
ATOM   5381  C  C    . ALA A 1 22 ? -5.985  -4.451  -4.733  1.00 0.00 ? 22  ALA A C    6  
ATOM   5382  O  O    . ALA A 1 22 ? -7.058  -4.659  -4.167  1.00 0.00 ? 22  ALA A O    6  
ATOM   5383  C  CB   . ALA A 1 22 ? -4.989  -2.170  -4.982  1.00 0.00 ? 22  ALA A CB   6  
ATOM   5384  H  H    . ALA A 1 22 ? -7.890  -2.883  -5.517  1.00 0.00 ? 22  ALA A H    6  
ATOM   5385  H  HA   . ALA A 1 22 ? -5.281  -3.572  -6.547  1.00 0.00 ? 22  ALA A HA   6  
ATOM   5386  H  HB1  . ALA A 1 22 ? -3.958  -2.251  -5.295  1.00 0.00 ? 22  ALA A HB1  6  
ATOM   5387  H  HB2  . ALA A 1 22 ? -5.374  -1.200  -5.257  1.00 0.00 ? 22  ALA A HB2  6  
ATOM   5388  H  HB3  . ALA A 1 22 ? -5.050  -2.291  -3.910  1.00 0.00 ? 22  ALA A HB3  6  
ATOM   5389  N  N    . MET A 1 23 ? -4.922  -5.235  -4.581  1.00 0.00 ? 23  MET A N    6  
ATOM   5390  C  CA   . MET A 1 23 ? -4.958  -6.411  -3.720  1.00 0.00 ? 23  MET A CA   6  
ATOM   5391  C  C    . MET A 1 23 ? -6.257  -7.187  -3.912  1.00 0.00 ? 23  MET A C    6  
ATOM   5392  O  O    . MET A 1 23 ? -6.720  -7.876  -3.004  1.00 0.00 ? 23  MET A O    6  
ATOM   5393  C  CB   . MET A 1 23 ? -4.808  -6.001  -2.254  1.00 0.00 ? 23  MET A CB   6  
ATOM   5394  C  CG   . MET A 1 23 ? -3.665  -5.029  -2.008  1.00 0.00 ? 23  MET A CG   6  
ATOM   5395  S  SD   . MET A 1 23 ? -3.378  -4.723  -0.254  1.00 0.00 ? 23  MET A SD   6  
ATOM   5396  C  CE   . MET A 1 23 ? -1.794  -5.529  -0.025  1.00 0.00 ? 23  MET A CE   6  
ATOM   5397  H  H    . MET A 1 23 ? -4.095  -5.017  -5.058  1.00 0.00 ? 23  MET A H    6  
ATOM   5398  H  HA   . MET A 1 23 ? -4.129  -7.046  -3.993  1.00 0.00 ? 23  MET A HA   6  
ATOM   5399  H  HB2  . MET A 1 23 ? -5.725  -5.533  -1.927  1.00 0.00 ? 23  MET A HB2  6  
ATOM   5400  H  HB3  . MET A 1 23 ? -4.633  -6.885  -1.660  1.00 0.00 ? 23  MET A HB3  6  
ATOM   5401  H  HG2  . MET A 1 23 ? -2.763  -5.438  -2.439  1.00 0.00 ? 23  MET A HG2  6  
ATOM   5402  H  HG3  . MET A 1 23 ? -3.898  -4.091  -2.490  1.00 0.00 ? 23  MET A HG3  6  
ATOM   5403  H  HE1  . MET A 1 23 ? -1.715  -6.367  -0.702  1.00 0.00 ? 23  MET A HE1  6  
ATOM   5404  H  HE2  . MET A 1 23 ? -1.000  -4.825  -0.229  1.00 0.00 ? 23  MET A HE2  6  
ATOM   5405  H  HE3  . MET A 1 23 ? -1.713  -5.879  0.993   1.00 0.00 ? 23  MET A HE3  6  
ATOM   5406  N  N    . ASN A 1 24 ? -6.840  -7.069  -5.101  1.00 0.00 ? 24  ASN A N    6  
ATOM   5407  C  CA   . ASN A 1 24 ? -8.087  -7.760  -5.412  1.00 0.00 ? 24  ASN A CA   6  
ATOM   5408  C  C    . ASN A 1 24 ? -9.243  -7.189  -4.596  1.00 0.00 ? 24  ASN A C    6  
ATOM   5409  O  O    . ASN A 1 24 ? -10.089 -7.929  -4.097  1.00 0.00 ? 24  ASN A O    6  
ATOM   5410  C  CB   . ASN A 1 24 ? -7.946  -9.258  -5.138  1.00 0.00 ? 24  ASN A CB   6  
ATOM   5411  C  CG   . ASN A 1 24 ? -6.649  -9.826  -5.681  1.00 0.00 ? 24  ASN A CG   6  
ATOM   5412  O  OD1  . ASN A 1 24 ? -5.879  -10.452 -4.952  1.00 0.00 ? 24  ASN A OD1  6  
ATOM   5413  N  ND2  . ASN A 1 24 ? -6.401  -9.609  -6.967  1.00 0.00 ? 24  ASN A ND2  6  
ATOM   5414  H  H    . ASN A 1 24 ? -6.423  -6.505  -5.785  1.00 0.00 ? 24  ASN A H    6  
ATOM   5415  H  HA   . ASN A 1 24 ? -8.295  -7.612  -6.461  1.00 0.00 ? 24  ASN A HA   6  
ATOM   5416  H  HB2  . ASN A 1 24 ? -7.972  -9.427  -4.071  1.00 0.00 ? 24  ASN A HB2  6  
ATOM   5417  H  HB3  . ASN A 1 24 ? -8.769  -9.782  -5.601  1.00 0.00 ? 24  ASN A HB3  6  
ATOM   5418  H  HD21 . ASN A 1 24 ? -7.059  -9.102  -7.487  1.00 0.00 ? 24  ASN A HD21 6  
ATOM   5419  H  HD22 . ASN A 1 24 ? -5.570  -9.965  -7.344  1.00 0.00 ? 24  ASN A HD22 6  
ATOM   5420  N  N    . ASN A 1 25 ? -9.272  -5.866  -4.465  1.00 0.00 ? 25  ASN A N    6  
ATOM   5421  C  CA   . ASN A 1 25 ? -10.323 -5.195  -3.710  1.00 0.00 ? 25  ASN A CA   6  
ATOM   5422  C  C    . ASN A 1 25 ? -10.373 -3.709  -4.049  1.00 0.00 ? 25  ASN A C    6  
ATOM   5423  O  O    . ASN A 1 25 ? -9.411  -3.150  -4.576  1.00 0.00 ? 25  ASN A O    6  
ATOM   5424  C  CB   . ASN A 1 25 ? -10.099 -5.380  -2.208  1.00 0.00 ? 25  ASN A CB   6  
ATOM   5425  C  CG   . ASN A 1 25 ? -10.486 -6.767  -1.732  1.00 0.00 ? 25  ASN A CG   6  
ATOM   5426  O  OD1  . ASN A 1 25 ? -11.505 -7.317  -2.150  1.00 0.00 ? 25  ASN A OD1  6  
ATOM   5427  N  ND2  . ASN A 1 25 ? -9.672  -7.339  -0.852  1.00 0.00 ? 25  ASN A ND2  6  
ATOM   5428  H  H    . ASN A 1 25 ? -8.568  -5.329  -4.886  1.00 0.00 ? 25  ASN A H    6  
ATOM   5429  H  HA   . ASN A 1 25 ? -11.266 -5.646  -3.982  1.00 0.00 ? 25  ASN A HA   6  
ATOM   5430  H  HB2  . ASN A 1 25 ? -9.054  -5.223  -1.985  1.00 0.00 ? 25  ASN A HB2  6  
ATOM   5431  H  HB3  . ASN A 1 25 ? -10.691 -4.656  -1.669  1.00 0.00 ? 25  ASN A HB3  6  
ATOM   5432  H  HD21 . ASN A 1 25 ? -8.879  -6.841  -0.563  1.00 0.00 ? 25  ASN A HD21 6  
ATOM   5433  H  HD22 . ASN A 1 25 ? -9.898  -8.235  -0.528  1.00 0.00 ? 25  ASN A HD22 6  
ATOM   5434  N  N    . SER A 1 26 ? -11.500 -3.075  -3.743  1.00 0.00 ? 26  SER A N    6  
ATOM   5435  C  CA   . SER A 1 26 ? -11.677 -1.653  -4.018  1.00 0.00 ? 26  SER A CA   6  
ATOM   5436  C  C    . SER A 1 26 ? -11.217 -0.810  -2.833  1.00 0.00 ? 26  SER A C    6  
ATOM   5437  O  O    . SER A 1 26 ? -11.374 -1.205  -1.677  1.00 0.00 ? 26  SER A O    6  
ATOM   5438  C  CB   . SER A 1 26 ? -13.143 -1.352  -4.335  1.00 0.00 ? 26  SER A CB   6  
ATOM   5439  O  OG   . SER A 1 26 ? -13.969 -1.600  -3.210  1.00 0.00 ? 26  SER A OG   6  
ATOM   5440  H  H    . SER A 1 26 ? -12.231 -3.575  -3.324  1.00 0.00 ? 26  SER A H    6  
ATOM   5441  H  HA   . SER A 1 26 ? -11.073 -1.405  -4.878  1.00 0.00 ? 26  SER A HA   6  
ATOM   5442  H  HB2  . SER A 1 26 ? -13.242 -0.315  -4.617  1.00 0.00 ? 26  SER A HB2  6  
ATOM   5443  H  HB3  . SER A 1 26 ? -13.468 -1.980  -5.151  1.00 0.00 ? 26  SER A HB3  6  
ATOM   5444  H  HG   . SER A 1 26 ? -13.836 -2.501  -2.907  1.00 0.00 ? 26  SER A HG   6  
ATOM   5445  N  N    . TRP A 1 27 ? -10.648 0.354   -3.128  1.00 0.00 ? 27  TRP A N    6  
ATOM   5446  C  CA   . TRP A 1 27 ? -10.165 1.254   -2.088  1.00 0.00 ? 27  TRP A CA   6  
ATOM   5447  C  C    . TRP A 1 27 ? -10.299 2.710   -2.523  1.00 0.00 ? 27  TRP A C    6  
ATOM   5448  O  O    . TRP A 1 27 ? -10.630 2.996   -3.674  1.00 0.00 ? 27  TRP A O    6  
ATOM   5449  C  CB   . TRP A 1 27 ? -8.706  0.941   -1.751  1.00 0.00 ? 27  TRP A CB   6  
ATOM   5450  C  CG   . TRP A 1 27 ? -8.411  -0.527  -1.697  1.00 0.00 ? 27  TRP A CG   6  
ATOM   5451  C  CD1  . TRP A 1 27 ? -8.611  -1.440  -2.692  1.00 0.00 ? 27  TRP A CD1  6  
ATOM   5452  C  CD2  . TRP A 1 27 ? -7.864  -1.251  -0.589  1.00 0.00 ? 27  TRP A CD2  6  
ATOM   5453  N  NE1  . TRP A 1 27 ? -8.221  -2.689  -2.269  1.00 0.00 ? 27  TRP A NE1  6  
ATOM   5454  C  CE2  . TRP A 1 27 ? -7.759  -2.599  -0.983  1.00 0.00 ? 27  TRP A CE2  6  
ATOM   5455  C  CE3  . TRP A 1 27 ? -7.452  -0.891  0.697   1.00 0.00 ? 27  TRP A CE3  6  
ATOM   5456  C  CZ2  . TRP A 1 27 ? -7.260  -3.585  -0.136  1.00 0.00 ? 27  TRP A CZ2  6  
ATOM   5457  C  CZ3  . TRP A 1 27 ? -6.957  -1.871  1.536   1.00 0.00 ? 27  TRP A CZ3  6  
ATOM   5458  C  CH2  . TRP A 1 27 ? -6.863  -3.204  1.117   1.00 0.00 ? 27  TRP A CH2  6  
ATOM   5459  H  H    . TRP A 1 27 ? -10.551 0.613   -4.069  1.00 0.00 ? 27  TRP A H    6  
ATOM   5460  H  HA   . TRP A 1 27 ? -10.770 1.097   -1.207  1.00 0.00 ? 27  TRP A HA   6  
ATOM   5461  H  HB2  . TRP A 1 27 ? -8.067  1.382   -2.502  1.00 0.00 ? 27  TRP A HB2  6  
ATOM   5462  H  HB3  . TRP A 1 27 ? -8.468  1.366   -0.787  1.00 0.00 ? 27  TRP A HB3  6  
ATOM   5463  H  HD1  . TRP A 1 27 ? -9.018  -1.203  -3.663  1.00 0.00 ? 27  TRP A HD1  6  
ATOM   5464  H  HE1  . TRP A 1 27 ? -8.266  -3.509  -2.804  1.00 0.00 ? 27  TRP A HE1  6  
ATOM   5465  H  HE3  . TRP A 1 27 ? -7.516  0.132   1.038   1.00 0.00 ? 27  TRP A HE3  6  
ATOM   5466  H  HZ2  . TRP A 1 27 ? -7.181  -4.617  -0.445  1.00 0.00 ? 27  TRP A HZ2  6  
ATOM   5467  H  HZ3  . TRP A 1 27 ? -6.634  -1.611  2.534   1.00 0.00 ? 27  TRP A HZ3  6  
ATOM   5468  H  HH2  . TRP A 1 27 ? -6.471  -3.936  1.806   1.00 0.00 ? 27  TRP A HH2  6  
ATOM   5469  N  N    . HIS A 1 28 ? -10.039 3.626   -1.595  1.00 0.00 ? 28  HIS A N    6  
ATOM   5470  C  CA   . HIS A 1 28 ? -10.130 5.053   -1.884  1.00 0.00 ? 28  HIS A CA   6  
ATOM   5471  C  C    . HIS A 1 28 ? -8.809  5.580   -2.437  1.00 0.00 ? 28  HIS A C    6  
ATOM   5472  O  O    . HIS A 1 28 ? -7.744  5.002   -2.224  1.00 0.00 ? 28  HIS A O    6  
ATOM   5473  C  CB   . HIS A 1 28 ? -10.513 5.827   -0.622  1.00 0.00 ? 28  HIS A CB   6  
ATOM   5474  C  CG   . HIS A 1 28 ? -11.959 5.696   -0.256  1.00 0.00 ? 28  HIS A CG   6  
ATOM   5475  N  ND1  . HIS A 1 28 ? -12.386 5.175   0.948   1.00 0.00 ? 28  HIS A ND1  6  
ATOM   5476  C  CD2  . HIS A 1 28 ? -13.080 6.023   -0.941  1.00 0.00 ? 28  HIS A CD2  6  
ATOM   5477  C  CE1  . HIS A 1 28 ? -13.707 5.186   0.986   1.00 0.00 ? 28  HIS A CE1  6  
ATOM   5478  N  NE2  . HIS A 1 28 ? -14.152 5.696   -0.148  1.00 0.00 ? 28  HIS A NE2  6  
ATOM   5479  H  H    . HIS A 1 28 ? -9.780  3.336   -0.696  1.00 0.00 ? 28  HIS A H    6  
ATOM   5480  H  HA   . HIS A 1 28 ? -10.899 5.192   -2.629  1.00 0.00 ? 28  HIS A HA   6  
ATOM   5481  H  HB2  . HIS A 1 28 ? -9.926  5.462   0.208   1.00 0.00 ? 28  HIS A HB2  6  
ATOM   5482  H  HB3  . HIS A 1 28 ? -10.302 6.876   -0.773  1.00 0.00 ? 28  HIS A HB3  6  
ATOM   5483  H  HD2  . HIS A 1 28 ? -13.123 6.459   -1.929  1.00 0.00 ? 28  HIS A HD2  6  
ATOM   5484  H  HE1  . HIS A 1 28 ? -14.318 4.837   1.805   1.00 0.00 ? 28  HIS A HE1  6  
ATOM   5485  H  HE2  . HIS A 1 28 ? -15.093 5.740   -0.415  1.00 0.00 ? 28  HIS A HE2  6  
ATOM   5486  N  N    . PRO A 1 29 ? -8.879  6.704   -3.166  1.00 0.00 ? 29  PRO A N    6  
ATOM   5487  C  CA   . PRO A 1 29 ? -7.698  7.334   -3.764  1.00 0.00 ? 29  PRO A CA   6  
ATOM   5488  C  C    . PRO A 1 29 ? -6.778  7.953   -2.718  1.00 0.00 ? 29  PRO A C    6  
ATOM   5489  O  O    . PRO A 1 29 ? -5.728  8.503   -3.050  1.00 0.00 ? 29  PRO A O    6  
ATOM   5490  C  CB   . PRO A 1 29 ? -8.293  8.421   -4.663  1.00 0.00 ? 29  PRO A CB   6  
ATOM   5491  C  CG   . PRO A 1 29 ? -9.615  8.736   -4.052  1.00 0.00 ? 29  PRO A CG   6  
ATOM   5492  C  CD   . PRO A 1 29 ? -10.115 7.447   -3.460  1.00 0.00 ? 29  PRO A CD   6  
ATOM   5493  H  HA   . PRO A 1 29 ? -7.138  6.634   -4.366  1.00 0.00 ? 29  PRO A HA   6  
ATOM   5494  H  HB2  . PRO A 1 29 ? -7.643  9.284   -4.667  1.00 0.00 ? 29  PRO A HB2  6  
ATOM   5495  H  HB3  . PRO A 1 29 ? -8.404  8.042   -5.668  1.00 0.00 ? 29  PRO A HB3  6  
ATOM   5496  H  HG2  . PRO A 1 29 ? -9.494  9.481   -3.280  1.00 0.00 ? 29  PRO A HG2  6  
ATOM   5497  H  HG3  . PRO A 1 29 ? -10.296 9.089   -4.812  1.00 0.00 ? 29  PRO A HG3  6  
ATOM   5498  H  HD2  . PRO A 1 29 ? -10.675 7.639   -2.557  1.00 0.00 ? 29  PRO A HD2  6  
ATOM   5499  H  HD3  . PRO A 1 29 ? -10.723 6.915   -4.177  1.00 0.00 ? 29  PRO A HD3  6  
ATOM   5500  N  N    . GLU A 1 30 ? -7.178  7.858   -1.454  1.00 0.00 ? 30  GLU A N    6  
ATOM   5501  C  CA   . GLU A 1 30 ? -6.388  8.409   -0.359  1.00 0.00 ? 30  GLU A CA   6  
ATOM   5502  C  C    . GLU A 1 30 ? -6.065  7.334   0.674   1.00 0.00 ? 30  GLU A C    6  
ATOM   5503  O  O    . GLU A 1 30 ? -5.042  7.400   1.357   1.00 0.00 ? 30  GLU A O    6  
ATOM   5504  C  CB   . GLU A 1 30 ? -7.136  9.565   0.308   1.00 0.00 ? 30  GLU A CB   6  
ATOM   5505  C  CG   . GLU A 1 30 ? -8.372  9.128   1.076   1.00 0.00 ? 30  GLU A CG   6  
ATOM   5506  C  CD   . GLU A 1 30 ? -8.750  10.101  2.176   1.00 0.00 ? 30  GLU A CD   6  
ATOM   5507  O  OE1  . GLU A 1 30 ? -9.129  11.246  1.852   1.00 0.00 ? 30  GLU A OE1  6  
ATOM   5508  O  OE2  . GLU A 1 30 ? -8.667  9.717   3.361   1.00 0.00 ? 30  GLU A OE2  6  
ATOM   5509  H  H    . GLU A 1 30 ? -8.025  7.407   -1.253  1.00 0.00 ? 30  GLU A H    6  
ATOM   5510  H  HA   . GLU A 1 30 ? -5.463  8.783   -0.773  1.00 0.00 ? 30  GLU A HA   6  
ATOM   5511  H  HB2  . GLU A 1 30 ? -6.467  10.063  0.994   1.00 0.00 ? 30  GLU A HB2  6  
ATOM   5512  H  HB3  . GLU A 1 30 ? -7.442  10.267  -0.454  1.00 0.00 ? 30  GLU A HB3  6  
ATOM   5513  H  HG2  . GLU A 1 30 ? -9.199  9.048   0.387   1.00 0.00 ? 30  GLU A HG2  6  
ATOM   5514  H  HG3  . GLU A 1 30 ? -8.181  8.162   1.520   1.00 0.00 ? 30  GLU A HG3  6  
ATOM   5515  N  N    . CYS A 1 31 ? -6.945  6.345   0.785   1.00 0.00 ? 31  CYS A N    6  
ATOM   5516  C  CA   . CYS A 1 31 ? -6.757  5.255   1.735   1.00 0.00 ? 31  CYS A CA   6  
ATOM   5517  C  C    . CYS A 1 31 ? -5.573  4.381   1.332   1.00 0.00 ? 31  CYS A C    6  
ATOM   5518  O  O    . CYS A 1 31 ? -4.591  4.271   2.066   1.00 0.00 ? 31  CYS A O    6  
ATOM   5519  C  CB   . CYS A 1 31 ? -8.025  4.405   1.826   1.00 0.00 ? 31  CYS A CB   6  
ATOM   5520  S  SG   . CYS A 1 31 ? -9.313  5.104   2.908   1.00 0.00 ? 31  CYS A SG   6  
ATOM   5521  H  H    . CYS A 1 31 ? -7.742  6.348   0.213   1.00 0.00 ? 31  CYS A H    6  
ATOM   5522  H  HA   . CYS A 1 31 ? -6.555  5.690   2.702   1.00 0.00 ? 31  CYS A HA   6  
ATOM   5523  H  HB2  . CYS A 1 31 ? -8.450  4.299   0.838   1.00 0.00 ? 31  CYS A HB2  6  
ATOM   5524  H  HB3  . CYS A 1 31 ? -7.768  3.428   2.208   1.00 0.00 ? 31  CYS A HB3  6  
ATOM   5525  N  N    . PHE A 1 32 ? -5.673  3.762   0.161   1.00 0.00 ? 32  PHE A N    6  
ATOM   5526  C  CA   . PHE A 1 32 ? -4.612  2.897   -0.340  1.00 0.00 ? 32  PHE A CA   6  
ATOM   5527  C  C    . PHE A 1 32 ? -3.257  3.595   -0.259  1.00 0.00 ? 32  PHE A C    6  
ATOM   5528  O  O    . PHE A 1 32 ? -2.851  4.293   -1.188  1.00 0.00 ? 32  PHE A O    6  
ATOM   5529  C  CB   . PHE A 1 32 ? -4.900  2.484   -1.785  1.00 0.00 ? 32  PHE A CB   6  
ATOM   5530  C  CG   . PHE A 1 32 ? -4.172  1.241   -2.210  1.00 0.00 ? 32  PHE A CG   6  
ATOM   5531  C  CD1  . PHE A 1 32 ? -4.312  0.062   -1.496  1.00 0.00 ? 32  PHE A CD1  6  
ATOM   5532  C  CD2  . PHE A 1 32 ? -3.348  1.252   -3.324  1.00 0.00 ? 32  PHE A CD2  6  
ATOM   5533  C  CE1  . PHE A 1 32 ? -3.643  -1.083  -1.885  1.00 0.00 ? 32  PHE A CE1  6  
ATOM   5534  C  CE2  . PHE A 1 32 ? -2.677  0.109   -3.718  1.00 0.00 ? 32  PHE A CE2  6  
ATOM   5535  C  CZ   . PHE A 1 32 ? -2.825  -1.060  -2.998  1.00 0.00 ? 32  PHE A CZ   6  
ATOM   5536  H  H    . PHE A 1 32 ? -6.481  3.889   -0.380  1.00 0.00 ? 32  PHE A H    6  
ATOM   5537  H  HA   . PHE A 1 32 ? -4.585  2.013   0.279   1.00 0.00 ? 32  PHE A HA   6  
ATOM   5538  H  HB2  . PHE A 1 32 ? -5.958  2.303   -1.896  1.00 0.00 ? 32  PHE A HB2  6  
ATOM   5539  H  HB3  . PHE A 1 32 ? -4.605  3.285   -2.446  1.00 0.00 ? 32  PHE A HB3  6  
ATOM   5540  H  HD1  . PHE A 1 32 ? -4.952  0.042   -0.626  1.00 0.00 ? 32  PHE A HD1  6  
ATOM   5541  H  HD2  . PHE A 1 32 ? -3.232  2.166   -3.889  1.00 0.00 ? 32  PHE A HD2  6  
ATOM   5542  H  HE1  . PHE A 1 32 ? -3.760  -1.996  -1.320  1.00 0.00 ? 32  PHE A HE1  6  
ATOM   5543  H  HE2  . PHE A 1 32 ? -2.038  0.132   -4.589  1.00 0.00 ? 32  PHE A HE2  6  
ATOM   5544  H  HZ   . PHE A 1 32 ? -2.301  -1.953  -3.304  1.00 0.00 ? 32  PHE A HZ   6  
ATOM   5545  N  N    . ARG A 1 33 ? -2.564  3.401   0.858   1.00 0.00 ? 33  ARG A N    6  
ATOM   5546  C  CA   . ARG A 1 33 ? -1.257  4.013   1.062   1.00 0.00 ? 33  ARG A CA   6  
ATOM   5547  C  C    . ARG A 1 33 ? -0.185  2.948   1.275   1.00 0.00 ? 33  ARG A C    6  
ATOM   5548  O  O    . ARG A 1 33 ? -0.494  1.775   1.486   1.00 0.00 ? 33  ARG A O    6  
ATOM   5549  C  CB   . ARG A 1 33 ? -1.295  4.960   2.263   1.00 0.00 ? 33  ARG A CB   6  
ATOM   5550  C  CG   . ARG A 1 33 ? -2.126  6.211   2.025   1.00 0.00 ? 33  ARG A CG   6  
ATOM   5551  C  CD   . ARG A 1 33 ? -1.774  7.310   3.017   1.00 0.00 ? 33  ARG A CD   6  
ATOM   5552  N  NE   . ARG A 1 33 ? -1.973  8.641   2.452   1.00 0.00 ? 33  ARG A NE   6  
ATOM   5553  C  CZ   . ARG A 1 33 ? -3.107  9.325   2.562   1.00 0.00 ? 33  ARG A CZ   6  
ATOM   5554  N  NH1  . ARG A 1 33 ? -4.137  8.805   3.214   1.00 0.00 ? 33  ARG A NH1  6  
ATOM   5555  N  NH2  . ARG A 1 33 ? -3.211  10.532  2.020   1.00 0.00 ? 33  ARG A NH2  6  
ATOM   5556  H  H    . ARG A 1 33 ? -2.942  2.834   1.563   1.00 0.00 ? 33  ARG A H    6  
ATOM   5557  H  HA   . ARG A 1 33 ? -1.014  4.579   0.176   1.00 0.00 ? 33  ARG A HA   6  
ATOM   5558  H  HB2  . ARG A 1 33 ? -1.712  4.434   3.109   1.00 0.00 ? 33  ARG A HB2  6  
ATOM   5559  H  HB3  . ARG A 1 33 ? -0.287  5.264   2.499   1.00 0.00 ? 33  ARG A HB3  6  
ATOM   5560  H  HG2  . ARG A 1 33 ? -1.938  6.572   1.025   1.00 0.00 ? 33  ARG A HG2  6  
ATOM   5561  H  HG3  . ARG A 1 33 ? -3.171  5.963   2.131   1.00 0.00 ? 33  ARG A HG3  6  
ATOM   5562  H  HD2  . ARG A 1 33 ? -2.401  7.202   3.890   1.00 0.00 ? 33  ARG A HD2  6  
ATOM   5563  H  HD3  . ARG A 1 33 ? -0.738  7.200   3.302   1.00 0.00 ? 33  ARG A HD3  6  
ATOM   5564  H  HE   . ARG A 1 33 ? -1.224  9.045   1.966   1.00 0.00 ? 33  ARG A HE   6  
ATOM   5565  H  HH11 . ARG A 1 33 ? -4.061  7.896   3.624   1.00 0.00 ? 33  ARG A HH11 6  
ATOM   5566  H  HH12 . ARG A 1 33 ? -4.989  9.322   3.297   1.00 0.00 ? 33  ARG A HH12 6  
ATOM   5567  H  HH21 . ARG A 1 33 ? -2.436  10.927  1.528   1.00 0.00 ? 33  ARG A HH21 6  
ATOM   5568  H  HH22 . ARG A 1 33 ? -4.064  11.045  2.104   1.00 0.00 ? 33  ARG A HH22 6  
ATOM   5569  N  N    . CYS A 1 34 ? 1.075   3.365   1.218   1.00 0.00 ? 34  CYS A N    6  
ATOM   5570  C  CA   . CYS A 1 34 ? 2.193   2.448   1.404   1.00 0.00 ? 34  CYS A CA   6  
ATOM   5571  C  C    . CYS A 1 34 ? 2.187   1.860   2.812   1.00 0.00 ? 34  CYS A C    6  
ATOM   5572  O  O    . CYS A 1 34 ? 1.600   2.431   3.731   1.00 0.00 ? 34  CYS A O    6  
ATOM   5573  C  CB   . CYS A 1 34 ? 3.518   3.167   1.145   1.00 0.00 ? 34  CYS A CB   6  
ATOM   5574  S  SG   . CYS A 1 34 ? 4.956   2.055   1.019   1.00 0.00 ? 34  CYS A SG   6  
ATOM   5575  H  H    . CYS A 1 34 ? 1.258   4.313   1.047   1.00 0.00 ? 34  CYS A H    6  
ATOM   5576  H  HA   . CYS A 1 34 ? 2.085   1.644   0.691   1.00 0.00 ? 34  CYS A HA   6  
ATOM   5577  H  HB2  . CYS A 1 34 ? 3.446   3.716   0.218   1.00 0.00 ? 34  CYS A HB2  6  
ATOM   5578  H  HB3  . CYS A 1 34 ? 3.707   3.859   1.953   1.00 0.00 ? 34  CYS A HB3  6  
ATOM   5579  N  N    . ASP A 1 35 ? 2.845   0.717   2.973   1.00 0.00 ? 35  ASP A N    6  
ATOM   5580  C  CA   . ASP A 1 35 ? 2.917   0.052   4.269   1.00 0.00 ? 35  ASP A CA   6  
ATOM   5581  C  C    . ASP A 1 35 ? 4.259   0.318   4.942   1.00 0.00 ? 35  ASP A C    6  
ATOM   5582  O  O    . ASP A 1 35 ? 4.603   -0.319  5.939   1.00 0.00 ? 35  ASP A O    6  
ATOM   5583  C  CB   . ASP A 1 35 ? 2.703   -1.454  4.106   1.00 0.00 ? 35  ASP A CB   6  
ATOM   5584  C  CG   . ASP A 1 35 ? 2.065   -2.083  5.328   1.00 0.00 ? 35  ASP A CG   6  
ATOM   5585  O  OD1  . ASP A 1 35 ? 2.642   -1.960  6.429   1.00 0.00 ? 35  ASP A OD1  6  
ATOM   5586  O  OD2  . ASP A 1 35 ? 0.988   -2.700  5.184   1.00 0.00 ? 35  ASP A OD2  6  
ATOM   5587  H  H    . ASP A 1 35 ? 3.293   0.311   2.202   1.00 0.00 ? 35  ASP A H    6  
ATOM   5588  H  HA   . ASP A 1 35 ? 2.131   0.452   4.891   1.00 0.00 ? 35  ASP A HA   6  
ATOM   5589  H  HB2  . ASP A 1 35 ? 2.060   -1.630  3.256   1.00 0.00 ? 35  ASP A HB2  6  
ATOM   5590  H  HB3  . ASP A 1 35 ? 3.658   -1.929  3.935   1.00 0.00 ? 35  ASP A HB3  6  
ATOM   5591  N  N    . LEU A 1 36 ? 5.014   1.262   4.392   1.00 0.00 ? 36  LEU A N    6  
ATOM   5592  C  CA   . LEU A 1 36 ? 6.321   1.613   4.938   1.00 0.00 ? 36  LEU A CA   6  
ATOM   5593  C  C    . LEU A 1 36 ? 6.458   3.124   5.096   1.00 0.00 ? 36  LEU A C    6  
ATOM   5594  O  O    . LEU A 1 36 ? 7.099   3.605   6.031   1.00 0.00 ? 36  LEU A O    6  
ATOM   5595  C  CB   . LEU A 1 36 ? 7.434   1.080   4.034   1.00 0.00 ? 36  LEU A CB   6  
ATOM   5596  C  CG   . LEU A 1 36 ? 7.583   -0.441  3.978   1.00 0.00 ? 36  LEU A CG   6  
ATOM   5597  C  CD1  . LEU A 1 36 ? 8.232   -0.865  2.669   1.00 0.00 ? 36  LEU A CD1  6  
ATOM   5598  C  CD2  . LEU A 1 36 ? 8.393   -0.941  5.164   1.00 0.00 ? 36  LEU A CD2  6  
ATOM   5599  H  H    . LEU A 1 36 ? 4.687   1.736   3.599   1.00 0.00 ? 36  LEU A H    6  
ATOM   5600  H  HA   . LEU A 1 36 ? 6.407   1.152   5.911   1.00 0.00 ? 36  LEU A HA   6  
ATOM   5601  H  HB2  . LEU A 1 36 ? 7.241   1.430   3.031   1.00 0.00 ? 36  LEU A HB2  6  
ATOM   5602  H  HB3  . LEU A 1 36 ? 8.369   1.493   4.384   1.00 0.00 ? 36  LEU A HB3  6  
ATOM   5603  H  HG   . LEU A 1 36 ? 6.602   -0.894  4.026   1.00 0.00 ? 36  LEU A HG   6  
ATOM   5604  H  HD11 . LEU A 1 36 ? 8.188   -1.940  2.578   1.00 0.00 ? 36  LEU A HD11 6  
ATOM   5605  H  HD12 . LEU A 1 36 ? 9.263   -0.544  2.658   1.00 0.00 ? 36  LEU A HD12 6  
ATOM   5606  H  HD13 . LEU A 1 36 ? 7.705   -0.412  1.842   1.00 0.00 ? 36  LEU A HD13 6  
ATOM   5607  H  HD21 . LEU A 1 36 ? 9.419   -0.619  5.061   1.00 0.00 ? 36  LEU A HD21 6  
ATOM   5608  H  HD22 . LEU A 1 36 ? 8.357   -2.021  5.195   1.00 0.00 ? 36  LEU A HD22 6  
ATOM   5609  H  HD23 . LEU A 1 36 ? 7.980   -0.540  6.077   1.00 0.00 ? 36  LEU A HD23 6  
ATOM   5610  N  N    . CYS A 1 37 ? 5.849   3.867   4.178   1.00 0.00 ? 37  CYS A N    6  
ATOM   5611  C  CA   . CYS A 1 37 ? 5.901   5.323   4.215   1.00 0.00 ? 37  CYS A CA   6  
ATOM   5612  C  C    . CYS A 1 37 ? 4.495   5.918   4.212   1.00 0.00 ? 37  CYS A C    6  
ATOM   5613  O  O    . CYS A 1 37 ? 4.319   7.119   4.410   1.00 0.00 ? 37  CYS A O    6  
ATOM   5614  C  CB   . CYS A 1 37 ? 6.695   5.857   3.021   1.00 0.00 ? 37  CYS A CB   6  
ATOM   5615  S  SG   . CYS A 1 37 ? 5.875   5.611   1.413   1.00 0.00 ? 37  CYS A SG   6  
ATOM   5616  H  H    . CYS A 1 37 ? 5.353   3.425   3.457   1.00 0.00 ? 37  CYS A H    6  
ATOM   5617  H  HA   . CYS A 1 37 ? 6.399   5.615   5.127   1.00 0.00 ? 37  CYS A HA   6  
ATOM   5618  H  HB2  . CYS A 1 37 ? 6.853   6.918   3.150   1.00 0.00 ? 37  CYS A HB2  6  
ATOM   5619  H  HB3  . CYS A 1 37 ? 7.652   5.358   2.983   1.00 0.00 ? 37  CYS A HB3  6  
ATOM   5620  N  N    . GLN A 1 38 ? 3.499   5.067   3.986   1.00 0.00 ? 38  GLN A N    6  
ATOM   5621  C  CA   . GLN A 1 38 ? 2.110   5.508   3.957   1.00 0.00 ? 38  GLN A CA   6  
ATOM   5622  C  C    . GLN A 1 38 ? 1.898   6.567   2.881   1.00 0.00 ? 38  GLN A C    6  
ATOM   5623  O  O    . GLN A 1 38 ? 1.406   7.660   3.161   1.00 0.00 ? 38  GLN A O    6  
ATOM   5624  C  CB   . GLN A 1 38 ? 1.700   6.062   5.322   1.00 0.00 ? 38  GLN A CB   6  
ATOM   5625  C  CG   . GLN A 1 38 ? 1.923   5.087   6.467   1.00 0.00 ? 38  GLN A CG   6  
ATOM   5626  C  CD   . GLN A 1 38 ? 0.711   4.217   6.737   1.00 0.00 ? 38  GLN A CD   6  
ATOM   5627  O  OE1  . GLN A 1 38 ? -0.190  4.601   7.482   1.00 0.00 ? 38  GLN A OE1  6  
ATOM   5628  N  NE2  . GLN A 1 38 ? 0.683   3.036   6.130   1.00 0.00 ? 38  GLN A NE2  6  
ATOM   5629  H  H    . GLN A 1 38 ? 3.704   4.121   3.835   1.00 0.00 ? 38  GLN A H    6  
ATOM   5630  H  HA   . GLN A 1 38 ? 1.495   4.651   3.727   1.00 0.00 ? 38  GLN A HA   6  
ATOM   5631  H  HB2  . GLN A 1 38 ? 2.273   6.955   5.522   1.00 0.00 ? 38  GLN A HB2  6  
ATOM   5632  H  HB3  . GLN A 1 38 ? 0.650   6.316   5.294   1.00 0.00 ? 38  GLN A HB3  6  
ATOM   5633  H  HG2  . GLN A 1 38 ? 2.758   4.447   6.221   1.00 0.00 ? 38  GLN A HG2  6  
ATOM   5634  H  HG3  . GLN A 1 38 ? 2.152   5.647   7.361   1.00 0.00 ? 38  GLN A HG3  6  
ATOM   5635  H  HE21 . GLN A 1 38 ? 1.437   2.795   5.551   1.00 0.00 ? 38  GLN A HE21 6  
ATOM   5636  H  HE22 . GLN A 1 38 ? -0.088  2.453   6.287   1.00 0.00 ? 38  GLN A HE22 6  
ATOM   5637  N  N    . GLU A 1 39 ? 2.272   6.236   1.649   1.00 0.00 ? 39  GLU A N    6  
ATOM   5638  C  CA   . GLU A 1 39 ? 2.124   7.161   0.531   1.00 0.00 ? 39  GLU A CA   6  
ATOM   5639  C  C    . GLU A 1 39 ? 1.011   6.704   -0.408  1.00 0.00 ? 39  GLU A C    6  
ATOM   5640  O  O    . GLU A 1 39 ? 0.973   5.547   -0.828  1.00 0.00 ? 39  GLU A O    6  
ATOM   5641  C  CB   . GLU A 1 39 ? 3.440   7.280   -0.240  1.00 0.00 ? 39  GLU A CB   6  
ATOM   5642  C  CG   . GLU A 1 39 ? 3.302   7.993   -1.574  1.00 0.00 ? 39  GLU A CG   6  
ATOM   5643  C  CD   . GLU A 1 39 ? 4.567   8.725   -1.978  1.00 0.00 ? 39  GLU A CD   6  
ATOM   5644  O  OE1  . GLU A 1 39 ? 5.186   9.368   -1.104  1.00 0.00 ? 39  GLU A OE1  6  
ATOM   5645  O  OE2  . GLU A 1 39 ? 4.938   8.655   -3.168  1.00 0.00 ? 39  GLU A OE2  6  
ATOM   5646  H  H    . GLU A 1 39 ? 2.658   5.350   1.488   1.00 0.00 ? 39  GLU A H    6  
ATOM   5647  H  HA   . GLU A 1 39 ? 1.864   8.128   0.933   1.00 0.00 ? 39  GLU A HA   6  
ATOM   5648  H  HB2  . GLU A 1 39 ? 4.150   7.824   0.365   1.00 0.00 ? 39  GLU A HB2  6  
ATOM   5649  H  HB3  . GLU A 1 39 ? 3.826   6.288   -0.425  1.00 0.00 ? 39  GLU A HB3  6  
ATOM   5650  H  HG2  . GLU A 1 39 ? 3.068   7.264   -2.335  1.00 0.00 ? 39  GLU A HG2  6  
ATOM   5651  H  HG3  . GLU A 1 39 ? 2.496   8.709   -1.503  1.00 0.00 ? 39  GLU A HG3  6  
ATOM   5652  N  N    . VAL A 1 40 ? 0.106   7.622   -0.734  1.00 0.00 ? 40  VAL A N    6  
ATOM   5653  C  CA   . VAL A 1 40 ? -1.007  7.315   -1.624  1.00 0.00 ? 40  VAL A CA   6  
ATOM   5654  C  C    . VAL A 1 40 ? -0.531  6.564   -2.862  1.00 0.00 ? 40  VAL A C    6  
ATOM   5655  O  O    . VAL A 1 40 ? 0.202   7.108   -3.688  1.00 0.00 ? 40  VAL A O    6  
ATOM   5656  C  CB   . VAL A 1 40 ? -1.742  8.595   -2.065  1.00 0.00 ? 40  VAL A CB   6  
ATOM   5657  C  CG1  . VAL A 1 40 ? -2.898  8.255   -2.993  1.00 0.00 ? 40  VAL A CG1  6  
ATOM   5658  C  CG2  . VAL A 1 40 ? -2.232  9.372   -0.853  1.00 0.00 ? 40  VAL A CG2  6  
ATOM   5659  H  H    . VAL A 1 40 ? 0.190   8.527   -0.368  1.00 0.00 ? 40  VAL A H    6  
ATOM   5660  H  HA   . VAL A 1 40 ? -1.705  6.693   -1.083  1.00 0.00 ? 40  VAL A HA   6  
ATOM   5661  H  HB   . VAL A 1 40 ? -1.045  9.217   -2.608  1.00 0.00 ? 40  VAL A HB   6  
ATOM   5662  H  HG11 . VAL A 1 40 ? -3.525  7.509   -2.527  1.00 0.00 ? 40  VAL A HG11 6  
ATOM   5663  H  HG12 . VAL A 1 40 ? -3.478  9.145   -3.189  1.00 0.00 ? 40  VAL A HG12 6  
ATOM   5664  H  HG13 . VAL A 1 40 ? -2.509  7.866   -3.924  1.00 0.00 ? 40  VAL A HG13 6  
ATOM   5665  H  HG21 . VAL A 1 40 ? -3.037  8.830   -0.379  1.00 0.00 ? 40  VAL A HG21 6  
ATOM   5666  H  HG22 . VAL A 1 40 ? -1.420  9.496   -0.151  1.00 0.00 ? 40  VAL A HG22 6  
ATOM   5667  H  HG23 . VAL A 1 40 ? -2.587  10.343  -1.166  1.00 0.00 ? 40  VAL A HG23 6  
ATOM   5668  N  N    . LEU A 1 41 ? -0.952  5.310   -2.984  1.00 0.00 ? 41  LEU A N    6  
ATOM   5669  C  CA   . LEU A 1 41 ? -0.569  4.481   -4.122  1.00 0.00 ? 41  LEU A CA   6  
ATOM   5670  C  C    . LEU A 1 41 ? -1.718  4.361   -5.119  1.00 0.00 ? 41  LEU A C    6  
ATOM   5671  O  O    . LEU A 1 41 ? -2.017  3.271   -5.606  1.00 0.00 ? 41  LEU A O    6  
ATOM   5672  C  CB   . LEU A 1 41 ? -0.144  3.091   -3.646  1.00 0.00 ? 41  LEU A CB   6  
ATOM   5673  C  CG   . LEU A 1 41 ? 0.581   3.035   -2.301  1.00 0.00 ? 41  LEU A CG   6  
ATOM   5674  C  CD1  . LEU A 1 41 ? 0.545   1.625   -1.734  1.00 0.00 ? 41  LEU A CD1  6  
ATOM   5675  C  CD2  . LEU A 1 41 ? 2.018   3.516   -2.449  1.00 0.00 ? 41  LEU A CD2  6  
ATOM   5676  H  H    . LEU A 1 41 ? -1.534  4.931   -2.293  1.00 0.00 ? 41  LEU A H    6  
ATOM   5677  H  HA   . LEU A 1 41 ? 0.267   4.957   -4.611  1.00 0.00 ? 41  LEU A HA   6  
ATOM   5678  H  HB2  . LEU A 1 41 ? -1.031  2.482   -3.569  1.00 0.00 ? 41  LEU A HB2  6  
ATOM   5679  H  HB3  . LEU A 1 41 ? 0.514   2.673   -4.395  1.00 0.00 ? 41  LEU A HB3  6  
ATOM   5680  H  HG   . LEU A 1 41 ? 0.080   3.689   -1.601  1.00 0.00 ? 41  LEU A HG   6  
ATOM   5681  H  HD11 . LEU A 1 41 ? 0.262   0.931   -2.511  1.00 0.00 ? 41  LEU A HD11 6  
ATOM   5682  H  HD12 . LEU A 1 41 ? -0.175  1.579   -0.930  1.00 0.00 ? 41  LEU A HD12 6  
ATOM   5683  H  HD13 . LEU A 1 41 ? 1.523   1.364   -1.355  1.00 0.00 ? 41  LEU A HD13 6  
ATOM   5684  H  HD21 . LEU A 1 41 ? 2.495   2.979   -3.256  1.00 0.00 ? 41  LEU A HD21 6  
ATOM   5685  H  HD22 . LEU A 1 41 ? 2.555   3.334   -1.529  1.00 0.00 ? 41  LEU A HD22 6  
ATOM   5686  H  HD23 . LEU A 1 41 ? 2.023   4.573   -2.667  1.00 0.00 ? 41  LEU A HD23 6  
ATOM   5687  N  N    . ALA A 1 42 ? -2.356  5.488   -5.418  1.00 0.00 ? 42  ALA A N    6  
ATOM   5688  C  CA   . ALA A 1 42 ? -3.468  5.509   -6.359  1.00 0.00 ? 42  ALA A CA   6  
ATOM   5689  C  C    . ALA A 1 42 ? -2.986  5.819   -7.772  1.00 0.00 ? 42  ALA A C    6  
ATOM   5690  O  O    . ALA A 1 42 ? -3.321  5.112   -8.722  1.00 0.00 ? 42  ALA A O    6  
ATOM   5691  C  CB   . ALA A 1 42 ? -4.512  6.526   -5.920  1.00 0.00 ? 42  ALA A CB   6  
ATOM   5692  H  H    . ALA A 1 42 ? -2.070  6.325   -4.996  1.00 0.00 ? 42  ALA A H    6  
ATOM   5693  H  HA   . ALA A 1 42 ? -3.929  4.531   -6.354  1.00 0.00 ? 42  ALA A HA   6  
ATOM   5694  H  HB1  . ALA A 1 42 ? -5.253  6.036   -5.306  1.00 0.00 ? 42  ALA A HB1  6  
ATOM   5695  H  HB2  . ALA A 1 42 ? -4.033  7.310   -5.353  1.00 0.00 ? 42  ALA A HB2  6  
ATOM   5696  H  HB3  . ALA A 1 42 ? -4.988  6.950   -6.791  1.00 0.00 ? 42  ALA A HB3  6  
ATOM   5697  N  N    . ASP A 1 43 ? -2.198  6.881   -7.903  1.00 0.00 ? 43  ASP A N    6  
ATOM   5698  C  CA   . ASP A 1 43 ? -1.669  7.285   -9.201  1.00 0.00 ? 43  ASP A CA   6  
ATOM   5699  C  C    . ASP A 1 43 ? -0.252  6.757   -9.398  1.00 0.00 ? 43  ASP A C    6  
ATOM   5700  O  O    . ASP A 1 43 ? 0.058   6.151   -10.424 1.00 0.00 ? 43  ASP A O    6  
ATOM   5701  C  CB   . ASP A 1 43 ? -1.682  8.809   -9.329  1.00 0.00 ? 43  ASP A CB   6  
ATOM   5702  C  CG   . ASP A 1 43 ? -1.845  9.268   -10.764 1.00 0.00 ? 43  ASP A CG   6  
ATOM   5703  O  OD1  . ASP A 1 43 ? -2.976  9.190   -11.288 1.00 0.00 ? 43  ASP A OD1  6  
ATOM   5704  O  OD2  . ASP A 1 43 ? -0.841  9.707   -11.364 1.00 0.00 ? 43  ASP A OD2  6  
ATOM   5705  H  H    . ASP A 1 43 ? -1.966  7.405   -7.108  1.00 0.00 ? 43  ASP A H    6  
ATOM   5706  H  HA   . ASP A 1 43 ? -2.306  6.864   -9.964  1.00 0.00 ? 43  ASP A HA   6  
ATOM   5707  H  HB2  . ASP A 1 43 ? -2.502  9.206   -8.748  1.00 0.00 ? 43  ASP A HB2  6  
ATOM   5708  H  HB3  . ASP A 1 43 ? -0.752  9.203   -8.946  1.00 0.00 ? 43  ASP A HB3  6  
ATOM   5709  N  N    . ILE A 1 44 ? 0.604   6.992   -8.409  1.00 0.00 ? 44  ILE A N    6  
ATOM   5710  C  CA   . ILE A 1 44 ? 1.989   6.540   -8.475  1.00 0.00 ? 44  ILE A CA   6  
ATOM   5711  C  C    . ILE A 1 44 ? 2.065   5.028   -8.652  1.00 0.00 ? 44  ILE A C    6  
ATOM   5712  O  O    . ILE A 1 44 ? 3.015   4.508   -9.237  1.00 0.00 ? 44  ILE A O    6  
ATOM   5713  C  CB   . ILE A 1 44 ? 2.771   6.938   -7.209  1.00 0.00 ? 44  ILE A CB   6  
ATOM   5714  C  CG1  . ILE A 1 44 ? 2.171   6.256   -5.977  1.00 0.00 ? 44  ILE A CG1  6  
ATOM   5715  C  CG2  . ILE A 1 44 ? 2.769   8.450   -7.038  1.00 0.00 ? 44  ILE A CG2  6  
ATOM   5716  C  CD1  . ILE A 1 44 ? 3.042   6.361   -4.745  1.00 0.00 ? 44  ILE A CD1  6  
ATOM   5717  H  H    . ILE A 1 44 ? 0.298   7.480   -7.617  1.00 0.00 ? 44  ILE A H    6  
ATOM   5718  H  HA   . ILE A 1 44 ? 2.454   7.016   -9.326  1.00 0.00 ? 44  ILE A HA   6  
ATOM   5719  H  HB   . ILE A 1 44 ? 3.794   6.615   -7.328  1.00 0.00 ? 44  ILE A HB   6  
ATOM   5720  H  HG12 . ILE A 1 44 ? 1.220   6.709   -5.750  1.00 0.00 ? 44  ILE A HG12 6  
ATOM   5721  H  HG13 . ILE A 1 44 ? 2.024   5.207   -6.192  1.00 0.00 ? 44  ILE A HG13 6  
ATOM   5722  H  HG21 . ILE A 1 44 ? 2.179   8.713   -6.172  1.00 0.00 ? 44  ILE A HG21 6  
ATOM   5723  H  HG22 . ILE A 1 44 ? 3.782   8.797   -6.902  1.00 0.00 ? 44  ILE A HG22 6  
ATOM   5724  H  HG23 . ILE A 1 44 ? 2.343   8.911   -7.916  1.00 0.00 ? 44  ILE A HG23 6  
ATOM   5725  H  HD11 . ILE A 1 44 ? 2.451   6.144   -3.867  1.00 0.00 ? 44  ILE A HD11 6  
ATOM   5726  H  HD12 . ILE A 1 44 ? 3.855   5.655   -4.816  1.00 0.00 ? 44  ILE A HD12 6  
ATOM   5727  H  HD13 . ILE A 1 44 ? 3.440   7.363   -4.670  1.00 0.00 ? 44  ILE A HD13 6  
ATOM   5728  N  N    . GLY A 1 45 ? 1.057   4.326   -8.144  1.00 0.00 ? 45  GLY A N    6  
ATOM   5729  C  CA   . GLY A 1 45 ? 1.029   2.879   -8.258  1.00 0.00 ? 45  GLY A CA   6  
ATOM   5730  C  C    . GLY A 1 45 ? 1.499   2.189   -6.993  1.00 0.00 ? 45  GLY A C    6  
ATOM   5731  O  O    . GLY A 1 45 ? 1.998   2.836   -6.073  1.00 0.00 ? 45  GLY A O    6  
ATOM   5732  H  H    . GLY A 1 45 ? 0.327   4.794   -7.688  1.00 0.00 ? 45  GLY A H    6  
ATOM   5733  H  HA2  . GLY A 1 45 ? 0.018   2.566   -8.473  1.00 0.00 ? 45  GLY A HA2  6  
ATOM   5734  H  HA3  . GLY A 1 45 ? 1.668   2.581   -9.076  1.00 0.00 ? 45  GLY A HA3  6  
ATOM   5735  N  N    . PHE A 1 46 ? 1.338   0.870   -6.946  1.00 0.00 ? 46  PHE A N    6  
ATOM   5736  C  CA   . PHE A 1 46 ? 1.747   0.091   -5.783  1.00 0.00 ? 46  PHE A CA   6  
ATOM   5737  C  C    . PHE A 1 46 ? 2.484   -1.175  -6.209  1.00 0.00 ? 46  PHE A C    6  
ATOM   5738  O  O    . PHE A 1 46 ? 2.475   -1.548  -7.382  1.00 0.00 ? 46  PHE A O    6  
ATOM   5739  C  CB   . PHE A 1 46 ? 0.528   -0.275  -4.934  1.00 0.00 ? 46  PHE A CB   6  
ATOM   5740  C  CG   . PHE A 1 46 ? -0.372  -1.288  -5.582  1.00 0.00 ? 46  PHE A CG   6  
ATOM   5741  C  CD1  . PHE A 1 46 ? -1.077  -0.972  -6.732  1.00 0.00 ? 46  PHE A CD1  6  
ATOM   5742  C  CD2  . PHE A 1 46 ? -0.513  -2.556  -5.041  1.00 0.00 ? 46  PHE A CD2  6  
ATOM   5743  C  CE1  . PHE A 1 46 ? -1.906  -1.901  -7.332  1.00 0.00 ? 46  PHE A CE1  6  
ATOM   5744  C  CE2  . PHE A 1 46 ? -1.340  -3.489  -5.636  1.00 0.00 ? 46  PHE A CE2  6  
ATOM   5745  C  CZ   . PHE A 1 46 ? -2.038  -3.162  -6.782  1.00 0.00 ? 46  PHE A CZ   6  
ATOM   5746  H  H    . PHE A 1 46 ? 0.933   0.410   -7.711  1.00 0.00 ? 46  PHE A H    6  
ATOM   5747  H  HA   . PHE A 1 46 ? 2.415   0.701   -5.195  1.00 0.00 ? 46  PHE A HA   6  
ATOM   5748  H  HB2  . PHE A 1 46 ? 0.864   -0.685  -3.993  1.00 0.00 ? 46  PHE A HB2  6  
ATOM   5749  H  HB3  . PHE A 1 46 ? -0.052  0.616   -4.747  1.00 0.00 ? 46  PHE A HB3  6  
ATOM   5750  H  HD1  . PHE A 1 46 ? -0.974  0.014   -7.163  1.00 0.00 ? 46  PHE A HD1  6  
ATOM   5751  H  HD2  . PHE A 1 46 ? 0.031   -2.813  -4.144  1.00 0.00 ? 46  PHE A HD2  6  
ATOM   5752  H  HE1  . PHE A 1 46 ? -2.450  -1.642  -8.228  1.00 0.00 ? 46  PHE A HE1  6  
ATOM   5753  H  HE2  . PHE A 1 46 ? -1.443  -4.474  -5.205  1.00 0.00 ? 46  PHE A HE2  6  
ATOM   5754  H  HZ   . PHE A 1 46 ? -2.685  -3.889  -7.249  1.00 0.00 ? 46  PHE A HZ   6  
ATOM   5755  N  N    . VAL A 1 47 ? 3.122   -1.833  -5.246  1.00 0.00 ? 47  VAL A N    6  
ATOM   5756  C  CA   . VAL A 1 47 ? 3.864   -3.058  -5.520  1.00 0.00 ? 47  VAL A CA   6  
ATOM   5757  C  C    . VAL A 1 47 ? 3.558   -4.130  -4.479  1.00 0.00 ? 47  VAL A C    6  
ATOM   5758  O  O    . VAL A 1 47 ? 4.001   -4.043  -3.334  1.00 0.00 ? 47  VAL A O    6  
ATOM   5759  C  CB   . VAL A 1 47 ? 5.382   -2.801  -5.545  1.00 0.00 ? 47  VAL A CB   6  
ATOM   5760  C  CG1  . VAL A 1 47 ? 6.132   -4.065  -5.938  1.00 0.00 ? 47  VAL A CG1  6  
ATOM   5761  C  CG2  . VAL A 1 47 ? 5.713   -1.659  -6.494  1.00 0.00 ? 47  VAL A CG2  6  
ATOM   5762  H  H    . VAL A 1 47 ? 3.093   -1.487  -4.330  1.00 0.00 ? 47  VAL A H    6  
ATOM   5763  H  HA   . VAL A 1 47 ? 3.565   -3.420  -6.493  1.00 0.00 ? 47  VAL A HA   6  
ATOM   5764  H  HB   . VAL A 1 47 ? 5.696   -2.518  -4.551  1.00 0.00 ? 47  VAL A HB   6  
ATOM   5765  H  HG11 . VAL A 1 47 ? 6.611   -4.485  -5.066  1.00 0.00 ? 47  VAL A HG11 6  
ATOM   5766  H  HG12 . VAL A 1 47 ? 5.437   -4.783  -6.349  1.00 0.00 ? 47  VAL A HG12 6  
ATOM   5767  H  HG13 . VAL A 1 47 ? 6.880   -3.824  -6.678  1.00 0.00 ? 47  VAL A HG13 6  
ATOM   5768  H  HG21 . VAL A 1 47 ? 6.727   -1.331  -6.321  1.00 0.00 ? 47  VAL A HG21 6  
ATOM   5769  H  HG22 . VAL A 1 47 ? 5.613   -1.998  -7.515  1.00 0.00 ? 47  VAL A HG22 6  
ATOM   5770  H  HG23 . VAL A 1 47 ? 5.034   -0.838  -6.320  1.00 0.00 ? 47  VAL A HG23 6  
ATOM   5771  N  N    . LYS A 1 48 ? 2.799   -5.142  -4.886  1.00 0.00 ? 48  LYS A N    6  
ATOM   5772  C  CA   . LYS A 1 48 ? 2.434   -6.233  -3.990  1.00 0.00 ? 48  LYS A CA   6  
ATOM   5773  C  C    . LYS A 1 48 ? 3.675   -6.969  -3.496  1.00 0.00 ? 48  LYS A C    6  
ATOM   5774  O  O    . LYS A 1 48 ? 4.428   -7.536  -4.287  1.00 0.00 ? 48  LYS A O    6  
ATOM   5775  C  CB   . LYS A 1 48 ? 1.497   -7.212  -4.701  1.00 0.00 ? 48  LYS A CB   6  
ATOM   5776  C  CG   . LYS A 1 48 ? 0.024   -6.899  -4.500  1.00 0.00 ? 48  LYS A CG   6  
ATOM   5777  C  CD   . LYS A 1 48 ? -0.473  -7.397  -3.153  1.00 0.00 ? 48  LYS A CD   6  
ATOM   5778  C  CE   . LYS A 1 48 ? -0.633  -8.909  -3.143  1.00 0.00 ? 48  LYS A CE   6  
ATOM   5779  N  NZ   . LYS A 1 48 ? -1.738  -9.356  -4.036  1.00 0.00 ? 48  LYS A NZ   6  
ATOM   5780  H  H    . LYS A 1 48 ? 2.476   -5.155  -5.812  1.00 0.00 ? 48  LYS A H    6  
ATOM   5781  H  HA   . LYS A 1 48 ? 1.920   -5.808  -3.141  1.00 0.00 ? 48  LYS A HA   6  
ATOM   5782  H  HB2  . LYS A 1 48 ? 1.707   -7.188  -5.760  1.00 0.00 ? 48  LYS A HB2  6  
ATOM   5783  H  HB3  . LYS A 1 48 ? 1.686   -8.208  -4.327  1.00 0.00 ? 48  LYS A HB3  6  
ATOM   5784  H  HG2  . LYS A 1 48 ? -0.118  -5.830  -4.551  1.00 0.00 ? 48  LYS A HG2  6  
ATOM   5785  H  HG3  . LYS A 1 48 ? -0.546  -7.377  -5.283  1.00 0.00 ? 48  LYS A HG3  6  
ATOM   5786  H  HD2  . LYS A 1 48 ? 0.239   -7.117  -2.390  1.00 0.00 ? 48  LYS A HD2  6  
ATOM   5787  H  HD3  . LYS A 1 48 ? -1.429  -6.940  -2.941  1.00 0.00 ? 48  LYS A HD3  6  
ATOM   5788  H  HE2  . LYS A 1 48 ? 0.290   -9.359  -3.474  1.00 0.00 ? 48  LYS A HE2  6  
ATOM   5789  H  HE3  . LYS A 1 48 ? -0.847  -9.228  -2.133  1.00 0.00 ? 48  LYS A HE3  6  
ATOM   5790  H  HZ1  . LYS A 1 48 ? -2.033  -10.321 -3.784  1.00 0.00 ? 48  LYS A HZ1  6  
ATOM   5791  H  HZ2  . LYS A 1 48 ? -1.421  -9.351  -5.026  1.00 0.00 ? 48  LYS A HZ2  6  
ATOM   5792  H  HZ3  . LYS A 1 48 ? -2.554  -8.719  -3.941  1.00 0.00 ? 48  LYS A HZ3  6  
ATOM   5793  N  N    . ASN A 1 49 ? 3.881   -6.957  -2.183  1.00 0.00 ? 49  ASN A N    6  
ATOM   5794  C  CA   . ASN A 1 49 ? 5.031   -7.624  -1.583  1.00 0.00 ? 49  ASN A CA   6  
ATOM   5795  C  C    . ASN A 1 49 ? 4.692   -8.145  -0.190  1.00 0.00 ? 49  ASN A C    6  
ATOM   5796  O  O    . ASN A 1 49 ? 4.128   -7.425  0.633   1.00 0.00 ? 49  ASN A O    6  
ATOM   5797  C  CB   . ASN A 1 49 ? 6.221   -6.665  -1.506  1.00 0.00 ? 49  ASN A CB   6  
ATOM   5798  C  CG   . ASN A 1 49 ? 7.536   -7.391  -1.300  1.00 0.00 ? 49  ASN A CG   6  
ATOM   5799  O  OD1  . ASN A 1 49 ? 7.669   -8.567  -1.639  1.00 0.00 ? 49  ASN A OD1  6  
ATOM   5800  N  ND2  . ASN A 1 49 ? 8.517   -6.691  -0.742  1.00 0.00 ? 49  ASN A ND2  6  
ATOM   5801  H  H    . ASN A 1 49 ? 3.246   -6.487  -1.603  1.00 0.00 ? 49  ASN A H    6  
ATOM   5802  H  HA   . ASN A 1 49 ? 5.295   -8.460  -2.214  1.00 0.00 ? 49  ASN A HA   6  
ATOM   5803  H  HB2  . ASN A 1 49 ? 6.283   -6.103  -2.427  1.00 0.00 ? 49  ASN A HB2  6  
ATOM   5804  H  HB3  . ASN A 1 49 ? 6.074   -5.983  -0.682  1.00 0.00 ? 49  ASN A HB3  6  
ATOM   5805  H  HD21 . ASN A 1 49 ? 8.340   -5.759  -0.497  1.00 0.00 ? 49  ASN A HD21 6  
ATOM   5806  H  HD22 . ASN A 1 49 ? 9.378   -7.136  -0.597  1.00 0.00 ? 49  ASN A HD22 6  
ATOM   5807  N  N    . ALA A 1 50 ? 5.042   -9.401  0.067   1.00 0.00 ? 50  ALA A N    6  
ATOM   5808  C  CA   . ALA A 1 50 ? 4.778   -10.018 1.361   1.00 0.00 ? 50  ALA A CA   6  
ATOM   5809  C  C    . ALA A 1 50 ? 3.341   -9.766  1.806   1.00 0.00 ? 50  ALA A C    6  
ATOM   5810  O  O    . ALA A 1 50 ? 3.063   -9.644  2.998   1.00 0.00 ? 50  ALA A O    6  
ATOM   5811  C  CB   . ALA A 1 50 ? 5.755   -9.496  2.404   1.00 0.00 ? 50  ALA A CB   6  
ATOM   5812  H  H    . ALA A 1 50 ? 5.490   -9.925  -0.629  1.00 0.00 ? 50  ALA A H    6  
ATOM   5813  H  HA   . ALA A 1 50 ? 4.932   -11.083 1.261   1.00 0.00 ? 50  ALA A HA   6  
ATOM   5814  H  HB1  . ALA A 1 50 ? 6.731   -9.380  1.956   1.00 0.00 ? 50  ALA A HB1  6  
ATOM   5815  H  HB2  . ALA A 1 50 ? 5.411   -8.540  2.772   1.00 0.00 ? 50  ALA A HB2  6  
ATOM   5816  H  HB3  . ALA A 1 50 ? 5.816   -10.197 3.223   1.00 0.00 ? 50  ALA A HB3  6  
ATOM   5817  N  N    . GLY A 1 51 ? 2.432   -9.688  0.839   1.00 0.00 ? 51  GLY A N    6  
ATOM   5818  C  CA   . GLY A 1 51 ? 1.035   -9.450  1.152   1.00 0.00 ? 51  GLY A CA   6  
ATOM   5819  C  C    . GLY A 1 51 ? 0.788   -8.049  1.674   1.00 0.00 ? 51  GLY A C    6  
ATOM   5820  O  O    . GLY A 1 51 ? -0.122  -7.828  2.473   1.00 0.00 ? 51  GLY A O    6  
ATOM   5821  H  H    . GLY A 1 51 ? 2.712   -9.793  -0.094  1.00 0.00 ? 51  GLY A H    6  
ATOM   5822  H  HA2  . GLY A 1 51 ? 0.447   -9.599  0.259   1.00 0.00 ? 51  GLY A HA2  6  
ATOM   5823  H  HA3  . GLY A 1 51 ? 0.719   -10.162 1.901   1.00 0.00 ? 51  GLY A HA3  6  
ATOM   5824  N  N    . ARG A 1 52 ? 1.602   -7.099  1.224   1.00 0.00 ? 52  ARG A N    6  
ATOM   5825  C  CA   . ARG A 1 52 ? 1.470   -5.713  1.654   1.00 0.00 ? 52  ARG A CA   6  
ATOM   5826  C  C    . ARG A 1 52 ? 1.598   -4.761  0.467   1.00 0.00 ? 52  ARG A C    6  
ATOM   5827  O  O    . ARG A 1 52 ? 2.311   -5.046  -0.496  1.00 0.00 ? 52  ARG A O    6  
ATOM   5828  C  CB   . ARG A 1 52 ? 2.529   -5.379  2.705   1.00 0.00 ? 52  ARG A CB   6  
ATOM   5829  C  CG   . ARG A 1 52 ? 2.448   -6.249  3.949   1.00 0.00 ? 52  ARG A CG   6  
ATOM   5830  C  CD   . ARG A 1 52 ? 3.710   -6.137  4.790   1.00 0.00 ? 52  ARG A CD   6  
ATOM   5831  N  NE   . ARG A 1 52 ? 3.828   -7.234  5.747   1.00 0.00 ? 52  ARG A NE   6  
ATOM   5832  C  CZ   . ARG A 1 52 ? 4.599   -7.186  6.828   1.00 0.00 ? 52  ARG A CZ   6  
ATOM   5833  N  NH1  . ARG A 1 52 ? 5.314   -6.101  7.089   1.00 0.00 ? 52  ARG A NH1  6  
ATOM   5834  N  NH2  . ARG A 1 52 ? 4.654   -8.225  7.652   1.00 0.00 ? 52  ARG A NH2  6  
ATOM   5835  H  H    . ARG A 1 52 ? 2.309   -7.337  0.588   1.00 0.00 ? 52  ARG A H    6  
ATOM   5836  H  HA   . ARG A 1 52 ? 0.490   -5.593  2.092   1.00 0.00 ? 52  ARG A HA   6  
ATOM   5837  H  HB2  . ARG A 1 52 ? 3.508   -5.506  2.267   1.00 0.00 ? 52  ARG A HB2  6  
ATOM   5838  H  HB3  . ARG A 1 52 ? 2.409   -4.348  3.005   1.00 0.00 ? 52  ARG A HB3  6  
ATOM   5839  H  HG2  . ARG A 1 52 ? 1.603   -5.933  4.544   1.00 0.00 ? 52  ARG A HG2  6  
ATOM   5840  H  HG3  . ARG A 1 52 ? 2.315   -7.277  3.649   1.00 0.00 ? 52  ARG A HG3  6  
ATOM   5841  H  HD2  . ARG A 1 52 ? 4.567   -6.151  4.133   1.00 0.00 ? 52  ARG A HD2  6  
ATOM   5842  H  HD3  . ARG A 1 52 ? 3.685   -5.202  5.330   1.00 0.00 ? 52  ARG A HD3  6  
ATOM   5843  H  HE   . ARG A 1 52 ? 3.308   -8.046  5.574   1.00 0.00 ? 52  ARG A HE   6  
ATOM   5844  H  HH11 . ARG A 1 52 ? 5.274   -5.316  6.471   1.00 0.00 ? 52  ARG A HH11 6  
ATOM   5845  H  HH12 . ARG A 1 52 ? 5.892   -6.067  7.904   1.00 0.00 ? 52  ARG A HH12 6  
ATOM   5846  H  HH21 . ARG A 1 52 ? 4.116   -9.045  7.458   1.00 0.00 ? 52  ARG A HH21 6  
ATOM   5847  H  HH22 . ARG A 1 52 ? 5.234   -8.189  8.465   1.00 0.00 ? 52  ARG A HH22 6  
ATOM   5848  N  N    . HIS A 1 53 ? 0.902   -3.631  0.544   1.00 0.00 ? 53  HIS A N    6  
ATOM   5849  C  CA   . HIS A 1 53 ? 0.938   -2.638  -0.524  1.00 0.00 ? 53  HIS A CA   6  
ATOM   5850  C  C    . HIS A 1 53 ? 2.037   -1.610  -0.272  1.00 0.00 ? 53  HIS A C    6  
ATOM   5851  O  O    . HIS A 1 53 ? 1.960   -0.821  0.670   1.00 0.00 ? 53  HIS A O    6  
ATOM   5852  C  CB   . HIS A 1 53 ? -0.415  -1.936  -0.642  1.00 0.00 ? 53  HIS A CB   6  
ATOM   5853  C  CG   . HIS A 1 53 ? -0.916  -1.378  0.654   1.00 0.00 ? 53  HIS A CG   6  
ATOM   5854  N  ND1  . HIS A 1 53 ? -0.174  -1.393  1.817   1.00 0.00 ? 53  HIS A ND1  6  
ATOM   5855  C  CD2  . HIS A 1 53 ? -2.091  -0.785  0.968   1.00 0.00 ? 53  HIS A CD2  6  
ATOM   5856  C  CE1  . HIS A 1 53 ? -0.872  -0.834  2.789   1.00 0.00 ? 53  HIS A CE1  6  
ATOM   5857  N  NE2  . HIS A 1 53 ? -2.039  -0.456  2.300   1.00 0.00 ? 53  HIS A NE2  6  
ATOM   5858  H  H    . HIS A 1 53 ? 0.352   -3.461  1.336   1.00 0.00 ? 53  HIS A H    6  
ATOM   5859  H  HA   . HIS A 1 53 ? 1.149   -3.153  -1.449  1.00 0.00 ? 53  HIS A HA   6  
ATOM   5860  H  HB2  . HIS A 1 53 ? -0.330  -1.119  -1.343  1.00 0.00 ? 53  HIS A HB2  6  
ATOM   5861  H  HB3  . HIS A 1 53 ? -1.149  -2.641  -1.006  1.00 0.00 ? 53  HIS A HB3  6  
ATOM   5862  H  HD1  . HIS A 1 53 ? 0.729   -1.760  1.914   1.00 0.00 ? 53  HIS A HD1  6  
ATOM   5863  H  HD2  . HIS A 1 53 ? -2.918  -0.603  0.295   1.00 0.00 ? 53  HIS A HD2  6  
ATOM   5864  H  HE1  . HIS A 1 53 ? -0.545  -0.708  3.810   1.00 0.00 ? 53  HIS A HE1  6  
ATOM   5865  H  HE2  . HIS A 1 53 ? -2.781  -0.093  2.827   1.00 0.00 ? 53  HIS A HE2  6  
ATOM   5866  N  N    . LEU A 1 54 ? 3.060   -1.625  -1.120  1.00 0.00 ? 54  LEU A N    6  
ATOM   5867  C  CA   . LEU A 1 54 ? 4.176   -0.695  -0.990  1.00 0.00 ? 54  LEU A CA   6  
ATOM   5868  C  C    . LEU A 1 54 ? 4.335   0.145   -2.253  1.00 0.00 ? 54  LEU A C    6  
ATOM   5869  O  O    . LEU A 1 54 ? 3.749   -0.160  -3.293  1.00 0.00 ? 54  LEU A O    6  
ATOM   5870  C  CB   . LEU A 1 54 ? 5.470   -1.457  -0.704  1.00 0.00 ? 54  LEU A CB   6  
ATOM   5871  C  CG   . LEU A 1 54 ? 5.325   -2.747  0.105   1.00 0.00 ? 54  LEU A CG   6  
ATOM   5872  C  CD1  . LEU A 1 54 ? 6.620   -3.545  0.074   1.00 0.00 ? 54  LEU A CD1  6  
ATOM   5873  C  CD2  . LEU A 1 54 ? 4.923   -2.435  1.539   1.00 0.00 ? 54  LEU A CD2  6  
ATOM   5874  H  H    . LEU A 1 54 ? 3.065   -2.277  -1.852  1.00 0.00 ? 54  LEU A H    6  
ATOM   5875  H  HA   . LEU A 1 54 ? 3.964   -0.037  -0.160  1.00 0.00 ? 54  LEU A HA   6  
ATOM   5876  H  HB2  . LEU A 1 54 ? 5.921   -1.710  -1.651  1.00 0.00 ? 54  LEU A HB2  6  
ATOM   5877  H  HB3  . LEU A 1 54 ? 6.129   -0.796  -0.159  1.00 0.00 ? 54  LEU A HB3  6  
ATOM   5878  H  HG   . LEU A 1 54 ? 4.548   -3.355  -0.337  1.00 0.00 ? 54  LEU A HG   6  
ATOM   5879  H  HD11 . LEU A 1 54 ? 6.892   -3.748  -0.951  1.00 0.00 ? 54  LEU A HD11 6  
ATOM   5880  H  HD12 . LEU A 1 54 ? 6.481   -4.477  0.601   1.00 0.00 ? 54  LEU A HD12 6  
ATOM   5881  H  HD13 . LEU A 1 54 ? 7.405   -2.976  0.550   1.00 0.00 ? 54  LEU A HD13 6  
ATOM   5882  H  HD21 . LEU A 1 54 ? 4.513   -3.322  1.998   1.00 0.00 ? 54  LEU A HD21 6  
ATOM   5883  H  HD22 . LEU A 1 54 ? 4.179   -1.651  1.541   1.00 0.00 ? 54  LEU A HD22 6  
ATOM   5884  H  HD23 . LEU A 1 54 ? 5.791   -2.110  2.093   1.00 0.00 ? 54  LEU A HD23 6  
ATOM   5885  N  N    . CYS A 1 55 ? 5.133   1.203   -2.158  1.00 0.00 ? 55  CYS A N    6  
ATOM   5886  C  CA   . CYS A 1 55 ? 5.372   2.087   -3.292  1.00 0.00 ? 55  CYS A CA   6  
ATOM   5887  C  C    . CYS A 1 55 ? 6.719   1.785   -3.943  1.00 0.00 ? 55  CYS A C    6  
ATOM   5888  O  O    . CYS A 1 55 ? 7.660   1.356   -3.275  1.00 0.00 ? 55  CYS A O    6  
ATOM   5889  C  CB   . CYS A 1 55 ? 5.326   3.549   -2.845  1.00 0.00 ? 55  CYS A CB   6  
ATOM   5890  S  SG   . CYS A 1 55 ? 6.711   4.042   -1.770  1.00 0.00 ? 55  CYS A SG   6  
ATOM   5891  H  H    . CYS A 1 55 ? 5.572   1.395   -1.302  1.00 0.00 ? 55  CYS A H    6  
ATOM   5892  H  HA   . CYS A 1 55 ? 4.590   1.916   -4.016  1.00 0.00 ? 55  CYS A HA   6  
ATOM   5893  H  HB2  . CYS A 1 55 ? 5.346   4.185   -3.718  1.00 0.00 ? 55  CYS A HB2  6  
ATOM   5894  H  HB3  . CYS A 1 55 ? 4.409   3.723   -2.302  1.00 0.00 ? 55  CYS A HB3  6  
ATOM   5895  N  N    . ARG A 1 56 ? 6.802   2.011   -5.250  1.00 0.00 ? 56  ARG A N    6  
ATOM   5896  C  CA   . ARG A 1 56 ? 8.033   1.763   -5.991  1.00 0.00 ? 56  ARG A CA   6  
ATOM   5897  C  C    . ARG A 1 56 ? 9.255   2.139   -5.158  1.00 0.00 ? 56  ARG A C    6  
ATOM   5898  O  O    . ARG A 1 56 ? 10.189  1.354   -4.992  1.00 0.00 ? 56  ARG A O    6  
ATOM   5899  C  CB   . ARG A 1 56 ? 8.032   2.553   -7.301  1.00 0.00 ? 56  ARG A CB   6  
ATOM   5900  C  CG   . ARG A 1 56 ? 7.620   1.728   -8.510  1.00 0.00 ? 56  ARG A CG   6  
ATOM   5901  C  CD   . ARG A 1 56 ? 8.081   2.372   -9.808  1.00 0.00 ? 56  ARG A CD   6  
ATOM   5902  N  NE   . ARG A 1 56 ? 7.262   1.959   -10.944 1.00 0.00 ? 56  ARG A NE   6  
ATOM   5903  C  CZ   . ARG A 1 56 ? 6.935   2.768   -11.946 1.00 0.00 ? 56  ARG A CZ   6  
ATOM   5904  N  NH1  . ARG A 1 56 ? 7.356   4.025   -11.952 1.00 0.00 ? 56  ARG A NH1  6  
ATOM   5905  N  NH2  . ARG A 1 56 ? 6.187   2.319   -12.946 1.00 0.00 ? 56  ARG A NH2  6  
ATOM   5906  H  H    . ARG A 1 56 ? 6.017   2.353   -5.727  1.00 0.00 ? 56  ARG A H    6  
ATOM   5907  H  HA   . ARG A 1 56 ? 8.077   0.708   -6.217  1.00 0.00 ? 56  ARG A HA   6  
ATOM   5908  H  HB2  . ARG A 1 56 ? 7.347   3.382   -7.208  1.00 0.00 ? 56  ARG A HB2  6  
ATOM   5909  H  HB3  . ARG A 1 56 ? 9.026   2.936   -7.477  1.00 0.00 ? 56  ARG A HB3  6  
ATOM   5910  H  HG2  . ARG A 1 56 ? 8.061   0.745   -8.431  1.00 0.00 ? 56  ARG A HG2  6  
ATOM   5911  H  HG3  . ARG A 1 56 ? 6.543   1.641   -8.523  1.00 0.00 ? 56  ARG A HG3  6  
ATOM   5912  H  HD2  . ARG A 1 56 ? 8.020   3.445   -9.703  1.00 0.00 ? 56  ARG A HD2  6  
ATOM   5913  H  HD3  . ARG A 1 56 ? 9.106   2.086   -9.991  1.00 0.00 ? 56  ARG A HD3  6  
ATOM   5914  H  HE   . ARG A 1 56 ? 6.940   1.034   -10.960 1.00 0.00 ? 56  ARG A HE   6  
ATOM   5915  H  HH11 . ARG A 1 56 ? 7.921   4.366   -11.201 1.00 0.00 ? 56  ARG A HH11 6  
ATOM   5916  H  HH12 . ARG A 1 56 ? 7.110   4.632   -12.709 1.00 0.00 ? 56  ARG A HH12 6  
ATOM   5917  H  HH21 . ARG A 1 56 ? 5.868   1.372   -12.945 1.00 0.00 ? 56  ARG A HH21 6  
ATOM   5918  H  HH22 . ARG A 1 56 ? 5.941   2.928   -13.699 1.00 0.00 ? 56  ARG A HH22 6  
ATOM   5919  N  N    . PRO A 1 57 ? 9.250   3.368   -4.622  1.00 0.00 ? 57  PRO A N    6  
ATOM   5920  C  CA   . PRO A 1 57 ? 10.350  3.877   -3.798  1.00 0.00 ? 57  PRO A CA   6  
ATOM   5921  C  C    . PRO A 1 57 ? 10.775  2.883   -2.722  1.00 0.00 ? 57  PRO A C    6  
ATOM   5922  O  O    . PRO A 1 57 ? 11.907  2.398   -2.722  1.00 0.00 ? 57  PRO A O    6  
ATOM   5923  C  CB   . PRO A 1 57 ? 9.762   5.138   -3.160  1.00 0.00 ? 57  PRO A CB   6  
ATOM   5924  C  CG   . PRO A 1 57 ? 8.705   5.585   -4.109  1.00 0.00 ? 57  PRO A CG   6  
ATOM   5925  C  CD   . PRO A 1 57 ? 8.169   4.357   -4.779  1.00 0.00 ? 57  PRO A CD   6  
ATOM   5926  H  HA   . PRO A 1 57 ? 11.207  4.142   -4.400  1.00 0.00 ? 57  PRO A HA   6  
ATOM   5927  H  HB2  . PRO A 1 57 ? 9.348   4.894   -2.191  1.00 0.00 ? 57  PRO A HB2  6  
ATOM   5928  H  HB3  . PRO A 1 57 ? 10.535  5.884   -3.050  1.00 0.00 ? 57  PRO A HB3  6  
ATOM   5929  H  HG2  . PRO A 1 57 ? 7.913   6.082   -3.569  1.00 0.00 ? 57  PRO A HG2  6  
ATOM   5930  H  HG3  . PRO A 1 57 ? 9.131   6.248   -4.847  1.00 0.00 ? 57  PRO A HG3  6  
ATOM   5931  H  HD2  . PRO A 1 57 ? 7.268   4.025   -4.284  1.00 0.00 ? 57  PRO A HD2  6  
ATOM   5932  H  HD3  . PRO A 1 57 ? 7.978   4.555   -5.823  1.00 0.00 ? 57  PRO A HD3  6  
ATOM   5933  N  N    . CYS A 1 58 ? 9.861   2.585   -1.805  1.00 0.00 ? 58  CYS A N    6  
ATOM   5934  C  CA   . CYS A 1 58 ? 10.141  1.649   -0.722  1.00 0.00 ? 58  CYS A CA   6  
ATOM   5935  C  C    . CYS A 1 58 ? 10.500  0.272   -1.273  1.00 0.00 ? 58  CYS A C    6  
ATOM   5936  O  O    . CYS A 1 58 ? 11.622  -0.205  -1.097  1.00 0.00 ? 58  CYS A O    6  
ATOM   5937  C  CB   . CYS A 1 58 ? 8.932   1.538   0.209   1.00 0.00 ? 58  CYS A CB   6  
ATOM   5938  S  SG   . CYS A 1 58 ? 8.509   3.089   1.066   1.00 0.00 ? 58  CYS A SG   6  
ATOM   5939  H  H    . CYS A 1 58 ? 8.976   3.004   -1.857  1.00 0.00 ? 58  CYS A H    6  
ATOM   5940  H  HA   . CYS A 1 58 ? 10.981  2.030   -0.163  1.00 0.00 ? 58  CYS A HA   6  
ATOM   5941  H  HB2  . CYS A 1 58 ? 8.069   1.237   -0.368  1.00 0.00 ? 58  CYS A HB2  6  
ATOM   5942  H  HB3  . CYS A 1 58 ? 9.134   0.790   0.961   1.00 0.00 ? 58  CYS A HB3  6  
ATOM   5943  N  N    . HIS A 1 59 ? 9.541   -0.361  -1.940  1.00 0.00 ? 59  HIS A N    6  
ATOM   5944  C  CA   . HIS A 1 59 ? 9.757   -1.683  -2.518  1.00 0.00 ? 59  HIS A CA   6  
ATOM   5945  C  C    . HIS A 1 59 ? 11.139  -1.779  -3.156  1.00 0.00 ? 59  HIS A C    6  
ATOM   5946  O  O    . HIS A 1 59 ? 11.834  -2.782  -3.007  1.00 0.00 ? 59  HIS A O    6  
ATOM   5947  C  CB   . HIS A 1 59 ? 8.679   -1.990  -3.558  1.00 0.00 ? 59  HIS A CB   6  
ATOM   5948  C  CG   . HIS A 1 59 ? 8.824   -3.341  -4.189  1.00 0.00 ? 59  HIS A CG   6  
ATOM   5949  N  ND1  . HIS A 1 59 ? 8.716   -4.519  -3.480  1.00 0.00 ? 59  HIS A ND1  6  
ATOM   5950  C  CD2  . HIS A 1 59 ? 9.067   -3.697  -5.472  1.00 0.00 ? 59  HIS A CD2  6  
ATOM   5951  C  CE1  . HIS A 1 59 ? 8.888   -5.541  -4.299  1.00 0.00 ? 59  HIS A CE1  6  
ATOM   5952  N  NE2  . HIS A 1 59 ? 9.103   -5.069  -5.514  1.00 0.00 ? 59  HIS A NE2  6  
ATOM   5953  H  H    . HIS A 1 59 ? 8.668   0.071   -2.047  1.00 0.00 ? 59  HIS A H    6  
ATOM   5954  H  HA   . HIS A 1 59 ? 9.692   -2.408  -1.720  1.00 0.00 ? 59  HIS A HA   6  
ATOM   5955  H  HB2  . HIS A 1 59 ? 7.709   -1.948  -3.085  1.00 0.00 ? 59  HIS A HB2  6  
ATOM   5956  H  HB3  . HIS A 1 59 ? 8.724   -1.250  -4.343  1.00 0.00 ? 59  HIS A HB3  6  
ATOM   5957  H  HD1  . HIS A 1 59 ? 8.541   -4.594  -2.519  1.00 0.00 ? 59  HIS A HD1  6  
ATOM   5958  H  HD2  . HIS A 1 59 ? 9.208   -3.027  -6.309  1.00 0.00 ? 59  HIS A HD2  6  
ATOM   5959  H  HE1  . HIS A 1 59 ? 8.859   -6.584  -4.023  1.00 0.00 ? 59  HIS A HE1  6  
ATOM   5960  H  HE2  . HIS A 1 59 ? 9.345   -5.610  -6.294  1.00 0.00 ? 59  HIS A HE2  6  
ATOM   5961  N  N    . ASN A 1 60 ? 11.530  -0.727  -3.869  1.00 0.00 ? 60  ASN A N    6  
ATOM   5962  C  CA   . ASN A 1 60 ? 12.829  -0.693  -4.532  1.00 0.00 ? 60  ASN A CA   6  
ATOM   5963  C  C    . ASN A 1 60 ? 13.961  -0.758  -3.512  1.00 0.00 ? 60  ASN A C    6  
ATOM   5964  O  O    . ASN A 1 60 ? 14.969  -1.432  -3.730  1.00 0.00 ? 60  ASN A O    6  
ATOM   5965  C  CB   . ASN A 1 60 ? 12.960  0.575   -5.377  1.00 0.00 ? 60  ASN A CB   6  
ATOM   5966  C  CG   . ASN A 1 60 ? 12.336  0.422   -6.750  1.00 0.00 ? 60  ASN A CG   6  
ATOM   5967  O  OD1  . ASN A 1 60 ? 12.633  -0.526  -7.478  1.00 0.00 ? 60  ASN A OD1  6  
ATOM   5968  N  ND2  . ASN A 1 60 ? 11.465  1.357   -7.112  1.00 0.00 ? 60  ASN A ND2  6  
ATOM   5969  H  H    . ASN A 1 60 ? 10.931  0.044   -3.952  1.00 0.00 ? 60  ASN A H    6  
ATOM   5970  H  HA   . ASN A 1 60 ? 12.893  -1.555  -5.179  1.00 0.00 ? 60  ASN A HA   6  
ATOM   5971  H  HB2  . ASN A 1 60 ? 12.468  1.392   -4.869  1.00 0.00 ? 60  ASN A HB2  6  
ATOM   5972  H  HB3  . ASN A 1 60 ? 14.006  0.812   -5.501  1.00 0.00 ? 60  ASN A HB3  6  
ATOM   5973  H  HD21 . ASN A 1 60 ? 11.277  2.084   -6.481  1.00 0.00 ? 60  ASN A HD21 6  
ATOM   5974  H  HD22 . ASN A 1 60 ? 11.046  1.282   -7.995  1.00 0.00 ? 60  ASN A HD22 6  
ATOM   5975  N  N    . ARG A 1 61 ? 13.789  -0.053  -2.398  1.00 0.00 ? 61  ARG A N    6  
ATOM   5976  C  CA   . ARG A 1 61 ? 14.796  -0.030  -1.345  1.00 0.00 ? 61  ARG A CA   6  
ATOM   5977  C  C    . ARG A 1 61 ? 14.981  -1.417  -0.738  1.00 0.00 ? 61  ARG A C    6  
ATOM   5978  O  O    . ARG A 1 61 ? 16.098  -1.821  -0.417  1.00 0.00 ? 61  ARG A O    6  
ATOM   5979  C  CB   . ARG A 1 61 ? 14.402  0.968   -0.254  1.00 0.00 ? 61  ARG A CB   6  
ATOM   5980  C  CG   . ARG A 1 61 ? 14.365  2.410   -0.732  1.00 0.00 ? 61  ARG A CG   6  
ATOM   5981  C  CD   . ARG A 1 61 ? 13.631  3.305   0.254   1.00 0.00 ? 61  ARG A CD   6  
ATOM   5982  N  NE   . ARG A 1 61 ? 14.081  4.692   0.174   1.00 0.00 ? 61  ARG A NE   6  
ATOM   5983  C  CZ   . ARG A 1 61 ? 15.145  5.158   0.817   1.00 0.00 ? 61  ARG A CZ   6  
ATOM   5984  N  NH1  . ARG A 1 61 ? 15.866  4.352   1.584   1.00 0.00 ? 61  ARG A NH1  6  
ATOM   5985  N  NH2  . ARG A 1 61 ? 15.491  6.433   0.693   1.00 0.00 ? 61  ARG A NH2  6  
ATOM   5986  H  H    . ARG A 1 61 ? 12.964  0.464   -2.283  1.00 0.00 ? 61  ARG A H    6  
ATOM   5987  H  HA   . ARG A 1 61 ? 15.731  0.284   -1.786  1.00 0.00 ? 61  ARG A HA   6  
ATOM   5988  H  HB2  . ARG A 1 61 ? 13.420  0.709   0.116   1.00 0.00 ? 61  ARG A HB2  6  
ATOM   5989  H  HB3  . ARG A 1 61 ? 15.112  0.897   0.555   1.00 0.00 ? 61  ARG A HB3  6  
ATOM   5990  H  HG2  . ARG A 1 61 ? 15.377  2.769   -0.842  1.00 0.00 ? 61  ARG A HG2  6  
ATOM   5991  H  HG3  . ARG A 1 61 ? 13.860  2.451   -1.686  1.00 0.00 ? 61  ARG A HG3  6  
ATOM   5992  H  HD2  . ARG A 1 61 ? 12.574  3.266   0.038   1.00 0.00 ? 61  ARG A HD2  6  
ATOM   5993  H  HD3  . ARG A 1 61 ? 13.807  2.937   1.254   1.00 0.00 ? 61  ARG A HD3  6  
ATOM   5994  H  HE   . ARG A 1 61 ? 13.562  5.305   -0.387  1.00 0.00 ? 61  ARG A HE   6  
ATOM   5995  H  HH11 . ARG A 1 61 ? 15.609  3.391   1.678   1.00 0.00 ? 61  ARG A HH11 6  
ATOM   5996  H  HH12 . ARG A 1 61 ? 16.668  4.705   2.066   1.00 0.00 ? 61  ARG A HH12 6  
ATOM   5997  H  HH21 . ARG A 1 61 ? 14.950  7.044   0.116   1.00 0.00 ? 61  ARG A HH21 6  
ATOM   5998  H  HH22 . ARG A 1 61 ? 16.292  6.783   1.178   1.00 0.00 ? 61  ARG A HH22 6  
ATOM   5999  N  N    . GLU A 1 62 ? 13.877  -2.142  -0.584  1.00 0.00 ? 62  GLU A N    6  
ATOM   6000  C  CA   . GLU A 1 62 ? 13.917  -3.483  -0.014  1.00 0.00 ? 62  GLU A CA   6  
ATOM   6001  C  C    . GLU A 1 62 ? 14.561  -4.468  -0.986  1.00 0.00 ? 62  GLU A C    6  
ATOM   6002  O  O    . GLU A 1 62 ? 15.639  -5.002  -0.725  1.00 0.00 ? 62  GLU A O    6  
ATOM   6003  C  CB   . GLU A 1 62 ? 12.506  -3.952  0.344   1.00 0.00 ? 62  GLU A CB   6  
ATOM   6004  C  CG   . GLU A 1 62 ? 11.678  -2.899  1.062   1.00 0.00 ? 62  GLU A CG   6  
ATOM   6005  C  CD   . GLU A 1 62 ? 11.906  -2.899  2.561   1.00 0.00 ? 62  GLU A CD   6  
ATOM   6006  O  OE1  . GLU A 1 62 ? 12.105  -3.992  3.131   1.00 0.00 ? 62  GLU A OE1  6  
ATOM   6007  O  OE2  . GLU A 1 62 ? 11.886  -1.805  3.163   1.00 0.00 ? 62  GLU A OE2  6  
ATOM   6008  H  H    . GLU A 1 62 ? 13.015  -1.765  -0.859  1.00 0.00 ? 62  GLU A H    6  
ATOM   6009  H  HA   . GLU A 1 62 ? 14.513  -3.444  0.885   1.00 0.00 ? 62  GLU A HA   6  
ATOM   6010  H  HB2  . GLU A 1 62 ? 11.990  -4.230  -0.563  1.00 0.00 ? 62  GLU A HB2  6  
ATOM   6011  H  HB3  . GLU A 1 62 ? 12.579  -4.819  0.985   1.00 0.00 ? 62  GLU A HB3  6  
ATOM   6012  H  HG2  . GLU A 1 62 ? 11.942  -1.926  0.673   1.00 0.00 ? 62  GLU A HG2  6  
ATOM   6013  H  HG3  . GLU A 1 62 ? 10.632  -3.090  0.871   1.00 0.00 ? 62  GLU A HG3  6  
ATOM   6014  N  N    . LYS A 1 63 ? 13.891  -4.704  -2.110  1.00 0.00 ? 63  LYS A N    6  
ATOM   6015  C  CA   . LYS A 1 63 ? 14.395  -5.624  -3.123  1.00 0.00 ? 63  LYS A CA   6  
ATOM   6016  C  C    . LYS A 1 63 ? 15.846  -5.305  -3.473  1.00 0.00 ? 63  LYS A C    6  
ATOM   6017  O  O    . LYS A 1 63 ? 16.628  -6.201  -3.789  1.00 0.00 ? 63  LYS A O    6  
ATOM   6018  C  CB   . LYS A 1 63 ? 13.528  -5.553  -4.382  1.00 0.00 ? 63  LYS A CB   6  
ATOM   6019  C  CG   . LYS A 1 63 ? 13.730  -4.282  -5.188  1.00 0.00 ? 63  LYS A CG   6  
ATOM   6020  C  CD   . LYS A 1 63 ? 13.239  -4.444  -6.617  1.00 0.00 ? 63  LYS A CD   6  
ATOM   6021  C  CE   . LYS A 1 63 ? 11.765  -4.092  -6.744  1.00 0.00 ? 63  LYS A CE   6  
ATOM   6022  N  NZ   . LYS A 1 63 ? 11.414  -3.660  -8.125  1.00 0.00 ? 63  LYS A NZ   6  
ATOM   6023  H  H    . LYS A 1 63 ? 13.036  -4.248  -2.261  1.00 0.00 ? 63  LYS A H    6  
ATOM   6024  H  HA   . LYS A 1 63 ? 14.346  -6.623  -2.718  1.00 0.00 ? 63  LYS A HA   6  
ATOM   6025  H  HB2  . LYS A 1 63 ? 13.763  -6.396  -5.014  1.00 0.00 ? 63  LYS A HB2  6  
ATOM   6026  H  HB3  . LYS A 1 63 ? 12.489  -5.609  -4.092  1.00 0.00 ? 63  LYS A HB3  6  
ATOM   6027  H  HG2  . LYS A 1 63 ? 13.181  -3.478  -4.720  1.00 0.00 ? 63  LYS A HG2  6  
ATOM   6028  H  HG3  . LYS A 1 63 ? 14.783  -4.040  -5.204  1.00 0.00 ? 63  LYS A HG3  6  
ATOM   6029  H  HD2  . LYS A 1 63 ? 13.810  -3.792  -7.261  1.00 0.00 ? 63  LYS A HD2  6  
ATOM   6030  H  HD3  . LYS A 1 63 ? 13.383  -5.471  -6.924  1.00 0.00 ? 63  LYS A HD3  6  
ATOM   6031  H  HE2  . LYS A 1 63 ? 11.178  -4.961  -6.488  1.00 0.00 ? 63  LYS A HE2  6  
ATOM   6032  H  HE3  . LYS A 1 63 ? 11.540  -3.290  -6.056  1.00 0.00 ? 63  LYS A HE3  6  
ATOM   6033  H  HZ1  . LYS A 1 63 ? 10.426  -3.336  -8.157  1.00 0.00 ? 63  LYS A HZ1  6  
ATOM   6034  H  HZ2  . LYS A 1 63 ? 11.528  -4.453  -8.787  1.00 0.00 ? 63  LYS A HZ2  6  
ATOM   6035  H  HZ3  . LYS A 1 63 ? 12.034  -2.880  -8.424  1.00 0.00 ? 63  LYS A HZ3  6  
ATOM   6036  N  N    . ALA A 1 64 ? 16.197  -4.025  -3.412  1.00 0.00 ? 64  ALA A N    6  
ATOM   6037  C  CA   . ALA A 1 64 ? 17.554  -3.590  -3.719  1.00 0.00 ? 64  ALA A CA   6  
ATOM   6038  C  C    . ALA A 1 64 ? 18.582  -4.579  -3.182  1.00 0.00 ? 64  ALA A C    6  
ATOM   6039  O  O    . ALA A 1 64 ? 18.655  -4.820  -1.977  1.00 0.00 ? 64  ALA A O    6  
ATOM   6040  C  CB   . ALA A 1 64 ? 17.805  -2.202  -3.149  1.00 0.00 ? 64  ALA A CB   6  
ATOM   6041  H  H    . ALA A 1 64 ? 15.528  -3.357  -3.154  1.00 0.00 ? 64  ALA A H    6  
ATOM   6042  H  HA   . ALA A 1 64 ? 17.651  -3.533  -4.794  1.00 0.00 ? 64  ALA A HA   6  
ATOM   6043  H  HB1  . ALA A 1 64 ? 17.416  -2.152  -2.142  1.00 0.00 ? 64  ALA A HB1  6  
ATOM   6044  H  HB2  . ALA A 1 64 ? 18.866  -2.005  -3.135  1.00 0.00 ? 64  ALA A HB2  6  
ATOM   6045  H  HB3  . ALA A 1 64 ? 17.309  -1.465  -3.763  1.00 0.00 ? 64  ALA A HB3  6  
ATOM   6046  N  N    . SER A 1 65 ? 19.375  -5.149  -4.083  1.00 0.00 ? 65  SER A N    6  
ATOM   6047  C  CA   . SER A 1 65 ? 20.397  -6.116  -3.700  1.00 0.00 ? 65  SER A CA   6  
ATOM   6048  C  C    . SER A 1 65 ? 19.761  -7.410  -3.200  1.00 0.00 ? 65  SER A C    6  
ATOM   6049  O  O    . SER A 1 65 ? 20.226  -8.011  -2.233  1.00 0.00 ? 65  SER A O    6  
ATOM   6050  C  CB   . SER A 1 65 ? 21.304  -5.529  -2.616  1.00 0.00 ? 65  SER A CB   6  
ATOM   6051  O  OG   . SER A 1 65 ? 22.509  -6.266  -2.506  1.00 0.00 ? 65  SER A OG   6  
ATOM   6052  H  H    . SER A 1 65 ? 19.268  -4.916  -5.029  1.00 0.00 ? 65  SER A H    6  
ATOM   6053  H  HA   . SER A 1 65 ? 20.991  -6.335  -4.574  1.00 0.00 ? 65  SER A HA   6  
ATOM   6054  H  HB2  . SER A 1 65 ? 21.542  -4.507  -2.865  1.00 0.00 ? 65  SER A HB2  6  
ATOM   6055  H  HB3  . SER A 1 65 ? 20.790  -5.558  -1.666  1.00 0.00 ? 65  SER A HB3  6  
ATOM   6056  H  HG   . SER A 1 65 ? 23.151  -5.926  -3.134  1.00 0.00 ? 65  SER A HG   6  
ATOM   6057  N  N    . GLY A 1 66 ? 18.692  -7.833  -3.869  1.00 0.00 ? 66  GLY A N    6  
ATOM   6058  C  CA   . GLY A 1 66 ? 18.007  -9.052  -3.479  1.00 0.00 ? 66  GLY A CA   6  
ATOM   6059  C  C    . GLY A 1 66 ? 18.193  -10.168 -4.487  1.00 0.00 ? 66  GLY A C    6  
ATOM   6060  O  O    . GLY A 1 66 ? 18.974  -10.056 -5.433  1.00 0.00 ? 66  GLY A O    6  
ATOM   6061  H  H    . GLY A 1 66 ? 18.365  -7.312  -4.632  1.00 0.00 ? 66  GLY A H    6  
ATOM   6062  H  HA2  . GLY A 1 66 ? 18.390  -9.376  -2.523  1.00 0.00 ? 66  GLY A HA2  6  
ATOM   6063  H  HA3  . GLY A 1 66 ? 16.952  -8.843  -3.381  1.00 0.00 ? 66  GLY A HA3  6  
ATOM   6064  N  N    . PRO A 1 67 ? 17.465  -11.277 -4.289  1.00 0.00 ? 67  PRO A N    6  
ATOM   6065  C  CA   . PRO A 1 67 ? 17.537  -12.441 -5.177  1.00 0.00 ? 67  PRO A CA   6  
ATOM   6066  C  C    . PRO A 1 67 ? 16.923  -12.164 -6.545  1.00 0.00 ? 67  PRO A C    6  
ATOM   6067  O  O    . PRO A 1 67 ? 16.494  -11.046 -6.829  1.00 0.00 ? 67  PRO A O    6  
ATOM   6068  C  CB   . PRO A 1 67 ? 16.728  -13.506 -4.433  1.00 0.00 ? 67  PRO A CB   6  
ATOM   6069  C  CG   . PRO A 1 67 ? 15.785  -12.734 -3.575  1.00 0.00 ? 67  PRO A CG   6  
ATOM   6070  C  CD   . PRO A 1 67 ? 16.515  -11.480 -3.182  1.00 0.00 ? 67  PRO A CD   6  
ATOM   6071  H  HA   . PRO A 1 67 ? 18.554  -12.782 -5.303  1.00 0.00 ? 67  PRO A HA   6  
ATOM   6072  H  HB2  . PRO A 1 67 ? 16.199  -14.123 -5.146  1.00 0.00 ? 67  PRO A HB2  6  
ATOM   6073  H  HB3  . PRO A 1 67 ? 17.390  -14.118 -3.840  1.00 0.00 ? 67  PRO A HB3  6  
ATOM   6074  H  HG2  . PRO A 1 67 ? 14.895  -12.490 -4.135  1.00 0.00 ? 67  PRO A HG2  6  
ATOM   6075  H  HG3  . PRO A 1 67 ? 15.532  -13.311 -2.698  1.00 0.00 ? 67  PRO A HG3  6  
ATOM   6076  H  HD2  . PRO A 1 67 ? 15.827  -10.651 -3.107  1.00 0.00 ? 67  PRO A HD2  6  
ATOM   6077  H  HD3  . PRO A 1 67 ? 17.038  -11.625 -2.248  1.00 0.00 ? 67  PRO A HD3  6  
ATOM   6078  N  N    . SER A 1 68 ? 16.884  -13.190 -7.390  1.00 0.00 ? 68  SER A N    6  
ATOM   6079  C  CA   . SER A 1 68 ? 16.326  -13.057 -8.730  1.00 0.00 ? 68  SER A CA   6  
ATOM   6080  C  C    . SER A 1 68 ? 15.057  -13.892 -8.876  1.00 0.00 ? 68  SER A C    6  
ATOM   6081  O  O    . SER A 1 68 ? 15.118  -15.095 -9.127  1.00 0.00 ? 68  SER A O    6  
ATOM   6082  C  CB   . SER A 1 68 ? 17.354  -13.483 -9.779  1.00 0.00 ? 68  SER A CB   6  
ATOM   6083  O  OG   . SER A 1 68 ? 17.118  -12.836 -11.017 1.00 0.00 ? 68  SER A OG   6  
ATOM   6084  H  H    . SER A 1 68 ? 17.242  -14.057 -7.105  1.00 0.00 ? 68  SER A H    6  
ATOM   6085  H  HA   . SER A 1 68 ? 16.078  -12.017 -8.883  1.00 0.00 ? 68  SER A HA   6  
ATOM   6086  H  HB2  . SER A 1 68 ? 18.344  -13.226 -9.435  1.00 0.00 ? 68  SER A HB2  6  
ATOM   6087  H  HB3  . SER A 1 68 ? 17.291  -14.552 -9.927  1.00 0.00 ? 68  SER A HB3  6  
ATOM   6088  H  HG   . SER A 1 68 ? 16.656  -12.009 -10.863 1.00 0.00 ? 68  SER A HG   6  
ATOM   6089  N  N    . SER A 1 69 ? 13.908  -13.243 -8.716  1.00 0.00 ? 69  SER A N    6  
ATOM   6090  C  CA   . SER A 1 69 ? 12.624  -13.925 -8.826  1.00 0.00 ? 69  SER A CA   6  
ATOM   6091  C  C    . SER A 1 69 ? 11.929  -13.568 -10.136 1.00 0.00 ? 69  SER A C    6  
ATOM   6092  O  O    . SER A 1 69 ? 11.605  -14.443 -10.939 1.00 0.00 ? 69  SER A O    6  
ATOM   6093  C  CB   . SER A 1 69 ? 11.725  -13.559 -7.643  1.00 0.00 ? 69  SER A CB   6  
ATOM   6094  O  OG   . SER A 1 69 ? 10.434  -14.126 -7.788  1.00 0.00 ? 69  SER A OG   6  
ATOM   6095  H  H    . SER A 1 69 ? 13.924  -12.283 -8.517  1.00 0.00 ? 69  SER A H    6  
ATOM   6096  H  HA   . SER A 1 69 ? 12.811  -14.989 -8.809  1.00 0.00 ? 69  SER A HA   6  
ATOM   6097  H  HB2  . SER A 1 69 ? 12.167  -13.930 -6.730  1.00 0.00 ? 69  SER A HB2  6  
ATOM   6098  H  HB3  . SER A 1 69 ? 11.629  -12.485 -7.586  1.00 0.00 ? 69  SER A HB3  6  
ATOM   6099  H  HG   . SER A 1 69 ? 9.854   -13.495 -8.220  1.00 0.00 ? 69  SER A HG   6  
ATOM   6100  N  N    . GLY A 1 70 ? 11.702  -12.275 -10.346 1.00 0.00 ? 70  GLY A N    6  
ATOM   6101  C  CA   . GLY A 1 70 ? 11.048  -11.824 -11.559 1.00 0.00 ? 70  GLY A CA   6  
ATOM   6102  C  C    . GLY A 1 70 ? 10.264  -10.542 -11.353 1.00 0.00 ? 70  GLY A C    6  
ATOM   6103  O  O    . GLY A 1 70 ? 10.102  -9.780  -12.305 1.00 0.00 ? 70  GLY A O    6  
ATOM   6104  H  H    . GLY A 1 70 ? 11.982  -11.622 -9.670  1.00 0.00 ? 70  GLY A H    6  
ATOM   6105  H  HA2  . GLY A 1 70 ? 11.797  -11.657 -12.319 1.00 0.00 ? 70  GLY A HA2  6  
ATOM   6106  H  HA3  . GLY A 1 70 ? 10.371  -12.595 -11.898 1.00 0.00 ? 70  GLY A HA3  6  
HETATM 6107  ZN ZN   . ZN  B 2 .  ? -11.332 4.234   2.435   1.00 0.00 ? 201 ZN  A ZN   6  
HETATM 6108  ZN ZN   . ZN  C 2 .  ? 6.624   3.605   0.432   1.00 0.00 ? 401 ZN  A ZN   6  
ATOM   6109  N  N    . GLY A 1 1  ? -28.338 -14.839 -6.097  1.00 0.00 ? 1   GLY A N    7  
ATOM   6110  C  CA   . GLY A 1 1  ? -28.143 -13.681 -5.243  1.00 0.00 ? 1   GLY A CA   7  
ATOM   6111  C  C    . GLY A 1 1  ? -26.679 -13.398 -4.975  1.00 0.00 ? 1   GLY A C    7  
ATOM   6112  O  O    . GLY A 1 1  ? -26.045 -14.077 -4.168  1.00 0.00 ? 1   GLY A O    7  
ATOM   6113  H  H1   . GLY A 1 1  ? -28.170 -15.738 -5.745  1.00 0.00 ? 1   GLY A H1   7  
ATOM   6114  H  HA2  . GLY A 1 1  ? -28.586 -12.819 -5.718  1.00 0.00 ? 1   GLY A HA2  7  
ATOM   6115  H  HA3  . GLY A 1 1  ? -28.642 -13.856 -4.301  1.00 0.00 ? 1   GLY A HA3  7  
ATOM   6116  N  N    . SER A 1 2  ? -26.138 -12.392 -5.656  1.00 0.00 ? 2   SER A N    7  
ATOM   6117  C  CA   . SER A 1 2  ? -24.737 -12.023 -5.492  1.00 0.00 ? 2   SER A CA   7  
ATOM   6118  C  C    . SER A 1 2  ? -24.596 -10.526 -5.234  1.00 0.00 ? 2   SER A C    7  
ATOM   6119  O  O    . SER A 1 2  ? -24.380 -9.743  -6.159  1.00 0.00 ? 2   SER A O    7  
ATOM   6120  C  CB   . SER A 1 2  ? -23.935 -12.416 -6.734  1.00 0.00 ? 2   SER A CB   7  
ATOM   6121  O  OG   . SER A 1 2  ? -23.574 -13.786 -6.695  1.00 0.00 ? 2   SER A OG   7  
ATOM   6122  H  H    . SER A 1 2  ? -26.695 -11.887 -6.285  1.00 0.00 ? 2   SER A H    7  
ATOM   6123  H  HA   . SER A 1 2  ? -24.350 -12.561 -4.639  1.00 0.00 ? 2   SER A HA   7  
ATOM   6124  H  HB2  . SER A 1 2  ? -24.532 -12.239 -7.615  1.00 0.00 ? 2   SER A HB2  7  
ATOM   6125  H  HB3  . SER A 1 2  ? -23.036 -11.820 -6.782  1.00 0.00 ? 2   SER A HB3  7  
ATOM   6126  H  HG   . SER A 1 2  ? -24.358 -14.328 -6.811  1.00 0.00 ? 2   SER A HG   7  
ATOM   6127  N  N    . SER A 1 3  ? -24.720 -10.135 -3.969  1.00 0.00 ? 3   SER A N    7  
ATOM   6128  C  CA   . SER A 1 3  ? -24.610 -8.732  -3.589  1.00 0.00 ? 3   SER A CA   7  
ATOM   6129  C  C    . SER A 1 3  ? -23.290 -8.139  -4.074  1.00 0.00 ? 3   SER A C    7  
ATOM   6130  O  O    . SER A 1 3  ? -22.219 -8.497  -3.585  1.00 0.00 ? 3   SER A O    7  
ATOM   6131  C  CB   . SER A 1 3  ? -24.721 -8.583  -2.070  1.00 0.00 ? 3   SER A CB   7  
ATOM   6132  O  OG   . SER A 1 3  ? -23.818 -9.450  -1.405  1.00 0.00 ? 3   SER A OG   7  
ATOM   6133  H  H    . SER A 1 3  ? -24.891 -10.807 -3.277  1.00 0.00 ? 3   SER A H    7  
ATOM   6134  H  HA   . SER A 1 3  ? -25.424 -8.197  -4.055  1.00 0.00 ? 3   SER A HA   7  
ATOM   6135  H  HB2  . SER A 1 3  ? -24.494 -7.565  -1.793  1.00 0.00 ? 3   SER A HB2  7  
ATOM   6136  H  HB3  . SER A 1 3  ? -25.728 -8.825  -1.761  1.00 0.00 ? 3   SER A HB3  7  
ATOM   6137  H  HG   . SER A 1 3  ? -24.002 -10.358 -1.657  1.00 0.00 ? 3   SER A HG   7  
ATOM   6138  N  N    . GLY A 1 4  ? -23.377 -7.229  -5.040  1.00 0.00 ? 4   GLY A N    7  
ATOM   6139  C  CA   . GLY A 1 4  ? -22.184 -6.601  -5.576  1.00 0.00 ? 4   GLY A CA   7  
ATOM   6140  C  C    . GLY A 1 4  ? -21.999 -5.183  -5.072  1.00 0.00 ? 4   GLY A C    7  
ATOM   6141  O  O    . GLY A 1 4  ? -22.270 -4.221  -5.790  1.00 0.00 ? 4   GLY A O    7  
ATOM   6142  H  H    . GLY A 1 4  ? -24.258 -6.983  -5.391  1.00 0.00 ? 4   GLY A H    7  
ATOM   6143  H  HA2  . GLY A 1 4  ? -21.323 -7.188  -5.293  1.00 0.00 ? 4   GLY A HA2  7  
ATOM   6144  H  HA3  . GLY A 1 4  ? -22.255 -6.581  -6.653  1.00 0.00 ? 4   GLY A HA3  7  
ATOM   6145  N  N    . SER A 1 5  ? -21.537 -5.053  -3.832  1.00 0.00 ? 5   SER A N    7  
ATOM   6146  C  CA   . SER A 1 5  ? -21.322 -3.743  -3.230  1.00 0.00 ? 5   SER A CA   7  
ATOM   6147  C  C    . SER A 1 5  ? -19.839 -3.382  -3.230  1.00 0.00 ? 5   SER A C    7  
ATOM   6148  O  O    . SER A 1 5  ? -19.029 -4.038  -2.575  1.00 0.00 ? 5   SER A O    7  
ATOM   6149  C  CB   . SER A 1 5  ? -21.864 -3.720  -1.800  1.00 0.00 ? 5   SER A CB   7  
ATOM   6150  O  OG   . SER A 1 5  ? -23.265 -3.932  -1.782  1.00 0.00 ? 5   SER A OG   7  
ATOM   6151  H  H    . SER A 1 5  ? -21.339 -5.858  -3.309  1.00 0.00 ? 5   SER A H    7  
ATOM   6152  H  HA   . SER A 1 5  ? -21.857 -3.014  -3.821  1.00 0.00 ? 5   SER A HA   7  
ATOM   6153  H  HB2  . SER A 1 5  ? -21.387 -4.498  -1.224  1.00 0.00 ? 5   SER A HB2  7  
ATOM   6154  H  HB3  . SER A 1 5  ? -21.651 -2.759  -1.353  1.00 0.00 ? 5   SER A HB3  7  
ATOM   6155  H  HG   . SER A 1 5  ? -23.576 -3.938  -0.874  1.00 0.00 ? 5   SER A HG   7  
ATOM   6156  N  N    . SER A 1 6  ? -19.491 -2.334  -3.970  1.00 0.00 ? 6   SER A N    7  
ATOM   6157  C  CA   . SER A 1 6  ? -18.106 -1.887  -4.059  1.00 0.00 ? 6   SER A CA   7  
ATOM   6158  C  C    . SER A 1 6  ? -17.790 -0.876  -2.962  1.00 0.00 ? 6   SER A C    7  
ATOM   6159  O  O    . SER A 1 6  ? -18.208 0.279   -3.027  1.00 0.00 ? 6   SER A O    7  
ATOM   6160  C  CB   . SER A 1 6  ? -17.835 -1.269  -5.432  1.00 0.00 ? 6   SER A CB   7  
ATOM   6161  O  OG   . SER A 1 6  ? -17.818 -2.261  -6.444  1.00 0.00 ? 6   SER A OG   7  
ATOM   6162  H  H    . SER A 1 6  ? -20.183 -1.852  -4.469  1.00 0.00 ? 6   SER A H    7  
ATOM   6163  H  HA   . SER A 1 6  ? -17.470 -2.751  -3.931  1.00 0.00 ? 6   SER A HA   7  
ATOM   6164  H  HB2  . SER A 1 6  ? -18.609 -0.552  -5.660  1.00 0.00 ? 6   SER A HB2  7  
ATOM   6165  H  HB3  . SER A 1 6  ? -16.876 -0.771  -5.416  1.00 0.00 ? 6   SER A HB3  7  
ATOM   6166  H  HG   . SER A 1 6  ? -18.714 -2.422  -6.749  1.00 0.00 ? 6   SER A HG   7  
ATOM   6167  N  N    . GLY A 1 7  ? -17.047 -1.320  -1.952  1.00 0.00 ? 7   GLY A N    7  
ATOM   6168  C  CA   . GLY A 1 7  ? -16.686 -0.442  -0.854  1.00 0.00 ? 7   GLY A CA   7  
ATOM   6169  C  C    . GLY A 1 7  ? -15.217 -0.537  -0.495  1.00 0.00 ? 7   GLY A C    7  
ATOM   6170  O  O    . GLY A 1 7  ? -14.602 -1.594  -0.637  1.00 0.00 ? 7   GLY A O    7  
ATOM   6171  H  H    . GLY A 1 7  ? -16.741 -2.251  -1.953  1.00 0.00 ? 7   GLY A H    7  
ATOM   6172  H  HA2  . GLY A 1 7  ? -16.913 0.576   -1.133  1.00 0.00 ? 7   GLY A HA2  7  
ATOM   6173  H  HA3  . GLY A 1 7  ? -17.275 -0.707  0.012   1.00 0.00 ? 7   GLY A HA3  7  
ATOM   6174  N  N    . CYS A 1 8  ? -14.651 0.571   -0.027  1.00 0.00 ? 8   CYS A N    7  
ATOM   6175  C  CA   . CYS A 1 8  ? -13.244 0.610   0.352   1.00 0.00 ? 8   CYS A CA   7  
ATOM   6176  C  C    . CYS A 1 8  ? -12.946 -0.417  1.441   1.00 0.00 ? 8   CYS A C    7  
ATOM   6177  O  O    . CYS A 1 8  ? -13.770 -0.659  2.324   1.00 0.00 ? 8   CYS A O    7  
ATOM   6178  C  CB   . CYS A 1 8  ? -12.863 2.010   0.838   1.00 0.00 ? 8   CYS A CB   7  
ATOM   6179  S  SG   . CYS A 1 8  ? -11.256 2.090   1.692   1.00 0.00 ? 8   CYS A SG   7  
ATOM   6180  H  H    . CYS A 1 8  ? -15.193 1.383   0.064   1.00 0.00 ? 8   CYS A H    7  
ATOM   6181  H  HA   . CYS A 1 8  ? -12.657 0.370   -0.521  1.00 0.00 ? 8   CYS A HA   7  
ATOM   6182  H  HB2  . CYS A 1 8  ? -12.817 2.676   -0.011  1.00 0.00 ? 8   CYS A HB2  7  
ATOM   6183  H  HB3  . CYS A 1 8  ? -13.619 2.362   1.524   1.00 0.00 ? 8   CYS A HB3  7  
ATOM   6184  N  N    . HIS A 1 9  ? -11.762 -1.017  1.373   1.00 0.00 ? 9   HIS A N    7  
ATOM   6185  C  CA   . HIS A 1 9  ? -11.354 -2.017  2.353   1.00 0.00 ? 9   HIS A CA   7  
ATOM   6186  C  C    . HIS A 1 9  ? -10.600 -1.368  3.510   1.00 0.00 ? 9   HIS A C    7  
ATOM   6187  O  O    . HIS A 1 9  ? -10.722 -1.794  4.658   1.00 0.00 ? 9   HIS A O    7  
ATOM   6188  C  CB   . HIS A 1 9  ? -10.478 -3.082  1.693   1.00 0.00 ? 9   HIS A CB   7  
ATOM   6189  C  CG   . HIS A 1 9  ? -10.447 -4.380  2.439   1.00 0.00 ? 9   HIS A CG   7  
ATOM   6190  N  ND1  . HIS A 1 9  ? -11.570 -5.149  2.659   1.00 0.00 ? 9   HIS A ND1  7  
ATOM   6191  C  CD2  . HIS A 1 9  ? -9.419  -5.045  3.018   1.00 0.00 ? 9   HIS A CD2  7  
ATOM   6192  C  CE1  . HIS A 1 9  ? -11.235 -6.229  3.341   1.00 0.00 ? 9   HIS A CE1  7  
ATOM   6193  N  NE2  . HIS A 1 9  ? -9.935  -6.190  3.571   1.00 0.00 ? 9   HIS A NE2  7  
ATOM   6194  H  H    . HIS A 1 9  ? -11.148 -0.782  0.646   1.00 0.00 ? 9   HIS A H    7  
ATOM   6195  H  HA   . HIS A 1 9  ? -12.246 -2.486  2.739   1.00 0.00 ? 9   HIS A HA   7  
ATOM   6196  H  HB2  . HIS A 1 9  ? -10.852 -3.280  0.699   1.00 0.00 ? 9   HIS A HB2  7  
ATOM   6197  H  HB3  . HIS A 1 9  ? -9.464  -2.714  1.624   1.00 0.00 ? 9   HIS A HB3  7  
ATOM   6198  H  HD1  . HIS A 1 9  ? -12.478 -4.934  2.360   1.00 0.00 ? 9   HIS A HD1  7  
ATOM   6199  H  HD2  . HIS A 1 9  ? -8.384  -4.732  3.040   1.00 0.00 ? 9   HIS A HD2  7  
ATOM   6200  H  HE1  . HIS A 1 9  ? -11.909 -7.012  3.657   1.00 0.00 ? 9   HIS A HE1  7  
ATOM   6201  H  HE2  . HIS A 1 9  ? -9.442  -6.826  4.130   1.00 0.00 ? 9   HIS A HE2  7  
ATOM   6202  N  N    . GLN A 1 10 ? -9.823  -0.336  3.199   1.00 0.00 ? 10  GLN A N    7  
ATOM   6203  C  CA   . GLN A 1 10 ? -9.049  0.370   4.213   1.00 0.00 ? 10  GLN A CA   7  
ATOM   6204  C  C    . GLN A 1 10 ? -9.940  0.810   5.369   1.00 0.00 ? 10  GLN A C    7  
ATOM   6205  O  O    . GLN A 1 10 ? -9.859  0.267   6.472   1.00 0.00 ? 10  GLN A O    7  
ATOM   6206  C  CB   . GLN A 1 10 ? -8.353  1.586   3.599   1.00 0.00 ? 10  GLN A CB   7  
ATOM   6207  C  CG   . GLN A 1 10 ? -7.505  2.367   4.590   1.00 0.00 ? 10  GLN A CG   7  
ATOM   6208  C  CD   . GLN A 1 10 ? -6.188  1.683   4.899   1.00 0.00 ? 10  GLN A CD   7  
ATOM   6209  O  OE1  . GLN A 1 10 ? -5.268  1.684   4.080   1.00 0.00 ? 10  GLN A OE1  7  
ATOM   6210  N  NE2  . GLN A 1 10 ? -6.090  1.094   6.085   1.00 0.00 ? 10  GLN A NE2  7  
ATOM   6211  H  H    . GLN A 1 10 ? -9.767  -0.044  2.266   1.00 0.00 ? 10  GLN A H    7  
ATOM   6212  H  HA   . GLN A 1 10 ? -8.300  -0.309  4.591   1.00 0.00 ? 10  GLN A HA   7  
ATOM   6213  H  HB2  . GLN A 1 10 ? -7.713  1.252   2.796   1.00 0.00 ? 10  GLN A HB2  7  
ATOM   6214  H  HB3  . GLN A 1 10 ? -9.103  2.251   3.198   1.00 0.00 ? 10  GLN A HB3  7  
ATOM   6215  H  HG2  . GLN A 1 10 ? -7.298  3.343   4.176   1.00 0.00 ? 10  GLN A HG2  7  
ATOM   6216  H  HG3  . GLN A 1 10 ? -8.061  2.478   5.509   1.00 0.00 ? 10  GLN A HG3  7  
ATOM   6217  H  HE21 . GLN A 1 10 ? -6.864  1.133   6.686   1.00 0.00 ? 10  GLN A HE21 7  
ATOM   6218  H  HE22 . GLN A 1 10 ? -5.251  0.644   6.310   1.00 0.00 ? 10  GLN A HE22 7  
ATOM   6219  N  N    . CYS A 1 11 ? -10.791 1.798   5.111   1.00 0.00 ? 11  CYS A N    7  
ATOM   6220  C  CA   . CYS A 1 11 ? -11.698 2.312   6.130   1.00 0.00 ? 11  CYS A CA   7  
ATOM   6221  C  C    . CYS A 1 11 ? -13.004 1.522   6.145   1.00 0.00 ? 11  CYS A C    7  
ATOM   6222  O  O    . CYS A 1 11 ? -13.484 1.118   7.203   1.00 0.00 ? 11  CYS A O    7  
ATOM   6223  C  CB   . CYS A 1 11 ? -11.989 3.794   5.883   1.00 0.00 ? 11  CYS A CB   7  
ATOM   6224  S  SG   . CYS A 1 11 ? -12.801 4.136   4.289   1.00 0.00 ? 11  CYS A SG   7  
ATOM   6225  H  H    . CYS A 1 11 ? -10.810 2.191   4.213   1.00 0.00 ? 11  CYS A H    7  
ATOM   6226  H  HA   . CYS A 1 11 ? -11.215 2.204   7.089   1.00 0.00 ? 11  CYS A HA   7  
ATOM   6227  H  HB2  . CYS A 1 11 ? -12.636 4.162   6.666   1.00 0.00 ? 11  CYS A HB2  7  
ATOM   6228  H  HB3  . CYS A 1 11 ? -11.059 4.344   5.903   1.00 0.00 ? 11  CYS A HB3  7  
ATOM   6229  N  N    . GLY A 1 12 ? -13.572 1.307   4.963   1.00 0.00 ? 12  GLY A N    7  
ATOM   6230  C  CA   . GLY A 1 12 ? -14.816 0.566   4.862   1.00 0.00 ? 12  GLY A CA   7  
ATOM   6231  C  C    . GLY A 1 12 ? -15.903 1.351   4.154   1.00 0.00 ? 12  GLY A C    7  
ATOM   6232  O  O    . GLY A 1 12 ? -16.702 0.784   3.410   1.00 0.00 ? 12  GLY A O    7  
ATOM   6233  H  H    . GLY A 1 12 ? -13.144 1.653   4.152   1.00 0.00 ? 12  GLY A H    7  
ATOM   6234  H  HA2  . GLY A 1 12 ? -14.635 -0.349  4.318   1.00 0.00 ? 12  GLY A HA2  7  
ATOM   6235  H  HA3  . GLY A 1 12 ? -15.157 0.320   5.857   1.00 0.00 ? 12  GLY A HA3  7  
ATOM   6236  N  N    . GLU A 1 13 ? -15.934 2.660   4.388   1.00 0.00 ? 13  GLU A N    7  
ATOM   6237  C  CA   . GLU A 1 13 ? -16.932 3.523   3.769   1.00 0.00 ? 13  GLU A CA   7  
ATOM   6238  C  C    . GLU A 1 13 ? -17.101 3.185   2.290   1.00 0.00 ? 13  GLU A C    7  
ATOM   6239  O  O    . GLU A 1 13 ? -16.222 2.581   1.676   1.00 0.00 ? 13  GLU A O    7  
ATOM   6240  C  CB   . GLU A 1 13 ? -16.537 4.992   3.926   1.00 0.00 ? 13  GLU A CB   7  
ATOM   6241  C  CG   . GLU A 1 13 ? -16.007 5.336   5.308   1.00 0.00 ? 13  GLU A CG   7  
ATOM   6242  C  CD   . GLU A 1 13 ? -16.328 6.760   5.718   1.00 0.00 ? 13  GLU A CD   7  
ATOM   6243  O  OE1  . GLU A 1 13 ? -17.471 7.008   6.155   1.00 0.00 ? 13  GLU A OE1  7  
ATOM   6244  O  OE2  . GLU A 1 13 ? -15.435 7.626   5.603   1.00 0.00 ? 13  GLU A OE2  7  
ATOM   6245  H  H    . GLU A 1 13 ? -15.269 3.053   4.992   1.00 0.00 ? 13  GLU A H    7  
ATOM   6246  H  HA   . GLU A 1 13 ? -17.872 3.357   4.273   1.00 0.00 ? 13  GLU A HA   7  
ATOM   6247  H  HB2  . GLU A 1 13 ? -15.771 5.226   3.200   1.00 0.00 ? 13  GLU A HB2  7  
ATOM   6248  H  HB3  . GLU A 1 13 ? -17.403 5.608   3.732   1.00 0.00 ? 13  GLU A HB3  7  
ATOM   6249  H  HG2  . GLU A 1 13 ? -16.448 4.662   6.026   1.00 0.00 ? 13  GLU A HG2  7  
ATOM   6250  H  HG3  . GLU A 1 13 ? -14.934 5.210   5.310   1.00 0.00 ? 13  GLU A HG3  7  
ATOM   6251  N  N    . PHE A 1 14 ? -18.238 3.579   1.726   1.00 0.00 ? 14  PHE A N    7  
ATOM   6252  C  CA   . PHE A 1 14 ? -18.524 3.317   0.320   1.00 0.00 ? 14  PHE A CA   7  
ATOM   6253  C  C    . PHE A 1 14 ? -17.847 4.352   -0.575  1.00 0.00 ? 14  PHE A C    7  
ATOM   6254  O  O    . PHE A 1 14 ? -17.929 5.554   -0.323  1.00 0.00 ? 14  PHE A O    7  
ATOM   6255  C  CB   . PHE A 1 14 ? -20.035 3.325   0.075   1.00 0.00 ? 14  PHE A CB   7  
ATOM   6256  C  CG   . PHE A 1 14 ? -20.437 2.654   -1.207  1.00 0.00 ? 14  PHE A CG   7  
ATOM   6257  C  CD1  . PHE A 1 14 ? -20.552 1.275   -1.276  1.00 0.00 ? 14  PHE A CD1  7  
ATOM   6258  C  CD2  . PHE A 1 14 ? -20.702 3.403   -2.343  1.00 0.00 ? 14  PHE A CD2  7  
ATOM   6259  C  CE1  . PHE A 1 14 ? -20.922 0.656   -2.455  1.00 0.00 ? 14  PHE A CE1  7  
ATOM   6260  C  CE2  . PHE A 1 14 ? -21.072 2.789   -3.524  1.00 0.00 ? 14  PHE A CE2  7  
ATOM   6261  C  CZ   . PHE A 1 14 ? -21.184 1.413   -3.580  1.00 0.00 ? 14  PHE A CZ   7  
ATOM   6262  H  H    . PHE A 1 14 ? -18.900 4.057   2.268   1.00 0.00 ? 14  PHE A H    7  
ATOM   6263  H  HA   . PHE A 1 14 ? -18.134 2.341   0.079   1.00 0.00 ? 14  PHE A HA   7  
ATOM   6264  H  HB2  . PHE A 1 14 ? -20.526 2.811   0.887   1.00 0.00 ? 14  PHE A HB2  7  
ATOM   6265  H  HB3  . PHE A 1 14 ? -20.381 4.347   0.040   1.00 0.00 ? 14  PHE A HB3  7  
ATOM   6266  H  HD1  . PHE A 1 14 ? -20.349 0.682   -0.397  1.00 0.00 ? 14  PHE A HD1  7  
ATOM   6267  H  HD2  . PHE A 1 14 ? -20.615 4.480   -2.300  1.00 0.00 ? 14  PHE A HD2  7  
ATOM   6268  H  HE1  . PHE A 1 14 ? -21.009 -0.420  -2.496  1.00 0.00 ? 14  PHE A HE1  7  
ATOM   6269  H  HE2  . PHE A 1 14 ? -21.276 3.384   -4.402  1.00 0.00 ? 14  PHE A HE2  7  
ATOM   6270  H  HZ   . PHE A 1 14 ? -21.472 0.931   -4.502  1.00 0.00 ? 14  PHE A HZ   7  
ATOM   6271  N  N    . ILE A 1 15 ? -17.178 3.875   -1.619  1.00 0.00 ? 15  ILE A N    7  
ATOM   6272  C  CA   . ILE A 1 15 ? -16.488 4.757   -2.551  1.00 0.00 ? 15  ILE A CA   7  
ATOM   6273  C  C    . ILE A 1 15 ? -17.444 5.296   -3.610  1.00 0.00 ? 15  ILE A C    7  
ATOM   6274  O  O    . ILE A 1 15 ? -18.187 4.537   -4.233  1.00 0.00 ? 15  ILE A O    7  
ATOM   6275  C  CB   . ILE A 1 15 ? -15.320 4.036   -3.250  1.00 0.00 ? 15  ILE A CB   7  
ATOM   6276  C  CG1  . ILE A 1 15 ? -14.483 3.264   -2.227  1.00 0.00 ? 15  ILE A CG1  7  
ATOM   6277  C  CG2  . ILE A 1 15 ? -14.456 5.034   -4.004  1.00 0.00 ? 15  ILE A CG2  7  
ATOM   6278  C  CD1  . ILE A 1 15 ? -13.616 2.189   -2.843  1.00 0.00 ? 15  ILE A CD1  7  
ATOM   6279  H  H    . ILE A 1 15 ? -17.149 2.907   -1.766  1.00 0.00 ? 15  ILE A H    7  
ATOM   6280  H  HA   . ILE A 1 15 ? -16.086 5.588   -1.988  1.00 0.00 ? 15  ILE A HA   7  
ATOM   6281  H  HB   . ILE A 1 15 ? -15.732 3.340   -3.965  1.00 0.00 ? 15  ILE A HB   7  
ATOM   6282  H  HG12 . ILE A 1 15 ? -13.837 3.954   -1.707  1.00 0.00 ? 15  ILE A HG12 7  
ATOM   6283  H  HG13 . ILE A 1 15 ? -15.145 2.791   -1.515  1.00 0.00 ? 15  ILE A HG13 7  
ATOM   6284  H  HG21 . ILE A 1 15 ? -15.013 5.434   -4.839  1.00 0.00 ? 15  ILE A HG21 7  
ATOM   6285  H  HG22 . ILE A 1 15 ? -14.174 5.839   -3.342  1.00 0.00 ? 15  ILE A HG22 7  
ATOM   6286  H  HG23 . ILE A 1 15 ? -13.568 4.540   -4.368  1.00 0.00 ? 15  ILE A HG23 7  
ATOM   6287  H  HD11 . ILE A 1 15 ? -12.671 2.146   -2.322  1.00 0.00 ? 15  ILE A HD11 7  
ATOM   6288  H  HD12 . ILE A 1 15 ? -14.115 1.235   -2.765  1.00 0.00 ? 15  ILE A HD12 7  
ATOM   6289  H  HD13 . ILE A 1 15 ? -13.442 2.420   -3.884  1.00 0.00 ? 15  ILE A HD13 7  
ATOM   6290  N  N    . ILE A 1 16 ? -17.419 6.609   -3.808  1.00 0.00 ? 16  ILE A N    7  
ATOM   6291  C  CA   . ILE A 1 16 ? -18.282 7.249   -4.794  1.00 0.00 ? 16  ILE A CA   7  
ATOM   6292  C  C    . ILE A 1 16 ? -17.486 8.184   -5.697  1.00 0.00 ? 16  ILE A C    7  
ATOM   6293  O  O    . ILE A 1 16 ? -16.929 9.181   -5.240  1.00 0.00 ? 16  ILE A O    7  
ATOM   6294  C  CB   . ILE A 1 16 ? -19.413 8.046   -4.118  1.00 0.00 ? 16  ILE A CB   7  
ATOM   6295  C  CG1  . ILE A 1 16 ? -20.119 7.184   -3.069  1.00 0.00 ? 16  ILE A CG1  7  
ATOM   6296  C  CG2  . ILE A 1 16 ? -20.407 8.542   -5.159  1.00 0.00 ? 16  ILE A CG2  7  
ATOM   6297  C  CD1  . ILE A 1 16 ? -21.163 7.935   -2.273  1.00 0.00 ? 16  ILE A CD1  7  
ATOM   6298  H  H    . ILE A 1 16 ? -16.806 7.161   -3.280  1.00 0.00 ? 16  ILE A H    7  
ATOM   6299  H  HA   . ILE A 1 16 ? -18.728 6.473   -5.399  1.00 0.00 ? 16  ILE A HA   7  
ATOM   6300  H  HB   . ILE A 1 16 ? -18.978 8.906   -3.633  1.00 0.00 ? 16  ILE A HB   7  
ATOM   6301  H  HG12 . ILE A 1 16 ? -20.608 6.358   -3.560  1.00 0.00 ? 16  ILE A HG12 7  
ATOM   6302  H  HG13 . ILE A 1 16 ? -19.384 6.801   -2.376  1.00 0.00 ? 16  ILE A HG13 7  
ATOM   6303  H  HG21 . ILE A 1 16 ? -20.664 9.570   -4.950  1.00 0.00 ? 16  ILE A HG21 7  
ATOM   6304  H  HG22 . ILE A 1 16 ? -19.962 8.476   -6.140  1.00 0.00 ? 16  ILE A HG22 7  
ATOM   6305  H  HG23 . ILE A 1 16 ? -21.297 7.933   -5.125  1.00 0.00 ? 16  ILE A HG23 7  
ATOM   6306  H  HD11 . ILE A 1 16 ? -21.401 8.862   -2.774  1.00 0.00 ? 16  ILE A HD11 7  
ATOM   6307  H  HD12 . ILE A 1 16 ? -22.054 7.332   -2.187  1.00 0.00 ? 16  ILE A HD12 7  
ATOM   6308  H  HD13 . ILE A 1 16 ? -20.777 8.150   -1.286  1.00 0.00 ? 16  ILE A HD13 7  
ATOM   6309  N  N    . GLY A 1 17 ? -17.437 7.855   -6.985  1.00 0.00 ? 17  GLY A N    7  
ATOM   6310  C  CA   . GLY A 1 17 ? -16.708 8.676   -7.933  1.00 0.00 ? 17  GLY A CA   7  
ATOM   6311  C  C    . GLY A 1 17 ? -15.449 7.999   -8.439  1.00 0.00 ? 17  GLY A C    7  
ATOM   6312  O  O    . GLY A 1 17 ? -15.381 7.585   -9.596  1.00 0.00 ? 17  GLY A O    7  
ATOM   6313  H  H    . GLY A 1 17 ? -17.900 7.048   -7.293  1.00 0.00 ? 17  GLY A H    7  
ATOM   6314  H  HA2  . GLY A 1 17 ? -17.350 8.892   -8.774  1.00 0.00 ? 17  GLY A HA2  7  
ATOM   6315  H  HA3  . GLY A 1 17 ? -16.435 9.604   -7.453  1.00 0.00 ? 17  GLY A HA3  7  
ATOM   6316  N  N    . ARG A 1 18 ? -14.450 7.887   -7.570  1.00 0.00 ? 18  ARG A N    7  
ATOM   6317  C  CA   . ARG A 1 18 ? -13.186 7.258   -7.936  1.00 0.00 ? 18  ARG A CA   7  
ATOM   6318  C  C    . ARG A 1 18 ? -12.925 6.023   -7.079  1.00 0.00 ? 18  ARG A C    7  
ATOM   6319  O  O    . ARG A 1 18 ? -12.835 6.112   -5.854  1.00 0.00 ? 18  ARG A O    7  
ATOM   6320  C  CB   . ARG A 1 18 ? -12.034 8.252   -7.781  1.00 0.00 ? 18  ARG A CB   7  
ATOM   6321  C  CG   . ARG A 1 18 ? -10.663 7.596   -7.751  1.00 0.00 ? 18  ARG A CG   7  
ATOM   6322  C  CD   . ARG A 1 18 ? -9.579  8.548   -8.231  1.00 0.00 ? 18  ARG A CD   7  
ATOM   6323  N  NE   . ARG A 1 18 ? -8.473  7.841   -8.871  1.00 0.00 ? 18  ARG A NE   7  
ATOM   6324  C  CZ   . ARG A 1 18 ? -7.556  8.438   -9.624  1.00 0.00 ? 18  ARG A CZ   7  
ATOM   6325  N  NH1  . ARG A 1 18 ? -7.613  9.746   -9.830  1.00 0.00 ? 18  ARG A NH1  7  
ATOM   6326  N  NH2  . ARG A 1 18 ? -6.580  7.726   -10.172 1.00 0.00 ? 18  ARG A NH2  7  
ATOM   6327  H  H    . ARG A 1 18 ? -14.564 8.236   -6.661  1.00 0.00 ? 18  ARG A H    7  
ATOM   6328  H  HA   . ARG A 1 18 ? -13.253 6.956   -8.970  1.00 0.00 ? 18  ARG A HA   7  
ATOM   6329  H  HB2  . ARG A 1 18 ? -12.058 8.946   -8.609  1.00 0.00 ? 18  ARG A HB2  7  
ATOM   6330  H  HB3  . ARG A 1 18 ? -12.168 8.799   -6.860  1.00 0.00 ? 18  ARG A HB3  7  
ATOM   6331  H  HG2  . ARG A 1 18 ? -10.441 7.295   -6.738  1.00 0.00 ? 18  ARG A HG2  7  
ATOM   6332  H  HG3  . ARG A 1 18 ? -10.677 6.727   -8.392  1.00 0.00 ? 18  ARG A HG3  7  
ATOM   6333  H  HD2  . ARG A 1 18 ? -10.012 9.237   -8.940  1.00 0.00 ? 18  ARG A HD2  7  
ATOM   6334  H  HD3  . ARG A 1 18 ? -9.200  9.097   -7.382  1.00 0.00 ? 18  ARG A HD3  7  
ATOM   6335  H  HE   . ARG A 1 18 ? -8.413  6.873   -8.732  1.00 0.00 ? 18  ARG A HE   7  
ATOM   6336  H  HH11 . ARG A 1 18 ? -8.347  10.286  -9.417  1.00 0.00 ? 18  ARG A HH11 7  
ATOM   6337  H  HH12 . ARG A 1 18 ? -6.920  10.194  -10.396 1.00 0.00 ? 18  ARG A HH12 7  
ATOM   6338  H  HH21 . ARG A 1 18 ? -6.534  6.739   -10.019 1.00 0.00 ? 18  ARG A HH21 7  
ATOM   6339  H  HH22 . ARG A 1 18 ? -5.891  8.176   -10.739 1.00 0.00 ? 18  ARG A HH22 7  
ATOM   6340  N  N    . VAL A 1 19 ? -12.806 4.871   -7.731  1.00 0.00 ? 19  VAL A N    7  
ATOM   6341  C  CA   . VAL A 1 19 ? -12.555 3.618   -7.029  1.00 0.00 ? 19  VAL A CA   7  
ATOM   6342  C  C    . VAL A 1 19 ? -11.200 3.035   -7.413  1.00 0.00 ? 19  VAL A C    7  
ATOM   6343  O  O    . VAL A 1 19 ? -10.968 2.686   -8.571  1.00 0.00 ? 19  VAL A O    7  
ATOM   6344  C  CB   . VAL A 1 19 ? -13.651 2.578   -7.328  1.00 0.00 ? 19  VAL A CB   7  
ATOM   6345  C  CG1  . VAL A 1 19 ? -13.150 1.173   -7.030  1.00 0.00 ? 19  VAL A CG1  7  
ATOM   6346  C  CG2  . VAL A 1 19 ? -14.908 2.885   -6.528  1.00 0.00 ? 19  VAL A CG2  7  
ATOM   6347  H  H    . VAL A 1 19 ? -12.888 4.864   -8.707  1.00 0.00 ? 19  VAL A H    7  
ATOM   6348  H  HA   . VAL A 1 19 ? -12.561 3.822   -5.968  1.00 0.00 ? 19  VAL A HA   7  
ATOM   6349  H  HB   . VAL A 1 19 ? -13.896 2.634   -8.378  1.00 0.00 ? 19  VAL A HB   7  
ATOM   6350  H  HG11 . VAL A 1 19 ? -13.942 0.462   -7.217  1.00 0.00 ? 19  VAL A HG11 7  
ATOM   6351  H  HG12 . VAL A 1 19 ? -12.306 0.949   -7.666  1.00 0.00 ? 19  VAL A HG12 7  
ATOM   6352  H  HG13 . VAL A 1 19 ? -12.848 1.110   -5.995  1.00 0.00 ? 19  VAL A HG13 7  
ATOM   6353  H  HG21 . VAL A 1 19 ? -15.762 2.893   -7.189  1.00 0.00 ? 19  VAL A HG21 7  
ATOM   6354  H  HG22 . VAL A 1 19 ? -15.047 2.127   -5.770  1.00 0.00 ? 19  VAL A HG22 7  
ATOM   6355  H  HG23 . VAL A 1 19 ? -14.808 3.851   -6.056  1.00 0.00 ? 19  VAL A HG23 7  
ATOM   6356  N  N    . ILE A 1 20 ? -10.308 2.932   -6.433  1.00 0.00 ? 20  ILE A N    7  
ATOM   6357  C  CA   . ILE A 1 20 ? -8.975  2.390   -6.668  1.00 0.00 ? 20  ILE A CA   7  
ATOM   6358  C  C    . ILE A 1 20 ? -8.962  0.874   -6.505  1.00 0.00 ? 20  ILE A C    7  
ATOM   6359  O  O    . ILE A 1 20 ? -8.968  0.358   -5.387  1.00 0.00 ? 20  ILE A O    7  
ATOM   6360  C  CB   . ILE A 1 20 ? -7.939  3.007   -5.710  1.00 0.00 ? 20  ILE A CB   7  
ATOM   6361  C  CG1  . ILE A 1 20 ? -8.145  4.520   -5.607  1.00 0.00 ? 20  ILE A CG1  7  
ATOM   6362  C  CG2  . ILE A 1 20 ? -6.528  2.691   -6.181  1.00 0.00 ? 20  ILE A CG2  7  
ATOM   6363  C  CD1  . ILE A 1 20 ? -7.989  5.242   -6.927  1.00 0.00 ? 20  ILE A CD1  7  
ATOM   6364  H  H    . ILE A 1 20 ? -10.552 3.227   -5.531  1.00 0.00 ? 20  ILE A H    7  
ATOM   6365  H  HA   . ILE A 1 20 ? -8.690  2.634   -7.681  1.00 0.00 ? 20  ILE A HA   7  
ATOM   6366  H  HB   . ILE A 1 20 ? -8.075  2.565   -4.735  1.00 0.00 ? 20  ILE A HB   7  
ATOM   6367  H  HG12 . ILE A 1 20 ? -9.139  4.717   -5.237  1.00 0.00 ? 20  ILE A HG12 7  
ATOM   6368  H  HG13 . ILE A 1 20 ? -7.421  4.928   -4.917  1.00 0.00 ? 20  ILE A HG13 7  
ATOM   6369  H  HG21 . ILE A 1 20 ? -6.513  1.716   -6.646  1.00 0.00 ? 20  ILE A HG21 7  
ATOM   6370  H  HG22 . ILE A 1 20 ? -6.212  3.434   -6.897  1.00 0.00 ? 20  ILE A HG22 7  
ATOM   6371  H  HG23 . ILE A 1 20 ? -5.856  2.696   -5.336  1.00 0.00 ? 20  ILE A HG23 7  
ATOM   6372  H  HD11 . ILE A 1 20 ? -8.353  6.255   -6.829  1.00 0.00 ? 20  ILE A HD11 7  
ATOM   6373  H  HD12 . ILE A 1 20 ? -6.947  5.258   -7.208  1.00 0.00 ? 20  ILE A HD12 7  
ATOM   6374  H  HD13 . ILE A 1 20 ? -8.559  4.728   -7.688  1.00 0.00 ? 20  ILE A HD13 7  
ATOM   6375  N  N    . LYS A 1 21 ? -8.942  0.163   -7.627  1.00 0.00 ? 21  LYS A N    7  
ATOM   6376  C  CA   . LYS A 1 21 ? -8.925  -1.295  -7.611  1.00 0.00 ? 21  LYS A CA   7  
ATOM   6377  C  C    . LYS A 1 21 ? -7.516  -1.819  -7.349  1.00 0.00 ? 21  LYS A C    7  
ATOM   6378  O  O    . LYS A 1 21 ? -6.601  -1.589  -8.139  1.00 0.00 ? 21  LYS A O    7  
ATOM   6379  C  CB   . LYS A 1 21 ? -9.447  -1.847  -8.939  1.00 0.00 ? 21  LYS A CB   7  
ATOM   6380  C  CG   . LYS A 1 21 ? -10.949 -1.704  -9.109  1.00 0.00 ? 21  LYS A CG   7  
ATOM   6381  C  CD   . LYS A 1 21 ? -11.688 -2.927  -8.592  1.00 0.00 ? 21  LYS A CD   7  
ATOM   6382  C  CE   . LYS A 1 21 ? -12.122 -2.747  -7.146  1.00 0.00 ? 21  LYS A CE   7  
ATOM   6383  N  NZ   . LYS A 1 21 ? -12.938 -3.896  -6.664  1.00 0.00 ? 21  LYS A NZ   7  
ATOM   6384  H  H    . LYS A 1 21 ? -8.939  0.632   -8.489  1.00 0.00 ? 21  LYS A H    7  
ATOM   6385  H  HA   . LYS A 1 21 ? -9.573  -1.625  -6.814  1.00 0.00 ? 21  LYS A HA   7  
ATOM   6386  H  HB2  . LYS A 1 21 ? -8.962  -1.321  -9.749  1.00 0.00 ? 21  LYS A HB2  7  
ATOM   6387  H  HB3  . LYS A 1 21 ? -9.197  -2.896  -9.002  1.00 0.00 ? 21  LYS A HB3  7  
ATOM   6388  H  HG2  . LYS A 1 21 ? -11.284 -0.836  -8.559  1.00 0.00 ? 21  LYS A HG2  7  
ATOM   6389  H  HG3  . LYS A 1 21 ? -11.173 -1.576  -10.158 1.00 0.00 ? 21  LYS A HG3  7  
ATOM   6390  H  HD2  . LYS A 1 21 ? -12.564 -3.092  -9.201  1.00 0.00 ? 21  LYS A HD2  7  
ATOM   6391  H  HD3  . LYS A 1 21 ? -11.034 -3.786  -8.658  1.00 0.00 ? 21  LYS A HD3  7  
ATOM   6392  H  HE2  . LYS A 1 21 ? -11.241 -2.657  -6.528  1.00 0.00 ? 21  LYS A HE2  7  
ATOM   6393  H  HE3  . LYS A 1 21 ? -12.708 -1.843  -7.070  1.00 0.00 ? 21  LYS A HE3  7  
ATOM   6394  H  HZ1  . LYS A 1 21 ? -13.042 -3.851  -5.630  1.00 0.00 ? 21  LYS A HZ1  7  
ATOM   6395  H  HZ2  . LYS A 1 21 ? -12.475 -4.792  -6.915  1.00 0.00 ? 21  LYS A HZ2  7  
ATOM   6396  H  HZ3  . LYS A 1 21 ? -13.882 -3.871  -7.098  1.00 0.00 ? 21  LYS A HZ3  7  
ATOM   6397  N  N    . ALA A 1 22 ? -7.350  -2.525  -6.235  1.00 0.00 ? 22  ALA A N    7  
ATOM   6398  C  CA   . ALA A 1 22 ? -6.055  -3.084  -5.871  1.00 0.00 ? 22  ALA A CA   7  
ATOM   6399  C  C    . ALA A 1 22 ? -6.216  -4.297  -4.960  1.00 0.00 ? 22  ALA A C    7  
ATOM   6400  O  O    . ALA A 1 22 ? -7.275  -4.502  -4.367  1.00 0.00 ? 22  ALA A O    7  
ATOM   6401  C  CB   . ALA A 1 22 ? -5.194  -2.027  -5.197  1.00 0.00 ? 22  ALA A CB   7  
ATOM   6402  H  H    . ALA A 1 22 ? -8.118  -2.674  -5.645  1.00 0.00 ? 22  ALA A H    7  
ATOM   6403  H  HA   . ALA A 1 22 ? -5.557  -3.393  -6.780  1.00 0.00 ? 22  ALA A HA   7  
ATOM   6404  H  HB1  . ALA A 1 22 ? -4.629  -2.481  -4.396  1.00 0.00 ? 22  ALA A HB1  7  
ATOM   6405  H  HB2  . ALA A 1 22 ? -4.514  -1.601  -5.920  1.00 0.00 ? 22  ALA A HB2  7  
ATOM   6406  H  HB3  . ALA A 1 22 ? -5.827  -1.249  -4.796  1.00 0.00 ? 22  ALA A HB3  7  
ATOM   6407  N  N    . MET A 1 23 ? -5.161  -5.097  -4.856  1.00 0.00 ? 23  MET A N    7  
ATOM   6408  C  CA   . MET A 1 23 ? -5.187  -6.290  -4.016  1.00 0.00 ? 23  MET A CA   7  
ATOM   6409  C  C    . MET A 1 23 ? -6.502  -7.044  -4.184  1.00 0.00 ? 23  MET A C    7  
ATOM   6410  O  O    . MET A 1 23 ? -6.962  -7.719  -3.264  1.00 0.00 ? 23  MET A O    7  
ATOM   6411  C  CB   . MET A 1 23 ? -4.986  -5.910  -2.548  1.00 0.00 ? 23  MET A CB   7  
ATOM   6412  C  CG   . MET A 1 23 ? -3.733  -5.087  -2.299  1.00 0.00 ? 23  MET A CG   7  
ATOM   6413  S  SD   . MET A 1 23 ? -2.219  -6.016  -2.610  1.00 0.00 ? 23  MET A SD   7  
ATOM   6414  C  CE   . MET A 1 23 ? -1.583  -6.195  -0.945  1.00 0.00 ? 23  MET A CE   7  
ATOM   6415  H  H    . MET A 1 23 ? -4.345  -4.882  -5.354  1.00 0.00 ? 23  MET A H    7  
ATOM   6416  H  HA   . MET A 1 23 ? -4.376  -6.931  -4.327  1.00 0.00 ? 23  MET A HA   7  
ATOM   6417  H  HB2  . MET A 1 23 ? -5.839  -5.337  -2.217  1.00 0.00 ? 23  MET A HB2  7  
ATOM   6418  H  HB3  . MET A 1 23 ? -4.920  -6.814  -1.960  1.00 0.00 ? 23  MET A HB3  7  
ATOM   6419  H  HG2  . MET A 1 23 ? -3.749  -4.225  -2.948  1.00 0.00 ? 23  MET A HG2  7  
ATOM   6420  H  HG3  . MET A 1 23 ? -3.733  -4.760  -1.269  1.00 0.00 ? 23  MET A HG3  7  
ATOM   6421  H  HE1  . MET A 1 23 ? -1.032  -5.307  -0.673  1.00 0.00 ? 23  MET A HE1  7  
ATOM   6422  H  HE2  . MET A 1 23 ? -2.405  -6.333  -0.259  1.00 0.00 ? 23  MET A HE2  7  
ATOM   6423  H  HE3  . MET A 1 23 ? -0.928  -7.053  -0.901  1.00 0.00 ? 23  MET A HE3  7  
ATOM   6424  N  N    . ASN A 1 24 ? -7.102  -6.923  -5.363  1.00 0.00 ? 24  ASN A N    7  
ATOM   6425  C  CA   . ASN A 1 24 ? -8.365  -7.593  -5.650  1.00 0.00 ? 24  ASN A CA   7  
ATOM   6426  C  C    . ASN A 1 24 ? -9.489  -7.029  -4.786  1.00 0.00 ? 24  ASN A C    7  
ATOM   6427  O  O    . ASN A 1 24 ? -10.327 -7.772  -4.278  1.00 0.00 ? 24  ASN A O    7  
ATOM   6428  C  CB   . ASN A 1 24 ? -8.233  -9.099  -5.415  1.00 0.00 ? 24  ASN A CB   7  
ATOM   6429  C  CG   . ASN A 1 24 ? -9.469  -9.863  -5.849  1.00 0.00 ? 24  ASN A CG   7  
ATOM   6430  O  OD1  . ASN A 1 24 ? -10.144 -10.490 -5.032  1.00 0.00 ? 24  ASN A OD1  7  
ATOM   6431  N  ND2  . ASN A 1 24 ? -9.771  -9.815  -7.141  1.00 0.00 ? 24  ASN A ND2  7  
ATOM   6432  H  H    . ASN A 1 24 ? -6.686  -6.370  -6.057  1.00 0.00 ? 24  ASN A H    7  
ATOM   6433  H  HA   . ASN A 1 24 ? -8.604  -7.420  -6.689  1.00 0.00 ? 24  ASN A HA   7  
ATOM   6434  H  HB2  . ASN A 1 24 ? -7.388  -9.472  -5.975  1.00 0.00 ? 24  ASN A HB2  7  
ATOM   6435  H  HB3  . ASN A 1 24 ? -8.070  -9.281  -4.363  1.00 0.00 ? 24  ASN A HB3  7  
ATOM   6436  H  HD21 . ASN A 1 24 ? -9.187  -9.297  -7.734  1.00 0.00 ? 24  ASN A HD21 7  
ATOM   6437  H  HD22 . ASN A 1 24 ? -10.565 -10.300 -7.449  1.00 0.00 ? 24  ASN A HD22 7  
ATOM   6438  N  N    . ASN A 1 25 ? -9.499  -5.710  -4.625  1.00 0.00 ? 25  ASN A N    7  
ATOM   6439  C  CA   . ASN A 1 25 ? -10.519 -5.045  -3.823  1.00 0.00 ? 25  ASN A CA   7  
ATOM   6440  C  C    . ASN A 1 25 ? -10.569 -3.553  -4.133  1.00 0.00 ? 25  ASN A C    7  
ATOM   6441  O  O    . ASN A 1 25 ? -9.625  -2.992  -4.690  1.00 0.00 ? 25  ASN A O    7  
ATOM   6442  C  CB   . ASN A 1 25 ? -10.245 -5.259  -2.333  1.00 0.00 ? 25  ASN A CB   7  
ATOM   6443  C  CG   . ASN A 1 25 ? -10.594 -6.662  -1.876  1.00 0.00 ? 25  ASN A CG   7  
ATOM   6444  O  OD1  . ASN A 1 25 ? -11.758 -7.061  -1.892  1.00 0.00 ? 25  ASN A OD1  7  
ATOM   6445  N  ND2  . ASN A 1 25 ? -9.583  -7.419  -1.464  1.00 0.00 ? 25  ASN A ND2  7  
ATOM   6446  H  H    . ASN A 1 25 ? -8.803  -5.170  -5.056  1.00 0.00 ? 25  ASN A H    7  
ATOM   6447  H  HA   . ASN A 1 25 ? -11.474 -5.485  -4.070  1.00 0.00 ? 25  ASN A HA   7  
ATOM   6448  H  HB2  . ASN A 1 25 ? -9.196  -5.088  -2.138  1.00 0.00 ? 25  ASN A HB2  7  
ATOM   6449  H  HB3  . ASN A 1 25 ? -10.832 -4.557  -1.760  1.00 0.00 ? 25  ASN A HB3  7  
ATOM   6450  H  HD21 . ASN A 1 25 ? -8.681  -7.035  -1.478  1.00 0.00 ? 25  ASN A HD21 7  
ATOM   6451  H  HD22 . ASN A 1 25 ? -9.780  -8.330  -1.164  1.00 0.00 ? 25  ASN A HD22 7  
ATOM   6452  N  N    . SER A 1 26 ? -11.677 -2.914  -3.769  1.00 0.00 ? 26  SER A N    7  
ATOM   6453  C  CA   . SER A 1 26 ? -11.851 -1.487  -4.011  1.00 0.00 ? 26  SER A CA   7  
ATOM   6454  C  C    . SER A 1 26 ? -11.328 -0.668  -2.835  1.00 0.00 ? 26  SER A C    7  
ATOM   6455  O  O    . SER A 1 26 ? -11.406 -1.096  -1.683  1.00 0.00 ? 26  SER A O    7  
ATOM   6456  C  CB   . SER A 1 26 ? -13.327 -1.166  -4.253  1.00 0.00 ? 26  SER A CB   7  
ATOM   6457  O  OG   . SER A 1 26 ? -14.142 -1.707  -3.227  1.00 0.00 ? 26  SER A OG   7  
ATOM   6458  H  H    . SER A 1 26 ? -12.394 -3.416  -3.328  1.00 0.00 ? 26  SER A H    7  
ATOM   6459  H  HA   . SER A 1 26 ? -11.286 -1.229  -4.894  1.00 0.00 ? 26  SER A HA   7  
ATOM   6460  H  HB2  . SER A 1 26 ? -13.462 -0.096  -4.276  1.00 0.00 ? 26  SER A HB2  7  
ATOM   6461  H  HB3  . SER A 1 26 ? -13.634 -1.588  -5.200  1.00 0.00 ? 26  SER A HB3  7  
ATOM   6462  H  HG   . SER A 1 26 ? -14.141 -2.665  -3.289  1.00 0.00 ? 26  SER A HG   7  
ATOM   6463  N  N    . TRP A 1 27 ? -10.794 0.510   -3.134  1.00 0.00 ? 27  TRP A N    7  
ATOM   6464  C  CA   . TRP A 1 27 ? -10.256 1.390   -2.102  1.00 0.00 ? 27  TRP A CA   7  
ATOM   6465  C  C    . TRP A 1 27 ? -10.396 2.853   -2.508  1.00 0.00 ? 27  TRP A C    7  
ATOM   6466  O  O    . TRP A 1 27 ? -10.759 3.161   -3.644  1.00 0.00 ? 27  TRP A O    7  
ATOM   6467  C  CB   . TRP A 1 27 ? -8.787  1.060   -1.836  1.00 0.00 ? 27  TRP A CB   7  
ATOM   6468  C  CG   . TRP A 1 27 ? -8.509  -0.412  -1.781  1.00 0.00 ? 27  TRP A CG   7  
ATOM   6469  C  CD1  . TRP A 1 27 ? -8.716  -1.323  -2.777  1.00 0.00 ? 27  TRP A CD1  7  
ATOM   6470  C  CD2  . TRP A 1 27 ? -7.976  -1.143  -0.671  1.00 0.00 ? 27  TRP A CD2  7  
ATOM   6471  N  NE1  . TRP A 1 27 ? -8.343  -2.576  -2.354  1.00 0.00 ? 27  TRP A NE1  7  
ATOM   6472  C  CE2  . TRP A 1 27 ? -7.886  -2.492  -1.065  1.00 0.00 ? 27  TRP A CE2  7  
ATOM   6473  C  CE3  . TRP A 1 27 ? -7.565  -0.788  0.617   1.00 0.00 ? 27  TRP A CE3  7  
ATOM   6474  C  CZ2  . TRP A 1 27 ? -7.402  -3.484  -0.217  1.00 0.00 ? 27  TRP A CZ2  7  
ATOM   6475  C  CZ3  . TRP A 1 27 ? -7.086  -1.774  1.458   1.00 0.00 ? 27  TRP A CZ3  7  
ATOM   6476  C  CH2  . TRP A 1 27 ? -7.006  -3.109  1.038   1.00 0.00 ? 27  TRP A CH2  7  
ATOM   6477  H  H    . TRP A 1 27 ? -10.759 0.796   -4.072  1.00 0.00 ? 27  TRP A H    7  
ATOM   6478  H  HA   . TRP A 1 27 ? -10.823 1.223   -1.198  1.00 0.00 ? 27  TRP A HA   7  
ATOM   6479  H  HB2  . TRP A 1 27 ? -8.181  1.484   -2.622  1.00 0.00 ? 27  TRP A HB2  7  
ATOM   6480  H  HB3  . TRP A 1 27 ? -8.495  1.490   -0.889  1.00 0.00 ? 27  TRP A HB3  7  
ATOM   6481  H  HD1  . TRP A 1 27 ? -9.116  -1.080  -3.750  1.00 0.00 ? 27  TRP A HD1  7  
ATOM   6482  H  HE1  . TRP A 1 27 ? -8.396  -3.396  -2.888  1.00 0.00 ? 27  TRP A HE1  7  
ATOM   6483  H  HE3  . TRP A 1 27 ? -7.618  0.235   0.958   1.00 0.00 ? 27  TRP A HE3  7  
ATOM   6484  H  HZ2  . TRP A 1 27 ? -7.334  -4.517  -0.525  1.00 0.00 ? 27  TRP A HZ2  7  
ATOM   6485  H  HZ3  . TRP A 1 27 ? -6.764  -1.519  2.457   1.00 0.00 ? 27  TRP A HZ3  7  
ATOM   6486  H  HH2  . TRP A 1 27 ? -6.626  -3.846  1.729   1.00 0.00 ? 27  TRP A HH2  7  
ATOM   6487  N  N    . HIS A 1 28 ? -10.105 3.752   -1.573  1.00 0.00 ? 28  HIS A N    7  
ATOM   6488  C  CA   . HIS A 1 28 ? -10.198 5.184   -1.834  1.00 0.00 ? 28  HIS A CA   7  
ATOM   6489  C  C    . HIS A 1 28 ? -8.888  5.718   -2.405  1.00 0.00 ? 28  HIS A C    7  
ATOM   6490  O  O    . HIS A 1 28 ? -7.821  5.127   -2.234  1.00 0.00 ? 28  HIS A O    7  
ATOM   6491  C  CB   . HIS A 1 28 ? -10.554 5.936   -0.551  1.00 0.00 ? 28  HIS A CB   7  
ATOM   6492  C  CG   . HIS A 1 28 ? -12.001 5.836   -0.180  1.00 0.00 ? 28  HIS A CG   7  
ATOM   6493  N  ND1  . HIS A 1 28 ? -12.436 5.307   1.017   1.00 0.00 ? 28  HIS A ND1  7  
ATOM   6494  C  CD2  . HIS A 1 28 ? -13.116 6.202   -0.855  1.00 0.00 ? 28  HIS A CD2  7  
ATOM   6495  C  CE1  . HIS A 1 28 ? -13.755 5.351   1.062   1.00 0.00 ? 28  HIS A CE1  7  
ATOM   6496  N  NE2  . HIS A 1 28 ? -14.193 5.890   -0.062  1.00 0.00 ? 28  HIS A NE2  7  
ATOM   6497  H  H    . HIS A 1 28 ? -9.821  3.445   -0.687  1.00 0.00 ? 28  HIS A H    7  
ATOM   6498  H  HA   . HIS A 1 28 ? -10.981 5.339   -2.560  1.00 0.00 ? 28  HIS A HA   7  
ATOM   6499  H  HB2  . HIS A 1 28 ? -9.973  5.534   0.266   1.00 0.00 ? 28  HIS A HB2  7  
ATOM   6500  H  HB3  . HIS A 1 28 ? -10.314 6.982   -0.677  1.00 0.00 ? 28  HIS A HB3  7  
ATOM   6501  H  HD2  . HIS A 1 28 ? -13.152 6.656   -1.835  1.00 0.00 ? 28  HIS A HD2  7  
ATOM   6502  H  HE1  . HIS A 1 28 ? -14.372 5.005   1.878   1.00 0.00 ? 28  HIS A HE1  7  
ATOM   6503  H  HE2  . HIS A 1 28 ? -15.134 5.962   -0.324  1.00 0.00 ? 28  HIS A HE2  7  
ATOM   6504  N  N    . PRO A 1 29 ? -8.967  6.863   -3.099  1.00 0.00 ? 29  PRO A N    7  
ATOM   6505  C  CA   . PRO A 1 29 ? -7.796  7.502   -3.708  1.00 0.00 ? 29  PRO A CA   7  
ATOM   6506  C  C    . PRO A 1 29 ? -6.846  8.084   -2.668  1.00 0.00 ? 29  PRO A C    7  
ATOM   6507  O  O    . PRO A 1 29 ? -5.801  8.637   -3.010  1.00 0.00 ? 29  PRO A O    7  
ATOM   6508  C  CB   . PRO A 1 29 ? -8.405  8.618   -4.561  1.00 0.00 ? 29  PRO A CB   7  
ATOM   6509  C  CG   . PRO A 1 29 ? -9.709  8.925   -3.908  1.00 0.00 ? 29  PRO A CG   7  
ATOM   6510  C  CD   . PRO A 1 29 ? -10.205 7.623   -3.342  1.00 0.00 ? 29  PRO A CD   7  
ATOM   6511  H  HA   . PRO A 1 29 ? -7.256  6.815   -4.344  1.00 0.00 ? 29  PRO A HA   7  
ATOM   6512  H  HB2  . PRO A 1 29 ? -7.749  9.477   -4.556  1.00 0.00 ? 29  PRO A HB2  7  
ATOM   6513  H  HB3  . PRO A 1 29 ? -8.543  8.269   -5.573  1.00 0.00 ? 29  PRO A HB3  7  
ATOM   6514  H  HG2  . PRO A 1 29 ? -9.564  9.646   -3.119  1.00 0.00 ? 29  PRO A HG2  7  
ATOM   6515  H  HG3  . PRO A 1 29 ? -10.406 9.303   -4.641  1.00 0.00 ? 29  PRO A HG3  7  
ATOM   6516  H  HD2  . PRO A 1 29 ? -10.740 7.792   -2.419  1.00 0.00 ? 29  PRO A HD2  7  
ATOM   6517  H  HD3  . PRO A 1 29 ? -10.834 7.115   -4.058  1.00 0.00 ? 29  PRO A HD3  7  
ATOM   6518  N  N    . GLU A 1 30 ? -7.215  7.955   -1.397  1.00 0.00 ? 30  GLU A N    7  
ATOM   6519  C  CA   . GLU A 1 30 ? -6.394  8.469   -0.308  1.00 0.00 ? 30  GLU A CA   7  
ATOM   6520  C  C    . GLU A 1 30 ? -6.052  7.362   0.685   1.00 0.00 ? 30  GLU A C    7  
ATOM   6521  O  O    . GLU A 1 30 ? -4.973  7.355   1.277   1.00 0.00 ? 30  GLU A O    7  
ATOM   6522  C  CB   . GLU A 1 30 ? -7.118  9.609   0.412   1.00 0.00 ? 30  GLU A CB   7  
ATOM   6523  C  CG   . GLU A 1 30 ? -8.369  9.165   1.152   1.00 0.00 ? 30  GLU A CG   7  
ATOM   6524  C  CD   . GLU A 1 30 ? -9.360  10.295  1.353   1.00 0.00 ? 30  GLU A CD   7  
ATOM   6525  O  OE1  . GLU A 1 30 ? -9.505  11.128  0.435   1.00 0.00 ? 30  GLU A OE1  7  
ATOM   6526  O  OE2  . GLU A 1 30 ? -9.991  10.345  2.430   1.00 0.00 ? 30  GLU A OE2  7  
ATOM   6527  H  H    . GLU A 1 30 ? -8.060  7.504   -1.188  1.00 0.00 ? 30  GLU A H    7  
ATOM   6528  H  HA   . GLU A 1 30 ? -5.478  8.850   -0.734  1.00 0.00 ? 30  GLU A HA   7  
ATOM   6529  H  HB2  . GLU A 1 30 ? -6.442  10.056  1.125   1.00 0.00 ? 30  GLU A HB2  7  
ATOM   6530  H  HB3  . GLU A 1 30 ? -7.402  10.355  -0.316  1.00 0.00 ? 30  GLU A HB3  7  
ATOM   6531  H  HG2  . GLU A 1 30 ? -8.849  8.383   0.584   1.00 0.00 ? 30  GLU A HG2  7  
ATOM   6532  H  HG3  . GLU A 1 30 ? -8.082  8.781   2.120   1.00 0.00 ? 30  GLU A HG3  7  
ATOM   6533  N  N    . CYS A 1 31 ? -6.980  6.428   0.863   1.00 0.00 ? 31  CYS A N    7  
ATOM   6534  C  CA   . CYS A 1 31 ? -6.780  5.316   1.785   1.00 0.00 ? 31  CYS A CA   7  
ATOM   6535  C  C    . CYS A 1 31 ? -5.609  4.445   1.340   1.00 0.00 ? 31  CYS A C    7  
ATOM   6536  O  O    . CYS A 1 31 ? -4.617  4.306   2.056   1.00 0.00 ? 31  CYS A O    7  
ATOM   6537  C  CB   . CYS A 1 31 ? -8.051  4.470   1.881   1.00 0.00 ? 31  CYS A CB   7  
ATOM   6538  S  SG   . CYS A 1 31 ? -9.324  5.164   2.984   1.00 0.00 ? 31  CYS A SG   7  
ATOM   6539  H  H    . CYS A 1 31 ? -7.822  6.488   0.363   1.00 0.00 ? 31  CYS A H    7  
ATOM   6540  H  HA   . CYS A 1 31 ? -6.558  5.727   2.758   1.00 0.00 ? 31  CYS A HA   7  
ATOM   6541  H  HB2  . CYS A 1 31 ? -8.487  4.376   0.896   1.00 0.00 ? 31  CYS A HB2  7  
ATOM   6542  H  HB3  . CYS A 1 31 ? -7.794  3.489   2.250   1.00 0.00 ? 31  CYS A HB3  7  
ATOM   6543  N  N    . PHE A 1 32 ? -5.731  3.861   0.152   1.00 0.00 ? 32  PHE A N    7  
ATOM   6544  C  CA   . PHE A 1 32 ? -4.683  3.003   -0.389  1.00 0.00 ? 32  PHE A CA   7  
ATOM   6545  C  C    . PHE A 1 32 ? -3.321  3.684   -0.298  1.00 0.00 ? 32  PHE A C    7  
ATOM   6546  O  O    . PHE A 1 32 ? -2.921  4.419   -1.201  1.00 0.00 ? 32  PHE A O    7  
ATOM   6547  C  CB   . PHE A 1 32 ? -4.990  2.644   -1.844  1.00 0.00 ? 32  PHE A CB   7  
ATOM   6548  C  CG   . PHE A 1 32 ? -4.200  1.472   -2.352  1.00 0.00 ? 32  PHE A CG   7  
ATOM   6549  C  CD1  . PHE A 1 32 ? -4.319  0.228   -1.754  1.00 0.00 ? 32  PHE A CD1  7  
ATOM   6550  C  CD2  . PHE A 1 32 ? -3.338  1.614   -3.427  1.00 0.00 ? 32  PHE A CD2  7  
ATOM   6551  C  CE1  . PHE A 1 32 ? -3.592  -0.852  -2.219  1.00 0.00 ? 32  PHE A CE1  7  
ATOM   6552  C  CE2  . PHE A 1 32 ? -2.608  0.538   -3.897  1.00 0.00 ? 32  PHE A CE2  7  
ATOM   6553  C  CZ   . PHE A 1 32 ? -2.737  -0.697  -3.292  1.00 0.00 ? 32  PHE A CZ   7  
ATOM   6554  H  H    . PHE A 1 32 ? -6.546  4.010   -0.372  1.00 0.00 ? 32  PHE A H    7  
ATOM   6555  H  HA   . PHE A 1 32 ? -4.660  2.098   0.199   1.00 0.00 ? 32  PHE A HA   7  
ATOM   6556  H  HB2  . PHE A 1 32 ? -6.038  2.400   -1.934  1.00 0.00 ? 32  PHE A HB2  7  
ATOM   6557  H  HB3  . PHE A 1 32 ? -4.767  3.493   -2.472  1.00 0.00 ? 32  PHE A HB3  7  
ATOM   6558  H  HD1  . PHE A 1 32 ? -4.988  0.104   -0.915  1.00 0.00 ? 32  PHE A HD1  7  
ATOM   6559  H  HD2  . PHE A 1 32 ? -3.237  2.580   -3.902  1.00 0.00 ? 32  PHE A HD2  7  
ATOM   6560  H  HE1  . PHE A 1 32 ? -3.694  -1.817  -1.744  1.00 0.00 ? 32  PHE A HE1  7  
ATOM   6561  H  HE2  . PHE A 1 32 ? -1.941  0.663   -4.736  1.00 0.00 ? 32  PHE A HE2  7  
ATOM   6562  H  HZ   . PHE A 1 32 ? -2.167  -1.539  -3.657  1.00 0.00 ? 32  PHE A HZ   7  
ATOM   6563  N  N    . ARG A 1 33 ? -2.614  3.435   0.799   1.00 0.00 ? 33  ARG A N    7  
ATOM   6564  C  CA   . ARG A 1 33 ? -1.298  4.026   1.010   1.00 0.00 ? 33  ARG A CA   7  
ATOM   6565  C  C    . ARG A 1 33 ? -0.243  2.943   1.215   1.00 0.00 ? 33  ARG A C    7  
ATOM   6566  O  O    . ARG A 1 33 ? -0.569  1.781   1.458   1.00 0.00 ? 33  ARG A O    7  
ATOM   6567  C  CB   . ARG A 1 33 ? -1.323  4.963   2.219   1.00 0.00 ? 33  ARG A CB   7  
ATOM   6568  C  CG   . ARG A 1 33 ? -2.128  6.231   1.990   1.00 0.00 ? 33  ARG A CG   7  
ATOM   6569  C  CD   . ARG A 1 33 ? -1.800  7.294   3.027   1.00 0.00 ? 33  ARG A CD   7  
ATOM   6570  N  NE   . ARG A 1 33 ? -1.939  8.645   2.489   1.00 0.00 ? 33  ARG A NE   7  
ATOM   6571  C  CZ   . ARG A 1 33 ? -3.067  9.345   2.543   1.00 0.00 ? 33  ARG A CZ   7  
ATOM   6572  N  NH1  . ARG A 1 33 ? -4.148  8.824   3.108   1.00 0.00 ? 33  ARG A NH1  7  
ATOM   6573  N  NH2  . ARG A 1 33 ? -3.115  10.568  2.031   1.00 0.00 ? 33  ARG A NH2  7  
ATOM   6574  H  H    . ARG A 1 33 ? -2.987  2.842   1.484   1.00 0.00 ? 33  ARG A H    7  
ATOM   6575  H  HA   . ARG A 1 33 ? -1.045  4.596   0.129   1.00 0.00 ? 33  ARG A HA   7  
ATOM   6576  H  HB2  . ARG A 1 33 ? -1.753  4.436   3.059   1.00 0.00 ? 33  ARG A HB2  7  
ATOM   6577  H  HB3  . ARG A 1 33 ? -0.310  5.244   2.463   1.00 0.00 ? 33  ARG A HB3  7  
ATOM   6578  H  HG2  . ARG A 1 33 ? -1.900  6.619   1.009   1.00 0.00 ? 33  ARG A HG2  7  
ATOM   6579  H  HG3  . ARG A 1 33 ? -3.180  5.994   2.050   1.00 0.00 ? 33  ARG A HG3  7  
ATOM   6580  H  HD2  . ARG A 1 33 ? -2.471  7.180   3.865   1.00 0.00 ? 33  ARG A HD2  7  
ATOM   6581  H  HD3  . ARG A 1 33 ? -0.783  7.152   3.359   1.00 0.00 ? 33  ARG A HD3  7  
ATOM   6582  H  HE   . ARG A 1 33 ? -1.153  9.049   2.067   1.00 0.00 ? 33  ARG A HE   7  
ATOM   6583  H  HH11 . ARG A 1 33 ? -4.114  7.903   3.495   1.00 0.00 ? 33  ARG A HH11 7  
ATOM   6584  H  HH12 . ARG A 1 33 ? -4.995  9.354   3.148   1.00 0.00 ? 33  ARG A HH12 7  
ATOM   6585  H  HH21 . ARG A 1 33 ? -2.302  10.964  1.605   1.00 0.00 ? 33  ARG A HH21 7  
ATOM   6586  H  HH22 . ARG A 1 33 ? -3.964  11.094  2.072   1.00 0.00 ? 33  ARG A HH22 7  
ATOM   6587  N  N    . CYS A 1 34 ? 1.024   3.331   1.113   1.00 0.00 ? 34  CYS A N    7  
ATOM   6588  C  CA   . CYS A 1 34 ? 2.128   2.395   1.286   1.00 0.00 ? 34  CYS A CA   7  
ATOM   6589  C  C    . CYS A 1 34 ? 2.076   1.740   2.663   1.00 0.00 ? 34  CYS A C    7  
ATOM   6590  O  O    . CYS A 1 34 ? 1.378   2.213   3.561   1.00 0.00 ? 34  CYS A O    7  
ATOM   6591  C  CB   . CYS A 1 34 ? 3.467   3.112   1.100   1.00 0.00 ? 34  CYS A CB   7  
ATOM   6592  S  SG   . CYS A 1 34 ? 4.891   1.991   0.916   1.00 0.00 ? 34  CYS A SG   7  
ATOM   6593  H  H    . CYS A 1 34 ? 1.222   4.272   0.917   1.00 0.00 ? 34  CYS A H    7  
ATOM   6594  H  HA   . CYS A 1 34 ? 2.033   1.627   0.532   1.00 0.00 ? 34  CYS A HA   7  
ATOM   6595  H  HB2  . CYS A 1 34 ? 3.417   3.727   0.213   1.00 0.00 ? 34  CYS A HB2  7  
ATOM   6596  H  HB3  . CYS A 1 34 ? 3.651   3.741   1.958   1.00 0.00 ? 34  CYS A HB3  7  
ATOM   6597  N  N    . ASP A 1 35 ? 2.818   0.650   2.822   1.00 0.00 ? 35  ASP A N    7  
ATOM   6598  C  CA   . ASP A 1 35 ? 2.859   -0.070  4.090   1.00 0.00 ? 35  ASP A CA   7  
ATOM   6599  C  C    . ASP A 1 35 ? 4.174   0.186   4.818   1.00 0.00 ? 35  ASP A C    7  
ATOM   6600  O  O    . ASP A 1 35 ? 4.477   -0.461  5.822   1.00 0.00 ? 35  ASP A O    7  
ATOM   6601  C  CB   . ASP A 1 35 ? 2.674   -1.570  3.856   1.00 0.00 ? 35  ASP A CB   7  
ATOM   6602  C  CG   . ASP A 1 35 ? 2.002   -2.260  5.026   1.00 0.00 ? 35  ASP A CG   7  
ATOM   6603  O  OD1  . ASP A 1 35 ? 0.809   -1.986  5.272   1.00 0.00 ? 35  ASP A OD1  7  
ATOM   6604  O  OD2  . ASP A 1 35 ? 2.670   -3.076  5.696   1.00 0.00 ? 35  ASP A OD2  7  
ATOM   6605  H  H    . ASP A 1 35 ? 3.353   0.322   2.069   1.00 0.00 ? 35  ASP A H    7  
ATOM   6606  H  HA   . ASP A 1 35 ? 2.046   0.292   4.702   1.00 0.00 ? 35  ASP A HA   7  
ATOM   6607  H  HB2  . ASP A 1 35 ? 2.064   -1.718  2.976   1.00 0.00 ? 35  ASP A HB2  7  
ATOM   6608  H  HB3  . ASP A 1 35 ? 3.641   -2.024  3.699   1.00 0.00 ? 35  ASP A HB3  7  
ATOM   6609  N  N    . LEU A 1 36 ? 4.954   1.132   4.307   1.00 0.00 ? 36  LEU A N    7  
ATOM   6610  C  CA   . LEU A 1 36 ? 6.239   1.473   4.908   1.00 0.00 ? 36  LEU A CA   7  
ATOM   6611  C  C    . LEU A 1 36 ? 6.359   2.979   5.118   1.00 0.00 ? 36  LEU A C    7  
ATOM   6612  O  O    . LEU A 1 36 ? 6.953   3.434   6.096   1.00 0.00 ? 36  LEU A O    7  
ATOM   6613  C  CB   . LEU A 1 36 ? 7.385   0.977   4.024   1.00 0.00 ? 36  LEU A CB   7  
ATOM   6614  C  CG   . LEU A 1 36 ? 7.559   -0.540  3.939   1.00 0.00 ? 36  LEU A CG   7  
ATOM   6615  C  CD1  . LEU A 1 36 ? 8.262   -0.925  2.647   1.00 0.00 ? 36  LEU A CD1  7  
ATOM   6616  C  CD2  . LEU A 1 36 ? 8.331   -1.057  5.144   1.00 0.00 ? 36  LEU A CD2  7  
ATOM   6617  H  H    . LEU A 1 36 ? 4.659   1.613   3.506   1.00 0.00 ? 36  LEU A H    7  
ATOM   6618  H  HA   . LEU A 1 36 ? 6.296   0.981   5.867   1.00 0.00 ? 36  LEU A HA   7  
ATOM   6619  H  HB2  . LEU A 1 36 ? 7.216   1.346   3.025   1.00 0.00 ? 36  LEU A HB2  7  
ATOM   6620  H  HB3  . LEU A 1 36 ? 8.304   1.395   4.410   1.00 0.00 ? 36  LEU A HB3  7  
ATOM   6621  H  HG   . LEU A 1 36 ? 6.584   -1.008  3.940   1.00 0.00 ? 36  LEU A HG   7  
ATOM   6622  H  HD11 . LEU A 1 36 ? 9.253   -0.497  2.636   1.00 0.00 ? 36  LEU A HD11 7  
ATOM   6623  H  HD12 . LEU A 1 36 ? 7.699   -0.551  1.805   1.00 0.00 ? 36  LEU A HD12 7  
ATOM   6624  H  HD13 . LEU A 1 36 ? 8.333   -2.001  2.583   1.00 0.00 ? 36  LEU A HD13 7  
ATOM   6625  H  HD21 . LEU A 1 36 ? 8.320   -2.136  5.142   1.00 0.00 ? 36  LEU A HD21 7  
ATOM   6626  H  HD22 . LEU A 1 36 ? 7.869   -0.693  6.051   1.00 0.00 ? 36  LEU A HD22 7  
ATOM   6627  H  HD23 . LEU A 1 36 ? 9.352   -0.707  5.094   1.00 0.00 ? 36  LEU A HD23 7  
ATOM   6628  N  N    . CYS A 1 37 ? 5.790   3.747   4.196   1.00 0.00 ? 37  CYS A N    7  
ATOM   6629  C  CA   . CYS A 1 37 ? 5.831   5.202   4.280   1.00 0.00 ? 37  CYS A CA   7  
ATOM   6630  C  C    . CYS A 1 37 ? 4.423   5.789   4.241   1.00 0.00 ? 37  CYS A C    7  
ATOM   6631  O  O    . CYS A 1 37 ? 4.234   6.988   4.444   1.00 0.00 ? 37  CYS A O    7  
ATOM   6632  C  CB   . CYS A 1 37 ? 6.667   5.777   3.135   1.00 0.00 ? 37  CYS A CB   7  
ATOM   6633  S  SG   . CYS A 1 37 ? 5.929   5.544   1.486   1.00 0.00 ? 37  CYS A SG   7  
ATOM   6634  H  H    . CYS A 1 37 ? 5.330   3.325   3.438   1.00 0.00 ? 37  CYS A H    7  
ATOM   6635  H  HA   . CYS A 1 37 ? 6.292   5.467   5.219   1.00 0.00 ? 37  CYS A HA   7  
ATOM   6636  H  HB2  . CYS A 1 37 ? 6.795   6.838   3.290   1.00 0.00 ? 37  CYS A HB2  7  
ATOM   6637  H  HB3  . CYS A 1 37 ? 7.636   5.300   3.133   1.00 0.00 ? 37  CYS A HB3  7  
ATOM   6638  N  N    . GLN A 1 38 ? 3.439   4.935   3.977   1.00 0.00 ? 38  GLN A N    7  
ATOM   6639  C  CA   . GLN A 1 38 ? 2.049   5.370   3.911   1.00 0.00 ? 38  GLN A CA   7  
ATOM   6640  C  C    . GLN A 1 38 ? 1.863   6.439   2.839   1.00 0.00 ? 38  GLN A C    7  
ATOM   6641  O  O    . GLN A 1 38 ? 1.360   7.527   3.116   1.00 0.00 ? 38  GLN A O    7  
ATOM   6642  C  CB   . GLN A 1 38 ? 1.595   5.908   5.269   1.00 0.00 ? 38  GLN A CB   7  
ATOM   6643  C  CG   . GLN A 1 38 ? 1.836   4.943   6.418   1.00 0.00 ? 38  GLN A CG   7  
ATOM   6644  C  CD   . GLN A 1 38 ? 0.648   4.038   6.679   1.00 0.00 ? 38  GLN A CD   7  
ATOM   6645  O  OE1  . GLN A 1 38 ? -0.300  4.422   7.364   1.00 0.00 ? 38  GLN A OE1  7  
ATOM   6646  N  NE2  . GLN A 1 38 ? 0.694   2.828   6.133   1.00 0.00 ? 38  GLN A NE2  7  
ATOM   6647  H  H    . GLN A 1 38 ? 3.653   3.992   3.824   1.00 0.00 ? 38  GLN A H    7  
ATOM   6648  H  HA   . GLN A 1 38 ? 1.445   4.512   3.655   1.00 0.00 ? 38  GLN A HA   7  
ATOM   6649  H  HB2  . GLN A 1 38 ? 2.130   6.823   5.477   1.00 0.00 ? 38  GLN A HB2  7  
ATOM   6650  H  HB3  . GLN A 1 38 ? 0.537   6.122   5.223   1.00 0.00 ? 38  GLN A HB3  7  
ATOM   6651  H  HG2  . GLN A 1 38 ? 2.692   4.328   6.181   1.00 0.00 ? 38  GLN A HG2  7  
ATOM   6652  H  HG3  . GLN A 1 38 ? 2.040   5.512   7.313   1.00 0.00 ? 38  GLN A HG3  7  
ATOM   6653  H  HE21 . GLN A 1 38 ? 1.482   2.591   5.601   1.00 0.00 ? 38  GLN A HE21 7  
ATOM   6654  H  HE22 . GLN A 1 38 ? -0.060  2.222   6.286   1.00 0.00 ? 38  GLN A HE22 7  
ATOM   6655  N  N    . GLU A 1 39 ? 2.272   6.120   1.615   1.00 0.00 ? 39  GLU A N    7  
ATOM   6656  C  CA   . GLU A 1 39 ? 2.152   7.055   0.502   1.00 0.00 ? 39  GLU A CA   7  
ATOM   6657  C  C    . GLU A 1 39 ? 1.069   6.602   -0.474  1.00 0.00 ? 39  GLU A C    7  
ATOM   6658  O  O    . GLU A 1 39 ? 1.069   5.459   -0.931  1.00 0.00 ? 39  GLU A O    7  
ATOM   6659  C  CB   . GLU A 1 39 ? 3.489   7.187   -0.228  1.00 0.00 ? 39  GLU A CB   7  
ATOM   6660  C  CG   . GLU A 1 39 ? 3.392   7.941   -1.544  1.00 0.00 ? 39  GLU A CG   7  
ATOM   6661  C  CD   . GLU A 1 39 ? 4.699   8.602   -1.936  1.00 0.00 ? 39  GLU A CD   7  
ATOM   6662  O  OE1  . GLU A 1 39 ? 5.028   9.657   -1.355  1.00 0.00 ? 39  GLU A OE1  7  
ATOM   6663  O  OE2  . GLU A 1 39 ? 5.393   8.064   -2.824  1.00 0.00 ? 39  GLU A OE2  7  
ATOM   6664  H  H    . GLU A 1 39 ? 2.665   5.236   1.457   1.00 0.00 ? 39  GLU A H    7  
ATOM   6665  H  HA   . GLU A 1 39 ? 1.875   8.017   0.906   1.00 0.00 ? 39  GLU A HA   7  
ATOM   6666  H  HB2  . GLU A 1 39 ? 4.185   7.710   0.411   1.00 0.00 ? 39  GLU A HB2  7  
ATOM   6667  H  HB3  . GLU A 1 39 ? 3.874   6.199   -0.432  1.00 0.00 ? 39  GLU A HB3  7  
ATOM   6668  H  HG2  . GLU A 1 39 ? 3.111   7.247   -2.322  1.00 0.00 ? 39  GLU A HG2  7  
ATOM   6669  H  HG3  . GLU A 1 39 ? 2.633   8.703   -1.452  1.00 0.00 ? 39  GLU A HG3  7  
ATOM   6670  N  N    . VAL A 1 40 ? 0.148   7.507   -0.788  1.00 0.00 ? 40  VAL A N    7  
ATOM   6671  C  CA   . VAL A 1 40 ? -0.940  7.202   -1.709  1.00 0.00 ? 40  VAL A CA   7  
ATOM   6672  C  C    . VAL A 1 40 ? -0.440  6.396   -2.903  1.00 0.00 ? 40  VAL A C    7  
ATOM   6673  O  O    . VAL A 1 40 ? 0.369   6.878   -3.697  1.00 0.00 ? 40  VAL A O    7  
ATOM   6674  C  CB   . VAL A 1 40 ? -1.620  8.486   -2.220  1.00 0.00 ? 40  VAL A CB   7  
ATOM   6675  C  CG1  . VAL A 1 40 ? -2.743  8.148   -3.188  1.00 0.00 ? 40  VAL A CG1  7  
ATOM   6676  C  CG2  . VAL A 1 40 ? -2.141  9.313   -1.054  1.00 0.00 ? 40  VAL A CG2  7  
ATOM   6677  H  H    . VAL A 1 40 ? 0.201   8.401   -0.391  1.00 0.00 ? 40  VAL A H    7  
ATOM   6678  H  HA   . VAL A 1 40 ? -1.676  6.618   -1.176  1.00 0.00 ? 40  VAL A HA   7  
ATOM   6679  H  HB   . VAL A 1 40 ? -0.883  9.073   -2.749  1.00 0.00 ? 40  VAL A HB   7  
ATOM   6680  H  HG11 . VAL A 1 40 ? -3.580  8.808   -3.012  1.00 0.00 ? 40  VAL A HG11 7  
ATOM   6681  H  HG12 . VAL A 1 40 ? -2.394  8.270   -4.202  1.00 0.00 ? 40  VAL A HG12 7  
ATOM   6682  H  HG13 . VAL A 1 40 ? -3.054  7.125   -3.034  1.00 0.00 ? 40  VAL A HG13 7  
ATOM   6683  H  HG21 . VAL A 1 40 ? -2.488  10.268  -1.417  1.00 0.00 ? 40  VAL A HG21 7  
ATOM   6684  H  HG22 . VAL A 1 40 ? -2.958  8.790   -0.578  1.00 0.00 ? 40  VAL A HG22 7  
ATOM   6685  H  HG23 . VAL A 1 40 ? -1.347  9.467   -0.338  1.00 0.00 ? 40  VAL A HG23 7  
ATOM   6686  N  N    . LEU A 1 41 ? -0.927  5.166   -3.024  1.00 0.00 ? 41  LEU A N    7  
ATOM   6687  C  CA   . LEU A 1 41 ? -0.530  4.291   -4.122  1.00 0.00 ? 41  LEU A CA   7  
ATOM   6688  C  C    . LEU A 1 41 ? -1.635  4.196   -5.169  1.00 0.00 ? 41  LEU A C    7  
ATOM   6689  O  O    . LEU A 1 41 ? -1.835  3.147   -5.781  1.00 0.00 ? 41  LEU A O    7  
ATOM   6690  C  CB   . LEU A 1 41 ? -0.192  2.896   -3.593  1.00 0.00 ? 41  LEU A CB   7  
ATOM   6691  C  CG   . LEU A 1 41 ? 0.498   2.845   -2.229  1.00 0.00 ? 41  LEU A CG   7  
ATOM   6692  C  CD1  . LEU A 1 41 ? 0.343   1.468   -1.603  1.00 0.00 ? 41  LEU A CD1  7  
ATOM   6693  C  CD2  . LEU A 1 41 ? 1.970   3.210   -2.362  1.00 0.00 ? 41  LEU A CD2  7  
ATOM   6694  H  H    . LEU A 1 41 ? -1.568  4.837   -2.361  1.00 0.00 ? 41  LEU A H    7  
ATOM   6695  H  HA   . LEU A 1 41 ? 0.350   4.716   -4.582  1.00 0.00 ? 41  LEU A HA   7  
ATOM   6696  H  HB2  . LEU A 1 41 ? -1.113  2.339   -3.518  1.00 0.00 ? 41  LEU A HB2  7  
ATOM   6697  H  HB3  . LEU A 1 41 ? 0.459   2.419   -4.312  1.00 0.00 ? 41  LEU A HB3  7  
ATOM   6698  H  HG   . LEU A 1 41 ? 0.033   3.565   -1.570  1.00 0.00 ? 41  LEU A HG   7  
ATOM   6699  H  HD11 . LEU A 1 41 ? -0.052  0.782   -2.337  1.00 0.00 ? 41  LEU A HD11 7  
ATOM   6700  H  HD12 . LEU A 1 41 ? -0.334  1.528   -0.765  1.00 0.00 ? 41  LEU A HD12 7  
ATOM   6701  H  HD13 . LEU A 1 41 ? 1.307   1.117   -1.263  1.00 0.00 ? 41  LEU A HD13 7  
ATOM   6702  H  HD21 . LEU A 1 41 ? 2.470   3.035   -1.421  1.00 0.00 ? 41  LEU A HD21 7  
ATOM   6703  H  HD22 . LEU A 1 41 ? 2.059   4.254   -2.628  1.00 0.00 ? 41  LEU A HD22 7  
ATOM   6704  H  HD23 . LEU A 1 41 ? 2.423   2.602   -3.130  1.00 0.00 ? 41  LEU A HD23 7  
ATOM   6705  N  N    . ALA A 1 42 ? -2.348  5.299   -5.371  1.00 0.00 ? 42  ALA A N    7  
ATOM   6706  C  CA   . ALA A 1 42 ? -3.430  5.340   -6.347  1.00 0.00 ? 42  ALA A CA   7  
ATOM   6707  C  C    . ALA A 1 42 ? -2.889  5.542   -7.758  1.00 0.00 ? 42  ALA A C    7  
ATOM   6708  O  O    . ALA A 1 42 ? -3.181  4.759   -8.663  1.00 0.00 ? 42  ALA A O    7  
ATOM   6709  C  CB   . ALA A 1 42 ? -4.416  6.445   -5.995  1.00 0.00 ? 42  ALA A CB   7  
ATOM   6710  H  H    . ALA A 1 42 ? -2.141  6.103   -4.852  1.00 0.00 ? 42  ALA A H    7  
ATOM   6711  H  HA   . ALA A 1 42 ? -3.955  4.397   -6.305  1.00 0.00 ? 42  ALA A HA   7  
ATOM   6712  H  HB1  . ALA A 1 42 ? -5.167  6.516   -6.769  1.00 0.00 ? 42  ALA A HB1  7  
ATOM   6713  H  HB2  . ALA A 1 42 ? -4.890  6.217   -5.052  1.00 0.00 ? 42  ALA A HB2  7  
ATOM   6714  H  HB3  . ALA A 1 42 ? -3.890  7.385   -5.917  1.00 0.00 ? 42  ALA A HB3  7  
ATOM   6715  N  N    . ASP A 1 43 ? -2.100  6.595   -7.940  1.00 0.00 ? 43  ASP A N    7  
ATOM   6716  C  CA   . ASP A 1 43 ? -1.517  6.899   -9.242  1.00 0.00 ? 43  ASP A CA   7  
ATOM   6717  C  C    . ASP A 1 43 ? -0.144  6.250   -9.387  1.00 0.00 ? 43  ASP A C    7  
ATOM   6718  O  O    . ASP A 1 43 ? 0.119   5.545   -10.362 1.00 0.00 ? 43  ASP A O    7  
ATOM   6719  C  CB   . ASP A 1 43 ? -1.403  8.412   -9.432  1.00 0.00 ? 43  ASP A CB   7  
ATOM   6720  C  CG   . ASP A 1 43 ? -2.630  9.153   -8.938  1.00 0.00 ? 43  ASP A CG   7  
ATOM   6721  O  OD1  . ASP A 1 43 ? -2.811  9.246   -7.706  1.00 0.00 ? 43  ASP A OD1  7  
ATOM   6722  O  OD2  . ASP A 1 43 ? -3.409  9.639   -9.784  1.00 0.00 ? 43  ASP A OD2  7  
ATOM   6723  H  H    . ASP A 1 43 ? -1.904  7.182   -7.179  1.00 0.00 ? 43  ASP A H    7  
ATOM   6724  H  HA   . ASP A 1 43 ? -2.173  6.499   -10.000 1.00 0.00 ? 43  ASP A HA   7  
ATOM   6725  H  HB2  . ASP A 1 43 ? -0.543  8.773   -8.886  1.00 0.00 ? 43  ASP A HB2  7  
ATOM   6726  H  HB3  . ASP A 1 43 ? -1.273  8.627   -10.483 1.00 0.00 ? 43  ASP A HB3  7  
ATOM   6727  N  N    . ILE A 1 44 ? 0.726   6.494   -8.414  1.00 0.00 ? 44  ILE A N    7  
ATOM   6728  C  CA   . ILE A 1 44 ? 2.071   5.934   -8.434  1.00 0.00 ? 44  ILE A CA   7  
ATOM   6729  C  C    . ILE A 1 44 ? 2.031   4.410   -8.484  1.00 0.00 ? 44  ILE A C    7  
ATOM   6730  O  O    . ILE A 1 44 ? 3.001   3.766   -8.881  1.00 0.00 ? 44  ILE A O    7  
ATOM   6731  C  CB   . ILE A 1 44 ? 2.884   6.374   -7.202  1.00 0.00 ? 44  ILE A CB   7  
ATOM   6732  C  CG1  . ILE A 1 44 ? 2.188   5.922   -5.917  1.00 0.00 ? 44  ILE A CG1  7  
ATOM   6733  C  CG2  . ILE A 1 44 ? 3.074   7.884   -7.205  1.00 0.00 ? 44  ILE A CG2  7  
ATOM   6734  C  CD1  . ILE A 1 44 ? 3.130   5.758   -4.745  1.00 0.00 ? 44  ILE A CD1  7  
ATOM   6735  H  H    . ILE A 1 44 ? 0.457   7.064   -7.664  1.00 0.00 ? 44  ILE A H    7  
ATOM   6736  H  HA   . ILE A 1 44 ? 2.571   6.299   -9.320  1.00 0.00 ? 44  ILE A HA   7  
ATOM   6737  H  HB   . ILE A 1 44 ? 3.858   5.913   -7.257  1.00 0.00 ? 44  ILE A HB   7  
ATOM   6738  H  HG12 . ILE A 1 44 ? 1.443   6.652   -5.642  1.00 0.00 ? 44  ILE A HG12 7  
ATOM   6739  H  HG13 . ILE A 1 44 ? 1.706   4.971   -6.093  1.00 0.00 ? 44  ILE A HG13 7  
ATOM   6740  H  HG21 . ILE A 1 44 ? 2.367   8.337   -6.526  1.00 0.00 ? 44  ILE A HG21 7  
ATOM   6741  H  HG22 . ILE A 1 44 ? 4.078   8.121   -6.888  1.00 0.00 ? 44  ILE A HG22 7  
ATOM   6742  H  HG23 . ILE A 1 44 ? 2.911   8.265   -8.202  1.00 0.00 ? 44  ILE A HG23 7  
ATOM   6743  H  HD11 . ILE A 1 44 ? 2.582   5.878   -3.822  1.00 0.00 ? 44  ILE A HD11 7  
ATOM   6744  H  HD12 . ILE A 1 44 ? 3.575   4.775   -4.776  1.00 0.00 ? 44  ILE A HD12 7  
ATOM   6745  H  HD13 . ILE A 1 44 ? 3.908   6.506   -4.801  1.00 0.00 ? 44  ILE A HD13 7  
ATOM   6746  N  N    . GLY A 1 45 ? 0.900   3.840   -8.080  1.00 0.00 ? 45  GLY A N    7  
ATOM   6747  C  CA   . GLY A 1 45 ? 0.754   2.396   -8.089  1.00 0.00 ? 45  GLY A CA   7  
ATOM   6748  C  C    . GLY A 1 45 ? 1.459   1.735   -6.921  1.00 0.00 ? 45  GLY A C    7  
ATOM   6749  O  O    . GLY A 1 45 ? 2.340   2.330   -6.301  1.00 0.00 ? 45  GLY A O    7  
ATOM   6750  H  H    . GLY A 1 45 ? 0.159   4.404   -7.774  1.00 0.00 ? 45  GLY A H    7  
ATOM   6751  H  HA2  . GLY A 1 45 ? -0.297  2.151   -8.047  1.00 0.00 ? 45  GLY A HA2  7  
ATOM   6752  H  HA3  . GLY A 1 45 ? 1.167   2.009   -9.009  1.00 0.00 ? 45  GLY A HA3  7  
ATOM   6753  N  N    . PHE A 1 46 ? 1.069   0.501   -6.618  1.00 0.00 ? 46  PHE A N    7  
ATOM   6754  C  CA   . PHE A 1 46 ? 1.668   -0.241  -5.514  1.00 0.00 ? 46  PHE A CA   7  
ATOM   6755  C  C    . PHE A 1 46 ? 2.490   -1.417  -6.033  1.00 0.00 ? 46  PHE A C    7  
ATOM   6756  O  O    . PHE A 1 46 ? 2.409   -1.776  -7.207  1.00 0.00 ? 46  PHE A O    7  
ATOM   6757  C  CB   . PHE A 1 46 ? 0.582   -0.744  -4.561  1.00 0.00 ? 46  PHE A CB   7  
ATOM   6758  C  CG   . PHE A 1 46 ? -0.258  -1.847  -5.138  1.00 0.00 ? 46  PHE A CG   7  
ATOM   6759  C  CD1  . PHE A 1 46 ? -1.206  -1.577  -6.112  1.00 0.00 ? 46  PHE A CD1  7  
ATOM   6760  C  CD2  . PHE A 1 46 ? -0.100  -3.154  -4.706  1.00 0.00 ? 46  PHE A CD2  7  
ATOM   6761  C  CE1  . PHE A 1 46 ? -1.981  -2.591  -6.645  1.00 0.00 ? 46  PHE A CE1  7  
ATOM   6762  C  CE2  . PHE A 1 46 ? -0.871  -4.171  -5.235  1.00 0.00 ? 46  PHE A CE2  7  
ATOM   6763  C  CZ   . PHE A 1 46 ? -1.814  -3.889  -6.205  1.00 0.00 ? 46  PHE A CZ   7  
ATOM   6764  H  H    . PHE A 1 46 ? 0.361   0.079   -7.149  1.00 0.00 ? 46  PHE A H    7  
ATOM   6765  H  HA   . PHE A 1 46 ? 2.321   0.432   -4.980  1.00 0.00 ? 46  PHE A HA   7  
ATOM   6766  H  HB2  . PHE A 1 46 ? 1.047   -1.117  -3.662  1.00 0.00 ? 46  PHE A HB2  7  
ATOM   6767  H  HB3  . PHE A 1 46 ? -0.073  0.077   -4.309  1.00 0.00 ? 46  PHE A HB3  7  
ATOM   6768  H  HD1  . PHE A 1 46 ? -1.338  -0.561  -6.456  1.00 0.00 ? 46  PHE A HD1  7  
ATOM   6769  H  HD2  . PHE A 1 46 ? 0.635   -3.376  -3.947  1.00 0.00 ? 46  PHE A HD2  7  
ATOM   6770  H  HE1  . PHE A 1 46 ? -2.716  -2.366  -7.403  1.00 0.00 ? 46  PHE A HE1  7  
ATOM   6771  H  HE2  . PHE A 1 46 ? -0.739  -5.186  -4.890  1.00 0.00 ? 46  PHE A HE2  7  
ATOM   6772  H  HZ   . PHE A 1 46 ? -2.417  -4.682  -6.621  1.00 0.00 ? 46  PHE A HZ   7  
ATOM   6773  N  N    . VAL A 1 47 ? 3.282   -2.013  -5.147  1.00 0.00 ? 47  VAL A N    7  
ATOM   6774  C  CA   . VAL A 1 47 ? 4.119   -3.149  -5.514  1.00 0.00 ? 47  VAL A CA   7  
ATOM   6775  C  C    . VAL A 1 47 ? 3.996   -4.275  -4.493  1.00 0.00 ? 47  VAL A C    7  
ATOM   6776  O  O    . VAL A 1 47 ? 4.520   -4.182  -3.383  1.00 0.00 ? 47  VAL A O    7  
ATOM   6777  C  CB   . VAL A 1 47 ? 5.600   -2.740  -5.634  1.00 0.00 ? 47  VAL A CB   7  
ATOM   6778  C  CG1  . VAL A 1 47 ? 6.448   -3.927  -6.063  1.00 0.00 ? 47  VAL A CG1  7  
ATOM   6779  C  CG2  . VAL A 1 47 ? 5.755   -1.583  -6.608  1.00 0.00 ? 47  VAL A CG2  7  
ATOM   6780  H  H    . VAL A 1 47 ? 3.304   -1.681  -4.225  1.00 0.00 ? 47  VAL A H    7  
ATOM   6781  H  HA   . VAL A 1 47 ? 3.788   -3.511  -6.476  1.00 0.00 ? 47  VAL A HA   7  
ATOM   6782  H  HB   . VAL A 1 47 ? 5.942   -2.414  -4.663  1.00 0.00 ? 47  VAL A HB   7  
ATOM   6783  H  HG11 . VAL A 1 47 ? 7.204   -3.595  -6.760  1.00 0.00 ? 47  VAL A HG11 7  
ATOM   6784  H  HG12 . VAL A 1 47 ? 6.923   -4.363  -5.196  1.00 0.00 ? 47  VAL A HG12 7  
ATOM   6785  H  HG13 . VAL A 1 47 ? 5.820   -4.665  -6.539  1.00 0.00 ? 47  VAL A HG13 7  
ATOM   6786  H  HG21 . VAL A 1 47 ? 6.485   -0.886  -6.225  1.00 0.00 ? 47  VAL A HG21 7  
ATOM   6787  H  HG22 . VAL A 1 47 ? 6.085   -1.959  -7.566  1.00 0.00 ? 47  VAL A HG22 7  
ATOM   6788  H  HG23 . VAL A 1 47 ? 4.805   -1.082  -6.727  1.00 0.00 ? 47  VAL A HG23 7  
ATOM   6789  N  N    . LYS A 1 48 ? 3.299   -5.340  -4.876  1.00 0.00 ? 48  LYS A N    7  
ATOM   6790  C  CA   . LYS A 1 48 ? 3.107   -6.486  -3.995  1.00 0.00 ? 48  LYS A CA   7  
ATOM   6791  C  C    . LYS A 1 48 ? 4.431   -6.929  -3.382  1.00 0.00 ? 48  LYS A C    7  
ATOM   6792  O  O    . LYS A 1 48 ? 5.446   -7.017  -4.072  1.00 0.00 ? 48  LYS A O    7  
ATOM   6793  C  CB   . LYS A 1 48 ? 2.476   -7.647  -4.767  1.00 0.00 ? 48  LYS A CB   7  
ATOM   6794  C  CG   . LYS A 1 48 ? 0.963   -7.708  -4.644  1.00 0.00 ? 48  LYS A CG   7  
ATOM   6795  C  CD   . LYS A 1 48 ? 0.534   -8.177  -3.264  1.00 0.00 ? 48  LYS A CD   7  
ATOM   6796  C  CE   . LYS A 1 48 ? 0.636   -9.689  -3.132  1.00 0.00 ? 48  LYS A CE   7  
ATOM   6797  N  NZ   . LYS A 1 48 ? 2.023   -10.126 -2.812  1.00 0.00 ? 48  LYS A NZ   7  
ATOM   6798  H  H    . LYS A 1 48 ? 2.905   -5.355  -5.774  1.00 0.00 ? 48  LYS A H    7  
ATOM   6799  H  HA   . LYS A 1 48 ? 2.439   -6.187  -3.202  1.00 0.00 ? 48  LYS A HA   7  
ATOM   6800  H  HB2  . LYS A 1 48 ? 2.728   -7.548  -5.812  1.00 0.00 ? 48  LYS A HB2  7  
ATOM   6801  H  HB3  . LYS A 1 48 ? 2.884   -8.575  -4.393  1.00 0.00 ? 48  LYS A HB3  7  
ATOM   6802  H  HG2  . LYS A 1 48 ? 0.556   -6.723  -4.820  1.00 0.00 ? 48  LYS A HG2  7  
ATOM   6803  H  HG3  . LYS A 1 48 ? 0.578   -8.396  -5.384  1.00 0.00 ? 48  LYS A HG3  7  
ATOM   6804  H  HD2  . LYS A 1 48 ? 1.172   -7.719  -2.523  1.00 0.00 ? 48  LYS A HD2  7  
ATOM   6805  H  HD3  . LYS A 1 48 ? -0.491  -7.878  -3.094  1.00 0.00 ? 48  LYS A HD3  7  
ATOM   6806  H  HE2  . LYS A 1 48 ? -0.026  -10.014 -2.344  1.00 0.00 ? 48  LYS A HE2  7  
ATOM   6807  H  HE3  . LYS A 1 48 ? 0.333   -10.140 -4.066  1.00 0.00 ? 48  LYS A HE3  7  
ATOM   6808  H  HZ1  . LYS A 1 48 ? 2.544   -10.333 -3.688  1.00 0.00 ? 48  LYS A HZ1  7  
ATOM   6809  H  HZ2  . LYS A 1 48 ? 2.001   -10.983 -2.224  1.00 0.00 ? 48  LYS A HZ2  7  
ATOM   6810  H  HZ3  . LYS A 1 48 ? 2.523   -9.376  -2.293  1.00 0.00 ? 48  LYS A HZ3  7  
ATOM   6811  N  N    . ASN A 1 49 ? 4.413   -7.209  -2.083  1.00 0.00 ? 49  ASN A N    7  
ATOM   6812  C  CA   . ASN A 1 49 ? 5.613   -7.644  -1.378  1.00 0.00 ? 49  ASN A CA   7  
ATOM   6813  C  C    . ASN A 1 49 ? 5.268   -8.150  0.020   1.00 0.00 ? 49  ASN A C    7  
ATOM   6814  O  O    . ASN A 1 49 ? 4.738   -7.408  0.846   1.00 0.00 ? 49  ASN A O    7  
ATOM   6815  C  CB   . ASN A 1 49 ? 6.619   -6.496  -1.283  1.00 0.00 ? 49  ASN A CB   7  
ATOM   6816  C  CG   . ASN A 1 49 ? 8.049   -6.988  -1.166  1.00 0.00 ? 49  ASN A CG   7  
ATOM   6817  O  OD1  . ASN A 1 49 ? 8.353   -8.131  -1.508  1.00 0.00 ? 49  ASN A OD1  7  
ATOM   6818  N  ND2  . ASN A 1 49 ? 8.933   -6.125  -0.680  1.00 0.00 ? 49  ASN A ND2  7  
ATOM   6819  H  H    . ASN A 1 49 ? 3.572   -7.120  -1.587  1.00 0.00 ? 49  ASN A H    7  
ATOM   6820  H  HA   . ASN A 1 49 ? 6.054   -8.452  -1.942  1.00 0.00 ? 49  ASN A HA   7  
ATOM   6821  H  HB2  . ASN A 1 49 ? 6.541   -5.883  -2.170  1.00 0.00 ? 49  ASN A HB2  7  
ATOM   6822  H  HB3  . ASN A 1 49 ? 6.391   -5.896  -0.415  1.00 0.00 ? 49  ASN A HB3  7  
ATOM   6823  H  HD21 . ASN A 1 49 ? 8.619   -5.231  -0.428  1.00 0.00 ? 49  ASN A HD21 7  
ATOM   6824  H  HD22 . ASN A 1 49 ? 9.865   -6.417  -0.595  1.00 0.00 ? 49  ASN A HD22 7  
ATOM   6825  N  N    . ALA A 1 50 ? 5.575   -9.417  0.277   1.00 0.00 ? 50  ALA A N    7  
ATOM   6826  C  CA   . ALA A 1 50 ? 5.301   -10.022 1.575   1.00 0.00 ? 50  ALA A CA   7  
ATOM   6827  C  C    . ALA A 1 50 ? 3.843   -9.825  1.975   1.00 0.00 ? 50  ALA A C    7  
ATOM   6828  O  O    . ALA A 1 50 ? 3.528   -9.670  3.154   1.00 0.00 ? 50  ALA A O    7  
ATOM   6829  C  CB   . ALA A 1 50 ? 6.224   -9.439  2.634   1.00 0.00 ? 50  ALA A CB   7  
ATOM   6830  H  H    . ALA A 1 50 ? 5.997   -9.958  -0.423  1.00 0.00 ? 50  ALA A H    7  
ATOM   6831  H  HA   . ALA A 1 50 ? 5.503   -11.081 1.499   1.00 0.00 ? 50  ALA A HA   7  
ATOM   6832  H  HB1  . ALA A 1 50 ? 5.886   -8.447  2.898   1.00 0.00 ? 50  ALA A HB1  7  
ATOM   6833  H  HB2  . ALA A 1 50 ? 6.211   -10.070 3.510   1.00 0.00 ? 50  ALA A HB2  7  
ATOM   6834  H  HB3  . ALA A 1 50 ? 7.230   -9.384  2.244   1.00 0.00 ? 50  ALA A HB3  7  
ATOM   6835  N  N    . GLY A 1 51 ? 2.956   -9.831  0.984   1.00 0.00 ? 51  GLY A N    7  
ATOM   6836  C  CA   . GLY A 1 51 ? 1.541   -9.652  1.254   1.00 0.00 ? 51  GLY A CA   7  
ATOM   6837  C  C    . GLY A 1 51 ? 1.205   -8.232  1.665   1.00 0.00 ? 51  GLY A C    7  
ATOM   6838  O  O    . GLY A 1 51 ? 0.234   -8.000  2.385   1.00 0.00 ? 51  GLY A O    7  
ATOM   6839  H  H    . GLY A 1 51 ? 3.264   -9.959  0.063   1.00 0.00 ? 51  GLY A H    7  
ATOM   6840  H  HA2  . GLY A 1 51 ? 0.982   -9.900  0.365   1.00 0.00 ? 51  GLY A HA2  7  
ATOM   6841  H  HA3  . GLY A 1 51 ? 1.250   -10.322 2.049   1.00 0.00 ? 51  GLY A HA3  7  
ATOM   6842  N  N    . ARG A 1 52 ? 2.010   -7.279  1.207   1.00 0.00 ? 52  ARG A N    7  
ATOM   6843  C  CA   . ARG A 1 52 ? 1.795   -5.875  1.534   1.00 0.00 ? 52  ARG A CA   7  
ATOM   6844  C  C    . ARG A 1 52 ? 1.972   -4.996  0.299   1.00 0.00 ? 52  ARG A C    7  
ATOM   6845  O  O    . ARG A 1 52 ? 2.791   -5.289  -0.572  1.00 0.00 ? 52  ARG A O    7  
ATOM   6846  C  CB   . ARG A 1 52 ? 2.762   -5.430  2.633   1.00 0.00 ? 52  ARG A CB   7  
ATOM   6847  C  CG   . ARG A 1 52 ? 2.655   -6.252  3.907   1.00 0.00 ? 52  ARG A CG   7  
ATOM   6848  C  CD   . ARG A 1 52 ? 3.846   -6.018  4.822   1.00 0.00 ? 52  ARG A CD   7  
ATOM   6849  N  NE   . ARG A 1 52 ? 3.951   -7.043  5.857   1.00 0.00 ? 52  ARG A NE   7  
ATOM   6850  C  CZ   . ARG A 1 52 ? 4.631   -6.881  6.987   1.00 0.00 ? 52  ARG A CZ   7  
ATOM   6851  N  NH1  . ARG A 1 52 ? 5.263   -5.740  7.225   1.00 0.00 ? 52  ARG A NH1  7  
ATOM   6852  N  NH2  . ARG A 1 52 ? 4.680   -7.861  7.880   1.00 0.00 ? 52  ARG A NH2  7  
ATOM   6853  H  H    . ARG A 1 52 ? 2.768   -7.526  0.637   1.00 0.00 ? 52  ARG A H    7  
ATOM   6854  H  HA   . ARG A 1 52 ? 0.782   -5.769  1.894   1.00 0.00 ? 52  ARG A HA   7  
ATOM   6855  H  HB2  . ARG A 1 52 ? 3.773   -5.513  2.262   1.00 0.00 ? 52  ARG A HB2  7  
ATOM   6856  H  HB3  . ARG A 1 52 ? 2.560   -4.398  2.877   1.00 0.00 ? 52  ARG A HB3  7  
ATOM   6857  H  HG2  . ARG A 1 52 ? 1.753   -5.971  4.431   1.00 0.00 ? 52  ARG A HG2  7  
ATOM   6858  H  HG3  . ARG A 1 52 ? 2.611   -7.299  3.647   1.00 0.00 ? 52  ARG A HG3  7  
ATOM   6859  H  HD2  . ARG A 1 52 ? 4.748   -6.028  4.227   1.00 0.00 ? 52  ARG A HD2  7  
ATOM   6860  H  HD3  . ARG A 1 52 ? 3.737   -5.053  5.294   1.00 0.00 ? 52  ARG A HD3  7  
ATOM   6861  H  HE   . ARG A 1 52 ? 3.491   -7.894  5.701   1.00 0.00 ? 52  ARG A HE   7  
ATOM   6862  H  HH11 . ARG A 1 52 ? 5.228   -5.000  6.554   1.00 0.00 ? 52  ARG A HH11 7  
ATOM   6863  H  HH12 . ARG A 1 52 ? 5.774   -5.620  8.077   1.00 0.00 ? 52  ARG A HH12 7  
ATOM   6864  H  HH21 . ARG A 1 52 ? 4.204   -8.722  7.704   1.00 0.00 ? 52  ARG A HH21 7  
ATOM   6865  H  HH22 . ARG A 1 52 ? 5.192   -7.738  8.729   1.00 0.00 ? 52  ARG A HH22 7  
ATOM   6866  N  N    . HIS A 1 53 ? 1.199   -3.916  0.231   1.00 0.00 ? 53  HIS A N    7  
ATOM   6867  C  CA   . HIS A 1 53 ? 1.271   -2.994  -0.897  1.00 0.00 ? 53  HIS A CA   7  
ATOM   6868  C  C    . HIS A 1 53 ? 2.219   -1.837  -0.593  1.00 0.00 ? 53  HIS A C    7  
ATOM   6869  O  O    . HIS A 1 53 ? 1.930   -0.991  0.253   1.00 0.00 ? 53  HIS A O    7  
ATOM   6870  C  CB   . HIS A 1 53 ? -0.120  -2.455  -1.232  1.00 0.00 ? 53  HIS A CB   7  
ATOM   6871  C  CG   . HIS A 1 53 ? -1.008  -2.305  -0.035  1.00 0.00 ? 53  HIS A CG   7  
ATOM   6872  N  ND1  . HIS A 1 53 ? -2.319  -2.730  -0.013  1.00 0.00 ? 53  HIS A ND1  7  
ATOM   6873  C  CD2  . HIS A 1 53 ? -0.765  -1.773  1.186   1.00 0.00 ? 53  HIS A CD2  7  
ATOM   6874  C  CE1  . HIS A 1 53 ? -2.845  -2.465  1.170   1.00 0.00 ? 53  HIS A CE1  7  
ATOM   6875  N  NE2  . HIS A 1 53 ? -1.923  -1.884  1.916   1.00 0.00 ? 53  HIS A NE2  7  
ATOM   6876  H  H    . HIS A 1 53 ? 0.566   -3.736  0.957   1.00 0.00 ? 53  HIS A H    7  
ATOM   6877  H  HA   . HIS A 1 53 ? 1.651   -3.540  -1.747  1.00 0.00 ? 53  HIS A HA   7  
ATOM   6878  H  HB2  . HIS A 1 53 ? -0.020  -1.485  -1.695  1.00 0.00 ? 53  HIS A HB2  7  
ATOM   6879  H  HB3  . HIS A 1 53 ? -0.604  -3.131  -1.922  1.00 0.00 ? 53  HIS A HB3  7  
ATOM   6880  H  HD1  . HIS A 1 53 ? -2.794  -3.160  -0.754  1.00 0.00 ? 53  HIS A HD1  7  
ATOM   6881  H  HD2  . HIS A 1 53 ? 0.166   -1.340  1.524   1.00 0.00 ? 53  HIS A HD2  7  
ATOM   6882  H  HE1  . HIS A 1 53 ? -3.857  -2.685  1.475   1.00 0.00 ? 53  HIS A HE1  7  
ATOM   6883  H  HE2  . HIS A 1 53 ? -2.074  -1.507  2.807   1.00 0.00 ? 53  HIS A HE2  7  
ATOM   6884  N  N    . LEU A 1 54 ? 3.350   -1.808  -1.288  1.00 0.00 ? 54  LEU A N    7  
ATOM   6885  C  CA   . LEU A 1 54 ? 4.341   -0.755  -1.093  1.00 0.00 ? 54  LEU A CA   7  
ATOM   6886  C  C    . LEU A 1 54 ? 4.476   0.105   -2.345  1.00 0.00 ? 54  LEU A C    7  
ATOM   6887  O  O    . LEU A 1 54 ? 3.910   -0.211  -3.392  1.00 0.00 ? 54  LEU A O    7  
ATOM   6888  C  CB   . LEU A 1 54 ? 5.697   -1.365  -0.731  1.00 0.00 ? 54  LEU A CB   7  
ATOM   6889  C  CG   . LEU A 1 54 ? 5.656   -2.635  0.119   1.00 0.00 ? 54  LEU A CG   7  
ATOM   6890  C  CD1  . LEU A 1 54 ? 7.012   -3.324  0.114   1.00 0.00 ? 54  LEU A CD1  7  
ATOM   6891  C  CD2  . LEU A 1 54 ? 5.225   -2.312  1.542   1.00 0.00 ? 54  LEU A CD2  7  
ATOM   6892  H  H    . LEU A 1 54 ? 3.525   -2.510  -1.949  1.00 0.00 ? 54  LEU A H    7  
ATOM   6893  H  HA   . LEU A 1 54 ? 4.006   -0.133  -0.277  1.00 0.00 ? 54  LEU A HA   7  
ATOM   6894  H  HB2  . LEU A 1 54 ? 6.210   -1.599  -1.650  1.00 0.00 ? 54  LEU A HB2  7  
ATOM   6895  H  HB3  . LEU A 1 54 ? 6.259   -0.619  -0.186  1.00 0.00 ? 54  LEU A HB3  7  
ATOM   6896  H  HG   . LEU A 1 54 ? 4.933   -3.320  -0.303  1.00 0.00 ? 54  LEU A HG   7  
ATOM   6897  H  HD11 . LEU A 1 54 ? 7.328   -3.490  -0.904  1.00 0.00 ? 54  LEU A HD11 7  
ATOM   6898  H  HD12 . LEU A 1 54 ? 6.936   -4.272  0.626   1.00 0.00 ? 54  LEU A HD12 7  
ATOM   6899  H  HD13 . LEU A 1 54 ? 7.735   -2.700  0.619   1.00 0.00 ? 54  LEU A HD13 7  
ATOM   6900  H  HD21 . LEU A 1 54 ? 4.532   -1.483  1.528   1.00 0.00 ? 54  LEU A HD21 7  
ATOM   6901  H  HD22 . LEU A 1 54 ? 6.093   -2.045  2.129   1.00 0.00 ? 54  LEU A HD22 7  
ATOM   6902  H  HD23 . LEU A 1 54 ? 4.746   -3.175  1.978   1.00 0.00 ? 54  LEU A HD23 7  
ATOM   6903  N  N    . CYS A 1 55 ? 5.230   1.193   -2.230  1.00 0.00 ? 55  CYS A N    7  
ATOM   6904  C  CA   . CYS A 1 55 ? 5.441   2.099   -3.353  1.00 0.00 ? 55  CYS A CA   7  
ATOM   6905  C  C    . CYS A 1 55 ? 6.807   1.865   -3.991  1.00 0.00 ? 55  CYS A C    7  
ATOM   6906  O  O    . CYS A 1 55 ? 7.759   1.470   -3.318  1.00 0.00 ? 55  CYS A O    7  
ATOM   6907  C  CB   . CYS A 1 55 ? 5.325   3.553   -2.891  1.00 0.00 ? 55  CYS A CB   7  
ATOM   6908  S  SG   . CYS A 1 55 ? 6.662   4.088   -1.776  1.00 0.00 ? 55  CYS A SG   7  
ATOM   6909  H  H    . CYS A 1 55 ? 5.655   1.392   -1.369  1.00 0.00 ? 55  CYS A H    7  
ATOM   6910  H  HA   . CYS A 1 55 ? 4.676   1.902   -4.088  1.00 0.00 ? 55  CYS A HA   7  
ATOM   6911  H  HB2  . CYS A 1 55 ? 5.341   4.200   -3.756  1.00 0.00 ? 55  CYS A HB2  7  
ATOM   6912  H  HB3  . CYS A 1 55 ? 4.388   3.683   -2.368  1.00 0.00 ? 55  CYS A HB3  7  
ATOM   6913  N  N    . ARG A 1 56 ? 6.895   2.112   -5.294  1.00 0.00 ? 56  ARG A N    7  
ATOM   6914  C  CA   . ARG A 1 56 ? 8.144   1.927   -6.024  1.00 0.00 ? 56  ARG A CA   7  
ATOM   6915  C  C    . ARG A 1 56 ? 9.341   2.308   -5.158  1.00 0.00 ? 56  ARG A C    7  
ATOM   6916  O  O    . ARG A 1 56 ? 10.289  1.540   -4.993  1.00 0.00 ? 56  ARG A O    7  
ATOM   6917  C  CB   . ARG A 1 56 ? 8.140   2.765   -7.304  1.00 0.00 ? 56  ARG A CB   7  
ATOM   6918  C  CG   . ARG A 1 56 ? 7.793   1.968   -8.552  1.00 0.00 ? 56  ARG A CG   7  
ATOM   6919  C  CD   . ARG A 1 56 ? 8.915   1.015   -8.933  1.00 0.00 ? 56  ARG A CD   7  
ATOM   6920  N  NE   . ARG A 1 56 ? 9.850   1.619   -9.879  1.00 0.00 ? 56  ARG A NE   7  
ATOM   6921  C  CZ   . ARG A 1 56 ? 9.699   1.566   -11.197 1.00 0.00 ? 56  ARG A CZ   7  
ATOM   6922  N  NH1  . ARG A 1 56 ? 8.656   0.938   -11.724 1.00 0.00 ? 56  ARG A NH1  7  
ATOM   6923  N  NH2  . ARG A 1 56 ? 10.592  2.141   -11.992 1.00 0.00 ? 56  ARG A NH2  7  
ATOM   6924  H  H    . ARG A 1 56 ? 6.102   2.425   -5.777  1.00 0.00 ? 56  ARG A H    7  
ATOM   6925  H  HA   . ARG A 1 56 ? 8.223   0.883   -6.288  1.00 0.00 ? 56  ARG A HA   7  
ATOM   6926  H  HB2  . ARG A 1 56 ? 7.416   3.559   -7.199  1.00 0.00 ? 56  ARG A HB2  7  
ATOM   6927  H  HB3  . ARG A 1 56 ? 9.119   3.197   -7.440  1.00 0.00 ? 56  ARG A HB3  7  
ATOM   6928  H  HG2  . ARG A 1 56 ? 6.897   1.395   -8.365  1.00 0.00 ? 56  ARG A HG2  7  
ATOM   6929  H  HG3  . ARG A 1 56 ? 7.621   2.653   -9.369  1.00 0.00 ? 56  ARG A HG3  7  
ATOM   6930  H  HD2  . ARG A 1 56 ? 9.453   0.736   -8.039  1.00 0.00 ? 56  ARG A HD2  7  
ATOM   6931  H  HD3  . ARG A 1 56 ? 8.483   0.133   -9.382  1.00 0.00 ? 56  ARG A HD3  7  
ATOM   6932  H  HE   . ARG A 1 56 ? 10.627  2.088   -9.511  1.00 0.00 ? 56  ARG A HE   7  
ATOM   6933  H  HH11 . ARG A 1 56 ? 7.981   0.505   -11.127 1.00 0.00 ? 56  ARG A HH11 7  
ATOM   6934  H  HH12 . ARG A 1 56 ? 8.545   0.900   -12.717 1.00 0.00 ? 56  ARG A HH12 7  
ATOM   6935  H  HH21 . ARG A 1 56 ? 11.380  2.615   -11.599 1.00 0.00 ? 56  ARG A HH21 7  
ATOM   6936  H  HH22 . ARG A 1 56 ? 10.478  2.099   -12.984 1.00 0.00 ? 56  ARG A HH22 7  
ATOM   6937  N  N    . PRO A 1 57 ? 9.300   3.524   -4.592  1.00 0.00 ? 57  PRO A N    7  
ATOM   6938  C  CA   . PRO A 1 57 ? 10.373  4.035   -3.734  1.00 0.00 ? 57  PRO A CA   7  
ATOM   6939  C  C    . PRO A 1 57 ? 10.798  3.024   -2.675  1.00 0.00 ? 57  PRO A C    7  
ATOM   6940  O  O    . PRO A 1 57 ? 11.957  2.610   -2.627  1.00 0.00 ? 57  PRO A O    7  
ATOM   6941  C  CB   . PRO A 1 57 ? 9.746   5.267   -3.077  1.00 0.00 ? 57  PRO A CB   7  
ATOM   6942  C  CG   . PRO A 1 57 ? 8.697   5.715   -4.036  1.00 0.00 ? 57  PRO A CG   7  
ATOM   6943  C  CD   . PRO A 1 57 ? 8.201   4.493   -4.746  1.00 0.00 ? 57  PRO A CD   7  
ATOM   6944  H  HA   . PRO A 1 57 ? 11.235  4.333   -4.313  1.00 0.00 ? 57  PRO A HA   7  
ATOM   6945  H  HB2  . PRO A 1 57 ? 9.318   4.991   -2.124  1.00 0.00 ? 57  PRO A HB2  7  
ATOM   6946  H  HB3  . PRO A 1 57 ? 10.500  6.026   -2.934  1.00 0.00 ? 57  PRO A HB3  7  
ATOM   6947  H  HG2  . PRO A 1 57 ? 7.885   6.182   -3.500  1.00 0.00 ? 57  PRO A HG2  7  
ATOM   6948  H  HG3  . PRO A 1 57 ? 9.123   6.405   -4.749  1.00 0.00 ? 57  PRO A HG3  7  
ATOM   6949  H  HD2  . PRO A 1 57 ? 7.299   4.130   -4.278  1.00 0.00 ? 57  PRO A HD2  7  
ATOM   6950  H  HD3  . PRO A 1 57 ? 8.026   4.713   -5.789  1.00 0.00 ? 57  PRO A HD3  7  
ATOM   6951  N  N    . CYS A 1 58 ? 9.854   2.631   -1.826  1.00 0.00 ? 58  CYS A N    7  
ATOM   6952  C  CA   . CYS A 1 58 ? 10.131  1.669   -0.766  1.00 0.00 ? 58  CYS A CA   7  
ATOM   6953  C  C    . CYS A 1 58 ? 10.524  0.315   -1.350  1.00 0.00 ? 58  CYS A C    7  
ATOM   6954  O  O    . CYS A 1 58 ? 11.676  -0.109  -1.243  1.00 0.00 ? 58  CYS A O    7  
ATOM   6955  C  CB   . CYS A 1 58 ? 8.908   1.510   0.139   1.00 0.00 ? 58  CYS A CB   7  
ATOM   6956  S  SG   . CYS A 1 58 ? 8.447   3.026   1.039   1.00 0.00 ? 58  CYS A SG   7  
ATOM   6957  H  H    . CYS A 1 58 ? 8.949   2.997   -1.914  1.00 0.00 ? 58  CYS A H    7  
ATOM   6958  H  HA   . CYS A 1 58 ? 10.955  2.047   -0.181  1.00 0.00 ? 58  CYS A HA   7  
ATOM   6959  H  HB2  . CYS A 1 58 ? 8.060   1.216   -0.462  1.00 0.00 ? 58  CYS A HB2  7  
ATOM   6960  H  HB3  . CYS A 1 58 ? 9.108   0.741   0.871   1.00 0.00 ? 58  CYS A HB3  7  
ATOM   6961  N  N    . HIS A 1 59 ? 9.560   -0.360  -1.968  1.00 0.00 ? 59  HIS A N    7  
ATOM   6962  C  CA   . HIS A 1 59 ? 9.805   -1.666  -2.570  1.00 0.00 ? 59  HIS A CA   7  
ATOM   6963  C  C    . HIS A 1 59 ? 11.208  -1.735  -3.164  1.00 0.00 ? 59  HIS A C    7  
ATOM   6964  O  O    . HIS A 1 59 ? 11.908  -2.735  -3.011  1.00 0.00 ? 59  HIS A O    7  
ATOM   6965  C  CB   . HIS A 1 59 ? 8.765   -1.955  -3.652  1.00 0.00 ? 59  HIS A CB   7  
ATOM   6966  C  CG   . HIS A 1 59 ? 8.928   -3.298  -4.296  1.00 0.00 ? 59  HIS A CG   7  
ATOM   6967  N  ND1  . HIS A 1 59 ? 8.728   -4.484  -3.623  1.00 0.00 ? 59  HIS A ND1  7  
ATOM   6968  C  CD2  . HIS A 1 59 ? 9.273   -3.637  -5.560  1.00 0.00 ? 59  HIS A CD2  7  
ATOM   6969  C  CE1  . HIS A 1 59 ? 8.945   -5.496  -4.445  1.00 0.00 ? 59  HIS A CE1  7  
ATOM   6970  N  NE2  . HIS A 1 59 ? 9.276   -5.008  -5.627  1.00 0.00 ? 59  HIS A NE2  7  
ATOM   6971  H  H    . HIS A 1 59 ? 8.662   0.030   -2.020  1.00 0.00 ? 59  HIS A H    7  
ATOM   6972  H  HA   . HIS A 1 59 ? 9.719   -2.410  -1.793  1.00 0.00 ? 59  HIS A HA   7  
ATOM   6973  H  HB2  . HIS A 1 59 ? 7.778   -1.916  -3.214  1.00 0.00 ? 59  HIS A HB2  7  
ATOM   6974  H  HB3  . HIS A 1 59 ? 8.841   -1.204  -4.425  1.00 0.00 ? 59  HIS A HB3  7  
ATOM   6975  H  HD1  . HIS A 1 59 ? 8.468   -4.572  -2.683  1.00 0.00 ? 59  HIS A HD1  7  
ATOM   6976  H  HD2  . HIS A 1 59 ? 9.504   -2.956  -6.368  1.00 0.00 ? 59  HIS A HD2  7  
ATOM   6977  H  HE1  . HIS A 1 59 ? 8.864   -6.543  -4.195  1.00 0.00 ? 59  HIS A HE1  7  
ATOM   6978  H  HE2  . HIS A 1 59 ? 9.572   -5.541  -6.394  1.00 0.00 ? 59  HIS A HE2  7  
ATOM   6979  N  N    . ASN A 1 60 ? 11.612  -0.666  -3.842  1.00 0.00 ? 60  ASN A N    7  
ATOM   6980  C  CA   . ASN A 1 60 ? 12.931  -0.607  -4.461  1.00 0.00 ? 60  ASN A CA   7  
ATOM   6981  C  C    . ASN A 1 60 ? 14.030  -0.657  -3.404  1.00 0.00 ? 60  ASN A C    7  
ATOM   6982  O  O    . ASN A 1 60 ? 15.015  -1.381  -3.552  1.00 0.00 ? 60  ASN A O    7  
ATOM   6983  C  CB   . ASN A 1 60 ? 13.069  0.668   -5.296  1.00 0.00 ? 60  ASN A CB   7  
ATOM   6984  C  CG   . ASN A 1 60 ? 12.379  0.556   -6.641  1.00 0.00 ? 60  ASN A CG   7  
ATOM   6985  O  OD1  . ASN A 1 60 ? 12.484  -0.464  -7.322  1.00 0.00 ? 60  ASN A OD1  7  
ATOM   6986  N  ND2  . ASN A 1 60 ? 11.668  1.607   -7.031  1.00 0.00 ? 60  ASN A ND2  7  
ATOM   6987  H  H    . ASN A 1 60 ? 11.008  0.101   -3.929  1.00 0.00 ? 60  ASN A H    7  
ATOM   6988  H  HA   . ASN A 1 60 ? 13.032  -1.464  -5.110  1.00 0.00 ? 60  ASN A HA   7  
ATOM   6989  H  HB2  . ASN A 1 60 ? 12.630  1.494   -4.755  1.00 0.00 ? 60  ASN A HB2  7  
ATOM   6990  H  HB3  . ASN A 1 60 ? 14.116  0.870   -5.464  1.00 0.00 ? 60  ASN A HB3  7  
ATOM   6991  H  HD21 . ASN A 1 60 ? 11.628  2.386   -6.437  1.00 0.00 ? 60  ASN A HD21 7  
ATOM   6992  H  HD22 . ASN A 1 60 ? 11.210  1.561   -7.896  1.00 0.00 ? 60  ASN A HD22 7  
ATOM   6993  N  N    . ARG A 1 61 ? 13.854  0.116   -2.337  1.00 0.00 ? 61  ARG A N    7  
ATOM   6994  C  CA   . ARG A 1 61 ? 14.831  0.160   -1.256  1.00 0.00 ? 61  ARG A CA   7  
ATOM   6995  C  C    . ARG A 1 61 ? 15.012  -1.220  -0.631  1.00 0.00 ? 61  ARG A C    7  
ATOM   6996  O  O    . ARG A 1 61 ? 16.136  -1.661  -0.393  1.00 0.00 ? 61  ARG A O    7  
ATOM   6997  C  CB   . ARG A 1 61 ? 14.394  1.162   -0.186  1.00 0.00 ? 61  ARG A CB   7  
ATOM   6998  C  CG   . ARG A 1 61 ? 14.463  2.610   -0.644  1.00 0.00 ? 61  ARG A CG   7  
ATOM   6999  C  CD   . ARG A 1 61 ? 13.559  3.502   0.192   1.00 0.00 ? 61  ARG A CD   7  
ATOM   7000  N  NE   . ARG A 1 61 ? 13.110  4.677   -0.551  1.00 0.00 ? 61  ARG A NE   7  
ATOM   7001  C  CZ   . ARG A 1 61 ? 13.815  5.799   -0.648  1.00 0.00 ? 61  ARG A CZ   7  
ATOM   7002  N  NH1  . ARG A 1 61 ? 14.996  5.897   -0.052  1.00 0.00 ? 61  ARG A NH1  7  
ATOM   7003  N  NH2  . ARG A 1 61 ? 13.340  6.825   -1.342  1.00 0.00 ? 61  ARG A NH2  7  
ATOM   7004  H  H    . ARG A 1 61 ? 13.048  0.671   -2.277  1.00 0.00 ? 61  ARG A H    7  
ATOM   7005  H  HA   . ARG A 1 61 ? 15.774  0.480   -1.673  1.00 0.00 ? 61  ARG A HA   7  
ATOM   7006  H  HB2  . ARG A 1 61 ? 13.375  0.946   0.099   1.00 0.00 ? 61  ARG A HB2  7  
ATOM   7007  H  HB3  . ARG A 1 61 ? 15.032  1.050   0.677   1.00 0.00 ? 61  ARG A HB3  7  
ATOM   7008  H  HG2  . ARG A 1 61 ? 15.480  2.960   -0.551  1.00 0.00 ? 61  ARG A HG2  7  
ATOM   7009  H  HG3  . ARG A 1 61 ? 14.154  2.666   -1.677  1.00 0.00 ? 61  ARG A HG3  7  
ATOM   7010  H  HD2  . ARG A 1 61 ? 12.695  2.931   0.499   1.00 0.00 ? 61  ARG A HD2  7  
ATOM   7011  H  HD3  . ARG A 1 61 ? 14.104  3.827   1.066   1.00 0.00 ? 61  ARG A HD3  7  
ATOM   7012  H  HE   . ARG A 1 61 ? 12.241  4.626   -0.999  1.00 0.00 ? 61  ARG A HE   7  
ATOM   7013  H  HH11 . ARG A 1 61 ? 15.357  5.125   0.471   1.00 0.00 ? 61  ARG A HH11 7  
ATOM   7014  H  HH12 . ARG A 1 61 ? 15.526  6.742   -0.128  1.00 0.00 ? 61  ARG A HH12 7  
ATOM   7015  H  HH21 . ARG A 1 61 ? 12.451  6.754   -1.792  1.00 0.00 ? 61  ARG A HH21 7  
ATOM   7016  H  HH22 . ARG A 1 61 ? 13.871  7.668   -1.414  1.00 0.00 ? 61  ARG A HH22 7  
ATOM   7017  N  N    . GLU A 1 62 ? 13.898  -1.896  -0.368  1.00 0.00 ? 62  GLU A N    7  
ATOM   7018  C  CA   . GLU A 1 62 ? 13.936  -3.225  0.231   1.00 0.00 ? 62  GLU A CA   7  
ATOM   7019  C  C    . GLU A 1 62 ? 14.524  -4.244  -0.741  1.00 0.00 ? 62  GLU A C    7  
ATOM   7020  O  O    . GLU A 1 62 ? 15.567  -4.842  -0.476  1.00 0.00 ? 62  GLU A O    7  
ATOM   7021  C  CB   . GLU A 1 62 ? 12.530  -3.659  0.652   1.00 0.00 ? 62  GLU A CB   7  
ATOM   7022  C  CG   . GLU A 1 62 ? 11.757  -2.581  1.393   1.00 0.00 ? 62  GLU A CG   7  
ATOM   7023  C  CD   . GLU A 1 62 ? 11.969  -2.638  2.893   1.00 0.00 ? 62  GLU A CD   7  
ATOM   7024  O  OE1  . GLU A 1 62 ? 13.055  -3.082  3.322   1.00 0.00 ? 62  GLU A OE1  7  
ATOM   7025  O  OE2  . GLU A 1 62 ? 11.050  -2.239  3.638   1.00 0.00 ? 62  GLU A OE2  7  
ATOM   7026  H  H    . GLU A 1 62 ? 13.032  -1.492  -0.580  1.00 0.00 ? 62  GLU A H    7  
ATOM   7027  H  HA   . GLU A 1 62 ? 14.565  -3.177  1.107   1.00 0.00 ? 62  GLU A HA   7  
ATOM   7028  H  HB2  . GLU A 1 62 ? 11.971  -3.932  -0.231  1.00 0.00 ? 62  GLU A HB2  7  
ATOM   7029  H  HB3  . GLU A 1 62 ? 12.611  -4.522  1.297   1.00 0.00 ? 62  GLU A HB3  7  
ATOM   7030  H  HG2  . GLU A 1 62 ? 12.079  -1.615  1.036   1.00 0.00 ? 62  GLU A HG2  7  
ATOM   7031  H  HG3  . GLU A 1 62 ? 10.704  -2.706  1.188   1.00 0.00 ? 62  GLU A HG3  7  
ATOM   7032  N  N    . LYS A 1 63 ? 13.848  -4.436  -1.869  1.00 0.00 ? 63  LYS A N    7  
ATOM   7033  C  CA   . LYS A 1 63 ? 14.301  -5.380  -2.883  1.00 0.00 ? 63  LYS A CA   7  
ATOM   7034  C  C    . LYS A 1 63 ? 15.741  -5.088  -3.293  1.00 0.00 ? 63  LYS A C    7  
ATOM   7035  O  O    . LYS A 1 63 ? 16.534  -6.005  -3.508  1.00 0.00 ? 63  LYS A O    7  
ATOM   7036  C  CB   . LYS A 1 63 ? 13.388  -5.322  -4.109  1.00 0.00 ? 63  LYS A CB   7  
ATOM   7037  C  CG   . LYS A 1 63 ? 13.616  -4.097  -4.979  1.00 0.00 ? 63  LYS A CG   7  
ATOM   7038  C  CD   . LYS A 1 63 ? 12.536  -3.958  -6.039  1.00 0.00 ? 63  LYS A CD   7  
ATOM   7039  C  CE   . LYS A 1 63 ? 12.726  -4.966  -7.162  1.00 0.00 ? 63  LYS A CE   7  
ATOM   7040  N  NZ   . LYS A 1 63 ? 13.913  -4.645  -8.001  1.00 0.00 ? 63  LYS A NZ   7  
ATOM   7041  H  H    . LYS A 1 63 ? 13.022  -3.929  -2.023  1.00 0.00 ? 63  LYS A H    7  
ATOM   7042  H  HA   . LYS A 1 63 ? 14.255  -6.371  -2.457  1.00 0.00 ? 63  LYS A HA   7  
ATOM   7043  H  HB2  . LYS A 1 63 ? 13.558  -6.202  -4.712  1.00 0.00 ? 63  LYS A HB2  7  
ATOM   7044  H  HB3  . LYS A 1 63 ? 12.360  -5.316  -3.777  1.00 0.00 ? 63  LYS A HB3  7  
ATOM   7045  H  HG2  . LYS A 1 63 ? 13.607  -3.216  -4.354  1.00 0.00 ? 63  LYS A HG2  7  
ATOM   7046  H  HG3  . LYS A 1 63 ? 14.577  -4.186  -5.465  1.00 0.00 ? 63  LYS A HG3  7  
ATOM   7047  H  HD2  . LYS A 1 63 ? 11.572  -4.122  -5.583  1.00 0.00 ? 63  LYS A HD2  7  
ATOM   7048  H  HD3  . LYS A 1 63 ? 12.576  -2.960  -6.452  1.00 0.00 ? 63  LYS A HD3  7  
ATOM   7049  H  HE2  . LYS A 1 63 ? 12.855  -5.947  -6.730  1.00 0.00 ? 63  LYS A HE2  7  
ATOM   7050  H  HE3  . LYS A 1 63 ? 11.843  -4.961  -7.785  1.00 0.00 ? 63  LYS A HE3  7  
ATOM   7051  H  HZ1  . LYS A 1 63 ? 14.488  -3.911  -7.540  1.00 0.00 ? 63  LYS A HZ1  7  
ATOM   7052  H  HZ2  . LYS A 1 63 ? 13.609  -4.297  -8.933  1.00 0.00 ? 63  LYS A HZ2  7  
ATOM   7053  H  HZ3  . LYS A 1 63 ? 14.497  -5.495  -8.135  1.00 0.00 ? 63  LYS A HZ3  7  
ATOM   7054  N  N    . ALA A 1 64 ? 16.073  -3.805  -3.399  1.00 0.00 ? 64  ALA A N    7  
ATOM   7055  C  CA   . ALA A 1 64 ? 17.418  -3.393  -3.780  1.00 0.00 ? 64  ALA A CA   7  
ATOM   7056  C  C    . ALA A 1 64 ? 18.471  -4.128  -2.958  1.00 0.00 ? 64  ALA A C    7  
ATOM   7057  O  O    . ALA A 1 64 ? 19.317  -4.836  -3.505  1.00 0.00 ? 64  ALA A O    7  
ATOM   7058  C  CB   . ALA A 1 64 ? 17.574  -1.888  -3.617  1.00 0.00 ? 64  ALA A CB   7  
ATOM   7059  H  H    . ALA A 1 64 ? 15.397  -3.120  -3.215  1.00 0.00 ? 64  ALA A H    7  
ATOM   7060  H  HA   . ALA A 1 64 ? 17.558  -3.634  -4.824  1.00 0.00 ? 64  ALA A HA   7  
ATOM   7061  H  HB1  . ALA A 1 64 ? 17.054  -1.384  -4.418  1.00 0.00 ? 64  ALA A HB1  7  
ATOM   7062  H  HB2  . ALA A 1 64 ? 17.157  -1.584  -2.669  1.00 0.00 ? 64  ALA A HB2  7  
ATOM   7063  H  HB3  . ALA A 1 64 ? 18.622  -1.630  -3.650  1.00 0.00 ? 64  ALA A HB3  7  
ATOM   7064  N  N    . SER A 1 65 ? 18.414  -3.956  -1.641  1.00 0.00 ? 65  SER A N    7  
ATOM   7065  C  CA   . SER A 1 65 ? 19.366  -4.600  -0.744  1.00 0.00 ? 65  SER A CA   7  
ATOM   7066  C  C    . SER A 1 65 ? 19.503  -6.084  -1.072  1.00 0.00 ? 65  SER A C    7  
ATOM   7067  O  O    . SER A 1 65 ? 18.599  -6.875  -0.810  1.00 0.00 ? 65  SER A O    7  
ATOM   7068  C  CB   . SER A 1 65 ? 18.927  -4.426  0.711   1.00 0.00 ? 65  SER A CB   7  
ATOM   7069  O  OG   . SER A 1 65 ? 19.955  -4.815  1.605   1.00 0.00 ? 65  SER A OG   7  
ATOM   7070  H  H    . SER A 1 65 ? 17.716  -3.380  -1.265  1.00 0.00 ? 65  SER A H    7  
ATOM   7071  H  HA   . SER A 1 65 ? 20.325  -4.123  -0.881  1.00 0.00 ? 65  SER A HA   7  
ATOM   7072  H  HB2  . SER A 1 65 ? 18.684  -3.390  0.889   1.00 0.00 ? 65  SER A HB2  7  
ATOM   7073  H  HB3  . SER A 1 65 ? 18.055  -5.037  0.896   1.00 0.00 ? 65  SER A HB3  7  
ATOM   7074  H  HG   . SER A 1 65 ? 20.805  -4.748  1.163   1.00 0.00 ? 65  SER A HG   7  
ATOM   7075  N  N    . GLY A 1 66 ? 20.643  -6.454  -1.648  1.00 0.00 ? 66  GLY A N    7  
ATOM   7076  C  CA   . GLY A 1 66 ? 20.879  -7.841  -2.003  1.00 0.00 ? 66  GLY A CA   7  
ATOM   7077  C  C    . GLY A 1 66 ? 21.679  -7.984  -3.283  1.00 0.00 ? 66  GLY A C    7  
ATOM   7078  O  O    . GLY A 1 66 ? 21.842  -7.033  -4.048  1.00 0.00 ? 66  GLY A O    7  
ATOM   7079  H  H    . GLY A 1 66 ? 21.329  -5.779  -1.834  1.00 0.00 ? 66  GLY A H    7  
ATOM   7080  H  HA2  . GLY A 1 66 ? 21.418  -8.320  -1.199  1.00 0.00 ? 66  GLY A HA2  7  
ATOM   7081  H  HA3  . GLY A 1 66 ? 19.927  -8.335  -2.130  1.00 0.00 ? 66  GLY A HA3  7  
ATOM   7082  N  N    . PRO A 1 67 ? 22.195  -9.197  -3.530  1.00 0.00 ? 67  PRO A N    7  
ATOM   7083  C  CA   . PRO A 1 67 ? 22.991  -9.489  -4.726  1.00 0.00 ? 67  PRO A CA   7  
ATOM   7084  C  C    . PRO A 1 67 ? 22.152  -9.479  -5.999  1.00 0.00 ? 67  PRO A C    7  
ATOM   7085  O  O    . PRO A 1 67 ? 22.687  -9.438  -7.106  1.00 0.00 ? 67  PRO A O    7  
ATOM   7086  C  CB   . PRO A 1 67 ? 23.535  -10.895 -4.455  1.00 0.00 ? 67  PRO A CB   7  
ATOM   7087  C  CG   . PRO A 1 67 ? 22.554  -11.505 -3.513  1.00 0.00 ? 67  PRO A CG   7  
ATOM   7088  C  CD   . PRO A 1 67 ? 22.040  -10.376 -2.663  1.00 0.00 ? 67  PRO A CD   7  
ATOM   7089  H  HA   . PRO A 1 67 ? 23.814  -8.798  -4.833  1.00 0.00 ? 67  PRO A HA   7  
ATOM   7090  H  HB2  . PRO A 1 67 ? 23.589  -11.447 -5.383  1.00 0.00 ? 67  PRO A HB2  7  
ATOM   7091  H  HB3  . PRO A 1 67 ? 24.517  -10.826 -4.012  1.00 0.00 ? 67  PRO A HB3  7  
ATOM   7092  H  HG2  . PRO A 1 67 ? 21.745  -11.956 -4.067  1.00 0.00 ? 67  PRO A HG2  7  
ATOM   7093  H  HG3  . PRO A 1 67 ? 23.048  -12.243 -2.898  1.00 0.00 ? 67  PRO A HG3  7  
ATOM   7094  H  HD2  . PRO A 1 67 ? 21.002  -10.536 -2.411  1.00 0.00 ? 67  PRO A HD2  7  
ATOM   7095  H  HD3  . PRO A 1 67 ? 22.636  -10.277 -1.768  1.00 0.00 ? 67  PRO A HD3  7  
ATOM   7096  N  N    . SER A 1 68 ? 20.833  -9.516  -5.833  1.00 0.00 ? 68  SER A N    7  
ATOM   7097  C  CA   . SER A 1 68 ? 19.920  -9.514  -6.969  1.00 0.00 ? 68  SER A CA   7  
ATOM   7098  C  C    . SER A 1 68 ? 18.725  -8.603  -6.705  1.00 0.00 ? 68  SER A C    7  
ATOM   7099  O  O    . SER A 1 68 ? 18.191  -8.567  -5.596  1.00 0.00 ? 68  SER A O    7  
ATOM   7100  C  CB   . SER A 1 68 ? 19.436  -10.935 -7.264  1.00 0.00 ? 68  SER A CB   7  
ATOM   7101  O  OG   . SER A 1 68 ? 20.327  -11.605 -8.140  1.00 0.00 ? 68  SER A OG   7  
ATOM   7102  H  H    . SER A 1 68 ? 20.467  -9.548  -4.924  1.00 0.00 ? 68  SER A H    7  
ATOM   7103  H  HA   . SER A 1 68 ? 20.459  -9.141  -7.827  1.00 0.00 ? 68  SER A HA   7  
ATOM   7104  H  HB2  . SER A 1 68 ? 19.373  -11.490 -6.341  1.00 0.00 ? 68  SER A HB2  7  
ATOM   7105  H  HB3  . SER A 1 68 ? 18.460  -10.892 -7.726  1.00 0.00 ? 68  SER A HB3  7  
ATOM   7106  H  HG   . SER A 1 68 ? 19.864  -11.842 -8.947  1.00 0.00 ? 68  SER A HG   7  
ATOM   7107  N  N    . SER A 1 69 ? 18.311  -7.867  -7.731  1.00 0.00 ? 69  SER A N    7  
ATOM   7108  C  CA   . SER A 1 69 ? 17.182  -6.953  -7.610  1.00 0.00 ? 69  SER A CA   7  
ATOM   7109  C  C    . SER A 1 69 ? 16.713  -6.483  -8.984  1.00 0.00 ? 69  SER A C    7  
ATOM   7110  O  O    . SER A 1 69 ? 17.438  -5.789  -9.696  1.00 0.00 ? 69  SER A O    7  
ATOM   7111  C  CB   . SER A 1 69 ? 17.565  -5.747  -6.749  1.00 0.00 ? 69  SER A CB   7  
ATOM   7112  O  OG   . SER A 1 69 ? 18.577  -4.976  -7.373  1.00 0.00 ? 69  SER A OG   7  
ATOM   7113  H  H    . SER A 1 69 ? 18.777  -7.940  -8.590  1.00 0.00 ? 69  SER A H    7  
ATOM   7114  H  HA   . SER A 1 69 ? 16.374  -7.485  -7.129  1.00 0.00 ? 69  SER A HA   7  
ATOM   7115  H  HB2  . SER A 1 69 ? 16.696  -5.124  -6.599  1.00 0.00 ? 69  SER A HB2  7  
ATOM   7116  H  HB3  . SER A 1 69 ? 17.930  -6.093  -5.793  1.00 0.00 ? 69  SER A HB3  7  
ATOM   7117  H  HG   . SER A 1 69 ? 18.662  -4.133  -6.922  1.00 0.00 ? 69  SER A HG   7  
ATOM   7118  N  N    . GLY A 1 70 ? 15.494  -6.866  -9.349  1.00 0.00 ? 70  GLY A N    7  
ATOM   7119  C  CA   . GLY A 1 70 ? 14.948  -6.476  -10.636 1.00 0.00 ? 70  GLY A CA   7  
ATOM   7120  C  C    . GLY A 1 70 ? 15.926  -6.699  -11.772 1.00 0.00 ? 70  GLY A C    7  
ATOM   7121  O  O    . GLY A 1 70 ? 15.951  -7.793  -12.335 1.00 0.00 ? 70  GLY A O    7  
ATOM   7122  H  H    . GLY A 1 70 ? 14.960  -7.419  -8.740  1.00 0.00 ? 70  GLY A H    7  
ATOM   7123  H  HA2  . GLY A 1 70 ? 14.054  -7.052  -10.826 1.00 0.00 ? 70  GLY A HA2  7  
ATOM   7124  H  HA3  . GLY A 1 70 ? 14.688  -5.428  -10.601 1.00 0.00 ? 70  GLY A HA3  7  
HETATM 7125  ZN ZN   . ZN  B 2 .  ? -11.344 4.323   2.458   1.00 0.00 ? 201 ZN  A ZN   7  
HETATM 7126  ZN ZN   . ZN  C 2 .  ? 6.573   3.557   0.405   1.00 0.00 ? 401 ZN  A ZN   7  
ATOM   7127  N  N    . GLY A 1 1  ? -30.624 -8.102  -6.915  1.00 0.00 ? 1   GLY A N    8  
ATOM   7128  C  CA   . GLY A 1 1  ? -29.295 -8.670  -7.052  1.00 0.00 ? 1   GLY A CA   8  
ATOM   7129  C  C    . GLY A 1 1  ? -28.705 -8.437  -8.428  1.00 0.00 ? 1   GLY A C    8  
ATOM   7130  O  O    . GLY A 1 1  ? -28.376 -9.387  -9.139  1.00 0.00 ? 1   GLY A O    8  
ATOM   7131  H  H1   . GLY A 1 1  ? -31.408 -8.622  -7.191  1.00 0.00 ? 1   GLY A H1   8  
ATOM   7132  H  HA2  . GLY A 1 1  ? -28.647 -8.223  -6.313  1.00 0.00 ? 1   GLY A HA2  8  
ATOM   7133  H  HA3  . GLY A 1 1  ? -29.351 -9.734  -6.872  1.00 0.00 ? 1   GLY A HA3  8  
ATOM   7134  N  N    . SER A 1 2  ? -28.570 -7.170  -8.806  1.00 0.00 ? 2   SER A N    8  
ATOM   7135  C  CA   . SER A 1 2  ? -28.020 -6.815  -10.109 1.00 0.00 ? 2   SER A CA   8  
ATOM   7136  C  C    . SER A 1 2  ? -26.498 -6.914  -10.102 1.00 0.00 ? 2   SER A C    8  
ATOM   7137  O  O    . SER A 1 2  ? -25.906 -7.618  -10.920 1.00 0.00 ? 2   SER A O    8  
ATOM   7138  C  CB   . SER A 1 2  ? -28.449 -5.399  -10.499 1.00 0.00 ? 2   SER A CB   8  
ATOM   7139  O  OG   . SER A 1 2  ? -29.855 -5.248  -10.406 1.00 0.00 ? 2   SER A OG   8  
ATOM   7140  H  H    . SER A 1 2  ? -28.850 -6.457  -8.195  1.00 0.00 ? 2   SER A H    8  
ATOM   7141  H  HA   . SER A 1 2  ? -28.411 -7.513  -10.835 1.00 0.00 ? 2   SER A HA   8  
ATOM   7142  H  HB2  . SER A 1 2  ? -27.978 -4.688  -9.837  1.00 0.00 ? 2   SER A HB2  8  
ATOM   7143  H  HB3  . SER A 1 2  ? -28.144 -5.201  -11.516 1.00 0.00 ? 2   SER A HB3  8  
ATOM   7144  H  HG   . SER A 1 2  ? -30.067 -4.328  -10.234 1.00 0.00 ? 2   SER A HG   8  
ATOM   7145  N  N    . SER A 1 3  ? -25.870 -6.203  -9.171  1.00 0.00 ? 3   SER A N    8  
ATOM   7146  C  CA   . SER A 1 3  ? -24.416 -6.207  -9.058  1.00 0.00 ? 3   SER A CA   8  
ATOM   7147  C  C    . SER A 1 3  ? -23.985 -6.242  -7.594  1.00 0.00 ? 3   SER A C    8  
ATOM   7148  O  O    . SER A 1 3  ? -24.724 -5.817  -6.707  1.00 0.00 ? 3   SER A O    8  
ATOM   7149  C  CB   . SER A 1 3  ? -23.827 -4.973  -9.744  1.00 0.00 ? 3   SER A CB   8  
ATOM   7150  O  OG   . SER A 1 3  ? -24.160 -4.948  -11.121 1.00 0.00 ? 3   SER A OG   8  
ATOM   7151  H  H    . SER A 1 3  ? -26.397 -5.661  -8.547  1.00 0.00 ? 3   SER A H    8  
ATOM   7152  H  HA   . SER A 1 3  ? -24.047 -7.093  -9.551  1.00 0.00 ? 3   SER A HA   8  
ATOM   7153  H  HB2  . SER A 1 3  ? -24.217 -4.082  -9.276  1.00 0.00 ? 3   SER A HB2  8  
ATOM   7154  H  HB3  . SER A 1 3  ? -22.751 -4.990  -9.647  1.00 0.00 ? 3   SER A HB3  8  
ATOM   7155  H  HG   . SER A 1 3  ? -24.968 -5.447  -11.265 1.00 0.00 ? 3   SER A HG   8  
ATOM   7156  N  N    . GLY A 1 4  ? -22.783 -6.755  -7.350  1.00 0.00 ? 4   GLY A N    8  
ATOM   7157  C  CA   . GLY A 1 4  ? -22.273 -6.838  -5.994  1.00 0.00 ? 4   GLY A CA   8  
ATOM   7158  C  C    . GLY A 1 4  ? -22.045 -5.472  -5.376  1.00 0.00 ? 4   GLY A C    8  
ATOM   7159  O  O    . GLY A 1 4  ? -22.493 -4.459  -5.911  1.00 0.00 ? 4   GLY A O    8  
ATOM   7160  H  H    . GLY A 1 4  ? -22.237 -7.079  -8.097  1.00 0.00 ? 4   GLY A H    8  
ATOM   7161  H  HA2  . GLY A 1 4  ? -22.981 -7.382  -5.388  1.00 0.00 ? 4   GLY A HA2  8  
ATOM   7162  H  HA3  . GLY A 1 4  ? -21.336 -7.375  -6.006  1.00 0.00 ? 4   GLY A HA3  8  
ATOM   7163  N  N    . SER A 1 5  ? -21.349 -5.446  -4.244  1.00 0.00 ? 5   SER A N    8  
ATOM   7164  C  CA   . SER A 1 5  ? -21.067 -4.195  -3.549  1.00 0.00 ? 5   SER A CA   8  
ATOM   7165  C  C    . SER A 1 5  ? -19.585 -3.846  -3.637  1.00 0.00 ? 5   SER A C    8  
ATOM   7166  O  O    . SER A 1 5  ? -18.722 -4.700  -3.430  1.00 0.00 ? 5   SER A O    8  
ATOM   7167  C  CB   . SER A 1 5  ? -21.493 -4.295  -2.083  1.00 0.00 ? 5   SER A CB   8  
ATOM   7168  O  OG   . SER A 1 5  ? -21.689 -3.009  -1.520  1.00 0.00 ? 5   SER A OG   8  
ATOM   7169  H  H    . SER A 1 5  ? -21.018 -6.288  -3.867  1.00 0.00 ? 5   SER A H    8  
ATOM   7170  H  HA   . SER A 1 5  ? -21.638 -3.414  -4.029  1.00 0.00 ? 5   SER A HA   8  
ATOM   7171  H  HB2  . SER A 1 5  ? -22.418 -4.848  -2.016  1.00 0.00 ? 5   SER A HB2  8  
ATOM   7172  H  HB3  . SER A 1 5  ? -20.725 -4.807  -1.522  1.00 0.00 ? 5   SER A HB3  8  
ATOM   7173  H  HG   . SER A 1 5  ? -22.614 -2.764  -1.596  1.00 0.00 ? 5   SER A HG   8  
ATOM   7174  N  N    . SER A 1 6  ? -19.297 -2.586  -3.946  1.00 0.00 ? 6   SER A N    8  
ATOM   7175  C  CA   . SER A 1 6  ? -17.919 -2.124  -4.065  1.00 0.00 ? 6   SER A CA   8  
ATOM   7176  C  C    . SER A 1 6  ? -17.601 -1.080  -2.998  1.00 0.00 ? 6   SER A C    8  
ATOM   7177  O  O    . SER A 1 6  ? -17.938 0.094   -3.143  1.00 0.00 ? 6   SER A O    8  
ATOM   7178  C  CB   . SER A 1 6  ? -17.674 -1.538  -5.457  1.00 0.00 ? 6   SER A CB   8  
ATOM   7179  O  OG   . SER A 1 6  ? -17.544 -2.563  -6.427  1.00 0.00 ? 6   SER A OG   8  
ATOM   7180  H  H    . SER A 1 6  ? -20.029 -1.953  -4.099  1.00 0.00 ? 6   SER A H    8  
ATOM   7181  H  HA   . SER A 1 6  ? -17.270 -2.975  -3.924  1.00 0.00 ? 6   SER A HA   8  
ATOM   7182  H  HB2  . SER A 1 6  ? -18.505 -0.905  -5.729  1.00 0.00 ? 6   SER A HB2  8  
ATOM   7183  H  HB3  . SER A 1 6  ? -16.765 -0.953  -5.444  1.00 0.00 ? 6   SER A HB3  8  
ATOM   7184  H  HG   . SER A 1 6  ? -18.368 -2.652  -6.911  1.00 0.00 ? 6   SER A HG   8  
ATOM   7185  N  N    . GLY A 1 7  ? -16.951 -1.519  -1.925  1.00 0.00 ? 7   GLY A N    8  
ATOM   7186  C  CA   . GLY A 1 7  ? -16.598 -0.612  -0.849  1.00 0.00 ? 7   GLY A CA   8  
ATOM   7187  C  C    . GLY A 1 7  ? -15.134 -0.704  -0.469  1.00 0.00 ? 7   GLY A C    8  
ATOM   7188  O  O    . GLY A 1 7  ? -14.529 -1.774  -0.552  1.00 0.00 ? 7   GLY A O    8  
ATOM   7189  H  H    . GLY A 1 7  ? -16.708 -2.467  -1.864  1.00 0.00 ? 7   GLY A H    8  
ATOM   7190  H  HA2  . GLY A 1 7  ? -16.816 0.399   -1.159  1.00 0.00 ? 7   GLY A HA2  8  
ATOM   7191  H  HA3  . GLY A 1 7  ? -17.198 -0.849  0.018   1.00 0.00 ? 7   GLY A HA3  8  
ATOM   7192  N  N    . CYS A 1 8  ? -14.560 0.420   -0.052  1.00 0.00 ? 8   CYS A N    8  
ATOM   7193  C  CA   . CYS A 1 8  ? -13.157 0.463   0.340   1.00 0.00 ? 8   CYS A CA   8  
ATOM   7194  C  C    . CYS A 1 8  ? -12.862 -0.573  1.421   1.00 0.00 ? 8   CYS A C    8  
ATOM   7195  O  O    . CYS A 1 8  ? -13.698 -0.840  2.285   1.00 0.00 ? 8   CYS A O    8  
ATOM   7196  C  CB   . CYS A 1 8  ? -12.789 1.860   0.843   1.00 0.00 ? 8   CYS A CB   8  
ATOM   7197  S  SG   . CYS A 1 8  ? -11.182 1.944   1.698   1.00 0.00 ? 8   CYS A SG   8  
ATOM   7198  H  H    . CYS A 1 8  ? -15.094 1.241   -0.007  1.00 0.00 ? 8   CYS A H    8  
ATOM   7199  H  HA   . CYS A 1 8  ? -12.562 0.235   -0.531  1.00 0.00 ? 8   CYS A HA   8  
ATOM   7200  H  HB2  . CYS A 1 8  ? -12.749 2.538   0.003   1.00 0.00 ? 8   CYS A HB2  8  
ATOM   7201  H  HB3  . CYS A 1 8  ? -13.548 2.197   1.534   1.00 0.00 ? 8   CYS A HB3  8  
ATOM   7202  N  N    . HIS A 1 9  ? -11.667 -1.153  1.367   1.00 0.00 ? 9   HIS A N    8  
ATOM   7203  C  CA   . HIS A 1 9  ? -11.261 -2.159  2.341   1.00 0.00 ? 9   HIS A CA   8  
ATOM   7204  C  C    . HIS A 1 9  ? -10.518 -1.516  3.509   1.00 0.00 ? 9   HIS A C    8  
ATOM   7205  O  O    . HIS A 1 9  ? -10.637 -1.959  4.651   1.00 0.00 ? 9   HIS A O    8  
ATOM   7206  C  CB   . HIS A 1 9  ? -10.375 -3.214  1.678   1.00 0.00 ? 9   HIS A CB   8  
ATOM   7207  C  CG   . HIS A 1 9  ? -10.222 -4.464  2.489   1.00 0.00 ? 9   HIS A CG   8  
ATOM   7208  N  ND1  . HIS A 1 9  ? -11.294 -5.176  2.984   1.00 0.00 ? 9   HIS A ND1  8  
ATOM   7209  C  CD2  . HIS A 1 9  ? -9.113  -5.129  2.890   1.00 0.00 ? 9   HIS A CD2  8  
ATOM   7210  C  CE1  . HIS A 1 9  ? -10.851 -6.224  3.655   1.00 0.00 ? 9   HIS A CE1  8  
ATOM   7211  N  NE2  . HIS A 1 9  ? -9.531  -6.219  3.613   1.00 0.00 ? 9   HIS A NE2  8  
ATOM   7212  H  H    . HIS A 1 9  ? -11.044 -0.899  0.654   1.00 0.00 ? 9   HIS A H    8  
ATOM   7213  H  HA   . HIS A 1 9  ? -12.153 -2.636  2.717   1.00 0.00 ? 9   HIS A HA   8  
ATOM   7214  H  HB2  . HIS A 1 9  ? -10.805 -3.488  0.725   1.00 0.00 ? 9   HIS A HB2  8  
ATOM   7215  H  HB3  . HIS A 1 9  ? -9.391  -2.799  1.517   1.00 0.00 ? 9   HIS A HB3  8  
ATOM   7216  H  HD1  . HIS A 1 9  ? -12.239 -4.947  2.862   1.00 0.00 ? 9   HIS A HD1  8  
ATOM   7217  H  HD2  . HIS A 1 9  ? -8.089  -4.854  2.680   1.00 0.00 ? 9   HIS A HD2  8  
ATOM   7218  H  HE1  . HIS A 1 9  ? -11.464 -6.961  4.154   1.00 0.00 ? 9   HIS A HE1  8  
ATOM   7219  H  HE2  . HIS A 1 9  ? -8.949  -6.836  4.102   1.00 0.00 ? 9   HIS A HE2  8  
ATOM   7220  N  N    . GLN A 1 10 ? -9.753  -0.471  3.213   1.00 0.00 ? 10  GLN A N    8  
ATOM   7221  C  CA   . GLN A 1 10 ? -8.990  0.231   4.238   1.00 0.00 ? 10  GLN A CA   8  
ATOM   7222  C  C    . GLN A 1 10 ? -9.895  0.672   5.384   1.00 0.00 ? 10  GLN A C    8  
ATOM   7223  O  O    . GLN A 1 10 ? -9.797  0.158   6.499   1.00 0.00 ? 10  GLN A O    8  
ATOM   7224  C  CB   . GLN A 1 10 ? -8.283  1.446   3.635   1.00 0.00 ? 10  GLN A CB   8  
ATOM   7225  C  CG   . GLN A 1 10 ? -7.520  2.275   4.656   1.00 0.00 ? 10  GLN A CG   8  
ATOM   7226  C  CD   . GLN A 1 10 ? -6.149  1.705   4.964   1.00 0.00 ? 10  GLN A CD   8  
ATOM   7227  O  OE1  . GLN A 1 10 ? -5.171  2.006   4.279   1.00 0.00 ? 10  GLN A OE1  8  
ATOM   7228  N  NE2  . GLN A 1 10 ? -6.071  0.876   5.998   1.00 0.00 ? 10  GLN A NE2  8  
ATOM   7229  H  H    . GLN A 1 10 ? -9.699  -0.165  2.284   1.00 0.00 ? 10  GLN A H    8  
ATOM   7230  H  HA   . GLN A 1 10 ? -8.248  -0.451  4.624   1.00 0.00 ? 10  GLN A HA   8  
ATOM   7231  H  HB2  . GLN A 1 10 ? -7.585  1.106   2.885   1.00 0.00 ? 10  GLN A HB2  8  
ATOM   7232  H  HB3  . GLN A 1 10 ? -9.021  2.082   3.168   1.00 0.00 ? 10  GLN A HB3  8  
ATOM   7233  H  HG2  . GLN A 1 10 ? -7.398  3.276   4.270   1.00 0.00 ? 10  GLN A HG2  8  
ATOM   7234  H  HG3  . GLN A 1 10 ? -8.093  2.311   5.571   1.00 0.00 ? 10  GLN A HG3  8  
ATOM   7235  H  HE21 . GLN A 1 10 ? -6.892  0.680   6.497   1.00 0.00 ? 10  GLN A HE21 8  
ATOM   7236  H  HE22 . GLN A 1 10 ? -5.198  0.492   6.218   1.00 0.00 ? 10  GLN A HE22 8  
ATOM   7237  N  N    . CYS A 1 11 ? -10.777 1.625   5.102   1.00 0.00 ? 11  CYS A N    8  
ATOM   7238  C  CA   . CYS A 1 11 ? -11.699 2.136   6.109   1.00 0.00 ? 11  CYS A CA   8  
ATOM   7239  C  C    . CYS A 1 11 ? -13.008 1.351   6.096   1.00 0.00 ? 11  CYS A C    8  
ATOM   7240  O  O    . CYS A 1 11 ? -13.502 0.931   7.141   1.00 0.00 ? 11  CYS A O    8  
ATOM   7241  C  CB   . CYS A 1 11 ? -11.980 3.621   5.867   1.00 0.00 ? 11  CYS A CB   8  
ATOM   7242  S  SG   . CYS A 1 11 ? -12.778 3.975   4.268   1.00 0.00 ? 11  CYS A SG   8  
ATOM   7243  H  H    . CYS A 1 11 ? -10.807 1.996   4.194   1.00 0.00 ? 11  CYS A H    8  
ATOM   7244  H  HA   . CYS A 1 11 ? -11.234 2.020   7.075   1.00 0.00 ? 11  CYS A HA   8  
ATOM   7245  H  HB2  . CYS A 1 11 ? -12.632 3.988   6.647   1.00 0.00 ? 11  CYS A HB2  8  
ATOM   7246  H  HB3  . CYS A 1 11 ? -11.048 4.165   5.898   1.00 0.00 ? 11  CYS A HB3  8  
ATOM   7247  N  N    . GLY A 1 12 ? -13.563 1.156   4.903   1.00 0.00 ? 12  GLY A N    8  
ATOM   7248  C  CA   . GLY A 1 12 ? -14.808 0.422   4.776   1.00 0.00 ? 12  GLY A CA   8  
ATOM   7249  C  C    . GLY A 1 12 ? -15.878 1.216   4.052   1.00 0.00 ? 12  GLY A C    8  
ATOM   7250  O  O    . GLY A 1 12 ? -16.660 0.658   3.283   1.00 0.00 ? 12  GLY A O    8  
ATOM   7251  H  H    . GLY A 1 12 ? -13.123 1.514   4.104   1.00 0.00 ? 12  GLY A H    8  
ATOM   7252  H  HA2  . GLY A 1 12 ? -14.621 -0.491  4.230   1.00 0.00 ? 12  GLY A HA2  8  
ATOM   7253  H  HA3  . GLY A 1 12 ? -15.168 0.172   5.763   1.00 0.00 ? 12  GLY A HA3  8  
ATOM   7254  N  N    . GLU A 1 13 ? -15.913 2.522   4.300   1.00 0.00 ? 13  GLU A N    8  
ATOM   7255  C  CA   . GLU A 1 13 ? -16.898 3.392   3.668   1.00 0.00 ? 13  GLU A CA   8  
ATOM   7256  C  C    . GLU A 1 13 ? -17.041 3.064   2.185   1.00 0.00 ? 13  GLU A C    8  
ATOM   7257  O  O    . GLU A 1 13 ? -16.134 2.501   1.572   1.00 0.00 ? 13  GLU A O    8  
ATOM   7258  C  CB   . GLU A 1 13 ? -16.499 4.859   3.841   1.00 0.00 ? 13  GLU A CB   8  
ATOM   7259  C  CG   . GLU A 1 13 ? -16.024 5.200   5.244   1.00 0.00 ? 13  GLU A CG   8  
ATOM   7260  C  CD   . GLU A 1 13 ? -16.354 6.625   5.642   1.00 0.00 ? 13  GLU A CD   8  
ATOM   7261  O  OE1  . GLU A 1 13 ? -17.518 6.883   6.015   1.00 0.00 ? 13  GLU A OE1  8  
ATOM   7262  O  OE2  . GLU A 1 13 ? -15.448 7.483   5.580   1.00 0.00 ? 13  GLU A OE2  8  
ATOM   7263  H  H    . GLU A 1 13 ? -15.263 2.908   4.924   1.00 0.00 ? 13  GLU A H    8  
ATOM   7264  H  HA   . GLU A 1 13 ? -17.847 3.227   4.154   1.00 0.00 ? 13  GLU A HA   8  
ATOM   7265  H  HB2  . GLU A 1 13 ? -15.703 5.088   3.148   1.00 0.00 ? 13  GLU A HB2  8  
ATOM   7266  H  HB3  . GLU A 1 13 ? -17.353 5.480   3.612   1.00 0.00 ? 13  GLU A HB3  8  
ATOM   7267  H  HG2  . GLU A 1 13 ? -16.499 4.528   5.944   1.00 0.00 ? 13  GLU A HG2  8  
ATOM   7268  H  HG3  . GLU A 1 13 ? -14.953 5.068   5.289   1.00 0.00 ? 13  GLU A HG3  8  
ATOM   7269  N  N    . PHE A 1 14 ? -18.187 3.420   1.614   1.00 0.00 ? 14  PHE A N    8  
ATOM   7270  C  CA   . PHE A 1 14 ? -18.451 3.162   0.203   1.00 0.00 ? 14  PHE A CA   8  
ATOM   7271  C  C    . PHE A 1 14 ? -17.744 4.188   -0.678  1.00 0.00 ? 14  PHE A C    8  
ATOM   7272  O  O    . PHE A 1 14 ? -17.808 5.391   -0.423  1.00 0.00 ? 14  PHE A O    8  
ATOM   7273  C  CB   . PHE A 1 14 ? -19.956 3.190   -0.069  1.00 0.00 ? 14  PHE A CB   8  
ATOM   7274  C  CG   . PHE A 1 14 ? -20.354 2.448   -1.313  1.00 0.00 ? 14  PHE A CG   8  
ATOM   7275  C  CD1  . PHE A 1 14 ? -20.398 1.063   -1.324  1.00 0.00 ? 14  PHE A CD1  8  
ATOM   7276  C  CD2  . PHE A 1 14 ? -20.684 3.135   -2.470  1.00 0.00 ? 14  PHE A CD2  8  
ATOM   7277  C  CE1  . PHE A 1 14 ? -20.763 0.377   -2.468  1.00 0.00 ? 14  PHE A CE1  8  
ATOM   7278  C  CE2  . PHE A 1 14 ? -21.050 2.454   -3.616  1.00 0.00 ? 14  PHE A CE2  8  
ATOM   7279  C  CZ   . PHE A 1 14 ? -21.091 1.074   -3.614  1.00 0.00 ? 14  PHE A CZ   8  
ATOM   7280  H  H    . PHE A 1 14 ? -18.872 3.866   2.155   1.00 0.00 ? 14  PHE A H    8  
ATOM   7281  H  HA   . PHE A 1 14 ? -18.069 2.181   -0.031  1.00 0.00 ? 14  PHE A HA   8  
ATOM   7282  H  HB2  . PHE A 1 14 ? -20.474 2.741   0.765   1.00 0.00 ? 14  PHE A HB2  8  
ATOM   7283  H  HB3  . PHE A 1 14 ? -20.276 4.216   -0.177  1.00 0.00 ? 14  PHE A HB3  8  
ATOM   7284  H  HD1  . PHE A 1 14 ? -20.144 0.517   -0.428  1.00 0.00 ? 14  PHE A HD1  8  
ATOM   7285  H  HD2  . PHE A 1 14 ? -20.653 4.215   -2.472  1.00 0.00 ? 14  PHE A HD2  8  
ATOM   7286  H  HE1  . PHE A 1 14 ? -20.795 -0.702  -2.464  1.00 0.00 ? 14  PHE A HE1  8  
ATOM   7287  H  HE2  . PHE A 1 14 ? -21.306 3.002   -4.511  1.00 0.00 ? 14  PHE A HE2  8  
ATOM   7288  H  HZ   . PHE A 1 14 ? -21.376 0.541   -4.509  1.00 0.00 ? 14  PHE A HZ   8  
ATOM   7289  N  N    . ILE A 1 15 ? -17.070 3.703   -1.716  1.00 0.00 ? 15  ILE A N    8  
ATOM   7290  C  CA   . ILE A 1 15 ? -16.352 4.577   -2.635  1.00 0.00 ? 15  ILE A CA   8  
ATOM   7291  C  C    . ILE A 1 15 ? -17.289 5.154   -3.690  1.00 0.00 ? 15  ILE A C    8  
ATOM   7292  O  O    . ILE A 1 15 ? -18.081 4.430   -4.294  1.00 0.00 ? 15  ILE A O    8  
ATOM   7293  C  CB   . ILE A 1 15 ? -15.202 3.831   -3.338  1.00 0.00 ? 15  ILE A CB   8  
ATOM   7294  C  CG1  . ILE A 1 15 ? -14.385 3.033   -2.321  1.00 0.00 ? 15  ILE A CG1  8  
ATOM   7295  C  CG2  . ILE A 1 15 ? -14.313 4.813   -4.087  1.00 0.00 ? 15  ILE A CG2  8  
ATOM   7296  C  CD1  . ILE A 1 15 ? -13.533 1.950   -2.945  1.00 0.00 ? 15  ILE A CD1  8  
ATOM   7297  H  H    . ILE A 1 15 ? -17.056 2.735   -1.867  1.00 0.00 ? 15  ILE A H    8  
ATOM   7298  H  HA   . ILE A 1 15 ? -15.929 5.389   -2.061  1.00 0.00 ? 15  ILE A HA   8  
ATOM   7299  H  HB   . ILE A 1 15 ? -15.632 3.151   -4.058  1.00 0.00 ? 15  ILE A HB   8  
ATOM   7300  H  HG12 . ILE A 1 15 ? -13.730 3.704   -1.788  1.00 0.00 ? 15  ILE A HG12 8  
ATOM   7301  H  HG13 . ILE A 1 15 ? -15.058 2.562   -1.619  1.00 0.00 ? 15  ILE A HG13 8  
ATOM   7302  H  HG21 . ILE A 1 15 ? -13.444 4.295   -4.465  1.00 0.00 ? 15  ILE A HG21 8  
ATOM   7303  H  HG22 . ILE A 1 15 ? -14.864 5.240   -4.911  1.00 0.00 ? 15  ILE A HG22 8  
ATOM   7304  H  HG23 . ILE A 1 15 ? -14.000 5.599   -3.416  1.00 0.00 ? 15  ILE A HG23 8  
ATOM   7305  H  HD11 . ILE A 1 15 ? -13.380 2.171   -3.991  1.00 0.00 ? 15  ILE A HD11 8  
ATOM   7306  H  HD12 . ILE A 1 15 ? -12.579 1.907   -2.442  1.00 0.00 ? 15  ILE A HD12 8  
ATOM   7307  H  HD13 . ILE A 1 15 ? -14.034 0.998   -2.849  1.00 0.00 ? 15  ILE A HD13 8  
ATOM   7308  N  N    . ILE A 1 16 ? -17.192 6.461   -3.908  1.00 0.00 ? 16  ILE A N    8  
ATOM   7309  C  CA   . ILE A 1 16 ? -18.029 7.135   -4.893  1.00 0.00 ? 16  ILE A CA   8  
ATOM   7310  C  C    . ILE A 1 16 ? -17.203 8.075   -5.765  1.00 0.00 ? 16  ILE A C    8  
ATOM   7311  O  O    . ILE A 1 16 ? -16.603 9.029   -5.272  1.00 0.00 ? 16  ILE A O    8  
ATOM   7312  C  CB   . ILE A 1 16 ? -19.157 7.938   -4.218  1.00 0.00 ? 16  ILE A CB   8  
ATOM   7313  C  CG1  . ILE A 1 16 ? -19.912 7.057   -3.221  1.00 0.00 ? 16  ILE A CG1  8  
ATOM   7314  C  CG2  . ILE A 1 16 ? -20.108 8.497   -5.265  1.00 0.00 ? 16  ILE A CG2  8  
ATOM   7315  C  CD1  . ILE A 1 16 ? -20.972 7.801   -2.438  1.00 0.00 ? 16  ILE A CD1  8  
ATOM   7316  H  H    . ILE A 1 16 ? -16.541 6.985   -3.395  1.00 0.00 ? 16  ILE A H    8  
ATOM   7317  H  HA   . ILE A 1 16 ? -18.478 6.380   -5.521  1.00 0.00 ? 16  ILE A HA   8  
ATOM   7318  H  HB   . ILE A 1 16 ? -18.712 8.767   -3.690  1.00 0.00 ? 16  ILE A HB   8  
ATOM   7319  H  HG12 . ILE A 1 16 ? -20.398 6.254   -3.754  1.00 0.00 ? 16  ILE A HG12 8  
ATOM   7320  H  HG13 . ILE A 1 16 ? -19.208 6.641   -2.514  1.00 0.00 ? 16  ILE A HG13 8  
ATOM   7321  H  HG21 . ILE A 1 16 ? -19.900 8.041   -6.221  1.00 0.00 ? 16  ILE A HG21 8  
ATOM   7322  H  HG22 . ILE A 1 16 ? -21.126 8.281   -4.978  1.00 0.00 ? 16  ILE A HG22 8  
ATOM   7323  H  HG23 . ILE A 1 16 ? -19.974 9.566   -5.339  1.00 0.00 ? 16  ILE A HG23 8  
ATOM   7324  H  HD11 . ILE A 1 16 ? -21.897 7.246   -2.465  1.00 0.00 ? 16  ILE A HD11 8  
ATOM   7325  H  HD12 . ILE A 1 16 ? -20.649 7.917   -1.414  1.00 0.00 ? 16  ILE A HD12 8  
ATOM   7326  H  HD13 . ILE A 1 16 ? -21.125 8.776   -2.879  1.00 0.00 ? 16  ILE A HD13 8  
ATOM   7327  N  N    . GLY A 1 17 ? -17.180 7.800   -7.065  1.00 0.00 ? 17  GLY A N    8  
ATOM   7328  C  CA   . GLY A 1 17 ? -16.427 8.631   -7.986  1.00 0.00 ? 17  GLY A CA   8  
ATOM   7329  C  C    . GLY A 1 17 ? -15.183 7.938   -8.508  1.00 0.00 ? 17  GLY A C    8  
ATOM   7330  O  O    . GLY A 1 17 ? -15.144 7.502   -9.658  1.00 0.00 ? 17  GLY A O    8  
ATOM   7331  H  H    . GLY A 1 17 ? -17.678 7.026   -7.402  1.00 0.00 ? 17  GLY A H    8  
ATOM   7332  H  HA2  . GLY A 1 17 ? -17.060 8.888   -8.822  1.00 0.00 ? 17  GLY A HA2  8  
ATOM   7333  H  HA3  . GLY A 1 17 ? -16.133 9.537   -7.478  1.00 0.00 ? 17  GLY A HA3  8  
ATOM   7334  N  N    . ARG A 1 18 ? -14.164 7.839   -7.661  1.00 0.00 ? 18  ARG A N    8  
ATOM   7335  C  CA   . ARG A 1 18 ? -12.912 7.197   -8.044  1.00 0.00 ? 18  ARG A CA   8  
ATOM   7336  C  C    . ARG A 1 18 ? -12.653 5.959   -7.191  1.00 0.00 ? 18  ARG A C    8  
ATOM   7337  O  O    . ARG A 1 18 ? -12.507 6.051   -5.972  1.00 0.00 ? 18  ARG A O    8  
ATOM   7338  C  CB   . ARG A 1 18 ? -11.748 8.179   -7.903  1.00 0.00 ? 18  ARG A CB   8  
ATOM   7339  C  CG   . ARG A 1 18 ? -10.382 7.513   -7.936  1.00 0.00 ? 18  ARG A CG   8  
ATOM   7340  C  CD   . ARG A 1 18 ? -9.317  8.451   -8.483  1.00 0.00 ? 18  ARG A CD   8  
ATOM   7341  N  NE   . ARG A 1 18 ? -8.218  7.724   -9.111  1.00 0.00 ? 18  ARG A NE   8  
ATOM   7342  C  CZ   . ARG A 1 18 ? -7.419  8.252   -10.032 1.00 0.00 ? 18  ARG A CZ   8  
ATOM   7343  N  NH1  . ARG A 1 18 ? -7.595  9.505   -10.428 1.00 0.00 ? 18  ARG A NH1  8  
ATOM   7344  N  NH2  . ARG A 1 18 ? -6.440  7.526   -10.557 1.00 0.00 ? 18  ARG A NH2  8  
ATOM   7345  H  H    . ARG A 1 18 ? -14.256 8.206   -6.757  1.00 0.00 ? 18  ARG A H    8  
ATOM   7346  H  HA   . ARG A 1 18 ? -12.996 6.897   -9.077  1.00 0.00 ? 18  ARG A HA   8  
ATOM   7347  H  HB2  . ARG A 1 18 ? -11.794 8.893   -8.713  1.00 0.00 ? 18  ARG A HB2  8  
ATOM   7348  H  HB3  . ARG A 1 18 ? -11.846 8.704   -6.965  1.00 0.00 ? 18  ARG A HB3  8  
ATOM   7349  H  HG2  . ARG A 1 18 ? -10.109 7.224   -6.931  1.00 0.00 ? 18  ARG A HG2  8  
ATOM   7350  H  HG3  . ARG A 1 18 ? -10.434 6.636   -8.564  1.00 0.00 ? 18  ARG A HG3  8  
ATOM   7351  H  HD2  . ARG A 1 18 ? -9.771  9.101   -9.215  1.00 0.00 ? 18  ARG A HD2  8  
ATOM   7352  H  HD3  . ARG A 1 18 ? -8.926  9.043   -7.669  1.00 0.00 ? 18  ARG A HD3  8  
ATOM   7353  H  HE   . ARG A 1 18 ? -8.069  6.796   -8.834  1.00 0.00 ? 18  ARG A HE   8  
ATOM   7354  H  HH11 . ARG A 1 18 ? -8.331  10.054  -10.033 1.00 0.00 ? 18  ARG A HH11 8  
ATOM   7355  H  HH12 . ARG A 1 18 ? -6.991  9.900   -11.120 1.00 0.00 ? 18  ARG A HH12 8  
ATOM   7356  H  HH21 . ARG A 1 18 ? -6.303  6.582   -10.261 1.00 0.00 ? 18  ARG A HH21 8  
ATOM   7357  H  HH22 . ARG A 1 18 ? -5.839  7.925   -11.250 1.00 0.00 ? 18  ARG A HH22 8  
ATOM   7358  N  N    . VAL A 1 19 ? -12.597 4.801   -7.840  1.00 0.00 ? 19  VAL A N    8  
ATOM   7359  C  CA   . VAL A 1 19 ? -12.355 3.544   -7.142  1.00 0.00 ? 19  VAL A CA   8  
ATOM   7360  C  C    . VAL A 1 19 ? -10.984 2.976   -7.492  1.00 0.00 ? 19  VAL A C    8  
ATOM   7361  O  O    . VAL A 1 19 ? -10.700 2.687   -8.655  1.00 0.00 ? 19  VAL A O    8  
ATOM   7362  C  CB   . VAL A 1 19 ? -13.434 2.497   -7.479  1.00 0.00 ? 19  VAL A CB   8  
ATOM   7363  C  CG1  . VAL A 1 19 ? -12.940 1.096   -7.153  1.00 0.00 ? 19  VAL A CG1  8  
ATOM   7364  C  CG2  . VAL A 1 19 ? -14.724 2.804   -6.733  1.00 0.00 ? 19  VAL A CG2  8  
ATOM   7365  H  H    . VAL A 1 19 ? -12.721 4.791   -8.812  1.00 0.00 ? 19  VAL A H    8  
ATOM   7366  H  HA   . VAL A 1 19 ? -12.392 3.739   -6.080  1.00 0.00 ? 19  VAL A HA   8  
ATOM   7367  H  HB   . VAL A 1 19 ? -13.635 2.546   -8.539  1.00 0.00 ? 19  VAL A HB   8  
ATOM   7368  H  HG11 . VAL A 1 19 ? -13.704 0.377   -7.408  1.00 0.00 ? 19  VAL A HG11 8  
ATOM   7369  H  HG12 . VAL A 1 19 ? -12.044 0.889   -7.720  1.00 0.00 ? 19  VAL A HG12 8  
ATOM   7370  H  HG13 . VAL A 1 19 ? -12.721 1.029   -6.097  1.00 0.00 ? 19  VAL A HG13 8  
ATOM   7371  H  HG21 . VAL A 1 19 ? -14.931 2.009   -6.032  1.00 0.00 ? 19  VAL A HG21 8  
ATOM   7372  H  HG22 . VAL A 1 19 ? -14.619 3.737   -6.199  1.00 0.00 ? 19  VAL A HG22 8  
ATOM   7373  H  HG23 . VAL A 1 19 ? -15.538 2.883   -7.439  1.00 0.00 ? 19  VAL A HG23 8  
ATOM   7374  N  N    . ILE A 1 20 ? -10.139 2.818   -6.480  1.00 0.00 ? 20  ILE A N    8  
ATOM   7375  C  CA   . ILE A 1 20 ? -8.798  2.282   -6.681  1.00 0.00 ? 20  ILE A CA   8  
ATOM   7376  C  C    . ILE A 1 20 ? -8.783  0.765   -6.527  1.00 0.00 ? 20  ILE A C    8  
ATOM   7377  O  O    . ILE A 1 20 ? -8.786  0.243   -5.412  1.00 0.00 ? 20  ILE A O    8  
ATOM   7378  C  CB   . ILE A 1 20 ? -7.792  2.898   -5.691  1.00 0.00 ? 20  ILE A CB   8  
ATOM   7379  C  CG1  . ILE A 1 20 ? -7.977  4.415   -5.619  1.00 0.00 ? 20  ILE A CG1  8  
ATOM   7380  C  CG2  . ILE A 1 20 ? -6.368  2.551   -6.099  1.00 0.00 ? 20  ILE A CG2  8  
ATOM   7381  C  CD1  . ILE A 1 20 ? -7.734  5.117   -6.937  1.00 0.00 ? 20  ILE A CD1  8  
ATOM   7382  H  H    . ILE A 1 20 ? -10.424 3.066   -5.576  1.00 0.00 ? 20  ILE A H    8  
ATOM   7383  H  HA   . ILE A 1 20 ? -8.486  2.534   -7.684  1.00 0.00 ? 20  ILE A HA   8  
ATOM   7384  H  HB   . ILE A 1 20 ? -7.974  2.473   -4.716  1.00 0.00 ? 20  ILE A HB   8  
ATOM   7385  H  HG12 . ILE A 1 20 ? -8.986  4.634   -5.309  1.00 0.00 ? 20  ILE A HG12 8  
ATOM   7386  H  HG13 . ILE A 1 20 ? -7.286  4.820   -4.894  1.00 0.00 ? 20  ILE A HG13 8  
ATOM   7387  H  HG21 . ILE A 1 20 ? -6.298  2.527   -7.177  1.00 0.00 ? 20  ILE A HG21 8  
ATOM   7388  H  HG22 . ILE A 1 20 ? -5.691  3.299   -5.713  1.00 0.00 ? 20  ILE A HG22 8  
ATOM   7389  H  HG23 . ILE A 1 20 ? -6.103  1.584   -5.699  1.00 0.00 ? 20  ILE A HG23 8  
ATOM   7390  H  HD11 . ILE A 1 20 ? -8.336  4.657   -7.706  1.00 0.00 ? 20  ILE A HD11 8  
ATOM   7391  H  HD12 . ILE A 1 20 ? -7.999  6.159   -6.845  1.00 0.00 ? 20  ILE A HD12 8  
ATOM   7392  H  HD13 . ILE A 1 20 ? -6.689  5.033   -7.201  1.00 0.00 ? 20  ILE A HD13 8  
ATOM   7393  N  N    . LYS A 1 21 ? -8.765  0.061   -7.654  1.00 0.00 ? 21  LYS A N    8  
ATOM   7394  C  CA   . LYS A 1 21 ? -8.746  -1.396  -7.646  1.00 0.00 ? 21  LYS A CA   8  
ATOM   7395  C  C    . LYS A 1 21 ? -7.345  -1.921  -7.349  1.00 0.00 ? 21  LYS A C    8  
ATOM   7396  O  O    . LYS A 1 21 ? -6.416  -1.711  -8.128  1.00 0.00 ? 21  LYS A O    8  
ATOM   7397  C  CB   . LYS A 1 21 ? -9.231  -1.941  -8.991  1.00 0.00 ? 21  LYS A CB   8  
ATOM   7398  C  CG   . LYS A 1 21 ? -10.737 -1.860  -9.172  1.00 0.00 ? 21  LYS A CG   8  
ATOM   7399  C  CD   . LYS A 1 21 ? -11.424 -3.131  -8.701  1.00 0.00 ? 21  LYS A CD   8  
ATOM   7400  C  CE   . LYS A 1 21 ? -12.852 -2.859  -8.252  1.00 0.00 ? 21  LYS A CE   8  
ATOM   7401  N  NZ   . LYS A 1 21 ? -13.821 -2.992  -9.375  1.00 0.00 ? 21  LYS A NZ   8  
ATOM   7402  H  H    . LYS A 1 21 ? -8.764  0.535   -8.512  1.00 0.00 ? 21  LYS A H    8  
ATOM   7403  H  HA   . LYS A 1 21 ? -9.415  -1.733  -6.868  1.00 0.00 ? 21  LYS A HA   8  
ATOM   7404  H  HB2  . LYS A 1 21 ? -8.764  -1.376  -9.784  1.00 0.00 ? 21  LYS A HB2  8  
ATOM   7405  H  HB3  . LYS A 1 21 ? -8.935  -2.976  -9.075  1.00 0.00 ? 21  LYS A HB3  8  
ATOM   7406  H  HG2  . LYS A 1 21 ? -11.116 -1.026  -8.600  1.00 0.00 ? 21  LYS A HG2  8  
ATOM   7407  H  HG3  . LYS A 1 21 ? -10.957 -1.710  -10.220 1.00 0.00 ? 21  LYS A HG3  8  
ATOM   7408  H  HD2  . LYS A 1 21 ? -11.444 -3.842  -9.513  1.00 0.00 ? 21  LYS A HD2  8  
ATOM   7409  H  HD3  . LYS A 1 21 ? -10.868 -3.544  -7.871  1.00 0.00 ? 21  LYS A HD3  8  
ATOM   7410  H  HE2  . LYS A 1 21 ? -13.113 -3.564  -7.477  1.00 0.00 ? 21  LYS A HE2  8  
ATOM   7411  H  HE3  . LYS A 1 21 ? -12.906 -1.855  -7.858  1.00 0.00 ? 21  LYS A HE3  8  
ATOM   7412  H  HZ1  . LYS A 1 21 ? -14.330 -3.897  -9.302  1.00 0.00 ? 21  LYS A HZ1  8  
ATOM   7413  H  HZ2  . LYS A 1 21 ? -13.320 -2.963  -10.285 1.00 0.00 ? 21  LYS A HZ2  8  
ATOM   7414  H  HZ3  . LYS A 1 21 ? -14.511 -2.215  -9.346  1.00 0.00 ? 21  LYS A HZ3  8  
ATOM   7415  N  N    . ALA A 1 22 ? -7.201  -2.604  -6.218  1.00 0.00 ? 22  ALA A N    8  
ATOM   7416  C  CA   . ALA A 1 22 ? -5.914  -3.161  -5.821  1.00 0.00 ? 22  ALA A CA   8  
ATOM   7417  C  C    . ALA A 1 22 ? -6.096  -4.373  -4.914  1.00 0.00 ? 22  ALA A C    8  
ATOM   7418  O  O    . ALA A 1 22 ? -7.173  -4.587  -4.358  1.00 0.00 ? 22  ALA A O    8  
ATOM   7419  C  CB   . ALA A 1 22 ? -5.072  -2.101  -5.126  1.00 0.00 ? 22  ALA A CB   8  
ATOM   7420  H  H    . ALA A 1 22 ? -7.979  -2.738  -5.638  1.00 0.00 ? 22  ALA A H    8  
ATOM   7421  H  HA   . ALA A 1 22 ? -5.393  -3.469  -6.716  1.00 0.00 ? 22  ALA A HA   8  
ATOM   7422  H  HB1  . ALA A 1 22 ? -4.343  -2.582  -4.490  1.00 0.00 ? 22  ALA A HB1  8  
ATOM   7423  H  HB2  . ALA A 1 22 ? -4.564  -1.502  -5.867  1.00 0.00 ? 22  ALA A HB2  8  
ATOM   7424  H  HB3  . ALA A 1 22 ? -5.711  -1.470  -4.527  1.00 0.00 ? 22  ALA A HB3  8  
ATOM   7425  N  N    . MET A 1 23 ? -5.038  -5.163  -4.769  1.00 0.00 ? 23  MET A N    8  
ATOM   7426  C  CA   . MET A 1 23 ? -5.082  -6.353  -3.928  1.00 0.00 ? 23  MET A CA   8  
ATOM   7427  C  C    . MET A 1 23 ? -6.393  -7.109  -4.124  1.00 0.00 ? 23  MET A C    8  
ATOM   7428  O  O    . MET A 1 23 ? -6.885  -7.764  -3.207  1.00 0.00 ? 23  MET A O    8  
ATOM   7429  C  CB   . MET A 1 23 ? -4.916  -5.971  -2.456  1.00 0.00 ? 23  MET A CB   8  
ATOM   7430  C  CG   . MET A 1 23 ? -3.706  -5.091  -2.189  1.00 0.00 ? 23  MET A CG   8  
ATOM   7431  S  SD   . MET A 1 23 ? -3.546  -4.638  -0.451  1.00 0.00 ? 23  MET A SD   8  
ATOM   7432  C  CE   . MET A 1 23 ? -2.041  -5.505  -0.013  1.00 0.00 ? 23  MET A CE   8  
ATOM   7433  H  H    . MET A 1 23 ? -4.206  -4.940  -5.237  1.00 0.00 ? 23  MET A H    8  
ATOM   7434  H  HA   . MET A 1 23 ? -4.263  -6.995  -4.218  1.00 0.00 ? 23  MET A HA   8  
ATOM   7435  H  HB2  . MET A 1 23 ? -5.799  -5.439  -2.133  1.00 0.00 ? 23  MET A HB2  8  
ATOM   7436  H  HB3  . MET A 1 23 ? -4.814  -6.872  -1.871  1.00 0.00 ? 23  MET A HB3  8  
ATOM   7437  H  HG2  . MET A 1 23 ? -2.816  -5.624  -2.490  1.00 0.00 ? 23  MET A HG2  8  
ATOM   7438  H  HG3  . MET A 1 23 ? -3.798  -4.189  -2.775  1.00 0.00 ? 23  MET A HG3  8  
ATOM   7439  H  HE1  . MET A 1 23 ? -1.977  -6.424  -0.576  1.00 0.00 ? 23  MET A HE1  8  
ATOM   7440  H  HE2  . MET A 1 23 ? -1.188  -4.883  -0.241  1.00 0.00 ? 23  MET A HE2  8  
ATOM   7441  H  HE3  . MET A 1 23 ? -2.051  -5.730  1.044   1.00 0.00 ? 23  MET A HE3  8  
ATOM   7442  N  N    . ASN A 1 24 ? -6.952  -7.012  -5.326  1.00 0.00 ? 24  ASN A N    8  
ATOM   7443  C  CA   . ASN A 1 24 ? -8.206  -7.686  -5.642  1.00 0.00 ? 24  ASN A CA   8  
ATOM   7444  C  C    . ASN A 1 24 ? -9.353  -7.120  -4.810  1.00 0.00 ? 24  ASN A C    8  
ATOM   7445  O  O    . ASN A 1 24 ? -10.198 -7.862  -4.313  1.00 0.00 ? 24  ASN A O    8  
ATOM   7446  C  CB   . ASN A 1 24 ? -8.077  -9.191  -5.395  1.00 0.00 ? 24  ASN A CB   8  
ATOM   7447  C  CG   . ASN A 1 24 ? -9.201  -9.980  -6.036  1.00 0.00 ? 24  ASN A CG   8  
ATOM   7448  O  OD1  . ASN A 1 24 ? -10.135 -9.408  -6.598  1.00 0.00 ? 24  ASN A OD1  8  
ATOM   7449  N  ND2  . ASN A 1 24 ? -9.117  -11.303 -5.955  1.00 0.00 ? 24  ASN A ND2  8  
ATOM   7450  H  H    . ASN A 1 24 ? -6.511  -6.475  -6.017  1.00 0.00 ? 24  ASN A H    8  
ATOM   7451  H  HA   . ASN A 1 24 ? -8.418  -7.519  -6.687  1.00 0.00 ? 24  ASN A HA   8  
ATOM   7452  H  HB2  . ASN A 1 24 ? -7.140  -9.538  -5.806  1.00 0.00 ? 24  ASN A HB2  8  
ATOM   7453  H  HB3  . ASN A 1 24 ? -8.090  -9.378  -4.332  1.00 0.00 ? 24  ASN A HB3  8  
ATOM   7454  H  HD21 . ASN A 1 24 ? -8.344  -11.690 -5.492  1.00 0.00 ? 24  ASN A HD21 8  
ATOM   7455  H  HD22 . ASN A 1 24 ? -9.830  -11.838 -6.361  1.00 0.00 ? 24  ASN A HD22 8  
ATOM   7456  N  N    . ASN A 1 25 ? -9.374  -5.799  -4.664  1.00 0.00 ? 25  ASN A N    8  
ATOM   7457  C  CA   . ASN A 1 25 ? -10.417 -5.132  -3.893  1.00 0.00 ? 25  ASN A CA   8  
ATOM   7458  C  C    . ASN A 1 25 ? -10.450 -3.638  -4.200  1.00 0.00 ? 25  ASN A C    8  
ATOM   7459  O  O    . ASN A 1 25 ? -9.485  -3.080  -4.723  1.00 0.00 ? 25  ASN A O    8  
ATOM   7460  C  CB   . ASN A 1 25 ? -10.192 -5.351  -2.395  1.00 0.00 ? 25  ASN A CB   8  
ATOM   7461  C  CG   . ASN A 1 25 ? -10.584 -6.747  -1.950  1.00 0.00 ? 25  ASN A CG   8  
ATOM   7462  O  OD1  . ASN A 1 25 ? -11.762 -7.035  -1.737  1.00 0.00 ? 25  ASN A OD1  8  
ATOM   7463  N  ND2  . ASN A 1 25 ? -9.595  -7.622  -1.807  1.00 0.00 ? 25  ASN A ND2  8  
ATOM   7464  H  H    . ASN A 1 25 ? -8.672  -5.259  -5.085  1.00 0.00 ? 25  ASN A H    8  
ATOM   7465  H  HA   . ASN A 1 25 ? -11.365 -5.566  -4.173  1.00 0.00 ? 25  ASN A HA   8  
ATOM   7466  H  HB2  . ASN A 1 25 ? -9.146  -5.203  -2.169  1.00 0.00 ? 25  ASN A HB2  8  
ATOM   7467  H  HB3  . ASN A 1 25 ? -10.780 -4.637  -1.840  1.00 0.00 ? 25  ASN A HB3  8  
ATOM   7468  H  HD21 . ASN A 1 25 ? -8.680  -7.322  -1.994  1.00 0.00 ? 25  ASN A HD21 8  
ATOM   7469  H  HD22 . ASN A 1 25 ? -9.820  -8.531  -1.521  1.00 0.00 ? 25  ASN A HD22 8  
ATOM   7470  N  N    . SER A 1 26 ? -11.566 -2.996  -3.871  1.00 0.00 ? 26  SER A N    8  
ATOM   7471  C  CA   . SER A 1 26 ? -11.726 -1.567  -4.114  1.00 0.00 ? 26  SER A CA   8  
ATOM   7472  C  C    . SER A 1 26 ? -11.255 -0.755  -2.912  1.00 0.00 ? 26  SER A C    8  
ATOM   7473  O  O    . SER A 1 26 ? -11.426 -1.168  -1.765  1.00 0.00 ? 26  SER A O    8  
ATOM   7474  C  CB   . SER A 1 26 ? -13.189 -1.242  -4.422  1.00 0.00 ? 26  SER A CB   8  
ATOM   7475  O  OG   . SER A 1 26 ? -14.031 -1.605  -3.341  1.00 0.00 ? 26  SER A OG   8  
ATOM   7476  H  H    . SER A 1 26 ? -12.300 -3.496  -3.457  1.00 0.00 ? 26  SER A H    8  
ATOM   7477  H  HA   . SER A 1 26 ? -11.121 -1.307  -4.969  1.00 0.00 ? 26  SER A HA   8  
ATOM   7478  H  HB2  . SER A 1 26 ? -13.290 -0.182  -4.600  1.00 0.00 ? 26  SER A HB2  8  
ATOM   7479  H  HB3  . SER A 1 26 ? -13.498 -1.786  -5.303  1.00 0.00 ? 26  SER A HB3  8  
ATOM   7480  H  HG   . SER A 1 26 ? -13.980 -2.554  -3.201  1.00 0.00 ? 26  SER A HG   8  
ATOM   7481  N  N    . TRP A 1 27 ? -10.660 0.401   -3.183  1.00 0.00 ? 27  TRP A N    8  
ATOM   7482  C  CA   . TRP A 1 27 ? -10.163 1.272   -2.124  1.00 0.00 ? 27  TRP A CA   8  
ATOM   7483  C  C    . TRP A 1 27 ? -10.276 2.738   -2.527  1.00 0.00 ? 27  TRP A C    8  
ATOM   7484  O  O    . TRP A 1 27 ? -10.590 3.054   -3.675  1.00 0.00 ? 27  TRP A O    8  
ATOM   7485  C  CB   . TRP A 1 27 ? -8.709  0.931   -1.796  1.00 0.00 ? 27  TRP A CB   8  
ATOM   7486  C  CG   . TRP A 1 27 ? -8.430  -0.541  -1.794  1.00 0.00 ? 27  TRP A CG   8  
ATOM   7487  C  CD1  . TRP A 1 27 ? -8.657  -1.420  -2.814  1.00 0.00 ? 27  TRP A CD1  8  
ATOM   7488  C  CD2  . TRP A 1 27 ? -7.873  -1.306  -0.719  1.00 0.00 ? 27  TRP A CD2  8  
ATOM   7489  N  NE1  . TRP A 1 27 ? -8.275  -2.686  -2.438  1.00 0.00 ? 27  TRP A NE1  8  
ATOM   7490  C  CE2  . TRP A 1 27 ? -7.790  -2.642  -1.158  1.00 0.00 ? 27  TRP A CE2  8  
ATOM   7491  C  CE3  . TRP A 1 27 ? -7.434  -0.993  0.570   1.00 0.00 ? 27  TRP A CE3  8  
ATOM   7492  C  CZ2  . TRP A 1 27 ? -7.288  -3.661  -0.352  1.00 0.00 ? 27  TRP A CZ2  8  
ATOM   7493  C  CZ3  . TRP A 1 27 ? -6.936  -2.005  1.369   1.00 0.00 ? 27  TRP A CZ3  8  
ATOM   7494  C  CH2  . TRP A 1 27 ? -6.865  -3.325  0.905   1.00 0.00 ? 27  TRP A CH2  8  
ATOM   7495  H  H    . TRP A 1 27 ? -10.552 0.676   -4.118  1.00 0.00 ? 27  TRP A H    8  
ATOM   7496  H  HA   . TRP A 1 27 ? -10.770 1.104   -1.246  1.00 0.00 ? 27  TRP A HA   8  
ATOM   7497  H  HB2  . TRP A 1 27 ? -8.063  1.392   -2.528  1.00 0.00 ? 27  TRP A HB2  8  
ATOM   7498  H  HB3  . TRP A 1 27 ? -8.469  1.318   -0.816  1.00 0.00 ? 27  TRP A HB3  8  
ATOM   7499  H  HD1  . TRP A 1 27 ? -9.078  -1.147  -3.769  1.00 0.00 ? 27  TRP A HD1  8  
ATOM   7500  H  HE1  . TRP A 1 27 ? -8.339  -3.488  -2.998  1.00 0.00 ? 27  TRP A HE1  8  
ATOM   7501  H  HE3  . TRP A 1 27 ? -7.480  0.019   0.945   1.00 0.00 ? 27  TRP A HE3  8  
ATOM   7502  H  HZ2  . TRP A 1 27 ? -7.226  -4.683  -0.695  1.00 0.00 ? 27  TRP A HZ2  8  
ATOM   7503  H  HZ3  . TRP A 1 27 ? -6.593  -1.782  2.368   1.00 0.00 ? 27  TRP A HZ3  8  
ATOM   7504  H  HH2  . TRP A 1 27 ? -6.470  -4.083  1.563   1.00 0.00 ? 27  TRP A HH2  8  
ATOM   7505  N  N    . HIS A 1 28 ? -10.018 3.630   -1.577  1.00 0.00 ? 28  HIS A N    8  
ATOM   7506  C  CA   . HIS A 1 28 ? -10.090 5.064   -1.834  1.00 0.00 ? 28  HIS A CA   8  
ATOM   7507  C  C    . HIS A 1 28 ? -8.759  5.589   -2.364  1.00 0.00 ? 28  HIS A C    8  
ATOM   7508  O  O    . HIS A 1 28 ? -7.701  4.996   -2.151  1.00 0.00 ? 28  HIS A O    8  
ATOM   7509  C  CB   . HIS A 1 28 ? -10.476 5.814   -0.559  1.00 0.00 ? 28  HIS A CB   8  
ATOM   7510  C  CG   . HIS A 1 28 ? -11.924 5.680   -0.199  1.00 0.00 ? 28  HIS A CG   8  
ATOM   7511  N  ND1  . HIS A 1 28 ? -12.355 5.153   1.000   1.00 0.00 ? 28  HIS A ND1  8  
ATOM   7512  C  CD2  . HIS A 1 28 ? -13.041 6.008   -0.888  1.00 0.00 ? 28  HIS A CD2  8  
ATOM   7513  C  CE1  . HIS A 1 28 ? -13.676 5.162   1.032   1.00 0.00 ? 28  HIS A CE1  8  
ATOM   7514  N  NE2  . HIS A 1 28 ? -14.117 5.677   -0.102  1.00 0.00 ? 28  HIS A NE2  8  
ATOM   7515  H  H    . HIS A 1 28 ? -9.773  3.317   -0.681  1.00 0.00 ? 28  HIS A H    8  
ATOM   7516  H  HA   . HIS A 1 28 ? -10.851 5.229   -2.582  1.00 0.00 ? 28  HIS A HA   8  
ATOM   7517  H  HB2  . HIS A 1 28 ? -9.893  5.432   0.266   1.00 0.00 ? 28  HIS A HB2  8  
ATOM   7518  H  HB3  . HIS A 1 28 ? -10.262 6.865   -0.688  1.00 0.00 ? 28  HIS A HB3  8  
ATOM   7519  H  HD2  . HIS A 1 28 ? -13.081 6.449   -1.874  1.00 0.00 ? 28  HIS A HD2  8  
ATOM   7520  H  HE1  . HIS A 1 28 ? -14.291 4.810   1.846   1.00 0.00 ? 28  HIS A HE1  8  
ATOM   7521  H  HE2  . HIS A 1 28 ? -15.057 5.720   -0.373  1.00 0.00 ? 28  HIS A HE2  8  
ATOM   7522  N  N    . PRO A 1 29 ? -8.811  6.727   -3.072  1.00 0.00 ? 29  PRO A N    8  
ATOM   7523  C  CA   . PRO A 1 29 ? -7.618  7.356   -3.647  1.00 0.00 ? 29  PRO A CA   8  
ATOM   7524  C  C    . PRO A 1 29 ? -6.702  7.946   -2.580  1.00 0.00 ? 29  PRO A C    8  
ATOM   7525  O  O    . PRO A 1 29 ? -5.641  8.487   -2.891  1.00 0.00 ? 29  PRO A O    8  
ATOM   7526  C  CB   . PRO A 1 29 ? -8.193  8.465   -4.531  1.00 0.00 ? 29  PRO A CB   8  
ATOM   7527  C  CG   . PRO A 1 29 ? -9.518  8.782   -3.927  1.00 0.00 ? 29  PRO A CG   8  
ATOM   7528  C  CD   . PRO A 1 29 ? -10.037 7.488   -3.365  1.00 0.00 ? 29  PRO A CD   8  
ATOM   7529  H  HA   . PRO A 1 29 ? -7.058  6.662   -4.257  1.00 0.00 ? 29  PRO A HA   8  
ATOM   7530  H  HB2  . PRO A 1 29 ? -7.534  9.322   -4.512  1.00 0.00 ? 29  PRO A HB2  8  
ATOM   7531  H  HB3  . PRO A 1 29 ? -8.297  8.106   -5.544  1.00 0.00 ? 29  PRO A HB3  8  
ATOM   7532  H  HG2  . PRO A 1 29 ? -9.398  9.511   -3.141  1.00 0.00 ? 29  PRO A HG2  8  
ATOM   7533  H  HG3  . PRO A 1 29 ? -10.188 9.155   -4.688  1.00 0.00 ? 29  PRO A HG3  8  
ATOM   7534  H  HD2  . PRO A 1 29 ? -10.604 7.668   -2.464  1.00 0.00 ? 29  PRO A HD2  8  
ATOM   7535  H  HD3  . PRO A 1 29 ? -10.642 6.974   -4.097  1.00 0.00 ? 29  PRO A HD3  8  
ATOM   7536  N  N    . GLU A 1 30 ? -7.119  7.838   -1.323  1.00 0.00 ? 30  GLU A N    8  
ATOM   7537  C  CA   . GLU A 1 30 ? -6.335  8.361   -0.211  1.00 0.00 ? 30  GLU A CA   8  
ATOM   7538  C  C    . GLU A 1 30 ? -6.001  7.257   0.788   1.00 0.00 ? 30  GLU A C    8  
ATOM   7539  O  O    . GLU A 1 30 ? -4.932  7.259   1.399   1.00 0.00 ? 30  GLU A O    8  
ATOM   7540  C  CB   . GLU A 1 30 ? -7.096  9.487   0.493   1.00 0.00 ? 30  GLU A CB   8  
ATOM   7541  C  CG   . GLU A 1 30 ? -8.320  9.009   1.257   1.00 0.00 ? 30  GLU A CG   8  
ATOM   7542  C  CD   . GLU A 1 30 ? -9.341  10.110  1.471   1.00 0.00 ? 30  GLU A CD   8  
ATOM   7543  O  OE1  . GLU A 1 30 ? -8.964  11.171  2.012   1.00 0.00 ? 30  GLU A OE1  8  
ATOM   7544  O  OE2  . GLU A 1 30 ? -10.515 9.911   1.097   1.00 0.00 ? 30  GLU A OE2  8  
ATOM   7545  H  H    . GLU A 1 30 ? -7.974  7.396   -1.139  1.00 0.00 ? 30  GLU A H    8  
ATOM   7546  H  HA   . GLU A 1 30 ? -5.415  8.758   -0.611  1.00 0.00 ? 30  GLU A HA   8  
ATOM   7547  H  HB2  . GLU A 1 30 ? -6.430  9.975   1.189   1.00 0.00 ? 30  GLU A HB2  8  
ATOM   7548  H  HB3  . GLU A 1 30 ? -7.418  10.205  -0.247  1.00 0.00 ? 30  GLU A HB3  8  
ATOM   7549  H  HG2  . GLU A 1 30 ? -8.786  8.210   0.702   1.00 0.00 ? 30  GLU A HG2  8  
ATOM   7550  H  HG3  . GLU A 1 30 ? -8.004  8.639   2.222   1.00 0.00 ? 30  GLU A HG3  8  
ATOM   7551  N  N    . CYS A 1 31 ? -6.924  6.314   0.948   1.00 0.00 ? 31  CYS A N    8  
ATOM   7552  C  CA   . CYS A 1 31 ? -6.730  5.203   1.872   1.00 0.00 ? 31  CYS A CA   8  
ATOM   7553  C  C    . CYS A 1 31 ? -5.545  4.340   1.445   1.00 0.00 ? 31  CYS A C    8  
ATOM   7554  O  O    . CYS A 1 31 ? -4.576  4.186   2.188   1.00 0.00 ? 31  CYS A O    8  
ATOM   7555  C  CB   . CYS A 1 31 ? -7.996  4.348   1.948   1.00 0.00 ? 31  CYS A CB   8  
ATOM   7556  S  SG   . CYS A 1 31 ? -9.281  5.019   3.052   1.00 0.00 ? 31  CYS A SG   8  
ATOM   7557  H  H    . CYS A 1 31 ? -7.756  6.366   0.432   1.00 0.00 ? 31  CYS A H    8  
ATOM   7558  H  HA   . CYS A 1 31 ? -6.525  5.615   2.849   1.00 0.00 ? 31  CYS A HA   8  
ATOM   7559  H  HB2  . CYS A 1 31 ? -8.424  4.264   0.959   1.00 0.00 ? 31  CYS A HB2  8  
ATOM   7560  H  HB3  . CYS A 1 31 ? -7.736  3.363   2.306   1.00 0.00 ? 31  CYS A HB3  8  
ATOM   7561  N  N    . PHE A 1 32 ? -5.631  3.781   0.242   1.00 0.00 ? 32  PHE A N    8  
ATOM   7562  C  CA   . PHE A 1 32 ? -4.568  2.934   -0.284  1.00 0.00 ? 32  PHE A CA   8  
ATOM   7563  C  C    . PHE A 1 32 ? -3.218  3.641   -0.202  1.00 0.00 ? 32  PHE A C    8  
ATOM   7564  O  O    . PHE A 1 32 ? -2.838  4.382   -1.109  1.00 0.00 ? 32  PHE A O    8  
ATOM   7565  C  CB   . PHE A 1 32 ? -4.866  2.547   -1.734  1.00 0.00 ? 32  PHE A CB   8  
ATOM   7566  C  CG   . PHE A 1 32 ? -4.087  1.353   -2.208  1.00 0.00 ? 32  PHE A CG   8  
ATOM   7567  C  CD1  . PHE A 1 32 ? -4.056  0.188   -1.460  1.00 0.00 ? 32  PHE A CD1  8  
ATOM   7568  C  CD2  . PHE A 1 32 ? -3.386  1.397   -3.402  1.00 0.00 ? 32  PHE A CD2  8  
ATOM   7569  C  CE1  . PHE A 1 32 ? -3.339  -0.911  -1.894  1.00 0.00 ? 32  PHE A CE1  8  
ATOM   7570  C  CE2  . PHE A 1 32 ? -2.667  0.301   -3.842  1.00 0.00 ? 32  PHE A CE2  8  
ATOM   7571  C  CZ   . PHE A 1 32 ? -2.645  -0.855  -3.087  1.00 0.00 ? 32  PHE A CZ   8  
ATOM   7572  H  H    . PHE A 1 32 ? -6.429  3.942   -0.304  1.00 0.00 ? 32  PHE A H    8  
ATOM   7573  H  HA   . PHE A 1 32 ? -4.529  2.039   0.318   1.00 0.00 ? 32  PHE A HA   8  
ATOM   7574  H  HB2  . PHE A 1 32 ? -5.916  2.315   -1.828  1.00 0.00 ? 32  PHE A HB2  8  
ATOM   7575  H  HB3  . PHE A 1 32 ? -4.626  3.379   -2.378  1.00 0.00 ? 32  PHE A HB3  8  
ATOM   7576  H  HD1  . PHE A 1 32 ? -4.599  0.141   -0.528  1.00 0.00 ? 32  PHE A HD1  8  
ATOM   7577  H  HD2  . PHE A 1 32 ? -3.403  2.302   -3.994  1.00 0.00 ? 32  PHE A HD2  8  
ATOM   7578  H  HE1  . PHE A 1 32 ? -3.323  -1.814  -1.302  1.00 0.00 ? 32  PHE A HE1  8  
ATOM   7579  H  HE2  . PHE A 1 32 ? -2.126  0.349   -4.775  1.00 0.00 ? 32  PHE A HE2  8  
ATOM   7580  H  HZ   . PHE A 1 32 ? -2.083  -1.712  -3.428  1.00 0.00 ? 32  PHE A HZ   8  
ATOM   7581  N  N    . ARG A 1 33 ? -2.499  3.406   0.890   1.00 0.00 ? 33  ARG A N    8  
ATOM   7582  C  CA   . ARG A 1 33 ? -1.193  4.021   1.092   1.00 0.00 ? 33  ARG A CA   8  
ATOM   7583  C  C    . ARG A 1 33 ? -0.119  2.959   1.305   1.00 0.00 ? 33  ARG A C    8  
ATOM   7584  O  O    . ARG A 1 33 ? -0.425  1.790   1.542   1.00 0.00 ? 33  ARG A O    8  
ATOM   7585  C  CB   . ARG A 1 33 ? -1.232  4.969   2.292   1.00 0.00 ? 33  ARG A CB   8  
ATOM   7586  C  CG   . ARG A 1 33 ? -2.051  6.226   2.049   1.00 0.00 ? 33  ARG A CG   8  
ATOM   7587  C  CD   . ARG A 1 33 ? -1.746  7.299   3.083   1.00 0.00 ? 33  ARG A CD   8  
ATOM   7588  N  NE   . ARG A 1 33 ? -1.882  8.645   2.532   1.00 0.00 ? 33  ARG A NE   8  
ATOM   7589  C  CZ   . ARG A 1 33 ? -3.010  9.344   2.571   1.00 0.00 ? 33  ARG A CZ   8  
ATOM   7590  N  NH1  . ARG A 1 33 ? -4.095  8.828   3.133   1.00 0.00 ? 33  ARG A NH1  8  
ATOM   7591  N  NH2  . ARG A 1 33 ? -3.055  10.563  2.048   1.00 0.00 ? 33  ARG A NH2  8  
ATOM   7592  H  H    . ARG A 1 33 ? -2.856  2.806   1.578   1.00 0.00 ? 33  ARG A H    8  
ATOM   7593  H  HA   . ARG A 1 33 ? -0.952  4.588   0.205   1.00 0.00 ? 33  ARG A HA   8  
ATOM   7594  H  HB2  . ARG A 1 33 ? -1.658  4.446   3.136   1.00 0.00 ? 33  ARG A HB2  8  
ATOM   7595  H  HB3  . ARG A 1 33 ? -0.222  5.265   2.535   1.00 0.00 ? 33  ARG A HB3  8  
ATOM   7596  H  HG2  . ARG A 1 33 ? -1.819  6.612   1.068   1.00 0.00 ? 33  ARG A HG2  8  
ATOM   7597  H  HG3  . ARG A 1 33 ? -3.100  5.976   2.101   1.00 0.00 ? 33  ARG A HG3  8  
ATOM   7598  H  HD2  . ARG A 1 33 ? -2.431  7.188   3.910   1.00 0.00 ? 33  ARG A HD2  8  
ATOM   7599  H  HD3  . ARG A 1 33 ? -0.734  7.164   3.434   1.00 0.00 ? 33  ARG A HD3  8  
ATOM   7600  H  HE   . ARG A 1 33 ? -1.092  9.045   2.112   1.00 0.00 ? 33  ARG A HE   8  
ATOM   7601  H  HH11 . ARG A 1 33 ? -4.064  7.911   3.528   1.00 0.00 ? 33  ARG A HH11 8  
ATOM   7602  H  HH12 . ARG A 1 33 ? -4.943  9.357   3.162   1.00 0.00 ? 33  ARG A HH12 8  
ATOM   7603  H  HH21 . ARG A 1 33 ? -2.240  10.955  1.624   1.00 0.00 ? 33  ARG A HH21 8  
ATOM   7604  H  HH22 . ARG A 1 33 ? -3.905  11.088  2.078   1.00 0.00 ? 33  ARG A HH22 8  
ATOM   7605  N  N    . CYS A 1 34 ? 1.141   3.373   1.217   1.00 0.00 ? 34  CYS A N    8  
ATOM   7606  C  CA   . CYS A 1 34 ? 2.262   2.458   1.398   1.00 0.00 ? 34  CYS A CA   8  
ATOM   7607  C  C    . CYS A 1 34 ? 2.241   1.842   2.794   1.00 0.00 ? 34  CYS A C    8  
ATOM   7608  O  O    . CYS A 1 34 ? 1.514   2.301   3.676   1.00 0.00 ? 34  CYS A O    8  
ATOM   7609  C  CB   . CYS A 1 34 ? 3.586   3.189   1.172   1.00 0.00 ? 34  CYS A CB   8  
ATOM   7610  S  SG   . CYS A 1 34 ? 5.020   2.084   0.966   1.00 0.00 ? 34  CYS A SG   8  
ATOM   7611  H  H    . CYS A 1 34 ? 1.322   4.318   1.026   1.00 0.00 ? 34  CYS A H    8  
ATOM   7612  H  HA   . CYS A 1 34 ? 2.167   1.668   0.669   1.00 0.00 ? 34  CYS A HA   8  
ATOM   7613  H  HB2  . CYS A 1 34 ? 3.507   3.793   0.279   1.00 0.00 ? 34  CYS A HB2  8  
ATOM   7614  H  HB3  . CYS A 1 34 ? 3.784   3.831   2.017   1.00 0.00 ? 34  CYS A HB3  8  
ATOM   7615  N  N    . ASP A 1 35 ? 3.042   0.800   2.987   1.00 0.00 ? 35  ASP A N    8  
ATOM   7616  C  CA   . ASP A 1 35 ? 3.117   0.121   4.276   1.00 0.00 ? 35  ASP A CA   8  
ATOM   7617  C  C    . ASP A 1 35 ? 4.418   0.464   4.995   1.00 0.00 ? 35  ASP A C    8  
ATOM   7618  O  O    . ASP A 1 35 ? 4.677   -0.022  6.097   1.00 0.00 ? 35  ASP A O    8  
ATOM   7619  C  CB   . ASP A 1 35 ? 3.008   -1.392  4.086   1.00 0.00 ? 35  ASP A CB   8  
ATOM   7620  C  CG   . ASP A 1 35 ? 2.694   -2.117  5.380   1.00 0.00 ? 35  ASP A CG   8  
ATOM   7621  O  OD1  . ASP A 1 35 ? 3.614   -2.272  6.211   1.00 0.00 ? 35  ASP A OD1  8  
ATOM   7622  O  OD2  . ASP A 1 35 ? 1.529   -2.529  5.563   1.00 0.00 ? 35  ASP A OD2  8  
ATOM   7623  H  H    . ASP A 1 35 ? 3.597   0.480   2.245   1.00 0.00 ? 35  ASP A H    8  
ATOM   7624  H  HA   . ASP A 1 35 ? 2.288   0.460   4.878   1.00 0.00 ? 35  ASP A HA   8  
ATOM   7625  H  HB2  . ASP A 1 35 ? 2.221   -1.604  3.377   1.00 0.00 ? 35  ASP A HB2  8  
ATOM   7626  H  HB3  . ASP A 1 35 ? 3.944   -1.769  3.702   1.00 0.00 ? 35  ASP A HB3  8  
ATOM   7627  N  N    . LEU A 1 36 ? 5.233   1.302   4.365   1.00 0.00 ? 36  LEU A N    8  
ATOM   7628  C  CA   . LEU A 1 36 ? 6.509   1.710   4.945   1.00 0.00 ? 36  LEU A CA   8  
ATOM   7629  C  C    . LEU A 1 36 ? 6.591   3.228   5.069   1.00 0.00 ? 36  LEU A C    8  
ATOM   7630  O  O    . LEU A 1 36 ? 7.206   3.753   5.996   1.00 0.00 ? 36  LEU A O    8  
ATOM   7631  C  CB   . LEU A 1 36 ? 7.668   1.193   4.090   1.00 0.00 ? 36  LEU A CB   8  
ATOM   7632  C  CG   . LEU A 1 36 ? 7.874   -0.322  4.085   1.00 0.00 ? 36  LEU A CG   8  
ATOM   7633  C  CD1  . LEU A 1 36 ? 8.459   -0.777  2.757   1.00 0.00 ? 36  LEU A CD1  8  
ATOM   7634  C  CD2  . LEU A 1 36 ? 8.775   -0.741  5.238   1.00 0.00 ? 36  LEU A CD2  8  
ATOM   7635  H  H    . LEU A 1 36 ? 4.973   1.656   3.490   1.00 0.00 ? 36  LEU A H    8  
ATOM   7636  H  HA   . LEU A 1 36 ? 6.578   1.276   5.931   1.00 0.00 ? 36  LEU A HA   8  
ATOM   7637  H  HB2  . LEU A 1 36 ? 7.493   1.506   3.072   1.00 0.00 ? 36  LEU A HB2  8  
ATOM   7638  H  HB3  . LEU A 1 36 ? 8.576   1.651   4.455   1.00 0.00 ? 36  LEU A HB3  8  
ATOM   7639  H  HG   . LEU A 1 36 ? 6.918   -0.810  4.212   1.00 0.00 ? 36  LEU A HG   8  
ATOM   7640  H  HD11 . LEU A 1 36 ? 7.886   -0.351  1.947   1.00 0.00 ? 36  LEU A HD11 8  
ATOM   7641  H  HD12 . LEU A 1 36 ? 8.422   -1.854  2.697   1.00 0.00 ? 36  LEU A HD12 8  
ATOM   7642  H  HD13 . LEU A 1 36 ? 9.486   -0.448  2.684   1.00 0.00 ? 36  LEU A HD13 8  
ATOM   7643  H  HD21 . LEU A 1 36 ? 8.519   -1.743  5.548   1.00 0.00 ? 36  LEU A HD21 8  
ATOM   7644  H  HD22 . LEU A 1 36 ? 8.639   -0.062  6.067   1.00 0.00 ? 36  LEU A HD22 8  
ATOM   7645  H  HD23 . LEU A 1 36 ? 9.806   -0.716  4.917   1.00 0.00 ? 36  LEU A HD23 8  
ATOM   7646  N  N    . CYS A 1 37 ? 5.964   3.927   4.129   1.00 0.00 ? 37  CYS A N    8  
ATOM   7647  C  CA   . CYS A 1 37 ? 5.963   5.385   4.133   1.00 0.00 ? 37  CYS A CA   8  
ATOM   7648  C  C    . CYS A 1 37 ? 4.539   5.929   4.084   1.00 0.00 ? 37  CYS A C    8  
ATOM   7649  O  O    . CYS A 1 37 ? 4.322   7.138   4.168   1.00 0.00 ? 37  CYS A O    8  
ATOM   7650  C  CB   . CYS A 1 37 ? 6.765   5.919   2.944   1.00 0.00 ? 37  CYS A CB   8  
ATOM   7651  S  SG   . CYS A 1 37 ? 5.992   5.607   1.325   1.00 0.00 ? 37  CYS A SG   8  
ATOM   7652  H  H    . CYS A 1 37 ? 5.490   3.452   3.414   1.00 0.00 ? 37  CYS A H    8  
ATOM   7653  H  HA   . CYS A 1 37 ? 6.431   5.715   5.048   1.00 0.00 ? 37  CYS A HA   8  
ATOM   7654  H  HB2  . CYS A 1 37 ? 6.883   6.988   3.050   1.00 0.00 ? 37  CYS A HB2  8  
ATOM   7655  H  HB3  . CYS A 1 37 ? 7.740   5.454   2.939   1.00 0.00 ? 37  CYS A HB3  8  
ATOM   7656  N  N    . GLN A 1 38 ? 3.571   5.027   3.949   1.00 0.00 ? 38  GLN A N    8  
ATOM   7657  C  CA   . GLN A 1 38 ? 2.168   5.417   3.890   1.00 0.00 ? 38  GLN A CA   8  
ATOM   7658  C  C    . GLN A 1 38 ? 1.944   6.485   2.825   1.00 0.00 ? 38  GLN A C    8  
ATOM   7659  O  O    . GLN A 1 38 ? 1.394   7.549   3.106   1.00 0.00 ? 38  GLN A O    8  
ATOM   7660  C  CB   . GLN A 1 38 ? 1.701   5.933   5.252   1.00 0.00 ? 38  GLN A CB   8  
ATOM   7661  C  CG   . GLN A 1 38 ? 1.996   4.978   6.398   1.00 0.00 ? 38  GLN A CG   8  
ATOM   7662  C  CD   . GLN A 1 38 ? 0.856   4.014   6.663   1.00 0.00 ? 38  GLN A CD   8  
ATOM   7663  O  OE1  . GLN A 1 38 ? -0.297  4.422   6.801   1.00 0.00 ? 38  GLN A OE1  8  
ATOM   7664  N  NE2  . GLN A 1 38 ? 1.174   2.727   6.735   1.00 0.00 ? 38  GLN A NE2  8  
ATOM   7665  H  H    . GLN A 1 38 ? 3.807   4.079   3.888   1.00 0.00 ? 38  GLN A H    8  
ATOM   7666  H  HA   . GLN A 1 38 ? 1.592   4.542   3.630   1.00 0.00 ? 38  GLN A HA   8  
ATOM   7667  H  HB2  . GLN A 1 38 ? 2.195   6.871   5.457   1.00 0.00 ? 38  GLN A HB2  8  
ATOM   7668  H  HB3  . GLN A 1 38 ? 0.634   6.097   5.216   1.00 0.00 ? 38  GLN A HB3  8  
ATOM   7669  H  HG2  . GLN A 1 38 ? 2.880   4.407   6.155   1.00 0.00 ? 38  GLN A HG2  8  
ATOM   7670  H  HG3  . GLN A 1 38 ? 2.176   5.555   7.293   1.00 0.00 ? 38  GLN A HG3  8  
ATOM   7671  H  HE21 . GLN A 1 38 ? 2.114   2.475   6.617   1.00 0.00 ? 38  GLN A HE21 8  
ATOM   7672  H  HE22 . GLN A 1 38 ? 0.457   2.083   6.906   1.00 0.00 ? 38  GLN A HE22 8  
ATOM   7673  N  N    . GLU A 1 39 ? 2.375   6.194   1.601   1.00 0.00 ? 39  GLU A N    8  
ATOM   7674  C  CA   . GLU A 1 39 ? 2.222   7.131   0.495   1.00 0.00 ? 39  GLU A CA   8  
ATOM   7675  C  C    . GLU A 1 39 ? 1.096   6.693   -0.438  1.00 0.00 ? 39  GLU A C    8  
ATOM   7676  O  O    . GLU A 1 39 ? 1.048   5.543   -0.874  1.00 0.00 ? 39  GLU A O    8  
ATOM   7677  C  CB   . GLU A 1 39 ? 3.531   7.248   -0.288  1.00 0.00 ? 39  GLU A CB   8  
ATOM   7678  C  CG   . GLU A 1 39 ? 3.389   7.994   -1.604  1.00 0.00 ? 39  GLU A CG   8  
ATOM   7679  C  CD   . GLU A 1 39 ? 4.677   8.669   -2.035  1.00 0.00 ? 39  GLU A CD   8  
ATOM   7680  O  OE1  . GLU A 1 39 ? 5.206   9.488   -1.256  1.00 0.00 ? 39  GLU A OE1  8  
ATOM   7681  O  OE2  . GLU A 1 39 ? 5.154   8.377   -3.151  1.00 0.00 ? 39  GLU A OE2  8  
ATOM   7682  H  H    . GLU A 1 39 ? 2.806   5.329   1.439   1.00 0.00 ? 39  GLU A H    8  
ATOM   7683  H  HA   . GLU A 1 39 ? 1.974   8.096   0.909   1.00 0.00 ? 39  GLU A HA   8  
ATOM   7684  H  HB2  . GLU A 1 39 ? 4.256   7.769   0.321   1.00 0.00 ? 39  GLU A HB2  8  
ATOM   7685  H  HB3  . GLU A 1 39 ? 3.900   6.255   -0.500  1.00 0.00 ? 39  GLU A HB3  8  
ATOM   7686  H  HG2  . GLU A 1 39 ? 3.095   7.292   -2.371  1.00 0.00 ? 39  GLU A HG2  8  
ATOM   7687  H  HG3  . GLU A 1 39 ? 2.623   8.748   -1.496  1.00 0.00 ? 39  GLU A HG3  8  
ATOM   7688  N  N    . VAL A 1 40 ? 0.191   7.619   -0.739  1.00 0.00 ? 40  VAL A N    8  
ATOM   7689  C  CA   . VAL A 1 40 ? -0.934  7.330   -1.620  1.00 0.00 ? 40  VAL A CA   8  
ATOM   7690  C  C    . VAL A 1 40 ? -0.487  6.530   -2.839  1.00 0.00 ? 40  VAL A C    8  
ATOM   7691  O  O    . VAL A 1 40 ? 0.250   7.033   -3.688  1.00 0.00 ? 40  VAL A O    8  
ATOM   7692  C  CB   . VAL A 1 40 ? -1.624  8.623   -2.093  1.00 0.00 ? 40  VAL A CB   8  
ATOM   7693  C  CG1  . VAL A 1 40 ? -2.782  8.301   -3.024  1.00 0.00 ? 40  VAL A CG1  8  
ATOM   7694  C  CG2  . VAL A 1 40 ? -2.099  9.440   -0.900  1.00 0.00 ? 40  VAL A CG2  8  
ATOM   7695  H  H    . VAL A 1 40 ? 0.283   8.518   -0.361  1.00 0.00 ? 40  VAL A H    8  
ATOM   7696  H  HA   . VAL A 1 40 ? -1.653  6.746   -1.063  1.00 0.00 ? 40  VAL A HA   8  
ATOM   7697  H  HB   . VAL A 1 40 ? -0.903  9.212   -2.641  1.00 0.00 ? 40  VAL A HB   8  
ATOM   7698  H  HG11 . VAL A 1 40 ? -2.420  8.239   -4.040  1.00 0.00 ? 40  VAL A HG11 8  
ATOM   7699  H  HG12 . VAL A 1 40 ? -3.222  7.357   -2.739  1.00 0.00 ? 40  VAL A HG12 8  
ATOM   7700  H  HG13 . VAL A 1 40 ? -3.526  9.081   -2.956  1.00 0.00 ? 40  VAL A HG13 8  
ATOM   7701  H  HG21 . VAL A 1 40 ? -1.289  9.549   -0.195  1.00 0.00 ? 40  VAL A HG21 8  
ATOM   7702  H  HG22 . VAL A 1 40 ? -2.419  10.416  -1.236  1.00 0.00 ? 40  VAL A HG22 8  
ATOM   7703  H  HG23 . VAL A 1 40 ? -2.926  8.934   -0.424  1.00 0.00 ? 40  VAL A HG23 8  
ATOM   7704  N  N    . LEU A 1 41 ? -0.937  5.283   -2.919  1.00 0.00 ? 41  LEU A N    8  
ATOM   7705  C  CA   . LEU A 1 41 ? -0.584  4.413   -4.036  1.00 0.00 ? 41  LEU A CA   8  
ATOM   7706  C  C    . LEU A 1 41 ? -1.721  4.341   -5.051  1.00 0.00 ? 41  LEU A C    8  
ATOM   7707  O  O    . LEU A 1 41 ? -2.020  3.275   -5.587  1.00 0.00 ? 41  LEU A O    8  
ATOM   7708  C  CB   . LEU A 1 41 ? -0.249  3.010   -3.528  1.00 0.00 ? 41  LEU A CB   8  
ATOM   7709  C  CG   . LEU A 1 41 ? 0.442   2.936   -2.165  1.00 0.00 ? 41  LEU A CG   8  
ATOM   7710  C  CD1  . LEU A 1 41 ? 0.224   1.572   -1.529  1.00 0.00 ? 41  LEU A CD1  8  
ATOM   7711  C  CD2  . LEU A 1 41 ? 1.928   3.230   -2.304  1.00 0.00 ? 41  LEU A CD2  8  
ATOM   7712  H  H    . LEU A 1 41 ? -1.521  4.939   -2.212  1.00 0.00 ? 41  LEU A H    8  
ATOM   7713  H  HA   . LEU A 1 41 ? 0.287   4.830   -4.518  1.00 0.00 ? 41  LEU A HA   8  
ATOM   7714  H  HB2  . LEU A 1 41 ? -1.171  2.453   -3.461  1.00 0.00 ? 41  LEU A HB2  8  
ATOM   7715  H  HB3  . LEU A 1 41 ? 0.400   2.542   -4.254  1.00 0.00 ? 41  LEU A HB3  8  
ATOM   7716  H  HG   . LEU A 1 41 ? 0.012   3.682   -1.510  1.00 0.00 ? 41  LEU A HG   8  
ATOM   7717  H  HD11 . LEU A 1 41 ? 1.153   1.219   -1.108  1.00 0.00 ? 41  LEU A HD11 8  
ATOM   7718  H  HD12 . LEU A 1 41 ? -0.119  0.876   -2.280  1.00 0.00 ? 41  LEU A HD12 8  
ATOM   7719  H  HD13 . LEU A 1 41 ? -0.519  1.654   -0.749  1.00 0.00 ? 41  LEU A HD13 8  
ATOM   7720  H  HD21 . LEU A 1 41 ? 2.373   2.520   -2.985  1.00 0.00 ? 41  LEU A HD21 8  
ATOM   7721  H  HD22 . LEU A 1 41 ? 2.403   3.148   -1.337  1.00 0.00 ? 41  LEU A HD22 8  
ATOM   7722  H  HD23 . LEU A 1 41 ? 2.063   4.231   -2.689  1.00 0.00 ? 41  LEU A HD23 8  
ATOM   7723  N  N    . ALA A 1 42 ? -2.348  5.483   -5.310  1.00 0.00 ? 42  ALA A N    8  
ATOM   7724  C  CA   . ALA A 1 42 ? -3.449  5.550   -6.264  1.00 0.00 ? 42  ALA A CA   8  
ATOM   7725  C  C    . ALA A 1 42 ? -2.941  5.863   -7.667  1.00 0.00 ? 42  ALA A C    8  
ATOM   7726  O  O    . ALA A 1 42 ? -3.201  5.119   -8.612  1.00 0.00 ? 42  ALA A O    8  
ATOM   7727  C  CB   . ALA A 1 42 ? -4.466  6.593   -5.824  1.00 0.00 ? 42  ALA A CB   8  
ATOM   7728  H  H    . ALA A 1 42 ? -2.064  6.300   -4.851  1.00 0.00 ? 42  ALA A H    8  
ATOM   7729  H  HA   . ALA A 1 42 ? -3.939  4.587   -6.276  1.00 0.00 ? 42  ALA A HA   8  
ATOM   7730  H  HB1  . ALA A 1 42 ? -4.456  6.671   -4.746  1.00 0.00 ? 42  ALA A HB1  8  
ATOM   7731  H  HB2  . ALA A 1 42 ? -4.212  7.548   -6.258  1.00 0.00 ? 42  ALA A HB2  8  
ATOM   7732  H  HB3  . ALA A 1 42 ? -5.450  6.297   -6.154  1.00 0.00 ? 42  ALA A HB3  8  
ATOM   7733  N  N    . ASP A 1 43 ? -2.216  6.969   -7.796  1.00 0.00 ? 43  ASP A N    8  
ATOM   7734  C  CA   . ASP A 1 43 ? -1.671  7.381   -9.084  1.00 0.00 ? 43  ASP A CA   8  
ATOM   7735  C  C    . ASP A 1 43 ? -0.276  6.800   -9.295  1.00 0.00 ? 43  ASP A C    8  
ATOM   7736  O  O    . ASP A 1 43 ? 0.001   6.184   -10.325 1.00 0.00 ? 43  ASP A O    8  
ATOM   7737  C  CB   . ASP A 1 43 ? -1.621  8.907   -9.177  1.00 0.00 ? 43  ASP A CB   8  
ATOM   7738  C  CG   . ASP A 1 43 ? -2.969  9.511   -9.517  1.00 0.00 ? 43  ASP A CG   8  
ATOM   7739  O  OD1  . ASP A 1 43 ? -3.778  9.720   -8.589  1.00 0.00 ? 43  ASP A OD1  8  
ATOM   7740  O  OD2  . ASP A 1 43 ? -3.216  9.775   -10.713 1.00 0.00 ? 43  ASP A OD2  8  
ATOM   7741  H  H    . ASP A 1 43 ? -2.043  7.522   -7.005  1.00 0.00 ? 43  ASP A H    8  
ATOM   7742  H  HA   . ASP A 1 43 ? -2.325  7.004   -9.856  1.00 0.00 ? 43  ASP A HA   8  
ATOM   7743  H  HB2  . ASP A 1 43 ? -1.297  9.308   -8.228  1.00 0.00 ? 43  ASP A HB2  8  
ATOM   7744  H  HB3  . ASP A 1 43 ? -0.915  9.191   -9.943  1.00 0.00 ? 43  ASP A HB3  8  
ATOM   7745  N  N    . ILE A 1 44 ? 0.597   7.001   -8.314  1.00 0.00 ? 44  ILE A N    8  
ATOM   7746  C  CA   . ILE A 1 44 ? 1.963   6.497   -8.392  1.00 0.00 ? 44  ILE A CA   8  
ATOM   7747  C  C    . ILE A 1 44 ? 1.980   4.985   -8.583  1.00 0.00 ? 44  ILE A C    8  
ATOM   7748  O  O    . ILE A 1 44 ? 2.872   4.441   -9.233  1.00 0.00 ? 44  ILE A O    8  
ATOM   7749  C  CB   . ILE A 1 44 ? 2.767   6.854   -7.129  1.00 0.00 ? 44  ILE A CB   8  
ATOM   7750  C  CG1  . ILE A 1 44 ? 2.157   6.175   -5.901  1.00 0.00 ? 44  ILE A CG1  8  
ATOM   7751  C  CG2  . ILE A 1 44 ? 2.814   8.362   -6.938  1.00 0.00 ? 44  ILE A CG2  8  
ATOM   7752  C  CD1  . ILE A 1 44 ? 3.012   6.290   -4.659  1.00 0.00 ? 44  ILE A CD1  8  
ATOM   7753  H  H    . ILE A 1 44 ? 0.316   7.499   -7.519  1.00 0.00 ? 44  ILE A H    8  
ATOM   7754  H  HA   . ILE A 1 44 ? 2.441   6.963   -9.242  1.00 0.00 ? 44  ILE A HA   8  
ATOM   7755  H  HB   . ILE A 1 44 ? 3.778   6.500   -7.261  1.00 0.00 ? 44  ILE A HB   8  
ATOM   7756  H  HG12 . ILE A 1 44 ? 1.200   6.625   -5.687  1.00 0.00 ? 44  ILE A HG12 8  
ATOM   7757  H  HG13 . ILE A 1 44 ? 2.017   5.124   -6.112  1.00 0.00 ? 44  ILE A HG13 8  
ATOM   7758  H  HG21 . ILE A 1 44 ? 3.835   8.672   -6.766  1.00 0.00 ? 44  ILE A HG21 8  
ATOM   7759  H  HG22 . ILE A 1 44 ? 2.437   8.848   -7.825  1.00 0.00 ? 44  ILE A HG22 8  
ATOM   7760  H  HG23 . ILE A 1 44 ? 2.207   8.637   -6.089  1.00 0.00 ? 44  ILE A HG23 8  
ATOM   7761  H  HD11 . ILE A 1 44 ? 2.418   6.055   -3.788  1.00 0.00 ? 44  ILE A HD11 8  
ATOM   7762  H  HD12 . ILE A 1 44 ? 3.841   5.602   -4.726  1.00 0.00 ? 44  ILE A HD12 8  
ATOM   7763  H  HD13 . ILE A 1 44 ? 3.389   7.300   -4.574  1.00 0.00 ? 44  ILE A HD13 8  
ATOM   7764  N  N    . GLY A 1 45 ? 0.986   4.310   -8.013  1.00 0.00 ? 45  GLY A N    8  
ATOM   7765  C  CA   . GLY A 1 45 ? 0.905   2.866   -8.134  1.00 0.00 ? 45  GLY A CA   8  
ATOM   7766  C  C    . GLY A 1 45 ? 1.368   2.153   -6.879  1.00 0.00 ? 45  GLY A C    8  
ATOM   7767  O  O    . GLY A 1 45 ? 1.819   2.788   -5.926  1.00 0.00 ? 45  GLY A O    8  
ATOM   7768  H  H    . GLY A 1 45 ? 0.303   4.796   -7.507  1.00 0.00 ? 45  GLY A H    8  
ATOM   7769  H  HA2  . GLY A 1 45 ? -0.119  2.589   -8.336  1.00 0.00 ? 45  GLY A HA2  8  
ATOM   7770  H  HA3  . GLY A 1 45 ? 1.523   2.550   -8.962  1.00 0.00 ? 45  GLY A HA3  8  
ATOM   7771  N  N    . PHE A 1 46 ? 1.255   0.829   -6.877  1.00 0.00 ? 46  PHE A N    8  
ATOM   7772  C  CA   . PHE A 1 46 ? 1.663   0.028   -5.728  1.00 0.00 ? 46  PHE A CA   8  
ATOM   7773  C  C    . PHE A 1 46 ? 2.379   -1.242  -6.178  1.00 0.00 ? 46  PHE A C    8  
ATOM   7774  O  O    . PHE A 1 46 ? 2.343   -1.607  -7.353  1.00 0.00 ? 46  PHE A O    8  
ATOM   7775  C  CB   . PHE A 1 46 ? 0.447   -0.334  -4.874  1.00 0.00 ? 46  PHE A CB   8  
ATOM   7776  C  CG   . PHE A 1 46 ? -0.442  -1.368  -5.503  1.00 0.00 ? 46  PHE A CG   8  
ATOM   7777  C  CD1  . PHE A 1 46 ? -1.180  -1.069  -6.637  1.00 0.00 ? 46  PHE A CD1  8  
ATOM   7778  C  CD2  . PHE A 1 46 ? -0.538  -2.640  -4.961  1.00 0.00 ? 46  PHE A CD2  8  
ATOM   7779  C  CE1  . PHE A 1 46 ? -1.998  -2.019  -7.219  1.00 0.00 ? 46  PHE A CE1  8  
ATOM   7780  C  CE2  . PHE A 1 46 ? -1.355  -3.594  -5.539  1.00 0.00 ? 46  PHE A CE2  8  
ATOM   7781  C  CZ   . PHE A 1 46 ? -2.086  -3.283  -6.668  1.00 0.00 ? 46  PHE A CZ   8  
ATOM   7782  H  H    . PHE A 1 46 ? 0.888   0.379   -7.667  1.00 0.00 ? 46  PHE A H    8  
ATOM   7783  H  HA   . PHE A 1 46 ? 2.344   0.621   -5.138  1.00 0.00 ? 46  PHE A HA   8  
ATOM   7784  H  HB2  . PHE A 1 46 ? 0.785   -0.721  -3.925  1.00 0.00 ? 46  PHE A HB2  8  
ATOM   7785  H  HB3  . PHE A 1 46 ? -0.143  0.555   -4.707  1.00 0.00 ? 46  PHE A HB3  8  
ATOM   7786  H  HD1  . PHE A 1 46 ? -1.112  -0.080  -7.068  1.00 0.00 ? 46  PHE A HD1  8  
ATOM   7787  H  HD2  . PHE A 1 46 ? 0.032   -2.884  -4.077  1.00 0.00 ? 46  PHE A HD2  8  
ATOM   7788  H  HE1  . PHE A 1 46 ? -2.569  -1.773  -8.102  1.00 0.00 ? 46  PHE A HE1  8  
ATOM   7789  H  HE2  . PHE A 1 46 ? -1.422  -4.581  -5.106  1.00 0.00 ? 46  PHE A HE2  8  
ATOM   7790  H  HZ   . PHE A 1 46 ? -2.724  -4.027  -7.122  1.00 0.00 ? 46  PHE A HZ   8  
ATOM   7791  N  N    . VAL A 1 47 ? 3.031   -1.913  -5.233  1.00 0.00 ? 47  VAL A N    8  
ATOM   7792  C  CA   . VAL A 1 47 ? 3.755   -3.143  -5.530  1.00 0.00 ? 47  VAL A CA   8  
ATOM   7793  C  C    . VAL A 1 47 ? 3.531   -4.189  -4.443  1.00 0.00 ? 47  VAL A C    8  
ATOM   7794  O  O    . VAL A 1 47 ? 4.070   -4.082  -3.342  1.00 0.00 ? 47  VAL A O    8  
ATOM   7795  C  CB   . VAL A 1 47 ? 5.267   -2.884  -5.672  1.00 0.00 ? 47  VAL A CB   8  
ATOM   7796  C  CG1  . VAL A 1 47 ? 5.999   -4.171  -6.020  1.00 0.00 ? 47  VAL A CG1  8  
ATOM   7797  C  CG2  . VAL A 1 47 ? 5.527   -1.813  -6.721  1.00 0.00 ? 47  VAL A CG2  8  
ATOM   7798  H  H    . VAL A 1 47 ? 3.024   -1.573  -4.314  1.00 0.00 ? 47  VAL A H    8  
ATOM   7799  H  HA   . VAL A 1 47 ? 3.387   -3.529  -6.469  1.00 0.00 ? 47  VAL A HA   8  
ATOM   7800  H  HB   . VAL A 1 47 ? 5.642   -2.527  -4.724  1.00 0.00 ? 47  VAL A HB   8  
ATOM   7801  H  HG11 . VAL A 1 47 ? 6.659   -3.994  -6.857  1.00 0.00 ? 47  VAL A HG11 8  
ATOM   7802  H  HG12 . VAL A 1 47 ? 6.577   -4.498  -5.167  1.00 0.00 ? 47  VAL A HG12 8  
ATOM   7803  H  HG13 . VAL A 1 47 ? 5.281   -4.933  -6.283  1.00 0.00 ? 47  VAL A HG13 8  
ATOM   7804  H  HG21 . VAL A 1 47 ? 6.287   -1.135  -6.363  1.00 0.00 ? 47  VAL A HG21 8  
ATOM   7805  H  HG22 . VAL A 1 47 ? 5.863   -2.279  -7.637  1.00 0.00 ? 47  VAL A HG22 8  
ATOM   7806  H  HG23 . VAL A 1 47 ? 4.615   -1.265  -6.911  1.00 0.00 ? 47  VAL A HG23 8  
ATOM   7807  N  N    . LYS A 1 48 ? 2.731   -5.201  -4.761  1.00 0.00 ? 48  LYS A N    8  
ATOM   7808  C  CA   . LYS A 1 48 ? 2.435   -6.270  -3.814  1.00 0.00 ? 48  LYS A CA   8  
ATOM   7809  C  C    . LYS A 1 48 ? 3.720   -6.898  -3.284  1.00 0.00 ? 48  LYS A C    8  
ATOM   7810  O  O    . LYS A 1 48 ? 4.646   -7.174  -4.045  1.00 0.00 ? 48  LYS A O    8  
ATOM   7811  C  CB   . LYS A 1 48 ? 1.566   -7.341  -4.477  1.00 0.00 ? 48  LYS A CB   8  
ATOM   7812  C  CG   . LYS A 1 48 ? 0.077   -7.129  -4.271  1.00 0.00 ? 48  LYS A CG   8  
ATOM   7813  C  CD   . LYS A 1 48 ? -0.325  -7.362  -2.824  1.00 0.00 ? 48  LYS A CD   8  
ATOM   7814  C  CE   . LYS A 1 48 ? -0.458  -8.845  -2.515  1.00 0.00 ? 48  LYS A CE   8  
ATOM   7815  N  NZ   . LYS A 1 48 ? -1.440  -9.098  -1.424  1.00 0.00 ? 48  LYS A NZ   8  
ATOM   7816  H  H    . LYS A 1 48 ? 2.331   -5.231  -5.656  1.00 0.00 ? 48  LYS A H    8  
ATOM   7817  H  HA   . LYS A 1 48 ? 1.892   -5.839  -2.987  1.00 0.00 ? 48  LYS A HA   8  
ATOM   7818  H  HB2  . LYS A 1 48 ? 1.765   -7.343  -5.538  1.00 0.00 ? 48  LYS A HB2  8  
ATOM   7819  H  HB3  . LYS A 1 48 ? 1.831   -8.306  -4.068  1.00 0.00 ? 48  LYS A HB3  8  
ATOM   7820  H  HG2  . LYS A 1 48 ? -0.175  -6.115  -4.544  1.00 0.00 ? 48  LYS A HG2  8  
ATOM   7821  H  HG3  . LYS A 1 48 ? -0.466  -7.819  -4.901  1.00 0.00 ? 48  LYS A HG3  8  
ATOM   7822  H  HD2  . LYS A 1 48 ? 0.428   -6.937  -2.177  1.00 0.00 ? 48  LYS A HD2  8  
ATOM   7823  H  HD3  . LYS A 1 48 ? -1.274  -6.878  -2.641  1.00 0.00 ? 48  LYS A HD3  8  
ATOM   7824  H  HE2  . LYS A 1 48 ? -0.784  -9.358  -3.407  1.00 0.00 ? 48  LYS A HE2  8  
ATOM   7825  H  HE3  . LYS A 1 48 ? 0.507   -9.225  -2.214  1.00 0.00 ? 48  LYS A HE3  8  
ATOM   7826  H  HZ1  . LYS A 1 48 ? -1.262  -10.027 -0.992  1.00 0.00 ? 48  LYS A HZ1  8  
ATOM   7827  H  HZ2  . LYS A 1 48 ? -2.408  -9.086  -1.805  1.00 0.00 ? 48  LYS A HZ2  8  
ATOM   7828  H  HZ3  . LYS A 1 48 ? -1.358  -8.365  -0.691  1.00 0.00 ? 48  LYS A HZ3  8  
ATOM   7829  N  N    . ASN A 1 49 ? 3.767   -7.123  -1.975  1.00 0.00 ? 49  ASN A N    8  
ATOM   7830  C  CA   . ASN A 1 49 ? 4.939   -7.720  -1.344  1.00 0.00 ? 49  ASN A CA   8  
ATOM   7831  C  C    . ASN A 1 49 ? 4.609   -8.206  0.065   1.00 0.00 ? 49  ASN A C    8  
ATOM   7832  O  O    . ASN A 1 49 ? 4.093   -7.451  0.888   1.00 0.00 ? 49  ASN A O    8  
ATOM   7833  C  CB   . ASN A 1 49 ? 6.086   -6.710  -1.291  1.00 0.00 ? 49  ASN A CB   8  
ATOM   7834  C  CG   . ASN A 1 49 ? 7.445   -7.381  -1.225  1.00 0.00 ? 49  ASN A CG   8  
ATOM   7835  O  OD1  . ASN A 1 49 ? 7.608   -8.522  -1.658  1.00 0.00 ? 49  ASN A OD1  8  
ATOM   7836  N  ND2  . ASN A 1 49 ? 8.428   -6.673  -0.680  1.00 0.00 ? 49  ASN A ND2  8  
ATOM   7837  H  H    . ASN A 1 49 ? 2.997   -6.881  -1.420  1.00 0.00 ? 49  ASN A H    8  
ATOM   7838  H  HA   . ASN A 1 49 ? 5.242   -8.566  -1.942  1.00 0.00 ? 49  ASN A HA   8  
ATOM   7839  H  HB2  . ASN A 1 49 ? 6.055   -6.092  -2.177  1.00 0.00 ? 49  ASN A HB2  8  
ATOM   7840  H  HB3  . ASN A 1 49 ? 5.970   -6.086  -0.418  1.00 0.00 ? 49  ASN A HB3  8  
ATOM   7841  H  HD21 . ASN A 1 49 ? 8.225   -5.771  -0.356  1.00 0.00 ? 49  ASN A HD21 8  
ATOM   7842  H  HD22 . ASN A 1 49 ? 9.316   -7.083  -0.625  1.00 0.00 ? 49  ASN A HD22 8  
ATOM   7843  N  N    . ALA A 1 50 ? 4.913   -9.472  0.334   1.00 0.00 ? 50  ALA A N    8  
ATOM   7844  C  CA   . ALA A 1 50 ? 4.652   -10.058 1.643   1.00 0.00 ? 50  ALA A CA   8  
ATOM   7845  C  C    . ALA A 1 50 ? 3.246   -9.718  2.126   1.00 0.00 ? 50  ALA A C    8  
ATOM   7846  O  O    . ALA A 1 50 ? 3.019   -9.525  3.320   1.00 0.00 ? 50  ALA A O    8  
ATOM   7847  C  CB   . ALA A 1 50 ? 5.688   -9.582  2.650   1.00 0.00 ? 50  ALA A CB   8  
ATOM   7848  H  H    . ALA A 1 50 ? 5.323   -10.024 -0.364  1.00 0.00 ? 50  ALA A H    8  
ATOM   7849  H  HA   . ALA A 1 50 ? 4.741   -11.131 1.551   1.00 0.00 ? 50  ALA A HA   8  
ATOM   7850  H  HB1  . ALA A 1 50 ? 5.762   -8.505  2.607   1.00 0.00 ? 50  ALA A HB1  8  
ATOM   7851  H  HB2  . ALA A 1 50 ? 5.389   -9.884  3.643   1.00 0.00 ? 50  ALA A HB2  8  
ATOM   7852  H  HB3  . ALA A 1 50 ? 6.647   -10.019 2.414   1.00 0.00 ? 50  ALA A HB3  8  
ATOM   7853  N  N    . GLY A 1 51 ? 2.304   -9.646  1.190   1.00 0.00 ? 51  GLY A N    8  
ATOM   7854  C  CA   . GLY A 1 51 ? 0.933   -9.328  1.541   1.00 0.00 ? 51  GLY A CA   8  
ATOM   7855  C  C    . GLY A 1 51 ? 0.773   -7.900  2.024   1.00 0.00 ? 51  GLY A C    8  
ATOM   7856  O  O    . GLY A 1 51 ? -0.065  -7.617  2.879   1.00 0.00 ? 51  GLY A O    8  
ATOM   7857  H  H    . GLY A 1 51 ? 2.543   -9.809  0.253   1.00 0.00 ? 51  GLY A H    8  
ATOM   7858  H  HA2  . GLY A 1 51 ? 0.307   -9.475  0.673   1.00 0.00 ? 51  GLY A HA2  8  
ATOM   7859  H  HA3  . GLY A 1 51 ? 0.609   -9.998  2.323   1.00 0.00 ? 51  GLY A HA3  8  
ATOM   7860  N  N    . ARG A 1 52 ? 1.582   -6.998  1.476   1.00 0.00 ? 52  ARG A N    8  
ATOM   7861  C  CA   . ARG A 1 52 ? 1.529   -5.592  1.858   1.00 0.00 ? 52  ARG A CA   8  
ATOM   7862  C  C    . ARG A 1 52 ? 1.686   -4.690  0.638   1.00 0.00 ? 52  ARG A C    8  
ATOM   7863  O  O    . ARG A 1 52 ? 2.406   -5.023  -0.304  1.00 0.00 ? 52  ARG A O    8  
ATOM   7864  C  CB   . ARG A 1 52 ? 2.622   -5.278  2.882   1.00 0.00 ? 52  ARG A CB   8  
ATOM   7865  C  CG   . ARG A 1 52 ? 2.574   -6.165  4.115   1.00 0.00 ? 52  ARG A CG   8  
ATOM   7866  C  CD   . ARG A 1 52 ? 3.882   -6.115  4.889   1.00 0.00 ? 52  ARG A CD   8  
ATOM   7867  N  NE   . ARG A 1 52 ? 3.953   -7.154  5.913   1.00 0.00 ? 52  ARG A NE   8  
ATOM   7868  C  CZ   . ARG A 1 52 ? 4.713   -7.065  6.998   1.00 0.00 ? 52  ARG A CZ   8  
ATOM   7869  N  NH1  . ARG A 1 52 ? 5.463   -5.990  7.200   1.00 0.00 ? 52  ARG A NH1  8  
ATOM   7870  N  NH2  . ARG A 1 52 ? 4.724   -8.052  7.885   1.00 0.00 ? 52  ARG A NH2  8  
ATOM   7871  H  H    . ARG A 1 52 ? 2.230   -7.285  0.799   1.00 0.00 ? 52  ARG A H    8  
ATOM   7872  H  HA   . ARG A 1 52 ? 0.564   -5.406  2.307   1.00 0.00 ? 52  ARG A HA   8  
ATOM   7873  H  HB2  . ARG A 1 52 ? 3.586   -5.405  2.412   1.00 0.00 ? 52  ARG A HB2  8  
ATOM   7874  H  HB3  . ARG A 1 52 ? 2.517   -4.252  3.199   1.00 0.00 ? 52  ARG A HB3  8  
ATOM   7875  H  HG2  . ARG A 1 52 ? 1.775   -5.828  4.759   1.00 0.00 ? 52  ARG A HG2  8  
ATOM   7876  H  HG3  . ARG A 1 52 ? 2.386   -7.183  3.808   1.00 0.00 ? 52  ARG A HG3  8  
ATOM   7877  H  HD2  . ARG A 1 52 ? 4.700   -6.250  4.196   1.00 0.00 ? 52  ARG A HD2  8  
ATOM   7878  H  HD3  . ARG A 1 52 ? 3.967   -5.149  5.363   1.00 0.00 ? 52  ARG A HD3  8  
ATOM   7879  H  HE   . ARG A 1 52 ? 3.407   -7.957  5.783   1.00 0.00 ? 52  ARG A HE   8  
ATOM   7880  H  HH11 . ARG A 1 52 ? 5.456   -5.245  6.535   1.00 0.00 ? 52  ARG A HH11 8  
ATOM   7881  H  HH12 . ARG A 1 52 ? 6.034   -5.925  8.019   1.00 0.00 ? 52  ARG A HH12 8  
ATOM   7882  H  HH21 . ARG A 1 52 ? 4.160   -8.864  7.736   1.00 0.00 ? 52  ARG A HH21 8  
ATOM   7883  H  HH22 . ARG A 1 52 ? 5.296   -7.985  8.701   1.00 0.00 ? 52  ARG A HH22 8  
ATOM   7884  N  N    . HIS A 1 53 ? 1.007   -3.548  0.661   1.00 0.00 ? 53  HIS A N    8  
ATOM   7885  C  CA   . HIS A 1 53 ? 1.071   -2.598  -0.444  1.00 0.00 ? 53  HIS A CA   8  
ATOM   7886  C  C    . HIS A 1 53 ? 2.217   -1.610  -0.245  1.00 0.00 ? 53  HIS A C    8  
ATOM   7887  O  O    . HIS A 1 53 ? 2.222   -0.833  0.710   1.00 0.00 ? 53  HIS A O    8  
ATOM   7888  C  CB   . HIS A 1 53 ? -0.252  -1.842  -0.572  1.00 0.00 ? 53  HIS A CB   8  
ATOM   7889  C  CG   . HIS A 1 53 ? -0.738  -1.262  0.720   1.00 0.00 ? 53  HIS A CG   8  
ATOM   7890  N  ND1  . HIS A 1 53 ? 0.035   -1.211  1.861   1.00 0.00 ? 53  HIS A ND1  8  
ATOM   7891  C  CD2  . HIS A 1 53 ? -1.927  -0.704  1.049   1.00 0.00 ? 53  HIS A CD2  8  
ATOM   7892  C  CE1  . HIS A 1 53 ? -0.657  -0.648  2.835   1.00 0.00 ? 53  HIS A CE1  8  
ATOM   7893  N  NE2  . HIS A 1 53 ? -1.851  -0.331  2.368   1.00 0.00 ? 53  HIS A NE2  8  
ATOM   7894  H  H    . HIS A 1 53 ? 0.450   -3.339  1.440   1.00 0.00 ? 53  HIS A H    8  
ATOM   7895  H  HA   . HIS A 1 53 ? 1.246   -3.155  -1.351  1.00 0.00 ? 53  HIS A HA   8  
ATOM   7896  H  HB2  . HIS A 1 53 ? -0.129  -1.031  -1.274  1.00 0.00 ? 53  HIS A HB2  8  
ATOM   7897  H  HB3  . HIS A 1 53 ? -1.011  -2.518  -0.939  1.00 0.00 ? 53  HIS A HB3  8  
ATOM   7898  H  HD1  . HIS A 1 53 ? 0.955   -1.539  1.944   1.00 0.00 ? 53  HIS A HD1  8  
ATOM   7899  H  HD2  . HIS A 1 53 ? -2.778  -0.576  0.395   1.00 0.00 ? 53  HIS A HD2  8  
ATOM   7900  H  HE1  . HIS A 1 53 ? -0.307  -0.476  3.842   1.00 0.00 ? 53  HIS A HE1  8  
ATOM   7901  H  HE2  . HIS A 1 53 ? -2.591  0.021   2.905   1.00 0.00 ? 53  HIS A HE2  8  
ATOM   7902  N  N    . LEU A 1 54 ? 3.186   -1.646  -1.153  1.00 0.00 ? 54  LEU A N    8  
ATOM   7903  C  CA   . LEU A 1 54 ? 4.339   -0.755  -1.077  1.00 0.00 ? 54  LEU A CA   8  
ATOM   7904  C  C    . LEU A 1 54 ? 4.479   0.063   -2.357  1.00 0.00 ? 54  LEU A C    8  
ATOM   7905  O  O    . LEU A 1 54 ? 3.989   -0.331  -3.415  1.00 0.00 ? 54  LEU A O    8  
ATOM   7906  C  CB   . LEU A 1 54 ? 5.616   -1.560  -0.830  1.00 0.00 ? 54  LEU A CB   8  
ATOM   7907  C  CG   . LEU A 1 54 ? 5.476   -2.775  0.089   1.00 0.00 ? 54  LEU A CG   8  
ATOM   7908  C  CD1  . LEU A 1 54 ? 6.787   -3.543  0.161   1.00 0.00 ? 54  LEU A CD1  8  
ATOM   7909  C  CD2  . LEU A 1 54 ? 5.031   -2.344  1.479   1.00 0.00 ? 54  LEU A CD2  8  
ATOM   7910  H  H    . LEU A 1 54 ? 3.127   -2.287  -1.891  1.00 0.00 ? 54  LEU A H    8  
ATOM   7911  H  HA   . LEU A 1 54 ? 4.182   -0.081  -0.248  1.00 0.00 ? 54  LEU A HA   8  
ATOM   7912  H  HB2  . LEU A 1 54 ? 5.977   -1.909  -1.785  1.00 0.00 ? 54  LEU A HB2  8  
ATOM   7913  H  HB3  . LEU A 1 54 ? 6.346   -0.895  -0.392  1.00 0.00 ? 54  LEU A HB3  8  
ATOM   7914  H  HG   . LEU A 1 54 ? 4.723   -3.438  -0.314  1.00 0.00 ? 54  LEU A HG   8  
ATOM   7915  H  HD11 . LEU A 1 54 ? 7.178   -3.682  -0.835  1.00 0.00 ? 54  LEU A HD11 8  
ATOM   7916  H  HD12 . LEU A 1 54 ? 6.615   -4.506  0.619   1.00 0.00 ? 54  LEU A HD12 8  
ATOM   7917  H  HD13 . LEU A 1 54 ? 7.498   -2.985  0.753   1.00 0.00 ? 54  LEU A HD13 8  
ATOM   7918  H  HD21 . LEU A 1 54 ? 4.271   -1.581  1.392   1.00 0.00 ? 54  LEU A HD21 8  
ATOM   7919  H  HD22 . LEU A 1 54 ? 5.878   -1.948  2.021   1.00 0.00 ? 54  LEU A HD22 8  
ATOM   7920  H  HD23 . LEU A 1 54 ? 4.629   -3.195  2.008   1.00 0.00 ? 54  LEU A HD23 8  
ATOM   7921  N  N    . CYS A 1 55 ? 5.154   1.203   -2.253  1.00 0.00 ? 55  CYS A N    8  
ATOM   7922  C  CA   . CYS A 1 55 ? 5.362   2.076   -3.401  1.00 0.00 ? 55  CYS A CA   8  
ATOM   7923  C  C    . CYS A 1 55 ? 6.700   1.783   -4.073  1.00 0.00 ? 55  CYS A C    8  
ATOM   7924  O  O    . CYS A 1 55 ? 7.657   1.367   -3.419  1.00 0.00 ? 55  CYS A O    8  
ATOM   7925  C  CB   . CYS A 1 55 ? 5.306   3.543   -2.970  1.00 0.00 ? 55  CYS A CB   8  
ATOM   7926  S  SG   . CYS A 1 55 ? 6.687   4.055   -1.897  1.00 0.00 ? 55  CYS A SG   8  
ATOM   7927  H  H    . CYS A 1 55 ? 5.522   1.464   -1.382  1.00 0.00 ? 55  CYS A H    8  
ATOM   7928  H  HA   . CYS A 1 55 ? 4.569   1.888   -4.109  1.00 0.00 ? 55  CYS A HA   8  
ATOM   7929  H  HB2  . CYS A 1 55 ? 5.325   4.170   -3.849  1.00 0.00 ? 55  CYS A HB2  8  
ATOM   7930  H  HB3  . CYS A 1 55 ? 4.387   3.717   -2.430  1.00 0.00 ? 55  CYS A HB3  8  
ATOM   7931  N  N    . ARG A 1 56 ? 6.759   2.003   -5.383  1.00 0.00 ? 56  ARG A N    8  
ATOM   7932  C  CA   . ARG A 1 56 ? 7.979   1.761   -6.144  1.00 0.00 ? 56  ARG A CA   8  
ATOM   7933  C  C    . ARG A 1 56 ? 9.213   2.123   -5.322  1.00 0.00 ? 56  ARG A C    8  
ATOM   7934  O  O    . ARG A 1 56 ? 10.142  1.330   -5.169  1.00 0.00 ? 56  ARG A O    8  
ATOM   7935  C  CB   . ARG A 1 56 ? 7.964   2.568   -7.443  1.00 0.00 ? 56  ARG A CB   8  
ATOM   7936  C  CG   . ARG A 1 56 ? 7.549   1.757   -8.659  1.00 0.00 ? 56  ARG A CG   8  
ATOM   7937  C  CD   . ARG A 1 56 ? 8.221   2.267   -9.925  1.00 0.00 ? 56  ARG A CD   8  
ATOM   7938  N  NE   . ARG A 1 56 ? 7.572   1.759   -11.131 1.00 0.00 ? 56  ARG A NE   8  
ATOM   7939  C  CZ   . ARG A 1 56 ? 8.187   1.645   -12.303 1.00 0.00 ? 56  ARG A CZ   8  
ATOM   7940  N  NH1  . ARG A 1 56 ? 9.458   2.000   -12.426 1.00 0.00 ? 56  ARG A NH1  8  
ATOM   7941  N  NH2  . ARG A 1 56 ? 7.529   1.175   -13.355 1.00 0.00 ? 56  ARG A NH2  8  
ATOM   7942  H  H    . ARG A 1 56 ? 5.963   2.335   -5.849  1.00 0.00 ? 56  ARG A H    8  
ATOM   7943  H  HA   . ARG A 1 56 ? 8.018   0.709   -6.384  1.00 0.00 ? 56  ARG A HA   8  
ATOM   7944  H  HB2  . ARG A 1 56 ? 7.272   3.391   -7.334  1.00 0.00 ? 56  ARG A HB2  8  
ATOM   7945  H  HB3  . ARG A 1 56 ? 8.953   2.962   -7.620  1.00 0.00 ? 56  ARG A HB3  8  
ATOM   7946  H  HG2  . ARG A 1 56 ? 7.832   0.725   -8.506  1.00 0.00 ? 56  ARG A HG2  8  
ATOM   7947  H  HG3  . ARG A 1 56 ? 6.478   1.825   -8.778  1.00 0.00 ? 56  ARG A HG3  8  
ATOM   7948  H  HD2  . ARG A 1 56 ? 8.176   3.345   -9.930  1.00 0.00 ? 56  ARG A HD2  8  
ATOM   7949  H  HD3  . ARG A 1 56 ? 9.253   1.949   -9.921  1.00 0.00 ? 56  ARG A HD3  8  
ATOM   7950  H  HE   . ARG A 1 56 ? 6.632   1.492   -11.063 1.00 0.00 ? 56  ARG A HE   8  
ATOM   7951  H  HH11 . ARG A 1 56 ? 9.957   2.353   -11.634 1.00 0.00 ? 56  ARG A HH11 8  
ATOM   7952  H  HH12 . ARG A 1 56 ? 9.919   1.911   -13.309 1.00 0.00 ? 56  ARG A HH12 8  
ATOM   7953  H  HH21 . ARG A 1 56 ? 6.571   0.906   -13.266 1.00 0.00 ? 56  ARG A HH21 8  
ATOM   7954  H  HH22 . ARG A 1 56 ? 7.993   1.089   -14.237 1.00 0.00 ? 56  ARG A HH22 8  
ATOM   7955  N  N    . PRO A 1 57 ? 9.224   3.350   -4.780  1.00 0.00 ? 57  PRO A N    8  
ATOM   7956  C  CA   . PRO A 1 57 ? 10.337  3.846   -3.965  1.00 0.00 ? 57  PRO A CA   8  
ATOM   7957  C  C    . PRO A 1 57 ? 10.765  2.844   -2.898  1.00 0.00 ? 57  PRO A C    8  
ATOM   7958  O  O    . PRO A 1 57 ? 11.896  2.356   -2.908  1.00 0.00 ? 57  PRO A O    8  
ATOM   7959  C  CB   . PRO A 1 57 ? 9.767   5.108   -3.315  1.00 0.00 ? 57  PRO A CB   8  
ATOM   7960  C  CG   . PRO A 1 57 ? 8.703   5.569   -4.251  1.00 0.00 ? 57  PRO A CG   8  
ATOM   7961  C  CD   . PRO A 1 57 ? 8.150   4.348   -4.921  1.00 0.00 ? 57  PRO A CD   8  
ATOM   7962  H  HA   . PRO A 1 57 ? 11.190  4.106   -4.575  1.00 0.00 ? 57  PRO A HA   8  
ATOM   7963  H  HB2  . PRO A 1 57 ? 9.361   4.864   -2.343  1.00 0.00 ? 57  PRO A HB2  8  
ATOM   7964  H  HB3  . PRO A 1 57 ? 10.547  5.847   -3.210  1.00 0.00 ? 57  PRO A HB3  8  
ATOM   7965  H  HG2  . PRO A 1 57 ? 7.921   6.070   -3.701  1.00 0.00 ? 57  PRO A HG2  8  
ATOM   7966  H  HG3  . PRO A 1 57 ? 9.127   6.231   -4.991  1.00 0.00 ? 57  PRO A HG3  8  
ATOM   7967  H  HD2  . PRO A 1 57 ? 7.252   4.021   -4.418  1.00 0.00 ? 57  PRO A HD2  8  
ATOM   7968  H  HD3  . PRO A 1 57 ? 7.949   4.553   -5.962  1.00 0.00 ? 57  PRO A HD3  8  
ATOM   7969  N  N    . CYS A 1 58 ? 9.855   2.541   -1.978  1.00 0.00 ? 58  CYS A N    8  
ATOM   7970  C  CA   . CYS A 1 58 ? 10.138  1.597   -0.904  1.00 0.00 ? 58  CYS A CA   8  
ATOM   7971  C  C    . CYS A 1 58 ? 10.472  0.218   -1.465  1.00 0.00 ? 58  CYS A C    8  
ATOM   7972  O  O    . CYS A 1 58 ? 11.613  -0.238  -1.381  1.00 0.00 ? 58  CYS A O    8  
ATOM   7973  C  CB   . CYS A 1 58 ? 8.941   1.498   0.044   1.00 0.00 ? 58  CYS A CB   8  
ATOM   7974  S  SG   . CYS A 1 58 ? 8.541   3.054   0.902   1.00 0.00 ? 58  CYS A SG   8  
ATOM   7975  H  H    . CYS A 1 58 ? 8.971   2.963   -2.023  1.00 0.00 ? 58  CYS A H    8  
ATOM   7976  H  HA   . CYS A 1 58 ? 10.991  1.965   -0.355  1.00 0.00 ? 58  CYS A HA   8  
ATOM   7977  H  HB2  . CYS A 1 58 ? 8.069   1.201   -0.520  1.00 0.00 ? 58  CYS A HB2  8  
ATOM   7978  H  HB3  . CYS A 1 58 ? 9.148   0.751   0.796   1.00 0.00 ? 58  CYS A HB3  8  
ATOM   7979  N  N    . HIS A 1 59 ? 9.470   -0.441  -2.037  1.00 0.00 ? 59  HIS A N    8  
ATOM   7980  C  CA   . HIS A 1 59 ? 9.657   -1.768  -2.614  1.00 0.00 ? 59  HIS A CA   8  
ATOM   7981  C  C    . HIS A 1 59 ? 11.032  -1.888  -3.265  1.00 0.00 ? 59  HIS A C    8  
ATOM   7982  O  O    . HIS A 1 59 ? 11.699  -2.915  -3.143  1.00 0.00 ? 59  HIS A O    8  
ATOM   7983  C  CB   . HIS A 1 59 ? 8.565   -2.058  -3.643  1.00 0.00 ? 59  HIS A CB   8  
ATOM   7984  C  CG   . HIS A 1 59 ? 8.682   -3.412  -4.274  1.00 0.00 ? 59  HIS A CG   8  
ATOM   7985  N  ND1  . HIS A 1 59 ? 8.611   -4.586  -3.555  1.00 0.00 ? 59  HIS A ND1  8  
ATOM   7986  C  CD2  . HIS A 1 59 ? 8.865   -3.774  -5.566  1.00 0.00 ? 59  HIS A CD2  8  
ATOM   7987  C  CE1  . HIS A 1 59 ? 8.746   -5.612  -4.377  1.00 0.00 ? 59  HIS A CE1  8  
ATOM   7988  N  NE2  . HIS A 1 59 ? 8.901   -5.146  -5.603  1.00 0.00 ? 59  HIS A NE2  8  
ATOM   7989  H  H    . HIS A 1 59 ? 8.584   -0.025  -2.074  1.00 0.00 ? 59  HIS A H    8  
ATOM   7990  H  HA   . HIS A 1 59 ? 9.587   -2.489  -1.814  1.00 0.00 ? 59  HIS A HA   8  
ATOM   7991  H  HB2  . HIS A 1 59 ? 7.600   -2.000  -3.162  1.00 0.00 ? 59  HIS A HB2  8  
ATOM   7992  H  HB3  . HIS A 1 59 ? 8.615   -1.319  -4.430  1.00 0.00 ? 59  HIS A HB3  8  
ATOM   7993  H  HD1  . HIS A 1 59 ? 8.482   -4.657  -2.587  1.00 0.00 ? 59  HIS A HD1  8  
ATOM   7994  H  HD2  . HIS A 1 59 ? 8.964   -3.107  -6.411  1.00 0.00 ? 59  HIS A HD2  8  
ATOM   7995  H  HE1  . HIS A 1 59 ? 8.732   -6.654  -4.095  1.00 0.00 ? 59  HIS A HE1  8  
ATOM   7996  H  HE2  . HIS A 1 59 ? 9.107   -5.690  -6.391  1.00 0.00 ? 59  HIS A HE2  8  
ATOM   7997  N  N    . ASN A 1 60 ? 11.448  -0.832  -3.956  1.00 0.00 ? 60  ASN A N    8  
ATOM   7998  C  CA   . ASN A 1 60 ? 12.743  -0.820  -4.628  1.00 0.00 ? 60  ASN A CA   8  
ATOM   7999  C  C    . ASN A 1 60 ? 13.882  -0.799  -3.613  1.00 0.00 ? 60  ASN A C    8  
ATOM   8000  O  O    . ASN A 1 60 ? 14.875  -1.511  -3.763  1.00 0.00 ? 60  ASN A O    8  
ATOM   8001  C  CB   . ASN A 1 60 ? 12.849  0.391   -5.556  1.00 0.00 ? 60  ASN A CB   8  
ATOM   8002  C  CG   . ASN A 1 60 ? 12.145  0.168   -6.880  1.00 0.00 ? 60  ASN A CG   8  
ATOM   8003  O  OD1  . ASN A 1 60 ? 12.323  -0.867  -7.523  1.00 0.00 ? 60  ASN A OD1  8  
ATOM   8004  N  ND2  . ASN A 1 60 ? 11.342  1.141   -7.295  1.00 0.00 ? 60  ASN A ND2  8  
ATOM   8005  H  H    . ASN A 1 60 ? 10.872  -0.042  -4.017  1.00 0.00 ? 60  ASN A H    8  
ATOM   8006  H  HA   . ASN A 1 60 ? 12.819  -1.722  -5.217  1.00 0.00 ? 60  ASN A HA   8  
ATOM   8007  H  HB2  . ASN A 1 60 ? 12.401  1.248   -5.072  1.00 0.00 ? 60  ASN A HB2  8  
ATOM   8008  H  HB3  . ASN A 1 60 ? 13.890  0.598   -5.752  1.00 0.00 ? 60  ASN A HB3  8  
ATOM   8009  H  HD21 . ASN A 1 60 ? 11.249  1.937   -6.731  1.00 0.00 ? 60  ASN A HD21 8  
ATOM   8010  H  HD22 . ASN A 1 60 ? 10.874  1.022   -8.148  1.00 0.00 ? 60  ASN A HD22 8  
ATOM   8011  N  N    . ARG A 1 61 ? 13.731  0.024   -2.580  1.00 0.00 ? 61  ARG A N    8  
ATOM   8012  C  CA   . ARG A 1 61 ? 14.747  0.139   -1.540  1.00 0.00 ? 61  ARG A CA   8  
ATOM   8013  C  C    . ARG A 1 61 ? 14.984  -1.206  -0.860  1.00 0.00 ? 61  ARG A C    8  
ATOM   8014  O  O    . ARG A 1 61 ? 16.125  -1.588  -0.602  1.00 0.00 ? 61  ARG A O    8  
ATOM   8015  C  CB   . ARG A 1 61 ? 14.327  1.180   -0.501  1.00 0.00 ? 61  ARG A CB   8  
ATOM   8016  C  CG   . ARG A 1 61 ? 14.432  2.613   -0.997  1.00 0.00 ? 61  ARG A CG   8  
ATOM   8017  C  CD   . ARG A 1 61 ? 13.578  3.555   -0.163  1.00 0.00 ? 61  ARG A CD   8  
ATOM   8018  N  NE   . ARG A 1 61 ? 13.449  4.871   -0.784  1.00 0.00 ? 61  ARG A NE   8  
ATOM   8019  C  CZ   . ARG A 1 61 ? 14.295  5.872   -0.566  1.00 0.00 ? 61  ARG A CZ   8  
ATOM   8020  N  NH1  . ARG A 1 61 ? 15.325  5.708   0.253   1.00 0.00 ? 61  ARG A NH1  8  
ATOM   8021  N  NH2  . ARG A 1 61 ? 14.111  7.040   -1.168  1.00 0.00 ? 61  ARG A NH2  8  
ATOM   8022  H  H    . ARG A 1 61 ? 12.917  0.567   -2.515  1.00 0.00 ? 61  ARG A H    8  
ATOM   8023  H  HA   . ARG A 1 61 ? 15.665  0.460   -2.008  1.00 0.00 ? 61  ARG A HA   8  
ATOM   8024  H  HB2  . ARG A 1 61 ? 13.302  0.995   -0.216  1.00 0.00 ? 61  ARG A HB2  8  
ATOM   8025  H  HB3  . ARG A 1 61 ? 14.958  1.077   0.369   1.00 0.00 ? 61  ARG A HB3  8  
ATOM   8026  H  HG2  . ARG A 1 61 ? 15.462  2.931   -0.937  1.00 0.00 ? 61  ARG A HG2  8  
ATOM   8027  H  HG3  . ARG A 1 61 ? 14.099  2.653   -2.024  1.00 0.00 ? 61  ARG A HG3  8  
ATOM   8028  H  HD2  . ARG A 1 61 ? 12.594  3.124   -0.050  1.00 0.00 ? 61  ARG A HD2  8  
ATOM   8029  H  HD3  . ARG A 1 61 ? 14.035  3.669   0.808   1.00 0.00 ? 61  ARG A HD3  8  
ATOM   8030  H  HE   . ARG A 1 61 ? 12.695  5.014   -1.392  1.00 0.00 ? 61  ARG A HE   8  
ATOM   8031  H  HH11 . ARG A 1 61 ? 15.466  4.829   0.707   1.00 0.00 ? 61  ARG A HH11 8  
ATOM   8032  H  HH12 . ARG A 1 61 ? 15.961  6.463   0.414   1.00 0.00 ? 61  ARG A HH12 8  
ATOM   8033  H  HH21 . ARG A 1 61 ? 13.336  7.168   -1.786  1.00 0.00 ? 61  ARG A HH21 8  
ATOM   8034  H  HH22 . ARG A 1 61 ? 14.747  7.793   -1.003  1.00 0.00 ? 61  ARG A HH22 8  
ATOM   8035  N  N    . GLU A 1 62 ? 13.899  -1.919  -0.574  1.00 0.00 ? 62  GLU A N    8  
ATOM   8036  C  CA   . GLU A 1 62 ? 13.991  -3.221  0.076   1.00 0.00 ? 62  GLU A CA   8  
ATOM   8037  C  C    . GLU A 1 62 ? 14.516  -4.277  -0.892  1.00 0.00 ? 62  GLU A C    8  
ATOM   8038  O  O    . GLU A 1 62 ? 15.603  -4.824  -0.703  1.00 0.00 ? 62  GLU A O    8  
ATOM   8039  C  CB   . GLU A 1 62 ? 12.623  -3.643  0.616   1.00 0.00 ? 62  GLU A CB   8  
ATOM   8040  C  CG   . GLU A 1 62 ? 11.876  -2.525  1.323   1.00 0.00 ? 62  GLU A CG   8  
ATOM   8041  C  CD   . GLU A 1 62 ? 12.199  -2.451  2.802   1.00 0.00 ? 62  GLU A CD   8  
ATOM   8042  O  OE1  . GLU A 1 62 ? 12.603  -3.485  3.374   1.00 0.00 ? 62  GLU A OE1  8  
ATOM   8043  O  OE2  . GLU A 1 62 ? 12.048  -1.359  3.388   1.00 0.00 ? 62  GLU A OE2  8  
ATOM   8044  H  H    . GLU A 1 62 ? 13.017  -1.561  -0.806  1.00 0.00 ? 62  GLU A H    8  
ATOM   8045  H  HA   . GLU A 1 62 ? 14.681  -3.131  0.901   1.00 0.00 ? 62  GLU A HA   8  
ATOM   8046  H  HB2  . GLU A 1 62 ? 12.016  -3.991  -0.207  1.00 0.00 ? 62  GLU A HB2  8  
ATOM   8047  H  HB3  . GLU A 1 62 ? 12.761  -4.454  1.316   1.00 0.00 ? 62  GLU A HB3  8  
ATOM   8048  H  HG2  . GLU A 1 62 ? 12.143  -1.585  0.864   1.00 0.00 ? 62  GLU A HG2  8  
ATOM   8049  H  HG3  . GLU A 1 62 ? 10.814  -2.690  1.209   1.00 0.00 ? 62  GLU A HG3  8  
ATOM   8050  N  N    . LYS A 1 63 ? 13.736  -4.560  -1.929  1.00 0.00 ? 63  LYS A N    8  
ATOM   8051  C  CA   . LYS A 1 63 ? 14.120  -5.550  -2.929  1.00 0.00 ? 63  LYS A CA   8  
ATOM   8052  C  C    . LYS A 1 63 ? 15.529  -5.281  -3.447  1.00 0.00 ? 63  LYS A C    8  
ATOM   8053  O  O    . LYS A 1 63 ? 16.292  -6.210  -3.711  1.00 0.00 ? 63  LYS A O    8  
ATOM   8054  C  CB   . LYS A 1 63 ? 13.127  -5.542  -4.093  1.00 0.00 ? 63  LYS A CB   8  
ATOM   8055  C  CG   . LYS A 1 63 ? 13.274  -4.339  -5.009  1.00 0.00 ? 63  LYS A CG   8  
ATOM   8056  C  CD   . LYS A 1 63 ? 12.022  -4.116  -5.840  1.00 0.00 ? 63  LYS A CD   8  
ATOM   8057  C  CE   . LYS A 1 63 ? 11.814  -5.235  -6.849  1.00 0.00 ? 63  LYS A CE   8  
ATOM   8058  N  NZ   . LYS A 1 63 ? 11.054  -4.772  -8.043  1.00 0.00 ? 63  LYS A NZ   8  
ATOM   8059  H  H    . LYS A 1 63 ? 12.880  -4.091  -2.026  1.00 0.00 ? 63  LYS A H    8  
ATOM   8060  H  HA   . LYS A 1 63 ? 14.102  -6.521  -2.458  1.00 0.00 ? 63  LYS A HA   8  
ATOM   8061  H  HB2  . LYS A 1 63 ? 13.272  -6.436  -4.681  1.00 0.00 ? 63  LYS A HB2  8  
ATOM   8062  H  HB3  . LYS A 1 63 ? 12.123  -5.543  -3.694  1.00 0.00 ? 63  LYS A HB3  8  
ATOM   8063  H  HG2  . LYS A 1 63 ? 13.456  -3.461  -4.409  1.00 0.00 ? 63  LYS A HG2  8  
ATOM   8064  H  HG3  . LYS A 1 63 ? 14.111  -4.504  -5.673  1.00 0.00 ? 63  LYS A HG3  8  
ATOM   8065  H  HD2  . LYS A 1 63 ? 11.166  -4.076  -5.183  1.00 0.00 ? 63  LYS A HD2  8  
ATOM   8066  H  HD3  . LYS A 1 63 ? 12.115  -3.178  -6.370  1.00 0.00 ? 63  LYS A HD3  8  
ATOM   8067  H  HE2  . LYS A 1 63 ? 12.779  -5.599  -7.166  1.00 0.00 ? 63  LYS A HE2  8  
ATOM   8068  H  HE3  . LYS A 1 63 ? 11.267  -6.035  -6.372  1.00 0.00 ? 63  LYS A HE3  8  
ATOM   8069  H  HZ1  . LYS A 1 63 ? 11.578  -5.004  -8.911  1.00 0.00 ? 63  LYS A HZ1  8  
ATOM   8070  H  HZ2  . LYS A 1 63 ? 10.914  -3.743  -8.000  1.00 0.00 ? 63  LYS A HZ2  8  
ATOM   8071  H  HZ3  . LYS A 1 63 ? 10.124  -5.237  -8.077  1.00 0.00 ? 63  LYS A HZ3  8  
ATOM   8072  N  N    . ALA A 1 64 ? 15.869  -4.004  -3.589  1.00 0.00 ? 64  ALA A N    8  
ATOM   8073  C  CA   . ALA A 1 64 ? 17.188  -3.613  -4.072  1.00 0.00 ? 64  ALA A CA   8  
ATOM   8074  C  C    . ALA A 1 64 ? 18.263  -4.569  -3.565  1.00 0.00 ? 64  ALA A C    8  
ATOM   8075  O  O    . ALA A 1 64 ? 18.453  -4.721  -2.359  1.00 0.00 ? 64  ALA A O    8  
ATOM   8076  C  CB   . ALA A 1 64 ? 17.504  -2.187  -3.647  1.00 0.00 ? 64  ALA A CB   8  
ATOM   8077  H  H    . ALA A 1 64 ? 15.218  -3.308  -3.361  1.00 0.00 ? 64  ALA A H    8  
ATOM   8078  H  HA   . ALA A 1 64 ? 17.171  -3.646  -5.152  1.00 0.00 ? 64  ALA A HA   8  
ATOM   8079  H  HB1  . ALA A 1 64 ? 18.573  -2.071  -3.545  1.00 0.00 ? 64  ALA A HB1  8  
ATOM   8080  H  HB2  . ALA A 1 64 ? 17.137  -1.499  -4.395  1.00 0.00 ? 64  ALA A HB2  8  
ATOM   8081  H  HB3  . ALA A 1 64 ? 17.027  -1.979  -2.701  1.00 0.00 ? 64  ALA A HB3  8  
ATOM   8082  N  N    . SER A 1 65 ? 18.964  -5.210  -4.495  1.00 0.00 ? 65  SER A N    8  
ATOM   8083  C  CA   . SER A 1 65 ? 20.017  -6.154  -4.143  1.00 0.00 ? 65  SER A CA   8  
ATOM   8084  C  C    . SER A 1 65 ? 21.317  -5.423  -3.820  1.00 0.00 ? 65  SER A C    8  
ATOM   8085  O  O    . SER A 1 65 ? 21.663  -4.435  -4.466  1.00 0.00 ? 65  SER A O    8  
ATOM   8086  C  CB   . SER A 1 65 ? 20.247  -7.145  -5.285  1.00 0.00 ? 65  SER A CB   8  
ATOM   8087  O  OG   . SER A 1 65 ? 20.957  -8.286  -4.836  1.00 0.00 ? 65  SER A OG   8  
ATOM   8088  H  H    . SER A 1 65 ? 18.765  -5.046  -5.441  1.00 0.00 ? 65  SER A H    8  
ATOM   8089  H  HA   . SER A 1 65 ? 19.696  -6.697  -3.266  1.00 0.00 ? 65  SER A HA   8  
ATOM   8090  H  HB2  . SER A 1 65 ? 19.294  -7.462  -5.681  1.00 0.00 ? 65  SER A HB2  8  
ATOM   8091  H  HB3  . SER A 1 65 ? 20.819  -6.664  -6.066  1.00 0.00 ? 65  SER A HB3  8  
ATOM   8092  H  HG   . SER A 1 65 ? 20.376  -8.836  -4.305  1.00 0.00 ? 65  SER A HG   8  
ATOM   8093  N  N    . GLY A 1 66 ? 22.033  -5.916  -2.814  1.00 0.00 ? 66  GLY A N    8  
ATOM   8094  C  CA   . GLY A 1 66 ? 23.286  -5.298  -2.422  1.00 0.00 ? 66  GLY A CA   8  
ATOM   8095  C  C    . GLY A 1 66 ? 24.493  -6.089  -2.886  1.00 0.00 ? 66  GLY A C    8  
ATOM   8096  O  O    . GLY A 1 66 ? 24.369  -7.128  -3.536  1.00 0.00 ? 66  GLY A O    8  
ATOM   8097  H  H    . GLY A 1 66 ? 21.707  -6.707  -2.334  1.00 0.00 ? 66  GLY A H    8  
ATOM   8098  H  HA2  . GLY A 1 66 ? 23.334  -4.306  -2.846  1.00 0.00 ? 66  GLY A HA2  8  
ATOM   8099  H  HA3  . GLY A 1 66 ? 23.314  -5.220  -1.345  1.00 0.00 ? 66  GLY A HA3  8  
ATOM   8100  N  N    . PRO A 1 67 ? 25.694  -5.595  -2.551  1.00 0.00 ? 67  PRO A N    8  
ATOM   8101  C  CA   . PRO A 1 67 ? 26.951  -6.247  -2.929  1.00 0.00 ? 67  PRO A CA   8  
ATOM   8102  C  C    . PRO A 1 67 ? 27.173  -7.557  -2.180  1.00 0.00 ? 67  PRO A C    8  
ATOM   8103  O  O    . PRO A 1 67 ? 28.202  -8.211  -2.346  1.00 0.00 ? 67  PRO A O    8  
ATOM   8104  C  CB   . PRO A 1 67 ? 28.016  -5.219  -2.535  1.00 0.00 ? 67  PRO A CB   8  
ATOM   8105  C  CG   . PRO A 1 67 ? 27.384  -4.415  -1.452  1.00 0.00 ? 67  PRO A CG   8  
ATOM   8106  C  CD   . PRO A 1 67 ? 25.917  -4.362  -1.778  1.00 0.00 ? 67  PRO A CD   8  
ATOM   8107  H  HA   . PRO A 1 67 ? 27.000  -6.429  -3.992  1.00 0.00 ? 67  PRO A HA   8  
ATOM   8108  H  HB2  . PRO A 1 67 ? 28.901  -5.731  -2.183  1.00 0.00 ? 67  PRO A HB2  8  
ATOM   8109  H  HB3  . PRO A 1 67 ? 28.262  -4.606  -3.388  1.00 0.00 ? 67  PRO A HB3  8  
ATOM   8110  H  HG2  . PRO A 1 67 ? 27.538  -4.897  -0.498  1.00 0.00 ? 67  PRO A HG2  8  
ATOM   8111  H  HG3  . PRO A 1 67 ? 27.801  -3.420  -1.442  1.00 0.00 ? 67  PRO A HG3  8  
ATOM   8112  H  HD2  . PRO A 1 67 ? 25.328  -4.363  -0.872  1.00 0.00 ? 67  PRO A HD2  8  
ATOM   8113  H  HD3  . PRO A 1 67 ? 25.694  -3.489  -2.373  1.00 0.00 ? 67  PRO A HD3  8  
ATOM   8114  N  N    . SER A 1 68 ? 26.201  -7.934  -1.356  1.00 0.00 ? 68  SER A N    8  
ATOM   8115  C  CA   . SER A 1 68 ? 26.291  -9.164  -0.579  1.00 0.00 ? 68  SER A CA   8  
ATOM   8116  C  C    . SER A 1 68 ? 25.046  -10.023 -0.775  1.00 0.00 ? 68  SER A C    8  
ATOM   8117  O  O    . SER A 1 68 ? 23.928  -9.587  -0.499  1.00 0.00 ? 68  SER A O    8  
ATOM   8118  C  CB   . SER A 1 68 ? 26.475  -8.843  0.905   1.00 0.00 ? 68  SER A CB   8  
ATOM   8119  O  OG   . SER A 1 68 ? 26.941  -9.976  1.618   1.00 0.00 ? 68  SER A OG   8  
ATOM   8120  H  H    . SER A 1 68 ? 25.404  -7.369  -1.267  1.00 0.00 ? 68  SER A H    8  
ATOM   8121  H  HA   . SER A 1 68 ? 27.152  -9.715  -0.929  1.00 0.00 ? 68  SER A HA   8  
ATOM   8122  H  HB2  . SER A 1 68 ? 27.195  -8.046  1.012   1.00 0.00 ? 68  SER A HB2  8  
ATOM   8123  H  HB3  . SER A 1 68 ? 25.529  -8.533  1.324   1.00 0.00 ? 68  SER A HB3  8  
ATOM   8124  H  HG   . SER A 1 68 ? 27.378  -10.579 1.012   1.00 0.00 ? 68  SER A HG   8  
ATOM   8125  N  N    . SER A 1 69 ? 25.247  -11.247 -1.252  1.00 0.00 ? 69  SER A N    8  
ATOM   8126  C  CA   . SER A 1 69 ? 24.141  -12.167 -1.489  1.00 0.00 ? 69  SER A CA   8  
ATOM   8127  C  C    . SER A 1 69 ? 23.216  -12.227 -0.277  1.00 0.00 ? 69  SER A C    8  
ATOM   8128  O  O    . SER A 1 69 ? 23.649  -12.039 0.859   1.00 0.00 ? 69  SER A O    8  
ATOM   8129  C  CB   . SER A 1 69 ? 24.673  -13.566 -1.809  1.00 0.00 ? 69  SER A CB   8  
ATOM   8130  O  OG   . SER A 1 69 ? 25.561  -14.017 -0.800  1.00 0.00 ? 69  SER A OG   8  
ATOM   8131  H  H    . SER A 1 69 ? 26.162  -11.537 -1.453  1.00 0.00 ? 69  SER A H    8  
ATOM   8132  H  HA   . SER A 1 69 ? 23.581  -11.802 -2.337  1.00 0.00 ? 69  SER A HA   8  
ATOM   8133  H  HB2  . SER A 1 69 ? 23.845  -14.256 -1.877  1.00 0.00 ? 69  SER A HB2  8  
ATOM   8134  H  HB3  . SER A 1 69 ? 25.200  -13.541 -2.751  1.00 0.00 ? 69  SER A HB3  8  
ATOM   8135  H  HG   . SER A 1 69 ? 26.195  -14.628 -1.182  1.00 0.00 ? 69  SER A HG   8  
ATOM   8136  N  N    . GLY A 1 70 ? 21.937  -12.491 -0.529  1.00 0.00 ? 70  GLY A N    8  
ATOM   8137  C  CA   . GLY A 1 70 ? 20.970  -12.571 0.549   1.00 0.00 ? 70  GLY A CA   8  
ATOM   8138  C  C    . GLY A 1 70 ? 19.595  -12.087 0.132   1.00 0.00 ? 70  GLY A C    8  
ATOM   8139  O  O    . GLY A 1 70 ? 18.855  -11.585 0.977   1.00 0.00 ? 70  GLY A O    8  
ATOM   8140  H  H    . GLY A 1 70 ? 21.648  -12.633 -1.455  1.00 0.00 ? 70  GLY A H    8  
ATOM   8141  H  HA2  . GLY A 1 70 ? 20.895  -13.598 0.875   1.00 0.00 ? 70  GLY A HA2  8  
ATOM   8142  H  HA3  . GLY A 1 70 ? 21.316  -11.967 1.374   1.00 0.00 ? 70  GLY A HA3  8  
HETATM 8143  ZN ZN   . ZN  B 2 .  ? -11.282 4.180   2.462   1.00 0.00 ? 201 ZN  A ZN   8  
HETATM 8144  ZN ZN   . ZN  C 2 .  ? 6.658   3.598   0.294   1.00 0.00 ? 401 ZN  A ZN   8  
ATOM   8145  N  N    . GLY A 1 1  ? -29.282 -8.389  -8.355  1.00 0.00 ? 1   GLY A N    9  
ATOM   8146  C  CA   . GLY A 1 1  ? -27.890 -8.103  -8.061  1.00 0.00 ? 1   GLY A CA   9  
ATOM   8147  C  C    . GLY A 1 1  ? -27.478 -6.713  -8.503  1.00 0.00 ? 1   GLY A C    9  
ATOM   8148  O  O    . GLY A 1 1  ? -27.331 -6.452  -9.697  1.00 0.00 ? 1   GLY A O    9  
ATOM   8149  H  H1   . GLY A 1 1  ? -29.861 -7.684  -8.714  1.00 0.00 ? 1   GLY A H1   9  
ATOM   8150  H  HA2  . GLY A 1 1  ? -27.733 -8.192  -6.996  1.00 0.00 ? 1   GLY A HA2  9  
ATOM   8151  H  HA3  . GLY A 1 1  ? -27.271 -8.828  -8.568  1.00 0.00 ? 1   GLY A HA3  9  
ATOM   8152  N  N    . SER A 1 2  ? -27.294 -5.817  -7.539  1.00 0.00 ? 2   SER A N    9  
ATOM   8153  C  CA   . SER A 1 2  ? -26.902 -4.444  -7.836  1.00 0.00 ? 2   SER A CA   9  
ATOM   8154  C  C    . SER A 1 2  ? -25.493 -4.396  -8.420  1.00 0.00 ? 2   SER A C    9  
ATOM   8155  O  O    . SER A 1 2  ? -24.551 -4.941  -7.844  1.00 0.00 ? 2   SER A O    9  
ATOM   8156  C  CB   . SER A 1 2  ? -26.971 -3.587  -6.570  1.00 0.00 ? 2   SER A CB   9  
ATOM   8157  O  OG   . SER A 1 2  ? -28.309 -3.227  -6.271  1.00 0.00 ? 2   SER A OG   9  
ATOM   8158  H  H    . SER A 1 2  ? -27.427 -6.086  -6.606  1.00 0.00 ? 2   SER A H    9  
ATOM   8159  H  HA   . SER A 1 2  ? -27.595 -4.052  -8.565  1.00 0.00 ? 2   SER A HA   9  
ATOM   8160  H  HB2  . SER A 1 2  ? -26.566 -4.143  -5.739  1.00 0.00 ? 2   SER A HB2  9  
ATOM   8161  H  HB3  . SER A 1 2  ? -26.392 -2.686  -6.717  1.00 0.00 ? 2   SER A HB3  9  
ATOM   8162  H  HG   . SER A 1 2  ? -28.868 -4.005  -6.320  1.00 0.00 ? 2   SER A HG   9  
ATOM   8163  N  N    . SER A 1 3  ? -25.357 -3.739  -9.567  1.00 0.00 ? 3   SER A N    9  
ATOM   8164  C  CA   . SER A 1 3  ? -24.065 -3.622  -10.233 1.00 0.00 ? 3   SER A CA   9  
ATOM   8165  C  C    . SER A 1 3  ? -23.160 -2.641  -9.493  1.00 0.00 ? 3   SER A C    9  
ATOM   8166  O  O    . SER A 1 3  ? -23.052 -1.475  -9.868  1.00 0.00 ? 3   SER A O    9  
ATOM   8167  C  CB   . SER A 1 3  ? -24.253 -3.166  -11.681 1.00 0.00 ? 3   SER A CB   9  
ATOM   8168  O  OG   . SER A 1 3  ? -25.068 -4.076  -12.400 1.00 0.00 ? 3   SER A OG   9  
ATOM   8169  H  H    . SER A 1 3  ? -26.146 -3.326  -9.977  1.00 0.00 ? 3   SER A H    9  
ATOM   8170  H  HA   . SER A 1 3  ? -23.600 -4.596  -10.228 1.00 0.00 ? 3   SER A HA   9  
ATOM   8171  H  HB2  . SER A 1 3  ? -24.723 -2.195  -11.692 1.00 0.00 ? 3   SER A HB2  9  
ATOM   8172  H  HB3  . SER A 1 3  ? -23.289 -3.106  -12.165 1.00 0.00 ? 3   SER A HB3  9  
ATOM   8173  H  HG   . SER A 1 3  ? -25.631 -4.555  -11.787 1.00 0.00 ? 3   SER A HG   9  
ATOM   8174  N  N    . GLY A 1 4  ? -22.511 -3.125  -8.438  1.00 0.00 ? 4   GLY A N    9  
ATOM   8175  C  CA   . GLY A 1 4  ? -21.623 -2.279  -7.661  1.00 0.00 ? 4   GLY A CA   9  
ATOM   8176  C  C    . GLY A 1 4  ? -21.235 -2.908  -6.338  1.00 0.00 ? 4   GLY A C    9  
ATOM   8177  O  O    . GLY A 1 4  ? -20.470 -3.872  -6.302  1.00 0.00 ? 4   GLY A O    9  
ATOM   8178  H  H    . GLY A 1 4  ? -22.636 -4.064  -8.186  1.00 0.00 ? 4   GLY A H    9  
ATOM   8179  H  HA2  . GLY A 1 4  ? -20.729 -2.092  -8.236  1.00 0.00 ? 4   GLY A HA2  9  
ATOM   8180  H  HA3  . GLY A 1 4  ? -22.119 -1.339  -7.468  1.00 0.00 ? 4   GLY A HA3  9  
ATOM   8181  N  N    . SER A 1 5  ? -21.761 -2.360  -5.247  1.00 0.00 ? 5   SER A N    9  
ATOM   8182  C  CA   . SER A 1 5  ? -21.460 -2.870  -3.915  1.00 0.00 ? 5   SER A CA   9  
ATOM   8183  C  C    . SER A 1 5  ? -19.953 -2.972  -3.699  1.00 0.00 ? 5   SER A C    9  
ATOM   8184  O  O    . SER A 1 5  ? -19.463 -3.932  -3.105  1.00 0.00 ? 5   SER A O    9  
ATOM   8185  C  CB   . SER A 1 5  ? -22.110 -4.240  -3.711  1.00 0.00 ? 5   SER A CB   9  
ATOM   8186  O  OG   . SER A 1 5  ? -23.504 -4.184  -3.955  1.00 0.00 ? 5   SER A OG   9  
ATOM   8187  H  H    . SER A 1 5  ? -22.364 -1.593  -5.341  1.00 0.00 ? 5   SER A H    9  
ATOM   8188  H  HA   . SER A 1 5  ? -21.869 -2.177  -3.194  1.00 0.00 ? 5   SER A HA   9  
ATOM   8189  H  HB2  . SER A 1 5  ? -21.666 -4.951  -4.391  1.00 0.00 ? 5   SER A HB2  9  
ATOM   8190  H  HB3  . SER A 1 5  ? -21.947 -4.565  -2.694  1.00 0.00 ? 5   SER A HB3  9  
ATOM   8191  H  HG   . SER A 1 5  ? -23.676 -3.611  -4.706  1.00 0.00 ? 5   SER A HG   9  
ATOM   8192  N  N    . SER A 1 6  ? -19.223 -1.974  -4.187  1.00 0.00 ? 6   SER A N    9  
ATOM   8193  C  CA   . SER A 1 6  ? -17.771 -1.952  -4.052  1.00 0.00 ? 6   SER A CA   9  
ATOM   8194  C  C    . SER A 1 6  ? -17.337 -0.912  -3.024  1.00 0.00 ? 6   SER A C    9  
ATOM   8195  O  O    . SER A 1 6  ? -17.270 0.280   -3.320  1.00 0.00 ? 6   SER A O    9  
ATOM   8196  C  CB   . SER A 1 6  ? -17.117 -1.654  -5.403  1.00 0.00 ? 6   SER A CB   9  
ATOM   8197  O  OG   . SER A 1 6  ? -17.269 -2.745  -6.294  1.00 0.00 ? 6   SER A OG   9  
ATOM   8198  H  H    . SER A 1 6  ? -19.672 -1.236  -4.651  1.00 0.00 ? 6   SER A H    9  
ATOM   8199  H  HA   . SER A 1 6  ? -17.455 -2.928  -3.716  1.00 0.00 ? 6   SER A HA   9  
ATOM   8200  H  HB2  . SER A 1 6  ? -17.579 -0.781  -5.839  1.00 0.00 ? 6   SER A HB2  9  
ATOM   8201  H  HB3  . SER A 1 6  ? -16.063 -1.468  -5.255  1.00 0.00 ? 6   SER A HB3  9  
ATOM   8202  H  HG   . SER A 1 6  ? -17.401 -3.553  -5.793  1.00 0.00 ? 6   SER A HG   9  
ATOM   8203  N  N    . GLY A 1 7  ? -17.043 -1.374  -1.812  1.00 0.00 ? 7   GLY A N    9  
ATOM   8204  C  CA   . GLY A 1 7  ? -16.620 -0.472  -0.757  1.00 0.00 ? 7   GLY A CA   9  
ATOM   8205  C  C    . GLY A 1 7  ? -15.145 -0.610  -0.434  1.00 0.00 ? 7   GLY A C    9  
ATOM   8206  O  O    . GLY A 1 7  ? -14.547 -1.661  -0.664  1.00 0.00 ? 7   GLY A O    9  
ATOM   8207  H  H    . GLY A 1 7  ? -17.115 -2.335  -1.633  1.00 0.00 ? 7   GLY A H    9  
ATOM   8208  H  HA2  . GLY A 1 7  ? -16.817 0.544   -1.066  1.00 0.00 ? 7   GLY A HA2  9  
ATOM   8209  H  HA3  . GLY A 1 7  ? -17.192 -0.684  0.134   1.00 0.00 ? 7   GLY A HA3  9  
ATOM   8210  N  N    . CYS A 1 8  ? -14.556 0.455   0.099   1.00 0.00 ? 8   CYS A N    9  
ATOM   8211  C  CA   . CYS A 1 8  ? -13.141 0.450   0.452   1.00 0.00 ? 8   CYS A CA   9  
ATOM   8212  C  C    . CYS A 1 8  ? -12.868 -0.531  1.588   1.00 0.00 ? 8   CYS A C    9  
ATOM   8213  O  O    . CYS A 1 8  ? -13.685 -0.691  2.495   1.00 0.00 ? 8   CYS A O    9  
ATOM   8214  C  CB   . CYS A 1 8  ? -12.690 1.855   0.857   1.00 0.00 ? 8   CYS A CB   9  
ATOM   8215  S  SG   . CYS A 1 8  ? -11.098 1.899   1.742   1.00 0.00 ? 8   CYS A SG   9  
ATOM   8216  H  H    . CYS A 1 8  ? -15.085 1.266   0.259   1.00 0.00 ? 8   CYS A H    9  
ATOM   8217  H  HA   . CYS A 1 8  ? -12.583 0.140   -0.418  1.00 0.00 ? 8   CYS A HA   9  
ATOM   8218  H  HB2  . CYS A 1 8  ? -12.589 2.462   -0.031  1.00 0.00 ? 8   CYS A HB2  9  
ATOM   8219  H  HB3  . CYS A 1 8  ? -13.438 2.293   1.502   1.00 0.00 ? 8   CYS A HB3  9  
ATOM   8220  N  N    . HIS A 1 9  ? -11.712 -1.186  1.532   1.00 0.00 ? 9   HIS A N    9  
ATOM   8221  C  CA   . HIS A 1 9  ? -11.330 -2.151  2.556   1.00 0.00 ? 9   HIS A CA   9  
ATOM   8222  C  C    . HIS A 1 9  ? -10.522 -1.478  3.662   1.00 0.00 ? 9   HIS A C    9  
ATOM   8223  O  O    . HIS A 1 9  ? -10.684 -1.793  4.841   1.00 0.00 ? 9   HIS A O    9  
ATOM   8224  C  CB   . HIS A 1 9  ? -10.519 -3.289  1.937   1.00 0.00 ? 9   HIS A CB   9  
ATOM   8225  C  CG   . HIS A 1 9  ? -10.306 -4.447  2.864   1.00 0.00 ? 9   HIS A CG   9  
ATOM   8226  N  ND1  . HIS A 1 9  ? -11.305 -4.966  3.660   1.00 0.00 ? 9   HIS A ND1  9  
ATOM   8227  C  CD2  . HIS A 1 9  ? -9.201  -5.186  3.117   1.00 0.00 ? 9   HIS A CD2  9  
ATOM   8228  C  CE1  . HIS A 1 9  ? -10.823 -5.975  4.365   1.00 0.00 ? 9   HIS A CE1  9  
ATOM   8229  N  NE2  . HIS A 1 9  ? -9.549  -6.129  4.053   1.00 0.00 ? 9   HIS A NE2  9  
ATOM   8230  H  H    . HIS A 1 9  ? -11.102 -1.015  0.784   1.00 0.00 ? 9   HIS A H    9  
ATOM   8231  H  HA   . HIS A 1 9  ? -12.234 -2.556  2.984   1.00 0.00 ? 9   HIS A HA   9  
ATOM   8232  H  HB2  . HIS A 1 9  ? -11.036 -3.656  1.062   1.00 0.00 ? 9   HIS A HB2  9  
ATOM   8233  H  HB3  . HIS A 1 9  ? -9.548  -2.914  1.645   1.00 0.00 ? 9   HIS A HB3  9  
ATOM   8234  H  HD1  . HIS A 1 9  ? -12.228 -4.643  3.703   1.00 0.00 ? 9   HIS A HD1  9  
ATOM   8235  H  HD2  . HIS A 1 9  ? -8.227  -5.059  2.668   1.00 0.00 ? 9   HIS A HD2  9  
ATOM   8236  H  HE1  . HIS A 1 9  ? -11.376 -6.572  5.074   1.00 0.00 ? 9   HIS A HE1  9  
ATOM   8237  H  HE2  . HIS A 1 9  ? -8.932  -6.750  4.493   1.00 0.00 ? 9   HIS A HE2  9  
ATOM   8238  N  N    . GLN A 1 10 ? -9.652  -0.552  3.273   1.00 0.00 ? 10  GLN A N    9  
ATOM   8239  C  CA   . GLN A 1 10 ? -8.818  0.164   4.232   1.00 0.00 ? 10  GLN A CA   9  
ATOM   8240  C  C    . GLN A 1 10 ? -9.645  0.644   5.420   1.00 0.00 ? 10  GLN A C    9  
ATOM   8241  O  O    . GLN A 1 10 ? -9.478  0.163   6.541   1.00 0.00 ? 10  GLN A O    9  
ATOM   8242  C  CB   . GLN A 1 10 ? -8.134  1.354   3.557   1.00 0.00 ? 10  GLN A CB   9  
ATOM   8243  C  CG   . GLN A 1 10 ? -7.285  2.185   4.505   1.00 0.00 ? 10  GLN A CG   9  
ATOM   8244  C  CD   . GLN A 1 10 ? -6.054  1.444   4.988   1.00 0.00 ? 10  GLN A CD   9  
ATOM   8245  O  OE1  . GLN A 1 10 ? -6.139  0.583   5.864   1.00 0.00 ? 10  GLN A OE1  9  
ATOM   8246  N  NE2  . GLN A 1 10 ? -4.901  1.777   4.420   1.00 0.00 ? 10  GLN A NE2  9  
ATOM   8247  H  H    . GLN A 1 10 ? -9.569  -0.345  2.319   1.00 0.00 ? 10  GLN A H    9  
ATOM   8248  H  HA   . GLN A 1 10 ? -8.062  -0.520  4.588   1.00 0.00 ? 10  GLN A HA   9  
ATOM   8249  H  HB2  . GLN A 1 10 ? -7.498  0.987   2.765   1.00 0.00 ? 10  GLN A HB2  9  
ATOM   8250  H  HB3  . GLN A 1 10 ? -8.892  1.995   3.130   1.00 0.00 ? 10  GLN A HB3  9  
ATOM   8251  H  HG2  . GLN A 1 10 ? -6.968  3.081   3.992   1.00 0.00 ? 10  GLN A HG2  9  
ATOM   8252  H  HG3  . GLN A 1 10 ? -7.885  2.456   5.361   1.00 0.00 ? 10  GLN A HG3  9  
ATOM   8253  H  HE21 . GLN A 1 10 ? -4.910  2.473   3.730   1.00 0.00 ? 10  GLN A HE21 9  
ATOM   8254  H  HE22 . GLN A 1 10 ? -4.090  1.314   4.714   1.00 0.00 ? 10  GLN A HE22 9  
ATOM   8255  N  N    . CYS A 1 11 ? -10.536 1.597   5.168   1.00 0.00 ? 11  CYS A N    9  
ATOM   8256  C  CA   . CYS A 1 11 ? -11.389 2.144   6.216   1.00 0.00 ? 11  CYS A CA   9  
ATOM   8257  C  C    . CYS A 1 11 ? -12.714 1.389   6.289   1.00 0.00 ? 11  CYS A C    9  
ATOM   8258  O  O    . CYS A 1 11 ? -13.192 1.057   7.372   1.00 0.00 ? 11  CYS A O    9  
ATOM   8259  C  CB   . CYS A 1 11 ? -11.650 3.630   5.966   1.00 0.00 ? 11  CYS A CB   9  
ATOM   8260  S  SG   . CYS A 1 11 ? -12.493 3.983   4.391   1.00 0.00 ? 11  CYS A SG   9  
ATOM   8261  H  H    . CYS A 1 11 ? -10.623 1.941   4.253   1.00 0.00 ? 11  CYS A H    9  
ATOM   8262  H  HA   . CYS A 1 11 ? -10.873 2.031   7.157   1.00 0.00 ? 11  CYS A HA   9  
ATOM   8263  H  HB2  . CYS A 1 11 ? -12.268 4.018   6.763   1.00 0.00 ? 11  CYS A HB2  9  
ATOM   8264  H  HB3  . CYS A 1 11 ? -10.707 4.157   5.960   1.00 0.00 ? 11  CYS A HB3  9  
ATOM   8265  N  N    . GLY A 1 12 ? -13.301 1.122   5.126   1.00 0.00 ? 12  GLY A N    9  
ATOM   8266  C  CA   . GLY A 1 12 ? -14.564 0.409   5.080   1.00 0.00 ? 12  GLY A CA   9  
ATOM   8267  C  C    . GLY A 1 12 ? -15.655 1.206   4.393   1.00 0.00 ? 12  GLY A C    9  
ATOM   8268  O  O    . GLY A 1 12 ? -16.483 0.646   3.676   1.00 0.00 ? 12  GLY A O    9  
ATOM   8269  H  H    . GLY A 1 12 ? -12.873 1.412   4.293   1.00 0.00 ? 12  GLY A H    9  
ATOM   8270  H  HA2  . GLY A 1 12 ? -14.422 -0.519  4.547   1.00 0.00 ? 12  GLY A HA2  9  
ATOM   8271  H  HA3  . GLY A 1 12 ? -14.877 0.188   6.090   1.00 0.00 ? 12  GLY A HA3  9  
ATOM   8272  N  N    . GLU A 1 13 ? -15.657 2.517   4.615   1.00 0.00 ? 13  GLU A N    9  
ATOM   8273  C  CA   . GLU A 1 13 ? -16.657 3.392   4.014   1.00 0.00 ? 13  GLU A CA   9  
ATOM   8274  C  C    . GLU A 1 13 ? -16.809 3.101   2.524   1.00 0.00 ? 13  GLU A C    9  
ATOM   8275  O  O    . GLU A 1 13 ? -15.863 2.667   1.865   1.00 0.00 ? 13  GLU A O    9  
ATOM   8276  C  CB   . GLU A 1 13 ? -16.275 4.859   4.222   1.00 0.00 ? 13  GLU A CB   9  
ATOM   8277  C  CG   . GLU A 1 13 ? -16.060 5.231   5.680   1.00 0.00 ? 13  GLU A CG   9  
ATOM   8278  C  CD   . GLU A 1 13 ? -17.362 5.376   6.443   1.00 0.00 ? 13  GLU A CD   9  
ATOM   8279  O  OE1  . GLU A 1 13 ? -17.863 4.357   6.963   1.00 0.00 ? 13  GLU A OE1  9  
ATOM   8280  O  OE2  . GLU A 1 13 ? -17.881 6.510   6.520   1.00 0.00 ? 13  GLU A OE2  9  
ATOM   8281  H  H    . GLU A 1 13 ? -14.970 2.905   5.197   1.00 0.00 ? 13  GLU A H    9  
ATOM   8282  H  HA   . GLU A 1 13 ? -17.601 3.202   4.503   1.00 0.00 ? 13  GLU A HA   9  
ATOM   8283  H  HB2  . GLU A 1 13 ? -15.363 5.061   3.682   1.00 0.00 ? 13  GLU A HB2  9  
ATOM   8284  H  HB3  . GLU A 1 13 ? -17.063 5.482   3.826   1.00 0.00 ? 13  GLU A HB3  9  
ATOM   8285  H  HG2  . GLU A 1 13 ? -15.469 4.460   6.151   1.00 0.00 ? 13  GLU A HG2  9  
ATOM   8286  H  HG3  . GLU A 1 13 ? -15.528 6.169   5.724   1.00 0.00 ? 13  GLU A HG3  9  
ATOM   8287  N  N    . PHE A 1 14 ? -18.005 3.342   1.999   1.00 0.00 ? 14  PHE A N    9  
ATOM   8288  C  CA   . PHE A 1 14 ? -18.283 3.105   0.587   1.00 0.00 ? 14  PHE A CA   9  
ATOM   8289  C  C    . PHE A 1 14 ? -17.606 4.159   -0.285  1.00 0.00 ? 14  PHE A C    9  
ATOM   8290  O  O    . PHE A 1 14 ? -17.580 5.341   0.060   1.00 0.00 ? 14  PHE A O    9  
ATOM   8291  C  CB   . PHE A 1 14 ? -19.792 3.110   0.334   1.00 0.00 ? 14  PHE A CB   9  
ATOM   8292  C  CG   . PHE A 1 14 ? -20.188 2.417   -0.938  1.00 0.00 ? 14  PHE A CG   9  
ATOM   8293  C  CD1  . PHE A 1 14 ? -19.903 1.074   -1.129  1.00 0.00 ? 14  PHE A CD1  9  
ATOM   8294  C  CD2  . PHE A 1 14 ? -20.847 3.107   -1.943  1.00 0.00 ? 14  PHE A CD2  9  
ATOM   8295  C  CE1  . PHE A 1 14 ? -20.266 0.434   -2.299  1.00 0.00 ? 14  PHE A CE1  9  
ATOM   8296  C  CE2  . PHE A 1 14 ? -21.213 2.472   -3.115  1.00 0.00 ? 14  PHE A CE2  9  
ATOM   8297  C  CZ   . PHE A 1 14 ? -20.923 1.134   -3.293  1.00 0.00 ? 14  PHE A CZ   9  
ATOM   8298  H  H    . PHE A 1 14 ? -18.719 3.688   2.575   1.00 0.00 ? 14  PHE A H    9  
ATOM   8299  H  HA   . PHE A 1 14 ? -17.886 2.135   0.330   1.00 0.00 ? 14  PHE A HA   9  
ATOM   8300  H  HB2  . PHE A 1 14 ? -20.288 2.610   1.152   1.00 0.00 ? 14  PHE A HB2  9  
ATOM   8301  H  HB3  . PHE A 1 14 ? -20.137 4.131   0.278   1.00 0.00 ? 14  PHE A HB3  9  
ATOM   8302  H  HD1  . PHE A 1 14 ? -19.390 0.525   -0.353  1.00 0.00 ? 14  PHE A HD1  9  
ATOM   8303  H  HD2  . PHE A 1 14 ? -21.075 4.155   -1.804  1.00 0.00 ? 14  PHE A HD2  9  
ATOM   8304  H  HE1  . PHE A 1 14 ? -20.038 -0.612  -2.436  1.00 0.00 ? 14  PHE A HE1  9  
ATOM   8305  H  HE2  . PHE A 1 14 ? -21.727 3.023   -3.889  1.00 0.00 ? 14  PHE A HE2  9  
ATOM   8306  H  HZ   . PHE A 1 14 ? -21.207 0.636   -4.208  1.00 0.00 ? 14  PHE A HZ   9  
ATOM   8307  N  N    . ILE A 1 15 ? -17.061 3.723   -1.415  1.00 0.00 ? 15  ILE A N    9  
ATOM   8308  C  CA   . ILE A 1 15 ? -16.385 4.628   -2.336  1.00 0.00 ? 15  ILE A CA   9  
ATOM   8309  C  C    . ILE A 1 15 ? -17.363 5.210   -3.351  1.00 0.00 ? 15  ILE A C    9  
ATOM   8310  O  O    . ILE A 1 15 ? -18.128 4.479   -3.981  1.00 0.00 ? 15  ILE A O    9  
ATOM   8311  C  CB   . ILE A 1 15 ? -15.245 3.918   -3.088  1.00 0.00 ? 15  ILE A CB   9  
ATOM   8312  C  CG1  . ILE A 1 15 ? -14.442 3.037   -2.128  1.00 0.00 ? 15  ILE A CG1  9  
ATOM   8313  C  CG2  . ILE A 1 15 ? -14.339 4.937   -3.763  1.00 0.00 ? 15  ILE A CG2  9  
ATOM   8314  C  CD1  . ILE A 1 15 ? -13.710 1.906   -2.815  1.00 0.00 ? 15  ILE A CD1  9  
ATOM   8315  H  H    . ILE A 1 15 ? -17.115 2.770   -1.635  1.00 0.00 ? 15  ILE A H    9  
ATOM   8316  H  HA   . ILE A 1 15 ? -15.960 5.436   -1.758  1.00 0.00 ? 15  ILE A HA   9  
ATOM   8317  H  HB   . ILE A 1 15 ? -15.681 3.296   -3.855  1.00 0.00 ? 15  ILE A HB   9  
ATOM   8318  H  HG12 . ILE A 1 15 ? -13.710 3.644   -1.620  1.00 0.00 ? 15  ILE A HG12 9  
ATOM   8319  H  HG13 . ILE A 1 15 ? -15.114 2.606   -1.401  1.00 0.00 ? 15  ILE A HG13 9  
ATOM   8320  H  HG21 . ILE A 1 15 ? -13.502 5.159   -3.117  1.00 0.00 ? 15  ILE A HG21 9  
ATOM   8321  H  HG22 . ILE A 1 15 ? -13.975 4.534   -4.696  1.00 0.00 ? 15  ILE A HG22 9  
ATOM   8322  H  HG23 . ILE A 1 15 ? -14.896 5.842   -3.954  1.00 0.00 ? 15  ILE A HG23 9  
ATOM   8323  H  HD11 . ILE A 1 15 ? -14.272 0.991   -2.701  1.00 0.00 ? 15  ILE A HD11 9  
ATOM   8324  H  HD12 . ILE A 1 15 ? -13.598 2.133   -3.864  1.00 0.00 ? 15  ILE A HD12 9  
ATOM   8325  H  HD13 . ILE A 1 15 ? -12.733 1.785   -2.368  1.00 0.00 ? 15  ILE A HD13 9  
ATOM   8326  N  N    . ILE A 1 16 ? -17.332 6.530   -3.505  1.00 0.00 ? 16  ILE A N    9  
ATOM   8327  C  CA   . ILE A 1 16 ? -18.213 7.210   -4.446  1.00 0.00 ? 16  ILE A CA   9  
ATOM   8328  C  C    . ILE A 1 16 ? -17.425 8.134   -5.368  1.00 0.00 ? 16  ILE A C    9  
ATOM   8329  O  O    . ILE A 1 16 ? -16.782 9.080   -4.914  1.00 0.00 ? 16  ILE A O    9  
ATOM   8330  C  CB   . ILE A 1 16 ? -19.292 8.030   -3.714  1.00 0.00 ? 16  ILE A CB   9  
ATOM   8331  C  CG1  . ILE A 1 16 ? -19.976 7.176   -2.645  1.00 0.00 ? 16  ILE A CG1  9  
ATOM   8332  C  CG2  . ILE A 1 16 ? -20.313 8.566   -4.706  1.00 0.00 ? 16  ILE A CG2  9  
ATOM   8333  C  CD1  . ILE A 1 16 ? -20.905 7.962   -1.746  1.00 0.00 ? 16  ILE A CD1  9  
ATOM   8334  H  H    . ILE A 1 16 ? -16.700 7.058   -2.974  1.00 0.00 ? 16  ILE A H    9  
ATOM   8335  H  HA   . ILE A 1 16 ? -18.706 6.457   -5.044  1.00 0.00 ? 16  ILE A HA   9  
ATOM   8336  H  HB   . ILE A 1 16 ? -18.812 8.872   -3.239  1.00 0.00 ? 16  ILE A HB   9  
ATOM   8337  H  HG12 . ILE A 1 16 ? -20.556 6.405   -3.127  1.00 0.00 ? 16  ILE A HG12 9  
ATOM   8338  H  HG13 . ILE A 1 16 ? -19.221 6.717   -2.024  1.00 0.00 ? 16  ILE A HG13 9  
ATOM   8339  H  HG21 . ILE A 1 16 ? -20.185 9.633   -4.814  1.00 0.00 ? 16  ILE A HG21 9  
ATOM   8340  H  HG22 . ILE A 1 16 ? -20.169 8.089   -5.664  1.00 0.00 ? 16  ILE A HG22 9  
ATOM   8341  H  HG23 . ILE A 1 16 ? -21.309 8.358   -4.346  1.00 0.00 ? 16  ILE A HG23 9  
ATOM   8342  H  HD11 . ILE A 1 16 ? -21.128 8.915   -2.203  1.00 0.00 ? 16  ILE A HD11 9  
ATOM   8343  H  HD12 . ILE A 1 16 ? -21.820 7.408   -1.601  1.00 0.00 ? 16  ILE A HD12 9  
ATOM   8344  H  HD13 . ILE A 1 16 ? -20.427 8.125   -0.791  1.00 0.00 ? 16  ILE A HD13 9  
ATOM   8345  N  N    . GLY A 1 17 ? -17.481 7.855   -6.666  1.00 0.00 ? 17  GLY A N    9  
ATOM   8346  C  CA   . GLY A 1 17 ? -16.770 8.671   -7.632  1.00 0.00 ? 17  GLY A CA   9  
ATOM   8347  C  C    . GLY A 1 17 ? -15.573 7.956   -8.226  1.00 0.00 ? 17  GLY A C    9  
ATOM   8348  O  O    . GLY A 1 17 ? -15.609 7.521   -9.377  1.00 0.00 ? 17  GLY A O    9  
ATOM   8349  H  H    . GLY A 1 17 ? -18.010 7.088   -6.971  1.00 0.00 ? 17  GLY A H    9  
ATOM   8350  H  HA2  . GLY A 1 17 ? -17.448 8.939   -8.429  1.00 0.00 ? 17  GLY A HA2  9  
ATOM   8351  H  HA3  . GLY A 1 17 ? -16.430 9.573   -7.144  1.00 0.00 ? 17  GLY A HA3  9  
ATOM   8352  N  N    . ARG A 1 18 ? -14.508 7.836   -7.440  1.00 0.00 ? 18  ARG A N    9  
ATOM   8353  C  CA   . ARG A 1 18 ? -13.293 7.172   -7.896  1.00 0.00 ? 18  ARG A CA   9  
ATOM   8354  C  C    . ARG A 1 18 ? -13.004 5.931   -7.056  1.00 0.00 ? 18  ARG A C    9  
ATOM   8355  O  O    . ARG A 1 18 ? -12.819 6.019   -5.842  1.00 0.00 ? 18  ARG A O    9  
ATOM   8356  C  CB   . ARG A 1 18 ? -12.105 8.133   -7.830  1.00 0.00 ? 18  ARG A CB   9  
ATOM   8357  C  CG   . ARG A 1 18 ? -10.754 7.437   -7.880  1.00 0.00 ? 18  ARG A CG   9  
ATOM   8358  C  CD   . ARG A 1 18 ? -9.670  8.363   -8.408  1.00 0.00 ? 18  ARG A CD   9  
ATOM   8359  N  NE   . ARG A 1 18 ? -8.594  7.627   -9.066  1.00 0.00 ? 18  ARG A NE   9  
ATOM   8360  C  CZ   . ARG A 1 18 ? -8.644  7.227   -10.331 1.00 0.00 ? 18  ARG A CZ   9  
ATOM   8361  N  NH1  . ARG A 1 18 ? -9.712  7.491   -11.072 1.00 0.00 ? 18  ARG A NH1  9  
ATOM   8362  N  NH2  . ARG A 1 18 ? -7.624  6.561   -10.859 1.00 0.00 ? 18  ARG A NH2  9  
ATOM   8363  H  H    . ARG A 1 18 ? -14.539 8.204   -6.532  1.00 0.00 ? 18  ARG A H    9  
ATOM   8364  H  HA   . ARG A 1 18 ? -13.444 6.870   -8.921  1.00 0.00 ? 18  ARG A HA   9  
ATOM   8365  H  HB2  . ARG A 1 18 ? -12.163 8.817   -8.663  1.00 0.00 ? 18  ARG A HB2  9  
ATOM   8366  H  HB3  . ARG A 1 18 ? -12.162 8.694   -6.909  1.00 0.00 ? 18  ARG A HB3  9  
ATOM   8367  H  HG2  . ARG A 1 18 ? -10.487 7.118   -6.884  1.00 0.00 ? 18  ARG A HG2  9  
ATOM   8368  H  HG3  . ARG A 1 18 ? -10.828 6.576   -8.529  1.00 0.00 ? 18  ARG A HG3  9  
ATOM   8369  H  HD2  . ARG A 1 18 ? -10.112 9.046   -9.118  1.00 0.00 ? 18  ARG A HD2  9  
ATOM   8370  H  HD3  . ARG A 1 18 ? -9.258  8.921   -7.580  1.00 0.00 ? 18  ARG A HD3  9  
ATOM   8371  H  HE   . ARG A 1 18 ? -7.795  7.421   -8.537  1.00 0.00 ? 18  ARG A HE   9  
ATOM   8372  H  HH11 . ARG A 1 18 ? -10.481 7.993   -10.677 1.00 0.00 ? 18  ARG A HH11 9  
ATOM   8373  H  HH12 . ARG A 1 18 ? -9.747  7.189   -12.025 1.00 0.00 ? 18  ARG A HH12 9  
ATOM   8374  H  HH21 . ARG A 1 18 ? -6.818  6.361   -10.304 1.00 0.00 ? 18  ARG A HH21 9  
ATOM   8375  H  HH22 . ARG A 1 18 ? -7.663  6.260   -11.811 1.00 0.00 ? 18  ARG A HH22 9  
ATOM   8376  N  N    . VAL A 1 19 ? -12.967 4.774   -7.711  1.00 0.00 ? 19  VAL A N    9  
ATOM   8377  C  CA   . VAL A 1 19 ? -12.701 3.516   -7.025  1.00 0.00 ? 19  VAL A CA   9  
ATOM   8378  C  C    . VAL A 1 19 ? -11.357 2.933   -7.449  1.00 0.00 ? 19  VAL A C    9  
ATOM   8379  O  O    . VAL A 1 19 ? -11.151 2.610   -8.619  1.00 0.00 ? 19  VAL A O    9  
ATOM   8380  C  CB   . VAL A 1 19 ? -13.807 2.480   -7.302  1.00 0.00 ? 19  VAL A CB   9  
ATOM   8381  C  CG1  . VAL A 1 19 ? -13.306 1.073   -7.015  1.00 0.00 ? 19  VAL A CG1  9  
ATOM   8382  C  CG2  . VAL A 1 19 ? -15.046 2.792   -6.476  1.00 0.00 ? 19  VAL A CG2  9  
ATOM   8383  H  H    . VAL A 1 19 ? -13.123 4.768   -8.678  1.00 0.00 ? 19  VAL A H    9  
ATOM   8384  H  HA   . VAL A 1 19 ? -12.678 3.712   -5.963  1.00 0.00 ? 19  VAL A HA   9  
ATOM   8385  H  HB   . VAL A 1 19 ? -14.073 2.538   -8.347  1.00 0.00 ? 19  VAL A HB   9  
ATOM   8386  H  HG11 . VAL A 1 19 ? -13.027 0.996   -5.975  1.00 0.00 ? 19  VAL A HG11 9  
ATOM   8387  H  HG12 . VAL A 1 19 ? -14.088 0.361   -7.234  1.00 0.00 ? 19  VAL A HG12 9  
ATOM   8388  H  HG13 . VAL A 1 19 ? -12.446 0.865   -7.634  1.00 0.00 ? 19  VAL A HG13 9  
ATOM   8389  H  HG21 . VAL A 1 19 ? -15.039 2.195   -5.577  1.00 0.00 ? 19  VAL A HG21 9  
ATOM   8390  H  HG22 . VAL A 1 19 ? -15.049 3.840   -6.212  1.00 0.00 ? 19  VAL A HG22 9  
ATOM   8391  H  HG23 . VAL A 1 19 ? -15.930 2.564   -7.053  1.00 0.00 ? 19  VAL A HG23 9  
ATOM   8392  N  N    . ILE A 1 20 ? -10.447 2.800   -6.490  1.00 0.00 ? 20  ILE A N    9  
ATOM   8393  C  CA   . ILE A 1 20 ? -9.124  2.255   -6.764  1.00 0.00 ? 20  ILE A CA   9  
ATOM   8394  C  C    . ILE A 1 20 ? -9.108  0.739   -6.596  1.00 0.00 ? 20  ILE A C    9  
ATOM   8395  O  O    . ILE A 1 20 ? -9.098  0.227   -5.476  1.00 0.00 ? 20  ILE A O    9  
ATOM   8396  C  CB   . ILE A 1 20 ? -8.058  2.873   -5.840  1.00 0.00 ? 20  ILE A CB   9  
ATOM   8397  C  CG1  . ILE A 1 20 ? -8.230  4.392   -5.771  1.00 0.00 ? 20  ILE A CG1  9  
ATOM   8398  C  CG2  . ILE A 1 20 ? -6.662  2.515   -6.329  1.00 0.00 ? 20  ILE A CG2  9  
ATOM   8399  C  CD1  . ILE A 1 20 ? -8.024  5.085   -7.100  1.00 0.00 ? 20  ILE A CD1  9  
ATOM   8400  H  H    . ILE A 1 20 ? -10.671 3.075   -5.577  1.00 0.00 ? 20  ILE A H    9  
ATOM   8401  H  HA   . ILE A 1 20 ? -8.869  2.495   -7.786  1.00 0.00 ? 20  ILE A HA   9  
ATOM   8402  H  HB   . ILE A 1 20 ? -8.185  2.458   -4.852  1.00 0.00 ? 20  ILE A HB   9  
ATOM   8403  H  HG12 . ILE A 1 20 ? -9.228  4.619   -5.430  1.00 0.00 ? 20  ILE A HG12 9  
ATOM   8404  H  HG13 . ILE A 1 20 ? -7.514  4.796   -5.070  1.00 0.00 ? 20  ILE A HG13 9  
ATOM   8405  H  HG21 . ILE A 1 20 ? -6.729  1.732   -7.069  1.00 0.00 ? 20  ILE A HG21 9  
ATOM   8406  H  HG22 . ILE A 1 20 ? -6.200  3.386   -6.769  1.00 0.00 ? 20  ILE A HG22 9  
ATOM   8407  H  HG23 . ILE A 1 20 ? -6.065  2.173   -5.496  1.00 0.00 ? 20  ILE A HG23 9  
ATOM   8408  H  HD11 . ILE A 1 20 ? -8.444  6.079   -7.057  1.00 0.00 ? 20  ILE A HD11 9  
ATOM   8409  H  HD12 . ILE A 1 20 ? -6.968  5.148   -7.313  1.00 0.00 ? 20  ILE A HD12 9  
ATOM   8410  H  HD13 . ILE A 1 20 ? -8.516  4.521   -7.880  1.00 0.00 ? 20  ILE A HD13 9  
ATOM   8411  N  N    . LYS A 1 21 ? -9.105  0.025   -7.716  1.00 0.00 ? 21  LYS A N    9  
ATOM   8412  C  CA   . LYS A 1 21 ? -9.088  -1.433  -7.695  1.00 0.00 ? 21  LYS A CA   9  
ATOM   8413  C  C    . LYS A 1 21 ? -7.677  -1.956  -7.444  1.00 0.00 ? 21  LYS A C    9  
ATOM   8414  O  O    . LYS A 1 21 ? -6.776  -1.754  -8.257  1.00 0.00 ? 21  LYS A O    9  
ATOM   8415  C  CB   . LYS A 1 21 ? -9.622  -1.989  -9.017  1.00 0.00 ? 21  LYS A CB   9  
ATOM   8416  C  CG   . LYS A 1 21 ? -11.134 -1.922  -9.138  1.00 0.00 ? 21  LYS A CG   9  
ATOM   8417  C  CD   . LYS A 1 21 ? -11.793 -3.187  -8.614  1.00 0.00 ? 21  LYS A CD   9  
ATOM   8418  C  CE   . LYS A 1 21 ? -13.196 -2.912  -8.095  1.00 0.00 ? 21  LYS A CE   9  
ATOM   8419  N  NZ   . LYS A 1 21 ? -13.813 -4.126  -7.493  1.00 0.00 ? 21  LYS A NZ   9  
ATOM   8420  H  H    . LYS A 1 21 ? -9.114  0.490   -8.580  1.00 0.00 ? 21  LYS A H    9  
ATOM   8421  H  HA   . LYS A 1 21 ? -9.729  -1.761  -6.891  1.00 0.00 ? 21  LYS A HA   9  
ATOM   8422  H  HB2  . LYS A 1 21 ? -9.191  -1.425  -9.831  1.00 0.00 ? 21  LYS A HB2  9  
ATOM   8423  H  HB3  . LYS A 1 21 ? -9.320  -3.023  -9.107  1.00 0.00 ? 21  LYS A HB3  9  
ATOM   8424  H  HG2  . LYS A 1 21 ? -11.495 -1.079  -8.568  1.00 0.00 ? 21  LYS A HG2  9  
ATOM   8425  H  HG3  . LYS A 1 21 ? -11.398 -1.794  -10.179 1.00 0.00 ? 21  LYS A HG3  9  
ATOM   8426  H  HD2  . LYS A 1 21 ? -11.853 -3.910  -9.415  1.00 0.00 ? 21  LYS A HD2  9  
ATOM   8427  H  HD3  . LYS A 1 21 ? -11.193 -3.588  -7.809  1.00 0.00 ? 21  LYS A HD3  9  
ATOM   8428  H  HE2  . LYS A 1 21 ? -13.143 -2.136  -7.346  1.00 0.00 ? 21  LYS A HE2  9  
ATOM   8429  H  HE3  . LYS A 1 21 ? -13.810 -2.576  -8.918  1.00 0.00 ? 21  LYS A HE3  9  
ATOM   8430  H  HZ1  . LYS A 1 21 ? -13.085 -4.850  -7.326  1.00 0.00 ? 21  LYS A HZ1  9  
ATOM   8431  H  HZ2  . LYS A 1 21 ? -14.532 -4.516  -8.135  1.00 0.00 ? 21  LYS A HZ2  9  
ATOM   8432  H  HZ3  . LYS A 1 21 ? -14.264 -3.886  -6.588  1.00 0.00 ? 21  LYS A HZ3  9  
ATOM   8433  N  N    . ALA A 1 22 ? -7.494  -2.631  -6.314  1.00 0.00 ? 22  ALA A N    9  
ATOM   8434  C  CA   . ALA A 1 22 ? -6.194  -3.187  -5.958  1.00 0.00 ? 22  ALA A CA   9  
ATOM   8435  C  C    . ALA A 1 22 ? -6.346  -4.396  -5.041  1.00 0.00 ? 22  ALA A C    9  
ATOM   8436  O  O    . ALA A 1 22 ? -7.407  -4.613  -4.456  1.00 0.00 ? 22  ALA A O    9  
ATOM   8437  C  CB   . ALA A 1 22 ? -5.330  -2.125  -5.296  1.00 0.00 ? 22  ALA A CB   9  
ATOM   8438  H  H    . ALA A 1 22 ? -8.251  -2.760  -5.706  1.00 0.00 ? 22  ALA A H    9  
ATOM   8439  H  HA   . ALA A 1 22 ? -5.704  -3.499  -6.870  1.00 0.00 ? 22  ALA A HA   9  
ATOM   8440  H  HB1  . ALA A 1 22 ? -5.160  -2.393  -4.263  1.00 0.00 ? 22  ALA A HB1  9  
ATOM   8441  H  HB2  . ALA A 1 22 ? -4.383  -2.058  -5.811  1.00 0.00 ? 22  ALA A HB2  9  
ATOM   8442  H  HB3  . ALA A 1 22 ? -5.833  -1.171  -5.343  1.00 0.00 ? 22  ALA A HB3  9  
ATOM   8443  N  N    . MET A 1 23 ? -5.280  -5.179  -4.921  1.00 0.00 ? 23  MET A N    9  
ATOM   8444  C  CA   . MET A 1 23 ? -5.295  -6.366  -4.074  1.00 0.00 ? 23  MET A CA   9  
ATOM   8445  C  C    . MET A 1 23 ? -6.614  -7.119  -4.218  1.00 0.00 ? 23  MET A C    9  
ATOM   8446  O  O    . MET A 1 23 ? -7.090  -7.743  -3.270  1.00 0.00 ? 23  MET A O    9  
ATOM   8447  C  CB   . MET A 1 23 ? -5.073  -5.978  -2.611  1.00 0.00 ? 23  MET A CB   9  
ATOM   8448  C  CG   . MET A 1 23 ? -3.874  -5.068  -2.399  1.00 0.00 ? 23  MET A CG   9  
ATOM   8449  S  SD   . MET A 1 23 ? -3.650  -4.605  -0.671  1.00 0.00 ? 23  MET A SD   9  
ATOM   8450  C  CE   . MET A 1 23 ? -2.052  -5.339  -0.329  1.00 0.00 ? 23  MET A CE   9  
ATOM   8451  H  H    . MET A 1 23 ? -4.462  -4.954  -5.413  1.00 0.00 ? 23  MET A H    9  
ATOM   8452  H  HA   . MET A 1 23 ? -4.490  -7.011  -4.392  1.00 0.00 ? 23  MET A HA   9  
ATOM   8453  H  HB2  . MET A 1 23 ? -5.953  -5.469  -2.248  1.00 0.00 ? 23  MET A HB2  9  
ATOM   8454  H  HB3  . MET A 1 23 ? -4.922  -6.876  -2.031  1.00 0.00 ? 23  MET A HB3  9  
ATOM   8455  H  HG2  . MET A 1 23 ? -2.986  -5.579  -2.738  1.00 0.00 ? 23  MET A HG2  9  
ATOM   8456  H  HG3  . MET A 1 23 ? -4.014  -4.170  -2.983  1.00 0.00 ? 23  MET A HG3  9  
ATOM   8457  H  HE1  . MET A 1 23 ? -1.277  -4.604  -0.489  1.00 0.00 ? 23  MET A HE1  9  
ATOM   8458  H  HE2  . MET A 1 23 ? -2.023  -5.675  0.697   1.00 0.00 ? 23  MET A HE2  9  
ATOM   8459  H  HE3  . MET A 1 23 ? -1.893  -6.179  -0.989  1.00 0.00 ? 23  MET A HE3  9  
ATOM   8460  N  N    . ASN A 1 24 ? -7.200  -7.055  -5.409  1.00 0.00 ? 24  ASN A N    9  
ATOM   8461  C  CA   . ASN A 1 24 ? -8.465  -7.731  -5.676  1.00 0.00 ? 24  ASN A CA   9  
ATOM   8462  C  C    . ASN A 1 24 ? -9.580  -7.162  -4.804  1.00 0.00 ? 24  ASN A C    9  
ATOM   8463  O  O    . ASN A 1 24 ? -10.390 -7.905  -4.252  1.00 0.00 ? 24  ASN A O    9  
ATOM   8464  C  CB   . ASN A 1 24 ? -8.326  -9.234  -5.429  1.00 0.00 ? 24  ASN A CB   9  
ATOM   8465  C  CG   . ASN A 1 24 ? -7.795  -9.973  -6.642  1.00 0.00 ? 24  ASN A CG   9  
ATOM   8466  O  OD1  . ASN A 1 24 ? -6.759  -10.633 -6.576  1.00 0.00 ? 24  ASN A OD1  9  
ATOM   8467  N  ND2  . ASN A 1 24 ? -8.506  -9.864  -7.759  1.00 0.00 ? 24  ASN A ND2  9  
ATOM   8468  H  H    . ASN A 1 24 ? -6.772  -6.542  -6.126  1.00 0.00 ? 24  ASN A H    9  
ATOM   8469  H  HA   . ASN A 1 24 ? -8.716  -7.567  -6.713  1.00 0.00 ? 24  ASN A HA   9  
ATOM   8470  H  HB2  . ASN A 1 24 ? -7.645  -9.397  -4.606  1.00 0.00 ? 24  ASN A HB2  9  
ATOM   8471  H  HB3  . ASN A 1 24 ? -9.293  -9.643  -5.176  1.00 0.00 ? 24  ASN A HB3  9  
ATOM   8472  H  HD21 . ASN A 1 24 ? -9.322  -9.320  -7.738  1.00 0.00 ? 24  ASN A HD21 9  
ATOM   8473  H  HD22 . ASN A 1 24 ? -8.186  -10.332 -8.558  1.00 0.00 ? 24  ASN A HD22 9  
ATOM   8474  N  N    . ASN A 1 25 ? -9.614  -5.838  -4.685  1.00 0.00 ? 25  ASN A N    9  
ATOM   8475  C  CA   . ASN A 1 25 ? -10.630 -5.169  -3.880  1.00 0.00 ? 25  ASN A CA   9  
ATOM   8476  C  C    . ASN A 1 25 ? -10.661 -3.673  -4.178  1.00 0.00 ? 25  ASN A C    9  
ATOM   8477  O  O    . ASN A 1 25 ? -9.709  -3.119  -4.728  1.00 0.00 ? 25  ASN A O    9  
ATOM   8478  C  CB   . ASN A 1 25 ? -10.363 -5.399  -2.391  1.00 0.00 ? 25  ASN A CB   9  
ATOM   8479  C  CG   . ASN A 1 25 ? -10.772 -6.787  -1.938  1.00 0.00 ? 25  ASN A CG   9  
ATOM   8480  O  OD1  . ASN A 1 25 ? -11.944 -7.157  -2.013  1.00 0.00 ? 25  ASN A OD1  9  
ATOM   8481  N  ND2  . ASN A 1 25 ? -9.804  -7.564  -1.466  1.00 0.00 ? 25  ASN A ND2  9  
ATOM   8482  H  H    . ASN A 1 25 ? -8.940  -5.299  -5.149  1.00 0.00 ? 25  ASN A H    9  
ATOM   8483  H  HA   . ASN A 1 25 ? -11.588 -5.595  -4.135  1.00 0.00 ? 25  ASN A HA   9  
ATOM   8484  H  HB2  . ASN A 1 25 ? -9.308  -5.274  -2.197  1.00 0.00 ? 25  ASN A HB2  9  
ATOM   8485  H  HB3  . ASN A 1 25 ? -10.919 -4.674  -1.816  1.00 0.00 ? 25  ASN A HB3  9  
ATOM   8486  H  HD21 . ASN A 1 25 ? -8.893  -7.203  -1.436  1.00 0.00 ? 25  ASN A HD21 9  
ATOM   8487  H  HD22 . ASN A 1 25 ? -10.040 -8.467  -1.166  1.00 0.00 ? 25  ASN A HD22 9  
ATOM   8488  N  N    . SER A 1 26 ? -11.761 -3.025  -3.810  1.00 0.00 ? 26  SER A N    9  
ATOM   8489  C  CA   . SER A 1 26 ? -11.918 -1.593  -4.040  1.00 0.00 ? 26  SER A CA   9  
ATOM   8490  C  C    . SER A 1 26 ? -11.379 -0.791  -2.859  1.00 0.00 ? 26  SER A C    9  
ATOM   8491  O  O    . SER A 1 26 ? -11.464 -1.224  -1.710  1.00 0.00 ? 26  SER A O    9  
ATOM   8492  C  CB   . SER A 1 26 ? -13.391 -1.251  -4.273  1.00 0.00 ? 26  SER A CB   9  
ATOM   8493  O  OG   . SER A 1 26 ? -14.204 -1.761  -3.231  1.00 0.00 ? 26  SER A OG   9  
ATOM   8494  H  H    . SER A 1 26 ? -12.486 -3.522  -3.375  1.00 0.00 ? 26  SER A H    9  
ATOM   8495  H  HA   . SER A 1 26 ? -11.353 -1.336  -4.923  1.00 0.00 ? 26  SER A HA   9  
ATOM   8496  H  HB2  . SER A 1 26 ? -13.507 -0.179  -4.312  1.00 0.00 ? 26  SER A HB2  9  
ATOM   8497  H  HB3  . SER A 1 26 ? -13.713 -1.682  -5.210  1.00 0.00 ? 26  SER A HB3  9  
ATOM   8498  H  HG   . SER A 1 26 ? -15.129 -1.641  -3.458  1.00 0.00 ? 26  SER A HG   9  
ATOM   8499  N  N    . TRP A 1 27 ? -10.824 0.379   -3.152  1.00 0.00 ? 27  TRP A N    9  
ATOM   8500  C  CA   . TRP A 1 27 ? -10.270 1.243   -2.116  1.00 0.00 ? 27  TRP A CA   9  
ATOM   8501  C  C    . TRP A 1 27 ? -10.399 2.712   -2.505  1.00 0.00 ? 27  TRP A C    9  
ATOM   8502  O  O    . TRP A 1 27 ? -10.818 3.035   -3.617  1.00 0.00 ? 27  TRP A O    9  
ATOM   8503  C  CB   . TRP A 1 27 ? -8.801  0.896   -1.865  1.00 0.00 ? 27  TRP A CB   9  
ATOM   8504  C  CG   . TRP A 1 27 ? -8.531  -0.578  -1.867  1.00 0.00 ? 27  TRP A CG   9  
ATOM   8505  C  CD1  . TRP A 1 27 ? -8.786  -1.456  -2.881  1.00 0.00 ? 27  TRP A CD1  9  
ATOM   8506  C  CD2  . TRP A 1 27 ? -7.954  -1.345  -0.805  1.00 0.00 ? 27  TRP A CD2  9  
ATOM   8507  N  NE1  . TRP A 1 27 ? -8.403  -2.724  -2.513  1.00 0.00 ? 27  TRP A NE1  9  
ATOM   8508  C  CE2  . TRP A 1 27 ? -7.888  -2.682  -1.244  1.00 0.00 ? 27  TRP A CE2  9  
ATOM   8509  C  CE3  . TRP A 1 27 ? -7.484  -1.033  0.474   1.00 0.00 ? 27  TRP A CE3  9  
ATOM   8510  C  CZ2  . TRP A 1 27 ? -7.374  -3.702  -0.449  1.00 0.00 ? 27  TRP A CZ2  9  
ATOM   8511  C  CZ3  . TRP A 1 27 ? -6.974  -2.046  1.262   1.00 0.00 ? 27  TRP A CZ3  9  
ATOM   8512  C  CH2  . TRP A 1 27 ? -6.921  -3.368  0.799   1.00 0.00 ? 27  TRP A CH2  9  
ATOM   8513  H  H    . TRP A 1 27 ? -10.785 0.670   -4.088  1.00 0.00 ? 27  TRP A H    9  
ATOM   8514  H  HA   . TRP A 1 27 ? -10.831 1.073   -1.209  1.00 0.00 ? 27  TRP A HA   9  
ATOM   8515  H  HB2  . TRP A 1 27 ? -8.194  1.348   -2.635  1.00 0.00 ? 27  TRP A HB2  9  
ATOM   8516  H  HB3  . TRP A 1 27 ? -8.506  1.289   -0.902  1.00 0.00 ? 27  TRP A HB3  9  
ATOM   8517  H  HD1  . TRP A 1 27 ? -9.227  -1.181  -3.827  1.00 0.00 ? 27  TRP A HD1  9  
ATOM   8518  H  HE1  . TRP A 1 27 ? -8.484  -3.526  -3.070  1.00 0.00 ? 27  TRP A HE1  9  
ATOM   8519  H  HE3  . TRP A 1 27 ? -7.516  -0.020  0.848   1.00 0.00 ? 27  TRP A HE3  9  
ATOM   8520  H  HZ2  . TRP A 1 27 ? -7.326  -4.725  -0.792  1.00 0.00 ? 27  TRP A HZ2  9  
ATOM   8521  H  HZ3  . TRP A 1 27 ? -6.607  -1.824  2.253   1.00 0.00 ? 27  TRP A HZ3  9  
ATOM   8522  H  HH2  . TRP A 1 27 ? -6.515  -4.127  1.448   1.00 0.00 ? 27  TRP A HH2  9  
ATOM   8523  N  N    . HIS A 1 28 ? -10.036 3.598   -1.583  1.00 0.00 ? 28  HIS A N    9  
ATOM   8524  C  CA   . HIS A 1 28 ? -10.111 5.033   -1.831  1.00 0.00 ? 28  HIS A CA   9  
ATOM   8525  C  C    . HIS A 1 28 ? -8.802  5.552   -2.420  1.00 0.00 ? 28  HIS A C    9  
ATOM   8526  O  O    . HIS A 1 28 ? -7.738  4.955   -2.253  1.00 0.00 ? 28  HIS A O    9  
ATOM   8527  C  CB   . HIS A 1 28 ? -10.432 5.780   -0.536  1.00 0.00 ? 28  HIS A CB   9  
ATOM   8528  C  CG   . HIS A 1 28 ? -11.867 5.669   -0.121  1.00 0.00 ? 28  HIS A CG   9  
ATOM   8529  N  ND1  . HIS A 1 28 ? -12.262 5.121   1.081   1.00 0.00 ? 28  HIS A ND1  9  
ATOM   8530  C  CD2  . HIS A 1 28 ? -13.003 6.043   -0.754  1.00 0.00 ? 28  HIS A CD2  9  
ATOM   8531  C  CE1  . HIS A 1 28 ? -13.580 5.159   1.168   1.00 0.00 ? 28  HIS A CE1  9  
ATOM   8532  N  NE2  . HIS A 1 28 ? -14.054 5.715   0.067   1.00 0.00 ? 28  HIS A NE2  9  
ATOM   8533  H  H    . HIS A 1 28 ? -9.710  3.279   -0.715  1.00 0.00 ? 28  HIS A H    9  
ATOM   8534  H  HA   . HIS A 1 28 ? -10.904 5.206   -2.542  1.00 0.00 ? 28  HIS A HA   9  
ATOM   8535  H  HB2  . HIS A 1 28 ? -9.824  5.380   0.263   1.00 0.00 ? 28  HIS A HB2  9  
ATOM   8536  H  HB3  . HIS A 1 28 ? -10.203 6.828   -0.665  1.00 0.00 ? 28  HIS A HB3  9  
ATOM   8537  H  HD2  . HIS A 1 28 ? -13.071 6.512   -1.726  1.00 0.00 ? 28  HIS A HD2  9  
ATOM   8538  H  HE1  . HIS A 1 28 ? -14.170 4.799   1.997   1.00 0.00 ? 28  HIS A HE1  9  
ATOM   8539  H  HE2  . HIS A 1 28 ? -15.003 5.788   -0.165  1.00 0.00 ? 28  HIS A HE2  9  
ATOM   8540  N  N    . PRO A 1 29 ? -8.880  6.689   -3.126  1.00 0.00 ? 29  PRO A N    9  
ATOM   8541  C  CA   . PRO A 1 29 ? -7.711  7.313   -3.754  1.00 0.00 ? 29  PRO A CA   9  
ATOM   8542  C  C    . PRO A 1 29 ? -6.747  7.900   -2.729  1.00 0.00 ? 29  PRO A C    9  
ATOM   8543  O  O    . PRO A 1 29 ? -5.694  8.428   -3.086  1.00 0.00 ? 29  PRO A O    9  
ATOM   8544  C  CB   . PRO A 1 29 ? -8.320  8.424   -4.613  1.00 0.00 ? 29  PRO A CB   9  
ATOM   8545  C  CG   . PRO A 1 29 ? -9.616  8.746   -3.952  1.00 0.00 ? 29  PRO A CG   9  
ATOM   8546  C  CD   . PRO A 1 29 ? -10.115 7.455   -3.366  1.00 0.00 ? 29  PRO A CD   9  
ATOM   8547  H  HA   . PRO A 1 29 ? -7.182  6.615   -4.387  1.00 0.00 ? 29  PRO A HA   9  
ATOM   8548  H  HB2  . PRO A 1 29 ? -7.658  9.278   -4.624  1.00 0.00 ? 29  PRO A HB2  9  
ATOM   8549  H  HB3  . PRO A 1 29 ? -8.470  8.064   -5.620  1.00 0.00 ? 29  PRO A HB3  9  
ATOM   8550  H  HG2  . PRO A 1 29 ? -9.458  9.476   -3.172  1.00 0.00 ? 29  PRO A HG2  9  
ATOM   8551  H  HG3  . PRO A 1 29 ? -10.317 9.122   -4.683  1.00 0.00 ? 29  PRO A HG3  9  
ATOM   8552  H  HD2  . PRO A 1 29 ? -10.640 7.638   -2.440  1.00 0.00 ? 29  PRO A HD2  9  
ATOM   8553  H  HD3  . PRO A 1 29 ? -10.754 6.943   -4.070  1.00 0.00 ? 29  PRO A HD3  9  
ATOM   8554  N  N    . GLU A 1 30 ? -7.114  7.804   -1.455  1.00 0.00 ? 30  GLU A N    9  
ATOM   8555  C  CA   . GLU A 1 30 ? -6.280  8.327   -0.379  1.00 0.00 ? 30  GLU A CA   9  
ATOM   8556  C  C    . GLU A 1 30 ? -5.947  7.234   0.632   1.00 0.00 ? 30  GLU A C    9  
ATOM   8557  O  O    . GLU A 1 30 ? -4.947  7.316   1.345   1.00 0.00 ? 30  GLU A O    9  
ATOM   8558  C  CB   . GLU A 1 30 ? -6.984  9.490   0.323   1.00 0.00 ? 30  GLU A CB   9  
ATOM   8559  C  CG   . GLU A 1 30 ? -8.332  9.115   0.916   1.00 0.00 ? 30  GLU A CG   9  
ATOM   8560  C  CD   . GLU A 1 30 ? -9.219  10.321  1.156   1.00 0.00 ? 30  GLU A CD   9  
ATOM   8561  O  OE1  . GLU A 1 30 ? -8.785  11.242  1.879   1.00 0.00 ? 30  GLU A OE1  9  
ATOM   8562  O  OE2  . GLU A 1 30 ? -10.347 10.345  0.621   1.00 0.00 ? 30  GLU A OE2  9  
ATOM   8563  H  H    . GLU A 1 30 ? -7.965  7.373   -1.234  1.00 0.00 ? 30  GLU A H    9  
ATOM   8564  H  HA   . GLU A 1 30 ? -5.361  8.687   -0.817  1.00 0.00 ? 30  GLU A HA   9  
ATOM   8565  H  HB2  . GLU A 1 30 ? -6.351  9.850   1.120   1.00 0.00 ? 30  GLU A HB2  9  
ATOM   8566  H  HB3  . GLU A 1 30 ? -7.137  10.286  -0.391  1.00 0.00 ? 30  GLU A HB3  9  
ATOM   8567  H  HG2  . GLU A 1 30 ? -8.837  8.446   0.236   1.00 0.00 ? 30  GLU A HG2  9  
ATOM   8568  H  HG3  . GLU A 1 30 ? -8.169  8.613   1.859   1.00 0.00 ? 30  GLU A HG3  9  
ATOM   8569  N  N    . CYS A 1 31 ? -6.793  6.211   0.687   1.00 0.00 ? 31  CYS A N    9  
ATOM   8570  C  CA   . CYS A 1 31 ? -6.591  5.101   1.611   1.00 0.00 ? 31  CYS A CA   9  
ATOM   8571  C  C    . CYS A 1 31 ? -5.449  4.204   1.143   1.00 0.00 ? 31  CYS A C    9  
ATOM   8572  O  O    . CYS A 1 31 ? -4.456  4.025   1.849   1.00 0.00 ? 31  CYS A O    9  
ATOM   8573  C  CB   . CYS A 1 31 ? -7.876  4.280   1.743   1.00 0.00 ? 31  CYS A CB   9  
ATOM   8574  S  SG   . CYS A 1 31 ? -9.116  5.015   2.857   1.00 0.00 ? 31  CYS A SG   9  
ATOM   8575  H  H    . CYS A 1 31 ? -7.573  6.202   0.093   1.00 0.00 ? 31  CYS A H    9  
ATOM   8576  H  HA   . CYS A 1 31 ? -6.337  5.513   2.575   1.00 0.00 ? 31  CYS A HA   9  
ATOM   8577  H  HB2  . CYS A 1 31 ? -8.331  4.178   0.768   1.00 0.00 ? 31  CYS A HB2  9  
ATOM   8578  H  HB3  . CYS A 1 31 ? -7.631  3.300   2.125   1.00 0.00 ? 31  CYS A HB3  9  
ATOM   8579  N  N    . PHE A 1 32 ? -5.595  3.644   -0.053  1.00 0.00 ? 32  PHE A N    9  
ATOM   8580  C  CA   . PHE A 1 32 ? -4.576  2.765   -0.616  1.00 0.00 ? 32  PHE A CA   9  
ATOM   8581  C  C    . PHE A 1 32 ? -3.210  3.445   -0.613  1.00 0.00 ? 32  PHE A C    9  
ATOM   8582  O  O    . PHE A 1 32 ? -2.785  4.011   -1.621  1.00 0.00 ? 32  PHE A O    9  
ATOM   8583  C  CB   . PHE A 1 32 ? -4.954  2.360   -2.042  1.00 0.00 ? 32  PHE A CB   9  
ATOM   8584  C  CG   . PHE A 1 32 ? -4.195  1.166   -2.547  1.00 0.00 ? 32  PHE A CG   9  
ATOM   8585  C  CD1  . PHE A 1 32 ? -4.243  -0.040  -1.867  1.00 0.00 ? 32  PHE A CD1  9  
ATOM   8586  C  CD2  . PHE A 1 32 ? -3.434  1.250   -3.702  1.00 0.00 ? 32  PHE A CD2  9  
ATOM   8587  C  CE1  . PHE A 1 32 ? -3.544  -1.140  -2.329  1.00 0.00 ? 32  PHE A CE1  9  
ATOM   8588  C  CE2  . PHE A 1 32 ? -2.734  0.153   -4.169  1.00 0.00 ? 32  PHE A CE2  9  
ATOM   8589  C  CZ   . PHE A 1 32 ? -2.790  -1.043  -3.482  1.00 0.00 ? 32  PHE A CZ   9  
ATOM   8590  H  H    . PHE A 1 32 ? -6.409  3.825   -0.569  1.00 0.00 ? 32  PHE A H    9  
ATOM   8591  H  HA   . PHE A 1 32 ? -4.526  1.881   -0.001  1.00 0.00 ? 32  PHE A HA   9  
ATOM   8592  H  HB2  . PHE A 1 32 ? -6.006  2.121   -2.075  1.00 0.00 ? 32  PHE A HB2  9  
ATOM   8593  H  HB3  . PHE A 1 32 ? -4.756  3.186   -2.708  1.00 0.00 ? 32  PHE A HB3  9  
ATOM   8594  H  HD1  . PHE A 1 32 ? -4.833  -0.117  -0.965  1.00 0.00 ? 32  PHE A HD1  9  
ATOM   8595  H  HD2  . PHE A 1 32 ? -3.390  2.186   -4.241  1.00 0.00 ? 32  PHE A HD2  9  
ATOM   8596  H  HE1  . PHE A 1 32 ? -3.590  -2.074  -1.790  1.00 0.00 ? 32  PHE A HE1  9  
ATOM   8597  H  HE2  . PHE A 1 32 ? -2.145  0.233   -5.071  1.00 0.00 ? 32  PHE A HE2  9  
ATOM   8598  H  HZ   . PHE A 1 32 ? -2.243  -1.901  -3.844  1.00 0.00 ? 32  PHE A HZ   9  
ATOM   8599  N  N    . ARG A 1 33 ? -2.529  3.386   0.526   1.00 0.00 ? 33  ARG A N    9  
ATOM   8600  C  CA   . ARG A 1 33 ? -1.212  3.997   0.661   1.00 0.00 ? 33  ARG A CA   9  
ATOM   8601  C  C    . ARG A 1 33 ? -0.149  2.940   0.945   1.00 0.00 ? 33  ARG A C    9  
ATOM   8602  O  O    . ARG A 1 33 ? -0.461  1.763   1.130   1.00 0.00 ? 33  ARG A O    9  
ATOM   8603  C  CB   . ARG A 1 33 ? -1.222  5.038   1.782   1.00 0.00 ? 33  ARG A CB   9  
ATOM   8604  C  CG   . ARG A 1 33 ? -2.163  6.203   1.522   1.00 0.00 ? 33  ARG A CG   9  
ATOM   8605  C  CD   . ARG A 1 33 ? -2.139  7.205   2.666   1.00 0.00 ? 33  ARG A CD   9  
ATOM   8606  N  NE   . ARG A 1 33 ? -3.106  6.869   3.708   1.00 0.00 ? 33  ARG A NE   9  
ATOM   8607  C  CZ   . ARG A 1 33 ? -3.315  7.617   4.786   1.00 0.00 ? 33  ARG A CZ   9  
ATOM   8608  N  NH1  . ARG A 1 33 ? -2.629  8.738   4.962   1.00 0.00 ? 33  ARG A NH1  9  
ATOM   8609  N  NH2  . ARG A 1 33 ? -4.212  7.245   5.689   1.00 0.00 ? 33  ARG A NH2  9  
ATOM   8610  H  H    . ARG A 1 33 ? -2.921  2.921   1.294   1.00 0.00 ? 33  ARG A H    9  
ATOM   8611  H  HA   . ARG A 1 33 ? -0.976  4.487   -0.271  1.00 0.00 ? 33  ARG A HA   9  
ATOM   8612  H  HB2  . ARG A 1 33 ? -1.525  4.558   2.701   1.00 0.00 ? 33  ARG A HB2  9  
ATOM   8613  H  HB3  . ARG A 1 33 ? -0.224  5.430   1.902   1.00 0.00 ? 33  ARG A HB3  9  
ATOM   8614  H  HG2  . ARG A 1 33 ? -1.860  6.704   0.614   1.00 0.00 ? 33  ARG A HG2  9  
ATOM   8615  H  HG3  . ARG A 1 33 ? -3.168  5.824   1.408   1.00 0.00 ? 33  ARG A HG3  9  
ATOM   8616  H  HD2  . ARG A 1 33 ? -1.149  7.215   3.097   1.00 0.00 ? 33  ARG A HD2  9  
ATOM   8617  H  HD3  . ARG A 1 33 ? -2.371  8.184   2.275   1.00 0.00 ? 33  ARG A HD3  9  
ATOM   8618  H  HE   . ARG A 1 33 ? -3.624  6.045   3.598   1.00 0.00 ? 33  ARG A HE   9  
ATOM   8619  H  HH11 . ARG A 1 33 ? -1.953  9.021   4.282   1.00 0.00 ? 33  ARG A HH11 9  
ATOM   8620  H  HH12 . ARG A 1 33 ? -2.789  9.300   5.773   1.00 0.00 ? 33  ARG A HH12 9  
ATOM   8621  H  HH21 . ARG A 1 33 ? -4.732  6.401   5.560   1.00 0.00 ? 33  ARG A HH21 9  
ATOM   8622  H  HH22 . ARG A 1 33 ? -4.369  7.808   6.500   1.00 0.00 ? 33  ARG A HH22 9  
ATOM   8623  N  N    . CYS A 1 34 ? 1.109   3.367   0.976   1.00 0.00 ? 34  CYS A N    9  
ATOM   8624  C  CA   . CYS A 1 34 ? 2.220   2.459   1.235   1.00 0.00 ? 34  CYS A CA   9  
ATOM   8625  C  C    . CYS A 1 34 ? 2.114   1.855   2.633   1.00 0.00 ? 34  CYS A C    9  
ATOM   8626  O  O    . CYS A 1 34 ? 1.309   2.298   3.452   1.00 0.00 ? 34  CYS A O    9  
ATOM   8627  C  CB   . CYS A 1 34 ? 3.553   3.194   1.084   1.00 0.00 ? 34  CYS A CB   9  
ATOM   8628  S  SG   . CYS A 1 34 ? 4.996   2.092   0.931   1.00 0.00 ? 34  CYS A SG   9  
ATOM   8629  H  H    . CYS A 1 34 ? 1.296   4.317   0.820   1.00 0.00 ? 34  CYS A H    9  
ATOM   8630  H  HA   . CYS A 1 34 ? 2.174   1.662   0.508   1.00 0.00 ? 34  CYS A HA   9  
ATOM   8631  H  HB2  . CYS A 1 34 ? 3.517   3.811   0.199   1.00 0.00 ? 34  CYS A HB2  9  
ATOM   8632  H  HB3  . CYS A 1 34 ? 3.708   3.822   1.949   1.00 0.00 ? 34  CYS A HB3  9  
ATOM   8633  N  N    . ASP A 1 35 ? 2.932   0.843   2.897   1.00 0.00 ? 35  ASP A N    9  
ATOM   8634  C  CA   . ASP A 1 35 ? 2.933   0.179   4.196   1.00 0.00 ? 35  ASP A CA   9  
ATOM   8635  C  C    . ASP A 1 35 ? 4.154   0.587   5.014   1.00 0.00 ? 35  ASP A C    9  
ATOM   8636  O  O    . ASP A 1 35 ? 4.297   0.194   6.173   1.00 0.00 ? 35  ASP A O    9  
ATOM   8637  C  CB   . ASP A 1 35 ? 2.907   -1.339  4.016   1.00 0.00 ? 35  ASP A CB   9  
ATOM   8638  C  CG   . ASP A 1 35 ? 2.571   -2.069  5.302   1.00 0.00 ? 35  ASP A CG   9  
ATOM   8639  O  OD1  . ASP A 1 35 ? 1.528   -1.749  5.910   1.00 0.00 ? 35  ASP A OD1  9  
ATOM   8640  O  OD2  . ASP A 1 35 ? 3.349   -2.961  5.699   1.00 0.00 ? 35  ASP A OD2  9  
ATOM   8641  H  H    . ASP A 1 35 ? 3.552   0.535   2.203   1.00 0.00 ? 35  ASP A H    9  
ATOM   8642  H  HA   . ASP A 1 35 ? 2.042   0.485   4.724   1.00 0.00 ? 35  ASP A HA   9  
ATOM   8643  H  HB2  . ASP A 1 35 ? 2.165   -1.595  3.274   1.00 0.00 ? 35  ASP A HB2  9  
ATOM   8644  H  HB3  . ASP A 1 35 ? 3.878   -1.671  3.678   1.00 0.00 ? 35  ASP A HB3  9  
ATOM   8645  N  N    . LEU A 1 36 ? 5.032   1.376   4.404   1.00 0.00 ? 36  LEU A N    9  
ATOM   8646  C  CA   . LEU A 1 36 ? 6.242   1.836   5.076   1.00 0.00 ? 36  LEU A CA   9  
ATOM   8647  C  C    . LEU A 1 36 ? 6.258   3.357   5.188   1.00 0.00 ? 36  LEU A C    9  
ATOM   8648  O  O    . LEU A 1 36 ? 6.754   3.914   6.168   1.00 0.00 ? 36  LEU A O    9  
ATOM   8649  C  CB   . LEU A 1 36 ? 7.482   1.356   4.320   1.00 0.00 ? 36  LEU A CB   9  
ATOM   8650  C  CG   . LEU A 1 36 ? 7.733   -0.152  4.332   1.00 0.00 ? 36  LEU A CG   9  
ATOM   8651  C  CD1  . LEU A 1 36 ? 8.486   -0.578  3.081   1.00 0.00 ? 36  LEU A CD1  9  
ATOM   8652  C  CD2  . LEU A 1 36 ? 8.502   -0.556  5.582   1.00 0.00 ? 36  LEU A CD2  9  
ATOM   8653  H  H    . LEU A 1 36 ? 4.863   1.655   3.481   1.00 0.00 ? 36  LEU A H    9  
ATOM   8654  H  HA   . LEU A 1 36 ? 6.250   1.414   6.070   1.00 0.00 ? 36  LEU A HA   9  
ATOM   8655  H  HB2  . LEU A 1 36 ? 7.384   1.667   3.292   1.00 0.00 ? 36  LEU A HB2  9  
ATOM   8656  H  HB3  . LEU A 1 36 ? 8.344   1.839   4.759   1.00 0.00 ? 36  LEU A HB3  9  
ATOM   8657  H  HG   . LEU A 1 36 ? 6.783   -0.669  4.341   1.00 0.00 ? 36  LEU A HG   9  
ATOM   8658  H  HD11 . LEU A 1 36 ? 8.798   -1.606  3.181   1.00 0.00 ? 36  LEU A HD11 9  
ATOM   8659  H  HD12 . LEU A 1 36 ? 9.354   0.051   2.952   1.00 0.00 ? 36  LEU A HD12 9  
ATOM   8660  H  HD13 . LEU A 1 36 ? 7.839   -0.479  2.221   1.00 0.00 ? 36  LEU A HD13 9  
ATOM   8661  H  HD21 . LEU A 1 36 ? 8.111   -1.489  5.958   1.00 0.00 ? 36  LEU A HD21 9  
ATOM   8662  H  HD22 . LEU A 1 36 ? 8.391   0.211   6.335   1.00 0.00 ? 36  LEU A HD22 9  
ATOM   8663  H  HD23 . LEU A 1 36 ? 9.547   -0.674  5.339   1.00 0.00 ? 36  LEU A HD23 9  
ATOM   8664  N  N    . CYS A 1 37 ? 5.710   4.025   4.178   1.00 0.00 ? 37  CYS A N    9  
ATOM   8665  C  CA   . CYS A 1 37 ? 5.658   5.482   4.162   1.00 0.00 ? 37  CYS A CA   9  
ATOM   8666  C  C    . CYS A 1 37 ? 4.224   5.974   3.991   1.00 0.00 ? 37  CYS A C    9  
ATOM   8667  O  O    . CYS A 1 37 ? 3.967   7.177   3.988   1.00 0.00 ? 37  CYS A O    9  
ATOM   8668  C  CB   . CYS A 1 37 ? 6.535   6.032   3.036   1.00 0.00 ? 37  CYS A CB   9  
ATOM   8669  S  SG   . CYS A 1 37 ? 5.902   5.684   1.363   1.00 0.00 ? 37  CYS A SG   9  
ATOM   8670  H  H    . CYS A 1 37 ? 5.330   3.526   3.424   1.00 0.00 ? 37  CYS A H    9  
ATOM   8671  H  HA   . CYS A 1 37 ? 6.037   5.838   5.108   1.00 0.00 ? 37  CYS A HA   9  
ATOM   8672  H  HB2  . CYS A 1 37 ? 6.612   7.105   3.140   1.00 0.00 ? 37  CYS A HB2  9  
ATOM   8673  H  HB3  . CYS A 1 37 ? 7.521   5.597   3.112   1.00 0.00 ? 37  CYS A HB3  9  
ATOM   8674  N  N    . GLN A 1 38 ? 3.295   5.034   3.850   1.00 0.00 ? 38  GLN A N    9  
ATOM   8675  C  CA   . GLN A 1 38 ? 1.887   5.372   3.678   1.00 0.00 ? 38  GLN A CA   9  
ATOM   8676  C  C    . GLN A 1 38 ? 1.710   6.438   2.602   1.00 0.00 ? 38  GLN A C    9  
ATOM   8677  O  O    . GLN A 1 38 ? 1.113   7.486   2.846   1.00 0.00 ? 38  GLN A O    9  
ATOM   8678  C  CB   . GLN A 1 38 ? 1.293   5.862   5.000   1.00 0.00 ? 38  GLN A CB   9  
ATOM   8679  C  CG   . GLN A 1 38 ? 1.675   5.002   6.194   1.00 0.00 ? 38  GLN A CG   9  
ATOM   8680  C  CD   . GLN A 1 38 ? 0.669   3.901   6.466   1.00 0.00 ? 38  GLN A CD   9  
ATOM   8681  O  OE1  . GLN A 1 38 ? -0.527  4.158   6.603   1.00 0.00 ? 38  GLN A OE1  9  
ATOM   8682  N  NE2  . GLN A 1 38 ? 1.150   2.666   6.545   1.00 0.00 ? 38  GLN A NE2  9  
ATOM   8683  H  H    . GLN A 1 38 ? 3.562   4.092   3.860   1.00 0.00 ? 38  GLN A H    9  
ATOM   8684  H  HA   . GLN A 1 38 ? 1.367   4.478   3.370   1.00 0.00 ? 38  GLN A HA   9  
ATOM   8685  H  HB2  . GLN A 1 38 ? 1.637   6.869   5.184   1.00 0.00 ? 38  GLN A HB2  9  
ATOM   8686  H  HB3  . GLN A 1 38 ? 0.217   5.867   4.918   1.00 0.00 ? 38  GLN A HB3  9  
ATOM   8687  H  HG2  . GLN A 1 38 ? 2.637   4.550   6.003   1.00 0.00 ? 38  GLN A HG2  9  
ATOM   8688  H  HG3  . GLN A 1 38 ? 1.742   5.633   7.068   1.00 0.00 ? 38  GLN A HG3  9  
ATOM   8689  H  HE21 . GLN A 1 38 ? 2.114   2.537   6.426   1.00 0.00 ? 38  GLN A HE21 9  
ATOM   8690  H  HE22 . GLN A 1 38 ? 0.522   1.935   6.720   1.00 0.00 ? 38  GLN A HE22 9  
ATOM   8691  N  N    . GLU A 1 39 ? 2.234   6.163   1.411   1.00 0.00 ? 39  GLU A N    9  
ATOM   8692  C  CA   . GLU A 1 39 ? 2.135   7.100   0.298   1.00 0.00 ? 39  GLU A CA   9  
ATOM   8693  C  C    . GLU A 1 39 ? 1.073   6.648   -0.700  1.00 0.00 ? 39  GLU A C    9  
ATOM   8694  O  O    . GLU A 1 39 ? 1.165   5.562   -1.272  1.00 0.00 ? 39  GLU A O    9  
ATOM   8695  C  CB   . GLU A 1 39 ? 3.487   7.236   -0.405  1.00 0.00 ? 39  GLU A CB   9  
ATOM   8696  C  CG   . GLU A 1 39 ? 3.417   8.003   -1.714  1.00 0.00 ? 39  GLU A CG   9  
ATOM   8697  C  CD   . GLU A 1 39 ? 4.753   8.599   -2.114  1.00 0.00 ? 39  GLU A CD   9  
ATOM   8698  O  OE1  . GLU A 1 39 ? 5.750   7.846   -2.151  1.00 0.00 ? 39  GLU A OE1  9  
ATOM   8699  O  OE2  . GLU A 1 39 ? 4.803   9.816   -2.388  1.00 0.00 ? 39  GLU A OE2  9  
ATOM   8700  H  H    . GLU A 1 39 ? 2.699   5.310   1.279   1.00 0.00 ? 39  GLU A H    9  
ATOM   8701  H  HA   . GLU A 1 39 ? 1.849   8.061   0.699   1.00 0.00 ? 39  GLU A HA   9  
ATOM   8702  H  HB2  . GLU A 1 39 ? 4.172   7.749   0.254   1.00 0.00 ? 39  GLU A HB2  9  
ATOM   8703  H  HB3  . GLU A 1 39 ? 3.872   6.248   -0.611  1.00 0.00 ? 39  GLU A HB3  9  
ATOM   8704  H  HG2  . GLU A 1 39 ? 3.093   7.330   -2.494  1.00 0.00 ? 39  GLU A HG2  9  
ATOM   8705  H  HG3  . GLU A 1 39 ? 2.700   8.804   -1.610  1.00 0.00 ? 39  GLU A HG3  9  
ATOM   8706  N  N    . VAL A 1 40 ? 0.064   7.489   -0.904  1.00 0.00 ? 40  VAL A N    9  
ATOM   8707  C  CA   . VAL A 1 40 ? -1.016  7.178   -1.833  1.00 0.00 ? 40  VAL A CA   9  
ATOM   8708  C  C    . VAL A 1 40 ? -0.481  6.497   -3.088  1.00 0.00 ? 40  VAL A C    9  
ATOM   8709  O  O    . VAL A 1 40 ? 0.199   7.120   -3.904  1.00 0.00 ? 40  VAL A O    9  
ATOM   8710  C  CB   . VAL A 1 40 ? -1.789  8.446   -2.240  1.00 0.00 ? 40  VAL A CB   9  
ATOM   8711  C  CG1  . VAL A 1 40 ? -3.032  8.081   -3.037  1.00 0.00 ? 40  VAL A CG1  9  
ATOM   8712  C  CG2  . VAL A 1 40 ? -2.156  9.263   -1.010  1.00 0.00 ? 40  VAL A CG2  9  
ATOM   8713  H  H    . VAL A 1 40 ? 0.046   8.340   -0.418  1.00 0.00 ? 40  VAL A H    9  
ATOM   8714  H  HA   . VAL A 1 40 ? -1.701  6.507   -1.335  1.00 0.00 ? 40  VAL A HA   9  
ATOM   8715  H  HB   . VAL A 1 40 ? -1.149  9.047   -2.868  1.00 0.00 ? 40  VAL A HB   9  
ATOM   8716  H  HG11 . VAL A 1 40 ? -3.661  7.432   -2.446  1.00 0.00 ? 40  VAL A HG11 9  
ATOM   8717  H  HG12 . VAL A 1 40 ? -3.575  8.980   -3.290  1.00 0.00 ? 40  VAL A HG12 9  
ATOM   8718  H  HG13 . VAL A 1 40 ? -2.740  7.569   -3.943  1.00 0.00 ? 40  VAL A HG13 9  
ATOM   8719  H  HG21 . VAL A 1 40 ? -2.834  10.054  -1.294  1.00 0.00 ? 40  VAL A HG21 9  
ATOM   8720  H  HG22 . VAL A 1 40 ? -2.633  8.624   -0.281  1.00 0.00 ? 40  VAL A HG22 9  
ATOM   8721  H  HG23 . VAL A 1 40 ? -1.261  9.692   -0.582  1.00 0.00 ? 40  VAL A HG23 9  
ATOM   8722  N  N    . LEU A 1 41 ? -0.794  5.214   -3.237  1.00 0.00 ? 41  LEU A N    9  
ATOM   8723  C  CA   . LEU A 1 41 ? -0.346  4.447   -4.394  1.00 0.00 ? 41  LEU A CA   9  
ATOM   8724  C  C    . LEU A 1 41 ? -1.473  4.284   -5.409  1.00 0.00 ? 41  LEU A C    9  
ATOM   8725  O  O    . LEU A 1 41 ? -1.618  3.230   -6.026  1.00 0.00 ? 41  LEU A O    9  
ATOM   8726  C  CB   . LEU A 1 41 ? 0.162   3.073   -3.954  1.00 0.00 ? 41  LEU A CB   9  
ATOM   8727  C  CG   . LEU A 1 41 ? 0.816   3.010   -2.573  1.00 0.00 ? 41  LEU A CG   9  
ATOM   8728  C  CD1  . LEU A 1 41 ? 0.797   1.586   -2.038  1.00 0.00 ? 41  LEU A CD1  9  
ATOM   8729  C  CD2  . LEU A 1 41 ? 2.242   3.539   -2.634  1.00 0.00 ? 41  LEU A CD2  9  
ATOM   8730  H  H    . LEU A 1 41 ? -1.339  4.772   -2.554  1.00 0.00 ? 41  LEU A H    9  
ATOM   8731  H  HA   . LEU A 1 41 ? 0.464   4.990   -4.857  1.00 0.00 ? 41  LEU A HA   9  
ATOM   8732  H  HB2  . LEU A 1 41 ? -0.678  2.395   -3.952  1.00 0.00 ? 41  LEU A HB2  9  
ATOM   8733  H  HB3  . LEU A 1 41 ? 0.889   2.741   -4.681  1.00 0.00 ? 41  LEU A HB3  9  
ATOM   8734  H  HG   . LEU A 1 41 ? 0.257   3.631   -1.888  1.00 0.00 ? 41  LEU A HG   9  
ATOM   8735  H  HD11 . LEU A 1 41 ? 0.550   0.904   -2.837  1.00 0.00 ? 41  LEU A HD11 9  
ATOM   8736  H  HD12 . LEU A 1 41 ? 0.058   1.506   -1.255  1.00 0.00 ? 41  LEU A HD12 9  
ATOM   8737  H  HD13 . LEU A 1 41 ? 1.771   1.338   -1.640  1.00 0.00 ? 41  LEU A HD13 9  
ATOM   8738  H  HD21 . LEU A 1 41 ? 2.234   4.548   -3.021  1.00 0.00 ? 41  LEU A HD21 9  
ATOM   8739  H  HD22 . LEU A 1 41 ? 2.832   2.909   -3.283  1.00 0.00 ? 41  LEU A HD22 9  
ATOM   8740  H  HD23 . LEU A 1 41 ? 2.669   3.537   -1.643  1.00 0.00 ? 41  LEU A HD23 9  
ATOM   8741  N  N    . ALA A 1 42 ? -2.267  5.337   -5.578  1.00 0.00 ? 42  ALA A N    9  
ATOM   8742  C  CA   . ALA A 1 42 ? -3.378  5.312   -6.521  1.00 0.00 ? 42  ALA A CA   9  
ATOM   8743  C  C    . ALA A 1 42 ? -2.891  5.534   -7.949  1.00 0.00 ? 42  ALA A C    9  
ATOM   8744  O  O    . ALA A 1 42 ? -3.163  4.730   -8.840  1.00 0.00 ? 42  ALA A O    9  
ATOM   8745  C  CB   . ALA A 1 42 ? -4.413  6.362   -6.145  1.00 0.00 ? 42  ALA A CB   9  
ATOM   8746  H  H    . ALA A 1 42 ? -2.100  6.149   -5.056  1.00 0.00 ? 42  ALA A H    9  
ATOM   8747  H  HA   . ALA A 1 42 ? -3.847  4.340   -6.458  1.00 0.00 ? 42  ALA A HA   9  
ATOM   8748  H  HB1  . ALA A 1 42 ? -4.608  6.995   -6.998  1.00 0.00 ? 42  ALA A HB1  9  
ATOM   8749  H  HB2  . ALA A 1 42 ? -5.327  5.873   -5.841  1.00 0.00 ? 42  ALA A HB2  9  
ATOM   8750  H  HB3  . ALA A 1 42 ? -4.037  6.962   -5.330  1.00 0.00 ? 42  ALA A HB3  9  
ATOM   8751  N  N    . ASP A 1 43 ? -2.169  6.630   -8.159  1.00 0.00 ? 43  ASP A N    9  
ATOM   8752  C  CA   . ASP A 1 43 ? -1.644  6.957   -9.479  1.00 0.00 ? 43  ASP A CA   9  
ATOM   8753  C  C    . ASP A 1 43 ? -0.211  6.458   -9.633  1.00 0.00 ? 43  ASP A C    9  
ATOM   8754  O  O    . ASP A 1 43 ? 0.093   5.685   -10.542 1.00 0.00 ? 43  ASP A O    9  
ATOM   8755  C  CB   . ASP A 1 43 ? -1.698  8.468   -9.713  1.00 0.00 ? 43  ASP A CB   9  
ATOM   8756  C  CG   . ASP A 1 43 ? -3.115  9.007   -9.689  1.00 0.00 ? 43  ASP A CG   9  
ATOM   8757  O  OD1  . ASP A 1 43 ? -3.834  8.745   -8.702  1.00 0.00 ? 43  ASP A OD1  9  
ATOM   8758  O  OD2  . ASP A 1 43 ? -3.506  9.691   -10.658 1.00 0.00 ? 43  ASP A OD2  9  
ATOM   8759  H  H    . ASP A 1 43 ? -1.985  7.232   -7.408  1.00 0.00 ? 43  ASP A H    9  
ATOM   8760  H  HA   . ASP A 1 43 ? -2.264  6.466   -10.214 1.00 0.00 ? 43  ASP A HA   9  
ATOM   8761  H  HB2  . ASP A 1 43 ? -1.131  8.966   -8.940  1.00 0.00 ? 43  ASP A HB2  9  
ATOM   8762  H  HB3  . ASP A 1 43 ? -1.263  8.693   -10.675 1.00 0.00 ? 43  ASP A HB3  9  
ATOM   8763  N  N    . ILE A 1 44 ? 0.665   6.905   -8.740  1.00 0.00 ? 44  ILE A N    9  
ATOM   8764  C  CA   . ILE A 1 44 ? 2.066   6.503   -8.776  1.00 0.00 ? 44  ILE A CA   9  
ATOM   8765  C  C    . ILE A 1 44 ? 2.200   4.993   -8.944  1.00 0.00 ? 44  ILE A C    9  
ATOM   8766  O  O    . ILE A 1 44 ? 3.177   4.506   -9.512  1.00 0.00 ? 44  ILE A O    9  
ATOM   8767  C  CB   . ILE A 1 44 ? 2.809   6.934   -7.498  1.00 0.00 ? 44  ILE A CB   9  
ATOM   8768  C  CG1  . ILE A 1 44 ? 2.152   6.311   -6.265  1.00 0.00 ? 44  ILE A CG1  9  
ATOM   8769  C  CG2  . ILE A 1 44 ? 2.831   8.451   -7.385  1.00 0.00 ? 44  ILE A CG2  9  
ATOM   8770  C  CD1  . ILE A 1 44 ? 3.017   6.367   -5.026  1.00 0.00 ? 44  ILE A CD1  9  
ATOM   8771  H  H    . ILE A 1 44 ? 0.362   7.519   -8.039  1.00 0.00 ? 44  ILE A H    9  
ATOM   8772  H  HA   . ILE A 1 44 ? 2.530   6.991   -9.621  1.00 0.00 ? 44  ILE A HA   9  
ATOM   8773  H  HB   . ILE A 1 44 ? 3.829   6.588   -7.567  1.00 0.00 ? 44  ILE A HB   9  
ATOM   8774  H  HG12 . ILE A 1 44 ? 1.233   6.835   -6.051  1.00 0.00 ? 44  ILE A HG12 9  
ATOM   8775  H  HG13 . ILE A 1 44 ? 1.930   5.274   -6.470  1.00 0.00 ? 44  ILE A HG13 9  
ATOM   8776  H  HG21 . ILE A 1 44 ? 2.036   8.774   -6.729  1.00 0.00 ? 44  ILE A HG21 9  
ATOM   8777  H  HG22 . ILE A 1 44 ? 3.780   8.768   -6.980  1.00 0.00 ? 44  ILE A HG22 9  
ATOM   8778  H  HG23 . ILE A 1 44 ? 2.691   8.888   -8.362  1.00 0.00 ? 44  ILE A HG23 9  
ATOM   8779  H  HD11 . ILE A 1 44 ? 2.390   6.464   -4.152  1.00 0.00 ? 44  ILE A HD11 9  
ATOM   8780  H  HD12 . ILE A 1 44 ? 3.601   5.462   -4.953  1.00 0.00 ? 44  ILE A HD12 9  
ATOM   8781  H  HD13 . ILE A 1 44 ? 3.680   7.218   -5.088  1.00 0.00 ? 44  ILE A HD13 9  
ATOM   8782  N  N    . GLY A 1 45 ? 1.211   4.257   -8.448  1.00 0.00 ? 45  GLY A N    9  
ATOM   8783  C  CA   . GLY A 1 45 ? 1.237   2.810   -8.554  1.00 0.00 ? 45  GLY A CA   9  
ATOM   8784  C  C    . GLY A 1 45 ? 1.715   2.144   -7.280  1.00 0.00 ? 45  GLY A C    9  
ATOM   8785  O  O    . GLY A 1 45 ? 2.264   2.801   -6.395  1.00 0.00 ? 45  GLY A O    9  
ATOM   8786  H  H    . GLY A 1 45 ? 0.457   4.701   -8.005  1.00 0.00 ? 45  GLY A H    9  
ATOM   8787  H  HA2  . GLY A 1 45 ? 0.241   2.459   -8.780  1.00 0.00 ? 45  GLY A HA2  9  
ATOM   8788  H  HA3  . GLY A 1 45 ? 1.898   2.532   -9.362  1.00 0.00 ? 45  GLY A HA3  9  
ATOM   8789  N  N    . PHE A 1 46 ? 1.507   0.835   -7.184  1.00 0.00 ? 46  PHE A N    9  
ATOM   8790  C  CA   . PHE A 1 46 ? 1.919   0.079   -6.007  1.00 0.00 ? 46  PHE A CA   9  
ATOM   8791  C  C    . PHE A 1 46 ? 2.643   -1.203  -6.410  1.00 0.00 ? 46  PHE A C    9  
ATOM   8792  O  O    . PHE A 1 46 ? 2.568   -1.637  -7.559  1.00 0.00 ? 46  PHE A O    9  
ATOM   8793  C  CB   . PHE A 1 46 ? 0.704   -0.260  -5.141  1.00 0.00 ? 46  PHE A CB   9  
ATOM   8794  C  CG   . PHE A 1 46 ? -0.252  -1.215  -5.796  1.00 0.00 ? 46  PHE A CG   9  
ATOM   8795  C  CD1  . PHE A 1 46 ? -1.031  -0.811  -6.868  1.00 0.00 ? 46  PHE A CD1  9  
ATOM   8796  C  CD2  . PHE A 1 46 ? -0.372  -2.518  -5.340  1.00 0.00 ? 46  PHE A CD2  9  
ATOM   8797  C  CE1  . PHE A 1 46 ? -1.912  -1.688  -7.474  1.00 0.00 ? 46  PHE A CE1  9  
ATOM   8798  C  CE2  . PHE A 1 46 ? -1.250  -3.400  -5.942  1.00 0.00 ? 46  PHE A CE2  9  
ATOM   8799  C  CZ   . PHE A 1 46 ? -2.022  -2.984  -7.009  1.00 0.00 ? 46  PHE A CZ   9  
ATOM   8800  H  H    . PHE A 1 46 ? 1.065   0.366   -7.923  1.00 0.00 ? 46  PHE A H    9  
ATOM   8801  H  HA   . PHE A 1 46 ? 2.595   0.697   -5.438  1.00 0.00 ? 46  PHE A HA   9  
ATOM   8802  H  HB2  . PHE A 1 46 ? 1.041   -0.709  -4.219  1.00 0.00 ? 46  PHE A HB2  9  
ATOM   8803  H  HB3  . PHE A 1 46 ? 0.166   0.649   -4.918  1.00 0.00 ? 46  PHE A HB3  9  
ATOM   8804  H  HD1  . PHE A 1 46 ? -0.946  0.204   -7.232  1.00 0.00 ? 46  PHE A HD1  9  
ATOM   8805  H  HD2  . PHE A 1 46 ? 0.230   -2.845  -4.505  1.00 0.00 ? 46  PHE A HD2  9  
ATOM   8806  H  HE1  . PHE A 1 46 ? -2.514  -1.359  -8.308  1.00 0.00 ? 46  PHE A HE1  9  
ATOM   8807  H  HE2  . PHE A 1 46 ? -1.334  -4.412  -5.577  1.00 0.00 ? 46  PHE A HE2  9  
ATOM   8808  H  HZ   . PHE A 1 46 ? -2.708  -3.670  -7.481  1.00 0.00 ? 46  PHE A HZ   9  
ATOM   8809  N  N    . VAL A 1 47 ? 3.346   -1.803  -5.454  1.00 0.00 ? 47  VAL A N    9  
ATOM   8810  C  CA   . VAL A 1 47 ? 4.084   -3.035  -5.708  1.00 0.00 ? 47  VAL A CA   9  
ATOM   8811  C  C    . VAL A 1 47 ? 3.765   -4.093  -4.657  1.00 0.00 ? 47  VAL A C    9  
ATOM   8812  O  O    . VAL A 1 47 ? 4.299   -4.064  -3.549  1.00 0.00 ? 47  VAL A O    9  
ATOM   8813  C  CB   . VAL A 1 47 ? 5.603   -2.785  -5.724  1.00 0.00 ? 47  VAL A CB   9  
ATOM   8814  C  CG1  . VAL A 1 47 ? 6.351   -4.064  -6.069  1.00 0.00 ? 47  VAL A CG1  9  
ATOM   8815  C  CG2  . VAL A 1 47 ? 5.950   -1.674  -6.704  1.00 0.00 ? 47  VAL A CG2  9  
ATOM   8816  H  H    . VAL A 1 47 ? 3.367   -1.409  -4.558  1.00 0.00 ? 47  VAL A H    9  
ATOM   8817  H  HA   . VAL A 1 47 ? 3.790   -3.406  -6.679  1.00 0.00 ? 47  VAL A HA   9  
ATOM   8818  H  HB   . VAL A 1 47 ? 5.907   -2.472  -4.736  1.00 0.00 ? 47  VAL A HB   9  
ATOM   8819  H  HG11 . VAL A 1 47 ? 5.641   -4.860  -6.244  1.00 0.00 ? 47  VAL A HG11 9  
ATOM   8820  H  HG12 . VAL A 1 47 ? 6.943   -3.907  -6.958  1.00 0.00 ? 47  VAL A HG12 9  
ATOM   8821  H  HG13 . VAL A 1 47 ? 6.999   -4.335  -5.248  1.00 0.00 ? 47  VAL A HG13 9  
ATOM   8822  H  HG21 . VAL A 1 47 ? 6.354   -2.106  -7.607  1.00 0.00 ? 47  VAL A HG21 9  
ATOM   8823  H  HG22 . VAL A 1 47 ? 5.058   -1.112  -6.942  1.00 0.00 ? 47  VAL A HG22 9  
ATOM   8824  H  HG23 . VAL A 1 47 ? 6.682   -1.017  -6.259  1.00 0.00 ? 47  VAL A HG23 9  
ATOM   8825  N  N    . LYS A 1 48 ? 2.889   -5.027  -5.013  1.00 0.00 ? 48  LYS A N    9  
ATOM   8826  C  CA   . LYS A 1 48 ? 2.499   -6.097  -4.103  1.00 0.00 ? 48  LYS A CA   9  
ATOM   8827  C  C    . LYS A 1 48 ? 3.726   -6.807  -3.540  1.00 0.00 ? 48  LYS A C    9  
ATOM   8828  O  O    . LYS A 1 48 ? 4.654   -7.139  -4.275  1.00 0.00 ? 48  LYS A O    9  
ATOM   8829  C  CB   . LYS A 1 48 ? 1.599   -7.104  -4.822  1.00 0.00 ? 48  LYS A CB   9  
ATOM   8830  C  CG   . LYS A 1 48 ? 0.117   -6.804  -4.682  1.00 0.00 ? 48  LYS A CG   9  
ATOM   8831  C  CD   . LYS A 1 48 ? -0.402  -7.187  -3.306  1.00 0.00 ? 48  LYS A CD   9  
ATOM   8832  C  CE   . LYS A 1 48 ? -0.682  -8.679  -3.212  1.00 0.00 ? 48  LYS A CE   9  
ATOM   8833  N  NZ   . LYS A 1 48 ? -2.048  -9.019  -3.698  1.00 0.00 ? 48  LYS A NZ   9  
ATOM   8834  H  H    . LYS A 1 48 ? 2.497   -4.997  -5.911  1.00 0.00 ? 48  LYS A H    9  
ATOM   8835  H  HA   . LYS A 1 48 ? 1.948   -5.654  -3.287  1.00 0.00 ? 48  LYS A HA   9  
ATOM   8836  H  HB2  . LYS A 1 48 ? 1.847   -7.103  -5.874  1.00 0.00 ? 48  LYS A HB2  9  
ATOM   8837  H  HB3  . LYS A 1 48 ? 1.785   -8.088  -4.418  1.00 0.00 ? 48  LYS A HB3  9  
ATOM   8838  H  HG2  . LYS A 1 48 ? -0.043  -5.747  -4.833  1.00 0.00 ? 48  LYS A HG2  9  
ATOM   8839  H  HG3  . LYS A 1 48 ? -0.427  -7.363  -5.430  1.00 0.00 ? 48  LYS A HG3  9  
ATOM   8840  H  HD2  . LYS A 1 48 ? 0.338   -6.924  -2.565  1.00 0.00 ? 48  LYS A HD2  9  
ATOM   8841  H  HD3  . LYS A 1 48 ? -1.317  -6.645  -3.112  1.00 0.00 ? 48  LYS A HD3  9  
ATOM   8842  H  HE2  . LYS A 1 48 ? 0.045   -9.207  -3.810  1.00 0.00 ? 48  LYS A HE2  9  
ATOM   8843  H  HE3  . LYS A 1 48 ? -0.589  -8.985  -2.181  1.00 0.00 ? 48  LYS A HE3  9  
ATOM   8844  H  HZ1  . LYS A 1 48 ? -2.311  -8.397  -4.489  1.00 0.00 ? 48  LYS A HZ1  9  
ATOM   8845  H  HZ2  . LYS A 1 48 ? -2.740  -8.897  -2.931  1.00 0.00 ? 48  LYS A HZ2  9  
ATOM   8846  H  HZ3  . LYS A 1 48 ? -2.077  -10.006 -4.023  1.00 0.00 ? 48  LYS A HZ3  9  
ATOM   8847  N  N    . ASN A 1 49 ? 3.722   -7.038  -2.231  1.00 0.00 ? 49  ASN A N    9  
ATOM   8848  C  CA   . ASN A 1 49 ? 4.834   -7.710  -1.570  1.00 0.00 ? 49  ASN A CA   9  
ATOM   8849  C  C    . ASN A 1 49 ? 4.425   -8.208  -0.187  1.00 0.00 ? 49  ASN A C    9  
ATOM   8850  O  O    . ASN A 1 49 ? 3.857   -7.461  0.609   1.00 0.00 ? 49  ASN A O    9  
ATOM   8851  C  CB   . ASN A 1 49 ? 6.031   -6.764  -1.451  1.00 0.00 ? 49  ASN A CB   9  
ATOM   8852  C  CG   . ASN A 1 49 ? 7.348   -7.508  -1.346  1.00 0.00 ? 49  ASN A CG   9  
ATOM   8853  O  OD1  . ASN A 1 49 ? 7.480   -8.631  -1.833  1.00 0.00 ? 49  ASN A OD1  9  
ATOM   8854  N  ND2  . ASN A 1 49 ? 8.331   -6.884  -0.708  1.00 0.00 ? 49  ASN A ND2  9  
ATOM   8855  H  H    . ASN A 1 49 ? 2.952   -6.750  -1.697  1.00 0.00 ? 49  ASN A H    9  
ATOM   8856  H  HA   . ASN A 1 49 ? 5.116   -8.558  -2.176  1.00 0.00 ? 49  ASN A HA   9  
ATOM   8857  H  HB2  . ASN A 1 49 ? 6.067   -6.128  -2.324  1.00 0.00 ? 49  ASN A HB2  9  
ATOM   8858  H  HB3  . ASN A 1 49 ? 5.912   -6.152  -0.569  1.00 0.00 ? 49  ASN A HB3  9  
ATOM   8859  H  HD21 . ASN A 1 49 ? 8.154   -5.990  -0.345  1.00 0.00 ? 49  ASN A HD21 9  
ATOM   8860  H  HD22 . ASN A 1 49 ? 9.194   -7.341  -0.626  1.00 0.00 ? 49  ASN A HD22 9  
ATOM   8861  N  N    . ALA A 1 50 ? 4.720   -9.473  0.092   1.00 0.00 ? 50  ALA A N    9  
ATOM   8862  C  CA   . ALA A 1 50 ? 4.386   -10.070 1.379   1.00 0.00 ? 50  ALA A CA   9  
ATOM   8863  C  C    . ALA A 1 50 ? 2.969   -9.699  1.805   1.00 0.00 ? 50  ALA A C    9  
ATOM   8864  O  O    . ALA A 1 50 ? 2.704   -9.474  2.985   1.00 0.00 ? 50  ALA A O    9  
ATOM   8865  C  CB   . ALA A 1 50 ? 5.388   -9.636  2.438   1.00 0.00 ? 50  ALA A CB   9  
ATOM   8866  H  H    . ALA A 1 50 ? 5.174   -10.018 -0.584  1.00 0.00 ? 50  ALA A H    9  
ATOM   8867  H  HA   . ALA A 1 50 ? 4.450   -11.144 1.276   1.00 0.00 ? 50  ALA A HA   9  
ATOM   8868  H  HB1  . ALA A 1 50 ? 6.200   -9.102  1.966   1.00 0.00 ? 50  ALA A HB1  9  
ATOM   8869  H  HB2  . ALA A 1 50 ? 4.899   -8.990  3.153   1.00 0.00 ? 50  ALA A HB2  9  
ATOM   8870  H  HB3  . ALA A 1 50 ? 5.776   -10.507 2.945   1.00 0.00 ? 50  ALA A HB3  9  
ATOM   8871  N  N    . GLY A 1 51 ? 2.062   -9.635  0.835   1.00 0.00 ? 51  GLY A N    9  
ATOM   8872  C  CA   . GLY A 1 51 ? 0.684   -9.290  1.130   1.00 0.00 ? 51  GLY A CA   9  
ATOM   8873  C  C    . GLY A 1 51 ? 0.537   -7.867  1.632   1.00 0.00 ? 51  GLY A C    9  
ATOM   8874  O  O    . GLY A 1 51 ? -0.324  -7.581  2.464   1.00 0.00 ? 51  GLY A O    9  
ATOM   8875  H  H    . GLY A 1 51 ? 2.331   -9.824  -0.089  1.00 0.00 ? 51  GLY A H    9  
ATOM   8876  H  HA2  . GLY A 1 51 ? 0.095   -9.406  0.232   1.00 0.00 ? 51  GLY A HA2  9  
ATOM   8877  H  HA3  . GLY A 1 51 ? 0.309   -9.966  1.884   1.00 0.00 ? 51  GLY A HA3  9  
ATOM   8878  N  N    . ARG A 1 52 ? 1.381   -6.973  1.126   1.00 0.00 ? 52  ARG A N    9  
ATOM   8879  C  CA   . ARG A 1 52 ? 1.343   -5.573  1.531   1.00 0.00 ? 52  ARG A CA   9  
ATOM   8880  C  C    . ARG A 1 52 ? 1.587   -4.655  0.336   1.00 0.00 ? 52  ARG A C    9  
ATOM   8881  O  O    . ARG A 1 52 ? 2.322   -5.004  -0.588  1.00 0.00 ? 52  ARG A O    9  
ATOM   8882  C  CB   . ARG A 1 52 ? 2.389   -5.305  2.615   1.00 0.00 ? 52  ARG A CB   9  
ATOM   8883  C  CG   . ARG A 1 52 ? 2.269   -6.227  3.818   1.00 0.00 ? 52  ARG A CG   9  
ATOM   8884  C  CD   . ARG A 1 52 ? 3.554   -6.252  4.630   1.00 0.00 ? 52  ARG A CD   9  
ATOM   8885  N  NE   . ARG A 1 52 ? 3.547   -7.315  5.632   1.00 0.00 ? 52  ARG A NE   9  
ATOM   8886  C  CZ   . ARG A 1 52 ? 4.272   -7.281  6.745   1.00 0.00 ? 52  ARG A CZ   9  
ATOM   8887  N  NH1  . ARG A 1 52 ? 5.056   -6.242  6.997   1.00 0.00 ? 52  ARG A NH1  9  
ATOM   8888  N  NH2  . ARG A 1 52 ? 4.212   -8.287  7.608   1.00 0.00 ? 52  ARG A NH2  9  
ATOM   8889  H  H    . ARG A 1 52 ? 2.045   -7.262  0.466   1.00 0.00 ? 52  ARG A H    9  
ATOM   8890  H  HA   . ARG A 1 52 ? 0.361   -5.370  1.932   1.00 0.00 ? 52  ARG A HA   9  
ATOM   8891  H  HB2  . ARG A 1 52 ? 3.373   -5.432  2.189   1.00 0.00 ? 52  ARG A HB2  9  
ATOM   8892  H  HB3  . ARG A 1 52 ? 2.281   -4.287  2.957   1.00 0.00 ? 52  ARG A HB3  9  
ATOM   8893  H  HG2  . ARG A 1 52 ? 1.464   -5.878  4.448   1.00 0.00 ? 52  ARG A HG2  9  
ATOM   8894  H  HG3  . ARG A 1 52 ? 2.051   -7.226  3.473   1.00 0.00 ? 52  ARG A HG3  9  
ATOM   8895  H  HD2  . ARG A 1 52 ? 4.385   -6.408  3.959   1.00 0.00 ? 52  ARG A HD2  9  
ATOM   8896  H  HD3  . ARG A 1 52 ? 3.668   -5.301  5.129   1.00 0.00 ? 52  ARG A HD3  9  
ATOM   8897  H  HE   . ARG A 1 52 ? 2.975   -8.092  5.465   1.00 0.00 ? 52  ARG A HE   9  
ATOM   8898  H  HH11 . ARG A 1 52 ? 5.102   -5.482  6.349   1.00 0.00 ? 52  ARG A HH11 9  
ATOM   8899  H  HH12 . ARG A 1 52 ? 5.599   -6.218  7.837   1.00 0.00 ? 52  ARG A HH12 9  
ATOM   8900  H  HH21 . ARG A 1 52 ? 3.622   -9.071  7.421   1.00 0.00 ? 52  ARG A HH21 9  
ATOM   8901  H  HH22 . ARG A 1 52 ? 4.757   -8.260  8.445   1.00 0.00 ? 52  ARG A HH22 9  
ATOM   8902  N  N    . HIS A 1 53 ? 0.964   -3.481  0.362   1.00 0.00 ? 53  HIS A N    9  
ATOM   8903  C  CA   . HIS A 1 53 ? 1.114   -2.512  -0.718  1.00 0.00 ? 53  HIS A CA   9  
ATOM   8904  C  C    . HIS A 1 53 ? 2.270   -1.558  -0.436  1.00 0.00 ? 53  HIS A C    9  
ATOM   8905  O  O    . HIS A 1 53 ? 2.249   -0.814  0.546   1.00 0.00 ? 53  HIS A O    9  
ATOM   8906  C  CB   . HIS A 1 53 ? -0.182  -1.722  -0.906  1.00 0.00 ? 53  HIS A CB   9  
ATOM   8907  C  CG   . HIS A 1 53 ? -0.744  -1.182  0.373   1.00 0.00 ? 53  HIS A CG   9  
ATOM   8908  N  ND1  . HIS A 1 53 ? -0.022  -1.121  1.546   1.00 0.00 ? 53  HIS A ND1  9  
ATOM   8909  C  CD2  . HIS A 1 53 ? -1.967  -0.676  0.658   1.00 0.00 ? 53  HIS A CD2  9  
ATOM   8910  C  CE1  . HIS A 1 53 ? -0.777  -0.601  2.498   1.00 0.00 ? 53  HIS A CE1  9  
ATOM   8911  N  NE2  . HIS A 1 53 ? -1.962  -0.322  1.985   1.00 0.00 ? 53  HIS A NE2  9  
ATOM   8912  H  H    . HIS A 1 53 ? 0.392   -3.260  1.126   1.00 0.00 ? 53  HIS A H    9  
ATOM   8913  H  HA   . HIS A 1 53 ? 1.327   -3.058  -1.625  1.00 0.00 ? 53  HIS A HA   9  
ATOM   8914  H  HB2  . HIS A 1 53 ? 0.006   -0.886  -1.564  1.00 0.00 ? 53  HIS A HB2  9  
ATOM   8915  H  HB3  . HIS A 1 53 ? -0.927  -2.365  -1.352  1.00 0.00 ? 53  HIS A HB3  9  
ATOM   8916  H  HD1  . HIS A 1 53 ? 0.904   -1.415  1.664   1.00 0.00 ? 53  HIS A HD1  9  
ATOM   8917  H  HD2  . HIS A 1 53 ? -2.794  -0.570  -0.030  1.00 0.00 ? 53  HIS A HD2  9  
ATOM   8918  H  HE1  . HIS A 1 53 ? -0.477  -0.433  3.522   1.00 0.00 ? 53  HIS A HE1  9  
ATOM   8919  H  HE2  . HIS A 1 53 ? -2.737  -0.008  2.495   1.00 0.00 ? 53  HIS A HE2  9  
ATOM   8920  N  N    . LEU A 1 54 ? 3.277   -1.584  -1.302  1.00 0.00 ? 54  LEU A N    9  
ATOM   8921  C  CA   . LEU A 1 54 ? 4.443   -0.721  -1.146  1.00 0.00 ? 54  LEU A CA   9  
ATOM   8922  C  C    . LEU A 1 54 ? 4.676   0.112   -2.403  1.00 0.00 ? 54  LEU A C    9  
ATOM   8923  O  O    . LEU A 1 54 ? 4.224   -0.247  -3.491  1.00 0.00 ? 54  LEU A O    9  
ATOM   8924  C  CB   . LEU A 1 54 ? 5.684   -1.559  -0.838  1.00 0.00 ? 54  LEU A CB   9  
ATOM   8925  C  CG   . LEU A 1 54 ? 5.460   -2.797  0.031   1.00 0.00 ? 54  LEU A CG   9  
ATOM   8926  C  CD1  . LEU A 1 54 ? 6.748   -3.594  0.168   1.00 0.00 ? 54  LEU A CD1  9  
ATOM   8927  C  CD2  . LEU A 1 54 ? 4.929   -2.399  1.400   1.00 0.00 ? 54  LEU A CD2  9  
ATOM   8928  H  H    . LEU A 1 54 ? 3.236   -2.197  -2.065  1.00 0.00 ? 54  LEU A H    9  
ATOM   8929  H  HA   . LEU A 1 54 ? 4.253   -0.055  -0.318  1.00 0.00 ? 54  LEU A HA   9  
ATOM   8930  H  HB2  . LEU A 1 54 ? 6.104   -1.886  -1.777  1.00 0.00 ? 54  LEU A HB2  9  
ATOM   8931  H  HB3  . LEU A 1 54 ? 6.395   -0.922  -0.331  1.00 0.00 ? 54  LEU A HB3  9  
ATOM   8932  H  HG   . LEU A 1 54 ? 4.724   -3.433  -0.443  1.00 0.00 ? 54  LEU A HG   9  
ATOM   8933  H  HD11 . LEU A 1 54 ? 7.401   -3.104  0.874   1.00 0.00 ? 54  LEU A HD11 9  
ATOM   8934  H  HD12 . LEU A 1 54 ? 7.238   -3.655  -0.793  1.00 0.00 ? 54  LEU A HD12 9  
ATOM   8935  H  HD13 . LEU A 1 54 ? 6.520   -4.590  0.518   1.00 0.00 ? 54  LEU A HD13 9  
ATOM   8936  H  HD21 . LEU A 1 54 ? 4.518   -3.267  1.893   1.00 0.00 ? 54  LEU A HD21 9  
ATOM   8937  H  HD22 . LEU A 1 54 ? 4.157   -1.652  1.283   1.00 0.00 ? 54  LEU A HD22 9  
ATOM   8938  H  HD23 . LEU A 1 54 ? 5.734   -1.994  1.995   1.00 0.00 ? 54  LEU A HD23 9  
ATOM   8939  N  N    . CYS A 1 55 ? 5.386   1.224   -2.246  1.00 0.00 ? 55  CYS A N    9  
ATOM   8940  C  CA   . CYS A 1 55 ? 5.682   2.107   -3.368  1.00 0.00 ? 55  CYS A CA   9  
ATOM   8941  C  C    . CYS A 1 55 ? 7.076   1.831   -3.925  1.00 0.00 ? 55  CYS A C    9  
ATOM   8942  O  O    . CYS A 1 55 ? 7.980   1.428   -3.192  1.00 0.00 ? 55  CYS A O    9  
ATOM   8943  C  CB   . CYS A 1 55 ? 5.576   3.570   -2.933  1.00 0.00 ? 55  CYS A CB   9  
ATOM   8944  S  SG   . CYS A 1 55 ? 6.875   4.097   -1.770  1.00 0.00 ? 55  CYS A SG   9  
ATOM   8945  H  H    . CYS A 1 55 ? 5.720   1.456   -1.354  1.00 0.00 ? 55  CYS A H    9  
ATOM   8946  H  HA   . CYS A 1 55 ? 4.954   1.916   -4.141  1.00 0.00 ? 55  CYS A HA   9  
ATOM   8947  H  HB2  . CYS A 1 55 ? 5.641   4.203   -3.807  1.00 0.00 ? 55  CYS A HB2  9  
ATOM   8948  H  HB3  . CYS A 1 55 ? 4.621   3.726   -2.453  1.00 0.00 ? 55  CYS A HB3  9  
ATOM   8949  N  N    . ARG A 1 56 ? 7.241   2.051   -5.225  1.00 0.00 ? 56  ARG A N    9  
ATOM   8950  C  CA   . ARG A 1 56 ? 8.524   1.825   -5.881  1.00 0.00 ? 56  ARG A CA   9  
ATOM   8951  C  C    . ARG A 1 56 ? 9.680   2.216   -4.964  1.00 0.00 ? 56  ARG A C    9  
ATOM   8952  O  O    . ARG A 1 56 ? 10.609  1.443   -4.733  1.00 0.00 ? 56  ARG A O    9  
ATOM   8953  C  CB   . ARG A 1 56 ? 8.601   2.621   -7.185  1.00 0.00 ? 56  ARG A CB   9  
ATOM   8954  C  CG   . ARG A 1 56 ? 8.264   1.801   -8.420  1.00 0.00 ? 56  ARG A CG   9  
ATOM   8955  C  CD   . ARG A 1 56 ? 8.730   2.491   -9.691  1.00 0.00 ? 56  ARG A CD   9  
ATOM   8956  N  NE   . ARG A 1 56 ? 8.277   3.878   -9.759  1.00 0.00 ? 56  ARG A NE   9  
ATOM   8957  C  CZ   . ARG A 1 56 ? 8.144   4.553   -10.895 1.00 0.00 ? 56  ARG A CZ   9  
ATOM   8958  N  NH1  . ARG A 1 56 ? 8.428   3.972   -12.053 1.00 0.00 ? 56  ARG A NH1  9  
ATOM   8959  N  NH2  . ARG A 1 56 ? 7.727   5.812   -10.875 1.00 0.00 ? 56  ARG A NH2  9  
ATOM   8960  H  H    . ARG A 1 56 ? 6.483   2.372   -5.756  1.00 0.00 ? 56  ARG A H    9  
ATOM   8961  H  HA   . ARG A 1 56 ? 8.600   0.772   -6.107  1.00 0.00 ? 56  ARG A HA   9  
ATOM   8962  H  HB2  . ARG A 1 56 ? 7.909   3.448   -7.130  1.00 0.00 ? 56  ARG A HB2  9  
ATOM   8963  H  HB3  . ARG A 1 56 ? 9.603   3.006   -7.298  1.00 0.00 ? 56  ARG A HB3  9  
ATOM   8964  H  HG2  . ARG A 1 56 ? 8.751   0.839   -8.346  1.00 0.00 ? 56  ARG A HG2  9  
ATOM   8965  H  HG3  . ARG A 1 56 ? 7.194   1.662   -8.467  1.00 0.00 ? 56  ARG A HG3  9  
ATOM   8966  H  HD2  . ARG A 1 56 ? 9.810   2.474   -9.720  1.00 0.00 ? 56  ARG A HD2  9  
ATOM   8967  H  HD3  . ARG A 1 56 ? 8.339   1.952   -10.542 1.00 0.00 ? 56  ARG A HD3  9  
ATOM   8968  H  HE   . ARG A 1 56 ? 8.063   4.327   -8.915  1.00 0.00 ? 56  ARG A HE   9  
ATOM   8969  H  HH11 . ARG A 1 56 ? 8.742   3.023   -12.071 1.00 0.00 ? 56  ARG A HH11 9  
ATOM   8970  H  HH12 . ARG A 1 56 ? 8.326   4.482   -12.907 1.00 0.00 ? 56  ARG A HH12 9  
ATOM   8971  H  HH21 . ARG A 1 56 ? 7.512   6.254   -10.005 1.00 0.00 ? 56  ARG A HH21 9  
ATOM   8972  H  HH22 . ARG A 1 56 ? 7.627   6.320   -11.731 1.00 0.00 ? 56  ARG A HH22 9  
ATOM   8973  N  N    . PRO A 1 57 ? 9.622   3.445   -4.431  1.00 0.00 ? 57  PRO A N    9  
ATOM   8974  C  CA   . PRO A 1 57 ? 10.655  3.967   -3.531  1.00 0.00 ? 57  PRO A CA   9  
ATOM   8975  C  C    . PRO A 1 57 ? 11.016  2.979   -2.427  1.00 0.00 ? 57  PRO A C    9  
ATOM   8976  O  O    . PRO A 1 57 ? 12.152  2.512   -2.345  1.00 0.00 ? 57  PRO A O    9  
ATOM   8977  C  CB   . PRO A 1 57 ? 10.008  5.221   -2.937  1.00 0.00 ? 57  PRO A CB   9  
ATOM   8978  C  CG   . PRO A 1 57 ? 9.014   5.655   -3.958  1.00 0.00 ? 57  PRO A CG   9  
ATOM   8979  C  CD   . PRO A 1 57 ? 8.543   4.420   -4.663  1.00 0.00 ? 57  PRO A CD   9  
ATOM   8980  H  HA   . PRO A 1 57 ? 11.549  4.244   -4.072  1.00 0.00 ? 57  PRO A HA   9  
ATOM   8981  H  HB2  . PRO A 1 57 ? 9.530   4.972   -2.000  1.00 0.00 ? 57  PRO A HB2  9  
ATOM   8982  H  HB3  . PRO A 1 57 ? 10.761  5.976   -2.774  1.00 0.00 ? 57  PRO A HB3  9  
ATOM   8983  H  HG2  . PRO A 1 57 ? 8.180   6.142   -3.476  1.00 0.00 ? 57  PRO A HG2  9  
ATOM   8984  H  HG3  . PRO A 1 57 ? 9.483   6.323   -4.666  1.00 0.00 ? 57  PRO A HG3  9  
ATOM   8985  H  HD2  . PRO A 1 57 ? 7.613   4.077   -4.233  1.00 0.00 ? 57  PRO A HD2  9  
ATOM   8986  H  HD3  . PRO A 1 57 ? 8.422   4.616   -5.719  1.00 0.00 ? 57  PRO A HD3  9  
ATOM   8987  N  N    . CYS A 1 58 ? 10.042  2.665   -1.580  1.00 0.00 ? 58  CYS A N    9  
ATOM   8988  C  CA   . CYS A 1 58 ? 10.256  1.732   -0.480  1.00 0.00 ? 58  CYS A CA   9  
ATOM   8989  C  C    . CYS A 1 58 ? 10.634  0.350   -1.005  1.00 0.00 ? 58  CYS A C    9  
ATOM   8990  O  O    . CYS A 1 58 ? 11.752  -0.122  -0.793  1.00 0.00 ? 58  CYS A O    9  
ATOM   8991  C  CB   . CYS A 1 58 ? 8.998   1.634   0.386   1.00 0.00 ? 58  CYS A CB   9  
ATOM   8992  S  SG   . CYS A 1 58 ? 8.522   3.201   1.184   1.00 0.00 ? 58  CYS A SG   9  
ATOM   8993  H  H    . CYS A 1 58 ? 9.156   3.070   -1.697  1.00 0.00 ? 58  CYS A H    9  
ATOM   8994  H  HA   . CYS A 1 58 ? 11.068  2.109   0.122   1.00 0.00 ? 58  CYS A HA   9  
ATOM   8995  H  HB2  . CYS A 1 58 ? 8.170   1.315   -0.231  1.00 0.00 ? 58  CYS A HB2  9  
ATOM   8996  H  HB3  . CYS A 1 58 ? 9.163   0.904   1.164   1.00 0.00 ? 58  CYS A HB3  9  
ATOM   8997  N  N    . HIS A 1 59 ? 9.695   -0.294  -1.691  1.00 0.00 ? 59  HIS A N    9  
ATOM   8998  C  CA   . HIS A 1 59 ? 9.930   -1.622  -2.247  1.00 0.00 ? 59  HIS A CA   9  
ATOM   8999  C  C    . HIS A 1 59 ? 11.351  -1.741  -2.789  1.00 0.00 ? 59  HIS A C    9  
ATOM   9000  O  O    . HIS A 1 59 ? 12.046  -2.721  -2.526  1.00 0.00 ? 59  HIS A O    9  
ATOM   9001  C  CB   . HIS A 1 59 ? 8.921   -1.918  -3.358  1.00 0.00 ? 59  HIS A CB   9  
ATOM   9002  C  CG   . HIS A 1 59 ? 9.135   -3.243  -4.023  1.00 0.00 ? 59  HIS A CG   9  
ATOM   9003  N  ND1  . HIS A 1 59 ? 8.952   -4.447  -3.378  1.00 0.00 ? 59  HIS A ND1  9  
ATOM   9004  C  CD2  . HIS A 1 59 ? 9.518   -3.548  -5.285  1.00 0.00 ? 59  HIS A CD2  9  
ATOM   9005  C  CE1  . HIS A 1 59 ? 9.214   -5.436  -4.214  1.00 0.00 ? 59  HIS A CE1  9  
ATOM   9006  N  NE2  . HIS A 1 59 ? 9.559   -4.917  -5.378  1.00 0.00 ? 59  HIS A NE2  9  
ATOM   9007  H  H    . HIS A 1 59 ? 8.824   0.134   -1.826  1.00 0.00 ? 59  HIS A H    9  
ATOM   9008  H  HA   . HIS A 1 59 ? 9.799   -2.342  -1.453  1.00 0.00 ? 59  HIS A HA   9  
ATOM   9009  H  HB2  . HIS A 1 59 ? 7.925   -1.914  -2.941  1.00 0.00 ? 59  HIS A HB2  9  
ATOM   9010  H  HB3  . HIS A 1 59 ? 8.993   -1.150  -4.114  1.00 0.00 ? 59  HIS A HB3  9  
ATOM   9011  H  HD1  . HIS A 1 59 ? 8.673   -4.561  -2.446  1.00 0.00 ? 59  HIS A HD1  9  
ATOM   9012  H  HD2  . HIS A 1 59 ? 9.748   -2.845  -6.074  1.00 0.00 ? 59  HIS A HD2  9  
ATOM   9013  H  HE1  . HIS A 1 59 ? 9.155   -6.490  -3.985  1.00 0.00 ? 59  HIS A HE1  9  
ATOM   9014  H  HE2  . HIS A 1 59 ? 9.886   -5.427  -6.148  1.00 0.00 ? 59  HIS A HE2  9  
ATOM   9015  N  N    . ASN A 1 60 ? 11.775  -0.735  -3.548  1.00 0.00 ? 60  ASN A N    9  
ATOM   9016  C  CA   . ASN A 1 60 ? 13.113  -0.728  -4.128  1.00 0.00 ? 60  ASN A CA   9  
ATOM   9017  C  C    . ASN A 1 60 ? 14.180  -0.748  -3.037  1.00 0.00 ? 60  ASN A C    9  
ATOM   9018  O  O    . ASN A 1 60 ? 15.200  -1.425  -3.165  1.00 0.00 ? 60  ASN A O    9  
ATOM   9019  C  CB   . ASN A 1 60 ? 13.300  0.504   -5.016  1.00 0.00 ? 60  ASN A CB   9  
ATOM   9020  C  CG   . ASN A 1 60 ? 12.658  0.336   -6.380  1.00 0.00 ? 60  ASN A CG   9  
ATOM   9021  O  OD1  . ASN A 1 60 ? 12.796  -0.708  -7.019  1.00 0.00 ? 60  ASN A OD1  9  
ATOM   9022  N  ND2  . ASN A 1 60 ? 11.951  1.365   -6.832  1.00 0.00 ? 60  ASN A ND2  9  
ATOM   9023  H  H    . ASN A 1 60 ? 11.175  0.019   -3.722  1.00 0.00 ? 60  ASN A H    9  
ATOM   9024  H  HA   . ASN A 1 60 ? 13.217  -1.616  -4.733  1.00 0.00 ? 60  ASN A HA   9  
ATOM   9025  H  HB2  . ASN A 1 60 ? 12.853  1.360   -4.533  1.00 0.00 ? 60  ASN A HB2  9  
ATOM   9026  H  HB3  . ASN A 1 60 ? 14.355  0.684   -5.155  1.00 0.00 ? 60  ASN A HB3  9  
ATOM   9027  H  HD21 . ASN A 1 60 ? 11.885  2.164   -6.268  1.00 0.00 ? 60  ASN A HD21 9  
ATOM   9028  H  HD22 . ASN A 1 60 ? 11.525  1.283   -7.710  1.00 0.00 ? 60  ASN A HD22 9  
ATOM   9029  N  N    . ARG A 1 61 ? 13.935  -0.002  -1.965  1.00 0.00 ? 61  ARG A N    9  
ATOM   9030  C  CA   . ARG A 1 61 ? 14.874  0.067   -0.852  1.00 0.00 ? 61  ARG A CA   9  
ATOM   9031  C  C    . ARG A 1 61 ? 15.036  -1.300  -0.192  1.00 0.00 ? 61  ARG A C    9  
ATOM   9032  O  O    . ARG A 1 61 ? 16.130  -1.668  0.234   1.00 0.00 ? 61  ARG A O    9  
ATOM   9033  C  CB   . ARG A 1 61 ? 14.400  1.091   0.181   1.00 0.00 ? 61  ARG A CB   9  
ATOM   9034  C  CG   . ARG A 1 61 ? 14.606  2.533   -0.253  1.00 0.00 ? 61  ARG A CG   9  
ATOM   9035  C  CD   . ARG A 1 61 ? 14.053  3.508   0.774   1.00 0.00 ? 61  ARG A CD   9  
ATOM   9036  N  NE   . ARG A 1 61 ? 15.027  3.813   1.819   1.00 0.00 ? 61  ARG A NE   9  
ATOM   9037  C  CZ   . ARG A 1 61 ? 14.696  4.276   3.019   1.00 0.00 ? 61  ARG A CZ   9  
ATOM   9038  N  NH1  . ARG A 1 61 ? 13.424  4.486   3.325   1.00 0.00 ? 61  ARG A NH1  9  
ATOM   9039  N  NH2  . ARG A 1 61 ? 15.640  4.530   3.917   1.00 0.00 ? 61  ARG A NH2  9  
ATOM   9040  H  H    . ARG A 1 61 ? 13.104  0.516   -1.921  1.00 0.00 ? 61  ARG A H    9  
ATOM   9041  H  HA   . ARG A 1 61 ? 15.831  0.379   -1.243  1.00 0.00 ? 61  ARG A HA   9  
ATOM   9042  H  HB2  . ARG A 1 61 ? 13.346  0.940   0.363   1.00 0.00 ? 61  ARG A HB2  9  
ATOM   9043  H  HB3  . ARG A 1 61 ? 14.943  0.934   1.101   1.00 0.00 ? 61  ARG A HB3  9  
ATOM   9044  H  HG2  . ARG A 1 61 ? 15.664  2.716   -0.373  1.00 0.00 ? 61  ARG A HG2  9  
ATOM   9045  H  HG3  . ARG A 1 61 ? 14.102  2.691   -1.195  1.00 0.00 ? 61  ARG A HG3  9  
ATOM   9046  H  HD2  . ARG A 1 61 ? 13.781  4.424   0.272   1.00 0.00 ? 61  ARG A HD2  9  
ATOM   9047  H  HD3  . ARG A 1 61 ? 13.176  3.072   1.229   1.00 0.00 ? 61  ARG A HD3  9  
ATOM   9048  H  HE   . ARG A 1 61 ? 15.974  3.665   1.615   1.00 0.00 ? 61  ARG A HE   9  
ATOM   9049  H  HH11 . ARG A 1 61 ? 12.710  4.295   2.651   1.00 0.00 ? 61  ARG A HH11 9  
ATOM   9050  H  HH12 . ARG A 1 61 ? 13.177  4.834   4.230   1.00 0.00 ? 61  ARG A HH12 9  
ATOM   9051  H  HH21 . ARG A 1 61 ? 16.601  4.373   3.691   1.00 0.00 ? 61  ARG A HH21 9  
ATOM   9052  H  HH22 . ARG A 1 61 ? 15.390  4.879   4.820   1.00 0.00 ? 61  ARG A HH22 9  
ATOM   9053  N  N    . GLU A 1 62 ? 13.938  -2.045  -0.110  1.00 0.00 ? 62  GLU A N    9  
ATOM   9054  C  CA   . GLU A 1 62 ? 13.958  -3.370  0.500   1.00 0.00 ? 62  GLU A CA   9  
ATOM   9055  C  C    . GLU A 1 62 ? 14.632  -4.382  -0.421  1.00 0.00 ? 62  GLU A C    9  
ATOM   9056  O  O    . GLU A 1 62 ? 15.713  -4.890  -0.120  1.00 0.00 ? 62  GLU A O    9  
ATOM   9057  C  CB   . GLU A 1 62 ? 12.535  -3.828  0.825   1.00 0.00 ? 62  GLU A CB   9  
ATOM   9058  C  CG   . GLU A 1 62 ? 11.676  -2.744  1.455   1.00 0.00 ? 62  GLU A CG   9  
ATOM   9059  C  CD   . GLU A 1 62 ? 11.818  -2.691  2.964   1.00 0.00 ? 62  GLU A CD   9  
ATOM   9060  O  OE1  . GLU A 1 62 ? 12.844  -2.165  3.444   1.00 0.00 ? 62  GLU A OE1  9  
ATOM   9061  O  OE2  . GLU A 1 62 ? 10.904  -3.174  3.664   1.00 0.00 ? 62  GLU A OE2  9  
ATOM   9062  H  H    . GLU A 1 62 ? 13.095  -1.696  -0.467  1.00 0.00 ? 62  GLU A H    9  
ATOM   9063  H  HA   . GLU A 1 62 ? 14.524  -3.304  1.417   1.00 0.00 ? 62  GLU A HA   9  
ATOM   9064  H  HB2  . GLU A 1 62 ? 12.057  -4.153  -0.087  1.00 0.00 ? 62  GLU A HB2  9  
ATOM   9065  H  HB3  . GLU A 1 62 ? 12.586  -4.661  1.510   1.00 0.00 ? 62  GLU A HB3  9  
ATOM   9066  H  HG2  . GLU A 1 62 ? 11.968  -1.788  1.047   1.00 0.00 ? 62  GLU A HG2  9  
ATOM   9067  H  HG3  . GLU A 1 62 ? 10.641  -2.937  1.212   1.00 0.00 ? 62  GLU A HG3  9  
ATOM   9068  N  N    . LYS A 1 63 ? 13.987  -4.672  -1.546  1.00 0.00 ? 63  LYS A N    9  
ATOM   9069  C  CA   . LYS A 1 63 ? 14.522  -5.622  -2.513  1.00 0.00 ? 63  LYS A CA   9  
ATOM   9070  C  C    . LYS A 1 63 ? 15.984  -5.319  -2.823  1.00 0.00 ? 63  LYS A C    9  
ATOM   9071  O  O    . LYS A 1 63 ? 16.766  -6.222  -3.117  1.00 0.00 ? 63  LYS A O    9  
ATOM   9072  C  CB   . LYS A 1 63 ? 13.698  -5.587  -3.803  1.00 0.00 ? 63  LYS A CB   9  
ATOM   9073  C  CG   . LYS A 1 63 ? 13.823  -4.281  -4.568  1.00 0.00 ? 63  LYS A CG   9  
ATOM   9074  C  CD   . LYS A 1 63 ? 12.743  -4.152  -5.630  1.00 0.00 ? 63  LYS A CD   9  
ATOM   9075  C  CE   . LYS A 1 63 ? 13.095  -4.942  -6.881  1.00 0.00 ? 63  LYS A CE   9  
ATOM   9076  N  NZ   . LYS A 1 63 ? 14.011  -4.183  -7.777  1.00 0.00 ? 63  LYS A NZ   9  
ATOM   9077  H  H    . LYS A 1 63 ? 13.129  -4.234  -1.730  1.00 0.00 ? 63  LYS A H    9  
ATOM   9078  H  HA   . LYS A 1 63 ? 14.455  -6.609  -2.080  1.00 0.00 ? 63  LYS A HA   9  
ATOM   9079  H  HB2  . LYS A 1 63 ? 14.026  -6.390  -4.447  1.00 0.00 ? 63  LYS A HB2  9  
ATOM   9080  H  HB3  . LYS A 1 63 ? 12.657  -5.737  -3.555  1.00 0.00 ? 63  LYS A HB3  9  
ATOM   9081  H  HG2  . LYS A 1 63 ? 13.731  -3.458  -3.875  1.00 0.00 ? 63  LYS A HG2  9  
ATOM   9082  H  HG3  . LYS A 1 63 ? 14.791  -4.246  -5.046  1.00 0.00 ? 63  LYS A HG3  9  
ATOM   9083  H  HD2  . LYS A 1 63 ? 11.812  -4.527  -5.232  1.00 0.00 ? 63  LYS A HD2  9  
ATOM   9084  H  HD3  . LYS A 1 63 ? 12.631  -3.110  -5.892  1.00 0.00 ? 63  LYS A HD3  9  
ATOM   9085  H  HE2  . LYS A 1 63 ? 13.574  -5.863  -6.587  1.00 0.00 ? 63  LYS A HE2  9  
ATOM   9086  H  HE3  . LYS A 1 63 ? 12.184  -5.165  -7.418  1.00 0.00 ? 63  LYS A HE3  9  
ATOM   9087  H  HZ1  . LYS A 1 63 ? 14.915  -4.690  -7.875  1.00 0.00 ? 63  LYS A HZ1  9  
ATOM   9088  H  HZ2  . LYS A 1 63 ? 14.198  -3.240  -7.381  1.00 0.00 ? 63  LYS A HZ2  9  
ATOM   9089  H  HZ3  . LYS A 1 63 ? 13.583  -4.074  -8.718  1.00 0.00 ? 63  LYS A HZ3  9  
ATOM   9090  N  N    . ALA A 1 64 ? 16.347  -4.043  -2.752  1.00 0.00 ? 64  ALA A N    9  
ATOM   9091  C  CA   . ALA A 1 64 ? 17.716  -3.621  -3.021  1.00 0.00 ? 64  ALA A CA   9  
ATOM   9092  C  C    . ALA A 1 64 ? 18.719  -4.629  -2.469  1.00 0.00 ? 64  ALA A C    9  
ATOM   9093  O  O    . ALA A 1 64 ? 18.715  -4.933  -1.276  1.00 0.00 ? 64  ALA A O    9  
ATOM   9094  C  CB   . ALA A 1 64 ? 17.970  -2.243  -2.430  1.00 0.00 ? 64  ALA A CB   9  
ATOM   9095  H  H    . ALA A 1 64 ? 15.678  -3.368  -2.512  1.00 0.00 ? 64  ALA A H    9  
ATOM   9096  H  HA   . ALA A 1 64 ? 17.840  -3.555  -4.092  1.00 0.00 ? 64  ALA A HA   9  
ATOM   9097  H  HB1  . ALA A 1 64 ? 17.072  -1.890  -1.943  1.00 0.00 ? 64  ALA A HB1  9  
ATOM   9098  H  HB2  . ALA A 1 64 ? 18.771  -2.303  -1.708  1.00 0.00 ? 64  ALA A HB2  9  
ATOM   9099  H  HB3  . ALA A 1 64 ? 18.245  -1.558  -3.218  1.00 0.00 ? 64  ALA A HB3  9  
ATOM   9100  N  N    . SER A 1 65 ? 19.576  -5.144  -3.345  1.00 0.00 ? 65  SER A N    9  
ATOM   9101  C  CA   . SER A 1 65 ? 20.582  -6.121  -2.945  1.00 0.00 ? 65  SER A CA   9  
ATOM   9102  C  C    . SER A 1 65 ? 21.822  -5.428  -2.388  1.00 0.00 ? 65  SER A C    9  
ATOM   9103  O  O    . SER A 1 65 ? 22.836  -5.303  -3.073  1.00 0.00 ? 65  SER A O    9  
ATOM   9104  C  CB   . SER A 1 65 ? 20.967  -7.003  -4.135  1.00 0.00 ? 65  SER A CB   9  
ATOM   9105  O  OG   . SER A 1 65 ? 20.108  -8.125  -4.237  1.00 0.00 ? 65  SER A OG   9  
ATOM   9106  H  H    . SER A 1 65 ? 19.529  -4.862  -4.282  1.00 0.00 ? 65  SER A H    9  
ATOM   9107  H  HA   . SER A 1 65 ? 20.153  -6.742  -2.172  1.00 0.00 ? 65  SER A HA   9  
ATOM   9108  H  HB2  . SER A 1 65 ? 20.897  -6.427  -5.044  1.00 0.00 ? 65  SER A HB2  9  
ATOM   9109  H  HB3  . SER A 1 65 ? 21.982  -7.352  -4.007  1.00 0.00 ? 65  SER A HB3  9  
ATOM   9110  H  HG   . SER A 1 65 ? 20.466  -8.851  -3.721  1.00 0.00 ? 65  SER A HG   9  
ATOM   9111  N  N    . GLY A 1 66 ? 21.731  -4.979  -1.140  1.00 0.00 ? 66  GLY A N    9  
ATOM   9112  C  CA   . GLY A 1 66 ? 22.851  -4.304  -0.511  1.00 0.00 ? 66  GLY A CA   9  
ATOM   9113  C  C    . GLY A 1 66 ? 23.624  -5.212  0.425   1.00 0.00 ? 66  GLY A C    9  
ATOM   9114  O  O    . GLY A 1 66 ? 23.232  -6.350  0.684   1.00 0.00 ? 66  GLY A O    9  
ATOM   9115  H  H    . GLY A 1 66 ? 20.896  -5.108  -0.642  1.00 0.00 ? 66  GLY A H    9  
ATOM   9116  H  HA2  . GLY A 1 66 ? 23.518  -3.945  -1.280  1.00 0.00 ? 66  GLY A HA2  9  
ATOM   9117  H  HA3  . GLY A 1 66 ? 22.478  -3.460  0.051   1.00 0.00 ? 66  GLY A HA3  9  
ATOM   9118  N  N    . PRO A 1 67 ? 24.751  -4.707  0.948   1.00 0.00 ? 67  PRO A N    9  
ATOM   9119  C  CA   . PRO A 1 67 ? 25.605  -5.465  1.867   1.00 0.00 ? 67  PRO A CA   9  
ATOM   9120  C  C    . PRO A 1 67 ? 24.950  -5.672  3.229   1.00 0.00 ? 67  PRO A C    9  
ATOM   9121  O  O    . PRO A 1 67 ? 25.551  -6.249  4.135   1.00 0.00 ? 67  PRO A O    9  
ATOM   9122  C  CB   . PRO A 1 67 ? 26.850  -4.584  2.001   1.00 0.00 ? 67  PRO A CB   9  
ATOM   9123  C  CG   . PRO A 1 67 ? 26.373  -3.205  1.702   1.00 0.00 ? 67  PRO A CG   9  
ATOM   9124  C  CD   . PRO A 1 67 ? 25.278  -3.358  0.682   1.00 0.00 ? 67  PRO A CD   9  
ATOM   9125  H  HA   . PRO A 1 67 ? 25.883  -6.423  1.453   1.00 0.00 ? 67  PRO A HA   9  
ATOM   9126  H  HB2  . PRO A 1 67 ? 27.240  -4.658  3.007   1.00 0.00 ? 67  PRO A HB2  9  
ATOM   9127  H  HB3  . PRO A 1 67 ? 27.600  -4.904  1.294   1.00 0.00 ? 67  PRO A HB3  9  
ATOM   9128  H  HG2  . PRO A 1 67 ? 25.988  -2.746  2.600   1.00 0.00 ? 67  PRO A HG2  9  
ATOM   9129  H  HG3  . PRO A 1 67 ? 27.183  -2.617  1.296   1.00 0.00 ? 67  PRO A HG3  9  
ATOM   9130  H  HD2  . PRO A 1 67 ? 24.515  -2.609  0.833   1.00 0.00 ? 67  PRO A HD2  9  
ATOM   9131  H  HD3  . PRO A 1 67 ? 25.682  -3.293  -0.318  1.00 0.00 ? 67  PRO A HD3  9  
ATOM   9132  N  N    . SER A 1 68 ? 23.716  -5.199  3.365   1.00 0.00 ? 68  SER A N    9  
ATOM   9133  C  CA   . SER A 1 68 ? 22.981  -5.330  4.617   1.00 0.00 ? 68  SER A CA   9  
ATOM   9134  C  C    . SER A 1 68 ? 23.260  -6.680  5.272   1.00 0.00 ? 68  SER A C    9  
ATOM   9135  O  O    . SER A 1 68 ? 23.650  -6.747  6.438   1.00 0.00 ? 68  SER A O    9  
ATOM   9136  C  CB   . SER A 1 68 ? 21.479  -5.172  4.371   1.00 0.00 ? 68  SER A CB   9  
ATOM   9137  O  OG   . SER A 1 68 ? 20.742  -5.369  5.565   1.00 0.00 ? 68  SER A OG   9  
ATOM   9138  H  H    . SER A 1 68 ? 23.290  -4.749  2.605   1.00 0.00 ? 68  SER A H    9  
ATOM   9139  H  HA   . SER A 1 68 ? 23.313  -4.546  5.280   1.00 0.00 ? 68  SER A HA   9  
ATOM   9140  H  HB2  . SER A 1 68 ? 21.281  -4.178  4.000   1.00 0.00 ? 68  SER A HB2  9  
ATOM   9141  H  HB3  . SER A 1 68 ? 21.158  -5.900  3.639   1.00 0.00 ? 68  SER A HB3  9  
ATOM   9142  H  HG   . SER A 1 68 ? 21.291  -5.146  6.320   1.00 0.00 ? 68  SER A HG   9  
ATOM   9143  N  N    . SER A 1 69 ? 23.058  -7.752  4.514   1.00 0.00 ? 69  SER A N    9  
ATOM   9144  C  CA   . SER A 1 69 ? 23.285  -9.101  5.021   1.00 0.00 ? 69  SER A CA   9  
ATOM   9145  C  C    . SER A 1 69 ? 24.533  -9.149  5.896   1.00 0.00 ? 69  SER A C    9  
ATOM   9146  O  O    . SER A 1 69 ? 24.519  -9.720  6.986   1.00 0.00 ? 69  SER A O    9  
ATOM   9147  C  CB   . SER A 1 69 ? 23.423  -10.088 3.860   1.00 0.00 ? 69  SER A CB   9  
ATOM   9148  O  OG   . SER A 1 69 ? 22.152  -10.498 3.386   1.00 0.00 ? 69  SER A OG   9  
ATOM   9149  H  H    . SER A 1 69 ? 22.747  -7.633  3.592   1.00 0.00 ? 69  SER A H    9  
ATOM   9150  H  HA   . SER A 1 69 ? 22.429  -9.378  5.618   1.00 0.00 ? 69  SER A HA   9  
ATOM   9151  H  HB2  . SER A 1 69 ? 23.960  -9.616  3.052   1.00 0.00 ? 69  SER A HB2  9  
ATOM   9152  H  HB3  . SER A 1 69 ? 23.967  -10.959 4.195   1.00 0.00 ? 69  SER A HB3  9  
ATOM   9153  H  HG   . SER A 1 69 ? 21.762  -11.117 4.007   1.00 0.00 ? 69  SER A HG   9  
ATOM   9154  N  N    . GLY A 1 70 ? 25.614  -8.546  5.409   1.00 0.00 ? 70  GLY A N    9  
ATOM   9155  C  CA   . GLY A 1 70 ? 26.856  -8.532  6.159   1.00 0.00 ? 70  GLY A CA   9  
ATOM   9156  C  C    . GLY A 1 70 ? 26.815  -7.573  7.332   1.00 0.00 ? 70  GLY A C    9  
ATOM   9157  O  O    . GLY A 1 70 ? 27.475  -6.537  7.282   1.00 0.00 ? 70  GLY A O    9  
ATOM   9158  H  H    . GLY A 1 70 ? 25.566  -8.107  4.534   1.00 0.00 ? 70  GLY A H    9  
ATOM   9159  H  HA2  . GLY A 1 70 ? 27.053  -9.527  6.528   1.00 0.00 ? 70  GLY A HA2  9  
ATOM   9160  H  HA3  . GLY A 1 70 ? 27.659  -8.239  5.498   1.00 0.00 ? 70  GLY A HA3  9  
HETATM 9161  ZN ZN   . ZN  B 2 .  ? -11.160 4.133   2.515   1.00 0.00 ? 201 ZN  A ZN   9  
HETATM 9162  ZN ZN   . ZN  C 2 .  ? 6.667   3.670   0.424   1.00 0.00 ? 401 ZN  A ZN   9  
ATOM   9163  N  N    . GLY A 1 1  ? -30.409 -9.004  -0.551  1.00 0.00 ? 1   GLY A N    10 
ATOM   9164  C  CA   . GLY A 1 1  ? -30.146 -8.157  0.598   1.00 0.00 ? 1   GLY A CA   10 
ATOM   9165  C  C    . GLY A 1 1  ? -28.696 -7.722  0.678   1.00 0.00 ? 1   GLY A C    10 
ATOM   9166  O  O    . GLY A 1 1  ? -28.083 -7.774  1.744   1.00 0.00 ? 1   GLY A O    10 
ATOM   9167  H  H1   . GLY A 1 1  ? -30.672 -8.601  -1.405  1.00 0.00 ? 1   GLY A H1   10 
ATOM   9168  H  HA2  . GLY A 1 1  ? -30.771 -7.279  0.535   1.00 0.00 ? 1   GLY A HA2  10 
ATOM   9169  H  HA3  . GLY A 1 1  ? -30.397 -8.700  1.497   1.00 0.00 ? 1   GLY A HA3  10 
ATOM   9170  N  N    . SER A 1 2  ? -28.145 -7.295  -0.453  1.00 0.00 ? 2   SER A N    10 
ATOM   9171  C  CA   . SER A 1 2  ? -26.755 -6.855  -0.508  1.00 0.00 ? 2   SER A CA   10 
ATOM   9172  C  C    . SER A 1 2  ? -26.623 -5.413  -0.028  1.00 0.00 ? 2   SER A C    10 
ATOM   9173  O  O    . SER A 1 2  ? -27.291 -4.513  -0.537  1.00 0.00 ? 2   SER A O    10 
ATOM   9174  C  CB   . SER A 1 2  ? -26.214 -6.982  -1.933  1.00 0.00 ? 2   SER A CB   10 
ATOM   9175  O  OG   . SER A 1 2  ? -26.020 -8.340  -2.286  1.00 0.00 ? 2   SER A OG   10 
ATOM   9176  H  H    . SER A 1 2  ? -28.685 -7.277  -1.271  1.00 0.00 ? 2   SER A H    10 
ATOM   9177  H  HA   . SER A 1 2  ? -26.179 -7.494  0.145   1.00 0.00 ? 2   SER A HA   10 
ATOM   9178  H  HB2  . SER A 1 2  ? -26.917 -6.540  -2.623  1.00 0.00 ? 2   SER A HB2  10 
ATOM   9179  H  HB3  . SER A 1 2  ? -25.268 -6.465  -2.003  1.00 0.00 ? 2   SER A HB3  10 
ATOM   9180  H  HG   . SER A 1 2  ? -25.096 -8.572  -2.171  1.00 0.00 ? 2   SER A HG   10 
ATOM   9181  N  N    . SER A 1 3  ? -25.755 -5.201  0.956   1.00 0.00 ? 3   SER A N    10 
ATOM   9182  C  CA   . SER A 1 3  ? -25.536 -3.869  1.508   1.00 0.00 ? 3   SER A CA   10 
ATOM   9183  C  C    . SER A 1 3  ? -24.635 -3.043  0.595   1.00 0.00 ? 3   SER A C    10 
ATOM   9184  O  O    . SER A 1 3  ? -24.945 -1.899  0.268   1.00 0.00 ? 3   SER A O    10 
ATOM   9185  C  CB   . SER A 1 3  ? -24.914 -3.968  2.903   1.00 0.00 ? 3   SER A CB   10 
ATOM   9186  O  OG   . SER A 1 3  ? -24.482 -2.699  3.360   1.00 0.00 ? 3   SER A OG   10 
ATOM   9187  H  H    . SER A 1 3  ? -25.251 -5.959  1.320   1.00 0.00 ? 3   SER A H    10 
ATOM   9188  H  HA   . SER A 1 3  ? -26.496 -3.380  1.585   1.00 0.00 ? 3   SER A HA   10 
ATOM   9189  H  HB2  . SER A 1 3  ? -25.647 -4.356  3.594   1.00 0.00 ? 3   SER A HB2  10 
ATOM   9190  H  HB3  . SER A 1 3  ? -24.064 -4.634  2.869   1.00 0.00 ? 3   SER A HB3  10 
ATOM   9191  H  HG   . SER A 1 3  ? -24.721 -2.593  4.284   1.00 0.00 ? 3   SER A HG   10 
ATOM   9192  N  N    . GLY A 1 4  ? -23.515 -3.634  0.187   1.00 0.00 ? 4   GLY A N    10 
ATOM   9193  C  CA   . GLY A 1 4  ? -22.585 -2.939  -0.684  1.00 0.00 ? 4   GLY A CA   10 
ATOM   9194  C  C    . GLY A 1 4  ? -21.967 -3.856  -1.720  1.00 0.00 ? 4   GLY A C    10 
ATOM   9195  O  O    . GLY A 1 4  ? -21.997 -5.078  -1.575  1.00 0.00 ? 4   GLY A O    10 
ATOM   9196  H  H    . GLY A 1 4  ? -23.319 -4.548  0.480   1.00 0.00 ? 4   GLY A H    10 
ATOM   9197  H  HA2  . GLY A 1 4  ? -23.110 -2.142  -1.190  1.00 0.00 ? 4   GLY A HA2  10 
ATOM   9198  H  HA3  . GLY A 1 4  ? -21.797 -2.512  -0.082  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   9199  N  N    . SER A 1 5  ? -21.406 -3.266  -2.771  1.00 0.00 ? 5   SER A N    10 
ATOM   9200  C  CA   . SER A 1 5  ? -20.783 -4.038  -3.839  1.00 0.00 ? 5   SER A CA   10 
ATOM   9201  C  C    . SER A 1 5  ? -19.297 -3.709  -3.952  1.00 0.00 ? 5   SER A C    10 
ATOM   9202  O  O    . SER A 1 5  ? -18.450 -4.602  -3.950  1.00 0.00 ? 5   SER A O    10 
ATOM   9203  C  CB   . SER A 1 5  ? -21.481 -3.761  -5.172  1.00 0.00 ? 5   SER A CB   10 
ATOM   9204  O  OG   . SER A 1 5  ? -22.715 -4.452  -5.255  1.00 0.00 ? 5   SER A OG   10 
ATOM   9205  H  H    . SER A 1 5  ? -21.414 -2.287  -2.830  1.00 0.00 ? 5   SER A H    10 
ATOM   9206  H  HA   . SER A 1 5  ? -20.890 -5.085  -3.597  1.00 0.00 ? 5   SER A HA   10 
ATOM   9207  H  HB2  . SER A 1 5  ? -21.668 -2.702  -5.264  1.00 0.00 ? 5   SER A HB2  10 
ATOM   9208  H  HB3  . SER A 1 5  ? -20.845 -4.086  -5.983  1.00 0.00 ? 5   SER A HB3  10 
ATOM   9209  H  HG   . SER A 1 5  ? -23.435 -3.845  -5.066  1.00 0.00 ? 5   SER A HG   10 
ATOM   9210  N  N    . SER A 1 6  ? -18.989 -2.420  -4.051  1.00 0.00 ? 6   SER A N    10 
ATOM   9211  C  CA   . SER A 1 6  ? -17.607 -1.971  -4.169  1.00 0.00 ? 6   SER A CA   10 
ATOM   9212  C  C    . SER A 1 6  ? -17.283 -0.924  -3.107  1.00 0.00 ? 6   SER A C    10 
ATOM   9213  O  O    . SER A 1 6  ? -17.430 0.276   -3.338  1.00 0.00 ? 6   SER A O    10 
ATOM   9214  C  CB   . SER A 1 6  ? -17.352 -1.396  -5.563  1.00 0.00 ? 6   SER A CB   10 
ATOM   9215  O  OG   . SER A 1 6  ? -17.628 -2.356  -6.569  1.00 0.00 ? 6   SER A OG   10 
ATOM   9216  H  H    . SER A 1 6  ? -19.710 -1.755  -4.047  1.00 0.00 ? 6   SER A H    10 
ATOM   9217  H  HA   . SER A 1 6  ? -16.966 -2.828  -4.019  1.00 0.00 ? 6   SER A HA   10 
ATOM   9218  H  HB2  . SER A 1 6  ? -17.989 -0.538  -5.718  1.00 0.00 ? 6   SER A HB2  10 
ATOM   9219  H  HB3  . SER A 1 6  ? -16.317 -1.096  -5.642  1.00 0.00 ? 6   SER A HB3  10 
ATOM   9220  H  HG   . SER A 1 6  ? -17.371 -2.005  -7.425  1.00 0.00 ? 6   SER A HG   10 
ATOM   9221  N  N    . GLY A 1 7  ? -16.842 -1.388  -1.942  1.00 0.00 ? 7   GLY A N    10 
ATOM   9222  C  CA   . GLY A 1 7  ? -16.505 -0.479  -0.862  1.00 0.00 ? 7   GLY A CA   10 
ATOM   9223  C  C    . GLY A 1 7  ? -15.044 -0.568  -0.465  1.00 0.00 ? 7   GLY A C    10 
ATOM   9224  O  O    . GLY A 1 7  ? -14.433 -1.633  -0.553  1.00 0.00 ? 7   GLY A O    10 
ATOM   9225  H  H    . GLY A 1 7  ? -16.745 -2.355  -1.815  1.00 0.00 ? 7   GLY A H    10 
ATOM   9226  H  HA2  . GLY A 1 7  ? -16.721 0.531   -1.175  1.00 0.00 ? 7   GLY A HA2  10 
ATOM   9227  H  HA3  . GLY A 1 7  ? -17.114 -0.718  -0.003  1.00 0.00 ? 7   GLY A HA3  10 
ATOM   9228  N  N    . CYS A 1 8  ? -14.483 0.554   -0.027  1.00 0.00 ? 8   CYS A N    10 
ATOM   9229  C  CA   . CYS A 1 8  ? -13.085 0.600   0.384   1.00 0.00 ? 8   CYS A CA   10 
ATOM   9230  C  C    . CYS A 1 8  ? -12.823 -0.368  1.534   1.00 0.00 ? 8   CYS A C    10 
ATOM   9231  O  O    . CYS A 1 8  ? -13.660 -0.536  2.421   1.00 0.00 ? 8   CYS A O    10 
ATOM   9232  C  CB   . CYS A 1 8  ? -12.701 2.021   0.801   1.00 0.00 ? 8   CYS A CB   10 
ATOM   9233  S  SG   . CYS A 1 8  ? -11.107 2.134   1.676   1.00 0.00 ? 8   CYS A SG   10 
ATOM   9234  H  H    . CYS A 1 8  ? -15.022 1.372   0.021   1.00 0.00 ? 8   CYS A H    10 
ATOM   9235  H  HA   . CYS A 1 8  ? -12.481 0.307   -0.462  1.00 0.00 ? 8   CYS A HA   10 
ATOM   9236  H  HB2  . CYS A 1 8  ? -12.636 2.642   -0.080  1.00 0.00 ? 8   CYS A HB2  10 
ATOM   9237  H  HB3  . CYS A 1 8  ? -13.464 2.414   1.456   1.00 0.00 ? 8   CYS A HB3  10 
ATOM   9238  N  N    . HIS A 1 9  ? -11.655 -1.003  1.512   1.00 0.00 ? 9   HIS A N    10 
ATOM   9239  C  CA   . HIS A 1 9  ? -11.282 -1.954  2.553   1.00 0.00 ? 9   HIS A CA   10 
ATOM   9240  C  C    . HIS A 1 9  ? -10.522 -1.258  3.677   1.00 0.00 ? 9   HIS A C    10 
ATOM   9241  O  O    . HIS A 1 9  ? -10.711 -1.571  4.852   1.00 0.00 ? 9   HIS A O    10 
ATOM   9242  C  CB   . HIS A 1 9  ? -10.429 -3.078  1.964   1.00 0.00 ? 9   HIS A CB   10 
ATOM   9243  C  CG   . HIS A 1 9  ? -10.285 -4.259  2.873   1.00 0.00 ? 9   HIS A CG   10 
ATOM   9244  N  ND1  . HIS A 1 9  ? -11.355 -4.860  3.503   1.00 0.00 ? 9   HIS A ND1  10 
ATOM   9245  C  CD2  . HIS A 1 9  ? -9.187  -4.952  3.257   1.00 0.00 ? 9   HIS A CD2  10 
ATOM   9246  C  CE1  . HIS A 1 9  ? -10.921 -5.870  4.235   1.00 0.00 ? 9   HIS A CE1  10 
ATOM   9247  N  NE2  . HIS A 1 9  ? -9.609  -5.948  4.103   1.00 0.00 ? 9   HIS A NE2  10 
ATOM   9248  H  H    . HIS A 1 9  ? -11.030 -0.827  0.778   1.00 0.00 ? 9   HIS A H    10 
ATOM   9249  H  HA   . HIS A 1 9  ? -12.190 -2.376  2.956   1.00 0.00 ? 9   HIS A HA   10 
ATOM   9250  H  HB2  . HIS A 1 9  ? -10.882 -3.421  1.045   1.00 0.00 ? 9   HIS A HB2  10 
ATOM   9251  H  HB3  . HIS A 1 9  ? -9.440  -2.698  1.753   1.00 0.00 ? 9   HIS A HB3  10 
ATOM   9252  H  HD1  . HIS A 1 9  ? -12.292 -4.585  3.426   1.00 0.00 ? 9   HIS A HD1  10 
ATOM   9253  H  HD2  . HIS A 1 9  ? -8.168  -4.759  2.954   1.00 0.00 ? 9   HIS A HD2  10 
ATOM   9254  H  HE1  . HIS A 1 9  ? -11.534 -6.522  4.839   1.00 0.00 ? 9   HIS A HE1  10 
ATOM   9255  H  HE2  . HIS A 1 9  ? -9.027  -6.554  4.605   1.00 0.00 ? 9   HIS A HE2  10 
ATOM   9256  N  N    . GLN A 1 10 ? -9.662  -0.314  3.308   1.00 0.00 ? 10  GLN A N    10 
ATOM   9257  C  CA   . GLN A 1 10 ? -8.873  0.425   4.286   1.00 0.00 ? 10  GLN A CA   10 
ATOM   9258  C  C    . GLN A 1 10 ? -9.748  0.913   5.436   1.00 0.00 ? 10  GLN A C    10 
ATOM   9259  O  O    . GLN A 1 10 ? -9.654  0.414   6.557   1.00 0.00 ? 10  GLN A O    10 
ATOM   9260  C  CB   . GLN A 1 10 ? -8.177  1.613   3.619   1.00 0.00 ? 10  GLN A CB   10 
ATOM   9261  C  CG   . GLN A 1 10 ? -7.410  2.493   4.593   1.00 0.00 ? 10  GLN A CG   10 
ATOM   9262  C  CD   . GLN A 1 10 ? -6.165  1.818   5.134   1.00 0.00 ? 10  GLN A CD   10 
ATOM   9263  O  OE1  . GLN A 1 10 ? -6.246  0.802   5.824   1.00 0.00 ? 10  GLN A OE1  10 
ATOM   9264  N  NE2  . GLN A 1 10 ? -5.003  2.382   4.823   1.00 0.00 ? 10  GLN A NE2  10 
ATOM   9265  H  H    . GLN A 1 10 ? -9.556  -0.110  2.356   1.00 0.00 ? 10  GLN A H    10 
ATOM   9266  H  HA   . GLN A 1 10 ? -8.123  -0.245  4.681   1.00 0.00 ? 10  GLN A HA   10 
ATOM   9267  H  HB2  . GLN A 1 10 ? -7.483  1.240   2.881   1.00 0.00 ? 10  GLN A HB2  10 
ATOM   9268  H  HB3  . GLN A 1 10 ? -8.921  2.221   3.128   1.00 0.00 ? 10  GLN A HB3  10 
ATOM   9269  H  HG2  . GLN A 1 10 ? -7.117  3.400   4.084   1.00 0.00 ? 10  GLN A HG2  10 
ATOM   9270  H  HG3  . GLN A 1 10 ? -8.057  2.740   5.421   1.00 0.00 ? 10  GLN A HG3  10 
ATOM   9271  H  HE21 . GLN A 1 10 ? -5.015  3.191   4.270   1.00 0.00 ? 10  GLN A HE21 10 
ATOM   9272  H  HE22 . GLN A 1 10 ? -4.183  1.967   5.160   1.00 0.00 ? 10  GLN A HE22 10 
ATOM   9273  N  N    . CYS A 1 11 ? -10.600 1.892   5.149   1.00 0.00 ? 11  CYS A N    10 
ATOM   9274  C  CA   . CYS A 1 11 ? -11.492 2.450   6.159   1.00 0.00 ? 11  CYS A CA   10 
ATOM   9275  C  C    . CYS A 1 11 ? -12.796 1.660   6.227   1.00 0.00 ? 11  CYS A C    10 
ATOM   9276  O  O    . CYS A 1 11 ? -13.307 1.378   7.311   1.00 0.00 ? 11  CYS A O    10 
ATOM   9277  C  CB   . CYS A 1 11 ? -11.789 3.919   5.852   1.00 0.00 ? 11  CYS A CB   10 
ATOM   9278  S  SG   . CYS A 1 11 ? -12.643 4.190   4.266   1.00 0.00 ? 11  CYS A SG   10 
ATOM   9279  H  H    . CYS A 1 11 ? -10.629 2.250   4.236   1.00 0.00 ? 11  CYS A H    10 
ATOM   9280  H  HA   . CYS A 1 11 ? -10.995 2.384   7.114   1.00 0.00 ? 11  CYS A HA   10 
ATOM   9281  H  HB2  . CYS A 1 11 ? -12.414 4.323   6.634   1.00 0.00 ? 11  CYS A HB2  10 
ATOM   9282  H  HB3  . CYS A 1 11 ? -10.859 4.467   5.823   1.00 0.00 ? 11  CYS A HB3  10 
ATOM   9283  N  N    . GLY A 1 12 ? -13.329 1.305   5.062   1.00 0.00 ? 12  GLY A N    10 
ATOM   9284  C  CA   . GLY A 1 12 ? -14.568 0.552   5.012   1.00 0.00 ? 12  GLY A CA   10 
ATOM   9285  C  C    . GLY A 1 12 ? -15.680 1.309   4.314   1.00 0.00 ? 12  GLY A C    10 
ATOM   9286  O  O    . GLY A 1 12 ? -16.475 0.722   3.581   1.00 0.00 ? 12  GLY A O    10 
ATOM   9287  H  H    . GLY A 1 12 ? -12.877 1.558   4.230   1.00 0.00 ? 12  GLY A H    10 
ATOM   9288  H  HA2  . GLY A 1 12 ? -14.392 -0.375  4.486   1.00 0.00 ? 12  GLY A HA2  10 
ATOM   9289  H  HA3  . GLY A 1 12 ? -14.881 0.327   6.021   1.00 0.00 ? 12  GLY A HA3  10 
ATOM   9290  N  N    . GLU A 1 13 ? -15.737 2.618   4.542   1.00 0.00 ? 13  GLU A N    10 
ATOM   9291  C  CA   . GLU A 1 13 ? -16.762 3.456   3.931   1.00 0.00 ? 13  GLU A CA   10 
ATOM   9292  C  C    . GLU A 1 13 ? -16.921 3.127   2.450   1.00 0.00 ? 13  GLU A C    10 
ATOM   9293  O  O    . GLU A 1 13 ? -15.979 2.678   1.797   1.00 0.00 ? 13  GLU A O    10 
ATOM   9294  C  CB   . GLU A 1 13 ? -16.410 4.935   4.101   1.00 0.00 ? 13  GLU A CB   10 
ATOM   9295  C  CG   . GLU A 1 13 ? -16.215 5.352   5.549   1.00 0.00 ? 13  GLU A CG   10 
ATOM   9296  C  CD   . GLU A 1 13 ? -17.528 5.574   6.274   1.00 0.00 ? 13  GLU A CD   10 
ATOM   9297  O  OE1  . GLU A 1 13 ? -18.180 6.608   6.018   1.00 0.00 ? 13  GLU A OE1  10 
ATOM   9298  O  OE2  . GLU A 1 13 ? -17.905 4.714   7.098   1.00 0.00 ? 13  GLU A OE2  10 
ATOM   9299  H  H    . GLU A 1 13 ? -15.074 3.029   5.136   1.00 0.00 ? 13  GLU A H    10 
ATOM   9300  H  HA   . GLU A 1 13 ? -17.696 3.257   4.434   1.00 0.00 ? 13  GLU A HA   10 
ATOM   9301  H  HB2  . GLU A 1 13 ? -15.497 5.141   3.562   1.00 0.00 ? 13  GLU A HB2  10 
ATOM   9302  H  HB3  . GLU A 1 13 ? -17.207 5.532   3.681   1.00 0.00 ? 13  GLU A HB3  10 
ATOM   9303  H  HG2  . GLU A 1 13 ? -15.665 4.578   6.062   1.00 0.00 ? 13  GLU A HG2  10 
ATOM   9304  H  HG3  . GLU A 1 13 ? -15.648 6.271   5.573   1.00 0.00 ? 13  GLU A HG3  10 
ATOM   9305  N  N    . PHE A 1 14 ? -18.121 3.353   1.925   1.00 0.00 ? 14  PHE A N    10 
ATOM   9306  C  CA   . PHE A 1 14 ? -18.406 3.079   0.521   1.00 0.00 ? 14  PHE A CA   10 
ATOM   9307  C  C    . PHE A 1 14 ? -17.761 4.129   -0.379  1.00 0.00 ? 14  PHE A C    10 
ATOM   9308  O  O    . PHE A 1 14 ? -17.758 5.318   -0.060  1.00 0.00 ? 14  PHE A O    10 
ATOM   9309  C  CB   . PHE A 1 14 ? -19.917 3.045   0.283   1.00 0.00 ? 14  PHE A CB   10 
ATOM   9310  C  CG   . PHE A 1 14 ? -20.306 2.369   -1.001  1.00 0.00 ? 14  PHE A CG   10 
ATOM   9311  C  CD1  . PHE A 1 14 ? -20.172 0.998   -1.145  1.00 0.00 ? 14  PHE A CD1  10 
ATOM   9312  C  CD2  . PHE A 1 14 ? -20.805 3.105   -2.063  1.00 0.00 ? 14  PHE A CD2  10 
ATOM   9313  C  CE1  . PHE A 1 14 ? -20.529 0.373   -2.325  1.00 0.00 ? 14  PHE A CE1  10 
ATOM   9314  C  CE2  . PHE A 1 14 ? -21.164 2.486   -3.246  1.00 0.00 ? 14  PHE A CE2  10 
ATOM   9315  C  CZ   . PHE A 1 14 ? -21.027 1.118   -3.377  1.00 0.00 ? 14  PHE A CZ   10 
ATOM   9316  H  H    . PHE A 1 14 ? -18.832 3.712   2.496   1.00 0.00 ? 14  PHE A H    10 
ATOM   9317  H  HA   . PHE A 1 14 ? -17.990 2.113   0.282   1.00 0.00 ? 14  PHE A HA   10 
ATOM   9318  H  HB2  . PHE A 1 14 ? -20.390 2.513   1.094   1.00 0.00 ? 14  PHE A HB2  10 
ATOM   9319  H  HB3  . PHE A 1 14 ? -20.292 4.057   0.254   1.00 0.00 ? 14  PHE A HB3  10 
ATOM   9320  H  HD1  . PHE A 1 14 ? -19.785 0.413   -0.323  1.00 0.00 ? 14  PHE A HD1  10 
ATOM   9321  H  HD2  . PHE A 1 14 ? -20.914 4.176   -1.962  1.00 0.00 ? 14  PHE A HD2  10 
ATOM   9322  H  HE1  . PHE A 1 14 ? -20.421 -0.696  -2.425  1.00 0.00 ? 14  PHE A HE1  10 
ATOM   9323  H  HE2  . PHE A 1 14 ? -21.553 3.072   -4.066  1.00 0.00 ? 14  PHE A HE2  10 
ATOM   9324  H  HZ   . PHE A 1 14 ? -21.306 0.633   -4.300  1.00 0.00 ? 14  PHE A HZ   10 
ATOM   9325  N  N    . ILE A 1 15 ? -17.214 3.679   -1.504  1.00 0.00 ? 15  ILE A N    10 
ATOM   9326  C  CA   . ILE A 1 15 ? -16.567 4.579   -2.450  1.00 0.00 ? 15  ILE A CA   10 
ATOM   9327  C  C    . ILE A 1 15 ? -17.567 5.121   -3.466  1.00 0.00 ? 15  ILE A C    10 
ATOM   9328  O  O    . ILE A 1 15 ? -18.353 4.368   -4.041  1.00 0.00 ? 15  ILE A O    10 
ATOM   9329  C  CB   . ILE A 1 15 ? -15.420 3.876   -3.201  1.00 0.00 ? 15  ILE A CB   10 
ATOM   9330  C  CG1  . ILE A 1 15 ? -14.519 3.130   -2.215  1.00 0.00 ? 15  ILE A CG1  10 
ATOM   9331  C  CG2  . ILE A 1 15 ? -14.615 4.887   -4.003  1.00 0.00 ? 15  ILE A CG2  10 
ATOM   9332  C  CD1  . ILE A 1 15 ? -13.714 2.020   -2.855  1.00 0.00 ? 15  ILE A CD1  10 
ATOM   9333  H  H    . ILE A 1 15 ? -17.248 2.721   -1.702  1.00 0.00 ? 15  ILE A H    10 
ATOM   9334  H  HA   . ILE A 1 15 ? -16.152 5.406   -1.893  1.00 0.00 ? 15  ILE A HA   10 
ATOM   9335  H  HB   . ILE A 1 15 ? -15.852 3.167   -3.891  1.00 0.00 ? 15  ILE A HB   10 
ATOM   9336  H  HG12 . ILE A 1 15 ? -13.827 3.827   -1.771  1.00 0.00 ? 15  ILE A HG12 10 
ATOM   9337  H  HG13 . ILE A 1 15 ? -15.131 2.692   -1.440  1.00 0.00 ? 15  ILE A HG13 10 
ATOM   9338  H  HG21 . ILE A 1 15 ? -15.275 5.436   -4.658  1.00 0.00 ? 15  ILE A HG21 10 
ATOM   9339  H  HG22 . ILE A 1 15 ? -14.125 5.573   -3.329  1.00 0.00 ? 15  ILE A HG22 10 
ATOM   9340  H  HG23 . ILE A 1 15 ? -13.872 4.370   -4.592  1.00 0.00 ? 15  ILE A HG23 10 
ATOM   9341  H  HD11 . ILE A 1 15 ? -12.758 1.936   -2.358  1.00 0.00 ? 15  ILE A HD11 10 
ATOM   9342  H  HD12 . ILE A 1 15 ? -14.250 1.087   -2.765  1.00 0.00 ? 15  ILE A HD12 10 
ATOM   9343  H  HD13 . ILE A 1 15 ? -13.557 2.245   -3.900  1.00 0.00 ? 15  ILE A HD13 10 
ATOM   9344  N  N    . ILE A 1 16 ? -17.531 6.432   -3.683  1.00 0.00 ? 16  ILE A N    10 
ATOM   9345  C  CA   . ILE A 1 16 ? -18.432 7.074   -4.631  1.00 0.00 ? 16  ILE A CA   10 
ATOM   9346  C  C    . ILE A 1 16 ? -17.673 8.016   -5.559  1.00 0.00 ? 16  ILE A C    10 
ATOM   9347  O  O    . ILE A 1 16 ? -17.177 9.058   -5.132  1.00 0.00 ? 16  ILE A O    10 
ATOM   9348  C  CB   . ILE A 1 16 ? -19.539 7.864   -3.909  1.00 0.00 ? 16  ILE A CB   10 
ATOM   9349  C  CG1  . ILE A 1 16 ? -20.165 7.013   -2.803  1.00 0.00 ? 16  ILE A CG1  10 
ATOM   9350  C  CG2  . ILE A 1 16 ? -20.600 8.317   -4.901  1.00 0.00 ? 16  ILE A CG2  10 
ATOM   9351  C  CD1  . ILE A 1 16 ? -21.139 7.774   -1.932  1.00 0.00 ? 16  ILE A CD1  10 
ATOM   9352  H  H    . ILE A 1 16 ? -16.882 6.979   -3.194  1.00 0.00 ? 16  ILE A H    10 
ATOM   9353  H  HA   . ILE A 1 16 ? -18.898 6.300   -5.224  1.00 0.00 ? 16  ILE A HA   10 
ATOM   9354  H  HB   . ILE A 1 16 ? -19.094 8.743   -3.469  1.00 0.00 ? 16  ILE A HB   10 
ATOM   9355  H  HG12 . ILE A 1 16 ? -20.696 6.187   -3.250  1.00 0.00 ? 16  ILE A HG12 10 
ATOM   9356  H  HG13 . ILE A 1 16 ? -19.380 6.629   -2.167  1.00 0.00 ? 16  ILE A HG13 10 
ATOM   9357  H  HG21 . ILE A 1 16 ? -20.946 9.304   -4.633  1.00 0.00 ? 16  ILE A HG21 10 
ATOM   9358  H  HG22 . ILE A 1 16 ? -20.176 8.342   -5.894  1.00 0.00 ? 16  ILE A HG22 10 
ATOM   9359  H  HG23 . ILE A 1 16 ? -21.430 7.627   -4.881  1.00 0.00 ? 16  ILE A HG23 10 
ATOM   9360  H  HD11 . ILE A 1 16 ? -21.354 8.732   -2.383  1.00 0.00 ? 16  ILE A HD11 10 
ATOM   9361  H  HD12 . ILE A 1 16 ? -22.053 7.209   -1.833  1.00 0.00 ? 16  ILE A HD12 10 
ATOM   9362  H  HD13 . ILE A 1 16 ? -20.704 7.928   -0.955  1.00 0.00 ? 16  ILE A HD13 10 
ATOM   9363  N  N    . GLY A 1 17 ? -17.587 7.643   -6.832  1.00 0.00 ? 17  GLY A N    10 
ATOM   9364  C  CA   . GLY A 1 17 ? -16.889 8.467   -7.802  1.00 0.00 ? 17  GLY A CA   10 
ATOM   9365  C  C    . GLY A 1 17 ? -15.643 7.794   -8.344  1.00 0.00 ? 17  GLY A C    10 
ATOM   9366  O  O    . GLY A 1 17 ? -15.628 7.328   -9.483  1.00 0.00 ? 17  GLY A O    10 
ATOM   9367  H  H    . GLY A 1 17 ? -18.002 6.802   -7.116  1.00 0.00 ? 17  GLY A H    10 
ATOM   9368  H  HA2  . GLY A 1 17 ? -17.556 8.682   -8.623  1.00 0.00 ? 17  GLY A HA2  10 
ATOM   9369  H  HA3  . GLY A 1 17 ? -16.605 9.396   -7.329  1.00 0.00 ? 17  GLY A HA3  10 
ATOM   9370  N  N    . ARG A 1 18 ? -14.596 7.744   -7.527  1.00 0.00 ? 18  ARG A N    10 
ATOM   9371  C  CA   . ARG A 1 18 ? -13.340 7.126   -7.933  1.00 0.00 ? 18  ARG A CA   10 
ATOM   9372  C  C    . ARG A 1 18 ? -13.026 5.911   -7.064  1.00 0.00 ? 18  ARG A C    10 
ATOM   9373  O  O    . ARG A 1 18 ? -12.925 6.018   -5.842  1.00 0.00 ? 18  ARG A O    10 
ATOM   9374  C  CB   . ARG A 1 18 ? -12.197 8.138   -7.844  1.00 0.00 ? 18  ARG A CB   10 
ATOM   9375  C  CG   . ARG A 1 18 ? -10.817 7.501   -7.853  1.00 0.00 ? 18  ARG A CG   10 
ATOM   9376  C  CD   . ARG A 1 18 ? -9.784  8.418   -8.489  1.00 0.00 ? 18  ARG A CD   10 
ATOM   9377  N  NE   . ARG A 1 18 ? -8.681  7.669   -9.087  1.00 0.00 ? 18  ARG A NE   10 
ATOM   9378  C  CZ   . ARG A 1 18 ? -7.928  8.136   -10.076 1.00 0.00 ? 18  ARG A CZ   10 
ATOM   9379  N  NH1  . ARG A 1 18 ? -8.156  9.342   -10.576 1.00 0.00 ? 18  ARG A NH1  10 
ATOM   9380  N  NH2  . ARG A 1 18 ? -6.943  7.395   -10.567 1.00 0.00 ? 18  ARG A NH2  10 
ATOM   9381  H  H    . ARG A 1 18 ? -14.670 8.133   -6.630  1.00 0.00 ? 18  ARG A H    10 
ATOM   9382  H  HA   . ARG A 1 18 ? -13.444 6.803   -8.958  1.00 0.00 ? 18  ARG A HA   10 
ATOM   9383  H  HB2  . ARG A 1 18 ? -12.263 8.813   -8.684  1.00 0.00 ? 18  ARG A HB2  10 
ATOM   9384  H  HB3  . ARG A 1 18 ? -12.303 8.703   -6.930  1.00 0.00 ? 18  ARG A HB3  10 
ATOM   9385  H  HG2  . ARG A 1 18 ? -10.519 7.294   -6.835  1.00 0.00 ? 18  ARG A HG2  10 
ATOM   9386  H  HG3  . ARG A 1 18 ? -10.860 6.579   -8.412  1.00 0.00 ? 18  ARG A HG3  10 
ATOM   9387  H  HD2  . ARG A 1 18 ? -10.266 9.004   -9.257  1.00 0.00 ? 18  ARG A HD2  10 
ATOM   9388  H  HD3  . ARG A 1 18 ? -9.390  9.076   -7.729  1.00 0.00 ? 18  ARG A HD3  10 
ATOM   9389  H  HE   . ARG A 1 18 ? -8.495  6.775   -8.732  1.00 0.00 ? 18  ARG A HE   10 
ATOM   9390  H  HH11 . ARG A 1 18 ? -8.897  9.903   -10.207 1.00 0.00 ? 18  ARG A HH11 10 
ATOM   9391  H  HH12 . ARG A 1 18 ? -7.586  9.691   -11.320 1.00 0.00 ? 18  ARG A HH12 10 
ATOM   9392  H  HH21 . ARG A 1 18 ? -6.768  6.485   -10.193 1.00 0.00 ? 18  ARG A HH21 10 
ATOM   9393  H  HH22 . ARG A 1 18 ? -6.376  7.746   -11.312 1.00 0.00 ? 18  ARG A HH22 10 
ATOM   9394  N  N    . VAL A 1 19 ? -12.874 4.756   -7.704  1.00 0.00 ? 19  VAL A N    10 
ATOM   9395  C  CA   . VAL A 1 19 ? -12.572 3.521   -6.990  1.00 0.00 ? 19  VAL A CA   10 
ATOM   9396  C  C    . VAL A 1 19 ? -11.211 2.969   -7.399  1.00 0.00 ? 19  VAL A C    10 
ATOM   9397  O  O    . VAL A 1 19 ? -10.978 2.669   -8.571  1.00 0.00 ? 19  VAL A O    10 
ATOM   9398  C  CB   . VAL A 1 19 ? -13.646 2.447   -7.246  1.00 0.00 ? 19  VAL A CB   10 
ATOM   9399  C  CG1  . VAL A 1 19 ? -13.106 1.063   -6.923  1.00 0.00 ? 19  VAL A CG1  10 
ATOM   9400  C  CG2  . VAL A 1 19 ? -14.898 2.743   -6.434  1.00 0.00 ? 19  VAL A CG2  10 
ATOM   9401  H  H    . VAL A 1 19 ? -12.967 4.734   -8.679  1.00 0.00 ? 19  VAL A H    10 
ATOM   9402  H  HA   . VAL A 1 19 ? -12.557 3.741   -5.933  1.00 0.00 ? 19  VAL A HA   10 
ATOM   9403  H  HB   . VAL A 1 19 ? -13.908 2.471   -8.294  1.00 0.00 ? 19  VAL A HB   10 
ATOM   9404  H  HG11 . VAL A 1 19 ? -12.249 0.856   -7.548  1.00 0.00 ? 19  VAL A HG11 10 
ATOM   9405  H  HG12 . VAL A 1 19 ? -12.813 1.024   -5.884  1.00 0.00 ? 19  VAL A HG12 10 
ATOM   9406  H  HG13 . VAL A 1 19 ? -13.873 0.325   -7.109  1.00 0.00 ? 19  VAL A HG13 10 
ATOM   9407  H  HG21 . VAL A 1 19 ? -15.772 2.483   -7.013  1.00 0.00 ? 19  VAL A HG21 10 
ATOM   9408  H  HG22 . VAL A 1 19 ? -14.884 2.160   -5.524  1.00 0.00 ? 19  VAL A HG22 10 
ATOM   9409  H  HG23 . VAL A 1 19 ? -14.928 3.794   -6.188  1.00 0.00 ? 19  VAL A HG23 10 
ATOM   9410  N  N    . ILE A 1 20 ? -10.316 2.837   -6.426  1.00 0.00 ? 20  ILE A N    10 
ATOM   9411  C  CA   . ILE A 1 20 ? -8.978  2.319   -6.685  1.00 0.00 ? 20  ILE A CA   10 
ATOM   9412  C  C    . ILE A 1 20 ? -8.924  0.808   -6.485  1.00 0.00 ? 20  ILE A C    10 
ATOM   9413  O  O    . ILE A 1 20 ? -8.923  0.320   -5.354  1.00 0.00 ? 20  ILE A O    10 
ATOM   9414  C  CB   . ILE A 1 20 ? -7.931  2.984   -5.772  1.00 0.00 ? 20  ILE A CB   10 
ATOM   9415  C  CG1  . ILE A 1 20 ? -8.174  4.493   -5.695  1.00 0.00 ? 20  ILE A CG1  10 
ATOM   9416  C  CG2  . ILE A 1 20 ? -6.526  2.694   -6.278  1.00 0.00 ? 20  ILE A CG2  10 
ATOM   9417  C  CD1  . ILE A 1 20 ? -7.792  5.232   -6.958  1.00 0.00 ? 20  ILE A CD1  10 
ATOM   9418  H  H    . ILE A 1 20 ? -10.561 3.092   -5.513  1.00 0.00 ? 20  ILE A H    10 
ATOM   9419  H  HA   . ILE A 1 20 ? -8.726  2.545   -7.711  1.00 0.00 ? 20  ILE A HA   10 
ATOM   9420  H  HB   . ILE A 1 20 ? -8.026  2.560   -4.784  1.00 0.00 ? 20  ILE A HB   10 
ATOM   9421  H  HG12 . ILE A 1 20 ? -9.221  4.673   -5.509  1.00 0.00 ? 20  ILE A HG12 10 
ATOM   9422  H  HG13 . ILE A 1 20 ? -7.593  4.902   -4.881  1.00 0.00 ? 20  ILE A HG13 10 
ATOM   9423  H  HG21 . ILE A 1 20 ? -5.803  3.056   -5.562  1.00 0.00 ? 20  ILE A HG21 10 
ATOM   9424  H  HG22 . ILE A 1 20 ? -6.402  1.629   -6.405  1.00 0.00 ? 20  ILE A HG22 10 
ATOM   9425  H  HG23 . ILE A 1 20 ? -6.374  3.190   -7.225  1.00 0.00 ? 20  ILE A HG23 10 
ATOM   9426  H  HD11 . ILE A 1 20 ? -8.306  4.794   -7.801  1.00 0.00 ? 20  ILE A HD11 10 
ATOM   9427  H  HD12 . ILE A 1 20 ? -8.069  6.271   -6.865  1.00 0.00 ? 20  ILE A HD12 10 
ATOM   9428  H  HD13 . ILE A 1 20 ? -6.724  5.156   -7.110  1.00 0.00 ? 20  ILE A HD13 10 
ATOM   9429  N  N    . LYS A 1 21 ? -8.879  0.072   -7.590  1.00 0.00 ? 21  LYS A N    10 
ATOM   9430  C  CA   . LYS A 1 21 ? -8.822  -1.384  -7.537  1.00 0.00 ? 21  LYS A CA   10 
ATOM   9431  C  C    . LYS A 1 21 ? -7.403  -1.863  -7.247  1.00 0.00 ? 21  LYS A C    10 
ATOM   9432  O  O    . LYS A 1 21 ? -6.492  -1.656  -8.048  1.00 0.00 ? 21  LYS A O    10 
ATOM   9433  C  CB   . LYS A 1 21 ? -9.314  -1.982  -8.858  1.00 0.00 ? 21  LYS A CB   10 
ATOM   9434  C  CG   . LYS A 1 21 ? -10.823 -1.932  -9.024  1.00 0.00 ? 21  LYS A CG   10 
ATOM   9435  C  CD   . LYS A 1 21 ? -11.486 -3.180  -8.464  1.00 0.00 ? 21  LYS A CD   10 
ATOM   9436  C  CE   . LYS A 1 21 ? -12.904 -2.893  -7.993  1.00 0.00 ? 21  LYS A CE   10 
ATOM   9437  N  NZ   . LYS A 1 21 ? -13.771 -4.100  -8.080  1.00 0.00 ? 21  LYS A NZ   10 
ATOM   9438  H  H    . LYS A 1 21 ? -8.883  0.519   -8.462  1.00 0.00 ? 21  LYS A H    10 
ATOM   9439  H  HA   . LYS A 1 21 ? -9.471  -1.713  -6.740  1.00 0.00 ? 21  LYS A HA   10 
ATOM   9440  H  HB2  . LYS A 1 21 ? -8.864  -1.437  -9.675  1.00 0.00 ? 21  LYS A HB2  10 
ATOM   9441  H  HB3  . LYS A 1 21 ? -9.000  -3.015  -8.910  1.00 0.00 ? 21  LYS A HB3  10 
ATOM   9442  H  HG2  . LYS A 1 21 ? -11.205 -1.069  -8.500  1.00 0.00 ? 21  LYS A HG2  10 
ATOM   9443  H  HG3  . LYS A 1 21 ? -11.057 -1.851  -10.075 1.00 0.00 ? 21  LYS A HG3  10 
ATOM   9444  H  HD2  . LYS A 1 21 ? -11.521 -3.935  -9.235  1.00 0.00 ? 21  LYS A HD2  10 
ATOM   9445  H  HD3  . LYS A 1 21 ? -10.904 -3.542  -7.629  1.00 0.00 ? 21  LYS A HD3  10 
ATOM   9446  H  HE2  . LYS A 1 21 ? -12.868 -2.560  -6.968  1.00 0.00 ? 21  LYS A HE2  10 
ATOM   9447  H  HE3  . LYS A 1 21 ? -13.323 -2.113  -8.611  1.00 0.00 ? 21  LYS A HE3  10 
ATOM   9448  H  HZ1  . LYS A 1 21 ? -13.948 -4.483  -7.129  1.00 0.00 ? 21  LYS A HZ1  10 
ATOM   9449  H  HZ2  . LYS A 1 21 ? -13.308 -4.833  -8.655  1.00 0.00 ? 21  LYS A HZ2  10 
ATOM   9450  H  HZ3  . LYS A 1 21 ? -14.682 -3.855  -8.518  1.00 0.00 ? 21  LYS A HZ3  10 
ATOM   9451  N  N    . ALA A 1 22 ? -7.224  -2.505  -6.097  1.00 0.00 ? 22  ALA A N    10 
ATOM   9452  C  CA   . ALA A 1 22 ? -5.917  -3.017  -5.704  1.00 0.00 ? 22  ALA A CA   10 
ATOM   9453  C  C    . ALA A 1 22 ? -6.055  -4.222  -4.780  1.00 0.00 ? 22  ALA A C    10 
ATOM   9454  O  O    . ALA A 1 22 ? -7.134  -4.493  -4.255  1.00 0.00 ? 22  ALA A O    10 
ATOM   9455  C  CB   . ALA A 1 22 ? -5.104  -1.922  -5.029  1.00 0.00 ? 22  ALA A CB   10 
ATOM   9456  H  H    . ALA A 1 22 ? -7.990  -2.639  -5.501  1.00 0.00 ? 22  ALA A H    10 
ATOM   9457  H  HA   . ALA A 1 22 ? -5.394  -3.320  -6.599  1.00 0.00 ? 22  ALA A HA   10 
ATOM   9458  H  HB1  . ALA A 1 22 ? -5.757  -1.108  -4.753  1.00 0.00 ? 22  ALA A HB1  10 
ATOM   9459  H  HB2  . ALA A 1 22 ? -4.629  -2.320  -4.145  1.00 0.00 ? 22  ALA A HB2  10 
ATOM   9460  H  HB3  . ALA A 1 22 ? -4.349  -1.562  -5.712  1.00 0.00 ? 22  ALA A HB3  10 
ATOM   9461  N  N    . MET A 1 23 ? -4.955  -4.942  -4.586  1.00 0.00 ? 23  MET A N    10 
ATOM   9462  C  CA   . MET A 1 23 ? -4.954  -6.118  -3.724  1.00 0.00 ? 23  MET A CA   10 
ATOM   9463  C  C    . MET A 1 23 ? -6.243  -6.916  -3.892  1.00 0.00 ? 23  MET A C    10 
ATOM   9464  O  O    . MET A 1 23 ? -6.726  -7.538  -2.947  1.00 0.00 ? 23  MET A O    10 
ATOM   9465  C  CB   . MET A 1 23 ? -4.782  -5.705  -2.261  1.00 0.00 ? 23  MET A CB   10 
ATOM   9466  C  CG   . MET A 1 23 ? -3.565  -4.828  -2.016  1.00 0.00 ? 23  MET A CG   10 
ATOM   9467  S  SD   . MET A 1 23 ? -3.017  -4.866  -0.299  1.00 0.00 ? 23  MET A SD   10 
ATOM   9468  C  CE   . MET A 1 23 ? -1.518  -5.835  -0.443  1.00 0.00 ? 23  MET A CE   10 
ATOM   9469  H  H    . MET A 1 23 ? -4.123  -4.676  -5.032  1.00 0.00 ? 23  MET A H    10 
ATOM   9470  H  HA   . MET A 1 23 ? -4.120  -6.740  -4.013  1.00 0.00 ? 23  MET A HA   10 
ATOM   9471  H  HB2  . MET A 1 23 ? -5.661  -5.161  -1.948  1.00 0.00 ? 23  MET A HB2  10 
ATOM   9472  H  HB3  . MET A 1 23 ? -4.685  -6.595  -1.657  1.00 0.00 ? 23  MET A HB3  10 
ATOM   9473  H  HG2  . MET A 1 23 ? -2.757  -5.172  -2.644  1.00 0.00 ? 23  MET A HG2  10 
ATOM   9474  H  HG3  . MET A 1 23 ? -3.814  -3.810  -2.278  1.00 0.00 ? 23  MET A HG3  10 
ATOM   9475  H  HE1  . MET A 1 23 ? -1.696  -6.680  -1.092  1.00 0.00 ? 23  MET A HE1  10 
ATOM   9476  H  HE2  . MET A 1 23 ? -0.731  -5.222  -0.858  1.00 0.00 ? 23  MET A HE2  10 
ATOM   9477  H  HE3  . MET A 1 23 ? -1.222  -6.188  0.534   1.00 0.00 ? 23  MET A HE3  10 
ATOM   9478  N  N    . ASN A 1 24 ? -6.795  -6.892  -5.100  1.00 0.00 ? 24  ASN A N    10 
ATOM   9479  C  CA   . ASN A 1 24 ? -8.030  -7.613  -5.391  1.00 0.00 ? 24  ASN A CA   10 
ATOM   9480  C  C    . ASN A 1 24 ? -9.186  -7.068  -4.558  1.00 0.00 ? 24  ASN A C    10 
ATOM   9481  O  O    . ASN A 1 24 ? -9.969  -7.830  -3.991  1.00 0.00 ? 24  ASN A O    10 
ATOM   9482  C  CB   . ASN A 1 24 ? -7.849  -9.107  -5.117  1.00 0.00 ? 24  ASN A CB   10 
ATOM   9483  C  CG   . ASN A 1 24 ? -7.234  -9.841  -6.293  1.00 0.00 ? 24  ASN A CG   10 
ATOM   9484  O  OD1  . ASN A 1 24 ? -6.075  -10.253 -6.245  1.00 0.00 ? 24  ASN A OD1  10 
ATOM   9485  N  ND2  . ASN A 1 24 ? -8.010  -10.006 -7.358  1.00 0.00 ? 24  ASN A ND2  10 
ATOM   9486  H  H    . ASN A 1 24 ? -6.363  -6.378  -5.814  1.00 0.00 ? 24  ASN A H    10 
ATOM   9487  H  HA   . ASN A 1 24 ? -8.257  -7.473  -6.437  1.00 0.00 ? 24  ASN A HA   10 
ATOM   9488  H  HB2  . ASN A 1 24 ? -7.202  -9.234  -4.261  1.00 0.00 ? 24  ASN A HB2  10 
ATOM   9489  H  HB3  . ASN A 1 24 ? -8.811  -9.548  -4.904  1.00 0.00 ? 24  ASN A HB3  10 
ATOM   9490  H  HD21 . ASN A 1 24 ? -8.923  -9.651  -7.326  1.00 0.00 ? 24  ASN A HD21 10 
ATOM   9491  H  HD22 . ASN A 1 24 ? -7.638  -10.477 -8.133  1.00 0.00 ? 24  ASN A HD22 10 
ATOM   9492  N  N    . ASN A 1 25 ? -9.288  -5.745  -4.491  1.00 0.00 ? 25  ASN A N    10 
ATOM   9493  C  CA   . ASN A 1 25 ? -10.349 -5.098  -3.728  1.00 0.00 ? 25  ASN A CA   10 
ATOM   9494  C  C    . ASN A 1 25 ? -10.425 -3.610  -4.056  1.00 0.00 ? 25  ASN A C    10 
ATOM   9495  O  O    . ASN A 1 25 ? -9.495  -3.041  -4.628  1.00 0.00 ? 25  ASN A O    10 
ATOM   9496  C  CB   . ASN A 1 25 ? -10.116 -5.289  -2.227  1.00 0.00 ? 25  ASN A CB   10 
ATOM   9497  C  CG   . ASN A 1 25 ? -10.501 -6.678  -1.756  1.00 0.00 ? 25  ASN A CG   10 
ATOM   9498  O  OD1  . ASN A 1 25 ? -11.624 -7.132  -1.975  1.00 0.00 ? 25  ASN A OD1  10 
ATOM   9499  N  ND2  . ASN A 1 25 ? -9.567  -7.360  -1.103  1.00 0.00 ? 25  ASN A ND2  10 
ATOM   9500  H  H    . ASN A 1 25 ? -8.634  -5.190  -4.964  1.00 0.00 ? 25  ASN A H    10 
ATOM   9501  H  HA   . ASN A 1 25 ? -11.284 -5.563  -4.000  1.00 0.00 ? 25  ASN A HA   10 
ATOM   9502  H  HB2  . ASN A 1 25 ? -9.070  -5.132  -2.009  1.00 0.00 ? 25  ASN A HB2  10 
ATOM   9503  H  HB3  . ASN A 1 25 ? -10.706 -4.567  -1.683  1.00 0.00 ? 25  ASN A HB3  10 
ATOM   9504  H  HD21 . ASN A 1 25 ? -8.694  -6.935  -0.964  1.00 0.00 ? 25  ASN A HD21 10 
ATOM   9505  H  HD22 . ASN A 1 25 ? -9.788  -8.261  -0.787  1.00 0.00 ? 25  ASN A HD22 10 
ATOM   9506  N  N    . SER A 1 26 ? -11.539 -2.985  -3.689  1.00 0.00 ? 26  SER A N    10 
ATOM   9507  C  CA   . SER A 1 26 ? -11.739 -1.563  -3.947  1.00 0.00 ? 26  SER A CA   10 
ATOM   9508  C  C    . SER A 1 26 ? -11.221 -0.722  -2.785  1.00 0.00 ? 26  SER A C    10 
ATOM   9509  O  O    . SER A 1 26 ? -11.284 -1.137  -1.628  1.00 0.00 ? 26  SER A O    10 
ATOM   9510  C  CB   . SER A 1 26 ? -13.222 -1.270  -4.183  1.00 0.00 ? 26  SER A CB   10 
ATOM   9511  O  OG   . SER A 1 26 ? -13.999 -1.628  -3.053  1.00 0.00 ? 26  SER A OG   10 
ATOM   9512  H  H    . SER A 1 26 ? -12.245 -3.493  -3.236  1.00 0.00 ? 26  SER A H    10 
ATOM   9513  H  HA   . SER A 1 26 ? -11.184 -1.307  -4.837  1.00 0.00 ? 26  SER A HA   10 
ATOM   9514  H  HB2  . SER A 1 26 ? -13.351 -0.215  -4.374  1.00 0.00 ? 26  SER A HB2  10 
ATOM   9515  H  HB3  . SER A 1 26 ? -13.567 -1.835  -5.037  1.00 0.00 ? 26  SER A HB3  10 
ATOM   9516  H  HG   . SER A 1 26 ? -13.457 -2.126  -2.437  1.00 0.00 ? 26  SER A HG   10 
ATOM   9517  N  N    . TRP A 1 27 ? -10.709 0.462   -3.102  1.00 0.00 ? 27  TRP A N    10 
ATOM   9518  C  CA   . TRP A 1 27 ? -10.180 1.363   -2.084  1.00 0.00 ? 27  TRP A CA   10 
ATOM   9519  C  C    . TRP A 1 27 ? -10.331 2.818   -2.514  1.00 0.00 ? 27  TRP A C    10 
ATOM   9520  O  O    . TRP A 1 27 ? -10.715 3.104   -3.648  1.00 0.00 ? 27  TRP A O    10 
ATOM   9521  C  CB   . TRP A 1 27 ? -8.708  1.049   -1.812  1.00 0.00 ? 27  TRP A CB   10 
ATOM   9522  C  CG   . TRP A 1 27 ? -8.418  -0.420  -1.736  1.00 0.00 ? 27  TRP A CG   10 
ATOM   9523  C  CD1  . TRP A 1 27 ? -8.602  -1.344  -2.725  1.00 0.00 ? 27  TRP A CD1  10 
ATOM   9524  C  CD2  . TRP A 1 27 ? -7.894  -1.133  -0.610  1.00 0.00 ? 27  TRP A CD2  10 
ATOM   9525  N  NE1  . TRP A 1 27 ? -8.224  -2.589  -2.281  1.00 0.00 ? 27  TRP A NE1  10 
ATOM   9526  C  CE2  . TRP A 1 27 ? -7.785  -2.486  -0.988  1.00 0.00 ? 27  TRP A CE2  10 
ATOM   9527  C  CE3  . TRP A 1 27 ? -7.504  -0.760  0.679   1.00 0.00 ? 27  TRP A CE3  10 
ATOM   9528  C  CZ2  . TRP A 1 27 ? -7.305  -3.464  -0.121  1.00 0.00 ? 27  TRP A CZ2  10 
ATOM   9529  C  CZ3  . TRP A 1 27 ? -7.027  -1.732  1.538   1.00 0.00 ? 27  TRP A CZ3  10 
ATOM   9530  C  CH2  . TRP A 1 27 ? -6.930  -3.071  1.135   1.00 0.00 ? 27  TRP A CH2  10 
ATOM   9531  H  H    . TRP A 1 27 ? -10.687 0.737   -4.042  1.00 0.00 ? 27  TRP A H    10 
ATOM   9532  H  HA   . TRP A 1 27 ? -10.745 1.206   -1.178  1.00 0.00 ? 27  TRP A HA   10 
ATOM   9533  H  HB2  . TRP A 1 27 ? -8.104  1.467   -2.604  1.00 0.00 ? 27  TRP A HB2  10 
ATOM   9534  H  HB3  . TRP A 1 27 ? -8.420  1.495   -0.871  1.00 0.00 ? 27  TRP A HB3  10 
ATOM   9535  H  HD1  . TRP A 1 27 ? -8.991  -1.116  -3.705  1.00 0.00 ? 27  TRP A HD1  10 
ATOM   9536  H  HE1  . TRP A 1 27 ? -8.262  -3.415  -2.807  1.00 0.00 ? 27  TRP A HE1  10 
ATOM   9537  H  HE3  . TRP A 1 27 ? -7.571  0.266   1.007   1.00 0.00 ? 27  TRP A HE3  10 
ATOM   9538  H  HZ2  . TRP A 1 27 ? -7.223  -4.500  -0.417  1.00 0.00 ? 27  TRP A HZ2  10 
ATOM   9539  H  HZ3  . TRP A 1 27 ? -6.721  -1.463  2.538   1.00 0.00 ? 27  TRP A HZ3  10 
ATOM   9540  H  HH2  . TRP A 1 27 ? -6.552  -3.796  1.839   1.00 0.00 ? 27  TRP A HH2  10 
ATOM   9541  N  N    . HIS A 1 28 ? -10.027 3.734   -1.600  1.00 0.00 ? 28  HIS A N    10 
ATOM   9542  C  CA   . HIS A 1 28 ? -10.128 5.161   -1.886  1.00 0.00 ? 28  HIS A CA   10 
ATOM   9543  C  C    . HIS A 1 28 ? -8.817  5.697   -2.453  1.00 0.00 ? 28  HIS A C    10 
ATOM   9544  O  O    . HIS A 1 28 ? -7.748  5.117   -2.263  1.00 0.00 ? 28  HIS A O    10 
ATOM   9545  C  CB   . HIS A 1 28 ? -10.501 5.931   -0.619  1.00 0.00 ? 28  HIS A CB   10 
ATOM   9546  C  CG   . HIS A 1 28 ? -11.948 5.810   -0.248  1.00 0.00 ? 28  HIS A CG   10 
ATOM   9547  N  ND1  . HIS A 1 28 ? -12.375 5.304   0.961   1.00 0.00 ? 28  HIS A ND1  10 
ATOM   9548  C  CD2  . HIS A 1 28 ? -13.068 6.136   -0.935  1.00 0.00 ? 28  HIS A CD2  10 
ATOM   9549  C  CE1  . HIS A 1 28 ? -13.695 5.321   1.001   1.00 0.00 ? 28  HIS A CE1  10 
ATOM   9550  N  NE2  . HIS A 1 28 ? -14.140 5.822   -0.137  1.00 0.00 ? 28  HIS A NE2  10 
ATOM   9551  H  H    . HIS A 1 28 ? -9.727  3.444   -0.714  1.00 0.00 ? 28  HIS A H    10 
ATOM   9552  H  HA   . HIS A 1 28 ? -10.907 5.297   -2.621  1.00 0.00 ? 28  HIS A HA   10 
ATOM   9553  H  HB2  . HIS A 1 28 ? -9.915  5.557   0.208   1.00 0.00 ? 28  HIS A HB2  10 
ATOM   9554  H  HB3  . HIS A 1 28 ? -10.281 6.979   -0.764  1.00 0.00 ? 28  HIS A HB3  10 
ATOM   9555  H  HD2  . HIS A 1 28 ? -13.111 6.564   -1.927  1.00 0.00 ? 28  HIS A HD2  10 
ATOM   9556  H  HE1  . HIS A 1 28 ? -14.307 4.984   1.824   1.00 0.00 ? 28  HIS A HE1  10 
ATOM   9557  H  HE2  . HIS A 1 28 ? -15.082 5.868   -0.404  1.00 0.00 ? 28  HIS A HE2  10 
ATOM   9558  N  N    . PRO A 1 29 ? -8.899  6.829   -3.168  1.00 0.00 ? 29  PRO A N    10 
ATOM   9559  C  CA   . PRO A 1 29 ? -7.729  7.467   -3.777  1.00 0.00 ? 29  PRO A CA   10 
ATOM   9560  C  C    . PRO A 1 29 ? -6.793  8.075   -2.738  1.00 0.00 ? 29  PRO A C    10 
ATOM   9561  O  O    . PRO A 1 29 ? -5.745  8.622   -3.079  1.00 0.00 ? 29  PRO A O    10 
ATOM   9562  C  CB   . PRO A 1 29 ? -8.339  8.563   -4.654  1.00 0.00 ? 29  PRO A CB   10 
ATOM   9563  C  CG   . PRO A 1 29 ? -9.651  8.870   -4.019  1.00 0.00 ? 29  PRO A CG   10 
ATOM   9564  C  CD   . PRO A 1 29 ? -10.141 7.574   -3.435  1.00 0.00 ? 29  PRO A CD   10 
ATOM   9565  H  HA   . PRO A 1 29 ? -7.177  6.774   -4.396  1.00 0.00 ? 29  PRO A HA   10 
ATOM   9566  H  HB2  . PRO A 1 29 ? -7.689  9.427   -4.658  1.00 0.00 ? 29  PRO A HB2  10 
ATOM   9567  H  HB3  . PRO A 1 29 ? -8.464  8.195   -5.661  1.00 0.00 ? 29  PRO A HB3  10 
ATOM   9568  H  HG2  . PRO A 1 29 ? -9.519  9.606   -3.241  1.00 0.00 ? 29  PRO A HG2  10 
ATOM   9569  H  HG3  . PRO A 1 29 ? -10.344 9.230   -4.765  1.00 0.00 ? 29  PRO A HG3  10 
ATOM   9570  H  HD2  . PRO A 1 29 ? -10.687 7.754   -2.520  1.00 0.00 ? 29  PRO A HD2  10 
ATOM   9571  H  HD3  . PRO A 1 29 ? -10.759 7.048   -4.148  1.00 0.00 ? 29  PRO A HD3  10 
ATOM   9572  N  N    . GLU A 1 30 ? -7.179  7.974   -1.470  1.00 0.00 ? 30  GLU A N    10 
ATOM   9573  C  CA   . GLU A 1 30 ? -6.373  8.515   -0.382  1.00 0.00 ? 30  GLU A CA   10 
ATOM   9574  C  C    . GLU A 1 30 ? -6.044  7.433   0.642   1.00 0.00 ? 30  GLU A C    10 
ATOM   9575  O  O    . GLU A 1 30 ? -5.049  7.525   1.362   1.00 0.00 ? 30  GLU A O    10 
ATOM   9576  C  CB   . GLU A 1 30 ? -7.107  9.671   0.300   1.00 0.00 ? 30  GLU A CB   10 
ATOM   9577  C  CG   . GLU A 1 30 ? -8.486  9.296   0.817   1.00 0.00 ? 30  GLU A CG   10 
ATOM   9578  C  CD   . GLU A 1 30 ? -9.345  10.509  1.118   1.00 0.00 ? 30  GLU A CD   10 
ATOM   9579  O  OE1  . GLU A 1 30 ? -8.775  11.592  1.368   1.00 0.00 ? 30  GLU A OE1  10 
ATOM   9580  O  OE2  . GLU A 1 30 ? -10.586 10.375  1.105   1.00 0.00 ? 30  GLU A OE2  10 
ATOM   9581  H  H    . GLU A 1 30 ? -8.025  7.526   -1.262  1.00 0.00 ? 30  GLU A H    10 
ATOM   9582  H  HA   . GLU A 1 30 ? -5.451  8.886   -0.805  1.00 0.00 ? 30  GLU A HA   10 
ATOM   9583  H  HB2  . GLU A 1 30 ? -6.514  10.017  1.134   1.00 0.00 ? 30  GLU A HB2  10 
ATOM   9584  H  HB3  . GLU A 1 30 ? -7.219  10.478  -0.409  1.00 0.00 ? 30  GLU A HB3  10 
ATOM   9585  H  HG2  . GLU A 1 30 ? -8.985  8.697   0.071   1.00 0.00 ? 30  GLU A HG2  10 
ATOM   9586  H  HG3  . GLU A 1 30 ? -8.372  8.720   1.723   1.00 0.00 ? 30  GLU A HG3  10 
ATOM   9587  N  N    . CYS A 1 31 ? -6.887  6.407   0.701   1.00 0.00 ? 31  CYS A N    10 
ATOM   9588  C  CA   . CYS A 1 31 ? -6.688  5.306   1.637   1.00 0.00 ? 31  CYS A CA   10 
ATOM   9589  C  C    . CYS A 1 31 ? -5.558  4.394   1.171   1.00 0.00 ? 31  CYS A C    10 
ATOM   9590  O  O    . CYS A 1 31 ? -4.569  4.201   1.879   1.00 0.00 ? 31  CYS A O    10 
ATOM   9591  C  CB   . CYS A 1 31 ? -7.980  4.500   1.789   1.00 0.00 ? 31  CYS A CB   10 
ATOM   9592  S  SG   . CYS A 1 31 ? -9.213  5.271   2.886   1.00 0.00 ? 31  CYS A SG   10 
ATOM   9593  H  H    . CYS A 1 31 ? -7.663  6.390   0.101   1.00 0.00 ? 31  CYS A H    10 
ATOM   9594  H  HA   . CYS A 1 31 ? -6.423  5.728   2.594   1.00 0.00 ? 31  CYS A HA   10 
ATOM   9595  H  HB2  . CYS A 1 31 ? -8.436  4.379   0.817   1.00 0.00 ? 31  CYS A HB2  10 
ATOM   9596  H  HB3  . CYS A 1 31 ? -7.742  3.527   2.193   1.00 0.00 ? 31  CYS A HB3  10 
ATOM   9597  N  N    . PHE A 1 32 ? -5.710  3.835   -0.025  1.00 0.00 ? 32  PHE A N    10 
ATOM   9598  C  CA   . PHE A 1 32 ? -4.703  2.942   -0.586  1.00 0.00 ? 32  PHE A CA   10 
ATOM   9599  C  C    . PHE A 1 32 ? -3.324  3.595   -0.562  1.00 0.00 ? 32  PHE A C    10 
ATOM   9600  O  O    . PHE A 1 32 ? -2.879  4.167   -1.557  1.00 0.00 ? 32  PHE A O    10 
ATOM   9601  C  CB   . PHE A 1 32 ? -5.073  2.558   -2.020  1.00 0.00 ? 32  PHE A CB   10 
ATOM   9602  C  CG   . PHE A 1 32 ? -4.253  1.425   -2.568  1.00 0.00 ? 32  PHE A CG   10 
ATOM   9603  C  CD1  . PHE A 1 32 ? -4.308  0.168   -1.986  1.00 0.00 ? 32  PHE A CD1  10 
ATOM   9604  C  CD2  . PHE A 1 32 ? -3.428  1.616   -3.664  1.00 0.00 ? 32  PHE A CD2  10 
ATOM   9605  C  CE1  . PHE A 1 32 ? -3.554  -0.875  -2.488  1.00 0.00 ? 32  PHE A CE1  10 
ATOM   9606  C  CE2  . PHE A 1 32 ? -2.671  0.576   -4.170  1.00 0.00 ? 32  PHE A CE2  10 
ATOM   9607  C  CZ   . PHE A 1 32 ? -2.735  -0.672  -3.582  1.00 0.00 ? 32  PHE A CZ   10 
ATOM   9608  H  H    . PHE A 1 32 ? -6.521  4.027   -0.543  1.00 0.00 ? 32  PHE A H    10 
ATOM   9609  H  HA   . PHE A 1 32 ? -4.677  2.050   0.021   1.00 0.00 ? 32  PHE A HA   10 
ATOM   9610  H  HB2  . PHE A 1 32 ? -6.110  2.260   -2.049  1.00 0.00 ? 32  PHE A HB2  10 
ATOM   9611  H  HB3  . PHE A 1 32 ? -4.930  3.414   -2.662  1.00 0.00 ? 32  PHE A HB3  10 
ATOM   9612  H  HD1  . PHE A 1 32 ? -4.948  0.007   -1.132  1.00 0.00 ? 32  PHE A HD1  10 
ATOM   9613  H  HD2  . PHE A 1 32 ? -3.377  2.593   -4.126  1.00 0.00 ? 32  PHE A HD2  10 
ATOM   9614  H  HE1  . PHE A 1 32 ? -3.606  -1.850  -2.026  1.00 0.00 ? 32  PHE A HE1  10 
ATOM   9615  H  HE2  . PHE A 1 32 ? -2.033  0.739   -5.026  1.00 0.00 ? 32  PHE A HE2  10 
ATOM   9616  H  HZ   . PHE A 1 32 ? -2.145  -1.486  -3.976  1.00 0.00 ? 32  PHE A HZ   10 
ATOM   9617  N  N    . ARG A 1 33 ? -2.653  3.504   0.582   1.00 0.00 ? 33  ARG A N    10 
ATOM   9618  C  CA   . ARG A 1 33 ? -1.326  4.087   0.737   1.00 0.00 ? 33  ARG A CA   10 
ATOM   9619  C  C    . ARG A 1 33 ? -0.287  3.006   1.019   1.00 0.00 ? 33  ARG A C    10 
ATOM   9620  O  O    . ARG A 1 33 ? -0.630  1.848   1.262   1.00 0.00 ? 33  ARG A O    10 
ATOM   9621  C  CB   . ARG A 1 33 ? -1.326  5.116   1.870   1.00 0.00 ? 33  ARG A CB   10 
ATOM   9622  C  CG   . ARG A 1 33 ? -2.240  6.303   1.613   1.00 0.00 ? 33  ARG A CG   10 
ATOM   9623  C  CD   . ARG A 1 33 ? -2.174  7.313   2.748   1.00 0.00 ? 33  ARG A CD   10 
ATOM   9624  N  NE   . ARG A 1 33 ? -3.144  7.018   3.800   1.00 0.00 ? 33  ARG A NE   10 
ATOM   9625  C  CZ   . ARG A 1 33 ? -3.232  7.707   4.932   1.00 0.00 ? 33  ARG A CZ   10 
ATOM   9626  N  NH1  . ARG A 1 33 ? -2.414  8.726   5.158   1.00 0.00 ? 33  ARG A NH1  10 
ATOM   9627  N  NH2  . ARG A 1 33 ? -4.141  7.378   5.841   1.00 0.00 ? 33  ARG A NH2  10 
ATOM   9628  H  H    . ARG A 1 33 ? -3.061  3.035   1.340   1.00 0.00 ? 33  ARG A H    10 
ATOM   9629  H  HA   . ARG A 1 33 ? -1.071  4.583   -0.187  1.00 0.00 ? 33  ARG A HA   10 
ATOM   9630  H  HB2  . ARG A 1 33 ? -1.649  4.632   2.780   1.00 0.00 ? 33  ARG A HB2  10 
ATOM   9631  H  HB3  . ARG A 1 33 ? -0.321  5.486   2.004   1.00 0.00 ? 33  ARG A HB3  10 
ATOM   9632  H  HG2  . ARG A 1 33 ? -1.937  6.788   0.697   1.00 0.00 ? 33  ARG A HG2  10 
ATOM   9633  H  HG3  . ARG A 1 33 ? -3.256  5.949   1.516   1.00 0.00 ? 33  ARG A HG3  10 
ATOM   9634  H  HD2  . ARG A 1 33 ? -1.181  7.293   3.172   1.00 0.00 ? 33  ARG A HD2  10 
ATOM   9635  H  HD3  . ARG A 1 33 ? -2.376  8.296   2.350   1.00 0.00 ? 33  ARG A HD3  10 
ATOM   9636  H  HE   . ARG A 1 33 ? -3.758  6.269   3.654   1.00 0.00 ? 33  ARG A HE   10 
ATOM   9637  H  HH11 . ARG A 1 33 ? -1.729  8.977   4.474   1.00 0.00 ? 33  ARG A HH11 10 
ATOM   9638  H  HH12 . ARG A 1 33 ? -2.483  9.244   6.011   1.00 0.00 ? 33  ARG A HH12 10 
ATOM   9639  H  HH21 . ARG A 1 33 ? -4.759  6.611   5.675   1.00 0.00 ? 33  ARG A HH21 10 
ATOM   9640  H  HH22 . ARG A 1 33 ? -4.206  7.897   6.693   1.00 0.00 ? 33  ARG A HH22 10 
ATOM   9641  N  N    . CYS A 1 34 ? 0.985   3.390   0.985   1.00 0.00 ? 34  CYS A N    10 
ATOM   9642  C  CA   . CYS A 1 34 ? 2.074   2.455   1.235   1.00 0.00 ? 34  CYS A CA   10 
ATOM   9643  C  C    . CYS A 1 34 ? 1.946   1.829   2.621   1.00 0.00 ? 34  CYS A C    10 
ATOM   9644  O  O    . CYS A 1 34 ? 1.156   2.283   3.448   1.00 0.00 ? 34  CYS A O    10 
ATOM   9645  C  CB   . CYS A 1 34 ? 3.423   3.165   1.107   1.00 0.00 ? 34  CYS A CB   10 
ATOM   9646  S  SG   . CYS A 1 34 ? 4.848   2.037   0.972   1.00 0.00 ? 34  CYS A SG   10 
ATOM   9647  H  H    . CYS A 1 34 ? 1.196   4.327   0.786   1.00 0.00 ? 34  CYS A H    10 
ATOM   9648  H  HA   . CYS A 1 34 ? 2.017   1.673   0.493   1.00 0.00 ? 34  CYS A HA   10 
ATOM   9649  H  HB2  . CYS A 1 34 ? 3.412   3.786   0.223   1.00 0.00 ? 34  CYS A HB2  10 
ATOM   9650  H  HB3  . CYS A 1 34 ? 3.578   3.788   1.976   1.00 0.00 ? 34  CYS A HB3  10 
ATOM   9651  N  N    . ASP A 1 35 ? 2.728   0.783   2.866   1.00 0.00 ? 35  ASP A N    10 
ATOM   9652  C  CA   . ASP A 1 35 ? 2.704   0.095   4.151   1.00 0.00 ? 35  ASP A CA   10 
ATOM   9653  C  C    . ASP A 1 35 ? 3.940   0.440   4.976   1.00 0.00 ? 35  ASP A C    10 
ATOM   9654  O  O    . ASP A 1 35 ? 4.091   -0.019  6.109   1.00 0.00 ? 35  ASP A O    10 
ATOM   9655  C  CB   . ASP A 1 35 ? 2.621   -1.418  3.942   1.00 0.00 ? 35  ASP A CB   10 
ATOM   9656  C  CG   . ASP A 1 35 ? 2.470   -2.176  5.246   1.00 0.00 ? 35  ASP A CG   10 
ATOM   9657  O  OD1  . ASP A 1 35 ? 3.504   -2.535  5.847   1.00 0.00 ? 35  ASP A OD1  10 
ATOM   9658  O  OD2  . ASP A 1 35 ? 1.318   -2.410  5.666   1.00 0.00 ? 35  ASP A OD2  10 
ATOM   9659  H  H    . ASP A 1 35 ? 3.337   0.468   2.166   1.00 0.00 ? 35  ASP A H    10 
ATOM   9660  H  HA   . ASP A 1 35 ? 1.826   0.423   4.687   1.00 0.00 ? 35  ASP A HA   10 
ATOM   9661  H  HB2  . ASP A 1 35 ? 1.770   -1.643  3.316   1.00 0.00 ? 35  ASP A HB2  10 
ATOM   9662  H  HB3  . ASP A 1 35 ? 3.522   -1.757  3.452   1.00 0.00 ? 35  ASP A HB3  10 
ATOM   9663  N  N    . LEU A 1 36 ? 4.821   1.251   4.401   1.00 0.00 ? 36  LEU A N    10 
ATOM   9664  C  CA   . LEU A 1 36 ? 6.045   1.658   5.083   1.00 0.00 ? 36  LEU A CA   10 
ATOM   9665  C  C    . LEU A 1 36 ? 6.102   3.174   5.241   1.00 0.00 ? 36  LEU A C    10 
ATOM   9666  O  O    . LEU A 1 36 ? 6.624   3.687   6.231   1.00 0.00 ? 36  LEU A O    10 
ATOM   9667  C  CB   . LEU A 1 36 ? 7.270   1.168   4.309   1.00 0.00 ? 36  LEU A CB   10 
ATOM   9668  C  CG   . LEU A 1 36 ? 7.484   -0.346  4.281   1.00 0.00 ? 36  LEU A CG   10 
ATOM   9669  C  CD1  . LEU A 1 36 ? 8.169   -0.764  2.989   1.00 0.00 ? 36  LEU A CD1  10 
ATOM   9670  C  CD2  . LEU A 1 36 ? 8.299   -0.791  5.486   1.00 0.00 ? 36  LEU A CD2  10 
ATOM   9671  H  H    . LEU A 1 36 ? 4.645   1.585   3.497   1.00 0.00 ? 36  LEU A H    10 
ATOM   9672  H  HA   . LEU A 1 36 ? 6.044   1.206   6.063   1.00 0.00 ? 36  LEU A HA   10 
ATOM   9673  H  HB2  . LEU A 1 36 ? 7.174   1.507   3.289   1.00 0.00 ? 36  LEU A HB2  10 
ATOM   9674  H  HB3  . LEU A 1 36 ? 8.144   1.619   4.756   1.00 0.00 ? 36  LEU A HB3  10 
ATOM   9675  H  HG   . LEU A 1 36 ? 6.523   -0.840  4.324   1.00 0.00 ? 36  LEU A HG   10 
ATOM   9676  H  HD11 . LEU A 1 36 ? 9.149   -0.314  2.939   1.00 0.00 ? 36  LEU A HD11 10 
ATOM   9677  H  HD12 . LEU A 1 36 ? 7.578   -0.436  2.146   1.00 0.00 ? 36  LEU A HD12 10 
ATOM   9678  H  HD13 . LEU A 1 36 ? 8.263   -1.840  2.964   1.00 0.00 ? 36  LEU A HD13 10 
ATOM   9679  H  HD21 . LEU A 1 36 ? 7.638   -1.202  6.235   1.00 0.00 ? 36  LEU A HD21 10 
ATOM   9680  H  HD22 . LEU A 1 36 ? 8.826   0.057   5.898   1.00 0.00 ? 36  LEU A HD22 10 
ATOM   9681  H  HD23 . LEU A 1 36 ? 9.010   -1.544  5.182   1.00 0.00 ? 36  LEU A HD23 10 
ATOM   9682  N  N    . CYS A 1 37 ? 5.560   3.887   4.259   1.00 0.00 ? 37  CYS A N    10 
ATOM   9683  C  CA   . CYS A 1 37 ? 5.547   5.344   4.289   1.00 0.00 ? 37  CYS A CA   10 
ATOM   9684  C  C    . CYS A 1 37 ? 4.127   5.879   4.125   1.00 0.00 ? 37  CYS A C    10 
ATOM   9685  O  O    . CYS A 1 37 ? 3.901   7.089   4.162   1.00 0.00 ? 37  CYS A O    10 
ATOM   9686  C  CB   . CYS A 1 37 ? 6.446   5.906   3.185   1.00 0.00 ? 37  CYS A CB   10 
ATOM   9687  S  SG   . CYS A 1 37 ? 5.826   5.609   1.498   1.00 0.00 ? 37  CYS A SG   10 
ATOM   9688  H  H    . CYS A 1 37 ? 5.158   3.421   3.495   1.00 0.00 ? 37  CYS A H    10 
ATOM   9689  H  HA   . CYS A 1 37 ? 5.929   5.660   5.248   1.00 0.00 ? 37  CYS A HA   10 
ATOM   9690  H  HB2  . CYS A 1 37 ? 6.539   6.974   3.317   1.00 0.00 ? 37  CYS A HB2  10 
ATOM   9691  H  HB3  . CYS A 1 37 ? 7.423   5.452   3.262   1.00 0.00 ? 37  CYS A HB3  10 
ATOM   9692  N  N    . GLN A 1 38 ? 3.175   4.970   3.945   1.00 0.00 ? 38  GLN A N    10 
ATOM   9693  C  CA   . GLN A 1 38 ? 1.778   5.350   3.775   1.00 0.00 ? 38  GLN A CA   10 
ATOM   9694  C  C    . GLN A 1 38 ? 1.633   6.430   2.708   1.00 0.00 ? 38  GLN A C    10 
ATOM   9695  O  O    . GLN A 1 38 ? 1.067   7.493   2.960   1.00 0.00 ? 38  GLN A O    10 
ATOM   9696  C  CB   . GLN A 1 38 ? 1.197   5.846   5.101   1.00 0.00 ? 38  GLN A CB   10 
ATOM   9697  C  CG   . GLN A 1 38 ? 1.598   4.996   6.296   1.00 0.00 ? 38  GLN A CG   10 
ATOM   9698  C  CD   . GLN A 1 38 ? 0.602   3.891   6.586   1.00 0.00 ? 38  GLN A CD   10 
ATOM   9699  O  OE1  . GLN A 1 38 ? -0.548  4.153   6.940   1.00 0.00 ? 38  GLN A OE1  10 
ATOM   9700  N  NE2  . GLN A 1 38 ? 1.038   2.645   6.437   1.00 0.00 ? 38  GLN A NE2  10 
ATOM   9701  H  H    . GLN A 1 38 ? 3.418   4.021   3.925   1.00 0.00 ? 38  GLN A H    10 
ATOM   9702  H  HA   . GLN A 1 38 ? 1.232   4.474   3.459   1.00 0.00 ? 38  GLN A HA   10 
ATOM   9703  H  HB2  . GLN A 1 38 ? 1.538   6.856   5.274   1.00 0.00 ? 38  GLN A HB2  10 
ATOM   9704  H  HB3  . GLN A 1 38 ? 0.120   5.844   5.031   1.00 0.00 ? 38  GLN A HB3  10 
ATOM   9705  H  HG2  . GLN A 1 38 ? 2.560   4.548   6.096   1.00 0.00 ? 38  GLN A HG2  10 
ATOM   9706  H  HG3  . GLN A 1 38 ? 1.672   5.632   7.165   1.00 0.00 ? 38  GLN A HG3  10 
ATOM   9707  H  HE21 . GLN A 1 38 ? 1.967   2.512   6.153   1.00 0.00 ? 38  GLN A HE21 10 
ATOM   9708  H  HE22 . GLN A 1 38 ? 0.415   1.912   6.619   1.00 0.00 ? 38  GLN A HE22 10 
ATOM   9709  N  N    . GLU A 1 39 ? 2.150   6.150   1.516   1.00 0.00 ? 39  GLU A N    10 
ATOM   9710  C  CA   . GLU A 1 39 ? 2.080   7.100   0.411   1.00 0.00 ? 39  GLU A CA   10 
ATOM   9711  C  C    . GLU A 1 39 ? 1.029   6.670   -0.609  1.00 0.00 ? 39  GLU A C    10 
ATOM   9712  O  O    . GLU A 1 39 ? 1.124   5.595   -1.201  1.00 0.00 ? 39  GLU A O    10 
ATOM   9713  C  CB   . GLU A 1 39 ? 3.444   7.227   -0.270  1.00 0.00 ? 39  GLU A CB   10 
ATOM   9714  C  CG   . GLU A 1 39 ? 3.404   8.009   -1.572  1.00 0.00 ? 39  GLU A CG   10 
ATOM   9715  C  CD   . GLU A 1 39 ? 4.759   8.573   -1.955  1.00 0.00 ? 39  GLU A CD   10 
ATOM   9716  O  OE1  . GLU A 1 39 ? 5.782   7.981   -1.553  1.00 0.00 ? 39  GLU A OE1  10 
ATOM   9717  O  OE2  . GLU A 1 39 ? 4.795   9.605   -2.657  1.00 0.00 ? 39  GLU A OE2  10 
ATOM   9718  H  H    . GLU A 1 39 ? 2.590   5.286   1.376   1.00 0.00 ? 39  GLU A H    10 
ATOM   9719  H  HA   . GLU A 1 39 ? 1.799   8.060   0.816   1.00 0.00 ? 39  GLU A HA   10 
ATOM   9720  H  HB2  . GLU A 1 39 ? 4.125   7.725   0.405   1.00 0.00 ? 39  GLU A HB2  10 
ATOM   9721  H  HB3  . GLU A 1 39 ? 3.821   6.237   -0.480  1.00 0.00 ? 39  GLU A HB3  10 
ATOM   9722  H  HG2  . GLU A 1 39 ? 3.068   7.353   -2.361  1.00 0.00 ? 39  GLU A HG2  10 
ATOM   9723  H  HG3  . GLU A 1 39 ? 2.707   8.827   -1.464  1.00 0.00 ? 39  GLU A HG3  10 
ATOM   9724  N  N    . VAL A 1 40 ? 0.025   7.519   -0.808  1.00 0.00 ? 40  VAL A N    10 
ATOM   9725  C  CA   . VAL A 1 40 ? -1.045  7.229   -1.756  1.00 0.00 ? 40  VAL A CA   10 
ATOM   9726  C  C    . VAL A 1 40 ? -0.503  6.534   -3.000  1.00 0.00 ? 40  VAL A C    10 
ATOM   9727  O  O    . VAL A 1 40 ? 0.222   7.135   -3.794  1.00 0.00 ? 40  VAL A O    10 
ATOM   9728  C  CB   . VAL A 1 40 ? -1.783  8.512   -2.178  1.00 0.00 ? 40  VAL A CB   10 
ATOM   9729  C  CG1  . VAL A 1 40 ? -3.023  8.172   -2.992  1.00 0.00 ? 40  VAL A CG1  10 
ATOM   9730  C  CG2  . VAL A 1 40 ? -2.148  9.343   -0.958  1.00 0.00 ? 40  VAL A CG2  10 
ATOM   9731  H  H    . VAL A 1 40 ? 0.003   8.360   -0.306  1.00 0.00 ? 40  VAL A H    10 
ATOM   9732  H  HA   . VAL A 1 40 ? -1.753  6.574   -1.270  1.00 0.00 ? 40  VAL A HA   10 
ATOM   9733  H  HB   . VAL A 1 40 ? -1.121  9.097   -2.800  1.00 0.00 ? 40  VAL A HB   10 
ATOM   9734  H  HG11 . VAL A 1 40 ? -3.692  7.572   -2.394  1.00 0.00 ? 40  VAL A HG11 10 
ATOM   9735  H  HG12 . VAL A 1 40 ? -3.521  9.084   -3.288  1.00 0.00 ? 40  VAL A HG12 10 
ATOM   9736  H  HG13 . VAL A 1 40 ? -2.734  7.618   -3.873  1.00 0.00 ? 40  VAL A HG13 10 
ATOM   9737  H  HG21 . VAL A 1 40 ? -1.251  9.756   -0.522  1.00 0.00 ? 40  VAL A HG21 10 
ATOM   9738  H  HG22 . VAL A 1 40 ? -2.808  10.147  -1.252  1.00 0.00 ? 40  VAL A HG22 10 
ATOM   9739  H  HG23 . VAL A 1 40 ? -2.647  8.718   -0.232  1.00 0.00 ? 40  VAL A HG23 10 
ATOM   9740  N  N    . LEU A 1 41 ? -0.859  5.265   -3.165  1.00 0.00 ? 41  LEU A N    10 
ATOM   9741  C  CA   . LEU A 1 41 ? -0.409  4.487   -4.314  1.00 0.00 ? 41  LEU A CA   10 
ATOM   9742  C  C    . LEU A 1 41 ? -1.512  4.374   -5.361  1.00 0.00 ? 41  LEU A C    10 
ATOM   9743  O  O    . LEU A 1 41 ? -1.694  3.323   -5.974  1.00 0.00 ? 41  LEU A O    10 
ATOM   9744  C  CB   . LEU A 1 41 ? 0.032   3.091   -3.868  1.00 0.00 ? 41  LEU A CB   10 
ATOM   9745  C  CG   . LEU A 1 41 ? 0.588   2.984   -2.448  1.00 0.00 ? 41  LEU A CG   10 
ATOM   9746  C  CD1  . LEU A 1 41 ? 0.339   1.596   -1.880  1.00 0.00 ? 41  LEU A CD1  10 
ATOM   9747  C  CD2  . LEU A 1 41 ? 2.074   3.310   -2.431  1.00 0.00 ? 41  LEU A CD2  10 
ATOM   9748  H  H    . LEU A 1 41 ? -1.438  4.840   -2.498  1.00 0.00 ? 41  LEU A H    10 
ATOM   9749  H  HA   . LEU A 1 41 ? 0.435   5.000   -4.751  1.00 0.00 ? 41  LEU A HA   10 
ATOM   9750  H  HB2  . LEU A 1 41 ? -0.823  2.437   -3.939  1.00 0.00 ? 41  LEU A HB2  10 
ATOM   9751  H  HB3  . LEU A 1 41 ? 0.799   2.754   -4.551  1.00 0.00 ? 41  LEU A HB3  10 
ATOM   9752  H  HG   . LEU A 1 41 ? 0.081   3.699   -1.815  1.00 0.00 ? 41  LEU A HG   10 
ATOM   9753  H  HD11 . LEU A 1 41 ? 1.276   1.162   -1.567  1.00 0.00 ? 41  LEU A HD11 10 
ATOM   9754  H  HD12 . LEU A 1 41 ? -0.111  0.972   -2.639  1.00 0.00 ? 41  LEU A HD12 10 
ATOM   9755  H  HD13 . LEU A 1 41 ? -0.327  1.668   -1.033  1.00 0.00 ? 41  LEU A HD13 10 
ATOM   9756  H  HD21 . LEU A 1 41 ? 2.222   4.333   -2.746  1.00 0.00 ? 41  LEU A HD21 10 
ATOM   9757  H  HD22 . LEU A 1 41 ? 2.596   2.648   -3.107  1.00 0.00 ? 41  LEU A HD22 10 
ATOM   9758  H  HD23 . LEU A 1 41 ? 2.460   3.182   -1.431  1.00 0.00 ? 41  LEU A HD23 10 
ATOM   9759  N  N    . ALA A 1 42 ? -2.245  5.465   -5.561  1.00 0.00 ? 42  ALA A N    10 
ATOM   9760  C  CA   . ALA A 1 42 ? -3.327  5.490   -6.537  1.00 0.00 ? 42  ALA A CA   10 
ATOM   9761  C  C    . ALA A 1 42 ? -2.792  5.730   -7.944  1.00 0.00 ? 42  ALA A C    10 
ATOM   9762  O  O    . ALA A 1 42 ? -3.105  4.985   -8.873  1.00 0.00 ? 42  ALA A O    10 
ATOM   9763  C  CB   . ALA A 1 42 ? -4.345  6.559   -6.168  1.00 0.00 ? 42  ALA A CB   10 
ATOM   9764  H  H    . ALA A 1 42 ? -2.051  6.272   -5.041  1.00 0.00 ? 42  ALA A H    10 
ATOM   9765  H  HA   . ALA A 1 42 ? -3.823  4.530   -6.509  1.00 0.00 ? 42  ALA A HA   10 
ATOM   9766  H  HB1  . ALA A 1 42 ? -4.619  6.450   -5.129  1.00 0.00 ? 42  ALA A HB1  10 
ATOM   9767  H  HB2  . ALA A 1 42 ? -3.915  7.536   -6.328  1.00 0.00 ? 42  ALA A HB2  10 
ATOM   9768  H  HB3  . ALA A 1 42 ? -5.224  6.446   -6.786  1.00 0.00 ? 42  ALA A HB3  10 
ATOM   9769  N  N    . ASP A 1 43 ? -1.984  6.773   -8.095  1.00 0.00 ? 43  ASP A N    10 
ATOM   9770  C  CA   . ASP A 1 43 ? -1.405  7.111   -9.390  1.00 0.00 ? 43  ASP A CA   10 
ATOM   9771  C  C    . ASP A 1 43 ? -0.041  6.449   -9.565  1.00 0.00 ? 43  ASP A C    10 
ATOM   9772  O  O    . ASP A 1 43 ? 0.199   5.751   -10.550 1.00 0.00 ? 43  ASP A O    10 
ATOM   9773  C  CB   . ASP A 1 43 ? -1.271  8.628   -9.533  1.00 0.00 ? 43  ASP A CB   10 
ATOM   9774  C  CG   . ASP A 1 43 ? -2.580  9.290   -9.918  1.00 0.00 ? 43  ASP A CG   10 
ATOM   9775  O  OD1  . ASP A 1 43 ? -3.597  9.033   -9.241  1.00 0.00 ? 43  ASP A OD1  10 
ATOM   9776  O  OD2  . ASP A 1 43 ? -2.586  10.067  -10.896 1.00 0.00 ? 43  ASP A OD2  10 
ATOM   9777  H  H    . ASP A 1 43 ? -1.771  7.330   -7.316  1.00 0.00 ? 43  ASP A H    10 
ATOM   9778  H  HA   . ASP A 1 43 ? -2.070  6.743   -10.157 1.00 0.00 ? 43  ASP A HA   10 
ATOM   9779  H  HB2  . ASP A 1 43 ? -0.942  9.044   -8.592  1.00 0.00 ? 43  ASP A HB2  10 
ATOM   9780  H  HB3  . ASP A 1 43 ? -0.539  8.848   -10.296 1.00 0.00 ? 43  ASP A HB3  10 
ATOM   9781  N  N    . ILE A 1 44 ? 0.847   6.674   -8.603  1.00 0.00 ? 44  ILE A N    10 
ATOM   9782  C  CA   . ILE A 1 44 ? 2.186   6.100   -8.651  1.00 0.00 ? 44  ILE A CA   10 
ATOM   9783  C  C    . ILE A 1 44 ? 2.130   4.576   -8.664  1.00 0.00 ? 44  ILE A C    10 
ATOM   9784  O  O    . ILE A 1 44 ? 3.118   3.911   -8.973  1.00 0.00 ? 44  ILE A O    10 
ATOM   9785  C  CB   . ILE A 1 44 ? 3.040   6.561   -7.455  1.00 0.00 ? 44  ILE A CB   10 
ATOM   9786  C  CG1  . ILE A 1 44 ? 2.384   6.139   -6.139  1.00 0.00 ? 44  ILE A CG1  10 
ATOM   9787  C  CG2  . ILE A 1 44 ? 3.236   8.069   -7.495  1.00 0.00 ? 44  ILE A CG2  10 
ATOM   9788  C  CD1  . ILE A 1 44 ? 3.372   5.914   -5.016  1.00 0.00 ? 44  ILE A CD1  10 
ATOM   9789  H  H    . ILE A 1 44 ? 0.596   7.239   -7.843  1.00 0.00 ? 44  ILE A H    10 
ATOM   9790  H  HA   . ILE A 1 44 ? 2.662   6.440   -9.560  1.00 0.00 ? 44  ILE A HA   10 
ATOM   9791  H  HB   . ILE A 1 44 ? 4.010   6.094   -7.532  1.00 0.00 ? 44  ILE A HB   10 
ATOM   9792  H  HG12 . ILE A 1 44 ? 1.694   6.906   -5.824  1.00 0.00 ? 44  ILE A HG12 10 
ATOM   9793  H  HG13 . ILE A 1 44 ? 1.842   5.217   -6.295  1.00 0.00 ? 44  ILE A HG13 10 
ATOM   9794  H  HG21 . ILE A 1 44 ? 2.830   8.461   -8.416  1.00 0.00 ? 44  ILE A HG21 10 
ATOM   9795  H  HG22 . ILE A 1 44 ? 2.726   8.521   -6.657  1.00 0.00 ? 44  ILE A HG22 10 
ATOM   9796  H  HG23 . ILE A 1 44 ? 4.290   8.297   -7.440  1.00 0.00 ? 44  ILE A HG23 10 
ATOM   9797  H  HD11 . ILE A 1 44 ? 4.334   6.315   -5.297  1.00 0.00 ? 44  ILE A HD11 10 
ATOM   9798  H  HD12 . ILE A 1 44 ? 3.021   6.408   -4.123  1.00 0.00 ? 44  ILE A HD12 10 
ATOM   9799  H  HD13 . ILE A 1 44 ? 3.467   4.854   -4.827  1.00 0.00 ? 44  ILE A HD13 10 
ATOM   9800  N  N    . GLY A 1 45 ? 0.966   4.029   -8.327  1.00 0.00 ? 45  GLY A N    10 
ATOM   9801  C  CA   . GLY A 1 45 ? 0.802   2.587   -8.307  1.00 0.00 ? 45  GLY A CA   10 
ATOM   9802  C  C    . GLY A 1 45 ? 1.443   1.947   -7.091  1.00 0.00 ? 45  GLY A C    10 
ATOM   9803  O  O    . GLY A 1 45 ? 2.116   2.619   -6.309  1.00 0.00 ? 45  GLY A O    10 
ATOM   9804  H  H    . GLY A 1 45 ? 0.213   4.609   -8.089  1.00 0.00 ? 45  GLY A H    10 
ATOM   9805  H  HA2  . GLY A 1 45 ? -0.252  2.355   -8.310  1.00 0.00 ? 45  GLY A HA2  10 
ATOM   9806  H  HA3  . GLY A 1 45 ? 1.254   2.173   -9.197  1.00 0.00 ? 45  GLY A HA3  10 
ATOM   9807  N  N    . PHE A 1 46 ? 1.232   0.645   -6.930  1.00 0.00 ? 46  PHE A N    10 
ATOM   9808  C  CA   . PHE A 1 46 ? 1.792   -0.086  -5.799  1.00 0.00 ? 46  PHE A CA   10 
ATOM   9809  C  C    . PHE A 1 46 ? 2.602   -1.288  -6.276  1.00 0.00 ? 46  PHE A C    10 
ATOM   9810  O  O    . PHE A 1 46 ? 2.588   -1.631  -7.458  1.00 0.00 ? 46  PHE A O    10 
ATOM   9811  C  CB   . PHE A 1 46 ? 0.675   -0.549  -4.861  1.00 0.00 ? 46  PHE A CB   10 
ATOM   9812  C  CG   . PHE A 1 46 ? -0.301  -1.489  -5.509  1.00 0.00 ? 46  PHE A CG   10 
ATOM   9813  C  CD1  . PHE A 1 46 ? -1.149  -1.046  -6.511  1.00 0.00 ? 46  PHE A CD1  10 
ATOM   9814  C  CD2  . PHE A 1 46 ? -0.370  -2.816  -5.116  1.00 0.00 ? 46  PHE A CD2  10 
ATOM   9815  C  CE1  . PHE A 1 46 ? -2.048  -1.908  -7.109  1.00 0.00 ? 46  PHE A CE1  10 
ATOM   9816  C  CE2  . PHE A 1 46 ? -1.267  -3.683  -5.711  1.00 0.00 ? 46  PHE A CE2  10 
ATOM   9817  C  CZ   . PHE A 1 46 ? -2.108  -3.229  -6.708  1.00 0.00 ? 46  PHE A CZ   10 
ATOM   9818  H  H    . PHE A 1 46 ? 0.687   0.164   -7.588  1.00 0.00 ? 46  PHE A H    10 
ATOM   9819  H  HA   . PHE A 1 46 ? 2.446   0.584   -5.264  1.00 0.00 ? 46  PHE A HA   10 
ATOM   9820  H  HB2  . PHE A 1 46 ? 1.113   -1.057  -4.015  1.00 0.00 ? 46  PHE A HB2  10 
ATOM   9821  H  HB3  . PHE A 1 46 ? 0.127   0.313   -4.514  1.00 0.00 ? 46  PHE A HB3  10 
ATOM   9822  H  HD1  . PHE A 1 46 ? -1.103  -0.013  -6.826  1.00 0.00 ? 46  PHE A HD1  10 
ATOM   9823  H  HD2  . PHE A 1 46 ? 0.286   -3.172  -4.335  1.00 0.00 ? 46  PHE A HD2  10 
ATOM   9824  H  HE1  . PHE A 1 46 ? -2.704  -1.550  -7.889  1.00 0.00 ? 46  PHE A HE1  10 
ATOM   9825  H  HE2  . PHE A 1 46 ? -1.312  -4.714  -5.395  1.00 0.00 ? 46  PHE A HE2  10 
ATOM   9826  H  HZ   . PHE A 1 46 ? -2.809  -3.904  -7.175  1.00 0.00 ? 46  PHE A HZ   10 
ATOM   9827  N  N    . VAL A 1 47 ? 3.309   -1.924  -5.346  1.00 0.00 ? 47  VAL A N    10 
ATOM   9828  C  CA   . VAL A 1 47 ? 4.125   -3.088  -5.669  1.00 0.00 ? 47  VAL A CA   10 
ATOM   9829  C  C    . VAL A 1 47 ? 3.861   -4.232  -4.697  1.00 0.00 ? 47  VAL A C    10 
ATOM   9830  O  O    . VAL A 1 47 ? 4.416   -4.270  -3.599  1.00 0.00 ? 47  VAL A O    10 
ATOM   9831  C  CB   . VAL A 1 47 ? 5.627   -2.744  -5.645  1.00 0.00 ? 47  VAL A CB   10 
ATOM   9832  C  CG1  . VAL A 1 47 ? 6.460   -3.969  -5.991  1.00 0.00 ? 47  VAL A CG1  10 
ATOM   9833  C  CG2  . VAL A 1 47 ? 5.926   -1.598  -6.599  1.00 0.00 ? 47  VAL A CG2  10 
ATOM   9834  H  H    . VAL A 1 47 ? 3.280   -1.603  -4.421  1.00 0.00 ? 47  VAL A H    10 
ATOM   9835  H  HA   . VAL A 1 47 ? 3.867   -3.409  -6.668  1.00 0.00 ? 47  VAL A HA   10 
ATOM   9836  H  HB   . VAL A 1 47 ? 5.887   -2.430  -4.645  1.00 0.00 ? 47  VAL A HB   10 
ATOM   9837  H  HG11 . VAL A 1 47 ? 7.081   -3.751  -6.847  1.00 0.00 ? 47  VAL A HG11 10 
ATOM   9838  H  HG12 . VAL A 1 47 ? 7.085   -4.229  -5.149  1.00 0.00 ? 47  VAL A HG12 10 
ATOM   9839  H  HG13 . VAL A 1 47 ? 5.805   -4.796  -6.223  1.00 0.00 ? 47  VAL A HG13 10 
ATOM   9840  H  HG21 . VAL A 1 47 ? 6.600   -0.901  -6.123  1.00 0.00 ? 47  VAL A HG21 10 
ATOM   9841  H  HG22 . VAL A 1 47 ? 6.386   -1.987  -7.496  1.00 0.00 ? 47  VAL A HG22 10 
ATOM   9842  H  HG23 . VAL A 1 47 ? 5.007   -1.093  -6.856  1.00 0.00 ? 47  VAL A HG23 10 
ATOM   9843  N  N    . LYS A 1 48 ? 3.008   -5.164  -5.108  1.00 0.00 ? 48  LYS A N    10 
ATOM   9844  C  CA   . LYS A 1 48 ? 2.669   -6.312  -4.275  1.00 0.00 ? 48  LYS A CA   10 
ATOM   9845  C  C    . LYS A 1 48 ? 3.929   -6.981  -3.733  1.00 0.00 ? 48  LYS A C    10 
ATOM   9846  O  O    . LYS A 1 48 ? 4.786   -7.422  -4.497  1.00 0.00 ? 48  LYS A O    10 
ATOM   9847  C  CB   . LYS A 1 48 ? 1.846   -7.324  -5.075  1.00 0.00 ? 48  LYS A CB   10 
ATOM   9848  C  CG   . LYS A 1 48 ? 0.345   -7.138  -4.928  1.00 0.00 ? 48  LYS A CG   10 
ATOM   9849  C  CD   . LYS A 1 48 ? -0.122  -7.470  -3.521  1.00 0.00 ? 48  LYS A CD   10 
ATOM   9850  C  CE   . LYS A 1 48 ? -0.473  -8.944  -3.384  1.00 0.00 ? 48  LYS A CE   10 
ATOM   9851  N  NZ   . LYS A 1 48 ? -1.759  -9.273  -4.058  1.00 0.00 ? 48  LYS A NZ   10 
ATOM   9852  H  H    . LYS A 1 48 ? 2.597   -5.079  -5.994  1.00 0.00 ? 48  LYS A H    10 
ATOM   9853  H  HA   . LYS A 1 48 ? 2.079   -5.957  -3.444  1.00 0.00 ? 48  LYS A HA   10 
ATOM   9854  H  HB2  . LYS A 1 48 ? 2.099   -7.229  -6.121  1.00 0.00 ? 48  LYS A HB2  10 
ATOM   9855  H  HB3  . LYS A 1 48 ? 2.098   -8.320  -4.742  1.00 0.00 ? 48  LYS A HB3  10 
ATOM   9856  H  HG2  . LYS A 1 48 ? 0.096   -6.111  -5.146  1.00 0.00 ? 48  LYS A HG2  10 
ATOM   9857  H  HG3  . LYS A 1 48 ? -0.159  -7.789  -5.629  1.00 0.00 ? 48  LYS A HG3  10 
ATOM   9858  H  HD2  . LYS A 1 48 ? 0.667   -7.233  -2.823  1.00 0.00 ? 48  LYS A HD2  10 
ATOM   9859  H  HD3  . LYS A 1 48 ? -0.997  -6.878  -3.293  1.00 0.00 ? 48  LYS A HD3  10 
ATOM   9860  H  HE2  . LYS A 1 48 ? 0.316   -9.531  -3.827  1.00 0.00 ? 48  LYS A HE2  10 
ATOM   9861  H  HE3  . LYS A 1 48 ? -0.555  -9.184  -2.334  1.00 0.00 ? 48  LYS A HE3  10 
ATOM   9862  H  HZ1  . LYS A 1 48 ? -1.615  -10.040 -4.746  1.00 0.00 ? 48  LYS A HZ1  10 
ATOM   9863  H  HZ2  . LYS A 1 48 ? -2.125  -8.438  -4.558  1.00 0.00 ? 48  LYS A HZ2  10 
ATOM   9864  H  HZ3  . LYS A 1 48 ? -2.463  -9.579  -3.356  1.00 0.00 ? 48  LYS A HZ3  10 
ATOM   9865  N  N    . ASN A 1 49 ? 4.031   -7.055  -2.410  1.00 0.00 ? 49  ASN A N    10 
ATOM   9866  C  CA   . ASN A 1 49 ? 5.185   -7.672  -1.766  1.00 0.00 ? 49  ASN A CA   10 
ATOM   9867  C  C    . ASN A 1 49 ? 4.818   -8.203  -0.384  1.00 0.00 ? 49  ASN A C    10 
ATOM   9868  O  O    . ASN A 1 49 ? 4.160   -7.519  0.400   1.00 0.00 ? 49  ASN A O    10 
ATOM   9869  C  CB   . ASN A 1 49 ? 6.330   -6.664  -1.650  1.00 0.00 ? 49  ASN A CB   10 
ATOM   9870  C  CG   . ASN A 1 49 ? 7.685   -7.336  -1.548  1.00 0.00 ? 49  ASN A CG   10 
ATOM   9871  O  OD1  . ASN A 1 49 ? 7.791   -8.560  -1.629  1.00 0.00 ? 49  ASN A OD1  10 
ATOM   9872  N  ND2  . ASN A 1 49 ? 8.730   -6.537  -1.369  1.00 0.00 ? 49  ASN A ND2  10 
ATOM   9873  H  H    . ASN A 1 49 ? 3.314   -6.686  -1.853  1.00 0.00 ? 49  ASN A H    10 
ATOM   9874  H  HA   . ASN A 1 49 ? 5.506   -8.498  -2.383  1.00 0.00 ? 49  ASN A HA   10 
ATOM   9875  H  HB2  . ASN A 1 49 ? 6.331   -6.027  -2.523  1.00 0.00 ? 49  ASN A HB2  10 
ATOM   9876  H  HB3  . ASN A 1 49 ? 6.181   -6.058  -0.768  1.00 0.00 ? 49  ASN A HB3  10 
ATOM   9877  H  HD21 . ASN A 1 49 ? 8.571   -5.572  -1.313  1.00 0.00 ? 49  ASN A HD21 10 
ATOM   9878  H  HD22 . ASN A 1 49 ? 9.619   -6.946  -1.300  1.00 0.00 ? 49  ASN A HD22 10 
ATOM   9879  N  N    . ALA A 1 50 ? 5.248   -9.426  -0.092  1.00 0.00 ? 50  ALA A N    10 
ATOM   9880  C  CA   . ALA A 1 50 ? 4.967   -10.047 1.196   1.00 0.00 ? 50  ALA A CA   10 
ATOM   9881  C  C    . ALA A 1 50 ? 3.515   -9.827  1.607   1.00 0.00 ? 50  ALA A C    10 
ATOM   9882  O  O    . ALA A 1 50 ? 3.196   -9.779  2.794   1.00 0.00 ? 50  ALA A O    10 
ATOM   9883  C  CB   . ALA A 1 50 ? 5.907   -9.502  2.261   1.00 0.00 ? 50  ALA A CB   10 
ATOM   9884  H  H    . ALA A 1 50 ? 5.768   -9.921  -0.758  1.00 0.00 ? 50  ALA A H    10 
ATOM   9885  H  HA   . ALA A 1 50 ? 5.147   -11.109 1.101   1.00 0.00 ? 50  ALA A HA   10 
ATOM   9886  H  HB1  . ALA A 1 50 ? 5.476   -8.614  2.701   1.00 0.00 ? 50  ALA A HB1  10 
ATOM   9887  H  HB2  . ALA A 1 50 ? 6.054   -10.249 3.028   1.00 0.00 ? 50  ALA A HB2  10 
ATOM   9888  H  HB3  . ALA A 1 50 ? 6.857   -9.257  1.811   1.00 0.00 ? 50  ALA A HB3  10 
ATOM   9889  N  N    . GLY A 1 51 ? 2.638   -9.694  0.616   1.00 0.00 ? 51  GLY A N    10 
ATOM   9890  C  CA   . GLY A 1 51 ? 1.231   -9.480  0.895   1.00 0.00 ? 51  GLY A CA   10 
ATOM   9891  C  C    . GLY A 1 51 ? 0.952   -8.095  1.444   1.00 0.00 ? 51  GLY A C    10 
ATOM   9892  O  O    . GLY A 1 51 ? 0.090   -7.923  2.306   1.00 0.00 ? 51  GLY A O    10 
ATOM   9893  H  H    . GLY A 1 51 ? 2.950   -9.742  -0.312  1.00 0.00 ? 51  GLY A H    10 
ATOM   9894  H  HA2  . GLY A 1 51 ? 0.669   -9.614  -0.017  1.00 0.00 ? 51  GLY A HA2  10 
ATOM   9895  H  HA3  . GLY A 1 51 ? 0.903   -10.213 1.618   1.00 0.00 ? 51  GLY A HA3  10 
ATOM   9896  N  N    . ARG A 1 52 ? 1.686   -7.105  0.947   1.00 0.00 ? 52  ARG A N    10 
ATOM   9897  C  CA   . ARG A 1 52 ? 1.516   -5.728  1.395   1.00 0.00 ? 52  ARG A CA   10 
ATOM   9898  C  C    . ARG A 1 52 ? 1.710   -4.751  0.239   1.00 0.00 ? 52  ARG A C    10 
ATOM   9899  O  O    . ARG A 1 52 ? 2.601   -4.927  -0.593  1.00 0.00 ? 52  ARG A O    10 
ATOM   9900  C  CB   . ARG A 1 52 ? 2.505   -5.409  2.517   1.00 0.00 ? 52  ARG A CB   10 
ATOM   9901  C  CG   . ARG A 1 52 ? 2.401   -6.349  3.707   1.00 0.00 ? 52  ARG A CG   10 
ATOM   9902  C  CD   . ARG A 1 52 ? 3.643   -6.280  4.582   1.00 0.00 ? 52  ARG A CD   10 
ATOM   9903  N  NE   . ARG A 1 52 ? 3.726   -7.409  5.505   1.00 0.00 ? 52  ARG A NE   10 
ATOM   9904  C  CZ   . ARG A 1 52 ? 4.412   -7.380  6.642   1.00 0.00 ? 52  ARG A CZ   10 
ATOM   9905  N  NH1  . ARG A 1 52 ? 5.072   -6.285  6.994   1.00 0.00 ? 52  ARG A NH1  10 
ATOM   9906  N  NH2  . ARG A 1 52 ? 4.440   -8.447  7.429   1.00 0.00 ? 52  ARG A NH2  10 
ATOM   9907  H  H    . ARG A 1 52 ? 2.358   -7.305  0.262   1.00 0.00 ? 52  ARG A H    10 
ATOM   9908  H  HA   . ARG A 1 52 ? 0.510   -5.624  1.774   1.00 0.00 ? 52  ARG A HA   10 
ATOM   9909  H  HB2  . ARG A 1 52 ? 3.510   -5.470  2.125   1.00 0.00 ? 52  ARG A HB2  10 
ATOM   9910  H  HB3  . ARG A 1 52 ? 2.324   -4.403  2.865   1.00 0.00 ? 52  ARG A HB3  10 
ATOM   9911  H  HG2  . ARG A 1 52 ? 1.542   -6.072  4.299   1.00 0.00 ? 52  ARG A HG2  10 
ATOM   9912  H  HG3  . ARG A 1 52 ? 2.282   -7.360  3.345   1.00 0.00 ? 52  ARG A HG3  10 
ATOM   9913  H  HD2  . ARG A 1 52 ? 4.516   -6.283  3.946   1.00 0.00 ? 52  ARG A HD2  10 
ATOM   9914  H  HD3  . ARG A 1 52 ? 3.616   -5.363  5.151   1.00 0.00 ? 52  ARG A HD3  10 
ATOM   9915  H  HE   . ARG A 1 52 ? 3.246   -8.228  5.264   1.00 0.00 ? 52  ARG A HE   10 
ATOM   9916  H  HH11 . ARG A 1 52 ? 5.052   -5.478  6.403   1.00 0.00 ? 52  ARG A HH11 10 
ATOM   9917  H  HH12 . ARG A 1 52 ? 5.587   -6.265  7.851   1.00 0.00 ? 52  ARG A HH12 10 
ATOM   9918  H  HH21 . ARG A 1 52 ? 3.943   -9.274  7.167   1.00 0.00 ? 52  ARG A HH21 10 
ATOM   9919  H  HH22 . ARG A 1 52 ? 4.956   -8.424  8.285   1.00 0.00 ? 52  ARG A HH22 10 
ATOM   9920  N  N    . HIS A 1 53 ? 0.869   -3.723  0.192   1.00 0.00 ? 53  HIS A N    10 
ATOM   9921  C  CA   . HIS A 1 53 ? 0.948   -2.718  -0.862  1.00 0.00 ? 53  HIS A CA   10 
ATOM   9922  C  C    . HIS A 1 53 ? 2.015   -1.676  -0.542  1.00 0.00 ? 53  HIS A C    10 
ATOM   9923  O  O    . HIS A 1 53 ? 1.855   -0.871  0.377   1.00 0.00 ? 53  HIS A O    10 
ATOM   9924  C  CB   . HIS A 1 53 ? -0.408  -2.036  -1.048  1.00 0.00 ? 53  HIS A CB   10 
ATOM   9925  C  CG   . HIS A 1 53 ? -0.924  -1.380  0.195   1.00 0.00 ? 53  HIS A CG   10 
ATOM   9926  N  ND1  . HIS A 1 53 ? -2.016  -0.539  0.205   1.00 0.00 ? 53  HIS A ND1  10 
ATOM   9927  C  CD2  . HIS A 1 53 ? -0.491  -1.447  1.476   1.00 0.00 ? 53  HIS A CD2  10 
ATOM   9928  C  CE1  . HIS A 1 53 ? -2.232  -0.115  1.437   1.00 0.00 ? 53  HIS A CE1  10 
ATOM   9929  N  NE2  . HIS A 1 53 ? -1.321  -0.652  2.228   1.00 0.00 ? 53  HIS A NE2  10 
ATOM   9930  H  H    . HIS A 1 53 ? 0.180   -3.637  0.883   1.00 0.00 ? 53  HIS A H    10 
ATOM   9931  H  HA   . HIS A 1 53 ? 1.217   -3.220  -1.779  1.00 0.00 ? 53  HIS A HA   10 
ATOM   9932  H  HB2  . HIS A 1 53 ? -0.320  -1.277  -1.811  1.00 0.00 ? 53  HIS A HB2  10 
ATOM   9933  H  HB3  . HIS A 1 53 ? -1.134  -2.772  -1.362  1.00 0.00 ? 53  HIS A HB3  10 
ATOM   9934  H  HD1  . HIS A 1 53 ? -2.552  -0.288  -0.576  1.00 0.00 ? 53  HIS A HD1  10 
ATOM   9935  H  HD2  . HIS A 1 53 ? 0.351   -2.019  1.840   1.00 0.00 ? 53  HIS A HD2  10 
ATOM   9936  H  HE1  . HIS A 1 53 ? -3.020  0.556   1.746   1.00 0.00 ? 53  HIS A HE1  10 
ATOM   9937  H  HE2  . HIS A 1 53 ? -1.200  -0.437  3.176   1.00 0.00 ? 53  HIS A HE2  10 
ATOM   9938  N  N    . LEU A 1 54 ? 3.103   -1.698  -1.303  1.00 0.00 ? 54  LEU A N    10 
ATOM   9939  C  CA   . LEU A 1 54 ? 4.198   -0.755  -1.099  1.00 0.00 ? 54  LEU A CA   10 
ATOM   9940  C  C    . LEU A 1 54 ? 4.406   0.113   -2.336  1.00 0.00 ? 54  LEU A C    10 
ATOM   9941  O  O    . LEU A 1 54 ? 3.870   -0.174  -3.407  1.00 0.00 ? 54  LEU A O    10 
ATOM   9942  C  CB   . LEU A 1 54 ? 5.489   -1.506  -0.767  1.00 0.00 ? 54  LEU A CB   10 
ATOM   9943  C  CG   . LEU A 1 54 ? 5.325   -2.804  0.026   1.00 0.00 ? 54  LEU A CG   10 
ATOM   9944  C  CD1  . LEU A 1 54 ? 6.619   -3.602  0.015   1.00 0.00 ? 54  LEU A CD1  10 
ATOM   9945  C  CD2  . LEU A 1 54 ? 4.893   -2.505  1.454   1.00 0.00 ? 54  LEU A CD2  10 
ATOM   9946  H  H    . LEU A 1 54 ? 3.173   -2.363  -2.019  1.00 0.00 ? 54  LEU A H    10 
ATOM   9947  H  HA   . LEU A 1 54 ? 3.937   -0.119  -0.267  1.00 0.00 ? 54  LEU A HA   10 
ATOM   9948  H  HB2  . LEU A 1 54 ? 5.980   -1.747  -1.697  1.00 0.00 ? 54  LEU A HB2  10 
ATOM   9949  H  HB3  . LEU A 1 54 ? 6.118   -0.842  -0.191  1.00 0.00 ? 54  LEU A HB3  10 
ATOM   9950  H  HG   . LEU A 1 54 ? 4.557   -3.407  -0.438  1.00 0.00 ? 54  LEU A HG   10 
ATOM   9951  H  HD11 . LEU A 1 54 ? 6.926   -3.776  -1.005  1.00 0.00 ? 54  LEU A HD11 10 
ATOM   9952  H  HD12 . LEU A 1 54 ? 6.462   -4.549  0.510   1.00 0.00 ? 54  LEU A HD12 10 
ATOM   9953  H  HD13 . LEU A 1 54 ? 7.388   -3.049  0.534   1.00 0.00 ? 54  LEU A HD13 10 
ATOM   9954  H  HD21 . LEU A 1 54 ? 4.298   -1.603  1.468   1.00 0.00 ? 54  LEU A HD21 10 
ATOM   9955  H  HD22 . LEU A 1 54 ? 5.767   -2.369  2.074   1.00 0.00 ? 54  LEU A HD22 10 
ATOM   9956  H  HD23 . LEU A 1 54 ? 4.307   -3.329  1.833   1.00 0.00 ? 54  LEU A HD23 10 
ATOM   9957  N  N    . CYS A 1 55 ? 5.188   1.176   -2.181  1.00 0.00 ? 55  CYS A N    10 
ATOM   9958  C  CA   . CYS A 1 55 ? 5.469   2.087   -3.285  1.00 0.00 ? 55  CYS A CA   10 
ATOM   9959  C  C    . CYS A 1 55 ? 6.848   1.813   -3.878  1.00 0.00 ? 55  CYS A C    10 
ATOM   9960  O  O    . CYS A 1 55 ? 7.765   1.388   -3.174  1.00 0.00 ? 55  CYS A O    10 
ATOM   9961  C  CB   . CYS A 1 55 ? 5.385   3.538   -2.810  1.00 0.00 ? 55  CYS A CB   10 
ATOM   9962  S  SG   . CYS A 1 55 ? 6.718   4.026   -1.669  1.00 0.00 ? 55  CYS A SG   10 
ATOM   9963  H  H    . CYS A 1 55 ? 5.587   1.353   -1.303  1.00 0.00 ? 55  CYS A H    10 
ATOM   9964  H  HA   . CYS A 1 55 ? 4.724   1.923   -4.048  1.00 0.00 ? 55  CYS A HA   10 
ATOM   9965  H  HB2  . CYS A 1 55 ? 5.432   4.193   -3.668  1.00 0.00 ? 55  CYS A HB2  10 
ATOM   9966  H  HB3  . CYS A 1 55 ? 4.444   3.689   -2.301  1.00 0.00 ? 55  CYS A HB3  10 
ATOM   9967  N  N    . ARG A 1 56 ? 6.987   2.061   -5.176  1.00 0.00 ? 56  ARG A N    10 
ATOM   9968  C  CA   . ARG A 1 56 ? 8.254   1.841   -5.864  1.00 0.00 ? 56  ARG A CA   10 
ATOM   9969  C  C    . ARG A 1 56 ? 9.432   2.209   -4.967  1.00 0.00 ? 56  ARG A C    10 
ATOM   9970  O  O    . ARG A 1 56 ? 10.363  1.428   -4.771  1.00 0.00 ? 56  ARG A O    10 
ATOM   9971  C  CB   . ARG A 1 56 ? 8.306   2.660   -7.155  1.00 0.00 ? 56  ARG A CB   10 
ATOM   9972  C  CG   . ARG A 1 56 ? 7.956   1.861   -8.399  1.00 0.00 ? 56  ARG A CG   10 
ATOM   9973  C  CD   . ARG A 1 56 ? 9.016   0.815   -8.706  1.00 0.00 ? 56  ARG A CD   10 
ATOM   9974  N  NE   . ARG A 1 56 ? 8.780   0.157   -9.989  1.00 0.00 ? 56  ARG A NE   10 
ATOM   9975  C  CZ   . ARG A 1 56 ? 9.266   -1.039  -10.302 1.00 0.00 ? 56  ARG A CZ   10 
ATOM   9976  N  NH1  . ARG A 1 56 ? 10.010  -1.705  -9.429  1.00 0.00 ? 56  ARG A NH1  10 
ATOM   9977  N  NH2  . ARG A 1 56 ? 9.008   -1.571  -11.489 1.00 0.00 ? 56  ARG A NH2  10 
ATOM   9978  H  H    . ARG A 1 56 ? 6.220   2.399   -5.684  1.00 0.00 ? 56  ARG A H    10 
ATOM   9979  H  HA   . ARG A 1 56 ? 8.319   0.792   -6.112  1.00 0.00 ? 56  ARG A HA   10 
ATOM   9980  H  HB2  . ARG A 1 56 ? 7.611   3.483   -7.074  1.00 0.00 ? 56  ARG A HB2  10 
ATOM   9981  H  HB3  . ARG A 1 56 ? 9.304   3.054   -7.276  1.00 0.00 ? 56  ARG A HB3  10 
ATOM   9982  H  HG2  . ARG A 1 56 ? 7.010   1.363   -8.241  1.00 0.00 ? 56  ARG A HG2  10 
ATOM   9983  H  HG3  . ARG A 1 56 ? 7.874   2.536   -9.238  1.00 0.00 ? 56  ARG A HG3  10 
ATOM   9984  H  HD2  . ARG A 1 56 ? 9.981   1.297   -8.732  1.00 0.00 ? 56  ARG A HD2  10 
ATOM   9985  H  HD3  . ARG A 1 56 ? 9.006   0.071   -7.924  1.00 0.00 ? 56  ARG A HD3  10 
ATOM   9986  H  HE   . ARG A 1 56 ? 8.233   0.632   -10.648 1.00 0.00 ? 56  ARG A HE   10 
ATOM   9987  H  HH11 . ARG A 1 56 ? 10.205  -1.306  -8.533  1.00 0.00 ? 56  ARG A HH11 10 
ATOM   9988  H  HH12 . ARG A 1 56 ? 10.374  -2.606  -9.667  1.00 0.00 ? 56  ARG A HH12 10 
ATOM   9989  H  HH21 . ARG A 1 56 ? 8.447   -1.073  -12.149 1.00 0.00 ? 56  ARG A HH21 10 
ATOM   9990  H  HH22 . ARG A 1 56 ? 9.374   -2.471  -11.724 1.00 0.00 ? 56  ARG A HH22 10 
ATOM   9991  N  N    . PRO A 1 57 ? 9.391   3.427   -4.408  1.00 0.00 ? 57  PRO A N    10 
ATOM   9992  C  CA   . PRO A 1 57 ? 10.447  3.927   -3.522  1.00 0.00 ? 57  PRO A CA   10 
ATOM   9993  C  C    . PRO A 1 57 ? 10.828  2.916   -2.446  1.00 0.00 ? 57  PRO A C    10 
ATOM   9994  O  O    . PRO A 1 57 ? 11.949  2.407   -2.426  1.00 0.00 ? 57  PRO A O    10 
ATOM   9995  C  CB   . PRO A 1 57 ? 9.819   5.171   -2.888  1.00 0.00 ? 57  PRO A CB   10 
ATOM   9996  C  CG   . PRO A 1 57 ? 8.805   5.630   -3.878  1.00 0.00 ? 57  PRO A CG   10 
ATOM   9997  C  CD   . PRO A 1 57 ? 8.312   4.411   -4.597  1.00 0.00 ? 57  PRO A CD   10 
ATOM   9998  H  HA   . PRO A 1 57 ? 11.330  4.210   -4.077  1.00 0.00 ? 57  PRO A HA   10 
ATOM   9999  H  HB2  . PRO A 1 57 ? 9.361   4.906   -1.946  1.00 0.00 ? 57  PRO A HB2  10 
ATOM   10000 H  HB3  . PRO A 1 57 ? 10.580  5.920   -2.727  1.00 0.00 ? 57  PRO A HB3  10 
ATOM   10001 H  HG2  . PRO A 1 57 ? 7.985   6.111   -3.368  1.00 0.00 ? 57  PRO A HG2  10 
ATOM   10002 H  HG3  . PRO A 1 57 ? 9.261   6.310   -4.583  1.00 0.00 ? 57  PRO A HG3  10 
ATOM   10003 H  HD2  . PRO A 1 57 ? 7.391   4.063   -4.152  1.00 0.00 ? 57  PRO A HD2  10 
ATOM   10004 H  HD3  . PRO A 1 57 ? 8.169   4.629   -5.645  1.00 0.00 ? 57  PRO A HD3  10 
ATOM   10005 N  N    . CYS A 1 58 ? 9.888   2.628   -1.552  1.00 0.00 ? 58  CYS A N    10 
ATOM   10006 C  CA   . CYS A 1 58 ? 10.124  1.677   -0.472  1.00 0.00 ? 58  CYS A CA   10 
ATOM   10007 C  C    . CYS A 1 58 ? 10.520  0.312   -1.027  1.00 0.00 ? 58  CYS A C    10 
ATOM   10008 O  O    . CYS A 1 58 ? 11.662  -0.124  -0.878  1.00 0.00 ? 58  CYS A O    10 
ATOM   10009 C  CB   . CYS A 1 58 ? 8.874   1.543   0.400   1.00 0.00 ? 58  CYS A CB   10 
ATOM   10010 S  SG   . CYS A 1 58 ? 8.393   3.081   1.251   1.00 0.00 ? 58  CYS A SG   10 
ATOM   10011 H  H    . CYS A 1 58 ? 9.013   3.066   -1.620  1.00 0.00 ? 58  CYS A H    10 
ATOM   10012 H  HA   . CYS A 1 58 ? 10.935  2.055   0.131   1.00 0.00 ? 58  CYS A HA   10 
ATOM   10013 H  HB2  . CYS A 1 58 ? 8.044   1.238   -0.219  1.00 0.00 ? 58  CYS A HB2  10 
ATOM   10014 H  HB3  . CYS A 1 58 ? 9.050   0.791   1.154   1.00 0.00 ? 58  CYS A HB3  10 
ATOM   10015 N  N    . HIS A 1 59 ? 9.567   -0.360  -1.666  1.00 0.00 ? 59  HIS A N    10 
ATOM   10016 C  CA   . HIS A 1 59 ? 9.816   -1.676  -2.244  1.00 0.00 ? 59  HIS A CA   10 
ATOM   10017 C  C    . HIS A 1 59 ? 11.232  -1.765  -2.803  1.00 0.00 ? 59  HIS A C    10 
ATOM   10018 O  O    . HIS A 1 59 ? 11.950  -2.731  -2.549  1.00 0.00 ? 59  HIS A O    10 
ATOM   10019 C  CB   . HIS A 1 59 ? 8.800   -1.971  -3.348  1.00 0.00 ? 59  HIS A CB   10 
ATOM   10020 C  CG   . HIS A 1 59 ? 9.168   -3.145  -4.202  1.00 0.00 ? 59  HIS A CG   10 
ATOM   10021 N  ND1  . HIS A 1 59 ? 9.312   -4.423  -3.704  1.00 0.00 ? 59  HIS A ND1  10 
ATOM   10022 C  CD2  . HIS A 1 59 ? 9.420   -3.230  -5.529  1.00 0.00 ? 59  HIS A CD2  10 
ATOM   10023 C  CE1  . HIS A 1 59 ? 9.638   -5.242  -4.687  1.00 0.00 ? 59  HIS A CE1  10 
ATOM   10024 N  NE2  . HIS A 1 59 ? 9.710   -4.543  -5.805  1.00 0.00 ? 59  HIS A NE2  10 
ATOM   10025 H  H    . HIS A 1 59 ? 8.676   0.040   -1.752  1.00 0.00 ? 59  HIS A H    10 
ATOM   10026 H  HA   . HIS A 1 59 ? 9.705   -2.409  -1.460  1.00 0.00 ? 59  HIS A HA   10 
ATOM   10027 H  HB2  . HIS A 1 59 ? 7.839   -2.177  -2.898  1.00 0.00 ? 59  HIS A HB2  10 
ATOM   10028 H  HB3  . HIS A 1 59 ? 8.713   -1.107  -3.990  1.00 0.00 ? 59  HIS A HB3  10 
ATOM   10029 H  HD1  . HIS A 1 59 ? 9.193   -4.689  -2.768  1.00 0.00 ? 59  HIS A HD1  10 
ATOM   10030 H  HD2  . HIS A 1 59 ? 9.398   -2.416  -6.240  1.00 0.00 ? 59  HIS A HD2  10 
ATOM   10031 H  HE1  . HIS A 1 59 ? 9.816   -6.303  -4.593  1.00 0.00 ? 59  HIS A HE1  10 
ATOM   10032 H  HE2  . HIS A 1 59 ? 10.017  -4.890  -6.669  1.00 0.00 ? 59  HIS A HE2  10 
ATOM   10033 N  N    . ASN A 1 60 ? 11.627  -0.751  -3.567  1.00 0.00 ? 60  ASN A N    10 
ATOM   10034 C  CA   . ASN A 1 60 ? 12.957  -0.716  -4.163  1.00 0.00 ? 60  ASN A CA   10 
ATOM   10035 C  C    . ASN A 1 60 ? 14.036  -0.866  -3.095  1.00 0.00 ? 60  ASN A C    10 
ATOM   10036 O  O    . ASN A 1 60 ? 14.988  -1.629  -3.262  1.00 0.00 ? 60  ASN A O    10 
ATOM   10037 C  CB   . ASN A 1 60 ? 13.161  0.593   -4.929  1.00 0.00 ? 60  ASN A CB   10 
ATOM   10038 C  CG   . ASN A 1 60 ? 12.673  0.506   -6.362  1.00 0.00 ? 60  ASN A CG   10 
ATOM   10039 O  OD1  . ASN A 1 60 ? 12.989  -0.443  -7.081  1.00 0.00 ? 60  ASN A OD1  10 
ATOM   10040 N  ND2  . ASN A 1 60 ? 11.898  1.498   -6.785  1.00 0.00 ? 60  ASN A ND2  10 
ATOM   10041 H  H    . ASN A 1 60 ? 11.009  -0.009  -3.734  1.00 0.00 ? 60  ASN A H    10 
ATOM   10042 H  HA   . ASN A 1 60 ? 13.033  -1.542  -4.854  1.00 0.00 ? 60  ASN A HA   10 
ATOM   10043 H  HB2  . ASN A 1 60 ? 12.617  1.383   -4.432  1.00 0.00 ? 60  ASN A HB2  10 
ATOM   10044 H  HB3  . ASN A 1 60 ? 14.213  0.837   -4.941  1.00 0.00 ? 60  ASN A HB3  10 
ATOM   10045 H  HD21 . ASN A 1 60 ? 11.688  2.221   -6.157  1.00 0.00 ? 60  ASN A HD21 10 
ATOM   10046 H  HD22 . ASN A 1 60 ? 11.568  1.467   -7.707  1.00 0.00 ? 60  ASN A HD22 10 
ATOM   10047 N  N    . ARG A 1 61 ? 13.881  -0.133  -1.997  1.00 0.00 ? 61  ARG A N    10 
ATOM   10048 C  CA   . ARG A 1 61 ? 14.842  -0.184  -0.902  1.00 0.00 ? 61  ARG A CA   10 
ATOM   10049 C  C    . ARG A 1 61 ? 15.010  -1.613  -0.393  1.00 0.00 ? 61  ARG A C    10 
ATOM   10050 O  O    . ARG A 1 61 ? 16.129  -2.075  -0.174  1.00 0.00 ? 61  ARG A O    10 
ATOM   10051 C  CB   . ARG A 1 61 ? 14.392  0.727   0.242   1.00 0.00 ? 61  ARG A CB   10 
ATOM   10052 C  CG   . ARG A 1 61 ? 14.574  2.207   -0.051  1.00 0.00 ? 61  ARG A CG   10 
ATOM   10053 C  CD   . ARG A 1 61 ? 14.136  3.066   1.125   1.00 0.00 ? 61  ARG A CD   10 
ATOM   10054 N  NE   . ARG A 1 61 ? 15.217  3.269   2.086   1.00 0.00 ? 61  ARG A NE   10 
ATOM   10055 C  CZ   . ARG A 1 61 ? 15.016  3.543   3.370   1.00 0.00 ? 61  ARG A CZ   10 
ATOM   10056 N  NH1  . ARG A 1 61 ? 13.782  3.644   3.845   1.00 0.00 ? 61  ARG A NH1  10 
ATOM   10057 N  NH2  . ARG A 1 61 ? 16.051  3.714   4.183   1.00 0.00 ? 61  ARG A NH2  10 
ATOM   10058 H  H    . ARG A 1 61 ? 13.102  0.457   -1.923  1.00 0.00 ? 61  ARG A H    10 
ATOM   10059 H  HA   . ARG A 1 61 ? 15.792  0.166   -1.277  1.00 0.00 ? 61  ARG A HA   10 
ATOM   10060 H  HB2  . ARG A 1 61 ? 13.345  0.548   0.439   1.00 0.00 ? 61  ARG A HB2  10 
ATOM   10061 H  HB3  . ARG A 1 61 ? 14.964  0.484   1.125   1.00 0.00 ? 61  ARG A HB3  10 
ATOM   10062 H  HG2  . ARG A 1 61 ? 15.617  2.399   -0.254  1.00 0.00 ? 61  ARG A HG2  10 
ATOM   10063 H  HG3  . ARG A 1 61 ? 13.983  2.468   -0.917  1.00 0.00 ? 61  ARG A HG3  10 
ATOM   10064 H  HD2  . ARG A 1 61 ? 13.814  4.027   0.752   1.00 0.00 ? 61  ARG A HD2  10 
ATOM   10065 H  HD3  . ARG A 1 61 ? 13.311  2.578   1.622   1.00 0.00 ? 61  ARG A HD3  10 
ATOM   10066 H  HE   . ARG A 1 61 ? 16.137  3.199   1.757   1.00 0.00 ? 61  ARG A HE   10 
ATOM   10067 H  HH11 . ARG A 1 61 ? 13.001  3.514   3.235   1.00 0.00 ? 61  ARG A HH11 10 
ATOM   10068 H  HH12 . ARG A 1 61 ? 13.634  3.849   4.813   1.00 0.00 ? 61  ARG A HH12 10 
ATOM   10069 H  HH21 . ARG A 1 61 ? 16.983  3.638   3.829   1.00 0.00 ? 61  ARG A HH21 10 
ATOM   10070 H  HH22 . ARG A 1 61 ? 15.899  3.920   5.149   1.00 0.00 ? 61  ARG A HH22 10 
ATOM   10071 N  N    . GLU A 1 62 ? 13.890  -2.305  -0.206  1.00 0.00 ? 62  GLU A N    10 
ATOM   10072 C  CA   . GLU A 1 62 ? 13.915  -3.680  0.279   1.00 0.00 ? 62  GLU A CA   10 
ATOM   10073 C  C    . GLU A 1 62 ? 14.485  -4.620  -0.779  1.00 0.00 ? 62  GLU A C    10 
ATOM   10074 O  O    . GLU A 1 62 ? 15.537  -5.228  -0.584  1.00 0.00 ? 62  GLU A O    10 
ATOM   10075 C  CB   . GLU A 1 62 ? 12.506  -4.131  0.671   1.00 0.00 ? 62  GLU A CB   10 
ATOM   10076 C  CG   . GLU A 1 62 ? 11.749  -3.108  1.501   1.00 0.00 ? 62  GLU A CG   10 
ATOM   10077 C  CD   . GLU A 1 62 ? 11.992  -3.267  2.989   1.00 0.00 ? 62  GLU A CD   10 
ATOM   10078 O  OE1  . GLU A 1 62 ? 11.272  -4.063  3.627   1.00 0.00 ? 62  GLU A OE1  10 
ATOM   10079 O  OE2  . GLU A 1 62 ? 12.904  -2.596  3.516   1.00 0.00 ? 62  GLU A OE2  10 
ATOM   10080 H  H    . GLU A 1 62 ? 13.028  -1.881  -0.399  1.00 0.00 ? 62  GLU A H    10 
ATOM   10081 H  HA   . GLU A 1 62 ? 14.549  -3.712  1.151   1.00 0.00 ? 62  GLU A HA   10 
ATOM   10082 H  HB2  . GLU A 1 62 ? 11.940  -4.326  -0.227  1.00 0.00 ? 62  GLU A HB2  10 
ATOM   10083 H  HB3  . GLU A 1 62 ? 12.581  -5.043  1.244   1.00 0.00 ? 62  GLU A HB3  10 
ATOM   10084 H  HG2  . GLU A 1 62 ? 12.064  -2.118  1.205   1.00 0.00 ? 62  GLU A HG2  10 
ATOM   10085 H  HG3  . GLU A 1 62 ? 10.692  -3.220  1.310   1.00 0.00 ? 62  GLU A HG3  10 
ATOM   10086 N  N    . LYS A 1 63 ? 13.783  -4.734  -1.901  1.00 0.00 ? 63  LYS A N    10 
ATOM   10087 C  CA   . LYS A 1 63 ? 14.217  -5.598  -2.992  1.00 0.00 ? 63  LYS A CA   10 
ATOM   10088 C  C    . LYS A 1 63 ? 15.689  -5.365  -3.318  1.00 0.00 ? 63  LYS A C    10 
ATOM   10089 O  O    . LYS A 1 63 ? 16.388  -6.275  -3.761  1.00 0.00 ? 63  LYS A O    10 
ATOM   10090 C  CB   . LYS A 1 63 ? 13.363  -5.351  -4.237  1.00 0.00 ? 63  LYS A CB   10 
ATOM   10091 C  CG   . LYS A 1 63 ? 13.404  -3.914  -4.728  1.00 0.00 ? 63  LYS A CG   10 
ATOM   10092 C  CD   . LYS A 1 63 ? 14.486  -3.714  -5.776  1.00 0.00 ? 63  LYS A CD   10 
ATOM   10093 C  CE   . LYS A 1 63 ? 14.101  -4.349  -7.103  1.00 0.00 ? 63  LYS A CE   10 
ATOM   10094 N  NZ   . LYS A 1 63 ? 15.222  -4.309  -8.083  1.00 0.00 ? 63  LYS A NZ   10 
ATOM   10095 H  H    . LYS A 1 63 ? 12.951  -4.223  -1.999  1.00 0.00 ? 63  LYS A H    10 
ATOM   10096 H  HA   . LYS A 1 63 ? 14.089  -6.622  -2.675  1.00 0.00 ? 63  LYS A HA   10 
ATOM   10097 H  HB2  . LYS A 1 63 ? 13.714  -5.992  -5.033  1.00 0.00 ? 63  LYS A HB2  10 
ATOM   10098 H  HB3  . LYS A 1 63 ? 12.336  -5.603  -4.011  1.00 0.00 ? 63  LYS A HB3  10 
ATOM   10099 H  HG2  . LYS A 1 63 ? 12.447  -3.664  -5.162  1.00 0.00 ? 63  LYS A HG2  10 
ATOM   10100 H  HG3  . LYS A 1 63 ? 13.602  -3.263  -3.889  1.00 0.00 ? 63  LYS A HG3  10 
ATOM   10101 H  HD2  . LYS A 1 63 ? 14.636  -2.655  -5.927  1.00 0.00 ? 63  LYS A HD2  10 
ATOM   10102 H  HD3  . LYS A 1 63 ? 15.403  -4.163  -5.424  1.00 0.00 ? 63  LYS A HD3  10 
ATOM   10103 H  HE2  . LYS A 1 63 ? 13.824  -5.378  -6.928  1.00 0.00 ? 63  LYS A HE2  10 
ATOM   10104 H  HE3  . LYS A 1 63 ? 13.257  -3.814  -7.512  1.00 0.00 ? 63  LYS A HE3  10 
ATOM   10105 H  HZ1  . LYS A 1 63 ? 15.248  -3.384  -8.558  1.00 0.00 ? 63  LYS A HZ1  10 
ATOM   10106 H  HZ2  . LYS A 1 63 ? 15.096  -5.051  -8.801  1.00 0.00 ? 63  LYS A HZ2  10 
ATOM   10107 H  HZ3  . LYS A 1 63 ? 16.128  -4.463  -7.596  1.00 0.00 ? 63  LYS A HZ3  10 
ATOM   10108 N  N    . ALA A 1 64 ? 16.153  -4.139  -3.095  1.00 0.00 ? 64  ALA A N    10 
ATOM   10109 C  CA   . ALA A 1 64 ? 17.542  -3.788  -3.362  1.00 0.00 ? 64  ALA A CA   10 
ATOM   10110 C  C    . ALA A 1 64 ? 18.479  -4.931  -2.988  1.00 0.00 ? 64  ALA A C    10 
ATOM   10111 O  O    . ALA A 1 64 ? 19.226  -5.434  -3.827  1.00 0.00 ? 64  ALA A O    10 
ATOM   10112 C  CB   . ALA A 1 64 ? 17.921  -2.523  -2.606  1.00 0.00 ? 64  ALA A CB   10 
ATOM   10113 H  H    . ALA A 1 64 ? 15.546  -3.456  -2.741  1.00 0.00 ? 64  ALA A H    10 
ATOM   10114 H  HA   . ALA A 1 64 ? 17.638  -3.588  -4.420  1.00 0.00 ? 64  ALA A HA   10 
ATOM   10115 H  HB1  . ALA A 1 64 ? 17.065  -1.867  -2.552  1.00 0.00 ? 64  ALA A HB1  10 
ATOM   10116 H  HB2  . ALA A 1 64 ? 18.239  -2.783  -1.607  1.00 0.00 ? 64  ALA A HB2  10 
ATOM   10117 H  HB3  . ALA A 1 64 ? 18.726  -2.023  -3.122  1.00 0.00 ? 64  ALA A HB3  10 
ATOM   10118 N  N    . SER A 1 65 ? 18.434  -5.337  -1.723  1.00 0.00 ? 65  SER A N    10 
ATOM   10119 C  CA   . SER A 1 65 ? 19.283  -6.419  -1.237  1.00 0.00 ? 65  SER A CA   10 
ATOM   10120 C  C    . SER A 1 65 ? 18.510  -7.733  -1.182  1.00 0.00 ? 65  SER A C    10 
ATOM   10121 O  O    . SER A 1 65 ? 17.362  -7.773  -0.742  1.00 0.00 ? 65  SER A O    10 
ATOM   10122 C  CB   . SER A 1 65 ? 19.834  -6.080  0.150   1.00 0.00 ? 65  SER A CB   10 
ATOM   10123 O  OG   . SER A 1 65 ? 20.491  -4.824  0.144   1.00 0.00 ? 65  SER A OG   10 
ATOM   10124 H  H    . SER A 1 65 ? 17.817  -4.897  -1.102  1.00 0.00 ? 65  SER A H    10 
ATOM   10125 H  HA   . SER A 1 65 ? 20.108  -6.528  -1.926  1.00 0.00 ? 65  SER A HA   10 
ATOM   10126 H  HB2  . SER A 1 65 ? 19.020  -6.044  0.858   1.00 0.00 ? 65  SER A HB2  10 
ATOM   10127 H  HB3  . SER A 1 65 ? 20.539  -6.841  0.450   1.00 0.00 ? 65  SER A HB3  10 
ATOM   10128 H  HG   . SER A 1 65 ? 21.410  -4.944  -0.106  1.00 0.00 ? 65  SER A HG   10 
ATOM   10129 N  N    . GLY A 1 66 ? 19.150  -8.808  -1.633  1.00 0.00 ? 66  GLY A N    10 
ATOM   10130 C  CA   . GLY A 1 66 ? 18.508  -10.110 -1.628  1.00 0.00 ? 66  GLY A CA   10 
ATOM   10131 C  C    . GLY A 1 66 ? 19.415  -11.201 -1.093  1.00 0.00 ? 66  GLY A C    10 
ATOM   10132 O  O    . GLY A 1 66 ? 20.641  -11.108 -1.162  1.00 0.00 ? 66  GLY A O    10 
ATOM   10133 H  H    . GLY A 1 66 ? 20.065  -8.716  -1.973  1.00 0.00 ? 66  GLY A H    10 
ATOM   10134 H  HA2  . GLY A 1 66 ? 17.622  -10.060 -1.013  1.00 0.00 ? 66  GLY A HA2  10 
ATOM   10135 H  HA3  . GLY A 1 66 ? 18.220  -10.361 -2.638  1.00 0.00 ? 66  GLY A HA3  10 
ATOM   10136 N  N    . PRO A 1 67 ? 18.809  -12.264 -0.544  1.00 0.00 ? 67  PRO A N    10 
ATOM   10137 C  CA   . PRO A 1 67 ? 19.551  -13.397 0.016   1.00 0.00 ? 67  PRO A CA   10 
ATOM   10138 C  C    . PRO A 1 67 ? 20.244  -14.225 -1.061  1.00 0.00 ? 67  PRO A C    10 
ATOM   10139 O  O    . PRO A 1 67 ? 19.589  -14.841 -1.901  1.00 0.00 ? 67  PRO A O    10 
ATOM   10140 C  CB   . PRO A 1 67 ? 18.466  -14.223 0.711   1.00 0.00 ? 67  PRO A CB   10 
ATOM   10141 C  CG   . PRO A 1 67 ? 17.208  -13.878 -0.009  1.00 0.00 ? 67  PRO A CG   10 
ATOM   10142 C  CD   . PRO A 1 67 ? 17.352  -12.441 -0.428  1.00 0.00 ? 67  PRO A CD   10 
ATOM   10143 H  HA   . PRO A 1 67 ? 20.280  -13.072 0.744   1.00 0.00 ? 67  PRO A HA   10 
ATOM   10144 H  HB2  . PRO A 1 67 ? 18.698  -15.275 0.621   1.00 0.00 ? 67  PRO A HB2  10 
ATOM   10145 H  HB3  . PRO A 1 67 ? 18.412  -13.948 1.754   1.00 0.00 ? 67  PRO A HB3  10 
ATOM   10146 H  HG2  . PRO A 1 67 ? 17.095  -14.512 -0.875  1.00 0.00 ? 67  PRO A HG2  10 
ATOM   10147 H  HG3  . PRO A 1 67 ? 16.363  -13.992 0.654   1.00 0.00 ? 67  PRO A HG3  10 
ATOM   10148 H  HD2  . PRO A 1 67 ? 16.866  -12.275 -1.379  1.00 0.00 ? 67  PRO A HD2  10 
ATOM   10149 H  HD3  . PRO A 1 67 ? 16.943  -11.785 0.326   1.00 0.00 ? 67  PRO A HD3  10 
ATOM   10150 N  N    . SER A 1 68 ? 21.573  -14.235 -1.029  1.00 0.00 ? 68  SER A N    10 
ATOM   10151 C  CA   . SER A 1 68 ? 22.354  -14.986 -2.005  1.00 0.00 ? 68  SER A CA   10 
ATOM   10152 C  C    . SER A 1 68 ? 23.473  -15.766 -1.321  1.00 0.00 ? 68  SER A C    10 
ATOM   10153 O  O    . SER A 1 68 ? 24.308  -15.191 -0.622  1.00 0.00 ? 68  SER A O    10 
ATOM   10154 C  CB   . SER A 1 68 ? 22.944  -14.040 -3.053  1.00 0.00 ? 68  SER A CB   10 
ATOM   10155 O  OG   . SER A 1 68 ? 21.997  -13.745 -4.065  1.00 0.00 ? 68  SER A OG   10 
ATOM   10156 H  H    . SER A 1 68 ? 22.038  -13.723 -0.335  1.00 0.00 ? 68  SER A H    10 
ATOM   10157 H  HA   . SER A 1 68 ? 21.692  -15.684 -2.494  1.00 0.00 ? 68  SER A HA   10 
ATOM   10158 H  HB2  . SER A 1 68 ? 23.242  -13.119 -2.577  1.00 0.00 ? 68  SER A HB2  10 
ATOM   10159 H  HB3  . SER A 1 68 ? 23.807  -14.505 -3.509  1.00 0.00 ? 68  SER A HB3  10 
ATOM   10160 H  HG   . SER A 1 68 ? 21.648  -14.564 -4.426  1.00 0.00 ? 68  SER A HG   10 
ATOM   10161 N  N    . SER A 1 69 ? 23.482  -17.079 -1.527  1.00 0.00 ? 69  SER A N    10 
ATOM   10162 C  CA   . SER A 1 69 ? 24.495  -17.940 -0.928  1.00 0.00 ? 69  SER A CA   10 
ATOM   10163 C  C    . SER A 1 69 ? 25.885  -17.332 -1.082  1.00 0.00 ? 69  SER A C    10 
ATOM   10164 O  O    . SER A 1 69 ? 26.486  -17.391 -2.155  1.00 0.00 ? 69  SER A O    10 
ATOM   10165 C  CB   . SER A 1 69 ? 24.459  -19.328 -1.570  1.00 0.00 ? 69  SER A CB   10 
ATOM   10166 O  OG   . SER A 1 69 ? 25.415  -20.189 -0.976  1.00 0.00 ? 69  SER A OG   10 
ATOM   10167 H  H    . SER A 1 69 ? 22.789  -17.478 -2.095  1.00 0.00 ? 69  SER A H    10 
ATOM   10168 H  HA   . SER A 1 69 ? 24.270  -18.033 0.124   1.00 0.00 ? 69  SER A HA   10 
ATOM   10169 H  HB2  . SER A 1 69 ? 23.477  -19.756 -1.440  1.00 0.00 ? 69  SER A HB2  10 
ATOM   10170 H  HB3  . SER A 1 69 ? 24.677  -19.240 -2.624  1.00 0.00 ? 69  SER A HB3  10 
ATOM   10171 H  HG   . SER A 1 69 ? 25.375  -21.051 -1.397  1.00 0.00 ? 69  SER A HG   10 
ATOM   10172 N  N    . GLY A 1 70 ? 26.392  -16.746 -0.001  1.00 0.00 ? 70  GLY A N    10 
ATOM   10173 C  CA   . GLY A 1 70 ? 27.708  -16.135 -0.036  1.00 0.00 ? 70  GLY A CA   10 
ATOM   10174 C  C    . GLY A 1 70 ? 27.740  -14.788 0.657   1.00 0.00 ? 70  GLY A C    10 
ATOM   10175 O  O    . GLY A 1 70 ? 28.315  -13.847 0.112   1.00 0.00 ? 70  GLY A O    10 
ATOM   10176 H  H    . GLY A 1 70 ? 25.868  -16.729 0.827   1.00 0.00 ? 70  GLY A H    10 
ATOM   10177 H  HA2  . GLY A 1 70 ? 28.412  -16.795 0.448   1.00 0.00 ? 70  GLY A HA2  10 
ATOM   10178 H  HA3  . GLY A 1 70 ? 28.003  -16.003 -1.067  1.00 0.00 ? 70  GLY A HA3  10 
HETATM 10179 ZN ZN   . ZN  B 2 .  ? -11.229 4.381   2.402   1.00 0.00 ? 201 ZN  A ZN   10 
HETATM 10180 ZN ZN   . ZN  C 2 .  ? 6.554   3.597   0.524   1.00 0.00 ? 401 ZN  A ZN   10 
ATOM   10181 N  N    . GLY A 1 1  ? -24.152 -16.683 -4.856  1.00 0.00 ? 1   GLY A N    11 
ATOM   10182 C  CA   . GLY A 1 1  ? -24.643 -15.317 -4.888  1.00 0.00 ? 1   GLY A CA   11 
ATOM   10183 C  C    . GLY A 1 1  ? -23.641 -14.355 -5.493  1.00 0.00 ? 1   GLY A C    11 
ATOM   10184 O  O    . GLY A 1 1  ? -22.575 -14.765 -5.953  1.00 0.00 ? 1   GLY A O    11 
ATOM   10185 H  H1   . GLY A 1 1  ? -23.311 -16.888 -4.397  1.00 0.00 ? 1   GLY A H1   11 
ATOM   10186 H  HA2  . GLY A 1 1  ? -25.553 -15.287 -5.469  1.00 0.00 ? 1   GLY A HA2  11 
ATOM   10187 H  HA3  . GLY A 1 1  ? -24.862 -15.002 -3.878  1.00 0.00 ? 1   GLY A HA3  11 
ATOM   10188 N  N    . SER A 1 2  ? -23.983 -13.070 -5.496  1.00 0.00 ? 2   SER A N    11 
ATOM   10189 C  CA   . SER A 1 2  ? -23.107 -12.047 -6.055  1.00 0.00 ? 2   SER A CA   11 
ATOM   10190 C  C    . SER A 1 2  ? -23.419 -10.679 -5.455  1.00 0.00 ? 2   SER A C    11 
ATOM   10191 O  O    . SER A 1 2  ? -24.575 -10.258 -5.409  1.00 0.00 ? 2   SER A O    11 
ATOM   10192 C  CB   . SER A 1 2  ? -23.255 -11.995 -7.576  1.00 0.00 ? 2   SER A CB   11 
ATOM   10193 O  OG   . SER A 1 2  ? -22.339 -11.077 -8.147  1.00 0.00 ? 2   SER A OG   11 
ATOM   10194 H  H    . SER A 1 2  ? -24.846 -12.805 -5.114  1.00 0.00 ? 2   SER A H    11 
ATOM   10195 H  HA   . SER A 1 2  ? -22.090 -12.311 -5.809  1.00 0.00 ? 2   SER A HA   11 
ATOM   10196 H  HB2  . SER A 1 2  ? -23.067 -12.975 -7.987  1.00 0.00 ? 2   SER A HB2  11 
ATOM   10197 H  HB3  . SER A 1 2  ? -24.260 -11.686 -7.827  1.00 0.00 ? 2   SER A HB3  11 
ATOM   10198 H  HG   . SER A 1 2  ? -21.767 -11.537 -8.765  1.00 0.00 ? 2   SER A HG   11 
ATOM   10199 N  N    . SER A 1 3  ? -22.379 -9.990  -4.997  1.00 0.00 ? 3   SER A N    11 
ATOM   10200 C  CA   . SER A 1 3  ? -22.540 -8.671  -4.397  1.00 0.00 ? 3   SER A CA   11 
ATOM   10201 C  C    . SER A 1 3  ? -22.188 -7.573  -5.395  1.00 0.00 ? 3   SER A C    11 
ATOM   10202 O  O    . SER A 1 3  ? -21.120 -7.591  -6.004  1.00 0.00 ? 3   SER A O    11 
ATOM   10203 C  CB   . SER A 1 3  ? -21.662 -8.544  -3.150  1.00 0.00 ? 3   SER A CB   11 
ATOM   10204 O  OG   . SER A 1 3  ? -22.149 -7.533  -2.284  1.00 0.00 ? 3   SER A OG   11 
ATOM   10205 H  H    . SER A 1 3  ? -21.482 -10.379 -5.062  1.00 0.00 ? 3   SER A H    11 
ATOM   10206 H  HA   . SER A 1 3  ? -23.575 -8.562  -4.109  1.00 0.00 ? 3   SER A HA   11 
ATOM   10207 H  HB2  . SER A 1 3  ? -21.656 -9.483  -2.620  1.00 0.00 ? 3   SER A HB2  11 
ATOM   10208 H  HB3  . SER A 1 3  ? -20.654 -8.291  -3.448  1.00 0.00 ? 3   SER A HB3  11 
ATOM   10209 H  HG   . SER A 1 3  ? -22.099 -7.839  -1.376  1.00 0.00 ? 3   SER A HG   11 
ATOM   10210 N  N    . GLY A 1 4  ? -23.097 -6.615  -5.558  1.00 0.00 ? 4   GLY A N    11 
ATOM   10211 C  CA   . GLY A 1 4  ? -22.865 -5.522  -6.483  1.00 0.00 ? 4   GLY A CA   11 
ATOM   10212 C  C    . GLY A 1 4  ? -22.645 -4.200  -5.775  1.00 0.00 ? 4   GLY A C    11 
ATOM   10213 O  O    . GLY A 1 4  ? -23.418 -3.258  -5.950  1.00 0.00 ? 4   GLY A O    11 
ATOM   10214 H  H    . GLY A 1 4  ? -23.931 -6.652  -5.045  1.00 0.00 ? 4   GLY A H    11 
ATOM   10215 H  HA2  . GLY A 1 4  ? -21.994 -5.748  -7.080  1.00 0.00 ? 4   GLY A HA2  11 
ATOM   10216 H  HA3  . GLY A 1 4  ? -23.722 -5.429  -7.135  1.00 0.00 ? 4   GLY A HA3  11 
ATOM   10217 N  N    . SER A 1 5  ? -21.588 -4.129  -4.972  1.00 0.00 ? 5   SER A N    11 
ATOM   10218 C  CA   . SER A 1 5  ? -21.272 -2.914  -4.230  1.00 0.00 ? 5   SER A CA   11 
ATOM   10219 C  C    . SER A 1 5  ? -19.769 -2.797  -3.996  1.00 0.00 ? 5   SER A C    11 
ATOM   10220 O  O    . SER A 1 5  ? -19.176 -3.603  -3.278  1.00 0.00 ? 5   SER A O    11 
ATOM   10221 C  CB   . SER A 1 5  ? -22.010 -2.902  -2.890  1.00 0.00 ? 5   SER A CB   11 
ATOM   10222 O  OG   . SER A 1 5  ? -23.396 -2.667  -3.074  1.00 0.00 ? 5   SER A OG   11 
ATOM   10223 H  H    . SER A 1 5  ? -21.009 -4.914  -4.874  1.00 0.00 ? 5   SER A H    11 
ATOM   10224 H  HA   . SER A 1 5  ? -21.599 -2.071  -4.820  1.00 0.00 ? 5   SER A HA   11 
ATOM   10225 H  HB2  . SER A 1 5  ? -21.882 -3.856  -2.403  1.00 0.00 ? 5   SER A HB2  11 
ATOM   10226 H  HB3  . SER A 1 5  ? -21.604 -2.120  -2.265  1.00 0.00 ? 5   SER A HB3  11 
ATOM   10227 H  HG   . SER A 1 5  ? -23.579 -1.731  -2.962  1.00 0.00 ? 5   SER A HG   11 
ATOM   10228 N  N    . SER A 1 6  ? -19.158 -1.787  -4.607  1.00 0.00 ? 6   SER A N    11 
ATOM   10229 C  CA   . SER A 1 6  ? -17.723 -1.565  -4.470  1.00 0.00 ? 6   SER A CA   11 
ATOM   10230 C  C    . SER A 1 6  ? -17.426 -0.654  -3.283  1.00 0.00 ? 6   SER A C    11 
ATOM   10231 O  O    . SER A 1 6  ? -17.638 0.556   -3.346  1.00 0.00 ? 6   SER A O    11 
ATOM   10232 C  CB   . SER A 1 6  ? -17.155 -0.953  -5.752  1.00 0.00 ? 6   SER A CB   11 
ATOM   10233 O  OG   . SER A 1 6  ? -17.890 0.196   -6.138  1.00 0.00 ? 6   SER A OG   11 
ATOM   10234 H  H    . SER A 1 6  ? -19.685 -1.178  -5.167  1.00 0.00 ? 6   SER A H    11 
ATOM   10235 H  HA   . SER A 1 6  ? -17.255 -2.523  -4.300  1.00 0.00 ? 6   SER A HA   11 
ATOM   10236 H  HB2  . SER A 1 6  ? -16.127 -0.669  -5.587  1.00 0.00 ? 6   SER A HB2  11 
ATOM   10237 H  HB3  . SER A 1 6  ? -17.205 -1.682  -6.548  1.00 0.00 ? 6   SER A HB3  11 
ATOM   10238 H  HG   . SER A 1 6  ? -17.389 0.985   -5.919  1.00 0.00 ? 6   SER A HG   11 
ATOM   10239 N  N    . GLY A 1 7  ? -16.933 -1.246  -2.199  1.00 0.00 ? 7   GLY A N    11 
ATOM   10240 C  CA   . GLY A 1 7  ? -16.615 -0.474  -1.012  1.00 0.00 ? 7   GLY A CA   11 
ATOM   10241 C  C    . GLY A 1 7  ? -15.159 -0.602  -0.610  1.00 0.00 ? 7   GLY A C    11 
ATOM   10242 O  O    . GLY A 1 7  ? -14.561 -1.670  -0.748  1.00 0.00 ? 7   GLY A O    11 
ATOM   10243 H  H    . GLY A 1 7  ? -16.785 -2.215  -2.205  1.00 0.00 ? 7   GLY A H    11 
ATOM   10244 H  HA2  . GLY A 1 7  ? -16.834 0.566   -1.202  1.00 0.00 ? 7   GLY A HA2  11 
ATOM   10245 H  HA3  . GLY A 1 7  ? -17.233 -0.818  -0.196  1.00 0.00 ? 7   GLY A HA3  11 
ATOM   10246 N  N    . CYS A 1 8  ? -14.585 0.488   -0.113  1.00 0.00 ? 8   CYS A N    11 
ATOM   10247 C  CA   . CYS A 1 8  ? -13.190 0.495   0.309   1.00 0.00 ? 8   CYS A CA   11 
ATOM   10248 C  C    . CYS A 1 8  ? -12.959 -0.502  1.441   1.00 0.00 ? 8   CYS A C    11 
ATOM   10249 O  O    . CYS A 1 8  ? -13.828 -0.707  2.289   1.00 0.00 ? 8   CYS A O    11 
ATOM   10250 C  CB   . CYS A 1 8  ? -12.777 1.898   0.758   1.00 0.00 ? 8   CYS A CB   11 
ATOM   10251 S  SG   . CYS A 1 8  ? -11.214 1.950   1.691   1.00 0.00 ? 8   CYS A SG   11 
ATOM   10252 H  H    . CYS A 1 8  ? -15.114 1.310   -0.027  1.00 0.00 ? 8   CYS A H    11 
ATOM   10253 H  HA   . CYS A 1 8  ? -12.586 0.205   -0.538  1.00 0.00 ? 8   CYS A HA   11 
ATOM   10254 H  HB2  . CYS A 1 8  ? -12.660 2.526   -0.113  1.00 0.00 ? 8   CYS A HB2  11 
ATOM   10255 H  HB3  . CYS A 1 8  ? -13.552 2.308   1.389   1.00 0.00 ? 8   CYS A HB3  11 
ATOM   10256 N  N    . HIS A 1 9  ? -11.781 -1.119  1.448   1.00 0.00 ? 9   HIS A N    11 
ATOM   10257 C  CA   . HIS A 1 9  ? -11.435 -2.094  2.476   1.00 0.00 ? 9   HIS A CA   11 
ATOM   10258 C  C    . HIS A 1 9  ? -10.690 -1.427  3.628   1.00 0.00 ? 9   HIS A C    11 
ATOM   10259 O  O    . HIS A 1 9  ? -10.913 -1.751  4.794   1.00 0.00 ? 9   HIS A O    11 
ATOM   10260 C  CB   . HIS A 1 9  ? -10.580 -3.213  1.880   1.00 0.00 ? 9   HIS A CB   11 
ATOM   10261 C  CG   . HIS A 1 9  ? -10.306 -4.332  2.838   1.00 0.00 ? 9   HIS A CG   11 
ATOM   10262 N  ND1  . HIS A 1 9  ? -11.303 -5.013  3.504   1.00 0.00 ? 9   HIS A ND1  11 
ATOM   10263 C  CD2  . HIS A 1 9  ? -9.139  -4.888  3.238   1.00 0.00 ? 9   HIS A CD2  11 
ATOM   10264 C  CE1  . HIS A 1 9  ? -10.760 -5.939  4.274   1.00 0.00 ? 9   HIS A CE1  11 
ATOM   10265 N  NE2  . HIS A 1 9  ? -9.449  -5.885  4.131   1.00 0.00 ? 9   HIS A NE2  11 
ATOM   10266 H  H    . HIS A 1 9  ? -11.130 -0.913  0.745   1.00 0.00 ? 9   HIS A H    11 
ATOM   10267 H  HA   . HIS A 1 9  ? -12.353 -2.517  2.855   1.00 0.00 ? 9   HIS A HA   11 
ATOM   10268 H  HB2  . HIS A 1 9  ? -11.089 -3.628  1.023   1.00 0.00 ? 9   HIS A HB2  11 
ATOM   10269 H  HB3  . HIS A 1 9  ? -9.631  -2.804  1.566   1.00 0.00 ? 9   HIS A HB3  11 
ATOM   10270 H  HD1  . HIS A 1 9  ? -12.264 -4.842  3.426   1.00 0.00 ? 9   HIS A HD1  11 
ATOM   10271 H  HD2  . HIS A 1 9  ? -8.148  -4.602  2.916   1.00 0.00 ? 9   HIS A HD2  11 
ATOM   10272 H  HE1  . HIS A 1 9  ? -11.297 -6.625  4.912   1.00 0.00 ? 9   HIS A HE1  11 
ATOM   10273 H  HE2  . HIS A 1 9  ? -8.802  -6.404  4.652   1.00 0.00 ? 9   HIS A HE2  11 
ATOM   10274 N  N    . GLN A 1 10 ? -9.804  -0.495  3.293   1.00 0.00 ? 10  GLN A N    11 
ATOM   10275 C  CA   . GLN A 1 10 ? -9.025  0.216   4.300   1.00 0.00 ? 10  GLN A CA   11 
ATOM   10276 C  C    . GLN A 1 10 ? -9.917  0.690   5.443   1.00 0.00 ? 10  GLN A C    11 
ATOM   10277 O  O    . GLN A 1 10 ? -9.798  0.216   6.574   1.00 0.00 ? 10  GLN A O    11 
ATOM   10278 C  CB   . GLN A 1 10 ? -8.306  1.410   3.670   1.00 0.00 ? 10  GLN A CB   11 
ATOM   10279 C  CG   . GLN A 1 10 ? -7.590  2.292   4.681   1.00 0.00 ? 10  GLN A CG   11 
ATOM   10280 C  CD   . GLN A 1 10 ? -6.328  1.652   5.223   1.00 0.00 ? 10  GLN A CD   11 
ATOM   10281 O  OE1  . GLN A 1 10 ? -5.730  0.788   4.581   1.00 0.00 ? 10  GLN A OE1  11 
ATOM   10282 N  NE2  . GLN A 1 10 ? -5.915  2.073   6.413   1.00 0.00 ? 10  GLN A NE2  11 
ATOM   10283 H  H    . GLN A 1 10 ? -9.670  -0.281  2.346   1.00 0.00 ? 10  GLN A H    11 
ATOM   10284 H  HA   . GLN A 1 10 ? -8.289  -0.469  4.694   1.00 0.00 ? 10  GLN A HA   11 
ATOM   10285 H  HB2  . GLN A 1 10 ? -7.576  1.044   2.963   1.00 0.00 ? 10  GLN A HB2  11 
ATOM   10286 H  HB3  . GLN A 1 10 ? -9.030  2.016   3.146   1.00 0.00 ? 10  GLN A HB3  11 
ATOM   10287 H  HG2  . GLN A 1 10 ? -7.326  3.224   4.203   1.00 0.00 ? 10  GLN A HG2  11 
ATOM   10288 H  HG3  . GLN A 1 10 ? -8.260  2.489   5.505   1.00 0.00 ? 10  GLN A HG3  11 
ATOM   10289 H  HE21 . GLN A 1 10 ? -6.443  2.763   6.868   1.00 0.00 ? 10  GLN A HE21 11 
ATOM   10290 H  HE22 . GLN A 1 10 ? -5.103  1.675   6.788   1.00 0.00 ? 10  GLN A HE22 11 
ATOM   10291 N  N    . CYS A 1 11 ? -10.809 1.627   5.141   1.00 0.00 ? 11  CYS A N    11 
ATOM   10292 C  CA   . CYS A 1 11 ? -11.720 2.166   6.143   1.00 0.00 ? 11  CYS A CA   11 
ATOM   10293 C  C    . CYS A 1 11 ? -13.037 1.396   6.151   1.00 0.00 ? 11  CYS A C    11 
ATOM   10294 O  O    . CYS A 1 11 ? -13.569 1.065   7.210   1.00 0.00 ? 11  CYS A O    11 
ATOM   10295 C  CB   . CYS A 1 11 ? -11.986 3.649   5.876   1.00 0.00 ? 11  CYS A CB   11 
ATOM   10296 S  SG   . CYS A 1 11 ? -12.788 3.984   4.274   1.00 0.00 ? 11  CYS A SG   11 
ATOM   10297 H  H    . CYS A 1 11 ? -10.855 1.965   4.222   1.00 0.00 ? 11  CYS A H    11 
ATOM   10298 H  HA   . CYS A 1 11 ? -11.251 2.062   7.109   1.00 0.00 ? 11  CYS A HA   11 
ATOM   10299 H  HB2  . CYS A 1 11 ? -12.630 4.037   6.652   1.00 0.00 ? 11  CYS A HB2  11 
ATOM   10300 H  HB3  . CYS A 1 11 ? -11.048 4.184   5.893   1.00 0.00 ? 11  CYS A HB3  11 
ATOM   10301 N  N    . GLY A 1 12 ? -13.559 1.113   4.961   1.00 0.00 ? 12  GLY A N    11 
ATOM   10302 C  CA   . GLY A 1 12 ? -14.808 0.383   4.853   1.00 0.00 ? 12  GLY A CA   11 
ATOM   10303 C  C    . GLY A 1 12 ? -15.879 1.172   4.125   1.00 0.00 ? 12  GLY A C    11 
ATOM   10304 O  O    . GLY A 1 12 ? -16.646 0.612   3.342   1.00 0.00 ? 12  GLY A O    11 
ATOM   10305 H  H    . GLY A 1 12 ? -13.090 1.402   4.150   1.00 0.00 ? 12  GLY A H    11 
ATOM   10306 H  HA2  . GLY A 1 12 ? -14.629 -0.539  4.319   1.00 0.00 ? 12  GLY A HA2  11 
ATOM   10307 H  HA3  . GLY A 1 12 ? -15.163 0.150   5.846   1.00 0.00 ? 12  GLY A HA3  11 
ATOM   10308 N  N    . GLU A 1 13 ? -15.931 2.474   4.384   1.00 0.00 ? 13  GLU A N    11 
ATOM   10309 C  CA   . GLU A 1 13 ? -16.918 3.340   3.749   1.00 0.00 ? 13  GLU A CA   11 
ATOM   10310 C  C    . GLU A 1 13 ? -17.030 3.035   2.258   1.00 0.00 ? 13  GLU A C    11 
ATOM   10311 O  O    . GLU A 1 13 ? -16.071 2.582   1.632   1.00 0.00 ? 13  GLU A O    11 
ATOM   10312 C  CB   . GLU A 1 13 ? -16.547 4.810   3.954   1.00 0.00 ? 13  GLU A CB   11 
ATOM   10313 C  CG   . GLU A 1 13 ? -16.395 5.202   5.414   1.00 0.00 ? 13  GLU A CG   11 
ATOM   10314 C  CD   . GLU A 1 13 ? -17.726 5.296   6.134   1.00 0.00 ? 13  GLU A CD   11 
ATOM   10315 O  OE1  . GLU A 1 13 ? -18.639 5.967   5.608   1.00 0.00 ? 13  GLU A OE1  11 
ATOM   10316 O  OE2  . GLU A 1 13 ? -17.856 4.699   7.223   1.00 0.00 ? 13  GLU A OE2  11 
ATOM   10317 H  H    . GLU A 1 13 ? -15.292 2.862   5.017   1.00 0.00 ? 13  GLU A H    11 
ATOM   10318 H  HA   . GLU A 1 13 ? -17.874 3.151   4.215   1.00 0.00 ? 13  GLU A HA   11 
ATOM   10319 H  HB2  . GLU A 1 13 ? -15.612 5.006   3.450   1.00 0.00 ? 13  GLU A HB2  11 
ATOM   10320 H  HB3  . GLU A 1 13 ? -17.317 5.427   3.516   1.00 0.00 ? 13  GLU A HB3  11 
ATOM   10321 H  HG2  . GLU A 1 13 ? -15.786 4.461   5.911   1.00 0.00 ? 13  GLU A HG2  11 
ATOM   10322 H  HG3  . GLU A 1 13 ? -15.905 6.163   5.467   1.00 0.00 ? 13  GLU A HG3  11 
ATOM   10323 N  N    . PHE A 1 14 ? -18.207 3.286   1.695   1.00 0.00 ? 14  PHE A N    11 
ATOM   10324 C  CA   . PHE A 1 14 ? -18.446 3.038   0.278   1.00 0.00 ? 14  PHE A CA   11 
ATOM   10325 C  C    . PHE A 1 14 ? -17.762 4.097   -0.583  1.00 0.00 ? 14  PHE A C    11 
ATOM   10326 O  O    . PHE A 1 14 ? -17.786 5.284   -0.259  1.00 0.00 ? 14  PHE A O    11 
ATOM   10327 C  CB   . PHE A 1 14 ? -19.948 3.019   -0.013  1.00 0.00 ? 14  PHE A CB   11 
ATOM   10328 C  CG   . PHE A 1 14 ? -20.301 2.329   -1.299  1.00 0.00 ? 14  PHE A CG   11 
ATOM   10329 C  CD1  . PHE A 1 14 ? -19.976 0.996   -1.497  1.00 0.00 ? 14  PHE A CD1  11 
ATOM   10330 C  CD2  . PHE A 1 14 ? -20.959 3.012   -2.309  1.00 0.00 ? 14  PHE A CD2  11 
ATOM   10331 C  CE1  . PHE A 1 14 ? -20.300 0.359   -2.680  1.00 0.00 ? 14  PHE A CE1  11 
ATOM   10332 C  CE2  . PHE A 1 14 ? -21.285 2.379   -3.494  1.00 0.00 ? 14  PHE A CE2  11 
ATOM   10333 C  CZ   . PHE A 1 14 ? -20.956 1.051   -3.679  1.00 0.00 ? 14  PHE A CZ   11 
ATOM   10334 H  H    . PHE A 1 14 ? -18.933 3.647   2.246   1.00 0.00 ? 14  PHE A H    11 
ATOM   10335 H  HA   . PHE A 1 14 ? -18.029 2.072   0.037   1.00 0.00 ? 14  PHE A HA   11 
ATOM   10336 H  HB2  . PHE A 1 14 ? -20.456 2.506   0.790   1.00 0.00 ? 14  PHE A HB2  11 
ATOM   10337 H  HB3  . PHE A 1 14 ? -20.308 4.035   -0.070  1.00 0.00 ? 14  PHE A HB3  11 
ATOM   10338 H  HD1  . PHE A 1 14 ? -19.464 0.454   -0.716  1.00 0.00 ? 14  PHE A HD1  11 
ATOM   10339 H  HD2  . PHE A 1 14 ? -21.217 4.052   -2.165  1.00 0.00 ? 14  PHE A HD2  11 
ATOM   10340 H  HE1  . PHE A 1 14 ? -20.042 -0.680  -2.822  1.00 0.00 ? 14  PHE A HE1  11 
ATOM   10341 H  HE2  . PHE A 1 14 ? -21.798 2.924   -4.273  1.00 0.00 ? 14  PHE A HE2  11 
ATOM   10342 H  HZ   . PHE A 1 14 ? -21.209 0.555   -4.604  1.00 0.00 ? 14  PHE A HZ   11 
ATOM   10343 N  N    . ILE A 1 15 ? -17.154 3.657   -1.679  1.00 0.00 ? 15  ILE A N    11 
ATOM   10344 C  CA   . ILE A 1 15 ? -16.465 4.566   -2.586  1.00 0.00 ? 15  ILE A CA   11 
ATOM   10345 C  C    . ILE A 1 15 ? -17.425 5.142   -3.622  1.00 0.00 ? 15  ILE A C    11 
ATOM   10346 O  O    . ILE A 1 15 ? -18.200 4.410   -4.239  1.00 0.00 ? 15  ILE A O    11 
ATOM   10347 C  CB   . ILE A 1 15 ? -15.304 3.863   -3.314  1.00 0.00 ? 15  ILE A CB   11 
ATOM   10348 C  CG1  . ILE A 1 15 ? -14.428 3.108   -2.311  1.00 0.00 ? 15  ILE A CG1  11 
ATOM   10349 C  CG2  . ILE A 1 15 ? -14.476 4.875   -4.092  1.00 0.00 ? 15  ILE A CG2  11 
ATOM   10350 C  CD1  . ILE A 1 15 ? -13.589 2.020   -2.943  1.00 0.00 ? 15  ILE A CD1  11 
ATOM   10351 H  H    . ILE A 1 15 ? -17.170 2.699   -1.883  1.00 0.00 ? 15  ILE A H    11 
ATOM   10352 H  HA   . ILE A 1 15 ? -16.058 5.377   -1.999  1.00 0.00 ? 15  ILE A HA   11 
ATOM   10353 H  HB   . ILE A 1 15 ? -15.723 3.159   -4.017  1.00 0.00 ? 15  ILE A HB   11 
ATOM   10354 H  HG12 . ILE A 1 15 ? -13.760 3.805   -1.831  1.00 0.00 ? 15  ILE A HG12 11 
ATOM   10355 H  HG13 . ILE A 1 15 ? -15.062 2.650   -1.566  1.00 0.00 ? 15  ILE A HG13 11 
ATOM   10356 H  HG21 . ILE A 1 15 ? -13.619 4.381   -4.526  1.00 0.00 ? 15  ILE A HG21 11 
ATOM   10357 H  HG22 . ILE A 1 15 ? -15.079 5.304   -4.878  1.00 0.00 ? 15  ILE A HG22 11 
ATOM   10358 H  HG23 . ILE A 1 15 ? -14.143 5.656   -3.426  1.00 0.00 ? 15  ILE A HG23 11 
ATOM   10359 H  HD11 . ILE A 1 15 ? -14.122 1.081   -2.897  1.00 0.00 ? 15  ILE A HD11 11 
ATOM   10360 H  HD12 . ILE A 1 15 ? -13.387 2.271   -3.973  1.00 0.00 ? 15  ILE A HD12 11 
ATOM   10361 H  HD13 . ILE A 1 15 ? -12.656 1.928   -2.405  1.00 0.00 ? 15  ILE A HD13 11 
ATOM   10362 N  N    . ILE A 1 16 ? -17.367 6.456   -3.809  1.00 0.00 ? 16  ILE A N    11 
ATOM   10363 C  CA   . ILE A 1 16 ? -18.230 7.129   -4.772  1.00 0.00 ? 16  ILE A CA   11 
ATOM   10364 C  C    . ILE A 1 16 ? -17.426 8.064   -5.670  1.00 0.00 ? 16  ILE A C    11 
ATOM   10365 O  O    . ILE A 1 16 ? -16.843 9.041   -5.202  1.00 0.00 ? 16  ILE A O    11 
ATOM   10366 C  CB   . ILE A 1 16 ? -19.337 7.936   -4.069  1.00 0.00 ? 16  ILE A CB   11 
ATOM   10367 C  CG1  . ILE A 1 16 ? -20.042 7.071   -3.022  1.00 0.00 ? 16  ILE A CG1  11 
ATOM   10368 C  CG2  . ILE A 1 16 ? -20.336 8.463   -5.088  1.00 0.00 ? 16  ILE A CG2  11 
ATOM   10369 C  CD1  . ILE A 1 16 ? -21.033 7.837   -2.174  1.00 0.00 ? 16  ILE A CD1  11 
ATOM   10370 H  H    . ILE A 1 16 ? -16.729 6.985   -3.287  1.00 0.00 ? 16  ILE A H    11 
ATOM   10371 H  HA   . ILE A 1 16 ? -18.697 6.372   -5.386  1.00 0.00 ? 16  ILE A HA   11 
ATOM   10372 H  HB   . ILE A 1 16 ? -18.879 8.781   -3.579  1.00 0.00 ? 16  ILE A HB   11 
ATOM   10373 H  HG12 . ILE A 1 16 ? -20.576 6.277   -3.520  1.00 0.00 ? 16  ILE A HG12 11 
ATOM   10374 H  HG13 . ILE A 1 16 ? -19.301 6.643   -2.362  1.00 0.00 ? 16  ILE A HG13 11 
ATOM   10375 H  HG21 . ILE A 1 16 ? -20.146 8.006   -6.048  1.00 0.00 ? 16  ILE A HG21 11 
ATOM   10376 H  HG22 . ILE A 1 16 ? -21.338 8.221   -4.767  1.00 0.00 ? 16  ILE A HG22 11 
ATOM   10377 H  HG23 . ILE A 1 16 ? -20.233 9.534   -5.173  1.00 0.00 ? 16  ILE A HG23 11 
ATOM   10378 H  HD11 . ILE A 1 16 ? -21.740 7.149   -1.736  1.00 0.00 ? 16  ILE A HD11 11 
ATOM   10379 H  HD12 . ILE A 1 16 ? -20.507 8.362   -1.391  1.00 0.00 ? 16  ILE A HD12 11 
ATOM   10380 H  HD13 . ILE A 1 16 ? -21.561 8.549   -2.792  1.00 0.00 ? 16  ILE A HD13 11 
ATOM   10381 N  N    . GLY A 1 17 ? -17.402 7.758   -6.963  1.00 0.00 ? 17  GLY A N    11 
ATOM   10382 C  CA   . GLY A 1 17 ? -16.669 8.582   -7.907  1.00 0.00 ? 17  GLY A CA   11 
ATOM   10383 C  C    . GLY A 1 17 ? -15.427 7.892   -8.436  1.00 0.00 ? 17  GLY A C    11 
ATOM   10384 O  O    . GLY A 1 17 ? -15.391 7.460   -9.588  1.00 0.00 ? 17  GLY A O    11 
ATOM   10385 H  H    . GLY A 1 17 ? -17.886 6.966   -7.280  1.00 0.00 ? 17  GLY A H    11 
ATOM   10386 H  HA2  . GLY A 1 17 ? -17.316 8.822   -8.737  1.00 0.00 ? 17  GLY A HA2  11 
ATOM   10387 H  HA3  . GLY A 1 17 ? -16.375 9.498   -7.415  1.00 0.00 ? 17  GLY A HA3  11 
ATOM   10388 N  N    . ARG A 1 18 ? -14.404 7.789   -7.593  1.00 0.00 ? 18  ARG A N    11 
ATOM   10389 C  CA   . ARG A 1 18 ? -13.154 7.150   -7.983  1.00 0.00 ? 18  ARG A CA   11 
ATOM   10390 C  C    . ARG A 1 18 ? -12.889 5.910   -7.134  1.00 0.00 ? 18  ARG A C    11 
ATOM   10391 O  O    . ARG A 1 18 ? -12.833 5.984   -5.907  1.00 0.00 ? 18  ARG A O    11 
ATOM   10392 C  CB   . ARG A 1 18 ? -11.989 8.133   -7.846  1.00 0.00 ? 18  ARG A CB   11 
ATOM   10393 C  CG   . ARG A 1 18 ? -10.626 7.461   -7.819  1.00 0.00 ? 18  ARG A CG   11 
ATOM   10394 C  CD   . ARG A 1 18 ? -9.536  8.393   -8.326  1.00 0.00 ? 18  ARG A CD   11 
ATOM   10395 N  NE   . ARG A 1 18 ? -8.351  7.662   -8.766  1.00 0.00 ? 18  ARG A NE   11 
ATOM   10396 C  CZ   . ARG A 1 18 ? -7.183  8.241   -9.022  1.00 0.00 ? 18  ARG A CZ   11 
ATOM   10397 N  NH1  . ARG A 1 18 ? -7.045  9.552   -8.884  1.00 0.00 ? 18  ARG A NH1  11 
ATOM   10398 N  NH2  . ARG A 1 18 ? -6.151  7.508   -9.419  1.00 0.00 ? 18  ARG A NH2  11 
ATOM   10399 H  H    . ARG A 1 18 ? -14.493 8.153   -6.687  1.00 0.00 ? 18  ARG A H    11 
ATOM   10400 H  HA   . ARG A 1 18 ? -13.242 6.852   -9.017  1.00 0.00 ? 18  ARG A HA   11 
ATOM   10401 H  HB2  . ARG A 1 18 ? -12.012 8.819   -8.679  1.00 0.00 ? 18  ARG A HB2  11 
ATOM   10402 H  HB3  . ARG A 1 18 ? -12.110 8.689   -6.928  1.00 0.00 ? 18  ARG A HB3  11 
ATOM   10403 H  HG2  . ARG A 1 18 ? -10.395 7.175   -6.804  1.00 0.00 ? 18  ARG A HG2  11 
ATOM   10404 H  HG3  . ARG A 1 18 ? -10.656 6.582   -8.446  1.00 0.00 ? 18  ARG A HG3  11 
ATOM   10405 H  HD2  . ARG A 1 18 ? -9.925  8.962   -9.157  1.00 0.00 ? 18  ARG A HD2  11 
ATOM   10406 H  HD3  . ARG A 1 18 ? -9.258  9.066   -7.529  1.00 0.00 ? 18  ARG A HD3  11 
ATOM   10407 H  HE   . ARG A 1 18 ? -8.431  6.692   -8.875  1.00 0.00 ? 18  ARG A HE   11 
ATOM   10408 H  HH11 . ARG A 1 18 ? -7.821  10.107  -8.585  1.00 0.00 ? 18  ARG A HH11 11 
ATOM   10409 H  HH12 . ARG A 1 18 ? -6.165  9.986   -9.077  1.00 0.00 ? 18  ARG A HH12 11 
ATOM   10410 H  HH21 . ARG A 1 18 ? -6.251  6.519   -9.524  1.00 0.00 ? 18  ARG A HH21 11 
ATOM   10411 H  HH22 . ARG A 1 18 ? -5.273  7.944   -9.612  1.00 0.00 ? 18  ARG A HH22 11 
ATOM   10412 N  N    . VAL A 1 19 ? -12.728 4.769   -7.797  1.00 0.00 ? 19  VAL A N    11 
ATOM   10413 C  CA   . VAL A 1 19 ? -12.469 3.512   -7.105  1.00 0.00 ? 19  VAL A CA   11 
ATOM   10414 C  C    . VAL A 1 19 ? -11.092 2.963   -7.459  1.00 0.00 ? 19  VAL A C    11 
ATOM   10415 O  O    . VAL A 1 19 ? -10.809 2.674   -8.622  1.00 0.00 ? 19  VAL A O    11 
ATOM   10416 C  CB   . VAL A 1 19 ? -13.535 2.454   -7.445  1.00 0.00 ? 19  VAL A CB   11 
ATOM   10417 C  CG1  . VAL A 1 19 ? -13.018 1.057   -7.137  1.00 0.00 ? 19  VAL A CG1  11 
ATOM   10418 C  CG2  . VAL A 1 19 ? -14.824 2.733   -6.687  1.00 0.00 ? 19  VAL A CG2  11 
ATOM   10419 H  H    . VAL A 1 19 ? -12.784 4.772   -8.776  1.00 0.00 ? 19  VAL A H    11 
ATOM   10420 H  HA   . VAL A 1 19 ? -12.508 3.702   -6.042  1.00 0.00 ? 19  VAL A HA   11 
ATOM   10421 H  HB   . VAL A 1 19 ? -13.745 2.510   -8.503  1.00 0.00 ? 19  VAL A HB   11 
ATOM   10422 H  HG11 . VAL A 1 19 ? -12.805 0.977   -6.081  1.00 0.00 ? 19  VAL A HG11 11 
ATOM   10423 H  HG12 . VAL A 1 19 ? -13.767 0.327   -7.410  1.00 0.00 ? 19  VAL A HG12 11 
ATOM   10424 H  HG13 . VAL A 1 19 ? -12.115 0.875   -7.701  1.00 0.00 ? 19  VAL A HG13 11 
ATOM   10425 H  HG21 . VAL A 1 19 ? -15.030 1.915   -6.014  1.00 0.00 ? 19  VAL A HG21 11 
ATOM   10426 H  HG22 . VAL A 1 19 ? -14.719 3.647   -6.121  1.00 0.00 ? 19  VAL A HG22 11 
ATOM   10427 H  HG23 . VAL A 1 19 ? -15.639 2.837   -7.388  1.00 0.00 ? 19  VAL A HG23 11 
ATOM   10428 N  N    . ILE A 1 20 ? -10.240 2.821   -6.450  1.00 0.00 ? 20  ILE A N    11 
ATOM   10429 C  CA   . ILE A 1 20 ? -8.892  2.305   -6.655  1.00 0.00 ? 20  ILE A CA   11 
ATOM   10430 C  C    . ILE A 1 20 ? -8.851  0.791   -6.478  1.00 0.00 ? 20  ILE A C    11 
ATOM   10431 O  O    . ILE A 1 20 ? -8.880  0.284   -5.357  1.00 0.00 ? 20  ILE A O    11 
ATOM   10432 C  CB   . ILE A 1 20 ? -7.888  2.951   -5.683  1.00 0.00 ? 20  ILE A CB   11 
ATOM   10433 C  CG1  . ILE A 1 20 ? -8.087  4.468   -5.643  1.00 0.00 ? 20  ILE A CG1  11 
ATOM   10434 C  CG2  . ILE A 1 20 ? -6.462  2.609   -6.090  1.00 0.00 ? 20  ILE A CG2  11 
ATOM   10435 C  CD1  . ILE A 1 20 ? -7.813  5.148   -6.966  1.00 0.00 ? 20  ILE A CD1  11 
ATOM   10436 H  H    . ILE A 1 20 ? -10.524 3.069   -5.546  1.00 0.00 ? 20  ILE A H    11 
ATOM   10437 H  HA   . ILE A 1 20 ? -8.593  2.547   -7.665  1.00 0.00 ? 20  ILE A HA   11 
ATOM   10438 H  HB   . ILE A 1 20 ? -8.062  2.546   -4.698  1.00 0.00 ? 20  ILE A HB   11 
ATOM   10439 H  HG12 . ILE A 1 20 ? -9.106  4.683   -5.365  1.00 0.00 ? 20  ILE A HG12 11 
ATOM   10440 H  HG13 . ILE A 1 20 ? -7.420  4.891   -4.907  1.00 0.00 ? 20  ILE A HG13 11 
ATOM   10441 H  HG21 . ILE A 1 20 ? -6.481  1.890   -6.895  1.00 0.00 ? 20  ILE A HG21 11 
ATOM   10442 H  HG22 . ILE A 1 20 ? -5.958  3.505   -6.421  1.00 0.00 ? 20  ILE A HG22 11 
ATOM   10443 H  HG23 . ILE A 1 20 ? -5.937  2.191   -5.245  1.00 0.00 ? 20  ILE A HG23 11 
ATOM   10444 H  HD11 . ILE A 1 20 ? -8.216  6.150   -6.946  1.00 0.00 ? 20  ILE A HD11 11 
ATOM   10445 H  HD12 . ILE A 1 20 ? -6.748  5.191   -7.136  1.00 0.00 ? 20  ILE A HD12 11 
ATOM   10446 H  HD13 . ILE A 1 20 ? -8.283  4.588   -7.762  1.00 0.00 ? 20  ILE A HD13 11 
ATOM   10447 N  N    . LYS A 1 21 ? -8.782  0.072   -7.594  1.00 0.00 ? 21  LYS A N    11 
ATOM   10448 C  CA   . LYS A 1 21 ? -8.734  -1.385  -7.564  1.00 0.00 ? 21  LYS A CA   11 
ATOM   10449 C  C    . LYS A 1 21 ? -7.323  -1.876  -7.256  1.00 0.00 ? 21  LYS A C    11 
ATOM   10450 O  O    . LYS A 1 21 ? -6.389  -1.630  -8.019  1.00 0.00 ? 21  LYS A O    11 
ATOM   10451 C  CB   . LYS A 1 21 ? -9.203  -1.959  -8.903  1.00 0.00 ? 21  LYS A CB   11 
ATOM   10452 C  CG   . LYS A 1 21 ? -10.702 -1.848  -9.120  1.00 0.00 ? 21  LYS A CG   11 
ATOM   10453 C  CD   . LYS A 1 21 ? -11.432 -3.081  -8.615  1.00 0.00 ? 21  LYS A CD   11 
ATOM   10454 C  CE   . LYS A 1 21 ? -11.945 -2.884  -7.197  1.00 0.00 ? 21  LYS A CE   11 
ATOM   10455 N  NZ   . LYS A 1 21 ? -12.681 -4.081  -6.702  1.00 0.00 ? 21  LYS A NZ   11 
ATOM   10456 H  H    . LYS A 1 21 ? -8.763  0.534   -8.459  1.00 0.00 ? 21  LYS A H    11 
ATOM   10457 H  HA   . LYS A 1 21 ? -9.398  -1.723  -6.784  1.00 0.00 ? 21  LYS A HA   11 
ATOM   10458 H  HB2  . LYS A 1 21 ? -8.705  -1.430  -9.702  1.00 0.00 ? 21  LYS A HB2  11 
ATOM   10459 H  HB3  . LYS A 1 21 ? -8.931  -3.003  -8.949  1.00 0.00 ? 21  LYS A HB3  11 
ATOM   10460 H  HG2  . LYS A 1 21 ? -11.071 -0.982  -8.589  1.00 0.00 ? 21  LYS A HG2  11 
ATOM   10461 H  HG3  . LYS A 1 21 ? -10.896 -1.733  -10.177 1.00 0.00 ? 21  LYS A HG3  11 
ATOM   10462 H  HD2  . LYS A 1 21 ? -12.271 -3.284  -9.265  1.00 0.00 ? 21  LYS A HD2  11 
ATOM   10463 H  HD3  . LYS A 1 21 ? -10.752 -3.922  -8.629  1.00 0.00 ? 21  LYS A HD3  11 
ATOM   10464 H  HE2  . LYS A 1 21 ? -11.105 -2.694  -6.547  1.00 0.00 ? 21  LYS A HE2  11 
ATOM   10465 H  HE3  . LYS A 1 21 ? -12.610 -2.033  -7.184  1.00 0.00 ? 21  LYS A HE3  11 
ATOM   10466 H  HZ1  . LYS A 1 21 ? -12.034 -4.708  -6.183  1.00 0.00 ? 21  LYS A HZ1  11 
ATOM   10467 H  HZ2  . LYS A 1 21 ? -13.087 -4.606  -7.502  1.00 0.00 ? 21  LYS A HZ2  11 
ATOM   10468 H  HZ3  . LYS A 1 21 ? -13.450 -3.790  -6.066  1.00 0.00 ? 21  LYS A HZ3  11 
ATOM   10469 N  N    . ALA A 1 22 ? -7.176  -2.572  -6.133  1.00 0.00 ? 22  ALA A N    11 
ATOM   10470 C  CA   . ALA A 1 22 ? -5.879  -3.100  -5.726  1.00 0.00 ? 22  ALA A CA   11 
ATOM   10471 C  C    . ALA A 1 22 ? -6.042  -4.331  -4.841  1.00 0.00 ? 22  ALA A C    11 
ATOM   10472 O  O    . ALA A 1 22 ? -7.116  -4.575  -4.293  1.00 0.00 ? 22  ALA A O    11 
ATOM   10473 C  CB   . ALA A 1 22 ? -5.077  -2.029  -5.003  1.00 0.00 ? 22  ALA A CB   11 
ATOM   10474 H  H    . ALA A 1 22 ? -7.958  -2.735  -5.566  1.00 0.00 ? 22  ALA A H    11 
ATOM   10475 H  HA   . ALA A 1 22 ? -5.338  -3.380  -6.618  1.00 0.00 ? 22  ALA A HA   11 
ATOM   10476 H  HB1  . ALA A 1 22 ? -5.750  -1.285  -4.602  1.00 0.00 ? 22  ALA A HB1  11 
ATOM   10477 H  HB2  . ALA A 1 22 ? -4.518  -2.481  -4.196  1.00 0.00 ? 22  ALA A HB2  11 
ATOM   10478 H  HB3  . ALA A 1 22 ? -4.394  -1.562  -5.696  1.00 0.00 ? 22  ALA A HB3  11 
ATOM   10479 N  N    . MET A 1 23 ? -4.969  -5.103  -4.706  1.00 0.00 ? 23  MET A N    11 
ATOM   10480 C  CA   . MET A 1 23 ? -4.993  -6.309  -3.886  1.00 0.00 ? 23  MET A CA   11 
ATOM   10481 C  C    . MET A 1 23 ? -6.291  -7.082  -4.096  1.00 0.00 ? 23  MET A C    11 
ATOM   10482 O  O    . MET A 1 23 ? -6.760  -7.780  -3.197  1.00 0.00 ? 23  MET A O    11 
ATOM   10483 C  CB   . MET A 1 23 ? -4.833  -5.949  -2.408  1.00 0.00 ? 23  MET A CB   11 
ATOM   10484 C  CG   . MET A 1 23 ? -3.628  -5.067  -2.124  1.00 0.00 ? 23  MET A CG   11 
ATOM   10485 S  SD   . MET A 1 23 ? -3.467  -4.651  -0.377  1.00 0.00 ? 23  MET A SD   11 
ATOM   10486 C  CE   . MET A 1 23 ? -1.915  -5.451  0.020   1.00 0.00 ? 23  MET A CE   11 
ATOM   10487 H  H    . MET A 1 23 ? -4.140  -4.856  -5.168  1.00 0.00 ? 23  MET A H    11 
ATOM   10488 H  HA   . MET A 1 23 ? -4.164  -6.931  -4.188  1.00 0.00 ? 23  MET A HA   11 
ATOM   10489 H  HB2  . MET A 1 23 ? -5.719  -5.428  -2.078  1.00 0.00 ? 23  MET A HB2  11 
ATOM   10490 H  HB3  . MET A 1 23 ? -4.727  -6.860  -1.837  1.00 0.00 ? 23  MET A HB3  11 
ATOM   10491 H  HG2  . MET A 1 23 ? -2.735  -5.587  -2.438  1.00 0.00 ? 23  MET A HG2  11 
ATOM   10492 H  HG3  . MET A 1 23 ? -3.727  -4.153  -2.690  1.00 0.00 ? 23  MET A HG3  11 
ATOM   10493 H  HE1  . MET A 1 23 ? -1.911  -5.733  1.063   1.00 0.00 ? 23  MET A HE1  11 
ATOM   10494 H  HE2  . MET A 1 23 ? -1.798  -6.333  -0.592  1.00 0.00 ? 23  MET A HE2  11 
ATOM   10495 H  HE3  . MET A 1 23 ? -1.099  -4.769  -0.171  1.00 0.00 ? 23  MET A HE3  11 
ATOM   10496 N  N    . ASN A 1 24 ? -6.866  -6.953  -5.287  1.00 0.00 ? 24  ASN A N    11 
ATOM   10497 C  CA   . ASN A 1 24 ? -8.111  -7.640  -5.613  1.00 0.00 ? 24  ASN A CA   11 
ATOM   10498 C  C    . ASN A 1 24 ? -9.266  -7.099  -4.776  1.00 0.00 ? 24  ASN A C    11 
ATOM   10499 O  O    . ASN A 1 24 ? -10.098 -7.860  -4.283  1.00 0.00 ? 24  ASN A O    11 
ATOM   10500 C  CB   . ASN A 1 24 ? -7.962  -9.145  -5.385  1.00 0.00 ? 24  ASN A CB   11 
ATOM   10501 C  CG   . ASN A 1 24 ? -6.708  -9.706  -6.028  1.00 0.00 ? 24  ASN A CG   11 
ATOM   10502 O  OD1  . ASN A 1 24 ? -5.602  -9.529  -5.517  1.00 0.00 ? 24  ASN A OD1  11 
ATOM   10503 N  ND2  . ASN A 1 24 ? -6.875  -10.387 -7.156  1.00 0.00 ? 24  ASN A ND2  11 
ATOM   10504 H  H    . ASN A 1 24 ? -6.444  -6.383  -5.962  1.00 0.00 ? 24  ASN A H    11 
ATOM   10505 H  HA   . ASN A 1 24 ? -8.323  -7.462  -6.656  1.00 0.00 ? 24  ASN A HA   11 
ATOM   10506 H  HB2  . ASN A 1 24 ? -7.916  -9.340  -4.324  1.00 0.00 ? 24  ASN A HB2  11 
ATOM   10507 H  HB3  . ASN A 1 24 ? -8.817  -9.654  -5.804  1.00 0.00 ? 24  ASN A HB3  11 
ATOM   10508 H  HD21 . ASN A 1 24 ? -7.786  -10.488 -7.505  1.00 0.00 ? 24  ASN A HD21 11 
ATOM   10509 H  HD22 . ASN A 1 24 ? -6.082  -10.761 -7.592  1.00 0.00 ? 24  ASN A HD22 11 
ATOM   10510 N  N    . ASN A 1 25 ? -9.310  -5.780  -4.620  1.00 0.00 ? 25  ASN A N    11 
ATOM   10511 C  CA   . ASN A 1 25 ? -10.363 -5.137  -3.843  1.00 0.00 ? 25  ASN A CA   11 
ATOM   10512 C  C    . ASN A 1 25 ? -10.431 -3.644  -4.149  1.00 0.00 ? 25  ASN A C    11 
ATOM   10513 O  O    . ASN A 1 25 ? -9.485  -3.066  -4.685  1.00 0.00 ? 25  ASN A O    11 
ATOM   10514 C  CB   . ASN A 1 25 ? -10.125 -5.352  -2.347  1.00 0.00 ? 25  ASN A CB   11 
ATOM   10515 C  CG   . ASN A 1 25 ? -10.450 -6.767  -1.907  1.00 0.00 ? 25  ASN A CG   11 
ATOM   10516 O  OD1  . ASN A 1 25 ? -11.554 -7.262  -2.135  1.00 0.00 ? 25  ASN A OD1  11 
ATOM   10517 N  ND2  . ASN A 1 25 ? -9.486  -7.426  -1.274  1.00 0.00 ? 25  ASN A ND2  11 
ATOM   10518 H  H    . ASN A 1 25 ? -8.618  -5.226  -5.038  1.00 0.00 ? 25  ASN A H    11 
ATOM   10519 H  HA   . ASN A 1 25 ? -11.303 -5.592  -4.118  1.00 0.00 ? 25  ASN A HA   11 
ATOM   10520 H  HB2  . ASN A 1 25 ? -9.087  -5.156  -2.122  1.00 0.00 ? 25  ASN A HB2  11 
ATOM   10521 H  HB3  . ASN A 1 25 ? -10.746 -4.669  -1.787  1.00 0.00 ? 25  ASN A HB3  11 
ATOM   10522 H  HD21 . ASN A 1 25 ? -8.632  -6.968  -1.127  1.00 0.00 ? 25  ASN A HD21 11 
ATOM   10523 H  HD22 . ASN A 1 25 ? -9.669  -8.342  -0.979  1.00 0.00 ? 25  ASN A HD22 11 
ATOM   10524 N  N    . SER A 1 26 ? -11.555 -3.025  -3.803  1.00 0.00 ? 26  SER A N    11 
ATOM   10525 C  CA   . SER A 1 26 ? -11.748 -1.600  -4.043  1.00 0.00 ? 26  SER A CA   11 
ATOM   10526 C  C    . SER A 1 26 ? -11.270 -0.778  -2.850  1.00 0.00 ? 26  SER A C    11 
ATOM   10527 O  O    . SER A 1 26 ? -11.398 -1.200  -1.700  1.00 0.00 ? 26  SER A O    11 
ATOM   10528 C  CB   . SER A 1 26 ? -13.222 -1.303  -4.323  1.00 0.00 ? 26  SER A CB   11 
ATOM   10529 O  OG   . SER A 1 26 ? -14.053 -1.851  -3.314  1.00 0.00 ? 26  SER A OG   11 
ATOM   10530 H  H    . SER A 1 26 ? -12.273 -3.540  -3.379  1.00 0.00 ? 26  SER A H    11 
ATOM   10531 H  HA   . SER A 1 26 ? -11.164 -1.327  -4.910  1.00 0.00 ? 26  SER A HA   11 
ATOM   10532 H  HB2  . SER A 1 26 ? -13.372 -0.234  -4.355  1.00 0.00 ? 26  SER A HB2  11 
ATOM   10533 H  HB3  . SER A 1 26 ? -13.499 -1.734  -5.275  1.00 0.00 ? 26  SER A HB3  11 
ATOM   10534 H  HG   . SER A 1 26 ? -13.689 -1.643  -2.451  1.00 0.00 ? 26  SER A HG   11 
ATOM   10535 N  N    . TRP A 1 27 ? -10.718 0.397   -3.132  1.00 0.00 ? 27  TRP A N    11 
ATOM   10536 C  CA   . TRP A 1 27 ? -10.220 1.278   -2.082  1.00 0.00 ? 27  TRP A CA   11 
ATOM   10537 C  C    . TRP A 1 27 ? -10.364 2.741   -2.486  1.00 0.00 ? 27  TRP A C    11 
ATOM   10538 O  O    . TRP A 1 27 ? -10.787 3.049   -3.601  1.00 0.00 ? 27  TRP A O    11 
ATOM   10539 C  CB   . TRP A 1 27 ? -8.755  0.963   -1.775  1.00 0.00 ? 27  TRP A CB   11 
ATOM   10540 C  CG   . TRP A 1 27 ? -8.453  -0.505  -1.766  1.00 0.00 ? 27  TRP A CG   11 
ATOM   10541 C  CD1  . TRP A 1 27 ? -8.669  -1.392  -2.781  1.00 0.00 ? 27  TRP A CD1  11 
ATOM   10542 C  CD2  . TRP A 1 27 ? -7.880  -1.256  -0.690  1.00 0.00 ? 27  TRP A CD2  11 
ATOM   10543 N  NE1  . TRP A 1 27 ? -8.266  -2.650  -2.400  1.00 0.00 ? 27  TRP A NE1  11 
ATOM   10544 C  CE2  . TRP A 1 27 ? -7.778  -2.592  -1.122  1.00 0.00 ? 27  TRP A CE2  11 
ATOM   10545 C  CE3  . TRP A 1 27 ? -7.443  -0.928  0.597   1.00 0.00 ? 27  TRP A CE3  11 
ATOM   10546 C  CZ2  . TRP A 1 27 ? -7.257  -3.598  -0.312  1.00 0.00 ? 27  TRP A CZ2  11 
ATOM   10547 C  CZ3  . TRP A 1 27 ? -6.926  -1.928  1.399   1.00 0.00 ? 27  TRP A CZ3  11 
ATOM   10548 C  CH2  . TRP A 1 27 ? -6.836  -3.250  0.942   1.00 0.00 ? 27  TRP A CH2  11 
ATOM   10549 H  H    . TRP A 1 27 ? -10.643 0.678   -4.068  1.00 0.00 ? 27  TRP A H    11 
ATOM   10550 H  HA   . TRP A 1 27 ? -10.810 1.102   -1.195  1.00 0.00 ? 27  TRP A HA   11 
ATOM   10551 H  HB2  . TRP A 1 27 ? -8.129  1.428   -2.522  1.00 0.00 ? 27  TRP A HB2  11 
ATOM   10552 H  HB3  . TRP A 1 27 ? -8.505  1.362   -0.802  1.00 0.00 ? 27  TRP A HB3  11 
ATOM   10553 H  HD1  . TRP A 1 27 ? -9.097  -1.131  -3.737  1.00 0.00 ? 27  TRP A HD1  11 
ATOM   10554 H  HE1  . TRP A 1 27 ? -8.319  -3.456  -2.956  1.00 0.00 ? 27  TRP A HE1  11 
ATOM   10555 H  HE3  . TRP A 1 27 ? -7.504  0.085   0.967   1.00 0.00 ? 27  TRP A HE3  11 
ATOM   10556 H  HZ2  . TRP A 1 27 ? -7.180  -4.621  -0.650  1.00 0.00 ? 27  TRP A HZ2  11 
ATOM   10557 H  HZ3  . TRP A 1 27 ? -6.584  -1.694  2.396   1.00 0.00 ? 27  TRP A HZ3  11 
ATOM   10558 H  HH2  . TRP A 1 27 ? -6.426  -3.998  1.603   1.00 0.00 ? 27  TRP A HH2  11 
ATOM   10559 N  N    . HIS A 1 28 ? -10.009 3.641   -1.574  1.00 0.00 ? 28  HIS A N    11 
ATOM   10560 C  CA   . HIS A 1 28 ? -10.098 5.073   -1.837  1.00 0.00 ? 28  HIS A CA   11 
ATOM   10561 C  C    . HIS A 1 28 ? -8.773  5.611   -2.368  1.00 0.00 ? 28  HIS A C    11 
ATOM   10562 O  O    . HIS A 1 28 ? -7.710  5.025   -2.163  1.00 0.00 ? 28  HIS A O    11 
ATOM   10563 C  CB   . HIS A 1 28 ? -10.494 5.823   -0.565  1.00 0.00 ? 28  HIS A CB   11 
ATOM   10564 C  CG   . HIS A 1 28 ? -11.942 5.679   -0.210  1.00 0.00 ? 28  HIS A CG   11 
ATOM   10565 N  ND1  . HIS A 1 28 ? -12.374 5.169   0.996   1.00 0.00 ? 28  HIS A ND1  11 
ATOM   10566 C  CD2  . HIS A 1 28 ? -13.059 5.982   -0.911  1.00 0.00 ? 28  HIS A CD2  11 
ATOM   10567 C  CE1  . HIS A 1 28 ? -13.695 5.164   1.022   1.00 0.00 ? 28  HIS A CE1  11 
ATOM   10568 N  NE2  . HIS A 1 28 ? -14.135 5.653   -0.124  1.00 0.00 ? 28  HIS A NE2  11 
ATOM   10569 H  H    . HIS A 1 28 ? -9.679  3.334   -0.704  1.00 0.00 ? 28  HIS A H    11 
ATOM   10570 H  HA   . HIS A 1 28 ? -10.861 5.225   -2.586  1.00 0.00 ? 28  HIS A HA   11 
ATOM   10571 H  HB2  . HIS A 1 28 ? -9.911  5.446   0.263   1.00 0.00 ? 28  HIS A HB2  11 
ATOM   10572 H  HB3  . HIS A 1 28 ? -10.287 6.875   -0.696  1.00 0.00 ? 28  HIS A HB3  11 
ATOM   10573 H  HD2  . HIS A 1 28 ? -13.099 6.405   -1.905  1.00 0.00 ? 28  HIS A HD2  11 
ATOM   10574 H  HE1  . HIS A 1 28 ? -14.310 4.819   1.839   1.00 0.00 ? 28  HIS A HE1  11 
ATOM   10575 H  HE2  . HIS A 1 28 ? -15.075 5.681   -0.401  1.00 0.00 ? 28  HIS A HE2  11 
ATOM   10576 N  N    . PRO A 1 29 ? -8.836  6.753   -3.069  1.00 0.00 ? 29  PRO A N    11 
ATOM   10577 C  CA   . PRO A 1 29 ? -7.651  7.396   -3.644  1.00 0.00 ? 29  PRO A CA   11 
ATOM   10578 C  C    . PRO A 1 29 ? -6.736  7.986   -2.576  1.00 0.00 ? 29  PRO A C    11 
ATOM   10579 O  O    . PRO A 1 29 ? -5.682  8.540   -2.887  1.00 0.00 ? 29  PRO A O    11 
ATOM   10580 C  CB   . PRO A 1 29 ? -8.238  8.506   -4.519  1.00 0.00 ? 29  PRO A CB   11 
ATOM   10581 C  CG   . PRO A 1 29 ? -9.563  8.808   -3.908  1.00 0.00 ? 29  PRO A CG   11 
ATOM   10582 C  CD   . PRO A 1 29 ? -10.070 7.506   -3.353  1.00 0.00 ? 29  PRO A CD   11 
ATOM   10583 H  HA   . PRO A 1 29 ? -7.087  6.710   -4.260  1.00 0.00 ? 29  PRO A HA   11 
ATOM   10584 H  HB2  . PRO A 1 29 ? -7.586  9.368   -4.496  1.00 0.00 ? 29  PRO A HB2  11 
ATOM   10585 H  HB3  . PRO A 1 29 ? -8.342  8.153   -5.533  1.00 0.00 ? 29  PRO A HB3  11 
ATOM   10586 H  HG2  . PRO A 1 29 ? -9.446  9.533   -3.117  1.00 0.00 ? 29  PRO A HG2  11 
ATOM   10587 H  HG3  . PRO A 1 29 ? -10.238 9.181   -4.664  1.00 0.00 ? 29  PRO A HG3  11 
ATOM   10588 H  HD2  . PRO A 1 29 ? -10.635 7.676   -2.448  1.00 0.00 ? 29  PRO A HD2  11 
ATOM   10589 H  HD3  . PRO A 1 29 ? -10.674 6.993   -4.086  1.00 0.00 ? 29  PRO A HD3  11 
ATOM   10590 N  N    . GLU A 1 30 ? -7.146  7.863   -1.318  1.00 0.00 ? 30  GLU A N    11 
ATOM   10591 C  CA   . GLU A 1 30 ? -6.362  8.386   -0.205  1.00 0.00 ? 30  GLU A CA   11 
ATOM   10592 C  C    . GLU A 1 30 ? -6.030  7.280   0.793   1.00 0.00 ? 30  GLU A C    11 
ATOM   10593 O  O    . GLU A 1 30 ? -4.976  7.298   1.430   1.00 0.00 ? 30  GLU A O    11 
ATOM   10594 C  CB   . GLU A 1 30 ? -7.122  9.512   0.499   1.00 0.00 ? 30  GLU A CB   11 
ATOM   10595 C  CG   . GLU A 1 30 ? -8.329  9.032   1.287   1.00 0.00 ? 30  GLU A CG   11 
ATOM   10596 C  CD   . GLU A 1 30 ? -9.233  10.170  1.720   1.00 0.00 ? 30  GLU A CD   11 
ATOM   10597 O  OE1  . GLU A 1 30 ? -9.395  11.130  0.938   1.00 0.00 ? 30  GLU A OE1  11 
ATOM   10598 O  OE2  . GLU A 1 30 ? -9.779  10.100  2.841   1.00 0.00 ? 30  GLU A OE2  11 
ATOM   10599 H  H    . GLU A 1 30 ? -7.996  7.411   -1.134  1.00 0.00 ? 30  GLU A H    11 
ATOM   10600 H  HA   . GLU A 1 30 ? -5.441  8.781   -0.605  1.00 0.00 ? 30  GLU A HA   11 
ATOM   10601 H  HB2  . GLU A 1 30 ? -6.450  10.014  1.179   1.00 0.00 ? 30  GLU A HB2  11 
ATOM   10602 H  HB3  . GLU A 1 30 ? -7.461  10.219  -0.244  1.00 0.00 ? 30  GLU A HB3  11 
ATOM   10603 H  HG2  . GLU A 1 30 ? -8.900  8.355   0.670   1.00 0.00 ? 30  GLU A HG2  11 
ATOM   10604 H  HG3  . GLU A 1 30 ? -7.984  8.511   2.168   1.00 0.00 ? 30  GLU A HG3  11 
ATOM   10605 N  N    . CYS A 1 31 ? -6.938  6.319   0.926   1.00 0.00 ? 31  CYS A N    11 
ATOM   10606 C  CA   . CYS A 1 31 ? -6.745  5.205   1.847   1.00 0.00 ? 31  CYS A CA   11 
ATOM   10607 C  C    . CYS A 1 31 ? -5.561  4.344   1.417   1.00 0.00 ? 31  CYS A C    11 
ATOM   10608 O  O    . CYS A 1 31 ? -4.592  4.185   2.160   1.00 0.00 ? 31  CYS A O    11 
ATOM   10609 C  CB   . CYS A 1 31 ? -8.011  4.351   1.920   1.00 0.00 ? 31  CYS A CB   11 
ATOM   10610 S  SG   . CYS A 1 31 ? -9.290  5.010   3.037   1.00 0.00 ? 31  CYS A SG   11 
ATOM   10611 H  H    . CYS A 1 31 ? -7.759  6.359   0.391   1.00 0.00 ? 31  CYS A H    11 
ATOM   10612 H  HA   . CYS A 1 31 ? -6.540  5.614   2.824   1.00 0.00 ? 31  CYS A HA   11 
ATOM   10613 H  HB2  . CYS A 1 31 ? -8.445  4.278   0.933   1.00 0.00 ? 31  CYS A HB2  11 
ATOM   10614 H  HB3  . CYS A 1 31 ? -7.750  3.362   2.266   1.00 0.00 ? 31  CYS A HB3  11 
ATOM   10615 N  N    . PHE A 1 32 ? -5.646  3.789   0.212   1.00 0.00 ? 32  PHE A N    11 
ATOM   10616 C  CA   . PHE A 1 32 ? -4.583  2.943   -0.317  1.00 0.00 ? 32  PHE A CA   11 
ATOM   10617 C  C    . PHE A 1 32 ? -3.233  3.651   -0.236  1.00 0.00 ? 32  PHE A C    11 
ATOM   10618 O  O    . PHE A 1 32 ? -2.861  4.406   -1.134  1.00 0.00 ? 32  PHE A O    11 
ATOM   10619 C  CB   . PHE A 1 32 ? -4.883  2.558   -1.767  1.00 0.00 ? 32  PHE A CB   11 
ATOM   10620 C  CG   . PHE A 1 32 ? -4.086  1.380   -2.251  1.00 0.00 ? 32  PHE A CG   11 
ATOM   10621 C  CD1  . PHE A 1 32 ? -4.053  0.202   -1.523  1.00 0.00 ? 32  PHE A CD1  11 
ATOM   10622 C  CD2  . PHE A 1 32 ? -3.370  1.451   -3.436  1.00 0.00 ? 32  PHE A CD2  11 
ATOM   10623 C  CE1  . PHE A 1 32 ? -3.320  -0.882  -1.966  1.00 0.00 ? 32  PHE A CE1  11 
ATOM   10624 C  CE2  . PHE A 1 32 ? -2.636  0.369   -3.884  1.00 0.00 ? 32  PHE A CE2  11 
ATOM   10625 C  CZ   . PHE A 1 32 ? -2.612  -0.799  -3.148  1.00 0.00 ? 32  PHE A CZ   11 
ATOM   10626 H  H    . PHE A 1 32 ? -6.444  3.953   -0.334  1.00 0.00 ? 32  PHE A H    11 
ATOM   10627 H  HA   . PHE A 1 32 ? -4.543  2.048   0.284   1.00 0.00 ? 32  PHE A HA   11 
ATOM   10628 H  HB2  . PHE A 1 32 ? -5.929  2.309   -1.857  1.00 0.00 ? 32  PHE A HB2  11 
ATOM   10629 H  HB3  . PHE A 1 32 ? -4.660  3.397   -2.408  1.00 0.00 ? 32  PHE A HB3  11 
ATOM   10630 H  HD1  . PHE A 1 32 ? -4.608  0.135   -0.598  1.00 0.00 ? 32  PHE A HD1  11 
ATOM   10631 H  HD2  . PHE A 1 32 ? -3.389  2.365   -4.012  1.00 0.00 ? 32  PHE A HD2  11 
ATOM   10632 H  HE1  . PHE A 1 32 ? -3.303  -1.795  -1.389  1.00 0.00 ? 32  PHE A HE1  11 
ATOM   10633 H  HE2  . PHE A 1 32 ? -2.083  0.438   -4.809  1.00 0.00 ? 32  PHE A HE2  11 
ATOM   10634 H  HZ   . PHE A 1 32 ? -2.038  -1.645  -3.497  1.00 0.00 ? 32  PHE A HZ   11 
ATOM   10635 N  N    . ARG A 1 33 ? -2.505  3.401   0.847   1.00 0.00 ? 33  ARG A N    11 
ATOM   10636 C  CA   . ARG A 1 33 ? -1.198  4.015   1.048   1.00 0.00 ? 33  ARG A CA   11 
ATOM   10637 C  C    . ARG A 1 33 ? -0.126  2.951   1.268   1.00 0.00 ? 33  ARG A C    11 
ATOM   10638 O  O    . ARG A 1 33 ? -0.434  1.779   1.484   1.00 0.00 ? 33  ARG A O    11 
ATOM   10639 C  CB   . ARG A 1 33 ? -1.237  4.970   2.242   1.00 0.00 ? 33  ARG A CB   11 
ATOM   10640 C  CG   . ARG A 1 33 ? -2.063  6.222   1.993   1.00 0.00 ? 33  ARG A CG   11 
ATOM   10641 C  CD   . ARG A 1 33 ? -1.784  7.290   3.039   1.00 0.00 ? 33  ARG A CD   11 
ATOM   10642 N  NE   . ARG A 1 33 ? -1.905  8.638   2.491   1.00 0.00 ? 33  ARG A NE   11 
ATOM   10643 C  CZ   . ARG A 1 33 ? -3.018  9.361   2.557   1.00 0.00 ? 33  ARG A CZ   11 
ATOM   10644 N  NH1  . ARG A 1 33 ? -4.098  8.868   3.146   1.00 0.00 ? 33  ARG A NH1  11 
ATOM   10645 N  NH2  . ARG A 1 33 ? -3.050  10.580  2.035   1.00 0.00 ? 33  ARG A NH2  11 
ATOM   10646 H  H    . ARG A 1 33 ? -2.855  2.789   1.529   1.00 0.00 ? 33  ARG A H    11 
ATOM   10647 H  HA   . ARG A 1 33 ? -0.954  4.575   0.157   1.00 0.00 ? 33  ARG A HA   11 
ATOM   10648 H  HB2  . ARG A 1 33 ? -1.658  4.451   3.090   1.00 0.00 ? 33  ARG A HB2  11 
ATOM   10649 H  HB3  . ARG A 1 33 ? -0.228  5.272   2.479   1.00 0.00 ? 33  ARG A HB3  11 
ATOM   10650 H  HG2  . ARG A 1 33 ? -1.817  6.616   1.018   1.00 0.00 ? 33  ARG A HG2  11 
ATOM   10651 H  HG3  . ARG A 1 33 ? -3.110  5.963   2.026   1.00 0.00 ? 33  ARG A HG3  11 
ATOM   10652 H  HD2  . ARG A 1 33 ? -2.489  7.176   3.848   1.00 0.00 ? 33  ARG A HD2  11 
ATOM   10653 H  HD3  . ARG A 1 33 ? -0.781  7.153   3.415   1.00 0.00 ? 33  ARG A HD3  11 
ATOM   10654 H  HE   . ARG A 1 33 ? -1.118  9.022   2.051   1.00 0.00 ? 33  ARG A HE   11 
ATOM   10655 H  HH11 . ARG A 1 33 ? -4.076  7.950   3.542   1.00 0.00 ? 33  ARG A HH11 11 
ATOM   10656 H  HH12 . ARG A 1 33 ? -4.935  9.414   3.196   1.00 0.00 ? 33  ARG A HH12 11 
ATOM   10657 H  HH21 . ARG A 1 33 ? -2.238  10.955  1.590   1.00 0.00 ? 33  ARG A HH21 11 
ATOM   10658 H  HH22 . ARG A 1 33 ? -3.888  11.123  2.085   1.00 0.00 ? 33  ARG A HH22 11 
ATOM   10659 N  N    . CYS A 1 34 ? 1.135   3.369   1.212   1.00 0.00 ? 34  CYS A N    11 
ATOM   10660 C  CA   . CYS A 1 34 ? 2.253   2.454   1.405   1.00 0.00 ? 34  CYS A CA   11 
ATOM   10661 C  C    . CYS A 1 34 ? 2.227   1.851   2.806   1.00 0.00 ? 34  CYS A C    11 
ATOM   10662 O  O    . CYS A 1 34 ? 1.494   2.314   3.679   1.00 0.00 ? 34  CYS A O    11 
ATOM   10663 C  CB   . CYS A 1 34 ? 3.579   3.181   1.175   1.00 0.00 ? 34  CYS A CB   11 
ATOM   10664 S  SG   . CYS A 1 34 ? 5.010   2.071   0.974   1.00 0.00 ? 34  CYS A SG   11 
ATOM   10665 H  H    . CYS A 1 34 ? 1.317   4.316   1.037   1.00 0.00 ? 34  CYS A H    11 
ATOM   10666 H  HA   . CYS A 1 34 ? 2.159   1.658   0.682   1.00 0.00 ? 34  CYS A HA   11 
ATOM   10667 H  HB2  . CYS A 1 34 ? 3.502   3.781   0.279   1.00 0.00 ? 34  CYS A HB2  11 
ATOM   10668 H  HB3  . CYS A 1 34 ? 3.779   3.826   2.017   1.00 0.00 ? 34  CYS A HB3  11 
ATOM   10669 N  N    . ASP A 1 35 ? 3.033   0.815   3.013   1.00 0.00 ? 35  ASP A N    11 
ATOM   10670 C  CA   . ASP A 1 35 ? 3.104   0.149   4.308   1.00 0.00 ? 35  ASP A CA   11 
ATOM   10671 C  C    . ASP A 1 35 ? 4.398   0.507   5.033   1.00 0.00 ? 35  ASP A C    11 
ATOM   10672 O  O    . ASP A 1 35 ? 4.639   0.057   6.154   1.00 0.00 ? 35  ASP A O    11 
ATOM   10673 C  CB   . ASP A 1 35 ? 3.007   -1.368  4.132   1.00 0.00 ? 35  ASP A CB   11 
ATOM   10674 C  CG   . ASP A 1 35 ? 2.747   -2.087  5.441   1.00 0.00 ? 35  ASP A CG   11 
ATOM   10675 O  OD1  . ASP A 1 35 ? 1.579   -2.117  5.880   1.00 0.00 ? 35  ASP A OD1  11 
ATOM   10676 O  OD2  . ASP A 1 35 ? 3.713   -2.622  6.025   1.00 0.00 ? 35  ASP A OD2  11 
ATOM   10677 H  H    . ASP A 1 35 ? 3.594   0.491   2.277   1.00 0.00 ? 35  ASP A H    11 
ATOM   10678 H  HA   . ASP A 1 35 ? 2.269   0.487   4.902   1.00 0.00 ? 35  ASP A HA   11 
ATOM   10679 H  HB2  . ASP A 1 35 ? 2.199   -1.593  3.452   1.00 0.00 ? 35  ASP A HB2  11 
ATOM   10680 H  HB3  . ASP A 1 35 ? 3.934   -1.735  3.717   1.00 0.00 ? 35  ASP A HB3  11 
ATOM   10681 N  N    . LEU A 1 36 ? 5.228   1.318   4.386   1.00 0.00 ? 36  LEU A N    11 
ATOM   10682 C  CA   . LEU A 1 36 ? 6.498   1.736   4.968   1.00 0.00 ? 36  LEU A CA   11 
ATOM   10683 C  C    . LEU A 1 36 ? 6.567   3.255   5.092   1.00 0.00 ? 36  LEU A C    11 
ATOM   10684 O  O    . LEU A 1 36 ? 7.176   3.785   6.021   1.00 0.00 ? 36  LEU A O    11 
ATOM   10685 C  CB   . LEU A 1 36 ? 7.664   1.229   4.116   1.00 0.00 ? 36  LEU A CB   11 
ATOM   10686 C  CG   . LEU A 1 36 ? 7.877   -0.285  4.103   1.00 0.00 ? 36  LEU A CG   11 
ATOM   10687 C  CD1  . LEU A 1 36 ? 8.462   -0.730  2.771   1.00 0.00 ? 36  LEU A CD1  11 
ATOM   10688 C  CD2  . LEU A 1 36 ? 8.781   -0.706  5.252   1.00 0.00 ? 36  LEU A CD2  11 
ATOM   10689 H  H    . LEU A 1 36 ? 4.981   1.643   3.495   1.00 0.00 ? 36  LEU A H    11 
ATOM   10690 H  HA   . LEU A 1 36 ? 6.569   1.302   5.954   1.00 0.00 ? 36  LEU A HA   11 
ATOM   10691 H  HB2  . LEU A 1 36 ? 7.493   1.548   3.099   1.00 0.00 ? 36  LEU A HB2  11 
ATOM   10692 H  HB3  . LEU A 1 36 ? 8.568   1.689   4.488   1.00 0.00 ? 36  LEU A HB3  11 
ATOM   10693 H  HG   . LEU A 1 36 ? 6.923   -0.777  4.229   1.00 0.00 ? 36  LEU A HG   11 
ATOM   10694 H  HD11 . LEU A 1 36 ? 7.797   -0.440  1.971   1.00 0.00 ? 36  LEU A HD11 11 
ATOM   10695 H  HD12 . LEU A 1 36 ? 8.579   -1.803  2.770   1.00 0.00 ? 36  LEU A HD12 11 
ATOM   10696 H  HD13 . LEU A 1 36 ? 9.425   -0.262  2.627   1.00 0.00 ? 36  LEU A HD13 11 
ATOM   10697 H  HD21 . LEU A 1 36 ? 8.462   -1.668  5.626   1.00 0.00 ? 36  LEU A HD21 11 
ATOM   10698 H  HD22 . LEU A 1 36 ? 8.722   0.026   6.044   1.00 0.00 ? 36  LEU A HD22 11 
ATOM   10699 H  HD23 . LEU A 1 36 ? 9.800   -0.776  4.901   1.00 0.00 ? 36  LEU A HD23 11 
ATOM   10700 N  N    . CYS A 1 37 ? 5.936   3.949   4.151   1.00 0.00 ? 37  CYS A N    11 
ATOM   10701 C  CA   . CYS A 1 37 ? 5.923   5.407   4.155   1.00 0.00 ? 37  CYS A CA   11 
ATOM   10702 C  C    . CYS A 1 37 ? 4.494   5.938   4.092   1.00 0.00 ? 37  CYS A C    11 
ATOM   10703 O  O    . CYS A 1 37 ? 4.267   7.145   4.172   1.00 0.00 ? 37  CYS A O    11 
ATOM   10704 C  CB   . CYS A 1 37 ? 6.732   5.948   2.974   1.00 0.00 ? 37  CYS A CB   11 
ATOM   10705 S  SG   . CYS A 1 37 ? 5.975   5.633   1.348   1.00 0.00 ? 37  CYS A SG   11 
ATOM   10706 H  H    . CYS A 1 37 ? 5.468   3.469   3.435   1.00 0.00 ? 37  CYS A H    11 
ATOM   10707 H  HA   . CYS A 1 37 ? 6.378   5.740   5.075   1.00 0.00 ? 37  CYS A HA   11 
ATOM   10708 H  HB2  . CYS A 1 37 ? 6.842   7.017   3.083   1.00 0.00 ? 37  CYS A HB2  11 
ATOM   10709 H  HB3  . CYS A 1 37 ? 7.710   5.489   2.977   1.00 0.00 ? 37  CYS A HB3  11 
ATOM   10710 N  N    . GLN A 1 38 ? 3.536   5.028   3.950   1.00 0.00 ? 38  GLN A N    11 
ATOM   10711 C  CA   . GLN A 1 38 ? 2.129   5.405   3.877   1.00 0.00 ? 38  GLN A CA   11 
ATOM   10712 C  C    . GLN A 1 38 ? 1.906   6.469   2.807   1.00 0.00 ? 38  GLN A C    11 
ATOM   10713 O  O    . GLN A 1 38 ? 1.356   7.534   3.084   1.00 0.00 ? 38  GLN A O    11 
ATOM   10714 C  CB   . GLN A 1 38 ? 1.646   5.920   5.234   1.00 0.00 ? 38  GLN A CB   11 
ATOM   10715 C  CG   . GLN A 1 38 ? 1.928   4.966   6.383   1.00 0.00 ? 38  GLN A CG   11 
ATOM   10716 C  CD   . GLN A 1 38 ? 0.788   3.998   6.630   1.00 0.00 ? 38  GLN A CD   11 
ATOM   10717 O  OE1  . GLN A 1 38 ? -0.368  4.403   6.759   1.00 0.00 ? 38  GLN A OE1  11 
ATOM   10718 N  NE2  . GLN A 1 38 ? 1.107   2.711   6.698   1.00 0.00 ? 38  GLN A NE2  11 
ATOM   10719 H  H    . GLN A 1 38 ? 3.781   4.081   3.893   1.00 0.00 ? 38  GLN A H    11 
ATOM   10720 H  HA   . GLN A 1 38 ? 1.563   4.524   3.615   1.00 0.00 ? 38  GLN A HA   11 
ATOM   10721 H  HB2  . GLN A 1 38 ? 2.137   6.859   5.445   1.00 0.00 ? 38  GLN A HB2  11 
ATOM   10722 H  HB3  . GLN A 1 38 ? 0.580   6.085   5.184   1.00 0.00 ? 38  GLN A HB3  11 
ATOM   10723 H  HG2  . GLN A 1 38 ? 2.817   4.398   6.152   1.00 0.00 ? 38  GLN A HG2  11 
ATOM   10724 H  HG3  . GLN A 1 38 ? 2.093   5.542   7.281   1.00 0.00 ? 38  GLN A HG3  11 
ATOM   10725 H  HE21 . GLN A 1 38 ? 2.049   2.462   6.587   1.00 0.00 ? 38  GLN A HE21 11 
ATOM   10726 H  HE22 . GLN A 1 38 ? 0.390   2.064   6.858   1.00 0.00 ? 38  GLN A HE22 11 
ATOM   10727 N  N    . GLU A 1 39 ? 2.338   6.172   1.585   1.00 0.00 ? 39  GLU A N    11 
ATOM   10728 C  CA   . GLU A 1 39 ? 2.186   7.105   0.475   1.00 0.00 ? 39  GLU A CA   11 
ATOM   10729 C  C    . GLU A 1 39 ? 1.078   6.649   -0.471  1.00 0.00 ? 39  GLU A C    11 
ATOM   10730 O  O    . GLU A 1 39 ? 1.056   5.500   -0.912  1.00 0.00 ? 39  GLU A O    11 
ATOM   10731 C  CB   . GLU A 1 39 ? 3.503   7.238   -0.293  1.00 0.00 ? 39  GLU A CB   11 
ATOM   10732 C  CG   . GLU A 1 39 ? 3.369   7.990   -1.606  1.00 0.00 ? 39  GLU A CG   11 
ATOM   10733 C  CD   . GLU A 1 39 ? 4.663   8.655   -2.032  1.00 0.00 ? 39  GLU A CD   11 
ATOM   10734 O  OE1  . GLU A 1 39 ? 5.247   9.397   -1.214  1.00 0.00 ? 39  GLU A OE1  11 
ATOM   10735 O  OE2  . GLU A 1 39 ? 5.092   8.434   -3.184  1.00 0.00 ? 39  GLU A OE2  11 
ATOM   10736 H  H    . GLU A 1 39 ? 2.769   5.306   1.427   1.00 0.00 ? 39  GLU A H    11 
ATOM   10737 H  HA   . GLU A 1 39 ? 1.919   8.067   0.884   1.00 0.00 ? 39  GLU A HA   11 
ATOM   10738 H  HB2  . GLU A 1 39 ? 4.215   7.761   0.328   1.00 0.00 ? 39  GLU A HB2  11 
ATOM   10739 H  HB3  . GLU A 1 39 ? 3.882   6.250   -0.506  1.00 0.00 ? 39  GLU A HB3  11 
ATOM   10740 H  HG2  . GLU A 1 39 ? 3.069   7.295   -2.376  1.00 0.00 ? 39  GLU A HG2  11 
ATOM   10741 H  HG3  . GLU A 1 39 ? 2.610   8.751   -1.494  1.00 0.00 ? 39  GLU A HG3  11 
ATOM   10742 N  N    . VAL A 1 40 ? 0.158   7.558   -0.777  1.00 0.00 ? 40  VAL A N    11 
ATOM   10743 C  CA   . VAL A 1 40 ? -0.953  7.251   -1.670  1.00 0.00 ? 40  VAL A CA   11 
ATOM   10744 C  C    . VAL A 1 40 ? -0.481  6.454   -2.880  1.00 0.00 ? 40  VAL A C    11 
ATOM   10745 O  O    . VAL A 1 40 ? 0.273   6.957   -3.714  1.00 0.00 ? 40  VAL A O    11 
ATOM   10746 C  CB   . VAL A 1 40 ? -1.654  8.534   -2.155  1.00 0.00 ? 40  VAL A CB   11 
ATOM   10747 C  CG1  . VAL A 1 40 ? -2.802  8.193   -3.094  1.00 0.00 ? 40  VAL A CG1  11 
ATOM   10748 C  CG2  . VAL A 1 40 ? -2.148  9.351   -0.971  1.00 0.00 ? 40  VAL A CG2  11 
ATOM   10749 H  H    . VAL A 1 40 ? 0.229   8.457   -0.394  1.00 0.00 ? 40  VAL A H    11 
ATOM   10750 H  HA   . VAL A 1 40 ? -1.671  6.660   -1.119  1.00 0.00 ? 40  VAL A HA   11 
ATOM   10751 H  HB   . VAL A 1 40 ? -0.936  9.127   -2.702  1.00 0.00 ? 40  VAL A HB   11 
ATOM   10752 H  HG11 . VAL A 1 40 ? -3.441  9.056   -3.209  1.00 0.00 ? 40  VAL A HG11 11 
ATOM   10753 H  HG12 . VAL A 1 40 ? -2.406  7.905   -4.057  1.00 0.00 ? 40  VAL A HG12 11 
ATOM   10754 H  HG13 . VAL A 1 40 ? -3.374  7.375   -2.680  1.00 0.00 ? 40  VAL A HG13 11 
ATOM   10755 H  HG21 . VAL A 1 40 ? -2.482  10.318  -1.317  1.00 0.00 ? 40  VAL A HG21 11 
ATOM   10756 H  HG22 . VAL A 1 40 ? -2.969  8.836   -0.494  1.00 0.00 ? 40  VAL A HG22 11 
ATOM   10757 H  HG23 . VAL A 1 40 ? -1.344  9.480   -0.262  1.00 0.00 ? 40  VAL A HG23 11 
ATOM   10758 N  N    . LEU A 1 41 ? -0.930  5.207   -2.972  1.00 0.00 ? 41  LEU A N    11 
ATOM   10759 C  CA   . LEU A 1 41 ? -0.554  4.338   -4.083  1.00 0.00 ? 41  LEU A CA   11 
ATOM   10760 C  C    . LEU A 1 41 ? -1.677  4.252   -5.111  1.00 0.00 ? 41  LEU A C    11 
ATOM   10761 O  O    . LEU A 1 41 ? -1.967  3.179   -5.640  1.00 0.00 ? 41  LEU A O    11 
ATOM   10762 C  CB   . LEU A 1 41 ? -0.211  2.939   -3.568  1.00 0.00 ? 41  LEU A CB   11 
ATOM   10763 C  CG   . LEU A 1 41 ? 0.458   2.875   -2.194  1.00 0.00 ? 41  LEU A CG   11 
ATOM   10764 C  CD1  . LEU A 1 41 ? 0.183   1.536   -1.528  1.00 0.00 ? 41  LEU A CD1  11 
ATOM   10765 C  CD2  . LEU A 1 41 ? 1.956   3.114   -2.318  1.00 0.00 ? 41  LEU A CD2  11 
ATOM   10766 H  H    . LEU A 1 41 ? -1.528  4.861   -2.278  1.00 0.00 ? 41  LEU A H    11 
ATOM   10767 H  HA   . LEU A 1 41 ? 0.319   4.763   -4.555  1.00 0.00 ? 41  LEU A HA   11 
ATOM   10768 H  HB2  . LEU A 1 41 ? -1.127  2.372   -3.516  1.00 0.00 ? 41  LEU A HB2  11 
ATOM   10769 H  HB3  . LEU A 1 41 ? 0.456   2.479   -4.283  1.00 0.00 ? 41  LEU A HB3  11 
ATOM   10770 H  HG   . LEU A 1 41 ? 0.046   3.651   -1.563  1.00 0.00 ? 41  LEU A HG   11 
ATOM   10771 H  HD11 . LEU A 1 41 ? 1.102   1.141   -1.121  1.00 0.00 ? 41  LEU A HD11 11 
ATOM   10772 H  HD12 . LEU A 1 41 ? -0.213  0.845   -2.259  1.00 0.00 ? 41  LEU A HD12 11 
ATOM   10773 H  HD13 . LEU A 1 41 ? -0.536  1.669   -0.733  1.00 0.00 ? 41  LEU A HD13 11 
ATOM   10774 H  HD21 . LEU A 1 41 ? 2.370   2.427   -3.041  1.00 0.00 ? 41  LEU A HD21 11 
ATOM   10775 H  HD22 . LEU A 1 41 ? 2.427   2.954   -1.359  1.00 0.00 ? 41  LEU A HD22 11 
ATOM   10776 H  HD23 . LEU A 1 41 ? 2.133   4.129   -2.642  1.00 0.00 ? 41  LEU A HD23 11 
ATOM   10777 N  N    . ALA A 1 42 ? -2.304  5.390   -5.392  1.00 0.00 ? 42  ALA A N    11 
ATOM   10778 C  CA   . ALA A 1 42 ? -3.392  5.444   -6.360  1.00 0.00 ? 42  ALA A CA   11 
ATOM   10779 C  C    . ALA A 1 42 ? -2.863  5.704   -7.766  1.00 0.00 ? 42  ALA A C    11 
ATOM   10780 O  O    . ALA A 1 42 ? -3.045  4.886   -8.669  1.00 0.00 ? 42  ALA A O    11 
ATOM   10781 C  CB   . ALA A 1 42 ? -4.397  6.517   -5.966  1.00 0.00 ? 42  ALA A CB   11 
ATOM   10782 H  H    . ALA A 1 42 ? -2.027  6.213   -4.937  1.00 0.00 ? 42  ALA A H    11 
ATOM   10783 H  HA   . ALA A 1 42 ? -3.898  4.489   -6.347  1.00 0.00 ? 42  ALA A HA   11 
ATOM   10784 H  HB1  . ALA A 1 42 ? -5.128  6.630   -6.753  1.00 0.00 ? 42  ALA A HB1  11 
ATOM   10785 H  HB2  . ALA A 1 42 ? -4.893  6.226   -5.052  1.00 0.00 ? 42  ALA A HB2  11 
ATOM   10786 H  HB3  . ALA A 1 42 ? -3.882  7.453   -5.814  1.00 0.00 ? 42  ALA A HB3  11 
ATOM   10787 N  N    . ASP A 1 43 ? -2.209  6.846   -7.946  1.00 0.00 ? 43  ASP A N    11 
ATOM   10788 C  CA   . ASP A 1 43 ? -1.653  7.213   -9.243  1.00 0.00 ? 43  ASP A CA   11 
ATOM   10789 C  C    . ASP A 1 43 ? -0.238  6.664   -9.403  1.00 0.00 ? 43  ASP A C    11 
ATOM   10790 O  O    . ASP A 1 43 ? 0.086   6.043   -10.416 1.00 0.00 ? 43  ASP A O    11 
ATOM   10791 C  CB   . ASP A 1 43 ? -1.645  8.734   -9.406  1.00 0.00 ? 43  ASP A CB   11 
ATOM   10792 C  CG   . ASP A 1 43 ? -3.013  9.347   -9.185  1.00 0.00 ? 43  ASP A CG   11 
ATOM   10793 O  OD1  . ASP A 1 43 ? -3.393  9.545   -8.012  1.00 0.00 ? 43  ASP A OD1  11 
ATOM   10794 O  OD2  . ASP A 1 43 ? -3.705  9.630   -10.185 1.00 0.00 ? 43  ASP A OD2  11 
ATOM   10795 H  H    . ASP A 1 43 ? -2.097  7.456   -7.187  1.00 0.00 ? 43  ASP A H    11 
ATOM   10796 H  HA   . ASP A 1 43 ? -2.281  6.781   -10.007 1.00 0.00 ? 43  ASP A HA   11 
ATOM   10797 H  HB2  . ASP A 1 43 ? -0.959  9.162   -8.690  1.00 0.00 ? 43  ASP A HB2  11 
ATOM   10798 H  HB3  . ASP A 1 43 ? -1.316  8.980   -10.405 1.00 0.00 ? 43  ASP A HB3  11 
ATOM   10799 N  N    . ILE A 1 44 ? 0.599   6.898   -8.398  1.00 0.00 ? 44  ILE A N    11 
ATOM   10800 C  CA   . ILE A 1 44 ? 1.978   6.427   -8.428  1.00 0.00 ? 44  ILE A CA   11 
ATOM   10801 C  C    . ILE A 1 44 ? 2.038   4.916   -8.624  1.00 0.00 ? 44  ILE A C    11 
ATOM   10802 O  O    . ILE A 1 44 ? 2.965   4.397   -9.244  1.00 0.00 ? 44  ILE A O    11 
ATOM   10803 C  CB   . ILE A 1 44 ? 2.726   6.795   -7.133  1.00 0.00 ? 44  ILE A CB   11 
ATOM   10804 C  CG1  . ILE A 1 44 ? 2.077   6.109   -5.930  1.00 0.00 ? 44  ILE A CG1  11 
ATOM   10805 C  CG2  . ILE A 1 44 ? 2.744   8.305   -6.943  1.00 0.00 ? 44  ILE A CG2  11 
ATOM   10806 C  CD1  . ILE A 1 44 ? 2.932   6.141   -4.682  1.00 0.00 ? 44  ILE A CD1  11 
ATOM   10807 H  H    . ILE A 1 44 ? 0.281   7.398   -7.618  1.00 0.00 ? 44  ILE A H    11 
ATOM   10808 H  HA   . ILE A 1 44 ? 2.476   6.908   -9.257  1.00 0.00 ? 44  ILE A HA   11 
ATOM   10809 H  HB   . ILE A 1 44 ? 3.747   6.456   -7.225  1.00 0.00 ? 44  ILE A HB   11 
ATOM   10810 H  HG12 . ILE A 1 44 ? 1.144   6.600   -5.704  1.00 0.00 ? 44  ILE A HG12 11 
ATOM   10811 H  HG13 . ILE A 1 44 ? 1.885   5.075   -6.175  1.00 0.00 ? 44  ILE A HG13 11 
ATOM   10812 H  HG21 . ILE A 1 44 ? 2.792   8.534   -5.889  1.00 0.00 ? 44  ILE A HG21 11 
ATOM   10813 H  HG22 . ILE A 1 44 ? 3.609   8.719   -7.440  1.00 0.00 ? 44  ILE A HG22 11 
ATOM   10814 H  HG23 . ILE A 1 44 ? 1.847   8.732   -7.364  1.00 0.00 ? 44  ILE A HG23 11 
ATOM   10815 H  HD11 . ILE A 1 44 ? 3.359   7.125   -4.562  1.00 0.00 ? 44  ILE A HD11 11 
ATOM   10816 H  HD12 . ILE A 1 44 ? 2.324   5.904   -3.822  1.00 0.00 ? 44  ILE A HD12 11 
ATOM   10817 H  HD13 . ILE A 1 44 ? 3.727   5.414   -4.772  1.00 0.00 ? 44  ILE A HD13 11 
ATOM   10818 N  N    . GLY A 1 45 ? 1.042   4.215   -8.092  1.00 0.00 ? 45  GLY A N    11 
ATOM   10819 C  CA   . GLY A 1 45 ? 1.000   2.770   -8.222  1.00 0.00 ? 45  GLY A CA   11 
ATOM   10820 C  C    . GLY A 1 45 ? 1.450   2.062   -6.959  1.00 0.00 ? 45  GLY A C    11 
ATOM   10821 O  O    . GLY A 1 45 ? 1.890   2.701   -6.003  1.00 0.00 ? 45  GLY A O    11 
ATOM   10822 H  H    . GLY A 1 45 ? 0.329   4.682   -7.608  1.00 0.00 ? 45  GLY A H    11 
ATOM   10823 H  HA2  . GLY A 1 45 ? -0.012  2.469   -8.450  1.00 0.00 ? 45  GLY A HA2  11 
ATOM   10824 H  HA3  . GLY A 1 45 ? 1.645   2.474   -9.036  1.00 0.00 ? 45  GLY A HA3  11 
ATOM   10825 N  N    . PHE A 1 46 ? 1.337   0.737   -6.954  1.00 0.00 ? 46  PHE A N    11 
ATOM   10826 C  CA   . PHE A 1 46 ? 1.733   -0.058  -5.798  1.00 0.00 ? 46  PHE A CA   11 
ATOM   10827 C  C    . PHE A 1 46 ? 2.457   -1.329  -6.234  1.00 0.00 ? 46  PHE A C    11 
ATOM   10828 O  O    . PHE A 1 46 ? 2.391   -1.726  -7.398  1.00 0.00 ? 46  PHE A O    11 
ATOM   10829 C  CB   . PHE A 1 46 ? 0.508   -0.420  -4.956  1.00 0.00 ? 46  PHE A CB   11 
ATOM   10830 C  CG   . PHE A 1 46 ? -0.377  -1.450  -5.598  1.00 0.00 ? 46  PHE A CG   11 
ATOM   10831 C  CD1  . PHE A 1 46 ? -1.079  -1.155  -6.756  1.00 0.00 ? 46  PHE A CD1  11 
ATOM   10832 C  CD2  . PHE A 1 46 ? -0.508  -2.713  -5.044  1.00 0.00 ? 46  PHE A CD2  11 
ATOM   10833 C  CE1  . PHE A 1 46 ? -1.894  -2.100  -7.350  1.00 0.00 ? 46  PHE A CE1  11 
ATOM   10834 C  CE2  . PHE A 1 46 ? -1.321  -3.662  -5.633  1.00 0.00 ? 46  PHE A CE2  11 
ATOM   10835 C  CZ   . PHE A 1 46 ? -2.016  -3.356  -6.787  1.00 0.00 ? 46  PHE A CZ   11 
ATOM   10836 H  H    . PHE A 1 46 ? 0.979   0.285   -7.746  1.00 0.00 ? 46  PHE A H    11 
ATOM   10837 H  HA   . PHE A 1 46 ? 2.406   0.538   -5.201  1.00 0.00 ? 46  PHE A HA   11 
ATOM   10838 H  HB2  . PHE A 1 46 ? 0.835   -0.812  -4.005  1.00 0.00 ? 46  PHE A HB2  11 
ATOM   10839 H  HB3  . PHE A 1 46 ? -0.082  0.469   -4.791  1.00 0.00 ? 46  PHE A HB3  11 
ATOM   10840 H  HD1  . PHE A 1 46 ? -0.984  -0.173  -7.198  1.00 0.00 ? 46  PHE A HD1  11 
ATOM   10841 H  HD2  . PHE A 1 46 ? 0.033   -2.954  -4.141  1.00 0.00 ? 46  PHE A HD2  11 
ATOM   10842 H  HE1  . PHE A 1 46 ? -2.436  -1.857  -8.252  1.00 0.00 ? 46  PHE A HE1  11 
ATOM   10843 H  HE2  . PHE A 1 46 ? -1.415  -4.643  -5.190  1.00 0.00 ? 46  PHE A HE2  11 
ATOM   10844 H  HZ   . PHE A 1 46 ? -2.652  -4.096  -7.249  1.00 0.00 ? 46  PHE A HZ   11 
ATOM   10845 N  N    . VAL A 1 47 ? 3.149   -1.962  -5.292  1.00 0.00 ? 47  VAL A N    11 
ATOM   10846 C  CA   . VAL A 1 47 ? 3.885   -3.188  -5.578  1.00 0.00 ? 47  VAL A CA   11 
ATOM   10847 C  C    . VAL A 1 47 ? 3.645   -4.238  -4.499  1.00 0.00 ? 47  VAL A C    11 
ATOM   10848 O  O    . VAL A 1 47 ? 4.231   -4.178  -3.418  1.00 0.00 ? 47  VAL A O    11 
ATOM   10849 C  CB   . VAL A 1 47 ? 5.397   -2.921  -5.692  1.00 0.00 ? 47  VAL A CB   11 
ATOM   10850 C  CG1  . VAL A 1 47 ? 6.138   -4.193  -6.074  1.00 0.00 ? 47  VAL A CG1  11 
ATOM   10851 C  CG2  . VAL A 1 47 ? 5.668   -1.814  -6.699  1.00 0.00 ? 47  VAL A CG2  11 
ATOM   10852 H  H    . VAL A 1 47 ? 3.163   -1.597  -4.383  1.00 0.00 ? 47  VAL A H    11 
ATOM   10853 H  HA   . VAL A 1 47 ? 3.537   -3.574  -6.525  1.00 0.00 ? 47  VAL A HA   11 
ATOM   10854 H  HB   . VAL A 1 47 ? 5.759   -2.596  -4.727  1.00 0.00 ? 47  VAL A HB   11 
ATOM   10855 H  HG11 . VAL A 1 47 ? 6.887   -4.411  -5.327  1.00 0.00 ? 47  VAL A HG11 11 
ATOM   10856 H  HG12 . VAL A 1 47 ? 5.437   -5.013  -6.133  1.00 0.00 ? 47  VAL A HG12 11 
ATOM   10857 H  HG13 . VAL A 1 47 ? 6.616   -4.057  -7.032  1.00 0.00 ? 47  VAL A HG13 11 
ATOM   10858 H  HG21 . VAL A 1 47 ? 4.767   -1.608  -7.258  1.00 0.00 ? 47  VAL A HG21 11 
ATOM   10859 H  HG22 . VAL A 1 47 ? 5.981   -0.920  -6.178  1.00 0.00 ? 47  VAL A HG22 11 
ATOM   10860 H  HG23 . VAL A 1 47 ? 6.449   -2.126  -7.377  1.00 0.00 ? 47  VAL A HG23 11 
ATOM   10861 N  N    . LYS A 1 48 ? 2.780   -5.200  -4.799  1.00 0.00 ? 48  LYS A N    11 
ATOM   10862 C  CA   . LYS A 1 48 ? 2.462   -6.266  -3.856  1.00 0.00 ? 48  LYS A CA   11 
ATOM   10863 C  C    . LYS A 1 48 ? 3.734   -6.916  -3.321  1.00 0.00 ? 48  LYS A C    11 
ATOM   10864 O  O    . LYS A 1 48 ? 4.677   -7.166  -4.071  1.00 0.00 ? 48  LYS A O    11 
ATOM   10865 C  CB   . LYS A 1 48 ? 1.580   -7.322  -4.526  1.00 0.00 ? 48  LYS A CB   11 
ATOM   10866 C  CG   . LYS A 1 48 ? 0.093   -7.081  -4.336  1.00 0.00 ? 48  LYS A CG   11 
ATOM   10867 C  CD   . LYS A 1 48 ? -0.359  -7.458  -2.936  1.00 0.00 ? 48  LYS A CD   11 
ATOM   10868 C  CE   . LYS A 1 48 ? -0.648  -8.947  -2.825  1.00 0.00 ? 48  LYS A CE   11 
ATOM   10869 N  NZ   . LYS A 1 48 ? -2.021  -9.282  -3.296  1.00 0.00 ? 48  LYS A NZ   11 
ATOM   10870 H  H    . LYS A 1 48 ? 2.344   -5.194  -5.678  1.00 0.00 ? 48  LYS A H    11 
ATOM   10871 H  HA   . LYS A 1 48 ? 1.921   -5.828  -3.031  1.00 0.00 ? 48  LYS A HA   11 
ATOM   10872 H  HB2  . LYS A 1 48 ? 1.790   -7.329  -5.586  1.00 0.00 ? 48  LYS A HB2  11 
ATOM   10873 H  HB3  . LYS A 1 48 ? 1.822   -8.290  -4.113  1.00 0.00 ? 48  LYS A HB3  11 
ATOM   10874 H  HG2  . LYS A 1 48 ? -0.118  -6.035  -4.501  1.00 0.00 ? 48  LYS A HG2  11 
ATOM   10875 H  HG3  . LYS A 1 48 ? -0.454  -7.677  -5.054  1.00 0.00 ? 48  LYS A HG3  11 
ATOM   10876 H  HD2  . LYS A 1 48 ? 0.421   -7.202  -2.234  1.00 0.00 ? 48  LYS A HD2  11 
ATOM   10877 H  HD3  . LYS A 1 48 ? -1.257  -6.907  -2.696  1.00 0.00 ? 48  LYS A HD3  11 
ATOM   10878 H  HE2  . LYS A 1 48 ? 0.070   -9.486  -3.425  1.00 0.00 ? 48  LYS A HE2  11 
ATOM   10879 H  HE3  . LYS A 1 48 ? -0.549  -9.244  -1.792  1.00 0.00 ? 48  LYS A HE3  11 
ATOM   10880 H  HZ1  . LYS A 1 48 ? -2.129  -9.019  -4.296  1.00 0.00 ? 48  LYS A HZ1  11 
ATOM   10881 H  HZ2  . LYS A 1 48 ? -2.727  -8.765  -2.734  1.00 0.00 ? 48  LYS A HZ2  11 
ATOM   10882 H  HZ3  . LYS A 1 48 ? -2.194  -10.303 -3.196  1.00 0.00 ? 48  LYS A HZ3  11 
ATOM   10883 N  N    . ASN A 1 49 ? 3.752   -7.189  -2.021  1.00 0.00 ? 49  ASN A N    11 
ATOM   10884 C  CA   . ASN A 1 49 ? 4.908   -7.811  -1.386  1.00 0.00 ? 49  ASN A CA   11 
ATOM   10885 C  C    . ASN A 1 49 ? 4.571   -8.269  0.029   1.00 0.00 ? 49  ASN A C    11 
ATOM   10886 O  O    . ASN A 1 49 ? 4.028   -7.506  0.827   1.00 0.00 ? 49  ASN A O    11 
ATOM   10887 C  CB   . ASN A 1 49 ? 6.085   -6.833  -1.351  1.00 0.00 ? 49  ASN A CB   11 
ATOM   10888 C  CG   . ASN A 1 49 ? 7.394   -7.516  -1.007  1.00 0.00 ? 49  ASN A CG   11 
ATOM   10889 O  OD1  . ASN A 1 49 ? 7.518   -8.736  -1.116  1.00 0.00 ? 49  ASN A OD1  11 
ATOM   10890 N  ND2  . ASN A 1 49 ? 8.380   -6.730  -0.589  1.00 0.00 ? 49  ASN A ND2  11 
ATOM   10891 H  H    . ASN A 1 49 ? 2.970   -6.966  -1.474  1.00 0.00 ? 49  ASN A H    11 
ATOM   10892 H  HA   . ASN A 1 49 ? 5.186   -8.673  -1.975  1.00 0.00 ? 49  ASN A HA   11 
ATOM   10893 H  HB2  . ASN A 1 49 ? 6.188   -6.368  -2.321  1.00 0.00 ? 49  ASN A HB2  11 
ATOM   10894 H  HB3  . ASN A 1 49 ? 5.891   -6.072  -0.610  1.00 0.00 ? 49  ASN A HB3  11 
ATOM   10895 H  HD21 . ASN A 1 49 ? 8.209   -5.767  -0.527  1.00 0.00 ? 49  ASN A HD21 11 
ATOM   10896 H  HD22 . ASN A 1 49 ? 9.237   -7.145  -0.360  1.00 0.00 ? 49  ASN A HD22 11 
ATOM   10897 N  N    . ALA A 1 50 ? 4.898   -9.521  0.334   1.00 0.00 ? 50  ALA A N    11 
ATOM   10898 C  CA   . ALA A 1 50 ? 4.632   -10.080 1.654   1.00 0.00 ? 50  ALA A CA   11 
ATOM   10899 C  C    . ALA A 1 50 ? 3.228   -9.724  2.128   1.00 0.00 ? 50  ALA A C    11 
ATOM   10900 O  O    . ALA A 1 50 ? 3.006   -9.478  3.313   1.00 0.00 ? 50  ALA A O    11 
ATOM   10901 C  CB   . ALA A 1 50 ? 5.669   -9.590  2.653   1.00 0.00 ? 50  ALA A CB   11 
ATOM   10902 H  H    . ALA A 1 50 ? 5.329   -10.081 -0.345  1.00 0.00 ? 50  ALA A H    11 
ATOM   10903 H  HA   . ALA A 1 50 ? 4.716   -11.155 1.583   1.00 0.00 ? 50  ALA A HA   11 
ATOM   10904 H  HB1  . ALA A 1 50 ? 5.229   -8.832  3.285   1.00 0.00 ? 50  ALA A HB1  11 
ATOM   10905 H  HB2  . ALA A 1 50 ? 6.002   -10.418 3.261   1.00 0.00 ? 50  ALA A HB2  11 
ATOM   10906 H  HB3  . ALA A 1 50 ? 6.511   -9.172  2.122   1.00 0.00 ? 50  ALA A HB3  11 
ATOM   10907 N  N    . GLY A 1 51 ? 2.281   -9.698  1.195   1.00 0.00 ? 51  GLY A N    11 
ATOM   10908 C  CA   . GLY A 1 51 ? 0.910   -9.370  1.538   1.00 0.00 ? 51  GLY A CA   11 
ATOM   10909 C  C    . GLY A 1 51 ? 0.759   -7.940  2.020   1.00 0.00 ? 51  GLY A C    11 
ATOM   10910 O  O    . GLY A 1 51 ? -0.067  -7.655  2.887   1.00 0.00 ? 51  GLY A O    11 
ATOM   10911 H  H    . GLY A 1 51 ? 2.516   -9.903  0.265   1.00 0.00 ? 51  GLY A H    11 
ATOM   10912 H  HA2  . GLY A 1 51 ? 0.288   -9.512  0.666   1.00 0.00 ? 51  GLY A HA2  11 
ATOM   10913 H  HA3  . GLY A 1 51 ? 0.576   -10.037 2.318   1.00 0.00 ? 51  GLY A HA3  11 
ATOM   10914 N  N    . ARG A 1 52 ? 1.559   -7.040  1.458   1.00 0.00 ? 52  ARG A N    11 
ATOM   10915 C  CA   . ARG A 1 52 ? 1.512   -5.634  1.838   1.00 0.00 ? 52  ARG A CA   11 
ATOM   10916 C  C    . ARG A 1 52 ? 1.679   -4.735  0.616   1.00 0.00 ? 52  ARG A C    11 
ATOM   10917 O  O    . ARG A 1 52 ? 2.386   -5.081  -0.331  1.00 0.00 ? 52  ARG A O    11 
ATOM   10918 C  CB   . ARG A 1 52 ? 2.603   -5.324  2.864   1.00 0.00 ? 52  ARG A CB   11 
ATOM   10919 C  CG   . ARG A 1 52 ? 2.548   -6.211  4.098   1.00 0.00 ? 52  ARG A CG   11 
ATOM   10920 C  CD   . ARG A 1 52 ? 3.866   -6.193  4.856   1.00 0.00 ? 52  ARG A CD   11 
ATOM   10921 N  NE   . ARG A 1 52 ? 3.918   -7.225  5.888   1.00 0.00 ? 52  ARG A NE   11 
ATOM   10922 C  CZ   . ARG A 1 52 ? 4.668   -7.136  6.980   1.00 0.00 ? 52  ARG A CZ   11 
ATOM   10923 N  NH1  . ARG A 1 52 ? 5.425   -6.066  7.182   1.00 0.00 ? 52  ARG A NH1  11 
ATOM   10924 N  NH2  . ARG A 1 52 ? 4.662   -8.117  7.874   1.00 0.00 ? 52  ARG A NH2  11 
ATOM   10925 H  H    . ARG A 1 52 ? 2.196   -7.329  0.771   1.00 0.00 ? 52  ARG A H    11 
ATOM   10926 H  HA   . ARG A 1 52 ? 0.547   -5.442  2.282   1.00 0.00 ? 52  ARG A HA   11 
ATOM   10927 H  HB2  . ARG A 1 52 ? 3.568   -5.455  2.397   1.00 0.00 ? 52  ARG A HB2  11 
ATOM   10928 H  HB3  . ARG A 1 52 ? 2.502   -4.297  3.181   1.00 0.00 ? 52  ARG A HB3  11 
ATOM   10929 H  HG2  . ARG A 1 52 ? 1.765   -5.856  4.751   1.00 0.00 ? 52  ARG A HG2  11 
ATOM   10930 H  HG3  . ARG A 1 52 ? 2.332   -7.224  3.792   1.00 0.00 ? 52  ARG A HG3  11 
ATOM   10931 H  HD2  . ARG A 1 52 ? 4.671   -6.357  4.156   1.00 0.00 ? 52  ARG A HD2  11 
ATOM   10932 H  HD3  . ARG A 1 52 ? 3.985   -5.226  5.321   1.00 0.00 ? 52  ARG A HD3  11 
ATOM   10933 H  HE   . ARG A 1 52 ? 3.366   -8.024  5.759   1.00 0.00 ? 52  ARG A HE   11 
ATOM   10934 H  HH11 . ARG A 1 52 ? 5.431   -5.325  6.511   1.00 0.00 ? 52  ARG A HH11 11 
ATOM   10935 H  HH12 . ARG A 1 52 ? 5.988   -6.001  8.006   1.00 0.00 ? 52  ARG A HH12 11 
ATOM   10936 H  HH21 . ARG A 1 52 ? 4.092   -8.924  7.725   1.00 0.00 ? 52  ARG A HH21 11 
ATOM   10937 H  HH22 . ARG A 1 52 ? 5.227   -8.048  8.695   1.00 0.00 ? 52  ARG A HH22 11 
ATOM   10938 N  N    . HIS A 1 53 ? 1.023   -3.579  0.644   1.00 0.00 ? 53  HIS A N    11 
ATOM   10939 C  CA   . HIS A 1 53 ? 1.098   -2.630  -0.461  1.00 0.00 ? 53  HIS A CA   11 
ATOM   10940 C  C    . HIS A 1 53 ? 2.241   -1.641  -0.251  1.00 0.00 ? 53  HIS A C    11 
ATOM   10941 O  O    . HIS A 1 53 ? 2.247   -0.878  0.716   1.00 0.00 ? 53  HIS A O    11 
ATOM   10942 C  CB   . HIS A 1 53 ? -0.224  -1.875  -0.604  1.00 0.00 ? 53  HIS A CB   11 
ATOM   10943 C  CG   . HIS A 1 53 ? -0.734  -1.309  0.686   1.00 0.00 ? 53  HIS A CG   11 
ATOM   10944 N  ND1  . HIS A 1 53 ? 0.035   -1.229  1.828   1.00 0.00 ? 53  HIS A ND1  11 
ATOM   10945 C  CD2  . HIS A 1 53 ? -1.942  -0.792  1.010   1.00 0.00 ? 53  HIS A CD2  11 
ATOM   10946 C  CE1  . HIS A 1 53 ? -0.680  -0.689  2.799   1.00 0.00 ? 53  HIS A CE1  11 
ATOM   10947 N  NE2  . HIS A 1 53 ? -1.883  -0.414  2.329   1.00 0.00 ? 53  HIS A NE2  11 
ATOM   10948 H  H    . HIS A 1 53 ? 0.475   -3.359  1.427   1.00 0.00 ? 53  HIS A H    11 
ATOM   10949 H  HA   . HIS A 1 53 ? 1.283   -3.188  -1.365  1.00 0.00 ? 53  HIS A HA   11 
ATOM   10950 H  HB2  . HIS A 1 53 ? -0.091  -1.056  -1.295  1.00 0.00 ? 53  HIS A HB2  11 
ATOM   10951 H  HB3  . HIS A 1 53 ? -0.975  -2.548  -0.992  1.00 0.00 ? 53  HIS A HB3  11 
ATOM   10952 H  HD1  . HIS A 1 53 ? 0.964   -1.526  1.914   1.00 0.00 ? 53  HIS A HD1  11 
ATOM   10953 H  HD2  . HIS A 1 53 ? -2.795  -0.695  0.353   1.00 0.00 ? 53  HIS A HD2  11 
ATOM   10954 H  HE1  . HIS A 1 53 ? -0.338  -0.503  3.807   1.00 0.00 ? 53  HIS A HE1  11 
ATOM   10955 H  HE2  . HIS A 1 53 ? -2.636  -0.087  2.863   1.00 0.00 ? 53  HIS A HE2  11 
ATOM   10956 N  N    . LEU A 1 54 ? 3.208   -1.660  -1.162  1.00 0.00 ? 54  LEU A N    11 
ATOM   10957 C  CA   . LEU A 1 54 ? 4.357   -0.766  -1.076  1.00 0.00 ? 54  LEU A CA   11 
ATOM   10958 C  C    . LEU A 1 54 ? 4.499   0.062   -2.349  1.00 0.00 ? 54  LEU A C    11 
ATOM   10959 O  O    . LEU A 1 54 ? 4.011   -0.325  -3.412  1.00 0.00 ? 54  LEU A O    11 
ATOM   10960 C  CB   . LEU A 1 54 ? 5.636   -1.569  -0.831  1.00 0.00 ? 54  LEU A CB   11 
ATOM   10961 C  CG   . LEU A 1 54 ? 5.493   -2.805  0.057   1.00 0.00 ? 54  LEU A CG   11 
ATOM   10962 C  CD1  . LEU A 1 54 ? 6.810   -3.561  0.137   1.00 0.00 ? 54  LEU A CD1  11 
ATOM   10963 C  CD2  . LEU A 1 54 ? 5.017   -2.410  1.448   1.00 0.00 ? 54  LEU A CD2  11 
ATOM   10964 H  H    . LEU A 1 54 ? 3.148   -2.290  -1.910  1.00 0.00 ? 54  LEU A H    11 
ATOM   10965 H  HA   . LEU A 1 54 ? 4.196   -0.098  -0.243  1.00 0.00 ? 54  LEU A HA   11 
ATOM   10966 H  HB2  . LEU A 1 54 ? 6.012   -1.893  -1.790  1.00 0.00 ? 54  LEU A HB2  11 
ATOM   10967 H  HB3  . LEU A 1 54 ? 6.356   -0.910  -0.369  1.00 0.00 ? 54  LEU A HB3  11 
ATOM   10968 H  HG   . LEU A 1 54 ? 4.754   -3.467  -0.374  1.00 0.00 ? 54  LEU A HG   11 
ATOM   10969 H  HD11 . LEU A 1 54 ? 7.267   -3.592  -0.840  1.00 0.00 ? 54  LEU A HD11 11 
ATOM   10970 H  HD12 . LEU A 1 54 ? 6.627   -4.568  0.481   1.00 0.00 ? 54  LEU A HD12 11 
ATOM   10971 H  HD13 . LEU A 1 54 ? 7.471   -3.060  0.830   1.00 0.00 ? 54  LEU A HD13 11 
ATOM   10972 H  HD21 . LEU A 1 54 ? 5.849   -2.022  2.016   1.00 0.00 ? 54  LEU A HD21 11 
ATOM   10973 H  HD22 . LEU A 1 54 ? 4.612   -3.278  1.950   1.00 0.00 ? 54  LEU A HD22 11 
ATOM   10974 H  HD23 . LEU A 1 54 ? 4.252   -1.653  1.365   1.00 0.00 ? 54  LEU A HD23 11 
ATOM   10975 N  N    . CYS A 1 55 ? 5.173   1.201   -2.236  1.00 0.00 ? 55  CYS A N    11 
ATOM   10976 C  CA   . CYS A 1 55 ? 5.381   2.084   -3.377  1.00 0.00 ? 55  CYS A CA   11 
ATOM   10977 C  C    . CYS A 1 55 ? 6.725   1.803   -4.044  1.00 0.00 ? 55  CYS A C    11 
ATOM   10978 O  O    . CYS A 1 55 ? 7.692   1.429   -3.380  1.00 0.00 ? 55  CYS A O    11 
ATOM   10979 C  CB   . CYS A 1 55 ? 5.314   3.547   -2.936  1.00 0.00 ? 55  CYS A CB   11 
ATOM   10980 S  SG   . CYS A 1 55 ? 6.695   4.066   -1.868  1.00 0.00 ? 55  CYS A SG   11 
ATOM   10981 H  H    . CYS A 1 55 ? 5.539   1.456   -1.362  1.00 0.00 ? 55  CYS A H    11 
ATOM   10982 H  HA   . CYS A 1 55 ? 4.594   1.896   -4.091  1.00 0.00 ? 55  CYS A HA   11 
ATOM   10983 H  HB2  . CYS A 1 55 ? 5.322   4.180   -3.812  1.00 0.00 ? 55  CYS A HB2  11 
ATOM   10984 H  HB3  . CYS A 1 55 ? 4.397   3.709   -2.390  1.00 0.00 ? 55  CYS A HB3  11 
ATOM   10985 N  N    . ARG A 1 56 ? 6.777   1.987   -5.359  1.00 0.00 ? 56  ARG A N    11 
ATOM   10986 C  CA   . ARG A 1 56 ? 8.001   1.753   -6.115  1.00 0.00 ? 56  ARG A CA   11 
ATOM   10987 C  C    . ARG A 1 56 ? 9.229   2.146   -5.298  1.00 0.00 ? 56  ARG A C    11 
ATOM   10988 O  O    . ARG A 1 56 ? 10.168  1.368   -5.130  1.00 0.00 ? 56  ARG A O    11 
ATOM   10989 C  CB   . ARG A 1 56 ? 7.975   2.541   -7.426  1.00 0.00 ? 56  ARG A CB   11 
ATOM   10990 C  CG   . ARG A 1 56 ? 7.565   1.707   -8.629  1.00 0.00 ? 56  ARG A CG   11 
ATOM   10991 C  CD   . ARG A 1 56 ? 8.633   0.686   -8.989  1.00 0.00 ? 56  ARG A CD   11 
ATOM   10992 N  NE   . ARG A 1 56 ? 9.735   1.285   -9.737  1.00 0.00 ? 56  ARG A NE   11 
ATOM   10993 C  CZ   . ARG A 1 56 ? 10.774  0.596   -10.193 1.00 0.00 ? 56  ARG A CZ   11 
ATOM   10994 N  NH1  . ARG A 1 56 ? 10.853  -0.710  -9.980  1.00 0.00 ? 56  ARG A NH1  11 
ATOM   10995 N  NH2  . ARG A 1 56 ? 11.737  1.213   -10.866 1.00 0.00 ? 56  ARG A NH2  11 
ATOM   10996 H  H    . ARG A 1 56 ? 5.973   2.287   -5.832  1.00 0.00 ? 56  ARG A H    11 
ATOM   10997 H  HA   . ARG A 1 56 ? 8.056   0.698   -6.340  1.00 0.00 ? 56  ARG A HA   11 
ATOM   10998 H  HB2  . ARG A 1 56 ? 7.275   3.358   -7.328  1.00 0.00 ? 56  ARG A HB2  11 
ATOM   10999 H  HB3  . ARG A 1 56 ? 8.960   2.941   -7.611  1.00 0.00 ? 56  ARG A HB3  11 
ATOM   11000 H  HG2  . ARG A 1 56 ? 6.648   1.186   -8.400  1.00 0.00 ? 56  ARG A HG2  11 
ATOM   11001 H  HG3  . ARG A 1 56 ? 7.408   2.363   -9.473  1.00 0.00 ? 56  ARG A HG3  11 
ATOM   11002 H  HD2  . ARG A 1 56 ? 9.022   0.255   -8.078  1.00 0.00 ? 56  ARG A HD2  11 
ATOM   11003 H  HD3  . ARG A 1 56 ? 8.182   -0.090  -9.589  1.00 0.00 ? 56  ARG A HD3  11 
ATOM   11004 H  HE   . ARG A 1 56 ? 9.697   2.249   -9.906  1.00 0.00 ? 56  ARG A HE   11 
ATOM   11005 H  HH11 . ARG A 1 56 ? 10.128  -1.178  -9.474  1.00 0.00 ? 56  ARG A HH11 11 
ATOM   11006 H  HH12 . ARG A 1 56 ? 11.636  -1.227  -10.326 1.00 0.00 ? 56  ARG A HH12 11 
ATOM   11007 H  HH21 . ARG A 1 56 ? 11.681  2.197   -11.029 1.00 0.00 ? 56  ARG A HH21 11 
ATOM   11008 H  HH22 . ARG A 1 56 ? 12.519  0.693   -11.209 1.00 0.00 ? 56  ARG A HH22 11 
ATOM   11009 N  N    . PRO A 1 57 ? 9.223   3.382   -4.778  1.00 0.00 ? 57  PRO A N    11 
ATOM   11010 C  CA   . PRO A 1 57 ? 10.328  3.907   -3.971  1.00 0.00 ? 57  PRO A CA   11 
ATOM   11011 C  C    . PRO A 1 57 ? 10.767  2.930   -2.885  1.00 0.00 ? 57  PRO A C    11 
ATOM   11012 O  O    . PRO A 1 57 ? 11.890  2.425   -2.907  1.00 0.00 ? 57  PRO A O    11 
ATOM   11013 C  CB   . PRO A 1 57 ? 9.740   5.173   -3.344  1.00 0.00 ? 57  PRO A CB   11 
ATOM   11014 C  CG   . PRO A 1 57 ? 8.672   5.603   -4.290  1.00 0.00 ? 57  PRO A CG   11 
ATOM   11015 C  CD   . PRO A 1 57 ? 8.137   4.363   -4.939  1.00 0.00 ? 57  PRO A CD   11 
ATOM   11016 H  HA   . PRO A 1 57 ? 11.178  4.168   -4.584  1.00 0.00 ? 57  PRO A HA   11 
ATOM   11017 H  HB2  . PRO A 1 57 ? 9.335   4.941   -2.369  1.00 0.00 ? 57  PRO A HB2  11 
ATOM   11018 H  HB3  . PRO A 1 57 ? 10.510  5.924   -3.251  1.00 0.00 ? 57  PRO A HB3  11 
ATOM   11019 H  HG2  . PRO A 1 57 ? 7.883   6.104   -3.750  1.00 0.00 ? 57  PRO A HG2  11 
ATOM   11020 H  HG3  . PRO A 1 57 ? 9.089   6.258   -5.041  1.00 0.00 ? 57  PRO A HG3  11 
ATOM   11021 H  HD2  . PRO A 1 57 ? 7.242   4.034   -4.432  1.00 0.00 ? 57  PRO A HD2  11 
ATOM   11022 H  HD3  . PRO A 1 57 ? 7.935   4.547   -5.984  1.00 0.00 ? 57  PRO A HD3  11 
ATOM   11023 N  N    . CYS A 1 58 ? 9.874   2.667   -1.936  1.00 0.00 ? 58  CYS A N    11 
ATOM   11024 C  CA   . CYS A 1 58 ? 10.169  1.750   -0.842  1.00 0.00 ? 58  CYS A CA   11 
ATOM   11025 C  C    . CYS A 1 58 ? 10.550  0.372   -1.374  1.00 0.00 ? 58  CYS A C    11 
ATOM   11026 O  O    . CYS A 1 58 ? 11.696  -0.060  -1.245  1.00 0.00 ? 58  CYS A O    11 
ATOM   11027 C  CB   . CYS A 1 58 ? 8.962   1.633   0.092   1.00 0.00 ? 58  CYS A CB   11 
ATOM   11028 S  SG   . CYS A 1 58 ? 8.546   3.176   0.966   1.00 0.00 ? 58  CYS A SG   11 
ATOM   11029 H  H    . CYS A 1 58 ? 8.995   3.100   -1.973  1.00 0.00 ? 58  CYS A H    11 
ATOM   11030 H  HA   . CYS A 1 58 ? 11.004  2.152   -0.288  1.00 0.00 ? 58  CYS A HA   11 
ATOM   11031 H  HB2  . CYS A 1 58 ? 8.098   1.340   -0.486  1.00 0.00 ? 58  CYS A HB2  11 
ATOM   11032 H  HB3  . CYS A 1 58 ? 9.165   0.877   0.836   1.00 0.00 ? 58  CYS A HB3  11 
ATOM   11033 N  N    . HIS A 1 59 ? 9.581   -0.314  -1.972  1.00 0.00 ? 59  HIS A N    11 
ATOM   11034 C  CA   . HIS A 1 59 ? 9.815   -1.643  -2.525  1.00 0.00 ? 59  HIS A CA   11 
ATOM   11035 C  C    . HIS A 1 59 ? 11.208  -1.739  -3.139  1.00 0.00 ? 59  HIS A C    11 
ATOM   11036 O  O    . HIS A 1 59 ? 11.932  -2.708  -2.911  1.00 0.00 ? 59  HIS A O    11 
ATOM   11037 C  CB   . HIS A 1 59 ? 8.757   -1.974  -3.578  1.00 0.00 ? 59  HIS A CB   11 
ATOM   11038 C  CG   . HIS A 1 59 ? 8.937   -3.322  -4.206  1.00 0.00 ? 59  HIS A CG   11 
ATOM   11039 N  ND1  . HIS A 1 59 ? 8.821   -4.501  -3.501  1.00 0.00 ? 59  HIS A ND1  11 
ATOM   11040 C  CD2  . HIS A 1 59 ? 9.225   -3.673  -5.481  1.00 0.00 ? 59  HIS A CD2  11 
ATOM   11041 C  CE1  . HIS A 1 59 ? 9.032   -5.520  -4.315  1.00 0.00 ? 59  HIS A CE1  11 
ATOM   11042 N  NE2  . HIS A 1 59 ? 9.278   -5.045  -5.523  1.00 0.00 ? 59  HIS A NE2  11 
ATOM   11043 H  H    . HIS A 1 59 ? 8.689   0.084   -2.044  1.00 0.00 ? 59  HIS A H    11 
ATOM   11044 H  HA   . HIS A 1 59 ? 9.741   -2.356  -1.717  1.00 0.00 ? 59  HIS A HA   11 
ATOM   11045 H  HB2  . HIS A 1 59 ? 7.780   -1.951  -3.117  1.00 0.00 ? 59  HIS A HB2  11 
ATOM   11046 H  HB3  . HIS A 1 59 ? 8.797   -1.233  -4.364  1.00 0.00 ? 59  HIS A HB3  11 
ATOM   11047 H  HD1  . HIS A 1 59 ? 8.617   -4.580  -2.546  1.00 0.00 ? 59  HIS A HD1  11 
ATOM   11048 H  HD2  . HIS A 1 59 ? 9.383   -3.000  -6.312  1.00 0.00 ? 59  HIS A HD2  11 
ATOM   11049 H  HE1  . HIS A 1 59 ? 9.006   -6.564  -4.042  1.00 0.00 ? 59  HIS A HE1  11 
ATOM   11050 H  HE2  . HIS A 1 59 ? 9.552   -5.581  -6.295  1.00 0.00 ? 59  HIS A HE2  11 
ATOM   11051 N  N    . ASN A 1 60 ? 11.577  -0.729  -3.919  1.00 0.00 ? 60  ASN A N    11 
ATOM   11052 C  CA   . ASN A 1 60 ? 12.883  -0.700  -4.567  1.00 0.00 ? 60  ASN A CA   11 
ATOM   11053 C  C    . ASN A 1 60 ? 14.004  -0.745  -3.533  1.00 0.00 ? 60  ASN A C    11 
ATOM   11054 O  O    . ASN A 1 60 ? 15.009  -1.431  -3.722  1.00 0.00 ? 60  ASN A O    11 
ATOM   11055 C  CB   . ASN A 1 60 ? 13.020  0.556   -5.430  1.00 0.00 ? 60  ASN A CB   11 
ATOM   11056 C  CG   . ASN A 1 60 ? 12.359  0.401   -6.786  1.00 0.00 ? 60  ASN A CG   11 
ATOM   11057 O  OD1  . ASN A 1 60 ? 12.585  -0.584  -7.490  1.00 0.00 ? 60  ASN A OD1  11 
ATOM   11058 N  ND2  . ASN A 1 60 ? 11.537  1.375   -7.159  1.00 0.00 ? 60  ASN A ND2  11 
ATOM   11059 H  H    . ASN A 1 60 ? 10.955  0.016   -4.063  1.00 0.00 ? 60  ASN A H    11 
ATOM   11060 H  HA   . ASN A 1 60 ? 12.958  -1.571  -5.201  1.00 0.00 ? 60  ASN A HA   11 
ATOM   11061 H  HB2  . ASN A 1 60 ? 12.558  1.388   -4.920  1.00 0.00 ? 60  ASN A HB2  11 
ATOM   11062 H  HB3  . ASN A 1 60 ? 14.067  0.769   -5.583  1.00 0.00 ? 60  ASN A HB3  11 
ATOM   11063 H  HD21 . ASN A 1 60 ? 11.404  2.128   -6.546  1.00 0.00 ? 60  ASN A HD21 11 
ATOM   11064 H  HD22 . ASN A 1 60 ? 11.096  1.299   -8.030  1.00 0.00 ? 60  ASN A HD22 11 
ATOM   11065 N  N    . ARG A 1 61 ? 13.824  -0.010  -2.441  1.00 0.00 ? 61  ARG A N    11 
ATOM   11066 C  CA   . ARG A 1 61 ? 14.820  0.035   -1.378  1.00 0.00 ? 61  ARG A CA   11 
ATOM   11067 C  C    . ARG A 1 61 ? 14.998  -1.340  -0.741  1.00 0.00 ? 61  ARG A C    11 
ATOM   11068 O  O    . ARG A 1 61 ? 16.103  -1.716  -0.352  1.00 0.00 ? 61  ARG A O    11 
ATOM   11069 C  CB   . ARG A 1 61 ? 14.414  1.054   -0.311  1.00 0.00 ? 61  ARG A CB   11 
ATOM   11070 C  CG   . ARG A 1 61 ? 14.445  2.493   -0.801  1.00 0.00 ? 61  ARG A CG   11 
ATOM   11071 C  CD   . ARG A 1 61 ? 13.916  3.452   0.254   1.00 0.00 ? 61  ARG A CD   11 
ATOM   11072 N  NE   . ARG A 1 61 ? 14.227  4.842   -0.065  1.00 0.00 ? 61  ARG A NE   11 
ATOM   11073 C  CZ   . ARG A 1 61 ? 13.927  5.864   0.730   1.00 0.00 ? 61  ARG A CZ   11 
ATOM   11074 N  NH1  . ARG A 1 61 ? 13.312  5.651   1.885   1.00 0.00 ? 61  ARG A NH1  11 
ATOM   11075 N  NH2  . ARG A 1 61 ? 14.242  7.101   0.370   1.00 0.00 ? 61  ARG A NH2  11 
ATOM   11076 H  H    . ARG A 1 61 ? 13.002  0.516   -2.348  1.00 0.00 ? 61  ARG A H    11 
ATOM   11077 H  HA   . ARG A 1 61 ? 15.759  0.340   -1.815  1.00 0.00 ? 61  ARG A HA   11 
ATOM   11078 H  HB2  . ARG A 1 61 ? 13.410  0.831   0.019   1.00 0.00 ? 61  ARG A HB2  11 
ATOM   11079 H  HB3  . ARG A 1 61 ? 15.088  0.967   0.527   1.00 0.00 ? 61  ARG A HB3  11 
ATOM   11080 H  HG2  . ARG A 1 61 ? 15.464  2.761   -1.036  1.00 0.00 ? 61  ARG A HG2  11 
ATOM   11081 H  HG3  . ARG A 1 61 ? 13.835  2.575   -1.688  1.00 0.00 ? 61  ARG A HG3  11 
ATOM   11082 H  HD2  . ARG A 1 61 ? 12.844  3.338   0.320   1.00 0.00 ? 61  ARG A HD2  11 
ATOM   11083 H  HD3  . ARG A 1 61 ? 14.363  3.201   1.205   1.00 0.00 ? 61  ARG A HD3  11 
ATOM   11084 H  HE   . ARG A 1 61 ? 14.681  5.023   -0.914  1.00 0.00 ? 61  ARG A HE   11 
ATOM   11085 H  HH11 . ARG A 1 61 ? 13.074  4.719   2.159   1.00 0.00 ? 61  ARG A HH11 11 
ATOM   11086 H  HH12 . ARG A 1 61 ? 13.088  6.421   2.482   1.00 0.00 ? 61  ARG A HH12 11 
ATOM   11087 H  HH21 . ARG A 1 61 ? 14.706  7.266   -0.500  1.00 0.00 ? 61  ARG A HH21 11 
ATOM   11088 H  HH22 . ARG A 1 61 ? 14.016  7.869   0.968   1.00 0.00 ? 61  ARG A HH22 11 
ATOM   11089 N  N    . GLU A 1 62 ? 13.901  -2.085  -0.637  1.00 0.00 ? 62  GLU A N    11 
ATOM   11090 C  CA   . GLU A 1 62 ? 13.936  -3.417  -0.046  1.00 0.00 ? 62  GLU A CA   11 
ATOM   11091 C  C    . GLU A 1 62 ? 14.610  -4.412  -0.987  1.00 0.00 ? 62  GLU A C    11 
ATOM   11092 O  O    . GLU A 1 62 ? 15.679  -4.944  -0.685  1.00 0.00 ? 62  GLU A O    11 
ATOM   11093 C  CB   . GLU A 1 62 ? 12.519  -3.891  0.284   1.00 0.00 ? 62  GLU A CB   11 
ATOM   11094 C  CG   . GLU A 1 62 ? 11.661  -2.827  0.948   1.00 0.00 ? 62  GLU A CG   11 
ATOM   11095 C  CD   . GLU A 1 62 ? 11.831  -2.797  2.455   1.00 0.00 ? 62  GLU A CD   11 
ATOM   11096 O  OE1  . GLU A 1 62 ? 12.227  -3.833  3.028   1.00 0.00 ? 62  GLU A OE1  11 
ATOM   11097 O  OE2  . GLU A 1 62 ? 11.566  -1.737  3.060   1.00 0.00 ? 62  GLU A OE2  11 
ATOM   11098 H  H    . GLU A 1 62 ? 13.049  -1.729  -0.965  1.00 0.00 ? 62  GLU A H    11 
ATOM   11099 H  HA   . GLU A 1 62 ? 14.509  -3.360  0.867   1.00 0.00 ? 62  GLU A HA   11 
ATOM   11100 H  HB2  . GLU A 1 62 ? 12.033  -4.198  -0.630  1.00 0.00 ? 62  GLU A HB2  11 
ATOM   11101 H  HB3  . GLU A 1 62 ? 12.583  -4.739  0.950   1.00 0.00 ? 62  GLU A HB3  11 
ATOM   11102 H  HG2  . GLU A 1 62 ? 11.937  -1.861  0.552   1.00 0.00 ? 62  GLU A HG2  11 
ATOM   11103 H  HG3  . GLU A 1 62 ? 10.624  -3.025  0.721   1.00 0.00 ? 62  GLU A HG3  11 
ATOM   11104 N  N    . LYS A 1 63 ? 13.978  -4.659  -2.129  1.00 0.00 ? 63  LYS A N    11 
ATOM   11105 C  CA   . LYS A 1 63 ? 14.514  -5.589  -3.116  1.00 0.00 ? 63  LYS A CA   11 
ATOM   11106 C  C    . LYS A 1 63 ? 15.957  -5.239  -3.465  1.00 0.00 ? 63  LYS A C    11 
ATOM   11107 O  O    . LYS A 1 63 ? 16.764  -6.119  -3.764  1.00 0.00 ? 63  LYS A O    11 
ATOM   11108 C  CB   . LYS A 1 63 ? 13.654  -5.573  -4.382  1.00 0.00 ? 63  LYS A CB   11 
ATOM   11109 C  CG   . LYS A 1 63 ? 13.641  -4.231  -5.091  1.00 0.00 ? 63  LYS A CG   11 
ATOM   11110 C  CD   . LYS A 1 63 ? 12.507  -4.144  -6.099  1.00 0.00 ? 63  LYS A CD   11 
ATOM   11111 C  CE   . LYS A 1 63 ? 12.774  -5.019  -7.315  1.00 0.00 ? 63  LYS A CE   11 
ATOM   11112 N  NZ   . LYS A 1 63 ? 13.716  -4.370  -8.268  1.00 0.00 ? 63  LYS A NZ   11 
ATOM   11113 H  H    . LYS A 1 63 ? 13.129  -4.204  -2.313  1.00 0.00 ? 63  LYS A H    11 
ATOM   11114 H  HA   . LYS A 1 63 ? 14.490  -6.579  -2.686  1.00 0.00 ? 63  LYS A HA   11 
ATOM   11115 H  HB2  . LYS A 1 63 ? 14.032  -6.316  -5.068  1.00 0.00 ? 63  LYS A HB2  11 
ATOM   11116 H  HB3  . LYS A 1 63 ? 12.638  -5.826  -4.115  1.00 0.00 ? 63  LYS A HB3  11 
ATOM   11117 H  HG2  . LYS A 1 63 ? 13.517  -3.447  -4.359  1.00 0.00 ? 63  LYS A HG2  11 
ATOM   11118 H  HG3  . LYS A 1 63 ? 14.581  -4.097  -5.608  1.00 0.00 ? 63  LYS A HG3  11 
ATOM   11119 H  HD2  . LYS A 1 63 ? 11.592  -4.472  -5.628  1.00 0.00 ? 63  LYS A HD2  11 
ATOM   11120 H  HD3  . LYS A 1 63 ? 12.400  -3.118  -6.421  1.00 0.00 ? 63  LYS A HD3  11 
ATOM   11121 H  HE2  . LYS A 1 63 ? 13.198  -5.954  -6.983  1.00 0.00 ? 63  LYS A HE2  11 
ATOM   11122 H  HE3  . LYS A 1 63 ? 11.837  -5.207  -7.819  1.00 0.00 ? 63  LYS A HE3  11 
ATOM   11123 H  HZ1  . LYS A 1 63 ? 14.679  -4.370  -7.874  1.00 0.00 ? 63  LYS A HZ1  11 
ATOM   11124 H  HZ2  . LYS A 1 63 ? 13.426  -3.387  -8.444  1.00 0.00 ? 63  LYS A HZ2  11 
ATOM   11125 H  HZ3  . LYS A 1 63 ? 13.722  -4.886  -9.171  1.00 0.00 ? 63  LYS A HZ3  11 
ATOM   11126 N  N    . ALA A 1 64 ? 16.276  -3.949  -3.423  1.00 0.00 ? 64  ALA A N    11 
ATOM   11127 C  CA   . ALA A 1 64 ? 17.622  -3.484  -3.731  1.00 0.00 ? 64  ALA A CA   11 
ATOM   11128 C  C    . ALA A 1 64 ? 18.672  -4.338  -3.029  1.00 0.00 ? 64  ALA A C    11 
ATOM   11129 O  O    . ALA A 1 64 ? 18.871  -4.224  -1.819  1.00 0.00 ? 64  ALA A O    11 
ATOM   11130 C  CB   . ALA A 1 64 ? 17.779  -2.023  -3.338  1.00 0.00 ? 64  ALA A CB   11 
ATOM   11131 H  H    . ALA A 1 64 ? 15.589  -3.295  -3.178  1.00 0.00 ? 64  ALA A H    11 
ATOM   11132 H  HA   . ALA A 1 64 ? 17.766  -3.562  -4.799  1.00 0.00 ? 64  ALA A HA   11 
ATOM   11133 H  HB1  . ALA A 1 64 ? 16.945  -1.726  -2.719  1.00 0.00 ? 64  ALA A HB1  11 
ATOM   11134 H  HB2  . ALA A 1 64 ? 18.700  -1.895  -2.789  1.00 0.00 ? 64  ALA A HB2  11 
ATOM   11135 H  HB3  . ALA A 1 64 ? 17.802  -1.412  -4.228  1.00 0.00 ? 64  ALA A HB3  11 
ATOM   11136 N  N    . SER A 1 65 ? 19.341  -5.195  -3.794  1.00 0.00 ? 65  SER A N    11 
ATOM   11137 C  CA   . SER A 1 65 ? 20.367  -6.072  -3.244  1.00 0.00 ? 65  SER A CA   11 
ATOM   11138 C  C    . SER A 1 65 ? 21.655  -5.299  -2.975  1.00 0.00 ? 65  SER A C    11 
ATOM   11139 O  O    . SER A 1 65 ? 22.074  -5.149  -1.828  1.00 0.00 ? 65  SER A O    11 
ATOM   11140 C  CB   . SER A 1 65 ? 20.646  -7.231  -4.203  1.00 0.00 ? 65  SER A CB   11 
ATOM   11141 O  OG   . SER A 1 65 ? 21.343  -8.278  -3.549  1.00 0.00 ? 65  SER A OG   11 
ATOM   11142 H  H    . SER A 1 65 ? 19.136  -5.240  -4.752  1.00 0.00 ? 65  SER A H    11 
ATOM   11143 H  HA   . SER A 1 65 ? 19.998  -6.469  -2.310  1.00 0.00 ? 65  SER A HA   11 
ATOM   11144 H  HB2  . SER A 1 65 ? 19.710  -7.618  -4.578  1.00 0.00 ? 65  SER A HB2  11 
ATOM   11145 H  HB3  . SER A 1 65 ? 21.245  -6.875  -5.028  1.00 0.00 ? 65  SER A HB3  11 
ATOM   11146 H  HG   . SER A 1 65 ? 20.936  -9.119  -3.768  1.00 0.00 ? 65  SER A HG   11 
ATOM   11147 N  N    . GLY A 1 66 ? 22.278  -4.810  -4.043  1.00 0.00 ? 66  GLY A N    11 
ATOM   11148 C  CA   . GLY A 1 66 ? 23.512  -4.059  -3.902  1.00 0.00 ? 66  GLY A CA   11 
ATOM   11149 C  C    . GLY A 1 66 ? 24.742  -4.930  -4.056  1.00 0.00 ? 66  GLY A C    11 
ATOM   11150 O  O    . GLY A 1 66 ? 24.670  -6.158  -4.003  1.00 0.00 ? 66  GLY A O    11 
ATOM   11151 H  H    . GLY A 1 66 ? 21.897  -4.961  -4.933  1.00 0.00 ? 66  GLY A H    11 
ATOM   11152 H  HA2  . GLY A 1 66 ? 23.536  -3.283  -4.653  1.00 0.00 ? 66  GLY A HA2  11 
ATOM   11153 H  HA3  . GLY A 1 66 ? 23.531  -3.599  -2.924  1.00 0.00 ? 66  GLY A HA3  11 
ATOM   11154 N  N    . PRO A 1 67 ? 25.904  -4.290  -4.254  1.00 0.00 ? 67  PRO A N    11 
ATOM   11155 C  CA   . PRO A 1 67 ? 27.178  -4.996  -4.422  1.00 0.00 ? 67  PRO A CA   11 
ATOM   11156 C  C    . PRO A 1 67 ? 27.649  -5.657  -3.131  1.00 0.00 ? 67  PRO A C    11 
ATOM   11157 O  O    . PRO A 1 67 ? 26.941  -5.650  -2.124  1.00 0.00 ? 67  PRO A O    11 
ATOM   11158 C  CB   . PRO A 1 67 ? 28.146  -3.886  -4.839  1.00 0.00 ? 67  PRO A CB   11 
ATOM   11159 C  CG   . PRO A 1 67 ? 27.555  -2.638  -4.280  1.00 0.00 ? 67  PRO A CG   11 
ATOM   11160 C  CD   . PRO A 1 67 ? 26.065  -2.828  -4.328  1.00 0.00 ? 67  PRO A CD   11 
ATOM   11161 H  HA   . PRO A 1 67 ? 27.120  -5.738  -5.205  1.00 0.00 ? 67  PRO A HA   11 
ATOM   11162 H  HB2  . PRO A 1 67 ? 29.124  -4.083  -4.421  1.00 0.00 ? 67  PRO A HB2  11 
ATOM   11163 H  HB3  . PRO A 1 67 ? 28.210  -3.845  -5.915  1.00 0.00 ? 67  PRO A HB3  11 
ATOM   11164 H  HG2  . PRO A 1 67 ? 27.883  -2.501  -3.260  1.00 0.00 ? 67  PRO A HG2  11 
ATOM   11165 H  HG3  . PRO A 1 67 ? 27.845  -1.792  -4.885  1.00 0.00 ? 67  PRO A HG3  11 
ATOM   11166 H  HD2  . PRO A 1 67 ? 25.595  -2.345  -3.484  1.00 0.00 ? 67  PRO A HD2  11 
ATOM   11167 H  HD3  . PRO A 1 67 ? 25.665  -2.444  -5.256  1.00 0.00 ? 67  PRO A HD3  11 
ATOM   11168 N  N    . SER A 1 68 ? 28.849  -6.227  -3.167  1.00 0.00 ? 68  SER A N    11 
ATOM   11169 C  CA   . SER A 1 68 ? 29.413  -6.896  -2.000  1.00 0.00 ? 68  SER A CA   11 
ATOM   11170 C  C    . SER A 1 68 ? 30.776  -6.309  -1.644  1.00 0.00 ? 68  SER A C    11 
ATOM   11171 O  O    . SER A 1 68 ? 31.302  -5.454  -2.357  1.00 0.00 ? 68  SER A O    11 
ATOM   11172 C  CB   . SER A 1 68 ? 29.545  -8.398  -2.261  1.00 0.00 ? 68  SER A CB   11 
ATOM   11173 O  OG   . SER A 1 68 ? 30.422  -8.653  -3.344  1.00 0.00 ? 68  SER A OG   11 
ATOM   11174 H  H    . SER A 1 68 ? 29.366  -6.200  -3.999  1.00 0.00 ? 68  SER A H    11 
ATOM   11175 H  HA   . SER A 1 68 ? 28.739  -6.741  -1.171  1.00 0.00 ? 68  SER A HA   11 
ATOM   11176 H  HB2  . SER A 1 68 ? 29.934  -8.881  -1.377  1.00 0.00 ? 68  SER A HB2  11 
ATOM   11177 H  HB3  . SER A 1 68 ? 28.572  -8.806  -2.496  1.00 0.00 ? 68  SER A HB3  11 
ATOM   11178 H  HG   . SER A 1 68 ? 31.331  -8.610  -3.038  1.00 0.00 ? 68  SER A HG   11 
ATOM   11179 N  N    . SER A 1 69 ? 31.342  -6.775  -0.535  1.00 0.00 ? 69  SER A N    11 
ATOM   11180 C  CA   . SER A 1 69 ? 32.641  -6.294  -0.080  1.00 0.00 ? 69  SER A CA   11 
ATOM   11181 C  C    . SER A 1 69 ? 33.771  -6.969  -0.852  1.00 0.00 ? 69  SER A C    11 
ATOM   11182 O  O    . SER A 1 69 ? 33.630  -8.099  -1.318  1.00 0.00 ? 69  SER A O    11 
ATOM   11183 C  CB   . SER A 1 69 ? 32.808  -6.550  1.419   1.00 0.00 ? 69  SER A CB   11 
ATOM   11184 O  OG   . SER A 1 69 ? 32.259  -5.490  2.182   1.00 0.00 ? 69  SER A OG   11 
ATOM   11185 H  H    . SER A 1 69 ? 30.873  -7.456  -0.009  1.00 0.00 ? 69  SER A H    11 
ATOM   11186 H  HA   . SER A 1 69 ? 32.683  -5.230  -0.262  1.00 0.00 ? 69  SER A HA   11 
ATOM   11187 H  HB2  . SER A 1 69 ? 32.302  -7.467  1.683   1.00 0.00 ? 69  SER A HB2  11 
ATOM   11188 H  HB3  . SER A 1 69 ? 33.859  -6.639  1.651   1.00 0.00 ? 69  SER A HB3  11 
ATOM   11189 H  HG   . SER A 1 69 ? 31.349  -5.697  2.409   1.00 0.00 ? 69  SER A HG   11 
ATOM   11190 N  N    . GLY A 1 70 ? 34.893  -6.268  -0.982  1.00 0.00 ? 70  GLY A N    11 
ATOM   11191 C  CA   . GLY A 1 70 ? 36.031  -6.814  -1.698  1.00 0.00 ? 70  GLY A CA   11 
ATOM   11192 C  C    . GLY A 1 70 ? 37.062  -7.424  -0.768  1.00 0.00 ? 70  GLY A C    11 
ATOM   11193 O  O    . GLY A 1 70 ? 37.828  -8.281  -1.204  1.00 0.00 ? 70  GLY A O    11 
ATOM   11194 H  H    . GLY A 1 70 ? 34.948  -5.371  -0.589  1.00 0.00 ? 70  GLY A H    11 
ATOM   11195 H  HA2  . GLY A 1 70 ? 35.682  -7.575  -2.380  1.00 0.00 ? 70  GLY A HA2  11 
ATOM   11196 H  HA3  . GLY A 1 70 ? 36.498  -6.023  -2.266  1.00 0.00 ? 70  GLY A HA3  11 
HETATM 11197 ZN ZN   . ZN  B 2 .  ? -11.309 4.183   2.458   1.00 0.00 ? 201 ZN  A ZN   11 
HETATM 11198 ZN ZN   . ZN  C 2 .  ? 6.650   3.628   0.329   1.00 0.00 ? 401 ZN  A ZN   11 
ATOM   11199 N  N    . GLY A 1 1  ? -18.297 -14.656 -7.843  1.00 0.00 ? 1   GLY A N    12 
ATOM   11200 C  CA   . GLY A 1 1  ? -18.842 -14.781 -9.183  1.00 0.00 ? 1   GLY A CA   12 
ATOM   11201 C  C    . GLY A 1 1  ? -19.204 -13.439 -9.788  1.00 0.00 ? 1   GLY A C    12 
ATOM   11202 O  O    . GLY A 1 1  ? -18.473 -12.910 -10.625 1.00 0.00 ? 1   GLY A O    12 
ATOM   11203 H  H1   . GLY A 1 1  ? -17.465 -15.118 -7.610  1.00 0.00 ? 1   GLY A H1   12 
ATOM   11204 H  HA2  . GLY A 1 1  ? -18.111 -15.263 -9.814  1.00 0.00 ? 1   GLY A HA2  12 
ATOM   11205 H  HA3  . GLY A 1 1  ? -19.730 -15.395 -9.142  1.00 0.00 ? 1   GLY A HA3  12 
ATOM   11206 N  N    . SER A 1 2  ? -20.337 -12.887 -9.366  1.00 0.00 ? 2   SER A N    12 
ATOM   11207 C  CA   . SER A 1 2  ? -20.798 -11.601 -9.876  1.00 0.00 ? 2   SER A CA   12 
ATOM   11208 C  C    . SER A 1 2  ? -20.457 -10.477 -8.903  1.00 0.00 ? 2   SER A C    12 
ATOM   11209 O  O    . SER A 1 2  ? -20.810 -10.532 -7.725  1.00 0.00 ? 2   SER A O    12 
ATOM   11210 C  CB   . SER A 1 2  ? -22.308 -11.638 -10.122 1.00 0.00 ? 2   SER A CB   12 
ATOM   11211 O  OG   . SER A 1 2  ? -23.004 -12.054 -8.961  1.00 0.00 ? 2   SER A OG   12 
ATOM   11212 H  H    . SER A 1 2  ? -20.877 -13.358 -8.696  1.00 0.00 ? 2   SER A H    12 
ATOM   11213 H  HA   . SER A 1 2  ? -20.293 -11.416 -10.812 1.00 0.00 ? 2   SER A HA   12 
ATOM   11214 H  HB2  . SER A 1 2  ? -22.649 -10.652 -10.398 1.00 0.00 ? 2   SER A HB2  12 
ATOM   11215 H  HB3  . SER A 1 2  ? -22.522 -12.330 -10.924 1.00 0.00 ? 2   SER A HB3  12 
ATOM   11216 H  HG   . SER A 1 2  ? -23.484 -11.309 -8.591  1.00 0.00 ? 2   SER A HG   12 
ATOM   11217 N  N    . SER A 1 3  ? -19.769 -9.457  -9.405  1.00 0.00 ? 3   SER A N    12 
ATOM   11218 C  CA   . SER A 1 3  ? -19.376 -8.320  -8.580  1.00 0.00 ? 3   SER A CA   12 
ATOM   11219 C  C    . SER A 1 3  ? -20.491 -7.281  -8.521  1.00 0.00 ? 3   SER A C    12 
ATOM   11220 O  O    . SER A 1 3  ? -21.079 -6.925  -9.542  1.00 0.00 ? 3   SER A O    12 
ATOM   11221 C  CB   . SER A 1 3  ? -18.098 -7.683  -9.128  1.00 0.00 ? 3   SER A CB   12 
ATOM   11222 O  OG   . SER A 1 3  ? -18.299 -7.181  -10.438 1.00 0.00 ? 3   SER A OG   12 
ATOM   11223 H  H    . SER A 1 3  ? -19.517 -9.470  -10.352 1.00 0.00 ? 3   SER A H    12 
ATOM   11224 H  HA   . SER A 1 3  ? -19.187 -8.685  -7.581  1.00 0.00 ? 3   SER A HA   12 
ATOM   11225 H  HB2  . SER A 1 3  ? -17.801 -6.868  -8.485  1.00 0.00 ? 3   SER A HB2  12 
ATOM   11226 H  HB3  . SER A 1 3  ? -17.313 -8.424  -9.156  1.00 0.00 ? 3   SER A HB3  12 
ATOM   11227 H  HG   . SER A 1 3  ? -17.450 -7.063  -10.870 1.00 0.00 ? 3   SER A HG   12 
ATOM   11228 N  N    . GLY A 1 4  ? -20.777 -6.796  -7.316  1.00 0.00 ? 4   GLY A N    12 
ATOM   11229 C  CA   . GLY A 1 4  ? -21.821 -5.802  -7.145  1.00 0.00 ? 4   GLY A CA   12 
ATOM   11230 C  C    . GLY A 1 4  ? -21.376 -4.636  -6.284  1.00 0.00 ? 4   GLY A C    12 
ATOM   11231 O  O    . GLY A 1 4  ? -20.806 -3.668  -6.786  1.00 0.00 ? 4   GLY A O    12 
ATOM   11232 H  H    . GLY A 1 4  ? -20.276 -7.116  -6.537  1.00 0.00 ? 4   GLY A H    12 
ATOM   11233 H  HA2  . GLY A 1 4  ? -22.111 -5.430  -8.116  1.00 0.00 ? 4   GLY A HA2  12 
ATOM   11234 H  HA3  . GLY A 1 4  ? -22.676 -6.271  -6.680  1.00 0.00 ? 4   GLY A HA3  12 
ATOM   11235 N  N    . SER A 1 5  ? -21.638 -4.728  -4.985  1.00 0.00 ? 5   SER A N    12 
ATOM   11236 C  CA   . SER A 1 5  ? -21.266 -3.670  -4.053  1.00 0.00 ? 5   SER A CA   12 
ATOM   11237 C  C    . SER A 1 5  ? -19.758 -3.436  -4.072  1.00 0.00 ? 5   SER A C    12 
ATOM   11238 O  O    . SER A 1 5  ? -18.972 -4.382  -4.116  1.00 0.00 ? 5   SER A O    12 
ATOM   11239 C  CB   . SER A 1 5  ? -21.720 -4.026  -2.636  1.00 0.00 ? 5   SER A CB   12 
ATOM   11240 O  OG   . SER A 1 5  ? -23.134 -4.020  -2.537  1.00 0.00 ? 5   SER A OG   12 
ATOM   11241 H  H    . SER A 1 5  ? -22.096 -5.526  -4.645  1.00 0.00 ? 5   SER A H    12 
ATOM   11242 H  HA   . SER A 1 5  ? -21.763 -2.764  -4.365  1.00 0.00 ? 5   SER A HA   12 
ATOM   11243 H  HB2  . SER A 1 5  ? -21.357 -5.010  -2.381  1.00 0.00 ? 5   SER A HB2  12 
ATOM   11244 H  HB3  . SER A 1 5  ? -21.320 -3.302  -1.941  1.00 0.00 ? 5   SER A HB3  12 
ATOM   11245 H  HG   . SER A 1 5  ? -23.516 -4.046  -3.418  1.00 0.00 ? 5   SER A HG   12 
ATOM   11246 N  N    . SER A 1 6  ? -19.363 -2.167  -4.039  1.00 0.00 ? 6   SER A N    12 
ATOM   11247 C  CA   . SER A 1 6  ? -17.950 -1.806  -4.056  1.00 0.00 ? 6   SER A CA   12 
ATOM   11248 C  C    . SER A 1 6  ? -17.614 -0.870  -2.899  1.00 0.00 ? 6   SER A C    12 
ATOM   11249 O  O    . SER A 1 6  ? -18.010 0.294   -2.893  1.00 0.00 ? 6   SER A O    12 
ATOM   11250 C  CB   . SER A 1 6  ? -17.588 -1.142  -5.386  1.00 0.00 ? 6   SER A CB   12 
ATOM   11251 O  OG   . SER A 1 6  ? -18.490 -0.094  -5.695  1.00 0.00 ? 6   SER A OG   12 
ATOM   11252 H  H    . SER A 1 6  ? -20.038 -1.457  -4.004  1.00 0.00 ? 6   SER A H    12 
ATOM   11253 H  HA   . SER A 1 6  ? -17.375 -2.714  -3.948  1.00 0.00 ? 6   SER A HA   12 
ATOM   11254 H  HB2  . SER A 1 6  ? -16.590 -0.734  -5.322  1.00 0.00 ? 6   SER A HB2  12 
ATOM   11255 H  HB3  . SER A 1 6  ? -17.626 -1.879  -6.175  1.00 0.00 ? 6   SER A HB3  12 
ATOM   11256 H  HG   . SER A 1 6  ? -19.145 -0.411  -6.322  1.00 0.00 ? 6   SER A HG   12 
ATOM   11257 N  N    . GLY A 1 7  ? -16.880 -1.389  -1.920  1.00 0.00 ? 7   GLY A N    12 
ATOM   11258 C  CA   . GLY A 1 7  ? -16.502 -0.588  -0.770  1.00 0.00 ? 7   GLY A CA   12 
ATOM   11259 C  C    . GLY A 1 7  ? -15.021 -0.678  -0.462  1.00 0.00 ? 7   GLY A C    12 
ATOM   11260 O  O    . GLY A 1 7  ? -14.390 -1.708  -0.703  1.00 0.00 ? 7   GLY A O    12 
ATOM   11261 H  H    . GLY A 1 7  ? -16.592 -2.325  -1.978  1.00 0.00 ? 7   GLY A H    12 
ATOM   11262 H  HA2  . GLY A 1 7  ? -16.757 0.443   -0.965  1.00 0.00 ? 7   GLY A HA2  12 
ATOM   11263 H  HA3  . GLY A 1 7  ? -17.058 -0.929  0.090   1.00 0.00 ? 7   GLY A HA3  12 
ATOM   11264 N  N    . CYS A 1 8  ? -14.462 0.404   0.071   1.00 0.00 ? 8   CYS A N    12 
ATOM   11265 C  CA   . CYS A 1 8  ? -13.045 0.445   0.411   1.00 0.00 ? 8   CYS A CA   12 
ATOM   11266 C  C    . CYS A 1 8  ? -12.712 -0.593  1.478   1.00 0.00 ? 8   CYS A C    12 
ATOM   11267 O  O    . CYS A 1 8  ? -13.524 -0.877  2.359   1.00 0.00 ? 8   CYS A O    12 
ATOM   11268 C  CB   . CYS A 1 8  ? -12.657 1.841   0.903   1.00 0.00 ? 8   CYS A CB   12 
ATOM   11269 S  SG   . CYS A 1 8  ? -11.051