data_2D99
# 
_entry.id   2D99 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D99         
RCSB  RCSB025144   
WWPDB D_1000025144 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hso002000922.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D99 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-09 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Doi-Katayama, Y.'                                       1 
'Hirota, H.'                                             2 
'Tochio, N.'                                             3 
'Koshiba, S.'                                            4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of RSGI RUH-048, a GTF2I domain in human cDNA' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Doi-Katayama, Y.' 1 
primary 'Hirota, H.'       2 
primary 'Tochio, N.'       3 
primary 'Koshiba, S.'      4 
primary 'Kigawa, T.'       5 
primary 'Yokoyama, S.'     6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'General transcription factor II-I repeat domain-containing protein 1' 
_entity.formula_weight             9848.354 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'GTF2I domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;GTF2I repeat domain containing protein 1; Muscle TFII-I repeat domain-containing protein 1; General transcription factor III; Slow-muscle-fiber enhancer binding protein; USE B1 binding protein; MusTRD1/BEN; Williams-Beuren syndrome chromosome region 11 protein; RSGI RUH-048, a GTF2I domain in human cDNA
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKL
KRPSSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGLRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKL
KRPSSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hso002000922.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  LEU n 
1 9  ARG n 
1 10 LYS n 
1 11 MET n 
1 12 VAL n 
1 13 GLU n 
1 14 GLU n 
1 15 VAL n 
1 16 PHE n 
1 17 ASP n 
1 18 VAL n 
1 19 LEU n 
1 20 TYR n 
1 21 SER n 
1 22 GLU n 
1 23 ALA n 
1 24 LEU n 
1 25 GLY n 
1 26 ARG n 
1 27 ALA n 
1 28 SER n 
1 29 VAL n 
1 30 VAL n 
1 31 PRO n 
1 32 LEU n 
1 33 PRO n 
1 34 TYR n 
1 35 GLU n 
1 36 ARG n 
1 37 LEU n 
1 38 LEU n 
1 39 ARG n 
1 40 GLU n 
1 41 PRO n 
1 42 GLY n 
1 43 LEU n 
1 44 LEU n 
1 45 ALA n 
1 46 VAL n 
1 47 GLN n 
1 48 GLY n 
1 49 LEU n 
1 50 PRO n 
1 51 GLU n 
1 52 GLY n 
1 53 LEU n 
1 54 ALA n 
1 55 PHE n 
1 56 ARG n 
1 57 ARG n 
1 58 PRO n 
1 59 ALA n 
1 60 GLU n 
1 61 TYR n 
1 62 ASP n 
1 63 PRO n 
1 64 LYS n 
1 65 ALA n 
1 66 LEU n 
1 67 MET n 
1 68 ALA n 
1 69 ILE n 
1 70 LEU n 
1 71 GLU n 
1 72 HIS n 
1 73 SER n 
1 74 HIS n 
1 75 ARG n 
1 76 ILE n 
1 77 ARG n 
1 78 PHE n 
1 79 LYS n 
1 80 LEU n 
1 81 LYS n 
1 82 ARG n 
1 83 PRO n 
1 84 SER n 
1 85 SER n 
1 86 GLY n 
1 87 PRO n 
1 88 SER n 
1 89 SER n 
1 90 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 NP005676 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050131-11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis(E. coli)' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GT2D1_HUMAN 
_struct_ref.pdbx_db_accession          Q9UHL9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LRKMVEEVFDVLYSEALGRASVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKLKRP 
_struct_ref.pdbx_align_begin           128 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2D99 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 83 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UHL9 
_struct_ref_seq.db_align_beg                  128 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  203 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       83 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2D99 GLY A 1  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 1  1  
1 2D99 SER A 2  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 2  2  
1 2D99 SER A 3  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 3  3  
1 2D99 GLY A 4  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 4  4  
1 2D99 SER A 5  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 5  5  
1 2D99 SER A 6  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 6  6  
1 2D99 GLY A 7  ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 7  7  
1 2D99 SER A 84 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 84 8  
1 2D99 SER A 85 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 85 9  
1 2D99 GLY A 86 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 86 10 
1 2D99 PRO A 87 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 87 11 
1 2D99 SER A 88 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 88 12 
1 2D99 SER A 89 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 89 13 
1 2D99 GLY A 90 ? UNP Q9UHL9 ? ? 'CLONING ARTIFACT' 90 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '120mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.43mM GTF2I domain U-15N, 13C; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2D99 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2D99 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2D99 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker          1 
processing           NMRPipe 20020425 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.9315   'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2D99 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2D99 
_struct.title                     'Solution Structure of RSGI RUH-048, a GTF2I domain in human cDNA' 
_struct.pdbx_descriptor           'General transcription factor II-I repeat domain-containing protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D99 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;TRANSCRIPTION FACTOR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 8  ? ALA A 23 ? LEU A 8  ALA A 23 1 ? 16 
HELX_P HELX_P2 2 TYR A 34 ? ARG A 39 ? TYR A 34 ARG A 39 1 ? 6  
HELX_P HELX_P3 3 PRO A 63 ? HIS A 72 ? PRO A 63 HIS A 72 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 44 ? GLN A 47 ? LEU A 44 GLN A 47 
A 2 ARG A 77 ? LEU A 80 ? ARG A 77 LEU A 80 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   GLN 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    47 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    GLN 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     47 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    77 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     77 
# 
_database_PDB_matrix.entry_id          2D99 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D99 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 8.224   -22.278 3.032   1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 9.310   -21.880 2.152   1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 9.973   -20.594 2.647   1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 10.195  -20.426 3.845   1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 8.509   -22.725 3.879   1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? 10.050  -22.678 2.098   1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? 8.929   -21.731 1.142   1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? 10.273  -19.718 1.699   1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? 10.907  -18.451 2.023   1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? 10.171  -17.304 1.328   1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? 9.434   -17.527 0.368   1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? 12.383  -18.455 1.622   1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? 13.168  -19.276 2.484   1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? 10.090  -19.862 0.727   1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? 10.825  -18.357 3.106   1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB3  . SER A 1 2  ? 12.768  -17.436 1.643   1.00 0.00 ? 2  SER A HB3  1  
ATOM 17    H HG   . SER A 1 2  ? 13.574  -18.719 3.210   1.00 0.00 ? 2  SER A HG   1  
ATOM 18    N N    . SER A 1 3  ? 10.398  -16.103 1.837   1.00 0.00 ? 3  SER A N    1  
ATOM 19    C CA   . SER A 1 3  ? 9.766   -14.920 1.277   1.00 0.00 ? 3  SER A CA   1  
ATOM 20    C C    . SER A 1 3  ? 10.467  -13.660 1.786   1.00 0.00 ? 3  SER A C    1  
ATOM 21    O O    . SER A 1 3  ? 10.371  -13.325 2.966   1.00 0.00 ? 3  SER A O    1  
ATOM 22    C CB   . SER A 1 3  ? 8.276   -14.875 1.624   1.00 0.00 ? 3  SER A CB   1  
ATOM 23    O OG   . SER A 1 3  ? 8.058   -14.749 3.026   1.00 0.00 ? 3  SER A OG   1  
ATOM 24    H H    . SER A 1 3  ? 11.000  -15.930 2.618   1.00 0.00 ? 3  SER A H    1  
ATOM 25    H HA   . SER A 1 3  ? 9.884   -15.014 0.197   1.00 0.00 ? 3  SER A HA   1  
ATOM 26    H HB3  . SER A 1 3  ? 7.792   -15.782 1.262   1.00 0.00 ? 3  SER A HB3  1  
ATOM 27    H HG   . SER A 1 3  ? 8.623   -14.011 3.395   1.00 0.00 ? 3  SER A HG   1  
ATOM 28    N N    . GLY A 1 4  ? 11.160  -12.996 0.872   1.00 0.00 ? 4  GLY A N    1  
ATOM 29    C CA   . GLY A 1 4  ? 11.878  -11.780 1.215   1.00 0.00 ? 4  GLY A CA   1  
ATOM 30    C C    . GLY A 1 4  ? 12.850  -12.024 2.371   1.00 0.00 ? 4  GLY A C    1  
ATOM 31    O O    . GLY A 1 4  ? 12.866  -13.107 2.954   1.00 0.00 ? 4  GLY A O    1  
ATOM 32    H H    . GLY A 1 4  ? 11.235  -13.276 -0.085  1.00 0.00 ? 4  GLY A H    1  
ATOM 33    H HA2  . GLY A 1 4  ? 12.426  -11.420 0.344   1.00 0.00 ? 4  GLY A HA2  1  
ATOM 34    H HA3  . GLY A 1 4  ? 11.168  -11.000 1.489   1.00 0.00 ? 4  GLY A HA3  1  
ATOM 35    N N    . SER A 1 5  ? 13.636  -11.000 2.666   1.00 0.00 ? 5  SER A N    1  
ATOM 36    C CA   . SER A 1 5  ? 14.609  -11.089 3.743   1.00 0.00 ? 5  SER A CA   1  
ATOM 37    C C    . SER A 1 5  ? 15.236  -9.717  3.998   1.00 0.00 ? 5  SER A C    1  
ATOM 38    O O    . SER A 1 5  ? 16.354  -9.451  3.560   1.00 0.00 ? 5  SER A O    1  
ATOM 39    C CB   . SER A 1 5  ? 15.695  -12.117 3.420   1.00 0.00 ? 5  SER A CB   1  
ATOM 40    O OG   . SER A 1 5  ? 15.905  -13.028 4.496   1.00 0.00 ? 5  SER A OG   1  
ATOM 41    H H    . SER A 1 5  ? 13.616  -10.123 2.187   1.00 0.00 ? 5  SER A H    1  
ATOM 42    H HA   . SER A 1 5  ? 14.045  -11.420 4.615   1.00 0.00 ? 5  SER A HA   1  
ATOM 43    H HB3  . SER A 1 5  ? 16.627  -11.601 3.194   1.00 0.00 ? 5  SER A HB3  1  
ATOM 44    H HG   . SER A 1 5  ? 16.058  -13.950 4.138   1.00 0.00 ? 5  SER A HG   1  
ATOM 45    N N    . SER A 1 6  ? 14.488  -8.882  4.704   1.00 0.00 ? 6  SER A N    1  
ATOM 46    C CA   . SER A 1 6  ? 14.957  -7.544  5.022   1.00 0.00 ? 6  SER A CA   1  
ATOM 47    C C    . SER A 1 6  ? 15.167  -6.744  3.736   1.00 0.00 ? 6  SER A C    1  
ATOM 48    O O    . SER A 1 6  ? 16.151  -6.948  3.027   1.00 0.00 ? 6  SER A O    1  
ATOM 49    C CB   . SER A 1 6  ? 16.251  -7.593  5.835   1.00 0.00 ? 6  SER A CB   1  
ATOM 50    O OG   . SER A 1 6  ? 16.006  -7.832  7.217   1.00 0.00 ? 6  SER A OG   1  
ATOM 51    H H    . SER A 1 6  ? 13.579  -9.107  5.057   1.00 0.00 ? 6  SER A H    1  
ATOM 52    H HA   . SER A 1 6  ? 14.167  -7.098  5.625   1.00 0.00 ? 6  SER A HA   1  
ATOM 53    H HB3  . SER A 1 6  ? 16.788  -6.650  5.720   1.00 0.00 ? 6  SER A HB3  1  
ATOM 54    H HG   . SER A 1 6  ? 16.838  -7.667  7.747   1.00 0.00 ? 6  SER A HG   1  
ATOM 55    N N    . GLY A 1 7  ? 14.226  -5.850  3.472   1.00 0.00 ? 7  GLY A N    1  
ATOM 56    C CA   . GLY A 1 7  ? 14.295  -5.018  2.282   1.00 0.00 ? 7  GLY A CA   1  
ATOM 57    C C    . GLY A 1 7  ? 13.348  -3.822  2.393   1.00 0.00 ? 7  GLY A C    1  
ATOM 58    O O    . GLY A 1 7  ? 12.177  -3.982  2.734   1.00 0.00 ? 7  GLY A O    1  
ATOM 59    H H    . GLY A 1 7  ? 13.427  -5.690  4.053   1.00 0.00 ? 7  GLY A H    1  
ATOM 60    H HA2  . GLY A 1 7  ? 15.317  -4.665  2.140   1.00 0.00 ? 7  GLY A HA2  1  
ATOM 61    H HA3  . GLY A 1 7  ? 14.038  -5.610  1.404   1.00 0.00 ? 7  GLY A HA3  1  
ATOM 62    N N    . LEU A 1 8  ? 13.890  -2.649  2.098   1.00 0.00 ? 8  LEU A N    1  
ATOM 63    C CA   . LEU A 1 8  ? 13.107  -1.426  2.160   1.00 0.00 ? 8  LEU A CA   1  
ATOM 64    C C    . LEU A 1 8  ? 11.819  -1.609  1.354   1.00 0.00 ? 8  LEU A C    1  
ATOM 65    O O    . LEU A 1 8  ? 10.723  -1.415  1.877   1.00 0.00 ? 8  LEU A O    1  
ATOM 66    C CB   . LEU A 1 8  ? 13.947  -0.229  1.713   1.00 0.00 ? 8  LEU A CB   1  
ATOM 67    C CG   . LEU A 1 8  ? 14.736  0.485   2.813   1.00 0.00 ? 8  LEU A CG   1  
ATOM 68    C CD1  . LEU A 1 8  ? 15.267  1.833   2.320   1.00 0.00 ? 8  LEU A CD1  1  
ATOM 69    C CD2  . LEU A 1 8  ? 13.895  0.632   4.083   1.00 0.00 ? 8  LEU A CD2  1  
ATOM 70    H H    . LEU A 1 8  ? 14.843  -2.527  1.821   1.00 0.00 ? 8  LEU A H    1  
ATOM 71    H HA   . LEU A 1 8  ? 12.841  -1.262  3.204   1.00 0.00 ? 8  LEU A HA   1  
ATOM 72    H HB3  . LEU A 1 8  ? 13.287  0.496   1.238   1.00 0.00 ? 8  LEU A HB3  1  
ATOM 73    H HG   . LEU A 1 8  ? 15.599  -0.128  3.068   1.00 0.00 ? 8  LEU A HG   1  
ATOM 74    H HD11 . LEU A 1 8  ? 15.844  2.308   3.114   1.00 0.00 ? 8  LEU A HD11 1  
ATOM 75    H HD12 . LEU A 1 8  ? 15.907  1.675   1.452   1.00 0.00 ? 8  LEU A HD12 1  
ATOM 76    H HD13 . LEU A 1 8  ? 14.431  2.475   2.044   1.00 0.00 ? 8  LEU A HD13 1  
ATOM 77    H HD21 . LEU A 1 8  ? 14.147  1.568   4.581   1.00 0.00 ? 8  LEU A HD21 1  
ATOM 78    H HD22 . LEU A 1 8  ? 12.837  0.632   3.821   1.00 0.00 ? 8  LEU A HD22 1  
ATOM 79    H HD23 . LEU A 1 8  ? 14.101  -0.203  4.754   1.00 0.00 ? 8  LEU A HD23 1  
ATOM 80    N N    . ARG A 1 9  ? 11.994  -1.980  0.094   1.00 0.00 ? 9  ARG A N    1  
ATOM 81    C CA   . ARG A 1 9  ? 10.861  -2.190  -0.789  1.00 0.00 ? 9  ARG A CA   1  
ATOM 82    C C    . ARG A 1 9  ? 10.077  -3.432  -0.359  1.00 0.00 ? 9  ARG A C    1  
ATOM 83    O O    . ARG A 1 9  ? 8.848   -3.450  -0.427  1.00 0.00 ? 9  ARG A O    1  
ATOM 84    C CB   . ARG A 1 9  ? 11.315  -2.360  -2.240  1.00 0.00 ? 9  ARG A CB   1  
ATOM 85    C CG   . ARG A 1 9  ? 10.135  -2.709  -3.147  1.00 0.00 ? 9  ARG A CG   1  
ATOM 86    C CD   . ARG A 1 9  ? 10.613  -3.396  -4.428  1.00 0.00 ? 9  ARG A CD   1  
ATOM 87    N NE   . ARG A 1 9  ? 10.766  -4.849  -4.197  1.00 0.00 ? 9  ARG A NE   1  
ATOM 88    C CZ   . ARG A 1 9  ? 11.369  -5.687  -5.052  1.00 0.00 ? 9  ARG A CZ   1  
ATOM 89    N NH1  . ARG A 1 9  ? 11.877  -5.220  -6.201  1.00 0.00 ? 9  ARG A NH1  1  
ATOM 90    N NH2  . ARG A 1 9  ? 11.462  -6.991  -4.759  1.00 0.00 ? 9  ARG A NH2  1  
ATOM 91    H H    . ARG A 1 9  ? 12.890  -2.135  -0.323  1.00 0.00 ? 9  ARG A H    1  
ATOM 92    H HA   . ARG A 1 9  ? 10.256  -1.289  -0.685  1.00 0.00 ? 9  ARG A HA   1  
ATOM 93    H HB3  . ARG A 1 9  ? 12.069  -3.145  -2.299  1.00 0.00 ? 9  ARG A HB3  1  
ATOM 94    H HG3  . ARG A 1 9  ? 9.584   -1.803  -3.400  1.00 0.00 ? 9  ARG A HG3  1  
ATOM 95    H HD3  . ARG A 1 9  ? 11.563  -2.967  -4.748  1.00 0.00 ? 9  ARG A HD3  1  
ATOM 96    H HE   . ARG A 1 9  ? 10.397  -5.231  -3.349  1.00 0.00 ? 9  ARG A HE   1  
ATOM 97    H HH11 . ARG A 1 9  ? 11.808  -4.246  -6.419  1.00 0.00 ? 9  ARG A HH11 1  
ATOM 98    H HH12 . ARG A 1 9  ? 12.327  -5.845  -6.839  1.00 0.00 ? 9  ARG A HH12 1  
ATOM 99    H HH21 . ARG A 1 9  ? 11.082  -7.339  -3.903  1.00 0.00 ? 9  ARG A HH21 1  
ATOM 100   H HH22 . ARG A 1 9  ? 11.911  -7.616  -5.397  1.00 0.00 ? 9  ARG A HH22 1  
ATOM 101   N N    . LYS A 1 10 ? 10.819  -4.441  0.073   1.00 0.00 ? 10 LYS A N    1  
ATOM 102   C CA   . LYS A 1 10 ? 10.208  -5.684  0.513   1.00 0.00 ? 10 LYS A CA   1  
ATOM 103   C C    . LYS A 1 10 ? 9.396   -5.427  1.784   1.00 0.00 ? 10 LYS A C    1  
ATOM 104   O O    . LYS A 1 10 ? 8.511   -6.208  2.128   1.00 0.00 ? 10 LYS A O    1  
ATOM 105   C CB   . LYS A 1 10 ? 11.270  -6.775  0.673   1.00 0.00 ? 10 LYS A CB   1  
ATOM 106   C CG   . LYS A 1 10 ? 10.717  -7.968  1.455   1.00 0.00 ? 10 LYS A CG   1  
ATOM 107   C CD   . LYS A 1 10 ? 9.469   -8.536  0.777   1.00 0.00 ? 10 LYS A CD   1  
ATOM 108   C CE   . LYS A 1 10 ? 9.847   -9.443  -0.396  1.00 0.00 ? 10 LYS A CE   1  
ATOM 109   N NZ   . LYS A 1 10 ? 9.180   -10.758 -0.269  1.00 0.00 ? 10 LYS A NZ   1  
ATOM 110   H H    . LYS A 1 10 ? 11.817  -4.419  0.125   1.00 0.00 ? 10 LYS A H    1  
ATOM 111   H HA   . LYS A 1 10 ? 9.528   -6.010  -0.273  1.00 0.00 ? 10 LYS A HA   1  
ATOM 112   H HB3  . LYS A 1 10 ? 12.139  -6.368  1.191   1.00 0.00 ? 10 LYS A HB3  1  
ATOM 113   H HG3  . LYS A 1 10 ? 10.475  -7.660  2.472   1.00 0.00 ? 10 LYS A HG3  1  
ATOM 114   H HD3  . LYS A 1 10 ? 8.840   -7.720  0.422   1.00 0.00 ? 10 LYS A HD3  1  
ATOM 115   H HE3  . LYS A 1 10 ? 10.927  -9.578  -0.426  1.00 0.00 ? 10 LYS A HE3  1  
ATOM 116   H HZ1  . LYS A 1 10 ? 8.362   -10.776 -0.844  1.00 0.00 ? 10 LYS A HZ1  1  
ATOM 117   H HZ2  . LYS A 1 10 ? 9.809   -11.479 -0.561  1.00 0.00 ? 10 LYS A HZ2  1  
ATOM 118   H HZ3  . LYS A 1 10 ? 8.920   -10.910 0.685   1.00 0.00 ? 10 LYS A HZ3  1  
ATOM 119   N N    . MET A 1 11 ? 9.725   -4.327  2.445   1.00 0.00 ? 11 MET A N    1  
ATOM 120   C CA   . MET A 1 11 ? 9.037   -3.956  3.670   1.00 0.00 ? 11 MET A CA   1  
ATOM 121   C C    . MET A 1 11 ? 7.699   -3.280  3.364   1.00 0.00 ? 11 MET A C    1  
ATOM 122   O O    . MET A 1 11 ? 6.740   -3.419  4.121   1.00 0.00 ? 11 MET A O    1  
ATOM 123   C CB   . MET A 1 11 ? 9.917   -3.004  4.483   1.00 0.00 ? 11 MET A CB   1  
ATOM 124   C CG   . MET A 1 11 ? 10.934  -3.779  5.322   1.00 0.00 ? 11 MET A CG   1  
ATOM 125   S SD   . MET A 1 11 ? 10.931  -3.172  7.000   1.00 0.00 ? 11 MET A SD   1  
ATOM 126   C CE   . MET A 1 11 ? 12.018  -1.767  6.823   1.00 0.00 ? 11 MET A CE   1  
ATOM 127   H H    . MET A 1 11 ? 10.446  -3.696  2.158   1.00 0.00 ? 11 MET A H    1  
ATOM 128   H HA   . MET A 1 11 ? 8.865   -4.891  4.204   1.00 0.00 ? 11 MET A HA   1  
ATOM 129   H HB3  . MET A 1 11 ? 9.292   -2.393  5.135   1.00 0.00 ? 11 MET A HB3  1  
ATOM 130   H HG3  . MET A 1 11 ? 11.930  -3.674  4.890   1.00 0.00 ? 11 MET A HG3  1  
ATOM 131   H HE1  . MET A 1 11 ? 12.713  -1.945  6.003   1.00 0.00 ? 11 MET A HE1  1  
ATOM 132   H HE2  . MET A 1 11 ? 11.427  -0.875  6.611   1.00 0.00 ? 11 MET A HE2  1  
ATOM 133   H HE3  . MET A 1 11 ? 12.577  -1.621  7.747   1.00 0.00 ? 11 MET A HE3  1  
ATOM 134   N N    . VAL A 1 12 ? 7.678   -2.561  2.252   1.00 0.00 ? 12 VAL A N    1  
ATOM 135   C CA   . VAL A 1 12 ? 6.474   -1.862  1.836   1.00 0.00 ? 12 VAL A CA   1  
ATOM 136   C C    . VAL A 1 12 ? 5.675   -2.753  0.880   1.00 0.00 ? 12 VAL A C    1  
ATOM 137   O O    . VAL A 1 12 ? 4.472   -2.563  0.708   1.00 0.00 ? 12 VAL A O    1  
ATOM 138   C CB   . VAL A 1 12 ? 6.839   -0.508  1.225   1.00 0.00 ? 12 VAL A CB   1  
ATOM 139   C CG1  . VAL A 1 12 ? 8.013   -0.643  0.253   1.00 0.00 ? 12 VAL A CG1  1  
ATOM 140   C CG2  . VAL A 1 12 ? 5.629   0.128   0.537   1.00 0.00 ? 12 VAL A CG2  1  
ATOM 141   H H    . VAL A 1 12 ? 8.462   -2.451  1.640   1.00 0.00 ? 12 VAL A H    1  
ATOM 142   H HA   . VAL A 1 12 ? 5.874   -1.679  2.728   1.00 0.00 ? 12 VAL A HA   1  
ATOM 143   H HB   . VAL A 1 12 ? 7.148   0.153   2.034   1.00 0.00 ? 12 VAL A HB   1  
ATOM 144   H HG11 . VAL A 1 12 ? 8.938   -0.765  0.816   1.00 0.00 ? 12 VAL A HG11 1  
ATOM 145   H HG12 . VAL A 1 12 ? 7.858   -1.514  -0.384  1.00 0.00 ? 12 VAL A HG12 1  
ATOM 146   H HG13 . VAL A 1 12 ? 8.079   0.252   -0.365  1.00 0.00 ? 12 VAL A HG13 1  
ATOM 147   H HG21 . VAL A 1 12 ? 4.824   0.253   1.260   1.00 0.00 ? 12 VAL A HG21 1  
ATOM 148   H HG22 . VAL A 1 12 ? 5.910   1.102   0.134   1.00 0.00 ? 12 VAL A HG22 1  
ATOM 149   H HG23 . VAL A 1 12 ? 5.292   -0.517  -0.275  1.00 0.00 ? 12 VAL A HG23 1  
ATOM 150   N N    . GLU A 1 13 ? 6.379   -3.705  0.286   1.00 0.00 ? 13 GLU A N    1  
ATOM 151   C CA   . GLU A 1 13 ? 5.751   -4.626  -0.647  1.00 0.00 ? 13 GLU A CA   1  
ATOM 152   C C    . GLU A 1 13 ? 4.573   -5.338  0.021   1.00 0.00 ? 13 GLU A C    1  
ATOM 153   O O    . GLU A 1 13 ? 3.611   -5.715  -0.646  1.00 0.00 ? 13 GLU A O    1  
ATOM 154   C CB   . GLU A 1 13 ? 6.765   -5.634  -1.188  1.00 0.00 ? 13 GLU A CB   1  
ATOM 155   C CG   . GLU A 1 13 ? 7.712   -4.974  -2.193  1.00 0.00 ? 13 GLU A CG   1  
ATOM 156   C CD   . GLU A 1 13 ? 7.463   -5.499  -3.609  1.00 0.00 ? 13 GLU A CD   1  
ATOM 157   O OE1  . GLU A 1 13 ? 6.282   -5.486  -4.018  1.00 0.00 ? 13 GLU A OE1  1  
ATOM 158   O OE2  . GLU A 1 13 ? 8.458   -5.900  -4.249  1.00 0.00 ? 13 GLU A OE2  1  
ATOM 159   H H    . GLU A 1 13 ? 7.357   -3.852  0.431   1.00 0.00 ? 13 GLU A H    1  
ATOM 160   H HA   . GLU A 1 13 ? 5.391   -4.006  -1.468  1.00 0.00 ? 13 GLU A HA   1  
ATOM 161   H HB3  . GLU A 1 13 ? 6.242   -6.462  -1.668  1.00 0.00 ? 13 GLU A HB3  1  
ATOM 162   H HG3  . GLU A 1 13 ? 8.746   -5.169  -1.907  1.00 0.00 ? 13 GLU A HG3  1  
ATOM 163   N N    . GLU A 1 14 ? 4.688   -5.501  1.331   1.00 0.00 ? 14 GLU A N    1  
ATOM 164   C CA   . GLU A 1 14 ? 3.644   -6.162  2.097   1.00 0.00 ? 14 GLU A CA   1  
ATOM 165   C C    . GLU A 1 14 ? 2.661   -5.130  2.653   1.00 0.00 ? 14 GLU A C    1  
ATOM 166   O O    . GLU A 1 14 ? 1.458   -5.382  2.711   1.00 0.00 ? 14 GLU A O    1  
ATOM 167   C CB   . GLU A 1 14 ? 4.243   -7.010  3.221   1.00 0.00 ? 14 GLU A CB   1  
ATOM 168   C CG   . GLU A 1 14 ? 4.549   -6.153  4.450   1.00 0.00 ? 14 GLU A CG   1  
ATOM 169   C CD   . GLU A 1 14 ? 5.438   -6.909  5.440   1.00 0.00 ? 14 GLU A CD   1  
ATOM 170   O OE1  . GLU A 1 14 ? 6.654   -6.994  5.161   1.00 0.00 ? 14 GLU A OE1  1  
ATOM 171   O OE2  . GLU A 1 14 ? 4.882   -7.388  6.451   1.00 0.00 ? 14 GLU A OE2  1  
ATOM 172   H H    . GLU A 1 14 ? 5.473   -5.191  1.867   1.00 0.00 ? 14 GLU A H    1  
ATOM 173   H HA   . GLU A 1 14 ? 3.135   -6.815  1.389   1.00 0.00 ? 14 GLU A HA   1  
ATOM 174   H HB3  . GLU A 1 14 ? 5.157   -7.490  2.872   1.00 0.00 ? 14 GLU A HB3  1  
ATOM 175   H HG3  . GLU A 1 14 ? 3.618   -5.865  4.939   1.00 0.00 ? 14 GLU A HG3  1  
ATOM 176   N N    . VAL A 1 15 ? 3.208   -3.990  3.048   1.00 0.00 ? 15 VAL A N    1  
ATOM 177   C CA   . VAL A 1 15 ? 2.393   -2.919  3.597   1.00 0.00 ? 15 VAL A CA   1  
ATOM 178   C C    . VAL A 1 15 ? 1.191   -2.679  2.682   1.00 0.00 ? 15 VAL A C    1  
ATOM 179   O O    . VAL A 1 15 ? 0.065   -3.037  3.025   1.00 0.00 ? 15 VAL A O    1  
ATOM 180   C CB   . VAL A 1 15 ? 3.247   -1.666  3.804   1.00 0.00 ? 15 VAL A CB   1  
ATOM 181   C CG1  . VAL A 1 15 ? 2.372   -0.458  4.143   1.00 0.00 ? 15 VAL A CG1  1  
ATOM 182   C CG2  . VAL A 1 15 ? 4.306   -1.897  4.883   1.00 0.00 ? 15 VAL A CG2  1  
ATOM 183   H H    . VAL A 1 15 ? 4.187   -3.793  2.997   1.00 0.00 ? 15 VAL A H    1  
ATOM 184   H HA   . VAL A 1 15 ? 2.033   -3.247  4.572   1.00 0.00 ? 15 VAL A HA   1  
ATOM 185   H HB   . VAL A 1 15 ? 3.763   -1.453  2.867   1.00 0.00 ? 15 VAL A HB   1  
ATOM 186   H HG11 . VAL A 1 15 ? 1.888   -0.093  3.237   1.00 0.00 ? 15 VAL A HG11 1  
ATOM 187   H HG12 . VAL A 1 15 ? 1.612   -0.751  4.867   1.00 0.00 ? 15 VAL A HG12 1  
ATOM 188   H HG13 . VAL A 1 15 ? 2.992   0.332   4.566   1.00 0.00 ? 15 VAL A HG13 1  
ATOM 189   H HG21 . VAL A 1 15 ? 4.615   -2.942  4.872   1.00 0.00 ? 15 VAL A HG21 1  
ATOM 190   H HG22 . VAL A 1 15 ? 5.169   -1.261  4.686   1.00 0.00 ? 15 VAL A HG22 1  
ATOM 191   H HG23 . VAL A 1 15 ? 3.890   -1.651  5.860   1.00 0.00 ? 15 VAL A HG23 1  
ATOM 192   N N    . PHE A 1 16 ? 1.469   -2.075  1.536   1.00 0.00 ? 16 PHE A N    1  
ATOM 193   C CA   . PHE A 1 16 ? 0.425   -1.782  0.570   1.00 0.00 ? 16 PHE A CA   1  
ATOM 194   C C    . PHE A 1 16 ? -0.520  -2.975  0.407   1.00 0.00 ? 16 PHE A C    1  
ATOM 195   O O    . PHE A 1 16 ? -1.734  -2.800  0.307   1.00 0.00 ? 16 PHE A O    1  
ATOM 196   C CB   . PHE A 1 16 ? 1.116   -1.508  -0.767  1.00 0.00 ? 16 PHE A CB   1  
ATOM 197   C CG   . PHE A 1 16 ? 1.734   -0.112  -0.872  1.00 0.00 ? 16 PHE A CG   1  
ATOM 198   C CD1  . PHE A 1 16 ? 1.084   0.961   -0.349  1.00 0.00 ? 16 PHE A CD1  1  
ATOM 199   C CD2  . PHE A 1 16 ? 2.934   0.054   -1.491  1.00 0.00 ? 16 PHE A CD2  1  
ATOM 200   C CE1  . PHE A 1 16 ? 1.659   2.256   -0.447  1.00 0.00 ? 16 PHE A CE1  1  
ATOM 201   C CE2  . PHE A 1 16 ? 3.508   1.349   -1.590  1.00 0.00 ? 16 PHE A CE2  1  
ATOM 202   C CZ   . PHE A 1 16 ? 2.858   2.422   -1.065  1.00 0.00 ? 16 PHE A CZ   1  
ATOM 203   H H    . PHE A 1 16 ? 2.388   -1.787  1.266   1.00 0.00 ? 16 PHE A H    1  
ATOM 204   H HA   . PHE A 1 16 ? -0.135  -0.927  0.948   1.00 0.00 ? 16 PHE A HA   1  
ATOM 205   H HB3  . PHE A 1 16 ? 0.391   -1.635  -1.572  1.00 0.00 ? 16 PHE A HB3  1  
ATOM 206   H HD1  . PHE A 1 16 ? 0.123   0.827   0.148   1.00 0.00 ? 16 PHE A HD1  1  
ATOM 207   H HD2  . PHE A 1 16 ? 3.455   -0.806  -1.911  1.00 0.00 ? 16 PHE A HD2  1  
ATOM 208   H HE1  . PHE A 1 16 ? 1.137   3.116   -0.026  1.00 0.00 ? 16 PHE A HE1  1  
ATOM 209   H HE2  . PHE A 1 16 ? 4.470   1.483   -2.086  1.00 0.00 ? 16 PHE A HE2  1  
ATOM 210   H HZ   . PHE A 1 16 ? 3.299   3.417   -1.141  1.00 0.00 ? 16 PHE A HZ   1  
ATOM 211   N N    . ASP A 1 17 ? 0.072   -4.160  0.386   1.00 0.00 ? 17 ASP A N    1  
ATOM 212   C CA   . ASP A 1 17 ? -0.702  -5.381  0.237   1.00 0.00 ? 17 ASP A CA   1  
ATOM 213   C C    . ASP A 1 17 ? -1.624  -5.546  1.447   1.00 0.00 ? 17 ASP A C    1  
ATOM 214   O O    . ASP A 1 17 ? -2.829  -5.739  1.291   1.00 0.00 ? 17 ASP A O    1  
ATOM 215   C CB   . ASP A 1 17 ? 0.212   -6.607  0.167   1.00 0.00 ? 17 ASP A CB   1  
ATOM 216   C CG   . ASP A 1 17 ? 0.756   -6.929  -1.226  1.00 0.00 ? 17 ASP A CG   1  
ATOM 217   O OD1  . ASP A 1 17 ? 0.446   -6.147  -2.151  1.00 0.00 ? 17 ASP A OD1  1  
ATOM 218   O OD2  . ASP A 1 17 ? 1.468   -7.950  -1.335  1.00 0.00 ? 17 ASP A OD2  1  
ATOM 219   H H    . ASP A 1 17 ? 1.060   -4.293  0.468   1.00 0.00 ? 17 ASP A H    1  
ATOM 220   H HA   . ASP A 1 17 ? -1.254  -5.258  -0.695  1.00 0.00 ? 17 ASP A HA   1  
ATOM 221   H HB3  . ASP A 1 17 ? -0.339  -7.472  0.536   1.00 0.00 ? 17 ASP A HB3  1  
ATOM 222   N N    . VAL A 1 18 ? -1.022  -5.464  2.625   1.00 0.00 ? 18 VAL A N    1  
ATOM 223   C CA   . VAL A 1 18 ? -1.774  -5.602  3.860   1.00 0.00 ? 18 VAL A CA   1  
ATOM 224   C C    . VAL A 1 18 ? -2.902  -4.569  3.884   1.00 0.00 ? 18 VAL A C    1  
ATOM 225   O O    . VAL A 1 18 ? -4.077  -4.928  3.916   1.00 0.00 ? 18 VAL A O    1  
ATOM 226   C CB   . VAL A 1 18 ? -0.833  -5.489  5.060   1.00 0.00 ? 18 VAL A CB   1  
ATOM 227   C CG1  . VAL A 1 18 ? -1.606  -5.128  6.331   1.00 0.00 ? 18 VAL A CG1  1  
ATOM 228   C CG2  . VAL A 1 18 ? -0.032  -6.778  5.253   1.00 0.00 ? 18 VAL A CG2  1  
ATOM 229   H H    . VAL A 1 18 ? -0.042  -5.307  2.741   1.00 0.00 ? 18 VAL A H    1  
ATOM 230   H HA   . VAL A 1 18 ? -2.213  -6.600  3.868   1.00 0.00 ? 18 VAL A HA   1  
ATOM 231   H HB   . VAL A 1 18 ? -0.127  -4.684  4.858   1.00 0.00 ? 18 VAL A HB   1  
ATOM 232   H HG11 . VAL A 1 18 ? -1.794  -4.054  6.350   1.00 0.00 ? 18 VAL A HG11 1  
ATOM 233   H HG12 . VAL A 1 18 ? -2.556  -5.663  6.343   1.00 0.00 ? 18 VAL A HG12 1  
ATOM 234   H HG13 . VAL A 1 18 ? -1.020  -5.410  7.206   1.00 0.00 ? 18 VAL A HG13 1  
ATOM 235   H HG21 . VAL A 1 18 ? -0.653  -7.520  5.755   1.00 0.00 ? 18 VAL A HG21 1  
ATOM 236   H HG22 . VAL A 1 18 ? 0.278   -7.162  4.282   1.00 0.00 ? 18 VAL A HG22 1  
ATOM 237   H HG23 . VAL A 1 18 ? 0.849   -6.571  5.861   1.00 0.00 ? 18 VAL A HG23 1  
ATOM 238   N N    . LEU A 1 19 ? -2.503  -3.305  3.869   1.00 0.00 ? 19 LEU A N    1  
ATOM 239   C CA   . LEU A 1 19 ? -3.465  -2.217  3.888   1.00 0.00 ? 19 LEU A CA   1  
ATOM 240   C C    . LEU A 1 19 ? -4.598  -2.525  2.908   1.00 0.00 ? 19 LEU A C    1  
ATOM 241   O O    . LEU A 1 19 ? -5.771  -2.481  3.274   1.00 0.00 ? 19 LEU A O    1  
ATOM 242   C CB   . LEU A 1 19 ? -2.769  -0.881  3.622   1.00 0.00 ? 19 LEU A CB   1  
ATOM 243   C CG   . LEU A 1 19 ? -1.565  -0.563  4.512   1.00 0.00 ? 19 LEU A CG   1  
ATOM 244   C CD1  . LEU A 1 19 ? -1.142  0.899   4.361   1.00 0.00 ? 19 LEU A CD1  1  
ATOM 245   C CD2  . LEU A 1 19 ? -1.850  -0.929  5.970   1.00 0.00 ? 19 LEU A CD2  1  
ATOM 246   H H    . LEU A 1 19 ? -1.545  -3.022  3.843   1.00 0.00 ? 19 LEU A H    1  
ATOM 247   H HA   . LEU A 1 19 ? -3.883  -2.168  4.894   1.00 0.00 ? 19 LEU A HA   1  
ATOM 248   H HB3  . LEU A 1 19 ? -3.502  -0.082  3.738   1.00 0.00 ? 19 LEU A HB3  1  
ATOM 249   H HG   . LEU A 1 19 ? -0.726  -1.177  4.184   1.00 0.00 ? 19 LEU A HG   1  
ATOM 250   H HD11 . LEU A 1 19 ? -1.426  1.454   5.254   1.00 0.00 ? 19 LEU A HD11 1  
ATOM 251   H HD12 . LEU A 1 19 ? -0.061  0.953   4.228   1.00 0.00 ? 19 LEU A HD12 1  
ATOM 252   H HD13 . LEU A 1 19 ? -1.637  1.333   3.491   1.00 0.00 ? 19 LEU A HD13 1  
ATOM 253   H HD21 . LEU A 1 19 ? -1.299  -0.256  6.628   1.00 0.00 ? 19 LEU A HD21 1  
ATOM 254   H HD22 . LEU A 1 19 ? -2.918  -0.835  6.167   1.00 0.00 ? 19 LEU A HD22 1  
ATOM 255   H HD23 . LEU A 1 19 ? -1.536  -1.956  6.156   1.00 0.00 ? 19 LEU A HD23 1  
ATOM 256   N N    . TYR A 1 20 ? -4.207  -2.830  1.678   1.00 0.00 ? 20 TYR A N    1  
ATOM 257   C CA   . TYR A 1 20 ? -5.175  -3.146  0.642   1.00 0.00 ? 20 TYR A CA   1  
ATOM 258   C C    . TYR A 1 20 ? -6.115  -4.267  1.092   1.00 0.00 ? 20 TYR A C    1  
ATOM 259   O O    . TYR A 1 20 ? -7.335  -4.120  1.033   1.00 0.00 ? 20 TYR A O    1  
ATOM 260   C CB   . TYR A 1 20 ? -4.362  -3.631  -0.560  1.00 0.00 ? 20 TYR A CB   1  
ATOM 261   C CG   . TYR A 1 20 ? -5.217  -4.091  -1.744  1.00 0.00 ? 20 TYR A CG   1  
ATOM 262   C CD1  . TYR A 1 20 ? -6.241  -3.291  -2.207  1.00 0.00 ? 20 TYR A CD1  1  
ATOM 263   C CD2  . TYR A 1 20 ? -4.961  -5.305  -2.349  1.00 0.00 ? 20 TYR A CD2  1  
ATOM 264   C CE1  . TYR A 1 20 ? -7.045  -3.724  -3.321  1.00 0.00 ? 20 TYR A CE1  1  
ATOM 265   C CE2  . TYR A 1 20 ? -5.764  -5.737  -3.462  1.00 0.00 ? 20 TYR A CE2  1  
ATOM 266   C CZ   . TYR A 1 20 ? -6.766  -4.925  -3.894  1.00 0.00 ? 20 TYR A CZ   1  
ATOM 267   O OH   . TYR A 1 20 ? -7.526  -5.333  -4.946  1.00 0.00 ? 20 TYR A OH   1  
ATOM 268   H H    . TYR A 1 20 ? -3.251  -2.864  1.389   1.00 0.00 ? 20 TYR A H    1  
ATOM 269   H HA   . TYR A 1 20 ? -5.761  -2.248  0.444   1.00 0.00 ? 20 TYR A HA   1  
ATOM 270   H HB3  . TYR A 1 20 ? -3.723  -4.456  -0.245  1.00 0.00 ? 20 TYR A HB3  1  
ATOM 271   H HD1  . TYR A 1 20 ? -6.443  -2.332  -1.730  1.00 0.00 ? 20 TYR A HD1  1  
ATOM 272   H HD2  . TYR A 1 20 ? -4.151  -5.936  -1.984  1.00 0.00 ? 20 TYR A HD2  1  
ATOM 273   H HE1  . TYR A 1 20 ? -7.857  -3.102  -3.697  1.00 0.00 ? 20 TYR A HE1  1  
ATOM 274   H HE2  . TYR A 1 20 ? -5.573  -6.693  -3.949  1.00 0.00 ? 20 TYR A HE2  1  
ATOM 275   H HH   . TYR A 1 20 ? -7.557  -6.333  -4.978  1.00 0.00 ? 20 TYR A HH   1  
ATOM 276   N N    . SER A 1 21 ? -5.512  -5.361  1.533   1.00 0.00 ? 21 SER A N    1  
ATOM 277   C CA   . SER A 1 21 ? -6.279  -6.505  1.992   1.00 0.00 ? 21 SER A CA   1  
ATOM 278   C C    . SER A 1 21 ? -7.163  -6.101  3.174   1.00 0.00 ? 21 SER A C    1  
ATOM 279   O O    . SER A 1 21 ? -8.273  -6.611  3.327   1.00 0.00 ? 21 SER A O    1  
ATOM 280   C CB   . SER A 1 21 ? -5.359  -7.662  2.390   1.00 0.00 ? 21 SER A CB   1  
ATOM 281   O OG   . SER A 1 21 ? -6.075  -8.885  2.541   1.00 0.00 ? 21 SER A OG   1  
ATOM 282   H H    . SER A 1 21 ? -4.519  -5.472  1.578   1.00 0.00 ? 21 SER A H    1  
ATOM 283   H HA   . SER A 1 21 ? -6.891  -6.803  1.142   1.00 0.00 ? 21 SER A HA   1  
ATOM 284   H HB3  . SER A 1 21 ? -4.854  -7.420  3.324   1.00 0.00 ? 21 SER A HB3  1  
ATOM 285   H HG   . SER A 1 21 ? -5.470  -9.659  2.359   1.00 0.00 ? 21 SER A HG   1  
ATOM 286   N N    . GLU A 1 22 ? -6.639  -5.189  3.980   1.00 0.00 ? 22 GLU A N    1  
ATOM 287   C CA   . GLU A 1 22 ? -7.368  -4.710  5.142   1.00 0.00 ? 22 GLU A CA   1  
ATOM 288   C C    . GLU A 1 22 ? -8.641  -3.982  4.709   1.00 0.00 ? 22 GLU A C    1  
ATOM 289   O O    . GLU A 1 22 ? -9.715  -4.218  5.261   1.00 0.00 ? 22 GLU A O    1  
ATOM 290   C CB   . GLU A 1 22 ? -6.487  -3.807  6.007   1.00 0.00 ? 22 GLU A CB   1  
ATOM 291   C CG   . GLU A 1 22 ? -5.491  -4.632  6.825   1.00 0.00 ? 22 GLU A CG   1  
ATOM 292   C CD   . GLU A 1 22 ? -6.217  -5.651  7.707   1.00 0.00 ? 22 GLU A CD   1  
ATOM 293   O OE1  . GLU A 1 22 ? -6.640  -5.246  8.811   1.00 0.00 ? 22 GLU A OE1  1  
ATOM 294   O OE2  . GLU A 1 22 ? -6.330  -6.811  7.258   1.00 0.00 ? 22 GLU A OE2  1  
ATOM 295   H H    . GLU A 1 22 ? -5.738  -4.780  3.849   1.00 0.00 ? 22 GLU A H    1  
ATOM 296   H HA   . GLU A 1 22 ? -7.628  -5.605  5.709   1.00 0.00 ? 22 GLU A HA   1  
ATOM 297   H HB3  . GLU A 1 22 ? -7.112  -3.217  6.678   1.00 0.00 ? 22 GLU A HB3  1  
ATOM 298   H HG3  . GLU A 1 22 ? -4.889  -3.971  7.448   1.00 0.00 ? 22 GLU A HG3  1  
ATOM 299   N N    . ALA A 1 23 ? -8.481  -3.112  3.723   1.00 0.00 ? 23 ALA A N    1  
ATOM 300   C CA   . ALA A 1 23 ? -9.604  -2.348  3.208   1.00 0.00 ? 23 ALA A CA   1  
ATOM 301   C C    . ALA A 1 23 ? -10.531 -3.277  2.423   1.00 0.00 ? 23 ALA A C    1  
ATOM 302   O O    . ALA A 1 23 ? -11.735 -3.037  2.343   1.00 0.00 ? 23 ALA A O    1  
ATOM 303   C CB   . ALA A 1 23 ? -9.085  -1.187  2.357   1.00 0.00 ? 23 ALA A CB   1  
ATOM 304   H H    . ALA A 1 23 ? -7.604  -2.927  3.278   1.00 0.00 ? 23 ALA A H    1  
ATOM 305   H HA   . ALA A 1 23 ? -10.148 -1.942  4.061   1.00 0.00 ? 23 ALA A HA   1  
ATOM 306   H HB1  . ALA A 1 23 ? -9.185  -1.437  1.301   1.00 0.00 ? 23 ALA A HB1  1  
ATOM 307   H HB2  . ALA A 1 23 ? -9.665  -0.290  2.574   1.00 0.00 ? 23 ALA A HB2  1  
ATOM 308   H HB3  . ALA A 1 23 ? -8.036  -1.006  2.590   1.00 0.00 ? 23 ALA A HB3  1  
ATOM 309   N N    . LEU A 1 24 ? -9.935  -4.319  1.863   1.00 0.00 ? 24 LEU A N    1  
ATOM 310   C CA   . LEU A 1 24 ? -10.692 -5.287  1.087   1.00 0.00 ? 24 LEU A CA   1  
ATOM 311   C C    . LEU A 1 24 ? -11.449 -6.217  2.037   1.00 0.00 ? 24 LEU A C    1  
ATOM 312   O O    . LEU A 1 24 ? -12.461 -6.806  1.659   1.00 0.00 ? 24 LEU A O    1  
ATOM 313   C CB   . LEU A 1 24 ? -9.777  -6.022  0.106   1.00 0.00 ? 24 LEU A CB   1  
ATOM 314   C CG   . LEU A 1 24 ? -9.897  -5.609  -1.362  1.00 0.00 ? 24 LEU A CG   1  
ATOM 315   C CD1  . LEU A 1 24 ? -8.809  -6.271  -2.210  1.00 0.00 ? 24 LEU A CD1  1  
ATOM 316   C CD2  . LEU A 1 24 ? -11.299 -5.900  -1.902  1.00 0.00 ? 24 LEU A CD2  1  
ATOM 317   H H    . LEU A 1 24 ? -8.955  -4.508  1.933   1.00 0.00 ? 24 LEU A H    1  
ATOM 318   H HA   . LEU A 1 24 ? -11.420 -4.732  0.494   1.00 0.00 ? 24 LEU A HA   1  
ATOM 319   H HB3  . LEU A 1 24 ? -9.981  -7.090  0.179   1.00 0.00 ? 24 LEU A HB3  1  
ATOM 320   H HG   . LEU A 1 24 ? -9.744  -4.531  -1.428  1.00 0.00 ? 24 LEU A HG   1  
ATOM 321   H HD11 . LEU A 1 24 ? -8.861  -5.892  -3.231  1.00 0.00 ? 24 LEU A HD11 1  
ATOM 322   H HD12 . LEU A 1 24 ? -7.830  -6.042  -1.787  1.00 0.00 ? 24 LEU A HD12 1  
ATOM 323   H HD13 . LEU A 1 24 ? -8.959  -7.350  -2.215  1.00 0.00 ? 24 LEU A HD13 1  
ATOM 324   H HD21 . LEU A 1 24 ? -12.033 -5.329  -1.332  1.00 0.00 ? 24 LEU A HD21 1  
ATOM 325   H HD22 . LEU A 1 24 ? -11.351 -5.615  -2.952  1.00 0.00 ? 24 LEU A HD22 1  
ATOM 326   H HD23 . LEU A 1 24 ? -11.512 -6.965  -1.802  1.00 0.00 ? 24 LEU A HD23 1  
ATOM 327   N N    . GLY A 1 25 ? -10.929 -6.321  3.251   1.00 0.00 ? 25 GLY A N    1  
ATOM 328   C CA   . GLY A 1 25 ? -11.543 -7.169  4.258   1.00 0.00 ? 25 GLY A CA   1  
ATOM 329   C C    . GLY A 1 25 ? -11.410 -8.647  3.884   1.00 0.00 ? 25 GLY A C    1  
ATOM 330   O O    . GLY A 1 25 ? -12.365 -9.412  4.011   1.00 0.00 ? 25 GLY A O    1  
ATOM 331   H H    . GLY A 1 25 ? -10.106 -5.838  3.550   1.00 0.00 ? 25 GLY A H    1  
ATOM 332   H HA2  . GLY A 1 25 ? -11.071 -6.992  5.225   1.00 0.00 ? 25 GLY A HA2  1  
ATOM 333   H HA3  . GLY A 1 25 ? -12.595 -6.911  4.365   1.00 0.00 ? 25 GLY A HA3  1  
ATOM 334   N N    . ARG A 1 26 ? -10.218 -9.006  3.430   1.00 0.00 ? 26 ARG A N    1  
ATOM 335   C CA   . ARG A 1 26 ? -9.948  -10.377 3.038   1.00 0.00 ? 26 ARG A CA   1  
ATOM 336   C C    . ARG A 1 26 ? -9.269  -11.134 4.181   1.00 0.00 ? 26 ARG A C    1  
ATOM 337   O O    . ARG A 1 26 ? -8.900  -10.537 5.192   1.00 0.00 ? 26 ARG A O    1  
ATOM 338   C CB   . ARG A 1 26 ? -9.052  -10.430 1.798   1.00 0.00 ? 26 ARG A CB   1  
ATOM 339   C CG   . ARG A 1 26 ? -9.749  -9.798  0.591   1.00 0.00 ? 26 ARG A CG   1  
ATOM 340   C CD   . ARG A 1 26 ? -10.269 -10.873 -0.366  1.00 0.00 ? 26 ARG A CD   1  
ATOM 341   N NE   . ARG A 1 26 ? -11.745 -10.942 -0.294  1.00 0.00 ? 26 ARG A NE   1  
ATOM 342   C CZ   . ARG A 1 26 ? -12.475 -11.952 -0.787  1.00 0.00 ? 26 ARG A CZ   1  
ATOM 343   N NH1  . ARG A 1 26 ? -11.870 -12.984 -1.390  1.00 0.00 ? 26 ARG A NH1  1  
ATOM 344   N NH2  . ARG A 1 26 ? -13.811 -11.930 -0.677  1.00 0.00 ? 26 ARG A NH2  1  
ATOM 345   H H    . ARG A 1 26 ? -9.446  -8.378  3.330   1.00 0.00 ? 26 ARG A H    1  
ATOM 346   H HA   . ARG A 1 26 ? -10.927 -10.801 2.814   1.00 0.00 ? 26 ARG A HA   1  
ATOM 347   H HB3  . ARG A 1 26 ? -8.796  -11.465 1.573   1.00 0.00 ? 26 ARG A HB3  1  
ATOM 348   H HG3  . ARG A 1 26 ? -9.052  -9.145  0.066   1.00 0.00 ? 26 ARG A HG3  1  
ATOM 349   H HD3  . ARG A 1 26 ? -9.839  -11.840 -0.108  1.00 0.00 ? 26 ARG A HD3  1  
ATOM 350   H HE   . ARG A 1 26 ? -12.229 -10.188 0.150   1.00 0.00 ? 26 ARG A HE   1  
ATOM 351   H HH11 . ARG A 1 26 ? -10.873 -13.000 -1.472  1.00 0.00 ? 26 ARG A HH11 1  
ATOM 352   H HH12 . ARG A 1 26 ? -12.414 -13.738 -1.758  1.00 0.00 ? 26 ARG A HH12 1  
ATOM 353   H HH21 . ARG A 1 26 ? -14.263 -11.160 -0.227  1.00 0.00 ? 26 ARG A HH21 1  
ATOM 354   H HH22 . ARG A 1 26 ? -14.355 -12.684 -1.045  1.00 0.00 ? 26 ARG A HH22 1  
ATOM 355   N N    . ALA A 1 27 ? -9.124  -12.436 3.984   1.00 0.00 ? 27 ALA A N    1  
ATOM 356   C CA   . ALA A 1 27 ? -8.496  -13.280 4.986   1.00 0.00 ? 27 ALA A CA   1  
ATOM 357   C C    . ALA A 1 27 ? -6.996  -13.376 4.698   1.00 0.00 ? 27 ALA A C    1  
ATOM 358   O O    . ALA A 1 27 ? -6.177  -13.223 5.603   1.00 0.00 ? 27 ALA A O    1  
ATOM 359   C CB   . ALA A 1 27 ? -9.176  -14.650 4.999   1.00 0.00 ? 27 ALA A CB   1  
ATOM 360   H H    . ALA A 1 27 ? -9.426  -12.913 3.159   1.00 0.00 ? 27 ALA A H    1  
ATOM 361   H HA   . ALA A 1 27 ? -8.642  -12.806 5.957   1.00 0.00 ? 27 ALA A HA   1  
ATOM 362   H HB1  . ALA A 1 27 ? -9.232  -15.038 3.982   1.00 0.00 ? 27 ALA A HB1  1  
ATOM 363   H HB2  . ALA A 1 27 ? -8.598  -15.337 5.618   1.00 0.00 ? 27 ALA A HB2  1  
ATOM 364   H HB3  . ALA A 1 27 ? -10.182 -14.553 5.406   1.00 0.00 ? 27 ALA A HB3  1  
ATOM 365   N N    . SER A 1 28 ? -6.683  -13.627 3.436   1.00 0.00 ? 28 SER A N    1  
ATOM 366   C CA   . SER A 1 28 ? -5.296  -13.746 3.018   1.00 0.00 ? 28 SER A CA   1  
ATOM 367   C C    . SER A 1 28 ? -4.796  -12.403 2.479   1.00 0.00 ? 28 SER A C    1  
ATOM 368   O O    . SER A 1 28 ? -5.590  -11.574 2.036   1.00 0.00 ? 28 SER A O    1  
ATOM 369   C CB   . SER A 1 28 ? -5.131  -14.838 1.960   1.00 0.00 ? 28 SER A CB   1  
ATOM 370   O OG   . SER A 1 28 ? -5.839  -16.025 2.304   1.00 0.00 ? 28 SER A OG   1  
ATOM 371   H H    . SER A 1 28 ? -7.356  -13.750 2.707   1.00 0.00 ? 28 SER A H    1  
ATOM 372   H HA   . SER A 1 28 ? -4.747  -14.024 3.917   1.00 0.00 ? 28 SER A HA   1  
ATOM 373   H HB3  . SER A 1 28 ? -4.073  -15.068 1.839   1.00 0.00 ? 28 SER A HB3  1  
ATOM 374   H HG   . SER A 1 28 ? -6.635  -16.134 1.708   1.00 0.00 ? 28 SER A HG   1  
ATOM 375   N N    . VAL A 1 29 ? -3.484  -12.232 2.533   1.00 0.00 ? 29 VAL A N    1  
ATOM 376   C CA   . VAL A 1 29 ? -2.869  -11.006 2.056   1.00 0.00 ? 29 VAL A CA   1  
ATOM 377   C C    . VAL A 1 29 ? -2.705  -11.080 0.537   1.00 0.00 ? 29 VAL A C    1  
ATOM 378   O O    . VAL A 1 29 ? -1.882  -11.844 0.034   1.00 0.00 ? 29 VAL A O    1  
ATOM 379   C CB   . VAL A 1 29 ? -1.547  -10.763 2.789   1.00 0.00 ? 29 VAL A CB   1  
ATOM 380   C CG1  . VAL A 1 29 ? -0.838  -9.523  2.242   1.00 0.00 ? 29 VAL A CG1  1  
ATOM 381   C CG2  . VAL A 1 29 ? -1.771  -10.646 4.298   1.00 0.00 ? 29 VAL A CG2  1  
ATOM 382   H H    . VAL A 1 29 ? -2.845  -12.912 2.895   1.00 0.00 ? 29 VAL A H    1  
ATOM 383   H HA   . VAL A 1 29 ? -3.544  -10.184 2.297   1.00 0.00 ? 29 VAL A HA   1  
ATOM 384   H HB   . VAL A 1 29 ? -0.904  -11.624 2.611   1.00 0.00 ? 29 VAL A HB   1  
ATOM 385   H HG11 . VAL A 1 29 ? -1.579  -8.787  1.931   1.00 0.00 ? 29 VAL A HG11 1  
ATOM 386   H HG12 . VAL A 1 29 ? -0.204  -9.095  3.018   1.00 0.00 ? 29 VAL A HG12 1  
ATOM 387   H HG13 . VAL A 1 29 ? -0.223  -9.803  1.386   1.00 0.00 ? 29 VAL A HG13 1  
ATOM 388   H HG21 . VAL A 1 29 ? -2.816  -10.855 4.528   1.00 0.00 ? 29 VAL A HG21 1  
ATOM 389   H HG22 . VAL A 1 29 ? -1.135  -11.364 4.815   1.00 0.00 ? 29 VAL A HG22 1  
ATOM 390   H HG23 . VAL A 1 29 ? -1.521  -9.637  4.625   1.00 0.00 ? 29 VAL A HG23 1  
ATOM 391   N N    . VAL A 1 30 ? -3.502  -10.276 -0.152  1.00 0.00 ? 30 VAL A N    1  
ATOM 392   C CA   . VAL A 1 30 ? -3.455  -10.241 -1.604  1.00 0.00 ? 30 VAL A CA   1  
ATOM 393   C C    . VAL A 1 30 ? -2.498  -9.135  -2.053  1.00 0.00 ? 30 VAL A C    1  
ATOM 394   O O    . VAL A 1 30 ? -2.258  -8.181  -1.316  1.00 0.00 ? 30 VAL A O    1  
ATOM 395   C CB   . VAL A 1 30 ? -4.867  -10.077 -2.169  1.00 0.00 ? 30 VAL A CB   1  
ATOM 396   C CG1  . VAL A 1 30 ? -5.632  -11.401 -2.128  1.00 0.00 ? 30 VAL A CG1  1  
ATOM 397   C CG2  . VAL A 1 30 ? -5.631  -8.980  -1.425  1.00 0.00 ? 30 VAL A CG2  1  
ATOM 398   H H    . VAL A 1 30 ? -4.168  -9.658  0.264   1.00 0.00 ? 30 VAL A H    1  
ATOM 399   H HA   . VAL A 1 30 ? -3.066  -11.202 -1.944  1.00 0.00 ? 30 VAL A HA   1  
ATOM 400   H HB   . VAL A 1 30 ? -4.778  -9.774  -3.212  1.00 0.00 ? 30 VAL A HB   1  
ATOM 401   H HG11 . VAL A 1 30 ? -5.700  -11.750 -1.098  1.00 0.00 ? 30 VAL A HG11 1  
ATOM 402   H HG12 . VAL A 1 30 ? -6.635  -11.255 -2.530  1.00 0.00 ? 30 VAL A HG12 1  
ATOM 403   H HG13 . VAL A 1 30 ? -5.105  -12.144 -2.729  1.00 0.00 ? 30 VAL A HG13 1  
ATOM 404   H HG21 . VAL A 1 30 ? -6.388  -8.554  -2.083  1.00 0.00 ? 30 VAL A HG21 1  
ATOM 405   H HG22 . VAL A 1 30 ? -6.113  -9.406  -0.545  1.00 0.00 ? 30 VAL A HG22 1  
ATOM 406   H HG23 . VAL A 1 30 ? -4.937  -8.199  -1.116  1.00 0.00 ? 30 VAL A HG23 1  
ATOM 407   N N    . PRO A 1 31 ? -1.967  -9.304  -3.293  1.00 0.00 ? 31 PRO A N    1  
ATOM 408   C CA   . PRO A 1 31 ? -1.041  -8.330  -3.850  1.00 0.00 ? 31 PRO A CA   1  
ATOM 409   C C    . PRO A 1 31 ? -1.780  -7.068  -4.300  1.00 0.00 ? 31 PRO A C    1  
ATOM 410   O O    . PRO A 1 31 ? -3.009  -7.028  -4.294  1.00 0.00 ? 31 PRO A O    1  
ATOM 411   C CB   . PRO A 1 31 ? -0.350  -9.054  -4.994  1.00 0.00 ? 31 PRO A CB   1  
ATOM 412   C CG   . PRO A 1 31 ? -1.236  -10.242 -5.332  1.00 0.00 ? 31 PRO A CG   1  
ATOM 413   C CD   . PRO A 1 31 ? -2.230  -10.421 -4.196  1.00 0.00 ? 31 PRO A CD   1  
ATOM 414   H HA   . PRO A 1 31 ? -0.391  -8.032  -3.152  1.00 0.00 ? 31 PRO A HA   1  
ATOM 415   H HB3  . PRO A 1 31 ? 0.648   -9.382  -4.702  1.00 0.00 ? 31 PRO A HB3  1  
ATOM 416   H HG3  . PRO A 1 31 ? -0.635  -11.142 -5.459  1.00 0.00 ? 31 PRO A HG3  1  
ATOM 417   H HD3  . PRO A 1 31 ? -2.088  -11.377 -3.693  1.00 0.00 ? 31 PRO A HD3  1  
ATOM 418   N N    . LEU A 1 32 ? -0.998  -6.068  -4.681  1.00 0.00 ? 32 LEU A N    1  
ATOM 419   C CA   . LEU A 1 32 ? -1.563  -4.808  -5.133  1.00 0.00 ? 32 LEU A CA   1  
ATOM 420   C C    . LEU A 1 32 ? -1.218  -4.601  -6.609  1.00 0.00 ? 32 LEU A C    1  
ATOM 421   O O    . LEU A 1 32 ? -0.093  -4.228  -6.942  1.00 0.00 ? 32 LEU A O    1  
ATOM 422   C CB   . LEU A 1 32 ? -1.107  -3.662  -4.229  1.00 0.00 ? 32 LEU A CB   1  
ATOM 423   C CG   . LEU A 1 32 ? -1.339  -2.249  -4.768  1.00 0.00 ? 32 LEU A CG   1  
ATOM 424   C CD1  . LEU A 1 32 ? -2.713  -2.134  -5.430  1.00 0.00 ? 32 LEU A CD1  1  
ATOM 425   C CD2  . LEU A 1 32 ? -1.143  -1.203  -3.669  1.00 0.00 ? 32 LEU A CD2  1  
ATOM 426   H H    . LEU A 1 32 ? 0.001   -6.109  -4.683  1.00 0.00 ? 32 LEU A H    1  
ATOM 427   H HA   . LEU A 1 32 ? -2.646  -4.882  -5.038  1.00 0.00 ? 32 LEU A HA   1  
ATOM 428   H HB3  . LEU A 1 32 ? -0.042  -3.782  -4.031  1.00 0.00 ? 32 LEU A HB3  1  
ATOM 429   H HG   . LEU A 1 32 ? -0.593  -2.049  -5.538  1.00 0.00 ? 32 LEU A HG   1  
ATOM 430   H HD11 . LEU A 1 32 ? -2.922  -3.043  -5.994  1.00 0.00 ? 32 LEU A HD11 1  
ATOM 431   H HD12 . LEU A 1 32 ? -3.476  -1.999  -4.662  1.00 0.00 ? 32 LEU A HD12 1  
ATOM 432   H HD13 . LEU A 1 32 ? -2.722  -1.277  -6.105  1.00 0.00 ? 32 LEU A HD13 1  
ATOM 433   H HD21 . LEU A 1 32 ? -0.138  -0.787  -3.737  1.00 0.00 ? 32 LEU A HD21 1  
ATOM 434   H HD22 . LEU A 1 32 ? -1.875  -0.405  -3.792  1.00 0.00 ? 32 LEU A HD22 1  
ATOM 435   H HD23 . LEU A 1 32 ? -1.277  -1.671  -2.694  1.00 0.00 ? 32 LEU A HD23 1  
ATOM 436   N N    . PRO A 1 33 ? -2.232  -4.859  -7.478  1.00 0.00 ? 33 PRO A N    1  
ATOM 437   C CA   . PRO A 1 33 ? -2.047  -4.705  -8.911  1.00 0.00 ? 33 PRO A CA   1  
ATOM 438   C C    . PRO A 1 33 ? -2.037  -3.226  -9.307  1.00 0.00 ? 33 PRO A C    1  
ATOM 439   O O    . PRO A 1 33 ? -3.026  -2.714  -9.829  1.00 0.00 ? 33 PRO A O    1  
ATOM 440   C CB   . PRO A 1 33 ? -3.192  -5.480  -9.541  1.00 0.00 ? 33 PRO A CB   1  
ATOM 441   C CG   . PRO A 1 33 ? -4.234  -5.649  -8.446  1.00 0.00 ? 33 PRO A CG   1  
ATOM 442   C CD   . PRO A 1 33 ? -3.576  -5.301  -7.121  1.00 0.00 ? 33 PRO A CD   1  
ATOM 443   H HA   . PRO A 1 33 ? -1.158  -5.067  -9.188  1.00 0.00 ? 33 PRO A HA   1  
ATOM 444   H HB3  . PRO A 1 33 ? -2.853  -6.448  -9.909  1.00 0.00 ? 33 PRO A HB3  1  
ATOM 445   H HG3  . PRO A 1 33 ? -4.608  -6.672  -8.429  1.00 0.00 ? 33 PRO A HG3  1  
ATOM 446   H HD3  . PRO A 1 33 ? -3.545  -6.165  -6.456  1.00 0.00 ? 33 PRO A HD3  1  
ATOM 447   N N    . TYR A 1 34 ? -0.909  -2.584  -9.043  1.00 0.00 ? 34 TYR A N    1  
ATOM 448   C CA   . TYR A 1 34 ? -0.758  -1.175  -9.365  1.00 0.00 ? 34 TYR A CA   1  
ATOM 449   C C    . TYR A 1 34 ? -1.121  -0.904  -10.827 1.00 0.00 ? 34 TYR A C    1  
ATOM 450   O O    . TYR A 1 34 ? -1.950  -0.043  -11.114 1.00 0.00 ? 34 TYR A O    1  
ATOM 451   C CB   . TYR A 1 34 ? 0.722   -0.851  -9.152  1.00 0.00 ? 34 TYR A CB   1  
ATOM 452   C CG   . TYR A 1 34 ? 1.189   -1.000  -7.702  1.00 0.00 ? 34 TYR A CG   1  
ATOM 453   C CD1  . TYR A 1 34 ? 0.932   0.000   -6.787  1.00 0.00 ? 34 TYR A CD1  1  
ATOM 454   C CD2  . TYR A 1 34 ? 1.868   -2.136  -7.311  1.00 0.00 ? 34 TYR A CD2  1  
ATOM 455   C CE1  . TYR A 1 34 ? 1.371   -0.140  -5.424  1.00 0.00 ? 34 TYR A CE1  1  
ATOM 456   C CE2  . TYR A 1 34 ? 2.308   -2.277  -5.946  1.00 0.00 ? 34 TYR A CE2  1  
ATOM 457   C CZ   . TYR A 1 34 ? 2.038   -1.273  -5.070  1.00 0.00 ? 34 TYR A CZ   1  
ATOM 458   O OH   . TYR A 1 34 ? 2.453   -1.405  -3.782  1.00 0.00 ? 34 TYR A OH   1  
ATOM 459   H H    . TYR A 1 34 ? -0.110  -3.009  -8.618  1.00 0.00 ? 34 TYR A H    1  
ATOM 460   H HA   . TYR A 1 34 ? -1.430  -0.608  -8.721  1.00 0.00 ? 34 TYR A HA   1  
ATOM 461   H HB3  . TYR A 1 34 ? 0.910   0.172   -9.479  1.00 0.00 ? 34 TYR A HB3  1  
ATOM 462   H HD1  . TYR A 1 34 ? 0.395   0.898   -7.097  1.00 0.00 ? 34 TYR A HD1  1  
ATOM 463   H HD2  . TYR A 1 34 ? 2.072   -2.926  -8.033  1.00 0.00 ? 34 TYR A HD2  1  
ATOM 464   H HE1  . TYR A 1 34 ? 1.175   0.642   -4.691  1.00 0.00 ? 34 TYR A HE1  1  
ATOM 465   H HE2  . TYR A 1 34 ? 2.845   -3.169  -5.623  1.00 0.00 ? 34 TYR A HE2  1  
ATOM 466   H HH   . TYR A 1 34 ? 2.863   -2.308  -3.646  1.00 0.00 ? 34 TYR A HH   1  
ATOM 467   N N    . GLU A 1 35 ? -0.483  -1.658  -11.711 1.00 0.00 ? 35 GLU A N    1  
ATOM 468   C CA   . GLU A 1 35 ? -0.729  -1.509  -13.135 1.00 0.00 ? 35 GLU A CA   1  
ATOM 469   C C    . GLU A 1 35 ? -2.218  -1.267  -13.395 1.00 0.00 ? 35 GLU A C    1  
ATOM 470   O O    . GLU A 1 35 ? -2.581  -0.590  -14.355 1.00 0.00 ? 35 GLU A O    1  
ATOM 471   C CB   . GLU A 1 35 ? -0.229  -2.732  -13.908 1.00 0.00 ? 35 GLU A CB   1  
ATOM 472   C CG   . GLU A 1 35 ? -0.966  -3.998  -13.466 1.00 0.00 ? 35 GLU A CG   1  
ATOM 473   C CD   . GLU A 1 35 ? -0.347  -5.243  -14.104 1.00 0.00 ? 35 GLU A CD   1  
ATOM 474   O OE1  . GLU A 1 35 ? 0.716   -5.670  -13.603 1.00 0.00 ? 35 GLU A OE1  1  
ATOM 475   O OE2  . GLU A 1 35 ? -0.950  -5.741  -15.078 1.00 0.00 ? 35 GLU A OE2  1  
ATOM 476   H H    . GLU A 1 35 ? 0.190   -2.356  -11.469 1.00 0.00 ? 35 GLU A H    1  
ATOM 477   H HA   . GLU A 1 35 ? -0.153  -0.635  -13.439 1.00 0.00 ? 35 GLU A HA   1  
ATOM 478   H HB3  . GLU A 1 35 ? 0.842   -2.855  -13.748 1.00 0.00 ? 35 GLU A HB3  1  
ATOM 479   H HG3  . GLU A 1 35 ? -2.017  -3.927  -13.743 1.00 0.00 ? 35 GLU A HG3  1  
ATOM 480   N N    . ARG A 1 36 ? -3.038  -1.834  -12.522 1.00 0.00 ? 36 ARG A N    1  
ATOM 481   C CA   . ARG A 1 36 ? -4.477  -1.688  -12.645 1.00 0.00 ? 36 ARG A CA   1  
ATOM 482   C C    . ARG A 1 36 ? -4.965  -0.507  -11.803 1.00 0.00 ? 36 ARG A C    1  
ATOM 483   O O    . ARG A 1 36 ? -5.412  0.503   -12.345 1.00 0.00 ? 36 ARG A O    1  
ATOM 484   C CB   . ARG A 1 36 ? -5.201  -2.960  -12.194 1.00 0.00 ? 36 ARG A CB   1  
ATOM 485   C CG   . ARG A 1 36 ? -5.121  -4.045  -13.268 1.00 0.00 ? 36 ARG A CG   1  
ATOM 486   C CD   . ARG A 1 36 ? -6.404  -4.879  -13.302 1.00 0.00 ? 36 ARG A CD   1  
ATOM 487   N NE   . ARG A 1 36 ? -6.103  -6.285  -12.954 1.00 0.00 ? 36 ARG A NE   1  
ATOM 488   C CZ   . ARG A 1 36 ? -5.505  -7.153  -13.780 1.00 0.00 ? 36 ARG A CZ   1  
ATOM 489   N NH1  . ARG A 1 36 ? -5.139  -6.764  -15.009 1.00 0.00 ? 36 ARG A NH1  1  
ATOM 490   N NH2  . ARG A 1 36 ? -5.271  -8.409  -13.379 1.00 0.00 ? 36 ARG A NH2  1  
ATOM 491   H H    . ARG A 1 36 ? -2.732  -2.383  -11.744 1.00 0.00 ? 36 ARG A H    1  
ATOM 492   H HA   . ARG A 1 36 ? -4.651  -1.512  -13.707 1.00 0.00 ? 36 ARG A HA   1  
ATOM 493   H HB3  . ARG A 1 36 ? -6.244  -2.731  -11.979 1.00 0.00 ? 36 ARG A HB3  1  
ATOM 494   H HG3  . ARG A 1 36 ? -4.267  -4.694  -13.073 1.00 0.00 ? 36 ARG A HG3  1  
ATOM 495   H HD3  . ARG A 1 36 ? -6.854  -4.829  -14.294 1.00 0.00 ? 36 ARG A HD3  1  
ATOM 496   H HE   . ARG A 1 36 ? -6.364  -6.609  -12.044 1.00 0.00 ? 36 ARG A HE   1  
ATOM 497   H HH11 . ARG A 1 36 ? -5.313  -5.825  -15.309 1.00 0.00 ? 36 ARG A HH11 1  
ATOM 498   H HH12 . ARG A 1 36 ? -4.692  -7.411  -15.627 1.00 0.00 ? 36 ARG A HH12 1  
ATOM 499   H HH21 . ARG A 1 36 ? -5.545  -8.700  -12.462 1.00 0.00 ? 36 ARG A HH21 1  
ATOM 500   H HH22 . ARG A 1 36 ? -4.825  -9.058  -13.996 1.00 0.00 ? 36 ARG A HH22 1  
ATOM 501   N N    . LEU A 1 37 ? -4.863  -0.673  -10.493 1.00 0.00 ? 37 LEU A N    1  
ATOM 502   C CA   . LEU A 1 37 ? -5.288  0.367   -9.571  1.00 0.00 ? 37 LEU A CA   1  
ATOM 503   C C    . LEU A 1 37 ? -4.819  1.727   -10.092 1.00 0.00 ? 37 LEU A C    1  
ATOM 504   O O    . LEU A 1 37 ? -5.501  2.734   -9.911  1.00 0.00 ? 37 LEU A O    1  
ATOM 505   C CB   . LEU A 1 37 ? -4.808  0.054   -8.152  1.00 0.00 ? 37 LEU A CB   1  
ATOM 506   C CG   . LEU A 1 37 ? -5.148  -1.340  -7.622  1.00 0.00 ? 37 LEU A CG   1  
ATOM 507   C CD1  . LEU A 1 37 ? -5.304  -1.324  -6.099  1.00 0.00 ? 37 LEU A CD1  1  
ATOM 508   C CD2  . LEU A 1 37 ? -6.389  -1.904  -8.319  1.00 0.00 ? 37 LEU A CD2  1  
ATOM 509   H H    . LEU A 1 37 ? -4.498  -1.498  -10.061 1.00 0.00 ? 37 LEU A H    1  
ATOM 510   H HA   . LEU A 1 37 ? -6.377  0.361   -9.552  1.00 0.00 ? 37 LEU A HA   1  
ATOM 511   H HB3  . LEU A 1 37 ? -5.235  0.794   -7.474  1.00 0.00 ? 37 LEU A HB3  1  
ATOM 512   H HG   . LEU A 1 37 ? -4.318  -2.007  -7.854  1.00 0.00 ? 37 LEU A HG   1  
ATOM 513   H HD11 . LEU A 1 37 ? -4.572  -0.642  -5.667  1.00 0.00 ? 37 LEU A HD11 1  
ATOM 514   H HD12 . LEU A 1 37 ? -6.310  -0.990  -5.840  1.00 0.00 ? 37 LEU A HD12 1  
ATOM 515   H HD13 . LEU A 1 37 ? -5.143  -2.329  -5.707  1.00 0.00 ? 37 LEU A HD13 1  
ATOM 516   H HD21 . LEU A 1 37 ? -7.131  -1.115  -8.435  1.00 0.00 ? 37 LEU A HD21 1  
ATOM 517   H HD22 . LEU A 1 37 ? -6.110  -2.289  -9.299  1.00 0.00 ? 37 LEU A HD22 1  
ATOM 518   H HD23 . LEU A 1 37 ? -6.808  -2.711  -7.718  1.00 0.00 ? 37 LEU A HD23 1  
ATOM 519   N N    . LEU A 1 38 ? -3.657  1.712   -10.731 1.00 0.00 ? 38 LEU A N    1  
ATOM 520   C CA   . LEU A 1 38 ? -3.089  2.932   -11.279 1.00 0.00 ? 38 LEU A CA   1  
ATOM 521   C C    . LEU A 1 38 ? -4.002  3.460   -12.389 1.00 0.00 ? 38 LEU A C    1  
ATOM 522   O O    . LEU A 1 38 ? -4.347  4.640   -12.404 1.00 0.00 ? 38 LEU A O    1  
ATOM 523   C CB   . LEU A 1 38 ? -1.647  2.696   -11.730 1.00 0.00 ? 38 LEU A CB   1  
ATOM 524   C CG   . LEU A 1 38 ? -0.634  2.415   -10.617 1.00 0.00 ? 38 LEU A CG   1  
ATOM 525   C CD1  . LEU A 1 38 ? 0.681   1.887   -11.193 1.00 0.00 ? 38 LEU A CD1  1  
ATOM 526   C CD2  . LEU A 1 38 ? -0.420  3.654   -9.746  1.00 0.00 ? 38 LEU A CD2  1  
ATOM 527   H H    . LEU A 1 38 ? -3.109  0.889   -10.874 1.00 0.00 ? 38 LEU A H    1  
ATOM 528   H HA   . LEU A 1 38 ? -3.060  3.668   -10.477 1.00 0.00 ? 38 LEU A HA   1  
ATOM 529   H HB3  . LEU A 1 38 ? -1.313  3.572   -12.285 1.00 0.00 ? 38 LEU A HB3  1  
ATOM 530   H HG   . LEU A 1 38 ? -1.041  1.635   -9.974  1.00 0.00 ? 38 LEU A HG   1  
ATOM 531   H HD11 . LEU A 1 38 ? 0.565   0.834   -11.454 1.00 0.00 ? 38 LEU A HD11 1  
ATOM 532   H HD12 . LEU A 1 38 ? 0.942   2.456   -12.086 1.00 0.00 ? 38 LEU A HD12 1  
ATOM 533   H HD13 . LEU A 1 38 ? 1.471   1.992   -10.451 1.00 0.00 ? 38 LEU A HD13 1  
ATOM 534   H HD21 . LEU A 1 38 ? 0.503   3.544   -9.176  1.00 0.00 ? 38 LEU A HD21 1  
ATOM 535   H HD22 . LEU A 1 38 ? -0.353  4.538   -10.380 1.00 0.00 ? 38 LEU A HD22 1  
ATOM 536   H HD23 . LEU A 1 38 ? -1.260  3.764   -9.058  1.00 0.00 ? 38 LEU A HD23 1  
ATOM 537   N N    . ARG A 1 39 ? -4.365  2.559   -13.290 1.00 0.00 ? 39 ARG A N    1  
ATOM 538   C CA   . ARG A 1 39 ? -5.230  2.919   -14.401 1.00 0.00 ? 39 ARG A CA   1  
ATOM 539   C C    . ARG A 1 39 ? -6.483  3.632   -13.888 1.00 0.00 ? 39 ARG A C    1  
ATOM 540   O O    . ARG A 1 39 ? -6.841  4.699   -14.383 1.00 0.00 ? 39 ARG A O    1  
ATOM 541   C CB   . ARG A 1 39 ? -5.647  1.681   -15.199 1.00 0.00 ? 39 ARG A CB   1  
ATOM 542   C CG   . ARG A 1 39 ? -6.602  2.057   -16.332 1.00 0.00 ? 39 ARG A CG   1  
ATOM 543   C CD   . ARG A 1 39 ? -8.002  1.491   -16.080 1.00 0.00 ? 39 ARG A CD   1  
ATOM 544   N NE   . ARG A 1 39 ? -8.768  1.451   -17.346 1.00 0.00 ? 39 ARG A NE   1  
ATOM 545   C CZ   . ARG A 1 39 ? -8.465  0.660   -18.383 1.00 0.00 ? 39 ARG A CZ   1  
ATOM 546   N NH1  . ARG A 1 39 ? -7.409  -0.162  -18.313 1.00 0.00 ? 39 ARG A NH1  1  
ATOM 547   N NH2  . ARG A 1 39 ? -9.217  0.691   -19.491 1.00 0.00 ? 39 ARG A NH2  1  
ATOM 548   H H    . ARG A 1 39 ? -4.080  1.602   -13.270 1.00 0.00 ? 39 ARG A H    1  
ATOM 549   H HA   . ARG A 1 39 ? -4.627  3.583   -15.020 1.00 0.00 ? 39 ARG A HA   1  
ATOM 550   H HB3  . ARG A 1 39 ? -6.126  0.962   -14.536 1.00 0.00 ? 39 ARG A HB3  1  
ATOM 551   H HG3  . ARG A 1 39 ? -6.218  1.676   -17.279 1.00 0.00 ? 39 ARG A HG3  1  
ATOM 552   H HD3  . ARG A 1 39 ? -8.524  2.105   -15.348 1.00 0.00 ? 39 ARG A HD3  1  
ATOM 553   H HE   . ARG A 1 39 ? -9.562  2.053   -17.431 1.00 0.00 ? 39 ARG A HE   1  
ATOM 554   H HH11 . ARG A 1 39 ? -6.848  -0.185  -17.485 1.00 0.00 ? 39 ARG A HH11 1  
ATOM 555   H HH12 . ARG A 1 39 ? -7.182  -0.753  -19.087 1.00 0.00 ? 39 ARG A HH12 1  
ATOM 556   H HH21 . ARG A 1 39 ? -10.004 1.305   -19.545 1.00 0.00 ? 39 ARG A HH21 1  
ATOM 557   H HH22 . ARG A 1 39 ? -8.989  0.101   -20.266 1.00 0.00 ? 39 ARG A HH22 1  
ATOM 558   N N    . GLU A 1 40 ? -7.116  3.012   -12.902 1.00 0.00 ? 40 GLU A N    1  
ATOM 559   C CA   . GLU A 1 40 ? -8.322  3.574   -12.317 1.00 0.00 ? 40 GLU A CA   1  
ATOM 560   C C    . GLU A 1 40 ? -8.071  3.967   -10.860 1.00 0.00 ? 40 GLU A C    1  
ATOM 561   O O    . GLU A 1 40 ? -8.033  3.109   -9.979  1.00 0.00 ? 40 GLU A O    1  
ATOM 562   C CB   . GLU A 1 40 ? -9.492  2.595   -12.427 1.00 0.00 ? 40 GLU A CB   1  
ATOM 563   C CG   . GLU A 1 40 ? -8.994  1.151   -12.505 1.00 0.00 ? 40 GLU A CG   1  
ATOM 564   C CD   . GLU A 1 40 ? -10.160 0.176   -12.680 1.00 0.00 ? 40 GLU A CD   1  
ATOM 565   O OE1  . GLU A 1 40 ? -11.276 0.546   -12.255 1.00 0.00 ? 40 GLU A OE1  1  
ATOM 566   O OE2  . GLU A 1 40 ? -9.910  -0.916  -13.234 1.00 0.00 ? 40 GLU A OE2  1  
ATOM 567   H H    . GLU A 1 40 ? -6.818  2.144   -12.505 1.00 0.00 ? 40 GLU A H    1  
ATOM 568   H HA   . GLU A 1 40 ? -8.543  4.463   -12.907 1.00 0.00 ? 40 GLU A HA   1  
ATOM 569   H HB3  . GLU A 1 40 ? -10.084 2.828   -13.313 1.00 0.00 ? 40 GLU A HB3  1  
ATOM 570   H HG3  . GLU A 1 40 ? -8.441  0.904   -11.599 1.00 0.00 ? 40 GLU A HG3  1  
ATOM 571   N N    . PRO A 1 41 ? -7.903  5.300   -10.644 1.00 0.00 ? 41 PRO A N    1  
ATOM 572   C CA   . PRO A 1 41 ? -7.657  5.816   -9.309  1.00 0.00 ? 41 PRO A CA   1  
ATOM 573   C C    . PRO A 1 41 ? -8.938  5.808   -8.473  1.00 0.00 ? 41 PRO A C    1  
ATOM 574   O O    . PRO A 1 41 ? -8.884  5.708   -7.249  1.00 0.00 ? 41 PRO A O    1  
ATOM 575   C CB   . PRO A 1 41 ? -7.098  7.213   -9.524  1.00 0.00 ? 41 PRO A CB   1  
ATOM 576   C CG   . PRO A 1 41 ? -7.484  7.603   -10.942 1.00 0.00 ? 41 PRO A CG   1  
ATOM 577   C CD   . PRO A 1 41 ? -7.942  6.344   -11.663 1.00 0.00 ? 41 PRO A CD   1  
ATOM 578   H HA   . PRO A 1 41 ? -7.009  5.229   -8.823  1.00 0.00 ? 41 PRO A HA   1  
ATOM 579   H HB3  . PRO A 1 41 ? -6.015  7.224   -9.398  1.00 0.00 ? 41 PRO A HB3  1  
ATOM 580   H HG3  . PRO A 1 41 ? -6.636  8.051   -11.460 1.00 0.00 ? 41 PRO A HG3  1  
ATOM 581   H HD3  . PRO A 1 41 ? -7.286  6.107   -12.500 1.00 0.00 ? 41 PRO A HD3  1  
ATOM 582   N N    . GLY A 1 42 ? -10.061 5.914   -9.169  1.00 0.00 ? 42 GLY A N    1  
ATOM 583   C CA   . GLY A 1 42 ? -11.354 5.919   -8.506  1.00 0.00 ? 42 GLY A CA   1  
ATOM 584   C C    . GLY A 1 42 ? -11.663 4.552   -7.894  1.00 0.00 ? 42 GLY A C    1  
ATOM 585   O O    . GLY A 1 42 ? -12.397 4.458   -6.911  1.00 0.00 ? 42 GLY A O    1  
ATOM 586   H H    . GLY A 1 42 ? -10.097 5.994   -10.165 1.00 0.00 ? 42 GLY A H    1  
ATOM 587   H HA2  . GLY A 1 42 ? -11.364 6.681   -7.726  1.00 0.00 ? 42 GLY A HA2  1  
ATOM 588   H HA3  . GLY A 1 42 ? -12.133 6.186   -9.222  1.00 0.00 ? 42 GLY A HA3  1  
ATOM 589   N N    . LEU A 1 43 ? -11.086 3.524   -8.499  1.00 0.00 ? 43 LEU A N    1  
ATOM 590   C CA   . LEU A 1 43 ? -11.290 2.166   -8.026  1.00 0.00 ? 43 LEU A CA   1  
ATOM 591   C C    . LEU A 1 43 ? -10.706 2.028   -6.618  1.00 0.00 ? 43 LEU A C    1  
ATOM 592   O O    . LEU A 1 43 ? -11.318 1.411   -5.747  1.00 0.00 ? 43 LEU A O    1  
ATOM 593   C CB   . LEU A 1 43 ? -10.723 1.159   -9.028  1.00 0.00 ? 43 LEU A CB   1  
ATOM 594   C CG   . LEU A 1 43 ? -11.197 -0.287  -8.867  1.00 0.00 ? 43 LEU A CG   1  
ATOM 595   C CD1  . LEU A 1 43 ? -12.609 -0.466  -9.429  1.00 0.00 ? 43 LEU A CD1  1  
ATOM 596   C CD2  . LEU A 1 43 ? -10.202 -1.264  -9.498  1.00 0.00 ? 43 LEU A CD2  1  
ATOM 597   H H    . LEU A 1 43 ? -10.489 3.608   -9.297  1.00 0.00 ? 43 LEU A H    1  
ATOM 598   H HA   . LEU A 1 43 ? -12.365 1.997   -7.973  1.00 0.00 ? 43 LEU A HA   1  
ATOM 599   H HB3  . LEU A 1 43 ? -9.635  1.173   -8.952  1.00 0.00 ? 43 LEU A HB3  1  
ATOM 600   H HG   . LEU A 1 43 ? -11.243 -0.516  -7.803  1.00 0.00 ? 43 LEU A HG   1  
ATOM 601   H HD11 . LEU A 1 43 ? -13.276 0.270   -8.979  1.00 0.00 ? 43 LEU A HD11 1  
ATOM 602   H HD12 . LEU A 1 43 ? -12.590 -0.326  -10.510 1.00 0.00 ? 43 LEU A HD12 1  
ATOM 603   H HD13 . LEU A 1 43 ? -12.967 -1.469  -9.199  1.00 0.00 ? 43 LEU A HD13 1  
ATOM 604   H HD21 . LEU A 1 43 ? -9.569  -0.731  -10.206 1.00 0.00 ? 43 LEU A HD21 1  
ATOM 605   H HD22 . LEU A 1 43 ? -9.582  -1.705  -8.716  1.00 0.00 ? 43 LEU A HD22 1  
ATOM 606   H HD23 . LEU A 1 43 ? -10.746 -2.052  -10.018 1.00 0.00 ? 43 LEU A HD23 1  
ATOM 607   N N    . LEU A 1 44 ? -9.532  2.613   -6.439  1.00 0.00 ? 44 LEU A N    1  
ATOM 608   C CA   . LEU A 1 44 ? -8.860  2.563   -5.151  1.00 0.00 ? 44 LEU A CA   1  
ATOM 609   C C    . LEU A 1 44 ? -7.895  3.745   -5.039  1.00 0.00 ? 44 LEU A C    1  
ATOM 610   O O    . LEU A 1 44 ? -6.900  3.810   -5.759  1.00 0.00 ? 44 LEU A O    1  
ATOM 611   C CB   . LEU A 1 44 ? -8.191  1.202   -4.949  1.00 0.00 ? 44 LEU A CB   1  
ATOM 612   C CG   . LEU A 1 44 ? -7.120  1.137   -3.859  1.00 0.00 ? 44 LEU A CG   1  
ATOM 613   C CD1  . LEU A 1 44 ? -7.583  1.857   -2.590  1.00 0.00 ? 44 LEU A CD1  1  
ATOM 614   C CD2  . LEU A 1 44 ? -6.709  -0.310  -3.579  1.00 0.00 ? 44 LEU A CD2  1  
ATOM 615   H H    . LEU A 1 44 ? -9.042  3.113   -7.153  1.00 0.00 ? 44 LEU A H    1  
ATOM 616   H HA   . LEU A 1 44 ? -9.623  2.665   -4.380  1.00 0.00 ? 44 LEU A HA   1  
ATOM 617   H HB3  . LEU A 1 44 ? -7.739  0.897   -5.893  1.00 0.00 ? 44 LEU A HB3  1  
ATOM 618   H HG   . LEU A 1 44 ? -6.234  1.659   -4.218  1.00 0.00 ? 44 LEU A HG   1  
ATOM 619   H HD11 . LEU A 1 44 ? -6.921  1.599   -1.764  1.00 0.00 ? 44 LEU A HD11 1  
ATOM 620   H HD12 . LEU A 1 44 ? -7.559  2.933   -2.754  1.00 0.00 ? 44 LEU A HD12 1  
ATOM 621   H HD13 . LEU A 1 44 ? -8.601  1.549   -2.349  1.00 0.00 ? 44 LEU A HD13 1  
ATOM 622   H HD21 . LEU A 1 44 ? -6.804  -0.515  -2.512  1.00 0.00 ? 44 LEU A HD21 1  
ATOM 623   H HD22 . LEU A 1 44 ? -7.356  -0.986  -4.138  1.00 0.00 ? 44 LEU A HD22 1  
ATOM 624   H HD23 . LEU A 1 44 ? -5.674  -0.460  -3.887  1.00 0.00 ? 44 LEU A HD23 1  
ATOM 625   N N    . ALA A 1 45 ? -8.223  4.651   -4.128  1.00 0.00 ? 45 ALA A N    1  
ATOM 626   C CA   . ALA A 1 45 ? -7.398  5.827   -3.912  1.00 0.00 ? 45 ALA A CA   1  
ATOM 627   C C    . ALA A 1 45 ? -6.517  5.607   -2.681  1.00 0.00 ? 45 ALA A C    1  
ATOM 628   O O    . ALA A 1 45 ? -6.991  5.126   -1.653  1.00 0.00 ? 45 ALA A O    1  
ATOM 629   C CB   . ALA A 1 45 ? -8.293  7.061   -3.776  1.00 0.00 ? 45 ALA A CB   1  
ATOM 630   H H    . ALA A 1 45 ? -9.034  4.590   -3.546  1.00 0.00 ? 45 ALA A H    1  
ATOM 631   H HA   . ALA A 1 45 ? -6.760  5.950   -4.788  1.00 0.00 ? 45 ALA A HA   1  
ATOM 632   H HB1  . ALA A 1 45 ? -8.998  6.909   -2.959  1.00 0.00 ? 45 ALA A HB1  1  
ATOM 633   H HB2  . ALA A 1 45 ? -7.677  7.936   -3.567  1.00 0.00 ? 45 ALA A HB2  1  
ATOM 634   H HB3  . ALA A 1 45 ? -8.841  7.216   -4.705  1.00 0.00 ? 45 ALA A HB3  1  
ATOM 635   N N    . VAL A 1 46 ? -5.251  5.970   -2.825  1.00 0.00 ? 46 VAL A N    1  
ATOM 636   C CA   . VAL A 1 46 ? -4.299  5.819   -1.738  1.00 0.00 ? 46 VAL A CA   1  
ATOM 637   C C    . VAL A 1 46 ? -4.163  7.149   -0.996  1.00 0.00 ? 46 VAL A C    1  
ATOM 638   O O    . VAL A 1 46 ? -3.798  8.161   -1.591  1.00 0.00 ? 46 VAL A O    1  
ATOM 639   C CB   . VAL A 1 46 ? -2.967  5.295   -2.278  1.00 0.00 ? 46 VAL A CB   1  
ATOM 640   C CG1  . VAL A 1 46 ? -1.989  5.004   -1.137  1.00 0.00 ? 46 VAL A CG1  1  
ATOM 641   C CG2  . VAL A 1 46 ? -3.176  4.057   -3.150  1.00 0.00 ? 46 VAL A CG2  1  
ATOM 642   H H    . VAL A 1 46 ? -4.873  6.360   -3.666  1.00 0.00 ? 46 VAL A H    1  
ATOM 643   H HA   . VAL A 1 46 ? -4.701  5.073   -1.051  1.00 0.00 ? 46 VAL A HA   1  
ATOM 644   H HB   . VAL A 1 46 ? -2.529  6.074   -2.903  1.00 0.00 ? 46 VAL A HB   1  
ATOM 645   H HG11 . VAL A 1 46 ? -2.000  5.833   -0.429  1.00 0.00 ? 46 VAL A HG11 1  
ATOM 646   H HG12 . VAL A 1 46 ? -2.287  4.088   -0.628  1.00 0.00 ? 46 VAL A HG12 1  
ATOM 647   H HG13 . VAL A 1 46 ? -0.985  4.886   -1.541  1.00 0.00 ? 46 VAL A HG13 1  
ATOM 648   H HG21 . VAL A 1 46 ? -2.586  3.229   -2.754  1.00 0.00 ? 46 VAL A HG21 1  
ATOM 649   H HG22 . VAL A 1 46 ? -4.232  3.784   -3.147  1.00 0.00 ? 46 VAL A HG22 1  
ATOM 650   H HG23 . VAL A 1 46 ? -2.860  4.272   -4.171  1.00 0.00 ? 46 VAL A HG23 1  
ATOM 651   N N    . GLN A 1 47 ? -4.465  7.104   0.294   1.00 0.00 ? 47 GLN A N    1  
ATOM 652   C CA   . GLN A 1 47 ? -4.381  8.295   1.123   1.00 0.00 ? 47 GLN A CA   1  
ATOM 653   C C    . GLN A 1 47 ? -3.386  8.076   2.265   1.00 0.00 ? 47 GLN A C    1  
ATOM 654   O O    . GLN A 1 47 ? -2.973  6.948   2.526   1.00 0.00 ? 47 GLN A O    1  
ATOM 655   C CB   . GLN A 1 47 ? -5.758  8.685   1.663   1.00 0.00 ? 47 GLN A CB   1  
ATOM 656   C CG   . GLN A 1 47 ? -6.643  9.249   0.551   1.00 0.00 ? 47 GLN A CG   1  
ATOM 657   C CD   . GLN A 1 47 ? -6.376  10.741  0.341   1.00 0.00 ? 47 GLN A CD   1  
ATOM 658   O OE1  . GLN A 1 47 ? -6.542  11.559  1.231   1.00 0.00 ? 47 GLN A OE1  1  
ATOM 659   N NE2  . GLN A 1 47 ? -5.954  11.049  -0.882  1.00 0.00 ? 47 GLN A NE2  1  
ATOM 660   H H    . GLN A 1 47 ? -4.761  6.277   0.770   1.00 0.00 ? 47 GLN A H    1  
ATOM 661   H HA   . GLN A 1 47 ? -4.019  9.083   0.463   1.00 0.00 ? 47 GLN A HA   1  
ATOM 662   H HB3  . GLN A 1 47 ? -5.646  9.426   2.455   1.00 0.00 ? 47 GLN A HB3  1  
ATOM 663   H HG3  . GLN A 1 47 ? -7.692  9.096   0.802   1.00 0.00 ? 47 GLN A HG3  1  
ATOM 664   H HE21 . GLN A 1 47 ? -5.837  10.329  -1.567  1.00 0.00 ? 47 GLN A HE21 1  
ATOM 665   H HE22 . GLN A 1 47 ? -5.751  11.999  -1.117  1.00 0.00 ? 47 GLN A HE22 1  
ATOM 666   N N    . GLY A 1 48 ? -3.030  9.174   2.915   1.00 0.00 ? 48 GLY A N    1  
ATOM 667   C CA   . GLY A 1 48 ? -2.091  9.117   4.022   1.00 0.00 ? 48 GLY A CA   1  
ATOM 668   C C    . GLY A 1 48 ? -0.699  8.709   3.541   1.00 0.00 ? 48 GLY A C    1  
ATOM 669   O O    . GLY A 1 48 ? 0.063   8.088   4.282   1.00 0.00 ? 48 GLY A O    1  
ATOM 670   H H    . GLY A 1 48 ? -3.371  10.089  2.696   1.00 0.00 ? 48 GLY A H    1  
ATOM 671   H HA2  . GLY A 1 48 ? -2.040  10.090  4.511   1.00 0.00 ? 48 GLY A HA2  1  
ATOM 672   H HA3  . GLY A 1 48 ? -2.445  8.405   4.768   1.00 0.00 ? 48 GLY A HA3  1  
ATOM 673   N N    . LEU A 1 49 ? -0.406  9.073   2.301   1.00 0.00 ? 49 LEU A N    1  
ATOM 674   C CA   . LEU A 1 49 ? 0.883   8.752   1.710   1.00 0.00 ? 49 LEU A CA   1  
ATOM 675   C C    . LEU A 1 49 ? 1.948   9.689   2.284   1.00 0.00 ? 49 LEU A C    1  
ATOM 676   O O    . LEU A 1 49 ? 1.623   10.705  2.894   1.00 0.00 ? 49 LEU A O    1  
ATOM 677   C CB   . LEU A 1 49 ? 0.794   8.783   0.184   1.00 0.00 ? 49 LEU A CB   1  
ATOM 678   C CG   . LEU A 1 49 ? 0.427   7.461   -0.494  1.00 0.00 ? 49 LEU A CG   1  
ATOM 679   C CD1  . LEU A 1 49 ? -0.162  7.703   -1.885  1.00 0.00 ? 49 LEU A CD1  1  
ATOM 680   C CD2  . LEU A 1 49 ? 1.627   6.513   -0.536  1.00 0.00 ? 49 LEU A CD2  1  
ATOM 681   H H    . LEU A 1 49 ? -1.030  9.578   1.704   1.00 0.00 ? 49 LEU A H    1  
ATOM 682   H HA   . LEU A 1 49 ? 1.128   7.730   1.999   1.00 0.00 ? 49 LEU A HA   1  
ATOM 683   H HB3  . LEU A 1 49 ? 1.756   9.113   -0.209  1.00 0.00 ? 49 LEU A HB3  1  
ATOM 684   H HG   . LEU A 1 49 ? -0.347  6.975   0.102   1.00 0.00 ? 49 LEU A HG   1  
ATOM 685   H HD11 . LEU A 1 49 ? -0.540  6.763   -2.289  1.00 0.00 ? 49 LEU A HD11 1  
ATOM 686   H HD12 . LEU A 1 49 ? -0.978  8.422   -1.815  1.00 0.00 ? 49 LEU A HD12 1  
ATOM 687   H HD13 . LEU A 1 49 ? 0.612   8.095   -2.544  1.00 0.00 ? 49 LEU A HD13 1  
ATOM 688   H HD21 . LEU A 1 49 ? 1.915   6.248   0.482   1.00 0.00 ? 49 LEU A HD21 1  
ATOM 689   H HD22 . LEU A 1 49 ? 1.357   5.610   -1.084  1.00 0.00 ? 49 LEU A HD22 1  
ATOM 690   H HD23 . LEU A 1 49 ? 2.462   7.005   -1.034  1.00 0.00 ? 49 LEU A HD23 1  
ATOM 691   N N    . PRO A 1 50 ? 3.233   9.301   2.061   1.00 0.00 ? 50 PRO A N    1  
ATOM 692   C CA   . PRO A 1 50 ? 4.348   10.095  2.548   1.00 0.00 ? 50 PRO A CA   1  
ATOM 693   C C    . PRO A 1 50 ? 4.543   11.351  1.696   1.00 0.00 ? 50 PRO A C    1  
ATOM 694   O O    . PRO A 1 50 ? 4.980   11.265  0.549   1.00 0.00 ? 50 PRO A O    1  
ATOM 695   C CB   . PRO A 1 50 ? 5.545   9.158   2.506   1.00 0.00 ? 50 PRO A CB   1  
ATOM 696   C CG   . PRO A 1 50 ? 5.157   8.028   1.567   1.00 0.00 ? 50 PRO A CG   1  
ATOM 697   C CD   . PRO A 1 50 ? 3.655   8.103   1.341   1.00 0.00 ? 50 PRO A CD   1  
ATOM 698   H HA   . PRO A 1 50 ? 4.164   10.419  3.476   1.00 0.00 ? 50 PRO A HA   1  
ATOM 699   H HB3  . PRO A 1 50 ? 5.777   8.776   3.501   1.00 0.00 ? 50 PRO A HB3  1  
ATOM 700   H HG3  . PRO A 1 50 ? 5.431   7.064   1.996   1.00 0.00 ? 50 PRO A HG3  1  
ATOM 701   H HD3  . PRO A 1 50 ? 3.153   7.215   1.723   1.00 0.00 ? 50 PRO A HD3  1  
ATOM 702   N N    . GLU A 1 51 ? 4.208   12.487  2.289   1.00 0.00 ? 51 GLU A N    1  
ATOM 703   C CA   . GLU A 1 51 ? 4.339   13.758  1.598   1.00 0.00 ? 51 GLU A CA   1  
ATOM 704   C C    . GLU A 1 51 ? 5.566   13.741  0.684   1.00 0.00 ? 51 GLU A C    1  
ATOM 705   O O    . GLU A 1 51 ? 6.593   13.159  1.028   1.00 0.00 ? 51 GLU A O    1  
ATOM 706   C CB   . GLU A 1 51 ? 4.414   14.917  2.593   1.00 0.00 ? 51 GLU A CB   1  
ATOM 707   C CG   . GLU A 1 51 ? 3.090   15.085  3.340   1.00 0.00 ? 51 GLU A CG   1  
ATOM 708   C CD   . GLU A 1 51 ? 3.059   16.404  4.114   1.00 0.00 ? 51 GLU A CD   1  
ATOM 709   O OE1  . GLU A 1 51 ? 3.932   17.251  3.826   1.00 0.00 ? 51 GLU A OE1  1  
ATOM 710   O OE2  . GLU A 1 51 ? 2.165   16.536  4.977   1.00 0.00 ? 51 GLU A OE2  1  
ATOM 711   H H    . GLU A 1 51 ? 3.853   12.547  3.221   1.00 0.00 ? 51 GLU A H    1  
ATOM 712   H HA   . GLU A 1 51 ? 3.433   13.858  1.000   1.00 0.00 ? 51 GLU A HA   1  
ATOM 713   H HB3  . GLU A 1 51 ? 4.657   15.840  2.066   1.00 0.00 ? 51 GLU A HB3  1  
ATOM 714   H HG3  . GLU A 1 51 ? 2.948   14.252  4.029   1.00 0.00 ? 51 GLU A HG3  1  
ATOM 715   N N    . GLY A 1 52 ? 5.417   14.387  -0.464  1.00 0.00 ? 52 GLY A N    1  
ATOM 716   C CA   . GLY A 1 52 ? 6.500   14.452  -1.431  1.00 0.00 ? 52 GLY A CA   1  
ATOM 717   C C    . GLY A 1 52 ? 6.727   13.093  -2.093  1.00 0.00 ? 52 GLY A C    1  
ATOM 718   O O    . GLY A 1 52 ? 7.841   12.569  -2.080  1.00 0.00 ? 52 GLY A O    1  
ATOM 719   H H    . GLY A 1 52 ? 4.578   14.858  -0.737  1.00 0.00 ? 52 GLY A H    1  
ATOM 720   H HA2  . GLY A 1 52 ? 6.268   15.198  -2.192  1.00 0.00 ? 52 GLY A HA2  1  
ATOM 721   H HA3  . GLY A 1 52 ? 7.416   14.777  -0.935  1.00 0.00 ? 52 GLY A HA3  1  
ATOM 722   N N    . LEU A 1 53 ? 5.654   12.558  -2.657  1.00 0.00 ? 53 LEU A N    1  
ATOM 723   C CA   . LEU A 1 53 ? 5.723   11.269  -3.324  1.00 0.00 ? 53 LEU A CA   1  
ATOM 724   C C    . LEU A 1 53 ? 4.509   11.110  -4.242  1.00 0.00 ? 53 LEU A C    1  
ATOM 725   O O    . LEU A 1 53 ? 3.770   12.066  -4.473  1.00 0.00 ? 53 LEU A O    1  
ATOM 726   C CB   . LEU A 1 53 ? 5.871   10.143  -2.298  1.00 0.00 ? 53 LEU A CB   1  
ATOM 727   C CG   . LEU A 1 53 ? 7.301   9.687   -2.004  1.00 0.00 ? 53 LEU A CG   1  
ATOM 728   C CD1  . LEU A 1 53 ? 7.309   8.429   -1.136  1.00 0.00 ? 53 LEU A CD1  1  
ATOM 729   C CD2  . LEU A 1 53 ? 8.093   9.495   -3.299  1.00 0.00 ? 53 LEU A CD2  1  
ATOM 730   H H    . LEU A 1 53 ? 4.752   12.990  -2.664  1.00 0.00 ? 53 LEU A H    1  
ATOM 731   H HA   . LEU A 1 53 ? 6.623   11.266  -3.939  1.00 0.00 ? 53 LEU A HA   1  
ATOM 732   H HB3  . LEU A 1 53 ? 5.302   9.282   -2.649  1.00 0.00 ? 53 LEU A HB3  1  
ATOM 733   H HG   . LEU A 1 53 ? 7.800   10.473  -1.437  1.00 0.00 ? 53 LEU A HG   1  
ATOM 734   H HD11 . LEU A 1 53 ? 6.356   7.909   -1.241  1.00 0.00 ? 53 LEU A HD11 1  
ATOM 735   H HD12 . LEU A 1 53 ? 8.119   7.772   -1.453  1.00 0.00 ? 53 LEU A HD12 1  
ATOM 736   H HD13 . LEU A 1 53 ? 7.457   8.708   -0.093  1.00 0.00 ? 53 LEU A HD13 1  
ATOM 737   H HD21 . LEU A 1 53 ? 7.401   9.345   -4.129  1.00 0.00 ? 53 LEU A HD21 1  
ATOM 738   H HD22 . LEU A 1 53 ? 8.701   10.379  -3.490  1.00 0.00 ? 53 LEU A HD22 1  
ATOM 739   H HD23 . LEU A 1 53 ? 8.739   8.623   -3.204  1.00 0.00 ? 53 LEU A HD23 1  
ATOM 740   N N    . ALA A 1 54 ? 4.339   9.893   -4.740  1.00 0.00 ? 54 ALA A N    1  
ATOM 741   C CA   . ALA A 1 54 ? 3.228   9.596   -5.627  1.00 0.00 ? 54 ALA A CA   1  
ATOM 742   C C    . ALA A 1 54 ? 2.901   8.103   -5.546  1.00 0.00 ? 54 ALA A C    1  
ATOM 743   O O    . ALA A 1 54 ? 3.803   7.270   -5.467  1.00 0.00 ? 54 ALA A O    1  
ATOM 744   C CB   . ALA A 1 54 ? 3.576   10.040  -7.049  1.00 0.00 ? 54 ALA A CB   1  
ATOM 745   H H    . ALA A 1 54 ? 4.945   9.120   -4.547  1.00 0.00 ? 54 ALA A H    1  
ATOM 746   H HA   . ALA A 1 54 ? 2.366   10.167  -5.283  1.00 0.00 ? 54 ALA A HA   1  
ATOM 747   H HB1  . ALA A 1 54 ? 2.662   10.137  -7.633  1.00 0.00 ? 54 ALA A HB1  1  
ATOM 748   H HB2  . ALA A 1 54 ? 4.089   11.001  -7.014  1.00 0.00 ? 54 ALA A HB2  1  
ATOM 749   H HB3  . ALA A 1 54 ? 4.227   9.298   -7.512  1.00 0.00 ? 54 ALA A HB3  1  
ATOM 750   N N    . PHE A 1 55 ? 1.609   7.811   -5.568  1.00 0.00 ? 55 PHE A N    1  
ATOM 751   C CA   . PHE A 1 55 ? 1.153   6.434   -5.498  1.00 0.00 ? 55 PHE A CA   1  
ATOM 752   C C    . PHE A 1 55 ? 1.722   5.608   -6.654  1.00 0.00 ? 55 PHE A C    1  
ATOM 753   O O    . PHE A 1 55 ? 1.325   5.787   -7.804  1.00 0.00 ? 55 PHE A O    1  
ATOM 754   C CB   . PHE A 1 55 ? -0.373  6.462   -5.610  1.00 0.00 ? 55 PHE A CB   1  
ATOM 755   C CG   . PHE A 1 55 ? -1.006  5.088   -5.837  1.00 0.00 ? 55 PHE A CG   1  
ATOM 756   C CD1  . PHE A 1 55 ? -0.660  4.040   -5.042  1.00 0.00 ? 55 PHE A CD1  1  
ATOM 757   C CD2  . PHE A 1 55 ? -1.914  4.914   -6.835  1.00 0.00 ? 55 PHE A CD2  1  
ATOM 758   C CE1  . PHE A 1 55 ? -1.248  2.764   -5.253  1.00 0.00 ? 55 PHE A CE1  1  
ATOM 759   C CE2  . PHE A 1 55 ? -2.502  3.639   -7.046  1.00 0.00 ? 55 PHE A CE2  1  
ATOM 760   C CZ   . PHE A 1 55 ? -2.156  2.591   -6.251  1.00 0.00 ? 55 PHE A CZ   1  
ATOM 761   H H    . PHE A 1 55 ? 0.882   8.495   -5.632  1.00 0.00 ? 55 PHE A H    1  
ATOM 762   H HA   . PHE A 1 55 ? 1.506   6.023   -4.552  1.00 0.00 ? 55 PHE A HA   1  
ATOM 763   H HB3  . PHE A 1 55 ? -0.654  7.120   -6.432  1.00 0.00 ? 55 PHE A HB3  1  
ATOM 764   H HD1  . PHE A 1 55 ? 0.067   4.179   -4.243  1.00 0.00 ? 55 PHE A HD1  1  
ATOM 765   H HD2  . PHE A 1 55 ? -2.190  5.754   -7.473  1.00 0.00 ? 55 PHE A HD2  1  
ATOM 766   H HE1  . PHE A 1 55 ? -0.971  1.924   -4.617  1.00 0.00 ? 55 PHE A HE1  1  
ATOM 767   H HE2  . PHE A 1 55 ? -3.229  3.499   -7.846  1.00 0.00 ? 55 PHE A HE2  1  
ATOM 768   H HZ   . PHE A 1 55 ? -2.607  1.612   -6.414  1.00 0.00 ? 55 PHE A HZ   1  
ATOM 769   N N    . ARG A 1 56 ? 2.642   4.720   -6.306  1.00 0.00 ? 56 ARG A N    1  
ATOM 770   C CA   . ARG A 1 56 ? 3.270   3.866   -7.301  1.00 0.00 ? 56 ARG A CA   1  
ATOM 771   C C    . ARG A 1 56 ? 3.968   2.686   -6.621  1.00 0.00 ? 56 ARG A C    1  
ATOM 772   O O    . ARG A 1 56 ? 4.188   2.703   -5.411  1.00 0.00 ? 56 ARG A O    1  
ATOM 773   C CB   . ARG A 1 56 ? 4.292   4.646   -8.130  1.00 0.00 ? 56 ARG A CB   1  
ATOM 774   C CG   . ARG A 1 56 ? 4.966   5.732   -7.290  1.00 0.00 ? 56 ARG A CG   1  
ATOM 775   C CD   . ARG A 1 56 ? 6.453   5.846   -7.630  1.00 0.00 ? 56 ARG A CD   1  
ATOM 776   N NE   . ARG A 1 56 ? 6.620   6.410   -8.988  1.00 0.00 ? 56 ARG A NE   1  
ATOM 777   C CZ   . ARG A 1 56 ? 6.641   7.722   -9.260  1.00 0.00 ? 56 ARG A CZ   1  
ATOM 778   N NH1  . ARG A 1 56 ? 6.505   8.613   -8.267  1.00 0.00 ? 56 ARG A NH1  1  
ATOM 779   N NH2  . ARG A 1 56 ? 6.797   8.144   -10.521 1.00 0.00 ? 56 ARG A NH2  1  
ATOM 780   H H    . ARG A 1 56 ? 2.959   4.580   -5.368  1.00 0.00 ? 56 ARG A H    1  
ATOM 781   H HA   . ARG A 1 56 ? 2.450   3.526   -7.933  1.00 0.00 ? 56 ARG A HA   1  
ATOM 782   H HB3  . ARG A 1 56 ? 3.799   5.099   -8.990  1.00 0.00 ? 56 ARG A HB3  1  
ATOM 783   H HG3  . ARG A 1 56 ? 4.847   5.504   -6.231  1.00 0.00 ? 56 ARG A HG3  1  
ATOM 784   H HD3  . ARG A 1 56 ? 6.923   4.864   -7.576  1.00 0.00 ? 56 ARG A HD3  1  
ATOM 785   H HE   . ARG A 1 56 ? 6.722   5.773   -9.751  1.00 0.00 ? 56 ARG A HE   1  
ATOM 786   H HH11 . ARG A 1 56 ? 6.388   8.299   -7.325  1.00 0.00 ? 56 ARG A HH11 1  
ATOM 787   H HH12 . ARG A 1 56 ? 6.521   9.593   -8.469  1.00 0.00 ? 56 ARG A HH12 1  
ATOM 788   H HH21 . ARG A 1 56 ? 6.898   7.479   -11.262 1.00 0.00 ? 56 ARG A HH21 1  
ATOM 789   H HH22 . ARG A 1 56 ? 6.813   9.123   -10.723 1.00 0.00 ? 56 ARG A HH22 1  
ATOM 790   N N    . ARG A 1 57 ? 4.295   1.688   -7.430  1.00 0.00 ? 57 ARG A N    1  
ATOM 791   C CA   . ARG A 1 57 ? 4.963   0.502   -6.923  1.00 0.00 ? 57 ARG A CA   1  
ATOM 792   C C    . ARG A 1 57 ? 5.978   0.885   -5.844  1.00 0.00 ? 57 ARG A C    1  
ATOM 793   O O    . ARG A 1 57 ? 6.462   2.015   -5.815  1.00 0.00 ? 57 ARG A O    1  
ATOM 794   C CB   . ARG A 1 57 ? 5.681   -0.249  -8.045  1.00 0.00 ? 57 ARG A CB   1  
ATOM 795   C CG   . ARG A 1 57 ? 4.971   -1.564  -8.368  1.00 0.00 ? 57 ARG A CG   1  
ATOM 796   C CD   . ARG A 1 57 ? 5.375   -2.082  -9.749  1.00 0.00 ? 57 ARG A CD   1  
ATOM 797   N NE   . ARG A 1 57 ? 4.267   -2.865  -10.341 1.00 0.00 ? 57 ARG A NE   1  
ATOM 798   C CZ   . ARG A 1 57 ? 4.372   -3.582  -11.468 1.00 0.00 ? 57 ARG A CZ   1  
ATOM 799   N NH1  . ARG A 1 57 ? 5.535   -3.619  -12.133 1.00 0.00 ? 57 ARG A NH1  1  
ATOM 800   N NH2  . ARG A 1 57 ? 3.314   -4.263  -11.931 1.00 0.00 ? 57 ARG A NH2  1  
ATOM 801   H H    . ARG A 1 57 ? 4.111   1.682   -8.412  1.00 0.00 ? 57 ARG A H    1  
ATOM 802   H HA   . ARG A 1 57 ? 4.164   -0.113  -6.508  1.00 0.00 ? 57 ARG A HA   1  
ATOM 803   H HB3  . ARG A 1 57 ? 6.712   -0.450  -7.752  1.00 0.00 ? 57 ARG A HB3  1  
ATOM 804   H HG3  . ARG A 1 57 ? 3.891   -1.417  -8.332  1.00 0.00 ? 57 ARG A HG3  1  
ATOM 805   H HD3  . ARG A 1 57 ? 6.267   -2.703  -9.668  1.00 0.00 ? 57 ARG A HD3  1  
ATOM 806   H HE   . ARG A 1 57 ? 3.385   -2.860  -9.870  1.00 0.00 ? 57 ARG A HE   1  
ATOM 807   H HH11 . ARG A 1 57 ? 6.325   -3.111  -11.788 1.00 0.00 ? 57 ARG A HH11 1  
ATOM 808   H HH12 . ARG A 1 57 ? 5.613   -4.155  -12.974 1.00 0.00 ? 57 ARG A HH12 1  
ATOM 809   H HH21 . ARG A 1 57 ? 2.446   -4.235  -11.434 1.00 0.00 ? 57 ARG A HH21 1  
ATOM 810   H HH22 . ARG A 1 57 ? 3.393   -4.797  -12.772 1.00 0.00 ? 57 ARG A HH22 1  
ATOM 811   N N    . PRO A 1 58 ? 6.277   -0.104  -4.959  1.00 0.00 ? 58 PRO A N    1  
ATOM 812   C CA   . PRO A 1 58 ? 7.226   0.118   -3.881  1.00 0.00 ? 58 PRO A CA   1  
ATOM 813   C C    . PRO A 1 58 ? 8.662   0.130   -4.409  1.00 0.00 ? 58 PRO A C    1  
ATOM 814   O O    . PRO A 1 58 ? 9.558   0.682   -3.770  1.00 0.00 ? 58 PRO A O    1  
ATOM 815   C CB   . PRO A 1 58 ? 6.966   -1.004  -2.891  1.00 0.00 ? 58 PRO A CB   1  
ATOM 816   C CG   . PRO A 1 58 ? 6.209   -2.073  -3.661  1.00 0.00 ? 58 PRO A CG   1  
ATOM 817   C CD   . PRO A 1 58 ? 5.723   -1.454  -4.962  1.00 0.00 ? 58 PRO A CD   1  
ATOM 818   H HA   . PRO A 1 58 ? 7.079   1.018   -3.470  1.00 0.00 ? 58 PRO A HA   1  
ATOM 819   H HB3  . PRO A 1 58 ? 6.382   -0.649  -2.041  1.00 0.00 ? 58 PRO A HB3  1  
ATOM 820   H HG3  . PRO A 1 58 ? 5.366   -2.442  -3.076  1.00 0.00 ? 58 PRO A HG3  1  
ATOM 821   H HD3  . PRO A 1 58 ? 4.635   -1.435  -5.010  1.00 0.00 ? 58 PRO A HD3  1  
ATOM 822   N N    . ALA A 1 59 ? 8.838   -0.487  -5.568  1.00 0.00 ? 59 ALA A N    1  
ATOM 823   C CA   . ALA A 1 59 ? 10.150  -0.555  -6.189  1.00 0.00 ? 59 ALA A CA   1  
ATOM 824   C C    . ALA A 1 59 ? 10.427  0.754   -6.930  1.00 0.00 ? 59 ALA A C    1  
ATOM 825   O O    . ALA A 1 59 ? 11.466  1.381   -6.724  1.00 0.00 ? 59 ALA A O    1  
ATOM 826   C CB   . ALA A 1 59 ? 10.217  -1.773  -7.111  1.00 0.00 ? 59 ALA A CB   1  
ATOM 827   H H    . ALA A 1 59 ? 8.105   -0.934  -6.081  1.00 0.00 ? 59 ALA A H    1  
ATOM 828   H HA   . ALA A 1 59 ? 10.887  -0.676  -5.394  1.00 0.00 ? 59 ALA A HA   1  
ATOM 829   H HB1  . ALA A 1 59 ? 10.262  -1.441  -8.148  1.00 0.00 ? 59 ALA A HB1  1  
ATOM 830   H HB2  . ALA A 1 59 ? 11.106  -2.358  -6.877  1.00 0.00 ? 59 ALA A HB2  1  
ATOM 831   H HB3  . ALA A 1 59 ? 9.328   -2.388  -6.965  1.00 0.00 ? 59 ALA A HB3  1  
ATOM 832   N N    . GLU A 1 60 ? 9.481   1.129   -7.778  1.00 0.00 ? 60 GLU A N    1  
ATOM 833   C CA   . GLU A 1 60 ? 9.610   2.352   -8.552  1.00 0.00 ? 60 GLU A CA   1  
ATOM 834   C C    . GLU A 1 60 ? 9.985   3.520   -7.639  1.00 0.00 ? 60 GLU A C    1  
ATOM 835   O O    . GLU A 1 60 ? 10.781  4.378   -8.018  1.00 0.00 ? 60 GLU A O    1  
ATOM 836   C CB   . GLU A 1 60 ? 8.324   2.650   -9.324  1.00 0.00 ? 60 GLU A CB   1  
ATOM 837   C CG   . GLU A 1 60 ? 8.164   1.699   -10.512 1.00 0.00 ? 60 GLU A CG   1  
ATOM 838   C CD   . GLU A 1 60 ? 8.340   2.443   -11.838 1.00 0.00 ? 60 GLU A CD   1  
ATOM 839   O OE1  . GLU A 1 60 ? 7.387   3.159   -12.217 1.00 0.00 ? 60 GLU A OE1  1  
ATOM 840   O OE2  . GLU A 1 60 ? 9.421   2.278   -12.442 1.00 0.00 ? 60 GLU A OE2  1  
ATOM 841   H H    . GLU A 1 60 ? 8.639   0.613   -7.941  1.00 0.00 ? 60 GLU A H    1  
ATOM 842   H HA   . GLU A 1 60 ? 10.417  2.163   -9.261  1.00 0.00 ? 60 GLU A HA   1  
ATOM 843   H HB3  . GLU A 1 60 ? 8.338   3.681   -9.679  1.00 0.00 ? 60 GLU A HB3  1  
ATOM 844   H HG3  . GLU A 1 60 ? 7.179   1.233   -10.480 1.00 0.00 ? 60 GLU A HG3  1  
ATOM 845   N N    . TYR A 1 61 ? 9.395   3.516   -6.453  1.00 0.00 ? 61 TYR A N    1  
ATOM 846   C CA   . TYR A 1 61 ? 9.656   4.565   -5.483  1.00 0.00 ? 61 TYR A CA   1  
ATOM 847   C C    . TYR A 1 61 ? 11.160  4.760   -5.279  1.00 0.00 ? 61 TYR A C    1  
ATOM 848   O O    . TYR A 1 61 ? 11.965  3.975   -5.777  1.00 0.00 ? 61 TYR A O    1  
ATOM 849   C CB   . TYR A 1 61 ? 9.032   4.091   -4.169  1.00 0.00 ? 61 TYR A CB   1  
ATOM 850   C CG   . TYR A 1 61 ? 7.692   4.752   -3.842  1.00 0.00 ? 61 TYR A CG   1  
ATOM 851   C CD1  . TYR A 1 61 ? 7.547   6.119   -3.973  1.00 0.00 ? 61 TYR A CD1  1  
ATOM 852   C CD2  . TYR A 1 61 ? 6.628   3.983   -3.415  1.00 0.00 ? 61 TYR A CD2  1  
ATOM 853   C CE1  . TYR A 1 61 ? 6.285   6.741   -3.665  1.00 0.00 ? 61 TYR A CE1  1  
ATOM 854   C CE2  . TYR A 1 61 ? 5.368   4.606   -3.107  1.00 0.00 ? 61 TYR A CE2  1  
ATOM 855   C CZ   . TYR A 1 61 ? 5.258   5.955   -3.248  1.00 0.00 ? 61 TYR A CZ   1  
ATOM 856   O OH   . TYR A 1 61 ? 4.067   6.543   -2.956  1.00 0.00 ? 61 TYR A OH   1  
ATOM 857   H H    . TYR A 1 61 ? 8.748   2.814   -6.153  1.00 0.00 ? 61 TYR A H    1  
ATOM 858   H HA   . TYR A 1 61 ? 9.226   5.491   -5.864  1.00 0.00 ? 61 TYR A HA   1  
ATOM 859   H HB3  . TYR A 1 61 ? 9.730   4.286   -3.356  1.00 0.00 ? 61 TYR A HB3  1  
ATOM 860   H HD1  . TYR A 1 61 ? 8.387   6.726   -4.310  1.00 0.00 ? 61 TYR A HD1  1  
ATOM 861   H HD2  . TYR A 1 61 ? 6.743   2.904   -3.313  1.00 0.00 ? 61 TYR A HD2  1  
ATOM 862   H HE1  . TYR A 1 61 ? 6.158   7.819   -3.764  1.00 0.00 ? 61 TYR A HE1  1  
ATOM 863   H HE2  . TYR A 1 61 ? 4.519   4.011   -2.769  1.00 0.00 ? 61 TYR A HE2  1  
ATOM 864   H HH   . TYR A 1 61 ? 3.934   7.349   -3.534  1.00 0.00 ? 61 TYR A HH   1  
ATOM 865   N N    . ASP A 1 62 ? 11.493  5.810   -4.543  1.00 0.00 ? 62 ASP A N    1  
ATOM 866   C CA   . ASP A 1 62 ? 12.887  6.118   -4.266  1.00 0.00 ? 62 ASP A CA   1  
ATOM 867   C C    . ASP A 1 62 ? 13.342  5.334   -3.033  1.00 0.00 ? 62 ASP A C    1  
ATOM 868   O O    . ASP A 1 62 ? 12.571  4.563   -2.464  1.00 0.00 ? 62 ASP A O    1  
ATOM 869   C CB   . ASP A 1 62 ? 13.074  7.608   -3.974  1.00 0.00 ? 62 ASP A CB   1  
ATOM 870   C CG   . ASP A 1 62 ? 11.872  8.490   -4.317  1.00 0.00 ? 62 ASP A CG   1  
ATOM 871   O OD1  . ASP A 1 62 ? 11.523  8.534   -5.516  1.00 0.00 ? 62 ASP A OD1  1  
ATOM 872   O OD2  . ASP A 1 62 ? 11.329  9.100   -3.371  1.00 0.00 ? 62 ASP A OD2  1  
ATOM 873   H H    . ASP A 1 62 ? 10.833  6.444   -4.140  1.00 0.00 ? 62 ASP A H    1  
ATOM 874   H HA   . ASP A 1 62 ? 13.428  5.830   -5.167  1.00 0.00 ? 62 ASP A HA   1  
ATOM 875   H HB3  . ASP A 1 62 ? 13.939  7.966   -4.534  1.00 0.00 ? 62 ASP A HB3  1  
ATOM 876   N N    . PRO A 1 63 ? 14.626  5.565   -2.648  1.00 0.00 ? 63 PRO A N    1  
ATOM 877   C CA   . PRO A 1 63 ? 15.193  4.889   -1.493  1.00 0.00 ? 63 PRO A CA   1  
ATOM 878   C C    . PRO A 1 63 ? 14.658  5.487   -0.191  1.00 0.00 ? 63 PRO A C    1  
ATOM 879   O O    . PRO A 1 63 ? 14.098  4.774   0.640   1.00 0.00 ? 63 PRO A O    1  
ATOM 880   C CB   . PRO A 1 63 ? 16.698  5.047   -1.645  1.00 0.00 ? 63 PRO A CB   1  
ATOM 881   C CG   . PRO A 1 63 ? 16.900  6.194   -2.621  1.00 0.00 ? 63 PRO A CG   1  
ATOM 882   C CD   . PRO A 1 63 ? 15.567  6.470   -3.299  1.00 0.00 ? 63 PRO A CD   1  
ATOM 883   H HA   . PRO A 1 63 ? 14.920  3.927   -1.485  1.00 0.00 ? 63 PRO A HA   1  
ATOM 884   H HB3  . PRO A 1 63 ? 17.150  4.129   -2.022  1.00 0.00 ? 63 PRO A HB3  1  
ATOM 885   H HG3  . PRO A 1 63 ? 17.658  5.937   -3.361  1.00 0.00 ? 63 PRO A HG3  1  
ATOM 886   H HD3  . PRO A 1 63 ? 15.622  6.282   -4.371  1.00 0.00 ? 63 PRO A HD3  1  
ATOM 887   N N    . LYS A 1 64 ? 14.850  6.791   -0.052  1.00 0.00 ? 64 LYS A N    1  
ATOM 888   C CA   . LYS A 1 64 ? 14.394  7.493   1.135   1.00 0.00 ? 64 LYS A CA   1  
ATOM 889   C C    . LYS A 1 64 ? 12.866  7.439   1.198   1.00 0.00 ? 64 LYS A C    1  
ATOM 890   O O    . LYS A 1 64 ? 12.280  7.590   2.270   1.00 0.00 ? 64 LYS A O    1  
ATOM 891   C CB   . LYS A 1 64 ? 14.962  8.913   1.168   1.00 0.00 ? 64 LYS A CB   1  
ATOM 892   C CG   . LYS A 1 64 ? 16.370  8.927   1.765   1.00 0.00 ? 64 LYS A CG   1  
ATOM 893   C CD   . LYS A 1 64 ? 17.429  8.739   0.676   1.00 0.00 ? 64 LYS A CD   1  
ATOM 894   C CE   . LYS A 1 64 ? 18.822  8.581   1.288   1.00 0.00 ? 64 LYS A CE   1  
ATOM 895   N NZ   . LYS A 1 64 ? 19.855  8.568   0.227   1.00 0.00 ? 64 LYS A NZ   1  
ATOM 896   H H    . LYS A 1 64 ? 15.307  7.364   -0.732  1.00 0.00 ? 64 LYS A H    1  
ATOM 897   H HA   . LYS A 1 64 ? 14.795  6.965   2.000   1.00 0.00 ? 64 LYS A HA   1  
ATOM 898   H HB3  . LYS A 1 64 ? 14.308  9.557   1.757   1.00 0.00 ? 64 LYS A HB3  1  
ATOM 899   H HG3  . LYS A 1 64 ? 16.463  8.135   2.508   1.00 0.00 ? 64 LYS A HG3  1  
ATOM 900   H HD3  . LYS A 1 64 ? 17.418  9.594   0.001   1.00 0.00 ? 64 LYS A HD3  1  
ATOM 901   H HE3  . LYS A 1 64 ? 18.872  7.656   1.862   1.00 0.00 ? 64 LYS A HE3  1  
ATOM 902   H HZ1  . LYS A 1 64 ? 19.550  7.989   -0.528  1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 903   H HZ2  . LYS A 1 64 ? 20.003  9.499   -0.105  1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 904   H HZ3  . LYS A 1 64 ? 20.710  8.207   0.600   1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 905   N N    . ALA A 1 65 ? 12.265  7.225   0.037   1.00 0.00 ? 65 ALA A N    1  
ATOM 906   C CA   . ALA A 1 65 ? 10.817  7.150   -0.052  1.00 0.00 ? 65 ALA A CA   1  
ATOM 907   C C    . ALA A 1 65 ? 10.321  5.954   0.763   1.00 0.00 ? 65 ALA A C    1  
ATOM 908   O O    . ALA A 1 65 ? 9.572   6.121   1.724   1.00 0.00 ? 65 ALA A O    1  
ATOM 909   C CB   . ALA A 1 65 ? 10.399  7.067   -1.522  1.00 0.00 ? 65 ALA A CB   1  
ATOM 910   H H    . ALA A 1 65 ? 12.749  7.104   -0.829  1.00 0.00 ? 65 ALA A H    1  
ATOM 911   H HA   . ALA A 1 65 ? 10.410  8.066   0.377   1.00 0.00 ? 65 ALA A HA   1  
ATOM 912   H HB1  . ALA A 1 65 ? 10.112  8.058   -1.875  1.00 0.00 ? 65 ALA A HB1  1  
ATOM 913   H HB2  . ALA A 1 65 ? 11.236  6.697   -2.116  1.00 0.00 ? 65 ALA A HB2  1  
ATOM 914   H HB3  . ALA A 1 65 ? 9.554   6.386   -1.621  1.00 0.00 ? 65 ALA A HB3  1  
ATOM 915   N N    . LEU A 1 66 ? 10.759  4.773   0.349   1.00 0.00 ? 66 LEU A N    1  
ATOM 916   C CA   . LEU A 1 66 ? 10.369  3.550   1.029   1.00 0.00 ? 66 LEU A CA   1  
ATOM 917   C C    . LEU A 1 66 ? 10.486  3.753   2.541   1.00 0.00 ? 66 LEU A C    1  
ATOM 918   O O    . LEU A 1 66 ? 9.589   3.373   3.293   1.00 0.00 ? 66 LEU A O    1  
ATOM 919   C CB   . LEU A 1 66 ? 11.178  2.363   0.503   1.00 0.00 ? 66 LEU A CB   1  
ATOM 920   C CG   . LEU A 1 66 ? 11.079  2.098   -1.001  1.00 0.00 ? 66 LEU A CG   1  
ATOM 921   C CD1  . LEU A 1 66 ? 12.080  1.025   -1.435  1.00 0.00 ? 66 LEU A CD1  1  
ATOM 922   C CD2  . LEU A 1 66 ? 9.647   1.741   -1.402  1.00 0.00 ? 66 LEU A CD2  1  
ATOM 923   H H    . LEU A 1 66 ? 11.367  4.646   -0.434  1.00 0.00 ? 66 LEU A H    1  
ATOM 924   H HA   . LEU A 1 66 ? 9.323   3.361   0.786   1.00 0.00 ? 66 LEU A HA   1  
ATOM 925   H HB3  . LEU A 1 66 ? 10.856  1.467   1.032   1.00 0.00 ? 66 LEU A HB3  1  
ATOM 926   H HG   . LEU A 1 66 ? 11.342  3.015   -1.528  1.00 0.00 ? 66 LEU A HG   1  
ATOM 927   H HD11 . LEU A 1 66 ? 11.747  0.576   -2.371  1.00 0.00 ? 66 LEU A HD11 1  
ATOM 928   H HD12 . LEU A 1 66 ? 13.060  1.479   -1.577  1.00 0.00 ? 66 LEU A HD12 1  
ATOM 929   H HD13 . LEU A 1 66 ? 12.143  0.255   -0.665  1.00 0.00 ? 66 LEU A HD13 1  
ATOM 930   H HD21 . LEU A 1 66 ? 9.579   0.671   -1.595  1.00 0.00 ? 66 LEU A HD21 1  
ATOM 931   H HD22 . LEU A 1 66 ? 8.965   2.008   -0.592  1.00 0.00 ? 66 LEU A HD22 1  
ATOM 932   H HD23 . LEU A 1 66 ? 9.373   2.292   -2.302  1.00 0.00 ? 66 LEU A HD23 1  
ATOM 933   N N    . MET A 1 67 ? 11.597  4.352   2.941   1.00 0.00 ? 67 MET A N    1  
ATOM 934   C CA   . MET A 1 67 ? 11.843  4.610   4.350   1.00 0.00 ? 67 MET A CA   1  
ATOM 935   C C    . MET A 1 67 ? 10.806  5.579   4.920   1.00 0.00 ? 67 MET A C    1  
ATOM 936   O O    . MET A 1 67 ? 10.444  5.488   6.093   1.00 0.00 ? 67 MET A O    1  
ATOM 937   C CB   . MET A 1 67 ? 13.244  5.201   4.524   1.00 0.00 ? 67 MET A CB   1  
ATOM 938   C CG   . MET A 1 67 ? 14.298  4.096   4.623   1.00 0.00 ? 67 MET A CG   1  
ATOM 939   S SD   . MET A 1 67 ? 15.934  4.809   4.613   1.00 0.00 ? 67 MET A SD   1  
ATOM 940   C CE   . MET A 1 67 ? 16.300  4.718   2.869   1.00 0.00 ? 67 MET A CE   1  
ATOM 941   H H    . MET A 1 67 ? 12.322  4.658   2.323   1.00 0.00 ? 67 MET A H    1  
ATOM 942   H HA   . MET A 1 67 ? 11.757  3.641   4.844   1.00 0.00 ? 67 MET A HA   1  
ATOM 943   H HB3  . MET A 1 67 ? 13.273  5.817   5.422   1.00 0.00 ? 67 MET A HB3  1  
ATOM 944   H HG3  . MET A 1 67 ? 14.189  3.402   3.789   1.00 0.00 ? 67 MET A HG3  1  
ATOM 945   H HE1  . MET A 1 67 ? 15.432  4.335   2.334   1.00 0.00 ? 67 MET A HE1  1  
ATOM 946   H HE2  . MET A 1 67 ? 16.546  5.714   2.497   1.00 0.00 ? 67 MET A HE2  1  
ATOM 947   H HE3  . MET A 1 67 ? 17.148  4.053   2.710   1.00 0.00 ? 67 MET A HE3  1  
ATOM 948   N N    . ALA A 1 68 ? 10.355  6.483   4.062   1.00 0.00 ? 68 ALA A N    1  
ATOM 949   C CA   . ALA A 1 68 ? 9.365   7.468   4.467   1.00 0.00 ? 68 ALA A CA   1  
ATOM 950   C C    . ALA A 1 68 ? 7.972   6.837   4.407   1.00 0.00 ? 68 ALA A C    1  
ATOM 951   O O    . ALA A 1 68 ? 7.036   7.333   5.033   1.00 0.00 ? 68 ALA A O    1  
ATOM 952   C CB   . ALA A 1 68 ? 9.484   8.705   3.574   1.00 0.00 ? 68 ALA A CB   1  
ATOM 953   H H    . ALA A 1 68 ? 10.653  6.549   3.111   1.00 0.00 ? 68 ALA A H    1  
ATOM 954   H HA   . ALA A 1 68 ? 9.582   7.754   5.495   1.00 0.00 ? 68 ALA A HA   1  
ATOM 955   H HB1  . ALA A 1 68 ? 10.034  8.450   2.669   1.00 0.00 ? 68 ALA A HB1  1  
ATOM 956   H HB2  . ALA A 1 68 ? 8.486   9.056   3.305   1.00 0.00 ? 68 ALA A HB2  1  
ATOM 957   H HB3  . ALA A 1 68 ? 10.012  9.492   4.113   1.00 0.00 ? 68 ALA A HB3  1  
ATOM 958   N N    . ILE A 1 69 ? 7.878   5.754   3.650   1.00 0.00 ? 69 ILE A N    1  
ATOM 959   C CA   . ILE A 1 69 ? 6.615   5.052   3.501   1.00 0.00 ? 69 ILE A CA   1  
ATOM 960   C C    . ILE A 1 69 ? 6.392   4.152   4.717   1.00 0.00 ? 69 ILE A C    1  
ATOM 961   O O    . ILE A 1 69 ? 5.291   4.103   5.264   1.00 0.00 ? 69 ILE A O    1  
ATOM 962   C CB   . ILE A 1 69 ? 6.571   4.306   2.167   1.00 0.00 ? 69 ILE A CB   1  
ATOM 963   C CG1  . ILE A 1 69 ? 6.670   5.279   0.991   1.00 0.00 ? 69 ILE A CG1  1  
ATOM 964   C CG2  . ILE A 1 69 ? 5.327   3.420   2.075   1.00 0.00 ? 69 ILE A CG2  1  
ATOM 965   C CD1  . ILE A 1 69 ? 7.390   4.634   -0.195  1.00 0.00 ? 69 ILE A CD1  1  
ATOM 966   H H    . ILE A 1 69 ? 8.645   5.359   3.144   1.00 0.00 ? 69 ILE A H    1  
ATOM 967   H HA   . ILE A 1 69 ? 5.825   5.802   3.478   1.00 0.00 ? 69 ILE A HA   1  
ATOM 968   H HB   . ILE A 1 69 ? 7.438   3.648   2.115   1.00 0.00 ? 69 ILE A HB   1  
ATOM 969   H HG13 . ILE A 1 69 ? 7.204   6.177   1.301   1.00 0.00 ? 69 ILE A HG13 1  
ATOM 970   H HG21 . ILE A 1 69 ? 4.505   3.991   1.644   1.00 0.00 ? 69 ILE A HG21 1  
ATOM 971   H HG22 . ILE A 1 69 ? 5.540   2.558   1.443   1.00 0.00 ? 69 ILE A HG22 1  
ATOM 972   H HG23 . ILE A 1 69 ? 5.048   3.079   3.072   1.00 0.00 ? 69 ILE A HG23 1  
ATOM 973   H HD11 . ILE A 1 69 ? 7.507   3.566   -0.013  1.00 0.00 ? 69 ILE A HD11 1  
ATOM 974   H HD12 . ILE A 1 69 ? 6.805   4.786   -1.102  1.00 0.00 ? 69 ILE A HD12 1  
ATOM 975   H HD13 . ILE A 1 69 ? 8.372   5.092   -0.316  1.00 0.00 ? 69 ILE A HD13 1  
ATOM 976   N N    . LEU A 1 70 ? 7.453   3.461   5.106   1.00 0.00 ? 70 LEU A N    1  
ATOM 977   C CA   . LEU A 1 70 ? 7.387   2.565   6.247   1.00 0.00 ? 70 LEU A CA   1  
ATOM 978   C C    . LEU A 1 70 ? 7.266   3.388   7.530   1.00 0.00 ? 70 LEU A C    1  
ATOM 979   O O    . LEU A 1 70 ? 6.795   2.888   8.552   1.00 0.00 ? 70 LEU A O    1  
ATOM 980   C CB   . LEU A 1 70 ? 8.577   1.603   6.244   1.00 0.00 ? 70 LEU A CB   1  
ATOM 981   C CG   . LEU A 1 70 ? 8.884   0.920   4.910   1.00 0.00 ? 70 LEU A CG   1  
ATOM 982   C CD1  . LEU A 1 70 ? 10.385  0.673   4.753   1.00 0.00 ? 70 LEU A CD1  1  
ATOM 983   C CD2  . LEU A 1 70 ? 8.071   -0.367  4.754   1.00 0.00 ? 70 LEU A CD2  1  
ATOM 984   H H    . LEU A 1 70 ? 8.346   3.507   4.655   1.00 0.00 ? 70 LEU A H    1  
ATOM 985   H HA   . LEU A 1 70 ? 6.486   1.961   6.137   1.00 0.00 ? 70 LEU A HA   1  
ATOM 986   H HB3  . LEU A 1 70 ? 8.398   0.832   6.993   1.00 0.00 ? 70 LEU A HB3  1  
ATOM 987   H HG   . LEU A 1 70 ? 8.582   1.590   4.105   1.00 0.00 ? 70 LEU A HG   1  
ATOM 988   H HD11 . LEU A 1 70 ? 10.558  -0.378  4.520   1.00 0.00 ? 70 LEU A HD11 1  
ATOM 989   H HD12 . LEU A 1 70 ? 10.773  1.293   3.944   1.00 0.00 ? 70 LEU A HD12 1  
ATOM 990   H HD13 . LEU A 1 70 ? 10.895  0.926   5.682   1.00 0.00 ? 70 LEU A HD13 1  
ATOM 991   H HD21 . LEU A 1 70 ? 7.043   -0.118  4.493   1.00 0.00 ? 70 LEU A HD21 1  
ATOM 992   H HD22 . LEU A 1 70 ? 8.509   -0.980  3.967   1.00 0.00 ? 70 LEU A HD22 1  
ATOM 993   H HD23 . LEU A 1 70 ? 8.083   -0.920  5.694   1.00 0.00 ? 70 LEU A HD23 1  
ATOM 994   N N    . GLU A 1 71 ? 7.699   4.637   7.438   1.00 0.00 ? 71 GLU A N    1  
ATOM 995   C CA   . GLU A 1 71 ? 7.644   5.535   8.579   1.00 0.00 ? 71 GLU A CA   1  
ATOM 996   C C    . GLU A 1 71 ? 6.313   6.289   8.598   1.00 0.00 ? 71 GLU A C    1  
ATOM 997   O O    . GLU A 1 71 ? 5.721   6.483   9.659   1.00 0.00 ? 71 GLU A O    1  
ATOM 998   C CB   . GLU A 1 71 ? 8.825   6.508   8.568   1.00 0.00 ? 71 GLU A CB   1  
ATOM 999   C CG   . GLU A 1 71 ? 10.096  5.834   9.088   1.00 0.00 ? 71 GLU A CG   1  
ATOM 1000  C CD   . GLU A 1 71 ? 11.181  6.869   9.390   1.00 0.00 ? 71 GLU A CD   1  
ATOM 1001  O OE1  . GLU A 1 71 ? 10.847  7.858   10.077  1.00 0.00 ? 71 GLU A OE1  1  
ATOM 1002  O OE2  . GLU A 1 71 ? 12.321  6.648   8.927   1.00 0.00 ? 71 GLU A OE2  1  
ATOM 1003  H H    . GLU A 1 71 ? 8.079   5.036   6.604   1.00 0.00 ? 71 GLU A H    1  
ATOM 1004  H HA   . GLU A 1 71 ? 7.719   4.893   9.457   1.00 0.00 ? 71 GLU A HA   1  
ATOM 1005  H HB3  . GLU A 1 71 ? 8.591   7.377   9.183   1.00 0.00 ? 71 GLU A HB3  1  
ATOM 1006  H HG3  . GLU A 1 71 ? 10.463  5.122   8.349   1.00 0.00 ? 71 GLU A HG3  1  
ATOM 1007  N N    . HIS A 1 72 ? 5.881   6.693   7.412   1.00 0.00 ? 72 HIS A N    1  
ATOM 1008  C CA   . HIS A 1 72 ? 4.630   7.421   7.280   1.00 0.00 ? 72 HIS A CA   1  
ATOM 1009  C C    . HIS A 1 72 ? 3.472   6.431   7.148   1.00 0.00 ? 72 HIS A C    1  
ATOM 1010  O O    . HIS A 1 72 ? 2.306   6.822   7.207   1.00 0.00 ? 72 HIS A O    1  
ATOM 1011  C CB   . HIS A 1 72 ? 4.700   8.412   6.116   1.00 0.00 ? 72 HIS A CB   1  
ATOM 1012  C CG   . HIS A 1 72 ? 5.737   9.494   6.291   1.00 0.00 ? 72 HIS A CG   1  
ATOM 1013  N ND1  . HIS A 1 72 ? 5.561   10.786  5.825   1.00 0.00 ? 72 HIS A ND1  1  
ATOM 1014  C CD2  . HIS A 1 72 ? 6.964   9.464   6.886   1.00 0.00 ? 72 HIS A CD2  1  
ATOM 1015  C CE1  . HIS A 1 72 ? 6.639   11.492  6.131   1.00 0.00 ? 72 HIS A CE1  1  
ATOM 1016  N NE2  . HIS A 1 72 ? 7.509   10.670  6.787   1.00 0.00 ? 72 HIS A NE2  1  
ATOM 1017  H H    . HIS A 1 72 ? 6.368   6.530   6.555   1.00 0.00 ? 72 HIS A H    1  
ATOM 1018  H HA   . HIS A 1 72 ? 4.503   7.996   8.198   1.00 0.00 ? 72 HIS A HA   1  
ATOM 1019  H HB3  . HIS A 1 72 ? 3.722   8.877   5.990   1.00 0.00 ? 72 HIS A HB3  1  
ATOM 1020  H HD1  . HIS A 1 72 ? 4.755   11.127  5.341   1.00 0.00 ? 72 HIS A HD1  1  
ATOM 1021  H HD2  . HIS A 1 72 ? 7.421   8.595   7.361   1.00 0.00 ? 72 HIS A HD2  1  
ATOM 1022  H HE1  . HIS A 1 72 ? 6.803   12.543  5.898   1.00 0.00 ? 72 HIS A HE1  1  
ATOM 1023  N N    . SER A 1 73 ? 3.831   5.168   6.971   1.00 0.00 ? 73 SER A N    1  
ATOM 1024  C CA   . SER A 1 73 ? 2.835   4.119   6.831   1.00 0.00 ? 73 SER A CA   1  
ATOM 1025  C C    . SER A 1 73 ? 1.699   4.339   7.830   1.00 0.00 ? 73 SER A C    1  
ATOM 1026  O O    . SER A 1 73 ? 0.525   4.255   7.469   1.00 0.00 ? 73 SER A O    1  
ATOM 1027  C CB   . SER A 1 73 ? 3.460   2.737   7.033   1.00 0.00 ? 73 SER A CB   1  
ATOM 1028  O OG   . SER A 1 73 ? 3.227   2.233   8.347   1.00 0.00 ? 73 SER A OG   1  
ATOM 1029  H H    . SER A 1 73 ? 4.781   4.859   6.925   1.00 0.00 ? 73 SER A H    1  
ATOM 1030  H HA   . SER A 1 73 ? 2.469   4.204   5.808   1.00 0.00 ? 73 SER A HA   1  
ATOM 1031  H HB3  . SER A 1 73 ? 4.534   2.794   6.853   1.00 0.00 ? 73 SER A HB3  1  
ATOM 1032  H HG   . SER A 1 73 ? 3.803   2.717   9.005   1.00 0.00 ? 73 SER A HG   1  
ATOM 1033  N N    . HIS A 1 74 ? 2.085   4.618   9.066   1.00 0.00 ? 74 HIS A N    1  
ATOM 1034  C CA   . HIS A 1 74 ? 1.111   4.851   10.120  1.00 0.00 ? 74 HIS A CA   1  
ATOM 1035  C C    . HIS A 1 74 ? -0.040  5.699   9.576   1.00 0.00 ? 74 HIS A C    1  
ATOM 1036  O O    . HIS A 1 74 ? -1.166  5.608   10.063  1.00 0.00 ? 74 HIS A O    1  
ATOM 1037  C CB   . HIS A 1 74 ? 1.780   5.474   11.347  1.00 0.00 ? 74 HIS A CB   1  
ATOM 1038  C CG   . HIS A 1 74 ? 2.027   6.959   11.224  1.00 0.00 ? 74 HIS A CG   1  
ATOM 1039  N ND1  . HIS A 1 74 ? 1.293   7.902   11.923  1.00 0.00 ? 74 HIS A ND1  1  
ATOM 1040  C CD2  . HIS A 1 74 ? 2.936   7.651   10.478  1.00 0.00 ? 74 HIS A CD2  1  
ATOM 1041  C CE1  . HIS A 1 74 ? 1.748   9.105   11.602  1.00 0.00 ? 74 HIS A CE1  1  
ATOM 1042  N NE2  . HIS A 1 74 ? 2.765   8.948   10.708  1.00 0.00 ? 74 HIS A NE2  1  
ATOM 1043  H H    . HIS A 1 74 ? 3.041   4.685   9.351   1.00 0.00 ? 74 HIS A H    1  
ATOM 1044  H HA   . HIS A 1 74 ? 0.727   3.874   10.412  1.00 0.00 ? 74 HIS A HA   1  
ATOM 1045  H HB3  . HIS A 1 74 ? 2.729   4.971   11.527  1.00 0.00 ? 74 HIS A HB3  1  
ATOM 1046  H HD1  . HIS A 1 74 ? 0.548   7.709   12.560  1.00 0.00 ? 74 HIS A HD1  1  
ATOM 1047  H HD2  . HIS A 1 74 ? 3.676   7.215   9.809   1.00 0.00 ? 74 HIS A HD2  1  
ATOM 1048  H HE1  . HIS A 1 74 ? 1.373   10.054  11.988  1.00 0.00 ? 74 HIS A HE1  1  
ATOM 1049  N N    . ARG A 1 75 ? 0.282   6.504   8.575   1.00 0.00 ? 75 ARG A N    1  
ATOM 1050  C CA   . ARG A 1 75 ? -0.711  7.368   7.960   1.00 0.00 ? 75 ARG A CA   1  
ATOM 1051  C C    . ARG A 1 75 ? -1.299  6.699   6.715   1.00 0.00 ? 75 ARG A C    1  
ATOM 1052  O O    . ARG A 1 75 ? -2.509  6.736   6.499   1.00 0.00 ? 75 ARG A O    1  
ATOM 1053  C CB   . ARG A 1 75 ? -0.102  8.716   7.567   1.00 0.00 ? 75 ARG A CB   1  
ATOM 1054  C CG   . ARG A 1 75 ? 0.746   9.287   8.705   1.00 0.00 ? 75 ARG A CG   1  
ATOM 1055  C CD   . ARG A 1 75 ? 2.073   9.836   8.177   1.00 0.00 ? 75 ARG A CD   1  
ATOM 1056  N NE   . ARG A 1 75 ? 2.363   11.145  8.802   1.00 0.00 ? 75 ARG A NE   1  
ATOM 1057  C CZ   . ARG A 1 75 ? 1.708   12.278  8.513   1.00 0.00 ? 75 ARG A CZ   1  
ATOM 1058  N NH1  . ARG A 1 75 ? 0.721   12.268  7.607   1.00 0.00 ? 75 ARG A NH1  1  
ATOM 1059  N NH2  . ARG A 1 75 ? 2.040   13.420  9.130   1.00 0.00 ? 75 ARG A NH2  1  
ATOM 1060  H H    . ARG A 1 75 ? 1.201   6.571   8.184   1.00 0.00 ? 75 ARG A H    1  
ATOM 1061  H HA   . ARG A 1 75 ? -1.473  7.507   8.728   1.00 0.00 ? 75 ARG A HA   1  
ATOM 1062  H HB3  . ARG A 1 75 ? -0.897  9.418   7.313   1.00 0.00 ? 75 ARG A HB3  1  
ATOM 1063  H HG3  . ARG A 1 75 ? 0.938   8.510   9.445   1.00 0.00 ? 75 ARG A HG3  1  
ATOM 1064  H HD3  . ARG A 1 75 ? 2.027   9.944   7.094   1.00 0.00 ? 75 ARG A HD3  1  
ATOM 1065  H HE   . ARG A 1 75 ? 3.094   11.188  9.483   1.00 0.00 ? 75 ARG A HE   1  
ATOM 1066  H HH11 . ARG A 1 75 ? 0.474   11.415  7.146   1.00 0.00 ? 75 ARG A HH11 1  
ATOM 1067  H HH12 . ARG A 1 75 ? 0.232   13.113  7.391   1.00 0.00 ? 75 ARG A HH12 1  
ATOM 1068  H HH21 . ARG A 1 75 ? 2.776   13.428  9.806   1.00 0.00 ? 75 ARG A HH21 1  
ATOM 1069  H HH22 . ARG A 1 75 ? 1.551   14.265  8.914   1.00 0.00 ? 75 ARG A HH22 1  
ATOM 1070  N N    . ILE A 1 76 ? -0.414  6.103   5.930   1.00 0.00 ? 76 ILE A N    1  
ATOM 1071  C CA   . ILE A 1 76 ? -0.830  5.427   4.712   1.00 0.00 ? 76 ILE A CA   1  
ATOM 1072  C C    . ILE A 1 76 ? -2.157  4.707   4.962   1.00 0.00 ? 76 ILE A C    1  
ATOM 1073  O O    . ILE A 1 76 ? -2.258  3.881   5.868   1.00 0.00 ? 76 ILE A O    1  
ATOM 1074  C CB   . ILE A 1 76 ? 0.281   4.508   4.204   1.00 0.00 ? 76 ILE A CB   1  
ATOM 1075  C CG1  . ILE A 1 76 ? 1.541   5.308   3.862   1.00 0.00 ? 76 ILE A CG1  1  
ATOM 1076  C CG2  . ILE A 1 76 ? -0.201  3.667   3.021   1.00 0.00 ? 76 ILE A CG2  1  
ATOM 1077  C CD1  . ILE A 1 76 ? 2.645   4.392   3.332   1.00 0.00 ? 76 ILE A CD1  1  
ATOM 1078  H H    . ILE A 1 76 ? 0.568   6.077   6.113   1.00 0.00 ? 76 ILE A H    1  
ATOM 1079  H HA   . ILE A 1 76 ? -0.990  6.191   3.953   1.00 0.00 ? 76 ILE A HA   1  
ATOM 1080  H HB   . ILE A 1 76 ? 0.547   3.816   5.003   1.00 0.00 ? 76 ILE A HB   1  
ATOM 1081  H HG13 . ILE A 1 76 ? 1.894   5.832   4.750   1.00 0.00 ? 76 ILE A HG13 1  
ATOM 1082  H HG21 . ILE A 1 76 ? -1.288  3.719   2.957   1.00 0.00 ? 76 ILE A HG21 1  
ATOM 1083  H HG22 . ILE A 1 76 ? 0.236   4.051   2.099   1.00 0.00 ? 76 ILE A HG22 1  
ATOM 1084  H HG23 . ILE A 1 76 ? 0.106   2.630   3.162   1.00 0.00 ? 76 ILE A HG23 1  
ATOM 1085  H HD11 . ILE A 1 76 ? 2.647   4.419   2.241   1.00 0.00 ? 76 ILE A HD11 1  
ATOM 1086  H HD12 . ILE A 1 76 ? 3.611   4.731   3.705   1.00 0.00 ? 76 ILE A HD12 1  
ATOM 1087  H HD13 . ILE A 1 76 ? 2.464   3.371   3.668   1.00 0.00 ? 76 ILE A HD13 1  
ATOM 1088  N N    . ARG A 1 77 ? -3.142  5.046   4.143   1.00 0.00 ? 77 ARG A N    1  
ATOM 1089  C CA   . ARG A 1 77 ? -4.458  4.443   4.264   1.00 0.00 ? 77 ARG A CA   1  
ATOM 1090  C C    . ARG A 1 77 ? -5.094  4.278   2.882   1.00 0.00 ? 77 ARG A C    1  
ATOM 1091  O O    . ARG A 1 77 ? -5.094  5.210   2.079   1.00 0.00 ? 77 ARG A O    1  
ATOM 1092  C CB   . ARG A 1 77 ? -5.376  5.295   5.143   1.00 0.00 ? 77 ARG A CB   1  
ATOM 1093  C CG   . ARG A 1 77 ? -5.203  4.939   6.621   1.00 0.00 ? 77 ARG A CG   1  
ATOM 1094  C CD   . ARG A 1 77 ? -6.265  5.630   7.478   1.00 0.00 ? 77 ARG A CD   1  
ATOM 1095  N NE   . ARG A 1 77 ? -5.851  5.626   8.899   1.00 0.00 ? 77 ARG A NE   1  
ATOM 1096  C CZ   . ARG A 1 77 ? -6.613  6.075   9.905   1.00 0.00 ? 77 ARG A CZ   1  
ATOM 1097  N NH1  . ARG A 1 77 ? -7.835  6.566   9.653   1.00 0.00 ? 77 ARG A NH1  1  
ATOM 1098  N NH2  . ARG A 1 77 ? -6.155  6.032   11.164  1.00 0.00 ? 77 ARG A NH2  1  
ATOM 1099  H H    . ARG A 1 77 ? -3.051  5.719   3.408   1.00 0.00 ? 77 ARG A H    1  
ATOM 1100  H HA   . ARG A 1 77 ? -4.278  3.475   4.732   1.00 0.00 ? 77 ARG A HA   1  
ATOM 1101  H HB3  . ARG A 1 77 ? -6.413  5.141   4.846   1.00 0.00 ? 77 ARG A HB3  1  
ATOM 1102  H HG3  . ARG A 1 77 ? -4.210  5.237   6.957   1.00 0.00 ? 77 ARG A HG3  1  
ATOM 1103  H HD3  . ARG A 1 77 ? -7.222  5.119   7.368   1.00 0.00 ? 77 ARG A HD3  1  
ATOM 1104  H HE   . ARG A 1 77 ? -4.945  5.266   9.122   1.00 0.00 ? 77 ARG A HE   1  
ATOM 1105  H HH11 . ARG A 1 77 ? -8.176  6.599   8.714   1.00 0.00 ? 77 ARG A HH11 1  
ATOM 1106  H HH12 . ARG A 1 77 ? -8.403  6.902   10.404  1.00 0.00 ? 77 ARG A HH12 1  
ATOM 1107  H HH21 . ARG A 1 77 ? -5.243  5.665   11.351  1.00 0.00 ? 77 ARG A HH21 1  
ATOM 1108  H HH22 . ARG A 1 77 ? -6.724  6.367   11.915  1.00 0.00 ? 77 ARG A HH22 1  
ATOM 1109  N N    . PHE A 1 78 ? -5.621  3.085   2.648   1.00 0.00 ? 78 PHE A N    1  
ATOM 1110  C CA   . PHE A 1 78 ? -6.260  2.786   1.377   1.00 0.00 ? 78 PHE A CA   1  
ATOM 1111  C C    . PHE A 1 78 ? -7.737  3.184   1.398   1.00 0.00 ? 78 PHE A C    1  
ATOM 1112  O O    . PHE A 1 78 ? -8.361  3.213   2.459   1.00 0.00 ? 78 PHE A O    1  
ATOM 1113  C CB   . PHE A 1 78 ? -6.155  1.274   1.168   1.00 0.00 ? 78 PHE A CB   1  
ATOM 1114  C CG   . PHE A 1 78 ? -4.781  0.808   0.680   1.00 0.00 ? 78 PHE A CG   1  
ATOM 1115  C CD1  . PHE A 1 78 ? -3.658  1.194   1.341   1.00 0.00 ? 78 PHE A CD1  1  
ATOM 1116  C CD2  . PHE A 1 78 ? -4.686  0.006   -0.415  1.00 0.00 ? 78 PHE A CD2  1  
ATOM 1117  C CE1  . PHE A 1 78 ? -2.384  0.761   0.888   1.00 0.00 ? 78 PHE A CE1  1  
ATOM 1118  C CE2  . PHE A 1 78 ? -3.412  -0.427  -0.867  1.00 0.00 ? 78 PHE A CE2  1  
ATOM 1119  C CZ   . PHE A 1 78 ? -2.287  -0.041  -0.207  1.00 0.00 ? 78 PHE A CZ   1  
ATOM 1120  H H    . PHE A 1 78 ? -5.617  2.332   3.306   1.00 0.00 ? 78 PHE A H    1  
ATOM 1121  H HA   . PHE A 1 78 ? -5.741  3.362   0.611   1.00 0.00 ? 78 PHE A HA   1  
ATOM 1122  H HB3  . PHE A 1 78 ? -6.910  0.964   0.446   1.00 0.00 ? 78 PHE A HB3  1  
ATOM 1123  H HD1  . PHE A 1 78 ? -3.735  1.836   2.218   1.00 0.00 ? 78 PHE A HD1  1  
ATOM 1124  H HD2  . PHE A 1 78 ? -5.586  -0.304  -0.944  1.00 0.00 ? 78 PHE A HD2  1  
ATOM 1125  H HE1  . PHE A 1 78 ? -1.483  1.071   1.417   1.00 0.00 ? 78 PHE A HE1  1  
ATOM 1126  H HE2  . PHE A 1 78 ? -3.334  -1.069  -1.745  1.00 0.00 ? 78 PHE A HE2  1  
ATOM 1127  H HZ   . PHE A 1 78 ? -1.309  -0.373  -0.554  1.00 0.00 ? 78 PHE A HZ   1  
ATOM 1128  N N    . LYS A 1 79 ? -8.254  3.482   0.215   1.00 0.00 ? 79 LYS A N    1  
ATOM 1129  C CA   . LYS A 1 79 ? -9.647  3.878   0.086   1.00 0.00 ? 79 LYS A CA   1  
ATOM 1130  C C    . LYS A 1 79 ? -10.260 3.178   -1.129  1.00 0.00 ? 79 LYS A C    1  
ATOM 1131  O O    . LYS A 1 79 ? -9.833  3.403   -2.260  1.00 0.00 ? 79 LYS A O    1  
ATOM 1132  C CB   . LYS A 1 79 ? -9.768  5.403   0.044   1.00 0.00 ? 79 LYS A CB   1  
ATOM 1133  C CG   . LYS A 1 79 ? -9.971  5.976   1.448   1.00 0.00 ? 79 LYS A CG   1  
ATOM 1134  C CD   . LYS A 1 79 ? -11.459 6.067   1.793   1.00 0.00 ? 79 LYS A CD   1  
ATOM 1135  C CE   . LYS A 1 79 ? -12.047 7.402   1.333   1.00 0.00 ? 79 LYS A CE   1  
ATOM 1136  N NZ   . LYS A 1 79 ? -13.525 7.337   1.314   1.00 0.00 ? 79 LYS A NZ   1  
ATOM 1137  H H    . LYS A 1 79 ? -7.740  3.457   -0.641  1.00 0.00 ? 79 LYS A H    1  
ATOM 1138  H HA   . LYS A 1 79 ? -10.168 3.537   0.980   1.00 0.00 ? 79 LYS A HA   1  
ATOM 1139  H HB3  . LYS A 1 79 ? -10.606 5.687   -0.593  1.00 0.00 ? 79 LYS A HB3  1  
ATOM 1140  H HG3  . LYS A 1 79 ? -9.518  6.964   1.510   1.00 0.00 ? 79 LYS A HG3  1  
ATOM 1141  H HD3  . LYS A 1 79 ? -11.593 5.958   2.870   1.00 0.00 ? 79 LYS A HD3  1  
ATOM 1142  H HE3  . LYS A 1 79 ? -11.674 7.647   0.339   1.00 0.00 ? 79 LYS A HE3  1  
ATOM 1143  H HZ1  . LYS A 1 79 ? -13.833 7.028   0.413   1.00 0.00 ? 79 LYS A HZ1  1  
ATOM 1144  H HZ2  . LYS A 1 79 ? -13.841 6.696   2.012   1.00 0.00 ? 79 LYS A HZ2  1  
ATOM 1145  H HZ3  . LYS A 1 79 ? -13.901 8.245   1.500   1.00 0.00 ? 79 LYS A HZ3  1  
ATOM 1146  N N    . LEU A 1 80 ? -11.250 2.344   -0.852  1.00 0.00 ? 80 LEU A N    1  
ATOM 1147  C CA   . LEU A 1 80 ? -11.927 1.609   -1.909  1.00 0.00 ? 80 LEU A CA   1  
ATOM 1148  C C    . LEU A 1 80 ? -13.115 2.429   -2.414  1.00 0.00 ? 80 LEU A C    1  
ATOM 1149  O O    . LEU A 1 80 ? -13.682 3.230   -1.672  1.00 0.00 ? 80 LEU A O    1  
ATOM 1150  C CB   . LEU A 1 80 ? -12.308 0.207   -1.428  1.00 0.00 ? 80 LEU A CB   1  
ATOM 1151  C CG   . LEU A 1 80 ? -11.197 -0.844  -1.478  1.00 0.00 ? 80 LEU A CG   1  
ATOM 1152  C CD1  . LEU A 1 80 ? -11.708 -2.205  -1.003  1.00 0.00 ? 80 LEU A CD1  1  
ATOM 1153  C CD2  . LEU A 1 80 ? -10.576 -0.920  -2.874  1.00 0.00 ? 80 LEU A CD2  1  
ATOM 1154  H H    . LEU A 1 80 ? -11.592 2.166   0.070   1.00 0.00 ? 80 LEU A H    1  
ATOM 1155  H HA   . LEU A 1 80 ? -11.218 1.487   -2.727  1.00 0.00 ? 80 LEU A HA   1  
ATOM 1156  H HB3  . LEU A 1 80 ? -13.143 -0.147  -2.031  1.00 0.00 ? 80 LEU A HB3  1  
ATOM 1157  H HG   . LEU A 1 80 ? -10.407 -0.539  -0.791  1.00 0.00 ? 80 LEU A HG   1  
ATOM 1158  H HD11 . LEU A 1 80 ? -12.549 -2.514  -1.625  1.00 0.00 ? 80 LEU A HD11 1  
ATOM 1159  H HD12 . LEU A 1 80 ? -10.908 -2.942  -1.083  1.00 0.00 ? 80 LEU A HD12 1  
ATOM 1160  H HD13 . LEU A 1 80 ? -12.032 -2.130  0.035   1.00 0.00 ? 80 LEU A HD13 1  
ATOM 1161  H HD21 . LEU A 1 80 ? -11.178 -0.335  -3.571  1.00 0.00 ? 80 LEU A HD21 1  
ATOM 1162  H HD22 . LEU A 1 80 ? -9.563  -0.518  -2.844  1.00 0.00 ? 80 LEU A HD22 1  
ATOM 1163  H HD23 . LEU A 1 80 ? -10.545 -1.959  -3.202  1.00 0.00 ? 80 LEU A HD23 1  
ATOM 1164  N N    . LYS A 1 81 ? -13.457 2.203   -3.674  1.00 0.00 ? 81 LYS A N    1  
ATOM 1165  C CA   . LYS A 1 81 ? -14.567 2.911   -4.287  1.00 0.00 ? 81 LYS A CA   1  
ATOM 1166  C C    . LYS A 1 81 ? -15.811 2.756   -3.412  1.00 0.00 ? 81 LYS A C    1  
ATOM 1167  O O    . LYS A 1 81 ? -16.702 3.604   -3.436  1.00 0.00 ? 81 LYS A O    1  
ATOM 1168  C CB   . LYS A 1 81 ? -14.768 2.445   -5.731  1.00 0.00 ? 81 LYS A CB   1  
ATOM 1169  C CG   . LYS A 1 81 ? -15.434 1.068   -5.774  1.00 0.00 ? 81 LYS A CG   1  
ATOM 1170  C CD   . LYS A 1 81 ? -14.597 0.080   -6.591  1.00 0.00 ? 81 LYS A CD   1  
ATOM 1171  C CE   . LYS A 1 81 ? -14.943 -1.365  -6.227  1.00 0.00 ? 81 LYS A CE   1  
ATOM 1172  N NZ   . LYS A 1 81 ? -14.005 -1.880  -5.205  1.00 0.00 ? 81 LYS A NZ   1  
ATOM 1173  H H    . LYS A 1 81 ? -12.990 1.551   -4.272  1.00 0.00 ? 81 LYS A H    1  
ATOM 1174  H HA   . LYS A 1 81 ? -14.300 3.968   -4.325  1.00 0.00 ? 81 LYS A HA   1  
ATOM 1175  H HB3  . LYS A 1 81 ? -13.806 2.404   -6.241  1.00 0.00 ? 81 LYS A HB3  1  
ATOM 1176  H HG3  . LYS A 1 81 ? -16.429 1.154   -6.209  1.00 0.00 ? 81 LYS A HG3  1  
ATOM 1177  H HD3  . LYS A 1 81 ? -13.538 0.261   -6.413  1.00 0.00 ? 81 LYS A HD3  1  
ATOM 1178  H HE3  . LYS A 1 81 ? -14.900 -1.991  -7.118  1.00 0.00 ? 81 LYS A HE3  1  
ATOM 1179  H HZ1  . LYS A 1 81 ? -14.374 -2.721  -4.809  1.00 0.00 ? 81 LYS A HZ1  1  
ATOM 1180  H HZ2  . LYS A 1 81 ? -13.121 -2.070  -5.630  1.00 0.00 ? 81 LYS A HZ2  1  
ATOM 1181  H HZ3  . LYS A 1 81 ? -13.889 -1.196  -4.484  1.00 0.00 ? 81 LYS A HZ3  1  
ATOM 1182  N N    . ARG A 1 82 ? -15.834 1.666   -2.659  1.00 0.00 ? 82 ARG A N    1  
ATOM 1183  C CA   . ARG A 1 82 ? -16.955 1.389   -1.777  1.00 0.00 ? 82 ARG A CA   1  
ATOM 1184  C C    . ARG A 1 82 ? -16.699 1.984   -0.391  1.00 0.00 ? 82 ARG A C    1  
ATOM 1185  O O    . ARG A 1 82 ? -15.582 1.924   0.118   1.00 0.00 ? 82 ARG A O    1  
ATOM 1186  C CB   . ARG A 1 82 ? -17.190 -0.117  -1.642  1.00 0.00 ? 82 ARG A CB   1  
ATOM 1187  C CG   . ARG A 1 82 ? -18.682 -0.448  -1.711  1.00 0.00 ? 82 ARG A CG   1  
ATOM 1188  C CD   . ARG A 1 82 ? -18.916 -1.785  -2.418  1.00 0.00 ? 82 ARG A CD   1  
ATOM 1189  N NE   . ARG A 1 82 ? -19.980 -1.639  -3.436  1.00 0.00 ? 82 ARG A NE   1  
ATOM 1190  C CZ   . ARG A 1 82 ? -19.810 -1.029  -4.617  1.00 0.00 ? 82 ARG A CZ   1  
ATOM 1191  N NH1  . ARG A 1 82 ? -18.618 -0.504  -4.936  1.00 0.00 ? 82 ARG A NH1  1  
ATOM 1192  N NH2  . ARG A 1 82 ? -20.831 -0.944  -5.480  1.00 0.00 ? 82 ARG A NH2  1  
ATOM 1193  H H    . ARG A 1 82 ? -15.106 0.980   -2.645  1.00 0.00 ? 82 ARG A H    1  
ATOM 1194  H HA   . ARG A 1 82 ? -17.811 1.863   -2.256  1.00 0.00 ? 82 ARG A HA   1  
ATOM 1195  H HB3  . ARG A 1 82 ? -16.779 -0.471  -0.697  1.00 0.00 ? 82 ARG A HB3  1  
ATOM 1196  H HG3  . ARG A 1 82 ? -19.210 0.345   -2.241  1.00 0.00 ? 82 ARG A HG3  1  
ATOM 1197  H HD3  . ARG A 1 82 ? -19.200 -2.545  -1.690  1.00 0.00 ? 82 ARG A HD3  1  
ATOM 1198  H HE   . ARG A 1 82 ? -20.881 -2.019  -3.230  1.00 0.00 ? 82 ARG A HE   1  
ATOM 1199  H HH11 . ARG A 1 82 ? -17.856 -0.568  -4.291  1.00 0.00 ? 82 ARG A HH11 1  
ATOM 1200  H HH12 . ARG A 1 82 ? -18.492 -0.049  -5.817  1.00 0.00 ? 82 ARG A HH12 1  
ATOM 1201  H HH21 . ARG A 1 82 ? -21.721 -1.336  -5.243  1.00 0.00 ? 82 ARG A HH21 1  
ATOM 1202  H HH22 . ARG A 1 82 ? -20.705 -0.489  -6.362  1.00 0.00 ? 82 ARG A HH22 1  
ATOM 1203  N N    . PRO A 1 83 ? -17.783 2.559   0.196   1.00 0.00 ? 83 PRO A N    1  
ATOM 1204  C CA   . PRO A 1 83 ? -17.687 3.164   1.514   1.00 0.00 ? 83 PRO A CA   1  
ATOM 1205  C C    . PRO A 1 83 ? -17.621 2.095   2.605   1.00 0.00 ? 83 PRO A C    1  
ATOM 1206  O O    . PRO A 1 83 ? -17.941 0.932   2.361   1.00 0.00 ? 83 PRO A O    1  
ATOM 1207  C CB   . PRO A 1 83 ? -18.914 4.054   1.627   1.00 0.00 ? 83 PRO A CB   1  
ATOM 1208  C CG   . PRO A 1 83 ? -19.887 3.561   0.568   1.00 0.00 ? 83 PRO A CG   1  
ATOM 1209  C CD   . PRO A 1 83 ? -19.123 2.648   -0.377  1.00 0.00 ? 83 PRO A CD   1  
ATOM 1210  H HA   . PRO A 1 83 ? -16.840 3.690   1.593   1.00 0.00 ? 83 PRO A HA   1  
ATOM 1211  H HB3  . PRO A 1 83 ? -18.655 5.100   1.463   1.00 0.00 ? 83 PRO A HB3  1  
ATOM 1212  H HG3  . PRO A 1 83 ? -20.316 4.402   0.023   1.00 0.00 ? 83 PRO A HG3  1  
ATOM 1213  H HD3  . PRO A 1 83 ? -19.096 3.058   -1.386  1.00 0.00 ? 83 PRO A HD3  1  
ATOM 1214  N N    . SER A 1 84 ? -17.203 2.525   3.786   1.00 0.00 ? 84 SER A N    1  
ATOM 1215  C CA   . SER A 1 84 ? -17.092 1.619   4.917   1.00 0.00 ? 84 SER A CA   1  
ATOM 1216  C C    . SER A 1 84 ? -15.847 0.743   4.762   1.00 0.00 ? 84 SER A C    1  
ATOM 1217  O O    . SER A 1 84 ? -15.940 -0.401  4.319   1.00 0.00 ? 84 SER A O    1  
ATOM 1218  C CB   . SER A 1 84 ? -18.341 0.748   5.050   1.00 0.00 ? 84 SER A CB   1  
ATOM 1219  O OG   . SER A 1 84 ? -18.821 0.705   6.391   1.00 0.00 ? 84 SER A OG   1  
ATOM 1220  H H    . SER A 1 84 ? -16.945 3.472   3.977   1.00 0.00 ? 84 SER A H    1  
ATOM 1221  H HA   . SER A 1 84 ? -17.001 2.261   5.793   1.00 0.00 ? 84 SER A HA   1  
ATOM 1222  H HB3  . SER A 1 84 ? -18.116 -0.265  4.713   1.00 0.00 ? 84 SER A HB3  1  
ATOM 1223  H HG   . SER A 1 84 ? -18.093 0.404   7.005   1.00 0.00 ? 84 SER A HG   1  
ATOM 1224  N N    . SER A 1 85 ? -14.711 1.312   5.138   1.00 0.00 ? 85 SER A N    1  
ATOM 1225  C CA   . SER A 1 85 ? -13.449 0.596   5.046   1.00 0.00 ? 85 SER A CA   1  
ATOM 1226  C C    . SER A 1 85 ? -13.170 -0.142  6.358   1.00 0.00 ? 85 SER A C    1  
ATOM 1227  O O    . SER A 1 85 ? -13.365 0.412   7.439   1.00 0.00 ? 85 SER A O    1  
ATOM 1228  C CB   . SER A 1 85 ? -12.298 1.549   4.718   1.00 0.00 ? 85 SER A CB   1  
ATOM 1229  O OG   . SER A 1 85 ? -11.793 2.196   5.882   1.00 0.00 ? 85 SER A OG   1  
ATOM 1230  H H    . SER A 1 85 ? -14.643 2.242   5.497   1.00 0.00 ? 85 SER A H    1  
ATOM 1231  H HA   . SER A 1 85 ? -13.579 -0.112  4.228   1.00 0.00 ? 85 SER A HA   1  
ATOM 1232  H HB3  . SER A 1 85 ? -12.641 2.300   4.005   1.00 0.00 ? 85 SER A HB3  1  
ATOM 1233  H HG   . SER A 1 85 ? -11.146 1.596   6.353   1.00 0.00 ? 85 SER A HG   1  
ATOM 1234  N N    . GLY A 1 86 ? -12.718 -1.379  6.218   1.00 0.00 ? 86 GLY A N    1  
ATOM 1235  C CA   . GLY A 1 86 ? -12.410 -2.198  7.378   1.00 0.00 ? 86 GLY A CA   1  
ATOM 1236  C C    . GLY A 1 86 ? -11.249 -1.603  8.177   1.00 0.00 ? 86 GLY A C    1  
ATOM 1237  O O    . GLY A 1 86 ? -10.112 -1.584  7.706   1.00 0.00 ? 86 GLY A O    1  
ATOM 1238  H H    . GLY A 1 86 ? -12.562 -1.821  5.335   1.00 0.00 ? 86 GLY A H    1  
ATOM 1239  H HA2  . GLY A 1 86 ? -13.290 -2.278  8.016   1.00 0.00 ? 86 GLY A HA2  1  
ATOM 1240  H HA3  . GLY A 1 86 ? -12.156 -3.208  7.058   1.00 0.00 ? 86 GLY A HA3  1  
ATOM 1241  N N    . PRO A 1 87 ? -11.581 -1.120  9.404   1.00 0.00 ? 87 PRO A N    1  
ATOM 1242  C CA   . PRO A 1 87 ? -10.580 -0.526  10.272  1.00 0.00 ? 87 PRO A CA   1  
ATOM 1243  C C    . PRO A 1 87 ? -9.691  -1.602  10.899  1.00 0.00 ? 87 PRO A C    1  
ATOM 1244  O O    . PRO A 1 87 ? -10.154 -2.704  11.187  1.00 0.00 ? 87 PRO A O    1  
ATOM 1245  C CB   . PRO A 1 87 ? -11.370 0.266   11.301  1.00 0.00 ? 87 PRO A CB   1  
ATOM 1246  C CG   . PRO A 1 87 ? -12.785 -0.287  11.254  1.00 0.00 ? 87 PRO A CG   1  
ATOM 1247  C CD   . PRO A 1 87 ? -12.917 -1.126  9.993   1.00 0.00 ? 87 PRO A CD   1  
ATOM 1248  H HA   . PRO A 1 87 ? -9.966  0.061   9.743   1.00 0.00 ? 87 PRO A HA   1  
ATOM 1249  H HB3  . PRO A 1 87 ? -11.358 1.330   11.067  1.00 0.00 ? 87 PRO A HB3  1  
ATOM 1250  H HG3  . PRO A 1 87 ? -13.512 0.526   11.249  1.00 0.00 ? 87 PRO A HG3  1  
ATOM 1251  H HD3  . PRO A 1 87 ? -13.654 -0.702  9.311   1.00 0.00 ? 87 PRO A HD3  1  
ATOM 1252  N N    . SER A 1 88 ? -8.430  -1.244  11.093  1.00 0.00 ? 88 SER A N    1  
ATOM 1253  C CA   . SER A 1 88 ? -7.473  -2.165  11.681  1.00 0.00 ? 88 SER A CA   1  
ATOM 1254  C C    . SER A 1 88 ? -7.967  -2.628  13.053  1.00 0.00 ? 88 SER A C    1  
ATOM 1255  O O    . SER A 1 88 ? -8.157  -3.823  13.277  1.00 0.00 ? 88 SER A O    1  
ATOM 1256  C CB   . SER A 1 88 ? -6.092  -1.518  11.806  1.00 0.00 ? 88 SER A CB   1  
ATOM 1257  O OG   . SER A 1 88 ? -5.077  -2.477  12.090  1.00 0.00 ? 88 SER A OG   1  
ATOM 1258  H H    . SER A 1 88 ? -8.061  -0.344  10.856  1.00 0.00 ? 88 SER A H    1  
ATOM 1259  H HA   . SER A 1 88 ? -7.419  -3.005  10.990  1.00 0.00 ? 88 SER A HA   1  
ATOM 1260  H HB3  . SER A 1 88 ? -6.112  -0.767  12.595  1.00 0.00 ? 88 SER A HB3  1  
ATOM 1261  H HG   . SER A 1 88 ? -5.343  -3.035  12.876  1.00 0.00 ? 88 SER A HG   1  
ATOM 1262  N N    . SER A 1 89 ? -8.161  -1.659  13.935  1.00 0.00 ? 89 SER A N    1  
ATOM 1263  C CA   . SER A 1 89 ? -8.629  -1.953  15.279  1.00 0.00 ? 89 SER A CA   1  
ATOM 1264  C C    . SER A 1 89 ? -9.081  -0.665  15.968  1.00 0.00 ? 89 SER A C    1  
ATOM 1265  O O    . SER A 1 89 ? -10.231 -0.555  16.392  1.00 0.00 ? 89 SER A O    1  
ATOM 1266  C CB   . SER A 1 89 ? -7.540  -2.642  16.104  1.00 0.00 ? 89 SER A CB   1  
ATOM 1267  O OG   . SER A 1 89 ? -8.085  -3.393  17.185  1.00 0.00 ? 89 SER A OG   1  
ATOM 1268  H H    . SER A 1 89 ? -8.003  -0.690  13.745  1.00 0.00 ? 89 SER A H    1  
ATOM 1269  H HA   . SER A 1 89 ? -9.471  -2.633  15.148  1.00 0.00 ? 89 SER A HA   1  
ATOM 1270  H HB3  . SER A 1 89 ? -6.851  -1.892  16.493  1.00 0.00 ? 89 SER A HB3  1  
ATOM 1271  H HG   . SER A 1 89 ? -7.454  -3.380  17.962  1.00 0.00 ? 89 SER A HG   1  
ATOM 1272  N N    . GLY A 1 90 ? -8.154  0.278   16.060  1.00 0.00 ? 90 GLY A N    1  
ATOM 1273  C CA   . GLY A 1 90 ? -8.444  1.553   16.691  1.00 0.00 ? 90 GLY A CA   1  
ATOM 1274  C C    . GLY A 1 90 ? -9.853  2.034   16.337  1.00 0.00 ? 90 GLY A C    1  
ATOM 1275  O O    . GLY A 1 90 ? -10.681 2.248   17.221  1.00 0.00 ? 90 GLY A O    1  
ATOM 1276  H H    . GLY A 1 90 ? -7.222  0.180   15.712  1.00 0.00 ? 90 GLY A H    1  
ATOM 1277  H HA2  . GLY A 1 90 ? -8.350  1.458   17.773  1.00 0.00 ? 90 GLY A HA2  1  
ATOM 1278  H HA3  . GLY A 1 90 ? -7.712  2.295   16.373  1.00 0.00 ? 90 GLY A HA3  1  
ATOM 1279  N N    . GLY A 1 1  ? 0.860   -14.913 2.271   1.00 0.00 ? 1  GLY A N    2  
ATOM 1280  C CA   . GLY A 1 1  ? 1.819   -13.847 2.503   1.00 0.00 ? 1  GLY A CA   2  
ATOM 1281  C C    . GLY A 1 1  ? 2.542   -14.040 3.838   1.00 0.00 ? 1  GLY A C    2  
ATOM 1282  O O    . GLY A 1 1  ? 2.894   -15.163 4.200   1.00 0.00 ? 1  GLY A O    2  
ATOM 1283  H H1   . GLY A 1 1  ? 0.606   -15.438 3.083   1.00 0.00 ? 1  GLY A H1   2  
ATOM 1284  H HA2  . GLY A 1 1  ? 2.547   -13.824 1.692   1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1285  H HA3  . GLY A 1 1  ? 1.307   -12.885 2.500   1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1286  N N    . SER A 1 2  ? 2.740   -12.931 4.534   1.00 0.00 ? 2  SER A N    2  
ATOM 1287  C CA   . SER A 1 2  ? 3.415   -12.965 5.821   1.00 0.00 ? 2  SER A CA   2  
ATOM 1288  C C    . SER A 1 2  ? 4.828   -13.528 5.657   1.00 0.00 ? 2  SER A C    2  
ATOM 1289  O O    . SER A 1 2  ? 5.014   -14.742 5.595   1.00 0.00 ? 2  SER A O    2  
ATOM 1290  C CB   . SER A 1 2  ? 2.626   -13.798 6.834   1.00 0.00 ? 2  SER A CB   2  
ATOM 1291  O OG   . SER A 1 2  ? 1.350   -13.229 7.115   1.00 0.00 ? 2  SER A OG   2  
ATOM 1292  H H    . SER A 1 2  ? 2.450   -12.023 4.233   1.00 0.00 ? 2  SER A H    2  
ATOM 1293  H HA   . SER A 1 2  ? 3.451   -11.928 6.154   1.00 0.00 ? 2  SER A HA   2  
ATOM 1294  H HB3  . SER A 1 2  ? 3.197   -13.881 7.758   1.00 0.00 ? 2  SER A HB3  2  
ATOM 1295  H HG   . SER A 1 2  ? 1.236   -12.376 6.605   1.00 0.00 ? 2  SER A HG   2  
ATOM 1296  N N    . SER A 1 3  ? 5.789   -12.617 5.590   1.00 0.00 ? 3  SER A N    2  
ATOM 1297  C CA   . SER A 1 3  ? 7.179   -13.007 5.434   1.00 0.00 ? 3  SER A CA   2  
ATOM 1298  C C    . SER A 1 3  ? 8.055   -11.764 5.264   1.00 0.00 ? 3  SER A C    2  
ATOM 1299  O O    . SER A 1 3  ? 7.867   -10.992 4.323   1.00 0.00 ? 3  SER A O    2  
ATOM 1300  C CB   . SER A 1 3  ? 7.357   -13.949 4.243   1.00 0.00 ? 3  SER A CB   2  
ATOM 1301  O OG   . SER A 1 3  ? 7.273   -15.318 4.627   1.00 0.00 ? 3  SER A OG   2  
ATOM 1302  H H    . SER A 1 3  ? 5.629   -11.631 5.641   1.00 0.00 ? 3  SER A H    2  
ATOM 1303  H HA   . SER A 1 3  ? 7.436   -13.532 6.354   1.00 0.00 ? 3  SER A HA   2  
ATOM 1304  H HB3  . SER A 1 3  ? 8.323   -13.763 3.773   1.00 0.00 ? 3  SER A HB3  2  
ATOM 1305  H HG   . SER A 1 3  ? 6.349   -15.528 4.947   1.00 0.00 ? 3  SER A HG   2  
ATOM 1306  N N    . GLY A 1 4  ? 8.994   -11.609 6.186   1.00 0.00 ? 4  GLY A N    2  
ATOM 1307  C CA   . GLY A 1 4  ? 9.898   -10.473 6.149   1.00 0.00 ? 4  GLY A CA   2  
ATOM 1308  C C    . GLY A 1 4  ? 11.248  -10.826 6.777   1.00 0.00 ? 4  GLY A C    2  
ATOM 1309  O O    . GLY A 1 4  ? 11.301  -11.500 7.805   1.00 0.00 ? 4  GLY A O    2  
ATOM 1310  H H    . GLY A 1 4  ? 9.140   -12.241 6.947   1.00 0.00 ? 4  GLY A H    2  
ATOM 1311  H HA2  . GLY A 1 4  ? 10.046  -10.155 5.117   1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1312  H HA3  . GLY A 1 4  ? 9.455   -9.632  6.682   1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1313  N N    . SER A 1 5  ? 12.305  -10.356 6.133   1.00 0.00 ? 5  SER A N    2  
ATOM 1314  C CA   . SER A 1 5  ? 13.652  -10.615 6.616   1.00 0.00 ? 5  SER A CA   2  
ATOM 1315  C C    . SER A 1 5  ? 14.470  -9.321  6.601   1.00 0.00 ? 5  SER A C    2  
ATOM 1316  O O    . SER A 1 5  ? 14.927  -8.860  7.645   1.00 0.00 ? 5  SER A O    2  
ATOM 1317  C CB   . SER A 1 5  ? 14.342  -11.689 5.774   1.00 0.00 ? 5  SER A CB   2  
ATOM 1318  O OG   . SER A 1 5  ? 13.608  -12.911 5.762   1.00 0.00 ? 5  SER A OG   2  
ATOM 1319  H H    . SER A 1 5  ? 12.255  -9.809  5.298   1.00 0.00 ? 5  SER A H    2  
ATOM 1320  H HA   . SER A 1 5  ? 13.528  -10.977 7.637   1.00 0.00 ? 5  SER A HA   2  
ATOM 1321  H HB3  . SER A 1 5  ? 15.342  -11.871 6.168   1.00 0.00 ? 5  SER A HB3  2  
ATOM 1322  H HG   . SER A 1 5  ? 14.025  -13.565 6.392   1.00 0.00 ? 5  SER A HG   2  
ATOM 1323  N N    . SER A 1 6  ? 14.629  -8.773  5.406   1.00 0.00 ? 6  SER A N    2  
ATOM 1324  C CA   . SER A 1 6  ? 15.385  -7.543  5.241   1.00 0.00 ? 6  SER A CA   2  
ATOM 1325  C C    . SER A 1 6  ? 15.217  -7.013  3.815   1.00 0.00 ? 6  SER A C    2  
ATOM 1326  O O    . SER A 1 6  ? 15.705  -7.620  2.863   1.00 0.00 ? 6  SER A O    2  
ATOM 1327  C CB   . SER A 1 6  ? 16.866  -7.760  5.557   1.00 0.00 ? 6  SER A CB   2  
ATOM 1328  O OG   . SER A 1 6  ? 17.411  -6.688  6.322   1.00 0.00 ? 6  SER A OG   2  
ATOM 1329  H H    . SER A 1 6  ? 14.254  -9.155  4.561   1.00 0.00 ? 6  SER A H    2  
ATOM 1330  H HA   . SER A 1 6  ? 14.958  -6.844  5.961   1.00 0.00 ? 6  SER A HA   2  
ATOM 1331  H HB3  . SER A 1 6  ? 17.423  -7.860  4.626   1.00 0.00 ? 6  SER A HB3  2  
ATOM 1332  H HG   . SER A 1 6  ? 16.676  -6.094  6.650   1.00 0.00 ? 6  SER A HG   2  
ATOM 1333  N N    . GLY A 1 7  ? 14.527  -5.887  3.714   1.00 0.00 ? 7  GLY A N    2  
ATOM 1334  C CA   . GLY A 1 7  ? 14.289  -5.269  2.421   1.00 0.00 ? 7  GLY A CA   2  
ATOM 1335  C C    . GLY A 1 7  ? 13.304  -4.104  2.542   1.00 0.00 ? 7  GLY A C    2  
ATOM 1336  O O    . GLY A 1 7  ? 12.175  -4.286  2.995   1.00 0.00 ? 7  GLY A O    2  
ATOM 1337  H H    . GLY A 1 7  ? 14.133  -5.399  4.494   1.00 0.00 ? 7  GLY A H    2  
ATOM 1338  H HA2  . GLY A 1 7  ? 15.231  -4.911  2.007   1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1339  H HA3  . GLY A 1 7  ? 13.897  -6.011  1.726   1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1340  N N    . LEU A 1 8  ? 13.768  -2.933  2.130   1.00 0.00 ? 8  LEU A N    2  
ATOM 1341  C CA   . LEU A 1 8  ? 12.942  -1.739  2.187   1.00 0.00 ? 8  LEU A CA   2  
ATOM 1342  C C    . LEU A 1 8  ? 11.756  -1.899  1.234   1.00 0.00 ? 8  LEU A C    2  
ATOM 1343  O O    . LEU A 1 8  ? 10.602  -1.855  1.661   1.00 0.00 ? 8  LEU A O    2  
ATOM 1344  C CB   . LEU A 1 8  ? 13.784  -0.492  1.915   1.00 0.00 ? 8  LEU A CB   2  
ATOM 1345  C CG   . LEU A 1 8  ? 14.285  0.261   3.150   1.00 0.00 ? 8  LEU A CG   2  
ATOM 1346  C CD1  . LEU A 1 8  ? 15.004  1.552   2.749   1.00 0.00 ? 8  LEU A CD1  2  
ATOM 1347  C CD2  . LEU A 1 8  ? 13.143  0.523   4.132   1.00 0.00 ? 8  LEU A CD2  2  
ATOM 1348  H H    . LEU A 1 8  ? 14.688  -2.794  1.763   1.00 0.00 ? 8  LEU A H    2  
ATOM 1349  H HA   . LEU A 1 8  ? 12.559  -1.655  3.204   1.00 0.00 ? 8  LEU A HA   2  
ATOM 1350  H HB3  . LEU A 1 8  ? 13.195  0.195   1.309   1.00 0.00 ? 8  LEU A HB3  2  
ATOM 1351  H HG   . LEU A 1 8  ? 15.013  -0.367  3.662   1.00 0.00 ? 8  LEU A HG   2  
ATOM 1352  H HD11 . LEU A 1 8  ? 15.502  1.975   3.622   1.00 0.00 ? 8  LEU A HD11 2  
ATOM 1353  H HD12 . LEU A 1 8  ? 15.744  1.332   1.980   1.00 0.00 ? 8  LEU A HD12 2  
ATOM 1354  H HD13 . LEU A 1 8  ? 14.279  2.267   2.362   1.00 0.00 ? 8  LEU A HD13 2  
ATOM 1355  H HD21 . LEU A 1 8  ? 13.321  1.463   4.656   1.00 0.00 ? 8  LEU A HD21 2  
ATOM 1356  H HD22 . LEU A 1 8  ? 12.201  0.585   3.587   1.00 0.00 ? 8  LEU A HD22 2  
ATOM 1357  H HD23 . LEU A 1 8  ? 13.092  -0.291  4.854   1.00 0.00 ? 8  LEU A HD23 2  
ATOM 1358  N N    . ARG A 1 9  ? 12.079  -2.082  -0.037  1.00 0.00 ? 9  ARG A N    2  
ATOM 1359  C CA   . ARG A 1 9  ? 11.053  -2.249  -1.053  1.00 0.00 ? 9  ARG A CA   2  
ATOM 1360  C C    . ARG A 1 9  ? 10.183  -3.467  -0.735  1.00 0.00 ? 9  ARG A C    2  
ATOM 1361  O O    . ARG A 1 9  ? 8.995   -3.484  -1.050  1.00 0.00 ? 9  ARG A O    2  
ATOM 1362  C CB   . ARG A 1 9  ? 11.676  -2.424  -2.440  1.00 0.00 ? 9  ARG A CB   2  
ATOM 1363  C CG   . ARG A 1 9  ? 10.601  -2.413  -3.529  1.00 0.00 ? 9  ARG A CG   2  
ATOM 1364  C CD   . ARG A 1 9  ? 10.791  -3.582  -4.499  1.00 0.00 ? 9  ARG A CD   2  
ATOM 1365  N NE   . ARG A 1 9  ? 12.032  -3.394  -5.281  1.00 0.00 ? 9  ARG A NE   2  
ATOM 1366  C CZ   . ARG A 1 9  ? 12.625  -4.363  -5.992  1.00 0.00 ? 9  ARG A CZ   2  
ATOM 1367  N NH1  . ARG A 1 9  ? 12.094  -5.593  -6.022  1.00 0.00 ? 9  ARG A NH1  2  
ATOM 1368  N NH2  . ARG A 1 9  ? 13.750  -4.102  -6.671  1.00 0.00 ? 9  ARG A NH2  2  
ATOM 1369  H H    . ARG A 1 9  ? 13.018  -2.117  -0.376  1.00 0.00 ? 9  ARG A H    2  
ATOM 1370  H HA   . ARG A 1 9  ? 10.470  -1.329  -1.014  1.00 0.00 ? 9  ARG A HA   2  
ATOM 1371  H HB3  . ARG A 1 9  ? 12.228  -3.363  -2.479  1.00 0.00 ? 9  ARG A HB3  2  
ATOM 1372  H HG3  . ARG A 1 9  ? 10.643  -1.472  -4.077  1.00 0.00 ? 9  ARG A HG3  2  
ATOM 1373  H HD3  . ARG A 1 9  ? 9.934   -3.650  -5.170  1.00 0.00 ? 9  ARG A HD3  2  
ATOM 1374  H HE   . ARG A 1 9  ? 12.455  -2.488  -5.280  1.00 0.00 ? 9  ARG A HE   2  
ATOM 1375  H HH11 . ARG A 1 9  ? 11.255  -5.787  -5.515  1.00 0.00 ? 9  ARG A HH11 2  
ATOM 1376  H HH12 . ARG A 1 9  ? 12.537  -6.316  -6.553  1.00 0.00 ? 9  ARG A HH12 2  
ATOM 1377  H HH21 . ARG A 1 9  ? 14.147  -3.184  -6.649  1.00 0.00 ? 9  ARG A HH21 2  
ATOM 1378  H HH22 . ARG A 1 9  ? 14.193  -4.824  -7.202  1.00 0.00 ? 9  ARG A HH22 2  
ATOM 1379  N N    . LYS A 1 10 ? 10.809  -4.455  -0.113  1.00 0.00 ? 10 LYS A N    2  
ATOM 1380  C CA   . LYS A 1 10 ? 10.107  -5.673  0.252   1.00 0.00 ? 10 LYS A CA   2  
ATOM 1381  C C    . LYS A 1 10 ? 9.176   -5.387  1.432   1.00 0.00 ? 10 LYS A C    2  
ATOM 1382  O O    . LYS A 1 10 ? 8.097   -5.970  1.531   1.00 0.00 ? 10 LYS A O    2  
ATOM 1383  C CB   . LYS A 1 10 ? 11.101  -6.807  0.514   1.00 0.00 ? 10 LYS A CB   2  
ATOM 1384  C CG   . LYS A 1 10 ? 10.445  -7.939  1.306   1.00 0.00 ? 10 LYS A CG   2  
ATOM 1385  C CD   . LYS A 1 10 ? 9.174   -8.430  0.611   1.00 0.00 ? 10 LYS A CD   2  
ATOM 1386  C CE   . LYS A 1 10 ? 8.011   -8.533  1.600   1.00 0.00 ? 10 LYS A CE   2  
ATOM 1387  N NZ   . LYS A 1 10 ? 7.633   -9.949  1.810   1.00 0.00 ? 10 LYS A NZ   2  
ATOM 1388  H H    . LYS A 1 10 ? 11.777  -4.433  0.141   1.00 0.00 ? 10 LYS A H    2  
ATOM 1389  H HA   . LYS A 1 10 ? 9.500   -5.969  -0.603  1.00 0.00 ? 10 LYS A HA   2  
ATOM 1390  H HB3  . LYS A 1 10 ? 11.959  -6.422  1.065   1.00 0.00 ? 10 LYS A HB3  2  
ATOM 1391  H HG3  . LYS A 1 10 ? 10.203  -7.593  2.311   1.00 0.00 ? 10 LYS A HG3  2  
ATOM 1392  H HD3  . LYS A 1 10 ? 9.357   -9.404  0.156   1.00 0.00 ? 10 LYS A HD3  2  
ATOM 1393  H HE3  . LYS A 1 10 ? 7.155   -7.973  1.224   1.00 0.00 ? 10 LYS A HE3  2  
ATOM 1394  H HZ1  . LYS A 1 10 ? 8.331   -10.543 1.410   1.00 0.00 ? 10 LYS A HZ1  2  
ATOM 1395  H HZ2  . LYS A 1 10 ? 7.560   -10.133 2.790   1.00 0.00 ? 10 LYS A HZ2  2  
ATOM 1396  H HZ3  . LYS A 1 10 ? 6.752   -10.127 1.370   1.00 0.00 ? 10 LYS A HZ3  2  
ATOM 1397  N N    . MET A 1 11 ? 9.627   -4.488  2.296   1.00 0.00 ? 11 MET A N    2  
ATOM 1398  C CA   . MET A 1 11 ? 8.848   -4.118  3.464   1.00 0.00 ? 11 MET A CA   2  
ATOM 1399  C C    . MET A 1 11 ? 7.542   -3.431  3.057   1.00 0.00 ? 11 MET A C    2  
ATOM 1400  O O    . MET A 1 11 ? 6.458   -3.886  3.422   1.00 0.00 ? 11 MET A O    2  
ATOM 1401  C CB   . MET A 1 11 ? 9.667   -3.174  4.346   1.00 0.00 ? 11 MET A CB   2  
ATOM 1402  C CG   . MET A 1 11 ? 10.549  -3.959  5.318   1.00 0.00 ? 11 MET A CG   2  
ATOM 1403  S SD   . MET A 1 11 ? 10.254  -3.410  6.990   1.00 0.00 ? 11 MET A SD   2  
ATOM 1404  C CE   . MET A 1 11 ? 11.294  -1.958  7.027   1.00 0.00 ? 11 MET A CE   2  
ATOM 1405  H H    . MET A 1 11 ? 10.506  -4.020  2.207   1.00 0.00 ? 11 MET A H    2  
ATOM 1406  H HA   . MET A 1 11 ? 8.630   -5.053  3.980   1.00 0.00 ? 11 MET A HA   2  
ATOM 1407  H HB3  . MET A 1 11 ? 8.999   -2.519  4.904   1.00 0.00 ? 11 MET A HB3  2  
ATOM 1408  H HG3  . MET A 1 11 ? 11.600  -3.821  5.061   1.00 0.00 ? 11 MET A HG3  2  
ATOM 1409  H HE1  . MET A 1 11 ? 11.584  -1.692  6.012   1.00 0.00 ? 11 MET A HE1  2  
ATOM 1410  H HE2  . MET A 1 11 ? 10.746  -1.131  7.477   1.00 0.00 ? 11 MET A HE2  2  
ATOM 1411  H HE3  . MET A 1 11 ? 12.186  -2.166  7.618   1.00 0.00 ? 11 MET A HE3  2  
ATOM 1412  N N    . VAL A 1 12 ? 7.688   -2.349  2.307   1.00 0.00 ? 12 VAL A N    2  
ATOM 1413  C CA   . VAL A 1 12 ? 6.534   -1.596  1.847   1.00 0.00 ? 12 VAL A CA   2  
ATOM 1414  C C    . VAL A 1 12 ? 5.653   -2.499  0.981   1.00 0.00 ? 12 VAL A C    2  
ATOM 1415  O O    . VAL A 1 12 ? 4.428   -2.397  1.017   1.00 0.00 ? 12 VAL A O    2  
ATOM 1416  C CB   . VAL A 1 12 ? 6.991   -0.331  1.118   1.00 0.00 ? 12 VAL A CB   2  
ATOM 1417  C CG1  . VAL A 1 12 ? 8.221   -0.611  0.253   1.00 0.00 ? 12 VAL A CG1  2  
ATOM 1418  C CG2  . VAL A 1 12 ? 5.855   0.260   0.281   1.00 0.00 ? 12 VAL A CG2  2  
ATOM 1419  H H    . VAL A 1 12 ? 8.573   -1.986  2.015   1.00 0.00 ? 12 VAL A H    2  
ATOM 1420  H HA   . VAL A 1 12 ? 5.966   -1.292  2.727   1.00 0.00 ? 12 VAL A HA   2  
ATOM 1421  H HB   . VAL A 1 12 ? 7.271   0.406   1.870   1.00 0.00 ? 12 VAL A HB   2  
ATOM 1422  H HG11 . VAL A 1 12 ? 8.095   -0.140  -0.722  1.00 0.00 ? 12 VAL A HG11 2  
ATOM 1423  H HG12 . VAL A 1 12 ? 9.108   -0.205  0.741   1.00 0.00 ? 12 VAL A HG12 2  
ATOM 1424  H HG13 . VAL A 1 12 ? 8.337   -1.687  0.124   1.00 0.00 ? 12 VAL A HG13 2  
ATOM 1425  H HG21 . VAL A 1 12 ? 4.960   0.351   0.896   1.00 0.00 ? 12 VAL A HG21 2  
ATOM 1426  H HG22 . VAL A 1 12 ? 6.146   1.245   -0.084  1.00 0.00 ? 12 VAL A HG22 2  
ATOM 1427  H HG23 . VAL A 1 12 ? 5.649   -0.394  -0.566  1.00 0.00 ? 12 VAL A HG23 2  
ATOM 1428  N N    . GLU A 1 13 ? 6.312   -3.364  0.223   1.00 0.00 ? 13 GLU A N    2  
ATOM 1429  C CA   . GLU A 1 13 ? 5.604   -4.284  -0.650  1.00 0.00 ? 13 GLU A CA   2  
ATOM 1430  C C    . GLU A 1 13 ? 4.429   -4.924  0.093   1.00 0.00 ? 13 GLU A C    2  
ATOM 1431  O O    . GLU A 1 13 ? 3.311   -4.957  -0.418  1.00 0.00 ? 13 GLU A O    2  
ATOM 1432  C CB   . GLU A 1 13 ? 6.550   -5.352  -1.204  1.00 0.00 ? 13 GLU A CB   2  
ATOM 1433  C CG   . GLU A 1 13 ? 7.224   -4.873  -2.491  1.00 0.00 ? 13 GLU A CG   2  
ATOM 1434  C CD   . GLU A 1 13 ? 6.397   -5.260  -3.719  1.00 0.00 ? 13 GLU A CD   2  
ATOM 1435  O OE1  . GLU A 1 13 ? 5.183   -4.962  -3.701  1.00 0.00 ? 13 GLU A OE1  2  
ATOM 1436  O OE2  . GLU A 1 13 ? 6.998   -5.843  -4.647  1.00 0.00 ? 13 GLU A OE2  2  
ATOM 1437  H H    . GLU A 1 13 ? 7.308   -3.441  0.200   1.00 0.00 ? 13 GLU A H    2  
ATOM 1438  H HA   . GLU A 1 13 ? 5.233   -3.675  -1.474  1.00 0.00 ? 13 GLU A HA   2  
ATOM 1439  H HB3  . GLU A 1 13 ? 5.994   -6.269  -1.399  1.00 0.00 ? 13 GLU A HB3  2  
ATOM 1440  H HG3  . GLU A 1 13 ? 8.221   -5.309  -2.568  1.00 0.00 ? 13 GLU A HG3  2  
ATOM 1441  N N    . GLU A 1 14 ? 4.724   -5.417  1.287   1.00 0.00 ? 14 GLU A N    2  
ATOM 1442  C CA   . GLU A 1 14 ? 3.707   -6.055  2.105   1.00 0.00 ? 14 GLU A CA   2  
ATOM 1443  C C    . GLU A 1 14 ? 2.738   -5.008  2.657   1.00 0.00 ? 14 GLU A C    2  
ATOM 1444  O O    . GLU A 1 14 ? 1.529   -5.232  2.690   1.00 0.00 ? 14 GLU A O    2  
ATOM 1445  C CB   . GLU A 1 14 ? 4.342   -6.865  3.237   1.00 0.00 ? 14 GLU A CB   2  
ATOM 1446  C CG   . GLU A 1 14 ? 4.417   -6.042  4.524   1.00 0.00 ? 14 GLU A CG   2  
ATOM 1447  C CD   . GLU A 1 14 ? 5.239   -6.768  5.592   1.00 0.00 ? 14 GLU A CD   2  
ATOM 1448  O OE1  . GLU A 1 14 ? 5.133   -8.013  5.639   1.00 0.00 ? 14 GLU A OE1  2  
ATOM 1449  O OE2  . GLU A 1 14 ? 5.952   -6.062  6.337   1.00 0.00 ? 14 GLU A OE2  2  
ATOM 1450  H H    . GLU A 1 14 ? 5.637   -5.387  1.694   1.00 0.00 ? 14 GLU A H    2  
ATOM 1451  H HA   . GLU A 1 14 ? 3.178   -6.732  1.435   1.00 0.00 ? 14 GLU A HA   2  
ATOM 1452  H HB3  . GLU A 1 14 ? 5.341   -7.183  2.945   1.00 0.00 ? 14 GLU A HB3  2  
ATOM 1453  H HG3  . GLU A 1 14 ? 3.412   -5.852  4.900   1.00 0.00 ? 14 GLU A HG3  2  
ATOM 1454  N N    . VAL A 1 15 ? 3.304   -3.886  3.077   1.00 0.00 ? 15 VAL A N    2  
ATOM 1455  C CA   . VAL A 1 15 ? 2.504   -2.804  3.626   1.00 0.00 ? 15 VAL A CA   2  
ATOM 1456  C C    . VAL A 1 15 ? 1.304   -2.549  2.713   1.00 0.00 ? 15 VAL A C    2  
ATOM 1457  O O    . VAL A 1 15 ? 0.162   -2.793  3.100   1.00 0.00 ? 15 VAL A O    2  
ATOM 1458  C CB   . VAL A 1 15 ? 3.375   -1.562  3.830   1.00 0.00 ? 15 VAL A CB   2  
ATOM 1459  C CG1  . VAL A 1 15 ? 2.512   -0.310  3.998   1.00 0.00 ? 15 VAL A CG1  2  
ATOM 1460  C CG2  . VAL A 1 15 ? 4.317   -1.744  5.022   1.00 0.00 ? 15 VAL A CG2  2  
ATOM 1461  H H    . VAL A 1 15 ? 4.288   -3.712  3.047   1.00 0.00 ? 15 VAL A H    2  
ATOM 1462  H HA   . VAL A 1 15 ? 2.140   -3.125  4.602   1.00 0.00 ? 15 VAL A HA   2  
ATOM 1463  H HB   . VAL A 1 15 ? 3.987   -1.431  2.937   1.00 0.00 ? 15 VAL A HB   2  
ATOM 1464  H HG11 . VAL A 1 15 ? 1.714   -0.511  4.714   1.00 0.00 ? 15 VAL A HG11 2  
ATOM 1465  H HG12 . VAL A 1 15 ? 3.130   0.510   4.364   1.00 0.00 ? 15 VAL A HG12 2  
ATOM 1466  H HG13 . VAL A 1 15 ? 2.078   -0.036  3.037   1.00 0.00 ? 15 VAL A HG13 2  
ATOM 1467  H HG21 . VAL A 1 15 ? 3.830   -1.383  5.928   1.00 0.00 ? 15 VAL A HG21 2  
ATOM 1468  H HG22 . VAL A 1 15 ? 4.560   -2.800  5.135   1.00 0.00 ? 15 VAL A HG22 2  
ATOM 1469  H HG23 . VAL A 1 15 ? 5.232   -1.176  4.851   1.00 0.00 ? 15 VAL A HG23 2  
ATOM 1470  N N    . PHE A 1 16 ? 1.603   -2.060  1.518   1.00 0.00 ? 16 PHE A N    2  
ATOM 1471  C CA   . PHE A 1 16 ? 0.562   -1.769  0.547   1.00 0.00 ? 16 PHE A CA   2  
ATOM 1472  C C    . PHE A 1 16 ? -0.378  -2.964  0.375   1.00 0.00 ? 16 PHE A C    2  
ATOM 1473  O O    . PHE A 1 16 ? -1.579  -2.790  0.177   1.00 0.00 ? 16 PHE A O    2  
ATOM 1474  C CB   . PHE A 1 16 ? 1.260   -1.489  -0.786  1.00 0.00 ? 16 PHE A CB   2  
ATOM 1475  C CG   . PHE A 1 16 ? 1.837   -0.076  -0.901  1.00 0.00 ? 16 PHE A CG   2  
ATOM 1476  C CD1  . PHE A 1 16 ? 1.147   0.983   -0.401  1.00 0.00 ? 16 PHE A CD1  2  
ATOM 1477  C CD2  . PHE A 1 16 ? 3.040   0.120   -1.504  1.00 0.00 ? 16 PHE A CD2  2  
ATOM 1478  C CE1  . PHE A 1 16 ? 1.682   2.294   -0.507  1.00 0.00 ? 16 PHE A CE1  2  
ATOM 1479  C CE2  . PHE A 1 16 ? 3.576   1.430   -1.612  1.00 0.00 ? 16 PHE A CE2  2  
ATOM 1480  C CZ   . PHE A 1 16 ? 2.885   2.490   -1.111  1.00 0.00 ? 16 PHE A CZ   2  
ATOM 1481  H H    . PHE A 1 16 ? 2.534   -1.864  1.211   1.00 0.00 ? 16 PHE A H    2  
ATOM 1482  H HA   . PHE A 1 16 ? -0.002  -0.916  0.923   1.00 0.00 ? 16 PHE A HA   2  
ATOM 1483  H HB3  . PHE A 1 16 ? 0.549   -1.647  -1.597  1.00 0.00 ? 16 PHE A HB3  2  
ATOM 1484  H HD1  . PHE A 1 16 ? 0.183   0.827   0.082   1.00 0.00 ? 16 PHE A HD1  2  
ATOM 1485  H HD2  . PHE A 1 16 ? 3.593   -0.729  -1.906  1.00 0.00 ? 16 PHE A HD2  2  
ATOM 1486  H HE1  . PHE A 1 16 ? 1.129   3.143   -0.107  1.00 0.00 ? 16 PHE A HE1  2  
ATOM 1487  H HE2  . PHE A 1 16 ? 4.540   1.587   -2.095  1.00 0.00 ? 16 PHE A HE2  2  
ATOM 1488  H HZ   . PHE A 1 16 ? 3.297   3.496   -1.194  1.00 0.00 ? 16 PHE A HZ   2  
ATOM 1489  N N    . ASP A 1 17 ? 0.205   -4.151  0.459   1.00 0.00 ? 17 ASP A N    2  
ATOM 1490  C CA   . ASP A 1 17 ? -0.565  -5.374  0.315   1.00 0.00 ? 17 ASP A CA   2  
ATOM 1491  C C    . ASP A 1 17 ? -1.518  -5.514  1.505   1.00 0.00 ? 17 ASP A C    2  
ATOM 1492  O O    . ASP A 1 17 ? -2.732  -5.603  1.324   1.00 0.00 ? 17 ASP A O    2  
ATOM 1493  C CB   . ASP A 1 17 ? 0.347   -6.601  0.295   1.00 0.00 ? 17 ASP A CB   2  
ATOM 1494  C CG   . ASP A 1 17 ? 0.727   -7.103  -1.100  1.00 0.00 ? 17 ASP A CG   2  
ATOM 1495  O OD1  . ASP A 1 17 ? 0.811   -6.246  -2.007  1.00 0.00 ? 17 ASP A OD1  2  
ATOM 1496  O OD2  . ASP A 1 17 ? 0.924   -8.330  -1.228  1.00 0.00 ? 17 ASP A OD2  2  
ATOM 1497  H H    . ASP A 1 17 ? 1.182   -4.284  0.620   1.00 0.00 ? 17 ASP A H    2  
ATOM 1498  H HA   . ASP A 1 17 ? -1.094  -5.271  -0.633  1.00 0.00 ? 17 ASP A HA   2  
ATOM 1499  H HB3  . ASP A 1 17 ? -0.144  -7.411  0.834   1.00 0.00 ? 17 ASP A HB3  2  
ATOM 1500  N N    . VAL A 1 18 ? -0.933  -5.528  2.693   1.00 0.00 ? 18 VAL A N    2  
ATOM 1501  C CA   . VAL A 1 18 ? -1.715  -5.655  3.911   1.00 0.00 ? 18 VAL A CA   2  
ATOM 1502  C C    . VAL A 1 18 ? -2.852  -4.631  3.891   1.00 0.00 ? 18 VAL A C    2  
ATOM 1503  O O    . VAL A 1 18 ? -4.024  -5.001  3.845   1.00 0.00 ? 18 VAL A O    2  
ATOM 1504  C CB   . VAL A 1 18 ? -0.806  -5.515  5.134   1.00 0.00 ? 18 VAL A CB   2  
ATOM 1505  C CG1  . VAL A 1 18 ? -1.608  -5.103  6.369   1.00 0.00 ? 18 VAL A CG1  2  
ATOM 1506  C CG2  . VAL A 1 18 ? -0.029  -6.809  5.390   1.00 0.00 ? 18 VAL A CG2  2  
ATOM 1507  H H    . VAL A 1 18 ? 0.054   -5.454  2.830   1.00 0.00 ? 18 VAL A H    2  
ATOM 1508  H HA   . VAL A 1 18 ? -2.145  -6.656  3.922   1.00 0.00 ? 18 VAL A HA   2  
ATOM 1509  H HB   . VAL A 1 18 ? -0.083  -4.727  4.925   1.00 0.00 ? 18 VAL A HB   2  
ATOM 1510  H HG11 . VAL A 1 18 ? -1.778  -4.027  6.350   1.00 0.00 ? 18 VAL A HG11 2  
ATOM 1511  H HG12 . VAL A 1 18 ? -2.566  -5.623  6.369   1.00 0.00 ? 18 VAL A HG12 2  
ATOM 1512  H HG13 . VAL A 1 18 ? -1.052  -5.367  7.268   1.00 0.00 ? 18 VAL A HG13 2  
ATOM 1513  H HG21 . VAL A 1 18 ? -0.714  -7.579  5.744   1.00 0.00 ? 18 VAL A HG21 2  
ATOM 1514  H HG22 . VAL A 1 18 ? 0.443   -7.139  4.464   1.00 0.00 ? 18 VAL A HG22 2  
ATOM 1515  H HG23 . VAL A 1 18 ? 0.737   -6.628  6.144   1.00 0.00 ? 18 VAL A HG23 2  
ATOM 1516  N N    . LEU A 1 19 ? -2.465  -3.364  3.927   1.00 0.00 ? 19 LEU A N    2  
ATOM 1517  C CA   . LEU A 1 19 ? -3.438  -2.285  3.913   1.00 0.00 ? 19 LEU A CA   2  
ATOM 1518  C C    . LEU A 1 19 ? -4.561  -2.628  2.934   1.00 0.00 ? 19 LEU A C    2  
ATOM 1519  O O    . LEU A 1 19 ? -5.725  -2.715  3.324   1.00 0.00 ? 19 LEU A O    2  
ATOM 1520  C CB   . LEU A 1 19 ? -2.751  -0.950  3.618   1.00 0.00 ? 19 LEU A CB   2  
ATOM 1521  C CG   . LEU A 1 19 ? -1.592  -0.573  4.542   1.00 0.00 ? 19 LEU A CG   2  
ATOM 1522  C CD1  . LEU A 1 19 ? -1.275  0.921   4.444   1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1523  C CD2  . LEU A 1 19 ? -1.874  -1.005  5.982   1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1524  H H    . LEU A 1 19 ? -1.509  -3.072  3.963   1.00 0.00 ? 19 LEU A H    2  
ATOM 1525  H HA   . LEU A 1 19 ? -3.861  -2.215  4.915   1.00 0.00 ? 19 LEU A HA   2  
ATOM 1526  H HB3  . LEU A 1 19 ? -3.500  -0.160  3.669   1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1527  H HG   . LEU A 1 19 ? -0.703  -1.113  4.212   1.00 0.00 ? 19 LEU A HG   2  
ATOM 1528  H HD11 . LEU A 1 19 ? -1.704  1.440   5.300   1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1529  H HD12 . LEU A 1 19 ? -0.195  1.064   4.437   1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1530  H HD13 . LEU A 1 19 ? -1.701  1.323   3.525   1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1531  H HD21 . LEU A 1 19 ? -2.933  -0.871  6.201   1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1532  H HD22 . LEU A 1 19 ? -1.610  -2.056  6.105   1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1533  H HD23 . LEU A 1 19 ? -1.282  -0.399  6.667   1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1534  N N    . TYR A 1 20 ? -4.174  -2.815  1.680   1.00 0.00 ? 20 TYR A N    2  
ATOM 1535  C CA   . TYR A 1 20 ? -5.135  -3.147  0.642   1.00 0.00 ? 20 TYR A CA   2  
ATOM 1536  C C    . TYR A 1 20 ? -6.049  -4.291  1.086   1.00 0.00 ? 20 TYR A C    2  
ATOM 1537  O O    . TYR A 1 20 ? -7.272  -4.177  1.016   1.00 0.00 ? 20 TYR A O    2  
ATOM 1538  C CB   . TYR A 1 20 ? -4.312  -3.605  -0.563  1.00 0.00 ? 20 TYR A CB   2  
ATOM 1539  C CG   . TYR A 1 20 ? -5.155  -4.066  -1.754  1.00 0.00 ? 20 TYR A CG   2  
ATOM 1540  C CD1  . TYR A 1 20 ? -6.201  -3.285  -2.202  1.00 0.00 ? 20 TYR A CD1  2  
ATOM 1541  C CD2  . TYR A 1 20 ? -4.870  -5.262  -2.379  1.00 0.00 ? 20 TYR A CD2  2  
ATOM 1542  C CE1  . TYR A 1 20 ? -6.994  -3.719  -3.323  1.00 0.00 ? 20 TYR A CE1  2  
ATOM 1543  C CE2  . TYR A 1 20 ? -5.663  -5.696  -3.499  1.00 0.00 ? 20 TYR A CE2  2  
ATOM 1544  C CZ   . TYR A 1 20 ? -6.687  -4.903  -3.916  1.00 0.00 ? 20 TYR A CZ   2  
ATOM 1545  O OH   . TYR A 1 20 ? -7.436  -5.314  -4.974  1.00 0.00 ? 20 TYR A OH   2  
ATOM 1546  H H    . TYR A 1 20 ? -3.226  -2.742  1.371   1.00 0.00 ? 20 TYR A H    2  
ATOM 1547  H HA   . TYR A 1 20 ? -5.741  -2.262  0.449   1.00 0.00 ? 20 TYR A HA   2  
ATOM 1548  H HB3  . TYR A 1 20 ? -3.659  -4.422  -0.255  1.00 0.00 ? 20 TYR A HB3  2  
ATOM 1549  H HD1  . TYR A 1 20 ? -6.427  -2.340  -1.708  1.00 0.00 ? 20 TYR A HD1  2  
ATOM 1550  H HD2  . TYR A 1 20 ? -4.043  -5.879  -2.025  1.00 0.00 ? 20 TYR A HD2  2  
ATOM 1551  H HE1  . TYR A 1 20 ? -7.824  -3.112  -3.687  1.00 0.00 ? 20 TYR A HE1  2  
ATOM 1552  H HE2  . TYR A 1 20 ? -5.449  -6.639  -4.003  1.00 0.00 ? 20 TYR A HE2  2  
ATOM 1553  H HH   . TYR A 1 20 ? -7.145  -4.838  -5.804  1.00 0.00 ? 20 TYR A HH   2  
ATOM 1554  N N    . SER A 1 21 ? -5.420  -5.369  1.532   1.00 0.00 ? 21 SER A N    2  
ATOM 1555  C CA   . SER A 1 21 ? -6.160  -6.533  1.986   1.00 0.00 ? 21 SER A CA   2  
ATOM 1556  C C    . SER A 1 21 ? -7.083  -6.147  3.145   1.00 0.00 ? 21 SER A C    2  
ATOM 1557  O O    . SER A 1 21 ? -8.193  -6.662  3.257   1.00 0.00 ? 21 SER A O    2  
ATOM 1558  C CB   . SER A 1 21 ? -5.212  -7.656  2.414   1.00 0.00 ? 21 SER A CB   2  
ATOM 1559  O OG   . SER A 1 21 ? -5.860  -8.612  3.249   1.00 0.00 ? 21 SER A OG   2  
ATOM 1560  H H    . SER A 1 21 ? -4.424  -5.453  1.585   1.00 0.00 ? 21 SER A H    2  
ATOM 1561  H HA   . SER A 1 21 ? -6.744  -6.859  1.125   1.00 0.00 ? 21 SER A HA   2  
ATOM 1562  H HB3  . SER A 1 21 ? -4.360  -7.230  2.943   1.00 0.00 ? 21 SER A HB3  2  
ATOM 1563  H HG   . SER A 1 21 ? -6.287  -9.322  2.689   1.00 0.00 ? 21 SER A HG   2  
ATOM 1564  N N    . GLU A 1 22 ? -6.587  -5.244  3.978   1.00 0.00 ? 22 GLU A N    2  
ATOM 1565  C CA   . GLU A 1 22 ? -7.352  -4.782  5.123   1.00 0.00 ? 22 GLU A CA   2  
ATOM 1566  C C    . GLU A 1 22 ? -8.593  -4.017  4.660   1.00 0.00 ? 22 GLU A C    2  
ATOM 1567  O O    . GLU A 1 22 ? -9.681  -4.206  5.200   1.00 0.00 ? 22 GLU A O    2  
ATOM 1568  C CB   . GLU A 1 22 ? -6.490  -3.920  6.047   1.00 0.00 ? 22 GLU A CB   2  
ATOM 1569  C CG   . GLU A 1 22 ? -5.467  -4.775  6.800   1.00 0.00 ? 22 GLU A CG   2  
ATOM 1570  C CD   . GLU A 1 22 ? -6.099  -5.431  8.028   1.00 0.00 ? 22 GLU A CD   2  
ATOM 1571  O OE1  . GLU A 1 22 ? -6.823  -4.709  8.749   1.00 0.00 ? 22 GLU A OE1  2  
ATOM 1572  O OE2  . GLU A 1 22 ? -5.845  -6.639  8.221   1.00 0.00 ? 22 GLU A OE2  2  
ATOM 1573  H H    . GLU A 1 22 ? -5.682  -4.829  3.879   1.00 0.00 ? 22 GLU A H    2  
ATOM 1574  H HA   . GLU A 1 22 ? -7.652  -5.686  5.655   1.00 0.00 ? 22 GLU A HA   2  
ATOM 1575  H HB3  . GLU A 1 22 ? -7.127  -3.396  6.761   1.00 0.00 ? 22 GLU A HB3  2  
ATOM 1576  H HG3  . GLU A 1 22 ? -4.625  -4.155  7.106   1.00 0.00 ? 22 GLU A HG3  2  
ATOM 1577  N N    . ALA A 1 23 ? -8.388  -3.168  3.663   1.00 0.00 ? 23 ALA A N    2  
ATOM 1578  C CA   . ALA A 1 23 ? -9.477  -2.374  3.120   1.00 0.00 ? 23 ALA A CA   2  
ATOM 1579  C C    . ALA A 1 23 ? -10.406 -3.277  2.307   1.00 0.00 ? 23 ALA A C    2  
ATOM 1580  O O    . ALA A 1 23 ? -11.603 -3.013  2.207   1.00 0.00 ? 23 ALA A O    2  
ATOM 1581  C CB   . ALA A 1 23 ? -8.904  -1.225  2.287   1.00 0.00 ? 23 ALA A CB   2  
ATOM 1582  H H    . ALA A 1 23 ? -7.499  -3.020  3.228   1.00 0.00 ? 23 ALA A H    2  
ATOM 1583  H HA   . ALA A 1 23 ? -10.033 -1.956  3.960   1.00 0.00 ? 23 ALA A HA   2  
ATOM 1584  H HB1  . ALA A 1 23 ? -7.819  -1.206  2.391   1.00 0.00 ? 23 ALA A HB1  2  
ATOM 1585  H HB2  . ALA A 1 23 ? -9.167  -1.371  1.239   1.00 0.00 ? 23 ALA A HB2  2  
ATOM 1586  H HB3  . ALA A 1 23 ? -9.320  -0.281  2.637   1.00 0.00 ? 23 ALA A HB3  2  
ATOM 1587  N N    . LEU A 1 24 ? -9.819  -4.326  1.748   1.00 0.00 ? 24 LEU A N    2  
ATOM 1588  C CA   . LEU A 1 24 ? -10.580 -5.270  0.948   1.00 0.00 ? 24 LEU A CA   2  
ATOM 1589  C C    . LEU A 1 24 ? -11.422 -6.153  1.871   1.00 0.00 ? 24 LEU A C    2  
ATOM 1590  O O    . LEU A 1 24 ? -12.434 -6.711  1.448   1.00 0.00 ? 24 LEU A O    2  
ATOM 1591  C CB   . LEU A 1 24 ? -9.650  -6.058  0.022   1.00 0.00 ? 24 LEU A CB   2  
ATOM 1592  C CG   . LEU A 1 24 ? -9.735  -5.713  -1.466  1.00 0.00 ? 24 LEU A CG   2  
ATOM 1593  C CD1  . LEU A 1 24 ? -8.647  -6.440  -2.259  1.00 0.00 ? 24 LEU A CD1  2  
ATOM 1594  C CD2  . LEU A 1 24 ? -11.133 -5.997  -2.017  1.00 0.00 ? 24 LEU A CD2  2  
ATOM 1595  H H    . LEU A 1 24 ? -8.845  -4.534  1.836   1.00 0.00 ? 24 LEU A H    2  
ATOM 1596  H HA   . LEU A 1 24 ? -11.252 -4.694  0.313   1.00 0.00 ? 24 LEU A HA   2  
ATOM 1597  H HB3  . LEU A 1 24 ? -9.867  -7.120  0.141   1.00 0.00 ? 24 LEU A HB3  2  
ATOM 1598  H HG   . LEU A 1 24 ? -9.555  -4.643  -1.578  1.00 0.00 ? 24 LEU A HG   2  
ATOM 1599  H HD11 . LEU A 1 24 ? -7.667  -6.154  -1.878  1.00 0.00 ? 24 LEU A HD11 2  
ATOM 1600  H HD12 . LEU A 1 24 ? -8.778  -7.516  -2.154  1.00 0.00 ? 24 LEU A HD12 2  
ATOM 1601  H HD13 . LEU A 1 24 ? -8.721  -6.166  -3.312  1.00 0.00 ? 24 LEU A HD13 2  
ATOM 1602  H HD21 . LEU A 1 24 ? -11.373 -7.051  -1.873  1.00 0.00 ? 24 LEU A HD21 2  
ATOM 1603  H HD22 . LEU A 1 24 ? -11.864 -5.384  -1.488  1.00 0.00 ? 24 LEU A HD22 2  
ATOM 1604  H HD23 . LEU A 1 24 ? -11.160 -5.760  -3.080  1.00 0.00 ? 24 LEU A HD23 2  
ATOM 1605  N N    . GLY A 1 25 ? -10.973 -6.252  3.114   1.00 0.00 ? 25 GLY A N    2  
ATOM 1606  C CA   . GLY A 1 25 ? -11.673 -7.057  4.101   1.00 0.00 ? 25 GLY A CA   2  
ATOM 1607  C C    . GLY A 1 25 ? -11.589 -8.545  3.753   1.00 0.00 ? 25 GLY A C    2  
ATOM 1608  O O    . GLY A 1 25 ? -12.540 -9.292  3.974   1.00 0.00 ? 25 GLY A O    2  
ATOM 1609  H H    . GLY A 1 25 ? -10.150 -5.795  3.449   1.00 0.00 ? 25 GLY A H    2  
ATOM 1610  H HA2  . GLY A 1 25 ? -11.242 -6.886  5.087   1.00 0.00 ? 25 GLY A HA2  2  
ATOM 1611  H HA3  . GLY A 1 25 ? -12.718 -6.750  4.150   1.00 0.00 ? 25 GLY A HA3  2  
ATOM 1612  N N    . ARG A 1 26 ? -10.442 -8.930  3.213   1.00 0.00 ? 26 ARG A N    2  
ATOM 1613  C CA   . ARG A 1 26 ? -10.221 -10.315 2.834   1.00 0.00 ? 26 ARG A CA   2  
ATOM 1614  C C    . ARG A 1 26 ? -9.636  -11.102 4.009   1.00 0.00 ? 26 ARG A C    2  
ATOM 1615  O O    . ARG A 1 26 ? -9.398  -10.542 5.078   1.00 0.00 ? 26 ARG A O    2  
ATOM 1616  C CB   . ARG A 1 26 ? -9.269  -10.413 1.639   1.00 0.00 ? 26 ARG A CB   2  
ATOM 1617  C CG   . ARG A 1 26 ? -9.958  -9.954  0.351   1.00 0.00 ? 26 ARG A CG   2  
ATOM 1618  C CD   . ARG A 1 26 ? -10.285 -11.146 -0.551  1.00 0.00 ? 26 ARG A CD   2  
ATOM 1619  N NE   . ARG A 1 26 ? -11.620 -11.687 -0.210  1.00 0.00 ? 26 ARG A NE   2  
ATOM 1620  C CZ   . ARG A 1 26 ? -12.152 -12.782 -0.770  1.00 0.00 ? 26 ARG A CZ   2  
ATOM 1621  N NH1  . ARG A 1 26 ? -11.467 -13.459 -1.701  1.00 0.00 ? 26 ARG A NH1  2  
ATOM 1622  N NH2  . ARG A 1 26 ? -13.370 -13.200 -0.399  1.00 0.00 ? 26 ARG A NH2  2  
ATOM 1623  H H    . ARG A 1 26 ? -9.673  -8.315  3.037   1.00 0.00 ? 26 ARG A H    2  
ATOM 1624  H HA   . ARG A 1 26 ? -11.207 -10.690 2.563   1.00 0.00 ? 26 ARG A HA   2  
ATOM 1625  H HB3  . ARG A 1 26 ? -8.927  -11.442 1.526   1.00 0.00 ? 26 ARG A HB3  2  
ATOM 1626  H HG3  . ARG A 1 26 ? -9.311  -9.257  -0.181  1.00 0.00 ? 26 ARG A HG3  2  
ATOM 1627  H HD3  . ARG A 1 26 ? -9.528  -11.922 -0.431  1.00 0.00 ? 26 ARG A HD3  2  
ATOM 1628  H HE   . ARG A 1 26 ? -12.158 -11.205 0.482   1.00 0.00 ? 26 ARG A HE   2  
ATOM 1629  H HH11 . ARG A 1 26 ? -10.557 -13.147 -1.977  1.00 0.00 ? 26 ARG A HH11 2  
ATOM 1630  H HH12 . ARG A 1 26 ? -11.864 -14.276 -2.118  1.00 0.00 ? 26 ARG A HH12 2  
ATOM 1631  H HH21 . ARG A 1 26 ? -13.882 -12.693 0.295   1.00 0.00 ? 26 ARG A HH21 2  
ATOM 1632  H HH22 . ARG A 1 26 ? -13.768 -14.016 -0.817  1.00 0.00 ? 26 ARG A HH22 2  
ATOM 1633  N N    . ALA A 1 27 ? -9.421  -12.387 3.770   1.00 0.00 ? 27 ALA A N    2  
ATOM 1634  C CA   . ALA A 1 27 ? -8.868  -13.255 4.795   1.00 0.00 ? 27 ALA A CA   2  
ATOM 1635  C C    . ALA A 1 27 ? -7.353  -13.354 4.611   1.00 0.00 ? 27 ALA A C    2  
ATOM 1636  O O    . ALA A 1 27 ? -6.597  -13.205 5.571   1.00 0.00 ? 27 ALA A O    2  
ATOM 1637  C CB   . ALA A 1 27 ? -9.553  -14.622 4.731   1.00 0.00 ? 27 ALA A CB   2  
ATOM 1638  H H    . ALA A 1 27 ? -9.617  -12.834 2.898   1.00 0.00 ? 27 ALA A H    2  
ATOM 1639  H HA   . ALA A 1 27 ? -9.080  -12.802 5.764   1.00 0.00 ? 27 ALA A HA   2  
ATOM 1640  H HB1  . ALA A 1 27 ? -10.478 -14.538 4.161   1.00 0.00 ? 27 ALA A HB1  2  
ATOM 1641  H HB2  . ALA A 1 27 ? -8.890  -15.338 4.244   1.00 0.00 ? 27 ALA A HB2  2  
ATOM 1642  H HB3  . ALA A 1 27 ? -9.779  -14.963 5.741   1.00 0.00 ? 27 ALA A HB3  2  
ATOM 1643  N N    . SER A 1 28 ? -6.953  -13.604 3.373   1.00 0.00 ? 28 SER A N    2  
ATOM 1644  C CA   . SER A 1 28 ? -5.541  -13.724 3.052   1.00 0.00 ? 28 SER A CA   2  
ATOM 1645  C C    . SER A 1 28 ? -5.010  -12.391 2.521   1.00 0.00 ? 28 SER A C    2  
ATOM 1646  O O    . SER A 1 28 ? -5.787  -11.526 2.116   1.00 0.00 ? 28 SER A O    2  
ATOM 1647  C CB   . SER A 1 28 ? -5.303  -14.836 2.028   1.00 0.00 ? 28 SER A CB   2  
ATOM 1648  O OG   . SER A 1 28 ? -6.017  -16.024 2.354   1.00 0.00 ? 28 SER A OG   2  
ATOM 1649  H H    . SER A 1 28 ? -7.575  -13.723 2.599   1.00 0.00 ? 28 SER A H    2  
ATOM 1650  H HA   . SER A 1 28 ? -5.053  -13.983 3.990   1.00 0.00 ? 28 SER A HA   2  
ATOM 1651  H HB3  . SER A 1 28 ? -4.237  -15.055 1.974   1.00 0.00 ? 28 SER A HB3  2  
ATOM 1652  H HG   . SER A 1 28 ? -6.798  -15.805 2.938   1.00 0.00 ? 28 SER A HG   2  
ATOM 1653  N N    . VAL A 1 29 ? -3.692  -12.265 2.541   1.00 0.00 ? 29 VAL A N    2  
ATOM 1654  C CA   . VAL A 1 29 ? -3.048  -11.052 2.066   1.00 0.00 ? 29 VAL A CA   2  
ATOM 1655  C C    . VAL A 1 29 ? -2.869  -11.134 0.549   1.00 0.00 ? 29 VAL A C    2  
ATOM 1656  O O    . VAL A 1 29 ? -2.128  -11.982 0.052   1.00 0.00 ? 29 VAL A O    2  
ATOM 1657  C CB   . VAL A 1 29 ? -1.730  -10.833 2.812   1.00 0.00 ? 29 VAL A CB   2  
ATOM 1658  C CG1  . VAL A 1 29 ? -0.951  -9.659  2.216   1.00 0.00 ? 29 VAL A CG1  2  
ATOM 1659  C CG2  . VAL A 1 29 ? -1.975  -10.626 4.308   1.00 0.00 ? 29 VAL A CG2  2  
ATOM 1660  H H    . VAL A 1 29 ? -3.068  -12.974 2.871   1.00 0.00 ? 29 VAL A H    2  
ATOM 1661  H HA   . VAL A 1 29 ? -3.710  -10.217 2.297   1.00 0.00 ? 29 VAL A HA   2  
ATOM 1662  H HB   . VAL A 1 29 ? -1.125  -11.731 2.694   1.00 0.00 ? 29 VAL A HB   2  
ATOM 1663  H HG11 . VAL A 1 29 ? -0.464  -9.977  1.295   1.00 0.00 ? 29 VAL A HG11 2  
ATOM 1664  H HG12 . VAL A 1 29 ? -1.638  -8.840  2.000   1.00 0.00 ? 29 VAL A HG12 2  
ATOM 1665  H HG13 . VAL A 1 29 ? -0.198  -9.323  2.928   1.00 0.00 ? 29 VAL A HG13 2  
ATOM 1666  H HG21 . VAL A 1 29 ? -1.721  -9.601  4.580   1.00 0.00 ? 29 VAL A HG21 2  
ATOM 1667  H HG22 . VAL A 1 29 ? -3.025  -10.811 4.533   1.00 0.00 ? 29 VAL A HG22 2  
ATOM 1668  H HG23 . VAL A 1 29 ? -1.355  -11.317 4.878   1.00 0.00 ? 29 VAL A HG23 2  
ATOM 1669  N N    . VAL A 1 30 ? -3.561  -10.242 -0.146  1.00 0.00 ? 30 VAL A N    2  
ATOM 1670  C CA   . VAL A 1 30 ? -3.487  -10.203 -1.596  1.00 0.00 ? 30 VAL A CA   2  
ATOM 1671  C C    . VAL A 1 30 ? -2.522  -9.097  -2.024  1.00 0.00 ? 30 VAL A C    2  
ATOM 1672  O O    . VAL A 1 30 ? -2.295  -8.143  -1.281  1.00 0.00 ? 30 VAL A O    2  
ATOM 1673  C CB   . VAL A 1 30 ? -4.889  -10.035 -2.187  1.00 0.00 ? 30 VAL A CB   2  
ATOM 1674  C CG1  . VAL A 1 30 ? -5.629  -11.374 -2.230  1.00 0.00 ? 30 VAL A CG1  2  
ATOM 1675  C CG2  . VAL A 1 30 ? -5.690  -8.990  -1.407  1.00 0.00 ? 30 VAL A CG2  2  
ATOM 1676  H H    . VAL A 1 30 ? -4.161  -9.556  0.266   1.00 0.00 ? 30 VAL A H    2  
ATOM 1677  H HA   . VAL A 1 30 ? -3.092  -11.162 -1.932  1.00 0.00 ? 30 VAL A HA   2  
ATOM 1678  H HB   . VAL A 1 30 ? -4.780  -9.679  -3.211  1.00 0.00 ? 30 VAL A HB   2  
ATOM 1679  H HG11 . VAL A 1 30 ? -6.602  -11.235 -2.702  1.00 0.00 ? 30 VAL A HG11 2  
ATOM 1680  H HG12 . VAL A 1 30 ? -5.046  -12.092 -2.806  1.00 0.00 ? 30 VAL A HG12 2  
ATOM 1681  H HG13 . VAL A 1 30 ? -5.767  -11.746 -1.216  1.00 0.00 ? 30 VAL A HG13 2  
ATOM 1682  H HG21 . VAL A 1 30 ? -5.008  -8.261  -0.972  1.00 0.00 ? 30 VAL A HG21 2  
ATOM 1683  H HG22 . VAL A 1 30 ? -6.381  -8.484  -2.082  1.00 0.00 ? 30 VAL A HG22 2  
ATOM 1684  H HG23 . VAL A 1 30 ? -6.252  -9.481  -0.613  1.00 0.00 ? 30 VAL A HG23 2  
ATOM 1685  N N    . PRO A 1 31 ? -1.963  -9.264  -3.252  1.00 0.00 ? 31 PRO A N    2  
ATOM 1686  C CA   . PRO A 1 31 ? -1.027  -8.290  -3.789  1.00 0.00 ? 31 PRO A CA   2  
ATOM 1687  C C    . PRO A 1 31 ? -1.755  -7.027  -4.253  1.00 0.00 ? 31 PRO A C    2  
ATOM 1688  O O    . PRO A 1 31 ? -2.984  -6.988  -4.277  1.00 0.00 ? 31 PRO A O    2  
ATOM 1689  C CB   . PRO A 1 31 ? -0.312  -9.012  -4.918  1.00 0.00 ? 31 PRO A CB   2  
ATOM 1690  C CG   . PRO A 1 31 ? -1.190  -10.200 -5.277  1.00 0.00 ? 31 PRO A CG   2  
ATOM 1691  C CD   . PRO A 1 31 ? -2.208  -10.381 -4.161  1.00 0.00 ? 31 PRO A CD   2  
ATOM 1692  H HA   . PRO A 1 31 ? -0.391  -7.992  -3.077  1.00 0.00 ? 31 PRO A HA   2  
ATOM 1693  H HB3  . PRO A 1 31 ? 0.680   -9.341  -4.606  1.00 0.00 ? 31 PRO A HB3  2  
ATOM 1694  H HG3  . PRO A 1 31 ? -0.587  -11.101 -5.391  1.00 0.00 ? 31 PRO A HG3  2  
ATOM 1695  H HD3  . PRO A 1 31 ? -2.078  -11.337 -3.657  1.00 0.00 ? 31 PRO A HD3  2  
ATOM 1696  N N    . LEU A 1 32 ? -0.966  -6.025  -4.612  1.00 0.00 ? 32 LEU A N    2  
ATOM 1697  C CA   . LEU A 1 32 ? -1.520  -4.765  -5.074  1.00 0.00 ? 32 LEU A CA   2  
ATOM 1698  C C    . LEU A 1 32 ? -1.133  -4.549  -6.539  1.00 0.00 ? 32 LEU A C    2  
ATOM 1699  O O    . LEU A 1 32 ? -0.013  -4.133  -6.834  1.00 0.00 ? 32 LEU A O    2  
ATOM 1700  C CB   . LEU A 1 32 ? -1.094  -3.621  -4.151  1.00 0.00 ? 32 LEU A CB   2  
ATOM 1701  C CG   . LEU A 1 32 ? -1.349  -2.206  -4.674  1.00 0.00 ? 32 LEU A CG   2  
ATOM 1702  C CD1  . LEU A 1 32 ? -2.705  -2.118  -5.377  1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1703  C CD2  . LEU A 1 32 ? -1.217  -1.175  -3.552  1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1704  H H    . LEU A 1 32 ? 0.033   -6.065  -4.590  1.00 0.00 ? 32 LEU A H    2  
ATOM 1705  H HA   . LEU A 1 32 ? -2.605  -4.842  -5.012  1.00 0.00 ? 32 LEU A HA   2  
ATOM 1706  H HB3  . LEU A 1 32 ? -0.029  -3.724  -3.945  1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1707  H HG   . LEU A 1 32 ? -0.585  -1.974  -5.416  1.00 0.00 ? 32 LEU A HG   2  
ATOM 1708  H HD11 . LEU A 1 32 ? -3.495  -2.023  -4.633  1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1709  H HD12 . LEU A 1 32 ? -2.718  -1.246  -6.033  1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1710  H HD13 . LEU A 1 32 ? -2.868  -3.019  -5.968  1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1711  H HD21 . LEU A 1 32 ? -1.186  -1.686  -2.590  1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1712  H HD22 . LEU A 1 32 ? -0.300  -0.603  -3.690  1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1713  H HD23 . LEU A 1 32 ? -2.073  -0.500  -3.576  1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1714  N N    . PRO A 1 33 ? -2.105  -4.849  -7.441  1.00 0.00 ? 33 PRO A N    2  
ATOM 1715  C CA   . PRO A 1 33 ? -1.877  -4.692  -8.867  1.00 0.00 ? 33 PRO A CA   2  
ATOM 1716  C C    . PRO A 1 33 ? -1.911  -3.217  -9.269  1.00 0.00 ? 33 PRO A C    2  
ATOM 1717  O O    . PRO A 1 33 ? -2.867  -2.762  -9.898  1.00 0.00 ? 33 PRO A O    2  
ATOM 1718  C CB   . PRO A 1 33 ? -2.969  -5.514  -9.533  1.00 0.00 ? 33 PRO A CB   2  
ATOM 1719  C CG   . PRO A 1 33 ? -4.040  -5.721  -8.474  1.00 0.00 ? 33 PRO A CG   2  
ATOM 1720  C CD   . PRO A 1 33 ? -3.443  -5.343  -7.128  1.00 0.00 ? 33 PRO A CD   2  
ATOM 1721  H HA   . PRO A 1 33 ? -0.965  -5.020  -9.111  1.00 0.00 ? 33 PRO A HA   2  
ATOM 1722  H HB3  . PRO A 1 33 ? -2.578  -6.470  -9.884  1.00 0.00 ? 33 PRO A HB3  2  
ATOM 1723  H HG3  . PRO A 1 33 ? -4.374  -6.758  -8.466  1.00 0.00 ? 33 PRO A HG3  2  
ATOM 1724  H HD3  . PRO A 1 33 ? -3.401  -6.203  -6.458  1.00 0.00 ? 33 PRO A HD3  2  
ATOM 1725  N N    . TYR A 1 34 ? -0.858  -2.508  -8.890  1.00 0.00 ? 34 TYR A N    2  
ATOM 1726  C CA   . TYR A 1 34 ? -0.756  -1.092  -9.203  1.00 0.00 ? 34 TYR A CA   2  
ATOM 1727  C C    . TYR A 1 34 ? -1.090  -0.831  -10.673 1.00 0.00 ? 34 TYR A C    2  
ATOM 1728  O O    . TYR A 1 34 ? -1.975  -0.033  -10.979 1.00 0.00 ? 34 TYR A O    2  
ATOM 1729  C CB   . TYR A 1 34 ? 0.703   -0.710  -8.949  1.00 0.00 ? 34 TYR A CB   2  
ATOM 1730  C CG   . TYR A 1 34 ? 1.163   -0.933  -7.506  1.00 0.00 ? 34 TYR A CG   2  
ATOM 1731  C CD1  . TYR A 1 34 ? 0.995   0.062   -6.565  1.00 0.00 ? 34 TYR A CD1  2  
ATOM 1732  C CD2  . TYR A 1 34 ? 1.747   -2.132  -7.147  1.00 0.00 ? 34 TYR A CD2  2  
ATOM 1733  C CE1  . TYR A 1 34 ? 1.428   -0.149  -5.208  1.00 0.00 ? 34 TYR A CE1  2  
ATOM 1734  C CE2  . TYR A 1 34 ? 2.180   -2.343  -5.790  1.00 0.00 ? 34 TYR A CE2  2  
ATOM 1735  C CZ   . TYR A 1 34 ? 1.998   -1.341  -4.887  1.00 0.00 ? 34 TYR A CZ   2  
ATOM 1736  O OH   . TYR A 1 34 ? 2.408   -1.540  -3.606  1.00 0.00 ? 34 TYR A OH   2  
ATOM 1737  H H    . TYR A 1 34 ? -0.086  -2.885  -8.379  1.00 0.00 ? 34 TYR A H    2  
ATOM 1738  H HA   . TYR A 1 34 ? -1.467  -0.557  -8.575  1.00 0.00 ? 34 TYR A HA   2  
ATOM 1739  H HB3  . TYR A 1 34 ? 0.842   0.342   -9.204  1.00 0.00 ? 34 TYR A HB3  2  
ATOM 1740  H HD1  . TYR A 1 34 ? 0.535   1.008   -6.850  1.00 0.00 ? 34 TYR A HD1  2  
ATOM 1741  H HD2  . TYR A 1 34 ? 1.879   -2.918  -7.890  1.00 0.00 ? 34 TYR A HD2  2  
ATOM 1742  H HE1  . TYR A 1 34 ? 1.301   0.628   -4.456  1.00 0.00 ? 34 TYR A HE1  2  
ATOM 1743  H HE2  . TYR A 1 34 ? 2.641   -3.284  -5.492  1.00 0.00 ? 34 TYR A HE2  2  
ATOM 1744  H HH   . TYR A 1 34 ? 2.388   -2.517  -3.389  1.00 0.00 ? 34 TYR A HH   2  
ATOM 1745  N N    . GLU A 1 35 ? -0.365  -1.518  -11.544 1.00 0.00 ? 35 GLU A N    2  
ATOM 1746  C CA   . GLU A 1 35 ? -0.574  -1.369  -12.974 1.00 0.00 ? 35 GLU A CA   2  
ATOM 1747  C C    . GLU A 1 35 ? -2.065  -1.207  -13.278 1.00 0.00 ? 35 GLU A C    2  
ATOM 1748  O O    . GLU A 1 35 ? -2.436  -0.528  -14.235 1.00 0.00 ? 35 GLU A O    2  
ATOM 1749  C CB   . GLU A 1 35 ? 0.017   -2.555  -13.740 1.00 0.00 ? 35 GLU A CB   2  
ATOM 1750  C CG   . GLU A 1 35 ? -0.964  -3.729  -13.773 1.00 0.00 ? 35 GLU A CG   2  
ATOM 1751  C CD   . GLU A 1 35 ? -0.378  -4.910  -14.550 1.00 0.00 ? 35 GLU A CD   2  
ATOM 1752  O OE1  . GLU A 1 35 ? 0.373   -5.686  -13.922 1.00 0.00 ? 35 GLU A OE1  2  
ATOM 1753  O OE2  . GLU A 1 35 ? -0.695  -5.009  -15.755 1.00 0.00 ? 35 GLU A OE2  2  
ATOM 1754  H H    . GLU A 1 35 ? 0.353   -2.165  -11.286 1.00 0.00 ? 35 GLU A H    2  
ATOM 1755  H HA   . GLU A 1 35 ? -0.038  -0.461  -13.252 1.00 0.00 ? 35 GLU A HA   2  
ATOM 1756  H HB3  . GLU A 1 35 ? 0.948   -2.868  -13.270 1.00 0.00 ? 35 GLU A HB3  2  
ATOM 1757  H HG3  . GLU A 1 35 ? -1.899  -3.413  -14.235 1.00 0.00 ? 35 GLU A HG3  2  
ATOM 1758  N N    . ARG A 1 36 ? -2.878  -1.842  -12.447 1.00 0.00 ? 36 ARG A N    2  
ATOM 1759  C CA   . ARG A 1 36 ? -4.320  -1.777  -12.616 1.00 0.00 ? 36 ARG A CA   2  
ATOM 1760  C C    . ARG A 1 36 ? -4.899  -0.624  -11.792 1.00 0.00 ? 36 ARG A C    2  
ATOM 1761  O O    . ARG A 1 36 ? -5.391  0.356   -12.349 1.00 0.00 ? 36 ARG A O    2  
ATOM 1762  C CB   . ARG A 1 36 ? -4.985  -3.085  -12.187 1.00 0.00 ? 36 ARG A CB   2  
ATOM 1763  C CG   . ARG A 1 36 ? -5.367  -3.930  -13.404 1.00 0.00 ? 36 ARG A CG   2  
ATOM 1764  C CD   . ARG A 1 36 ? -6.779  -3.590  -13.886 1.00 0.00 ? 36 ARG A CD   2  
ATOM 1765  N NE   . ARG A 1 36 ? -7.351  -4.736  -14.628 1.00 0.00 ? 36 ARG A NE   2  
ATOM 1766  C CZ   . ARG A 1 36 ? -6.920  -5.143  -15.830 1.00 0.00 ? 36 ARG A CZ   2  
ATOM 1767  N NH1  . ARG A 1 36 ? -5.911  -4.499  -16.433 1.00 0.00 ? 36 ARG A NH1  2  
ATOM 1768  N NH2  . ARG A 1 36 ? -7.498  -6.192  -16.429 1.00 0.00 ? 36 ARG A NH2  2  
ATOM 1769  H H    . ARG A 1 36 ? -2.568  -2.393  -11.672 1.00 0.00 ? 36 ARG A H    2  
ATOM 1770  H HA   . ARG A 1 36 ? -4.468  -1.608  -13.683 1.00 0.00 ? 36 ARG A HA   2  
ATOM 1771  H HB3  . ARG A 1 36 ? -5.874  -2.870  -11.596 1.00 0.00 ? 36 ARG A HB3  2  
ATOM 1772  H HG3  . ARG A 1 36 ? -5.311  -4.989  -13.150 1.00 0.00 ? 36 ARG A HG3  2  
ATOM 1773  H HD3  . ARG A 1 36 ? -6.752  -2.709  -14.526 1.00 0.00 ? 36 ARG A HD3  2  
ATOM 1774  H HE   . ARG A 1 36 ? -8.106  -5.237  -14.207 1.00 0.00 ? 36 ARG A HE   2  
ATOM 1775  H HH11 . ARG A 1 36 ? -5.479  -3.716  -15.986 1.00 0.00 ? 36 ARG A HH11 2  
ATOM 1776  H HH12 . ARG A 1 36 ? -5.589  -4.802  -17.330 1.00 0.00 ? 36 ARG A HH12 2  
ATOM 1777  H HH21 . ARG A 1 36 ? -8.252  -6.672  -15.980 1.00 0.00 ? 36 ARG A HH21 2  
ATOM 1778  H HH22 . ARG A 1 36 ? -7.177  -6.496  -17.326 1.00 0.00 ? 36 ARG A HH22 2  
ATOM 1779  N N    . LEU A 1 37 ? -4.821  -0.782  -10.479 1.00 0.00 ? 37 LEU A N    2  
ATOM 1780  C CA   . LEU A 1 37 ? -5.330  0.233   -9.572  1.00 0.00 ? 37 LEU A CA   2  
ATOM 1781  C C    . LEU A 1 37 ? -4.941  1.618   -10.091 1.00 0.00 ? 37 LEU A C    2  
ATOM 1782  O O    . LEU A 1 37 ? -5.705  2.573   -9.960  1.00 0.00 ? 37 LEU A O    2  
ATOM 1783  C CB   . LEU A 1 37 ? -4.862  -0.042  -8.142  1.00 0.00 ? 37 LEU A CB   2  
ATOM 1784  C CG   . LEU A 1 37 ? -5.139  -1.448  -7.604  1.00 0.00 ? 37 LEU A CG   2  
ATOM 1785  C CD1  . LEU A 1 37 ? -5.329  -1.425  -6.086  1.00 0.00 ? 37 LEU A CD1  2  
ATOM 1786  C CD2  . LEU A 1 37 ? -6.329  -2.086  -8.322  1.00 0.00 ? 37 LEU A CD2  2  
ATOM 1787  H H    . LEU A 1 37 ? -4.419  -1.582  -10.034 1.00 0.00 ? 37 LEU A H    2  
ATOM 1788  H HA   . LEU A 1 37 ? -6.418  0.157   -9.575  1.00 0.00 ? 37 LEU A HA   2  
ATOM 1789  H HB3  . LEU A 1 37 ? -5.339  0.680   -7.479  1.00 0.00 ? 37 LEU A HB3  2  
ATOM 1790  H HG   . LEU A 1 37 ? -4.267  -2.070  -7.810  1.00 0.00 ? 37 LEU A HG   2  
ATOM 1791  H HD11 . LEU A 1 37 ? -4.631  -0.717  -5.642  1.00 0.00 ? 37 LEU A HD11 2  
ATOM 1792  H HD12 . LEU A 1 37 ? -6.351  -1.125  -5.853  1.00 0.00 ? 37 LEU A HD12 2  
ATOM 1793  H HD13 . LEU A 1 37 ? -5.143  -2.420  -5.682  1.00 0.00 ? 37 LEU A HD13 2  
ATOM 1794  H HD21 . LEU A 1 37 ? -7.126  -1.350  -8.429  1.00 0.00 ? 37 LEU A HD21 2  
ATOM 1795  H HD22 . LEU A 1 37 ? -6.017  -2.429  -9.309  1.00 0.00 ? 37 LEU A HD22 2  
ATOM 1796  H HD23 . LEU A 1 37 ? -6.692  -2.934  -7.741  1.00 0.00 ? 37 LEU A HD23 2  
ATOM 1797  N N    . LEU A 1 38 ? -3.751  1.684   -10.671 1.00 0.00 ? 38 LEU A N    2  
ATOM 1798  C CA   . LEU A 1 38 ? -3.249  2.936   -11.211 1.00 0.00 ? 38 LEU A CA   2  
ATOM 1799  C C    . LEU A 1 38 ? -4.188  3.421   -12.319 1.00 0.00 ? 38 LEU A C    2  
ATOM 1800  O O    . LEU A 1 38 ? -4.626  4.570   -12.307 1.00 0.00 ? 38 LEU A O    2  
ATOM 1801  C CB   . LEU A 1 38 ? -1.795  2.782   -11.661 1.00 0.00 ? 38 LEU A CB   2  
ATOM 1802  C CG   . LEU A 1 38 ? -0.777  2.504   -10.553 1.00 0.00 ? 38 LEU A CG   2  
ATOM 1803  C CD1  . LEU A 1 38 ? 0.545   2.003   -11.137 1.00 0.00 ? 38 LEU A CD1  2  
ATOM 1804  C CD2  . LEU A 1 38 ? -0.581  3.737   -9.668  1.00 0.00 ? 38 LEU A CD2  2  
ATOM 1805  H H    . LEU A 1 38 ? -3.135  0.903   -10.774 1.00 0.00 ? 38 LEU A H    2  
ATOM 1806  H HA   . LEU A 1 38 ? -3.262  3.668   -10.404 1.00 0.00 ? 38 LEU A HA   2  
ATOM 1807  H HB3  . LEU A 1 38 ? -1.498  3.692   -12.181 1.00 0.00 ? 38 LEU A HB3  2  
ATOM 1808  H HG   . LEU A 1 38 ? -1.170  1.711   -9.918  1.00 0.00 ? 38 LEU A HG   2  
ATOM 1809  H HD11 . LEU A 1 38 ? 0.412   0.990   -11.520 1.00 0.00 ? 38 LEU A HD11 2  
ATOM 1810  H HD12 . LEU A 1 38 ? 0.857   2.660   -11.948 1.00 0.00 ? 38 LEU A HD12 2  
ATOM 1811  H HD13 . LEU A 1 38 ? 1.308   1.999   -10.359 1.00 0.00 ? 38 LEU A HD13 2  
ATOM 1812  H HD21 . LEU A 1 38 ? -1.427  3.833   -8.987  1.00 0.00 ? 38 LEU A HD21 2  
ATOM 1813  H HD22 . LEU A 1 38 ? 0.338   3.628   -9.092  1.00 0.00 ? 38 LEU A HD22 2  
ATOM 1814  H HD23 . LEU A 1 38 ? -0.515  4.627   -10.293 1.00 0.00 ? 38 LEU A HD23 2  
ATOM 1815  N N    . ARG A 1 39 ? -4.468  2.519   -13.249 1.00 0.00 ? 39 ARG A N    2  
ATOM 1816  C CA   . ARG A 1 39 ? -5.347  2.840   -14.361 1.00 0.00 ? 39 ARG A CA   2  
ATOM 1817  C C    . ARG A 1 39 ? -6.554  3.643   -13.870 1.00 0.00 ? 39 ARG A C    2  
ATOM 1818  O O    . ARG A 1 39 ? -6.880  4.686   -14.434 1.00 0.00 ? 39 ARG A O    2  
ATOM 1819  C CB   . ARG A 1 39 ? -5.837  1.571   -15.060 1.00 0.00 ? 39 ARG A CB   2  
ATOM 1820  C CG   . ARG A 1 39 ? -6.934  1.894   -16.077 1.00 0.00 ? 39 ARG A CG   2  
ATOM 1821  C CD   . ARG A 1 39 ? -6.413  2.836   -17.163 1.00 0.00 ? 39 ARG A CD   2  
ATOM 1822  N NE   . ARG A 1 39 ? -5.514  2.102   -18.082 1.00 0.00 ? 39 ARG A NE   2  
ATOM 1823  C CZ   . ARG A 1 39 ? -5.123  2.564   -19.278 1.00 0.00 ? 39 ARG A CZ   2  
ATOM 1824  N NH1  . ARG A 1 39 ? -5.550  3.759   -19.708 1.00 0.00 ? 39 ARG A NH1  2  
ATOM 1825  N NH2  . ARG A 1 39 ? -4.306  1.829   -20.044 1.00 0.00 ? 39 ARG A NH2  2  
ATOM 1826  H H    . ARG A 1 39 ? -4.109  1.586   -13.250 1.00 0.00 ? 39 ARG A H    2  
ATOM 1827  H HA   . ARG A 1 39 ? -4.731  3.432   -15.040 1.00 0.00 ? 39 ARG A HA   2  
ATOM 1828  H HB3  . ARG A 1 39 ? -6.219  0.867   -14.319 1.00 0.00 ? 39 ARG A HB3  2  
ATOM 1829  H HG3  . ARG A 1 39 ? -7.783  2.351   -15.569 1.00 0.00 ? 39 ARG A HG3  2  
ATOM 1830  H HD3  . ARG A 1 39 ? -5.879  3.671   -16.708 1.00 0.00 ? 39 ARG A HD3  2  
ATOM 1831  H HE   . ARG A 1 39 ? -5.177  1.207   -17.792 1.00 0.00 ? 39 ARG A HE   2  
ATOM 1832  H HH11 . ARG A 1 39 ? -6.160  4.307   -19.135 1.00 0.00 ? 39 ARG A HH11 2  
ATOM 1833  H HH12 . ARG A 1 39 ? -5.259  4.103   -20.600 1.00 0.00 ? 39 ARG A HH12 2  
ATOM 1834  H HH21 . ARG A 1 39 ? -3.987  0.937   -19.723 1.00 0.00 ? 39 ARG A HH21 2  
ATOM 1835  H HH22 . ARG A 1 39 ? -4.014  2.173   -20.938 1.00 0.00 ? 39 ARG A HH22 2  
ATOM 1836  N N    . GLU A 1 40 ? -7.181  3.127   -12.824 1.00 0.00 ? 40 GLU A N    2  
ATOM 1837  C CA   . GLU A 1 40 ? -8.345  3.782   -12.252 1.00 0.00 ? 40 GLU A CA   2  
ATOM 1838  C C    . GLU A 1 40 ? -8.073  4.171   -10.798 1.00 0.00 ? 40 GLU A C    2  
ATOM 1839  O O    . GLU A 1 40 ? -8.078  3.319   -9.911  1.00 0.00 ? 40 GLU A O    2  
ATOM 1840  C CB   . GLU A 1 40 ? -9.585  2.890   -12.357 1.00 0.00 ? 40 GLU A CB   2  
ATOM 1841  C CG   . GLU A 1 40 ? -9.194  1.443   -12.666 1.00 0.00 ? 40 GLU A CG   2  
ATOM 1842  C CD   . GLU A 1 40 ? -10.436 0.567   -12.842 1.00 0.00 ? 40 GLU A CD   2  
ATOM 1843  O OE1  . GLU A 1 40 ? -11.423 1.086   -13.406 1.00 0.00 ? 40 GLU A OE1  2  
ATOM 1844  O OE2  . GLU A 1 40 ? -10.370 -0.603  -12.405 1.00 0.00 ? 40 GLU A OE2  2  
ATOM 1845  H H    . GLU A 1 40 ? -6.910  2.278   -12.372 1.00 0.00 ? 40 GLU A H    2  
ATOM 1846  H HA   . GLU A 1 40 ? -8.498  4.678   -12.852 1.00 0.00 ? 40 GLU A HA   2  
ATOM 1847  H HB3  . GLU A 1 40 ? -10.243 3.268   -13.140 1.00 0.00 ? 40 GLU A HB3  2  
ATOM 1848  H HG3  . GLU A 1 40 ? -8.578  1.049   -11.858 1.00 0.00 ? 40 GLU A HG3  2  
ATOM 1849  N N    . PRO A 1 41 ? -7.834  5.494   -10.592 1.00 0.00 ? 41 PRO A N    2  
ATOM 1850  C CA   . PRO A 1 41 ? -7.560  6.007   -9.260  1.00 0.00 ? 41 PRO A CA   2  
ATOM 1851  C C    . PRO A 1 41 ? -8.839  6.073   -8.423  1.00 0.00 ? 41 PRO A C    2  
ATOM 1852  O O    . PRO A 1 41 ? -8.779  6.127   -7.196  1.00 0.00 ? 41 PRO A O    2  
ATOM 1853  C CB   . PRO A 1 41 ? -6.929  7.371   -9.487  1.00 0.00 ? 41 PRO A CB   2  
ATOM 1854  C CG   . PRO A 1 41 ? -7.295  7.771   -10.907 1.00 0.00 ? 41 PRO A CG   2  
ATOM 1855  C CD   . PRO A 1 41 ? -7.820  6.533   -11.617 1.00 0.00 ? 41 PRO A CD   2  
ATOM 1856  H HA   . PRO A 1 41 ? -6.944  5.391   -8.771  1.00 0.00 ? 41 PRO A HA   2  
ATOM 1857  H HB3  . PRO A 1 41 ? -5.847  7.328   -9.361  1.00 0.00 ? 41 PRO A HB3  2  
ATOM 1858  H HG3  . PRO A 1 41 ? -6.426  8.171   -11.428 1.00 0.00 ? 41 PRO A HG3  2  
ATOM 1859  H HD3  . PRO A 1 41 ? -7.179  6.256   -12.454 1.00 0.00 ? 41 PRO A HD3  2  
ATOM 1860  N N    . GLY A 1 42 ? -9.965  6.063   -9.121  1.00 0.00 ? 42 GLY A N    2  
ATOM 1861  C CA   . GLY A 1 42 ? -11.257 6.120   -8.457  1.00 0.00 ? 42 GLY A CA   2  
ATOM 1862  C C    . GLY A 1 42 ? -11.628 4.761   -7.862  1.00 0.00 ? 42 GLY A C    2  
ATOM 1863  O O    . GLY A 1 42 ? -12.402 4.687   -6.909  1.00 0.00 ? 42 GLY A O    2  
ATOM 1864  H H    . GLY A 1 42 ? -10.005 6.019   -10.119 1.00 0.00 ? 42 GLY A H    2  
ATOM 1865  H HA2  . GLY A 1 42 ? -11.232 6.872   -7.668  1.00 0.00 ? 42 GLY A HA2  2  
ATOM 1866  H HA3  . GLY A 1 42 ? -12.023 6.431   -9.169  1.00 0.00 ? 42 GLY A HA3  2  
ATOM 1867  N N    . LEU A 1 43 ? -11.058 3.718   -8.448  1.00 0.00 ? 43 LEU A N    2  
ATOM 1868  C CA   . LEU A 1 43 ? -11.319 2.364   -7.988  1.00 0.00 ? 43 LEU A CA   2  
ATOM 1869  C C    . LEU A 1 43 ? -10.731 2.185   -6.586  1.00 0.00 ? 43 LEU A C    2  
ATOM 1870  O O    . LEU A 1 43 ? -11.361 1.584   -5.718  1.00 0.00 ? 43 LEU A O    2  
ATOM 1871  C CB   . LEU A 1 43 ? -10.806 1.344   -9.006  1.00 0.00 ? 43 LEU A CB   2  
ATOM 1872  C CG   . LEU A 1 43 ? -11.374 -0.071  -8.882  1.00 0.00 ? 43 LEU A CG   2  
ATOM 1873  C CD1  . LEU A 1 43 ? -12.771 -0.157  -9.500  1.00 0.00 ? 43 LEU A CD1  2  
ATOM 1874  C CD2  . LEU A 1 43 ? -10.416 -1.102  -9.483  1.00 0.00 ? 43 LEU A CD2  2  
ATOM 1875  H H    . LEU A 1 43 ? -10.430 3.787   -9.223  1.00 0.00 ? 43 LEU A H    2  
ATOM 1876  H HA   . LEU A 1 43 ? -12.400 2.243   -7.928  1.00 0.00 ? 43 LEU A HA   2  
ATOM 1877  H HB3  . LEU A 1 43 ? -9.721  1.288   -8.918  1.00 0.00 ? 43 LEU A HB3  2  
ATOM 1878  H HG   . LEU A 1 43 ? -11.476 -0.306  -7.822  1.00 0.00 ? 43 LEU A HG   2  
ATOM 1879  H HD11 . LEU A 1 43 ? -13.221 -1.117  -9.247  1.00 0.00 ? 43 LEU A HD11 2  
ATOM 1880  H HD12 . LEU A 1 43 ? -13.391 0.650   -9.111  1.00 0.00 ? 43 LEU A HD12 2  
ATOM 1881  H HD13 . LEU A 1 43 ? -12.694 -0.066  -10.584 1.00 0.00 ? 43 LEU A HD13 2  
ATOM 1882  H HD21 . LEU A 1 43 ? -9.881  -1.611  -8.681  1.00 0.00 ? 43 LEU A HD21 2  
ATOM 1883  H HD22 . LEU A 1 43 ? -10.983 -1.829  -10.063 1.00 0.00 ? 43 LEU A HD22 2  
ATOM 1884  H HD23 . LEU A 1 43 ? -9.701  -0.597  -10.133 1.00 0.00 ? 43 LEU A HD23 2  
ATOM 1885  N N    . LEU A 1 44 ? -9.532  2.718   -6.411  1.00 0.00 ? 44 LEU A N    2  
ATOM 1886  C CA   . LEU A 1 44 ? -8.852  2.625   -5.130  1.00 0.00 ? 44 LEU A CA   2  
ATOM 1887  C C    . LEU A 1 44 ? -7.855  3.778   -5.000  1.00 0.00 ? 44 LEU A C    2  
ATOM 1888  O O    . LEU A 1 44 ? -6.843  3.810   -5.699  1.00 0.00 ? 44 LEU A O    2  
ATOM 1889  C CB   . LEU A 1 44 ? -8.219  1.243   -4.959  1.00 0.00 ? 44 LEU A CB   2  
ATOM 1890  C CG   . LEU A 1 44 ? -7.218  1.100   -3.810  1.00 0.00 ? 44 LEU A CG   2  
ATOM 1891  C CD1  . LEU A 1 44 ? -7.748  1.760   -2.536  1.00 0.00 ? 44 LEU A CD1  2  
ATOM 1892  C CD2  . LEU A 1 44 ? -6.847  -0.367  -3.585  1.00 0.00 ? 44 LEU A CD2  2  
ATOM 1893  H H    . LEU A 1 44 ? -9.026  3.207   -7.122  1.00 0.00 ? 44 LEU A H    2  
ATOM 1894  H HA   . LEU A 1 44 ? -9.607  2.732   -4.351  1.00 0.00 ? 44 LEU A HA   2  
ATOM 1895  H HB3  . LEU A 1 44 ? -7.715  0.978   -5.888  1.00 0.00 ? 44 LEU A HB3  2  
ATOM 1896  H HG   . LEU A 1 44 ? -6.303  1.624   -4.088  1.00 0.00 ? 44 LEU A HG   2  
ATOM 1897  H HD11 . LEU A 1 44 ? -8.792  1.483   -2.391  1.00 0.00 ? 44 LEU A HD11 2  
ATOM 1898  H HD12 . LEU A 1 44 ? -7.162  1.423   -1.682  1.00 0.00 ? 44 LEU A HD12 2  
ATOM 1899  H HD13 . LEU A 1 44 ? -7.668  2.843   -2.627  1.00 0.00 ? 44 LEU A HD13 2  
ATOM 1900  H HD21 . LEU A 1 44 ? -5.803  -0.525  -3.858  1.00 0.00 ? 44 LEU A HD21 2  
ATOM 1901  H HD22 . LEU A 1 44 ? -6.990  -0.620  -2.534  1.00 0.00 ? 44 LEU A HD22 2  
ATOM 1902  H HD23 . LEU A 1 44 ? -7.483  -1.001  -4.202  1.00 0.00 ? 44 LEU A HD23 2  
ATOM 1903  N N    . ALA A 1 45 ? -8.175  4.697   -4.101  1.00 0.00 ? 45 ALA A N    2  
ATOM 1904  C CA   . ALA A 1 45 ? -7.319  5.849   -3.871  1.00 0.00 ? 45 ALA A CA   2  
ATOM 1905  C C    . ALA A 1 45 ? -6.437  5.588   -2.649  1.00 0.00 ? 45 ALA A C    2  
ATOM 1906  O O    . ALA A 1 45 ? -6.907  5.063   -1.640  1.00 0.00 ? 45 ALA A O    2  
ATOM 1907  C CB   . ALA A 1 45 ? -8.183  7.102   -3.710  1.00 0.00 ? 45 ALA A CB   2  
ATOM 1908  H H    . ALA A 1 45 ? -8.999  4.663   -3.537  1.00 0.00 ? 45 ALA A H    2  
ATOM 1909  H HA   . ALA A 1 45 ? -6.684  5.970   -4.749  1.00 0.00 ? 45 ALA A HA   2  
ATOM 1910  H HB1  . ALA A 1 45 ? -7.546  7.953   -3.471  1.00 0.00 ? 45 ALA A HB1  2  
ATOM 1911  H HB2  . ALA A 1 45 ? -8.716  7.297   -4.640  1.00 0.00 ? 45 ALA A HB2  2  
ATOM 1912  H HB3  . ALA A 1 45 ? -8.901  6.947   -2.904  1.00 0.00 ? 45 ALA A HB3  2  
ATOM 1913  N N    . VAL A 1 46 ? -5.174  5.966   -2.779  1.00 0.00 ? 46 VAL A N    2  
ATOM 1914  C CA   . VAL A 1 46 ? -4.221  5.779   -1.698  1.00 0.00 ? 46 VAL A CA   2  
ATOM 1915  C C    . VAL A 1 46 ? -4.035  7.103   -0.954  1.00 0.00 ? 46 VAL A C    2  
ATOM 1916  O O    . VAL A 1 46 ? -3.530  8.071   -1.520  1.00 0.00 ? 46 VAL A O    2  
ATOM 1917  C CB   . VAL A 1 46 ? -2.911  5.212   -2.248  1.00 0.00 ? 46 VAL A CB   2  
ATOM 1918  C CG1  . VAL A 1 46 ? -1.944  4.867   -1.112  1.00 0.00 ? 46 VAL A CG1  2  
ATOM 1919  C CG2  . VAL A 1 46 ? -3.170  3.994   -3.137  1.00 0.00 ? 46 VAL A CG2  2  
ATOM 1920  H H    . VAL A 1 46 ? -4.800  6.392   -3.603  1.00 0.00 ? 46 VAL A H    2  
ATOM 1921  H HA   . VAL A 1 46 ? -4.644  5.046   -1.011  1.00 0.00 ? 46 VAL A HA   2  
ATOM 1922  H HB   . VAL A 1 46 ? -2.445  5.982   -2.862  1.00 0.00 ? 46 VAL A HB   2  
ATOM 1923  H HG11 . VAL A 1 46 ? -2.274  3.953   -0.620  1.00 0.00 ? 46 VAL A HG11 2  
ATOM 1924  H HG12 . VAL A 1 46 ? -0.944  4.719   -1.519  1.00 0.00 ? 46 VAL A HG12 2  
ATOM 1925  H HG13 . VAL A 1 46 ? -1.926  5.682   -0.390  1.00 0.00 ? 46 VAL A HG13 2  
ATOM 1926  H HG21 . VAL A 1 46 ? -4.244  3.825   -3.216  1.00 0.00 ? 46 VAL A HG21 2  
ATOM 1927  H HG22 . VAL A 1 46 ? -2.756  4.174   -4.129  1.00 0.00 ? 46 VAL A HG22 2  
ATOM 1928  H HG23 . VAL A 1 46 ? -2.694  3.117   -2.698  1.00 0.00 ? 46 VAL A HG23 2  
ATOM 1929  N N    . GLN A 1 47 ? -4.453  7.102   0.303   1.00 0.00 ? 47 GLN A N    2  
ATOM 1930  C CA   . GLN A 1 47 ? -4.338  8.291   1.130   1.00 0.00 ? 47 GLN A CA   2  
ATOM 1931  C C    . GLN A 1 47 ? -3.344  8.052   2.268   1.00 0.00 ? 47 GLN A C    2  
ATOM 1932  O O    . GLN A 1 47 ? -2.986  6.912   2.555   1.00 0.00 ? 47 GLN A O    2  
ATOM 1933  C CB   . GLN A 1 47 ? -5.704  8.714   1.676   1.00 0.00 ? 47 GLN A CB   2  
ATOM 1934  C CG   . GLN A 1 47 ? -6.480  9.528   0.638   1.00 0.00 ? 47 GLN A CG   2  
ATOM 1935  C CD   . GLN A 1 47 ? -6.115  11.012  0.721   1.00 0.00 ? 47 GLN A CD   2  
ATOM 1936  O OE1  . GLN A 1 47 ? -5.260  11.508  0.007   1.00 0.00 ? 47 GLN A OE1  2  
ATOM 1937  N NE2  . GLN A 1 47 ? -6.809  11.690  1.630   1.00 0.00 ? 47 GLN A NE2  2  
ATOM 1938  H H    . GLN A 1 47 ? -4.862  6.311   0.756   1.00 0.00 ? 47 GLN A H    2  
ATOM 1939  H HA   . GLN A 1 47 ? -3.962  9.071   0.467   1.00 0.00 ? 47 GLN A HA   2  
ATOM 1940  H HB3  . GLN A 1 47 ? -5.571  9.304   2.581   1.00 0.00 ? 47 GLN A HB3  2  
ATOM 1941  H HG3  . GLN A 1 47 ? -7.551  9.403   0.800   1.00 0.00 ? 47 GLN A HG3  2  
ATOM 1942  H HE21 . GLN A 1 47 ? -7.498  11.223  2.185   1.00 0.00 ? 47 GLN A HE21 2  
ATOM 1943  H HE22 . GLN A 1 47 ? -6.643  12.668  1.760   1.00 0.00 ? 47 GLN A HE22 2  
ATOM 1944  N N    . GLY A 1 48 ? -2.926  9.148   2.886   1.00 0.00 ? 48 GLY A N    2  
ATOM 1945  C CA   . GLY A 1 48 ? -1.980  9.072   3.986   1.00 0.00 ? 48 GLY A CA   2  
ATOM 1946  C C    . GLY A 1 48 ? -0.594  8.654   3.490   1.00 0.00 ? 48 GLY A C    2  
ATOM 1947  O O    . GLY A 1 48 ? 0.168   8.023   4.222   1.00 0.00 ? 48 GLY A O    2  
ATOM 1948  H H    . GLY A 1 48 ? -3.222  10.072  2.646   1.00 0.00 ? 48 GLY A H    2  
ATOM 1949  H HA2  . GLY A 1 48 ? -1.916  10.040  4.483   1.00 0.00 ? 48 GLY A HA2  2  
ATOM 1950  H HA3  . GLY A 1 48 ? -2.336  8.356   4.727   1.00 0.00 ? 48 GLY A HA3  2  
ATOM 1951  N N    . LEU A 1 49 ? -0.309  9.022   2.249   1.00 0.00 ? 49 LEU A N    2  
ATOM 1952  C CA   . LEU A 1 49 ? 0.971   8.694   1.646   1.00 0.00 ? 49 LEU A CA   2  
ATOM 1953  C C    . LEU A 1 49 ? 2.050   9.616   2.218   1.00 0.00 ? 49 LEU A C    2  
ATOM 1954  O O    . LEU A 1 49 ? 1.740   10.632  2.837   1.00 0.00 ? 49 LEU A O    2  
ATOM 1955  C CB   . LEU A 1 49 ? 0.871   8.737   0.120   1.00 0.00 ? 49 LEU A CB   2  
ATOM 1956  C CG   . LEU A 1 49 ? 0.436   7.438   -0.560  1.00 0.00 ? 49 LEU A CG   2  
ATOM 1957  C CD1  . LEU A 1 49 ? -0.237  7.722   -1.904  1.00 0.00 ? 49 LEU A CD1  2  
ATOM 1958  C CD2  . LEU A 1 49 ? 1.614   6.471   -0.703  1.00 0.00 ? 49 LEU A CD2  2  
ATOM 1959  H H    . LEU A 1 49 ? -0.934  9.535   1.661   1.00 0.00 ? 49 LEU A H    2  
ATOM 1960  H HA   . LEU A 1 49 ? 1.210   7.668   1.925   1.00 0.00 ? 49 LEU A HA   2  
ATOM 1961  H HB3  . LEU A 1 49 ? 1.845   9.025   -0.280  1.00 0.00 ? 49 LEU A HB3  2  
ATOM 1962  H HG   . LEU A 1 49 ? -0.304  6.951   0.075   1.00 0.00 ? 49 LEU A HG   2  
ATOM 1963  H HD11 . LEU A 1 49 ? 0.510   8.058   -2.622  1.00 0.00 ? 49 LEU A HD11 2  
ATOM 1964  H HD12 . LEU A 1 49 ? -0.711  6.812   -2.273  1.00 0.00 ? 49 LEU A HD12 2  
ATOM 1965  H HD13 . LEU A 1 49 ? -0.993  8.498   -1.775  1.00 0.00 ? 49 LEU A HD13 2  
ATOM 1966  H HD21 . LEU A 1 49 ? 1.895   6.094   0.281   1.00 0.00 ? 49 LEU A HD21 2  
ATOM 1967  H HD22 . LEU A 1 49 ? 1.325   5.638   -1.343  1.00 0.00 ? 49 LEU A HD22 2  
ATOM 1968  H HD23 . LEU A 1 49 ? 2.461   6.994   -1.147  1.00 0.00 ? 49 LEU A HD23 2  
ATOM 1969  N N    . PRO A 1 50 ? 3.330   9.216   1.987   1.00 0.00 ? 50 PRO A N    2  
ATOM 1970  C CA   . PRO A 1 50 ? 4.457   9.994   2.471   1.00 0.00 ? 50 PRO A CA   2  
ATOM 1971  C C    . PRO A 1 50 ? 4.659   11.253  1.624   1.00 0.00 ? 50 PRO A C    2  
ATOM 1972  O O    . PRO A 1 50 ? 5.200   11.183  0.522   1.00 0.00 ? 50 PRO A O    2  
ATOM 1973  C CB   . PRO A 1 50 ? 5.643   9.045   2.417   1.00 0.00 ? 50 PRO A CB   2  
ATOM 1974  C CG   . PRO A 1 50 ? 5.237   7.925   1.474   1.00 0.00 ? 50 PRO A CG   2  
ATOM 1975  C CD   . PRO A 1 50 ? 3.736   8.017   1.258   1.00 0.00 ? 50 PRO A CD   2  
ATOM 1976  H HA   . PRO A 1 50 ? 4.281   10.316  3.402   1.00 0.00 ? 50 PRO A HA   2  
ATOM 1977  H HB3  . PRO A 1 50 ? 5.877   8.656   3.408   1.00 0.00 ? 50 PRO A HB3  2  
ATOM 1978  H HG3  . PRO A 1 50 ? 5.503   6.955   1.896   1.00 0.00 ? 50 PRO A HG3  2  
ATOM 1979  H HD3  . PRO A 1 50 ? 3.225   7.132   1.637   1.00 0.00 ? 50 PRO A HD3  2  
ATOM 1980  N N    . GLU A 1 51 ? 4.215   12.374  2.173   1.00 0.00 ? 51 GLU A N    2  
ATOM 1981  C CA   . GLU A 1 51 ? 4.340   13.646  1.482   1.00 0.00 ? 51 GLU A CA   2  
ATOM 1982  C C    . GLU A 1 51 ? 5.602   13.658  0.618   1.00 0.00 ? 51 GLU A C    2  
ATOM 1983  O O    . GLU A 1 51 ? 6.613   13.060  0.982   1.00 0.00 ? 51 GLU A O    2  
ATOM 1984  C CB   . GLU A 1 51 ? 4.342   14.810  2.473   1.00 0.00 ? 51 GLU A CB   2  
ATOM 1985  C CG   . GLU A 1 51 ? 2.936   15.392  2.640   1.00 0.00 ? 51 GLU A CG   2  
ATOM 1986  C CD   . GLU A 1 51 ? 2.673   16.492  1.609   1.00 0.00 ? 51 GLU A CD   2  
ATOM 1987  O OE1  . GLU A 1 51 ? 3.654   17.173  1.241   1.00 0.00 ? 51 GLU A OE1  2  
ATOM 1988  O OE2  . GLU A 1 51 ? 1.496   16.627  1.212   1.00 0.00 ? 51 GLU A OE2  2  
ATOM 1989  H H    . GLU A 1 51 ? 3.776   12.421  3.070   1.00 0.00 ? 51 GLU A H    2  
ATOM 1990  H HA   . GLU A 1 51 ? 3.457   13.718  0.847   1.00 0.00 ? 51 GLU A HA   2  
ATOM 1991  H HB3  . GLU A 1 51 ? 5.022   15.588  2.125   1.00 0.00 ? 51 GLU A HB3  2  
ATOM 1992  H HG3  . GLU A 1 51 ? 2.823   15.796  3.645   1.00 0.00 ? 51 GLU A HG3  2  
ATOM 1993  N N    . GLY A 1 52 ? 5.504   14.347  -0.510  1.00 0.00 ? 52 GLY A N    2  
ATOM 1994  C CA   . GLY A 1 52 ? 6.625   14.445  -1.427  1.00 0.00 ? 52 GLY A CA   2  
ATOM 1995  C C    . GLY A 1 52 ? 6.854   13.120  -2.158  1.00 0.00 ? 52 GLY A C    2  
ATOM 1996  O O    . GLY A 1 52 ? 7.992   12.678  -2.307  1.00 0.00 ? 52 GLY A O    2  
ATOM 1997  H H    . GLY A 1 52 ? 4.677   14.831  -0.799  1.00 0.00 ? 52 GLY A H    2  
ATOM 1998  H HA2  . GLY A 1 52 ? 6.438   15.236  -2.153  1.00 0.00 ? 52 GLY A HA2  2  
ATOM 1999  H HA3  . GLY A 1 52 ? 7.526   14.722  -0.879  1.00 0.00 ? 52 GLY A HA3  2  
ATOM 2000  N N    . LEU A 1 53 ? 5.754   12.524  -2.593  1.00 0.00 ? 53 LEU A N    2  
ATOM 2001  C CA   . LEU A 1 53 ? 5.821   11.258  -3.304  1.00 0.00 ? 53 LEU A CA   2  
ATOM 2002  C C    . LEU A 1 53 ? 4.577   11.106  -4.184  1.00 0.00 ? 53 LEU A C    2  
ATOM 2003  O O    . LEU A 1 53 ? 3.814   12.056  -4.354  1.00 0.00 ? 53 LEU A O    2  
ATOM 2004  C CB   . LEU A 1 53 ? 6.025   10.102  -2.323  1.00 0.00 ? 53 LEU A CB   2  
ATOM 2005  C CG   . LEU A 1 53 ? 7.475   9.683   -2.072  1.00 0.00 ? 53 LEU A CG   2  
ATOM 2006  C CD1  . LEU A 1 53 ? 7.570   8.719   -0.888  1.00 0.00 ? 53 LEU A CD1  2  
ATOM 2007  C CD2  . LEU A 1 53 ? 8.104   9.101   -3.339  1.00 0.00 ? 53 LEU A CD2  2  
ATOM 2008  H H    . LEU A 1 53 ? 4.832   12.890  -2.468  1.00 0.00 ? 53 LEU A H    2  
ATOM 2009  H HA   . LEU A 1 53 ? 6.698   11.292  -3.950  1.00 0.00 ? 53 LEU A HA   2  
ATOM 2010  H HB3  . LEU A 1 53 ? 5.476   9.236   -2.693  1.00 0.00 ? 53 LEU A HB3  2  
ATOM 2011  H HG   . LEU A 1 53 ? 8.046   10.574  -1.808  1.00 0.00 ? 53 LEU A HG   2  
ATOM 2012  H HD11 . LEU A 1 53 ? 7.247   9.226   0.021   1.00 0.00 ? 53 LEU A HD11 2  
ATOM 2013  H HD12 . LEU A 1 53 ? 6.929   7.856   -1.071  1.00 0.00 ? 53 LEU A HD12 2  
ATOM 2014  H HD13 . LEU A 1 53 ? 8.602   8.387   -0.773  1.00 0.00 ? 53 LEU A HD13 2  
ATOM 2015  H HD21 . LEU A 1 53 ? 7.705   9.616   -4.213  1.00 0.00 ? 53 LEU A HD21 2  
ATOM 2016  H HD22 . LEU A 1 53 ? 9.186   9.233   -3.301  1.00 0.00 ? 53 LEU A HD22 2  
ATOM 2017  H HD23 . LEU A 1 53 ? 7.870   8.038   -3.405  1.00 0.00 ? 53 LEU A HD23 2  
ATOM 2018  N N    . ALA A 1 54 ? 4.413   9.905   -4.718  1.00 0.00 ? 54 ALA A N    2  
ATOM 2019  C CA   . ALA A 1 54 ? 3.276   9.617   -5.575  1.00 0.00 ? 54 ALA A CA   2  
ATOM 2020  C C    . ALA A 1 54 ? 2.957   8.122   -5.505  1.00 0.00 ? 54 ALA A C    2  
ATOM 2021  O O    . ALA A 1 54 ? 3.862   7.292   -5.447  1.00 0.00 ? 54 ALA A O    2  
ATOM 2022  C CB   . ALA A 1 54 ? 3.580   10.082  -7.001  1.00 0.00 ? 54 ALA A CB   2  
ATOM 2023  H H    . ALA A 1 54 ? 5.040   9.139   -4.575  1.00 0.00 ? 54 ALA A H    2  
ATOM 2024  H HA   . ALA A 1 54 ? 2.423   10.180  -5.196  1.00 0.00 ? 54 ALA A HA   2  
ATOM 2025  H HB1  . ALA A 1 54 ? 2.652   10.136  -7.571  1.00 0.00 ? 54 ALA A HB1  2  
ATOM 2026  H HB2  . ALA A 1 54 ? 4.047   11.067  -6.970  1.00 0.00 ? 54 ALA A HB2  2  
ATOM 2027  H HB3  . ALA A 1 54 ? 4.258   9.374   -7.477  1.00 0.00 ? 54 ALA A HB3  2  
ATOM 2028  N N    . PHE A 1 55 ? 1.665   7.824   -5.515  1.00 0.00 ? 55 PHE A N    2  
ATOM 2029  C CA   . PHE A 1 55 ? 1.215   6.445   -5.453  1.00 0.00 ? 55 PHE A CA   2  
ATOM 2030  C C    . PHE A 1 55 ? 1.721   5.649   -6.658  1.00 0.00 ? 55 PHE A C    2  
ATOM 2031  O O    . PHE A 1 55 ? 1.280   5.873   -7.784  1.00 0.00 ? 55 PHE A O    2  
ATOM 2032  C CB   . PHE A 1 55 ? -0.315  6.472   -5.480  1.00 0.00 ? 55 PHE A CB   2  
ATOM 2033  C CG   . PHE A 1 55 ? -0.958  5.102   -5.706  1.00 0.00 ? 55 PHE A CG   2  
ATOM 2034  C CD1  . PHE A 1 55 ? -0.565  4.034   -4.960  1.00 0.00 ? 55 PHE A CD1  2  
ATOM 2035  C CD2  . PHE A 1 55 ? -1.921  4.951   -6.654  1.00 0.00 ? 55 PHE A CD2  2  
ATOM 2036  C CE1  . PHE A 1 55 ? -1.161  2.764   -5.170  1.00 0.00 ? 55 PHE A CE1  2  
ATOM 2037  C CE2  . PHE A 1 55 ? -2.517  3.680   -6.864  1.00 0.00 ? 55 PHE A CE2  2  
ATOM 2038  C CZ   . PHE A 1 55 ? -2.125  2.613   -6.118  1.00 0.00 ? 55 PHE A CZ   2  
ATOM 2039  H H    . PHE A 1 55 ? 0.935   8.507   -5.562  1.00 0.00 ? 55 PHE A H    2  
ATOM 2040  H HA   . PHE A 1 55 ? 1.620   6.013   -4.538  1.00 0.00 ? 55 PHE A HA   2  
ATOM 2041  H HB3  . PHE A 1 55 ? -0.642  7.150   -6.268  1.00 0.00 ? 55 PHE A HB3  2  
ATOM 2042  H HD1  . PHE A 1 55 ? 0.207   4.156   -4.200  1.00 0.00 ? 55 PHE A HD1  2  
ATOM 2043  H HD2  . PHE A 1 55 ? -2.236  5.807   -7.252  1.00 0.00 ? 55 PHE A HD2  2  
ATOM 2044  H HE1  . PHE A 1 55 ? -0.847  1.909   -4.572  1.00 0.00 ? 55 PHE A HE1  2  
ATOM 2045  H HE2  . PHE A 1 55 ? -3.290  3.559   -7.624  1.00 0.00 ? 55 PHE A HE2  2  
ATOM 2046  H HZ   . PHE A 1 55 ? -2.583  1.637   -6.279  1.00 0.00 ? 55 PHE A HZ   2  
ATOM 2047  N N    . ARG A 1 56 ? 2.639   4.735   -6.380  1.00 0.00 ? 56 ARG A N    2  
ATOM 2048  C CA   . ARG A 1 56 ? 3.209   3.904   -7.426  1.00 0.00 ? 56 ARG A CA   2  
ATOM 2049  C C    . ARG A 1 56 ? 3.923   2.697   -6.816  1.00 0.00 ? 56 ARG A C    2  
ATOM 2050  O O    . ARG A 1 56 ? 4.172   2.662   -5.612  1.00 0.00 ? 56 ARG A O    2  
ATOM 2051  C CB   . ARG A 1 56 ? 4.201   4.697   -8.280  1.00 0.00 ? 56 ARG A CB   2  
ATOM 2052  C CG   . ARG A 1 56 ? 4.828   5.837   -7.474  1.00 0.00 ? 56 ARG A CG   2  
ATOM 2053  C CD   . ARG A 1 56 ? 6.227   6.172   -7.996  1.00 0.00 ? 56 ARG A CD   2  
ATOM 2054  N NE   . ARG A 1 56 ? 6.140   7.218   -9.040  1.00 0.00 ? 56 ARG A NE   2  
ATOM 2055  C CZ   . ARG A 1 56 ? 5.947   6.967   -10.342 1.00 0.00 ? 56 ARG A CZ   2  
ATOM 2056  N NH1  . ARG A 1 56 ? 5.818   5.702   -10.768 1.00 0.00 ? 56 ARG A NH1  2  
ATOM 2057  N NH2  . ARG A 1 56 ? 5.881   7.979   -11.218 1.00 0.00 ? 56 ARG A NH2  2  
ATOM 2058  H H    . ARG A 1 56 ? 2.992   4.559   -5.461  1.00 0.00 ? 56 ARG A H    2  
ATOM 2059  H HA   . ARG A 1 56 ? 2.356   3.593   -8.031  1.00 0.00 ? 56 ARG A HA   2  
ATOM 2060  H HB3  . ARG A 1 56 ? 3.692   5.102   -9.154  1.00 0.00 ? 56 ARG A HB3  2  
ATOM 2061  H HG3  . ARG A 1 56 ? 4.887   5.555   -6.423  1.00 0.00 ? 56 ARG A HG3  2  
ATOM 2062  H HD3  . ARG A 1 56 ? 6.695   5.277   -8.405  1.00 0.00 ? 56 ARG A HD3  2  
ATOM 2063  H HE   . ARG A 1 56 ? 6.232   8.173   -8.755  1.00 0.00 ? 56 ARG A HE   2  
ATOM 2064  H HH11 . ARG A 1 56 ? 5.867   4.947   -10.114 1.00 0.00 ? 56 ARG A HH11 2  
ATOM 2065  H HH12 . ARG A 1 56 ? 5.674   5.515   -11.739 1.00 0.00 ? 56 ARG A HH12 2  
ATOM 2066  H HH21 . ARG A 1 56 ? 5.977   8.922   -10.900 1.00 0.00 ? 56 ARG A HH21 2  
ATOM 2067  H HH22 . ARG A 1 56 ? 5.737   7.790   -12.189 1.00 0.00 ? 56 ARG A HH22 2  
ATOM 2068  N N    . ARG A 1 57 ? 4.232   1.737   -7.675  1.00 0.00 ? 57 ARG A N    2  
ATOM 2069  C CA   . ARG A 1 57 ? 4.913   0.530   -7.235  1.00 0.00 ? 57 ARG A CA   2  
ATOM 2070  C C    . ARG A 1 57 ? 6.004   0.876   -6.221  1.00 0.00 ? 57 ARG A C    2  
ATOM 2071  O O    . ARG A 1 57 ? 6.564   1.970   -6.256  1.00 0.00 ? 57 ARG A O    2  
ATOM 2072  C CB   . ARG A 1 57 ? 5.541   -0.210  -8.418  1.00 0.00 ? 57 ARG A CB   2  
ATOM 2073  C CG   . ARG A 1 57 ? 4.768   -1.490  -8.737  1.00 0.00 ? 57 ARG A CG   2  
ATOM 2074  C CD   . ARG A 1 57 ? 4.842   -1.819  -10.230 1.00 0.00 ? 57 ARG A CD   2  
ATOM 2075  N NE   . ARG A 1 57 ? 3.652   -2.598  -10.637 1.00 0.00 ? 57 ARG A NE   2  
ATOM 2076  C CZ   . ARG A 1 57 ? 3.419   -3.864  -10.265 1.00 0.00 ? 57 ARG A CZ   2  
ATOM 2077  N NH1  . ARG A 1 57 ? 4.293   -4.501  -9.474  1.00 0.00 ? 57 ARG A NH1  2  
ATOM 2078  N NH2  . ARG A 1 57 ? 2.311   -4.492  -10.684 1.00 0.00 ? 57 ARG A NH2  2  
ATOM 2079  H H    . ARG A 1 57 ? 4.026   1.773   -8.653  1.00 0.00 ? 57 ARG A H    2  
ATOM 2080  H HA   . ARG A 1 57 ? 4.132   -0.079  -6.779  1.00 0.00 ? 57 ARG A HA   2  
ATOM 2081  H HB3  . ARG A 1 57 ? 6.578   -0.455  -8.189  1.00 0.00 ? 57 ARG A HB3  2  
ATOM 2082  H HG3  . ARG A 1 57 ? 3.725   -1.374  -8.439  1.00 0.00 ? 57 ARG A HG3  2  
ATOM 2083  H HD3  . ARG A 1 57 ? 5.748   -2.387  -10.441 1.00 0.00 ? 57 ARG A HD3  2  
ATOM 2084  H HE   . ARG A 1 57 ? 2.980   -2.151  -11.228 1.00 0.00 ? 57 ARG A HE   2  
ATOM 2085  H HH11 . ARG A 1 57 ? 5.119   -4.032  -9.163  1.00 0.00 ? 57 ARG A HH11 2  
ATOM 2086  H HH12 . ARG A 1 57 ? 4.120   -5.446  -9.197  1.00 0.00 ? 57 ARG A HH12 2  
ATOM 2087  H HH21 . ARG A 1 57 ? 1.659   -4.015  -11.273 1.00 0.00 ? 57 ARG A HH21 2  
ATOM 2088  H HH22 . ARG A 1 57 ? 2.138   -5.436  -10.405 1.00 0.00 ? 57 ARG A HH22 2  
ATOM 2089  N N    . PRO A 1 58 ? 6.281   -0.103  -5.318  1.00 0.00 ? 58 PRO A N    2  
ATOM 2090  C CA   . PRO A 1 58 ? 7.296   0.088   -4.296  1.00 0.00 ? 58 PRO A CA   2  
ATOM 2091  C C    . PRO A 1 58 ? 8.701   -0.016  -4.892  1.00 0.00 ? 58 PRO A C    2  
ATOM 2092  O O    . PRO A 1 58 ? 9.665   0.476   -4.307  1.00 0.00 ? 58 PRO A O    2  
ATOM 2093  C CB   . PRO A 1 58 ? 7.012   -0.983  -3.255  1.00 0.00 ? 58 PRO A CB   2  
ATOM 2094  C CG   . PRO A 1 58 ? 6.146   -2.022  -3.951  1.00 0.00 ? 58 PRO A CG   2  
ATOM 2095  C CD   . PRO A 1 58 ? 5.638   -1.411  -5.248  1.00 0.00 ? 58 PRO A CD   2  
ATOM 2096  H HA   . PRO A 1 58 ? 7.231   1.007   -3.909  1.00 0.00 ? 58 PRO A HA   2  
ATOM 2097  H HB3  . PRO A 1 58 ? 6.497   -0.562  -2.391  1.00 0.00 ? 58 PRO A HB3  2  
ATOM 2098  H HG3  . PRO A 1 58 ? 5.311   -2.313  -3.314  1.00 0.00 ? 58 PRO A HG3  2  
ATOM 2099  H HD3  . PRO A 1 58 ? 4.552   -1.320  -5.243  1.00 0.00 ? 58 PRO A HD3  2  
ATOM 2100  N N    . ALA A 1 59 ? 8.773   -0.660  -6.047  1.00 0.00 ? 59 ALA A N    2  
ATOM 2101  C CA   . ALA A 1 59 ? 10.045  -0.835  -6.729  1.00 0.00 ? 59 ALA A CA   2  
ATOM 2102  C C    . ALA A 1 59 ? 10.354  0.417   -7.551  1.00 0.00 ? 59 ALA A C    2  
ATOM 2103  O O    . ALA A 1 59 ? 11.506  0.661   -7.906  1.00 0.00 ? 59 ALA A O    2  
ATOM 2104  C CB   . ALA A 1 59 ? 9.993   -2.100  -7.589  1.00 0.00 ? 59 ALA A CB   2  
ATOM 2105  H H    . ALA A 1 59 ? 7.984   -1.058  -6.516  1.00 0.00 ? 59 ALA A H    2  
ATOM 2106  H HA   . ALA A 1 59 ? 10.815  -0.960  -5.968  1.00 0.00 ? 59 ALA A HA   2  
ATOM 2107  H HB1  . ALA A 1 59 ? 9.357   -1.923  -8.457  1.00 0.00 ? 59 ALA A HB1  2  
ATOM 2108  H HB2  . ALA A 1 59 ? 10.999  -2.354  -7.921  1.00 0.00 ? 59 ALA A HB2  2  
ATOM 2109  H HB3  . ALA A 1 59 ? 9.585   -2.922  -7.002  1.00 0.00 ? 59 ALA A HB3  2  
ATOM 2110  N N    . GLU A 1 60 ? 9.306   1.178   -7.829  1.00 0.00 ? 60 GLU A N    2  
ATOM 2111  C CA   . GLU A 1 60 ? 9.451   2.399   -8.602  1.00 0.00 ? 60 GLU A CA   2  
ATOM 2112  C C    . GLU A 1 60 ? 9.805   3.570   -7.684  1.00 0.00 ? 60 GLU A C    2  
ATOM 2113  O O    . GLU A 1 60 ? 10.294  4.601   -8.146  1.00 0.00 ? 60 GLU A O    2  
ATOM 2114  C CB   . GLU A 1 60 ? 8.181   2.695   -9.403  1.00 0.00 ? 60 GLU A CB   2  
ATOM 2115  C CG   . GLU A 1 60 ? 7.995   1.679   -10.531 1.00 0.00 ? 60 GLU A CG   2  
ATOM 2116  C CD   . GLU A 1 60 ? 8.039   2.364   -11.899 1.00 0.00 ? 60 GLU A CD   2  
ATOM 2117  O OE1  . GLU A 1 60 ? 9.153   2.770   -12.295 1.00 0.00 ? 60 GLU A OE1  2  
ATOM 2118  O OE2  . GLU A 1 60 ? 6.957   2.466   -12.517 1.00 0.00 ? 60 GLU A OE2  2  
ATOM 2119  H H    . GLU A 1 60 ? 8.372   0.972   -7.535  1.00 0.00 ? 60 GLU A H    2  
ATOM 2120  H HA   . GLU A 1 60 ? 10.272  2.209   -9.293  1.00 0.00 ? 60 GLU A HA   2  
ATOM 2121  H HB3  . GLU A 1 60 ? 8.236   3.701   -9.819  1.00 0.00 ? 60 GLU A HB3  2  
ATOM 2122  H HG3  . GLU A 1 60 ? 7.042   1.165   -10.408 1.00 0.00 ? 60 GLU A HG3  2  
ATOM 2123  N N    . TYR A 1 61 ? 9.546   3.374   -6.399  1.00 0.00 ? 61 TYR A N    2  
ATOM 2124  C CA   . TYR A 1 61 ? 9.831   4.400   -5.412  1.00 0.00 ? 61 TYR A CA   2  
ATOM 2125  C C    . TYR A 1 61 ? 11.336  4.518   -5.163  1.00 0.00 ? 61 TYR A C    2  
ATOM 2126  O O    . TYR A 1 61 ? 12.107  3.652   -5.574  1.00 0.00 ? 61 TYR A O    2  
ATOM 2127  C CB   . TYR A 1 61 ? 9.146   3.946   -4.121  1.00 0.00 ? 61 TYR A CB   2  
ATOM 2128  C CG   . TYR A 1 61 ? 7.759   4.553   -3.906  1.00 0.00 ? 61 TYR A CG   2  
ATOM 2129  C CD1  . TYR A 1 61 ? 7.520   5.868   -4.250  1.00 0.00 ? 61 TYR A CD1  2  
ATOM 2130  C CD2  . TYR A 1 61 ? 6.746   3.786   -3.367  1.00 0.00 ? 61 TYR A CD2  2  
ATOM 2131  C CE1  . TYR A 1 61 ? 6.214   6.439   -4.047  1.00 0.00 ? 61 TYR A CE1  2  
ATOM 2132  C CE2  . TYR A 1 61 ? 5.440   4.357   -3.164  1.00 0.00 ? 61 TYR A CE2  2  
ATOM 2133  C CZ   . TYR A 1 61 ? 5.238   5.656   -3.514  1.00 0.00 ? 61 TYR A CZ   2  
ATOM 2134  O OH   . TYR A 1 61 ? 4.005   6.195   -3.323  1.00 0.00 ? 61 TYR A OH   2  
ATOM 2135  H H    . TYR A 1 61 ? 9.147   2.533   -6.032  1.00 0.00 ? 61 TYR A H    2  
ATOM 2136  H HA   . TYR A 1 61 ? 9.458   5.350   -5.796  1.00 0.00 ? 61 TYR A HA   2  
ATOM 2137  H HB3  . TYR A 1 61 ? 9.781   4.207   -3.274  1.00 0.00 ? 61 TYR A HB3  2  
ATOM 2138  H HD1  . TYR A 1 61 ? 8.319   6.474   -4.675  1.00 0.00 ? 61 TYR A HD1  2  
ATOM 2139  H HD2  . TYR A 1 61 ? 6.935   2.748   -3.095  1.00 0.00 ? 61 TYR A HD2  2  
ATOM 2140  H HE1  . TYR A 1 61 ? 6.011   7.477   -4.314  1.00 0.00 ? 61 TYR A HE1  2  
ATOM 2141  H HE2  . TYR A 1 61 ? 4.631   3.763   -2.739  1.00 0.00 ? 61 TYR A HE2  2  
ATOM 2142  H HH   . TYR A 1 61 ? 4.032   7.180   -3.492  1.00 0.00 ? 61 TYR A HH   2  
ATOM 2143  N N    . ASP A 1 62 ? 11.710  5.597   -4.491  1.00 0.00 ? 62 ASP A N    2  
ATOM 2144  C CA   . ASP A 1 62 ? 13.108  5.840   -4.183  1.00 0.00 ? 62 ASP A CA   2  
ATOM 2145  C C    . ASP A 1 62 ? 13.482  5.088   -2.904  1.00 0.00 ? 62 ASP A C    2  
ATOM 2146  O O    . ASP A 1 62 ? 12.652  4.388   -2.326  1.00 0.00 ? 62 ASP A O    2  
ATOM 2147  C CB   . ASP A 1 62 ? 13.370  7.329   -3.949  1.00 0.00 ? 62 ASP A CB   2  
ATOM 2148  C CG   . ASP A 1 62 ? 12.229  8.259   -4.363  1.00 0.00 ? 62 ASP A CG   2  
ATOM 2149  O OD1  . ASP A 1 62 ? 11.090  7.991   -3.923  1.00 0.00 ? 62 ASP A OD1  2  
ATOM 2150  O OD2  . ASP A 1 62 ? 12.522  9.218   -5.111  1.00 0.00 ? 62 ASP A OD2  2  
ATOM 2151  H H    . ASP A 1 62 ? 11.076  6.298   -4.161  1.00 0.00 ? 62 ASP A H    2  
ATOM 2152  H HA   . ASP A 1 62 ? 13.659  5.484   -5.053  1.00 0.00 ? 62 ASP A HA   2  
ATOM 2153  H HB3  . ASP A 1 62 ? 14.269  7.615   -4.496  1.00 0.00 ? 62 ASP A HB3  2  
ATOM 2154  N N    . PRO A 1 63 ? 14.765  5.261   -2.488  1.00 0.00 ? 63 PRO A N    2  
ATOM 2155  C CA   . PRO A 1 63 ? 15.259  4.607   -1.289  1.00 0.00 ? 63 PRO A CA   2  
ATOM 2156  C C    . PRO A 1 63 ? 14.723  5.292   -0.031  1.00 0.00 ? 63 PRO A C    2  
ATOM 2157  O O    . PRO A 1 63 ? 14.192  4.632   0.861   1.00 0.00 ? 63 PRO A O    2  
ATOM 2158  C CB   . PRO A 1 63 ? 16.774  4.672   -1.401  1.00 0.00 ? 63 PRO A CB   2  
ATOM 2159  C CG   . PRO A 1 63 ? 17.071  5.761   -2.418  1.00 0.00 ? 63 PRO A CG   2  
ATOM 2160  C CD   . PRO A 1 63 ? 15.776  6.082   -3.148  1.00 0.00 ? 63 PRO A CD   2  
ATOM 2161  H HA   . PRO A 1 63 ? 14.931  3.663   -1.248  1.00 0.00 ? 63 PRO A HA   2  
ATOM 2162  H HB3  . PRO A 1 63 ? 17.183  3.714   -1.724  1.00 0.00 ? 63 PRO A HB3  2  
ATOM 2163  H HG3  . PRO A 1 63 ? 17.834  5.429   -3.122  1.00 0.00 ? 63 PRO A HG3  2  
ATOM 2164  H HD3  . PRO A 1 63 ? 15.851  5.844   -4.209  1.00 0.00 ? 63 PRO A HD3  2  
ATOM 2165  N N    . LYS A 1 64 ? 14.879  6.607   0.001   1.00 0.00 ? 64 LYS A N    2  
ATOM 2166  C CA   . LYS A 1 64 ? 14.417  7.388   1.136   1.00 0.00 ? 64 LYS A CA   2  
ATOM 2167  C C    . LYS A 1 64 ? 12.888  7.368   1.175   1.00 0.00 ? 64 LYS A C    2  
ATOM 2168  O O    . LYS A 1 64 ? 12.287  7.590   2.225   1.00 0.00 ? 64 LYS A O    2  
ATOM 2169  C CB   . LYS A 1 64 ? 15.012  8.798   1.094   1.00 0.00 ? 64 LYS A CB   2  
ATOM 2170  C CG   . LYS A 1 64 ? 16.411  8.821   1.711   1.00 0.00 ? 64 LYS A CG   2  
ATOM 2171  C CD   . LYS A 1 64 ? 17.473  8.430   0.682   1.00 0.00 ? 64 LYS A CD   2  
ATOM 2172  C CE   . LYS A 1 64 ? 18.490  9.556   0.488   1.00 0.00 ? 64 LYS A CE   2  
ATOM 2173  N NZ   . LYS A 1 64 ? 18.136  10.377  -0.691  1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2174  H H    . LYS A 1 64 ? 15.312  7.137   -0.728  1.00 0.00 ? 64 LYS A H    2  
ATOM 2175  H HA   . LYS A 1 64 ? 14.793  6.907   2.039   1.00 0.00 ? 64 LYS A HA   2  
ATOM 2176  H HB3  . LYS A 1 64 ? 14.361  9.487   1.631   1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2177  H HG3  . LYS A 1 64 ? 16.450  8.135   2.558   1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2178  H HD3  . LYS A 1 64 ? 16.993  8.201   -0.271  1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2179  H HE3  . LYS A 1 64 ? 19.487  9.135   0.360   1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2180  H HZ1  . LYS A 1 64 ? 18.708  11.197  -0.710  1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2181  H HZ2  . LYS A 1 64 ? 18.290  9.846   -1.525  1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2182  H HZ3  . LYS A 1 64 ? 17.174  10.641  -0.637  1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2183  N N    . ALA A 1 65 ? 12.301  7.097   0.018   1.00 0.00 ? 65 ALA A N    2  
ATOM 2184  C CA   . ALA A 1 65 ? 10.854  7.044   -0.093  1.00 0.00 ? 65 ALA A CA   2  
ATOM 2185  C C    . ALA A 1 65 ? 10.329  5.846   0.702   1.00 0.00 ? 65 ALA A C    2  
ATOM 2186  O O    . ALA A 1 65 ? 9.526   6.010   1.619   1.00 0.00 ? 65 ALA A O    2  
ATOM 2187  C CB   . ALA A 1 65 ? 10.457  6.982   -1.569  1.00 0.00 ? 65 ALA A CB   2  
ATOM 2188  H H    . ALA A 1 65 ? 12.797  6.916   -0.831  1.00 0.00 ? 65 ALA A H    2  
ATOM 2189  H HA   . ALA A 1 65 ? 10.453  7.961   0.340   1.00 0.00 ? 65 ALA A HA   2  
ATOM 2190  H HB1  . ALA A 1 65 ? 10.180  7.979   -1.914  1.00 0.00 ? 65 ALA A HB1  2  
ATOM 2191  H HB2  . ALA A 1 65 ? 11.298  6.616   -2.157  1.00 0.00 ? 65 ALA A HB2  2  
ATOM 2192  H HB3  . ALA A 1 65 ? 9.608   6.308   -1.690  1.00 0.00 ? 65 ALA A HB3  2  
ATOM 2193  N N    . LEU A 1 66 ? 10.804  4.670   0.321   1.00 0.00 ? 66 LEU A N    2  
ATOM 2194  C CA   . LEU A 1 66 ? 10.394  3.446   0.988   1.00 0.00 ? 66 LEU A CA   2  
ATOM 2195  C C    . LEU A 1 66 ? 10.464  3.646   2.503   1.00 0.00 ? 66 LEU A C    2  
ATOM 2196  O O    . LEU A 1 66 ? 9.582   3.199   3.233   1.00 0.00 ? 66 LEU A O    2  
ATOM 2197  C CB   . LEU A 1 66 ? 11.219  2.259   0.485   1.00 0.00 ? 66 LEU A CB   2  
ATOM 2198  C CG   . LEU A 1 66 ? 11.122  1.961   -1.013  1.00 0.00 ? 66 LEU A CG   2  
ATOM 2199  C CD1  . LEU A 1 66 ? 12.191  0.954   -1.441  1.00 0.00 ? 66 LEU A CD1  2  
ATOM 2200  C CD2  . LEU A 1 66 ? 9.714   1.498   -1.389  1.00 0.00 ? 66 LEU A CD2  2  
ATOM 2201  H H    . LEU A 1 66 ? 11.458  4.546   -0.425  1.00 0.00 ? 66 LEU A H    2  
ATOM 2202  H HA   . LEU A 1 66 ? 9.356   3.256   0.712   1.00 0.00 ? 66 LEU A HA   2  
ATOM 2203  H HB3  . LEU A 1 66 ? 10.910  1.369   1.033   1.00 0.00 ? 66 LEU A HB3  2  
ATOM 2204  H HG   . LEU A 1 66 ? 11.315  2.885   -1.558  1.00 0.00 ? 66 LEU A HG   2  
ATOM 2205  H HD11 . LEU A 1 66 ? 12.840  1.408   -2.191  1.00 0.00 ? 66 LEU A HD11 2  
ATOM 2206  H HD12 . LEU A 1 66 ? 12.785  0.664   -0.574  1.00 0.00 ? 66 LEU A HD12 2  
ATOM 2207  H HD13 . LEU A 1 66 ? 11.710  0.071   -1.864  1.00 0.00 ? 66 LEU A HD13 2  
ATOM 2208  H HD21 . LEU A 1 66 ? 9.344   2.097   -2.221  1.00 0.00 ? 66 LEU A HD21 2  
ATOM 2209  H HD22 . LEU A 1 66 ? 9.743   0.449   -1.682  1.00 0.00 ? 66 LEU A HD22 2  
ATOM 2210  H HD23 . LEU A 1 66 ? 9.051   1.617   -0.532  1.00 0.00 ? 66 LEU A HD23 2  
ATOM 2211  N N    . MET A 1 67 ? 11.523  4.318   2.930   1.00 0.00 ? 67 MET A N    2  
ATOM 2212  C CA   . MET A 1 67 ? 11.720  4.583   4.345   1.00 0.00 ? 67 MET A CA   2  
ATOM 2213  C C    . MET A 1 67 ? 10.663  5.555   4.873   1.00 0.00 ? 67 MET A C    2  
ATOM 2214  O O    . MET A 1 67 ? 10.223  5.439   6.016   1.00 0.00 ? 67 MET A O    2  
ATOM 2215  C CB   . MET A 1 67 ? 13.113  5.176   4.564   1.00 0.00 ? 67 MET A CB   2  
ATOM 2216  C CG   . MET A 1 67 ? 14.137  4.076   4.855   1.00 0.00 ? 67 MET A CG   2  
ATOM 2217  S SD   . MET A 1 67 ? 15.782  4.769   4.895   1.00 0.00 ? 67 MET A SD   2  
ATOM 2218  C CE   . MET A 1 67 ? 16.186  4.709   3.157   1.00 0.00 ? 67 MET A CE   2  
ATOM 2219  H H    . MET A 1 67 ? 12.236  4.679   2.329   1.00 0.00 ? 67 MET A H    2  
ATOM 2220  H HA   . MET A 1 67 ? 11.616  3.618   4.841   1.00 0.00 ? 67 MET A HA   2  
ATOM 2221  H HB3  . MET A 1 67 ? 13.086  5.882   5.395   1.00 0.00 ? 67 MET A HB3  2  
ATOM 2222  H HG3  . MET A 1 67 ? 14.078  3.301   4.090   1.00 0.00 ? 67 MET A HG3  2  
ATOM 2223  H HE1  . MET A 1 67 ? 15.403  4.172   2.620   1.00 0.00 ? 67 MET A HE1  2  
ATOM 2224  H HE2  . MET A 1 67 ? 16.263  5.723   2.767   1.00 0.00 ? 67 MET A HE2  2  
ATOM 2225  H HE3  . MET A 1 67 ? 17.137  4.193   3.023   1.00 0.00 ? 67 MET A HE3  2  
ATOM 2226  N N    . ALA A 1 68 ? 10.287  6.493   4.016   1.00 0.00 ? 68 ALA A N    2  
ATOM 2227  C CA   . ALA A 1 68 ? 9.289   7.485   4.382   1.00 0.00 ? 68 ALA A CA   2  
ATOM 2228  C C    . ALA A 1 68 ? 7.902   6.842   4.351   1.00 0.00 ? 68 ALA A C    2  
ATOM 2229  O O    . ALA A 1 68 ? 6.960   7.358   4.952   1.00 0.00 ? 68 ALA A O    2  
ATOM 2230  C CB   . ALA A 1 68 ? 9.396   8.687   3.442   1.00 0.00 ? 68 ALA A CB   2  
ATOM 2231  H H    . ALA A 1 68 ? 10.650  6.581   3.088   1.00 0.00 ? 68 ALA A H    2  
ATOM 2232  H HA   . ALA A 1 68 ? 9.506   7.814   5.398   1.00 0.00 ? 68 ALA A HA   2  
ATOM 2233  H HB1  . ALA A 1 68 ? 8.396   9.032   3.177   1.00 0.00 ? 68 ALA A HB1  2  
ATOM 2234  H HB2  . ALA A 1 68 ? 9.937   9.492   3.941   1.00 0.00 ? 68 ALA A HB2  2  
ATOM 2235  H HB3  . ALA A 1 68 ? 9.931   8.396   2.538   1.00 0.00 ? 68 ALA A HB3  2  
ATOM 2236  N N    . ILE A 1 69 ? 7.818   5.724   3.644   1.00 0.00 ? 69 ILE A N    2  
ATOM 2237  C CA   . ILE A 1 69 ? 6.560   5.005   3.527   1.00 0.00 ? 69 ILE A CA   2  
ATOM 2238  C C    . ILE A 1 69 ? 6.329   4.181   4.795   1.00 0.00 ? 69 ILE A C    2  
ATOM 2239  O O    . ILE A 1 69 ? 5.221   4.154   5.328   1.00 0.00 ? 69 ILE A O    2  
ATOM 2240  C CB   . ILE A 1 69 ? 6.536   4.176   2.242   1.00 0.00 ? 69 ILE A CB   2  
ATOM 2241  C CG1  . ILE A 1 69 ? 6.672   5.072   1.008   1.00 0.00 ? 69 ILE A CG1  2  
ATOM 2242  C CG2  . ILE A 1 69 ? 5.283   3.299   2.179   1.00 0.00 ? 69 ILE A CG2  2  
ATOM 2243  C CD1  . ILE A 1 69 ? 7.402   4.342   -0.121  1.00 0.00 ? 69 ILE A CD1  2  
ATOM 2244  H H    . ILE A 1 69 ? 8.588   5.310   3.158   1.00 0.00 ? 69 ILE A H    2  
ATOM 2245  H HA   . ILE A 1 69 ? 5.766   5.747   3.447   1.00 0.00 ? 69 ILE A HA   2  
ATOM 2246  H HB   . ILE A 1 69 ? 7.397   3.507   2.250   1.00 0.00 ? 69 ILE A HB   2  
ATOM 2247  H HG13 . ILE A 1 69 ? 7.215   5.978   1.272   1.00 0.00 ? 69 ILE A HG13 2  
ATOM 2248  H HG21 . ILE A 1 69 ? 4.536   3.779   1.546   1.00 0.00 ? 69 ILE A HG21 2  
ATOM 2249  H HG22 . ILE A 1 69 ? 5.541   2.326   1.763   1.00 0.00 ? 69 ILE A HG22 2  
ATOM 2250  H HG23 . ILE A 1 69 ? 4.880   3.169   3.183   1.00 0.00 ? 69 ILE A HG23 2  
ATOM 2251  H HD11 . ILE A 1 69 ? 7.455   3.278   0.108   1.00 0.00 ? 69 ILE A HD11 2  
ATOM 2252  H HD12 . ILE A 1 69 ? 6.860   4.484   -1.056  1.00 0.00 ? 69 ILE A HD12 2  
ATOM 2253  H HD13 . ILE A 1 69 ? 8.410   4.743   -0.221  1.00 0.00 ? 69 ILE A HD13 2  
ATOM 2254  N N    . LEU A 1 70 ? 7.392   3.530   5.242   1.00 0.00 ? 70 LEU A N    2  
ATOM 2255  C CA   . LEU A 1 70 ? 7.319   2.707   6.437   1.00 0.00 ? 70 LEU A CA   2  
ATOM 2256  C C    . LEU A 1 70 ? 7.095   3.605   7.656   1.00 0.00 ? 70 LEU A C    2  
ATOM 2257  O O    . LEU A 1 70 ? 6.574   3.156   8.675   1.00 0.00 ? 70 LEU A O    2  
ATOM 2258  C CB   . LEU A 1 70 ? 8.557   1.815   6.551   1.00 0.00 ? 70 LEU A CB   2  
ATOM 2259  C CG   . LEU A 1 70 ? 8.941   1.038   5.290   1.00 0.00 ? 70 LEU A CG   2  
ATOM 2260  C CD1  . LEU A 1 70 ? 10.456  0.832   5.214   1.00 0.00 ? 70 LEU A CD1  2  
ATOM 2261  C CD2  . LEU A 1 70 ? 8.178   -0.284  5.206   1.00 0.00 ? 70 LEU A CD2  2  
ATOM 2262  H H    . LEU A 1 70 ? 8.291   3.557   4.802   1.00 0.00 ? 70 LEU A H    2  
ATOM 2263  H HA   . LEU A 1 70 ? 6.457   2.050   6.329   1.00 0.00 ? 70 LEU A HA   2  
ATOM 2264  H HB3  . LEU A 1 70 ? 8.392   1.100   7.357   1.00 0.00 ? 70 LEU A HB3  2  
ATOM 2265  H HG   . LEU A 1 70 ? 8.654   1.631   4.422   1.00 0.00 ? 70 LEU A HG   2  
ATOM 2266  H HD11 . LEU A 1 70 ? 10.868  0.793   6.222   1.00 0.00 ? 70 LEU A HD11 2  
ATOM 2267  H HD12 . LEU A 1 70 ? 10.669  -0.104  4.697   1.00 0.00 ? 70 LEU A HD12 2  
ATOM 2268  H HD13 . LEU A 1 70 ? 10.908  1.659   4.667   1.00 0.00 ? 70 LEU A HD13 2  
ATOM 2269  H HD21 . LEU A 1 70 ? 8.509   -0.947  6.006   1.00 0.00 ? 70 LEU A HD21 2  
ATOM 2270  H HD22 . LEU A 1 70 ? 7.109   -0.095  5.311   1.00 0.00 ? 70 LEU A HD22 2  
ATOM 2271  H HD23 . LEU A 1 70 ? 8.370   -0.756  4.242   1.00 0.00 ? 70 LEU A HD23 2  
ATOM 2272  N N    . GLU A 1 71 ? 7.499   4.858   7.510   1.00 0.00 ? 71 GLU A N    2  
ATOM 2273  C CA   . GLU A 1 71 ? 7.350   5.823   8.586   1.00 0.00 ? 71 GLU A CA   2  
ATOM 2274  C C    . GLU A 1 71 ? 5.981   6.502   8.503   1.00 0.00 ? 71 GLU A C    2  
ATOM 2275  O O    . GLU A 1 71 ? 5.317   6.696   9.521   1.00 0.00 ? 71 GLU A O    2  
ATOM 2276  C CB   . GLU A 1 71 ? 8.477   6.857   8.556   1.00 0.00 ? 71 GLU A CB   2  
ATOM 2277  C CG   . GLU A 1 71 ? 9.766   6.279   9.145   1.00 0.00 ? 71 GLU A CG   2  
ATOM 2278  C CD   . GLU A 1 71 ? 10.816  7.374   9.345   1.00 0.00 ? 71 GLU A CD   2  
ATOM 2279  O OE1  . GLU A 1 71 ? 10.999  8.166   8.395   1.00 0.00 ? 71 GLU A OE1  2  
ATOM 2280  O OE2  . GLU A 1 71 ? 11.412  7.394   10.444  1.00 0.00 ? 71 GLU A OE2  2  
ATOM 2281  H H    . GLU A 1 71 ? 7.922   5.216   6.677   1.00 0.00 ? 71 GLU A H    2  
ATOM 2282  H HA   . GLU A 1 71 ? 7.420   5.244   9.507   1.00 0.00 ? 71 GLU A HA   2  
ATOM 2283  H HB3  . GLU A 1 71 ? 8.180   7.741   9.121   1.00 0.00 ? 71 GLU A HB3  2  
ATOM 2284  H HG3  . GLU A 1 71 ? 10.160  5.510   8.481   1.00 0.00 ? 71 GLU A HG3  2  
ATOM 2285  N N    . HIS A 1 72 ? 5.599   6.845   7.281   1.00 0.00 ? 72 HIS A N    2  
ATOM 2286  C CA   . HIS A 1 72 ? 4.321   7.497   7.052   1.00 0.00 ? 72 HIS A CA   2  
ATOM 2287  C C    . HIS A 1 72 ? 3.210   6.446   6.997   1.00 0.00 ? 72 HIS A C    2  
ATOM 2288  O O    . HIS A 1 72 ? 2.028   6.786   7.012   1.00 0.00 ? 72 HIS A O    2  
ATOM 2289  C CB   . HIS A 1 72 ? 4.375   8.369   5.796   1.00 0.00 ? 72 HIS A CB   2  
ATOM 2290  C CG   . HIS A 1 72 ? 5.301   9.557   5.911   1.00 0.00 ? 72 HIS A CG   2  
ATOM 2291  N ND1  . HIS A 1 72 ? 4.926   10.837  5.543   1.00 0.00 ? 72 HIS A ND1  2  
ATOM 2292  C CD2  . HIS A 1 72 ? 6.586   9.644   6.359   1.00 0.00 ? 72 HIS A CD2  2  
ATOM 2293  C CE1  . HIS A 1 72 ? 5.949   11.651  5.762   1.00 0.00 ? 72 HIS A CE1  2  
ATOM 2294  N NE2  . HIS A 1 72 ? 6.977   10.909  6.267   1.00 0.00 ? 72 HIS A NE2  2  
ATOM 2295  H H    . HIS A 1 72 ? 6.144   6.682   6.459   1.00 0.00 ? 72 HIS A H    2  
ATOM 2296  H HA   . HIS A 1 72 ? 4.147   8.153   7.905   1.00 0.00 ? 72 HIS A HA   2  
ATOM 2297  H HB3  . HIS A 1 72 ? 3.369   8.727   5.571   1.00 0.00 ? 72 HIS A HB3  2  
ATOM 2298  H HD1  . HIS A 1 72 ? 4.036   11.104  5.175   1.00 0.00 ? 72 HIS A HD1  2  
ATOM 2299  H HD2  . HIS A 1 72 ? 7.190   8.815   6.729   1.00 0.00 ? 72 HIS A HD2  2  
ATOM 2300  H HE1  . HIS A 1 72 ? 5.967   12.723  5.573   1.00 0.00 ? 72 HIS A HE1  2  
ATOM 2301  N N    . SER A 1 73 ? 3.630   5.191   6.935   1.00 0.00 ? 73 SER A N    2  
ATOM 2302  C CA   . SER A 1 73 ? 2.685   4.088   6.878   1.00 0.00 ? 73 SER A CA   2  
ATOM 2303  C C    . SER A 1 73 ? 1.575   4.296   7.912   1.00 0.00 ? 73 SER A C    2  
ATOM 2304  O O    . SER A 1 73 ? 0.401   4.083   7.617   1.00 0.00 ? 73 SER A O    2  
ATOM 2305  C CB   . SER A 1 73 ? 3.386   2.749   7.115   1.00 0.00 ? 73 SER A CB   2  
ATOM 2306  O OG   . SER A 1 73 ? 3.186   2.269   8.441   1.00 0.00 ? 73 SER A OG   2  
ATOM 2307  H H    . SER A 1 73 ? 4.593   4.923   6.924   1.00 0.00 ? 73 SER A H    2  
ATOM 2308  H HA   . SER A 1 73 ? 2.276   4.110   5.868   1.00 0.00 ? 73 SER A HA   2  
ATOM 2309  H HB3  . SER A 1 73 ? 4.454   2.861   6.926   1.00 0.00 ? 73 SER A HB3  2  
ATOM 2310  H HG   . SER A 1 73 ? 2.672   1.412   8.421   1.00 0.00 ? 73 SER A HG   2  
ATOM 2311  N N    . HIS A 1 74 ? 1.988   4.708   9.101   1.00 0.00 ? 74 HIS A N    2  
ATOM 2312  C CA   . HIS A 1 74 ? 1.044   4.948   10.179  1.00 0.00 ? 74 HIS A CA   2  
ATOM 2313  C C    . HIS A 1 74 ? -0.121  5.795   9.663   1.00 0.00 ? 74 HIS A C    2  
ATOM 2314  O O    . HIS A 1 74 ? -1.217  5.757   10.222  1.00 0.00 ? 74 HIS A O    2  
ATOM 2315  C CB   . HIS A 1 74 ? 1.744   5.574   11.386  1.00 0.00 ? 74 HIS A CB   2  
ATOM 2316  C CG   . HIS A 1 74 ? 2.074   7.037   11.212  1.00 0.00 ? 74 HIS A CG   2  
ATOM 2317  N ND1  . HIS A 1 74 ? 3.103   7.484   10.401  1.00 0.00 ? 74 HIS A ND1  2  
ATOM 2318  C CD2  . HIS A 1 74 ? 1.501   8.151   11.754  1.00 0.00 ? 74 HIS A CD2  2  
ATOM 2319  C CE1  . HIS A 1 74 ? 3.138   8.806   10.459  1.00 0.00 ? 74 HIS A CE1  2  
ATOM 2320  N NE2  . HIS A 1 74 ? 2.145   9.218   11.299  1.00 0.00 ? 74 HIS A NE2  2  
ATOM 2321  H H    . HIS A 1 74 ? 2.946   4.880   9.332   1.00 0.00 ? 74 HIS A H    2  
ATOM 2322  H HA   . HIS A 1 74 ? 0.664   3.972   10.485  1.00 0.00 ? 74 HIS A HA   2  
ATOM 2323  H HB3  . HIS A 1 74 ? 2.665   5.026   11.584  1.00 0.00 ? 74 HIS A HB3  2  
ATOM 2324  H HD1  . HIS A 1 74 ? 3.714   6.905   9.862   1.00 0.00 ? 74 HIS A HD1  2  
ATOM 2325  H HD2  . HIS A 1 74 ? 0.657   8.161   12.443  1.00 0.00 ? 74 HIS A HD2  2  
ATOM 2326  H HE1  . HIS A 1 74 ? 3.838   9.453   9.929   1.00 0.00 ? 74 HIS A HE1  2  
ATOM 2327  N N    . ARG A 1 75 ? 0.156   6.540   8.603   1.00 0.00 ? 75 ARG A N    2  
ATOM 2328  C CA   . ARG A 1 75 ? -0.855  7.395   8.006   1.00 0.00 ? 75 ARG A CA   2  
ATOM 2329  C C    . ARG A 1 75 ? -1.412  6.751   6.735   1.00 0.00 ? 75 ARG A C    2  
ATOM 2330  O O    . ARG A 1 75 ? -2.606  6.853   6.454   1.00 0.00 ? 75 ARG A O    2  
ATOM 2331  C CB   . ARG A 1 75 ? -0.280  8.770   7.662   1.00 0.00 ? 75 ARG A CB   2  
ATOM 2332  C CG   . ARG A 1 75 ? 0.780   9.192   8.681   1.00 0.00 ? 75 ARG A CG   2  
ATOM 2333  C CD   . ARG A 1 75 ? 0.766   10.707  8.893   1.00 0.00 ? 75 ARG A CD   2  
ATOM 2334  N NE   . ARG A 1 75 ? -0.568  11.139  9.366   1.00 0.00 ? 75 ARG A NE   2  
ATOM 2335  C CZ   . ARG A 1 75 ? -0.833  12.358  9.855   1.00 0.00 ? 75 ARG A CZ   2  
ATOM 2336  N NH1  . ARG A 1 75 ? 0.142   13.274  9.940   1.00 0.00 ? 75 ARG A NH1  2  
ATOM 2337  N NH2  . ARG A 1 75 ? -2.074  12.663  10.260  1.00 0.00 ? 75 ARG A NH2  2  
ATOM 2338  H H    . ARG A 1 75 ? 1.049   6.565   8.155   1.00 0.00 ? 75 ARG A H    2  
ATOM 2339  H HA   . ARG A 1 75 ? -1.628  7.488   8.769   1.00 0.00 ? 75 ARG A HA   2  
ATOM 2340  H HB3  . ARG A 1 75 ? -1.082  9.509   7.640   1.00 0.00 ? 75 ARG A HB3  2  
ATOM 2341  H HG3  . ARG A 1 75 ? 1.766   8.879   8.336   1.00 0.00 ? 75 ARG A HG3  2  
ATOM 2342  H HD3  . ARG A 1 75 ? 1.013   11.215  7.961   1.00 0.00 ? 75 ARG A HD3  2  
ATOM 2343  H HE   . ARG A 1 75 ? -1.319  10.480  9.316   1.00 0.00 ? 75 ARG A HE   2  
ATOM 2344  H HH11 . ARG A 1 75 ? 1.067   13.046  9.637   1.00 0.00 ? 75 ARG A HH11 2  
ATOM 2345  H HH12 . ARG A 1 75 ? -0.055  14.182  10.305  1.00 0.00 ? 75 ARG A HH12 2  
ATOM 2346  H HH21 . ARG A 1 75 ? -2.802  11.979  10.196  1.00 0.00 ? 75 ARG A HH21 2  
ATOM 2347  H HH22 . ARG A 1 75 ? -2.272  13.572  10.625  1.00 0.00 ? 75 ARG A HH22 2  
ATOM 2348  N N    . ILE A 1 76 ? -0.522  6.102   6.000   1.00 0.00 ? 76 ILE A N    2  
ATOM 2349  C CA   . ILE A 1 76 ? -0.909  5.441   4.765   1.00 0.00 ? 76 ILE A CA   2  
ATOM 2350  C C    . ILE A 1 76 ? -2.216  4.678   4.988   1.00 0.00 ? 76 ILE A C    2  
ATOM 2351  O O    . ILE A 1 76 ? -2.275  3.770   5.816   1.00 0.00 ? 76 ILE A O    2  
ATOM 2352  C CB   . ILE A 1 76 ? 0.232   4.566   4.245   1.00 0.00 ? 76 ILE A CB   2  
ATOM 2353  C CG1  . ILE A 1 76 ? 1.487   5.400   3.979   1.00 0.00 ? 76 ILE A CG1  2  
ATOM 2354  C CG2  . ILE A 1 76 ? -0.202  3.775   3.008   1.00 0.00 ? 76 ILE A CG2  2  
ATOM 2355  C CD1  . ILE A 1 76 ? 2.576   4.558   3.314   1.00 0.00 ? 76 ILE A CD1  2  
ATOM 2356  H H    . ILE A 1 76 ? 0.447   6.023   6.235   1.00 0.00 ? 76 ILE A H    2  
ATOM 2357  H HA   . ILE A 1 76 ? -1.085  6.217   4.020   1.00 0.00 ? 76 ILE A HA   2  
ATOM 2358  H HB   . ILE A 1 76 ? 0.486   3.840   5.018   1.00 0.00 ? 76 ILE A HB   2  
ATOM 2359  H HG13 . ILE A 1 76 ? 1.861   5.809   4.919   1.00 0.00 ? 76 ILE A HG13 2  
ATOM 2360  H HG21 . ILE A 1 76 ? 0.511   3.943   2.201   1.00 0.00 ? 76 ILE A HG21 2  
ATOM 2361  H HG22 . ILE A 1 76 ? -0.235  2.712   3.249   1.00 0.00 ? 76 ILE A HG22 2  
ATOM 2362  H HG23 . ILE A 1 76 ? -1.191  4.107   2.694   1.00 0.00 ? 76 ILE A HG23 2  
ATOM 2363  H HD11 . ILE A 1 76 ? 3.484   4.594   3.916   1.00 0.00 ? 76 ILE A HD11 2  
ATOM 2364  H HD12 . ILE A 1 76 ? 2.237   3.525   3.231   1.00 0.00 ? 76 ILE A HD12 2  
ATOM 2365  H HD13 . ILE A 1 76 ? 2.784   4.952   2.319   1.00 0.00 ? 76 ILE A HD13 2  
ATOM 2366  N N    . ARG A 1 77 ? -3.232  5.074   4.236   1.00 0.00 ? 77 ARG A N    2  
ATOM 2367  C CA   . ARG A 1 77 ? -4.535  4.439   4.342   1.00 0.00 ? 77 ARG A CA   2  
ATOM 2368  C C    . ARG A 1 77 ? -5.157  4.269   2.954   1.00 0.00 ? 77 ARG A C    2  
ATOM 2369  O O    . ARG A 1 77 ? -5.189  5.212   2.165   1.00 0.00 ? 77 ARG A O    2  
ATOM 2370  C CB   . ARG A 1 77 ? -5.480  5.263   5.219   1.00 0.00 ? 77 ARG A CB   2  
ATOM 2371  C CG   . ARG A 1 77 ? -5.247  4.968   6.702   1.00 0.00 ? 77 ARG A CG   2  
ATOM 2372  C CD   . ARG A 1 77 ? -5.970  3.689   7.128   1.00 0.00 ? 77 ARG A CD   2  
ATOM 2373  N NE   . ARG A 1 77 ? -7.401  3.974   7.374   1.00 0.00 ? 77 ARG A NE   2  
ATOM 2374  C CZ   . ARG A 1 77 ? -8.336  3.030   7.550   1.00 0.00 ? 77 ARG A CZ   2  
ATOM 2375  N NH1  . ARG A 1 77 ? -7.996  1.734   7.510   1.00 0.00 ? 77 ARG A NH1  2  
ATOM 2376  N NH2  . ARG A 1 77 ? -9.610  3.382   7.768   1.00 0.00 ? 77 ARG A NH2  2  
ATOM 2377  H H    . ARG A 1 77 ? -3.176  5.813   3.565   1.00 0.00 ? 77 ARG A H    2  
ATOM 2378  H HA   . ARG A 1 77 ? -4.336  3.472   4.803   1.00 0.00 ? 77 ARG A HA   2  
ATOM 2379  H HB3  . ARG A 1 77 ? -6.514  5.037   4.958   1.00 0.00 ? 77 ARG A HB3  2  
ATOM 2380  H HG3  . ARG A 1 77 ? -5.599  5.806   7.303   1.00 0.00 ? 77 ARG A HG3  2  
ATOM 2381  H HD3  . ARG A 1 77 ? -5.511  3.285   8.030   1.00 0.00 ? 77 ARG A HD3  2  
ATOM 2382  H HE   . ARG A 1 77 ? -7.689  4.931   7.410   1.00 0.00 ? 77 ARG A HE   2  
ATOM 2383  H HH11 . ARG A 1 77 ? -7.044  1.472   7.348   1.00 0.00 ? 77 ARG A HH11 2  
ATOM 2384  H HH12 . ARG A 1 77 ? -8.693  1.031   7.642   1.00 0.00 ? 77 ARG A HH12 2  
ATOM 2385  H HH21 . ARG A 1 77 ? -9.863  4.349   7.798   1.00 0.00 ? 77 ARG A HH21 2  
ATOM 2386  H HH22 . ARG A 1 77 ? -10.308 2.678   7.900   1.00 0.00 ? 77 ARG A HH22 2  
ATOM 2387  N N    . PHE A 1 78 ? -5.636  3.060   2.699   1.00 0.00 ? 78 PHE A N    2  
ATOM 2388  C CA   . PHE A 1 78 ? -6.255  2.755   1.421   1.00 0.00 ? 78 PHE A CA   2  
ATOM 2389  C C    . PHE A 1 78 ? -7.733  3.147   1.420   1.00 0.00 ? 78 PHE A C    2  
ATOM 2390  O O    . PHE A 1 78 ? -8.392  3.100   2.457   1.00 0.00 ? 78 PHE A O    2  
ATOM 2391  C CB   . PHE A 1 78 ? -6.140  1.243   1.218   1.00 0.00 ? 78 PHE A CB   2  
ATOM 2392  C CG   . PHE A 1 78 ? -4.766  0.782   0.730   1.00 0.00 ? 78 PHE A CG   2  
ATOM 2393  C CD1  . PHE A 1 78 ? -3.646  1.143   1.412   1.00 0.00 ? 78 PHE A CD1  2  
ATOM 2394  C CD2  . PHE A 1 78 ? -4.663  0.011   -0.385  1.00 0.00 ? 78 PHE A CD2  2  
ATOM 2395  C CE1  . PHE A 1 78 ? -2.369  0.715   0.960   1.00 0.00 ? 78 PHE A CE1  2  
ATOM 2396  C CE2  . PHE A 1 78 ? -3.387  -0.417  -0.838  1.00 0.00 ? 78 PHE A CE2  2  
ATOM 2397  C CZ   . PHE A 1 78 ? -2.266  -0.055  -0.157  1.00 0.00 ? 78 PHE A CZ   2  
ATOM 2398  H H    . PHE A 1 78 ? -5.605  2.299   3.347   1.00 0.00 ? 78 PHE A H    2  
ATOM 2399  H HA   . PHE A 1 78 ? -5.727  3.331   0.659   1.00 0.00 ? 78 PHE A HA   2  
ATOM 2400  H HB3  . PHE A 1 78 ? -6.895  0.925   0.499   1.00 0.00 ? 78 PHE A HB3  2  
ATOM 2401  H HD1  . PHE A 1 78 ? -3.728  1.761   2.307   1.00 0.00 ? 78 PHE A HD1  2  
ATOM 2402  H HD2  . PHE A 1 78 ? -5.560  -0.279  -0.932  1.00 0.00 ? 78 PHE A HD2  2  
ATOM 2403  H HE1  . PHE A 1 78 ? -1.473  1.005   1.506   1.00 0.00 ? 78 PHE A HE1  2  
ATOM 2404  H HE2  . PHE A 1 78 ? -3.304  -1.034  -1.733  1.00 0.00 ? 78 PHE A HE2  2  
ATOM 2405  H HZ   . PHE A 1 78 ? -1.287  -0.382  -0.504  1.00 0.00 ? 78 PHE A HZ   2  
ATOM 2406  N N    . LYS A 1 79 ? -8.212  3.526   0.244   1.00 0.00 ? 79 LYS A N    2  
ATOM 2407  C CA   . LYS A 1 79 ? -9.600  3.926   0.094   1.00 0.00 ? 79 LYS A CA   2  
ATOM 2408  C C    . LYS A 1 79 ? -10.195 3.238   -1.136  1.00 0.00 ? 79 LYS A C    2  
ATOM 2409  O O    . LYS A 1 79 ? -9.758  3.482   -2.259  1.00 0.00 ? 79 LYS A O    2  
ATOM 2410  C CB   . LYS A 1 79 ? -9.718  5.452   0.063   1.00 0.00 ? 79 LYS A CB   2  
ATOM 2411  C CG   . LYS A 1 79 ? -10.016 6.007   1.457   1.00 0.00 ? 79 LYS A CG   2  
ATOM 2412  C CD   . LYS A 1 79 ? -11.523 6.084   1.707   1.00 0.00 ? 79 LYS A CD   2  
ATOM 2413  C CE   . LYS A 1 79 ? -12.089 7.425   1.236   1.00 0.00 ? 79 LYS A CE   2  
ATOM 2414  N NZ   . LYS A 1 79 ? -11.988 8.436   2.312   1.00 0.00 ? 79 LYS A NZ   2  
ATOM 2415  H H    . LYS A 1 79 ? -7.669  3.561   -0.596  1.00 0.00 ? 79 LYS A H    2  
ATOM 2416  H HA   . LYS A 1 79 ? -10.137 3.580   0.978   1.00 0.00 ? 79 LYS A HA   2  
ATOM 2417  H HB3  . LYS A 1 79 ? -10.509 5.745   -0.626  1.00 0.00 ? 79 LYS A HB3  2  
ATOM 2418  H HG3  . LYS A 1 79 ? -9.576  6.999   1.559   1.00 0.00 ? 79 LYS A HG3  2  
ATOM 2419  H HD3  . LYS A 1 79 ? -11.727 5.951   2.769   1.00 0.00 ? 79 LYS A HD3  2  
ATOM 2420  H HE3  . LYS A 1 79 ? -13.131 7.303   0.940   1.00 0.00 ? 79 LYS A HE3  2  
ATOM 2421  H HZ1  . LYS A 1 79 ? -11.349 8.116   3.011   1.00 0.00 ? 79 LYS A HZ1  2  
ATOM 2422  H HZ2  . LYS A 1 79 ? -11.657 9.298   1.929   1.00 0.00 ? 79 LYS A HZ2  2  
ATOM 2423  H HZ3  . LYS A 1 79 ? -12.888 8.578   2.722   1.00 0.00 ? 79 LYS A HZ3  2  
ATOM 2424  N N    . LEU A 1 80 ? -11.184 2.394   -0.883  1.00 0.00 ? 80 LEU A N    2  
ATOM 2425  C CA   . LEU A 1 80 ? -11.844 1.670   -1.955  1.00 0.00 ? 80 LEU A CA   2  
ATOM 2426  C C    . LEU A 1 80 ? -13.052 2.472   -2.439  1.00 0.00 ? 80 LEU A C    2  
ATOM 2427  O O    . LEU A 1 80 ? -13.604 3.281   -1.693  1.00 0.00 ? 80 LEU A O    2  
ATOM 2428  C CB   . LEU A 1 80 ? -12.189 0.247   -1.508  1.00 0.00 ? 80 LEU A CB   2  
ATOM 2429  C CG   . LEU A 1 80 ? -11.047 -0.768  -1.564  1.00 0.00 ? 80 LEU A CG   2  
ATOM 2430  C CD1  . LEU A 1 80 ? -11.524 -2.156  -1.127  1.00 0.00 ? 80 LEU A CD1  2  
ATOM 2431  C CD2  . LEU A 1 80 ? -10.403 -0.796  -2.952  1.00 0.00 ? 80 LEU A CD2  2  
ATOM 2432  H H    . LEU A 1 80 ? -11.534 2.202   0.035   1.00 0.00 ? 80 LEU A H    2  
ATOM 2433  H HA   . LEU A 1 80 ? -11.133 1.586   -2.778  1.00 0.00 ? 80 LEU A HA   2  
ATOM 2434  H HB3  . LEU A 1 80 ? -13.006 -0.119  -2.130  1.00 0.00 ? 80 LEU A HB3  2  
ATOM 2435  H HG   . LEU A 1 80 ? -10.277 -0.457  -0.859  1.00 0.00 ? 80 LEU A HG   2  
ATOM 2436  H HD11 . LEU A 1 80 ? -12.448 -2.402  -1.649  1.00 0.00 ? 80 LEU A HD11 2  
ATOM 2437  H HD12 . LEU A 1 80 ? -10.761 -2.895  -1.367  1.00 0.00 ? 80 LEU A HD12 2  
ATOM 2438  H HD13 . LEU A 1 80 ? -11.704 -2.155  -0.051  1.00 0.00 ? 80 LEU A HD13 2  
ATOM 2439  H HD21 . LEU A 1 80 ? -9.405  -0.362  -2.899  1.00 0.00 ? 80 LEU A HD21 2  
ATOM 2440  H HD22 . LEU A 1 80 ? -10.334 -1.827  -3.300  1.00 0.00 ? 80 LEU A HD22 2  
ATOM 2441  H HD23 . LEU A 1 80 ? -11.014 -0.218  -3.646  1.00 0.00 ? 80 LEU A HD23 2  
ATOM 2442  N N    . LYS A 1 81 ? -13.430 2.221   -3.684  1.00 0.00 ? 81 LYS A N    2  
ATOM 2443  C CA   . LYS A 1 81 ? -14.563 2.911   -4.276  1.00 0.00 ? 81 LYS A CA   2  
ATOM 2444  C C    . LYS A 1 81 ? -15.795 2.713   -3.390  1.00 0.00 ? 81 LYS A C    2  
ATOM 2445  O O    . LYS A 1 81 ? -16.712 3.532   -3.405  1.00 0.00 ? 81 LYS A O    2  
ATOM 2446  C CB   . LYS A 1 81 ? -14.769 2.460   -5.723  1.00 0.00 ? 81 LYS A CB   2  
ATOM 2447  C CG   . LYS A 1 81 ? -15.376 1.058   -5.780  1.00 0.00 ? 81 LYS A CG   2  
ATOM 2448  C CD   . LYS A 1 81 ? -14.528 0.126   -6.648  1.00 0.00 ? 81 LYS A CD   2  
ATOM 2449  C CE   . LYS A 1 81 ? -14.776 -1.339  -6.285  1.00 0.00 ? 81 LYS A CE   2  
ATOM 2450  N NZ   . LYS A 1 81 ? -13.816 -1.787  -5.251  1.00 0.00 ? 81 LYS A NZ   2  
ATOM 2451  H H    . LYS A 1 81 ? -12.976 1.562   -4.283  1.00 0.00 ? 81 LYS A H    2  
ATOM 2452  H HA   . LYS A 1 81 ? -14.323 3.974   -4.301  1.00 0.00 ? 81 LYS A HA   2  
ATOM 2453  H HB3  . LYS A 1 81 ? -13.814 2.468   -6.249  1.00 0.00 ? 81 LYS A HB3  2  
ATOM 2454  H HG3  . LYS A 1 81 ? -16.389 1.112   -6.181  1.00 0.00 ? 81 LYS A HG3  2  
ATOM 2455  H HD3  . LYS A 1 81 ? -13.472 0.363   -6.517  1.00 0.00 ? 81 LYS A HD3  2  
ATOM 2456  H HE3  . LYS A 1 81 ? -14.679 -1.962  -7.174  1.00 0.00 ? 81 LYS A HE3  2  
ATOM 2457  H HZ1  . LYS A 1 81 ? -14.081 -2.692  -4.919  1.00 0.00 ? 81 LYS A HZ1  2  
ATOM 2458  H HZ2  . LYS A 1 81 ? -12.899 -1.833  -5.646  1.00 0.00 ? 81 LYS A HZ2  2  
ATOM 2459  H HZ3  . LYS A 1 81 ? -13.819 -1.138  -4.490  1.00 0.00 ? 81 LYS A HZ3  2  
ATOM 2460  N N    . ARG A 1 82 ? -15.775 1.621   -2.639  1.00 0.00 ? 82 ARG A N    2  
ATOM 2461  C CA   . ARG A 1 82 ? -16.878 1.305   -1.749  1.00 0.00 ? 82 ARG A CA   2  
ATOM 2462  C C    . ARG A 1 82 ? -16.468 1.536   -0.292  1.00 0.00 ? 82 ARG A C    2  
ATOM 2463  O O    . ARG A 1 82 ? -15.411 1.078   0.138   1.00 0.00 ? 82 ARG A O    2  
ATOM 2464  C CB   . ARG A 1 82 ? -17.327 -0.148  -1.921  1.00 0.00 ? 82 ARG A CB   2  
ATOM 2465  C CG   . ARG A 1 82 ? -18.476 -0.484  -0.968  1.00 0.00 ? 82 ARG A CG   2  
ATOM 2466  C CD   . ARG A 1 82 ? -18.447 -1.962  -0.574  1.00 0.00 ? 82 ARG A CD   2  
ATOM 2467  N NE   . ARG A 1 82 ? -19.582 -2.675  -1.198  1.00 0.00 ? 82 ARG A NE   2  
ATOM 2468  C CZ   . ARG A 1 82 ? -20.849 -2.595  -0.765  1.00 0.00 ? 82 ARG A CZ   2  
ATOM 2469  N NH1  . ARG A 1 82 ? -21.147 -1.833  0.295   1.00 0.00 ? 82 ARG A NH1  2  
ATOM 2470  N NH2  . ARG A 1 82 ? -21.815 -3.277  -1.395  1.00 0.00 ? 82 ARG A NH2  2  
ATOM 2471  H H    . ARG A 1 82 ? -15.024 0.960   -2.633  1.00 0.00 ? 82 ARG A H    2  
ATOM 2472  H HA   . ARG A 1 82 ? -17.678 1.985   -2.043  1.00 0.00 ? 82 ARG A HA   2  
ATOM 2473  H HB3  . ARG A 1 82 ? -16.486 -0.816  -1.733  1.00 0.00 ? 82 ARG A HB3  2  
ATOM 2474  H HG3  . ARG A 1 82 ? -19.428 -0.249  -1.444  1.00 0.00 ? 82 ARG A HG3  2  
ATOM 2475  H HD3  . ARG A 1 82 ? -18.497 -2.058  0.511   1.00 0.00 ? 82 ARG A HD3  2  
ATOM 2476  H HE   . ARG A 1 82 ? -19.394 -3.252  -1.993  1.00 0.00 ? 82 ARG A HE   2  
ATOM 2477  H HH11 . ARG A 1 82 ? -20.426 -1.324  0.765   1.00 0.00 ? 82 ARG A HH11 2  
ATOM 2478  H HH12 . ARG A 1 82 ? -22.092 -1.774  0.618   1.00 0.00 ? 82 ARG A HH12 2  
ATOM 2479  H HH21 . ARG A 1 82 ? -21.592 -3.846  -2.186  1.00 0.00 ? 82 ARG A HH21 2  
ATOM 2480  H HH22 . ARG A 1 82 ? -22.760 -3.219  -1.072  1.00 0.00 ? 82 ARG A HH22 2  
ATOM 2481  N N    . PRO A 1 83 ? -17.349 2.265   0.443   1.00 0.00 ? 83 PRO A N    2  
ATOM 2482  C CA   . PRO A 1 83 ? -17.089 2.562   1.842   1.00 0.00 ? 83 PRO A CA   2  
ATOM 2483  C C    . PRO A 1 83 ? -17.324 1.329   2.717   1.00 0.00 ? 83 PRO A C    2  
ATOM 2484  O O    . PRO A 1 83 ? -18.461 1.025   3.075   1.00 0.00 ? 83 PRO A O    2  
ATOM 2485  C CB   . PRO A 1 83 ? -18.020 3.716   2.179   1.00 0.00 ? 83 PRO A CB   2  
ATOM 2486  C CG   . PRO A 1 83 ? -19.091 3.715   1.099   1.00 0.00 ? 83 PRO A CG   2  
ATOM 2487  C CD   . PRO A 1 83 ? -18.612 2.823   -0.033  1.00 0.00 ? 83 PRO A CD   2  
ATOM 2488  H HA   . PRO A 1 83 ? -16.129 2.811   1.972   1.00 0.00 ? 83 PRO A HA   2  
ATOM 2489  H HB3  . PRO A 1 83 ? -17.479 4.662   2.193   1.00 0.00 ? 83 PRO A HB3  2  
ATOM 2490  H HG3  . PRO A 1 83 ? -19.269 4.729   0.739   1.00 0.00 ? 83 PRO A HG3  2  
ATOM 2491  H HD3  . PRO A 1 83 ? -18.470 3.392   -0.952  1.00 0.00 ? 83 PRO A HD3  2  
ATOM 2492  N N    . SER A 1 84 ? -16.230 0.653   3.037   1.00 0.00 ? 84 SER A N    2  
ATOM 2493  C CA   . SER A 1 84 ? -16.303 -0.540  3.863   1.00 0.00 ? 84 SER A CA   2  
ATOM 2494  C C    . SER A 1 84 ? -14.908 -0.914  4.367   1.00 0.00 ? 84 SER A C    2  
ATOM 2495  O O    . SER A 1 84 ? -14.055 -1.339  3.588   1.00 0.00 ? 84 SER A O    2  
ATOM 2496  C CB   . SER A 1 84 ? -16.919 -1.709  3.091   1.00 0.00 ? 84 SER A CB   2  
ATOM 2497  O OG   . SER A 1 84 ? -17.190 -2.824  3.936   1.00 0.00 ? 84 SER A OG   2  
ATOM 2498  H H    . SER A 1 84 ? -15.310 0.906   2.742   1.00 0.00 ? 84 SER A H    2  
ATOM 2499  H HA   . SER A 1 84 ? -16.953 -0.274  4.697   1.00 0.00 ? 84 SER A HA   2  
ATOM 2500  H HB3  . SER A 1 84 ? -16.240 -2.015  2.295   1.00 0.00 ? 84 SER A HB3  2  
ATOM 2501  H HG   . SER A 1 84 ? -17.234 -3.662  3.393   1.00 0.00 ? 84 SER A HG   2  
ATOM 2502  N N    . SER A 1 85 ? -14.716 -0.742  5.667   1.00 0.00 ? 85 SER A N    2  
ATOM 2503  C CA   . SER A 1 85 ? -13.440 -1.055  6.284   1.00 0.00 ? 85 SER A CA   2  
ATOM 2504  C C    . SER A 1 85 ? -13.624 -1.275  7.786   1.00 0.00 ? 85 SER A C    2  
ATOM 2505  O O    . SER A 1 85 ? -14.468 -0.635  8.412   1.00 0.00 ? 85 SER A O    2  
ATOM 2506  C CB   . SER A 1 85 ? -12.419 0.057   6.031   1.00 0.00 ? 85 SER A CB   2  
ATOM 2507  O OG   . SER A 1 85 ? -11.079 -0.399  6.203   1.00 0.00 ? 85 SER A OG   2  
ATOM 2508  H H    . SER A 1 85 ? -15.415 -0.395  6.293   1.00 0.00 ? 85 SER A H    2  
ATOM 2509  H HA   . SER A 1 85 ? -13.102 -1.972  5.800   1.00 0.00 ? 85 SER A HA   2  
ATOM 2510  H HB3  . SER A 1 85 ? -12.609 0.886   6.713   1.00 0.00 ? 85 SER A HB3  2  
ATOM 2511  H HG   . SER A 1 85 ? -10.446 0.372   6.145   1.00 0.00 ? 85 SER A HG   2  
ATOM 2512  N N    . GLY A 1 86 ? -12.820 -2.182  8.322   1.00 0.00 ? 86 GLY A N    2  
ATOM 2513  C CA   . GLY A 1 86 ? -12.885 -2.495  9.740   1.00 0.00 ? 86 GLY A CA   2  
ATOM 2514  C C    . GLY A 1 86 ? -11.536 -2.246  10.418  1.00 0.00 ? 86 GLY A C    2  
ATOM 2515  O O    . GLY A 1 86 ? -10.495 -2.264  9.763   1.00 0.00 ? 86 GLY A O    2  
ATOM 2516  H H    . GLY A 1 86 ? -12.136 -2.698  7.806   1.00 0.00 ? 86 GLY A H    2  
ATOM 2517  H HA2  . GLY A 1 86 ? -13.653 -1.886  10.216  1.00 0.00 ? 86 GLY A HA2  2  
ATOM 2518  H HA3  . GLY A 1 86 ? -13.175 -3.537  9.873   1.00 0.00 ? 86 GLY A HA3  2  
ATOM 2519  N N    . PRO A 1 87 ? -11.600 -2.012  11.755  1.00 0.00 ? 87 PRO A N    2  
ATOM 2520  C CA   . PRO A 1 87 ? -10.397 -1.758  12.530  1.00 0.00 ? 87 PRO A CA   2  
ATOM 2521  C C    . PRO A 1 87 ? -9.610  -3.051  12.758  1.00 0.00 ? 87 PRO A C    2  
ATOM 2522  O O    . PRO A 1 87 ? -10.143 -4.147  12.585  1.00 0.00 ? 87 PRO A O    2  
ATOM 2523  C CB   . PRO A 1 87 ? -10.886 -1.125  13.822  1.00 0.00 ? 87 PRO A CB   2  
ATOM 2524  C CG   . PRO A 1 87 ? -12.363 -1.471  13.922  1.00 0.00 ? 87 PRO A CG   2  
ATOM 2525  C CD   . PRO A 1 87 ? -12.815 -1.983  12.564  1.00 0.00 ? 87 PRO A CD   2  
ATOM 2526  H HA   . PRO A 1 87 ? -9.782  -1.150  12.028  1.00 0.00 ? 87 PRO A HA   2  
ATOM 2527  H HB3  . PRO A 1 87 ? -10.738 -0.047  13.809  1.00 0.00 ? 87 PRO A HB3  2  
ATOM 2528  H HG3  . PRO A 1 87 ? -12.942 -0.594  14.212  1.00 0.00 ? 87 PRO A HG3  2  
ATOM 2529  H HD3  . PRO A 1 87 ? -13.567 -1.328  12.125  1.00 0.00 ? 87 PRO A HD3  2  
ATOM 2530  N N    . SER A 1 88 ? -8.354  -2.881  13.143  1.00 0.00 ? 88 SER A N    2  
ATOM 2531  C CA   . SER A 1 88 ? -7.487  -4.020  13.396  1.00 0.00 ? 88 SER A CA   2  
ATOM 2532  C C    . SER A 1 88 ? -6.201  -3.557  14.083  1.00 0.00 ? 88 SER A C    2  
ATOM 2533  O O    . SER A 1 88 ? -5.929  -3.937  15.221  1.00 0.00 ? 88 SER A O    2  
ATOM 2534  C CB   . SER A 1 88 ? -7.160  -4.762  12.099  1.00 0.00 ? 88 SER A CB   2  
ATOM 2535  O OG   . SER A 1 88 ? -6.779  -6.114  12.339  1.00 0.00 ? 88 SER A OG   2  
ATOM 2536  H H    . SER A 1 88 ? -7.927  -1.987  13.281  1.00 0.00 ? 88 SER A H    2  
ATOM 2537  H HA   . SER A 1 88 ? -8.058  -4.675  14.055  1.00 0.00 ? 88 SER A HA   2  
ATOM 2538  H HB3  . SER A 1 88 ? -6.353  -4.245  11.580  1.00 0.00 ? 88 SER A HB3  2  
ATOM 2539  H HG   . SER A 1 88 ? -6.596  -6.250  13.312  1.00 0.00 ? 88 SER A HG   2  
ATOM 2540  N N    . SER A 1 89 ? -5.444  -2.742  13.362  1.00 0.00 ? 89 SER A N    2  
ATOM 2541  C CA   . SER A 1 89 ? -4.193  -2.223  13.888  1.00 0.00 ? 89 SER A CA   2  
ATOM 2542  C C    . SER A 1 89 ? -3.312  -3.376  14.375  1.00 0.00 ? 89 SER A C    2  
ATOM 2543  O O    . SER A 1 89 ? -3.536  -3.918  15.456  1.00 0.00 ? 89 SER A O    2  
ATOM 2544  C CB   . SER A 1 89 ? -4.442  -1.229  15.023  1.00 0.00 ? 89 SER A CB   2  
ATOM 2545  O OG   . SER A 1 89 ? -4.917  0.025   14.540  1.00 0.00 ? 89 SER A OG   2  
ATOM 2546  H H    . SER A 1 89 ? -5.673  -2.438  12.437  1.00 0.00 ? 89 SER A H    2  
ATOM 2547  H HA   . SER A 1 89 ? -3.720  -1.709  13.051  1.00 0.00 ? 89 SER A HA   2  
ATOM 2548  H HB3  . SER A 1 89 ? -3.518  -1.076  15.580  1.00 0.00 ? 89 SER A HB3  2  
ATOM 2549  H HG   . SER A 1 89 ? -5.844  -0.077  14.180  1.00 0.00 ? 89 SER A HG   2  
ATOM 2550  N N    . GLY A 1 90 ? -2.328  -3.715  13.554  1.00 0.00 ? 90 GLY A N    2  
ATOM 2551  C CA   . GLY A 1 90 ? -1.413  -4.793  13.889  1.00 0.00 ? 90 GLY A CA   2  
ATOM 2552  C C    . GLY A 1 90 ? -1.921  -6.131  13.350  1.00 0.00 ? 90 GLY A C    2  
ATOM 2553  O O    . GLY A 1 90 ? -2.982  -6.192  12.730  1.00 0.00 ? 90 GLY A O    2  
ATOM 2554  H H    . GLY A 1 90 ? -2.153  -3.268  12.677  1.00 0.00 ? 90 GLY A H    2  
ATOM 2555  H HA2  . GLY A 1 90 ? -0.428  -4.580  13.474  1.00 0.00 ? 90 GLY A HA2  2  
ATOM 2556  H HA3  . GLY A 1 90 ? -1.296  -4.853  14.971  1.00 0.00 ? 90 GLY A HA3  2  
ATOM 2557  N N    . GLY A 1 1  ? 4.952   -20.163 0.403   1.00 0.00 ? 1  GLY A N    3  
ATOM 2558  C CA   . GLY A 1 1  ? 4.820   -19.282 1.550   1.00 0.00 ? 1  GLY A CA   3  
ATOM 2559  C C    . GLY A 1 1  ? 6.185   -18.748 1.992   1.00 0.00 ? 1  GLY A C    3  
ATOM 2560  O O    . GLY A 1 1  ? 7.218   -19.181 1.483   1.00 0.00 ? 1  GLY A O    3  
ATOM 2561  H H1   . GLY A 1 1  ? 5.212   -19.711 -0.450  1.00 0.00 ? 1  GLY A H1   3  
ATOM 2562  H HA2  . GLY A 1 1  ? 4.164   -18.448 1.299   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2563  H HA3  . GLY A 1 1  ? 4.351   -19.818 2.374   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2564  N N    . SER A 1 2  ? 6.145   -17.817 2.933   1.00 0.00 ? 2  SER A N    3  
ATOM 2565  C CA   . SER A 1 2  ? 7.366   -17.221 3.449   1.00 0.00 ? 2  SER A CA   3  
ATOM 2566  C C    . SER A 1 2  ? 7.079   -16.501 4.768   1.00 0.00 ? 2  SER A C    3  
ATOM 2567  O O    . SER A 1 2  ? 6.046   -15.851 4.913   1.00 0.00 ? 2  SER A O    3  
ATOM 2568  C CB   . SER A 1 2  ? 7.975   -16.251 2.436   1.00 0.00 ? 2  SER A CB   3  
ATOM 2569  O OG   . SER A 1 2  ? 9.324   -15.920 2.758   1.00 0.00 ? 2  SER A OG   3  
ATOM 2570  H H    . SER A 1 2  ? 5.300   -17.471 3.341   1.00 0.00 ? 2  SER A H    3  
ATOM 2571  H HA   . SER A 1 2  ? 8.049   -18.055 3.608   1.00 0.00 ? 2  SER A HA   3  
ATOM 2572  H HB3  . SER A 1 2  ? 7.377   -15.340 2.400   1.00 0.00 ? 2  SER A HB3  3  
ATOM 2573  H HG   . SER A 1 2  ? 9.940   -16.285 2.061   1.00 0.00 ? 2  SER A HG   3  
ATOM 2574  N N    . SER A 1 3  ? 8.014   -16.642 5.697   1.00 0.00 ? 3  SER A N    3  
ATOM 2575  C CA   . SER A 1 3  ? 7.874   -16.012 6.999   1.00 0.00 ? 3  SER A CA   3  
ATOM 2576  C C    . SER A 1 3  ? 9.189   -15.337 7.397   1.00 0.00 ? 3  SER A C    3  
ATOM 2577  O O    . SER A 1 3  ? 10.064  -15.972 7.984   1.00 0.00 ? 3  SER A O    3  
ATOM 2578  C CB   . SER A 1 3  ? 7.459   -17.032 8.062   1.00 0.00 ? 3  SER A CB   3  
ATOM 2579  O OG   . SER A 1 3  ? 6.045   -17.202 8.114   1.00 0.00 ? 3  SER A OG   3  
ATOM 2580  H H    . SER A 1 3  ? 8.852   -17.173 5.571   1.00 0.00 ? 3  SER A H    3  
ATOM 2581  H HA   . SER A 1 3  ? 7.085   -15.271 6.879   1.00 0.00 ? 3  SER A HA   3  
ATOM 2582  H HB3  . SER A 1 3  ? 7.822   -16.708 9.037   1.00 0.00 ? 3  SER A HB3  3  
ATOM 2583  H HG   . SER A 1 3  ? 5.819   -18.176 8.146   1.00 0.00 ? 3  SER A HG   3  
ATOM 2584  N N    . GLY A 1 4  ? 9.285   -14.060 7.061   1.00 0.00 ? 4  GLY A N    3  
ATOM 2585  C CA   . GLY A 1 4  ? 10.478  -13.292 7.376   1.00 0.00 ? 4  GLY A CA   3  
ATOM 2586  C C    . GLY A 1 4  ? 11.203  -12.858 6.101   1.00 0.00 ? 4  GLY A C    3  
ATOM 2587  O O    . GLY A 1 4  ? 11.626  -13.696 5.306   1.00 0.00 ? 4  GLY A O    3  
ATOM 2588  H H    . GLY A 1 4  ? 8.569   -13.551 6.583   1.00 0.00 ? 4  GLY A H    3  
ATOM 2589  H HA2  . GLY A 1 4  ? 10.206  -12.413 7.960   1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2590  H HA3  . GLY A 1 4  ? 11.148  -13.890 7.994   1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2591  N N    . SER A 1 5  ? 11.326  -11.547 5.944   1.00 0.00 ? 5  SER A N    3  
ATOM 2592  C CA   . SER A 1 5  ? 11.992  -10.991 4.778   1.00 0.00 ? 5  SER A CA   3  
ATOM 2593  C C    . SER A 1 5  ? 12.539  -9.601  5.102   1.00 0.00 ? 5  SER A C    3  
ATOM 2594  O O    . SER A 1 5  ? 11.846  -8.782  5.704   1.00 0.00 ? 5  SER A O    3  
ATOM 2595  C CB   . SER A 1 5  ? 11.042  -10.923 3.581   1.00 0.00 ? 5  SER A CB   3  
ATOM 2596  O OG   . SER A 1 5  ? 11.731  -11.080 2.344   1.00 0.00 ? 5  SER A OG   3  
ATOM 2597  H H    . SER A 1 5  ? 10.979  -10.872 6.594   1.00 0.00 ? 5  SER A H    3  
ATOM 2598  H HA   . SER A 1 5  ? 12.807  -11.681 4.556   1.00 0.00 ? 5  SER A HA   3  
ATOM 2599  H HB3  . SER A 1 5  ? 10.520  -9.967  3.587   1.00 0.00 ? 5  SER A HB3  3  
ATOM 2600  H HG   . SER A 1 5  ? 12.583  -10.555 2.357   1.00 0.00 ? 5  SER A HG   3  
ATOM 2601  N N    . SER A 1 6  ? 13.777  -9.375  4.689   1.00 0.00 ? 6  SER A N    3  
ATOM 2602  C CA   . SER A 1 6  ? 14.425  -8.096  4.927   1.00 0.00 ? 6  SER A CA   3  
ATOM 2603  C C    . SER A 1 6  ? 14.421  -7.260  3.646   1.00 0.00 ? 6  SER A C    3  
ATOM 2604  O O    . SER A 1 6  ? 14.227  -7.793  2.555   1.00 0.00 ? 6  SER A O    3  
ATOM 2605  C CB   . SER A 1 6  ? 15.857  -8.289  5.431   1.00 0.00 ? 6  SER A CB   3  
ATOM 2606  O OG   . SER A 1 6  ? 16.029  -7.790  6.754   1.00 0.00 ? 6  SER A OG   3  
ATOM 2607  H H    . SER A 1 6  ? 14.335  -10.046 4.201   1.00 0.00 ? 6  SER A H    3  
ATOM 2608  H HA   . SER A 1 6  ? 13.831  -7.611  5.702   1.00 0.00 ? 6  SER A HA   3  
ATOM 2609  H HB3  . SER A 1 6  ? 16.549  -7.782  4.759   1.00 0.00 ? 6  SER A HB3  3  
ATOM 2610  H HG   . SER A 1 6  ? 16.869  -7.251  6.809   1.00 0.00 ? 6  SER A HG   3  
ATOM 2611  N N    . GLY A 1 7  ? 14.638  -5.965  3.822   1.00 0.00 ? 7  GLY A N    3  
ATOM 2612  C CA   . GLY A 1 7  ? 14.661  -5.050  2.693   1.00 0.00 ? 7  GLY A CA   3  
ATOM 2613  C C    . GLY A 1 7  ? 13.725  -3.864  2.929   1.00 0.00 ? 7  GLY A C    3  
ATOM 2614  O O    . GLY A 1 7  ? 12.943  -3.865  3.878   1.00 0.00 ? 7  GLY A O    3  
ATOM 2615  H H    . GLY A 1 7  ? 14.794  -5.540  4.714   1.00 0.00 ? 7  GLY A H    3  
ATOM 2616  H HA2  . GLY A 1 7  ? 15.678  -4.691  2.534   1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2617  H HA3  . GLY A 1 7  ? 14.364  -5.578  1.787   1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2618  N N    . LEU A 1 8  ? 13.835  -2.879  2.049   1.00 0.00 ? 8  LEU A N    3  
ATOM 2619  C CA   . LEU A 1 8  ? 13.009  -1.689  2.149   1.00 0.00 ? 8  LEU A CA   3  
ATOM 2620  C C    . LEU A 1 8  ? 11.769  -1.858  1.268   1.00 0.00 ? 8  LEU A C    3  
ATOM 2621  O O    . LEU A 1 8  ? 10.642  -1.753  1.750   1.00 0.00 ? 8  LEU A O    3  
ATOM 2622  C CB   . LEU A 1 8  ? 13.828  -0.439  1.824   1.00 0.00 ? 8  LEU A CB   3  
ATOM 2623  C CG   . LEU A 1 8  ? 14.464  0.276   3.019   1.00 0.00 ? 8  LEU A CG   3  
ATOM 2624  C CD1  . LEU A 1 8  ? 15.144  1.574   2.581   1.00 0.00 ? 8  LEU A CD1  3  
ATOM 2625  C CD2  . LEU A 1 8  ? 13.436  0.512   4.127   1.00 0.00 ? 8  LEU A CD2  3  
ATOM 2626  H H    . LEU A 1 8  ? 14.474  -2.887  1.279   1.00 0.00 ? 8  LEU A H    3  
ATOM 2627  H HA   . LEU A 1 8  ? 12.686  -1.603  3.187   1.00 0.00 ? 8  LEU A HA   3  
ATOM 2628  H HB3  . LEU A 1 8  ? 13.182  0.269   1.304   1.00 0.00 ? 8  LEU A HB3  3  
ATOM 2629  H HG   . LEU A 1 8  ? 15.239  -0.371  3.430   1.00 0.00 ? 8  LEU A HG   3  
ATOM 2630  H HD11 . LEU A 1 8  ? 15.629  2.038   3.440   1.00 0.00 ? 8  LEU A HD11 3  
ATOM 2631  H HD12 . LEU A 1 8  ? 15.891  1.355   1.817   1.00 0.00 ? 8  LEU A HD12 3  
ATOM 2632  H HD13 . LEU A 1 8  ? 14.398  2.257   2.174   1.00 0.00 ? 8  LEU A HD13 3  
ATOM 2633  H HD21 . LEU A 1 8  ? 12.437  0.556   3.693   1.00 0.00 ? 8  LEU A HD21 3  
ATOM 2634  H HD22 . LEU A 1 8  ? 13.484  -0.305  4.847   1.00 0.00 ? 8  LEU A HD22 3  
ATOM 2635  H HD23 . LEU A 1 8  ? 13.655  1.454   4.631   1.00 0.00 ? 8  LEU A HD23 3  
ATOM 2636  N N    . ARG A 1 9  ? 12.019  -2.119  -0.007  1.00 0.00 ? 9  ARG A N    3  
ATOM 2637  C CA   . ARG A 1 9  ? 10.938  -2.305  -0.959  1.00 0.00 ? 9  ARG A CA   3  
ATOM 2638  C C    . ARG A 1 9  ? 10.107  -3.533  -0.586  1.00 0.00 ? 9  ARG A C    3  
ATOM 2639  O O    . ARG A 1 9  ? 8.897   -3.558  -0.802  1.00 0.00 ? 9  ARG A O    3  
ATOM 2640  C CB   . ARG A 1 9  ? 11.479  -2.474  -2.380  1.00 0.00 ? 9  ARG A CB   3  
ATOM 2641  C CG   . ARG A 1 9  ? 10.337  -2.553  -3.395  1.00 0.00 ? 9  ARG A CG   3  
ATOM 2642  C CD   . ARG A 1 9  ? 10.497  -3.770  -4.308  1.00 0.00 ? 9  ARG A CD   3  
ATOM 2643  N NE   . ARG A 1 9  ? 11.636  -3.563  -5.232  1.00 0.00 ? 9  ARG A NE   3  
ATOM 2644  C CZ   . ARG A 1 9  ? 12.253  -4.550  -5.897  1.00 0.00 ? 9  ARG A CZ   3  
ATOM 2645  N NH1  . ARG A 1 9  ? 11.844  -5.817  -5.744  1.00 0.00 ? 9  ARG A NH1  3  
ATOM 2646  N NH2  . ARG A 1 9  ? 13.278  -4.269  -6.713  1.00 0.00 ? 9  ARG A NH2  3  
ATOM 2647  H H    . ARG A 1 9  ? 12.939  -2.204  -0.389  1.00 0.00 ? 9  ARG A H    3  
ATOM 2648  H HA   . ARG A 1 9  ? 10.344  -1.393  -0.887  1.00 0.00 ? 9  ARG A HA   3  
ATOM 2649  H HB3  . ARG A 1 9  ? 12.084  -3.379  -2.437  1.00 0.00 ? 9  ARG A HB3  3  
ATOM 2650  H HG3  . ARG A 1 9  ? 10.316  -1.643  -3.996  1.00 0.00 ? 9  ARG A HG3  3  
ATOM 2651  H HD3  . ARG A 1 9  ? 9.582   -3.931  -4.877  1.00 0.00 ? 9  ARG A HD3  3  
ATOM 2652  H HE   . ARG A 1 9  ? 11.966  -2.629  -5.367  1.00 0.00 ? 9  ARG A HE   3  
ATOM 2653  H HH11 . ARG A 1 9  ? 11.080  -6.026  -5.135  1.00 0.00 ? 9  ARG A HH11 3  
ATOM 2654  H HH12 . ARG A 1 9  ? 12.304  -6.553  -6.241  1.00 0.00 ? 9  ARG A HH12 3  
ATOM 2655  H HH21 . ARG A 1 9  ? 13.582  -3.323  -6.825  1.00 0.00 ? 9  ARG A HH21 3  
ATOM 2656  H HH22 . ARG A 1 9  ? 13.738  -5.005  -7.209  1.00 0.00 ? 9  ARG A HH22 3  
ATOM 2657  N N    . LYS A 1 10 ? 10.790  -4.525  -0.033  1.00 0.00 ? 10 LYS A N    3  
ATOM 2658  C CA   . LYS A 1 10 ? 10.131  -5.754  0.372   1.00 0.00 ? 10 LYS A CA   3  
ATOM 2659  C C    . LYS A 1 10 ? 9.200   -5.464  1.550   1.00 0.00 ? 10 LYS A C    3  
ATOM 2660  O O    . LYS A 1 10 ? 8.133   -6.066  1.667   1.00 0.00 ? 10 LYS A O    3  
ATOM 2661  C CB   . LYS A 1 10 ? 11.163  -6.847  0.658   1.00 0.00 ? 10 LYS A CB   3  
ATOM 2662  C CG   . LYS A 1 10 ? 10.539  -7.996  1.453   1.00 0.00 ? 10 LYS A CG   3  
ATOM 2663  C CD   . LYS A 1 10 ? 9.277   -8.518  0.764   1.00 0.00 ? 10 LYS A CD   3  
ATOM 2664  C CE   . LYS A 1 10 ? 8.119   -8.634  1.757   1.00 0.00 ? 10 LYS A CE   3  
ATOM 2665  N NZ   . LYS A 1 10 ? 7.789   -10.056 2.007   1.00 0.00 ? 10 LYS A NZ   3  
ATOM 2666  H H    . LYS A 1 10 ? 11.775  -4.497  0.138   1.00 0.00 ? 10 LYS A H    3  
ATOM 2667  H HA   . LYS A 1 10 ? 9.527   -6.094  -0.470  1.00 0.00 ? 10 LYS A HA   3  
ATOM 2668  H HB3  . LYS A 1 10 ? 11.999  -6.426  1.214   1.00 0.00 ? 10 LYS A HB3  3  
ATOM 2669  H HG3  . LYS A 1 10 ? 10.294  -7.655  2.459   1.00 0.00 ? 10 LYS A HG3  3  
ATOM 2670  H HD3  . LYS A 1 10 ? 9.478   -9.493  0.320   1.00 0.00 ? 10 LYS A HD3  3  
ATOM 2671  H HE3  . LYS A 1 10 ? 7.244   -8.115  1.366   1.00 0.00 ? 10 LYS A HE3  3  
ATOM 2672  H HZ1  . LYS A 1 10 ? 7.473   -10.164 2.949   1.00 0.00 ? 10 LYS A HZ1  3  
ATOM 2673  H HZ2  . LYS A 1 10 ? 7.068   -10.345 1.378   1.00 0.00 ? 10 LYS A HZ2  3  
ATOM 2674  H HZ3  . LYS A 1 10 ? 8.604   -10.616 1.861   1.00 0.00 ? 10 LYS A HZ3  3  
ATOM 2675  N N    . MET A 1 11 ? 9.637   -4.542  2.396   1.00 0.00 ? 11 MET A N    3  
ATOM 2676  C CA   . MET A 1 11 ? 8.857   -4.165  3.562   1.00 0.00 ? 11 MET A CA   3  
ATOM 2677  C C    . MET A 1 11 ? 7.547   -3.488  3.149   1.00 0.00 ? 11 MET A C    3  
ATOM 2678  O O    . MET A 1 11 ? 6.466   -3.944  3.520   1.00 0.00 ? 11 MET A O    3  
ATOM 2679  C CB   . MET A 1 11 ? 9.672   -3.210  4.435   1.00 0.00 ? 11 MET A CB   3  
ATOM 2680  C CG   . MET A 1 11 ? 10.338  -3.958  5.593   1.00 0.00 ? 11 MET A CG   3  
ATOM 2681  S SD   . MET A 1 11 ? 10.121  -3.047  7.112   1.00 0.00 ? 11 MET A SD   3  
ATOM 2682  C CE   . MET A 1 11 ? 11.288  -1.723  6.850   1.00 0.00 ? 11 MET A CE   3  
ATOM 2683  H H    . MET A 1 11 ? 10.506  -4.058  2.294   1.00 0.00 ? 11 MET A H    3  
ATOM 2684  H HA   . MET A 1 11 ? 8.643   -5.097  4.085   1.00 0.00 ? 11 MET A HA   3  
ATOM 2685  H HB3  . MET A 1 11 ? 9.023   -2.427  4.828   1.00 0.00 ? 11 MET A HB3  3  
ATOM 2686  H HG3  . MET A 1 11 ? 11.400  -4.092  5.387   1.00 0.00 ? 11 MET A HG3  3  
ATOM 2687  H HE1  . MET A 1 11 ? 11.409  -1.551  5.780   1.00 0.00 ? 11 MET A HE1  3  
ATOM 2688  H HE2  . MET A 1 11 ? 10.921  -0.814  7.325   1.00 0.00 ? 11 MET A HE2  3  
ATOM 2689  H HE3  . MET A 1 11 ? 12.251  -1.996  7.284   1.00 0.00 ? 11 MET A HE3  3  
ATOM 2690  N N    . VAL A 1 12 ? 7.689   -2.414  2.389   1.00 0.00 ? 12 VAL A N    3  
ATOM 2691  C CA   . VAL A 1 12 ? 6.530   -1.670  1.922   1.00 0.00 ? 12 VAL A CA   3  
ATOM 2692  C C    . VAL A 1 12 ? 5.677   -2.571  1.027   1.00 0.00 ? 12 VAL A C    3  
ATOM 2693  O O    . VAL A 1 12 ? 4.455   -2.440  0.994   1.00 0.00 ? 12 VAL A O    3  
ATOM 2694  C CB   . VAL A 1 12 ? 6.980   -0.386  1.223   1.00 0.00 ? 12 VAL A CB   3  
ATOM 2695  C CG1  . VAL A 1 12 ? 8.235   -0.630  0.382   1.00 0.00 ? 12 VAL A CG1  3  
ATOM 2696  C CG2  . VAL A 1 12 ? 5.853   0.197   0.368   1.00 0.00 ? 12 VAL A CG2  3  
ATOM 2697  H H    . VAL A 1 12 ? 8.572   -2.050  2.092   1.00 0.00 ? 12 VAL A H    3  
ATOM 2698  H HA   . VAL A 1 12 ? 5.945   -1.389  2.798   1.00 0.00 ? 12 VAL A HA   3  
ATOM 2699  H HB   . VAL A 1 12 ? 7.229   0.345   1.992   1.00 0.00 ? 12 VAL A HB   3  
ATOM 2700  H HG11 . VAL A 1 12 ? 8.132   -0.128  -0.580  1.00 0.00 ? 12 VAL A HG11 3  
ATOM 2701  H HG12 . VAL A 1 12 ? 9.105   -0.235  0.906   1.00 0.00 ? 12 VAL A HG12 3  
ATOM 2702  H HG13 . VAL A 1 12 ? 8.362   -1.700  0.222   1.00 0.00 ? 12 VAL A HG13 3  
ATOM 2703  H HG21 . VAL A 1 12 ? 6.184   1.132   -0.082  1.00 0.00 ? 12 VAL A HG21 3  
ATOM 2704  H HG22 . VAL A 1 12 ? 5.590   -0.511  -0.417  1.00 0.00 ? 12 VAL A HG22 3  
ATOM 2705  H HG23 . VAL A 1 12 ? 4.981   0.384   0.995   1.00 0.00 ? 12 VAL A HG23 3  
ATOM 2706  N N    . GLU A 1 13 ? 6.356   -3.466  0.324   1.00 0.00 ? 13 GLU A N    3  
ATOM 2707  C CA   . GLU A 1 13 ? 5.676   -4.388  -0.569  1.00 0.00 ? 13 GLU A CA   3  
ATOM 2708  C C    . GLU A 1 13 ? 4.486   -5.034  0.142   1.00 0.00 ? 13 GLU A C    3  
ATOM 2709  O O    . GLU A 1 13 ? 3.400   -5.140  -0.428  1.00 0.00 ? 13 GLU A O    3  
ATOM 2710  C CB   . GLU A 1 13 ? 6.641   -5.451  -1.098  1.00 0.00 ? 13 GLU A CB   3  
ATOM 2711  C CG   . GLU A 1 13 ? 7.369   -4.956  -2.350  1.00 0.00 ? 13 GLU A CG   3  
ATOM 2712  C CD   . GLU A 1 13 ? 6.678   -5.457  -3.620  1.00 0.00 ? 13 GLU A CD   3  
ATOM 2713  O OE1  . GLU A 1 13 ? 5.437   -5.317  -3.683  1.00 0.00 ? 13 GLU A OE1  3  
ATOM 2714  O OE2  . GLU A 1 13 ? 7.406   -5.967  -4.499  1.00 0.00 ? 13 GLU A OE2  3  
ATOM 2715  H H    . GLU A 1 13 ? 7.351   -3.565  0.357   1.00 0.00 ? 13 GLU A H    3  
ATOM 2716  H HA   . GLU A 1 13 ? 5.324   -3.779  -1.402  1.00 0.00 ? 13 GLU A HA   3  
ATOM 2717  H HB3  . GLU A 1 13 ? 6.092   -6.363  -1.329  1.00 0.00 ? 13 GLU A HB3  3  
ATOM 2718  H HG3  . GLU A 1 13 ? 8.402   -5.301  -2.334  1.00 0.00 ? 13 GLU A HG3  3  
ATOM 2719  N N    . GLU A 1 14 ? 4.729   -5.449  1.376   1.00 0.00 ? 14 GLU A N    3  
ATOM 2720  C CA   . GLU A 1 14 ? 3.689   -6.082  2.171   1.00 0.00 ? 14 GLU A CA   3  
ATOM 2721  C C    . GLU A 1 14 ? 2.701   -5.033  2.685   1.00 0.00 ? 14 GLU A C    3  
ATOM 2722  O O    . GLU A 1 14 ? 1.495   -5.271  2.710   1.00 0.00 ? 14 GLU A O    3  
ATOM 2723  C CB   . GLU A 1 14 ? 4.294   -6.880  3.329   1.00 0.00 ? 14 GLU A CB   3  
ATOM 2724  C CG   . GLU A 1 14 ? 4.386   -6.025  4.594   1.00 0.00 ? 14 GLU A CG   3  
ATOM 2725  C CD   . GLU A 1 14 ? 5.271   -6.696  5.646   1.00 0.00 ? 14 GLU A CD   3  
ATOM 2726  O OE1  . GLU A 1 14 ? 6.188   -7.435  5.228   1.00 0.00 ? 14 GLU A OE1  3  
ATOM 2727  O OE2  . GLU A 1 14 ? 5.010   -6.456  6.845   1.00 0.00 ? 14 GLU A OE2  3  
ATOM 2728  H H    . GLU A 1 14 ? 5.614   -5.359  1.833   1.00 0.00 ? 14 GLU A H    3  
ATOM 2729  H HA   . GLU A 1 14 ? 3.182   -6.767  1.492   1.00 0.00 ? 14 GLU A HA   3  
ATOM 2730  H HB3  . GLU A 1 14 ? 5.287   -7.234  3.051   1.00 0.00 ? 14 GLU A HB3  3  
ATOM 2731  H HG3  . GLU A 1 14 ? 3.389   -5.863  5.002   1.00 0.00 ? 14 GLU A HG3  3  
ATOM 2732  N N    . VAL A 1 15 ? 3.250   -3.895  3.082   1.00 0.00 ? 15 VAL A N    3  
ATOM 2733  C CA   . VAL A 1 15 ? 2.432   -2.808  3.594   1.00 0.00 ? 15 VAL A CA   3  
ATOM 2734  C C    . VAL A 1 15 ? 1.240   -2.589  2.660   1.00 0.00 ? 15 VAL A C    3  
ATOM 2735  O O    . VAL A 1 15 ? 0.108   -2.926  3.002   1.00 0.00 ? 15 VAL A O    3  
ATOM 2736  C CB   . VAL A 1 15 ? 3.285   -1.552  3.779   1.00 0.00 ? 15 VAL A CB   3  
ATOM 2737  C CG1  . VAL A 1 15 ? 2.406   -0.311  3.948   1.00 0.00 ? 15 VAL A CG1  3  
ATOM 2738  C CG2  . VAL A 1 15 ? 4.244   -1.710  4.961   1.00 0.00 ? 15 VAL A CG2  3  
ATOM 2739  H H    . VAL A 1 15 ? 4.232   -3.708  3.059   1.00 0.00 ? 15 VAL A H    3  
ATOM 2740  H HA   . VAL A 1 15 ? 2.058   -3.110  4.573   1.00 0.00 ? 15 VAL A HA   3  
ATOM 2741  H HB   . VAL A 1 15 ? 3.884   -1.418  2.878   1.00 0.00 ? 15 VAL A HB   3  
ATOM 2742  H HG11 . VAL A 1 15 ? 1.692   -0.479  4.755   1.00 0.00 ? 15 VAL A HG11 3  
ATOM 2743  H HG12 . VAL A 1 15 ? 3.032   0.548   4.189   1.00 0.00 ? 15 VAL A HG12 3  
ATOM 2744  H HG13 . VAL A 1 15 ? 1.867   -0.119  3.020   1.00 0.00 ? 15 VAL A HG13 3  
ATOM 2745  H HG21 . VAL A 1 15 ? 4.500   -2.762  5.083   1.00 0.00 ? 15 VAL A HG21 3  
ATOM 2746  H HG22 . VAL A 1 15 ? 5.149   -1.134  4.775   1.00 0.00 ? 15 VAL A HG22 3  
ATOM 2747  H HG23 . VAL A 1 15 ? 3.763   -1.347  5.870   1.00 0.00 ? 15 VAL A HG23 3  
ATOM 2748  N N    . PHE A 1 16 ? 1.536   -2.025  1.497   1.00 0.00 ? 16 PHE A N    3  
ATOM 2749  C CA   . PHE A 1 16 ? 0.504   -1.757  0.511   1.00 0.00 ? 16 PHE A CA   3  
ATOM 2750  C C    . PHE A 1 16 ? -0.422  -2.963  0.345   1.00 0.00 ? 16 PHE A C    3  
ATOM 2751  O O    . PHE A 1 16 ? -1.609  -2.804  0.061   1.00 0.00 ? 16 PHE A O    3  
ATOM 2752  C CB   . PHE A 1 16 ? 1.213   -1.486  -0.817  1.00 0.00 ? 16 PHE A CB   3  
ATOM 2753  C CG   . PHE A 1 16 ? 1.799   -0.078  -0.935  1.00 0.00 ? 16 PHE A CG   3  
ATOM 2754  C CD1  . PHE A 1 16 ? 1.110   0.988   -0.447  1.00 0.00 ? 16 PHE A CD1  3  
ATOM 2755  C CD2  . PHE A 1 16 ? 3.009   0.108   -1.528  1.00 0.00 ? 16 PHE A CD2  3  
ATOM 2756  C CE1  . PHE A 1 16 ? 1.654   2.295   -0.556  1.00 0.00 ? 16 PHE A CE1  3  
ATOM 2757  C CE2  . PHE A 1 16 ? 3.552   1.415   -1.637  1.00 0.00 ? 16 PHE A CE2  3  
ATOM 2758  C CZ   . PHE A 1 16 ? 2.863   2.481   -1.149  1.00 0.00 ? 16 PHE A CZ   3  
ATOM 2759  H H    . PHE A 1 16 ? 2.460   -1.754  1.227   1.00 0.00 ? 16 PHE A H    3  
ATOM 2760  H HA   . PHE A 1 16 ? -0.073  -0.905  0.870   1.00 0.00 ? 16 PHE A HA   3  
ATOM 2761  H HB3  . PHE A 1 16 ? 0.508   -1.645  -1.632  1.00 0.00 ? 16 PHE A HB3  3  
ATOM 2762  H HD1  . PHE A 1 16 ? 0.141   0.839   0.029   1.00 0.00 ? 16 PHE A HD1  3  
ATOM 2763  H HD2  . PHE A 1 16 ? 3.561   -0.746  -1.920  1.00 0.00 ? 16 PHE A HD2  3  
ATOM 2764  H HE1  . PHE A 1 16 ? 1.102   3.149   -0.164  1.00 0.00 ? 16 PHE A HE1  3  
ATOM 2765  H HE2  . PHE A 1 16 ? 4.522   1.564   -2.113  1.00 0.00 ? 16 PHE A HE2  3  
ATOM 2766  H HZ   . PHE A 1 16 ? 3.281   3.485   -1.233  1.00 0.00 ? 16 PHE A HZ   3  
ATOM 2767  N N    . ASP A 1 17 ? 0.154   -4.142  0.529   1.00 0.00 ? 17 ASP A N    3  
ATOM 2768  C CA   . ASP A 1 17 ? -0.605  -5.374  0.403   1.00 0.00 ? 17 ASP A CA   3  
ATOM 2769  C C    . ASP A 1 17 ? -1.553  -5.508  1.596   1.00 0.00 ? 17 ASP A C    3  
ATOM 2770  O O    . ASP A 1 17 ? -2.772  -5.527  1.425   1.00 0.00 ? 17 ASP A O    3  
ATOM 2771  C CB   . ASP A 1 17 ? 0.321   -6.593  0.395   1.00 0.00 ? 17 ASP A CB   3  
ATOM 2772  C CG   . ASP A 1 17 ? 0.529   -7.238  -0.976  1.00 0.00 ? 17 ASP A CG   3  
ATOM 2773  O OD1  . ASP A 1 17 ? 0.596   -6.471  -1.960  1.00 0.00 ? 17 ASP A OD1  3  
ATOM 2774  O OD2  . ASP A 1 17 ? 0.616   -8.484  -1.008  1.00 0.00 ? 17 ASP A OD2  3  
ATOM 2775  H H    . ASP A 1 17 ? 1.120   -4.262  0.760   1.00 0.00 ? 17 ASP A H    3  
ATOM 2776  H HA   . ASP A 1 17 ? -1.136  -5.287  -0.545  1.00 0.00 ? 17 ASP A HA   3  
ATOM 2777  H HB3  . ASP A 1 17 ? -0.085  -7.342  1.076   1.00 0.00 ? 17 ASP A HB3  3  
ATOM 2778  N N    . VAL A 1 18 ? -0.959  -5.597  2.776   1.00 0.00 ? 18 VAL A N    3  
ATOM 2779  C CA   . VAL A 1 18 ? -1.736  -5.728  3.997   1.00 0.00 ? 18 VAL A CA   3  
ATOM 2780  C C    . VAL A 1 18 ? -2.899  -4.735  3.966   1.00 0.00 ? 18 VAL A C    3  
ATOM 2781  O O    . VAL A 1 18 ? -4.062  -5.134  4.007   1.00 0.00 ? 18 VAL A O    3  
ATOM 2782  C CB   . VAL A 1 18 ? -0.829  -5.549  5.217   1.00 0.00 ? 18 VAL A CB   3  
ATOM 2783  C CG1  . VAL A 1 18 ? -1.632  -5.085  6.434   1.00 0.00 ? 18 VAL A CG1  3  
ATOM 2784  C CG2  . VAL A 1 18 ? -0.062  -6.837  5.524   1.00 0.00 ? 18 VAL A CG2  3  
ATOM 2785  H H    . VAL A 1 18 ? 0.032   -5.581  2.906   1.00 0.00 ? 18 VAL A H    3  
ATOM 2786  H HA   . VAL A 1 18 ? -2.140  -6.741  4.023   1.00 0.00 ? 18 VAL A HA   3  
ATOM 2787  H HB   . VAL A 1 18 ? -0.100  -4.773  4.981   1.00 0.00 ? 18 VAL A HB   3  
ATOM 2788  H HG11 . VAL A 1 18 ? -1.791  -4.008  6.375   1.00 0.00 ? 18 VAL A HG11 3  
ATOM 2789  H HG12 . VAL A 1 18 ? -2.596  -5.594  6.448   1.00 0.00 ? 18 VAL A HG12 3  
ATOM 2790  H HG13 . VAL A 1 18 ? -1.082  -5.323  7.344   1.00 0.00 ? 18 VAL A HG13 3  
ATOM 2791  H HG21 . VAL A 1 18 ? -0.664  -7.472  6.173   1.00 0.00 ? 18 VAL A HG21 3  
ATOM 2792  H HG22 . VAL A 1 18 ? 0.149   -7.364  4.594   1.00 0.00 ? 18 VAL A HG22 3  
ATOM 2793  H HG23 . VAL A 1 18 ? 0.875   -6.591  6.025   1.00 0.00 ? 18 VAL A HG23 3  
ATOM 2794  N N    . LEU A 1 19 ? -2.545  -3.461  3.894   1.00 0.00 ? 19 LEU A N    3  
ATOM 2795  C CA   . LEU A 1 19 ? -3.545  -2.407  3.857   1.00 0.00 ? 19 LEU A CA   3  
ATOM 2796  C C    . LEU A 1 19 ? -4.665  -2.807  2.893   1.00 0.00 ? 19 LEU A C    3  
ATOM 2797  O O    . LEU A 1 19 ? -5.812  -2.976  3.304   1.00 0.00 ? 19 LEU A O    3  
ATOM 2798  C CB   . LEU A 1 19 ? -2.896  -1.063  3.521   1.00 0.00 ? 19 LEU A CB   3  
ATOM 2799  C CG   . LEU A 1 19 ? -1.702  -0.659  4.390   1.00 0.00 ? 19 LEU A CG   3  
ATOM 2800  C CD1  . LEU A 1 19 ? -1.389  0.830   4.234   1.00 0.00 ? 19 LEU A CD1  3  
ATOM 2801  C CD2  . LEU A 1 19 ? -1.934  -1.047  5.853   1.00 0.00 ? 19 LEU A CD2  3  
ATOM 2802  H H    . LEU A 1 19 ? -1.598  -3.144  3.861   1.00 0.00 ? 19 LEU A H    3  
ATOM 2803  H HA   . LEU A 1 19 ? -3.966  -2.321  4.859   1.00 0.00 ? 19 LEU A HA   3  
ATOM 2804  H HB3  . LEU A 1 19 ? -3.656  -0.285  3.599   1.00 0.00 ? 19 LEU A HB3  3  
ATOM 2805  H HG   . LEU A 1 19 ? -0.828  -1.210  4.047   1.00 0.00 ? 19 LEU A HG   3  
ATOM 2806  H HD11 . LEU A 1 19 ? -0.312  0.967   4.141   1.00 0.00 ? 19 LEU A HD11 3  
ATOM 2807  H HD12 . LEU A 1 19 ? -1.884  1.213   3.342   1.00 0.00 ? 19 LEU A HD12 3  
ATOM 2808  H HD13 . LEU A 1 19 ? -1.750  1.370   5.110   1.00 0.00 ? 19 LEU A HD13 3  
ATOM 2809  H HD21 . LEU A 1 19 ? -1.415  -0.340  6.501   1.00 0.00 ? 19 LEU A HD21 3  
ATOM 2810  H HD22 . LEU A 1 19 ? -3.001  -1.024  6.070   1.00 0.00 ? 19 LEU A HD22 3  
ATOM 2811  H HD23 . LEU A 1 19 ? -1.548  -2.051  6.028   1.00 0.00 ? 19 LEU A HD23 3  
ATOM 2812  N N    . TYR A 1 20 ? -4.292  -2.944  1.630   1.00 0.00 ? 20 TYR A N    3  
ATOM 2813  C CA   . TYR A 1 20 ? -5.251  -3.320  0.604   1.00 0.00 ? 20 TYR A CA   3  
ATOM 2814  C C    . TYR A 1 20 ? -6.163  -4.447  1.093   1.00 0.00 ? 20 TYR A C    3  
ATOM 2815  O O    . TYR A 1 20 ? -7.384  -4.351  0.989   1.00 0.00 ? 20 TYR A O    3  
ATOM 2816  C CB   . TYR A 1 20 ? -4.425  -3.826  -0.581  1.00 0.00 ? 20 TYR A CB   3  
ATOM 2817  C CG   . TYR A 1 20 ? -5.260  -4.212  -1.803  1.00 0.00 ? 20 TYR A CG   3  
ATOM 2818  C CD1  . TYR A 1 20 ? -6.176  -3.320  -2.322  1.00 0.00 ? 20 TYR A CD1  3  
ATOM 2819  C CD2  . TYR A 1 20 ? -5.098  -5.452  -2.386  1.00 0.00 ? 20 TYR A CD2  3  
ATOM 2820  C CE1  . TYR A 1 20 ? -6.962  -3.682  -3.472  1.00 0.00 ? 20 TYR A CE1  3  
ATOM 2821  C CE2  . TYR A 1 20 ? -5.884  -5.815  -3.536  1.00 0.00 ? 20 TYR A CE2  3  
ATOM 2822  C CZ   . TYR A 1 20 ? -6.778  -4.912  -4.023  1.00 0.00 ? 20 TYR A CZ   3  
ATOM 2823  O OH   . TYR A 1 20 ? -7.521  -5.255  -5.110  1.00 0.00 ? 20 TYR A OH   3  
ATOM 2824  H H    . TYR A 1 20 ? -3.358  -2.805  1.303   1.00 0.00 ? 20 TYR A H    3  
ATOM 2825  H HA   . TYR A 1 20 ? -5.859  -2.446  0.374   1.00 0.00 ? 20 TYR A HA   3  
ATOM 2826  H HB3  . TYR A 1 20 ? -3.844  -4.692  -0.262  1.00 0.00 ? 20 TYR A HB3  3  
ATOM 2827  H HD1  . TYR A 1 20 ? -6.304  -2.340  -1.861  1.00 0.00 ? 20 TYR A HD1  3  
ATOM 2828  H HD2  . TYR A 1 20 ? -4.374  -6.157  -1.976  1.00 0.00 ? 20 TYR A HD2  3  
ATOM 2829  H HE1  . TYR A 1 20 ? -7.689  -2.988  -3.893  1.00 0.00 ? 20 TYR A HE1  3  
ATOM 2830  H HE2  . TYR A 1 20 ? -5.766  -6.792  -4.007  1.00 0.00 ? 20 TYR A HE2  3  
ATOM 2831  H HH   . TYR A 1 20 ? -7.010  -5.062  -5.948  1.00 0.00 ? 20 TYR A HH   3  
ATOM 2832  N N    . SER A 1 21 ? -5.533  -5.491  1.614   1.00 0.00 ? 21 SER A N    3  
ATOM 2833  C CA   . SER A 1 21 ? -6.273  -6.635  2.119   1.00 0.00 ? 21 SER A CA   3  
ATOM 2834  C C    . SER A 1 21 ? -7.213  -6.195  3.244   1.00 0.00 ? 21 SER A C    3  
ATOM 2835  O O    . SER A 1 21 ? -8.359  -6.639  3.309   1.00 0.00 ? 21 SER A O    3  
ATOM 2836  C CB   . SER A 1 21 ? -5.325  -7.728  2.617   1.00 0.00 ? 21 SER A CB   3  
ATOM 2837  O OG   . SER A 1 21 ? -4.797  -8.505  1.546   1.00 0.00 ? 21 SER A OG   3  
ATOM 2838  H H    . SER A 1 21 ? -4.540  -5.561  1.695   1.00 0.00 ? 21 SER A H    3  
ATOM 2839  H HA   . SER A 1 21 ? -6.843  -7.008  1.268   1.00 0.00 ? 21 SER A HA   3  
ATOM 2840  H HB3  . SER A 1 21 ? -5.855  -8.379  3.311   1.00 0.00 ? 21 SER A HB3  3  
ATOM 2841  H HG   . SER A 1 21 ? -4.504  -7.906  0.800   1.00 0.00 ? 21 SER A HG   3  
ATOM 2842  N N    . GLU A 1 22 ? -6.694  -5.329  4.102   1.00 0.00 ? 22 GLU A N    3  
ATOM 2843  C CA   . GLU A 1 22 ? -7.472  -4.826  5.220   1.00 0.00 ? 22 GLU A CA   3  
ATOM 2844  C C    . GLU A 1 22 ? -8.740  -4.133  4.716   1.00 0.00 ? 22 GLU A C    3  
ATOM 2845  O O    . GLU A 1 22 ? -9.836  -4.403  5.204   1.00 0.00 ? 22 GLU A O    3  
ATOM 2846  C CB   . GLU A 1 22 ? -6.639  -3.880  6.087   1.00 0.00 ? 22 GLU A CB   3  
ATOM 2847  C CG   . GLU A 1 22 ? -5.529  -4.639  6.816   1.00 0.00 ? 22 GLU A CG   3  
ATOM 2848  C CD   . GLU A 1 22 ? -6.029  -5.194  8.151   1.00 0.00 ? 22 GLU A CD   3  
ATOM 2849  O OE1  . GLU A 1 22 ? -7.022  -5.952  8.114   1.00 0.00 ? 22 GLU A OE1  3  
ATOM 2850  O OE2  . GLU A 1 22 ? -5.406  -4.849  9.178   1.00 0.00 ? 22 GLU A OE2  3  
ATOM 2851  H H    . GLU A 1 22 ? -5.761  -4.975  4.042   1.00 0.00 ? 22 GLU A H    3  
ATOM 2852  H HA   . GLU A 1 22 ? -7.740  -5.705  5.807   1.00 0.00 ? 22 GLU A HA   3  
ATOM 2853  H HB3  . GLU A 1 22 ? -7.283  -3.384  6.814   1.00 0.00 ? 22 GLU A HB3  3  
ATOM 2854  H HG3  . GLU A 1 22 ? -4.681  -3.976  6.988   1.00 0.00 ? 22 GLU A HG3  3  
ATOM 2855  N N    . ALA A 1 23 ? -8.547  -3.252  3.743   1.00 0.00 ? 23 ALA A N    3  
ATOM 2856  C CA   . ALA A 1 23 ? -9.661  -2.519  3.167   1.00 0.00 ? 23 ALA A CA   3  
ATOM 2857  C C    . ALA A 1 23 ? -10.553 -3.486  2.384   1.00 0.00 ? 23 ALA A C    3  
ATOM 2858  O O    . ALA A 1 23 ? -11.770 -3.317  2.342   1.00 0.00 ? 23 ALA A O    3  
ATOM 2859  C CB   . ALA A 1 23 ? -9.127  -1.382  2.294   1.00 0.00 ? 23 ALA A CB   3  
ATOM 2860  H H    . ALA A 1 23 ? -7.653  -3.039  3.352   1.00 0.00 ? 23 ALA A H    3  
ATOM 2861  H HA   . ALA A 1 23 ? -10.236 -2.091  3.987   1.00 0.00 ? 23 ALA A HA   3  
ATOM 2862  H HB1  . ALA A 1 23 ? -8.039  -1.351  2.363   1.00 0.00 ? 23 ALA A HB1  3  
ATOM 2863  H HB2  . ALA A 1 23 ? -9.421  -1.550  1.258   1.00 0.00 ? 23 ALA A HB2  3  
ATOM 2864  H HB3  . ALA A 1 23 ? -9.539  -0.434  2.640   1.00 0.00 ? 23 ALA A HB3  3  
ATOM 2865  N N    . LEU A 1 24 ? -9.911  -4.476  1.782   1.00 0.00 ? 24 LEU A N    3  
ATOM 2866  C CA   . LEU A 1 24 ? -10.630 -5.469  1.003   1.00 0.00 ? 24 LEU A CA   3  
ATOM 2867  C C    . LEU A 1 24 ? -11.379 -6.410  1.950   1.00 0.00 ? 24 LEU A C    3  
ATOM 2868  O O    . LEU A 1 24 ? -12.378 -7.016  1.566   1.00 0.00 ? 24 LEU A O    3  
ATOM 2869  C CB   . LEU A 1 24 ? -9.679  -6.191  0.046   1.00 0.00 ? 24 LEU A CB   3  
ATOM 2870  C CG   . LEU A 1 24 ? -9.751  -5.761  -1.422  1.00 0.00 ? 24 LEU A CG   3  
ATOM 2871  C CD1  . LEU A 1 24 ? -8.648  -6.430  -2.244  1.00 0.00 ? 24 LEU A CD1  3  
ATOM 2872  C CD2  . LEU A 1 24 ? -11.141 -6.026  -2.003  1.00 0.00 ? 24 LEU A CD2  3  
ATOM 2873  H H    . LEU A 1 24 ? -8.920  -4.606  1.821   1.00 0.00 ? 24 LEU A H    3  
ATOM 2874  H HA   . LEU A 1 24 ? -11.360 -4.940  0.393   1.00 0.00 ? 24 LEU A HA   3  
ATOM 2875  H HB3  . LEU A 1 24 ? -9.882  -7.260  0.101   1.00 0.00 ? 24 LEU A HB3  3  
ATOM 2876  H HG   . LEU A 1 24 ? -9.582  -4.686  -1.471  1.00 0.00 ? 24 LEU A HG   3  
ATOM 2877  H HD11 . LEU A 1 24 ? -8.737  -6.126  -3.287  1.00 0.00 ? 24 LEU A HD11 3  
ATOM 2878  H HD12 . LEU A 1 24 ? -7.674  -6.127  -1.859  1.00 0.00 ? 24 LEU A HD12 3  
ATOM 2879  H HD13 . LEU A 1 24 ? -8.747  -7.513  -2.171  1.00 0.00 ? 24 LEU A HD13 3  
ATOM 2880  H HD21 . LEU A 1 24 ? -11.389 -7.082  -1.884  1.00 0.00 ? 24 LEU A HD21 3  
ATOM 2881  H HD22 . LEU A 1 24 ? -11.877 -5.420  -1.477  1.00 0.00 ? 24 LEU A HD22 3  
ATOM 2882  H HD23 . LEU A 1 24 ? -11.148 -5.770  -3.062  1.00 0.00 ? 24 LEU A HD23 3  
ATOM 2883  N N    . GLY A 1 25 ? -10.867 -6.503  3.168   1.00 0.00 ? 25 GLY A N    3  
ATOM 2884  C CA   . GLY A 1 25 ? -11.475 -7.359  4.172   1.00 0.00 ? 25 GLY A CA   3  
ATOM 2885  C C    . GLY A 1 25 ? -11.361 -8.833  3.778   1.00 0.00 ? 25 GLY A C    3  
ATOM 2886  O O    . GLY A 1 25 ? -12.331 -9.583  3.880   1.00 0.00 ? 25 GLY A O    3  
ATOM 2887  H H    . GLY A 1 25 ? -10.053 -6.006  3.472   1.00 0.00 ? 25 GLY A H    3  
ATOM 2888  H HA2  . GLY A 1 25 ? -10.988 -7.198  5.134   1.00 0.00 ? 25 GLY A HA2  3  
ATOM 2889  H HA3  . GLY A 1 25 ? -12.523 -7.091  4.297   1.00 0.00 ? 25 GLY A HA3  3  
ATOM 2890  N N    . ARG A 1 26 ? -10.170 -9.203  3.333   1.00 0.00 ? 26 ARG A N    3  
ATOM 2891  C CA   . ARG A 1 26 ? -9.918  -10.574 2.922   1.00 0.00 ? 26 ARG A CA   3  
ATOM 2892  C C    . ARG A 1 26 ? -9.232  -11.349 4.050   1.00 0.00 ? 26 ARG A C    3  
ATOM 2893  O O    . ARG A 1 26 ? -8.900  -10.778 5.087   1.00 0.00 ? 26 ARG A O    3  
ATOM 2894  C CB   . ARG A 1 26 ? -9.038  -10.621 1.672   1.00 0.00 ? 26 ARG A CB   3  
ATOM 2895  C CG   . ARG A 1 26 ? -9.707  -9.898  0.502   1.00 0.00 ? 26 ARG A CG   3  
ATOM 2896  C CD   . ARG A 1 26 ? -10.254 -10.897 -0.520  1.00 0.00 ? 26 ARG A CD   3  
ATOM 2897  N NE   . ARG A 1 26 ? -11.632 -11.292 -0.152  1.00 0.00 ? 26 ARG A NE   3  
ATOM 2898  C CZ   . ARG A 1 26 ? -12.253 -12.381 -0.627  1.00 0.00 ? 26 ARG A CZ   3  
ATOM 2899  N NH1  . ARG A 1 26 ? -11.622 -13.189 -1.490  1.00 0.00 ? 26 ARG A NH1  3  
ATOM 2900  N NH2  . ARG A 1 26 ? -13.504 -12.662 -0.239  1.00 0.00 ? 26 ARG A NH2  3  
ATOM 2901  H H    . ARG A 1 26 ? -9.386  -8.587  3.252   1.00 0.00 ? 26 ARG A H    3  
ATOM 2902  H HA   . ARG A 1 26 ? -10.903 -10.986 2.706   1.00 0.00 ? 26 ARG A HA   3  
ATOM 2903  H HB3  . ARG A 1 26 ? -8.842  -11.658 1.399   1.00 0.00 ? 26 ARG A HB3  3  
ATOM 2904  H HG3  . ARG A 1 26 ? -8.988  -9.235  0.020   1.00 0.00 ? 26 ARG A HG3  3  
ATOM 2905  H HD3  . ARG A 1 26 ? -9.612  -11.777 -0.560  1.00 0.00 ? 26 ARG A HD3  3  
ATOM 2906  H HE   . ARG A 1 26 ? -12.132 -10.710 0.489   1.00 0.00 ? 26 ARG A HE   3  
ATOM 2907  H HH11 . ARG A 1 26 ? -10.689 -12.980 -1.780  1.00 0.00 ? 26 ARG A HH11 3  
ATOM 2908  H HH12 . ARG A 1 26 ? -12.085 -14.002 -1.844  1.00 0.00 ? 26 ARG A HH12 3  
ATOM 2909  H HH21 . ARG A 1 26 ? -13.976 -12.059 0.405   1.00 0.00 ? 26 ARG A HH21 3  
ATOM 2910  H HH22 . ARG A 1 26 ? -13.967 -13.474 -0.592  1.00 0.00 ? 26 ARG A HH22 3  
ATOM 2911  N N    . ALA A 1 27 ? -9.039  -12.637 3.808   1.00 0.00 ? 27 ALA A N    3  
ATOM 2912  C CA   . ALA A 1 27 ? -8.400  -13.495 4.789   1.00 0.00 ? 27 ALA A CA   3  
ATOM 2913  C C    . ALA A 1 27 ? -6.892  -13.526 4.530   1.00 0.00 ? 27 ALA A C    3  
ATOM 2914  O O    . ALA A 1 27 ? -6.097  -13.285 5.437   1.00 0.00 ? 27 ALA A O    3  
ATOM 2915  C CB   . ALA A 1 27 ? -9.029  -14.889 4.736   1.00 0.00 ? 27 ALA A CB   3  
ATOM 2916  H H    . ALA A 1 27 ? -9.313  -13.094 2.961   1.00 0.00 ? 27 ALA A H    3  
ATOM 2917  H HA   . ALA A 1 27 ? -8.581  -13.066 5.775   1.00 0.00 ? 27 ALA A HA   3  
ATOM 2918  H HB1  . ALA A 1 27 ? -8.499  -15.554 5.419   1.00 0.00 ? 27 ALA A HB1  3  
ATOM 2919  H HB2  . ALA A 1 27 ? -10.077 -14.827 5.030   1.00 0.00 ? 27 ALA A HB2  3  
ATOM 2920  H HB3  . ALA A 1 27 ? -8.958  -15.281 3.722   1.00 0.00 ? 27 ALA A HB3  3  
ATOM 2921  N N    . SER A 1 28 ? -6.544  -13.824 3.286   1.00 0.00 ? 28 SER A N    3  
ATOM 2922  C CA   . SER A 1 28 ? -5.147  -13.888 2.895   1.00 0.00 ? 28 SER A CA   3  
ATOM 2923  C C    . SER A 1 28 ? -4.685  -12.524 2.379   1.00 0.00 ? 28 SER A C    3  
ATOM 2924  O O    . SER A 1 28 ? -5.504  -11.689 1.998   1.00 0.00 ? 28 SER A O    3  
ATOM 2925  C CB   . SER A 1 28 ? -4.922  -14.962 1.829   1.00 0.00 ? 28 SER A CB   3  
ATOM 2926  O OG   . SER A 1 28 ? -5.593  -16.179 2.147   1.00 0.00 ? 28 SER A OG   3  
ATOM 2927  H H    . SER A 1 28 ? -7.198  -14.018 2.554   1.00 0.00 ? 28 SER A H    3  
ATOM 2928  H HA   . SER A 1 28 ? -4.605  -14.158 3.801   1.00 0.00 ? 28 SER A HA   3  
ATOM 2929  H HB3  . SER A 1 28 ? -3.854  -15.154 1.726   1.00 0.00 ? 28 SER A HB3  3  
ATOM 2930  H HG   . SER A 1 28 ? -5.372  -16.879 1.469   1.00 0.00 ? 28 SER A HG   3  
ATOM 2931  N N    . VAL A 1 29 ? -3.372  -12.339 2.382   1.00 0.00 ? 29 VAL A N    3  
ATOM 2932  C CA   . VAL A 1 29 ? -2.791  -11.091 1.920   1.00 0.00 ? 29 VAL A CA   3  
ATOM 2933  C C    . VAL A 1 29 ? -2.596  -11.156 0.404   1.00 0.00 ? 29 VAL A C    3  
ATOM 2934  O O    . VAL A 1 29 ? -1.740  -11.891 -0.085  1.00 0.00 ? 29 VAL A O    3  
ATOM 2935  C CB   . VAL A 1 29 ? -1.493  -10.805 2.678   1.00 0.00 ? 29 VAL A CB   3  
ATOM 2936  C CG1  . VAL A 1 29 ? -0.806  -9.550  2.135   1.00 0.00 ? 29 VAL A CG1  3  
ATOM 2937  C CG2  . VAL A 1 29 ? -1.751  -10.683 4.181   1.00 0.00 ? 29 VAL A CG2  3  
ATOM 2938  H H    . VAL A 1 29 ? -2.712  -13.023 2.693   1.00 0.00 ? 29 VAL A H    3  
ATOM 2939  H HA   . VAL A 1 29 ? -3.498  -10.294 2.148   1.00 0.00 ? 29 VAL A HA   3  
ATOM 2940  H HB   . VAL A 1 29 ? -0.821  -11.650 2.521   1.00 0.00 ? 29 VAL A HB   3  
ATOM 2941  H HG11 . VAL A 1 29 ? -0.345  -9.776  1.173   1.00 0.00 ? 29 VAL A HG11 3  
ATOM 2942  H HG12 . VAL A 1 29 ? -1.544  -8.758  2.008   1.00 0.00 ? 29 VAL A HG12 3  
ATOM 2943  H HG13 . VAL A 1 29 ? -0.039  -9.224  2.837   1.00 0.00 ? 29 VAL A HG13 3  
ATOM 2944  H HG21 . VAL A 1 29 ? -2.799  -10.897 4.388   1.00 0.00 ? 29 VAL A HG21 3  
ATOM 2945  H HG22 . VAL A 1 29 ? -1.122  -11.394 4.717   1.00 0.00 ? 29 VAL A HG22 3  
ATOM 2946  H HG23 . VAL A 1 29 ? -1.515  -9.670  4.508   1.00 0.00 ? 29 VAL A HG23 3  
ATOM 2947  N N    . VAL A 1 30 ? -3.405  -10.375 -0.299  1.00 0.00 ? 30 VAL A N    3  
ATOM 2948  C CA   . VAL A 1 30 ? -3.331  -10.333 -1.749  1.00 0.00 ? 30 VAL A CA   3  
ATOM 2949  C C    . VAL A 1 30 ? -2.399  -9.198  -2.177  1.00 0.00 ? 30 VAL A C    3  
ATOM 2950  O O    . VAL A 1 30 ? -2.187  -8.248  -1.426  1.00 0.00 ? 30 VAL A O    3  
ATOM 2951  C CB   . VAL A 1 30 ? -4.738  -10.208 -2.341  1.00 0.00 ? 30 VAL A CB   3  
ATOM 2952  C CG1  . VAL A 1 30 ? -5.465  -11.553 -2.317  1.00 0.00 ? 30 VAL A CG1  3  
ATOM 2953  C CG2  . VAL A 1 30 ? -5.545  -9.134  -1.609  1.00 0.00 ? 30 VAL A CG2  3  
ATOM 2954  H H    . VAL A 1 30 ? -4.098  -9.780  0.107   1.00 0.00 ? 30 VAL A H    3  
ATOM 2955  H HA   . VAL A 1 30 ? -2.908  -11.281 -2.084  1.00 0.00 ? 30 VAL A HA   3  
ATOM 2956  H HB   . VAL A 1 30 ? -4.636  -9.900  -3.382  1.00 0.00 ? 30 VAL A HB   3  
ATOM 2957  H HG11 . VAL A 1 30 ? -4.930  -12.267 -2.943  1.00 0.00 ? 30 VAL A HG11 3  
ATOM 2958  H HG12 . VAL A 1 30 ? -5.504  -11.928 -1.293  1.00 0.00 ? 30 VAL A HG12 3  
ATOM 2959  H HG13 . VAL A 1 30 ? -6.479  -11.425 -2.696  1.00 0.00 ? 30 VAL A HG13 3  
ATOM 2960  H HG21 . VAL A 1 30 ? -4.866  -8.400  -1.177  1.00 0.00 ? 30 VAL A HG21 3  
ATOM 2961  H HG22 . VAL A 1 30 ? -6.216  -8.641  -2.313  1.00 0.00 ? 30 VAL A HG22 3  
ATOM 2962  H HG23 . VAL A 1 30 ? -6.131  -9.598  -0.815  1.00 0.00 ? 30 VAL A HG23 3  
ATOM 2963  N N    . PRO A 1 31 ? -1.853  -9.339  -3.415  1.00 0.00 ? 31 PRO A N    3  
ATOM 2964  C CA   . PRO A 1 31 ? -0.948  -8.337  -3.952  1.00 0.00 ? 31 PRO A CA   3  
ATOM 2965  C C    . PRO A 1 31 ? -1.713  -7.087  -4.393  1.00 0.00 ? 31 PRO A C    3  
ATOM 2966  O O    . PRO A 1 31 ? -2.943  -7.090  -4.434  1.00 0.00 ? 31 PRO A O    3  
ATOM 2967  C CB   . PRO A 1 31 ? -0.230  -9.029  -5.098  1.00 0.00 ? 31 PRO A CB   3  
ATOM 2968  C CG   . PRO A 1 31 ? -1.083  -10.234 -5.458  1.00 0.00 ? 31 PRO A CG   3  
ATOM 2969  C CD   . PRO A 1 31 ? -2.081  -10.451 -4.332  1.00 0.00 ? 31 PRO A CD   3  
ATOM 2970  H HA   . PRO A 1 31 ? -0.311  -8.030  -3.245  1.00 0.00 ? 31 PRO A HA   3  
ATOM 2971  H HB3  . PRO A 1 31 ? 0.773   -9.335  -4.802  1.00 0.00 ? 31 PRO A HB3  3  
ATOM 2972  H HG3  . PRO A 1 31 ? -0.459  -11.118 -5.591  1.00 0.00 ? 31 PRO A HG3  3  
ATOM 2973  H HD3  . PRO A 1 31 ? -1.921  -11.410 -3.840  1.00 0.00 ? 31 PRO A HD3  3  
ATOM 2974  N N    . LEU A 1 32 ? -0.955  -6.049  -4.711  1.00 0.00 ? 32 LEU A N    3  
ATOM 2975  C CA   . LEU A 1 32 ? -1.546  -4.795  -5.149  1.00 0.00 ? 32 LEU A CA   3  
ATOM 2976  C C    . LEU A 1 32 ? -1.164  -4.537  -6.607  1.00 0.00 ? 32 LEU A C    3  
ATOM 2977  O O    . LEU A 1 32 ? -0.046  -4.112  -6.894  1.00 0.00 ? 32 LEU A O    3  
ATOM 2978  C CB   . LEU A 1 32 ? -1.157  -3.660  -4.200  1.00 0.00 ? 32 LEU A CB   3  
ATOM 2979  C CG   . LEU A 1 32 ? -1.392  -2.241  -4.720  1.00 0.00 ? 32 LEU A CG   3  
ATOM 2980  C CD1  . LEU A 1 32 ? -2.740  -2.137  -5.438  1.00 0.00 ? 32 LEU A CD1  3  
ATOM 2981  C CD2  . LEU A 1 32 ? -1.263  -1.215  -3.593  1.00 0.00 ? 32 LEU A CD2  3  
ATOM 2982  H H    . LEU A 1 32 ? 0.044   -6.055  -4.675  1.00 0.00 ? 32 LEU A H    3  
ATOM 2983  H HA   . LEU A 1 32 ? -2.629  -4.907  -5.089  1.00 0.00 ? 32 LEU A HA   3  
ATOM 2984  H HB3  . LEU A 1 32 ? -0.099  -3.764  -3.955  1.00 0.00 ? 32 LEU A HB3  3  
ATOM 2985  H HG   . LEU A 1 32 ? -0.619  -2.012  -5.454  1.00 0.00 ? 32 LEU A HG   3  
ATOM 2986  H HD11 . LEU A 1 32 ? -2.933  -3.061  -5.984  1.00 0.00 ? 32 LEU A HD11 3  
ATOM 2987  H HD12 . LEU A 1 32 ? -3.531  -1.977  -4.704  1.00 0.00 ? 32 LEU A HD12 3  
ATOM 2988  H HD13 . LEU A 1 32 ? -2.717  -1.300  -6.135  1.00 0.00 ? 32 LEU A HD13 3  
ATOM 2989  H HD21 . LEU A 1 32 ? -1.241  -1.731  -2.633  1.00 0.00 ? 32 LEU A HD21 3  
ATOM 2990  H HD22 . LEU A 1 32 ? -0.341  -0.647  -3.721  1.00 0.00 ? 32 LEU A HD22 3  
ATOM 2991  H HD23 . LEU A 1 32 ? -2.115  -0.535  -3.620  1.00 0.00 ? 32 LEU A HD23 3  
ATOM 2992  N N    . PRO A 1 33 ? -2.139  -4.812  -7.515  1.00 0.00 ? 33 PRO A N    3  
ATOM 2993  C CA   . PRO A 1 33 ? -1.916  -4.614  -8.936  1.00 0.00 ? 33 PRO A CA   3  
ATOM 2994  C C    . PRO A 1 33 ? -1.954  -3.127  -9.295  1.00 0.00 ? 33 PRO A C    3  
ATOM 2995  O O    . PRO A 1 33 ? -2.975  -2.622  -9.758  1.00 0.00 ? 33 PRO A O    3  
ATOM 2996  C CB   . PRO A 1 33 ? -3.009  -5.418  -9.622  1.00 0.00 ? 33 PRO A CB   3  
ATOM 2997  C CG   . PRO A 1 33 ? -4.076  -5.656  -8.566  1.00 0.00 ? 33 PRO A CG   3  
ATOM 2998  C CD   . PRO A 1 33 ? -3.475  -5.317  -7.212  1.00 0.00 ? 33 PRO A CD   3  
ATOM 2999  H HA   . PRO A 1 33 ? -1.004  -4.934  -9.192  1.00 0.00 ? 33 PRO A HA   3  
ATOM 3000  H HB3  . PRO A 1 33 ? -2.618  -6.362  -10.003 1.00 0.00 ? 33 PRO A HB3  3  
ATOM 3001  H HG3  . PRO A 1 33 ? -4.409  -6.694  -8.586  1.00 0.00 ? 33 PRO A HG3  3  
ATOM 3002  H HD3  . PRO A 1 33 ? -3.430  -6.196  -6.567  1.00 0.00 ? 33 PRO A HD3  3  
ATOM 3003  N N    . TYR A 1 34 ? -0.826  -2.468  -9.069  1.00 0.00 ? 34 TYR A N    3  
ATOM 3004  C CA   . TYR A 1 34 ? -0.717  -1.049  -9.363  1.00 0.00 ? 34 TYR A CA   3  
ATOM 3005  C C    . TYR A 1 34 ? -1.023  -0.770  -10.835 1.00 0.00 ? 34 TYR A C    3  
ATOM 3006  O O    . TYR A 1 34 ? -1.827  0.106   -11.151 1.00 0.00 ? 34 TYR A O    3  
ATOM 3007  C CB   . TYR A 1 34 ? 0.737   -0.669  -9.074  1.00 0.00 ? 34 TYR A CB   3  
ATOM 3008  C CG   . TYR A 1 34 ? 1.193   -0.990  -7.650  1.00 0.00 ? 34 TYR A CG   3  
ATOM 3009  C CD1  . TYR A 1 34 ? 0.981   -0.078  -6.636  1.00 0.00 ? 34 TYR A CD1  3  
ATOM 3010  C CD2  . TYR A 1 34 ? 1.815   -2.192  -7.378  1.00 0.00 ? 34 TYR A CD2  3  
ATOM 3011  C CE1  . TYR A 1 34 ? 1.410   -0.381  -5.294  1.00 0.00 ? 34 TYR A CE1  3  
ATOM 3012  C CE2  . TYR A 1 34 ? 2.245   -2.494  -6.038  1.00 0.00 ? 34 TYR A CE2  3  
ATOM 3013  C CZ   . TYR A 1 34 ? 2.021   -1.574  -5.062  1.00 0.00 ? 34 TYR A CZ   3  
ATOM 3014  O OH   . TYR A 1 34 ? 2.426   -1.859  -3.796  1.00 0.00 ? 34 TYR A OH   3  
ATOM 3015  H H    . TYR A 1 34 ? 0.001   -2.887  -8.693  1.00 0.00 ? 34 TYR A H    3  
ATOM 3016  H HA   . TYR A 1 34 ? -1.441  -0.521  -8.743  1.00 0.00 ? 34 TYR A HA   3  
ATOM 3017  H HB3  . TYR A 1 34 ? 0.865   0.398   -9.254  1.00 0.00 ? 34 TYR A HB3  3  
ATOM 3018  H HD1  . TYR A 1 34 ? 0.490   0.871   -6.850  1.00 0.00 ? 34 TYR A HD1  3  
ATOM 3019  H HD2  . TYR A 1 34 ? 1.982   -2.913  -8.180  1.00 0.00 ? 34 TYR A HD2  3  
ATOM 3020  H HE1  . TYR A 1 34 ? 1.250   0.330   -4.484  1.00 0.00 ? 34 TYR A HE1  3  
ATOM 3021  H HE2  . TYR A 1 34 ? 2.737   -3.439  -5.810  1.00 0.00 ? 34 TYR A HE2  3  
ATOM 3022  H HH   . TYR A 1 34 ? 3.176   -2.520  -3.817  1.00 0.00 ? 34 TYR A HH   3  
ATOM 3023  N N    . GLU A 1 35 ? -0.363  -1.529  -11.698 1.00 0.00 ? 35 GLU A N    3  
ATOM 3024  C CA   . GLU A 1 35 ? -0.554  -1.373  -13.130 1.00 0.00 ? 35 GLU A CA   3  
ATOM 3025  C C    . GLU A 1 35 ? -2.037  -1.177  -13.450 1.00 0.00 ? 35 GLU A C    3  
ATOM 3026  O O    . GLU A 1 35 ? -2.382  -0.513  -14.427 1.00 0.00 ? 35 GLU A O    3  
ATOM 3027  C CB   . GLU A 1 35 ? 0.017   -2.570  -13.892 1.00 0.00 ? 35 GLU A CB   3  
ATOM 3028  C CG   . GLU A 1 35 ? -0.739  -3.854  -13.544 1.00 0.00 ? 35 GLU A CG   3  
ATOM 3029  C CD   . GLU A 1 35 ? -0.170  -5.050  -14.309 1.00 0.00 ? 35 GLU A CD   3  
ATOM 3030  O OE1  . GLU A 1 35 ? -0.175  -4.980  -15.557 1.00 0.00 ? 35 GLU A OE1  3  
ATOM 3031  O OE2  . GLU A 1 35 ? 0.256   -6.010  -13.630 1.00 0.00 ? 35 GLU A OE2  3  
ATOM 3032  H H    . GLU A 1 35 ? 0.289   -2.238  -11.433 1.00 0.00 ? 35 GLU A H    3  
ATOM 3033  H HA   . GLU A 1 35 ? 0.004   -0.478  -13.401 1.00 0.00 ? 35 GLU A HA   3  
ATOM 3034  H HB3  . GLU A 1 35 ? 1.074   -2.690  -13.651 1.00 0.00 ? 35 GLU A HB3  3  
ATOM 3035  H HG3  . GLU A 1 35 ? -1.796  -3.734  -13.782 1.00 0.00 ? 35 GLU A HG3  3  
ATOM 3036  N N    . ARG A 1 36 ? -2.874  -1.765  -12.609 1.00 0.00 ? 36 ARG A N    3  
ATOM 3037  C CA   . ARG A 1 36 ? -4.313  -1.664  -12.789 1.00 0.00 ? 36 ARG A CA   3  
ATOM 3038  C C    . ARG A 1 36 ? -4.869  -0.497  -11.970 1.00 0.00 ? 36 ARG A C    3  
ATOM 3039  O O    . ARG A 1 36 ? -5.359  0.483   -12.531 1.00 0.00 ? 36 ARG A O    3  
ATOM 3040  C CB   . ARG A 1 36 ? -5.014  -2.956  -12.365 1.00 0.00 ? 36 ARG A CB   3  
ATOM 3041  C CG   . ARG A 1 36 ? -5.207  -3.892  -13.560 1.00 0.00 ? 36 ARG A CG   3  
ATOM 3042  C CD   . ARG A 1 36 ? -6.468  -3.525  -14.346 1.00 0.00 ? 36 ARG A CD   3  
ATOM 3043  N NE   . ARG A 1 36 ? -7.182  -4.753  -14.758 1.00 0.00 ? 36 ARG A NE   3  
ATOM 3044  C CZ   . ARG A 1 36 ? -8.155  -4.783  -15.679 1.00 0.00 ? 36 ARG A CZ   3  
ATOM 3045  N NH1  . ARG A 1 36 ? -8.536  -3.653  -16.288 1.00 0.00 ? 36 ARG A NH1  3  
ATOM 3046  N NH2  . ARG A 1 36 ? -8.749  -5.944  -15.990 1.00 0.00 ? 36 ARG A NH2  3  
ATOM 3047  H H    . ARG A 1 36 ? -2.585  -2.303  -11.816 1.00 0.00 ? 36 ARG A H    3  
ATOM 3048  H HA   . ARG A 1 36 ? -4.448  -1.492  -13.857 1.00 0.00 ? 36 ARG A HA   3  
ATOM 3049  H HB3  . ARG A 1 36 ? -5.981  -2.720  -11.924 1.00 0.00 ? 36 ARG A HB3  3  
ATOM 3050  H HG3  . ARG A 1 36 ? -5.278  -4.922  -13.211 1.00 0.00 ? 36 ARG A HG3  3  
ATOM 3051  H HD3  . ARG A 1 36 ? -6.201  -2.937  -15.224 1.00 0.00 ? 36 ARG A HD3  3  
ATOM 3052  H HE   . ARG A 1 36 ? -6.923  -5.615  -14.322 1.00 0.00 ? 36 ARG A HE   3  
ATOM 3053  H HH11 . ARG A 1 36 ? -8.093  -2.787  -16.057 1.00 0.00 ? 36 ARG A HH11 3  
ATOM 3054  H HH12 . ARG A 1 36 ? -9.262  -3.675  -16.976 1.00 0.00 ? 36 ARG A HH12 3  
ATOM 3055  H HH21 . ARG A 1 36 ? -8.465  -6.789  -15.535 1.00 0.00 ? 36 ARG A HH21 3  
ATOM 3056  H HH22 . ARG A 1 36 ? -9.474  -5.967  -16.677 1.00 0.00 ? 36 ARG A HH22 3  
ATOM 3057  N N    . LEU A 1 37 ? -4.775  -0.641  -10.656 1.00 0.00 ? 37 LEU A N    3  
ATOM 3058  C CA   . LEU A 1 37 ? -5.263  0.389   -9.754  1.00 0.00 ? 37 LEU A CA   3  
ATOM 3059  C C    . LEU A 1 37 ? -4.811  1.760   -10.260 1.00 0.00 ? 37 LEU A C    3  
ATOM 3060  O O    . LEU A 1 37 ? -5.559  2.733   -10.178 1.00 0.00 ? 37 LEU A O    3  
ATOM 3061  C CB   . LEU A 1 37 ? -4.832  0.090   -8.317  1.00 0.00 ? 37 LEU A CB   3  
ATOM 3062  C CG   . LEU A 1 37 ? -5.098  -1.331  -7.818  1.00 0.00 ? 37 LEU A CG   3  
ATOM 3063  C CD1  . LEU A 1 37 ? -5.278  -1.354  -6.298  1.00 0.00 ? 37 LEU A CD1  3  
ATOM 3064  C CD2  . LEU A 1 37 ? -6.293  -1.952  -8.545  1.00 0.00 ? 37 LEU A CD2  3  
ATOM 3065  H H    . LEU A 1 37 ? -4.375  -1.440  -10.208 1.00 0.00 ? 37 LEU A H    3  
ATOM 3066  H HA   . LEU A 1 37 ? -6.353  0.354   -9.778  1.00 0.00 ? 37 LEU A HA   3  
ATOM 3067  H HB3  . LEU A 1 37 ? -5.341  0.789   -7.653  1.00 0.00 ? 37 LEU A HB3  3  
ATOM 3068  H HG   . LEU A 1 37 ? -4.227  -1.943  -8.048  1.00 0.00 ? 37 LEU A HG   3  
ATOM 3069  H HD11 . LEU A 1 37 ? -6.298  -1.068  -6.049  1.00 0.00 ? 37 LEU A HD11 3  
ATOM 3070  H HD12 . LEU A 1 37 ? -5.080  -2.359  -5.924  1.00 0.00 ? 37 LEU A HD12 3  
ATOM 3071  H HD13 . LEU A 1 37 ? -4.580  -0.652  -5.840  1.00 0.00 ? 37 LEU A HD13 3  
ATOM 3072  H HD21 . LEU A 1 37 ? -5.968  -2.342  -9.510  1.00 0.00 ? 37 LEU A HD21 3  
ATOM 3073  H HD22 . LEU A 1 37 ? -6.701  -2.765  -7.943  1.00 0.00 ? 37 LEU A HD22 3  
ATOM 3074  H HD23 . LEU A 1 37 ? -7.059  -1.193  -8.699  1.00 0.00 ? 37 LEU A HD23 3  
ATOM 3075  N N    . LEU A 1 38 ? -3.589  1.794   -10.771 1.00 0.00 ? 38 LEU A N    3  
ATOM 3076  C CA   . LEU A 1 38 ? -3.028  3.029   -11.290 1.00 0.00 ? 38 LEU A CA   3  
ATOM 3077  C C    . LEU A 1 38 ? -3.927  3.561   -12.410 1.00 0.00 ? 38 LEU A C    3  
ATOM 3078  O O    . LEU A 1 38 ? -4.200  4.758   -12.474 1.00 0.00 ? 38 LEU A O    3  
ATOM 3079  C CB   . LEU A 1 38 ? -1.574  2.821   -11.717 1.00 0.00 ? 38 LEU A CB   3  
ATOM 3080  C CG   . LEU A 1 38 ? -0.578  2.542   -10.588 1.00 0.00 ? 38 LEU A CG   3  
ATOM 3081  C CD1  . LEU A 1 38 ? 0.755   2.039   -11.145 1.00 0.00 ? 38 LEU A CD1  3  
ATOM 3082  C CD2  . LEU A 1 38 ? -0.399  3.774   -9.699  1.00 0.00 ? 38 LEU A CD2  3  
ATOM 3083  H H    . LEU A 1 38 ? -2.988  0.997   -10.834 1.00 0.00 ? 38 LEU A H    3  
ATOM 3084  H HA   . LEU A 1 38 ? -3.026  3.753   -10.476 1.00 0.00 ? 38 LEU A HA   3  
ATOM 3085  H HB3  . LEU A 1 38 ? -1.243  3.708   -12.256 1.00 0.00 ? 38 LEU A HB3  3  
ATOM 3086  H HG   . LEU A 1 38 ? -0.985  1.749   -9.961  1.00 0.00 ? 38 LEU A HG   3  
ATOM 3087  H HD11 . LEU A 1 38 ? 0.632   1.024   -11.521 1.00 0.00 ? 38 LEU A HD11 3  
ATOM 3088  H HD12 . LEU A 1 38 ? 1.078   2.690   -11.958 1.00 0.00 ? 38 LEU A HD12 3  
ATOM 3089  H HD13 . LEU A 1 38 ? 1.505   2.046   -10.355 1.00 0.00 ? 38 LEU A HD13 3  
ATOM 3090  H HD21 . LEU A 1 38 ? -0.404  4.673   -10.317 1.00 0.00 ? 38 LEU A HD21 3  
ATOM 3091  H HD22 . LEU A 1 38 ? -1.217  3.825   -8.979  1.00 0.00 ? 38 LEU A HD22 3  
ATOM 3092  H HD23 . LEU A 1 38 ? 0.549   3.705   -9.167  1.00 0.00 ? 38 LEU A HD23 3  
ATOM 3093  N N    . ARG A 1 39 ? -4.360  2.645   -13.262 1.00 0.00 ? 39 ARG A N    3  
ATOM 3094  C CA   . ARG A 1 39 ? -5.222  3.007   -14.376 1.00 0.00 ? 39 ARG A CA   3  
ATOM 3095  C C    . ARG A 1 39 ? -6.475  3.720   -13.866 1.00 0.00 ? 39 ARG A C    3  
ATOM 3096  O O    . ARG A 1 39 ? -6.907  4.714   -14.448 1.00 0.00 ? 39 ARG A O    3  
ATOM 3097  C CB   . ARG A 1 39 ? -5.636  1.770   -15.176 1.00 0.00 ? 39 ARG A CB   3  
ATOM 3098  C CG   . ARG A 1 39 ? -6.555  2.152   -16.338 1.00 0.00 ? 39 ARG A CG   3  
ATOM 3099  C CD   . ARG A 1 39 ? -6.611  1.036   -17.382 1.00 0.00 ? 39 ARG A CD   3  
ATOM 3100  N NE   . ARG A 1 39 ? -7.441  1.458   -18.533 1.00 0.00 ? 39 ARG A NE   3  
ATOM 3101  C CZ   . ARG A 1 39 ? -7.592  0.742   -19.654 1.00 0.00 ? 39 ARG A CZ   3  
ATOM 3102  N NH1  . ARG A 1 39 ? -6.971  -0.439  -19.783 1.00 0.00 ? 39 ARG A NH1  3  
ATOM 3103  N NH2  . ARG A 1 39 ? -8.365  1.204   -20.646 1.00 0.00 ? 39 ARG A NH2  3  
ATOM 3104  H H    . ARG A 1 39 ? -4.133  1.673   -13.203 1.00 0.00 ? 39 ARG A H    3  
ATOM 3105  H HA   . ARG A 1 39 ? -4.616  3.671   -14.993 1.00 0.00 ? 39 ARG A HA   3  
ATOM 3106  H HB3  . ARG A 1 39 ? -6.147  1.064   -14.521 1.00 0.00 ? 39 ARG A HB3  3  
ATOM 3107  H HG3  . ARG A 1 39 ? -6.196  3.071   -16.802 1.00 0.00 ? 39 ARG A HG3  3  
ATOM 3108  H HD3  . ARG A 1 39 ? -7.027  0.131   -16.937 1.00 0.00 ? 39 ARG A HD3  3  
ATOM 3109  H HE   . ARG A 1 39 ? -7.919  2.336   -18.468 1.00 0.00 ? 39 ARG A HE   3  
ATOM 3110  H HH11 . ARG A 1 39 ? -6.395  -0.785  -19.043 1.00 0.00 ? 39 ARG A HH11 3  
ATOM 3111  H HH12 . ARG A 1 39 ? -7.085  -0.974  -20.620 1.00 0.00 ? 39 ARG A HH12 3  
ATOM 3112  H HH21 . ARG A 1 39 ? -8.829  2.085   -20.549 1.00 0.00 ? 39 ARG A HH21 3  
ATOM 3113  H HH22 . ARG A 1 39 ? -8.478  0.669   -21.484 1.00 0.00 ? 39 ARG A HH22 3  
ATOM 3114  N N    . GLU A 1 40 ? -7.024  3.185   -12.785 1.00 0.00 ? 40 GLU A N    3  
ATOM 3115  C CA   . GLU A 1 40 ? -8.219  3.759   -12.191 1.00 0.00 ? 40 GLU A CA   3  
ATOM 3116  C C    . GLU A 1 40 ? -7.955  4.148   -10.735 1.00 0.00 ? 40 GLU A C    3  
ATOM 3117  O O    . GLU A 1 40 ? -7.886  3.286   -9.861  1.00 0.00 ? 40 GLU A O    3  
ATOM 3118  C CB   . GLU A 1 40 ? -9.400  2.792   -12.293 1.00 0.00 ? 40 GLU A CB   3  
ATOM 3119  C CG   . GLU A 1 40 ? -8.920  1.339   -12.311 1.00 0.00 ? 40 GLU A CG   3  
ATOM 3120  C CD   . GLU A 1 40 ? -10.085 0.380   -12.567 1.00 0.00 ? 40 GLU A CD   3  
ATOM 3121  O OE1  . GLU A 1 40 ? -11.111 0.535   -11.870 1.00 0.00 ? 40 GLU A OE1  3  
ATOM 3122  O OE2  . GLU A 1 40 ? -9.921  -0.486  -13.452 1.00 0.00 ? 40 GLU A OE2  3  
ATOM 3123  H H    . GLU A 1 40 ? -6.666  2.377   -12.318 1.00 0.00 ? 40 GLU A H    3  
ATOM 3124  H HA   . GLU A 1 40 ? -8.436  4.651   -12.780 1.00 0.00 ? 40 GLU A HA   3  
ATOM 3125  H HB3  . GLU A 1 40 ? -9.970  3.001   -13.199 1.00 0.00 ? 40 GLU A HB3  3  
ATOM 3126  H HG3  . GLU A 1 40 ? -8.447  1.098   -11.359 1.00 0.00 ? 40 GLU A HG3  3  
ATOM 3127  N N    . PRO A 1 41 ? -7.808  5.482   -10.515 1.00 0.00 ? 41 PRO A N    3  
ATOM 3128  C CA   . PRO A 1 41 ? -7.552  5.996   -9.180  1.00 0.00 ? 41 PRO A CA   3  
ATOM 3129  C C    . PRO A 1 41 ? -8.820  5.959   -8.325  1.00 0.00 ? 41 PRO A C    3  
ATOM 3130  O O    . PRO A 1 41 ? -8.746  5.934   -7.097  1.00 0.00 ? 41 PRO A O    3  
ATOM 3131  C CB   . PRO A 1 41 ? -7.022  7.405   -9.396  1.00 0.00 ? 41 PRO A CB   3  
ATOM 3132  C CG   . PRO A 1 41 ? -7.438  7.794   -10.805 1.00 0.00 ? 41 PRO A CG   3  
ATOM 3133  C CD   . PRO A 1 41 ? -7.882  6.532   -11.526 1.00 0.00 ? 41 PRO A CD   3  
ATOM 3134  H HA   . PRO A 1 41 ? -6.886  5.419   -8.707  1.00 0.00 ? 41 PRO A HA   3  
ATOM 3135  H HB3  . PRO A 1 41 ? -5.939  7.436   -9.285  1.00 0.00 ? 41 PRO A HB3  3  
ATOM 3136  H HG3  . PRO A 1 41 ? -6.606  8.262   -11.332 1.00 0.00 ? 41 PRO A HG3  3  
ATOM 3137  H HD3  . PRO A 1 41 ? -7.235  6.312   -12.374 1.00 0.00 ? 41 PRO A HD3  3  
ATOM 3138  N N    . GLY A 1 42 ? -9.955  5.956   -9.008  1.00 0.00 ? 42 GLY A N    3  
ATOM 3139  C CA   . GLY A 1 42 ? -11.238 5.922   -8.327  1.00 0.00 ? 42 GLY A CA   3  
ATOM 3140  C C    . GLY A 1 42 ? -11.508 4.537   -7.734  1.00 0.00 ? 42 GLY A C    3  
ATOM 3141  O O    . GLY A 1 42 ? -12.208 4.413   -6.730  1.00 0.00 ? 42 GLY A O    3  
ATOM 3142  H H    . GLY A 1 42 ? -10.008 5.976   -10.006 1.00 0.00 ? 42 GLY A H    3  
ATOM 3143  H HA2  . GLY A 1 42 ? -11.253 6.670   -7.533  1.00 0.00 ? 42 GLY A HA2  3  
ATOM 3144  H HA3  . GLY A 1 42 ? -12.032 6.183   -9.026  1.00 0.00 ? 42 GLY A HA3  3  
ATOM 3145  N N    . LEU A 1 43 ? -10.938 3.531   -8.381  1.00 0.00 ? 43 LEU A N    3  
ATOM 3146  C CA   . LEU A 1 43 ? -11.109 2.160   -7.930  1.00 0.00 ? 43 LEU A CA   3  
ATOM 3147  C C    . LEU A 1 43 ? -10.513 2.011   -6.529  1.00 0.00 ? 43 LEU A C    3  
ATOM 3148  O O    . LEU A 1 43 ? -11.103 1.364   -5.665  1.00 0.00 ? 43 LEU A O    3  
ATOM 3149  C CB   . LEU A 1 43 ? -10.525 1.184   -8.954  1.00 0.00 ? 43 LEU A CB   3  
ATOM 3150  C CG   . LEU A 1 43 ? -11.031 -0.258  -8.870  1.00 0.00 ? 43 LEU A CG   3  
ATOM 3151  C CD1  . LEU A 1 43 ? -12.512 -0.342  -9.247  1.00 0.00 ? 43 LEU A CD1  3  
ATOM 3152  C CD2  . LEU A 1 43 ? -10.169 -1.193  -9.721  1.00 0.00 ? 43 LEU A CD2  3  
ATOM 3153  H H    . LEU A 1 43 ? -10.371 3.640   -9.196  1.00 0.00 ? 43 LEU A H    3  
ATOM 3154  H HA   . LEU A 1 43 ? -12.179 1.966   -7.873  1.00 0.00 ? 43 LEU A HA   3  
ATOM 3155  H HB3  . LEU A 1 43 ? -9.441  1.174   -8.839  1.00 0.00 ? 43 LEU A HB3  3  
ATOM 3156  H HG   . LEU A 1 43 ? -10.943 -0.591  -7.835  1.00 0.00 ? 43 LEU A HG   3  
ATOM 3157  H HD11 . LEU A 1 43 ? -13.104 0.206   -8.514  1.00 0.00 ? 43 LEU A HD11 3  
ATOM 3158  H HD12 . LEU A 1 43 ? -12.660 0.095   -10.234 1.00 0.00 ? 43 LEU A HD12 3  
ATOM 3159  H HD13 . LEU A 1 43 ? -12.825 -1.386  -9.260  1.00 0.00 ? 43 LEU A HD13 3  
ATOM 3160  H HD21 . LEU A 1 43 ? -10.810 -1.783  -10.374 1.00 0.00 ? 43 LEU A HD21 3  
ATOM 3161  H HD22 . LEU A 1 43 ? -9.481  -0.601  -10.324 1.00 0.00 ? 43 LEU A HD22 3  
ATOM 3162  H HD23 . LEU A 1 43 ? -9.602  -1.857  -9.069  1.00 0.00 ? 43 LEU A HD23 3  
ATOM 3163  N N    . LEU A 1 44 ? -9.351  2.621   -6.346  1.00 0.00 ? 44 LEU A N    3  
ATOM 3164  C CA   . LEU A 1 44 ? -8.668  2.564   -5.064  1.00 0.00 ? 44 LEU A CA   3  
ATOM 3165  C C    . LEU A 1 44 ? -7.739  3.771   -4.932  1.00 0.00 ? 44 LEU A C    3  
ATOM 3166  O O    . LEU A 1 44 ? -6.726  3.858   -5.624  1.00 0.00 ? 44 LEU A O    3  
ATOM 3167  C CB   . LEU A 1 44 ? -7.959  1.219   -4.894  1.00 0.00 ? 44 LEU A CB   3  
ATOM 3168  C CG   . LEU A 1 44 ? -6.951  1.133   -3.747  1.00 0.00 ? 44 LEU A CG   3  
ATOM 3169  C CD1  . LEU A 1 44 ? -7.480  1.840   -2.497  1.00 0.00 ? 44 LEU A CD1  3  
ATOM 3170  C CD2  . LEU A 1 44 ? -6.564  -0.319  -3.463  1.00 0.00 ? 44 LEU A CD2  3  
ATOM 3171  H H    . LEU A 1 44 ? -8.877  3.145   -7.054  1.00 0.00 ? 44 LEU A H    3  
ATOM 3172  H HA   . LEU A 1 44 ? -9.429  2.627   -4.287  1.00 0.00 ? 44 LEU A HA   3  
ATOM 3173  H HB3  . LEU A 1 44 ? -7.443  0.983   -5.824  1.00 0.00 ? 44 LEU A HB3  3  
ATOM 3174  H HG   . LEU A 1 44 ? -6.042  1.654   -4.051  1.00 0.00 ? 44 LEU A HG   3  
ATOM 3175  H HD11 . LEU A 1 44 ? -6.818  1.633   -1.655  1.00 0.00 ? 44 LEU A HD11 3  
ATOM 3176  H HD12 . LEU A 1 44 ? -7.517  2.914   -2.675  1.00 0.00 ? 44 LEU A HD12 3  
ATOM 3177  H HD13 . LEU A 1 44 ? -8.481  1.474   -2.270  1.00 0.00 ? 44 LEU A HD13 3  
ATOM 3178  H HD21 . LEU A 1 44 ? -5.716  -0.598  -4.090  1.00 0.00 ? 44 LEU A HD21 3  
ATOM 3179  H HD22 . LEU A 1 44 ? -6.291  -0.426  -2.414  1.00 0.00 ? 44 LEU A HD22 3  
ATOM 3180  H HD23 . LEU A 1 44 ? -7.410  -0.970  -3.686  1.00 0.00 ? 44 LEU A HD23 3  
ATOM 3181  N N    . ALA A 1 45 ? -8.116  4.673   -4.038  1.00 0.00 ? 45 ALA A N    3  
ATOM 3182  C CA   . ALA A 1 45 ? -7.327  5.871   -3.806  1.00 0.00 ? 45 ALA A CA   3  
ATOM 3183  C C    . ALA A 1 45 ? -6.455  5.671   -2.565  1.00 0.00 ? 45 ALA A C    3  
ATOM 3184  O O    . ALA A 1 45 ? -6.948  5.260   -1.516  1.00 0.00 ? 45 ALA A O    3  
ATOM 3185  C CB   . ALA A 1 45 ? -8.259  7.078   -3.676  1.00 0.00 ? 45 ALA A CB   3  
ATOM 3186  H H    . ALA A 1 45 ? -8.941  4.596   -3.478  1.00 0.00 ? 45 ALA A H    3  
ATOM 3187  H HA   . ALA A 1 45 ? -6.683  6.018   -4.673  1.00 0.00 ? 45 ALA A HA   3  
ATOM 3188  H HB1  . ALA A 1 45 ? -8.808  7.216   -4.607  1.00 0.00 ? 45 ALA A HB1  3  
ATOM 3189  H HB2  . ALA A 1 45 ? -8.962  6.908   -2.861  1.00 0.00 ? 45 ALA A HB2  3  
ATOM 3190  H HB3  . ALA A 1 45 ? -7.670  7.971   -3.466  1.00 0.00 ? 45 ALA A HB3  3  
ATOM 3191  N N    . VAL A 1 46 ? -5.175  5.973   -2.725  1.00 0.00 ? 46 VAL A N    3  
ATOM 3192  C CA   . VAL A 1 46 ? -4.231  5.831   -1.631  1.00 0.00 ? 46 VAL A CA   3  
ATOM 3193  C C    . VAL A 1 46 ? -4.057  7.182   -0.934  1.00 0.00 ? 46 VAL A C    3  
ATOM 3194  O O    . VAL A 1 46 ? -3.653  8.160   -1.561  1.00 0.00 ? 46 VAL A O    3  
ATOM 3195  C CB   . VAL A 1 46 ? -2.912  5.253   -2.149  1.00 0.00 ? 46 VAL A CB   3  
ATOM 3196  C CG1  . VAL A 1 46 ? -1.920  5.038   -1.004  1.00 0.00 ? 46 VAL A CG1  3  
ATOM 3197  C CG2  . VAL A 1 46 ? -3.149  3.953   -2.921  1.00 0.00 ? 46 VAL A CG2  3  
ATOM 3198  H H    . VAL A 1 46 ? -4.783  6.307   -3.582  1.00 0.00 ? 46 VAL A H    3  
ATOM 3199  H HA   . VAL A 1 46 ? -4.654  5.122   -0.921  1.00 0.00 ? 46 VAL A HA   3  
ATOM 3200  H HB   . VAL A 1 46 ? -2.477  5.976   -2.839  1.00 0.00 ? 46 VAL A HB   3  
ATOM 3201  H HG11 . VAL A 1 46 ? -2.139  4.093   -0.506  1.00 0.00 ? 46 VAL A HG11 3  
ATOM 3202  H HG12 . VAL A 1 46 ? -0.905  5.011   -1.402  1.00 0.00 ? 46 VAL A HG12 3  
ATOM 3203  H HG13 . VAL A 1 46 ? -2.009  5.855   -0.289  1.00 0.00 ? 46 VAL A HG13 3  
ATOM 3204  H HG21 . VAL A 1 46 ? -4.221  3.793   -3.044  1.00 0.00 ? 46 VAL A HG21 3  
ATOM 3205  H HG22 . VAL A 1 46 ? -2.678  4.020   -3.900  1.00 0.00 ? 46 VAL A HG22 3  
ATOM 3206  H HG23 . VAL A 1 46 ? -2.720  3.118   -2.368  1.00 0.00 ? 46 VAL A HG23 3  
ATOM 3207  N N    . GLN A 1 47 ? -4.371  7.193   0.353   1.00 0.00 ? 47 GLN A N    3  
ATOM 3208  C CA   . GLN A 1 47 ? -4.256  8.408   1.142   1.00 0.00 ? 47 GLN A CA   3  
ATOM 3209  C C    . GLN A 1 47 ? -3.239  8.214   2.268   1.00 0.00 ? 47 GLN A C    3  
ATOM 3210  O O    . GLN A 1 47 ? -2.839  7.089   2.562   1.00 0.00 ? 47 GLN A O    3  
ATOM 3211  C CB   . GLN A 1 47 ? -5.617  8.832   1.697   1.00 0.00 ? 47 GLN A CB   3  
ATOM 3212  C CG   . GLN A 1 47 ? -6.308  9.822   0.758   1.00 0.00 ? 47 GLN A CG   3  
ATOM 3213  C CD   . GLN A 1 47 ? -5.732  11.230  0.923   1.00 0.00 ? 47 GLN A CD   3  
ATOM 3214  O OE1  . GLN A 1 47 ? -6.108  11.981  1.809   1.00 0.00 ? 47 GLN A OE1  3  
ATOM 3215  N NE2  . GLN A 1 47 ? -4.804  11.544  0.025   1.00 0.00 ? 47 GLN A NE2  3  
ATOM 3216  H H    . GLN A 1 47 ? -4.700  6.393   0.855   1.00 0.00 ? 47 GLN A H    3  
ATOM 3217  H HA   . GLN A 1 47 ? -3.900  9.170   0.448   1.00 0.00 ? 47 GLN A HA   3  
ATOM 3218  H HB3  . GLN A 1 47 ? -5.486  9.288   2.679   1.00 0.00 ? 47 GLN A HB3  3  
ATOM 3219  H HG3  . GLN A 1 47 ? -7.379  9.836   0.963   1.00 0.00 ? 47 GLN A HG3  3  
ATOM 3220  H HE21 . GLN A 1 47 ? -4.542  10.880  -0.676  1.00 0.00 ? 47 GLN A HE21 3  
ATOM 3221  H HE22 . GLN A 1 47 ? -4.367  12.443  0.051   1.00 0.00 ? 47 GLN A HE22 3  
ATOM 3222  N N    . GLY A 1 48 ? -2.849  9.330   2.869   1.00 0.00 ? 48 GLY A N    3  
ATOM 3223  C CA   . GLY A 1 48 ? -1.887  9.297   3.957   1.00 0.00 ? 48 GLY A CA   3  
ATOM 3224  C C    . GLY A 1 48 ? -0.512  8.847   3.460   1.00 0.00 ? 48 GLY A C    3  
ATOM 3225  O O    . GLY A 1 48 ? 0.244   8.216   4.198   1.00 0.00 ? 48 GLY A O    3  
ATOM 3226  H H    . GLY A 1 48 ? -3.179  10.241  2.624   1.00 0.00 ? 48 GLY A H    3  
ATOM 3227  H HA2  . GLY A 1 48 ? -1.809  10.286  4.408   1.00 0.00 ? 48 GLY A HA2  3  
ATOM 3228  H HA3  . GLY A 1 48 ? -2.236  8.618   4.736   1.00 0.00 ? 48 GLY A HA3  3  
ATOM 3229  N N    . LEU A 1 49 ? -0.230  9.187   2.210   1.00 0.00 ? 49 LEU A N    3  
ATOM 3230  C CA   . LEU A 1 49 ? 1.042   8.826   1.606   1.00 0.00 ? 49 LEU A CA   3  
ATOM 3231  C C    . LEU A 1 49 ? 2.136   9.755   2.135   1.00 0.00 ? 49 LEU A C    3  
ATOM 3232  O O    . LEU A 1 49 ? 1.842   10.788  2.737   1.00 0.00 ? 49 LEU A O    3  
ATOM 3233  C CB   . LEU A 1 49 ? 0.925   8.818   0.080   1.00 0.00 ? 49 LEU A CB   3  
ATOM 3234  C CG   . LEU A 1 49 ? 0.529   7.485   -0.555  1.00 0.00 ? 49 LEU A CG   3  
ATOM 3235  C CD1  . LEU A 1 49 ? -0.150  7.704   -1.909  1.00 0.00 ? 49 LEU A CD1  3  
ATOM 3236  C CD2  . LEU A 1 49 ? 1.734   6.549   -0.663  1.00 0.00 ? 49 LEU A CD2  3  
ATOM 3237  H H    . LEU A 1 49 ? -0.850  9.700   1.617   1.00 0.00 ? 49 LEU A H    3  
ATOM 3238  H HA   . LEU A 1 49 ? 1.273   7.807   1.917   1.00 0.00 ? 49 LEU A HA   3  
ATOM 3239  H HB3  . LEU A 1 49 ? 1.884   9.127   -0.339  1.00 0.00 ? 49 LEU A HB3  3  
ATOM 3240  H HG   . LEU A 1 49 ? -0.198  7.000   0.095   1.00 0.00 ? 49 LEU A HG   3  
ATOM 3241  H HD11 . LEU A 1 49 ? -0.994  8.382   -1.787  1.00 0.00 ? 49 LEU A HD11 3  
ATOM 3242  H HD12 . LEU A 1 49 ? 0.565   8.136   -2.609  1.00 0.00 ? 49 LEU A HD12 3  
ATOM 3243  H HD13 . LEU A 1 49 ? -0.504  6.748   -2.296  1.00 0.00 ? 49 LEU A HD13 3  
ATOM 3244  H HD21 . LEU A 1 49 ? 2.071   6.274   0.336   1.00 0.00 ? 49 LEU A HD21 3  
ATOM 3245  H HD22 . LEU A 1 49 ? 1.448   5.650   -1.210  1.00 0.00 ? 49 LEU A HD22 3  
ATOM 3246  H HD23 . LEU A 1 49 ? 2.542   7.055   -1.193  1.00 0.00 ? 49 LEU A HD23 3  
ATOM 3247  N N    . PRO A 1 50 ? 3.408   9.346   1.886   1.00 0.00 ? 50 PRO A N    3  
ATOM 3248  C CA   . PRO A 1 50 ? 4.548   10.130  2.330   1.00 0.00 ? 50 PRO A CA   3  
ATOM 3249  C C    . PRO A 1 50 ? 4.738   11.369  1.452   1.00 0.00 ? 50 PRO A C    3  
ATOM 3250  O O    . PRO A 1 50 ? 5.262   11.272  0.344   1.00 0.00 ? 50 PRO A O    3  
ATOM 3251  C CB   . PRO A 1 50 ? 5.729   9.175   2.274   1.00 0.00 ? 50 PRO A CB   3  
ATOM 3252  C CG   . PRO A 1 50 ? 5.300   8.036   1.364   1.00 0.00 ? 50 PRO A CG   3  
ATOM 3253  C CD   . PRO A 1 50 ? 3.794   8.130   1.177   1.00 0.00 ? 50 PRO A CD   3  
ATOM 3254  H HA   . PRO A 1 50 ? 4.393   10.474  3.256   1.00 0.00 ? 50 PRO A HA   3  
ATOM 3255  H HB3  . PRO A 1 50 ? 5.982   8.807   3.268   1.00 0.00 ? 50 PRO A HB3  3  
ATOM 3256  H HG3  . PRO A 1 50 ? 5.570   7.074   1.802   1.00 0.00 ? 50 PRO A HG3  3  
ATOM 3257  H HD3  . PRO A 1 50 ? 3.289   7.255   1.587   1.00 0.00 ? 50 PRO A HD3  3  
ATOM 3258  N N    . GLU A 1 51 ? 4.300   12.502  1.980   1.00 0.00 ? 51 GLU A N    3  
ATOM 3259  C CA   . GLU A 1 51 ? 4.415   13.757  1.258   1.00 0.00 ? 51 GLU A CA   3  
ATOM 3260  C C    . GLU A 1 51 ? 5.666   13.751  0.376   1.00 0.00 ? 51 GLU A C    3  
ATOM 3261  O O    . GLU A 1 51 ? 6.681   13.158  0.739   1.00 0.00 ? 51 GLU A O    3  
ATOM 3262  C CB   . GLU A 1 51 ? 4.430   14.945  2.221   1.00 0.00 ? 51 GLU A CB   3  
ATOM 3263  C CG   . GLU A 1 51 ? 3.017   15.276  2.706   1.00 0.00 ? 51 GLU A CG   3  
ATOM 3264  C CD   . GLU A 1 51 ? 2.598   16.678  2.259   1.00 0.00 ? 51 GLU A CD   3  
ATOM 3265  O OE1  . GLU A 1 51 ? 3.182   17.643  2.798   1.00 0.00 ? 51 GLU A OE1  3  
ATOM 3266  O OE2  . GLU A 1 51 ? 1.703   16.753  1.390   1.00 0.00 ? 51 GLU A OE2  3  
ATOM 3267  H H    . GLU A 1 51 ? 3.874   12.571  2.881   1.00 0.00 ? 51 GLU A H    3  
ATOM 3268  H HA   . GLU A 1 51 ? 3.524   13.815  0.633   1.00 0.00 ? 51 GLU A HA   3  
ATOM 3269  H HB3  . GLU A 1 51 ? 4.861   15.815  1.725   1.00 0.00 ? 51 GLU A HB3  3  
ATOM 3270  H HG3  . GLU A 1 51 ? 2.977   15.210  3.793   1.00 0.00 ? 51 GLU A HG3  3  
ATOM 3271  N N    . GLY A 1 52 ? 5.552   14.415  -0.764  1.00 0.00 ? 52 GLY A N    3  
ATOM 3272  C CA   . GLY A 1 52 ? 6.661   14.493  -1.699  1.00 0.00 ? 52 GLY A CA   3  
ATOM 3273  C C    . GLY A 1 52 ? 6.874   13.155  -2.410  1.00 0.00 ? 52 GLY A C    3  
ATOM 3274  O O    . GLY A 1 52 ? 8.008   12.712  -2.581  1.00 0.00 ? 52 GLY A O    3  
ATOM 3275  H H    . GLY A 1 52 ? 4.723   14.894  -1.051  1.00 0.00 ? 52 GLY A H    3  
ATOM 3276  H HA2  . GLY A 1 52 ? 6.467   15.273  -2.435  1.00 0.00 ? 52 GLY A HA2  3  
ATOM 3277  H HA3  . GLY A 1 52 ? 7.570   14.775  -1.168  1.00 0.00 ? 52 GLY A HA3  3  
ATOM 3278  N N    . LEU A 1 53 ? 5.763   12.549  -2.806  1.00 0.00 ? 53 LEU A N    3  
ATOM 3279  C CA   . LEU A 1 53 ? 5.814   11.271  -3.494  1.00 0.00 ? 53 LEU A CA   3  
ATOM 3280  C C    . LEU A 1 53 ? 4.557   11.107  -4.350  1.00 0.00 ? 53 LEU A C    3  
ATOM 3281  O O    . LEU A 1 53 ? 3.794   12.057  -4.528  1.00 0.00 ? 53 LEU A O    3  
ATOM 3282  C CB   . LEU A 1 53 ? 6.030   10.132  -2.495  1.00 0.00 ? 53 LEU A CB   3  
ATOM 3283  C CG   . LEU A 1 53 ? 7.484   9.730   -2.242  1.00 0.00 ? 53 LEU A CG   3  
ATOM 3284  C CD1  . LEU A 1 53 ? 7.591   8.784   -1.044  1.00 0.00 ? 53 LEU A CD1  3  
ATOM 3285  C CD2  . LEU A 1 53 ? 8.116   9.132   -3.501  1.00 0.00 ? 53 LEU A CD2  3  
ATOM 3286  H H    . LEU A 1 53 ? 4.844   12.916  -2.663  1.00 0.00 ? 53 LEU A H    3  
ATOM 3287  H HA   . LEU A 1 53 ? 6.681   11.289  -4.154  1.00 0.00 ? 53 LEU A HA   3  
ATOM 3288  H HB3  . LEU A 1 53 ? 5.488   9.255   -2.851  1.00 0.00 ? 53 LEU A HB3  3  
ATOM 3289  H HG   . LEU A 1 53 ? 8.049   10.628  -1.994  1.00 0.00 ? 53 LEU A HG   3  
ATOM 3290  H HD11 . LEU A 1 53 ? 6.947   7.918   -1.206  1.00 0.00 ? 53 LEU A HD11 3  
ATOM 3291  H HD12 . LEU A 1 53 ? 8.623   8.452   -0.933  1.00 0.00 ? 53 LEU A HD12 3  
ATOM 3292  H HD13 . LEU A 1 53 ? 7.277   9.305   -0.140  1.00 0.00 ? 53 LEU A HD13 3  
ATOM 3293  H HD21 . LEU A 1 53 ? 9.187   9.007   -3.346  1.00 0.00 ? 53 LEU A HD21 3  
ATOM 3294  H HD22 . LEU A 1 53 ? 7.662   8.163   -3.711  1.00 0.00 ? 53 LEU A HD22 3  
ATOM 3295  H HD23 . LEU A 1 53 ? 7.947   9.802   -4.345  1.00 0.00 ? 53 LEU A HD23 3  
ATOM 3296  N N    . ALA A 1 54 ? 4.378   9.896   -4.857  1.00 0.00 ? 54 ALA A N    3  
ATOM 3297  C CA   . ALA A 1 54 ? 3.225   9.597   -5.690  1.00 0.00 ? 54 ALA A CA   3  
ATOM 3298  C C    . ALA A 1 54 ? 2.924   8.098   -5.617  1.00 0.00 ? 54 ALA A C    3  
ATOM 3299  O O    . ALA A 1 54 ? 3.840   7.278   -5.595  1.00 0.00 ? 54 ALA A O    3  
ATOM 3300  C CB   . ALA A 1 54 ? 3.493   10.068  -7.121  1.00 0.00 ? 54 ALA A CB   3  
ATOM 3301  H H    . ALA A 1 54 ? 5.001   9.130   -4.708  1.00 0.00 ? 54 ALA A H    3  
ATOM 3302  H HA   . ALA A 1 54 ? 2.375   10.150  -5.292  1.00 0.00 ? 54 ALA A HA   3  
ATOM 3303  H HB1  . ALA A 1 54 ? 3.964   11.051  -7.097  1.00 0.00 ? 54 ALA A HB1  3  
ATOM 3304  H HB2  . ALA A 1 54 ? 4.154   9.360   -7.619  1.00 0.00 ? 54 ALA A HB2  3  
ATOM 3305  H HB3  . ALA A 1 54 ? 2.550   10.129  -7.665  1.00 0.00 ? 54 ALA A HB3  3  
ATOM 3306  N N    . PHE A 1 55 ? 1.637   7.786   -5.581  1.00 0.00 ? 55 PHE A N    3  
ATOM 3307  C CA   . PHE A 1 55 ? 1.204   6.401   -5.510  1.00 0.00 ? 55 PHE A CA   3  
ATOM 3308  C C    . PHE A 1 55 ? 1.716   5.605   -6.712  1.00 0.00 ? 55 PHE A C    3  
ATOM 3309  O O    . PHE A 1 55 ? 1.278   5.826   -7.841  1.00 0.00 ? 55 PHE A O    3  
ATOM 3310  C CB   . PHE A 1 55 ? -0.326  6.410   -5.533  1.00 0.00 ? 55 PHE A CB   3  
ATOM 3311  C CG   . PHE A 1 55 ? -0.952  5.031   -5.755  1.00 0.00 ? 55 PHE A CG   3  
ATOM 3312  C CD1  . PHE A 1 55 ? -0.544  3.971   -5.006  1.00 0.00 ? 55 PHE A CD1  3  
ATOM 3313  C CD2  . PHE A 1 55 ? -1.916  4.866   -6.700  1.00 0.00 ? 55 PHE A CD2  3  
ATOM 3314  C CE1  . PHE A 1 55 ? -1.125  2.691   -5.211  1.00 0.00 ? 55 PHE A CE1  3  
ATOM 3315  C CE2  . PHE A 1 55 ? -2.497  3.586   -6.905  1.00 0.00 ? 55 PHE A CE2  3  
ATOM 3316  C CZ   . PHE A 1 55 ? -2.090  2.526   -6.156  1.00 0.00 ? 55 PHE A CZ   3  
ATOM 3317  H H    . PHE A 1 55 ? 0.898   8.460   -5.599  1.00 0.00 ? 55 PHE A H    3  
ATOM 3318  H HA   . PHE A 1 55 ? 1.617   5.979   -4.595  1.00 0.00 ? 55 PHE A HA   3  
ATOM 3319  H HB3  . PHE A 1 55 ? -0.664  7.081   -6.323  1.00 0.00 ? 55 PHE A HB3  3  
ATOM 3320  H HD1  . PHE A 1 55 ? 0.228   4.103   -4.248  1.00 0.00 ? 55 PHE A HD1  3  
ATOM 3321  H HD2  . PHE A 1 55 ? -2.242  5.715   -7.299  1.00 0.00 ? 55 PHE A HD2  3  
ATOM 3322  H HE1  . PHE A 1 55 ? -0.799  1.842   -4.612  1.00 0.00 ? 55 PHE A HE1  3  
ATOM 3323  H HE2  . PHE A 1 55 ? -3.269  3.454   -7.662  1.00 0.00 ? 55 PHE A HE2  3  
ATOM 3324  H HZ   . PHE A 1 55 ? -2.535  1.544   -6.314  1.00 0.00 ? 55 PHE A HZ   3  
ATOM 3325  N N    . ARG A 1 56 ? 2.636   4.695   -6.430  1.00 0.00 ? 56 ARG A N    3  
ATOM 3326  C CA   . ARG A 1 56 ? 3.213   3.864   -7.473  1.00 0.00 ? 56 ARG A CA   3  
ATOM 3327  C C    . ARG A 1 56 ? 3.926   2.658   -6.859  1.00 0.00 ? 56 ARG A C    3  
ATOM 3328  O O    . ARG A 1 56 ? 4.187   2.633   -5.657  1.00 0.00 ? 56 ARG A O    3  
ATOM 3329  C CB   . ARG A 1 56 ? 4.208   4.658   -8.323  1.00 0.00 ? 56 ARG A CB   3  
ATOM 3330  C CG   . ARG A 1 56 ? 4.892   5.746   -7.492  1.00 0.00 ? 56 ARG A CG   3  
ATOM 3331  C CD   . ARG A 1 56 ? 6.364   5.891   -7.885  1.00 0.00 ? 56 ARG A CD   3  
ATOM 3332  N NE   . ARG A 1 56 ? 6.470   6.423   -9.261  1.00 0.00 ? 56 ARG A NE   3  
ATOM 3333  C CZ   . ARG A 1 56 ? 7.574   6.993   -9.763  1.00 0.00 ? 56 ARG A CZ   3  
ATOM 3334  N NH1  . ARG A 1 56 ? 8.673   7.108   -9.004  1.00 0.00 ? 56 ARG A NH1  3  
ATOM 3335  N NH2  . ARG A 1 56 ? 7.580   7.448   -11.023 1.00 0.00 ? 56 ARG A NH2  3  
ATOM 3336  H H    . ARG A 1 56 ? 2.987   4.522   -5.509  1.00 0.00 ? 56 ARG A H    3  
ATOM 3337  H HA   . ARG A 1 56 ? 2.364   3.550   -8.081  1.00 0.00 ? 56 ARG A HA   3  
ATOM 3338  H HB3  . ARG A 1 56 ? 3.690   5.113   -9.166  1.00 0.00 ? 56 ARG A HB3  3  
ATOM 3339  H HG3  . ARG A 1 56 ? 4.818   5.501   -6.433  1.00 0.00 ? 56 ARG A HG3  3  
ATOM 3340  H HD3  . ARG A 1 56 ? 6.863   4.924   -7.820  1.00 0.00 ? 56 ARG A HD3  3  
ATOM 3341  H HE   . ARG A 1 56 ? 5.668   6.353   -9.855  1.00 0.00 ? 56 ARG A HE   3  
ATOM 3342  H HH11 . ARG A 1 56 ? 8.669   6.769   -8.064  1.00 0.00 ? 56 ARG A HH11 3  
ATOM 3343  H HH12 . ARG A 1 56 ? 9.497   7.533   -9.379  1.00 0.00 ? 56 ARG A HH12 3  
ATOM 3344  H HH21 . ARG A 1 56 ? 6.760   7.361   -11.590 1.00 0.00 ? 56 ARG A HH21 3  
ATOM 3345  H HH22 . ARG A 1 56 ? 8.404   7.873   -11.398 1.00 0.00 ? 56 ARG A HH22 3  
ATOM 3346  N N    . ARG A 1 57 ? 4.222   1.688   -7.711  1.00 0.00 ? 57 ARG A N    3  
ATOM 3347  C CA   . ARG A 1 57 ? 4.900   0.483   -7.267  1.00 0.00 ? 57 ARG A CA   3  
ATOM 3348  C C    . ARG A 1 57 ? 5.969   0.827   -6.229  1.00 0.00 ? 57 ARG A C    3  
ATOM 3349  O O    . ARG A 1 57 ? 6.547   1.913   -6.263  1.00 0.00 ? 57 ARG A O    3  
ATOM 3350  C CB   . ARG A 1 57 ? 5.556   -0.245  -8.442  1.00 0.00 ? 57 ARG A CB   3  
ATOM 3351  C CG   . ARG A 1 57 ? 4.843   -1.566  -8.736  1.00 0.00 ? 57 ARG A CG   3  
ATOM 3352  C CD   . ARG A 1 57 ? 5.189   -2.077  -10.135 1.00 0.00 ? 57 ARG A CD   3  
ATOM 3353  N NE   . ARG A 1 57 ? 4.908   -3.527  -10.229 1.00 0.00 ? 57 ARG A NE   3  
ATOM 3354  C CZ   . ARG A 1 57 ? 5.758   -4.484  -9.835  1.00 0.00 ? 57 ARG A CZ   3  
ATOM 3355  N NH1  . ARG A 1 57 ? 6.948   -4.152  -9.317  1.00 0.00 ? 57 ARG A NH1  3  
ATOM 3356  N NH2  . ARG A 1 57 ? 5.418   -5.774  -9.958  1.00 0.00 ? 57 ARG A NH2  3  
ATOM 3357  H H    . ARG A 1 57 ? 4.007   1.717   -8.688  1.00 0.00 ? 57 ARG A H    3  
ATOM 3358  H HA   . ARG A 1 57 ? 4.114   -0.135  -6.831  1.00 0.00 ? 57 ARG A HA   3  
ATOM 3359  H HB3  . ARG A 1 57 ? 6.606   -0.436  -8.216  1.00 0.00 ? 57 ARG A HB3  3  
ATOM 3360  H HG3  . ARG A 1 57 ? 3.766   -1.429  -8.651  1.00 0.00 ? 57 ARG A HG3  3  
ATOM 3361  H HD3  . ARG A 1 57 ? 6.240   -1.888  -10.352 1.00 0.00 ? 57 ARG A HD3  3  
ATOM 3362  H HE   . ARG A 1 57 ? 4.029   -3.810  -10.612 1.00 0.00 ? 57 ARG A HE   3  
ATOM 3363  H HH11 . ARG A 1 57 ? 7.202   -3.189  -9.225  1.00 0.00 ? 57 ARG A HH11 3  
ATOM 3364  H HH12 . ARG A 1 57 ? 7.583   -4.867  -9.023  1.00 0.00 ? 57 ARG A HH12 3  
ATOM 3365  H HH21 . ARG A 1 57 ? 4.530   -6.024  -10.345 1.00 0.00 ? 57 ARG A HH21 3  
ATOM 3366  H HH22 . ARG A 1 57 ? 6.053   -6.489  -9.663  1.00 0.00 ? 57 ARG A HH22 3  
ATOM 3367  N N    . PRO A 1 58 ? 6.208   -0.143  -5.305  1.00 0.00 ? 58 PRO A N    3  
ATOM 3368  C CA   . PRO A 1 58 ? 7.198   0.047   -4.259  1.00 0.00 ? 58 PRO A CA   3  
ATOM 3369  C C    . PRO A 1 58 ? 8.617   -0.086  -4.815  1.00 0.00 ? 58 PRO A C    3  
ATOM 3370  O O    . PRO A 1 58 ? 9.572   0.402   -4.213  1.00 0.00 ? 58 PRO A O    3  
ATOM 3371  C CB   . PRO A 1 58 ? 6.869   -1.004  -3.211  1.00 0.00 ? 58 PRO A CB   3  
ATOM 3372  C CG   . PRO A 1 58 ? 6.008   -2.040  -3.916  1.00 0.00 ? 58 PRO A CG   3  
ATOM 3373  C CD   . PRO A 1 58 ? 5.544   -1.441  -5.233  1.00 0.00 ? 58 PRO A CD   3  
ATOM 3374  H HA   . PRO A 1 58 ? 7.135   0.973   -3.886  1.00 0.00 ? 58 PRO A HA   3  
ATOM 3375  H HB3  . PRO A 1 58 ? 6.339   -0.564  -2.367  1.00 0.00 ? 58 PRO A HB3  3  
ATOM 3376  H HG3  . PRO A 1 58 ? 5.152   -2.310  -3.297  1.00 0.00 ? 58 PRO A HG3  3  
ATOM 3377  H HD3  . PRO A 1 58 ? 4.460   -1.333  -5.260  1.00 0.00 ? 58 PRO A HD3  3  
ATOM 3378  N N    . ALA A 1 59 ? 8.709   -0.749  -5.958  1.00 0.00 ? 59 ALA A N    3  
ATOM 3379  C CA   . ALA A 1 59 ? 9.997   -0.952  -6.603  1.00 0.00 ? 59 ALA A CA   3  
ATOM 3380  C C    . ALA A 1 59 ? 10.325  0.265   -7.470  1.00 0.00 ? 59 ALA A C    3  
ATOM 3381  O O    . ALA A 1 59 ? 11.479  0.472   -7.843  1.00 0.00 ? 59 ALA A O    3  
ATOM 3382  C CB   . ALA A 1 59 ? 9.963   -2.252  -7.410  1.00 0.00 ? 59 ALA A CB   3  
ATOM 3383  H H    . ALA A 1 59 ? 7.928   -1.142  -6.441  1.00 0.00 ? 59 ALA A H    3  
ATOM 3384  H HA   . ALA A 1 59 ? 10.749  -1.044  -5.820  1.00 0.00 ? 59 ALA A HA   3  
ATOM 3385  H HB1  . ALA A 1 59 ? 10.977  -2.521  -7.706  1.00 0.00 ? 59 ALA A HB1  3  
ATOM 3386  H HB2  . ALA A 1 59 ? 9.539   -3.049  -6.799  1.00 0.00 ? 59 ALA A HB2  3  
ATOM 3387  H HB3  . ALA A 1 59 ? 9.351   -2.111  -8.300  1.00 0.00 ? 59 ALA A HB3  3  
ATOM 3388  N N    . GLU A 1 60 ? 9.290   1.037   -7.765  1.00 0.00 ? 60 GLU A N    3  
ATOM 3389  C CA   . GLU A 1 60 ? 9.455   2.229   -8.582  1.00 0.00 ? 60 GLU A CA   3  
ATOM 3390  C C    . GLU A 1 60 ? 9.811   3.429   -7.704  1.00 0.00 ? 60 GLU A C    3  
ATOM 3391  O O    . GLU A 1 60 ? 10.347  4.423   -8.193  1.00 0.00 ? 60 GLU A O    3  
ATOM 3392  C CB   . GLU A 1 60 ? 8.196   2.506   -9.407  1.00 0.00 ? 60 GLU A CB   3  
ATOM 3393  C CG   . GLU A 1 60 ? 8.043   1.483   -10.534 1.00 0.00 ? 60 GLU A CG   3  
ATOM 3394  C CD   . GLU A 1 60 ? 8.117   2.163   -11.904 1.00 0.00 ? 60 GLU A CD   3  
ATOM 3395  O OE1  . GLU A 1 60 ? 7.279   3.061   -12.138 1.00 0.00 ? 60 GLU A OE1  3  
ATOM 3396  O OE2  . GLU A 1 60 ? 9.008   1.768   -12.686 1.00 0.00 ? 60 GLU A OE2  3  
ATOM 3397  H H    . GLU A 1 60 ? 8.355   0.862   -7.458  1.00 0.00 ? 60 GLU A H    3  
ATOM 3398  H HA   . GLU A 1 60 ? 10.282  2.005   -9.257  1.00 0.00 ? 60 GLU A HA   3  
ATOM 3399  H HB3  . GLU A 1 60 ? 8.246   3.511   -9.826  1.00 0.00 ? 60 GLU A HB3  3  
ATOM 3400  H HG3  . GLU A 1 60 ? 7.089   0.966   -10.433 1.00 0.00 ? 60 GLU A HG3  3  
ATOM 3401  N N    . TYR A 1 61 ? 9.499   3.298   -6.423  1.00 0.00 ? 61 TYR A N    3  
ATOM 3402  C CA   . TYR A 1 61 ? 9.780   4.360   -5.471  1.00 0.00 ? 61 TYR A CA   3  
ATOM 3403  C C    . TYR A 1 61 ? 11.285  4.503   -5.237  1.00 0.00 ? 61 TYR A C    3  
ATOM 3404  O O    . TYR A 1 61 ? 12.066  3.654   -5.663  1.00 0.00 ? 61 TYR A O    3  
ATOM 3405  C CB   . TYR A 1 61 ? 9.109   3.941   -4.162  1.00 0.00 ? 61 TYR A CB   3  
ATOM 3406  C CG   . TYR A 1 61 ? 7.719   4.544   -3.954  1.00 0.00 ? 61 TYR A CG   3  
ATOM 3407  C CD1  . TYR A 1 61 ? 7.467   5.847   -4.334  1.00 0.00 ? 61 TYR A CD1  3  
ATOM 3408  C CD2  . TYR A 1 61 ? 6.715   3.784   -3.388  1.00 0.00 ? 61 TYR A CD2  3  
ATOM 3409  C CE1  . TYR A 1 61 ? 6.158   6.414   -4.139  1.00 0.00 ? 61 TYR A CE1  3  
ATOM 3410  C CE2  . TYR A 1 61 ? 5.406   4.352   -3.192  1.00 0.00 ? 61 TYR A CE2  3  
ATOM 3411  C CZ   . TYR A 1 61 ? 5.192   5.639   -3.578  1.00 0.00 ? 61 TYR A CZ   3  
ATOM 3412  O OH   . TYR A 1 61 ? 3.956   6.174   -3.393  1.00 0.00 ? 61 TYR A OH   3  
ATOM 3413  H H    . TYR A 1 61 ? 9.064   2.486   -6.033  1.00 0.00 ? 61 TYR A H    3  
ATOM 3414  H HA   . TYR A 1 61 ? 9.395   5.292   -5.885  1.00 0.00 ? 61 TYR A HA   3  
ATOM 3415  H HB3  . TYR A 1 61 ? 9.748   4.234   -3.329  1.00 0.00 ? 61 TYR A HB3  3  
ATOM 3416  H HD1  . TYR A 1 61 ? 8.261   6.447   -4.782  1.00 0.00 ? 61 TYR A HD1  3  
ATOM 3417  H HD2  . TYR A 1 61 ? 6.914   2.756   -3.088  1.00 0.00 ? 61 TYR A HD2  3  
ATOM 3418  H HE1  . TYR A 1 61 ? 5.947   7.442   -4.434  1.00 0.00 ? 61 TYR A HE1  3  
ATOM 3419  H HE2  . TYR A 1 61 ? 4.604   3.764   -2.746  1.00 0.00 ? 61 TYR A HE2  3  
ATOM 3420  H HH   . TYR A 1 61 ? 3.980   7.160   -3.566  1.00 0.00 ? 61 TYR A HH   3  
ATOM 3421  N N    . ASP A 1 62 ? 11.646  5.583   -4.561  1.00 0.00 ? 62 ASP A N    3  
ATOM 3422  C CA   . ASP A 1 62 ? 13.044  5.847   -4.264  1.00 0.00 ? 62 ASP A CA   3  
ATOM 3423  C C    . ASP A 1 62 ? 13.443  5.095   -2.993  1.00 0.00 ? 62 ASP A C    3  
ATOM 3424  O O    . ASP A 1 62 ? 12.629  4.381   -2.408  1.00 0.00 ? 62 ASP A O    3  
ATOM 3425  C CB   . ASP A 1 62 ? 13.283  7.339   -4.025  1.00 0.00 ? 62 ASP A CB   3  
ATOM 3426  C CG   . ASP A 1 62 ? 12.120  8.252   -4.417  1.00 0.00 ? 62 ASP A CG   3  
ATOM 3427  O OD1  . ASP A 1 62 ? 11.799  8.273   -5.625  1.00 0.00 ? 62 ASP A OD1  3  
ATOM 3428  O OD2  . ASP A 1 62 ? 11.579  8.907   -3.501  1.00 0.00 ? 62 ASP A OD2  3  
ATOM 3429  H H    . ASP A 1 62 ? 11.005  6.268   -4.217  1.00 0.00 ? 62 ASP A H    3  
ATOM 3430  H HA   . ASP A 1 62 ? 13.593  5.504   -5.141  1.00 0.00 ? 62 ASP A HA   3  
ATOM 3431  H HB3  . ASP A 1 62 ? 14.169  7.644   -4.582  1.00 0.00 ? 62 ASP A HB3  3  
ATOM 3432  N N    . PRO A 1 63 ? 14.729  5.284   -2.592  1.00 0.00 ? 63 PRO A N    3  
ATOM 3433  C CA   . PRO A 1 63 ? 15.246  4.631   -1.401  1.00 0.00 ? 63 PRO A CA   3  
ATOM 3434  C C    . PRO A 1 63 ? 14.714  5.303   -0.133  1.00 0.00 ? 63 PRO A C    3  
ATOM 3435  O O    . PRO A 1 63 ? 14.189  4.635   0.754   1.00 0.00 ? 63 PRO A O    3  
ATOM 3436  C CB   . PRO A 1 63 ? 16.757  4.717   -1.530  1.00 0.00 ? 63 PRO A CB   3  
ATOM 3437  C CG   . PRO A 1 63 ? 17.027  5.814   -2.546  1.00 0.00 ? 63 PRO A CG   3  
ATOM 3438  C CD   . PRO A 1 63 ? 15.721  6.121   -3.260  1.00 0.00 ? 63 PRO A CD   3  
ATOM 3439  H HA   . PRO A 1 63 ? 14.930  3.684   -1.360  1.00 0.00 ? 63 PRO A HA   3  
ATOM 3440  H HB3  . PRO A 1 63 ? 17.175  3.766   -1.862  1.00 0.00 ? 63 PRO A HB3  3  
ATOM 3441  H HG3  . PRO A 1 63 ? 17.787  5.496   -3.261  1.00 0.00 ? 63 PRO A HG3  3  
ATOM 3442  H HD3  . PRO A 1 63 ? 15.785  5.888   -4.322  1.00 0.00 ? 63 PRO A HD3  3  
ATOM 3443  N N    . LYS A 1 64 ? 14.871  6.619   -0.090  1.00 0.00 ? 64 LYS A N    3  
ATOM 3444  C CA   . LYS A 1 64 ? 14.414  7.389   1.055   1.00 0.00 ? 64 LYS A CA   3  
ATOM 3445  C C    . LYS A 1 64 ? 12.886  7.351   1.112   1.00 0.00 ? 64 LYS A C    3  
ATOM 3446  O O    . LYS A 1 64 ? 12.296  7.518   2.178   1.00 0.00 ? 64 LYS A O    3  
ATOM 3447  C CB   . LYS A 1 64 ? 14.994  8.805   1.013   1.00 0.00 ? 64 LYS A CB   3  
ATOM 3448  C CG   . LYS A 1 64 ? 16.446  8.817   1.494   1.00 0.00 ? 64 LYS A CG   3  
ATOM 3449  C CD   . LYS A 1 64 ? 17.405  9.097   0.335   1.00 0.00 ? 64 LYS A CD   3  
ATOM 3450  C CE   . LYS A 1 64 ? 18.835  8.689   0.695   1.00 0.00 ? 64 LYS A CE   3  
ATOM 3451  N NZ   . LYS A 1 64 ? 19.660  8.559   -0.527  1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3452  H H    . LYS A 1 64 ? 15.301  7.156   -0.816  1.00 0.00 ? 64 LYS A H    3  
ATOM 3453  H HA   . LYS A 1 64 ? 14.806  6.907   1.950   1.00 0.00 ? 64 LYS A HA   3  
ATOM 3454  H HB3  . LYS A 1 64 ? 14.394  9.465   1.639   1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3455  H HG3  . LYS A 1 64 ? 16.691  7.856   1.948   1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3456  H HD3  . LYS A 1 64 ? 17.378  10.158  0.085   1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3457  H HE3  . LYS A 1 64 ? 18.824  7.742   1.236   1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3458  H HZ1  . LYS A 1 64 ? 19.139  8.882   -1.317  1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3459  H HZ2  . LYS A 1 64 ? 20.490  9.108   -0.427  1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3460  H HZ3  . LYS A 1 64 ? 19.909  7.600   -0.661  1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3461  N N    . ALA A 1 65 ? 12.287  7.131   -0.050  1.00 0.00 ? 65 ALA A N    3  
ATOM 3462  C CA   . ALA A 1 65 ? 10.839  7.070   -0.145  1.00 0.00 ? 65 ALA A CA   3  
ATOM 3463  C C    . ALA A 1 65 ? 10.328  5.886   0.678   1.00 0.00 ? 65 ALA A C    3  
ATOM 3464  O O    . ALA A 1 65 ? 9.534   6.064   1.601   1.00 0.00 ? 65 ALA A O    3  
ATOM 3465  C CB   . ALA A 1 65 ? 10.427  6.978   -1.616  1.00 0.00 ? 65 ALA A CB   3  
ATOM 3466  H H    . ALA A 1 65 ? 12.774  6.996   -0.913  1.00 0.00 ? 65 ALA A H    3  
ATOM 3467  H HA   . ALA A 1 65 ? 10.439  7.994   0.273   1.00 0.00 ? 65 ALA A HA   3  
ATOM 3468  H HB1  . ALA A 1 65 ? 10.235  7.978   -2.003  1.00 0.00 ? 65 ALA A HB1  3  
ATOM 3469  H HB2  . ALA A 1 65 ? 11.231  6.515   -2.190  1.00 0.00 ? 65 ALA A HB2  3  
ATOM 3470  H HB3  . ALA A 1 65 ? 9.524   6.374   -1.704  1.00 0.00 ? 65 ALA A HB3  3  
ATOM 3471  N N    . LEU A 1 66 ? 10.803  4.704   0.315   1.00 0.00 ? 66 LEU A N    3  
ATOM 3472  C CA   . LEU A 1 66 ? 10.404  3.491   1.009   1.00 0.00 ? 66 LEU A CA   3  
ATOM 3473  C C    . LEU A 1 66 ? 10.526  3.709   2.518   1.00 0.00 ? 66 LEU A C    3  
ATOM 3474  O O    . LEU A 1 66 ? 9.645   3.312   3.280   1.00 0.00 ? 66 LEU A O    3  
ATOM 3475  C CB   . LEU A 1 66 ? 11.202  2.292   0.494   1.00 0.00 ? 66 LEU A CB   3  
ATOM 3476  C CG   . LEU A 1 66 ? 11.082  1.999   -1.003  1.00 0.00 ? 66 LEU A CG   3  
ATOM 3477  C CD1  . LEU A 1 66 ? 12.112  0.957   -1.442  1.00 0.00 ? 66 LEU A CD1  3  
ATOM 3478  C CD2  . LEU A 1 66 ? 9.655   1.583   -1.367  1.00 0.00 ? 66 LEU A CD2  3  
ATOM 3479  H H    . LEU A 1 66 ? 11.448  4.568   -0.437  1.00 0.00 ? 66 LEU A H    3  
ATOM 3480  H HA   . LEU A 1 66 ? 9.356   3.309   0.770   1.00 0.00 ? 66 LEU A HA   3  
ATOM 3481  H HB3  . LEU A 1 66 ? 10.884  1.406   1.045   1.00 0.00 ? 66 LEU A HB3  3  
ATOM 3482  H HG   . LEU A 1 66 ? 11.299  2.916   -1.549  1.00 0.00 ? 66 LEU A HG   3  
ATOM 3483  H HD11 . LEU A 1 66 ? 12.765  1.388   -2.200  1.00 0.00 ? 66 LEU A HD11 3  
ATOM 3484  H HD12 . LEU A 1 66 ? 12.707  0.649   -0.582  1.00 0.00 ? 66 LEU A HD12 3  
ATOM 3485  H HD13 . LEU A 1 66 ? 11.597  0.090   -1.857  1.00 0.00 ? 66 LEU A HD13 3  
ATOM 3486  H HD21 . LEU A 1 66 ? 9.659   0.560   -1.743  1.00 0.00 ? 66 LEU A HD21 3  
ATOM 3487  H HD22 . LEU A 1 66 ? 9.022   1.643   -0.481  1.00 0.00 ? 66 LEU A HD22 3  
ATOM 3488  H HD23 . LEU A 1 66 ? 9.267   2.252   -2.135  1.00 0.00 ? 66 LEU A HD23 3  
ATOM 3489  N N    . MET A 1 67 ? 11.626  4.339   2.906   1.00 0.00 ? 67 MET A N    3  
ATOM 3490  C CA   . MET A 1 67 ? 11.874  4.615   4.311   1.00 0.00 ? 67 MET A CA   3  
ATOM 3491  C C    . MET A 1 67 ? 10.849  5.606   4.865   1.00 0.00 ? 67 MET A C    3  
ATOM 3492  O O    . MET A 1 67 ? 10.509  5.558   6.046   1.00 0.00 ? 67 MET A O    3  
ATOM 3493  C CB   . MET A 1 67 ? 13.283  5.189   4.477   1.00 0.00 ? 67 MET A CB   3  
ATOM 3494  C CG   . MET A 1 67 ? 14.309  4.074   4.686   1.00 0.00 ? 67 MET A CG   3  
ATOM 3495  S SD   . MET A 1 67 ? 15.962  4.737   4.579   1.00 0.00 ? 67 MET A SD   3  
ATOM 3496  C CE   . MET A 1 67 ? 16.260  4.548   2.828   1.00 0.00 ? 67 MET A CE   3  
ATOM 3497  H H    . MET A 1 67 ? 12.337  4.659   2.280   1.00 0.00 ? 67 MET A H    3  
ATOM 3498  H HA   . MET A 1 67 ? 11.774  3.656   4.819   1.00 0.00 ? 67 MET A HA   3  
ATOM 3499  H HB3  . MET A 1 67 ? 13.303  5.871   5.328   1.00 0.00 ? 67 MET A HB3  3  
ATOM 3500  H HG3  . MET A 1 67 ? 14.170  3.296   3.934   1.00 0.00 ? 67 MET A HG3  3  
ATOM 3501  H HE1  . MET A 1 67 ? 16.269  5.529   2.353   1.00 0.00 ? 67 MET A HE1  3  
ATOM 3502  H HE2  . MET A 1 67 ? 17.222  4.060   2.674   1.00 0.00 ? 67 MET A HE2  3  
ATOM 3503  H HE3  . MET A 1 67 ? 15.469  3.939   2.390   1.00 0.00 ? 67 MET A HE3  3  
ATOM 3504  N N    . ALA A 1 68 ? 10.386  6.483   3.986   1.00 0.00 ? 68 ALA A N    3  
ATOM 3505  C CA   . ALA A 1 68 ? 9.406   7.484   4.373   1.00 0.00 ? 68 ALA A CA   3  
ATOM 3506  C C    . ALA A 1 68 ? 8.009   6.863   4.342   1.00 0.00 ? 68 ALA A C    3  
ATOM 3507  O O    . ALA A 1 68 ? 7.095   7.348   5.007   1.00 0.00 ? 68 ALA A O    3  
ATOM 3508  C CB   . ALA A 1 68 ? 9.526   8.698   3.450   1.00 0.00 ? 68 ALA A CB   3  
ATOM 3509  H H    . ALA A 1 68 ? 10.668  6.516   3.027   1.00 0.00 ? 68 ALA A H    3  
ATOM 3510  H HA   . ALA A 1 68 ? 9.634   7.795   5.392   1.00 0.00 ? 68 ALA A HA   3  
ATOM 3511  H HB1  . ALA A 1 68 ? 10.108  8.429   2.568   1.00 0.00 ? 68 ALA A HB1  3  
ATOM 3512  H HB2  . ALA A 1 68 ? 8.531   9.021   3.143   1.00 0.00 ? 68 ALA A HB2  3  
ATOM 3513  H HB3  . ALA A 1 68 ? 10.024  9.510   3.979   1.00 0.00 ? 68 ALA A HB3  3  
ATOM 3514  N N    . ILE A 1 69 ? 7.887   5.798   3.562   1.00 0.00 ? 69 ILE A N    3  
ATOM 3515  C CA   . ILE A 1 69 ? 6.616   5.106   3.435   1.00 0.00 ? 69 ILE A CA   3  
ATOM 3516  C C    . ILE A 1 69 ? 6.358   4.285   4.701   1.00 0.00 ? 69 ILE A C    3  
ATOM 3517  O O    . ILE A 1 69 ? 5.245   4.278   5.225   1.00 0.00 ? 69 ILE A O    3  
ATOM 3518  C CB   . ILE A 1 69 ? 6.582   4.278   2.149   1.00 0.00 ? 69 ILE A CB   3  
ATOM 3519  C CG1  . ILE A 1 69 ? 6.728   5.174   0.918   1.00 0.00 ? 69 ILE A CG1  3  
ATOM 3520  C CG2  . ILE A 1 69 ? 5.319   3.417   2.084   1.00 0.00 ? 69 ILE A CG2  3  
ATOM 3521  C CD1  . ILE A 1 69 ? 7.436   4.433   -0.219  1.00 0.00 ? 69 ILE A CD1  3  
ATOM 3522  H H    . ILE A 1 69 ? 8.634   5.410   3.025   1.00 0.00 ? 69 ILE A H    3  
ATOM 3523  H HA   . ILE A 1 69 ? 5.837   5.865   3.351   1.00 0.00 ? 69 ILE A HA   3  
ATOM 3524  H HB   . ILE A 1 69 ? 7.434   3.600   2.158   1.00 0.00 ? 69 ILE A HB   3  
ATOM 3525  H HG13 . ILE A 1 69 ? 7.293   6.070   1.180   1.00 0.00 ? 69 ILE A HG13 3  
ATOM 3526  H HG21 . ILE A 1 69 ? 5.496   2.560   1.434   1.00 0.00 ? 69 ILE A HG21 3  
ATOM 3527  H HG22 . ILE A 1 69 ? 5.065   3.068   3.085   1.00 0.00 ? 69 ILE A HG22 3  
ATOM 3528  H HG23 . ILE A 1 69 ? 4.495   4.010   1.687   1.00 0.00 ? 69 ILE A HG23 3  
ATOM 3529  H HD11 . ILE A 1 69 ? 6.863   4.547   -1.139  1.00 0.00 ? 69 ILE A HD11 3  
ATOM 3530  H HD12 . ILE A 1 69 ? 8.434   4.848   -0.357  1.00 0.00 ? 69 ILE A HD12 3  
ATOM 3531  H HD13 . ILE A 1 69 ? 7.516   3.375   0.032   1.00 0.00 ? 69 ILE A HD13 3  
ATOM 3532  N N    . LEU A 1 70 ? 7.406   3.614   5.156   1.00 0.00 ? 70 LEU A N    3  
ATOM 3533  C CA   . LEU A 1 70 ? 7.308   2.792   6.350   1.00 0.00 ? 70 LEU A CA   3  
ATOM 3534  C C    . LEU A 1 70 ? 7.111   3.694   7.570   1.00 0.00 ? 70 LEU A C    3  
ATOM 3535  O O    . LEU A 1 70 ? 6.600   3.251   8.598   1.00 0.00 ? 70 LEU A O    3  
ATOM 3536  C CB   . LEU A 1 70 ? 8.517   1.862   6.461   1.00 0.00 ? 70 LEU A CB   3  
ATOM 3537  C CG   . LEU A 1 70 ? 8.889   1.090   5.194   1.00 0.00 ? 70 LEU A CG   3  
ATOM 3538  C CD1  . LEU A 1 70 ? 10.401  0.869   5.111   1.00 0.00 ? 70 LEU A CD1  3  
ATOM 3539  C CD2  . LEU A 1 70 ? 8.112   -0.224  5.104   1.00 0.00 ? 70 LEU A CD2  3  
ATOM 3540  H H    . LEU A 1 70 ? 8.308   3.625   4.723   1.00 0.00 ? 70 LEU A H    3  
ATOM 3541  H HA   . LEU A 1 70 ? 6.425   2.161   6.241   1.00 0.00 ? 70 LEU A HA   3  
ATOM 3542  H HB3  . LEU A 1 70 ? 8.325   1.143   7.258   1.00 0.00 ? 70 LEU A HB3  3  
ATOM 3543  H HG   . LEU A 1 70 ? 8.604   1.692   4.331   1.00 0.00 ? 70 LEU A HG   3  
ATOM 3544  H HD11 . LEU A 1 70 ? 10.601  -0.086  4.626   1.00 0.00 ? 70 LEU A HD11 3  
ATOM 3545  H HD12 . LEU A 1 70 ? 10.854  1.673   4.531   1.00 0.00 ? 70 LEU A HD12 3  
ATOM 3546  H HD13 . LEU A 1 70 ? 10.823  0.862   6.115   1.00 0.00 ? 70 LEU A HD13 3  
ATOM 3547  H HD21 . LEU A 1 70 ? 7.044   -0.021  5.185   1.00 0.00 ? 70 LEU A HD21 3  
ATOM 3548  H HD22 . LEU A 1 70 ? 8.319   -0.705  4.148   1.00 0.00 ? 70 LEU A HD22 3  
ATOM 3549  H HD23 . LEU A 1 70 ? 8.418   -0.884  5.917   1.00 0.00 ? 70 LEU A HD23 3  
ATOM 3550  N N    . GLU A 1 71 ? 7.525   4.943   7.415   1.00 0.00 ? 71 GLU A N    3  
ATOM 3551  C CA   . GLU A 1 71 ? 7.401   5.911   8.492   1.00 0.00 ? 71 GLU A CA   3  
ATOM 3552  C C    . GLU A 1 71 ? 6.049   6.623   8.412   1.00 0.00 ? 71 GLU A C    3  
ATOM 3553  O O    . GLU A 1 71 ? 5.419   6.882   9.436   1.00 0.00 ? 71 GLU A O    3  
ATOM 3554  C CB   . GLU A 1 71 ? 8.553   6.917   8.459   1.00 0.00 ? 71 GLU A CB   3  
ATOM 3555  C CG   . GLU A 1 71 ? 9.805   6.340   9.125   1.00 0.00 ? 71 GLU A CG   3  
ATOM 3556  C CD   . GLU A 1 71 ? 10.732  7.456   9.609   1.00 0.00 ? 71 GLU A CD   3  
ATOM 3557  O OE1  . GLU A 1 71 ? 10.991  8.370   8.797   1.00 0.00 ? 71 GLU A OE1  3  
ATOM 3558  O OE2  . GLU A 1 71 ? 11.161  7.370   10.779  1.00 0.00 ? 71 GLU A OE2  3  
ATOM 3559  H H    . GLU A 1 71 ? 7.939   5.295   6.577   1.00 0.00 ? 71 GLU A H    3  
ATOM 3560  H HA   . GLU A 1 71 ? 7.460   5.330   9.412   1.00 0.00 ? 71 GLU A HA   3  
ATOM 3561  H HB3  . GLU A 1 71 ? 8.255   7.833   8.970   1.00 0.00 ? 71 GLU A HB3  3  
ATOM 3562  H HG3  . GLU A 1 71 ? 10.335  5.703   8.418   1.00 0.00 ? 71 GLU A HG3  3  
ATOM 3563  N N    . HIS A 1 72 ? 5.643   6.918   7.186   1.00 0.00 ? 72 HIS A N    3  
ATOM 3564  C CA   . HIS A 1 72 ? 4.377   7.594   6.960   1.00 0.00 ? 72 HIS A CA   3  
ATOM 3565  C C    . HIS A 1 72 ? 3.249   6.563   6.896   1.00 0.00 ? 72 HIS A C    3  
ATOM 3566  O O    . HIS A 1 72 ? 2.072   6.923   6.908   1.00 0.00 ? 72 HIS A O    3  
ATOM 3567  C CB   . HIS A 1 72 ? 4.447   8.475   5.710   1.00 0.00 ? 72 HIS A CB   3  
ATOM 3568  C CG   . HIS A 1 72 ? 5.427   9.619   5.820   1.00 0.00 ? 72 HIS A CG   3  
ATOM 3569  N ND1  . HIS A 1 72 ? 5.115   10.911  5.433   1.00 0.00 ? 72 HIS A ND1  3  
ATOM 3570  C CD2  . HIS A 1 72 ? 6.710   9.652   6.278   1.00 0.00 ? 72 HIS A CD2  3  
ATOM 3571  C CE1  . HIS A 1 72 ? 6.173   11.679  5.652   1.00 0.00 ? 72 HIS A CE1  3  
ATOM 3572  N NE2  . HIS A 1 72 ? 7.161   10.897  6.174   1.00 0.00 ? 72 HIS A NE2  3  
ATOM 3573  H H    . HIS A 1 72 ? 6.161   6.703   6.359   1.00 0.00 ? 72 HIS A H    3  
ATOM 3574  H HA   . HIS A 1 72 ? 4.213   8.247   7.818   1.00 0.00 ? 72 HIS A HA   3  
ATOM 3575  H HB3  . HIS A 1 72 ? 3.456   8.877   5.506   1.00 0.00 ? 72 HIS A HB3  3  
ATOM 3576  H HD1  . HIS A 1 72 ? 4.241   11.214  5.054   1.00 0.00 ? 72 HIS A HD1  3  
ATOM 3577  H HD2  . HIS A 1 72 ? 7.272   8.802   6.663   1.00 0.00 ? 72 HIS A HD2  3  
ATOM 3578  H HE1  . HIS A 1 72 ? 6.242   12.748  5.450   1.00 0.00 ? 72 HIS A HE1  3  
ATOM 3579  N N    . SER A 1 73 ? 3.646   5.301   6.828   1.00 0.00 ? 73 SER A N    3  
ATOM 3580  C CA   . SER A 1 73 ? 2.683   4.215   6.762   1.00 0.00 ? 73 SER A CA   3  
ATOM 3581  C C    . SER A 1 73 ? 1.558   4.452   7.771   1.00 0.00 ? 73 SER A C    3  
ATOM 3582  O O    . SER A 1 73 ? 0.381   4.355   7.427   1.00 0.00 ? 73 SER A O    3  
ATOM 3583  C CB   . SER A 1 73 ? 3.356   2.866   7.024   1.00 0.00 ? 73 SER A CB   3  
ATOM 3584  O OG   . SER A 1 73 ? 3.269   2.484   8.394   1.00 0.00 ? 73 SER A OG   3  
ATOM 3585  H H    . SER A 1 73 ? 4.605   5.016   6.818   1.00 0.00 ? 73 SER A H    3  
ATOM 3586  H HA   . SER A 1 73 ? 2.295   4.235   5.744   1.00 0.00 ? 73 SER A HA   3  
ATOM 3587  H HB3  . SER A 1 73 ? 4.403   2.919   6.727   1.00 0.00 ? 73 SER A HB3  3  
ATOM 3588  H HG   . SER A 1 73 ? 2.344   2.169   8.603   1.00 0.00 ? 73 SER A HG   3  
ATOM 3589  N N    . HIS A 1 74 ? 1.959   4.757   8.996   1.00 0.00 ? 74 HIS A N    3  
ATOM 3590  C CA   . HIS A 1 74 ? 0.998   5.008   10.057  1.00 0.00 ? 74 HIS A CA   3  
ATOM 3591  C C    . HIS A 1 74 ? -0.129  5.897   9.529   1.00 0.00 ? 74 HIS A C    3  
ATOM 3592  O O    . HIS A 1 74 ? -1.250  5.848   10.032  1.00 0.00 ? 74 HIS A O    3  
ATOM 3593  C CB   . HIS A 1 74 ? 1.690   5.597   11.288  1.00 0.00 ? 74 HIS A CB   3  
ATOM 3594  C CG   . HIS A 1 74 ? 1.506   7.087   11.443  1.00 0.00 ? 74 HIS A CG   3  
ATOM 3595  N ND1  . HIS A 1 74 ? 2.568   7.970   11.533  1.00 0.00 ? 74 HIS A ND1  3  
ATOM 3596  C CD2  . HIS A 1 74 ? 0.372   7.842   11.521  1.00 0.00 ? 74 HIS A CD2  3  
ATOM 3597  C CE1  . HIS A 1 74 ? 2.085   9.196   11.660  1.00 0.00 ? 74 HIS A CE1  3  
ATOM 3598  N NE2  . HIS A 1 74 ? 0.722   9.114   11.654  1.00 0.00 ? 74 HIS A NE2  3  
ATOM 3599  H H    . HIS A 1 74 ? 2.918   4.833   9.267   1.00 0.00 ? 74 HIS A H    3  
ATOM 3600  H HA   . HIS A 1 74 ? 0.584   4.040   10.340  1.00 0.00 ? 74 HIS A HA   3  
ATOM 3601  H HB3  . HIS A 1 74 ? 2.757   5.377   11.233  1.00 0.00 ? 74 HIS A HB3  3  
ATOM 3602  H HD1  . HIS A 1 74 ? 3.537   7.723   11.505  1.00 0.00 ? 74 HIS A HD1  3  
ATOM 3603  H HD2  . HIS A 1 74 ? -0.650  7.462   11.483  1.00 0.00 ? 74 HIS A HD2  3  
ATOM 3604  H HE1  . HIS A 1 74 ? 2.670   10.110  11.754  1.00 0.00 ? 74 HIS A HE1  3  
ATOM 3605  N N    . ARG A 1 75 ? 0.208   6.690   8.522   1.00 0.00 ? 75 ARG A N    3  
ATOM 3606  C CA   . ARG A 1 75 ? -0.762  7.589   7.921   1.00 0.00 ? 75 ARG A CA   3  
ATOM 3607  C C    . ARG A 1 75 ? -1.366  6.955   6.667   1.00 0.00 ? 75 ARG A C    3  
ATOM 3608  O O    . ARG A 1 75 ? -2.552  7.127   6.389   1.00 0.00 ? 75 ARG A O    3  
ATOM 3609  C CB   . ARG A 1 75 ? -0.117  8.926   7.549   1.00 0.00 ? 75 ARG A CB   3  
ATOM 3610  C CG   . ARG A 1 75 ? 1.061   9.242   8.472   1.00 0.00 ? 75 ARG A CG   3  
ATOM 3611  C CD   . ARG A 1 75 ? 1.142   10.742  8.762   1.00 0.00 ? 75 ARG A CD   3  
ATOM 3612  N NE   . ARG A 1 75 ? 2.385   11.048  9.504   1.00 0.00 ? 75 ARG A NE   3  
ATOM 3613  C CZ   . ARG A 1 75 ? 2.728   12.273  9.923   1.00 0.00 ? 75 ARG A CZ   3  
ATOM 3614  N NH1  . ARG A 1 75 ? 1.924   13.316  9.676   1.00 0.00 ? 75 ARG A NH1  3  
ATOM 3615  N NH2  . ARG A 1 75 ? 3.877   12.457  10.590  1.00 0.00 ? 75 ARG A NH2  3  
ATOM 3616  H H    . ARG A 1 75 ? 1.123   6.725   8.120   1.00 0.00 ? 75 ARG A H    3  
ATOM 3617  H HA   . ARG A 1 75 ? -1.520  7.736   8.690   1.00 0.00 ? 75 ARG A HA   3  
ATOM 3618  H HB3  . ARG A 1 75 ? -0.860  9.722   7.613   1.00 0.00 ? 75 ARG A HB3  3  
ATOM 3619  H HG3  . ARG A 1 75 ? 1.990   8.906   8.011   1.00 0.00 ? 75 ARG A HG3  3  
ATOM 3620  H HD3  . ARG A 1 75 ? 0.276   11.056  9.343   1.00 0.00 ? 75 ARG A HD3  3  
ATOM 3621  H HE   . ARG A 1 75 ? 3.009   10.292  9.705   1.00 0.00 ? 75 ARG A HE   3  
ATOM 3622  H HH11 . ARG A 1 75 ? 1.067   13.179  9.178   1.00 0.00 ? 75 ARG A HH11 3  
ATOM 3623  H HH12 . ARG A 1 75 ? 2.180   14.231  9.989   1.00 0.00 ? 75 ARG A HH12 3  
ATOM 3624  H HH21 . ARG A 1 75 ? 4.477   11.679  10.774  1.00 0.00 ? 75 ARG A HH21 3  
ATOM 3625  H HH22 . ARG A 1 75 ? 4.133   13.371  10.903  1.00 0.00 ? 75 ARG A HH22 3  
ATOM 3626  N N    . ILE A 1 76 ? -0.522  6.235   5.941   1.00 0.00 ? 76 ILE A N    3  
ATOM 3627  C CA   . ILE A 1 76 ? -0.959  5.575   4.723   1.00 0.00 ? 76 ILE A CA   3  
ATOM 3628  C C    . ILE A 1 76 ? -2.279  4.849   4.985   1.00 0.00 ? 76 ILE A C    3  
ATOM 3629  O O    . ILE A 1 76 ? -2.345  3.958   5.831   1.00 0.00 ? 76 ILE A O    3  
ATOM 3630  C CB   . ILE A 1 76 ? 0.146   4.665   4.181   1.00 0.00 ? 76 ILE A CB   3  
ATOM 3631  C CG1  . ILE A 1 76 ? 1.417   5.463   3.883   1.00 0.00 ? 76 ILE A CG1  3  
ATOM 3632  C CG2  . ILE A 1 76 ? -0.339  3.881   2.960   1.00 0.00 ? 76 ILE A CG2  3  
ATOM 3633  C CD1  . ILE A 1 76 ? 2.492   4.569   3.262   1.00 0.00 ? 76 ILE A CD1  3  
ATOM 3634  H H    . ILE A 1 76 ? 0.440   6.101   6.173   1.00 0.00 ? 76 ILE A H    3  
ATOM 3635  H HA   . ILE A 1 76 ? -1.133  6.349   3.975   1.00 0.00 ? 76 ILE A HA   3  
ATOM 3636  H HB   . ILE A 1 76 ? 0.397   3.937   4.953   1.00 0.00 ? 76 ILE A HB   3  
ATOM 3637  H HG13 . ILE A 1 76 ? 1.795   5.909   4.803   1.00 0.00 ? 76 ILE A HG13 3  
ATOM 3638  H HG21 . ILE A 1 76 ? 0.458   3.836   2.218   1.00 0.00 ? 76 ILE A HG21 3  
ATOM 3639  H HG22 . ILE A 1 76 ? -0.612  2.871   3.262   1.00 0.00 ? 76 ILE A HG22 3  
ATOM 3640  H HG23 . ILE A 1 76 ? -1.207  4.379   2.530   1.00 0.00 ? 76 ILE A HG23 3  
ATOM 3641  H HD11 . ILE A 1 76 ? 2.679   4.885   2.236   1.00 0.00 ? 76 ILE A HD11 3  
ATOM 3642  H HD12 . ILE A 1 76 ? 3.412   4.653   3.841   1.00 0.00 ? 76 ILE A HD12 3  
ATOM 3643  H HD13 . ILE A 1 76 ? 2.152   3.534   3.268   1.00 0.00 ? 76 ILE A HD13 3  
ATOM 3644  N N    . ARG A 1 77 ? -3.300  5.258   4.246   1.00 0.00 ? 77 ARG A N    3  
ATOM 3645  C CA   . ARG A 1 77 ? -4.615  4.657   4.389   1.00 0.00 ? 77 ARG A CA   3  
ATOM 3646  C C    . ARG A 1 77 ? -5.215  4.360   3.012   1.00 0.00 ? 77 ARG A C    3  
ATOM 3647  O O    . ARG A 1 77 ? -5.190  5.209   2.122   1.00 0.00 ? 77 ARG A O    3  
ATOM 3648  C CB   . ARG A 1 77 ? -5.561  5.579   5.160   1.00 0.00 ? 77 ARG A CB   3  
ATOM 3649  C CG   . ARG A 1 77 ? -5.430  5.361   6.669   1.00 0.00 ? 77 ARG A CG   3  
ATOM 3650  C CD   . ARG A 1 77 ? -6.522  6.117   7.429   1.00 0.00 ? 77 ARG A CD   3  
ATOM 3651  N NE   . ARG A 1 77 ? -5.941  7.294   8.112   1.00 0.00 ? 77 ARG A NE   3  
ATOM 3652  C CZ   . ARG A 1 77 ? -5.223  7.229   9.242   1.00 0.00 ? 77 ARG A CZ   3  
ATOM 3653  N NH1  . ARG A 1 77 ? -4.993  6.042   9.822   1.00 0.00 ? 77 ARG A NH1  3  
ATOM 3654  N NH2  . ARG A 1 77 ? -4.734  8.349   9.792   1.00 0.00 ? 77 ARG A NH2  3  
ATOM 3655  H H    . ARG A 1 77 ? -3.239  5.983   3.560   1.00 0.00 ? 77 ARG A H    3  
ATOM 3656  H HA   . ARG A 1 77 ? -4.443  3.738   4.949   1.00 0.00 ? 77 ARG A HA   3  
ATOM 3657  H HB3  . ARG A 1 77 ? -6.590  5.395   4.850   1.00 0.00 ? 77 ARG A HB3  3  
ATOM 3658  H HG3  . ARG A 1 77 ? -4.449  5.698   7.004   1.00 0.00 ? 77 ARG A HG3  3  
ATOM 3659  H HD3  . ARG A 1 77 ? -6.990  5.457   8.159   1.00 0.00 ? 77 ARG A HD3  3  
ATOM 3660  H HE   . ARG A 1 77 ? -6.093  8.195   7.706   1.00 0.00 ? 77 ARG A HE   3  
ATOM 3661  H HH11 . ARG A 1 77 ? -5.358  5.207   9.412   1.00 0.00 ? 77 ARG A HH11 3  
ATOM 3662  H HH12 . ARG A 1 77 ? -4.457  5.994   10.665  1.00 0.00 ? 77 ARG A HH12 3  
ATOM 3663  H HH21 . ARG A 1 77 ? -4.905  9.234   9.359   1.00 0.00 ? 77 ARG A HH21 3  
ATOM 3664  H HH22 . ARG A 1 77 ? -4.198  8.300   10.634  1.00 0.00 ? 77 ARG A HH22 3  
ATOM 3665  N N    . PHE A 1 78 ? -5.741  3.151   2.880   1.00 0.00 ? 78 PHE A N    3  
ATOM 3666  C CA   . PHE A 1 78 ? -6.346  2.730   1.629   1.00 0.00 ? 78 PHE A CA   3  
ATOM 3667  C C    . PHE A 1 78 ? -7.841  3.057   1.604   1.00 0.00 ? 78 PHE A C    3  
ATOM 3668  O O    . PHE A 1 78 ? -8.510  2.995   2.634   1.00 0.00 ? 78 PHE A O    3  
ATOM 3669  C CB   . PHE A 1 78 ? -6.167  1.214   1.532   1.00 0.00 ? 78 PHE A CB   3  
ATOM 3670  C CG   . PHE A 1 78 ? -4.816  0.784   0.958   1.00 0.00 ? 78 PHE A CG   3  
ATOM 3671  C CD1  . PHE A 1 78 ? -3.663  1.270   1.491   1.00 0.00 ? 78 PHE A CD1  3  
ATOM 3672  C CD2  . PHE A 1 78 ? -4.767  -0.087  -0.087  1.00 0.00 ? 78 PHE A CD2  3  
ATOM 3673  C CE1  . PHE A 1 78 ? -2.410  0.870   0.958   1.00 0.00 ? 78 PHE A CE1  3  
ATOM 3674  C CE2  . PHE A 1 78 ? -3.512  -0.487  -0.620  1.00 0.00 ? 78 PHE A CE2  3  
ATOM 3675  C CZ   . PHE A 1 78 ? -2.361  0.000   -0.086  1.00 0.00 ? 78 PHE A CZ   3  
ATOM 3676  H H    . PHE A 1 78 ? -5.758  2.466   3.609   1.00 0.00 ? 78 PHE A H    3  
ATOM 3677  H HA   . PHE A 1 78 ? -5.845  3.274   0.828   1.00 0.00 ? 78 PHE A HA   3  
ATOM 3678  H HB3  . PHE A 1 78 ? -6.962  0.803   0.909   1.00 0.00 ? 78 PHE A HB3  3  
ATOM 3679  H HD1  . PHE A 1 78 ? -3.703  1.968   2.328   1.00 0.00 ? 78 PHE A HD1  3  
ATOM 3680  H HD2  . PHE A 1 78 ? -5.690  -0.477  -0.514  1.00 0.00 ? 78 PHE A HD2  3  
ATOM 3681  H HE1  . PHE A 1 78 ? -1.485  1.260   1.386   1.00 0.00 ? 78 PHE A HE1  3  
ATOM 3682  H HE2  . PHE A 1 78 ? -3.474  -1.184  -1.456  1.00 0.00 ? 78 PHE A HE2  3  
ATOM 3683  H HZ   . PHE A 1 78 ? -1.398  -0.307  -0.494  1.00 0.00 ? 78 PHE A HZ   3  
ATOM 3684  N N    . LYS A 1 79 ? -8.320  3.399   0.417   1.00 0.00 ? 79 LYS A N    3  
ATOM 3685  C CA   . LYS A 1 79 ? -9.724  3.736   0.246   1.00 0.00 ? 79 LYS A CA   3  
ATOM 3686  C C    . LYS A 1 79 ? -10.258 3.049   -1.012  1.00 0.00 ? 79 LYS A C    3  
ATOM 3687  O O    . LYS A 1 79 ? -9.743  3.265   -2.108  1.00 0.00 ? 79 LYS A O    3  
ATOM 3688  C CB   . LYS A 1 79 ? -9.914  5.254   0.247   1.00 0.00 ? 79 LYS A CB   3  
ATOM 3689  C CG   . LYS A 1 79 ? -10.145 5.776   1.666   1.00 0.00 ? 79 LYS A CG   3  
ATOM 3690  C CD   . LYS A 1 79 ? -11.636 5.787   2.011   1.00 0.00 ? 79 LYS A CD   3  
ATOM 3691  C CE   . LYS A 1 79 ? -12.338 6.985   1.369   1.00 0.00 ? 79 LYS A CE   3  
ATOM 3692  N NZ   . LYS A 1 79 ? -13.360 7.538   2.286   1.00 0.00 ? 79 LYS A NZ   3  
ATOM 3693  H H    . LYS A 1 79 ? -7.770  3.447   -0.416  1.00 0.00 ? 79 LYS A H    3  
ATOM 3694  H HA   . LYS A 1 79 ? -10.262 3.343   1.109   1.00 0.00 ? 79 LYS A HA   3  
ATOM 3695  H HB3  . LYS A 1 79 ? -10.763 5.518   -0.385  1.00 0.00 ? 79 LYS A HB3  3  
ATOM 3696  H HG3  . LYS A 1 79 ? -9.740  6.784   1.756   1.00 0.00 ? 79 LYS A HG3  3  
ATOM 3697  H HD3  . LYS A 1 79 ? -11.762 5.823   3.093   1.00 0.00 ? 79 LYS A HD3  3  
ATOM 3698  H HE3  . LYS A 1 79 ? -12.807 6.681   0.433   1.00 0.00 ? 79 LYS A HE3  3  
ATOM 3699  H HZ1  . LYS A 1 79 ? -13.626 8.452   1.977   1.00 0.00 ? 79 LYS A HZ1  3  
ATOM 3700  H HZ2  . LYS A 1 79 ? -14.163 6.941   2.289   1.00 0.00 ? 79 LYS A HZ2  3  
ATOM 3701  H HZ3  . LYS A 1 79 ? -12.984 7.594   3.211   1.00 0.00 ? 79 LYS A HZ3  3  
ATOM 3702  N N    . LEU A 1 80 ? -11.285 2.236   -0.814  1.00 0.00 ? 80 LEU A N    3  
ATOM 3703  C CA   . LEU A 1 80 ? -11.896 1.517   -1.919  1.00 0.00 ? 80 LEU A CA   3  
ATOM 3704  C C    . LEU A 1 80 ? -13.111 2.299   -2.422  1.00 0.00 ? 80 LEU A C    3  
ATOM 3705  O O    . LEU A 1 80 ? -13.799 2.953   -1.640  1.00 0.00 ? 80 LEU A O    3  
ATOM 3706  C CB   . LEU A 1 80 ? -12.216 0.078   -1.510  1.00 0.00 ? 80 LEU A CB   3  
ATOM 3707  C CG   . LEU A 1 80 ? -11.050 -0.911  -1.567  1.00 0.00 ? 80 LEU A CG   3  
ATOM 3708  C CD1  . LEU A 1 80 ? -11.498 -2.311  -1.141  1.00 0.00 ? 80 LEU A CD1  3  
ATOM 3709  C CD2  . LEU A 1 80 ? -10.401 -0.915  -2.953  1.00 0.00 ? 80 LEU A CD2  3  
ATOM 3710  H H    . LEU A 1 80 ? -11.699 2.066   0.081   1.00 0.00 ? 80 LEU A H    3  
ATOM 3711  H HA   . LEU A 1 80 ? -11.160 1.467   -2.722  1.00 0.00 ? 80 LEU A HA   3  
ATOM 3712  H HB3  . LEU A 1 80 ? -13.013 -0.292  -2.154  1.00 0.00 ? 80 LEU A HB3  3  
ATOM 3713  H HG   . LEU A 1 80 ? -10.291 -0.586  -0.857  1.00 0.00 ? 80 LEU A HG   3  
ATOM 3714  H HD11 . LEU A 1 80 ? -11.756 -2.303  -0.082  1.00 0.00 ? 80 LEU A HD11 3  
ATOM 3715  H HD12 . LEU A 1 80 ? -12.369 -2.608  -1.725  1.00 0.00 ? 80 LEU A HD12 3  
ATOM 3716  H HD13 . LEU A 1 80 ? -10.686 -3.020  -1.312  1.00 0.00 ? 80 LEU A HD13 3  
ATOM 3717  H HD21 . LEU A 1 80 ? -10.999 -0.311  -3.635  1.00 0.00 ? 80 LEU A HD21 3  
ATOM 3718  H HD22 . LEU A 1 80 ? -9.397  -0.497  -2.885  1.00 0.00 ? 80 LEU A HD22 3  
ATOM 3719  H HD23 . LEU A 1 80 ? -10.346 -1.937  -3.326  1.00 0.00 ? 80 LEU A HD23 3  
ATOM 3720  N N    . LYS A 1 81 ? -13.337 2.206   -3.724  1.00 0.00 ? 81 LYS A N    3  
ATOM 3721  C CA   . LYS A 1 81 ? -14.457 2.896   -4.340  1.00 0.00 ? 81 LYS A CA   3  
ATOM 3722  C C    . LYS A 1 81 ? -15.726 2.625   -3.529  1.00 0.00 ? 81 LYS A C    3  
ATOM 3723  O O    . LYS A 1 81 ? -15.914 1.524   -3.013  1.00 0.00 ? 81 LYS A O    3  
ATOM 3724  C CB   . LYS A 1 81 ? -14.577 2.511   -5.816  1.00 0.00 ? 81 LYS A CB   3  
ATOM 3725  C CG   . LYS A 1 81 ? -15.107 1.085   -5.970  1.00 0.00 ? 81 LYS A CG   3  
ATOM 3726  C CD   . LYS A 1 81 ? -16.019 0.968   -7.194  1.00 0.00 ? 81 LYS A CD   3  
ATOM 3727  C CE   . LYS A 1 81 ? -16.973 -0.220  -7.056  1.00 0.00 ? 81 LYS A CE   3  
ATOM 3728  N NZ   . LYS A 1 81 ? -18.175 -0.019  -7.895  1.00 0.00 ? 81 LYS A NZ   3  
ATOM 3729  H H    . LYS A 1 81 ? -12.772 1.671   -4.352  1.00 0.00 ? 81 LYS A H    3  
ATOM 3730  H HA   . LYS A 1 81 ? -14.244 3.964   -4.301  1.00 0.00 ? 81 LYS A HA   3  
ATOM 3731  H HB3  . LYS A 1 81 ? -13.602 2.594   -6.298  1.00 0.00 ? 81 LYS A HB3  3  
ATOM 3732  H HG3  . LYS A 1 81 ? -15.658 0.800   -5.074  1.00 0.00 ? 81 LYS A HG3  3  
ATOM 3733  H HD3  . LYS A 1 81 ? -15.413 0.849   -8.092  1.00 0.00 ? 81 LYS A HD3  3  
ATOM 3734  H HE3  . LYS A 1 81 ? -17.267 -0.338  -6.012  1.00 0.00 ? 81 LYS A HE3  3  
ATOM 3735  H HZ1  . LYS A 1 81 ? -18.035 0.767   -8.496  1.00 0.00 ? 81 LYS A HZ1  3  
ATOM 3736  H HZ2  . LYS A 1 81 ? -18.336 -0.837  -8.448  1.00 0.00 ? 81 LYS A HZ2  3  
ATOM 3737  H HZ3  . LYS A 1 81 ? -18.968 0.147   -7.308  1.00 0.00 ? 81 LYS A HZ3  3  
ATOM 3738  N N    . ARG A 1 82 ? -16.564 3.647   -3.442  1.00 0.00 ? 82 ARG A N    3  
ATOM 3739  C CA   . ARG A 1 82 ? -17.809 3.534   -2.704  1.00 0.00 ? 82 ARG A CA   3  
ATOM 3740  C C    . ARG A 1 82 ? -18.848 4.509   -3.262  1.00 0.00 ? 82 ARG A C    3  
ATOM 3741  O O    . ARG A 1 82 ? -18.510 5.620   -3.663  1.00 0.00 ? 82 ARG A O    3  
ATOM 3742  C CB   . ARG A 1 82 ? -17.596 3.822   -1.217  1.00 0.00 ? 82 ARG A CB   3  
ATOM 3743  C CG   . ARG A 1 82 ? -17.723 2.544   -0.386  1.00 0.00 ? 82 ARG A CG   3  
ATOM 3744  C CD   . ARG A 1 82 ? -17.039 2.703   0.974   1.00 0.00 ? 82 ARG A CD   3  
ATOM 3745  N NE   . ARG A 1 82 ? -16.530 1.395   1.441   1.00 0.00 ? 82 ARG A NE   3  
ATOM 3746  C CZ   . ARG A 1 82 ? -15.660 1.243   2.450   1.00 0.00 ? 82 ARG A CZ   3  
ATOM 3747  N NH1  . ARG A 1 82 ? -15.199 2.318   3.103   1.00 0.00 ? 82 ARG A NH1  3  
ATOM 3748  N NH2  . ARG A 1 82 ? -15.253 0.018   2.805   1.00 0.00 ? 82 ARG A NH2  3  
ATOM 3749  H H    . ARG A 1 82 ? -16.404 4.539   -3.866  1.00 0.00 ? 82 ARG A H    3  
ATOM 3750  H HA   . ARG A 1 82 ? -18.125 2.500   -2.846  1.00 0.00 ? 82 ARG A HA   3  
ATOM 3751  H HB3  . ARG A 1 82 ? -18.328 4.555   -0.876  1.00 0.00 ? 82 ARG A HB3  3  
ATOM 3752  H HG3  . ARG A 1 82 ? -17.275 1.710   -0.926  1.00 0.00 ? 82 ARG A HG3  3  
ATOM 3753  H HD3  . ARG A 1 82 ? -17.745 3.108   1.699   1.00 0.00 ? 82 ARG A HD3  3  
ATOM 3754  H HE   . ARG A 1 82 ? -16.854 0.572   0.974   1.00 0.00 ? 82 ARG A HE   3  
ATOM 3755  H HH11 . ARG A 1 82 ? -15.503 3.233   2.838   1.00 0.00 ? 82 ARG A HH11 3  
ATOM 3756  H HH12 . ARG A 1 82 ? -14.550 2.206   3.856   1.00 0.00 ? 82 ARG A HH12 3  
ATOM 3757  H HH21 . ARG A 1 82 ? -15.598 -0.785  2.317   1.00 0.00 ? 82 ARG A HH21 3  
ATOM 3758  H HH22 . ARG A 1 82 ? -14.605 -0.096  3.557   1.00 0.00 ? 82 ARG A HH22 3  
ATOM 3759  N N    . PRO A 1 83 ? -20.127 4.043   -3.268  1.00 0.00 ? 83 PRO A N    3  
ATOM 3760  C CA   . PRO A 1 83 ? -21.218 4.862   -3.770  1.00 0.00 ? 83 PRO A CA   3  
ATOM 3761  C C    . PRO A 1 83 ? -21.585 5.959   -2.769  1.00 0.00 ? 83 PRO A C    3  
ATOM 3762  O O    . PRO A 1 83 ? -22.578 5.843   -2.052  1.00 0.00 ? 83 PRO A O    3  
ATOM 3763  C CB   . PRO A 1 83 ? -22.356 3.887   -4.027  1.00 0.00 ? 83 PRO A CB   3  
ATOM 3764  C CG   . PRO A 1 83 ? -22.022 2.638   -3.227  1.00 0.00 ? 83 PRO A CG   3  
ATOM 3765  C CD   . PRO A 1 83 ? -20.567 2.732   -2.801  1.00 0.00 ? 83 PRO A CD   3  
ATOM 3766  H HA   . PRO A 1 83 ? -20.940 5.337   -4.605  1.00 0.00 ? 83 PRO A HA   3  
ATOM 3767  H HB3  . PRO A 1 83 ? -22.442 3.659   -5.089  1.00 0.00 ? 83 PRO A HB3  3  
ATOM 3768  H HG3  . PRO A 1 83 ? -22.186 1.744   -3.830  1.00 0.00 ? 83 PRO A HG3  3  
ATOM 3769  H HD3  . PRO A 1 83 ? -19.970 1.934   -3.245  1.00 0.00 ? 83 PRO A HD3  3  
ATOM 3770  N N    . SER A 1 84 ? -20.766 7.000   -2.753  1.00 0.00 ? 84 SER A N    3  
ATOM 3771  C CA   . SER A 1 84 ? -20.992 8.116   -1.851  1.00 0.00 ? 84 SER A CA   3  
ATOM 3772  C C    . SER A 1 84 ? -21.083 7.615   -0.409  1.00 0.00 ? 84 SER A C    3  
ATOM 3773  O O    . SER A 1 84 ? -22.171 7.319   0.082   1.00 0.00 ? 84 SER A O    3  
ATOM 3774  C CB   . SER A 1 84 ? -22.263 8.880   -2.229  1.00 0.00 ? 84 SER A CB   3  
ATOM 3775  O OG   . SER A 1 84 ? -22.017 10.272  -2.406  1.00 0.00 ? 84 SER A OG   3  
ATOM 3776  H H    . SER A 1 84 ? -19.960 7.086   -3.338  1.00 0.00 ? 84 SER A H    3  
ATOM 3777  H HA   . SER A 1 84 ? -20.127 8.768   -1.976  1.00 0.00 ? 84 SER A HA   3  
ATOM 3778  H HB3  . SER A 1 84 ? -23.014 8.740   -1.451  1.00 0.00 ? 84 SER A HB3  3  
ATOM 3779  H HG   . SER A 1 84 ? -21.112 10.507  -2.051  1.00 0.00 ? 84 SER A HG   3  
ATOM 3780  N N    . SER A 1 85 ? -19.925 7.535   0.230   1.00 0.00 ? 85 SER A N    3  
ATOM 3781  C CA   . SER A 1 85 ? -19.860 7.074   1.607   1.00 0.00 ? 85 SER A CA   3  
ATOM 3782  C C    . SER A 1 85 ? -18.461 7.322   2.177   1.00 0.00 ? 85 SER A C    3  
ATOM 3783  O O    . SER A 1 85 ? -17.462 7.069   1.507   1.00 0.00 ? 85 SER A O    3  
ATOM 3784  C CB   . SER A 1 85 ? -20.219 5.590   1.710   1.00 0.00 ? 85 SER A CB   3  
ATOM 3785  O OG   . SER A 1 85 ? -20.324 5.158   3.063   1.00 0.00 ? 85 SER A OG   3  
ATOM 3786  H H    . SER A 1 85 ? -19.044 7.778   -0.176  1.00 0.00 ? 85 SER A H    3  
ATOM 3787  H HA   . SER A 1 85 ? -20.602 7.665   2.145   1.00 0.00 ? 85 SER A HA   3  
ATOM 3788  H HB3  . SER A 1 85 ? -19.461 4.998   1.197   1.00 0.00 ? 85 SER A HB3  3  
ATOM 3789  H HG   . SER A 1 85 ? -21.282 4.984   3.293   1.00 0.00 ? 85 SER A HG   3  
ATOM 3790  N N    . GLY A 1 86 ? -18.437 7.815   3.406   1.00 0.00 ? 86 GLY A N    3  
ATOM 3791  C CA   . GLY A 1 86 ? -17.178 8.099   4.074   1.00 0.00 ? 86 GLY A CA   3  
ATOM 3792  C C    . GLY A 1 86 ? -16.569 6.825   4.661   1.00 0.00 ? 86 GLY A C    3  
ATOM 3793  O O    . GLY A 1 86 ? -16.688 5.748   4.077   1.00 0.00 ? 86 GLY A O    3  
ATOM 3794  H H    . GLY A 1 86 ? -19.255 8.017   3.944   1.00 0.00 ? 86 GLY A H    3  
ATOM 3795  H HA2  . GLY A 1 86 ? -16.481 8.547   3.366   1.00 0.00 ? 86 GLY A HA2  3  
ATOM 3796  H HA3  . GLY A 1 86 ? -17.340 8.829   4.867   1.00 0.00 ? 86 GLY A HA3  3  
ATOM 3797  N N    . PRO A 1 87 ? -15.911 6.992   5.839   1.00 0.00 ? 87 PRO A N    3  
ATOM 3798  C CA   . PRO A 1 87 ? -15.282 5.869   6.512   1.00 0.00 ? 87 PRO A CA   3  
ATOM 3799  C C    . PRO A 1 87 ? -16.328 4.977   7.184   1.00 0.00 ? 87 PRO A C    3  
ATOM 3800  O O    . PRO A 1 87 ? -17.523 5.267   7.132   1.00 0.00 ? 87 PRO A O    3  
ATOM 3801  C CB   . PRO A 1 87 ? -14.312 6.495   7.502   1.00 0.00 ? 87 PRO A CB   3  
ATOM 3802  C CG   . PRO A 1 87 ? -14.767 7.936   7.676   1.00 0.00 ? 87 PRO A CG   3  
ATOM 3803  C CD   . PRO A 1 87 ? -15.748 8.252   6.559   1.00 0.00 ? 87 PRO A CD   3  
ATOM 3804  H HA   . PRO A 1 87 ? -14.811 5.287   5.849   1.00 0.00 ? 87 PRO A HA   3  
ATOM 3805  H HB3  . PRO A 1 87 ? -13.289 6.450   7.128   1.00 0.00 ? 87 PRO A HB3  3  
ATOM 3806  H HG3  . PRO A 1 87 ? -13.913 8.612   7.637   1.00 0.00 ? 87 PRO A HG3  3  
ATOM 3807  H HD3  . PRO A 1 87 ? -15.366 9.036   5.906   1.00 0.00 ? 87 PRO A HD3  3  
ATOM 3808  N N    . SER A 1 88 ? -15.841 3.909   7.798   1.00 0.00 ? 88 SER A N    3  
ATOM 3809  C CA   . SER A 1 88 ? -16.719 2.972   8.479   1.00 0.00 ? 88 SER A CA   3  
ATOM 3810  C C    . SER A 1 88 ? -16.693 3.232   9.987   1.00 0.00 ? 88 SER A C    3  
ATOM 3811  O O    . SER A 1 88 ? -15.776 2.791   10.680  1.00 0.00 ? 88 SER A O    3  
ATOM 3812  C CB   . SER A 1 88 ? -16.319 1.525   8.182   1.00 0.00 ? 88 SER A CB   3  
ATOM 3813  O OG   . SER A 1 88 ? -16.945 1.030   7.002   1.00 0.00 ? 88 SER A OG   3  
ATOM 3814  H H    . SER A 1 88 ? -14.869 3.679   7.835   1.00 0.00 ? 88 SER A H    3  
ATOM 3815  H HA   . SER A 1 88 ? -17.714 3.163   8.076   1.00 0.00 ? 88 SER A HA   3  
ATOM 3816  H HB3  . SER A 1 88 ? -16.588 0.893   9.028   1.00 0.00 ? 88 SER A HB3  3  
ATOM 3817  H HG   . SER A 1 88 ? -16.639 0.096   6.819   1.00 0.00 ? 88 SER A HG   3  
ATOM 3818  N N    . SER A 1 89 ? -17.709 3.944   10.450  1.00 0.00 ? 89 SER A N    3  
ATOM 3819  C CA   . SER A 1 89 ? -17.814 4.266   11.863  1.00 0.00 ? 89 SER A CA   3  
ATOM 3820  C C    . SER A 1 89 ? -18.036 2.990   12.676  1.00 0.00 ? 89 SER A C    3  
ATOM 3821  O O    . SER A 1 89 ? -19.072 2.339   12.547  1.00 0.00 ? 89 SER A O    3  
ATOM 3822  C CB   . SER A 1 89 ? -18.948 5.262   12.118  1.00 0.00 ? 89 SER A CB   3  
ATOM 3823  O OG   . SER A 1 89 ? -20.227 4.635   12.079  1.00 0.00 ? 89 SER A OG   3  
ATOM 3824  H H    . SER A 1 89 ? -18.451 4.297   9.880   1.00 0.00 ? 89 SER A H    3  
ATOM 3825  H HA   . SER A 1 89 ? -16.862 4.727   12.126  1.00 0.00 ? 89 SER A HA   3  
ATOM 3826  H HB3  . SER A 1 89 ? -18.909 6.054   11.371  1.00 0.00 ? 89 SER A HB3  3  
ATOM 3827  H HG   . SER A 1 89 ? -20.465 4.401   11.136  1.00 0.00 ? 89 SER A HG   3  
ATOM 3828  N N    . GLY A 1 90 ? -17.045 2.669   13.497  1.00 0.00 ? 90 GLY A N    3  
ATOM 3829  C CA   . GLY A 1 90 ? -17.119 1.482   14.331  1.00 0.00 ? 90 GLY A CA   3  
ATOM 3830  C C    . GLY A 1 90 ? -15.720 0.976   14.689  1.00 0.00 ? 90 GLY A C    3  
ATOM 3831  O O    . GLY A 1 90 ? -15.353 -0.143  14.335  1.00 0.00 ? 90 GLY A O    3  
ATOM 3832  H H    . GLY A 1 90 ? -16.206 3.204   13.595  1.00 0.00 ? 90 GLY A H    3  
ATOM 3833  H HA2  . GLY A 1 90 ? -17.672 1.708   15.243  1.00 0.00 ? 90 GLY A HA2  3  
ATOM 3834  H HA3  . GLY A 1 90 ? -17.670 0.700   13.809  1.00 0.00 ? 90 GLY A HA3  3  
ATOM 3835  N N    . GLY A 1 1  ? -0.804  -16.884 5.156   1.00 0.00 ? 1  GLY A N    4  
ATOM 3836  C CA   . GLY A 1 1  ? 0.070   -15.939 4.482   1.00 0.00 ? 1  GLY A CA   4  
ATOM 3837  C C    . GLY A 1 1  ? 1.535   -16.195 4.842   1.00 0.00 ? 1  GLY A C    4  
ATOM 3838  O O    . GLY A 1 1  ? 1.957   -17.344 4.961   1.00 0.00 ? 1  GLY A O    4  
ATOM 3839  H H1   . GLY A 1 1  ? -0.415  -17.312 5.971   1.00 0.00 ? 1  GLY A H1   4  
ATOM 3840  H HA2  . GLY A 1 1  ? -0.063  -16.021 3.403   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3841  H HA3  . GLY A 1 1  ? -0.204  -14.922 4.761   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3842  N N    . SER A 1 2  ? 2.270   -15.105 5.006   1.00 0.00 ? 2  SER A N    4  
ATOM 3843  C CA   . SER A 1 2  ? 3.679   -15.196 5.351   1.00 0.00 ? 2  SER A CA   4  
ATOM 3844  C C    . SER A 1 2  ? 4.118   -13.936 6.098   1.00 0.00 ? 2  SER A C    4  
ATOM 3845  O O    . SER A 1 2  ? 3.377   -12.956 6.159   1.00 0.00 ? 2  SER A O    4  
ATOM 3846  C CB   . SER A 1 2  ? 4.539   -15.400 4.101   1.00 0.00 ? 2  SER A CB   4  
ATOM 3847  O OG   . SER A 1 2  ? 5.363   -16.558 4.203   1.00 0.00 ? 2  SER A OG   4  
ATOM 3848  H H    . SER A 1 2  ? 1.919   -14.174 4.908   1.00 0.00 ? 2  SER A H    4  
ATOM 3849  H HA   . SER A 1 2  ? 3.762   -16.072 5.995   1.00 0.00 ? 2  SER A HA   4  
ATOM 3850  H HB3  . SER A 1 2  ? 5.165   -14.522 3.946   1.00 0.00 ? 2  SER A HB3  4  
ATOM 3851  H HG   . SER A 1 2  ? 6.054   -16.425 4.914   1.00 0.00 ? 2  SER A HG   4  
ATOM 3852  N N    . SER A 1 3  ? 5.322   -14.002 6.648   1.00 0.00 ? 3  SER A N    4  
ATOM 3853  C CA   . SER A 1 3  ? 5.869   -12.878 7.389   1.00 0.00 ? 3  SER A CA   4  
ATOM 3854  C C    . SER A 1 3  ? 7.329   -12.652 6.994   1.00 0.00 ? 3  SER A C    4  
ATOM 3855  O O    . SER A 1 3  ? 7.979   -13.550 6.460   1.00 0.00 ? 3  SER A O    4  
ATOM 3856  C CB   . SER A 1 3  ? 5.757   -13.107 8.898   1.00 0.00 ? 3  SER A CB   4  
ATOM 3857  O OG   . SER A 1 3  ? 6.326   -14.352 9.293   1.00 0.00 ? 3  SER A OG   4  
ATOM 3858  H H    . SER A 1 3  ? 5.919   -14.803 6.593   1.00 0.00 ? 3  SER A H    4  
ATOM 3859  H HA   . SER A 1 3  ? 5.258   -12.021 7.106   1.00 0.00 ? 3  SER A HA   4  
ATOM 3860  H HB3  . SER A 1 3  ? 4.708   -13.079 9.192   1.00 0.00 ? 3  SER A HB3  4  
ATOM 3861  H HG   . SER A 1 3  ? 5.667   -14.872 9.836   1.00 0.00 ? 3  SER A HG   4  
ATOM 3862  N N    . GLY A 1 4  ? 7.803   -11.446 7.270   1.00 0.00 ? 4  GLY A N    4  
ATOM 3863  C CA   . GLY A 1 4  ? 9.175   -11.090 6.949   1.00 0.00 ? 4  GLY A CA   4  
ATOM 3864  C C    . GLY A 1 4  ? 9.345   -9.571  6.878   1.00 0.00 ? 4  GLY A C    4  
ATOM 3865  O O    . GLY A 1 4  ? 8.407   -8.853  6.532   1.00 0.00 ? 4  GLY A O    4  
ATOM 3866  H H    . GLY A 1 4  ? 7.269   -10.721 7.703   1.00 0.00 ? 4  GLY A H    4  
ATOM 3867  H HA2  . GLY A 1 4  ? 9.846   -11.500 7.704   1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3868  H HA3  . GLY A 1 4  ? 9.457   -11.535 5.995   1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3869  N N    . SER A 1 5  ? 10.547  -9.125  7.212   1.00 0.00 ? 5  SER A N    4  
ATOM 3870  C CA   . SER A 1 5  ? 10.852  -7.705  7.191   1.00 0.00 ? 5  SER A CA   4  
ATOM 3871  C C    . SER A 1 5  ? 12.367  -7.495  7.206   1.00 0.00 ? 5  SER A C    4  
ATOM 3872  O O    . SER A 1 5  ? 12.998  -7.571  8.260   1.00 0.00 ? 5  SER A O    4  
ATOM 3873  C CB   . SER A 1 5  ? 10.204  -6.985  8.376   1.00 0.00 ? 5  SER A CB   4  
ATOM 3874  O OG   . SER A 1 5  ? 10.665  -7.492  9.625   1.00 0.00 ? 5  SER A OG   4  
ATOM 3875  H H    . SER A 1 5  ? 11.304  -9.716  7.493   1.00 0.00 ? 5  SER A H    4  
ATOM 3876  H HA   . SER A 1 5  ? 10.423  -7.332  6.261   1.00 0.00 ? 5  SER A HA   4  
ATOM 3877  H HB3  . SER A 1 5  ? 9.121   -7.093  8.316   1.00 0.00 ? 5  SER A HB3  4  
ATOM 3878  H HG   . SER A 1 5  ? 11.366  -8.188  9.474   1.00 0.00 ? 5  SER A HG   4  
ATOM 3879  N N    . SER A 1 6  ? 12.909  -7.233  6.026   1.00 0.00 ? 6  SER A N    4  
ATOM 3880  C CA   . SER A 1 6  ? 14.338  -7.012  5.889   1.00 0.00 ? 6  SER A CA   4  
ATOM 3881  C C    . SER A 1 6  ? 14.599  -5.872  4.903   1.00 0.00 ? 6  SER A C    4  
ATOM 3882  O O    . SER A 1 6  ? 15.073  -4.805  5.293   1.00 0.00 ? 6  SER A O    4  
ATOM 3883  C CB   . SER A 1 6  ? 15.052  -8.285  5.431   1.00 0.00 ? 6  SER A CB   4  
ATOM 3884  O OG   . SER A 1 6  ? 16.457  -8.221  5.662   1.00 0.00 ? 6  SER A OG   4  
ATOM 3885  H H    . SER A 1 6  ? 12.389  -7.173  5.173   1.00 0.00 ? 6  SER A H    4  
ATOM 3886  H HA   . SER A 1 6  ? 14.684  -6.741  6.887   1.00 0.00 ? 6  SER A HA   4  
ATOM 3887  H HB3  . SER A 1 6  ? 14.866  -8.442  4.369   1.00 0.00 ? 6  SER A HB3  4  
ATOM 3888  H HG   . SER A 1 6  ? 16.919  -8.949  5.154   1.00 0.00 ? 6  SER A HG   4  
ATOM 3889  N N    . GLY A 1 7  ? 14.279  -6.136  3.645   1.00 0.00 ? 7  GLY A N    4  
ATOM 3890  C CA   . GLY A 1 7  ? 14.474  -5.146  2.599   1.00 0.00 ? 7  GLY A CA   4  
ATOM 3891  C C    . GLY A 1 7  ? 13.529  -3.957  2.788   1.00 0.00 ? 7  GLY A C    4  
ATOM 3892  O O    . GLY A 1 7  ? 12.559  -4.043  3.541   1.00 0.00 ? 7  GLY A O    4  
ATOM 3893  H H    . GLY A 1 7  ? 13.895  -7.006  3.335   1.00 0.00 ? 7  GLY A H    4  
ATOM 3894  H HA2  . GLY A 1 7  ? 15.507  -4.798  2.610   1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3895  H HA3  . GLY A 1 7  ? 14.300  -5.601  1.625   1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3896  N N    . LEU A 1 8  ? 13.844  -2.875  2.090   1.00 0.00 ? 8  LEU A N    4  
ATOM 3897  C CA   . LEU A 1 8  ? 13.034  -1.671  2.171   1.00 0.00 ? 8  LEU A CA   4  
ATOM 3898  C C    . LEU A 1 8  ? 11.773  -1.851  1.324   1.00 0.00 ? 8  LEU A C    4  
ATOM 3899  O O    . LEU A 1 8  ? 10.658  -1.729  1.829   1.00 0.00 ? 8  LEU A O    4  
ATOM 3900  C CB   . LEU A 1 8  ? 13.862  -0.442  1.789   1.00 0.00 ? 8  LEU A CB   4  
ATOM 3901  C CG   . LEU A 1 8  ? 14.496  0.327   2.950   1.00 0.00 ? 8  LEU A CG   4  
ATOM 3902  C CD1  . LEU A 1 8  ? 15.100  1.647   2.467   1.00 0.00 ? 8  LEU A CD1  4  
ATOM 3903  C CD2  . LEU A 1 8  ? 13.490  0.537   4.083   1.00 0.00 ? 8  LEU A CD2  4  
ATOM 3904  H H    . LEU A 1 8  ? 14.633  -2.813  1.480   1.00 0.00 ? 8  LEU A H    4  
ATOM 3905  H HA   . LEU A 1 8  ? 12.736  -1.548  3.213   1.00 0.00 ? 8  LEU A HA   4  
ATOM 3906  H HB3  . LEU A 1 8  ? 13.224  0.242   1.231   1.00 0.00 ? 8  LEU A HB3  4  
ATOM 3907  H HG   . LEU A 1 8  ? 15.313  -0.273  3.351   1.00 0.00 ? 8  LEU A HG   4  
ATOM 3908  H HD11 . LEU A 1 8  ? 15.653  2.113   3.283   1.00 0.00 ? 8  LEU A HD11 4  
ATOM 3909  H HD12 . LEU A 1 8  ? 15.775  1.456   1.633   1.00 0.00 ? 8  LEU A HD12 4  
ATOM 3910  H HD13 . LEU A 1 8  ? 14.302  2.315   2.142   1.00 0.00 ? 8  LEU A HD13 4  
ATOM 3911  H HD21 . LEU A 1 8  ? 12.477  0.464   3.687   1.00 0.00 ? 8  LEU A HD21 4  
ATOM 3912  H HD22 . LEU A 1 8  ? 13.637  -0.228  4.845   1.00 0.00 ? 8  LEU A HD22 4  
ATOM 3913  H HD23 . LEU A 1 8  ? 13.639  1.523   4.522   1.00 0.00 ? 8  LEU A HD23 4  
ATOM 3914  N N    . ARG A 1 9  ? 11.992  -2.138  0.049   1.00 0.00 ? 9  ARG A N    4  
ATOM 3915  C CA   . ARG A 1 9  ? 10.887  -2.337  -0.874  1.00 0.00 ? 9  ARG A CA   4  
ATOM 3916  C C    . ARG A 1 9  ? 10.082  -3.576  -0.479  1.00 0.00 ? 9  ARG A C    4  
ATOM 3917  O O    . ARG A 1 9  ? 8.867   -3.618  -0.669  1.00 0.00 ? 9  ARG A O    4  
ATOM 3918  C CB   . ARG A 1 9  ? 11.391  -2.499  -2.310  1.00 0.00 ? 9  ARG A CB   4  
ATOM 3919  C CG   . ARG A 1 9  ? 10.226  -2.712  -3.278  1.00 0.00 ? 9  ARG A CG   4  
ATOM 3920  C CD   . ARG A 1 9  ? 10.424  -3.986  -4.102  1.00 0.00 ? 9  ARG A CD   4  
ATOM 3921  N NE   . ARG A 1 9  ? 10.506  -5.161  -3.205  1.00 0.00 ? 9  ARG A NE   4  
ATOM 3922  C CZ   . ARG A 1 9  ? 10.337  -6.427  -3.609  1.00 0.00 ? 9  ARG A CZ   4  
ATOM 3923  N NH1  . ARG A 1 9  ? 10.075  -6.691  -4.896  1.00 0.00 ? 9  ARG A NH1  4  
ATOM 3924  N NH2  . ARG A 1 9  ? 10.429  -7.430  -2.724  1.00 0.00 ? 9  ARG A NH2  4  
ATOM 3925  H H    . ARG A 1 9  ? 12.902  -2.236  -0.355  1.00 0.00 ? 9  ARG A H    4  
ATOM 3926  H HA   . ARG A 1 9  ? 10.285  -1.432  -0.785  1.00 0.00 ? 9  ARG A HA   4  
ATOM 3927  H HB3  . ARG A 1 9  ? 12.074  -3.347  -2.365  1.00 0.00 ? 9  ARG A HB3  4  
ATOM 3928  H HG3  . ARG A 1 9  ? 10.142  -1.853  -3.945  1.00 0.00 ? 9  ARG A HG3  4  
ATOM 3929  H HD3  . ARG A 1 9  ? 11.333  -3.908  -4.696  1.00 0.00 ? 9  ARG A HD3  4  
ATOM 3930  H HE   . ARG A 1 9  ? 10.699  -4.999  -2.237  1.00 0.00 ? 9  ARG A HE   4  
ATOM 3931  H HH11 . ARG A 1 9  ? 10.006  -5.943  -5.555  1.00 0.00 ? 9  ARG A HH11 4  
ATOM 3932  H HH12 . ARG A 1 9  ? 9.949   -7.636  -5.197  1.00 0.00 ? 9  ARG A HH12 4  
ATOM 3933  H HH21 . ARG A 1 9  ? 10.624  -7.233  -1.763  1.00 0.00 ? 9  ARG A HH21 4  
ATOM 3934  H HH22 . ARG A 1 9  ? 10.303  -8.375  -3.026  1.00 0.00 ? 9  ARG A HH22 4  
ATOM 3935  N N    . LYS A 1 10 ? 10.790  -4.556  0.062   1.00 0.00 ? 10 LYS A N    4  
ATOM 3936  C CA   . LYS A 1 10 ? 10.157  -5.792  0.485   1.00 0.00 ? 10 LYS A CA   4  
ATOM 3937  C C    . LYS A 1 10 ? 9.195   -5.499  1.638   1.00 0.00 ? 10 LYS A C    4  
ATOM 3938  O O    . LYS A 1 10 ? 8.159   -6.150  1.767   1.00 0.00 ? 10 LYS A O    4  
ATOM 3939  C CB   . LYS A 1 10 ? 11.212  -6.849  0.819   1.00 0.00 ? 10 LYS A CB   4  
ATOM 3940  C CG   . LYS A 1 10 ? 10.609  -7.985  1.647   1.00 0.00 ? 10 LYS A CG   4  
ATOM 3941  C CD   . LYS A 1 10 ? 9.357   -8.548  0.973   1.00 0.00 ? 10 LYS A CD   4  
ATOM 3942  C CE   . LYS A 1 10 ? 8.227   -8.738  1.986   1.00 0.00 ? 10 LYS A CE   4  
ATOM 3943  N NZ   . LYS A 1 10 ? 6.912   -8.507  1.347   1.00 0.00 ? 10 LYS A NZ   4  
ATOM 3944  H H    . LYS A 1 10 ? 11.778  -4.513  0.213   1.00 0.00 ? 10 LYS A H    4  
ATOM 3945  H HA   . LYS A 1 10 ? 9.580   -6.169  -0.360  1.00 0.00 ? 10 LYS A HA   4  
ATOM 3946  H HB3  . LYS A 1 10 ? 12.031  -6.387  1.370   1.00 0.00 ? 10 LYS A HB3  4  
ATOM 3947  H HG3  . LYS A 1 10 ? 10.358  -7.621  2.643   1.00 0.00 ? 10 LYS A HG3  4  
ATOM 3948  H HD3  . LYS A 1 10 ? 9.591   -9.502  0.502   1.00 0.00 ? 10 LYS A HD3  4  
ATOM 3949  H HE3  . LYS A 1 10 ? 8.358   -8.048  2.820   1.00 0.00 ? 10 LYS A HE3  4  
ATOM 3950  H HZ1  . LYS A 1 10 ? 6.883   -7.582  0.969   1.00 0.00 ? 10 LYS A HZ1  4  
ATOM 3951  H HZ2  . LYS A 1 10 ? 6.778   -9.172  0.611   1.00 0.00 ? 10 LYS A HZ2  4  
ATOM 3952  H HZ3  . LYS A 1 10 ? 6.187   -8.613  2.028   1.00 0.00 ? 10 LYS A HZ3  4  
ATOM 3953  N N    . MET A 1 11 ? 9.571   -4.519  2.447   1.00 0.00 ? 11 MET A N    4  
ATOM 3954  C CA   . MET A 1 11 ? 8.754   -4.132  3.583   1.00 0.00 ? 11 MET A CA   4  
ATOM 3955  C C    . MET A 1 11 ? 7.473   -3.433  3.126   1.00 0.00 ? 11 MET A C    4  
ATOM 3956  O O    . MET A 1 11 ? 6.372   -3.862  3.468   1.00 0.00 ? 11 MET A O    4  
ATOM 3957  C CB   . MET A 1 11 ? 9.554   -3.193  4.490   1.00 0.00 ? 11 MET A CB   4  
ATOM 3958  C CG   . MET A 1 11 ? 10.284  -3.976  5.583   1.00 0.00 ? 11 MET A CG   4  
ATOM 3959  S SD   . MET A 1 11 ? 10.028  -3.195  7.167   1.00 0.00 ? 11 MET A SD   4  
ATOM 3960  C CE   . MET A 1 11 ? 11.200  -1.854  7.045   1.00 0.00 ? 11 MET A CE   4  
ATOM 3961  H H    . MET A 1 11 ? 10.415  -3.995  2.335   1.00 0.00 ? 11 MET A H    4  
ATOM 3962  H HA   . MET A 1 11 ? 8.506   -5.062  4.096   1.00 0.00 ? 11 MET A HA   4  
ATOM 3963  H HB3  . MET A 1 11 ? 8.882   -2.465  4.946   1.00 0.00 ? 11 MET A HB3  4  
ATOM 3964  H HG3  . MET A 1 11 ? 11.349  -4.022  5.359   1.00 0.00 ? 11 MET A HG3  4  
ATOM 3965  H HE1  . MET A 1 11 ? 12.159  -2.171  7.454   1.00 0.00 ? 11 MET A HE1  4  
ATOM 3966  H HE2  . MET A 1 11 ? 11.326  -1.575  5.999   1.00 0.00 ? 11 MET A HE2  4  
ATOM 3967  H HE3  . MET A 1 11 ? 10.831  -0.996  7.608   1.00 0.00 ? 11 MET A HE3  4  
ATOM 3968  N N    . VAL A 1 12 ? 7.660   -2.367  2.362   1.00 0.00 ? 12 VAL A N    4  
ATOM 3969  C CA   . VAL A 1 12 ? 6.532   -1.604  1.853   1.00 0.00 ? 12 VAL A CA   4  
ATOM 3970  C C    . VAL A 1 12 ? 5.684   -2.498  0.947   1.00 0.00 ? 12 VAL A C    4  
ATOM 3971  O O    . VAL A 1 12 ? 4.494   -2.247  0.759   1.00 0.00 ? 12 VAL A O    4  
ATOM 3972  C CB   . VAL A 1 12 ? 7.030   -0.340  1.149   1.00 0.00 ? 12 VAL A CB   4  
ATOM 3973  C CG1  . VAL A 1 12 ? 8.272   -0.636  0.305   1.00 0.00 ? 12 VAL A CG1  4  
ATOM 3974  C CG2  . VAL A 1 12 ? 5.924   0.285   0.298   1.00 0.00 ? 12 VAL A CG2  4  
ATOM 3975  H H    . VAL A 1 12 ? 8.559   -2.024  2.089   1.00 0.00 ? 12 VAL A H    4  
ATOM 3976  H HA   . VAL A 1 12 ? 5.930   -1.299  2.708   1.00 0.00 ? 12 VAL A HA   4  
ATOM 3977  H HB   . VAL A 1 12 ? 7.311   0.382   1.916   1.00 0.00 ? 12 VAL A HB   4  
ATOM 3978  H HG11 . VAL A 1 12 ? 8.392   -1.714  0.201   1.00 0.00 ? 12 VAL A HG11 4  
ATOM 3979  H HG12 . VAL A 1 12 ? 8.155   -0.186  -0.681  1.00 0.00 ? 12 VAL A HG12 4  
ATOM 3980  H HG13 . VAL A 1 12 ? 9.151   -0.217  0.794   1.00 0.00 ? 12 VAL A HG13 4  
ATOM 3981  H HG21 . VAL A 1 12 ? 6.300   1.192   -0.177  1.00 0.00 ? 12 VAL A HG21 4  
ATOM 3982  H HG22 . VAL A 1 12 ? 5.612   -0.424  -0.470  1.00 0.00 ? 12 VAL A HG22 4  
ATOM 3983  H HG23 . VAL A 1 12 ? 5.073   0.532   0.932   1.00 0.00 ? 12 VAL A HG23 4  
ATOM 3984  N N    . GLU A 1 13 ? 6.328   -3.523  0.409   1.00 0.00 ? 13 GLU A N    4  
ATOM 3985  C CA   . GLU A 1 13 ? 5.648   -4.456  -0.473  1.00 0.00 ? 13 GLU A CA   4  
ATOM 3986  C C    . GLU A 1 13 ? 4.456   -5.092  0.245   1.00 0.00 ? 13 GLU A C    4  
ATOM 3987  O O    . GLU A 1 13 ? 3.369   -5.197  -0.322  1.00 0.00 ? 13 GLU A O    4  
ATOM 3988  C CB   . GLU A 1 13 ? 6.612   -5.526  -0.988  1.00 0.00 ? 13 GLU A CB   4  
ATOM 3989  C CG   . GLU A 1 13 ? 7.352   -5.043  -2.237  1.00 0.00 ? 13 GLU A CG   4  
ATOM 3990  C CD   . GLU A 1 13 ? 6.647   -5.517  -3.509  1.00 0.00 ? 13 GLU A CD   4  
ATOM 3991  O OE1  . GLU A 1 13 ? 5.453   -5.175  -3.659  1.00 0.00 ? 13 GLU A OE1  4  
ATOM 3992  O OE2  . GLU A 1 13 ? 7.317   -6.212  -4.305  1.00 0.00 ? 13 GLU A OE2  4  
ATOM 3993  H H    . GLU A 1 13 ? 7.295   -3.721  0.568   1.00 0.00 ? 13 GLU A H    4  
ATOM 3994  H HA   . GLU A 1 13 ? 5.298   -3.857  -1.314  1.00 0.00 ? 13 GLU A HA   4  
ATOM 3995  H HB3  . GLU A 1 13 ? 6.061   -6.438  -1.218  1.00 0.00 ? 13 GLU A HB3  4  
ATOM 3996  H HG3  . GLU A 1 13 ? 8.376   -5.415  -2.224  1.00 0.00 ? 13 GLU A HG3  4  
ATOM 3997  N N    . GLU A 1 14 ? 4.698   -5.499  1.481   1.00 0.00 ? 14 GLU A N    4  
ATOM 3998  C CA   . GLU A 1 14 ? 3.658   -6.122  2.282   1.00 0.00 ? 14 GLU A CA   4  
ATOM 3999  C C    . GLU A 1 14 ? 2.686   -5.062  2.807   1.00 0.00 ? 14 GLU A C    4  
ATOM 4000  O O    . GLU A 1 14 ? 1.480   -5.298  2.867   1.00 0.00 ? 14 GLU A O    4  
ATOM 4001  C CB   . GLU A 1 14 ? 4.262   -6.930  3.434   1.00 0.00 ? 14 GLU A CB   4  
ATOM 4002  C CG   . GLU A 1 14 ? 4.434   -6.061  4.681   1.00 0.00 ? 14 GLU A CG   4  
ATOM 4003  C CD   . GLU A 1 14 ? 5.384   -6.722  5.682   1.00 0.00 ? 14 GLU A CD   4  
ATOM 4004  O OE1  . GLU A 1 14 ? 6.339   -7.376  5.210   1.00 0.00 ? 14 GLU A OE1  4  
ATOM 4005  O OE2  . GLU A 1 14 ? 5.134   -6.557  6.895   1.00 0.00 ? 14 GLU A OE2  4  
ATOM 4006  H H    . GLU A 1 14 ? 5.585   -5.411  1.936   1.00 0.00 ? 14 GLU A H    4  
ATOM 4007  H HA   . GLU A 1 14 ? 3.137   -6.799  1.606   1.00 0.00 ? 14 GLU A HA   4  
ATOM 4008  H HB3  . GLU A 1 14 ? 5.228   -7.334  3.132   1.00 0.00 ? 14 GLU A HB3  4  
ATOM 4009  H HG3  . GLU A 1 14 ? 3.464   -5.896  5.150   1.00 0.00 ? 14 GLU A HG3  4  
ATOM 4010  N N    . VAL A 1 15 ? 3.247   -3.919  3.172   1.00 0.00 ? 15 VAL A N    4  
ATOM 4011  C CA   . VAL A 1 15 ? 2.446   -2.824  3.689   1.00 0.00 ? 15 VAL A CA   4  
ATOM 4012  C C    . VAL A 1 15 ? 1.248   -2.594  2.766   1.00 0.00 ? 15 VAL A C    4  
ATOM 4013  O O    . VAL A 1 15 ? 0.118   -2.932  3.113   1.00 0.00 ? 15 VAL A O    4  
ATOM 4014  C CB   . VAL A 1 15 ? 3.315   -1.576  3.863   1.00 0.00 ? 15 VAL A CB   4  
ATOM 4015  C CG1  . VAL A 1 15 ? 2.451   -0.334  4.090   1.00 0.00 ? 15 VAL A CG1  4  
ATOM 4016  C CG2  . VAL A 1 15 ? 4.320   -1.761  5.001   1.00 0.00 ? 15 VAL A CG2  4  
ATOM 4017  H H    . VAL A 1 15 ? 4.229   -3.737  3.119   1.00 0.00 ? 15 VAL A H    4  
ATOM 4018  H HA   . VAL A 1 15 ? 2.080   -3.119  4.672   1.00 0.00 ? 15 VAL A HA   4  
ATOM 4019  H HB   . VAL A 1 15 ? 3.877   -1.429  2.941   1.00 0.00 ? 15 VAL A HB   4  
ATOM 4020  H HG11 . VAL A 1 15 ? 3.081   0.491   4.421   1.00 0.00 ? 15 VAL A HG11 4  
ATOM 4021  H HG12 . VAL A 1 15 ? 1.954   -0.061  3.159   1.00 0.00 ? 15 VAL A HG12 4  
ATOM 4022  H HG13 . VAL A 1 15 ? 1.702   -0.547  4.852   1.00 0.00 ? 15 VAL A HG13 4  
ATOM 4023  H HG21 . VAL A 1 15 ? 5.217   -1.180  4.793   1.00 0.00 ? 15 VAL A HG21 4  
ATOM 4024  H HG22 . VAL A 1 15 ? 3.875   -1.420  5.937   1.00 0.00 ? 15 VAL A HG22 4  
ATOM 4025  H HG23 . VAL A 1 15 ? 4.581   -2.816  5.087   1.00 0.00 ? 15 VAL A HG23 4  
ATOM 4026  N N    . PHE A 1 16 ? 1.537   -2.020  1.606   1.00 0.00 ? 16 PHE A N    4  
ATOM 4027  C CA   . PHE A 1 16 ? 0.497   -1.742  0.630   1.00 0.00 ? 16 PHE A CA   4  
ATOM 4028  C C    . PHE A 1 16 ? -0.447  -2.936  0.478   1.00 0.00 ? 16 PHE A C    4  
ATOM 4029  O O    . PHE A 1 16 ? -1.651  -2.761  0.297   1.00 0.00 ? 16 PHE A O    4  
ATOM 4030  C CB   . PHE A 1 16 ? 1.196   -1.486  -0.707  1.00 0.00 ? 16 PHE A CB   4  
ATOM 4031  C CG   . PHE A 1 16 ? 1.782   -0.080  -0.845  1.00 0.00 ? 16 PHE A CG   4  
ATOM 4032  C CD1  . PHE A 1 16 ? 1.095   0.993   -0.369  1.00 0.00 ? 16 PHE A CD1  4  
ATOM 4033  C CD2  . PHE A 1 16 ? 2.992   0.096   -1.442  1.00 0.00 ? 16 PHE A CD2  4  
ATOM 4034  C CE1  . PHE A 1 16 ? 1.639   2.297   -0.497  1.00 0.00 ? 16 PHE A CE1  4  
ATOM 4035  C CE2  . PHE A 1 16 ? 3.536   1.402   -1.569  1.00 0.00 ? 16 PHE A CE2  4  
ATOM 4036  C CZ   . PHE A 1 16 ? 2.849   2.474   -1.094  1.00 0.00 ? 16 PHE A CZ   4  
ATOM 4037  H H    . PHE A 1 16 ? 2.459   -1.749  1.331   1.00 0.00 ? 16 PHE A H    4  
ATOM 4038  H HA   . PHE A 1 16 ? -0.064  -0.881  0.991   1.00 0.00 ? 16 PHE A HA   4  
ATOM 4039  H HB3  . PHE A 1 16 ? 0.483   -1.653  -1.515  1.00 0.00 ? 16 PHE A HB3  4  
ATOM 4040  H HD1  . PHE A 1 16 ? 0.126   0.851   0.108   1.00 0.00 ? 16 PHE A HD1  4  
ATOM 4041  H HD2  . PHE A 1 16 ? 3.543   -0.764  -1.822  1.00 0.00 ? 16 PHE A HD2  4  
ATOM 4042  H HE1  . PHE A 1 16 ? 1.088   3.158   -0.117  1.00 0.00 ? 16 PHE A HE1  4  
ATOM 4043  H HE2  . PHE A 1 16 ? 4.505   1.544   -2.047  1.00 0.00 ? 16 PHE A HE2  4  
ATOM 4044  H HZ   . PHE A 1 16 ? 3.267   3.477   -1.192  1.00 0.00 ? 16 PHE A HZ   4  
ATOM 4045  N N    . ASP A 1 17 ? 0.135   -4.124  0.559   1.00 0.00 ? 17 ASP A N    4  
ATOM 4046  C CA   . ASP A 1 17 ? -0.641  -5.346  0.434   1.00 0.00 ? 17 ASP A CA   4  
ATOM 4047  C C    . ASP A 1 17 ? -1.585  -5.472  1.632   1.00 0.00 ? 17 ASP A C    4  
ATOM 4048  O O    . ASP A 1 17 ? -2.803  -5.474  1.469   1.00 0.00 ? 17 ASP A O    4  
ATOM 4049  C CB   . ASP A 1 17 ? 0.269   -6.576  0.418   1.00 0.00 ? 17 ASP A CB   4  
ATOM 4050  C CG   . ASP A 1 17 ? 0.664   -7.070  -0.976  1.00 0.00 ? 17 ASP A CG   4  
ATOM 4051  O OD1  . ASP A 1 17 ? 0.886   -6.200  -1.844  1.00 0.00 ? 17 ASP A OD1  4  
ATOM 4052  O OD2  . ASP A 1 17 ? 0.734   -8.307  -1.140  1.00 0.00 ? 17 ASP A OD2  4  
ATOM 4053  H H    . ASP A 1 17 ? 1.114   -4.257  0.707   1.00 0.00 ? 17 ASP A H    4  
ATOM 4054  H HA   . ASP A 1 17 ? -1.177  -5.250  -0.510  1.00 0.00 ? 17 ASP A HA   4  
ATOM 4055  H HB3  . ASP A 1 17 ? -0.231  -7.387  0.946   1.00 0.00 ? 17 ASP A HB3  4  
ATOM 4056  N N    . VAL A 1 18 ? -0.985  -5.576  2.808   1.00 0.00 ? 18 VAL A N    4  
ATOM 4057  C CA   . VAL A 1 18 ? -1.756  -5.702  4.033   1.00 0.00 ? 18 VAL A CA   4  
ATOM 4058  C C    . VAL A 1 18 ? -2.897  -4.683  4.020   1.00 0.00 ? 18 VAL A C    4  
ATOM 4059  O O    . VAL A 1 18 ? -4.067  -5.054  4.103   1.00 0.00 ? 18 VAL A O    4  
ATOM 4060  C CB   . VAL A 1 18 ? -0.837  -5.555  5.248   1.00 0.00 ? 18 VAL A CB   4  
ATOM 4061  C CG1  . VAL A 1 18 ? -1.625  -5.103  6.480   1.00 0.00 ? 18 VAL A CG1  4  
ATOM 4062  C CG2  . VAL A 1 18 ? -0.084  -6.858  5.526   1.00 0.00 ? 18 VAL A CG2  4  
ATOM 4063  H H    . VAL A 1 18 ? 0.008   -5.574  2.932   1.00 0.00 ? 18 VAL A H    4  
ATOM 4064  H HA   . VAL A 1 18 ? -2.182  -6.705  4.052   1.00 0.00 ? 18 VAL A HA   4  
ATOM 4065  H HB   . VAL A 1 18 ? -0.101  -4.785  5.020   1.00 0.00 ? 18 VAL A HB   4  
ATOM 4066  H HG11 . VAL A 1 18 ? -1.774  -4.024  6.440   1.00 0.00 ? 18 VAL A HG11 4  
ATOM 4067  H HG12 . VAL A 1 18 ? -2.593  -5.603  6.495   1.00 0.00 ? 18 VAL A HG12 4  
ATOM 4068  H HG13 . VAL A 1 18 ? -1.068  -5.359  7.381   1.00 0.00 ? 18 VAL A HG13 4  
ATOM 4069  H HG21 . VAL A 1 18 ? 0.195   -7.325  4.582   1.00 0.00 ? 18 VAL A HG21 4  
ATOM 4070  H HG22 . VAL A 1 18 ? 0.814   -6.641  6.105   1.00 0.00 ? 18 VAL A HG22 4  
ATOM 4071  H HG23 . VAL A 1 18 ? -0.724  -7.534  6.091   1.00 0.00 ? 18 VAL A HG23 4  
ATOM 4072  N N    . LEU A 1 19 ? -2.516  -3.418  3.915   1.00 0.00 ? 19 LEU A N    4  
ATOM 4073  C CA   . LEU A 1 19 ? -3.493  -2.342  3.890   1.00 0.00 ? 19 LEU A CA   4  
ATOM 4074  C C    . LEU A 1 19 ? -4.604  -2.691  2.897   1.00 0.00 ? 19 LEU A C    4  
ATOM 4075  O O    . LEU A 1 19 ? -5.769  -2.794  3.275   1.00 0.00 ? 19 LEU A O    4  
ATOM 4076  C CB   . LEU A 1 19 ? -2.808  -1.004  3.602   1.00 0.00 ? 19 LEU A CB   4  
ATOM 4077  C CG   . LEU A 1 19 ? -1.626  -0.647  4.505   1.00 0.00 ? 19 LEU A CG   4  
ATOM 4078  C CD1  . LEU A 1 19 ? -1.264  0.834   4.375   1.00 0.00 ? 19 LEU A CD1  4  
ATOM 4079  C CD2  . LEU A 1 19 ? -1.906  -1.044  5.956   1.00 0.00 ? 19 LEU A CD2  4  
ATOM 4080  H H    . LEU A 1 19 ? -1.563  -3.124  3.848   1.00 0.00 ? 19 LEU A H    4  
ATOM 4081  H HA   . LEU A 1 19 ? -3.929  -2.274  4.886   1.00 0.00 ? 19 LEU A HA   4  
ATOM 4082  H HB3  . LEU A 1 19 ? -3.554  -0.212  3.683   1.00 0.00 ? 19 LEU A HB3  4  
ATOM 4083  H HG   . LEU A 1 19 ? -0.759  -1.221  4.175   1.00 0.00 ? 19 LEU A HG   4  
ATOM 4084  H HD11 . LEU A 1 19 ? -1.737  1.246   3.484   1.00 0.00 ? 19 LEU A HD11 4  
ATOM 4085  H HD12 . LEU A 1 19 ? -1.615  1.372   5.255   1.00 0.00 ? 19 LEU A HD12 4  
ATOM 4086  H HD13 . LEU A 1 19 ? -0.182  0.938   4.293   1.00 0.00 ? 19 LEU A HD13 4  
ATOM 4087  H HD21 . LEU A 1 19 ? -2.976  -0.991  6.147   1.00 0.00 ? 19 LEU A HD21 4  
ATOM 4088  H HD22 . LEU A 1 19 ? -1.555  -2.062  6.128   1.00 0.00 ? 19 LEU A HD22 4  
ATOM 4089  H HD23 . LEU A 1 19 ? -1.382  -0.362  6.626   1.00 0.00 ? 19 LEU A HD23 4  
ATOM 4090  N N    . TYR A 1 20 ? -4.203  -2.863  1.646   1.00 0.00 ? 20 TYR A N    4  
ATOM 4091  C CA   . TYR A 1 20 ? -5.150  -3.198  0.596   1.00 0.00 ? 20 TYR A CA   4  
ATOM 4092  C C    . TYR A 1 20 ? -6.071  -4.339  1.032   1.00 0.00 ? 20 TYR A C    4  
ATOM 4093  O O    . TYR A 1 20 ? -7.293  -4.222  0.948   1.00 0.00 ? 20 TYR A O    4  
ATOM 4094  C CB   . TYR A 1 20 ? -4.311  -3.664  -0.595  1.00 0.00 ? 20 TYR A CB   4  
ATOM 4095  C CG   . TYR A 1 20 ? -5.139  -4.127  -1.796  1.00 0.00 ? 20 TYR A CG   4  
ATOM 4096  C CD1  . TYR A 1 20 ? -6.203  -3.366  -2.235  1.00 0.00 ? 20 TYR A CD1  4  
ATOM 4097  C CD2  . TYR A 1 20 ? -4.821  -5.306  -2.440  1.00 0.00 ? 20 TYR A CD2  4  
ATOM 4098  C CE1  . TYR A 1 20 ? -6.982  -3.802  -3.365  1.00 0.00 ? 20 TYR A CE1  4  
ATOM 4099  C CE2  . TYR A 1 20 ? -5.600  -5.742  -3.570  1.00 0.00 ? 20 TYR A CE2  4  
ATOM 4100  C CZ   . TYR A 1 20 ? -6.642  -4.968  -3.977  1.00 0.00 ? 20 TYR A CZ   4  
ATOM 4101  O OH   . TYR A 1 20 ? -7.378  -5.380  -5.044  1.00 0.00 ? 20 TYR A OH   4  
ATOM 4102  H H    . TYR A 1 20 ? -3.252  -2.778  1.347   1.00 0.00 ? 20 TYR A H    4  
ATOM 4103  H HA   . TYR A 1 20 ? -5.751  -2.313  0.391   1.00 0.00 ? 20 TYR A HA   4  
ATOM 4104  H HB3  . TYR A 1 20 ? -3.666  -4.482  -0.275  1.00 0.00 ? 20 TYR A HB3  4  
ATOM 4105  H HD1  . TYR A 1 20 ? -6.454  -2.435  -1.727  1.00 0.00 ? 20 TYR A HD1  4  
ATOM 4106  H HD2  . TYR A 1 20 ? -3.980  -5.907  -2.092  1.00 0.00 ? 20 TYR A HD2  4  
ATOM 4107  H HE1  . TYR A 1 20 ? -7.825  -3.210  -3.722  1.00 0.00 ? 20 TYR A HE1  4  
ATOM 4108  H HE2  . TYR A 1 20 ? -5.361  -6.670  -4.087  1.00 0.00 ? 20 TYR A HE2  4  
ATOM 4109  H HH   . TYR A 1 20 ? -7.516  -4.619  -5.678  1.00 0.00 ? 20 TYR A HH   4  
ATOM 4110  N N    . SER A 1 21 ? -5.451  -5.416  1.491   1.00 0.00 ? 21 SER A N    4  
ATOM 4111  C CA   . SER A 1 21 ? -6.199  -6.577  1.941   1.00 0.00 ? 21 SER A CA   4  
ATOM 4112  C C    . SER A 1 21 ? -7.143  -6.182  3.079   1.00 0.00 ? 21 SER A C    4  
ATOM 4113  O O    . SER A 1 21 ? -8.282  -6.645  3.134   1.00 0.00 ? 21 SER A O    4  
ATOM 4114  C CB   . SER A 1 21 ? -5.260  -7.696  2.394   1.00 0.00 ? 21 SER A CB   4  
ATOM 4115  O OG   . SER A 1 21 ? -5.959  -8.740  3.068   1.00 0.00 ? 21 SER A OG   4  
ATOM 4116  H H    . SER A 1 21 ? -4.456  -5.503  1.557   1.00 0.00 ? 21 SER A H    4  
ATOM 4117  H HA   . SER A 1 21 ? -6.766  -6.910  1.072   1.00 0.00 ? 21 SER A HA   4  
ATOM 4118  H HB3  . SER A 1 21 ? -4.499  -7.285  3.056   1.00 0.00 ? 21 SER A HB3  4  
ATOM 4119  H HG   . SER A 1 21 ? -5.904  -8.606  4.057   1.00 0.00 ? 21 SER A HG   4  
ATOM 4120  N N    . GLU A 1 22 ? -6.635  -5.331  3.957   1.00 0.00 ? 22 GLU A N    4  
ATOM 4121  C CA   . GLU A 1 22 ? -7.419  -4.869  5.090   1.00 0.00 ? 22 GLU A CA   4  
ATOM 4122  C C    . GLU A 1 22 ? -8.675  -4.141  4.605   1.00 0.00 ? 22 GLU A C    4  
ATOM 4123  O O    . GLU A 1 22 ? -9.781  -4.445  5.048   1.00 0.00 ? 22 GLU A O    4  
ATOM 4124  C CB   . GLU A 1 22 ? -6.583  -3.970  6.004   1.00 0.00 ? 22 GLU A CB   4  
ATOM 4125  C CG   . GLU A 1 22 ? -5.526  -4.783  6.754   1.00 0.00 ? 22 GLU A CG   4  
ATOM 4126  C CD   . GLU A 1 22 ? -5.552  -4.467  8.251   1.00 0.00 ? 22 GLU A CD   4  
ATOM 4127  O OE1  . GLU A 1 22 ? -4.929  -3.451  8.628   1.00 0.00 ? 22 GLU A OE1  4  
ATOM 4128  O OE2  . GLU A 1 22 ? -6.195  -5.249  8.985   1.00 0.00 ? 22 GLU A OE2  4  
ATOM 4129  H H    . GLU A 1 22 ? -5.708  -4.959  3.904   1.00 0.00 ? 22 GLU A H    4  
ATOM 4130  H HA   . GLU A 1 22 ? -7.700  -5.769  5.634   1.00 0.00 ? 22 GLU A HA   4  
ATOM 4131  H HB3  . GLU A 1 22 ? -7.234  -3.466  6.718   1.00 0.00 ? 22 GLU A HB3  4  
ATOM 4132  H HG3  . GLU A 1 22 ? -4.538  -4.562  6.349   1.00 0.00 ? 22 GLU A HG3  4  
ATOM 4133  N N    . ALA A 1 23 ? -8.461  -3.195  3.703   1.00 0.00 ? 23 ALA A N    4  
ATOM 4134  C CA   . ALA A 1 23 ? -9.562  -2.422  3.153   1.00 0.00 ? 23 ALA A CA   4  
ATOM 4135  C C    . ALA A 1 23 ? -10.500 -3.355  2.384   1.00 0.00 ? 23 ALA A C    4  
ATOM 4136  O O    . ALA A 1 23 ? -11.709 -3.131  2.346   1.00 0.00 ? 23 ALA A O    4  
ATOM 4137  C CB   . ALA A 1 23 ? -9.009  -1.298  2.275   1.00 0.00 ? 23 ALA A CB   4  
ATOM 4138  H H    . ALA A 1 23 ? -7.557  -2.955  3.348   1.00 0.00 ? 23 ALA A H    4  
ATOM 4139  H HA   . ALA A 1 23 ? -10.107 -1.981  3.988   1.00 0.00 ? 23 ALA A HA   4  
ATOM 4140  H HB1  . ALA A 1 23 ? -9.442  -0.347  2.587   1.00 0.00 ? 23 ALA A HB1  4  
ATOM 4141  H HB2  . ALA A 1 23 ? -7.925  -1.256  2.379   1.00 0.00 ? 23 ALA A HB2  4  
ATOM 4142  H HB3  . ALA A 1 23 ? -9.266  -1.491  1.233   1.00 0.00 ? 23 ALA A HB3  4  
ATOM 4143  N N    . LEU A 1 24 ? -9.906  -4.381  1.790   1.00 0.00 ? 24 LEU A N    4  
ATOM 4144  C CA   . LEU A 1 24 ? -10.675 -5.348  1.024   1.00 0.00 ? 24 LEU A CA   4  
ATOM 4145  C C    . LEU A 1 24 ? -11.418 -6.277  1.985   1.00 0.00 ? 24 LEU A C    4  
ATOM 4146  O O    . LEU A 1 24 ? -12.428 -6.877  1.617   1.00 0.00 ? 24 LEU A O    4  
ATOM 4147  C CB   . LEU A 1 24 ? -9.772  -6.083  0.031   1.00 0.00 ? 24 LEU A CB   4  
ATOM 4148  C CG   . LEU A 1 24 ? -9.839  -5.602  -1.419  1.00 0.00 ? 24 LEU A CG   4  
ATOM 4149  C CD1  . LEU A 1 24 ? -8.730  -6.237  -2.260  1.00 0.00 ? 24 LEU A CD1  4  
ATOM 4150  C CD2  . LEU A 1 24 ? -11.225 -5.851  -2.016  1.00 0.00 ? 24 LEU A CD2  4  
ATOM 4151  H H    . LEU A 1 24 ? -8.923  -4.555  1.826   1.00 0.00 ? 24 LEU A H    4  
ATOM 4152  H HA   . LEU A 1 24 ? -11.410 -4.793  0.441   1.00 0.00 ? 24 LEU A HA   4  
ATOM 4153  H HB3  . LEU A 1 24 ? -10.027 -7.142  0.055   1.00 0.00 ? 24 LEU A HB3  4  
ATOM 4154  H HG   . LEU A 1 24 ? -9.674  -4.524  -1.431  1.00 0.00 ? 24 LEU A HG   4  
ATOM 4155  H HD11 . LEU A 1 24 ? -8.805  -7.323  -2.199  1.00 0.00 ? 24 LEU A HD11 4  
ATOM 4156  H HD12 . LEU A 1 24 ? -8.835  -5.924  -3.299  1.00 0.00 ? 24 LEU A HD12 4  
ATOM 4157  H HD13 . LEU A 1 24 ? -7.759  -5.918  -1.881  1.00 0.00 ? 24 LEU A HD13 4  
ATOM 4158  H HD21 . LEU A 1 24 ? -11.482 -6.906  -1.910  1.00 0.00 ? 24 LEU A HD21 4  
ATOM 4159  H HD22 . LEU A 1 24 ? -11.962 -5.243  -1.493  1.00 0.00 ? 24 LEU A HD22 4  
ATOM 4160  H HD23 . LEU A 1 24 ? -11.219 -5.585  -3.073  1.00 0.00 ? 24 LEU A HD23 4  
ATOM 4161  N N    . GLY A 1 25 ? -10.890 -6.371  3.196   1.00 0.00 ? 25 GLY A N    4  
ATOM 4162  C CA   . GLY A 1 25 ? -11.490 -7.218  4.212   1.00 0.00 ? 25 GLY A CA   4  
ATOM 4163  C C    . GLY A 1 25 ? -11.400 -8.694  3.819   1.00 0.00 ? 25 GLY A C    4  
ATOM 4164  O O    . GLY A 1 25 ? -12.370 -9.437  3.952   1.00 0.00 ? 25 GLY A O    4  
ATOM 4165  H H    . GLY A 1 25 ? -10.068 -5.880  3.487   1.00 0.00 ? 25 GLY A H    4  
ATOM 4166  H HA2  . GLY A 1 25 ? -10.987 -7.060  5.166   1.00 0.00 ? 25 GLY A HA2  4  
ATOM 4167  H HA3  . GLY A 1 25 ? -12.535 -6.939  4.352   1.00 0.00 ? 25 GLY A HA3  4  
ATOM 4168  N N    . ARG A 1 26 ? -10.223 -9.075  3.341   1.00 0.00 ? 26 ARG A N    4  
ATOM 4169  C CA   . ARG A 1 26 ? -9.993  -10.448 2.928   1.00 0.00 ? 26 ARG A CA   4  
ATOM 4170  C C    . ARG A 1 26 ? -9.338  -11.241 4.062   1.00 0.00 ? 26 ARG A C    4  
ATOM 4171  O O    . ARG A 1 26 ? -9.003  -10.679 5.103   1.00 0.00 ? 26 ARG A O    4  
ATOM 4172  C CB   . ARG A 1 26 ? -9.097  -10.508 1.689   1.00 0.00 ? 26 ARG A CB   4  
ATOM 4173  C CG   . ARG A 1 26 ? -9.739  -9.769  0.513   1.00 0.00 ? 26 ARG A CG   4  
ATOM 4174  C CD   . ARG A 1 26 ? -10.259 -10.756 -0.535  1.00 0.00 ? 26 ARG A CD   4  
ATOM 4175  N NE   . ARG A 1 26 ? -11.374 -10.147 -1.294  1.00 0.00 ? 26 ARG A NE   4  
ATOM 4176  C CZ   . ARG A 1 26 ? -12.175 -10.825 -2.127  1.00 0.00 ? 26 ARG A CZ   4  
ATOM 4177  N NH1  . ARG A 1 26 ? -11.990 -12.139 -2.313  1.00 0.00 ? 26 ARG A NH1  4  
ATOM 4178  N NH2  . ARG A 1 26 ? -13.161 -10.189 -2.774  1.00 0.00 ? 26 ARG A NH2  4  
ATOM 4179  H H    . ARG A 1 26 ? -9.439  -8.464  3.236   1.00 0.00 ? 26 ARG A H    4  
ATOM 4180  H HA   . ARG A 1 26 ? -10.983 -10.840 2.698   1.00 0.00 ? 26 ARG A HA   4  
ATOM 4181  H HB3  . ARG A 1 26 ? -8.917  -11.547 1.417   1.00 0.00 ? 26 ARG A HB3  4  
ATOM 4182  H HG3  . ARG A 1 26 ? -9.010  -9.101  0.056   1.00 0.00 ? 26 ARG A HG3  4  
ATOM 4183  H HD3  . ARG A 1 26 ? -10.597 -11.671 -0.049  1.00 0.00 ? 26 ARG A HD3  4  
ATOM 4184  H HE   . ARG A 1 26 ? -11.540 -9.167  -1.178  1.00 0.00 ? 26 ARG A HE   4  
ATOM 4185  H HH11 . ARG A 1 26 ? -11.254 -12.614 -1.831  1.00 0.00 ? 26 ARG A HH11 4  
ATOM 4186  H HH12 . ARG A 1 26 ? -12.587 -12.645 -2.935  1.00 0.00 ? 26 ARG A HH12 4  
ATOM 4187  H HH21 . ARG A 1 26 ? -13.300 -9.208  -2.636  1.00 0.00 ? 26 ARG A HH21 4  
ATOM 4188  H HH22 . ARG A 1 26 ? -13.759 -10.696 -3.396  1.00 0.00 ? 26 ARG A HH22 4  
ATOM 4189  N N    . ALA A 1 27 ? -9.176  -12.533 3.819   1.00 0.00 ? 27 ALA A N    4  
ATOM 4190  C CA   . ALA A 1 27 ? -8.566  -13.409 4.807   1.00 0.00 ? 27 ALA A CA   4  
ATOM 4191  C C    . ALA A 1 27 ? -7.061  -13.497 4.544   1.00 0.00 ? 27 ALA A C    4  
ATOM 4192  O O    . ALA A 1 27 ? -6.258  -13.357 5.465   1.00 0.00 ? 27 ALA A O    4  
ATOM 4193  C CB   . ALA A 1 27 ? -9.247  -14.779 4.763   1.00 0.00 ? 27 ALA A CB   4  
ATOM 4194  H H    . ALA A 1 27 ? -9.451  -12.982 2.969   1.00 0.00 ? 27 ALA A H    4  
ATOM 4195  H HA   . ALA A 1 27 ? -8.730  -12.965 5.789   1.00 0.00 ? 27 ALA A HA   4  
ATOM 4196  H HB1  . ALA A 1 27 ? -9.245  -15.153 3.739   1.00 0.00 ? 27 ALA A HB1  4  
ATOM 4197  H HB2  . ALA A 1 27 ? -8.705  -15.474 5.405   1.00 0.00 ? 27 ALA A HB2  4  
ATOM 4198  H HB3  . ALA A 1 27 ? -10.274 -14.684 5.114   1.00 0.00 ? 27 ALA A HB3  4  
ATOM 4199  N N    . SER A 1 28 ? -6.725  -13.729 3.284   1.00 0.00 ? 28 SER A N    4  
ATOM 4200  C CA   . SER A 1 28 ? -5.331  -13.836 2.889   1.00 0.00 ? 28 SER A CA   4  
ATOM 4201  C C    . SER A 1 28 ? -4.827  -12.487 2.374   1.00 0.00 ? 28 SER A C    4  
ATOM 4202  O O    . SER A 1 28 ? -5.621  -11.621 2.009   1.00 0.00 ? 28 SER A O    4  
ATOM 4203  C CB   . SER A 1 28 ? -5.143  -14.915 1.821   1.00 0.00 ? 28 SER A CB   4  
ATOM 4204  O OG   . SER A 1 28 ? -5.854  -16.109 2.137   1.00 0.00 ? 28 SER A OG   4  
ATOM 4205  H H    . SER A 1 28 ? -7.385  -13.841 2.541   1.00 0.00 ? 28 SER A H    4  
ATOM 4206  H HA   . SER A 1 28 ? -4.796  -14.124 3.794   1.00 0.00 ? 28 SER A HA   4  
ATOM 4207  H HB3  . SER A 1 28 ? -4.083  -15.142 1.717   1.00 0.00 ? 28 SER A HB3  4  
ATOM 4208  H HG   . SER A 1 28 ? -6.521  -16.310 1.421   1.00 0.00 ? 28 SER A HG   4  
ATOM 4209  N N    . VAL A 1 29 ? -3.508  -12.349 2.360   1.00 0.00 ? 29 VAL A N    4  
ATOM 4210  C CA   . VAL A 1 29 ? -2.889  -11.120 1.897   1.00 0.00 ? 29 VAL A CA   4  
ATOM 4211  C C    . VAL A 1 29 ? -2.741  -11.172 0.374   1.00 0.00 ? 29 VAL A C    4  
ATOM 4212  O O    . VAL A 1 29 ? -2.010  -12.008 -0.153  1.00 0.00 ? 29 VAL A O    4  
ATOM 4213  C CB   . VAL A 1 29 ? -1.559  -10.899 2.619   1.00 0.00 ? 29 VAL A CB   4  
ATOM 4214  C CG1  . VAL A 1 29 ? -0.806  -9.704  2.029   1.00 0.00 ? 29 VAL A CG1  4  
ATOM 4215  C CG2  . VAL A 1 29 ? -1.776  -10.722 4.124   1.00 0.00 ? 29 VAL A CG2  4  
ATOM 4216  H H    . VAL A 1 29 ? -2.870  -13.058 2.659   1.00 0.00 ? 29 VAL A H    4  
ATOM 4217  H HA   . VAL A 1 29 ? -3.555  -10.297 2.156   1.00 0.00 ? 29 VAL A HA   4  
ATOM 4218  H HB   . VAL A 1 29 ? -0.945  -11.787 2.472   1.00 0.00 ? 29 VAL A HB   4  
ATOM 4219  H HG11 . VAL A 1 29 ? 0.004   -9.419  2.700   1.00 0.00 ? 29 VAL A HG11 4  
ATOM 4220  H HG12 . VAL A 1 29 ? -0.394  -9.978  1.058   1.00 0.00 ? 29 VAL A HG12 4  
ATOM 4221  H HG13 . VAL A 1 29 ? -1.492  -8.865  1.910   1.00 0.00 ? 29 VAL A HG13 4  
ATOM 4222  H HG21 . VAL A 1 29 ? -2.823  -10.903 4.364   1.00 0.00 ? 29 VAL A HG21 4  
ATOM 4223  H HG22 . VAL A 1 29 ? -1.151  -11.431 4.666   1.00 0.00 ? 29 VAL A HG22 4  
ATOM 4224  H HG23 . VAL A 1 29 ? -1.507  -9.706  4.413   1.00 0.00 ? 29 VAL A HG23 4  
ATOM 4225  N N    . VAL A 1 30 ? -3.446  -10.266 -0.288  1.00 0.00 ? 30 VAL A N    4  
ATOM 4226  C CA   . VAL A 1 30 ? -3.403  -10.199 -1.738  1.00 0.00 ? 30 VAL A CA   4  
ATOM 4227  C C    . VAL A 1 30 ? -2.436  -9.092  -2.164  1.00 0.00 ? 30 VAL A C    4  
ATOM 4228  O O    . VAL A 1 30 ? -2.189  -8.154  -1.408  1.00 0.00 ? 30 VAL A O    4  
ATOM 4229  C CB   . VAL A 1 30 ? -4.815  -10.005 -2.297  1.00 0.00 ? 30 VAL A CB   4  
ATOM 4230  C CG1  . VAL A 1 30 ? -5.565  -11.336 -2.362  1.00 0.00 ? 30 VAL A CG1  4  
ATOM 4231  C CG2  . VAL A 1 30 ? -5.593  -8.977  -1.474  1.00 0.00 ? 30 VAL A CG2  4  
ATOM 4232  H H    . VAL A 1 30 ? -4.039  -9.590  0.149   1.00 0.00 ? 30 VAL A H    4  
ATOM 4233  H HA   . VAL A 1 30 ? -3.025  -11.154 -2.102  1.00 0.00 ? 30 VAL A HA   4  
ATOM 4234  H HB   . VAL A 1 30 ? -4.724  -9.621  -3.312  1.00 0.00 ? 30 VAL A HB   4  
ATOM 4235  H HG11 . VAL A 1 30 ? -6.563  -11.171 -2.768  1.00 0.00 ? 30 VAL A HG11 4  
ATOM 4236  H HG12 . VAL A 1 30 ? -5.021  -12.029 -3.005  1.00 0.00 ? 30 VAL A HG12 4  
ATOM 4237  H HG13 . VAL A 1 30 ? -5.646  -11.758 -1.360  1.00 0.00 ? 30 VAL A HG13 4  
ATOM 4238  H HG21 . VAL A 1 30 ? -6.089  -9.478  -0.641  1.00 0.00 ? 30 VAL A HG21 4  
ATOM 4239  H HG22 . VAL A 1 30 ? -4.905  -8.225  -1.086  1.00 0.00 ? 30 VAL A HG22 4  
ATOM 4240  H HG23 . VAL A 1 30 ? -6.340  -8.495  -2.106  1.00 0.00 ? 30 VAL A HG23 4  
ATOM 4241  N N    . PRO A 1 31 ? -1.900  -9.243  -3.405  1.00 0.00 ? 31 PRO A N    4  
ATOM 4242  C CA   . PRO A 1 31 ? -0.964  -8.269  -3.940  1.00 0.00 ? 31 PRO A CA   4  
ATOM 4243  C C    . PRO A 1 31 ? -1.690  -6.992  -4.371  1.00 0.00 ? 31 PRO A C    4  
ATOM 4244  O O    . PRO A 1 31 ? -2.919  -6.939  -4.360  1.00 0.00 ? 31 PRO A O    4  
ATOM 4245  C CB   . PRO A 1 31 ? -0.274  -8.977  -5.094  1.00 0.00 ? 31 PRO A CB   4  
ATOM 4246  C CG   . PRO A 1 31 ? -1.168  -10.152 -5.457  1.00 0.00 ? 31 PRO A CG   4  
ATOM 4247  C CD   . PRO A 1 31 ? -2.169  -10.342 -4.328  1.00 0.00 ? 31 PRO A CD   4  
ATOM 4248  H HA   . PRO A 1 31 ? -0.313  -7.988  -3.234  1.00 0.00 ? 31 PRO A HA   4  
ATOM 4249  H HB3  . PRO A 1 31 ? 0.720   -9.319  -4.804  1.00 0.00 ? 31 PRO A HB3  4  
ATOM 4250  H HG3  . PRO A 1 31 ? -0.575  -11.054 -5.598  1.00 0.00 ? 31 PRO A HG3  4  
ATOM 4251  H HD3  . PRO A 1 31 ? -2.038  -11.309 -3.842  1.00 0.00 ? 31 PRO A HD3  4  
ATOM 4252  N N    . LEU A 1 32 ? -0.898  -5.996  -4.740  1.00 0.00 ? 32 LEU A N    4  
ATOM 4253  C CA   . LEU A 1 32 ? -1.449  -4.723  -5.174  1.00 0.00 ? 32 LEU A CA   4  
ATOM 4254  C C    . LEU A 1 32 ? -1.094  -4.493  -6.644  1.00 0.00 ? 32 LEU A C    4  
ATOM 4255  O O    . LEU A 1 32 ? 0.025   -4.091  -6.960  1.00 0.00 ? 32 LEU A O    4  
ATOM 4256  C CB   . LEU A 1 32 ? -0.990  -3.597  -4.246  1.00 0.00 ? 32 LEU A CB   4  
ATOM 4257  C CG   . LEU A 1 32 ? -1.249  -2.173  -4.742  1.00 0.00 ? 32 LEU A CG   4  
ATOM 4258  C CD1  . LEU A 1 32 ? -2.620  -2.067  -5.413  1.00 0.00 ? 32 LEU A CD1  4  
ATOM 4259  C CD2  . LEU A 1 32 ? -1.086  -1.158  -3.608  1.00 0.00 ? 32 LEU A CD2  4  
ATOM 4260  H H    . LEU A 1 32 ? 0.101   -6.048  -4.746  1.00 0.00 ? 32 LEU A H    4  
ATOM 4261  H HA   . LEU A 1 32 ? -2.534  -4.791  -5.087  1.00 0.00 ? 32 LEU A HA   4  
ATOM 4262  H HB3  . LEU A 1 32 ? 0.079   -3.710  -4.070  1.00 0.00 ? 32 LEU A HB3  4  
ATOM 4263  H HG   . LEU A 1 32 ? -0.501  -1.932  -5.498  1.00 0.00 ? 32 LEU A HG   4  
ATOM 4264  H HD11 . LEU A 1 32 ? -2.645  -1.181  -6.049  1.00 0.00 ? 32 LEU A HD11 4  
ATOM 4265  H HD12 . LEU A 1 32 ? -2.798  -2.955  -6.019  1.00 0.00 ? 32 LEU A HD12 4  
ATOM 4266  H HD13 . LEU A 1 32 ? -3.393  -1.986  -4.649  1.00 0.00 ? 32 LEU A HD13 4  
ATOM 4267  H HD21 . LEU A 1 32 ? -0.104  -0.691  -3.677  1.00 0.00 ? 32 LEU A HD21 4  
ATOM 4268  H HD22 . LEU A 1 32 ? -1.860  -0.395  -3.689  1.00 0.00 ? 32 LEU A HD22 4  
ATOM 4269  H HD23 . LEU A 1 32 ? -1.179  -1.669  -2.648  1.00 0.00 ? 32 LEU A HD23 4  
ATOM 4270  N N    . PRO A 1 33 ? -2.093  -4.764  -7.526  1.00 0.00 ? 33 PRO A N    4  
ATOM 4271  C CA   . PRO A 1 33 ? -1.897  -4.591  -8.955  1.00 0.00 ? 33 PRO A CA   4  
ATOM 4272  C C    . PRO A 1 33 ? -1.917  -3.109  -9.336  1.00 0.00 ? 33 PRO A C    4  
ATOM 4273  O O    . PRO A 1 33 ? -2.879  -2.631  -9.936  1.00 0.00 ? 33 PRO A O    4  
ATOM 4274  C CB   . PRO A 1 33 ? -3.018  -5.386  -9.605  1.00 0.00 ? 33 PRO A CB   4  
ATOM 4275  C CG   . PRO A 1 33 ? -4.066  -5.590  -8.523  1.00 0.00 ? 33 PRO A CG   4  
ATOM 4276  C CD   . PRO A 1 33 ? -3.430  -5.241  -7.187  1.00 0.00 ? 33 PRO A CD   4  
ATOM 4277  H HA   . PRO A 1 33 ? -0.996  -4.931  -9.225  1.00 0.00 ? 33 PRO A HA   4  
ATOM 4278  H HB3  . PRO A 1 33 ? -2.651  -6.341  -9.980  1.00 0.00 ? 33 PRO A HB3  4  
ATOM 4279  H HG3  . PRO A 1 33 ? -4.417  -6.622  -8.522  1.00 0.00 ? 33 PRO A HG3  4  
ATOM 4280  H HD3  . PRO A 1 33 ? -3.387  -6.111  -6.531  1.00 0.00 ? 33 PRO A HD3  4  
ATOM 4281  N N    . TYR A 1 34 ? -0.843  -2.423  -8.971  1.00 0.00 ? 34 TYR A N    4  
ATOM 4282  C CA   . TYR A 1 34 ? -0.725  -1.005  -9.266  1.00 0.00 ? 34 TYR A CA   4  
ATOM 4283  C C    . TYR A 1 34 ? -1.072  -0.719  -10.728 1.00 0.00 ? 34 TYR A C    4  
ATOM 4284  O O    . TYR A 1 34 ? -1.915  0.130   -11.015 1.00 0.00 ? 34 TYR A O    4  
ATOM 4285  C CB   . TYR A 1 34 ? 0.742   -0.645  -9.023  1.00 0.00 ? 34 TYR A CB   4  
ATOM 4286  C CG   . TYR A 1 34 ? 1.205   -0.864  -7.582  1.00 0.00 ? 34 TYR A CG   4  
ATOM 4287  C CD1  . TYR A 1 34 ? 1.041   0.137   -6.645  1.00 0.00 ? 34 TYR A CD1  4  
ATOM 4288  C CD2  . TYR A 1 34 ? 1.789   -2.060  -7.218  1.00 0.00 ? 34 TYR A CD2  4  
ATOM 4289  C CE1  . TYR A 1 34 ? 1.478   -0.070  -5.288  1.00 0.00 ? 34 TYR A CE1  4  
ATOM 4290  C CE2  . TYR A 1 34 ? 2.225   -2.267  -5.862  1.00 0.00 ? 34 TYR A CE2  4  
ATOM 4291  C CZ   . TYR A 1 34 ? 2.048   -1.261  -4.964  1.00 0.00 ? 34 TYR A CZ   4  
ATOM 4292  O OH   . TYR A 1 34 ? 2.460   -1.455  -3.682  1.00 0.00 ? 34 TYR A OH   4  
ATOM 4293  H H    . TYR A 1 34 ? -0.065  -2.820  -8.484  1.00 0.00 ? 34 TYR A H    4  
ATOM 4294  H HA   . TYR A 1 34 ? -1.422  -0.469  -8.623  1.00 0.00 ? 34 TYR A HA   4  
ATOM 4295  H HB3  . TYR A 1 34 ? 0.897   0.401   -9.289  1.00 0.00 ? 34 TYR A HB3  4  
ATOM 4296  H HD1  . TYR A 1 34 ? 0.581   1.082   -6.931  1.00 0.00 ? 34 TYR A HD1  4  
ATOM 4297  H HD2  . TYR A 1 34 ? 1.919   -2.850  -7.959  1.00 0.00 ? 34 TYR A HD2  4  
ATOM 4298  H HE1  . TYR A 1 34 ? 1.354   0.712   -4.538  1.00 0.00 ? 34 TYR A HE1  4  
ATOM 4299  H HE2  . TYR A 1 34 ? 2.687   -3.207  -5.562  1.00 0.00 ? 34 TYR A HE2  4  
ATOM 4300  H HH   . TYR A 1 34 ? 1.688   -1.738  -3.114  1.00 0.00 ? 34 TYR A HH   4  
ATOM 4301  N N    . GLU A 1 35 ? -0.405  -1.444  -11.615 1.00 0.00 ? 35 GLU A N    4  
ATOM 4302  C CA   . GLU A 1 35 ? -0.634  -1.279  -13.040 1.00 0.00 ? 35 GLU A CA   4  
ATOM 4303  C C    . GLU A 1 35 ? -2.120  -1.053  -13.317 1.00 0.00 ? 35 GLU A C    4  
ATOM 4304  O O    . GLU A 1 35 ? -2.480  -0.341  -14.254 1.00 0.00 ? 35 GLU A O    4  
ATOM 4305  C CB   . GLU A 1 35 ? -0.106  -2.483  -13.823 1.00 0.00 ? 35 GLU A CB   4  
ATOM 4306  C CG   . GLU A 1 35 ? -0.849  -3.761  -13.428 1.00 0.00 ? 35 GLU A CG   4  
ATOM 4307  C CD   . GLU A 1 35 ? -0.248  -4.982  -14.126 1.00 0.00 ? 35 GLU A CD   4  
ATOM 4308  O OE1  . GLU A 1 35 ? -0.422  -5.073  -15.361 1.00 0.00 ? 35 GLU A OE1  4  
ATOM 4309  O OE2  . GLU A 1 35 ? 0.372   -5.798  -13.409 1.00 0.00 ? 35 GLU A OE2  4  
ATOM 4310  H H    . GLU A 1 35 ? 0.279   -2.132  -11.372 1.00 0.00 ? 35 GLU A H    4  
ATOM 4311  H HA   . GLU A 1 35 ? -0.065  -0.393  -13.324 1.00 0.00 ? 35 GLU A HA   4  
ATOM 4312  H HB3  . GLU A 1 35 ? 0.960   -2.605  -13.635 1.00 0.00 ? 35 GLU A HB3  4  
ATOM 4313  H HG3  . GLU A 1 35 ? -1.903  -3.669  -13.691 1.00 0.00 ? 35 GLU A HG3  4  
ATOM 4314  N N    . ARG A 1 36 ? -2.946  -1.672  -12.487 1.00 0.00 ? 36 ARG A N    4  
ATOM 4315  C CA   . ARG A 1 36 ? -4.386  -1.548  -12.630 1.00 0.00 ? 36 ARG A CA   4  
ATOM 4316  C C    . ARG A 1 36 ? -4.907  -0.393  -11.773 1.00 0.00 ? 36 ARG A C    4  
ATOM 4317  O O    . ARG A 1 36 ? -5.372  0.617   -12.301 1.00 0.00 ? 36 ARG A O    4  
ATOM 4318  C CB   . ARG A 1 36 ? -5.095  -2.839  -12.218 1.00 0.00 ? 36 ARG A CB   4  
ATOM 4319  C CG   . ARG A 1 36 ? -4.943  -3.916  -13.295 1.00 0.00 ? 36 ARG A CG   4  
ATOM 4320  C CD   . ARG A 1 36 ? -6.237  -4.716  -13.456 1.00 0.00 ? 36 ARG A CD   4  
ATOM 4321  N NE   . ARG A 1 36 ? -6.000  -6.136  -13.110 1.00 0.00 ? 36 ARG A NE   4  
ATOM 4322  C CZ   . ARG A 1 36 ? -6.891  -7.116  -13.309 1.00 0.00 ? 36 ARG A CZ   4  
ATOM 4323  N NH1  . ARG A 1 36 ? -8.084  -6.837  -13.853 1.00 0.00 ? 36 ARG A NH1  4  
ATOM 4324  N NH2  . ARG A 1 36 ? -6.591  -8.376  -12.965 1.00 0.00 ? 36 ARG A NH2  4  
ATOM 4325  H H    . ARG A 1 36 ? -2.646  -2.250  -11.727 1.00 0.00 ? 36 ARG A H    4  
ATOM 4326  H HA   . ARG A 1 36 ? -4.545  -1.352  -13.691 1.00 0.00 ? 36 ARG A HA   4  
ATOM 4327  H HB3  . ARG A 1 36 ? -6.152  -2.640  -12.045 1.00 0.00 ? 36 ARG A HB3  4  
ATOM 4328  H HG3  . ARG A 1 36 ? -4.126  -4.588  -13.030 1.00 0.00 ? 36 ARG A HG3  4  
ATOM 4329  H HD3  . ARG A 1 36 ? -6.596  -4.638  -14.482 1.00 0.00 ? 36 ARG A HD3  4  
ATOM 4330  H HE   . ARG A 1 36 ? -5.119  -6.378  -12.703 1.00 0.00 ? 36 ARG A HE   4  
ATOM 4331  H HH11 . ARG A 1 36 ? -8.309  -5.897  -14.110 1.00 0.00 ? 36 ARG A HH11 4  
ATOM 4332  H HH12 . ARG A 1 36 ? -8.750  -7.569  -14.001 1.00 0.00 ? 36 ARG A HH12 4  
ATOM 4333  H HH21 . ARG A 1 36 ? -5.700  -8.584  -12.560 1.00 0.00 ? 36 ARG A HH21 4  
ATOM 4334  H HH22 . ARG A 1 36 ? -7.256  -9.107  -13.114 1.00 0.00 ? 36 ARG A HH22 4  
ATOM 4335  N N    . LEU A 1 37 ? -4.813  -0.579  -10.464 1.00 0.00 ? 37 LEU A N    4  
ATOM 4336  C CA   . LEU A 1 37 ? -5.269  0.435   -9.529  1.00 0.00 ? 37 LEU A CA   4  
ATOM 4337  C C    . LEU A 1 37 ? -4.836  1.815   -10.029 1.00 0.00 ? 37 LEU A C    4  
ATOM 4338  O O    . LEU A 1 37 ? -5.530  2.806   -9.804  1.00 0.00 ? 37 LEU A O    4  
ATOM 4339  C CB   . LEU A 1 37 ? -4.785  0.114   -8.114  1.00 0.00 ? 37 LEU A CB   4  
ATOM 4340  C CG   . LEU A 1 37 ? -5.083  -1.298  -7.607  1.00 0.00 ? 37 LEU A CG   4  
ATOM 4341  C CD1  . LEU A 1 37 ? -5.234  -1.314  -6.084  1.00 0.00 ? 37 LEU A CD1  4  
ATOM 4342  C CD2  . LEU A 1 37 ? -6.308  -1.886  -8.310  1.00 0.00 ? 37 LEU A CD2  4  
ATOM 4343  H H    . LEU A 1 37 ? -4.434  -1.402  -10.043 1.00 0.00 ? 37 LEU A H    4  
ATOM 4344  H HA   . LEU A 1 37 ? -6.358  0.399   -9.514  1.00 0.00 ? 37 LEU A HA   4  
ATOM 4345  H HB3  . LEU A 1 37 ? -5.237  0.829   -7.426  1.00 0.00 ? 37 LEU A HB3  4  
ATOM 4346  H HG   . LEU A 1 37 ? -4.234  -1.936  -7.852  1.00 0.00 ? 37 LEU A HG   4  
ATOM 4347  H HD11 . LEU A 1 37 ? -5.046  -2.320  -5.711  1.00 0.00 ? 37 LEU A HD11 4  
ATOM 4348  H HD12 . LEU A 1 37 ? -4.516  -0.622  -5.641  1.00 0.00 ? 37 LEU A HD12 4  
ATOM 4349  H HD13 . LEU A 1 37 ? -6.245  -1.009  -5.816  1.00 0.00 ? 37 LEU A HD13 4  
ATOM 4350  H HD21 . LEU A 1 37 ? -6.702  -2.714  -7.722  1.00 0.00 ? 37 LEU A HD21 4  
ATOM 4351  H HD22 . LEU A 1 37 ? -7.074  -1.115  -8.410  1.00 0.00 ? 37 LEU A HD22 4  
ATOM 4352  H HD23 . LEU A 1 37 ? -6.022  -2.245  -9.298  1.00 0.00 ? 37 LEU A HD23 4  
ATOM 4353  N N    . LEU A 1 38 ? -3.693  1.836   -10.697 1.00 0.00 ? 38 LEU A N    4  
ATOM 4354  C CA   . LEU A 1 38 ? -3.160  3.078   -11.231 1.00 0.00 ? 38 LEU A CA   4  
ATOM 4355  C C    . LEU A 1 38 ? -4.084  3.591   -12.336 1.00 0.00 ? 38 LEU A C    4  
ATOM 4356  O O    . LEU A 1 38 ? -4.490  4.752   -12.322 1.00 0.00 ? 38 LEU A O    4  
ATOM 4357  C CB   . LEU A 1 38 ? -1.710  2.889   -11.680 1.00 0.00 ? 38 LEU A CB   4  
ATOM 4358  C CG   . LEU A 1 38 ? -0.689  2.640   -10.567 1.00 0.00 ? 38 LEU A CG   4  
ATOM 4359  C CD1  . LEU A 1 38 ? 0.643   2.156   -11.144 1.00 0.00 ? 38 LEU A CD1  4  
ATOM 4360  C CD2  . LEU A 1 38 ? -0.518  3.883   -9.692  1.00 0.00 ? 38 LEU A CD2  4  
ATOM 4361  H H    . LEU A 1 38 ? -3.135  1.025   -10.876 1.00 0.00 ? 38 LEU A H    4  
ATOM 4362  H HA   . LEU A 1 38 ? -3.154  3.805   -10.420 1.00 0.00 ? 38 LEU A HA   4  
ATOM 4363  H HB3  . LEU A 1 38 ? -1.403  3.777   -12.234 1.00 0.00 ? 38 LEU A HB3  4  
ATOM 4364  H HG   . LEU A 1 38 ? -1.071  1.845   -9.927  1.00 0.00 ? 38 LEU A HG   4  
ATOM 4365  H HD11 . LEU A 1 38 ? 0.555   1.108   -11.429 1.00 0.00 ? 38 LEU A HD11 4  
ATOM 4366  H HD12 . LEU A 1 38 ? 0.897   2.752   -12.019 1.00 0.00 ? 38 LEU A HD12 4  
ATOM 4367  H HD13 . LEU A 1 38 ? 1.424   2.264   -10.391 1.00 0.00 ? 38 LEU A HD13 4  
ATOM 4368  H HD21 . LEU A 1 38 ? -0.567  4.776   -10.315 1.00 0.00 ? 38 LEU A HD21 4  
ATOM 4369  H HD22 . LEU A 1 38 ? -1.313  3.916   -8.948  1.00 0.00 ? 38 LEU A HD22 4  
ATOM 4370  H HD23 . LEU A 1 38 ? 0.448   3.842   -9.189  1.00 0.00 ? 38 LEU A HD23 4  
ATOM 4371  N N    . ARG A 1 39 ? -4.391  2.701   -13.269 1.00 0.00 ? 39 ARG A N    4  
ATOM 4372  C CA   . ARG A 1 39 ? -5.260  3.050   -14.380 1.00 0.00 ? 39 ARG A CA   4  
ATOM 4373  C C    . ARG A 1 39 ? -6.528  3.734   -13.867 1.00 0.00 ? 39 ARG A C    4  
ATOM 4374  O O    . ARG A 1 39 ? -6.946  4.757   -14.406 1.00 0.00 ? 39 ARG A O    4  
ATOM 4375  C CB   . ARG A 1 39 ? -5.648  1.808   -15.186 1.00 0.00 ? 39 ARG A CB   4  
ATOM 4376  C CG   . ARG A 1 39 ? -6.454  2.191   -16.428 1.00 0.00 ? 39 ARG A CG   4  
ATOM 4377  C CD   . ARG A 1 39 ? -6.591  1.002   -17.381 1.00 0.00 ? 39 ARG A CD   4  
ATOM 4378  N NE   . ARG A 1 39 ? -7.579  1.313   -18.440 1.00 0.00 ? 39 ARG A NE   4  
ATOM 4379  C CZ   . ARG A 1 39 ? -7.309  2.047   -19.527 1.00 0.00 ? 39 ARG A CZ   4  
ATOM 4380  N NH1  . ARG A 1 39 ? -6.080  2.550   -19.708 1.00 0.00 ? 39 ARG A NH1  4  
ATOM 4381  N NH2  . ARG A 1 39 ? -8.267  2.277   -20.435 1.00 0.00 ? 39 ARG A NH2  4  
ATOM 4382  H H    . ARG A 1 39 ? -4.056  1.759   -13.274 1.00 0.00 ? 39 ARG A H    4  
ATOM 4383  H HA   . ARG A 1 39 ? -4.668  3.729   -14.994 1.00 0.00 ? 39 ARG A HA   4  
ATOM 4384  H HB3  . ARG A 1 39 ? -6.233  1.133   -14.561 1.00 0.00 ? 39 ARG A HB3  4  
ATOM 4385  H HG3  . ARG A 1 39 ? -5.966  3.020   -16.942 1.00 0.00 ? 39 ARG A HG3  4  
ATOM 4386  H HD3  . ARG A 1 39 ? -6.904  0.116   -16.829 1.00 0.00 ? 39 ARG A HD3  4  
ATOM 4387  H HE   . ARG A 1 39 ? -8.506  0.952   -18.335 1.00 0.00 ? 39 ARG A HE   4  
ATOM 4388  H HH11 . ARG A 1 39 ? -5.365  2.378   -19.031 1.00 0.00 ? 39 ARG A HH11 4  
ATOM 4389  H HH12 . ARG A 1 39 ? -5.879  3.098   -20.520 1.00 0.00 ? 39 ARG A HH12 4  
ATOM 4390  H HH21 . ARG A 1 39 ? -9.184  1.900   -20.300 1.00 0.00 ? 39 ARG A HH21 4  
ATOM 4391  H HH22 . ARG A 1 39 ? -8.066  2.825   -21.247 1.00 0.00 ? 39 ARG A HH22 4  
ATOM 4392  N N    . GLU A 1 40 ? -7.105  3.141   -12.832 1.00 0.00 ? 40 GLU A N    4  
ATOM 4393  C CA   . GLU A 1 40 ? -8.317  3.681   -12.240 1.00 0.00 ? 40 GLU A CA   4  
ATOM 4394  C C    . GLU A 1 40 ? -8.075  4.050   -10.776 1.00 0.00 ? 40 GLU A C    4  
ATOM 4395  O O    . GLU A 1 40 ? -8.003  3.175   -9.915  1.00 0.00 ? 40 GLU A O    4  
ATOM 4396  C CB   . GLU A 1 40 ? -9.478  2.692   -12.371 1.00 0.00 ? 40 GLU A CB   4  
ATOM 4397  C CG   . GLU A 1 40 ? -8.968  1.250   -12.420 1.00 0.00 ? 40 GLU A CG   4  
ATOM 4398  C CD   . GLU A 1 40 ? -10.113 0.273   -12.692 1.00 0.00 ? 40 GLU A CD   4  
ATOM 4399  O OE1  . GLU A 1 40 ? -11.225 0.548   -12.193 1.00 0.00 ? 40 GLU A OE1  4  
ATOM 4400  O OE2  . GLU A 1 40 ? -9.850  -0.728  -13.393 1.00 0.00 ? 40 GLU A OE2  4  
ATOM 4401  H H    . GLU A 1 40 ? -6.758  2.308   -12.400 1.00 0.00 ? 40 GLU A H    4  
ATOM 4402  H HA   . GLU A 1 40 ? -8.546  4.578   -12.815 1.00 0.00 ? 40 GLU A HA   4  
ATOM 4403  H HB3  . GLU A 1 40 ? -10.047 2.911   -13.275 1.00 0.00 ? 40 GLU A HB3  4  
ATOM 4404  H HG3  . GLU A 1 40 ? -8.488  0.999   -11.474 1.00 0.00 ? 40 GLU A HG3  4  
ATOM 4405  N N    . PRO A 1 41 ? -7.950  5.382   -10.533 1.00 0.00 ? 41 PRO A N    4  
ATOM 4406  C CA   . PRO A 1 41 ? -7.717  5.878   -9.186  1.00 0.00 ? 41 PRO A CA   4  
ATOM 4407  C C    . PRO A 1 41 ? -8.994  5.809   -8.347  1.00 0.00 ? 41 PRO A C    4  
ATOM 4408  O O    . PRO A 1 41 ? -8.931  5.703   -7.123  1.00 0.00 ? 41 PRO A O    4  
ATOM 4409  C CB   . PRO A 1 41 ? -7.205  7.297   -9.373  1.00 0.00 ? 41 PRO A CB   4  
ATOM 4410  C CG   . PRO A 1 41 ? -7.610  7.704   -10.782 1.00 0.00 ? 41 PRO A CG   4  
ATOM 4411  C CD   . PRO A 1 41 ? -8.028  6.448   -11.528 1.00 0.00 ? 41 PRO A CD   4  
ATOM 4412  H HA   . PRO A 1 41 ? -7.048  5.303   -8.716  1.00 0.00 ? 41 PRO A HA   4  
ATOM 4413  H HB3  . PRO A 1 41 ? -6.123  7.343   -9.251  1.00 0.00 ? 41 PRO A HB3  4  
ATOM 4414  H HG3  . PRO A 1 41 ? -6.780  8.192   -11.292 1.00 0.00 ? 41 PRO A HG3  4  
ATOM 4415  H HD3  . PRO A 1 41 ? -7.369  6.249   -12.372 1.00 0.00 ? 41 PRO A HD3  4  
ATOM 4416  N N    . GLY A 1 42 ? -10.122 5.871   -9.039  1.00 0.00 ? 42 GLY A N    4  
ATOM 4417  C CA   . GLY A 1 42 ? -11.412 5.816   -8.372  1.00 0.00 ? 42 GLY A CA   4  
ATOM 4418  C C    . GLY A 1 42 ? -11.664 4.429   -7.777  1.00 0.00 ? 42 GLY A C    4  
ATOM 4419  O O    . GLY A 1 42 ? -12.348 4.299   -6.763  1.00 0.00 ? 42 GLY A O    4  
ATOM 4420  H H    . GLY A 1 42 ? -10.165 5.958   -10.033 1.00 0.00 ? 42 GLY A H    4  
ATOM 4421  H HA2  . GLY A 1 42 ? -11.449 6.567   -7.582  1.00 0.00 ? 42 GLY A HA2  4  
ATOM 4422  H HA3  . GLY A 1 42 ? -12.203 6.061   -9.081  1.00 0.00 ? 42 GLY A HA3  4  
ATOM 4423  N N    . LEU A 1 43 ? -11.097 3.428   -8.434  1.00 0.00 ? 43 LEU A N    4  
ATOM 4424  C CA   . LEU A 1 43 ? -11.252 2.055   -7.984  1.00 0.00 ? 43 LEU A CA   4  
ATOM 4425  C C    . LEU A 1 43 ? -10.653 1.911   -6.583  1.00 0.00 ? 43 LEU A C    4  
ATOM 4426  O O    . LEU A 1 43 ? -11.235 1.261   -5.718  1.00 0.00 ? 43 LEU A O    4  
ATOM 4427  C CB   . LEU A 1 43 ? -10.660 1.085   -9.009  1.00 0.00 ? 43 LEU A CB   4  
ATOM 4428  C CG   . LEU A 1 43 ? -11.068 -0.382  -8.857  1.00 0.00 ? 43 LEU A CG   4  
ATOM 4429  C CD1  . LEU A 1 43 ? -12.501 -0.606  -9.348  1.00 0.00 ? 43 LEU A CD1  4  
ATOM 4430  C CD2  . LEU A 1 43 ? -10.071 -1.304  -9.561  1.00 0.00 ? 43 LEU A CD2  4  
ATOM 4431  H H    . LEU A 1 43 ? -10.543 3.542   -9.259  1.00 0.00 ? 43 LEU A H    4  
ATOM 4432  H HA   . LEU A 1 43 ? -12.321 1.848   -7.925  1.00 0.00 ? 43 LEU A HA   4  
ATOM 4433  H HB3  . LEU A 1 43 ? -9.573  1.146   -8.952  1.00 0.00 ? 43 LEU A HB3  4  
ATOM 4434  H HG   . LEU A 1 43 ? -11.048 -0.635  -7.798  1.00 0.00 ? 43 LEU A HG   4  
ATOM 4435  H HD11 . LEU A 1 43 ? -12.624 -1.647  -9.645  1.00 0.00 ? 43 LEU A HD11 4  
ATOM 4436  H HD12 . LEU A 1 43 ? -13.200 -0.371  -8.544  1.00 0.00 ? 43 LEU A HD12 4  
ATOM 4437  H HD13 . LEU A 1 43 ? -12.698 0.042   -10.202 1.00 0.00 ? 43 LEU A HD13 4  
ATOM 4438  H HD21 . LEU A 1 43 ? -9.412  -0.711  -10.195 1.00 0.00 ? 43 LEU A HD21 4  
ATOM 4439  H HD22 . LEU A 1 43 ? -9.477  -1.834  -8.817  1.00 0.00 ? 43 LEU A HD22 4  
ATOM 4440  H HD23 . LEU A 1 43 ? -10.612 -2.025  -10.175 1.00 0.00 ? 43 LEU A HD23 4  
ATOM 4441  N N    . LEU A 1 44 ? -9.495  2.530   -6.404  1.00 0.00 ? 44 LEU A N    4  
ATOM 4442  C CA   . LEU A 1 44 ? -8.810  2.480   -5.124  1.00 0.00 ? 44 LEU A CA   4  
ATOM 4443  C C    . LEU A 1 44 ? -7.846  3.664   -5.020  1.00 0.00 ? 44 LEU A C    4  
ATOM 4444  O O    . LEU A 1 44 ? -6.853  3.726   -5.743  1.00 0.00 ? 44 LEU A O    4  
ATOM 4445  C CB   . LEU A 1 44 ? -8.137  1.120   -4.930  1.00 0.00 ? 44 LEU A CB   4  
ATOM 4446  C CG   . LEU A 1 44 ? -7.096  1.039   -3.810  1.00 0.00 ? 44 LEU A CG   4  
ATOM 4447  C CD1  . LEU A 1 44 ? -7.594  1.751   -2.549  1.00 0.00 ? 44 LEU A CD1  4  
ATOM 4448  C CD2  . LEU A 1 44 ? -6.701  -0.412  -3.532  1.00 0.00 ? 44 LEU A CD2  4  
ATOM 4449  H H    . LEU A 1 44 ? -9.026  3.057   -7.114  1.00 0.00 ? 44 LEU A H    4  
ATOM 4450  H HA   . LEU A 1 44 ? -9.565  2.579   -4.345  1.00 0.00 ? 44 LEU A HA   4  
ATOM 4451  H HB3  . LEU A 1 44 ? -7.655  0.838   -5.866  1.00 0.00 ? 44 LEU A HB3  4  
ATOM 4452  H HG   . LEU A 1 44 ? -6.198  1.561   -4.141  1.00 0.00 ? 44 LEU A HG   4  
ATOM 4453  H HD11 . LEU A 1 44 ? -7.529  2.829   -2.691  1.00 0.00 ? 44 LEU A HD11 4  
ATOM 4454  H HD12 . LEU A 1 44 ? -8.629  1.469   -2.358  1.00 0.00 ? 44 LEU A HD12 4  
ATOM 4455  H HD13 . LEU A 1 44 ? -6.976  1.458   -1.700  1.00 0.00 ? 44 LEU A HD13 4  
ATOM 4456  H HD21 . LEU A 1 44 ? -7.317  -1.079  -4.135  1.00 0.00 ? 44 LEU A HD21 4  
ATOM 4457  H HD22 . LEU A 1 44 ? -5.652  -0.558  -3.787  1.00 0.00 ? 44 LEU A HD22 4  
ATOM 4458  H HD23 . LEU A 1 44 ? -6.852  -0.633  -2.475  1.00 0.00 ? 44 LEU A HD23 4  
ATOM 4459  N N    . ALA A 1 45 ? -8.172  4.572   -4.112  1.00 0.00 ? 45 ALA A N    4  
ATOM 4460  C CA   . ALA A 1 45 ? -7.347  5.750   -3.903  1.00 0.00 ? 45 ALA A CA   4  
ATOM 4461  C C    . ALA A 1 45 ? -6.463  5.537   -2.673  1.00 0.00 ? 45 ALA A C    4  
ATOM 4462  O O    . ALA A 1 45 ? -6.938  5.084   -1.633  1.00 0.00 ? 45 ALA A O    4  
ATOM 4463  C CB   . ALA A 1 45 ? -8.243  6.983   -3.770  1.00 0.00 ? 45 ALA A CB   4  
ATOM 4464  H H    . ALA A 1 45 ? -8.981  4.513   -3.527  1.00 0.00 ? 45 ALA A H    4  
ATOM 4465  H HA   . ALA A 1 45 ? -6.713  5.870   -4.781  1.00 0.00 ? 45 ALA A HA   4  
ATOM 4466  H HB1  . ALA A 1 45 ? -7.630  7.857   -3.548  1.00 0.00 ? 45 ALA A HB1  4  
ATOM 4467  H HB2  . ALA A 1 45 ? -8.780  7.144   -4.704  1.00 0.00 ? 45 ALA A HB2  4  
ATOM 4468  H HB3  . ALA A 1 45 ? -8.958  6.828   -2.961  1.00 0.00 ? 45 ALA A HB3  4  
ATOM 4469  N N    . VAL A 1 46 ? -5.191  5.873   -2.833  1.00 0.00 ? 46 VAL A N    4  
ATOM 4470  C CA   . VAL A 1 46 ? -4.236  5.724   -1.748  1.00 0.00 ? 46 VAL A CA   4  
ATOM 4471  C C    . VAL A 1 46 ? -4.088  7.060   -1.017  1.00 0.00 ? 46 VAL A C    4  
ATOM 4472  O O    . VAL A 1 46 ? -3.651  8.048   -1.606  1.00 0.00 ? 46 VAL A O    4  
ATOM 4473  C CB   . VAL A 1 46 ? -2.909  5.187   -2.290  1.00 0.00 ? 46 VAL A CB   4  
ATOM 4474  C CG1  . VAL A 1 46 ? -1.947  4.851   -1.149  1.00 0.00 ? 46 VAL A CG1  4  
ATOM 4475  C CG2  . VAL A 1 46 ? -3.136  3.973   -3.192  1.00 0.00 ? 46 VAL A CG2  4  
ATOM 4476  H H    . VAL A 1 46 ? -4.812  6.241   -3.682  1.00 0.00 ? 46 VAL A H    4  
ATOM 4477  H HA   . VAL A 1 46 ? -4.639  4.987   -1.054  1.00 0.00 ? 46 VAL A HA   4  
ATOM 4478  H HB   . VAL A 1 46 ? -2.452  5.972   -2.893  1.00 0.00 ? 46 VAL A HB   4  
ATOM 4479  H HG11 . VAL A 1 46 ? -0.937  4.742   -1.545  1.00 0.00 ? 46 VAL A HG11 4  
ATOM 4480  H HG12 . VAL A 1 46 ? -1.963  5.653   -0.411  1.00 0.00 ? 46 VAL A HG12 4  
ATOM 4481  H HG13 . VAL A 1 46 ? -2.255  3.917   -0.678  1.00 0.00 ? 46 VAL A HG13 4  
ATOM 4482  H HG21 . VAL A 1 46 ? -2.709  4.167   -4.176  1.00 0.00 ? 46 VAL A HG21 4  
ATOM 4483  H HG22 . VAL A 1 46 ? -2.653  3.099   -2.753  1.00 0.00 ? 46 VAL A HG22 4  
ATOM 4484  H HG23 . VAL A 1 46 ? -4.205  3.788   -3.290  1.00 0.00 ? 46 VAL A HG23 4  
ATOM 4485  N N    . GLN A 1 47 ? -4.459  7.047   0.254   1.00 0.00 ? 47 GLN A N    4  
ATOM 4486  C CA   . GLN A 1 47 ? -4.372  8.245   1.070   1.00 0.00 ? 47 GLN A CA   4  
ATOM 4487  C C    . GLN A 1 47 ? -3.376  8.038   2.213   1.00 0.00 ? 47 GLN A C    4  
ATOM 4488  O O    . GLN A 1 47 ? -2.999  6.907   2.516   1.00 0.00 ? 47 GLN A O    4  
ATOM 4489  C CB   . GLN A 1 47 ? -5.748  8.642   1.609   1.00 0.00 ? 47 GLN A CB   4  
ATOM 4490  C CG   . GLN A 1 47 ? -6.546  9.417   0.557   1.00 0.00 ? 47 GLN A CG   4  
ATOM 4491  C CD   . GLN A 1 47 ? -6.034  10.853  0.429   1.00 0.00 ? 47 GLN A CD   4  
ATOM 4492  O OE1  . GLN A 1 47 ? -5.120  11.149  -0.323  1.00 0.00 ? 47 GLN A OE1  4  
ATOM 4493  N NE2  . GLN A 1 47 ? -6.672  11.725  1.204   1.00 0.00 ? 47 GLN A NE2  4  
ATOM 4494  H H    . GLN A 1 47 ? -4.812  6.239   0.725   1.00 0.00 ? 47 GLN A H    4  
ATOM 4495  H HA   . GLN A 1 47 ? -4.011  9.027   0.402   1.00 0.00 ? 47 GLN A HA   4  
ATOM 4496  H HB3  . GLN A 1 47 ? -5.630  9.253   2.504   1.00 0.00 ? 47 GLN A HB3  4  
ATOM 4497  H HG3  . GLN A 1 47 ? -7.600  9.427   0.830   1.00 0.00 ? 47 GLN A HG3  4  
ATOM 4498  H HE21 . GLN A 1 47 ? -7.414  11.417  1.800   1.00 0.00 ? 47 GLN A HE21 4  
ATOM 4499  H HE22 . GLN A 1 47 ? -6.409  12.691  1.192   1.00 0.00 ? 47 GLN A HE22 4  
ATOM 4500  N N    . GLY A 1 48 ? -2.977  9.148   2.817   1.00 0.00 ? 48 GLY A N    4  
ATOM 4501  C CA   . GLY A 1 48 ? -2.031  9.103   3.919   1.00 0.00 ? 48 GLY A CA   4  
ATOM 4502  C C    . GLY A 1 48 ? -0.644  8.677   3.434   1.00 0.00 ? 48 GLY A C    4  
ATOM 4503  O O    . GLY A 1 48 ? 0.118   8.065   4.181   1.00 0.00 ? 48 GLY A O    4  
ATOM 4504  H H    . GLY A 1 48 ? -3.288  10.065  2.565   1.00 0.00 ? 48 GLY A H    4  
ATOM 4505  H HA2  . GLY A 1 48 ? -1.970  10.083  4.391   1.00 0.00 ? 48 GLY A HA2  4  
ATOM 4506  H HA3  . GLY A 1 48 ? -2.386  8.405   4.678   1.00 0.00 ? 48 GLY A HA3  4  
ATOM 4507  N N    . LEU A 1 49 ? -0.358  9.017   2.186   1.00 0.00 ? 49 LEU A N    4  
ATOM 4508  C CA   . LEU A 1 49 ? 0.924   8.678   1.593   1.00 0.00 ? 49 LEU A CA   4  
ATOM 4509  C C    . LEU A 1 49 ? 2.005   9.598   2.165   1.00 0.00 ? 49 LEU A C    4  
ATOM 4510  O O    . LEU A 1 49 ? 1.697   10.613  2.787   1.00 0.00 ? 49 LEU A O    4  
ATOM 4511  C CB   . LEU A 1 49 ? 0.833   8.712   0.066   1.00 0.00 ? 49 LEU A CB   4  
ATOM 4512  C CG   . LEU A 1 49 ? 0.449   7.395   -0.612  1.00 0.00 ? 49 LEU A CG   4  
ATOM 4513  C CD1  . LEU A 1 49 ? -0.172  7.648   -1.988  1.00 0.00 ? 49 LEU A CD1  4  
ATOM 4514  C CD2  . LEU A 1 49 ? 1.648   6.448   -0.690  1.00 0.00 ? 49 LEU A CD2  4  
ATOM 4515  H H    . LEU A 1 49 ? -0.984  9.515   1.586   1.00 0.00 ? 49 LEU A H    4  
ATOM 4516  H HA   . LEU A 1 49 ? 1.155   7.652   1.879   1.00 0.00 ? 49 LEU A HA   4  
ATOM 4517  H HB3  . LEU A 1 49 ? 1.797   9.033   -0.329  1.00 0.00 ? 49 LEU A HB3  4  
ATOM 4518  H HG   . LEU A 1 49 ? -0.310  6.906   -0.002  1.00 0.00 ? 49 LEU A HG   4  
ATOM 4519  H HD11 . LEU A 1 49 ? 0.583   8.059   -2.657  1.00 0.00 ? 49 LEU A HD11 4  
ATOM 4520  H HD12 . LEU A 1 49 ? -0.546  6.710   -2.396  1.00 0.00 ? 49 LEU A HD12 4  
ATOM 4521  H HD13 . LEU A 1 49 ? -0.995  8.356   -1.890  1.00 0.00 ? 49 LEU A HD13 4  
ATOM 4522  H HD21 . LEU A 1 49 ? 1.956   6.169   0.317   1.00 0.00 ? 49 LEU A HD21 4  
ATOM 4523  H HD22 . LEU A 1 49 ? 1.369   5.553   -1.247  1.00 0.00 ? 49 LEU A HD22 4  
ATOM 4524  H HD23 . LEU A 1 49 ? 2.474   6.948   -1.196  1.00 0.00 ? 49 LEU A HD23 4  
ATOM 4525  N N    . PRO A 1 50 ? 3.283   9.197   1.929   1.00 0.00 ? 50 PRO A N    4  
ATOM 4526  C CA   . PRO A 1 50 ? 4.412   9.973   2.415   1.00 0.00 ? 50 PRO A CA   4  
ATOM 4527  C C    . PRO A 1 50 ? 4.615   11.233  1.571   1.00 0.00 ? 50 PRO A C    4  
ATOM 4528  O O    . PRO A 1 50 ? 5.157   11.166  0.469   1.00 0.00 ? 50 PRO A O    4  
ATOM 4529  C CB   . PRO A 1 50 ? 5.597   9.022   2.356   1.00 0.00 ? 50 PRO A CB   4  
ATOM 4530  C CG   . PRO A 1 50 ? 5.189   7.905   1.411   1.00 0.00 ? 50 PRO A CG   4  
ATOM 4531  C CD   . PRO A 1 50 ? 3.686   8.000   1.197   1.00 0.00 ? 50 PRO A CD   4  
ATOM 4532  H HA   . PRO A 1 50 ? 4.239   10.293  3.346   1.00 0.00 ? 50 PRO A HA   4  
ATOM 4533  H HB3  . PRO A 1 50 ? 5.832   8.630   3.345   1.00 0.00 ? 50 PRO A HB3  4  
ATOM 4534  H HG3  . PRO A 1 50 ? 5.454   6.934   1.829   1.00 0.00 ? 50 PRO A HG3  4  
ATOM 4535  H HD3  . PRO A 1 50 ? 3.176   7.114   1.576   1.00 0.00 ? 50 PRO A HD3  4  
ATOM 4536  N N    . GLU A 1 51 ? 4.166   12.352  2.120   1.00 0.00 ? 51 GLU A N    4  
ATOM 4537  C CA   . GLU A 1 51 ? 4.291   13.626  1.432   1.00 0.00 ? 51 GLU A CA   4  
ATOM 4538  C C    . GLU A 1 51 ? 5.548   13.637  0.560   1.00 0.00 ? 51 GLU A C    4  
ATOM 4539  O O    . GLU A 1 51 ? 6.565   13.050  0.924   1.00 0.00 ? 51 GLU A O    4  
ATOM 4540  C CB   . GLU A 1 51 ? 4.303   14.788  2.427   1.00 0.00 ? 51 GLU A CB   4  
ATOM 4541  C CG   . GLU A 1 51 ? 2.962   14.901  3.156   1.00 0.00 ? 51 GLU A CG   4  
ATOM 4542  C CD   . GLU A 1 51 ? 3.169   15.041  4.665   1.00 0.00 ? 51 GLU A CD   4  
ATOM 4543  O OE1  . GLU A 1 51 ? 4.143   15.727  5.044   1.00 0.00 ? 51 GLU A OE1  4  
ATOM 4544  O OE2  . GLU A 1 51 ? 2.348   14.457  5.406   1.00 0.00 ? 51 GLU A OE2  4  
ATOM 4545  H H    . GLU A 1 51 ? 3.725   12.398  3.017   1.00 0.00 ? 51 GLU A H    4  
ATOM 4546  H HA   . GLU A 1 51 ? 3.404   13.704  0.803   1.00 0.00 ? 51 GLU A HA   4  
ATOM 4547  H HB3  . GLU A 1 51 ? 4.516   15.719  1.902   1.00 0.00 ? 51 GLU A HB3  4  
ATOM 4548  H HG3  . GLU A 1 51 ? 2.357   14.018  2.947   1.00 0.00 ? 51 GLU A HG3  4  
ATOM 4549  N N    . GLY A 1 52 ? 5.436   14.312  -0.575  1.00 0.00 ? 52 GLY A N    4  
ATOM 4550  C CA   . GLY A 1 52 ? 6.552   14.407  -1.502  1.00 0.00 ? 52 GLY A CA   4  
ATOM 4551  C C    . GLY A 1 52 ? 6.799   13.070  -2.201  1.00 0.00 ? 52 GLY A C    4  
ATOM 4552  O O    . GLY A 1 52 ? 7.933   12.595  -2.259  1.00 0.00 ? 52 GLY A O    4  
ATOM 4553  H H    . GLY A 1 52 ? 4.606   14.787  -0.864  1.00 0.00 ? 52 GLY A H    4  
ATOM 4554  H HA2  . GLY A 1 52 ? 6.347   15.178  -2.245  1.00 0.00 ? 52 GLY A HA2  4  
ATOM 4555  H HA3  . GLY A 1 52 ? 7.450   14.713  -0.965  1.00 0.00 ? 52 GLY A HA3  4  
ATOM 4556  N N    . LEU A 1 53 ? 5.719   12.498  -2.715  1.00 0.00 ? 53 LEU A N    4  
ATOM 4557  C CA   . LEU A 1 53 ? 5.806   11.224  -3.409  1.00 0.00 ? 53 LEU A CA   4  
ATOM 4558  C C    . LEU A 1 53 ? 4.586   11.060  -4.317  1.00 0.00 ? 53 LEU A C    4  
ATOM 4559  O O    . LEU A 1 53 ? 3.844   12.015  -4.546  1.00 0.00 ? 53 LEU A O    4  
ATOM 4560  C CB   . LEU A 1 53 ? 5.986   10.081  -2.409  1.00 0.00 ? 53 LEU A CB   4  
ATOM 4561  C CG   . LEU A 1 53 ? 7.420   9.590   -2.201  1.00 0.00 ? 53 LEU A CG   4  
ATOM 4562  C CD1  . LEU A 1 53 ? 7.504   8.626   -1.016  1.00 0.00 ? 53 LEU A CD1  4  
ATOM 4563  C CD2  . LEU A 1 53 ? 7.977   8.971   -3.484  1.00 0.00 ? 53 LEU A CD2  4  
ATOM 4564  H H    . LEU A 1 53 ? 4.802   12.890  -2.664  1.00 0.00 ? 53 LEU A H    4  
ATOM 4565  H HA   . LEU A 1 53 ? 6.699   11.251  -4.031  1.00 0.00 ? 53 LEU A HA   4  
ATOM 4566  H HB3  . LEU A 1 53 ? 5.377   9.237   -2.737  1.00 0.00 ? 53 LEU A HB3  4  
ATOM 4567  H HG   . LEU A 1 53 ? 8.044   10.450  -1.961  1.00 0.00 ? 53 LEU A HG   4  
ATOM 4568  H HD11 . LEU A 1 53 ? 7.229   9.151   -0.101  1.00 0.00 ? 53 LEU A HD11 4  
ATOM 4569  H HD12 . LEU A 1 53 ? 6.820   7.793   -1.177  1.00 0.00 ? 53 LEU A HD12 4  
ATOM 4570  H HD13 . LEU A 1 53 ? 8.522   8.247   -0.927  1.00 0.00 ? 53 LEU A HD13 4  
ATOM 4571  H HD21 . LEU A 1 53 ? 9.062   9.080   -3.498  1.00 0.00 ? 53 LEU A HD21 4  
ATOM 4572  H HD22 . LEU A 1 53 ? 7.718   7.913   -3.520  1.00 0.00 ? 53 LEU A HD22 4  
ATOM 4573  H HD23 . LEU A 1 53 ? 7.550   9.478   -4.349  1.00 0.00 ? 53 LEU A HD23 4  
ATOM 4574  N N    . ALA A 1 54 ? 4.415   9.842   -4.811  1.00 0.00 ? 54 ALA A N    4  
ATOM 4575  C CA   . ALA A 1 54 ? 3.298   9.541   -5.691  1.00 0.00 ? 54 ALA A CA   4  
ATOM 4576  C C    . ALA A 1 54 ? 2.982   8.046   -5.612  1.00 0.00 ? 54 ALA A C    4  
ATOM 4577  O O    . ALA A 1 54 ? 3.890   7.217   -5.575  1.00 0.00 ? 54 ALA A O    4  
ATOM 4578  C CB   . ALA A 1 54 ? 3.631   9.993   -7.114  1.00 0.00 ? 54 ALA A CB   4  
ATOM 4579  H H    . ALA A 1 54 ? 5.023   9.071   -4.620  1.00 0.00 ? 54 ALA A H    4  
ATOM 4580  H HA   . ALA A 1 54 ? 2.435   10.106  -5.336  1.00 0.00 ? 54 ALA A HA   4  
ATOM 4581  H HB1  . ALA A 1 54 ? 2.711   10.078  -7.692  1.00 0.00 ? 54 ALA A HB1  4  
ATOM 4582  H HB2  . ALA A 1 54 ? 4.130   10.962  -7.080  1.00 0.00 ? 54 ALA A HB2  4  
ATOM 4583  H HB3  . ALA A 1 54 ? 4.289   9.261   -7.582  1.00 0.00 ? 54 ALA A HB3  4  
ATOM 4584  N N    . PHE A 1 55 ? 1.692   7.747   -5.590  1.00 0.00 ? 55 PHE A N    4  
ATOM 4585  C CA   . PHE A 1 55 ? 1.245   6.367   -5.516  1.00 0.00 ? 55 PHE A CA   4  
ATOM 4586  C C    . PHE A 1 55 ? 1.759   5.560   -6.711  1.00 0.00 ? 55 PHE A C    4  
ATOM 4587  O O    . PHE A 1 55 ? 1.350   5.796   -7.846  1.00 0.00 ? 55 PHE A O    4  
ATOM 4588  C CB   . PHE A 1 55 ? -0.285  6.388   -5.551  1.00 0.00 ? 55 PHE A CB   4  
ATOM 4589  C CG   . PHE A 1 55 ? -0.922  5.015   -5.770  1.00 0.00 ? 55 PHE A CG   4  
ATOM 4590  C CD1  . PHE A 1 55 ? -0.531  3.955   -5.014  1.00 0.00 ? 55 PHE A CD1  4  
ATOM 4591  C CD2  . PHE A 1 55 ? -1.880  4.855   -6.722  1.00 0.00 ? 55 PHE A CD2  4  
ATOM 4592  C CE1  . PHE A 1 55 ? -1.122  2.680   -5.217  1.00 0.00 ? 55 PHE A CE1  4  
ATOM 4593  C CE2  . PHE A 1 55 ? -2.473  3.580   -6.925  1.00 0.00 ? 55 PHE A CE2  4  
ATOM 4594  C CZ   . PHE A 1 55 ? -2.080  2.520   -6.169  1.00 0.00 ? 55 PHE A CZ   4  
ATOM 4595  H H    . PHE A 1 55 ? 0.959   8.427   -5.620  1.00 0.00 ? 55 PHE A H    4  
ATOM 4596  H HA   . PHE A 1 55 ? 1.647   5.944   -4.596  1.00 0.00 ? 55 PHE A HA   4  
ATOM 4597  H HB3  . PHE A 1 55 ? -0.610  7.060   -6.347  1.00 0.00 ? 55 PHE A HB3  4  
ATOM 4598  H HD1  . PHE A 1 55 ? 0.237   4.083   -4.251  1.00 0.00 ? 55 PHE A HD1  4  
ATOM 4599  H HD2  . PHE A 1 55 ? -2.194  5.704   -7.329  1.00 0.00 ? 55 PHE A HD2  4  
ATOM 4600  H HE1  . PHE A 1 55 ? -0.808  1.831   -4.611  1.00 0.00 ? 55 PHE A HE1  4  
ATOM 4601  H HE2  . PHE A 1 55 ? -3.240  3.451   -7.688  1.00 0.00 ? 55 PHE A HE2  4  
ATOM 4602  H HZ   . PHE A 1 55 ? -2.535  1.542   -6.325  1.00 0.00 ? 55 PHE A HZ   4  
ATOM 4603  N N    . ARG A 1 56 ? 2.647   4.623   -6.413  1.00 0.00 ? 56 ARG A N    4  
ATOM 4604  C CA   . ARG A 1 56 ? 3.221   3.781   -7.448  1.00 0.00 ? 56 ARG A CA   4  
ATOM 4605  C C    . ARG A 1 56 ? 3.891   2.554   -6.824  1.00 0.00 ? 56 ARG A C    4  
ATOM 4606  O O    . ARG A 1 56 ? 4.041   2.478   -5.606  1.00 0.00 ? 56 ARG A O    4  
ATOM 4607  C CB   . ARG A 1 56 ? 4.253   4.550   -8.276  1.00 0.00 ? 56 ARG A CB   4  
ATOM 4608  C CG   . ARG A 1 56 ? 4.936   5.630   -7.434  1.00 0.00 ? 56 ARG A CG   4  
ATOM 4609  C CD   . ARG A 1 56 ? 6.422   5.738   -7.782  1.00 0.00 ? 56 ARG A CD   4  
ATOM 4610  N NE   . ARG A 1 56 ? 6.583   6.260   -9.158  1.00 0.00 ? 56 ARG A NE   4  
ATOM 4611  C CZ   . ARG A 1 56 ? 7.710   6.818   -9.622  1.00 0.00 ? 56 ARG A CZ   4  
ATOM 4612  N NH1  . ARG A 1 56 ? 8.781   6.928   -8.825  1.00 0.00 ? 56 ARG A NH1  4  
ATOM 4613  N NH2  . ARG A 1 56 ? 7.765   7.264   -10.884 1.00 0.00 ? 56 ARG A NH2  4  
ATOM 4614  H H    . ARG A 1 56 ? 2.975   4.438   -5.487  1.00 0.00 ? 56 ARG A H    4  
ATOM 4615  H HA   . ARG A 1 56 ? 2.376   3.492   -8.073  1.00 0.00 ? 56 ARG A HA   4  
ATOM 4616  H HB3  . ARG A 1 56 ? 3.765   5.008   -9.136  1.00 0.00 ? 56 ARG A HB3  4  
ATOM 4617  H HG3  . ARG A 1 56 ? 4.823   5.397   -6.376  1.00 0.00 ? 56 ARG A HG3  4  
ATOM 4618  H HD3  . ARG A 1 56 ? 6.896   4.761   -7.698  1.00 0.00 ? 56 ARG A HD3  4  
ATOM 4619  H HE   . ARG A 1 56 ? 5.802   6.193   -9.779  1.00 0.00 ? 56 ARG A HE   4  
ATOM 4620  H HH11 . ARG A 1 56 ? 8.740   6.596   -7.883  1.00 0.00 ? 56 ARG A HH11 4  
ATOM 4621  H HH12 . ARG A 1 56 ? 9.622   7.345   -9.172  1.00 0.00 ? 56 ARG A HH12 4  
ATOM 4622  H HH21 . ARG A 1 56 ? 6.966   7.181   -11.480 1.00 0.00 ? 56 ARG A HH21 4  
ATOM 4623  H HH22 . ARG A 1 56 ? 8.606   7.680   -11.232 1.00 0.00 ? 56 ARG A HH22 4  
ATOM 4624  N N    . ARG A 1 57 ? 4.274   1.626   -7.688  1.00 0.00 ? 57 ARG A N    4  
ATOM 4625  C CA   . ARG A 1 57 ? 4.924   0.407   -7.236  1.00 0.00 ? 57 ARG A CA   4  
ATOM 4626  C C    . ARG A 1 57 ? 5.986   0.730   -6.183  1.00 0.00 ? 57 ARG A C    4  
ATOM 4627  O O    . ARG A 1 57 ? 6.582   1.805   -6.207  1.00 0.00 ? 57 ARG A O    4  
ATOM 4628  C CB   . ARG A 1 57 ? 5.581   -0.332  -8.404  1.00 0.00 ? 57 ARG A CB   4  
ATOM 4629  C CG   . ARG A 1 57 ? 4.851   -1.643  -8.704  1.00 0.00 ? 57 ARG A CG   4  
ATOM 4630  C CD   . ARG A 1 57 ? 5.026   -2.044  -10.169 1.00 0.00 ? 57 ARG A CD   4  
ATOM 4631  N NE   . ARG A 1 57 ? 4.696   -3.476  -10.346 1.00 0.00 ? 57 ARG A NE   4  
ATOM 4632  C CZ   . ARG A 1 57 ? 5.541   -4.480  -10.075 1.00 0.00 ? 57 ARG A CZ   4  
ATOM 4633  N NH1  . ARG A 1 57 ? 6.772   -4.215  -9.615  1.00 0.00 ? 57 ARG A NH1  4  
ATOM 4634  N NH2  . ARG A 1 57 ? 5.156   -5.749  -10.265 1.00 0.00 ? 57 ARG A NH2  4  
ATOM 4635  H H    . ARG A 1 57 ? 4.148   1.696   -8.677  1.00 0.00 ? 57 ARG A H    4  
ATOM 4636  H HA   . ARG A 1 57 ? 4.121   -0.195  -6.811  1.00 0.00 ? 57 ARG A HA   4  
ATOM 4637  H HB3  . ARG A 1 57 ? 6.625   -0.539  -8.166  1.00 0.00 ? 57 ARG A HB3  4  
ATOM 4638  H HG3  . ARG A 1 57 ? 3.791   -1.533  -8.476  1.00 0.00 ? 57 ARG A HG3  4  
ATOM 4639  H HD3  . ARG A 1 57 ? 6.052   -1.857  -10.487 1.00 0.00 ? 57 ARG A HD3  4  
ATOM 4640  H HE   . ARG A 1 57 ? 3.786   -3.709  -10.688 1.00 0.00 ? 57 ARG A HE   4  
ATOM 4641  H HH11 . ARG A 1 57 ? 7.059   -3.268  -9.474  1.00 0.00 ? 57 ARG A HH11 4  
ATOM 4642  H HH12 . ARG A 1 57 ? 7.402   -4.965  -9.413  1.00 0.00 ? 57 ARG A HH12 4  
ATOM 4643  H HH21 . ARG A 1 57 ? 4.238   -5.947  -10.608 1.00 0.00 ? 57 ARG A HH21 4  
ATOM 4644  H HH22 . ARG A 1 57 ? 5.787   -6.499  -10.063 1.00 0.00 ? 57 ARG A HH22 4  
ATOM 4645  N N    . PRO A 1 58 ? 6.195   -0.246  -5.260  1.00 0.00 ? 58 PRO A N    4  
ATOM 4646  C CA   . PRO A 1 58 ? 7.174   -0.077  -4.199  1.00 0.00 ? 58 PRO A CA   4  
ATOM 4647  C C    . PRO A 1 58 ? 8.597   -0.233  -4.738  1.00 0.00 ? 58 PRO A C    4  
ATOM 4648  O O    . PRO A 1 58 ? 9.553   0.241   -4.126  1.00 0.00 ? 58 PRO A O    4  
ATOM 4649  C CB   . PRO A 1 58 ? 6.814   -1.124  -3.159  1.00 0.00 ? 58 PRO A CB   4  
ATOM 4650  C CG   . PRO A 1 58 ? 5.944   -2.142  -3.877  1.00 0.00 ? 58 PRO A CG   4  
ATOM 4651  C CD   . PRO A 1 58 ? 5.507   -1.533  -5.199  1.00 0.00 ? 58 PRO A CD   4  
ATOM 4652  H HA   . PRO A 1 58 ? 7.124   0.850   -3.826  1.00 0.00 ? 58 PRO A HA   4  
ATOM 4653  H HB3  . PRO A 1 58 ? 6.280   -0.676  -2.321  1.00 0.00 ? 58 PRO A HB3  4  
ATOM 4654  H HG3  . PRO A 1 58 ? 5.076   -2.399  -3.270  1.00 0.00 ? 58 PRO A HG3  4  
ATOM 4655  H HD3  . PRO A 1 58 ? 4.425   -1.405  -5.239  1.00 0.00 ? 58 PRO A HD3  4  
ATOM 4656  N N    . ALA A 1 59 ? 8.694   -0.899  -5.879  1.00 0.00 ? 59 ALA A N    4  
ATOM 4657  C CA   . ALA A 1 59 ? 9.985   -1.124  -6.507  1.00 0.00 ? 59 ALA A CA   4  
ATOM 4658  C C    . ALA A 1 59 ? 10.329  0.071   -7.398  1.00 0.00 ? 59 ALA A C    4  
ATOM 4659  O O    . ALA A 1 59 ? 11.488  0.265   -7.763  1.00 0.00 ? 59 ALA A O    4  
ATOM 4660  C CB   . ALA A 1 59 ? 9.951   -2.441  -7.286  1.00 0.00 ? 59 ALA A CB   4  
ATOM 4661  H H    . ALA A 1 59 ? 7.912   -1.282  -6.371  1.00 0.00 ? 59 ALA A H    4  
ATOM 4662  H HA   . ALA A 1 59 ? 10.730  -1.204  -5.716  1.00 0.00 ? 59 ALA A HA   4  
ATOM 4663  H HB1  . ALA A 1 59 ? 9.539   -3.227  -6.654  1.00 0.00 ? 59 ALA A HB1  4  
ATOM 4664  H HB2  . ALA A 1 59 ? 9.328   -2.323  -8.173  1.00 0.00 ? 59 ALA A HB2  4  
ATOM 4665  H HB3  . ALA A 1 59 ? 10.963  -2.711  -7.588  1.00 0.00 ? 59 ALA A HB3  4  
ATOM 4666  N N    . GLU A 1 60 ? 9.302   0.842   -7.723  1.00 0.00 ? 60 GLU A N    4  
ATOM 4667  C CA   . GLU A 1 60 ? 9.481   2.013   -8.563  1.00 0.00 ? 60 GLU A CA   4  
ATOM 4668  C C    . GLU A 1 60 ? 9.810   3.237   -7.706  1.00 0.00 ? 60 GLU A C    4  
ATOM 4669  O O    . GLU A 1 60 ? 10.334  4.229   -8.210  1.00 0.00 ? 60 GLU A O    4  
ATOM 4670  C CB   . GLU A 1 60 ? 8.241   2.265   -9.424  1.00 0.00 ? 60 GLU A CB   4  
ATOM 4671  C CG   . GLU A 1 60 ? 8.119   1.216   -10.530 1.00 0.00 ? 60 GLU A CG   4  
ATOM 4672  C CD   . GLU A 1 60 ? 8.170   1.867   -11.913 1.00 0.00 ? 60 GLU A CD   4  
ATOM 4673  O OE1  . GLU A 1 60 ? 7.569   2.954   -12.051 1.00 0.00 ? 60 GLU A OE1  4  
ATOM 4674  O OE2  . GLU A 1 60 ? 8.810   1.263   -12.801 1.00 0.00 ? 60 GLU A OE2  4  
ATOM 4675  H H    . GLU A 1 60 ? 8.363   0.677   -7.422  1.00 0.00 ? 60 GLU A H    4  
ATOM 4676  H HA   . GLU A 1 60 ? 10.324  1.778   -9.213  1.00 0.00 ? 60 GLU A HA   4  
ATOM 4677  H HB3  . GLU A 1 60 ? 8.297   3.260   -9.867  1.00 0.00 ? 60 GLU A HB3  4  
ATOM 4678  H HG3  . GLU A 1 60 ? 7.182   0.670   -10.416 1.00 0.00 ? 60 GLU A HG3  4  
ATOM 4679  N N    . TYR A 1 61 ? 9.492   3.126   -6.425  1.00 0.00 ? 61 TYR A N    4  
ATOM 4680  C CA   . TYR A 1 61 ? 9.747   4.210   -5.493  1.00 0.00 ? 61 TYR A CA   4  
ATOM 4681  C C    . TYR A 1 61 ? 11.249  4.395   -5.266  1.00 0.00 ? 61 TYR A C    4  
ATOM 4682  O O    . TYR A 1 61 ? 12.050  3.554   -5.671  1.00 0.00 ? 61 TYR A O    4  
ATOM 4683  C CB   . TYR A 1 61 ? 9.091   3.797   -4.174  1.00 0.00 ? 61 TYR A CB   4  
ATOM 4684  C CG   . TYR A 1 61 ? 7.706   4.407   -3.950  1.00 0.00 ? 61 TYR A CG   4  
ATOM 4685  C CD1  . TYR A 1 61 ? 7.453   5.707   -4.339  1.00 0.00 ? 61 TYR A CD1  4  
ATOM 4686  C CD2  . TYR A 1 61 ? 6.709   3.658   -3.359  1.00 0.00 ? 61 TYR A CD2  4  
ATOM 4687  C CE1  . TYR A 1 61 ? 6.150   6.282   -4.129  1.00 0.00 ? 61 TYR A CE1  4  
ATOM 4688  C CE2  . TYR A 1 61 ? 5.405   4.232   -3.148  1.00 0.00 ? 61 TYR A CE2  4  
ATOM 4689  C CZ   . TYR A 1 61 ? 5.190   5.516   -3.544  1.00 0.00 ? 61 TYR A CZ   4  
ATOM 4690  O OH   . TYR A 1 61 ? 3.959   6.058   -3.345  1.00 0.00 ? 61 TYR A OH   4  
ATOM 4691  H H    . TYR A 1 61 ? 9.066   2.315   -6.023  1.00 0.00 ? 61 TYR A H    4  
ATOM 4692  H HA   . TYR A 1 61 ? 9.337   5.125   -5.920  1.00 0.00 ? 61 TYR A HA   4  
ATOM 4693  H HB3  . TYR A 1 61 ? 9.742   4.087   -3.349  1.00 0.00 ? 61 TYR A HB3  4  
ATOM 4694  H HD1  . TYR A 1 61 ? 8.241   6.298   -4.807  1.00 0.00 ? 61 TYR A HD1  4  
ATOM 4695  H HD2  . TYR A 1 61 ? 6.909   2.631   -3.050  1.00 0.00 ? 61 TYR A HD2  4  
ATOM 4696  H HE1  . TYR A 1 61 ? 5.936   7.307   -4.433  1.00 0.00 ? 61 TYR A HE1  4  
ATOM 4697  H HE2  . TYR A 1 61 ? 4.610   3.652   -2.682  1.00 0.00 ? 61 TYR A HE2  4  
ATOM 4698  H HH   . TYR A 1 61 ? 3.975   7.033   -3.567  1.00 0.00 ? 61 TYR A HH   4  
ATOM 4699  N N    . ASP A 1 62 ? 11.586  5.501   -4.618  1.00 0.00 ? 62 ASP A N    4  
ATOM 4700  C CA   . ASP A 1 62 ? 12.977  5.806   -4.331  1.00 0.00 ? 62 ASP A CA   4  
ATOM 4701  C C    . ASP A 1 62 ? 13.397  5.091   -3.046  1.00 0.00 ? 62 ASP A C    4  
ATOM 4702  O O    . ASP A 1 62 ? 12.602  4.375   -2.440  1.00 0.00 ? 62 ASP A O    4  
ATOM 4703  C CB   . ASP A 1 62 ? 13.180  7.308   -4.125  1.00 0.00 ? 62 ASP A CB   4  
ATOM 4704  C CG   . ASP A 1 62 ? 11.995  8.184   -4.537  1.00 0.00 ? 62 ASP A CG   4  
ATOM 4705  O OD1  . ASP A 1 62 ? 11.495  7.969   -5.663  1.00 0.00 ? 62 ASP A OD1  4  
ATOM 4706  O OD2  . ASP A 1 62 ? 11.616  9.048   -3.718  1.00 0.00 ? 62 ASP A OD2  4  
ATOM 4707  H H    . ASP A 1 62 ? 10.928  6.180   -4.291  1.00 0.00 ? 62 ASP A H    4  
ATOM 4708  H HA   . ASP A 1 62 ? 13.532  5.458   -5.202  1.00 0.00 ? 62 ASP A HA   4  
ATOM 4709  H HB3  . ASP A 1 62 ? 14.057  7.622   -4.689  1.00 0.00 ? 62 ASP A HB3  4  
ATOM 4710  N N    . PRO A 1 63 ? 14.681  5.316   -2.657  1.00 0.00 ? 63 PRO A N    4  
ATOM 4711  C CA   . PRO A 1 63 ? 15.218  4.702   -1.454  1.00 0.00 ? 63 PRO A CA   4  
ATOM 4712  C C    . PRO A 1 63 ? 14.679  5.393   -0.199  1.00 0.00 ? 63 PRO A C    4  
ATOM 4713  O O    . PRO A 1 63 ? 14.144  4.737   0.693   1.00 0.00 ? 63 PRO A O    4  
ATOM 4714  C CB   . PRO A 1 63 ? 16.727  4.815   -1.593  1.00 0.00 ? 63 PRO A CB   4  
ATOM 4715  C CG   . PRO A 1 63 ? 16.969  5.895   -2.636  1.00 0.00 ? 63 PRO A CG   4  
ATOM 4716  C CD   . PRO A 1 63 ? 15.652  6.158   -3.349  1.00 0.00 ? 63 PRO A CD   4  
ATOM 4717  H HA   . PRO A 1 63 ? 14.922  3.749   -1.390  1.00 0.00 ? 63 PRO A HA   4  
ATOM 4718  H HB3  . PRO A 1 63 ? 17.163  3.867   -1.905  1.00 0.00 ? 63 PRO A HB3  4  
ATOM 4719  H HG3  . PRO A 1 63 ? 17.731  5.575   -3.346  1.00 0.00 ? 63 PRO A HG3  4  
ATOM 4720  H HD3  . PRO A 1 63 ? 15.716  5.902   -4.406  1.00 0.00 ? 63 PRO A HD3  4  
ATOM 4721  N N    . LYS A 1 64 ? 14.841  6.707   -0.170  1.00 0.00 ? 64 LYS A N    4  
ATOM 4722  C CA   . LYS A 1 64 ? 14.378  7.494   0.960   1.00 0.00 ? 64 LYS A CA   4  
ATOM 4723  C C    . LYS A 1 64 ? 12.850  7.447   1.018   1.00 0.00 ? 64 LYS A C    4  
ATOM 4724  O O    . LYS A 1 64 ? 12.260  7.641   2.079   1.00 0.00 ? 64 LYS A O    4  
ATOM 4725  C CB   . LYS A 1 64 ? 14.947  8.913   0.895   1.00 0.00 ? 64 LYS A CB   4  
ATOM 4726  C CG   . LYS A 1 64 ? 16.370  8.960   1.455   1.00 0.00 ? 64 LYS A CG   4  
ATOM 4727  C CD   . LYS A 1 64 ? 17.402  8.713   0.354   1.00 0.00 ? 64 LYS A CD   4  
ATOM 4728  C CE   . LYS A 1 64 ? 18.686  9.504   0.617   1.00 0.00 ? 64 LYS A CE   4  
ATOM 4729  N NZ   . LYS A 1 64 ? 19.783  9.012   -0.246  1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4730  H H    . LYS A 1 64 ? 15.278  7.233   -0.900  1.00 0.00 ? 64 LYS A H    4  
ATOM 4731  H HA   . LYS A 1 64 ? 14.773  7.031   1.864   1.00 0.00 ? 64 LYS A HA   4  
ATOM 4732  H HB3  . LYS A 1 64 ? 14.307  9.591   1.458   1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4733  H HG3  . LYS A 1 64 ? 16.481  8.210   2.238   1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4734  H HD3  . LYS A 1 64 ? 16.985  9.001   -0.612  1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4735  H HE3  . LYS A 1 64 ? 18.969  9.409   1.665   1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4736  H HZ1  . LYS A 1 64 ? 20.325  8.338   0.255   1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4737  H HZ2  . LYS A 1 64 ? 19.398  8.588   -1.066  1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4738  H HZ3  . LYS A 1 64 ? 20.367  9.780   -0.510  1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4739  N N    . ALA A 1 65 ? 12.254  7.185   -0.136  1.00 0.00 ? 65 ALA A N    4  
ATOM 4740  C CA   . ALA A 1 65 ? 10.805  7.109   -0.230  1.00 0.00 ? 65 ALA A CA   4  
ATOM 4741  C C    . ALA A 1 65 ? 10.304  5.940   0.620   1.00 0.00 ? 65 ALA A C    4  
ATOM 4742  O O    . ALA A 1 65 ? 9.522   6.133   1.548   1.00 0.00 ? 65 ALA A O    4  
ATOM 4743  C CB   . ALA A 1 65 ? 10.395  6.980   -1.698  1.00 0.00 ? 65 ALA A CB   4  
ATOM 4744  H H    . ALA A 1 65 ? 12.742  7.028   -0.995  1.00 0.00 ? 65 ALA A H    4  
ATOM 4745  H HA   . ALA A 1 65 ? 10.398  8.038   0.168   1.00 0.00 ? 65 ALA A HA   4  
ATOM 4746  H HB1  . ALA A 1 65 ? 9.530   6.324   -1.778  1.00 0.00 ? 65 ALA A HB1  4  
ATOM 4747  H HB2  . ALA A 1 65 ? 10.142  7.965   -2.092  1.00 0.00 ? 65 ALA A HB2  4  
ATOM 4748  H HB3  . ALA A 1 65 ? 11.222  6.563   -2.272  1.00 0.00 ? 65 ALA A HB3  4  
ATOM 4749  N N    . LEU A 1 66 ? 10.776  4.752   0.270   1.00 0.00 ? 66 LEU A N    4  
ATOM 4750  C CA   . LEU A 1 66 ? 10.386  3.551   0.990   1.00 0.00 ? 66 LEU A CA   4  
ATOM 4751  C C    . LEU A 1 66 ? 10.451  3.819   2.495   1.00 0.00 ? 66 LEU A C    4  
ATOM 4752  O O    . LEU A 1 66 ? 9.464   3.631   3.205   1.00 0.00 ? 66 LEU A O    4  
ATOM 4753  C CB   . LEU A 1 66 ? 11.232  2.358   0.540   1.00 0.00 ? 66 LEU A CB   4  
ATOM 4754  C CG   . LEU A 1 66 ? 11.128  1.980   -0.939  1.00 0.00 ? 66 LEU A CG   4  
ATOM 4755  C CD1  . LEU A 1 66 ? 12.160  0.913   -1.306  1.00 0.00 ? 66 LEU A CD1  4  
ATOM 4756  C CD2  . LEU A 1 66 ? 9.704   1.548   -1.295  1.00 0.00 ? 66 LEU A CD2  4  
ATOM 4757  H H    . LEU A 1 66 ? 11.413  4.603   -0.486  1.00 0.00 ? 66 LEU A H    4  
ATOM 4758  H HA   . LEU A 1 66 ? 9.352   3.331   0.722   1.00 0.00 ? 66 LEU A HA   4  
ATOM 4759  H HB3  . LEU A 1 66 ? 10.949  1.492   1.137   1.00 0.00 ? 66 LEU A HB3  4  
ATOM 4760  H HG   . LEU A 1 66 ? 11.355  2.865   -1.534  1.00 0.00 ? 66 LEU A HG   4  
ATOM 4761  H HD11 . LEU A 1 66 ? 12.231  0.183   -0.500  1.00 0.00 ? 66 LEU A HD11 4  
ATOM 4762  H HD12 . LEU A 1 66 ? 11.853  0.411   -2.225  1.00 0.00 ? 66 LEU A HD12 4  
ATOM 4763  H HD13 . LEU A 1 66 ? 13.131  1.383   -1.456  1.00 0.00 ? 66 LEU A HD13 4  
ATOM 4764  H HD21 . LEU A 1 66 ? 9.297   2.224   -2.046  1.00 0.00 ? 66 LEU A HD21 4  
ATOM 4765  H HD22 . LEU A 1 66 ? 9.722   0.533   -1.691  1.00 0.00 ? 66 LEU A HD22 4  
ATOM 4766  H HD23 . LEU A 1 66 ? 9.081   1.579   -0.401  1.00 0.00 ? 66 LEU A HD23 4  
ATOM 4767  N N    . MET A 1 67 ? 11.622  4.254   2.936   1.00 0.00 ? 67 MET A N    4  
ATOM 4768  C CA   . MET A 1 67 ? 11.829  4.550   4.344   1.00 0.00 ? 67 MET A CA   4  
ATOM 4769  C C    . MET A 1 67 ? 10.763  5.518   4.863   1.00 0.00 ? 67 MET A C    4  
ATOM 4770  O O    . MET A 1 67 ? 10.342  5.423   6.014   1.00 0.00 ? 67 MET A O    4  
ATOM 4771  C CB   . MET A 1 67 ? 13.216  5.164   4.538   1.00 0.00 ? 67 MET A CB   4  
ATOM 4772  C CG   . MET A 1 67 ? 14.287  4.078   4.644   1.00 0.00 ? 67 MET A CG   4  
ATOM 4773  S SD   . MET A 1 67 ? 15.912  4.809   4.535   1.00 0.00 ? 67 MET A SD   4  
ATOM 4774  C CE   . MET A 1 67 ? 16.215  4.630   2.786   1.00 0.00 ? 67 MET A CE   4  
ATOM 4775  H H    . MET A 1 67 ? 12.419  4.404   2.351   1.00 0.00 ? 67 MET A H    4  
ATOM 4776  H HA   . MET A 1 67 ? 11.743  3.593   4.860   1.00 0.00 ? 67 MET A HA   4  
ATOM 4777  H HB3  . MET A 1 67 ? 13.223  5.776   5.440   1.00 0.00 ? 67 MET A HB3  4  
ATOM 4778  H HG3  . MET A 1 67 ? 14.155  3.345   3.848   1.00 0.00 ? 67 MET A HG3  4  
ATOM 4779  H HE1  . MET A 1 67 ? 17.173  4.132   2.632   1.00 0.00 ? 67 MET A HE1  4  
ATOM 4780  H HE2  . MET A 1 67 ? 15.420  4.034   2.338   1.00 0.00 ? 67 MET A HE2  4  
ATOM 4781  H HE3  . MET A 1 67 ? 16.239  5.615   2.318   1.00 0.00 ? 67 MET A HE3  4  
ATOM 4782  N N    . ALA A 1 68 ? 10.359  6.426   3.987   1.00 0.00 ? 68 ALA A N    4  
ATOM 4783  C CA   . ALA A 1 68 ? 9.351   7.411   4.343   1.00 0.00 ? 68 ALA A CA   4  
ATOM 4784  C C    . ALA A 1 68 ? 7.976   6.740   4.367   1.00 0.00 ? 68 ALA A C    4  
ATOM 4785  O O    . ALA A 1 68 ? 7.100   7.140   5.132   1.00 0.00 ? 68 ALA A O    4  
ATOM 4786  C CB   . ALA A 1 68 ? 9.412   8.581   3.359   1.00 0.00 ? 68 ALA A CB   4  
ATOM 4787  H H    . ALA A 1 68 ? 10.707  6.496   3.052   1.00 0.00 ? 68 ALA A H    4  
ATOM 4788  H HA   . ALA A 1 68 ? 9.584   7.779   5.341   1.00 0.00 ? 68 ALA A HA   4  
ATOM 4789  H HB1  . ALA A 1 68 ? 8.399   8.890   3.098   1.00 0.00 ? 68 ALA A HB1  4  
ATOM 4790  H HB2  . ALA A 1 68 ? 9.938   9.417   3.820   1.00 0.00 ? 68 ALA A HB2  4  
ATOM 4791  H HB3  . ALA A 1 68 ? 9.940   8.271   2.458   1.00 0.00 ? 68 ALA A HB3  4  
ATOM 4792  N N    . ILE A 1 69 ? 7.829   5.733   3.520   1.00 0.00 ? 69 ILE A N    4  
ATOM 4793  C CA   . ILE A 1 69 ? 6.575   5.003   3.434   1.00 0.00 ? 69 ILE A CA   4  
ATOM 4794  C C    . ILE A 1 69 ? 6.386   4.174   4.706   1.00 0.00 ? 69 ILE A C    4  
ATOM 4795  O O    . ILE A 1 69 ? 5.273   4.065   5.220   1.00 0.00 ? 69 ILE A O    4  
ATOM 4796  C CB   . ILE A 1 69 ? 6.522   4.177   2.148   1.00 0.00 ? 69 ILE A CB   4  
ATOM 4797  C CG1  . ILE A 1 69 ? 6.643   5.074   0.915   1.00 0.00 ? 69 ILE A CG1  4  
ATOM 4798  C CG2  . ILE A 1 69 ? 5.263   3.309   2.105   1.00 0.00 ? 69 ILE A CG2  4  
ATOM 4799  C CD1  . ILE A 1 69 ? 7.405   4.366   -0.207  1.00 0.00 ? 69 ILE A CD1  4  
ATOM 4800  H H    . ILE A 1 69 ? 8.547   5.414   2.900   1.00 0.00 ? 69 ILE A H    4  
ATOM 4801  H HA   . ILE A 1 69 ? 5.773   5.738   3.378   1.00 0.00 ? 69 ILE A HA   4  
ATOM 4802  H HB   . ILE A 1 69 ? 7.378   3.502   2.140   1.00 0.00 ? 69 ILE A HB   4  
ATOM 4803  H HG13 . ILE A 1 69 ? 7.156   5.998   1.182   1.00 0.00 ? 69 ILE A HG13 4  
ATOM 4804  H HG21 . ILE A 1 69 ? 4.938   3.090   3.121   1.00 0.00 ? 69 ILE A HG21 4  
ATOM 4805  H HG22 . ILE A 1 69 ? 4.472   3.842   1.578   1.00 0.00 ? 69 ILE A HG22 4  
ATOM 4806  H HG23 . ILE A 1 69 ? 5.482   2.376   1.585   1.00 0.00 ? 69 ILE A HG23 4  
ATOM 4807  H HD11 . ILE A 1 69 ? 8.401   4.798   -0.298  1.00 0.00 ? 69 ILE A HD11 4  
ATOM 4808  H HD12 . ILE A 1 69 ? 7.490   3.305   0.026   1.00 0.00 ? 69 ILE A HD12 4  
ATOM 4809  H HD13 . ILE A 1 69 ? 6.867   4.489   -1.147  1.00 0.00 ? 69 ILE A HD13 4  
ATOM 4810  N N    . LEU A 1 70 ? 7.488   3.610   5.177   1.00 0.00 ? 70 LEU A N    4  
ATOM 4811  C CA   . LEU A 1 70 ? 7.457   2.795   6.379   1.00 0.00 ? 70 LEU A CA   4  
ATOM 4812  C C    . LEU A 1 70 ? 7.209   3.691   7.593   1.00 0.00 ? 70 LEU A C    4  
ATOM 4813  O O    . LEU A 1 70 ? 6.665   3.242   8.601   1.00 0.00 ? 70 LEU A O    4  
ATOM 4814  C CB   . LEU A 1 70 ? 8.729   1.951   6.487   1.00 0.00 ? 70 LEU A CB   4  
ATOM 4815  C CG   . LEU A 1 70 ? 9.192   1.267   5.199   1.00 0.00 ? 70 LEU A CG   4  
ATOM 4816  C CD1  . LEU A 1 70 ? 10.718  1.208   5.127   1.00 0.00 ? 70 LEU A CD1  4  
ATOM 4817  C CD2  . LEU A 1 70 ? 8.558   -0.119  5.056   1.00 0.00 ? 70 LEU A CD2  4  
ATOM 4818  H H    . LEU A 1 70 ? 8.389   3.704   4.753   1.00 0.00 ? 70 LEU A H    4  
ATOM 4819  H HA   . LEU A 1 70 ? 6.620   2.104   6.283   1.00 0.00 ? 70 LEU A HA   4  
ATOM 4820  H HB3  . LEU A 1 70 ? 8.570   1.185   7.245   1.00 0.00 ? 70 LEU A HB3  4  
ATOM 4821  H HG   . LEU A 1 70 ? 8.851   1.864   4.353   1.00 0.00 ? 70 LEU A HG   4  
ATOM 4822  H HD11 . LEU A 1 70 ? 11.062  1.766   4.255   1.00 0.00 ? 70 LEU A HD11 4  
ATOM 4823  H HD12 . LEU A 1 70 ? 11.142  1.648   6.030   1.00 0.00 ? 70 LEU A HD12 4  
ATOM 4824  H HD13 . LEU A 1 70 ? 11.039  0.170   5.044   1.00 0.00 ? 70 LEU A HD13 4  
ATOM 4825  H HD21 . LEU A 1 70 ? 8.804   -0.723  5.930   1.00 0.00 ? 70 LEU A HD21 4  
ATOM 4826  H HD22 . LEU A 1 70 ? 7.475   -0.018  4.980   1.00 0.00 ? 70 LEU A HD22 4  
ATOM 4827  H HD23 . LEU A 1 70 ? 8.942   -0.603  4.159   1.00 0.00 ? 70 LEU A HD23 4  
ATOM 4828  N N    . GLU A 1 71 ? 7.621   4.943   7.458   1.00 0.00 ? 71 GLU A N    4  
ATOM 4829  C CA   . GLU A 1 71 ? 7.451   5.908   8.531   1.00 0.00 ? 71 GLU A CA   4  
ATOM 4830  C C    . GLU A 1 71 ? 6.066   6.553   8.451   1.00 0.00 ? 71 GLU A C    4  
ATOM 4831  O O    . GLU A 1 71 ? 5.417   6.771   9.473   1.00 0.00 ? 71 GLU A O    4  
ATOM 4832  C CB   . GLU A 1 71 ? 8.552   6.968   8.496   1.00 0.00 ? 71 GLU A CB   4  
ATOM 4833  C CG   . GLU A 1 71 ? 9.830   6.455   9.163   1.00 0.00 ? 71 GLU A CG   4  
ATOM 4834  C CD   . GLU A 1 71 ? 10.631  7.608   9.774   1.00 0.00 ? 71 GLU A CD   4  
ATOM 4835  O OE1  . GLU A 1 71 ? 9.978   8.556   10.261  1.00 0.00 ? 71 GLU A OE1  4  
ATOM 4836  O OE2  . GLU A 1 71 ? 11.876  7.514   9.740   1.00 0.00 ? 71 GLU A OE2  4  
ATOM 4837  H H    . GLU A 1 71 ? 8.064   5.301   6.635   1.00 0.00 ? 71 GLU A H    4  
ATOM 4838  H HA   . GLU A 1 71 ? 7.538   5.333   9.453   1.00 0.00 ? 71 GLU A HA   4  
ATOM 4839  H HB3  . GLU A 1 71 ? 8.210   7.871   9.002   1.00 0.00 ? 71 GLU A HB3  4  
ATOM 4840  H HG3  . GLU A 1 71 ? 10.442  5.931   8.429   1.00 0.00 ? 71 GLU A HG3  4  
ATOM 4841  N N    . HIS A 1 72 ? 5.652   6.840   7.225   1.00 0.00 ? 72 HIS A N    4  
ATOM 4842  C CA   . HIS A 1 72 ? 4.356   7.455   6.997   1.00 0.00 ? 72 HIS A CA   4  
ATOM 4843  C C    . HIS A 1 72 ? 3.278   6.371   6.931   1.00 0.00 ? 72 HIS A C    4  
ATOM 4844  O O    . HIS A 1 72 ? 2.086   6.676   6.941   1.00 0.00 ? 72 HIS A O    4  
ATOM 4845  C CB   . HIS A 1 72 ? 4.386   8.339   5.749   1.00 0.00 ? 72 HIS A CB   4  
ATOM 4846  C CG   . HIS A 1 72 ? 5.336   9.509   5.846   1.00 0.00 ? 72 HIS A CG   4  
ATOM 4847  N ND1  . HIS A 1 72 ? 4.983   10.795  5.477   1.00 0.00 ? 72 HIS A ND1  4  
ATOM 4848  C CD2  . HIS A 1 72 ? 6.629   9.574   6.277   1.00 0.00 ? 72 HIS A CD2  4  
ATOM 4849  C CE1  . HIS A 1 72 ? 6.024   11.589  5.679   1.00 0.00 ? 72 HIS A CE1  4  
ATOM 4850  N NE2  . HIS A 1 72 ? 7.043   10.830  6.175   1.00 0.00 ? 72 HIS A NE2  4  
ATOM 4851  H H    . HIS A 1 72 ? 6.185   6.659   6.398   1.00 0.00 ? 72 HIS A H    4  
ATOM 4852  H HA   . HIS A 1 72 ? 4.160   8.098   7.855   1.00 0.00 ? 72 HIS A HA   4  
ATOM 4853  H HB3  . HIS A 1 72 ? 3.381   8.716   5.558   1.00 0.00 ? 72 HIS A HB3  4  
ATOM 4854  H HD1  . HIS A 1 72 ? 4.093   11.077  5.118   1.00 0.00 ? 72 HIS A HD1  4  
ATOM 4855  H HD2  . HIS A 1 72 ? 7.221   8.734   6.643   1.00 0.00 ? 72 HIS A HD2  4  
ATOM 4856  H HE1  . HIS A 1 72 ? 6.060   12.661  5.484   1.00 0.00 ? 72 HIS A HE1  4  
ATOM 4857  N N    . SER A 1 73 ? 3.736   5.130   6.863   1.00 0.00 ? 73 SER A N    4  
ATOM 4858  C CA   . SER A 1 73 ? 2.825   4.000   6.795   1.00 0.00 ? 73 SER A CA   4  
ATOM 4859  C C    . SER A 1 73 ? 1.678   4.191   7.788   1.00 0.00 ? 73 SER A C    4  
ATOM 4860  O O    . SER A 1 73 ? 0.509   4.125   7.413   1.00 0.00 ? 73 SER A O    4  
ATOM 4861  C CB   . SER A 1 73 ? 3.557   2.686   7.074   1.00 0.00 ? 73 SER A CB   4  
ATOM 4862  O OG   . SER A 1 73 ? 3.355   2.237   8.412   1.00 0.00 ? 73 SER A OG   4  
ATOM 4863  H H    . SER A 1 73 ? 4.707   4.892   6.855   1.00 0.00 ? 73 SER A H    4  
ATOM 4864  H HA   . SER A 1 73 ? 2.449   3.994   5.772   1.00 0.00 ? 73 SER A HA   4  
ATOM 4865  H HB3  . SER A 1 73 ? 4.623   2.818   6.894   1.00 0.00 ? 73 SER A HB3  4  
ATOM 4866  H HG   . SER A 1 73 ? 3.959   2.734   9.035   1.00 0.00 ? 73 SER A HG   4  
ATOM 4867  N N    . HIS A 1 74 ? 2.053   4.424   9.038   1.00 0.00 ? 74 HIS A N    4  
ATOM 4868  C CA   . HIS A 1 74 ? 1.070   4.625   10.089  1.00 0.00 ? 74 HIS A CA   4  
ATOM 4869  C C    . HIS A 1 74 ? -0.057  5.522   9.572   1.00 0.00 ? 74 HIS A C    4  
ATOM 4870  O O    . HIS A 1 74 ? -1.197  5.416   10.025  1.00 0.00 ? 74 HIS A O    4  
ATOM 4871  C CB   . HIS A 1 74 ? 1.732   5.175   11.354  1.00 0.00 ? 74 HIS A CB   4  
ATOM 4872  C CG   . HIS A 1 74 ? 2.117   6.632   11.262  1.00 0.00 ? 74 HIS A CG   4  
ATOM 4873  N ND1  . HIS A 1 74 ? 1.786   7.558   12.235  1.00 0.00 ? 74 HIS A ND1  4  
ATOM 4874  C CD2  . HIS A 1 74 ? 2.811   7.312   10.304  1.00 0.00 ? 74 HIS A CD2  4  
ATOM 4875  C CE1  . HIS A 1 74 ? 2.262   8.738   11.869  1.00 0.00 ? 74 HIS A CE1  4  
ATOM 4876  N NE2  . HIS A 1 74 ? 2.896   8.584   10.671  1.00 0.00 ? 74 HIS A NE2  4  
ATOM 4877  H H    . HIS A 1 74 ? 3.006   4.477   9.336   1.00 0.00 ? 74 HIS A H    4  
ATOM 4878  H HA   . HIS A 1 74 ? 0.661   3.643   10.327  1.00 0.00 ? 74 HIS A HA   4  
ATOM 4879  H HB3  . HIS A 1 74 ? 2.623   4.586   11.571  1.00 0.00 ? 74 HIS A HB3  4  
ATOM 4880  H HD1  . HIS A 1 74 ? 1.274   7.368   13.074  1.00 0.00 ? 74 HIS A HD1  4  
ATOM 4881  H HD2  . HIS A 1 74 ? 3.224   6.882   9.391   1.00 0.00 ? 74 HIS A HD2  4  
ATOM 4882  H HE1  . HIS A 1 74 ? 2.164   9.670   12.427  1.00 0.00 ? 74 HIS A HE1  4  
ATOM 4883  N N    . ARG A 1 75 ? 0.299   6.384   8.632   1.00 0.00 ? 75 ARG A N    4  
ATOM 4884  C CA   . ARG A 1 75 ? -0.668  7.298   8.049   1.00 0.00 ? 75 ARG A CA   4  
ATOM 4885  C C    . ARG A 1 75 ? -1.260  6.701   6.772   1.00 0.00 ? 75 ARG A C    4  
ATOM 4886  O O    . ARG A 1 75 ? -2.443  6.883   6.487   1.00 0.00 ? 75 ARG A O    4  
ATOM 4887  C CB   . ARG A 1 75 ? -0.023  8.647   7.723   1.00 0.00 ? 75 ARG A CB   4  
ATOM 4888  C CG   . ARG A 1 75 ? 0.982   9.051   8.803   1.00 0.00 ? 75 ARG A CG   4  
ATOM 4889  C CD   . ARG A 1 75 ? 0.934   10.558  9.063   1.00 0.00 ? 75 ARG A CD   4  
ATOM 4890  N NE   . ARG A 1 75 ? -0.413  10.946  9.540   1.00 0.00 ? 75 ARG A NE   4  
ATOM 4891  C CZ   . ARG A 1 75 ? -0.697  12.126  10.108  1.00 0.00 ? 75 ARG A CZ   4  
ATOM 4892  N NH1  . ARG A 1 75 ? 0.269   13.040  10.272  1.00 0.00 ? 75 ARG A NH1  4  
ATOM 4893  N NH2  . ARG A 1 75 ? -1.947  12.391  10.513  1.00 0.00 ? 75 ARG A NH2  4  
ATOM 4894  H H    . ARG A 1 75 ? 1.228   6.465   8.270   1.00 0.00 ? 75 ARG A H    4  
ATOM 4895  H HA   . ARG A 1 75 ? -1.433  7.421   8.816   1.00 0.00 ? 75 ARG A HA   4  
ATOM 4896  H HB3  . ARG A 1 75 ? -0.796  9.412   7.636   1.00 0.00 ? 75 ARG A HB3  4  
ATOM 4897  H HG3  . ARG A 1 75 ? 1.988   8.763   8.495   1.00 0.00 ? 75 ARG A HG3  4  
ATOM 4898  H HD3  . ARG A 1 75 ? 1.173   11.101  8.147   1.00 0.00 ? 75 ARG A HD3  4  
ATOM 4899  H HE   . ARG A 1 75 ? -1.156  10.286  9.433   1.00 0.00 ? 75 ARG A HE   4  
ATOM 4900  H HH11 . ARG A 1 75 ? 1.202   12.842  9.971   1.00 0.00 ? 75 ARG A HH11 4  
ATOM 4901  H HH12 . ARG A 1 75 ? 0.057   13.921  10.696  1.00 0.00 ? 75 ARG A HH12 4  
ATOM 4902  H HH21 . ARG A 1 75 ? -2.667  11.709  10.390  1.00 0.00 ? 75 ARG A HH21 4  
ATOM 4903  H HH22 . ARG A 1 75 ? -2.158  13.272  10.936  1.00 0.00 ? 75 ARG A HH22 4  
ATOM 4904  N N    . ILE A 1 76 ? -0.411  6.000   6.035   1.00 0.00 ? 76 ILE A N    4  
ATOM 4905  C CA   . ILE A 1 76 ? -0.835  5.374   4.795   1.00 0.00 ? 76 ILE A CA   4  
ATOM 4906  C C    . ILE A 1 76 ? -2.157  4.638   5.025   1.00 0.00 ? 76 ILE A C    4  
ATOM 4907  O O    . ILE A 1 76 ? -2.252  3.792   5.913   1.00 0.00 ? 76 ILE A O    4  
ATOM 4908  C CB   . ILE A 1 76 ? 0.276   4.484   4.236   1.00 0.00 ? 76 ILE A CB   4  
ATOM 4909  C CG1  . ILE A 1 76 ? 1.549   5.291   3.979   1.00 0.00 ? 76 ILE A CG1  4  
ATOM 4910  C CG2  . ILE A 1 76 ? -0.195  3.740   2.984   1.00 0.00 ? 76 ILE A CG2  4  
ATOM 4911  C CD1  . ILE A 1 76 ? 2.637   4.417   3.351   1.00 0.00 ? 76 ILE A CD1  4  
ATOM 4912  H H    . ILE A 1 76 ? 0.550   5.857   6.274   1.00 0.00 ? 76 ILE A H    4  
ATOM 4913  H HA   . ILE A 1 76 ? -1.006  6.170   4.070   1.00 0.00 ? 76 ILE A HA   4  
ATOM 4914  H HB   . ILE A 1 76 ? 0.519   3.730   4.985   1.00 0.00 ? 76 ILE A HB   4  
ATOM 4915  H HG13 . ILE A 1 76 ? 1.913   5.712   4.916   1.00 0.00 ? 76 ILE A HG13 4  
ATOM 4916  H HG21 . ILE A 1 76 ? 0.523   3.897   2.178   1.00 0.00 ? 76 ILE A HG21 4  
ATOM 4917  H HG22 . ILE A 1 76 ? -0.270  2.675   3.201   1.00 0.00 ? 76 ILE A HG22 4  
ATOM 4918  H HG23 . ILE A 1 76 ? -1.170  4.120   2.681   1.00 0.00 ? 76 ILE A HG23 4  
ATOM 4919  H HD11 . ILE A 1 76 ? 2.764   4.691   2.304   1.00 0.00 ? 76 ILE A HD11 4  
ATOM 4920  H HD12 . ILE A 1 76 ? 3.576   4.566   3.883   1.00 0.00 ? 76 ILE A HD12 4  
ATOM 4921  H HD13 . ILE A 1 76 ? 2.343   3.369   3.418   1.00 0.00 ? 76 ILE A HD13 4  
ATOM 4922  N N    . ARG A 1 77 ? -3.141  4.987   4.211   1.00 0.00 ? 77 ARG A N    4  
ATOM 4923  C CA   . ARG A 1 77 ? -4.453  4.369   4.316   1.00 0.00 ? 77 ARG A CA   4  
ATOM 4924  C C    . ARG A 1 77 ? -5.079  4.214   2.929   1.00 0.00 ? 77 ARG A C    4  
ATOM 4925  O O    . ARG A 1 77 ? -5.101  5.161   2.144   1.00 0.00 ? 77 ARG A O    4  
ATOM 4926  C CB   . ARG A 1 77 ? -5.385  5.202   5.199   1.00 0.00 ? 77 ARG A CB   4  
ATOM 4927  C CG   . ARG A 1 77 ? -5.152  4.900   6.680   1.00 0.00 ? 77 ARG A CG   4  
ATOM 4928  C CD   . ARG A 1 77 ? -5.918  3.646   7.111   1.00 0.00 ? 77 ARG A CD   4  
ATOM 4929  N NE   . ARG A 1 77 ? -6.458  3.828   8.477   1.00 0.00 ? 77 ARG A NE   4  
ATOM 4930  C CZ   . ARG A 1 77 ? -7.279  2.959   9.082   1.00 0.00 ? 77 ARG A CZ   4  
ATOM 4931  N NH1  . ARG A 1 77 ? -7.661  1.843   8.445   1.00 0.00 ? 77 ARG A NH1  4  
ATOM 4932  N NH2  . ARG A 1 77 ? -7.720  3.206   10.323  1.00 0.00 ? 77 ARG A NH2  4  
ATOM 4933  H H    . ARG A 1 77 ? -3.056  5.676   3.493   1.00 0.00 ? 77 ARG A H    4  
ATOM 4934  H HA   . ARG A 1 77 ? -4.268  3.397   4.774   1.00 0.00 ? 77 ARG A HA   4  
ATOM 4935  H HB3  . ARG A 1 77 ? -6.423  4.991   4.939   1.00 0.00 ? 77 ARG A HB3  4  
ATOM 4936  H HG3  . ARG A 1 77 ? -5.471  5.750   7.283   1.00 0.00 ? 77 ARG A HG3  4  
ATOM 4937  H HD3  . ARG A 1 77 ? -5.258  2.780   7.084   1.00 0.00 ? 77 ARG A HD3  4  
ATOM 4938  H HE   . ARG A 1 77 ? -6.194  4.650   8.980   1.00 0.00 ? 77 ARG A HE   4  
ATOM 4939  H HH11 . ARG A 1 77 ? -7.332  1.660   7.519   1.00 0.00 ? 77 ARG A HH11 4  
ATOM 4940  H HH12 . ARG A 1 77 ? -8.274  1.195   8.897   1.00 0.00 ? 77 ARG A HH12 4  
ATOM 4941  H HH21 . ARG A 1 77 ? -7.436  4.039   10.798  1.00 0.00 ? 77 ARG A HH21 4  
ATOM 4942  H HH22 . ARG A 1 77 ? -8.333  2.558   10.774  1.00 0.00 ? 77 ARG A HH22 4  
ATOM 4943  N N    . PHE A 1 78 ? -5.573  3.013   2.669   1.00 0.00 ? 78 PHE A N    4  
ATOM 4944  C CA   . PHE A 1 78 ? -6.198  2.722   1.390   1.00 0.00 ? 78 PHE A CA   4  
ATOM 4945  C C    . PHE A 1 78 ? -7.674  3.127   1.395   1.00 0.00 ? 78 PHE A C    4  
ATOM 4946  O O    . PHE A 1 78 ? -8.313  3.141   2.445   1.00 0.00 ? 78 PHE A O    4  
ATOM 4947  C CB   . PHE A 1 78 ? -6.098  1.210   1.176   1.00 0.00 ? 78 PHE A CB   4  
ATOM 4948  C CG   . PHE A 1 78 ? -4.725  0.740   0.688   1.00 0.00 ? 78 PHE A CG   4  
ATOM 4949  C CD1  . PHE A 1 78 ? -3.603  1.099   1.367   1.00 0.00 ? 78 PHE A CD1  4  
ATOM 4950  C CD2  . PHE A 1 78 ? -4.629  -0.037  -0.423  1.00 0.00 ? 78 PHE A CD2  4  
ATOM 4951  C CE1  . PHE A 1 78 ? -2.330  0.664   0.914   1.00 0.00 ? 78 PHE A CE1  4  
ATOM 4952  C CE2  . PHE A 1 78 ? -3.356  -0.473  -0.875  1.00 0.00 ? 78 PHE A CE2  4  
ATOM 4953  C CZ   . PHE A 1 78 ? -2.233  -0.114  -0.197  1.00 0.00 ? 78 PHE A CZ   4  
ATOM 4954  H H    . PHE A 1 78 ? -5.552  2.247   3.313   1.00 0.00 ? 78 PHE A H    4  
ATOM 4955  H HA   . PHE A 1 78 ? -5.667  3.298   0.632   1.00 0.00 ? 78 PHE A HA   4  
ATOM 4956  H HB3  . PHE A 1 78 ? -6.853  0.905   0.453   1.00 0.00 ? 78 PHE A HB3  4  
ATOM 4957  H HD1  . PHE A 1 78 ? -3.681  1.722   2.258   1.00 0.00 ? 78 PHE A HD1  4  
ATOM 4958  H HD2  . PHE A 1 78 ? -5.528  -0.325  -0.967  1.00 0.00 ? 78 PHE A HD2  4  
ATOM 4959  H HE1  . PHE A 1 78 ? -1.430  0.951   1.458   1.00 0.00 ? 78 PHE A HE1  4  
ATOM 4960  H HE2  . PHE A 1 78 ? -3.278  -1.096  -1.767  1.00 0.00 ? 78 PHE A HE2  4  
ATOM 4961  H HZ   . PHE A 1 78 ? -1.256  -0.449  -0.545  1.00 0.00 ? 78 PHE A HZ   4  
ATOM 4962  N N    . LYS A 1 79 ? -8.170  3.447   0.209   1.00 0.00 ? 79 LYS A N    4  
ATOM 4963  C CA   . LYS A 1 79 ? -9.559  3.852   0.064   1.00 0.00 ? 79 LYS A CA   4  
ATOM 4964  C C    . LYS A 1 79 ? -10.162 3.161   -1.160  1.00 0.00 ? 79 LYS A C    4  
ATOM 4965  O O    . LYS A 1 79 ? -9.728  3.397   -2.287  1.00 0.00 ? 79 LYS A O    4  
ATOM 4966  C CB   . LYS A 1 79 ? -9.671  5.377   0.027   1.00 0.00 ? 79 LYS A CB   4  
ATOM 4967  C CG   . LYS A 1 79 ? -9.931  5.942   1.426   1.00 0.00 ? 79 LYS A CG   4  
ATOM 4968  C CD   . LYS A 1 79 ? -11.432 6.038   1.707   1.00 0.00 ? 79 LYS A CD   4  
ATOM 4969  C CE   . LYS A 1 79 ? -11.999 7.371   1.214   1.00 0.00 ? 79 LYS A CE   4  
ATOM 4970  N NZ   . LYS A 1 79 ? -13.478 7.352   1.253   1.00 0.00 ? 79 LYS A NZ   4  
ATOM 4971  H H    . LYS A 1 79 ? -7.643  3.433   -0.641  1.00 0.00 ? 79 LYS A H    4  
ATOM 4972  H HA   . LYS A 1 79 ? -10.093 3.511   0.951   1.00 0.00 ? 79 LYS A HA   4  
ATOM 4973  H HB3  . LYS A 1 79 ? -10.478 5.670   -0.644  1.00 0.00 ? 79 LYS A HB3  4  
ATOM 4974  H HG3  . LYS A 1 79 ? -9.477  6.929   1.513   1.00 0.00 ? 79 LYS A HG3  4  
ATOM 4975  H HD3  . LYS A 1 79 ? -11.611 5.936   2.777   1.00 0.00 ? 79 LYS A HD3  4  
ATOM 4976  H HE3  . LYS A 1 79 ? -11.659 7.562   0.195   1.00 0.00 ? 79 LYS A HE3  4  
ATOM 4977  H HZ1  . LYS A 1 79 ? -13.815 6.550   0.760   1.00 0.00 ? 79 LYS A HZ1  4  
ATOM 4978  H HZ2  . LYS A 1 79 ? -13.784 7.312   2.204   1.00 0.00 ? 79 LYS A HZ2  4  
ATOM 4979  H HZ3  . LYS A 1 79 ? -13.834 8.181   0.824   1.00 0.00 ? 79 LYS A HZ3  4  
ATOM 4980  N N    . LEU A 1 80 ? -11.151 2.320   -0.899  1.00 0.00 ? 80 LEU A N    4  
ATOM 4981  C CA   . LEU A 1 80 ? -11.818 1.594   -1.965  1.00 0.00 ? 80 LEU A CA   4  
ATOM 4982  C C    . LEU A 1 80 ? -12.985 2.429   -2.494  1.00 0.00 ? 80 LEU A C    4  
ATOM 4983  O O    . LEU A 1 80 ? -13.488 3.310   -1.799  1.00 0.00 ? 80 LEU A O    4  
ATOM 4984  C CB   . LEU A 1 80 ? -12.227 0.199   -1.489  1.00 0.00 ? 80 LEU A CB   4  
ATOM 4985  C CG   . LEU A 1 80 ? -11.123 -0.861  -1.489  1.00 0.00 ? 80 LEU A CG   4  
ATOM 4986  C CD1  . LEU A 1 80 ? -11.658 -2.212  -1.011  1.00 0.00 ? 80 LEU A CD1  4  
ATOM 4987  C CD2  . LEU A 1 80 ? -10.460 -0.961  -2.865  1.00 0.00 ? 80 LEU A CD2  4  
ATOM 4988  H H    . LEU A 1 80 ? -11.497 2.134   0.021   1.00 0.00 ? 80 LEU A H    4  
ATOM 4989  H HA   . LEU A 1 80 ? -11.096 1.460   -2.770  1.00 0.00 ? 80 LEU A HA   4  
ATOM 4990  H HB3  . LEU A 1 80 ? -13.042 -0.156  -2.120  1.00 0.00 ? 80 LEU A HB3  4  
ATOM 4991  H HG   . LEU A 1 80 ? -10.353 -0.552  -0.783  1.00 0.00 ? 80 LEU A HG   4  
ATOM 4992  H HD11 . LEU A 1 80 ? -12.477 -2.527  -1.657  1.00 0.00 ? 80 LEU A HD11 4  
ATOM 4993  H HD12 . LEU A 1 80 ? -10.860 -2.953  -1.048  1.00 0.00 ? 80 LEU A HD12 4  
ATOM 4994  H HD13 . LEU A 1 80 ? -12.019 -2.118  0.013   1.00 0.00 ? 80 LEU A HD13 4  
ATOM 4995  H HD21 . LEU A 1 80 ? -9.441  -0.580  -2.805  1.00 0.00 ? 80 LEU A HD21 4  
ATOM 4996  H HD22 . LEU A 1 80 ? -10.440 -2.004  -3.183  1.00 0.00 ? 80 LEU A HD22 4  
ATOM 4997  H HD23 . LEU A 1 80 ? -11.027 -0.373  -3.585  1.00 0.00 ? 80 LEU A HD23 4  
ATOM 4998  N N    . LYS A 1 81 ? -13.383 2.123   -3.720  1.00 0.00 ? 81 LYS A N    4  
ATOM 4999  C CA   . LYS A 1 81 ? -14.482 2.835   -4.350  1.00 0.00 ? 81 LYS A CA   4  
ATOM 5000  C C    . LYS A 1 81 ? -15.723 2.740   -3.460  1.00 0.00 ? 81 LYS A C    4  
ATOM 5001  O O    . LYS A 1 81 ? -16.585 3.616   -3.496  1.00 0.00 ? 81 LYS A O    4  
ATOM 5002  C CB   . LYS A 1 81 ? -14.705 2.323   -5.775  1.00 0.00 ? 81 LYS A CB   4  
ATOM 5003  C CG   . LYS A 1 81 ? -15.456 0.989   -5.766  1.00 0.00 ? 81 LYS A CG   4  
ATOM 5004  C CD   . LYS A 1 81 ? -14.695 -0.073  -6.563  1.00 0.00 ? 81 LYS A CD   4  
ATOM 5005  C CE   . LYS A 1 81 ? -15.055 -1.481  -6.083  1.00 0.00 ? 81 LYS A CE   4  
ATOM 5006  N NZ   . LYS A 1 81 ? -13.833 -2.296  -5.907  1.00 0.00 ? 81 LYS A NZ   4  
ATOM 5007  H H    . LYS A 1 81 ? -12.969 1.405   -4.280  1.00 0.00 ? 81 LYS A H    4  
ATOM 5008  H HA   . LYS A 1 81 ? -14.191 3.883   -4.427  1.00 0.00 ? 81 LYS A HA   4  
ATOM 5009  H HB3  . LYS A 1 81 ? -13.745 2.201   -6.277  1.00 0.00 ? 81 LYS A HB3  4  
ATOM 5010  H HG3  . LYS A 1 81 ? -16.450 1.125   -6.191  1.00 0.00 ? 81 LYS A HG3  4  
ATOM 5011  H HD3  . LYS A 1 81 ? -13.622 0.088   -6.458  1.00 0.00 ? 81 LYS A HD3  4  
ATOM 5012  H HE3  . LYS A 1 81 ? -15.717 -1.958  -6.804  1.00 0.00 ? 81 LYS A HE3  4  
ATOM 5013  H HZ1  . LYS A 1 81 ? -13.121 -1.969  -6.529  1.00 0.00 ? 81 LYS A HZ1  4  
ATOM 5014  H HZ2  . LYS A 1 81 ? -13.512 -2.216  -4.962  1.00 0.00 ? 81 LYS A HZ2  4  
ATOM 5015  H HZ3  . LYS A 1 81 ? -14.039 -3.253  -6.109  1.00 0.00 ? 81 LYS A HZ3  4  
ATOM 5016  N N    . ARG A 1 82 ? -15.773 1.668   -2.683  1.00 0.00 ? 82 ARG A N    4  
ATOM 5017  C CA   . ARG A 1 82 ? -16.894 1.447   -1.785  1.00 0.00 ? 82 ARG A CA   4  
ATOM 5018  C C    . ARG A 1 82 ? -16.526 1.870   -0.363  1.00 0.00 ? 82 ARG A C    4  
ATOM 5019  O O    . ARG A 1 82 ? -15.471 1.497   0.148   1.00 0.00 ? 82 ARG A O    4  
ATOM 5020  C CB   . ARG A 1 82 ? -17.312 -0.025  -1.780  1.00 0.00 ? 82 ARG A CB   4  
ATOM 5021  C CG   . ARG A 1 82 ? -18.476 -0.261  -0.814  1.00 0.00 ? 82 ARG A CG   4  
ATOM 5022  C CD   . ARG A 1 82 ? -18.484 -1.704  -0.306  1.00 0.00 ? 82 ARG A CD   4  
ATOM 5023  N NE   . ARG A 1 82 ? -19.874 -2.207  -0.235  1.00 0.00 ? 82 ARG A NE   4  
ATOM 5024  C CZ   . ARG A 1 82 ? -20.241 -3.307  0.437   1.00 0.00 ? 82 ARG A CZ   4  
ATOM 5025  N NH1  . ARG A 1 82 ? -19.323 -4.026  1.097   1.00 0.00 ? 82 ARG A NH1  4  
ATOM 5026  N NH2  . ARG A 1 82 ? -21.526 -3.688  0.448   1.00 0.00 ? 82 ARG A NH2  4  
ATOM 5027  H H    . ARG A 1 82 ? -15.067 0.960   -2.660  1.00 0.00 ? 82 ARG A H    4  
ATOM 5028  H HA   . ARG A 1 82 ? -17.697 2.067   -2.184  1.00 0.00 ? 82 ARG A HA   4  
ATOM 5029  H HB3  . ARG A 1 82 ? -16.465 -0.647  -1.492  1.00 0.00 ? 82 ARG A HB3  4  
ATOM 5030  H HG3  . ARG A 1 82 ? -19.419 -0.042  -1.315  1.00 0.00 ? 82 ARG A HG3  4  
ATOM 5031  H HD3  . ARG A 1 82 ? -18.018 -1.755  0.677   1.00 0.00 ? 82 ARG A HD3  4  
ATOM 5032  H HE   . ARG A 1 82 ? -20.585 -1.693  -0.716  1.00 0.00 ? 82 ARG A HE   4  
ATOM 5033  H HH11 . ARG A 1 82 ? -18.364 -3.742  1.090   1.00 0.00 ? 82 ARG A HH11 4  
ATOM 5034  H HH12 . ARG A 1 82 ? -19.597 -4.847  1.598   1.00 0.00 ? 82 ARG A HH12 4  
ATOM 5035  H HH21 . ARG A 1 82 ? -22.210 -3.151  -0.044  1.00 0.00 ? 82 ARG A HH21 4  
ATOM 5036  H HH22 . ARG A 1 82 ? -21.799 -4.509  0.949   1.00 0.00 ? 82 ARG A HH22 4  
ATOM 5037  N N    . PRO A 1 83 ? -17.440 2.666   0.255   1.00 0.00 ? 83 PRO A N    4  
ATOM 5038  C CA   . PRO A 1 83 ? -17.223 3.146   1.609   1.00 0.00 ? 83 PRO A CA   4  
ATOM 5039  C C    . PRO A 1 83 ? -17.454 2.030   2.629   1.00 0.00 ? 83 PRO A C    4  
ATOM 5040  O O    . PRO A 1 83 ? -18.578 1.555   2.792   1.00 0.00 ? 83 PRO A O    4  
ATOM 5041  C CB   . PRO A 1 83 ? -18.186 4.310   1.774   1.00 0.00 ? 83 PRO A CB   4  
ATOM 5042  C CG   . PRO A 1 83 ? -19.228 4.147   0.679   1.00 0.00 ? 83 PRO A CG   4  
ATOM 5043  C CD   . PRO A 1 83 ? -18.701 3.129   -0.319  1.00 0.00 ? 83 PRO A CD   4  
ATOM 5044  H HA   . PRO A 1 83 ? -16.272 3.431   1.728   1.00 0.00 ? 83 PRO A HA   4  
ATOM 5045  H HB3  . PRO A 1 83 ? -17.665 5.263   1.679   1.00 0.00 ? 83 PRO A HB3  4  
ATOM 5046  H HG3  . PRO A 1 83 ? -19.418 5.101   0.188   1.00 0.00 ? 83 PRO A HG3  4  
ATOM 5047  H HD3  . PRO A 1 83 ? -18.549 3.579   -1.300  1.00 0.00 ? 83 PRO A HD3  4  
ATOM 5048  N N    . SER A 1 84 ? -16.373 1.642   3.291   1.00 0.00 ? 84 SER A N    4  
ATOM 5049  C CA   . SER A 1 84 ? -16.444 0.591   4.291   1.00 0.00 ? 84 SER A CA   4  
ATOM 5050  C C    . SER A 1 84 ? -16.267 1.185   5.689   1.00 0.00 ? 84 SER A C    4  
ATOM 5051  O O    . SER A 1 84 ? -16.086 2.393   5.835   1.00 0.00 ? 84 SER A O    4  
ATOM 5052  C CB   . SER A 1 84 ? -15.389 -0.487  4.033   1.00 0.00 ? 84 SER A CB   4  
ATOM 5053  O OG   . SER A 1 84 ? -15.913 -1.581  3.288   1.00 0.00 ? 84 SER A OG   4  
ATOM 5054  H H    . SER A 1 84 ? -15.463 2.033   3.152   1.00 0.00 ? 84 SER A H    4  
ATOM 5055  H HA   . SER A 1 84 ? -17.439 0.156   4.183   1.00 0.00 ? 84 SER A HA   4  
ATOM 5056  H HB3  . SER A 1 84 ? -15.001 -0.849  4.985   1.00 0.00 ? 84 SER A HB3  4  
ATOM 5057  H HG   . SER A 1 84 ? -15.204 -1.960  2.692   1.00 0.00 ? 84 SER A HG   4  
ATOM 5058  N N    . SER A 1 85 ? -16.323 0.309   6.681   1.00 0.00 ? 85 SER A N    4  
ATOM 5059  C CA   . SER A 1 85 ? -16.171 0.733   8.063   1.00 0.00 ? 85 SER A CA   4  
ATOM 5060  C C    . SER A 1 85 ? -15.255 -0.239  8.810   1.00 0.00 ? 85 SER A C    4  
ATOM 5061  O O    . SER A 1 85 ? -15.106 -1.391  8.406   1.00 0.00 ? 85 SER A O    4  
ATOM 5062  C CB   . SER A 1 85 ? -17.529 0.828   8.763   1.00 0.00 ? 85 SER A CB   4  
ATOM 5063  O OG   . SER A 1 85 ? -18.074 2.142   8.694   1.00 0.00 ? 85 SER A OG   4  
ATOM 5064  H H    . SER A 1 85 ? -16.471 -0.671  6.554   1.00 0.00 ? 85 SER A H    4  
ATOM 5065  H HA   . SER A 1 85 ? -15.719 1.723   8.012   1.00 0.00 ? 85 SER A HA   4  
ATOM 5066  H HB3  . SER A 1 85 ? -17.419 0.535   9.807   1.00 0.00 ? 85 SER A HB3  4  
ATOM 5067  H HG   . SER A 1 85 ? -19.060 2.095   8.537   1.00 0.00 ? 85 SER A HG   4  
ATOM 5068  N N    . GLY A 1 86 ? -14.666 0.262   9.886   1.00 0.00 ? 86 GLY A N    4  
ATOM 5069  C CA   . GLY A 1 86 ? -13.770 -0.548  10.693  1.00 0.00 ? 86 GLY A CA   4  
ATOM 5070  C C    . GLY A 1 86 ? -12.947 0.326   11.643  1.00 0.00 ? 86 GLY A C    4  
ATOM 5071  O O    . GLY A 1 86 ? -12.400 1.350   11.234  1.00 0.00 ? 86 GLY A O    4  
ATOM 5072  H H    . GLY A 1 86 ? -14.794 1.200   10.207  1.00 0.00 ? 86 GLY A H    4  
ATOM 5073  H HA2  . GLY A 1 86 ? -14.346 -1.273  11.268  1.00 0.00 ? 86 GLY A HA2  4  
ATOM 5074  H HA3  . GLY A 1 86 ? -13.102 -1.113  10.044  1.00 0.00 ? 86 GLY A HA3  4  
ATOM 5075  N N    . PRO A 1 87 ? -12.884 -0.121  12.925  1.00 0.00 ? 87 PRO A N    4  
ATOM 5076  C CA   . PRO A 1 87 ? -12.138 0.608   13.936  1.00 0.00 ? 87 PRO A CA   4  
ATOM 5077  C C    . PRO A 1 87 ? -10.632 0.409   13.756  1.00 0.00 ? 87 PRO A C    4  
ATOM 5078  O O    . PRO A 1 87 ? -10.203 -0.463  13.004  1.00 0.00 ? 87 PRO A O    4  
ATOM 5079  C CB   . PRO A 1 87 ? -12.653 0.078   15.264  1.00 0.00 ? 87 PRO A CB   4  
ATOM 5080  C CG   . PRO A 1 87 ? -13.326 -1.248  14.951  1.00 0.00 ? 87 PRO A CG   4  
ATOM 5081  C CD   . PRO A 1 87 ? -13.519 -1.328  13.446  1.00 0.00 ? 87 PRO A CD   4  
ATOM 5082  H HA   . PRO A 1 87 ? -12.297 1.592   13.843  1.00 0.00 ? 87 PRO A HA   4  
ATOM 5083  H HB3  . PRO A 1 87 ? -13.357 0.776   15.717  1.00 0.00 ? 87 PRO A HB3  4  
ATOM 5084  H HG3  . PRO A 1 87 ? -14.284 -1.320  15.464  1.00 0.00 ? 87 PRO A HG3  4  
ATOM 5085  H HD3  . PRO A 1 87 ? -14.576 -1.363  13.184  1.00 0.00 ? 87 PRO A HD3  4  
ATOM 5086  N N    . SER A 1 88 ? -9.870  1.234   14.460  1.00 0.00 ? 88 SER A N    4  
ATOM 5087  C CA   . SER A 1 88 ? -8.421  1.159   14.387  1.00 0.00 ? 88 SER A CA   4  
ATOM 5088  C C    . SER A 1 88 ? -7.795  2.200   15.319  1.00 0.00 ? 88 SER A C    4  
ATOM 5089  O O    . SER A 1 88 ? -8.453  3.166   15.706  1.00 0.00 ? 88 SER A O    4  
ATOM 5090  C CB   . SER A 1 88 ? -7.929  1.367   12.953  1.00 0.00 ? 88 SER A CB   4  
ATOM 5091  O OG   . SER A 1 88 ? -6.841  0.506   12.632  1.00 0.00 ? 88 SER A OG   4  
ATOM 5092  H H    . SER A 1 88 ? -10.226 1.941   15.070  1.00 0.00 ? 88 SER A H    4  
ATOM 5093  H HA   . SER A 1 88 ? -8.166  0.152   14.715  1.00 0.00 ? 88 SER A HA   4  
ATOM 5094  H HB3  . SER A 1 88 ? -7.622  2.405   12.822  1.00 0.00 ? 88 SER A HB3  4  
ATOM 5095  H HG   . SER A 1 88 ? -7.065  -0.436  12.881  1.00 0.00 ? 88 SER A HG   4  
ATOM 5096  N N    . SER A 1 89 ? -6.534  1.969   15.652  1.00 0.00 ? 89 SER A N    4  
ATOM 5097  C CA   . SER A 1 89 ? -5.813  2.875   16.530  1.00 0.00 ? 89 SER A CA   4  
ATOM 5098  C C    . SER A 1 89 ? -4.588  3.437   15.810  1.00 0.00 ? 89 SER A C    4  
ATOM 5099  O O    . SER A 1 89 ? -3.705  2.685   15.397  1.00 0.00 ? 89 SER A O    4  
ATOM 5100  C CB   . SER A 1 89 ? -5.393  2.171   17.822  1.00 0.00 ? 89 SER A CB   4  
ATOM 5101  O OG   . SER A 1 89 ? -6.500  1.937   18.688  1.00 0.00 ? 89 SER A OG   4  
ATOM 5102  H H    . SER A 1 89 ? -6.007  1.181   15.333  1.00 0.00 ? 89 SER A H    4  
ATOM 5103  H HA   . SER A 1 89 ? -6.519  3.671   16.764  1.00 0.00 ? 89 SER A HA   4  
ATOM 5104  H HB3  . SER A 1 89 ? -4.649  2.777   18.339  1.00 0.00 ? 89 SER A HB3  4  
ATOM 5105  H HG   . SER A 1 89 ? -6.573  2.677   19.357  1.00 0.00 ? 89 SER A HG   4  
ATOM 5106  N N    . GLY A 1 90 ? -4.571  4.755   15.678  1.00 0.00 ? 90 GLY A N    4  
ATOM 5107  C CA   . GLY A 1 90 ? -3.468  5.428   15.014  1.00 0.00 ? 90 GLY A CA   4  
ATOM 5108  C C    . GLY A 1 90 ? -2.384  5.826   16.017  1.00 0.00 ? 90 GLY A C    4  
ATOM 5109  O O    . GLY A 1 90 ? -2.518  6.830   16.716  1.00 0.00 ? 90 GLY A O    4  
ATOM 5110  H H    . GLY A 1 90 ? -5.293  5.360   16.016  1.00 0.00 ? 90 GLY A H    4  
ATOM 5111  H HA2  . GLY A 1 90 ? -3.042  4.773   14.255  1.00 0.00 ? 90 GLY A HA2  4  
ATOM 5112  H HA3  . GLY A 1 90 ? -3.836  6.316   14.499  1.00 0.00 ? 90 GLY A HA3  4  
ATOM 5113  N N    . GLY A 1 1  ? -0.378  -15.397 5.870   1.00 0.00 ? 1  GLY A N    5  
ATOM 5114  C CA   . GLY A 1 1  ? 0.342   -14.387 6.626   1.00 0.00 ? 1  GLY A CA   5  
ATOM 5115  C C    . GLY A 1 1  ? 1.596   -14.978 7.276   1.00 0.00 ? 1  GLY A C    5  
ATOM 5116  O O    . GLY A 1 1  ? 2.179   -15.928 6.757   1.00 0.00 ? 1  GLY A O    5  
ATOM 5117  H H1   . GLY A 1 1  ? 0.014   -16.316 5.914   1.00 0.00 ? 1  GLY A H1   5  
ATOM 5118  H HA2  . GLY A 1 1  ? 0.623   -13.565 5.967   1.00 0.00 ? 1  GLY A HA2  5  
ATOM 5119  H HA3  . GLY A 1 1  ? -0.308  -13.970 7.395   1.00 0.00 ? 1  GLY A HA3  5  
ATOM 5120  N N    . SER A 1 2  ? 1.972   -14.389 8.402   1.00 0.00 ? 2  SER A N    5  
ATOM 5121  C CA   . SER A 1 2  ? 3.145   -14.845 9.129   1.00 0.00 ? 2  SER A CA   5  
ATOM 5122  C C    . SER A 1 2  ? 4.306   -15.072 8.158   1.00 0.00 ? 2  SER A C    5  
ATOM 5123  O O    . SER A 1 2  ? 4.436   -16.149 7.579   1.00 0.00 ? 2  SER A O    5  
ATOM 5124  C CB   . SER A 1 2  ? 2.846   -16.129 9.907   1.00 0.00 ? 2  SER A CB   5  
ATOM 5125  O OG   . SER A 1 2  ? 2.369   -17.170 9.058   1.00 0.00 ? 2  SER A OG   5  
ATOM 5126  H H    . SER A 1 2  ? 1.492   -13.617 8.818   1.00 0.00 ? 2  SER A H    5  
ATOM 5127  H HA   . SER A 1 2  ? 3.381   -14.044 9.828   1.00 0.00 ? 2  SER A HA   5  
ATOM 5128  H HB3  . SER A 1 2  ? 2.105   -15.921 10.678  1.00 0.00 ? 2  SER A HB3  5  
ATOM 5129  H HG   . SER A 1 2  ? 2.657   -17.001 8.115   1.00 0.00 ? 2  SER A HG   5  
ATOM 5130  N N    . SER A 1 3  ? 5.121   -14.038 8.011   1.00 0.00 ? 3  SER A N    5  
ATOM 5131  C CA   . SER A 1 3  ? 6.267   -14.109 7.120   1.00 0.00 ? 3  SER A CA   5  
ATOM 5132  C C    . SER A 1 3  ? 7.429   -13.297 7.697   1.00 0.00 ? 3  SER A C    5  
ATOM 5133  O O    . SER A 1 3  ? 7.235   -12.484 8.599   1.00 0.00 ? 3  SER A O    5  
ATOM 5134  C CB   . SER A 1 3  ? 5.911   -13.605 5.721   1.00 0.00 ? 3  SER A CB   5  
ATOM 5135  O OG   . SER A 1 3  ? 5.460   -14.658 4.873   1.00 0.00 ? 3  SER A OG   5  
ATOM 5136  H H    . SER A 1 3  ? 5.010   -13.165 8.485   1.00 0.00 ? 3  SER A H    5  
ATOM 5137  H HA   . SER A 1 3  ? 6.528   -15.167 7.070   1.00 0.00 ? 3  SER A HA   5  
ATOM 5138  H HB3  . SER A 1 3  ? 6.783   -13.128 5.274   1.00 0.00 ? 3  SER A HB3  5  
ATOM 5139  H HG   . SER A 1 3  ? 6.118   -15.411 4.882   1.00 0.00 ? 3  SER A HG   5  
ATOM 5140  N N    . GLY A 1 4  ? 8.611   -13.546 7.152   1.00 0.00 ? 4  GLY A N    5  
ATOM 5141  C CA   . GLY A 1 4  ? 9.804   -12.849 7.601   1.00 0.00 ? 4  GLY A CA   5  
ATOM 5142  C C    . GLY A 1 4  ? 10.789  -12.648 6.446   1.00 0.00 ? 4  GLY A C    5  
ATOM 5143  O O    . GLY A 1 4  ? 11.330  -13.615 5.913   1.00 0.00 ? 4  GLY A O    5  
ATOM 5144  H H    . GLY A 1 4  ? 8.760   -14.210 6.419   1.00 0.00 ? 4  GLY A H    5  
ATOM 5145  H HA2  . GLY A 1 4  ? 9.528   -11.881 8.020   1.00 0.00 ? 4  GLY A HA2  5  
ATOM 5146  H HA3  . GLY A 1 4  ? 10.284  -13.417 8.398   1.00 0.00 ? 4  GLY A HA3  5  
ATOM 5147  N N    . SER A 1 5  ? 10.990  -11.386 6.096   1.00 0.00 ? 5  SER A N    5  
ATOM 5148  C CA   . SER A 1 5  ? 11.900  -11.046 5.015   1.00 0.00 ? 5  SER A CA   5  
ATOM 5149  C C    . SER A 1 5  ? 12.736  -9.823  5.399   1.00 0.00 ? 5  SER A C    5  
ATOM 5150  O O    . SER A 1 5  ? 12.713  -9.389  6.549   1.00 0.00 ? 5  SER A O    5  
ATOM 5151  C CB   . SER A 1 5  ? 11.137  -10.782 3.716   1.00 0.00 ? 5  SER A CB   5  
ATOM 5152  O OG   . SER A 1 5  ? 11.633  -11.567 2.635   1.00 0.00 ? 5  SER A OG   5  
ATOM 5153  H H    . SER A 1 5  ? 10.546  -10.606 6.536   1.00 0.00 ? 5  SER A H    5  
ATOM 5154  H HA   . SER A 1 5  ? 12.538  -11.921 4.889   1.00 0.00 ? 5  SER A HA   5  
ATOM 5155  H HB3  . SER A 1 5  ? 11.212  -9.724  3.460   1.00 0.00 ? 5  SER A HB3  5  
ATOM 5156  H HG   . SER A 1 5  ? 11.389  -12.527 2.770   1.00 0.00 ? 5  SER A HG   5  
ATOM 5157  N N    . SER A 1 6  ? 13.453  -9.303  4.414   1.00 0.00 ? 6  SER A N    5  
ATOM 5158  C CA   . SER A 1 6  ? 14.293  -8.139  4.635   1.00 0.00 ? 6  SER A CA   5  
ATOM 5159  C C    . SER A 1 6  ? 14.226  -7.208  3.422   1.00 0.00 ? 6  SER A C    5  
ATOM 5160  O O    . SER A 1 6  ? 13.630  -7.552  2.403   1.00 0.00 ? 6  SER A O    5  
ATOM 5161  C CB   . SER A 1 6  ? 15.741  -8.550  4.909   1.00 0.00 ? 6  SER A CB   5  
ATOM 5162  O OG   . SER A 1 6  ? 15.963  -8.830  6.288   1.00 0.00 ? 6  SER A OG   5  
ATOM 5163  H H    . SER A 1 6  ? 13.465  -9.663  3.482   1.00 0.00 ? 6  SER A H    5  
ATOM 5164  H HA   . SER A 1 6  ? 13.882  -7.649  5.516   1.00 0.00 ? 6  SER A HA   5  
ATOM 5165  H HB3  . SER A 1 6  ? 16.411  -7.752  4.589   1.00 0.00 ? 6  SER A HB3  5  
ATOM 5166  H HG   . SER A 1 6  ? 15.138  -9.220  6.696   1.00 0.00 ? 6  SER A HG   5  
ATOM 5167  N N    . GLY A 1 7  ? 14.847  -6.048  3.572   1.00 0.00 ? 7  GLY A N    5  
ATOM 5168  C CA   . GLY A 1 7  ? 14.866  -5.065  2.502   1.00 0.00 ? 7  GLY A CA   5  
ATOM 5169  C C    . GLY A 1 7  ? 13.923  -3.900  2.811   1.00 0.00 ? 7  GLY A C    5  
ATOM 5170  O O    . GLY A 1 7  ? 13.171  -3.946  3.783   1.00 0.00 ? 7  GLY A O    5  
ATOM 5171  H H    . GLY A 1 7  ? 15.331  -5.775  4.404   1.00 0.00 ? 7  GLY A H    5  
ATOM 5172  H HA2  . GLY A 1 7  ? 15.880  -4.689  2.366   1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5173  H HA3  . GLY A 1 7  ? 14.572  -5.536  1.565   1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5174  N N    . LEU A 1 8  ? 13.994  -2.882  1.966   1.00 0.00 ? 8  LEU A N    5  
ATOM 5175  C CA   . LEU A 1 8  ? 13.156  -1.708  2.136   1.00 0.00 ? 8  LEU A CA   5  
ATOM 5176  C C    . LEU A 1 8  ? 11.890  -1.862  1.291   1.00 0.00 ? 8  LEU A C    5  
ATOM 5177  O O    . LEU A 1 8  ? 10.779  -1.757  1.806   1.00 0.00 ? 8  LEU A O    5  
ATOM 5178  C CB   . LEU A 1 8  ? 13.948  -0.435  1.830   1.00 0.00 ? 8  LEU A CB   5  
ATOM 5179  C CG   . LEU A 1 8  ? 14.509  0.314   3.040   1.00 0.00 ? 8  LEU A CG   5  
ATOM 5180  C CD1  . LEU A 1 8  ? 15.074  1.675   2.629   1.00 0.00 ? 8  LEU A CD1  5  
ATOM 5181  C CD2  . LEU A 1 8  ? 13.455  0.440   4.143   1.00 0.00 ? 8  LEU A CD2  5  
ATOM 5182  H H    . LEU A 1 8  ? 14.609  -2.852  1.177   1.00 0.00 ? 8  LEU A H    5  
ATOM 5183  H HA   . LEU A 1 8  ? 12.867  -1.662  3.186   1.00 0.00 ? 8  LEU A HA   5  
ATOM 5184  H HB3  . LEU A 1 8  ? 13.305  0.245   1.272   1.00 0.00 ? 8  LEU A HB3  5  
ATOM 5185  H HG   . LEU A 1 8  ? 15.335  -0.267  3.449   1.00 0.00 ? 8  LEU A HG   5  
ATOM 5186  H HD11 . LEU A 1 8  ? 15.758  1.546   1.791   1.00 0.00 ? 8  LEU A HD11 5  
ATOM 5187  H HD12 . LEU A 1 8  ? 14.257  2.333   2.333   1.00 0.00 ? 8  LEU A HD12 5  
ATOM 5188  H HD13 . LEU A 1 8  ? 15.609  2.115   3.470   1.00 0.00 ? 8  LEU A HD13 5  
ATOM 5189  H HD21 . LEU A 1 8  ? 13.564  1.404   4.640   1.00 0.00 ? 8  LEU A HD21 5  
ATOM 5190  H HD22 . LEU A 1 8  ? 12.460  0.367   3.704   1.00 0.00 ? 8  LEU A HD22 5  
ATOM 5191  H HD23 . LEU A 1 8  ? 13.593  -0.361  4.869   1.00 0.00 ? 8  LEU A HD23 5  
ATOM 5192  N N    . ARG A 1 9  ? 12.102  -2.110  0.007   1.00 0.00 ? 9  ARG A N    5  
ATOM 5193  C CA   . ARG A 1 9  ? 10.991  -2.281  -0.916  1.00 0.00 ? 9  ARG A CA   5  
ATOM 5194  C C    . ARG A 1 9  ? 10.161  -3.506  -0.527  1.00 0.00 ? 9  ARG A C    5  
ATOM 5195  O O    . ARG A 1 9  ? 8.948   -3.527  -0.726  1.00 0.00 ? 9  ARG A O    5  
ATOM 5196  C CB   . ARG A 1 9  ? 11.489  -2.445  -2.352  1.00 0.00 ? 9  ARG A CB   5  
ATOM 5197  C CG   . ARG A 1 9  ? 10.317  -2.600  -3.324  1.00 0.00 ? 9  ARG A CG   5  
ATOM 5198  C CD   . ARG A 1 9  ? 10.488  -3.847  -4.195  1.00 0.00 ? 9  ARG A CD   5  
ATOM 5199  N NE   . ARG A 1 9  ? 10.610  -5.048  -3.339  1.00 0.00 ? 9  ARG A NE   5  
ATOM 5200  C CZ   . ARG A 1 9  ? 10.748  -6.296  -3.811  1.00 0.00 ? 9  ARG A CZ   5  
ATOM 5201  N NH1  . ARG A 1 9  ? 10.783  -6.512  -5.132  1.00 0.00 ? 9  ARG A NH1  5  
ATOM 5202  N NH2  . ARG A 1 9  ? 10.852  -7.325  -2.960  1.00 0.00 ? 9  ARG A NH2  5  
ATOM 5203  H H    . ARG A 1 9  ? 13.009  -2.194  -0.405  1.00 0.00 ? 9  ARG A H    5  
ATOM 5204  H HA   . ARG A 1 9  ? 10.407  -1.365  -0.820  1.00 0.00 ? 9  ARG A HA   5  
ATOM 5205  H HB3  . ARG A 1 9  ? 12.139  -3.318  -2.419  1.00 0.00 ? 9  ARG A HB3  5  
ATOM 5206  H HG3  . ARG A 1 9  ? 10.246  -1.717  -3.959  1.00 0.00 ? 9  ARG A HG3  5  
ATOM 5207  H HD3  . ARG A 1 9  ? 11.375  -3.745  -4.821  1.00 0.00 ? 9  ARG A HD3  5  
ATOM 5208  H HE   . ARG A 1 9  ? 10.587  -4.922  -2.348  1.00 0.00 ? 9  ARG A HE   5  
ATOM 5209  H HH11 . ARG A 1 9  ? 10.705  -5.744  -5.767  1.00 0.00 ? 9  ARG A HH11 5  
ATOM 5210  H HH12 . ARG A 1 9  ? 10.886  -7.442  -5.483  1.00 0.00 ? 9  ARG A HH12 5  
ATOM 5211  H HH21 . ARG A 1 9  ? 10.826  -7.164  -1.973  1.00 0.00 ? 9  ARG A HH21 5  
ATOM 5212  H HH22 . ARG A 1 9  ? 10.955  -8.256  -3.311  1.00 0.00 ? 9  ARG A HH22 5  
ATOM 5213  N N    . LYS A 1 10 ? 10.850  -4.497  0.021   1.00 0.00 ? 10 LYS A N    5  
ATOM 5214  C CA   . LYS A 1 10 ? 10.193  -5.724  0.439   1.00 0.00 ? 10 LYS A CA   5  
ATOM 5215  C C    . LYS A 1 10 ? 9.290   -5.430  1.639   1.00 0.00 ? 10 LYS A C    5  
ATOM 5216  O O    . LYS A 1 10 ? 8.265   -6.083  1.825   1.00 0.00 ? 10 LYS A O    5  
ATOM 5217  C CB   . LYS A 1 10 ? 11.224  -6.822  0.701   1.00 0.00 ? 10 LYS A CB   5  
ATOM 5218  C CG   . LYS A 1 10 ? 10.570  -8.047  1.344   1.00 0.00 ? 10 LYS A CG   5  
ATOM 5219  C CD   . LYS A 1 10 ? 9.417   -8.569  0.483   1.00 0.00 ? 10 LYS A CD   5  
ATOM 5220  C CE   . LYS A 1 10 ? 9.942   -9.235  -0.790  1.00 0.00 ? 10 LYS A CE   5  
ATOM 5221  N NZ   . LYS A 1 10 ? 9.539   -10.658 -0.835  1.00 0.00 ? 10 LYS A NZ   5  
ATOM 5222  H H    . LYS A 1 10 ? 11.837  -4.472  0.179   1.00 0.00 ? 10 LYS A H    5  
ATOM 5223  H HA   . LYS A 1 10 ? 9.568   -6.057  -0.389  1.00 0.00 ? 10 LYS A HA   5  
ATOM 5224  H HB3  . LYS A 1 10 ? 12.010  -6.441  1.351   1.00 0.00 ? 10 LYS A HB3  5  
ATOM 5225  H HG3  . LYS A 1 10 ? 10.200  -7.786  2.335   1.00 0.00 ? 10 LYS A HG3  5  
ATOM 5226  H HD3  . LYS A 1 10 ? 8.753   -7.746  0.220   1.00 0.00 ? 10 LYS A HD3  5  
ATOM 5227  H HE3  . LYS A 1 10 ? 11.029  -9.157  -0.827  1.00 0.00 ? 10 LYS A HE3  5  
ATOM 5228  H HZ1  . LYS A 1 10 ? 9.767   -11.042 -1.730  1.00 0.00 ? 10 LYS A HZ1  5  
ATOM 5229  H HZ2  . LYS A 1 10 ? 10.025  -11.165 -0.122  1.00 0.00 ? 10 LYS A HZ2  5  
ATOM 5230  H HZ3  . LYS A 1 10 ? 8.554   -10.731 -0.683  1.00 0.00 ? 10 LYS A HZ3  5  
ATOM 5231  N N    . MET A 1 11 ? 9.705   -4.445  2.423   1.00 0.00 ? 11 MET A N    5  
ATOM 5232  C CA   . MET A 1 11 ? 8.946   -4.056  3.600   1.00 0.00 ? 11 MET A CA   5  
ATOM 5233  C C    . MET A 1 11 ? 7.632   -3.378  3.207   1.00 0.00 ? 11 MET A C    5  
ATOM 5234  O O    . MET A 1 11 ? 6.564   -3.764  3.682   1.00 0.00 ? 11 MET A O    5  
ATOM 5235  C CB   . MET A 1 11 ? 9.780   -3.096  4.451   1.00 0.00 ? 11 MET A CB   5  
ATOM 5236  C CG   . MET A 1 11 ? 10.555  -3.853  5.531   1.00 0.00 ? 11 MET A CG   5  
ATOM 5237  S SD   . MET A 1 11 ? 10.241  -3.125  7.131   1.00 0.00 ? 11 MET A SD   5  
ATOM 5238  C CE   . MET A 1 11 ? 11.509  -1.868  7.153   1.00 0.00 ? 11 MET A CE   5  
ATOM 5239  H H    . MET A 1 11 ? 10.539  -3.918  2.265   1.00 0.00 ? 11 MET A H    5  
ATOM 5240  H HA   . MET A 1 11 ? 8.740   -4.984  4.135   1.00 0.00 ? 11 MET A HA   5  
ATOM 5241  H HB3  . MET A 1 11 ? 9.130   -2.356  4.916   1.00 0.00 ? 11 MET A HB3  5  
ATOM 5242  H HG3  . MET A 1 11 ? 11.623  -3.825  5.313   1.00 0.00 ? 11 MET A HG3  5  
ATOM 5243  H HE1  . MET A 1 11 ? 12.460  -2.316  7.443   1.00 0.00 ? 11 MET A HE1  5  
ATOM 5244  H HE2  . MET A 1 11 ? 11.603  -1.429  6.160   1.00 0.00 ? 11 MET A HE2  5  
ATOM 5245  H HE3  . MET A 1 11 ? 11.240  -1.093  7.870   1.00 0.00 ? 11 MET A HE3  5  
ATOM 5246  N N    . VAL A 1 12 ? 7.752   -2.382  2.343   1.00 0.00 ? 12 VAL A N    5  
ATOM 5247  C CA   . VAL A 1 12 ? 6.586   -1.648  1.879   1.00 0.00 ? 12 VAL A CA   5  
ATOM 5248  C C    . VAL A 1 12 ? 5.764   -2.541  0.948   1.00 0.00 ? 12 VAL A C    5  
ATOM 5249  O O    . VAL A 1 12 ? 4.590   -2.269  0.701   1.00 0.00 ? 12 VAL A O    5  
ATOM 5250  C CB   . VAL A 1 12 ? 7.021   -0.337  1.221   1.00 0.00 ? 12 VAL A CB   5  
ATOM 5251  C CG1  . VAL A 1 12 ? 8.240   -0.553  0.322   1.00 0.00 ? 12 VAL A CG1  5  
ATOM 5252  C CG2  . VAL A 1 12 ? 5.867   0.293   0.440   1.00 0.00 ? 12 VAL A CG2  5  
ATOM 5253  H H    . VAL A 1 12 ? 8.624   -2.075  1.960   1.00 0.00 ? 12 VAL A H    5  
ATOM 5254  H HA   . VAL A 1 12 ? 5.984   -1.403  2.754   1.00 0.00 ? 12 VAL A HA   5  
ATOM 5255  H HB   . VAL A 1 12 ? 7.307   0.356   2.013   1.00 0.00 ? 12 VAL A HB   5  
ATOM 5256  H HG11 . VAL A 1 12 ? 9.142   -0.249  0.854   1.00 0.00 ? 12 VAL A HG11 5  
ATOM 5257  H HG12 . VAL A 1 12 ? 8.313   -1.608  0.056   1.00 0.00 ? 12 VAL A HG12 5  
ATOM 5258  H HG13 . VAL A 1 12 ? 8.134   0.045   -0.583  1.00 0.00 ? 12 VAL A HG13 5  
ATOM 5259  H HG21 . VAL A 1 12 ? 5.638   -0.323  -0.430  1.00 0.00 ? 12 VAL A HG21 5  
ATOM 5260  H HG22 . VAL A 1 12 ? 4.988   0.359   1.080   1.00 0.00 ? 12 VAL A HG22 5  
ATOM 5261  H HG23 . VAL A 1 12 ? 6.153   1.292   0.110   1.00 0.00 ? 12 VAL A HG23 5  
ATOM 5262  N N    . GLU A 1 13 ? 6.412   -3.586  0.457   1.00 0.00 ? 13 GLU A N    5  
ATOM 5263  C CA   . GLU A 1 13 ? 5.755   -4.520  -0.441  1.00 0.00 ? 13 GLU A CA   5  
ATOM 5264  C C    . GLU A 1 13 ? 4.491   -5.085  0.212   1.00 0.00 ? 13 GLU A C    5  
ATOM 5265  O O    . GLU A 1 13 ? 3.398   -4.962  -0.336  1.00 0.00 ? 13 GLU A O    5  
ATOM 5266  C CB   . GLU A 1 13 ? 6.707   -5.643  -0.856  1.00 0.00 ? 13 GLU A CB   5  
ATOM 5267  C CG   . GLU A 1 13 ? 6.881   -5.680  -2.377  1.00 0.00 ? 13 GLU A CG   5  
ATOM 5268  C CD   . GLU A 1 13 ? 6.782   -7.112  -2.905  1.00 0.00 ? 13 GLU A CD   5  
ATOM 5269  O OE1  . GLU A 1 13 ? 5.638   -7.543  -3.167  1.00 0.00 ? 13 GLU A OE1  5  
ATOM 5270  O OE2  . GLU A 1 13 ? 7.852   -7.745  -3.036  1.00 0.00 ? 13 GLU A OE2  5  
ATOM 5271  H H    . GLU A 1 13 ? 7.367   -3.799  0.664   1.00 0.00 ? 13 GLU A H    5  
ATOM 5272  H HA   . GLU A 1 13 ? 5.487   -3.935  -1.321  1.00 0.00 ? 13 GLU A HA   5  
ATOM 5273  H HB3  . GLU A 1 13 ? 6.320   -6.601  -0.508  1.00 0.00 ? 13 GLU A HB3  5  
ATOM 5274  H HG3  . GLU A 1 13 ? 7.849   -5.256  -2.645  1.00 0.00 ? 13 GLU A HG3  5  
ATOM 5275  N N    . GLU A 1 14 ? 4.685   -5.692  1.374   1.00 0.00 ? 14 GLU A N    5  
ATOM 5276  C CA   . GLU A 1 14 ? 3.576   -6.276  2.107   1.00 0.00 ? 14 GLU A CA   5  
ATOM 5277  C C    . GLU A 1 14 ? 2.644   -5.178  2.624   1.00 0.00 ? 14 GLU A C    5  
ATOM 5278  O O    . GLU A 1 14 ? 1.433   -5.374  2.707   1.00 0.00 ? 14 GLU A O    5  
ATOM 5279  C CB   . GLU A 1 14 ? 4.078   -7.155  3.255   1.00 0.00 ? 14 GLU A CB   5  
ATOM 5280  C CG   . GLU A 1 14 ? 4.827   -6.320  4.296   1.00 0.00 ? 14 GLU A CG   5  
ATOM 5281  C CD   . GLU A 1 14 ? 6.103   -7.030  4.752   1.00 0.00 ? 14 GLU A CD   5  
ATOM 5282  O OE1  . GLU A 1 14 ? 6.674   -7.765  3.918   1.00 0.00 ? 14 GLU A OE1  5  
ATOM 5283  O OE2  . GLU A 1 14 ? 6.478   -6.822  5.927   1.00 0.00 ? 14 GLU A OE2  5  
ATOM 5284  H H    . GLU A 1 14 ? 5.579   -5.787  1.813   1.00 0.00 ? 14 GLU A H    5  
ATOM 5285  H HA   . GLU A 1 14 ? 3.047   -6.899  1.385   1.00 0.00 ? 14 GLU A HA   5  
ATOM 5286  H HB3  . GLU A 1 14 ? 4.736   -7.930  2.862   1.00 0.00 ? 14 GLU A HB3  5  
ATOM 5287  H HG3  . GLU A 1 14 ? 4.181   -6.138  5.154   1.00 0.00 ? 14 GLU A HG3  5  
ATOM 5288  N N    . VAL A 1 15 ? 3.245   -4.045  2.959   1.00 0.00 ? 15 VAL A N    5  
ATOM 5289  C CA   . VAL A 1 15 ? 2.484   -2.916  3.465   1.00 0.00 ? 15 VAL A CA   5  
ATOM 5290  C C    . VAL A 1 15 ? 1.295   -2.651  2.540   1.00 0.00 ? 15 VAL A C    5  
ATOM 5291  O O    . VAL A 1 15 ? 0.152   -2.933  2.897   1.00 0.00 ? 15 VAL A O    5  
ATOM 5292  C CB   . VAL A 1 15 ? 3.399   -1.699  3.627   1.00 0.00 ? 15 VAL A CB   5  
ATOM 5293  C CG1  . VAL A 1 15 ? 2.582   -0.426  3.854   1.00 0.00 ? 15 VAL A CG1  5  
ATOM 5294  C CG2  . VAL A 1 15 ? 4.405   -1.916  4.759   1.00 0.00 ? 15 VAL A CG2  5  
ATOM 5295  H H    . VAL A 1 15 ? 4.231   -3.893  2.888   1.00 0.00 ? 15 VAL A H    5  
ATOM 5296  H HA   . VAL A 1 15 ? 2.109   -3.188  4.451   1.00 0.00 ? 15 VAL A HA   5  
ATOM 5297  H HB   . VAL A 1 15 ? 3.959   -1.576  2.699   1.00 0.00 ? 15 VAL A HB   5  
ATOM 5298  H HG11 . VAL A 1 15 ? 1.712   -0.658  4.469   1.00 0.00 ? 15 VAL A HG11 5  
ATOM 5299  H HG12 . VAL A 1 15 ? 3.198   0.315   4.362   1.00 0.00 ? 15 VAL A HG12 5  
ATOM 5300  H HG13 . VAL A 1 15 ? 2.252   -0.030  2.894   1.00 0.00 ? 15 VAL A HG13 5  
ATOM 5301  H HG21 . VAL A 1 15 ? 4.784   -2.937  4.717   1.00 0.00 ? 15 VAL A HG21 5  
ATOM 5302  H HG22 . VAL A 1 15 ? 5.233   -1.216  4.647   1.00 0.00 ? 15 VAL A HG22 5  
ATOM 5303  H HG23 . VAL A 1 15 ? 3.914   -1.749  5.718   1.00 0.00 ? 15 VAL A HG23 5  
ATOM 5304  N N    . PHE A 1 16 ? 1.605   -2.113  1.370   1.00 0.00 ? 16 PHE A N    5  
ATOM 5305  C CA   . PHE A 1 16 ? 0.575   -1.807  0.391   1.00 0.00 ? 16 PHE A CA   5  
ATOM 5306  C C    . PHE A 1 16 ? -0.376  -2.991  0.207   1.00 0.00 ? 16 PHE A C    5  
ATOM 5307  O O    . PHE A 1 16 ? -1.521  -2.814  -0.205  1.00 0.00 ? 16 PHE A O    5  
ATOM 5308  C CB   . PHE A 1 16 ? 1.287   -1.530  -0.936  1.00 0.00 ? 16 PHE A CB   5  
ATOM 5309  C CG   . PHE A 1 16 ? 1.892   -0.129  -1.036  1.00 0.00 ? 16 PHE A CG   5  
ATOM 5310  C CD1  . PHE A 1 16 ? 1.208   0.942   -0.551  1.00 0.00 ? 16 PHE A CD1  5  
ATOM 5311  C CD2  . PHE A 1 16 ? 3.111   0.046   -1.611  1.00 0.00 ? 16 PHE A CD2  5  
ATOM 5312  C CE1  . PHE A 1 16 ? 1.769   2.243   -0.645  1.00 0.00 ? 16 PHE A CE1  5  
ATOM 5313  C CE2  . PHE A 1 16 ? 3.673   1.348   -1.705  1.00 0.00 ? 16 PHE A CE2  5  
ATOM 5314  C CZ   . PHE A 1 16 ? 2.989   2.419   -1.220  1.00 0.00 ? 16 PHE A CZ   5  
ATOM 5315  H H    . PHE A 1 16 ? 2.538   -1.887  1.087   1.00 0.00 ? 16 PHE A H    5  
ATOM 5316  H HA   . PHE A 1 16 ? 0.017   -0.949  0.765   1.00 0.00 ? 16 PHE A HA   5  
ATOM 5317  H HB3  . PHE A 1 16 ? 0.579   -1.669  -1.752  1.00 0.00 ? 16 PHE A HB3  5  
ATOM 5318  H HD1  . PHE A 1 16 ? 0.231   0.802   -0.090  1.00 0.00 ? 16 PHE A HD1  5  
ATOM 5319  H HD2  . PHE A 1 16 ? 3.659   -0.812  -2.000  1.00 0.00 ? 16 PHE A HD2  5  
ATOM 5320  H HE1  . PHE A 1 16 ? 1.222   3.103   -0.256  1.00 0.00 ? 16 PHE A HE1  5  
ATOM 5321  H HE2  . PHE A 1 16 ? 4.650   1.488   -2.166  1.00 0.00 ? 16 PHE A HE2  5  
ATOM 5322  H HZ   . PHE A 1 16 ? 3.420   3.418   -1.292  1.00 0.00 ? 16 PHE A HZ   5  
ATOM 5323  N N    . ASP A 1 17 ? 0.134   -4.174  0.523   1.00 0.00 ? 17 ASP A N    5  
ATOM 5324  C CA   . ASP A 1 17 ? -0.657  -5.386  0.399   1.00 0.00 ? 17 ASP A CA   5  
ATOM 5325  C C    . ASP A 1 17 ? -1.603  -5.498  1.595   1.00 0.00 ? 17 ASP A C    5  
ATOM 5326  O O    . ASP A 1 17 ? -2.822  -5.485  1.430   1.00 0.00 ? 17 ASP A O    5  
ATOM 5327  C CB   . ASP A 1 17 ? 0.238   -6.628  0.385   1.00 0.00 ? 17 ASP A CB   5  
ATOM 5328  C CG   . ASP A 1 17 ? 0.398   -7.294  -0.982  1.00 0.00 ? 17 ASP A CG   5  
ATOM 5329  O OD1  . ASP A 1 17 ? 0.598   -6.542  -1.961  1.00 0.00 ? 17 ASP A OD1  5  
ATOM 5330  O OD2  . ASP A 1 17 ? 0.318   -8.541  -1.019  1.00 0.00 ? 17 ASP A OD2  5  
ATOM 5331  H H    . ASP A 1 17 ? 1.066   -4.309  0.857   1.00 0.00 ? 17 ASP A H    5  
ATOM 5332  H HA   . ASP A 1 17 ? -1.190  -5.285  -0.547  1.00 0.00 ? 17 ASP A HA   5  
ATOM 5333  H HB3  . ASP A 1 17 ? -0.171  -7.358  1.084   1.00 0.00 ? 17 ASP A HB3  5  
ATOM 5334  N N    . VAL A 1 18 ? -1.007  -5.607  2.773   1.00 0.00 ? 18 VAL A N    5  
ATOM 5335  C CA   . VAL A 1 18 ? -1.781  -5.720  3.997   1.00 0.00 ? 18 VAL A CA   5  
ATOM 5336  C C    . VAL A 1 18 ? -2.894  -4.671  3.991   1.00 0.00 ? 18 VAL A C    5  
ATOM 5337  O O    . VAL A 1 18 ? -4.071  -5.008  4.106   1.00 0.00 ? 18 VAL A O    5  
ATOM 5338  C CB   . VAL A 1 18 ? -0.859  -5.608  5.213   1.00 0.00 ? 18 VAL A CB   5  
ATOM 5339  C CG1  . VAL A 1 18 ? -1.632  -5.130  6.445   1.00 0.00 ? 18 VAL A CG1  5  
ATOM 5340  C CG2  . VAL A 1 18 ? -0.151  -6.935  5.490   1.00 0.00 ? 18 VAL A CG2  5  
ATOM 5341  H H    . VAL A 1 18 ? -0.015  -5.617  2.899   1.00 0.00 ? 18 VAL A H    5  
ATOM 5342  H HA   . VAL A 1 18 ? -2.234  -6.712  4.008   1.00 0.00 ? 18 VAL A HA   5  
ATOM 5343  H HB   . VAL A 1 18 ? -0.096  -4.862  4.987   1.00 0.00 ? 18 VAL A HB   5  
ATOM 5344  H HG11 . VAL A 1 18 ? -2.682  -5.403  6.343   1.00 0.00 ? 18 VAL A HG11 5  
ATOM 5345  H HG12 . VAL A 1 18 ? -1.220  -5.602  7.337   1.00 0.00 ? 18 VAL A HG12 5  
ATOM 5346  H HG13 . VAL A 1 18 ? -1.544  -4.048  6.532   1.00 0.00 ? 18 VAL A HG13 5  
ATOM 5347  H HG21 . VAL A 1 18 ? 0.903   -6.749  5.698   1.00 0.00 ? 18 VAL A HG21 5  
ATOM 5348  H HG22 . VAL A 1 18 ? -0.611  -7.420  6.351   1.00 0.00 ? 18 VAL A HG22 5  
ATOM 5349  H HG23 . VAL A 1 18 ? -0.240  -7.583  4.618   1.00 0.00 ? 18 VAL A HG23 5  
ATOM 5350  N N    . LEU A 1 19 ? -2.482  -3.419  3.856   1.00 0.00 ? 19 LEU A N    5  
ATOM 5351  C CA   . LEU A 1 19 ? -3.429  -2.317  3.833   1.00 0.00 ? 19 LEU A CA   5  
ATOM 5352  C C    . LEU A 1 19 ? -4.569  -2.650  2.868   1.00 0.00 ? 19 LEU A C    5  
ATOM 5353  O O    . LEU A 1 19 ? -5.735  -2.667  3.260   1.00 0.00 ? 19 LEU A O    5  
ATOM 5354  C CB   . LEU A 1 19 ? -2.715  -1.003  3.513   1.00 0.00 ? 19 LEU A CB   5  
ATOM 5355  C CG   . LEU A 1 19 ? -1.526  -0.650  4.408   1.00 0.00 ? 19 LEU A CG   5  
ATOM 5356  C CD1  . LEU A 1 19 ? -1.127  0.816   4.236   1.00 0.00 ? 19 LEU A CD1  5  
ATOM 5357  C CD2  . LEU A 1 19 ? -1.817  -0.998  5.868   1.00 0.00 ? 19 LEU A CD2  5  
ATOM 5358  H H    . LEU A 1 19 ? -1.522  -3.153  3.763   1.00 0.00 ? 19 LEU A H    5  
ATOM 5359  H HA   . LEU A 1 19 ? -3.843  -2.222  4.837   1.00 0.00 ? 19 LEU A HA   5  
ATOM 5360  H HB3  . LEU A 1 19 ? -3.442  -0.194  3.572   1.00 0.00 ? 19 LEU A HB3  5  
ATOM 5361  H HG   . LEU A 1 19 ? -0.673  -1.253  4.097   1.00 0.00 ? 19 LEU A HG   5  
ATOM 5362  H HD11 . LEU A 1 19 ? -0.051  0.884   4.074   1.00 0.00 ? 19 LEU A HD11 5  
ATOM 5363  H HD12 . LEU A 1 19 ? -1.650  1.238   3.377   1.00 0.00 ? 19 LEU A HD12 5  
ATOM 5364  H HD13 . LEU A 1 19 ? -1.395  1.374   5.134   1.00 0.00 ? 19 LEU A HD13 5  
ATOM 5365  H HD21 . LEU A 1 19 ? -2.888  -0.922  6.054   1.00 0.00 ? 19 LEU A HD21 5  
ATOM 5366  H HD22 . LEU A 1 19 ? -1.484  -2.015  6.073   1.00 0.00 ? 19 LEU A HD22 5  
ATOM 5367  H HD23 . LEU A 1 19 ? -1.285  -0.304  6.520   1.00 0.00 ? 19 LEU A HD23 5  
ATOM 5368  N N    . TYR A 1 20 ? -4.191  -2.906  1.624   1.00 0.00 ? 20 TYR A N    5  
ATOM 5369  C CA   . TYR A 1 20 ? -5.167  -3.237  0.599   1.00 0.00 ? 20 TYR A CA   5  
ATOM 5370  C C    . TYR A 1 20 ? -6.091  -4.364  1.066   1.00 0.00 ? 20 TYR A C    5  
ATOM 5371  O O    . TYR A 1 20 ? -7.308  -4.278  0.908   1.00 0.00 ? 20 TYR A O    5  
ATOM 5372  C CB   . TYR A 1 20 ? -4.362  -3.722  -0.609  1.00 0.00 ? 20 TYR A CB   5  
ATOM 5373  C CG   . TYR A 1 20 ? -5.221  -4.110  -1.813  1.00 0.00 ? 20 TYR A CG   5  
ATOM 5374  C CD1  . TYR A 1 20 ? -6.257  -3.291  -2.215  1.00 0.00 ? 20 TYR A CD1  5  
ATOM 5375  C CD2  . TYR A 1 20 ? -4.961  -5.278  -2.500  1.00 0.00 ? 20 TYR A CD2  5  
ATOM 5376  C CE1  . TYR A 1 20 ? -7.066  -3.656  -3.349  1.00 0.00 ? 20 TYR A CE1  5  
ATOM 5377  C CE2  . TYR A 1 20 ? -5.769  -5.644  -3.633  1.00 0.00 ? 20 TYR A CE2  5  
ATOM 5378  C CZ   . TYR A 1 20 ? -6.782  -4.815  -4.002  1.00 0.00 ? 20 TYR A CZ   5  
ATOM 5379  O OH   . TYR A 1 20 ? -7.545  -5.159  -5.073  1.00 0.00 ? 20 TYR A OH   5  
ATOM 5380  H H    . TYR A 1 20 ? -3.241  -2.890  1.313   1.00 0.00 ? 20 TYR A H    5  
ATOM 5381  H HA   . TYR A 1 20 ? -5.763  -2.346  0.401   1.00 0.00 ? 20 TYR A HA   5  
ATOM 5382  H HB3  . TYR A 1 20 ? -3.762  -4.581  -0.312  1.00 0.00 ? 20 TYR A HB3  5  
ATOM 5383  H HD1  . TYR A 1 20 ? -6.463  -2.367  -1.674  1.00 0.00 ? 20 TYR A HD1  5  
ATOM 5384  H HD2  . TYR A 1 20 ? -4.142  -5.925  -2.182  1.00 0.00 ? 20 TYR A HD2  5  
ATOM 5385  H HE1  . TYR A 1 20 ? -7.887  -3.018  -3.677  1.00 0.00 ? 20 TYR A HE1  5  
ATOM 5386  H HE2  . TYR A 1 20 ? -5.574  -6.564  -4.184  1.00 0.00 ? 20 TYR A HE2  5  
ATOM 5387  H HH   . TYR A 1 20 ? -8.062  -4.366  -5.396  1.00 0.00 ? 20 TYR A HH   5  
ATOM 5388  N N    . SER A 1 21 ? -5.478  -5.393  1.631   1.00 0.00 ? 21 SER A N    5  
ATOM 5389  C CA   . SER A 1 21 ? -6.231  -6.535  2.121   1.00 0.00 ? 21 SER A CA   5  
ATOM 5390  C C    . SER A 1 21 ? -7.150  -6.104  3.266   1.00 0.00 ? 21 SER A C    5  
ATOM 5391  O O    . SER A 1 21 ? -8.263  -6.611  3.398   1.00 0.00 ? 21 SER A O    5  
ATOM 5392  C CB   . SER A 1 21 ? -5.295  -7.654  2.584   1.00 0.00 ? 21 SER A CB   5  
ATOM 5393  O OG   . SER A 1 21 ? -6.014  -8.808  3.011   1.00 0.00 ? 21 SER A OG   5  
ATOM 5394  H H    . SER A 1 21 ? -4.488  -5.455  1.755   1.00 0.00 ? 21 SER A H    5  
ATOM 5395  H HA   . SER A 1 21 ? -6.817  -6.882  1.270   1.00 0.00 ? 21 SER A HA   5  
ATOM 5396  H HB3  . SER A 1 21 ? -4.674  -7.291  3.403   1.00 0.00 ? 21 SER A HB3  5  
ATOM 5397  H HG   . SER A 1 21 ? -6.971  -8.738  2.731   1.00 0.00 ? 21 SER A HG   5  
ATOM 5398  N N    . GLU A 1 22 ? -6.650  -5.172  4.064   1.00 0.00 ? 22 GLU A N    5  
ATOM 5399  C CA   . GLU A 1 22 ? -7.413  -4.666  5.193   1.00 0.00 ? 22 GLU A CA   5  
ATOM 5400  C C    . GLU A 1 22 ? -8.684  -3.969  4.705   1.00 0.00 ? 22 GLU A C    5  
ATOM 5401  O O    . GLU A 1 22 ? -9.778  -4.254  5.191   1.00 0.00 ? 22 GLU A O    5  
ATOM 5402  C CB   . GLU A 1 22 ? -6.565  -3.724  6.049   1.00 0.00 ? 22 GLU A CB   5  
ATOM 5403  C CG   . GLU A 1 22 ? -5.514  -4.502  6.845   1.00 0.00 ? 22 GLU A CG   5  
ATOM 5404  C CD   . GLU A 1 22 ? -6.174  -5.379  7.911   1.00 0.00 ? 22 GLU A CD   5  
ATOM 5405  O OE1  . GLU A 1 22 ? -6.696  -4.794  8.885   1.00 0.00 ? 22 GLU A OE1  5  
ATOM 5406  O OE2  . GLU A 1 22 ? -6.142  -6.615  7.727   1.00 0.00 ? 22 GLU A OE2  5  
ATOM 5407  H H    . GLU A 1 22 ? -5.745  -4.764  3.949   1.00 0.00 ? 22 GLU A H    5  
ATOM 5408  H HA   . GLU A 1 22 ? -7.676  -5.544  5.782   1.00 0.00 ? 22 GLU A HA   5  
ATOM 5409  H HB3  . GLU A 1 22 ? -7.208  -3.170  6.733   1.00 0.00 ? 22 GLU A HB3  5  
ATOM 5410  H HG3  . GLU A 1 22 ? -4.823  -3.805  7.319   1.00 0.00 ? 22 GLU A HG3  5  
ATOM 5411  N N    . ALA A 1 23 ? -8.498  -3.068  3.752   1.00 0.00 ? 23 ALA A N    5  
ATOM 5412  C CA   . ALA A 1 23 ? -9.617  -2.328  3.193   1.00 0.00 ? 23 ALA A CA   5  
ATOM 5413  C C    . ALA A 1 23 ? -10.533 -3.292  2.437   1.00 0.00 ? 23 ALA A C    5  
ATOM 5414  O O    . ALA A 1 23 ? -11.740 -3.067  2.349   1.00 0.00 ? 23 ALA A O    5  
ATOM 5415  C CB   . ALA A 1 23 ? -9.090  -1.203  2.300   1.00 0.00 ? 23 ALA A CB   5  
ATOM 5416  H H    . ALA A 1 23 ? -7.605  -2.842  3.362   1.00 0.00 ? 23 ALA A H    5  
ATOM 5417  H HA   . ALA A 1 23 ? -10.171 -1.888  4.022   1.00 0.00 ? 23 ALA A HA   5  
ATOM 5418  H HB1  . ALA A 1 23 ? -8.003  -1.167  2.364   1.00 0.00 ? 23 ALA A HB1  5  
ATOM 5419  H HB2  . ALA A 1 23 ? -9.387  -1.389  1.268   1.00 0.00 ? 23 ALA A HB2  5  
ATOM 5420  H HB3  . ALA A 1 23 ? -9.506  -0.251  2.631   1.00 0.00 ? 23 ALA A HB3  5  
ATOM 5421  N N    . LEU A 1 24 ? -9.927  -4.344  1.909   1.00 0.00 ? 24 LEU A N    5  
ATOM 5422  C CA   . LEU A 1 24 ? -10.674 -5.343  1.163   1.00 0.00 ? 24 LEU A CA   5  
ATOM 5423  C C    . LEU A 1 24 ? -11.400 -6.266  2.141   1.00 0.00 ? 24 LEU A C    5  
ATOM 5424  O O    . LEU A 1 24 ? -12.427 -6.853  1.803   1.00 0.00 ? 24 LEU A O    5  
ATOM 5425  C CB   . LEU A 1 24 ? -9.754  -6.082  0.187   1.00 0.00 ? 24 LEU A CB   5  
ATOM 5426  C CG   . LEU A 1 24 ? -9.810  -5.618  -1.269  1.00 0.00 ? 24 LEU A CG   5  
ATOM 5427  C CD1  . LEU A 1 24 ? -8.689  -6.257  -2.091  1.00 0.00 ? 24 LEU A CD1  5  
ATOM 5428  C CD2  . LEU A 1 24 ? -11.189 -5.884  -1.876  1.00 0.00 ? 24 LEU A CD2  5  
ATOM 5429  H H    . LEU A 1 24 ? -8.945  -4.519  1.984   1.00 0.00 ? 24 LEU A H    5  
ATOM 5430  H HA   . LEU A 1 24 ? -11.418 -4.816  0.567   1.00 0.00 ? 24 LEU A HA   5  
ATOM 5431  H HB3  . LEU A 1 24 ? -10.000 -7.142  0.221   1.00 0.00 ? 24 LEU A HB3  5  
ATOM 5432  H HG   . LEU A 1 24 ? -9.652  -4.539  -1.291  1.00 0.00 ? 24 LEU A HG   5  
ATOM 5433  H HD11 . LEU A 1 24 ? -8.746  -7.342  -2.003  1.00 0.00 ? 24 LEU A HD11 5  
ATOM 5434  H HD12 . LEU A 1 24 ? -8.797  -5.971  -3.138  1.00 0.00 ? 24 LEU A HD12 5  
ATOM 5435  H HD13 . LEU A 1 24 ? -7.724  -5.912  -1.719  1.00 0.00 ? 24 LEU A HD13 5  
ATOM 5436  H HD21 . LEU A 1 24 ? -11.451 -6.933  -1.737  1.00 0.00 ? 24 LEU A HD21 5  
ATOM 5437  H HD22 . LEU A 1 24 ? -11.931 -5.256  -1.383  1.00 0.00 ? 24 LEU A HD22 5  
ATOM 5438  H HD23 . LEU A 1 24 ? -11.167 -5.653  -2.941  1.00 0.00 ? 24 LEU A HD23 5  
ATOM 5439  N N    . GLY A 1 25 ? -10.839 -6.367  3.338   1.00 0.00 ? 25 GLY A N    5  
ATOM 5440  C CA   . GLY A 1 25 ? -11.421 -7.210  4.369   1.00 0.00 ? 25 GLY A CA   5  
ATOM 5441  C C    . GLY A 1 25 ? -11.392 -8.683  3.955   1.00 0.00 ? 25 GLY A C    5  
ATOM 5442  O O    . GLY A 1 25 ? -12.386 -9.392  4.098   1.00 0.00 ? 25 GLY A O    5  
ATOM 5443  H H    . GLY A 1 25 ? -10.004 -5.888  3.606   1.00 0.00 ? 25 GLY A H    5  
ATOM 5444  H HA2  . GLY A 1 25 ? -10.874 -7.080  5.302   1.00 0.00 ? 25 GLY A HA2  5  
ATOM 5445  H HA3  . GLY A 1 25 ? -12.450 -6.902  4.556   1.00 0.00 ? 25 GLY A HA3  5  
ATOM 5446  N N    . ARG A 1 26 ? -10.239 -9.099  3.451   1.00 0.00 ? 26 ARG A N    5  
ATOM 5447  C CA   . ARG A 1 26 ? -10.066 -10.475 3.015   1.00 0.00 ? 26 ARG A CA   5  
ATOM 5448  C C    . ARG A 1 26 ? -9.409  -11.303 4.121   1.00 0.00 ? 26 ARG A C    5  
ATOM 5449  O O    . ARG A 1 26 ? -9.019  -10.765 5.156   1.00 0.00 ? 26 ARG A O    5  
ATOM 5450  C CB   . ARG A 1 26 ? -9.205  -10.549 1.752   1.00 0.00 ? 26 ARG A CB   5  
ATOM 5451  C CG   . ARG A 1 26 ? -9.789  -9.677  0.639   1.00 0.00 ? 26 ARG A CG   5  
ATOM 5452  C CD   . ARG A 1 26 ? -10.584 -10.521 -0.359  1.00 0.00 ? 26 ARG A CD   5  
ATOM 5453  N NE   . ARG A 1 26 ? -12.015 -10.540 0.019   1.00 0.00 ? 26 ARG A NE   5  
ATOM 5454  C CZ   . ARG A 1 26 ? -12.566 -11.455 0.827   1.00 0.00 ? 26 ARG A CZ   5  
ATOM 5455  N NH1  . ARG A 1 26 ? -11.811 -12.433 1.345   1.00 0.00 ? 26 ARG A NH1  5  
ATOM 5456  N NH2  . ARG A 1 26 ? -13.873 -11.394 1.116   1.00 0.00 ? 26 ARG A NH2  5  
ATOM 5457  H H    . ARG A 1 26 ? -9.435  -8.517  3.337   1.00 0.00 ? 26 ARG A H    5  
ATOM 5458  H HA   . ARG A 1 26 ? -11.076 -10.830 2.806   1.00 0.00 ? 26 ARG A HA   5  
ATOM 5459  H HB3  . ARG A 1 26 ? -9.140  -11.583 1.412   1.00 0.00 ? 26 ARG A HB3  5  
ATOM 5460  H HG3  . ARG A 1 26 ? -8.985  -9.156  0.120   1.00 0.00 ? 26 ARG A HG3  5  
ATOM 5461  H HD3  . ARG A 1 26 ? -10.192 -11.538 -0.381  1.00 0.00 ? 26 ARG A HD3  5  
ATOM 5462  H HE   . ARG A 1 26 ? -12.606 -9.823  -0.350  1.00 0.00 ? 26 ARG A HE   5  
ATOM 5463  H HH11 . ARG A 1 26 ? -10.835 -12.480 1.129   1.00 0.00 ? 26 ARG A HH11 5  
ATOM 5464  H HH12 . ARG A 1 26 ? -12.223 -13.118 1.947   1.00 0.00 ? 26 ARG A HH12 5  
ATOM 5465  H HH21 . ARG A 1 26 ? -14.437 -10.664 0.730   1.00 0.00 ? 26 ARG A HH21 5  
ATOM 5466  H HH22 . ARG A 1 26 ? -14.285 -12.079 1.719   1.00 0.00 ? 26 ARG A HH22 5  
ATOM 5467  N N    . ALA A 1 27 ? -9.308  -12.599 3.864   1.00 0.00 ? 27 ALA A N    5  
ATOM 5468  C CA   . ALA A 1 27 ? -8.705  -13.507 4.825   1.00 0.00 ? 27 ALA A CA   5  
ATOM 5469  C C    . ALA A 1 27 ? -7.203  -13.604 4.556   1.00 0.00 ? 27 ALA A C    5  
ATOM 5470  O O    . ALA A 1 27 ? -6.397  -13.566 5.486   1.00 0.00 ? 27 ALA A O    5  
ATOM 5471  C CB   . ALA A 1 27 ? -9.400  -14.868 4.748   1.00 0.00 ? 27 ALA A CB   5  
ATOM 5472  H H    . ALA A 1 27 ? -9.628  -13.029 3.020   1.00 0.00 ? 27 ALA A H    5  
ATOM 5473  H HA   . ALA A 1 27 ? -8.862  -13.090 5.819   1.00 0.00 ? 27 ALA A HA   5  
ATOM 5474  H HB1  . ALA A 1 27 ? -8.666  -15.639 4.518   1.00 0.00 ? 27 ALA A HB1  5  
ATOM 5475  H HB2  . ALA A 1 27 ? -9.872  -15.090 5.705   1.00 0.00 ? 27 ALA A HB2  5  
ATOM 5476  H HB3  . ALA A 1 27 ? -10.159 -14.844 3.965   1.00 0.00 ? 27 ALA A HB3  5  
ATOM 5477  N N    . SER A 1 28 ? -6.869  -13.726 3.279   1.00 0.00 ? 28 SER A N    5  
ATOM 5478  C CA   . SER A 1 28 ? -5.477  -13.829 2.876   1.00 0.00 ? 28 SER A CA   5  
ATOM 5479  C C    . SER A 1 28 ? -4.971  -12.469 2.390   1.00 0.00 ? 28 SER A C    5  
ATOM 5480  O O    . SER A 1 28 ? -5.766  -11.572 2.110   1.00 0.00 ? 28 SER A O    5  
ATOM 5481  C CB   . SER A 1 28 ? -5.296  -14.884 1.783   1.00 0.00 ? 28 SER A CB   5  
ATOM 5482  O OG   . SER A 1 28 ? -6.010  -16.082 2.074   1.00 0.00 ? 28 SER A OG   5  
ATOM 5483  H H    . SER A 1 28 ? -7.530  -13.757 2.530   1.00 0.00 ? 28 SER A H    5  
ATOM 5484  H HA   . SER A 1 28 ? -4.939  -14.139 3.772   1.00 0.00 ? 28 SER A HA   5  
ATOM 5485  H HB3  . SER A 1 28 ? -4.237  -15.112 1.670   1.00 0.00 ? 28 SER A HB3  5  
ATOM 5486  H HG   . SER A 1 28 ? -5.865  -16.344 3.028   1.00 0.00 ? 28 SER A HG   5  
ATOM 5487  N N    . VAL A 1 29 ? -3.654  -12.360 2.304   1.00 0.00 ? 29 VAL A N    5  
ATOM 5488  C CA   . VAL A 1 29 ? -3.034  -11.124 1.856   1.00 0.00 ? 29 VAL A CA   5  
ATOM 5489  C C    . VAL A 1 29 ? -2.883  -11.156 0.334   1.00 0.00 ? 29 VAL A C    5  
ATOM 5490  O O    . VAL A 1 29 ? -2.127  -11.965 -0.202  1.00 0.00 ? 29 VAL A O    5  
ATOM 5491  C CB   . VAL A 1 29 ? -1.705  -10.912 2.583   1.00 0.00 ? 29 VAL A CB   5  
ATOM 5492  C CG1  . VAL A 1 29 ? -0.951  -9.712  2.008   1.00 0.00 ? 29 VAL A CG1  5  
ATOM 5493  C CG2  . VAL A 1 29 ? -1.923  -10.753 4.090   1.00 0.00 ? 29 VAL A CG2  5  
ATOM 5494  H H    . VAL A 1 29 ? -3.016  -13.094 2.533   1.00 0.00 ? 29 VAL A H    5  
ATOM 5495  H HA   . VAL A 1 29 ? -3.701  -10.304 2.125   1.00 0.00 ? 29 VAL A HA   5  
ATOM 5496  H HB   . VAL A 1 29 ? -1.091  -11.800 2.427   1.00 0.00 ? 29 VAL A HB   5  
ATOM 5497  H HG11 . VAL A 1 29 ? -0.175  -9.400  2.709   1.00 0.00 ? 29 VAL A HG11 5  
ATOM 5498  H HG12 . VAL A 1 29 ? -0.491  -9.991  1.060   1.00 0.00 ? 29 VAL A HG12 5  
ATOM 5499  H HG13 . VAL A 1 29 ? -1.647  -8.889  1.846   1.00 0.00 ? 29 VAL A HG13 5  
ATOM 5500  H HG21 . VAL A 1 29 ? -1.657  -9.739  4.390   1.00 0.00 ? 29 VAL A HG21 5  
ATOM 5501  H HG22 . VAL A 1 29 ? -2.971  -10.939 4.326   1.00 0.00 ? 29 VAL A HG22 5  
ATOM 5502  H HG23 . VAL A 1 29 ? -1.297  -11.467 4.625   1.00 0.00 ? 29 VAL A HG23 5  
ATOM 5503  N N    . VAL A 1 30 ? -3.616  -10.267 -0.320  1.00 0.00 ? 30 VAL A N    5  
ATOM 5504  C CA   . VAL A 1 30 ? -3.574  -10.184 -1.770  1.00 0.00 ? 30 VAL A CA   5  
ATOM 5505  C C    . VAL A 1 30 ? -2.592  -9.086  -2.186  1.00 0.00 ? 30 VAL A C    5  
ATOM 5506  O O    . VAL A 1 30 ? -2.350  -8.147  -1.429  1.00 0.00 ? 30 VAL A O    5  
ATOM 5507  C CB   . VAL A 1 30 ? -4.984  -9.966  -2.324  1.00 0.00 ? 30 VAL A CB   5  
ATOM 5508  C CG1  . VAL A 1 30 ? -5.760  -11.283 -2.381  1.00 0.00 ? 30 VAL A CG1  5  
ATOM 5509  C CG2  . VAL A 1 30 ? -5.740  -8.920  -1.502  1.00 0.00 ? 30 VAL A CG2  5  
ATOM 5510  H H    . VAL A 1 30 ? -4.230  -9.613  0.122   1.00 0.00 ? 30 VAL A H    5  
ATOM 5511  H HA   . VAL A 1 30 ? -3.209  -11.141 -2.145  1.00 0.00 ? 30 VAL A HA   5  
ATOM 5512  H HB   . VAL A 1 30 ? -4.890  -9.587  -3.341  1.00 0.00 ? 30 VAL A HB   5  
ATOM 5513  H HG11 . VAL A 1 30 ? -5.821  -11.713 -1.381  1.00 0.00 ? 30 VAL A HG11 5  
ATOM 5514  H HG12 . VAL A 1 30 ? -6.767  -11.095 -2.758  1.00 0.00 ? 30 VAL A HG12 5  
ATOM 5515  H HG13 . VAL A 1 30 ? -5.248  -11.977 -3.046  1.00 0.00 ? 30 VAL A HG13 5  
ATOM 5516  H HG21 . VAL A 1 30 ? -5.036  -8.177  -1.124  1.00 0.00 ? 30 VAL A HG21 5  
ATOM 5517  H HG22 . VAL A 1 30 ? -6.482  -8.430  -2.131  1.00 0.00 ? 30 VAL A HG22 5  
ATOM 5518  H HG23 . VAL A 1 30 ? -6.238  -9.406  -0.663  1.00 0.00 ? 30 VAL A HG23 5  
ATOM 5519  N N    . PRO A 1 31 ? -2.040  -9.245  -3.418  1.00 0.00 ? 31 PRO A N    5  
ATOM 5520  C CA   . PRO A 1 31 ? -1.091  -8.279  -3.943  1.00 0.00 ? 31 PRO A CA   5  
ATOM 5521  C C    . PRO A 1 31 ? -1.800  -6.999  -4.388  1.00 0.00 ? 31 PRO A C    5  
ATOM 5522  O O    . PRO A 1 31 ? -3.027  -6.920  -4.350  1.00 0.00 ? 31 PRO A O    5  
ATOM 5523  C CB   . PRO A 1 31 ? -0.390  -8.997  -5.085  1.00 0.00 ? 31 PRO A CB   5  
ATOM 5524  C CG   . PRO A 1 31 ? -1.288  -10.165 -5.457  1.00 0.00 ? 31 PRO A CG   5  
ATOM 5525  C CD   . PRO A 1 31 ? -2.305  -10.345 -4.342  1.00 0.00 ? 31 PRO A CD   5  
ATOM 5526  H HA   . PRO A 1 31 ? -0.447  -8.001  -3.230  1.00 0.00 ? 31 PRO A HA   5  
ATOM 5527  H HB3  . PRO A 1 31 ? 0.598   -9.345  -4.781  1.00 0.00 ? 31 PRO A HB3  5  
ATOM 5528  H HG3  . PRO A 1 31 ? -0.699  -11.073 -5.587  1.00 0.00 ? 31 PRO A HG3  5  
ATOM 5529  H HD3  . PRO A 1 31 ? -2.188  -11.311 -3.851  1.00 0.00 ? 31 PRO A HD3  5  
ATOM 5530  N N    . LEU A 1 32 ? -0.998  -6.028  -4.799  1.00 0.00 ? 32 LEU A N    5  
ATOM 5531  C CA   . LEU A 1 32 ? -1.534  -4.755  -5.249  1.00 0.00 ? 32 LEU A CA   5  
ATOM 5532  C C    . LEU A 1 32 ? -1.201  -4.561  -6.730  1.00 0.00 ? 32 LEU A C    5  
ATOM 5533  O O    . LEU A 1 32 ? -0.078  -4.195  -7.075  1.00 0.00 ? 32 LEU A O    5  
ATOM 5534  C CB   . LEU A 1 32 ? -1.037  -3.617  -4.355  1.00 0.00 ? 32 LEU A CB   5  
ATOM 5535  C CG   . LEU A 1 32 ? -1.282  -2.199  -4.875  1.00 0.00 ? 32 LEU A CG   5  
ATOM 5536  C CD1  . LEU A 1 32 ? -2.668  -2.080  -5.513  1.00 0.00 ? 32 LEU A CD1  5  
ATOM 5537  C CD2  . LEU A 1 32 ? -1.070  -1.164  -3.767  1.00 0.00 ? 32 LEU A CD2  5  
ATOM 5538  H H    . LEU A 1 32 ? -0.001  -6.099  -4.826  1.00 0.00 ? 32 LEU A H    5  
ATOM 5539  H HA   . LEU A 1 32 ? -2.617  -4.799  -5.142  1.00 0.00 ? 32 LEU A HA   5  
ATOM 5540  H HB3  . LEU A 1 32 ? 0.034   -3.745  -4.198  1.00 0.00 ? 32 LEU A HB3  5  
ATOM 5541  H HG   . LEU A 1 32 ? -0.549  -1.990  -5.654  1.00 0.00 ? 32 LEU A HG   5  
ATOM 5542  H HD11 . LEU A 1 32 ? -3.419  -1.977  -4.730  1.00 0.00 ? 32 LEU A HD11 5  
ATOM 5543  H HD12 . LEU A 1 32 ? -2.695  -1.205  -6.161  1.00 0.00 ? 32 LEU A HD12 5  
ATOM 5544  H HD13 . LEU A 1 32 ? -2.875  -2.974  -6.101  1.00 0.00 ? 32 LEU A HD13 5  
ATOM 5545  H HD21 . LEU A 1 32 ? -1.192  -1.642  -2.795  1.00 0.00 ? 32 LEU A HD21 5  
ATOM 5546  H HD22 . LEU A 1 32 ? -0.065  -0.750  -3.845  1.00 0.00 ? 32 LEU A HD22 5  
ATOM 5547  H HD23 . LEU A 1 32 ? -1.802  -0.364  -3.873  1.00 0.00 ? 32 LEU A HD23 5  
ATOM 5548  N N    . PRO A 1 33 ? -2.223  -4.825  -7.588  1.00 0.00 ? 33 PRO A N    5  
ATOM 5549  C CA   . PRO A 1 33 ? -2.049  -4.684  -9.024  1.00 0.00 ? 33 PRO A CA   5  
ATOM 5550  C C    . PRO A 1 33 ? -2.039  -3.210  -9.433  1.00 0.00 ? 33 PRO A C    5  
ATOM 5551  O O    . PRO A 1 33 ? -3.001  -2.719  -10.023 1.00 0.00 ? 33 PRO A O    5  
ATOM 5552  C CB   . PRO A 1 33 ? -3.202  -5.463  -9.637  1.00 0.00 ? 33 PRO A CB   5  
ATOM 5553  C CG   . PRO A 1 33 ? -4.234  -5.619  -8.532  1.00 0.00 ? 33 PRO A CG   5  
ATOM 5554  C CD   . PRO A 1 33 ? -3.565  -5.260  -7.215  1.00 0.00 ? 33 PRO A CD   5  
ATOM 5555  H HA   . PRO A 1 33 ? -1.162  -5.052  -9.304  1.00 0.00 ? 33 PRO A HA   5  
ATOM 5556  H HB3  . PRO A 1 33 ? -2.867  -6.435  -9.999  1.00 0.00 ? 33 PRO A HB3  5  
ATOM 5557  H HG3  . PRO A 1 33 ? -4.611  -6.642  -8.503  1.00 0.00 ? 33 PRO A HG3  5  
ATOM 5558  H HD3  . PRO A 1 33 ? -3.530  -6.118  -6.542  1.00 0.00 ? 33 PRO A HD3  5  
ATOM 5559  N N    . TYR A 1 34 ? -0.941  -2.546  -9.105  1.00 0.00 ? 34 TYR A N    5  
ATOM 5560  C CA   . TYR A 1 34 ? -0.792  -1.137  -9.431  1.00 0.00 ? 34 TYR A CA   5  
ATOM 5561  C C    . TYR A 1 34 ? -1.169  -0.869  -10.890 1.00 0.00 ? 34 TYR A C    5  
ATOM 5562  O O    . TYR A 1 34 ? -1.994  -0.003  -11.172 1.00 0.00 ? 34 TYR A O    5  
ATOM 5563  C CB   . TYR A 1 34 ? 0.689   -0.812  -9.231  1.00 0.00 ? 34 TYR A CB   5  
ATOM 5564  C CG   . TYR A 1 34 ? 1.154   -0.897  -7.775  1.00 0.00 ? 34 TYR A CG   5  
ATOM 5565  C CD1  . TYR A 1 34 ? 0.910   0.150   -6.910  1.00 0.00 ? 34 TYR A CD1  5  
ATOM 5566  C CD2  . TYR A 1 34 ? 1.816   -2.022  -7.328  1.00 0.00 ? 34 TYR A CD2  5  
ATOM 5567  C CE1  . TYR A 1 34 ? 1.348   0.069   -5.541  1.00 0.00 ? 34 TYR A CE1  5  
ATOM 5568  C CE2  . TYR A 1 34 ? 2.254   -2.104  -5.959  1.00 0.00 ? 34 TYR A CE2  5  
ATOM 5569  C CZ   . TYR A 1 34 ? 1.997   -1.054  -5.132  1.00 0.00 ? 34 TYR A CZ   5  
ATOM 5570  O OH   . TYR A 1 34 ? 2.411   -1.131  -3.838  1.00 0.00 ? 34 TYR A OH   5  
ATOM 5571  H H    . TYR A 1 34 ? -0.163  -2.952  -8.625  1.00 0.00 ? 34 TYR A H    5  
ATOM 5572  H HA   . TYR A 1 34 ? -1.459  -0.569  -8.782  1.00 0.00 ? 34 TYR A HA   5  
ATOM 5573  H HB3  . TYR A 1 34 ? 0.883   0.193   -9.604  1.00 0.00 ? 34 TYR A HB3  5  
ATOM 5574  H HD1  . TYR A 1 34 ? 0.386   1.038   -7.263  1.00 0.00 ? 34 TYR A HD1  5  
ATOM 5575  H HD2  . TYR A 1 34 ? 2.009   -2.849  -8.012  1.00 0.00 ? 34 TYR A HD2  5  
ATOM 5576  H HE1  . TYR A 1 34 ? 1.161   0.888   -4.847  1.00 0.00 ? 34 TYR A HE1  5  
ATOM 5577  H HE2  . TYR A 1 34 ? 2.779   -2.986  -5.592  1.00 0.00 ? 34 TYR A HE2  5  
ATOM 5578  H HH   . TYR A 1 34 ? 3.220   -1.714  -3.772  1.00 0.00 ? 34 TYR A HH   5  
ATOM 5579  N N    . GLU A 1 35 ? -0.545  -1.630  -11.777 1.00 0.00 ? 35 GLU A N    5  
ATOM 5580  C CA   . GLU A 1 35 ? -0.803  -1.487  -13.200 1.00 0.00 ? 35 GLU A CA   5  
ATOM 5581  C C    . GLU A 1 35 ? -2.292  -1.232  -13.445 1.00 0.00 ? 35 GLU A C    5  
ATOM 5582  O O    . GLU A 1 35 ? -2.661  -0.566  -14.411 1.00 0.00 ? 35 GLU A O    5  
ATOM 5583  C CB   . GLU A 1 35 ? -0.323  -2.716  -13.972 1.00 0.00 ? 35 GLU A CB   5  
ATOM 5584  C CG   . GLU A 1 35 ? -1.038  -3.981  -13.491 1.00 0.00 ? 35 GLU A CG   5  
ATOM 5585  C CD   . GLU A 1 35 ? -0.496  -5.222  -14.200 1.00 0.00 ? 35 GLU A CD   5  
ATOM 5586  O OE1  . GLU A 1 35 ? -0.146  -5.087  -15.394 1.00 0.00 ? 35 GLU A OE1  5  
ATOM 5587  O OE2  . GLU A 1 35 ? -0.442  -6.279  -13.535 1.00 0.00 ? 35 GLU A OE2  5  
ATOM 5588  H H    . GLU A 1 35 ? 0.125   -2.333  -11.538 1.00 0.00 ? 35 GLU A H    5  
ATOM 5589  H HA   . GLU A 1 35 ? -0.224  -0.619  -13.513 1.00 0.00 ? 35 GLU A HA   5  
ATOM 5590  H HB3  . GLU A 1 35 ? 0.754   -2.833  -13.844 1.00 0.00 ? 35 GLU A HB3  5  
ATOM 5591  H HG3  . GLU A 1 35 ? -2.109  -3.890  -13.676 1.00 0.00 ? 35 GLU A HG3  5  
ATOM 5592  N N    . ARG A 1 36 ? -3.108  -1.778  -12.554 1.00 0.00 ? 36 ARG A N    5  
ATOM 5593  C CA   . ARG A 1 36 ? -4.548  -1.619  -12.663 1.00 0.00 ? 36 ARG A CA   5  
ATOM 5594  C C    . ARG A 1 36 ? -5.018  -0.440  -11.806 1.00 0.00 ? 36 ARG A C    5  
ATOM 5595  O O    . ARG A 1 36 ? -5.476  0.571   -12.334 1.00 0.00 ? 36 ARG A O    5  
ATOM 5596  C CB   . ARG A 1 36 ? -5.278  -2.887  -12.216 1.00 0.00 ? 36 ARG A CB   5  
ATOM 5597  C CG   . ARG A 1 36 ? -5.174  -3.983  -13.279 1.00 0.00 ? 36 ARG A CG   5  
ATOM 5598  C CD   . ARG A 1 36 ? -6.496  -4.739  -13.418 1.00 0.00 ? 36 ARG A CD   5  
ATOM 5599  N NE   . ARG A 1 36 ? -6.286  -6.179  -13.148 1.00 0.00 ? 36 ARG A NE   5  
ATOM 5600  C CZ   . ARG A 1 36 ? -7.120  -7.148  -13.550 1.00 0.00 ? 36 ARG A CZ   5  
ATOM 5601  N NH1  . ARG A 1 36 ? -8.224  -6.837  -14.241 1.00 0.00 ? 36 ARG A NH1  5  
ATOM 5602  N NH2  . ARG A 1 36 ? -6.849  -8.428  -13.259 1.00 0.00 ? 36 ARG A NH2  5  
ATOM 5603  H H    . ARG A 1 36 ? -2.800  -2.318  -11.772 1.00 0.00 ? 36 ARG A H    5  
ATOM 5604  H HA   . ARG A 1 36 ? -4.729  -1.431  -13.721 1.00 0.00 ? 36 ARG A HA   5  
ATOM 5605  H HB3  . ARG A 1 36 ? -6.326  -2.659  -12.024 1.00 0.00 ? 36 ARG A HB3  5  
ATOM 5606  H HG3  . ARG A 1 36 ? -4.378  -4.679  -13.013 1.00 0.00 ? 36 ARG A HG3  5  
ATOM 5607  H HD3  . ARG A 1 36 ? -6.899  -4.604  -14.421 1.00 0.00 ? 36 ARG A HD3  5  
ATOM 5608  H HE   . ARG A 1 36 ? -5.471  -6.446  -12.634 1.00 0.00 ? 36 ARG A HE   5  
ATOM 5609  H HH11 . ARG A 1 36 ? -8.427  -5.883  -14.458 1.00 0.00 ? 36 ARG A HH11 5  
ATOM 5610  H HH12 . ARG A 1 36 ? -8.847  -7.560  -14.541 1.00 0.00 ? 36 ARG A HH12 5  
ATOM 5611  H HH21 . ARG A 1 36 ? -6.024  -8.660  -12.743 1.00 0.00 ? 36 ARG A HH21 5  
ATOM 5612  H HH22 . ARG A 1 36 ? -7.471  -9.151  -13.559 1.00 0.00 ? 36 ARG A HH22 5  
ATOM 5613  N N    . LEU A 1 37 ? -4.887  -0.611  -10.499 1.00 0.00 ? 37 LEU A N    5  
ATOM 5614  C CA   . LEU A 1 37 ? -5.292  0.425   -9.564  1.00 0.00 ? 37 LEU A CA   5  
ATOM 5615  C C    . LEU A 1 37 ? -4.820  1.786   -10.082 1.00 0.00 ? 37 LEU A C    5  
ATOM 5616  O O    . LEU A 1 37 ? -5.471  2.803   -9.851  1.00 0.00 ? 37 LEU A O    5  
ATOM 5617  C CB   . LEU A 1 37 ? -4.797  0.099   -8.154  1.00 0.00 ? 37 LEU A CB   5  
ATOM 5618  C CG   . LEU A 1 37 ? -5.143  -1.297  -7.629  1.00 0.00 ? 37 LEU A CG   5  
ATOM 5619  C CD1  . LEU A 1 37 ? -5.284  -1.289  -6.105  1.00 0.00 ? 37 LEU A CD1  5  
ATOM 5620  C CD2  . LEU A 1 37 ? -6.394  -1.847  -8.317  1.00 0.00 ? 37 LEU A CD2  5  
ATOM 5621  H H    . LEU A 1 37 ? -4.513  -1.437  -10.077 1.00 0.00 ? 37 LEU A H    5  
ATOM 5622  H HA   . LEU A 1 37 ? -6.382  0.428   -9.532  1.00 0.00 ? 37 LEU A HA   5  
ATOM 5623  H HB3  . LEU A 1 37 ? -5.210  0.836   -7.466  1.00 0.00 ? 37 LEU A HB3  5  
ATOM 5624  H HG   . LEU A 1 37 ? -4.320  -1.967  -7.874  1.00 0.00 ? 37 LEU A HG   5  
ATOM 5625  H HD11 . LEU A 1 37 ? -4.544  -0.613  -5.676  1.00 0.00 ? 37 LEU A HD11 5  
ATOM 5626  H HD12 . LEU A 1 37 ? -6.284  -0.954  -5.834  1.00 0.00 ? 37 LEU A HD12 5  
ATOM 5627  H HD13 . LEU A 1 37 ? -5.120  -2.297  -5.721  1.00 0.00 ? 37 LEU A HD13 5  
ATOM 5628  H HD21 . LEU A 1 37 ? -6.134  -2.206  -9.312  1.00 0.00 ? 37 LEU A HD21 5  
ATOM 5629  H HD22 . LEU A 1 37 ? -6.800  -2.671  -7.729  1.00 0.00 ? 37 LEU A HD22 5  
ATOM 5630  H HD23 . LEU A 1 37 ? -7.141  -1.058  -8.399  1.00 0.00 ? 37 LEU A HD23 5  
ATOM 5631  N N    . LEU A 1 38 ? -3.690  1.760   -10.773 1.00 0.00 ? 38 LEU A N    5  
ATOM 5632  C CA   . LEU A 1 38 ? -3.122  2.978   -11.326 1.00 0.00 ? 38 LEU A CA   5  
ATOM 5633  C C    . LEU A 1 38 ? -4.050  3.520   -12.415 1.00 0.00 ? 38 LEU A C    5  
ATOM 5634  O O    . LEU A 1 38 ? -4.376  4.705   -12.424 1.00 0.00 ? 38 LEU A O    5  
ATOM 5635  C CB   . LEU A 1 38 ? -1.689  2.733   -11.804 1.00 0.00 ? 38 LEU A CB   5  
ATOM 5636  C CG   . LEU A 1 38 ? -0.658  2.439   -10.712 1.00 0.00 ? 38 LEU A CG   5  
ATOM 5637  C CD1  . LEU A 1 38 ? 0.643   1.909   -11.316 1.00 0.00 ? 38 LEU A CD1  5  
ATOM 5638  C CD2  . LEU A 1 38 ? -0.424  3.669   -9.833  1.00 0.00 ? 38 LEU A CD2  5  
ATOM 5639  H H    . LEU A 1 38 ? -3.165  0.928   -10.957 1.00 0.00 ? 38 LEU A H    5  
ATOM 5640  H HA   . LEU A 1 38 ? -3.071  3.710   -10.520 1.00 0.00 ? 38 LEU A HA   5  
ATOM 5641  H HB3  . LEU A 1 38 ? -1.358  3.610   -12.361 1.00 0.00 ? 38 LEU A HB3  5  
ATOM 5642  H HG   . LEU A 1 38 ? -1.057  1.655   -10.068 1.00 0.00 ? 38 LEU A HG   5  
ATOM 5643  H HD11 . LEU A 1 38 ? 1.431   1.938   -10.562 1.00 0.00 ? 38 LEU A HD11 5  
ATOM 5644  H HD12 . LEU A 1 38 ? 0.498   0.881   -11.648 1.00 0.00 ? 38 LEU A HD12 5  
ATOM 5645  H HD13 . LEU A 1 38 ? 0.929   2.529   -12.165 1.00 0.00 ? 38 LEU A HD13 5  
ATOM 5646  H HD21 . LEU A 1 38 ? -1.277  3.809   -9.169  1.00 0.00 ? 38 LEU A HD21 5  
ATOM 5647  H HD22 . LEU A 1 38 ? 0.479   3.526   -9.241  1.00 0.00 ? 38 LEU A HD22 5  
ATOM 5648  H HD23 . LEU A 1 38 ? -0.308  4.550   -10.466 1.00 0.00 ? 38 LEU A HD23 5  
ATOM 5649  N N    . ARG A 1 39 ? -4.447  2.625   -13.307 1.00 0.00 ? 39 ARG A N    5  
ATOM 5650  C CA   . ARG A 1 39 ? -5.331  2.998   -14.398 1.00 0.00 ? 39 ARG A CA   5  
ATOM 5651  C C    . ARG A 1 39 ? -6.552  3.747   -13.861 1.00 0.00 ? 39 ARG A C    5  
ATOM 5652  O O    . ARG A 1 39 ? -6.958  4.763   -14.422 1.00 0.00 ? 39 ARG A O    5  
ATOM 5653  C CB   . ARG A 1 39 ? -5.800  1.765   -15.175 1.00 0.00 ? 39 ARG A CB   5  
ATOM 5654  C CG   . ARG A 1 39 ? -6.806  2.150   -16.260 1.00 0.00 ? 39 ARG A CG   5  
ATOM 5655  C CD   . ARG A 1 39 ? -8.195  1.591   -15.943 1.00 0.00 ? 39 ARG A CD   5  
ATOM 5656  N NE   . ARG A 1 39 ? -9.018  1.553   -17.173 1.00 0.00 ? 39 ARG A NE   5  
ATOM 5657  C CZ   . ARG A 1 39 ? -8.977  0.562   -18.073 1.00 0.00 ? 39 ARG A CZ   5  
ATOM 5658  N NH1  . ARG A 1 39 ? -8.152  -0.478  -17.889 1.00 0.00 ? 39 ARG A NH1  5  
ATOM 5659  N NH2  . ARG A 1 39 ? -9.759  0.612   -19.160 1.00 0.00 ? 39 ARG A NH2  5  
ATOM 5660  H H    . ARG A 1 39 ? -4.177  1.662   -13.293 1.00 0.00 ? 39 ARG A H    5  
ATOM 5661  H HA   . ARG A 1 39 ? -4.727  3.640   -15.039 1.00 0.00 ? 39 ARG A HA   5  
ATOM 5662  H HB3  . ARG A 1 39 ? -6.254  1.050   -14.489 1.00 0.00 ? 39 ARG A HB3  5  
ATOM 5663  H HG3  . ARG A 1 39 ? -6.469  1.771   -17.225 1.00 0.00 ? 39 ARG A HG3  5  
ATOM 5664  H HD3  . ARG A 1 39 ? -8.681  2.210   -15.189 1.00 0.00 ? 39 ARG A HD3  5  
ATOM 5665  H HE   . ARG A 1 39 ? -9.644  2.314   -17.342 1.00 0.00 ? 39 ARG A HE   5  
ATOM 5666  H HH11 . ARG A 1 39 ? -7.568  -0.515  -17.078 1.00 0.00 ? 39 ARG A HH11 5  
ATOM 5667  H HH12 . ARG A 1 39 ? -8.122  -1.218  -18.561 1.00 0.00 ? 39 ARG A HH12 5  
ATOM 5668  H HH21 . ARG A 1 39 ? -10.374 1.388   -19.298 1.00 0.00 ? 39 ARG A HH21 5  
ATOM 5669  H HH22 . ARG A 1 39 ? -9.728  -0.128  -19.833 1.00 0.00 ? 39 ARG A HH22 5  
ATOM 5670  N N    . GLU A 1 40 ? -7.103  3.216   -12.780 1.00 0.00 ? 40 GLU A N    5  
ATOM 5671  C CA   . GLU A 1 40 ? -8.269  3.821   -12.160 1.00 0.00 ? 40 GLU A CA   5  
ATOM 5672  C C    . GLU A 1 40 ? -7.956  4.221   -10.717 1.00 0.00 ? 40 GLU A C    5  
ATOM 5673  O O    . GLU A 1 40 ? -7.887  3.368   -9.833  1.00 0.00 ? 40 GLU A O    5  
ATOM 5674  C CB   . GLU A 1 40 ? -9.474  2.879   -12.218 1.00 0.00 ? 40 GLU A CB   5  
ATOM 5675  C CG   . GLU A 1 40 ? -9.024  1.418   -12.278 1.00 0.00 ? 40 GLU A CG   5  
ATOM 5676  C CD   . GLU A 1 40 ? -10.217 0.486   -12.497 1.00 0.00 ? 40 GLU A CD   5  
ATOM 5677  O OE1  . GLU A 1 40 ? -11.293 0.803   -11.946 1.00 0.00 ? 40 GLU A OE1  5  
ATOM 5678  O OE2  . GLU A 1 40 ? -10.026 -0.523  -13.210 1.00 0.00 ? 40 GLU A OE2  5  
ATOM 5679  H H    . GLU A 1 40 ? -6.767  2.389   -12.330 1.00 0.00 ? 40 GLU A H    5  
ATOM 5680  H HA   . GLU A 1 40 ? -8.483  4.711   -12.753 1.00 0.00 ? 40 GLU A HA   5  
ATOM 5681  H HB3  . GLU A 1 40 ? -10.081 3.113   -13.093 1.00 0.00 ? 40 GLU A HB3  5  
ATOM 5682  H HG3  . GLU A 1 40 ? -8.515  1.152   -11.352 1.00 0.00 ? 40 GLU A HG3  5  
ATOM 5683  N N    . PRO A 1 41 ? -7.770  5.554   -10.517 1.00 0.00 ? 41 PRO A N    5  
ATOM 5684  C CA   . PRO A 1 41 ? -7.465  6.077   -9.196  1.00 0.00 ? 41 PRO A CA   5  
ATOM 5685  C C    . PRO A 1 41 ? -8.712  6.083   -8.307  1.00 0.00 ? 41 PRO A C    5  
ATOM 5686  O O    . PRO A 1 41 ? -8.605  6.120   -7.083  1.00 0.00 ? 41 PRO A O    5  
ATOM 5687  C CB   . PRO A 1 41 ? -6.906  7.469   -9.444  1.00 0.00 ? 41 PRO A CB   5  
ATOM 5688  C CG   . PRO A 1 41 ? -7.348  7.852   -10.846 1.00 0.00 ? 41 PRO A CG   5  
ATOM 5689  C CD   . PRO A 1 41 ? -7.844  6.594   -11.539 1.00 0.00 ? 41 PRO A CD   5  
ATOM 5690  H HA   . PRO A 1 41 ? -6.803  5.488   -8.734  1.00 0.00 ? 41 PRO A HA   5  
ATOM 5691  H HB3  . PRO A 1 41 ? -5.819  7.473   -9.361  1.00 0.00 ? 41 PRO A HB3  5  
ATOM 5692  H HG3  . PRO A 1 41 ? -6.519  8.292   -11.401 1.00 0.00 ? 41 PRO A HG3  5  
ATOM 5693  H HD3  . PRO A 1 41 ? -7.225  6.346   -12.401 1.00 0.00 ? 41 PRO A HD3  5  
ATOM 5694  N N    . GLY A 1 42 ? -9.864  6.045   -8.961  1.00 0.00 ? 42 GLY A N    5  
ATOM 5695  C CA   . GLY A 1 42 ? -11.128 6.045   -8.245  1.00 0.00 ? 42 GLY A CA   5  
ATOM 5696  C C    . GLY A 1 42 ? -11.418 4.669   -7.641  1.00 0.00 ? 42 GLY A C    5  
ATOM 5697  O O    . GLY A 1 42 ? -11.984 4.571   -6.554  1.00 0.00 ? 42 GLY A O    5  
ATOM 5698  H H    . GLY A 1 42 ? -9.942  6.015   -9.956  1.00 0.00 ? 42 GLY A H    5  
ATOM 5699  H HA2  . GLY A 1 42 ? -11.103 6.795   -7.454  1.00 0.00 ? 42 GLY A HA2  5  
ATOM 5700  H HA3  . GLY A 1 42 ? -11.934 6.325   -8.924  1.00 0.00 ? 42 GLY A HA3  5  
ATOM 5701  N N    . LEU A 1 43 ? -11.015 3.641   -8.374  1.00 0.00 ? 43 LEU A N    5  
ATOM 5702  C CA   . LEU A 1 43 ? -11.224 2.275   -7.923  1.00 0.00 ? 43 LEU A CA   5  
ATOM 5703  C C    . LEU A 1 43 ? -10.622 2.105   -6.528  1.00 0.00 ? 43 LEU A C    5  
ATOM 5704  O O    . LEU A 1 43 ? -11.225 1.475   -5.661  1.00 0.00 ? 43 LEU A O    5  
ATOM 5705  C CB   . LEU A 1 43 ? -10.680 1.283   -8.955  1.00 0.00 ? 43 LEU A CB   5  
ATOM 5706  C CG   . LEU A 1 43 ? -11.178 -0.158  -8.826  1.00 0.00 ? 43 LEU A CG   5  
ATOM 5707  C CD1  . LEU A 1 43 ? -12.639 -0.274  -9.266  1.00 0.00 ? 43 LEU A CD1  5  
ATOM 5708  C CD2  . LEU A 1 43 ? -10.269 -1.123  -9.592  1.00 0.00 ? 43 LEU A CD2  5  
ATOM 5709  H H    . LEU A 1 43 ? -10.556 3.730   -9.257  1.00 0.00 ? 43 LEU A H    5  
ATOM 5710  H HA   . LEU A 1 43 ? -12.300 2.113   -7.858  1.00 0.00 ? 43 LEU A HA   5  
ATOM 5711  H HB3  . LEU A 1 43 ? -9.592  1.278   -8.884  1.00 0.00 ? 43 LEU A HB3  5  
ATOM 5712  H HG   . LEU A 1 43 ? -11.135 -0.442  -7.774  1.00 0.00 ? 43 LEU A HG   5  
ATOM 5713  H HD11 . LEU A 1 43 ? -12.966 -1.309  -9.168  1.00 0.00 ? 43 LEU A HD11 5  
ATOM 5714  H HD12 . LEU A 1 43 ? -13.259 0.364   -8.637  1.00 0.00 ? 43 LEU A HD12 5  
ATOM 5715  H HD13 . LEU A 1 43 ? -12.730 0.040   -10.306 1.00 0.00 ? 43 LEU A HD13 5  
ATOM 5716  H HD21 . LEU A 1 43 ? -9.641  -1.666  -8.887  1.00 0.00 ? 43 LEU A HD21 5  
ATOM 5717  H HD22 . LEU A 1 43 ? -10.881 -1.829  -10.153 1.00 0.00 ? 43 LEU A HD22 5  
ATOM 5718  H HD23 . LEU A 1 43 ? -9.640  -0.559  -10.280 1.00 0.00 ? 43 LEU A HD23 5  
ATOM 5719  N N    . LEU A 1 44 ? -9.438  2.675   -6.355  1.00 0.00 ? 44 LEU A N    5  
ATOM 5720  C CA   . LEU A 1 44 ? -8.748  2.595   -5.079  1.00 0.00 ? 44 LEU A CA   5  
ATOM 5721  C C    . LEU A 1 44 ? -7.771  3.766   -4.958  1.00 0.00 ? 44 LEU A C    5  
ATOM 5722  O O    . LEU A 1 44 ? -6.767  3.817   -5.666  1.00 0.00 ? 44 LEU A O    5  
ATOM 5723  C CB   . LEU A 1 44 ? -8.088  1.224   -4.913  1.00 0.00 ? 44 LEU A CB   5  
ATOM 5724  C CG   . LEU A 1 44 ? -7.042  1.114   -3.803  1.00 0.00 ? 44 LEU A CG   5  
ATOM 5725  C CD1  . LEU A 1 44 ? -7.510  1.828   -2.533  1.00 0.00 ? 44 LEU A CD1  5  
ATOM 5726  C CD2  . LEU A 1 44 ? -6.676  -0.347  -3.537  1.00 0.00 ? 44 LEU A CD2  5  
ATOM 5727  H H    . LEU A 1 44 ? -8.954  3.186   -7.066  1.00 0.00 ? 44 LEU A H    5  
ATOM 5728  H HA   . LEU A 1 44 ? -9.499  2.689   -4.294  1.00 0.00 ? 44 LEU A HA   5  
ATOM 5729  H HB3  . LEU A 1 44 ? -7.618  0.953   -5.857  1.00 0.00 ? 44 LEU A HB3  5  
ATOM 5730  H HG   . LEU A 1 44 ? -6.135  1.617   -4.138  1.00 0.00 ? 44 LEU A HG   5  
ATOM 5731  H HD11 . LEU A 1 44 ? -6.843  1.579   -1.709  1.00 0.00 ? 44 LEU A HD11 5  
ATOM 5732  H HD12 . LEU A 1 44 ? -7.500  2.905   -2.697  1.00 0.00 ? 44 LEU A HD12 5  
ATOM 5733  H HD13 . LEU A 1 44 ? -8.524  1.508   -2.290  1.00 0.00 ? 44 LEU A HD13 5  
ATOM 5734  H HD21 . LEU A 1 44 ? -6.807  -0.567  -2.476  1.00 0.00 ? 44 LEU A HD21 5  
ATOM 5735  H HD22 . LEU A 1 44 ? -7.325  -0.997  -4.125  1.00 0.00 ? 44 LEU A HD22 5  
ATOM 5736  H HD23 . LEU A 1 44 ? -5.638  -0.520  -3.818  1.00 0.00 ? 44 LEU A HD23 5  
ATOM 5737  N N    . ALA A 1 45 ? -8.099  4.677   -4.055  1.00 0.00 ? 45 ALA A N    5  
ATOM 5738  C CA   . ALA A 1 45 ? -7.263  5.845   -3.831  1.00 0.00 ? 45 ALA A CA   5  
ATOM 5739  C C    . ALA A 1 45 ? -6.385  5.610   -2.600  1.00 0.00 ? 45 ALA A C    5  
ATOM 5740  O O    . ALA A 1 45 ? -6.872  5.166   -1.562  1.00 0.00 ? 45 ALA A O    5  
ATOM 5741  C CB   . ALA A 1 45 ? -8.146  7.086   -3.690  1.00 0.00 ? 45 ALA A CB   5  
ATOM 5742  H H    . ALA A 1 45 ? -8.918  4.629   -3.482  1.00 0.00 ? 45 ALA A H    5  
ATOM 5743  H HA   . ALA A 1 45 ? -6.624  5.967   -4.705  1.00 0.00 ? 45 ALA A HA   5  
ATOM 5744  H HB1  . ALA A 1 45 ? -8.880  6.922   -2.900  1.00 0.00 ? 45 ALA A HB1  5  
ATOM 5745  H HB2  . ALA A 1 45 ? -7.526  7.946   -3.435  1.00 0.00 ? 45 ALA A HB2  5  
ATOM 5746  H HB3  . ALA A 1 45 ? -8.661  7.276   -4.631  1.00 0.00 ? 45 ALA A HB3  5  
ATOM 5747  N N    . VAL A 1 46 ? -5.106  5.918   -2.758  1.00 0.00 ? 46 VAL A N    5  
ATOM 5748  C CA   . VAL A 1 46 ? -4.155  5.746   -1.673  1.00 0.00 ? 46 VAL A CA   5  
ATOM 5749  C C    . VAL A 1 46 ? -3.988  7.075   -0.933  1.00 0.00 ? 46 VAL A C    5  
ATOM 5750  O O    . VAL A 1 46 ? -3.451  8.034   -1.485  1.00 0.00 ? 46 VAL A O    5  
ATOM 5751  C CB   . VAL A 1 46 ? -2.836  5.193   -2.215  1.00 0.00 ? 46 VAL A CB   5  
ATOM 5752  C CG1  . VAL A 1 46 ? -1.849  4.916   -1.079  1.00 0.00 ? 46 VAL A CG1  5  
ATOM 5753  C CG2  . VAL A 1 46 ? -3.073  3.936   -3.054  1.00 0.00 ? 46 VAL A CG2  5  
ATOM 5754  H H    . VAL A 1 46 ? -4.717  6.278   -3.606  1.00 0.00 ? 46 VAL A H    5  
ATOM 5755  H HA   . VAL A 1 46 ? -4.573  5.011   -0.984  1.00 0.00 ? 46 VAL A HA   5  
ATOM 5756  H HB   . VAL A 1 46 ? -2.397  5.950   -2.863  1.00 0.00 ? 46 VAL A HB   5  
ATOM 5757  H HG11 . VAL A 1 46 ? -1.887  5.733   -0.357  1.00 0.00 ? 46 VAL A HG11 5  
ATOM 5758  H HG12 . VAL A 1 46 ? -2.117  3.982   -0.584  1.00 0.00 ? 46 VAL A HG12 5  
ATOM 5759  H HG13 . VAL A 1 46 ? -0.840  4.837   -1.485  1.00 0.00 ? 46 VAL A HG13 5  
ATOM 5760  H HG21 . VAL A 1 46 ? -2.532  3.098   -2.613  1.00 0.00 ? 46 VAL A HG21 5  
ATOM 5761  H HG22 . VAL A 1 46 ? -4.139  3.708   -3.076  1.00 0.00 ? 46 VAL A HG22 5  
ATOM 5762  H HG23 . VAL A 1 46 ? -2.715  4.104   -4.070  1.00 0.00 ? 46 VAL A HG23 5  
ATOM 5763  N N    . GLN A 1 47 ? -4.456  7.089   0.307   1.00 0.00 ? 47 GLN A N    5  
ATOM 5764  C CA   . GLN A 1 47 ? -4.364  8.284   1.129   1.00 0.00 ? 47 GLN A CA   5  
ATOM 5765  C C    . GLN A 1 47 ? -3.350  8.076   2.256   1.00 0.00 ? 47 GLN A C    5  
ATOM 5766  O O    . GLN A 1 47 ? -2.950  6.947   2.535   1.00 0.00 ? 47 GLN A O    5  
ATOM 5767  C CB   . GLN A 1 47 ? -5.735  8.671   1.689   1.00 0.00 ? 47 GLN A CB   5  
ATOM 5768  C CG   . GLN A 1 47 ? -6.611  9.300   0.605   1.00 0.00 ? 47 GLN A CG   5  
ATOM 5769  C CD   . GLN A 1 47 ? -6.255  10.773  0.398   1.00 0.00 ? 47 GLN A CD   5  
ATOM 5770  O OE1  . GLN A 1 47 ? -5.945  11.500  1.328   1.00 0.00 ? 47 GLN A OE1  5  
ATOM 5771  N NE2  . GLN A 1 47 ? -6.315  11.172  -0.868  1.00 0.00 ? 47 GLN A NE2  5  
ATOM 5772  H H    . GLN A 1 47 ? -4.891  6.304   0.749   1.00 0.00 ? 47 GLN A H    5  
ATOM 5773  H HA   . GLN A 1 47 ? -4.017  9.069   0.458   1.00 0.00 ? 47 GLN A HA   5  
ATOM 5774  H HB3  . GLN A 1 47 ? -5.609  9.372   2.514   1.00 0.00 ? 47 GLN A HB3  5  
ATOM 5775  H HG3  . GLN A 1 47 ? -7.661  9.213   0.885   1.00 0.00 ? 47 GLN A HG3  5  
ATOM 5776  H HE21 . GLN A 1 47 ? -6.576  10.525  -1.585  1.00 0.00 ? 47 GLN A HE21 5  
ATOM 5777  H HE22 . GLN A 1 47 ? -6.099  12.119  -1.105  1.00 0.00 ? 47 GLN A HE22 5  
ATOM 5778  N N    . GLY A 1 48 ? -2.963  9.184   2.870   1.00 0.00 ? 48 GLY A N    5  
ATOM 5779  C CA   . GLY A 1 48 ? -2.002  9.138   3.960   1.00 0.00 ? 48 GLY A CA   5  
ATOM 5780  C C    . GLY A 1 48 ? -0.621  8.716   3.456   1.00 0.00 ? 48 GLY A C    5  
ATOM 5781  O O    . GLY A 1 48 ? 0.138   8.072   4.180   1.00 0.00 ? 48 GLY A O    5  
ATOM 5782  H H    . GLY A 1 48 ? -3.292  10.099  2.636   1.00 0.00 ? 48 GLY A H    5  
ATOM 5783  H HA2  . GLY A 1 48 ? -1.937  10.118  4.433   1.00 0.00 ? 48 GLY A HA2  5  
ATOM 5784  H HA3  . GLY A 1 48 ? -2.345  8.438   4.722   1.00 0.00 ? 48 GLY A HA3  5  
ATOM 5785  N N    . LEU A 1 49 ? -0.336  9.095   2.219   1.00 0.00 ? 49 LEU A N    5  
ATOM 5786  C CA   . LEU A 1 49 ? 0.941   8.763   1.610   1.00 0.00 ? 49 LEU A CA   5  
ATOM 5787  C C    . LEU A 1 49 ? 2.021   9.696   2.160   1.00 0.00 ? 49 LEU A C    5  
ATOM 5788  O O    . LEU A 1 49 ? 1.712   10.721  2.766   1.00 0.00 ? 49 LEU A O    5  
ATOM 5789  C CB   . LEU A 1 49 ? 0.829   8.785   0.084   1.00 0.00 ? 49 LEU A CB   5  
ATOM 5790  C CG   . LEU A 1 49 ? 0.425   7.466   -0.578  1.00 0.00 ? 49 LEU A CG   5  
ATOM 5791  C CD1  . LEU A 1 49 ? -0.194  7.710   -1.956  1.00 0.00 ? 49 LEU A CD1  5  
ATOM 5792  C CD2  . LEU A 1 49 ? 1.611   6.501   -0.644  1.00 0.00 ? 49 LEU A CD2  5  
ATOM 5793  H H    . LEU A 1 49 ? -0.959  9.618   1.637   1.00 0.00 ? 49 LEU A H    5  
ATOM 5794  H HA   . LEU A 1 49 ? 1.186   7.742   1.901   1.00 0.00 ? 49 LEU A HA   5  
ATOM 5795  H HB3  . LEU A 1 49 ? 1.789   9.096   -0.327  1.00 0.00 ? 49 LEU A HB3  5  
ATOM 5796  H HG   . LEU A 1 49 ? -0.340  6.994   0.040   1.00 0.00 ? 49 LEU A HG   5  
ATOM 5797  H HD11 . LEU A 1 49 ? -1.061  8.362   -1.853  1.00 0.00 ? 49 LEU A HD11 5  
ATOM 5798  H HD12 . LEU A 1 49 ? 0.543   8.184   -2.605  1.00 0.00 ? 49 LEU A HD12 5  
ATOM 5799  H HD13 . LEU A 1 49 ? -0.502  6.758   -2.388  1.00 0.00 ? 49 LEU A HD13 5  
ATOM 5800  H HD21 . LEU A 1 49 ? 2.425   6.964   -1.204  1.00 0.00 ? 49 LEU A HD21 5  
ATOM 5801  H HD22 . LEU A 1 49 ? 1.950   6.271   0.365   1.00 0.00 ? 49 LEU A HD22 5  
ATOM 5802  H HD23 . LEU A 1 49 ? 1.304   5.582   -1.143  1.00 0.00 ? 49 LEU A HD23 5  
ATOM 5803  N N    . PRO A 1 50 ? 3.300   9.298   1.924   1.00 0.00 ? 50 PRO A N    5  
ATOM 5804  C CA   . PRO A 1 50 ? 4.427   10.087  2.389   1.00 0.00 ? 50 PRO A CA   5  
ATOM 5805  C C    . PRO A 1 50 ? 4.619   11.334  1.523   1.00 0.00 ? 50 PRO A C    5  
ATOM 5806  O O    . PRO A 1 50 ? 5.088   11.240  0.390   1.00 0.00 ? 50 PRO A O    5  
ATOM 5807  C CB   . PRO A 1 50 ? 5.617   9.141   2.340   1.00 0.00 ? 50 PRO A CB   5  
ATOM 5808  C CG   . PRO A 1 50 ? 5.208   8.006   1.416   1.00 0.00 ? 50 PRO A CG   5  
ATOM 5809  C CD   . PRO A 1 50 ? 3.704   8.090   1.210   1.00 0.00 ? 50 PRO A CD   5  
ATOM 5810  H HA   . PRO A 1 50 ? 4.258   10.421  3.316   1.00 0.00 ? 50 PRO A HA   5  
ATOM 5811  H HB3  . PRO A 1 50 ? 5.859   8.767   3.335   1.00 0.00 ? 50 PRO A HB3  5  
ATOM 5812  H HG3  . PRO A 1 50 ? 5.480   7.044   1.850   1.00 0.00 ? 50 PRO A HG3  5  
ATOM 5813  H HD3  . PRO A 1 50 ? 3.200   7.209   1.606   1.00 0.00 ? 50 PRO A HD3  5  
ATOM 5814  N N    . GLU A 1 51 ? 4.247   12.472  2.090   1.00 0.00 ? 51 GLU A N    5  
ATOM 5815  C CA   . GLU A 1 51 ? 4.371   13.735  1.383   1.00 0.00 ? 51 GLU A CA   5  
ATOM 5816  C C    . GLU A 1 51 ? 5.604   13.717  0.477   1.00 0.00 ? 51 GLU A C    5  
ATOM 5817  O O    . GLU A 1 51 ? 6.631   13.139  0.831   1.00 0.00 ? 51 GLU A O    5  
ATOM 5818  C CB   . GLU A 1 51 ? 4.430   14.909  2.364   1.00 0.00 ? 51 GLU A CB   5  
ATOM 5819  C CG   . GLU A 1 51 ? 3.088   15.095  3.076   1.00 0.00 ? 51 GLU A CG   5  
ATOM 5820  C CD   . GLU A 1 51 ? 3.222   16.062  4.254   1.00 0.00 ? 51 GLU A CD   5  
ATOM 5821  O OE1  . GLU A 1 51 ? 4.060   15.770  5.134   1.00 0.00 ? 51 GLU A OE1  5  
ATOM 5822  O OE2  . GLU A 1 51 ? 2.483   17.070  4.248   1.00 0.00 ? 51 GLU A OE2  5  
ATOM 5823  H H    . GLU A 1 51 ? 3.867   12.539  3.012   1.00 0.00 ? 51 GLU A H    5  
ATOM 5824  H HA   . GLU A 1 51 ? 3.469   13.820  0.779   1.00 0.00 ? 51 GLU A HA   5  
ATOM 5825  H HB3  . GLU A 1 51 ? 4.693   15.822  1.830   1.00 0.00 ? 51 GLU A HB3  5  
ATOM 5826  H HG3  . GLU A 1 51 ? 2.723   14.132  3.430   1.00 0.00 ? 51 GLU A HG3  5  
ATOM 5827  N N    . GLY A 1 52 ? 5.462   14.357  -0.674  1.00 0.00 ? 52 GLY A N    5  
ATOM 5828  C CA   . GLY A 1 52 ? 6.551   14.422  -1.634  1.00 0.00 ? 52 GLY A CA   5  
ATOM 5829  C C    . GLY A 1 52 ? 6.788   13.059  -2.288  1.00 0.00 ? 52 GLY A C    5  
ATOM 5830  O O    . GLY A 1 52 ? 7.910   12.556  -2.294  1.00 0.00 ? 52 GLY A O    5  
ATOM 5831  H H    . GLY A 1 52 ? 4.624   14.825  -0.955  1.00 0.00 ? 52 GLY A H    5  
ATOM 5832  H HA2  . GLY A 1 52 ? 6.321   15.162  -2.400  1.00 0.00 ? 52 GLY A HA2  5  
ATOM 5833  H HA3  . GLY A 1 52 ? 7.462   14.753  -1.134  1.00 0.00 ? 52 GLY A HA3  5  
ATOM 5834  N N    . LEU A 1 53 ? 5.712   12.501  -2.822  1.00 0.00 ? 53 LEU A N    5  
ATOM 5835  C CA   . LEU A 1 53 ? 5.788   11.205  -3.476  1.00 0.00 ? 53 LEU A CA   5  
ATOM 5836  C C    . LEU A 1 53 ? 4.571   11.027  -4.386  1.00 0.00 ? 53 LEU A C    5  
ATOM 5837  O O    . LEU A 1 53 ? 3.820   11.973  -4.619  1.00 0.00 ? 53 LEU A O    5  
ATOM 5838  C CB   . LEU A 1 53 ? 5.951   10.090  -2.442  1.00 0.00 ? 53 LEU A CB   5  
ATOM 5839  C CG   . LEU A 1 53 ? 7.389   9.679   -2.120  1.00 0.00 ? 53 LEU A CG   5  
ATOM 5840  C CD1  . LEU A 1 53 ? 7.417   8.436   -1.228  1.00 0.00 ? 53 LEU A CD1  5  
ATOM 5841  C CD2  . LEU A 1 53 ? 8.204   9.485   -3.400  1.00 0.00 ? 53 LEU A CD2  5  
ATOM 5842  H H    . LEU A 1 53 ? 4.803   12.916  -2.813  1.00 0.00 ? 53 LEU A H    5  
ATOM 5843  H HA   . LEU A 1 53 ? 6.686   11.205  -4.096  1.00 0.00 ? 53 LEU A HA   5  
ATOM 5844  H HB3  . LEU A 1 53 ? 5.414   9.212   -2.797  1.00 0.00 ? 53 LEU A HB3  5  
ATOM 5845  H HG   . LEU A 1 53 ? 7.859   10.488  -1.560  1.00 0.00 ? 53 LEU A HG   5  
ATOM 5846  H HD11 . LEU A 1 53 ? 8.272   7.815   -1.497  1.00 0.00 ? 53 LEU A HD11 5  
ATOM 5847  H HD12 . LEU A 1 53 ? 7.502   8.740   -0.185  1.00 0.00 ? 53 LEU A HD12 5  
ATOM 5848  H HD13 . LEU A 1 53 ? 6.497   7.868   -1.367  1.00 0.00 ? 53 LEU A HD13 5  
ATOM 5849  H HD21 . LEU A 1 53 ? 7.550   9.123   -4.195  1.00 0.00 ? 53 LEU A HD21 5  
ATOM 5850  H HD22 . LEU A 1 53 ? 8.646   10.435  -3.698  1.00 0.00 ? 53 LEU A HD22 5  
ATOM 5851  H HD23 . LEU A 1 53 ? 8.994   8.756   -3.220  1.00 0.00 ? 53 LEU A HD23 5  
ATOM 5852  N N    . ALA A 1 54 ? 4.414   9.806   -4.879  1.00 0.00 ? 54 ALA A N    5  
ATOM 5853  C CA   . ALA A 1 54 ? 3.302   9.492   -5.759  1.00 0.00 ? 54 ALA A CA   5  
ATOM 5854  C C    . ALA A 1 54 ? 3.003   7.993   -5.680  1.00 0.00 ? 54 ALA A C    5  
ATOM 5855  O O    . ALA A 1 54 ? 3.921   7.175   -5.654  1.00 0.00 ? 54 ALA A O    5  
ATOM 5856  C CB   . ALA A 1 54 ? 3.631   9.947   -7.182  1.00 0.00 ? 54 ALA A CB   5  
ATOM 5857  H H    . ALA A 1 54 ? 5.030   9.043   -4.685  1.00 0.00 ? 54 ALA A H    5  
ATOM 5858  H HA   . ALA A 1 54 ? 2.432   10.046  -5.405  1.00 0.00 ? 54 ALA A HA   5  
ATOM 5859  H HB1  . ALA A 1 54 ? 2.714   10.001  -7.767  1.00 0.00 ? 54 ALA A HB1  5  
ATOM 5860  H HB2  . ALA A 1 54 ? 4.101   10.930  -7.149  1.00 0.00 ? 54 ALA A HB2  5  
ATOM 5861  H HB3  . ALA A 1 54 ? 4.313   9.233   -7.642  1.00 0.00 ? 54 ALA A HB3  5  
ATOM 5862  N N    . PHE A 1 55 ? 1.716   7.680   -5.644  1.00 0.00 ? 55 PHE A N    5  
ATOM 5863  C CA   . PHE A 1 55 ? 1.286   6.294   -5.569  1.00 0.00 ? 55 PHE A CA   5  
ATOM 5864  C C    . PHE A 1 55 ? 1.814   5.490   -6.758  1.00 0.00 ? 55 PHE A C    5  
ATOM 5865  O O    . PHE A 1 55 ? 1.367   5.680   -7.889  1.00 0.00 ? 55 PHE A O    5  
ATOM 5866  C CB   . PHE A 1 55 ? -0.243  6.298   -5.610  1.00 0.00 ? 55 PHE A CB   5  
ATOM 5867  C CG   . PHE A 1 55 ? -0.864  4.918   -5.839  1.00 0.00 ? 55 PHE A CG   5  
ATOM 5868  C CD1  . PHE A 1 55 ? -0.461  3.859   -5.085  1.00 0.00 ? 55 PHE A CD1  5  
ATOM 5869  C CD2  . PHE A 1 55 ? -1.816  4.750   -6.793  1.00 0.00 ? 55 PHE A CD2  5  
ATOM 5870  C CE1  . PHE A 1 55 ? -1.038  2.578   -5.296  1.00 0.00 ? 55 PHE A CE1  5  
ATOM 5871  C CE2  . PHE A 1 55 ? -2.392  3.468   -7.005  1.00 0.00 ? 55 PHE A CE2  5  
ATOM 5872  C CZ   . PHE A 1 55 ? -1.990  2.410   -6.252  1.00 0.00 ? 55 PHE A CZ   5  
ATOM 5873  H H    . PHE A 1 55 ? 0.976   8.351   -5.665  1.00 0.00 ? 55 PHE A H    5  
ATOM 5874  H HA   . PHE A 1 55 ? 1.689   5.880   -4.645  1.00 0.00 ? 55 PHE A HA   5  
ATOM 5875  H HB3  . PHE A 1 55 ? -0.574  6.969   -6.405  1.00 0.00 ? 55 PHE A HB3  5  
ATOM 5876  H HD1  . PHE A 1 55 ? 0.302   3.994   -4.320  1.00 0.00 ? 55 PHE A HD1  5  
ATOM 5877  H HD2  . PHE A 1 55 ? -2.139  5.598   -7.398  1.00 0.00 ? 55 PHE A HD2  5  
ATOM 5878  H HE1  . PHE A 1 55 ? -0.715  1.730   -4.693  1.00 0.00 ? 55 PHE A HE1  5  
ATOM 5879  H HE2  . PHE A 1 55 ? -3.156  3.334   -7.771  1.00 0.00 ? 55 PHE A HE2  5  
ATOM 5880  H HZ   . PHE A 1 55 ? -2.432  1.426   -6.415  1.00 0.00 ? 55 PHE A HZ   5  
ATOM 5881  N N    . ARG A 1 56 ? 2.758   4.609   -6.463  1.00 0.00 ? 56 ARG A N    5  
ATOM 5882  C CA   . ARG A 1 56 ? 3.353   3.775   -7.495  1.00 0.00 ? 56 ARG A CA   5  
ATOM 5883  C C    . ARG A 1 56 ? 4.097   2.597   -6.861  1.00 0.00 ? 56 ARG A C    5  
ATOM 5884  O O    . ARG A 1 56 ? 4.388   2.612   -5.667  1.00 0.00 ? 56 ARG A O    5  
ATOM 5885  C CB   . ARG A 1 56 ? 4.326   4.579   -8.360  1.00 0.00 ? 56 ARG A CB   5  
ATOM 5886  C CG   . ARG A 1 56 ? 5.033   5.655   -7.533  1.00 0.00 ? 56 ARG A CG   5  
ATOM 5887  C CD   . ARG A 1 56 ? 6.510   5.762   -7.923  1.00 0.00 ? 56 ARG A CD   5  
ATOM 5888  N NE   . ARG A 1 56 ? 6.633   6.348   -9.276  1.00 0.00 ? 56 ARG A NE   5  
ATOM 5889  C CZ   . ARG A 1 56 ? 7.803   6.588   -9.888  1.00 0.00 ? 56 ARG A CZ   5  
ATOM 5890  N NH1  . ARG A 1 56 ? 8.954   6.292   -9.269  1.00 0.00 ? 56 ARG A NH1  5  
ATOM 5891  N NH2  . ARG A 1 56 ? 7.819   7.121   -11.117 1.00 0.00 ? 56 ARG A NH2  5  
ATOM 5892  H H    . ARG A 1 56 ? 3.116   4.459   -5.542  1.00 0.00 ? 56 ARG A H    5  
ATOM 5893  H HA   . ARG A 1 56 ? 2.511   3.430   -8.094  1.00 0.00 ? 56 ARG A HA   5  
ATOM 5894  H HB3  . ARG A 1 56 ? 3.786   5.045   -9.184  1.00 0.00 ? 56 ARG A HB3  5  
ATOM 5895  H HG3  . ARG A 1 56 ? 4.951   5.417   -6.472  1.00 0.00 ? 56 ARG A HG3  5  
ATOM 5896  H HD3  . ARG A 1 56 ? 6.974   4.777   -7.901  1.00 0.00 ? 56 ARG A HD3  5  
ATOM 5897  H HE   . ARG A 1 56 ? 5.793   6.581   -9.766  1.00 0.00 ? 56 ARG A HE   5  
ATOM 5898  H HH11 . ARG A 1 56 ? 8.942   5.894   -8.352  1.00 0.00 ? 56 ARG A HH11 5  
ATOM 5899  H HH12 . ARG A 1 56 ? 9.826   6.471   -9.726  1.00 0.00 ? 56 ARG A HH12 5  
ATOM 5900  H HH21 . ARG A 1 56 ? 6.960   7.341   -11.577 1.00 0.00 ? 56 ARG A HH21 5  
ATOM 5901  H HH22 . ARG A 1 56 ? 8.691   7.300   -11.572 1.00 0.00 ? 56 ARG A HH22 5  
ATOM 5902  N N    . ARG A 1 57 ? 4.384   1.605   -7.692  1.00 0.00 ? 57 ARG A N    5  
ATOM 5903  C CA   . ARG A 1 57 ? 5.089   0.422   -7.229  1.00 0.00 ? 57 ARG A CA   5  
ATOM 5904  C C    . ARG A 1 57 ? 6.147   0.806   -6.193  1.00 0.00 ? 57 ARG A C    5  
ATOM 5905  O O    . ARG A 1 57 ? 6.723   1.890   -6.261  1.00 0.00 ? 57 ARG A O    5  
ATOM 5906  C CB   . ARG A 1 57 ? 5.764   -0.307  -8.392  1.00 0.00 ? 57 ARG A CB   5  
ATOM 5907  C CG   . ARG A 1 57 ? 5.008   -1.589  -8.748  1.00 0.00 ? 57 ARG A CG   5  
ATOM 5908  C CD   . ARG A 1 57 ? 5.320   -2.029  -10.180 1.00 0.00 ? 57 ARG A CD   5  
ATOM 5909  N NE   . ARG A 1 57 ? 4.065   -2.173  -10.951 1.00 0.00 ? 57 ARG A NE   5  
ATOM 5910  C CZ   . ARG A 1 57 ? 3.994   -2.703  -12.179 1.00 0.00 ? 57 ARG A CZ   5  
ATOM 5911  N NH1  . ARG A 1 57 ? 5.105   -3.141  -12.785 1.00 0.00 ? 57 ARG A NH1  5  
ATOM 5912  N NH2  . ARG A 1 57 ? 2.811   -2.793  -12.803 1.00 0.00 ? 57 ARG A NH2  5  
ATOM 5913  H H    . ARG A 1 57 ? 4.145   1.602   -8.663  1.00 0.00 ? 57 ARG A H    5  
ATOM 5914  H HA   . ARG A 1 57 ? 4.316   -0.207  -6.785  1.00 0.00 ? 57 ARG A HA   5  
ATOM 5915  H HB3  . ARG A 1 57 ? 6.793   -0.550  -8.126  1.00 0.00 ? 57 ARG A HB3  5  
ATOM 5916  H HG3  . ARG A 1 57 ? 3.936   -1.426  -8.640  1.00 0.00 ? 57 ARG A HG3  5  
ATOM 5917  H HD3  . ARG A 1 57 ? 5.860   -2.976  -10.169 1.00 0.00 ? 57 ARG A HD3  5  
ATOM 5918  H HE   . ARG A 1 57 ? 3.216   -1.855  -10.527 1.00 0.00 ? 57 ARG A HE   5  
ATOM 5919  H HH11 . ARG A 1 57 ? 5.988   -3.073  -12.320 1.00 0.00 ? 57 ARG A HH11 5  
ATOM 5920  H HH12 . ARG A 1 57 ? 5.052   -3.536  -13.702 1.00 0.00 ? 57 ARG A HH12 5  
ATOM 5921  H HH21 . ARG A 1 57 ? 1.981   -2.466  -12.350 1.00 0.00 ? 57 ARG A HH21 5  
ATOM 5922  H HH22 . ARG A 1 57 ? 2.757   -3.188  -13.720 1.00 0.00 ? 57 ARG A HH22 5  
ATOM 5923  N N    . PRO A 1 58 ? 6.377   -0.129  -5.232  1.00 0.00 ? 58 PRO A N    5  
ATOM 5924  C CA   . PRO A 1 58 ? 7.356   0.101   -4.183  1.00 0.00 ? 58 PRO A CA   5  
ATOM 5925  C C    . PRO A 1 58 ? 8.780   -0.051  -4.720  1.00 0.00 ? 58 PRO A C    5  
ATOM 5926  O O    . PRO A 1 58 ? 9.731   0.440   -4.114  1.00 0.00 ? 58 PRO A O    5  
ATOM 5927  C CB   . PRO A 1 58 ? 7.018   -0.913  -3.101  1.00 0.00 ? 58 PRO A CB   5  
ATOM 5928  C CG   . PRO A 1 58 ? 6.165   -1.974  -3.776  1.00 0.00 ? 58 PRO A CG   5  
ATOM 5929  C CD   . PRO A 1 58 ? 5.713   -1.425  -5.120  1.00 0.00 ? 58 PRO A CD   5  
ATOM 5930  H HA   . PRO A 1 58 ? 7.289   1.040   -3.845  1.00 0.00 ? 58 PRO A HA   5  
ATOM 5931  H HB3  . PRO A 1 58 ? 6.478   -0.441  -2.280  1.00 0.00 ? 58 PRO A HB3  5  
ATOM 5932  H HG3  . PRO A 1 58 ? 5.303   -2.222  -3.157  1.00 0.00 ? 58 PRO A HG3  5  
ATOM 5933  H HD3  . PRO A 1 58 ? 4.629   -1.319  -5.160  1.00 0.00 ? 58 PRO A HD3  5  
ATOM 5934  N N    . ALA A 1 59 ? 8.883   -0.732  -5.851  1.00 0.00 ? 59 ALA A N    5  
ATOM 5935  C CA   . ALA A 1 59 ? 10.175  -0.955  -6.477  1.00 0.00 ? 59 ALA A CA   5  
ATOM 5936  C C    . ALA A 1 59 ? 10.521  0.244   -7.364  1.00 0.00 ? 59 ALA A C    5  
ATOM 5937  O O    . ALA A 1 59 ? 11.679  0.435   -7.731  1.00 0.00 ? 59 ALA A O    5  
ATOM 5938  C CB   . ALA A 1 59 ? 10.145  -2.269  -7.260  1.00 0.00 ? 59 ALA A CB   5  
ATOM 5939  H H    . ALA A 1 59 ? 8.104   -1.128  -6.339  1.00 0.00 ? 59 ALA A H    5  
ATOM 5940  H HA   . ALA A 1 59 ? 10.919  -1.036  -5.684  1.00 0.00 ? 59 ALA A HA   5  
ATOM 5941  H HB1  . ALA A 1 59 ? 11.164  -2.579  -7.488  1.00 0.00 ? 59 ALA A HB1  5  
ATOM 5942  H HB2  . ALA A 1 59 ? 9.657   -3.037  -6.660  1.00 0.00 ? 59 ALA A HB2  5  
ATOM 5943  H HB3  . ALA A 1 59 ? 9.591   -2.126  -8.188  1.00 0.00 ? 59 ALA A HB3  5  
ATOM 5944  N N    . GLU A 1 60 ? 9.495   1.020   -7.681  1.00 0.00 ? 60 GLU A N    5  
ATOM 5945  C CA   . GLU A 1 60 ? 9.675   2.194   -8.517  1.00 0.00 ? 60 GLU A CA   5  
ATOM 5946  C C    . GLU A 1 60 ? 9.989   3.418   -7.654  1.00 0.00 ? 60 GLU A C    5  
ATOM 5947  O O    . GLU A 1 60 ? 10.473  4.430   -8.157  1.00 0.00 ? 60 GLU A O    5  
ATOM 5948  C CB   . GLU A 1 60 ? 8.443   2.441   -9.390  1.00 0.00 ? 60 GLU A CB   5  
ATOM 5949  C CG   . GLU A 1 60 ? 8.327   1.381   -10.487 1.00 0.00 ? 60 GLU A CG   5  
ATOM 5950  C CD   . GLU A 1 60 ? 8.343   2.024   -11.875 1.00 0.00 ? 60 GLU A CD   5  
ATOM 5951  O OE1  . GLU A 1 60 ? 7.347   2.709   -12.194 1.00 0.00 ? 60 GLU A OE1  5  
ATOM 5952  O OE2  . GLU A 1 60 ? 9.349   1.816   -12.585 1.00 0.00 ? 60 GLU A OE2  5  
ATOM 5953  H H    . GLU A 1 60 ? 8.556   0.857   -7.378  1.00 0.00 ? 60 GLU A H    5  
ATOM 5954  H HA   . GLU A 1 60 ? 10.527  1.965   -9.158  1.00 0.00 ? 60 GLU A HA   5  
ATOM 5955  H HB3  . GLU A 1 60 ? 8.505   3.431   -9.842  1.00 0.00 ? 60 GLU A HB3  5  
ATOM 5956  H HG3  . GLU A 1 60 ? 7.405   0.815   -10.354 1.00 0.00 ? 60 GLU A HG3  5  
ATOM 5957  N N    . TYR A 1 61 ? 9.702   3.284   -6.368  1.00 0.00 ? 61 TYR A N    5  
ATOM 5958  C CA   . TYR A 1 61 ? 9.947   4.366   -5.429  1.00 0.00 ? 61 TYR A CA   5  
ATOM 5959  C C    . TYR A 1 61 ? 11.446  4.545   -5.179  1.00 0.00 ? 61 TYR A C    5  
ATOM 5960  O O    . TYR A 1 61 ? 12.254  3.725   -5.611  1.00 0.00 ? 61 TYR A O    5  
ATOM 5961  C CB   . TYR A 1 61 ? 9.270   3.951   -4.121  1.00 0.00 ? 61 TYR A CB   5  
ATOM 5962  C CG   . TYR A 1 61 ? 7.896   4.589   -3.902  1.00 0.00 ? 61 TYR A CG   5  
ATOM 5963  C CD1  . TYR A 1 61 ? 7.683   5.905   -4.256  1.00 0.00 ? 61 TYR A CD1  5  
ATOM 5964  C CD2  . TYR A 1 61 ? 6.872   3.847   -3.350  1.00 0.00 ? 61 TYR A CD2  5  
ATOM 5965  C CE1  . TYR A 1 61 ? 6.390   6.506   -4.050  1.00 0.00 ? 61 TYR A CE1  5  
ATOM 5966  C CE2  . TYR A 1 61 ? 5.579   4.448   -3.143  1.00 0.00 ? 61 TYR A CE2  5  
ATOM 5967  C CZ   . TYR A 1 61 ? 5.402   5.748   -3.503  1.00 0.00 ? 61 TYR A CZ   5  
ATOM 5968  O OH   . TYR A 1 61 ? 4.181   6.314   -3.309  1.00 0.00 ? 61 TYR A OH   5  
ATOM 5969  H H    . TYR A 1 61 ? 9.308   2.457   -5.965  1.00 0.00 ? 61 TYR A H    5  
ATOM 5970  H HA   . TYR A 1 61 ? 9.546   5.283   -5.861  1.00 0.00 ? 61 TYR A HA   5  
ATOM 5971  H HB3  . TYR A 1 61 ? 9.920   4.218   -3.288  1.00 0.00 ? 61 TYR A HB3  5  
ATOM 5972  H HD1  . TYR A 1 61 ? 8.492   6.490   -4.693  1.00 0.00 ? 61 TYR A HD1  5  
ATOM 5973  H HD2  . TYR A 1 61 ? 7.041   2.808   -3.069  1.00 0.00 ? 61 TYR A HD2  5  
ATOM 5974  H HE1  . TYR A 1 61 ? 6.207   7.544   -4.326  1.00 0.00 ? 61 TYR A HE1  5  
ATOM 5975  H HE2  . TYR A 1 61 ? 4.761   3.873   -2.708  1.00 0.00 ? 61 TYR A HE2  5  
ATOM 5976  H HH   . TYR A 1 61 ? 4.153   7.219   -3.733  1.00 0.00 ? 61 TYR A HH   5  
ATOM 5977  N N    . ASP A 1 62 ? 11.772  5.624   -4.483  1.00 0.00 ? 62 ASP A N    5  
ATOM 5978  C CA   . ASP A 1 62 ? 13.160  5.922   -4.170  1.00 0.00 ? 62 ASP A CA   5  
ATOM 5979  C C    . ASP A 1 62 ? 13.565  5.170   -2.901  1.00 0.00 ? 62 ASP A C    5  
ATOM 5980  O O    . ASP A 1 62 ? 12.764  4.429   -2.332  1.00 0.00 ? 62 ASP A O    5  
ATOM 5981  C CB   . ASP A 1 62 ? 13.358  7.418   -3.918  1.00 0.00 ? 62 ASP A CB   5  
ATOM 5982  C CG   . ASP A 1 62 ? 12.178  8.304   -4.318  1.00 0.00 ? 62 ASP A CG   5  
ATOM 5983  O OD1  . ASP A 1 62 ? 11.750  8.186   -5.487  1.00 0.00 ? 62 ASP A OD1  5  
ATOM 5984  O OD2  . ASP A 1 62 ? 11.728  9.079   -3.446  1.00 0.00 ? 62 ASP A OD2  5  
ATOM 5985  H H    . ASP A 1 62 ? 11.109  6.287   -4.135  1.00 0.00 ? 62 ASP A H    5  
ATOM 5986  H HA   . ASP A 1 62 ? 13.725  5.600   -5.044  1.00 0.00 ? 62 ASP A HA   5  
ATOM 5987  H HB3  . ASP A 1 62 ? 14.243  7.749   -4.462  1.00 0.00 ? 62 ASP A HB3  5  
ATOM 5988  N N    . PRO A 1 63 ? 14.839  5.392   -2.483  1.00 0.00 ? 63 PRO A N    5  
ATOM 5989  C CA   . PRO A 1 63 ? 15.361  4.744   -1.291  1.00 0.00 ? 63 PRO A CA   5  
ATOM 5990  C C    . PRO A 1 63 ? 14.795  5.390   -0.024  1.00 0.00 ? 63 PRO A C    5  
ATOM 5991  O O    . PRO A 1 63 ? 14.232  4.706   0.828   1.00 0.00 ? 63 PRO A O    5  
ATOM 5992  C CB   . PRO A 1 63 ? 16.871  4.874   -1.401  1.00 0.00 ? 63 PRO A CB   5  
ATOM 5993  C CG   . PRO A 1 63 ? 17.122  5.989   -2.404  1.00 0.00 ? 63 PRO A CG   5  
ATOM 5994  C CD   . PRO A 1 63 ? 15.815  6.264   -3.131  1.00 0.00 ? 63 PRO A CD   5  
ATOM 5995  H HA   . PRO A 1 63 ? 15.072  3.787   -1.262  1.00 0.00 ? 63 PRO A HA   5  
ATOM 5996  H HB3  . PRO A 1 63 ? 17.320  3.939   -1.735  1.00 0.00 ? 63 PRO A HB3  5  
ATOM 5997  H HG3  . PRO A 1 63 ? 17.898  5.697   -3.112  1.00 0.00 ? 63 PRO A HG3  5  
ATOM 5998  H HD3  . PRO A 1 63 ? 15.899  6.042   -4.195  1.00 0.00 ? 63 PRO A HD3  5  
ATOM 5999  N N    . LYS A 1 64 ? 14.967  6.702   0.060   1.00 0.00 ? 64 LYS A N    5  
ATOM 6000  C CA   . LYS A 1 64 ? 14.481  7.449   1.207   1.00 0.00 ? 64 LYS A CA   5  
ATOM 6001  C C    . LYS A 1 64 ? 12.952  7.405   1.229   1.00 0.00 ? 64 LYS A C    5  
ATOM 6002  O O    . LYS A 1 64 ? 12.337  7.560   2.283   1.00 0.00 ? 64 LYS A O    5  
ATOM 6003  C CB   . LYS A 1 64 ? 15.056  8.865   1.208   1.00 0.00 ? 64 LYS A CB   5  
ATOM 6004  C CG   . LYS A 1 64 ? 16.462  8.887   1.813   1.00 0.00 ? 64 LYS A CG   5  
ATOM 6005  C CD   . LYS A 1 64 ? 17.527  8.696   0.732   1.00 0.00 ? 64 LYS A CD   5  
ATOM 6006  C CE   . LYS A 1 64 ? 18.871  9.278   1.178   1.00 0.00 ? 64 LYS A CE   5  
ATOM 6007  N NZ   . LYS A 1 64 ? 19.890  8.211   1.277   1.00 0.00 ? 64 LYS A NZ   5  
ATOM 6008  H H    . LYS A 1 64 ? 15.426  7.252   -0.638  1.00 0.00 ? 64 LYS A H    5  
ATOM 6009  H HA   . LYS A 1 64 ? 14.853  6.949   2.103   1.00 0.00 ? 64 LYS A HA   5  
ATOM 6010  H HB3  . LYS A 1 64 ? 14.402  9.528   1.775   1.00 0.00 ? 64 LYS A HB3  5  
ATOM 6011  H HG3  . LYS A 1 64 ? 16.551  8.100   2.561   1.00 0.00 ? 64 LYS A HG3  5  
ATOM 6012  H HD3  . LYS A 1 64 ? 17.205  9.180   -0.190  1.00 0.00 ? 64 LYS A HD3  5  
ATOM 6013  H HE3  . LYS A 1 64 ? 18.757  9.773   2.142   1.00 0.00 ? 64 LYS A HE3  5  
ATOM 6014  H HZ1  . LYS A 1 64 ? 20.012  7.781   0.383   1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 6015  H HZ2  . LYS A 1 64 ? 20.758  8.606   1.578   1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 6016  H HZ3  . LYS A 1 64 ? 19.590  7.524   1.939   1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 6017  N N    . ALA A 1 65 ? 12.382  7.195   0.052   1.00 0.00 ? 65 ALA A N    5  
ATOM 6018  C CA   . ALA A 1 65 ? 10.936  7.130   -0.078  1.00 0.00 ? 65 ALA A CA   5  
ATOM 6019  C C    . ALA A 1 65 ? 10.409  5.939   0.725   1.00 0.00 ? 65 ALA A C    5  
ATOM 6020  O O    . ALA A 1 65 ? 9.609   6.110   1.643   1.00 0.00 ? 65 ALA A O    5  
ATOM 6021  C CB   . ALA A 1 65 ? 10.560  7.046   -1.559  1.00 0.00 ? 65 ALA A CB   5  
ATOM 6022  H H    . ALA A 1 65 ? 12.888  7.070   -0.801  1.00 0.00 ? 65 ALA A H    5  
ATOM 6023  H HA   . ALA A 1 65 ? 10.523  8.048   0.337   1.00 0.00 ? 65 ALA A HA   5  
ATOM 6024  H HB1  . ALA A 1 65 ? 11.390  6.619   -2.122  1.00 0.00 ? 65 ALA A HB1  5  
ATOM 6025  H HB2  . ALA A 1 65 ? 9.679   6.414   -1.675  1.00 0.00 ? 65 ALA A HB2  5  
ATOM 6026  H HB3  . ALA A 1 65 ? 10.341  8.046   -1.935  1.00 0.00 ? 65 ALA A HB3  5  
ATOM 6027  N N    . LEU A 1 66 ? 10.879  4.758   0.350   1.00 0.00 ? 66 LEU A N    5  
ATOM 6028  C CA   . LEU A 1 66 ? 10.465  3.539   1.024   1.00 0.00 ? 66 LEU A CA   5  
ATOM 6029  C C    . LEU A 1 66 ? 10.501  3.761   2.537   1.00 0.00 ? 66 LEU A C    5  
ATOM 6030  O O    . LEU A 1 66 ? 9.554   3.412   3.241   1.00 0.00 ? 66 LEU A O    5  
ATOM 6031  C CB   . LEU A 1 66 ? 11.313  2.354   0.556   1.00 0.00 ? 66 LEU A CB   5  
ATOM 6032  C CG   . LEU A 1 66 ? 11.223  2.011   -0.931  1.00 0.00 ? 66 LEU A CG   5  
ATOM 6033  C CD1  . LEU A 1 66 ? 12.248  0.941   -1.311  1.00 0.00 ? 66 LEU A CD1  5  
ATOM 6034  C CD2  . LEU A 1 66 ? 9.800   1.601   -1.315  1.00 0.00 ? 66 LEU A CD2  5  
ATOM 6035  H H    . LEU A 1 66 ? 11.529  4.627   -0.398  1.00 0.00 ? 66 LEU A H    5  
ATOM 6036  H HA   . LEU A 1 66 ? 9.436   3.336   0.728   1.00 0.00 ? 66 LEU A HA   5  
ATOM 6037  H HB3  . LEU A 1 66 ? 11.021  1.475   1.131   1.00 0.00 ? 66 LEU A HB3  5  
ATOM 6038  H HG   . LEU A 1 66 ? 11.466  2.906   -1.504  1.00 0.00 ? 66 LEU A HG   5  
ATOM 6039  H HD11 . LEU A 1 66 ? 12.233  0.143   -0.567  1.00 0.00 ? 66 LEU A HD11 5  
ATOM 6040  H HD12 . LEU A 1 66 ? 12.001  0.529   -2.289  1.00 0.00 ? 66 LEU A HD12 5  
ATOM 6041  H HD13 . LEU A 1 66 ? 13.243  1.386   -1.345  1.00 0.00 ? 66 LEU A HD13 5  
ATOM 6042  H HD21 . LEU A 1 66 ? 9.134   1.768   -0.468  1.00 0.00 ? 66 LEU A HD21 5  
ATOM 6043  H HD22 . LEU A 1 66 ? 9.465   2.199   -2.163  1.00 0.00 ? 66 LEU A HD22 5  
ATOM 6044  H HD23 . LEU A 1 66 ? 9.785   0.546   -1.587  1.00 0.00 ? 66 LEU A HD23 5  
ATOM 6045  N N    . MET A 1 67 ? 11.601  4.341   2.993   1.00 0.00 ? 67 MET A N    5  
ATOM 6046  C CA   . MET A 1 67 ? 11.772  4.614   4.410   1.00 0.00 ? 67 MET A CA   5  
ATOM 6047  C C    . MET A 1 67 ? 10.743  5.636   4.899   1.00 0.00 ? 67 MET A C    5  
ATOM 6048  O O    . MET A 1 67 ? 10.339  5.608   6.061   1.00 0.00 ? 67 MET A O    5  
ATOM 6049  C CB   . MET A 1 67 ? 13.183  5.149   4.660   1.00 0.00 ? 67 MET A CB   5  
ATOM 6050  C CG   . MET A 1 67 ? 14.173  4.004   4.883   1.00 0.00 ? 67 MET A CG   5  
ATOM 6051  S SD   . MET A 1 67 ? 15.845  4.630   4.867   1.00 0.00 ? 67 MET A SD   5  
ATOM 6052  C CE   . MET A 1 67 ? 16.171  4.596   3.112   1.00 0.00 ? 67 MET A CE   5  
ATOM 6053  H H    . MET A 1 67 ? 12.366  4.621   2.413   1.00 0.00 ? 67 MET A H    5  
ATOM 6054  H HA   . MET A 1 67 ? 11.614  3.660   4.913   1.00 0.00 ? 67 MET A HA   5  
ATOM 6055  H HB3  . MET A 1 67 ? 13.177  5.805   5.531   1.00 0.00 ? 67 MET A HB3  5  
ATOM 6056  H HG3  . MET A 1 67 ? 14.050  3.250   4.105   1.00 0.00 ? 67 MET A HG3  5  
ATOM 6057  H HE1  . MET A 1 67 ? 16.242  5.617   2.736   1.00 0.00 ? 67 MET A HE1  5  
ATOM 6058  H HE2  . MET A 1 67 ? 17.111  4.074   2.927   1.00 0.00 ? 67 MET A HE2  5  
ATOM 6059  H HE3  . MET A 1 67 ? 15.361  4.076   2.602   1.00 0.00 ? 67 MET A HE3  5  
ATOM 6060  N N    . ALA A 1 68 ? 10.349  6.513   3.989   1.00 0.00 ? 68 ALA A N    5  
ATOM 6061  C CA   . ALA A 1 68 ? 9.375   7.542   4.313   1.00 0.00 ? 68 ALA A CA   5  
ATOM 6062  C C    . ALA A 1 68 ? 7.969   6.943   4.252   1.00 0.00 ? 68 ALA A C    5  
ATOM 6063  O O    . ALA A 1 68 ? 7.017   7.530   4.767   1.00 0.00 ? 68 ALA A O    5  
ATOM 6064  C CB   . ALA A 1 68 ? 9.546   8.726   3.358   1.00 0.00 ? 68 ALA A CB   5  
ATOM 6065  H H    . ALA A 1 68 ? 10.682  6.529   3.045   1.00 0.00 ? 68 ALA A H    5  
ATOM 6066  H HA   . ALA A 1 68 ? 9.575   7.878   5.330   1.00 0.00 ? 68 ALA A HA   5  
ATOM 6067  H HB1  . ALA A 1 68 ? 10.125  8.412   2.490   1.00 0.00 ? 68 ALA A HB1  5  
ATOM 6068  H HB2  . ALA A 1 68 ? 8.566   9.076   3.035   1.00 0.00 ? 68 ALA A HB2  5  
ATOM 6069  H HB3  . ALA A 1 68 ? 10.069  9.533   3.872   1.00 0.00 ? 68 ALA A HB3  5  
ATOM 6070  N N    . ILE A 1 69 ? 7.880   5.782   3.620   1.00 0.00 ? 69 ILE A N    5  
ATOM 6071  C CA   . ILE A 1 69 ? 6.605   5.098   3.486   1.00 0.00 ? 69 ILE A CA   5  
ATOM 6072  C C    . ILE A 1 69 ? 6.345   4.263   4.741   1.00 0.00 ? 69 ILE A C    5  
ATOM 6073  O O    . ILE A 1 69 ? 5.237   4.268   5.276   1.00 0.00 ? 69 ILE A O    5  
ATOM 6074  C CB   . ILE A 1 69 ? 6.567   4.287   2.189   1.00 0.00 ? 69 ILE A CB   5  
ATOM 6075  C CG1  . ILE A 1 69 ? 6.722   5.197   0.969   1.00 0.00 ? 69 ILE A CG1  5  
ATOM 6076  C CG2  . ILE A 1 69 ? 5.297   3.436   2.113   1.00 0.00 ? 69 ILE A CG2  5  
ATOM 6077  C CD1  . ILE A 1 69 ? 7.478   4.484   -0.154  1.00 0.00 ? 69 ILE A CD1  5  
ATOM 6078  H H    . ILE A 1 69 ? 8.659   5.312   3.204   1.00 0.00 ? 69 ILE A H    5  
ATOM 6079  H HA   . ILE A 1 69 ? 5.831   5.862   3.412   1.00 0.00 ? 69 ILE A HA   5  
ATOM 6080  H HB   . ILE A 1 69 ? 7.414   3.601   2.190   1.00 0.00 ? 69 ILE A HB   5  
ATOM 6081  H HG13 . ILE A 1 69 ? 7.255   6.103   1.252   1.00 0.00 ? 69 ILE A HG13 5  
ATOM 6082  H HG21 . ILE A 1 69 ? 5.544   2.450   1.721   1.00 0.00 ? 69 ILE A HG21 5  
ATOM 6083  H HG22 . ILE A 1 69 ? 4.866   3.335   3.108   1.00 0.00 ? 69 ILE A HG22 5  
ATOM 6084  H HG23 . ILE A 1 69 ? 4.575   3.919   1.453   1.00 0.00 ? 69 ILE A HG23 5  
ATOM 6085  H HD11 . ILE A 1 69 ? 7.534   3.417   0.066   1.00 0.00 ? 69 ILE A HD11 5  
ATOM 6086  H HD12 . ILE A 1 69 ? 6.954   4.633   -1.097  1.00 0.00 ? 69 ILE A HD12 5  
ATOM 6087  H HD13 . ILE A 1 69 ? 8.486   4.892   -0.229  1.00 0.00 ? 69 ILE A HD13 5  
ATOM 6088  N N    . LEU A 1 70 ? 7.385   3.565   5.175   1.00 0.00 ? 70 LEU A N    5  
ATOM 6089  C CA   . LEU A 1 70 ? 7.282   2.728   6.358   1.00 0.00 ? 70 LEU A CA   5  
ATOM 6090  C C    . LEU A 1 70 ? 7.065   3.612   7.588   1.00 0.00 ? 70 LEU A C    5  
ATOM 6091  O O    . LEU A 1 70 ? 6.518   3.161   8.593   1.00 0.00 ? 70 LEU A O    5  
ATOM 6092  C CB   . LEU A 1 70 ? 8.500   1.807   6.470   1.00 0.00 ? 70 LEU A CB   5  
ATOM 6093  C CG   . LEU A 1 70 ? 8.897   1.063   5.193   1.00 0.00 ? 70 LEU A CG   5  
ATOM 6094  C CD1  . LEU A 1 70 ? 10.399  0.772   5.173   1.00 0.00 ? 70 LEU A CD1  5  
ATOM 6095  C CD2  . LEU A 1 70 ? 8.065   -0.208  5.018   1.00 0.00 ? 70 LEU A CD2  5  
ATOM 6096  H H    . LEU A 1 70 ? 8.282   3.567   4.734   1.00 0.00 ? 70 LEU A H    5  
ATOM 6097  H HA   . LEU A 1 70 ? 6.407   2.090   6.232   1.00 0.00 ? 70 LEU A HA   5  
ATOM 6098  H HB3  . LEU A 1 70 ? 8.304   1.072   7.250   1.00 0.00 ? 70 LEU A HB3  5  
ATOM 6099  H HG   . LEU A 1 70 ? 8.683   1.708   4.341   1.00 0.00 ? 70 LEU A HG   5  
ATOM 6100  H HD11 . LEU A 1 70 ? 10.820  0.968   6.159   1.00 0.00 ? 70 LEU A HD11 5  
ATOM 6101  H HD12 . LEU A 1 70 ? 10.563  -0.273  4.909   1.00 0.00 ? 70 LEU A HD12 5  
ATOM 6102  H HD13 . LEU A 1 70 ? 10.884  1.413   4.437   1.00 0.00 ? 70 LEU A HD13 5  
ATOM 6103  H HD21 . LEU A 1 70 ? 7.008   0.055   4.961   1.00 0.00 ? 70 LEU A HD21 5  
ATOM 6104  H HD22 . LEU A 1 70 ? 8.363   -0.715  4.101   1.00 0.00 ? 70 LEU A HD22 5  
ATOM 6105  H HD23 . LEU A 1 70 ? 8.228   -0.871  5.868   1.00 0.00 ? 70 LEU A HD23 5  
ATOM 6106  N N    . GLU A 1 71 ? 7.506   4.856   7.467   1.00 0.00 ? 71 GLU A N    5  
ATOM 6107  C CA   . GLU A 1 71 ? 7.368   5.808   8.556   1.00 0.00 ? 71 GLU A CA   5  
ATOM 6108  C C    . GLU A 1 71 ? 6.017   6.521   8.468   1.00 0.00 ? 71 GLU A C    5  
ATOM 6109  O O    . GLU A 1 71 ? 5.356   6.734   9.484   1.00 0.00 ? 71 GLU A O    5  
ATOM 6110  C CB   . GLU A 1 71 ? 8.521   6.813   8.556   1.00 0.00 ? 71 GLU A CB   5  
ATOM 6111  C CG   . GLU A 1 71 ? 9.740   6.249   9.287   1.00 0.00 ? 71 GLU A CG   5  
ATOM 6112  C CD   . GLU A 1 71 ? 10.382  7.310   10.183  1.00 0.00 ? 71 GLU A CD   5  
ATOM 6113  O OE1  . GLU A 1 71 ? 10.916  8.287   9.614   1.00 0.00 ? 71 GLU A OE1  5  
ATOM 6114  O OE2  . GLU A 1 71 ? 10.323  7.122   11.418  1.00 0.00 ? 71 GLU A OE2  5  
ATOM 6115  H H    . GLU A 1 71 ? 7.951   5.215   6.647   1.00 0.00 ? 71 GLU A H    5  
ATOM 6116  H HA   . GLU A 1 71 ? 7.413   5.213   9.469   1.00 0.00 ? 71 GLU A HA   5  
ATOM 6117  H HB3  . GLU A 1 71 ? 8.201   7.739   9.035   1.00 0.00 ? 71 GLU A HB3  5  
ATOM 6118  H HG3  . GLU A 1 71 ? 10.471  5.891   8.563   1.00 0.00 ? 71 GLU A HG3  5  
ATOM 6119  N N    . HIS A 1 72 ? 5.647   6.872   7.245   1.00 0.00 ? 72 HIS A N    5  
ATOM 6120  C CA   . HIS A 1 72 ? 4.388   7.558   7.011   1.00 0.00 ? 72 HIS A CA   5  
ATOM 6121  C C    . HIS A 1 72 ? 3.250   6.537   6.963   1.00 0.00 ? 72 HIS A C    5  
ATOM 6122  O O    . HIS A 1 72 ? 2.077   6.908   6.977   1.00 0.00 ? 72 HIS A O    5  
ATOM 6123  C CB   . HIS A 1 72 ? 4.465   8.421   5.750   1.00 0.00 ? 72 HIS A CB   5  
ATOM 6124  C CG   . HIS A 1 72 ? 5.430   9.577   5.855   1.00 0.00 ? 72 HIS A CG   5  
ATOM 6125  N ND1  . HIS A 1 72 ? 5.090   10.872  5.503   1.00 0.00 ? 72 HIS A ND1  5  
ATOM 6126  C CD2  . HIS A 1 72 ? 6.726   9.622   6.278   1.00 0.00 ? 72 HIS A CD2  5  
ATOM 6127  C CE1  . HIS A 1 72 ? 6.141   11.651  5.708   1.00 0.00 ? 72 HIS A CE1  5  
ATOM 6128  N NE2  . HIS A 1 72 ? 7.155   10.875  6.188   1.00 0.00 ? 72 HIS A NE2  5  
ATOM 6129  H H    . HIS A 1 72 ? 6.192   6.695   6.424   1.00 0.00 ? 72 HIS A H    5  
ATOM 6130  H HA   . HIS A 1 72 ? 4.232   8.223   7.860   1.00 0.00 ? 72 HIS A HA   5  
ATOM 6131  H HB3  . HIS A 1 72 ? 3.472   8.808   5.526   1.00 0.00 ? 72 HIS A HB3  5  
ATOM 6132  H HD1  . HIS A 1 72 ? 4.200   11.168  5.154   1.00 0.00 ? 72 HIS A HD1  5  
ATOM 6133  H HD2  . HIS A 1 72 ? 7.310   8.772   6.631   1.00 0.00 ? 72 HIS A HD2  5  
ATOM 6134  H HE1  . HIS A 1 72 ? 6.187   12.725  5.525   1.00 0.00 ? 72 HIS A HE1  5  
ATOM 6135  N N    . SER A 1 73 ? 3.635   5.270   6.905   1.00 0.00 ? 73 SER A N    5  
ATOM 6136  C CA   . SER A 1 73 ? 2.661   4.193   6.854   1.00 0.00 ? 73 SER A CA   5  
ATOM 6137  C C    . SER A 1 73 ? 1.575   4.419   7.908   1.00 0.00 ? 73 SER A C    5  
ATOM 6138  O O    . SER A 1 73 ? 0.406   4.120   7.673   1.00 0.00 ? 73 SER A O    5  
ATOM 6139  C CB   . SER A 1 73 ? 3.331   2.834   7.066   1.00 0.00 ? 73 SER A CB   5  
ATOM 6140  O OG   . SER A 1 73 ? 3.273   2.417   8.427   1.00 0.00 ? 73 SER A OG   5  
ATOM 6141  H H    . SER A 1 73 ? 4.591   4.977   6.893   1.00 0.00 ? 73 SER A H    5  
ATOM 6142  H HA   . SER A 1 73 ? 2.236   4.236   5.852   1.00 0.00 ? 73 SER A HA   5  
ATOM 6143  H HB3  . SER A 1 73 ? 4.373   2.890   6.748   1.00 0.00 ? 73 SER A HB3  5  
ATOM 6144  H HG   . SER A 1 73 ? 3.999   2.860   8.952   1.00 0.00 ? 73 SER A HG   5  
ATOM 6145  N N    . HIS A 1 74 ? 2.001   4.946   9.047   1.00 0.00 ? 74 HIS A N    5  
ATOM 6146  C CA   . HIS A 1 74 ? 1.079   5.216   10.137  1.00 0.00 ? 74 HIS A CA   5  
ATOM 6147  C C    . HIS A 1 74 ? -0.103  6.038   9.618   1.00 0.00 ? 74 HIS A C    5  
ATOM 6148  O O    . HIS A 1 74 ? -1.169  6.056   10.233  1.00 0.00 ? 74 HIS A O    5  
ATOM 6149  C CB   . HIS A 1 74 ? 1.802   5.889   11.306  1.00 0.00 ? 74 HIS A CB   5  
ATOM 6150  C CG   . HIS A 1 74 ? 2.018   7.372   11.122  1.00 0.00 ? 74 HIS A CG   5  
ATOM 6151  N ND1  . HIS A 1 74 ? 3.032   7.890   10.336  1.00 0.00 ? 74 HIS A ND1  5  
ATOM 6152  C CD2  . HIS A 1 74 ? 1.340   8.442   11.629  1.00 0.00 ? 74 HIS A CD2  5  
ATOM 6153  C CE1  . HIS A 1 74 ? 2.959   9.212   10.376  1.00 0.00 ? 74 HIS A CE1  5  
ATOM 6154  N NE2  . HIS A 1 74 ? 1.910   9.551   11.179  1.00 0.00 ? 74 HIS A NE2  5  
ATOM 6155  H H    . HIS A 1 74 ? 2.954   5.187   9.229   1.00 0.00 ? 74 HIS A H    5  
ATOM 6156  H HA   . HIS A 1 74 ? 0.714   4.250   10.484  1.00 0.00 ? 74 HIS A HA   5  
ATOM 6157  H HB3  . HIS A 1 74 ? 2.768   5.406   11.448  1.00 0.00 ? 74 HIS A HB3  5  
ATOM 6158  H HD1  . HIS A 1 74 ? 3.707   7.356   9.824   1.00 0.00 ? 74 HIS A HD1  5  
ATOM 6159  H HD2  . HIS A 1 74 ? 0.477   8.392   12.292  1.00 0.00 ? 74 HIS A HD2  5  
ATOM 6160  H HE1  . HIS A 1 74 ? 3.622   9.907   9.859   1.00 0.00 ? 74 HIS A HE1  5  
ATOM 6161  N N    . ARG A 1 75 ? 0.126   6.699   8.492   1.00 0.00 ? 75 ARG A N    5  
ATOM 6162  C CA   . ARG A 1 75 ? -0.907  7.521   7.884   1.00 0.00 ? 75 ARG A CA   5  
ATOM 6163  C C    . ARG A 1 75 ? -1.472  6.829   6.643   1.00 0.00 ? 75 ARG A C    5  
ATOM 6164  O O    . ARG A 1 75 ? -2.665  6.929   6.360   1.00 0.00 ? 75 ARG A O    5  
ATOM 6165  C CB   . ARG A 1 75 ? -0.357  8.893   7.491   1.00 0.00 ? 75 ARG A CB   5  
ATOM 6166  C CG   . ARG A 1 75 ? 0.736   9.344   8.461   1.00 0.00 ? 75 ARG A CG   5  
ATOM 6167  C CD   . ARG A 1 75 ? 0.841   10.871  8.498   1.00 0.00 ? 75 ARG A CD   5  
ATOM 6168  N NE   . ARG A 1 75 ? -0.433  11.453  8.978   1.00 0.00 ? 75 ARG A NE   5  
ATOM 6169  C CZ   . ARG A 1 75 ? -1.411  11.887  8.171   1.00 0.00 ? 75 ARG A CZ   5  
ATOM 6170  N NH1  . ARG A 1 75 ? -1.269  11.807  6.841   1.00 0.00 ? 75 ARG A NH1  5  
ATOM 6171  N NH2  . ARG A 1 75 ? -2.533  12.401  8.694   1.00 0.00 ? 75 ARG A NH2  5  
ATOM 6172  H H    . ARG A 1 75 ? 0.995   6.679   7.999   1.00 0.00 ? 75 ARG A H    5  
ATOM 6173  H HA   . ARG A 1 75 ? -1.670  7.626   8.656   1.00 0.00 ? 75 ARG A HA   5  
ATOM 6174  H HB3  . ARG A 1 75 ? -1.166  9.623   7.483   1.00 0.00 ? 75 ARG A HB3  5  
ATOM 6175  H HG3  . ARG A 1 75 ? 1.694   8.918   8.159   1.00 0.00 ? 75 ARG A HG3  5  
ATOM 6176  H HD3  . ARG A 1 75 ? 1.073   11.252  7.503   1.00 0.00 ? 75 ARG A HD3  5  
ATOM 6177  H HE   . ARG A 1 75 ? -0.572  11.528  9.965   1.00 0.00 ? 75 ARG A HE   5  
ATOM 6178  H HH11 . ARG A 1 75 ? -0.432  11.424  6.450   1.00 0.00 ? 75 ARG A HH11 5  
ATOM 6179  H HH12 . ARG A 1 75 ? -1.999  12.131  6.239   1.00 0.00 ? 75 ARG A HH12 5  
ATOM 6180  H HH21 . ARG A 1 75 ? -2.639  12.462  9.688   1.00 0.00 ? 75 ARG A HH21 5  
ATOM 6181  H HH22 . ARG A 1 75 ? -3.263  12.725  8.093   1.00 0.00 ? 75 ARG A HH22 5  
ATOM 6182  N N    . ILE A 1 76 ? -0.588  6.144   5.932   1.00 0.00 ? 76 ILE A N    5  
ATOM 6183  C CA   . ILE A 1 76 ? -0.985  5.436   4.726   1.00 0.00 ? 76 ILE A CA   5  
ATOM 6184  C C    . ILE A 1 76 ? -2.308  4.711   4.977   1.00 0.00 ? 76 ILE A C    5  
ATOM 6185  O O    . ILE A 1 76 ? -2.401  3.875   5.874   1.00 0.00 ? 76 ILE A O    5  
ATOM 6186  C CB   . ILE A 1 76 ? 0.142   4.515   4.252   1.00 0.00 ? 76 ILE A CB   5  
ATOM 6187  C CG1  . ILE A 1 76 ? 1.384   5.321   3.866   1.00 0.00 ? 76 ILE A CG1  5  
ATOM 6188  C CG2  . ILE A 1 76 ? -0.333  3.612   3.112   1.00 0.00 ? 76 ILE A CG2  5  
ATOM 6189  C CD1  . ILE A 1 76 ? 2.462   4.413   3.269   1.00 0.00 ? 76 ILE A CD1  5  
ATOM 6190  H H    . ILE A 1 76 ? 0.381   6.066   6.168   1.00 0.00 ? 76 ILE A H    5  
ATOM 6191  H HA   . ILE A 1 76 ? -1.141  6.181   3.947   1.00 0.00 ? 76 ILE A HA   5  
ATOM 6192  H HB   . ILE A 1 76 ? 0.424   3.865   5.080   1.00 0.00 ? 76 ILE A HB   5  
ATOM 6193  H HG13 . ILE A 1 76 ? 1.778   5.830   4.745   1.00 0.00 ? 76 ILE A HG13 5  
ATOM 6194  H HG21 . ILE A 1 76 ? -0.299  4.164   2.172   1.00 0.00 ? 76 ILE A HG21 5  
ATOM 6195  H HG22 . ILE A 1 76 ? 0.318   2.740   3.043   1.00 0.00 ? 76 ILE A HG22 5  
ATOM 6196  H HG23 . ILE A 1 76 ? -1.355  3.288   3.305   1.00 0.00 ? 76 ILE A HG23 5  
ATOM 6197  H HD11 . ILE A 1 76 ? 2.203   3.371   3.454   1.00 0.00 ? 76 ILE A HD11 5  
ATOM 6198  H HD12 . ILE A 1 76 ? 2.529   4.588   2.195   1.00 0.00 ? 76 ILE A HD12 5  
ATOM 6199  H HD13 . ILE A 1 76 ? 3.422   4.637   3.734   1.00 0.00 ? 76 ILE A HD13 5  
ATOM 6200  N N    . ARG A 1 77 ? -3.299  5.057   4.168   1.00 0.00 ? 77 ARG A N    5  
ATOM 6201  C CA   . ARG A 1 77 ? -4.613  4.449   4.290   1.00 0.00 ? 77 ARG A CA   5  
ATOM 6202  C C    . ARG A 1 77 ? -5.234  4.247   2.907   1.00 0.00 ? 77 ARG A C    5  
ATOM 6203  O O    . ARG A 1 77 ? -5.251  5.166   2.089   1.00 0.00 ? 77 ARG A O    5  
ATOM 6204  C CB   . ARG A 1 77 ? -5.543  5.318   5.139   1.00 0.00 ? 77 ARG A CB   5  
ATOM 6205  C CG   . ARG A 1 77 ? -5.240  5.153   6.629   1.00 0.00 ? 77 ARG A CG   5  
ATOM 6206  C CD   . ARG A 1 77 ? -5.994  3.957   7.213   1.00 0.00 ? 77 ARG A CD   5  
ATOM 6207  N NE   . ARG A 1 77 ? -5.041  3.015   7.840   1.00 0.00 ? 77 ARG A NE   5  
ATOM 6208  C CZ   . ARG A 1 77 ? -5.405  1.915   8.514   1.00 0.00 ? 77 ARG A CZ   5  
ATOM 6209  N NH1  . ARG A 1 77 ? -6.703  1.613   8.654   1.00 0.00 ? 77 ARG A NH1  5  
ATOM 6210  N NH2  . ARG A 1 77 ? -4.470  1.118   9.050   1.00 0.00 ? 77 ARG A NH2  5  
ATOM 6211  H H    . ARG A 1 77 ? -3.213  5.738   3.440   1.00 0.00 ? 77 ARG A H    5  
ATOM 6212  H HA   . ARG A 1 77 ? -4.433  3.494   4.784   1.00 0.00 ? 77 ARG A HA   5  
ATOM 6213  H HB3  . ARG A 1 77 ? -6.580  5.045   4.942   1.00 0.00 ? 77 ARG A HB3  5  
ATOM 6214  H HG3  . ARG A 1 77 ? -5.520  6.061   7.164   1.00 0.00 ? 77 ARG A HG3  5  
ATOM 6215  H HD3  . ARG A 1 77 ? -6.554  3.451   6.427   1.00 0.00 ? 77 ARG A HD3  5  
ATOM 6216  H HE   . ARG A 1 77 ? -4.064  3.211   7.755   1.00 0.00 ? 77 ARG A HE   5  
ATOM 6217  H HH11 . ARG A 1 77 ? -7.400  2.209   8.254   1.00 0.00 ? 77 ARG A HH11 5  
ATOM 6218  H HH12 . ARG A 1 77 ? -6.974  0.793   9.157   1.00 0.00 ? 77 ARG A HH12 5  
ATOM 6219  H HH21 . ARG A 1 77 ? -3.502  1.343   8.946   1.00 0.00 ? 77 ARG A HH21 5  
ATOM 6220  H HH22 . ARG A 1 77 ? -4.742  0.297   9.553   1.00 0.00 ? 77 ARG A HH22 5  
ATOM 6221  N N    . PHE A 1 78 ? -5.732  3.039   2.689   1.00 0.00 ? 78 PHE A N    5  
ATOM 6222  C CA   . PHE A 1 78 ? -6.354  2.704   1.419   1.00 0.00 ? 78 PHE A CA   5  
ATOM 6223  C C    . PHE A 1 78 ? -7.841  3.062   1.425   1.00 0.00 ? 78 PHE A C    5  
ATOM 6224  O O    . PHE A 1 78 ? -8.498  2.985   2.463   1.00 0.00 ? 78 PHE A O    5  
ATOM 6225  C CB   . PHE A 1 78 ? -6.207  1.192   1.234   1.00 0.00 ? 78 PHE A CB   5  
ATOM 6226  C CG   . PHE A 1 78 ? -4.829  0.758   0.728   1.00 0.00 ? 78 PHE A CG   5  
ATOM 6227  C CD1  . PHE A 1 78 ? -3.705  1.194   1.357   1.00 0.00 ? 78 PHE A CD1  5  
ATOM 6228  C CD2  . PHE A 1 78 ? -4.730  -0.066  -0.350  1.00 0.00 ? 78 PHE A CD2  5  
ATOM 6229  C CE1  . PHE A 1 78 ? -2.428  0.791   0.887   1.00 0.00 ? 78 PHE A CE1  5  
ATOM 6230  C CE2  . PHE A 1 78 ? -3.452  -0.469  -0.819  1.00 0.00 ? 78 PHE A CE2  5  
ATOM 6231  C CZ   . PHE A 1 78 ? -2.328  -0.032  -0.191  1.00 0.00 ? 78 PHE A CZ   5  
ATOM 6232  H H    . PHE A 1 78 ? -5.715  2.296   3.360   1.00 0.00 ? 78 PHE A H    5  
ATOM 6233  H HA   . PHE A 1 78 ? -5.845  3.282   0.647   1.00 0.00 ? 78 PHE A HA   5  
ATOM 6234  H HB3  . PHE A 1 78 ? -6.966  0.846   0.533   1.00 0.00 ? 78 PHE A HB3  5  
ATOM 6235  H HD1  . PHE A 1 78 ? -3.786  1.854   2.221   1.00 0.00 ? 78 PHE A HD1  5  
ATOM 6236  H HD2  . PHE A 1 78 ? -5.632  -0.416  -0.853  1.00 0.00 ? 78 PHE A HD2  5  
ATOM 6237  H HE1  . PHE A 1 78 ? -1.527  1.141   1.391   1.00 0.00 ? 78 PHE A HE1  5  
ATOM 6238  H HE2  . PHE A 1 78 ? -3.372  -1.129  -1.683  1.00 0.00 ? 78 PHE A HE2  5  
ATOM 6239  H HZ   . PHE A 1 78 ? -1.346  -0.342  -0.551  1.00 0.00 ? 78 PHE A HZ   5  
ATOM 6240  N N    . LYS A 1 79 ? -8.329  3.448   0.255   1.00 0.00 ? 79 LYS A N    5  
ATOM 6241  C CA   . LYS A 1 79 ? -9.727  3.819   0.112   1.00 0.00 ? 79 LYS A CA   5  
ATOM 6242  C C    . LYS A 1 79 ? -10.309 3.130   -1.123  1.00 0.00 ? 79 LYS A C    5  
ATOM 6243  O O    . LYS A 1 79 ? -9.871  3.384   -2.245  1.00 0.00 ? 79 LYS A O    5  
ATOM 6244  C CB   . LYS A 1 79 ? -9.877  5.341   0.097   1.00 0.00 ? 79 LYS A CB   5  
ATOM 6245  C CG   . LYS A 1 79 ? -10.198 5.876   1.494   1.00 0.00 ? 79 LYS A CG   5  
ATOM 6246  C CD   . LYS A 1 79 ? -11.709 5.921   1.731   1.00 0.00 ? 79 LYS A CD   5  
ATOM 6247  C CE   . LYS A 1 79 ? -12.307 7.230   1.212   1.00 0.00 ? 79 LYS A CE   5  
ATOM 6248  N NZ   . LYS A 1 79 ? -13.784 7.177   1.256   1.00 0.00 ? 79 LYS A NZ   5  
ATOM 6249  H H    . LYS A 1 79 ? -7.788  3.508   -0.584  1.00 0.00 ? 79 LYS A H    5  
ATOM 6250  H HA   . LYS A 1 79 ? -10.253 3.452   0.994   1.00 0.00 ? 79 LYS A HA   5  
ATOM 6251  H HB3  . LYS A 1 79 ? -10.670 5.625   -0.596  1.00 0.00 ? 79 LYS A HB3  5  
ATOM 6252  H HG3  . LYS A 1 79 ? -9.778  6.875   1.611   1.00 0.00 ? 79 LYS A HG3  5  
ATOM 6253  H HD3  . LYS A 1 79 ? -11.916 5.817   2.796   1.00 0.00 ? 79 LYS A HD3  5  
ATOM 6254  H HE3  . LYS A 1 79 ? -11.973 7.409   0.190   1.00 0.00 ? 79 LYS A HE3  5  
ATOM 6255  H HZ1  . LYS A 1 79 ? -14.153 7.418   0.359   1.00 0.00 ? 79 LYS A HZ1  5  
ATOM 6256  H HZ2  . LYS A 1 79 ? -14.078 6.254   1.501   1.00 0.00 ? 79 LYS A HZ2  5  
ATOM 6257  H HZ3  . LYS A 1 79 ? -14.121 7.826   1.939   1.00 0.00 ? 79 LYS A HZ3  5  
ATOM 6258  N N    . LEU A 1 80 ? -11.288 2.272   -0.876  1.00 0.00 ? 80 LEU A N    5  
ATOM 6259  C CA   . LEU A 1 80 ? -11.934 1.545   -1.955  1.00 0.00 ? 80 LEU A CA   5  
ATOM 6260  C C    . LEU A 1 80 ? -13.110 2.368   -2.486  1.00 0.00 ? 80 LEU A C    5  
ATOM 6261  O O    . LEU A 1 80 ? -13.719 3.138   -1.745  1.00 0.00 ? 80 LEU A O    5  
ATOM 6262  C CB   . LEU A 1 80 ? -12.327 0.140   -1.493  1.00 0.00 ? 80 LEU A CB   5  
ATOM 6263  C CG   . LEU A 1 80 ? -11.218 -0.913  -1.532  1.00 0.00 ? 80 LEU A CG   5  
ATOM 6264  C CD1  . LEU A 1 80 ? -11.753 -2.289  -1.129  1.00 0.00 ? 80 LEU A CD1  5  
ATOM 6265  C CD2  . LEU A 1 80 ? -10.537 -0.943  -2.902  1.00 0.00 ? 80 LEU A CD2  5  
ATOM 6266  H H    . LEU A 1 80 ? -11.637 2.071   0.039   1.00 0.00 ? 80 LEU A H    5  
ATOM 6267  H HA   . LEU A 1 80 ? -11.205 1.429   -2.755  1.00 0.00 ? 80 LEU A HA   5  
ATOM 6268  H HB3  . LEU A 1 80 ? -13.152 -0.208  -2.115  1.00 0.00 ? 80 LEU A HB3  5  
ATOM 6269  H HG   . LEU A 1 80 ? -10.458 -0.637  -0.801  1.00 0.00 ? 80 LEU A HG   5  
ATOM 6270  H HD11 . LEU A 1 80 ? -12.147 -2.241  -0.114  1.00 0.00 ? 80 LEU A HD11 5  
ATOM 6271  H HD12 . LEU A 1 80 ? -12.547 -2.585  -1.814  1.00 0.00 ? 80 LEU A HD12 5  
ATOM 6272  H HD13 . LEU A 1 80 ? -10.946 -3.020  -1.171  1.00 0.00 ? 80 LEU A HD13 5  
ATOM 6273  H HD21 . LEU A 1 80 ? -9.547  -0.491  -2.826  1.00 0.00 ? 80 LEU A HD21 5  
ATOM 6274  H HD22 . LEU A 1 80 ? -10.440 -1.974  -3.238  1.00 0.00 ? 80 LEU A HD22 5  
ATOM 6275  H HD23 . LEU A 1 80 ? -11.138 -0.382  -3.618  1.00 0.00 ? 80 LEU A HD23 5  
ATOM 6276  N N    . LYS A 1 81 ? -13.393 2.178   -3.766  1.00 0.00 ? 81 LYS A N    5  
ATOM 6277  C CA   . LYS A 1 81 ? -14.484 2.893   -4.406  1.00 0.00 ? 81 LYS A CA   5  
ATOM 6278  C C    . LYS A 1 81 ? -15.761 2.706   -3.584  1.00 0.00 ? 81 LYS A C    5  
ATOM 6279  O O    . LYS A 1 81 ? -16.345 3.677   -3.105  1.00 0.00 ? 81 LYS A O    5  
ATOM 6280  C CB   . LYS A 1 81 ? -14.625 2.463   -5.867  1.00 0.00 ? 81 LYS A CB   5  
ATOM 6281  C CG   . LYS A 1 81 ? -14.998 3.651   -6.755  1.00 0.00 ? 81 LYS A CG   5  
ATOM 6282  C CD   . LYS A 1 81 ? -15.429 3.181   -8.146  1.00 0.00 ? 81 LYS A CD   5  
ATOM 6283  C CE   . LYS A 1 81 ? -16.890 2.728   -8.145  1.00 0.00 ? 81 LYS A CE   5  
ATOM 6284  N NZ   . LYS A 1 81 ? -17.557 3.124   -9.405  1.00 0.00 ? 81 LYS A NZ   5  
ATOM 6285  H H    . LYS A 1 81 ? -12.893 1.550   -4.362  1.00 0.00 ? 81 LYS A H    5  
ATOM 6286  H HA   . LYS A 1 81 ? -14.225 3.952   -4.405  1.00 0.00 ? 81 LYS A HA   5  
ATOM 6287  H HB3  . LYS A 1 81 ? -15.386 1.688   -5.950  1.00 0.00 ? 81 LYS A HB3  5  
ATOM 6288  H HG3  . LYS A 1 81 ? -14.148 4.327   -6.843  1.00 0.00 ? 81 LYS A HG3  5  
ATOM 6289  H HD3  . LYS A 1 81 ? -14.790 2.360   -8.471  1.00 0.00 ? 81 LYS A HD3  5  
ATOM 6290  H HE3  . LYS A 1 81 ? -17.413 3.169   -7.296  1.00 0.00 ? 81 LYS A HE3  5  
ATOM 6291  H HZ1  . LYS A 1 81 ? -18.534 3.256   -9.238  1.00 0.00 ? 81 LYS A HZ1  5  
ATOM 6292  H HZ2  . LYS A 1 81 ? -17.157 3.976   -9.741  1.00 0.00 ? 81 LYS A HZ2  5  
ATOM 6293  H HZ3  . LYS A 1 81 ? -17.431 2.405   -10.089 1.00 0.00 ? 81 LYS A HZ3  5  
ATOM 6294  N N    . ARG A 1 82 ? -16.160 1.450   -3.447  1.00 0.00 ? 82 ARG A N    5  
ATOM 6295  C CA   . ARG A 1 82 ? -17.358 1.122   -2.693  1.00 0.00 ? 82 ARG A CA   5  
ATOM 6296  C C    . ARG A 1 82 ? -17.074 1.193   -1.190  1.00 0.00 ? 82 ARG A C    5  
ATOM 6297  O O    . ARG A 1 82 ? -15.927 1.071   -0.765  1.00 0.00 ? 82 ARG A O    5  
ATOM 6298  C CB   . ARG A 1 82 ? -17.864 -0.278  -3.043  1.00 0.00 ? 82 ARG A CB   5  
ATOM 6299  C CG   . ARG A 1 82 ? -19.144 -0.205  -3.878  1.00 0.00 ? 82 ARG A CG   5  
ATOM 6300  C CD   . ARG A 1 82 ? -19.603 -1.602  -4.303  1.00 0.00 ? 82 ARG A CD   5  
ATOM 6301  N NE   . ARG A 1 82 ? -20.745 -1.496  -5.238  1.00 0.00 ? 82 ARG A NE   5  
ATOM 6302  C CZ   . ARG A 1 82 ? -21.564 -2.514  -5.542  1.00 0.00 ? 82 ARG A CZ   5  
ATOM 6303  N NH1  . ARG A 1 82 ? -21.371 -3.717  -4.985  1.00 0.00 ? 82 ARG A NH1  5  
ATOM 6304  N NH2  . ARG A 1 82 ? -22.575 -2.326  -6.401  1.00 0.00 ? 82 ARG A NH2  5  
ATOM 6305  H H    . ARG A 1 82 ? -15.681 0.665   -3.840  1.00 0.00 ? 82 ARG A H    5  
ATOM 6306  H HA   . ARG A 1 82 ? -18.089 1.875   -2.989  1.00 0.00 ? 82 ARG A HA   5  
ATOM 6307  H HB3  . ARG A 1 82 ? -18.054 -0.840  -2.128  1.00 0.00 ? 82 ARG A HB3  5  
ATOM 6308  H HG3  . ARG A 1 82 ? -18.971 0.409   -4.762  1.00 0.00 ? 82 ARG A HG3  5  
ATOM 6309  H HD3  . ARG A 1 82 ? -19.892 -2.181  -3.426  1.00 0.00 ? 82 ARG A HD3  5  
ATOM 6310  H HE   . ARG A 1 82 ? -20.917 -0.612  -5.671  1.00 0.00 ? 82 ARG A HE   5  
ATOM 6311  H HH11 . ARG A 1 82 ? -20.616 -3.856  -4.344  1.00 0.00 ? 82 ARG A HH11 5  
ATOM 6312  H HH12 . ARG A 1 82 ? -21.982 -4.476  -5.211  1.00 0.00 ? 82 ARG A HH12 5  
ATOM 6313  H HH21 . ARG A 1 82 ? -22.718 -1.428  -6.816  1.00 0.00 ? 82 ARG A HH21 5  
ATOM 6314  H HH22 . ARG A 1 82 ? -23.185 -3.084  -6.627  1.00 0.00 ? 82 ARG A HH22 5  
ATOM 6315  N N    . PRO A 1 83 ? -18.168 1.395   -0.408  1.00 0.00 ? 83 PRO A N    5  
ATOM 6316  C CA   . PRO A 1 83 ? -18.049 1.483   1.037   1.00 0.00 ? 83 PRO A CA   5  
ATOM 6317  C C    . PRO A 1 83 ? -17.819 0.102   1.654   1.00 0.00 ? 83 PRO A C    5  
ATOM 6318  O O    . PRO A 1 83 ? -18.552 -0.842  1.360   1.00 0.00 ? 83 PRO A O    5  
ATOM 6319  C CB   . PRO A 1 83 ? -19.342 2.134   1.500   1.00 0.00 ? 83 PRO A CB   5  
ATOM 6320  C CG   . PRO A 1 83 ? -20.328 1.961   0.356   1.00 0.00 ? 83 PRO A CG   5  
ATOM 6321  C CD   . PRO A 1 83 ? -19.542 1.544   -0.877  1.00 0.00 ? 83 PRO A CD   5  
ATOM 6322  H HA   . PRO A 1 83 ? -17.249 2.030   1.287   1.00 0.00 ? 83 PRO A HA   5  
ATOM 6323  H HB3  . PRO A 1 83 ? -19.189 3.188   1.729   1.00 0.00 ? 83 PRO A HB3  5  
ATOM 6324  H HG3  . PRO A 1 83 ? -20.864 2.892   0.171   1.00 0.00 ? 83 PRO A HG3  5  
ATOM 6325  H HD3  . PRO A 1 83 ? -19.613 2.295   -1.664  1.00 0.00 ? 83 PRO A HD3  5  
ATOM 6326  N N    . SER A 1 84 ? -16.800 0.028   2.498   1.00 0.00 ? 84 SER A N    5  
ATOM 6327  C CA   . SER A 1 84 ? -16.467 -1.222  3.159   1.00 0.00 ? 84 SER A CA   5  
ATOM 6328  C C    . SER A 1 84 ? -15.230 -1.034  4.039   1.00 0.00 ? 84 SER A C    5  
ATOM 6329  O O    . SER A 1 84 ? -14.428 -0.132  3.805   1.00 0.00 ? 84 SER A O    5  
ATOM 6330  C CB   . SER A 1 84 ? -16.227 -2.338  2.139   1.00 0.00 ? 84 SER A CB   5  
ATOM 6331  O OG   . SER A 1 84 ? -16.987 -3.506  2.438   1.00 0.00 ? 84 SER A OG   5  
ATOM 6332  H H    . SER A 1 84 ? -16.211 0.800   2.731   1.00 0.00 ? 84 SER A H    5  
ATOM 6333  H HA   . SER A 1 84 ? -17.336 -1.469  3.769   1.00 0.00 ? 84 SER A HA   5  
ATOM 6334  H HB3  . SER A 1 84 ? -15.168 -2.590  2.119   1.00 0.00 ? 84 SER A HB3  5  
ATOM 6335  H HG   . SER A 1 84 ? -17.944 -3.261  2.592   1.00 0.00 ? 84 SER A HG   5  
ATOM 6336  N N    . SER A 1 85 ? -15.113 -1.902  5.034   1.00 0.00 ? 85 SER A N    5  
ATOM 6337  C CA   . SER A 1 85 ? -13.987 -1.843  5.951   1.00 0.00 ? 85 SER A CA   5  
ATOM 6338  C C    . SER A 1 85 ? -13.443 -3.251  6.202   1.00 0.00 ? 85 SER A C    5  
ATOM 6339  O O    . SER A 1 85 ? -12.268 -3.520  5.953   1.00 0.00 ? 85 SER A O    5  
ATOM 6340  C CB   . SER A 1 85 ? -14.387 -1.184  7.272   1.00 0.00 ? 85 SER A CB   5  
ATOM 6341  O OG   . SER A 1 85 ? -14.093 0.210   7.283   1.00 0.00 ? 85 SER A OG   5  
ATOM 6342  H H    . SER A 1 85 ? -15.769 -2.634  5.217   1.00 0.00 ? 85 SER A H    5  
ATOM 6343  H HA   . SER A 1 85 ? -13.239 -1.228  5.450   1.00 0.00 ? 85 SER A HA   5  
ATOM 6344  H HB3  . SER A 1 85 ? -13.862 -1.671  8.094   1.00 0.00 ? 85 SER A HB3  5  
ATOM 6345  H HG   . SER A 1 85 ? -14.878 0.722   7.632   1.00 0.00 ? 85 SER A HG   5  
ATOM 6346  N N    . GLY A 1 86 ? -14.322 -4.111  6.694   1.00 0.00 ? 86 GLY A N    5  
ATOM 6347  C CA   . GLY A 1 86 ? -13.945 -5.484  6.982   1.00 0.00 ? 86 GLY A CA   5  
ATOM 6348  C C    . GLY A 1 86 ? -12.905 -5.543  8.103   1.00 0.00 ? 86 GLY A C    5  
ATOM 6349  O O    . GLY A 1 86 ? -11.716 -5.332  7.864   1.00 0.00 ? 86 GLY A O    5  
ATOM 6350  H H    . GLY A 1 86 ? -15.275 -3.884  6.894   1.00 0.00 ? 86 GLY A H    5  
ATOM 6351  H HA2  . GLY A 1 86 ? -14.827 -6.055  7.271   1.00 0.00 ? 86 GLY A HA2  5  
ATOM 6352  H HA3  . GLY A 1 86 ? -13.543 -5.951  6.083   1.00 0.00 ? 86 GLY A HA3  5  
ATOM 6353  N N    . PRO A 1 87 ? -13.402 -5.837  9.334   1.00 0.00 ? 87 PRO A N    5  
ATOM 6354  C CA   . PRO A 1 87 ? -12.528 -5.927  10.492  1.00 0.00 ? 87 PRO A CA   5  
ATOM 6355  C C    . PRO A 1 87 ? -11.719 -7.225  10.470  1.00 0.00 ? 87 PRO A C    5  
ATOM 6356  O O    . PRO A 1 87 ? -12.274 -8.303  10.265  1.00 0.00 ? 87 PRO A O    5  
ATOM 6357  C CB   . PRO A 1 87 ? -13.455 -5.825  11.693  1.00 0.00 ? 87 PRO A CB   5  
ATOM 6358  C CG   . PRO A 1 87 ? -14.847 -6.150  11.173  1.00 0.00 ? 87 PRO A CG   5  
ATOM 6359  C CD   . PRO A 1 87 ? -14.803 -6.093  9.655   1.00 0.00 ? 87 PRO A CD   5  
ATOM 6360  H HA   . PRO A 1 87 ? -11.857 -5.186  10.479  1.00 0.00 ? 87 PRO A HA   5  
ATOM 6361  H HB3  . PRO A 1 87 ? -13.424 -4.826  12.127  1.00 0.00 ? 87 PRO A HB3  5  
ATOM 6362  H HG3  . PRO A 1 87 ? -15.575 -5.438  11.561  1.00 0.00 ? 87 PRO A HG3  5  
ATOM 6363  H HD3  . PRO A 1 87 ? -15.448 -5.304  9.269   1.00 0.00 ? 87 PRO A HD3  5  
ATOM 6364  N N    . SER A 1 88 ? -10.420 -7.078  10.684  1.00 0.00 ? 88 SER A N    5  
ATOM 6365  C CA   . SER A 1 88 ? -9.528  -8.226  10.691  1.00 0.00 ? 88 SER A CA   5  
ATOM 6366  C C    . SER A 1 88 ? -8.115  -7.788  11.081  1.00 0.00 ? 88 SER A C    5  
ATOM 6367  O O    . SER A 1 88 ? -7.594  -6.810  10.547  1.00 0.00 ? 88 SER A O    5  
ATOM 6368  C CB   . SER A 1 88 ? -9.511  -8.918  9.327   1.00 0.00 ? 88 SER A CB   5  
ATOM 6369  O OG   . SER A 1 88 ? -9.130  -8.029  8.281   1.00 0.00 ? 88 SER A OG   5  
ATOM 6370  H H    . SER A 1 88 ? -9.976  -6.198  10.850  1.00 0.00 ? 88 SER A H    5  
ATOM 6371  H HA   . SER A 1 88 ? -9.939  -8.905  11.437  1.00 0.00 ? 88 SER A HA   5  
ATOM 6372  H HB3  . SER A 1 88 ? -10.499 -9.326  9.115   1.00 0.00 ? 88 SER A HB3  5  
ATOM 6373  H HG   . SER A 1 88 ? -9.904  -7.870  7.668   1.00 0.00 ? 88 SER A HG   5  
ATOM 6374  N N    . SER A 1 89 ? -7.535  -8.533  12.011  1.00 0.00 ? 89 SER A N    5  
ATOM 6375  C CA   . SER A 1 89 ? -6.193  -8.235  12.479  1.00 0.00 ? 89 SER A CA   5  
ATOM 6376  C C    . SER A 1 89 ? -5.339  -9.504  12.465  1.00 0.00 ? 89 SER A C    5  
ATOM 6377  O O    . SER A 1 89 ? -5.538  -10.400 13.284  1.00 0.00 ? 89 SER A O    5  
ATOM 6378  C CB   . SER A 1 89 ? -6.221  -7.629  13.885  1.00 0.00 ? 89 SER A CB   5  
ATOM 6379  O OG   . SER A 1 89 ? -6.139  -6.208  13.855  1.00 0.00 ? 89 SER A OG   5  
ATOM 6380  H H    . SER A 1 89 ? -7.966  -9.326  12.441  1.00 0.00 ? 89 SER A H    5  
ATOM 6381  H HA   . SER A 1 89 ? -5.798  -7.501  11.776  1.00 0.00 ? 89 SER A HA   5  
ATOM 6382  H HB3  . SER A 1 89 ? -5.392  -8.028  14.467  1.00 0.00 ? 89 SER A HB3  5  
ATOM 6383  H HG   . SER A 1 89 ? -5.266  -5.907  14.240  1.00 0.00 ? 89 SER A HG   5  
ATOM 6384  N N    . GLY A 1 90 ? -4.406  -9.540  11.525  1.00 0.00 ? 90 GLY A N    5  
ATOM 6385  C CA   . GLY A 1 90 ? -3.521  -10.686 11.394  1.00 0.00 ? 90 GLY A CA   5  
ATOM 6386  C C    . GLY A 1 90 ? -3.684  -11.351 10.026  1.00 0.00 ? 90 GLY A C    5  
ATOM 6387  O O    . GLY A 1 90 ? -4.227  -12.451 9.928   1.00 0.00 ? 90 GLY A O    5  
ATOM 6388  H H    . GLY A 1 90 ? -4.249  -8.808  10.863  1.00 0.00 ? 90 GLY A H    5  
ATOM 6389  H HA2  . GLY A 1 90 ? -2.486  -10.368 11.526  1.00 0.00 ? 90 GLY A HA2  5  
ATOM 6390  H HA3  . GLY A 1 90 ? -3.734  -11.408 12.182  1.00 0.00 ? 90 GLY A HA3  5  
ATOM 6391  N N    . GLY A 1 1  ? 6.714   -14.774 3.153   1.00 0.00 ? 1  GLY A N    6  
ATOM 6392  C CA   . GLY A 1 1  ? 6.913   -16.209 3.249   1.00 0.00 ? 1  GLY A CA   6  
ATOM 6393  C C    . GLY A 1 1  ? 6.645   -16.706 4.672   1.00 0.00 ? 1  GLY A C    6  
ATOM 6394  O O    . GLY A 1 1  ? 7.506   -17.332 5.287   1.00 0.00 ? 1  GLY A O    6  
ATOM 6395  H H1   . GLY A 1 1  ? 7.553   -14.230 3.144   1.00 0.00 ? 1  GLY A H1   6  
ATOM 6396  H HA2  . GLY A 1 1  ? 6.250   -16.721 2.550   1.00 0.00 ? 1  GLY A HA2  6  
ATOM 6397  H HA3  . GLY A 1 1  ? 7.935   -16.459 2.960   1.00 0.00 ? 1  GLY A HA3  6  
ATOM 6398  N N    . SER A 1 2  ? 5.447   -16.408 5.152   1.00 0.00 ? 2  SER A N    6  
ATOM 6399  C CA   . SER A 1 2  ? 5.054   -16.817 6.490   1.00 0.00 ? 2  SER A CA   6  
ATOM 6400  C C    . SER A 1 2  ? 6.095   -16.344 7.507   1.00 0.00 ? 2  SER A C    6  
ATOM 6401  O O    . SER A 1 2  ? 7.000   -17.095 7.869   1.00 0.00 ? 2  SER A O    6  
ATOM 6402  C CB   . SER A 1 2  ? 4.881   -18.334 6.574   1.00 0.00 ? 2  SER A CB   6  
ATOM 6403  O OG   . SER A 1 2  ? 3.580   -18.698 7.029   1.00 0.00 ? 2  SER A OG   6  
ATOM 6404  H H    . SER A 1 2  ? 4.752   -15.898 4.644   1.00 0.00 ? 2  SER A H    6  
ATOM 6405  H HA   . SER A 1 2  ? 4.095   -16.331 6.670   1.00 0.00 ? 2  SER A HA   6  
ATOM 6406  H HB3  . SER A 1 2  ? 5.630   -18.748 7.249   1.00 0.00 ? 2  SER A HB3  6  
ATOM 6407  H HG   . SER A 1 2  ? 2.901   -18.492 6.324   1.00 0.00 ? 2  SER A HG   6  
ATOM 6408  N N    . SER A 1 3  ? 5.932   -15.103 7.940   1.00 0.00 ? 3  SER A N    6  
ATOM 6409  C CA   . SER A 1 3  ? 6.846   -14.522 8.909   1.00 0.00 ? 3  SER A CA   6  
ATOM 6410  C C    . SER A 1 3  ? 8.278   -14.577 8.376   1.00 0.00 ? 3  SER A C    6  
ATOM 6411  O O    . SER A 1 3  ? 8.907   -15.634 8.384   1.00 0.00 ? 3  SER A O    6  
ATOM 6412  C CB   . SER A 1 3  ? 6.752   -15.243 10.256  1.00 0.00 ? 3  SER A CB   6  
ATOM 6413  O OG   . SER A 1 3  ? 5.570   -14.890 10.969  1.00 0.00 ? 3  SER A OG   6  
ATOM 6414  H H    . SER A 1 3  ? 5.192   -14.499 7.641   1.00 0.00 ? 3  SER A H    6  
ATOM 6415  H HA   . SER A 1 3  ? 6.521   -13.488 9.028   1.00 0.00 ? 3  SER A HA   6  
ATOM 6416  H HB3  . SER A 1 3  ? 7.626   -14.998 10.859  1.00 0.00 ? 3  SER A HB3  6  
ATOM 6417  H HG   . SER A 1 3  ? 4.950   -14.381 10.373  1.00 0.00 ? 3  SER A HG   6  
ATOM 6418  N N    . GLY A 1 4  ? 8.752   -13.425 7.923   1.00 0.00 ? 4  GLY A N    6  
ATOM 6419  C CA   . GLY A 1 4  ? 10.099  -13.329 7.387   1.00 0.00 ? 4  GLY A CA   6  
ATOM 6420  C C    . GLY A 1 4  ? 10.202  -12.198 6.363   1.00 0.00 ? 4  GLY A C    6  
ATOM 6421  O O    . GLY A 1 4  ? 9.548   -11.165 6.505   1.00 0.00 ? 4  GLY A O    6  
ATOM 6422  H H    . GLY A 1 4  ? 8.234   -12.570 7.920   1.00 0.00 ? 4  GLY A H    6  
ATOM 6423  H HA2  . GLY A 1 4  ? 10.805  -13.156 8.198   1.00 0.00 ? 4  GLY A HA2  6  
ATOM 6424  H HA3  . GLY A 1 4  ? 10.376  -14.274 6.919   1.00 0.00 ? 4  GLY A HA3  6  
ATOM 6425  N N    . SER A 1 5  ? 11.028  -12.429 5.353   1.00 0.00 ? 5  SER A N    6  
ATOM 6426  C CA   . SER A 1 5  ? 11.225  -11.442 4.305   1.00 0.00 ? 5  SER A CA   6  
ATOM 6427  C C    . SER A 1 5  ? 11.826  -10.165 4.897   1.00 0.00 ? 5  SER A C    6  
ATOM 6428  O O    . SER A 1 5  ? 11.417  -9.720  5.968   1.00 0.00 ? 5  SER A O    6  
ATOM 6429  C CB   . SER A 1 5  ? 9.910   -11.128 3.590   1.00 0.00 ? 5  SER A CB   6  
ATOM 6430  O OG   . SER A 1 5  ? 9.599   -12.099 2.594   1.00 0.00 ? 5  SER A OG   6  
ATOM 6431  H H    . SER A 1 5  ? 11.556  -13.271 5.245   1.00 0.00 ? 5  SER A H    6  
ATOM 6432  H HA   . SER A 1 5  ? 11.920  -11.902 3.603   1.00 0.00 ? 5  SER A HA   6  
ATOM 6433  H HB3  . SER A 1 5  ? 9.974   -10.143 3.128   1.00 0.00 ? 5  SER A HB3  6  
ATOM 6434  H HG   . SER A 1 5  ? 9.447   -12.991 3.021   1.00 0.00 ? 5  SER A HG   6  
ATOM 6435  N N    . SER A 1 6  ? 12.787  -9.611  4.171   1.00 0.00 ? 6  SER A N    6  
ATOM 6436  C CA   . SER A 1 6  ? 13.447  -8.393  4.611   1.00 0.00 ? 6  SER A CA   6  
ATOM 6437  C C    . SER A 1 6  ? 13.674  -7.462  3.418   1.00 0.00 ? 6  SER A C    6  
ATOM 6438  O O    . SER A 1 6  ? 13.498  -7.864  2.269   1.00 0.00 ? 6  SER A O    6  
ATOM 6439  C CB   . SER A 1 6  ? 14.777  -8.707  5.300   1.00 0.00 ? 6  SER A CB   6  
ATOM 6440  O OG   . SER A 1 6  ? 14.592  -9.132  6.647   1.00 0.00 ? 6  SER A OG   6  
ATOM 6441  H H    . SER A 1 6  ? 13.113  -9.979  3.301   1.00 0.00 ? 6  SER A H    6  
ATOM 6442  H HA   . SER A 1 6  ? 12.765  -7.937  5.328   1.00 0.00 ? 6  SER A HA   6  
ATOM 6443  H HB3  . SER A 1 6  ? 15.411  -7.820  5.283   1.00 0.00 ? 6  SER A HB3  6  
ATOM 6444  H HG   . SER A 1 6  ? 14.529  -10.128 6.686   1.00 0.00 ? 6  SER A HG   6  
ATOM 6445  N N    . GLY A 1 7  ? 14.062  -6.235  3.732   1.00 0.00 ? 7  GLY A N    6  
ATOM 6446  C CA   . GLY A 1 7  ? 14.315  -5.243  2.701   1.00 0.00 ? 7  GLY A CA   6  
ATOM 6447  C C    . GLY A 1 7  ? 13.350  -4.063  2.826   1.00 0.00 ? 7  GLY A C    6  
ATOM 6448  O O    . GLY A 1 7  ? 12.264  -4.201  3.387   1.00 0.00 ? 7  GLY A O    6  
ATOM 6449  H H    . GLY A 1 7  ? 14.204  -5.915  4.669   1.00 0.00 ? 7  GLY A H    6  
ATOM 6450  H HA2  . GLY A 1 7  ? 15.342  -4.886  2.779   1.00 0.00 ? 7  GLY A HA2  6  
ATOM 6451  H HA3  . GLY A 1 7  ? 14.210  -5.700  1.718   1.00 0.00 ? 7  GLY A HA3  6  
ATOM 6452  N N    . LEU A 1 8  ? 13.779  -2.928  2.295   1.00 0.00 ? 8  LEU A N    6  
ATOM 6453  C CA   . LEU A 1 8  ? 12.967  -1.725  2.339   1.00 0.00 ? 8  LEU A CA   6  
ATOM 6454  C C    . LEU A 1 8  ? 11.777  -1.882  1.390   1.00 0.00 ? 8  LEU A C    6  
ATOM 6455  O O    . LEU A 1 8  ? 10.625  -1.775  1.809   1.00 0.00 ? 8  LEU A O    6  
ATOM 6456  C CB   . LEU A 1 8  ? 13.821  -0.489  2.054   1.00 0.00 ? 8  LEU A CB   6  
ATOM 6457  C CG   . LEU A 1 8  ? 14.344  0.264   3.279   1.00 0.00 ? 8  LEU A CG   6  
ATOM 6458  C CD1  . LEU A 1 8  ? 15.072  1.544   2.868   1.00 0.00 ? 8  LEU A CD1  6  
ATOM 6459  C CD2  . LEU A 1 8  ? 13.216  0.540   4.275   1.00 0.00 ? 8  LEU A CD2  6  
ATOM 6460  H H    . LEU A 1 8  ? 14.664  -2.823  1.840   1.00 0.00 ? 8  LEU A H    6  
ATOM 6461  H HA   . LEU A 1 8  ? 12.586  -1.626  3.356   1.00 0.00 ? 8  LEU A HA   6  
ATOM 6462  H HB3  . LEU A 1 8  ? 13.235  0.204   1.451   1.00 0.00 ? 8  LEU A HB3  6  
ATOM 6463  H HG   . LEU A 1 8  ? 15.071  -0.372  3.786   1.00 0.00 ? 8  LEU A HG   6  
ATOM 6464  H HD11 . LEU A 1 8  ? 15.533  1.998   3.745   1.00 0.00 ? 8  LEU A HD11 6  
ATOM 6465  H HD12 . LEU A 1 8  ? 15.843  1.304   2.136   1.00 0.00 ? 8  LEU A HD12 6  
ATOM 6466  H HD13 . LEU A 1 8  ? 14.359  2.242   2.429   1.00 0.00 ? 8  LEU A HD13 6  
ATOM 6467  H HD21 . LEU A 1 8  ? 12.254  0.394   3.784   1.00 0.00 ? 8  LEU A HD21 6  
ATOM 6468  H HD22 . LEU A 1 8  ? 13.300  -0.145  5.119   1.00 0.00 ? 8  LEU A HD22 6  
ATOM 6469  H HD23 . LEU A 1 8  ? 13.290  1.568   4.632   1.00 0.00 ? 8  LEU A HD23 6  
ATOM 6470  N N    . ARG A 1 9  ? 12.097  -2.134  0.129   1.00 0.00 ? 9  ARG A N    6  
ATOM 6471  C CA   . ARG A 1 9  ? 11.068  -2.307  -0.883  1.00 0.00 ? 9  ARG A CA   6  
ATOM 6472  C C    . ARG A 1 9  ? 10.206  -3.528  -0.560  1.00 0.00 ? 9  ARG A C    6  
ATOM 6473  O O    . ARG A 1 9  ? 9.008   -3.539  -0.841  1.00 0.00 ? 9  ARG A O    6  
ATOM 6474  C CB   . ARG A 1 9  ? 11.687  -2.480  -2.271  1.00 0.00 ? 9  ARG A CB   6  
ATOM 6475  C CG   . ARG A 1 9  ? 10.616  -2.411  -3.362  1.00 0.00 ? 9  ARG A CG   6  
ATOM 6476  C CD   . ARG A 1 9  ? 10.665  -3.649  -4.260  1.00 0.00 ? 9  ARG A CD   6  
ATOM 6477  N NE   . ARG A 1 9  ? 10.604  -4.876  -3.434  1.00 0.00 ? 9  ARG A NE   6  
ATOM 6478  C CZ   . ARG A 1 9  ? 10.399  -6.104  -3.928  1.00 0.00 ? 9  ARG A CZ   6  
ATOM 6479  N NH1  . ARG A 1 9  ? 10.233  -6.278  -5.246  1.00 0.00 ? 9  ARG A NH1  6  
ATOM 6480  N NH2  . ARG A 1 9  ? 10.359  -7.160  -3.103  1.00 0.00 ? 9  ARG A NH2  6  
ATOM 6481  H H    . ARG A 1 9  ? 13.035  -2.219  -0.204  1.00 0.00 ? 9  ARG A H    6  
ATOM 6482  H HA   . ARG A 1 9  ? 10.481  -1.389  -0.843  1.00 0.00 ? 9  ARG A HA   6  
ATOM 6483  H HB3  . ARG A 1 9  ? 12.204  -3.439  -2.327  1.00 0.00 ? 9  ARG A HB3  6  
ATOM 6484  H HG3  . ARG A 1 9  ? 10.763  -1.515  -3.964  1.00 0.00 ? 9  ARG A HG3  6  
ATOM 6485  H HD3  . ARG A 1 9  ? 11.581  -3.644  -4.851  1.00 0.00 ? 9  ARG A HD3  6  
ATOM 6486  H HE   . ARG A 1 9  ? 10.724  -4.782  -2.445  1.00 0.00 ? 9  ARG A HE   6  
ATOM 6487  H HH11 . ARG A 1 9  ? 10.263  -5.490  -5.861  1.00 0.00 ? 9  ARG A HH11 6  
ATOM 6488  H HH12 . ARG A 1 9  ? 10.080  -7.195  -5.614  1.00 0.00 ? 9  ARG A HH12 6  
ATOM 6489  H HH21 . ARG A 1 9  ? 10.482  -7.031  -2.119  1.00 0.00 ? 9  ARG A HH21 6  
ATOM 6490  H HH22 . ARG A 1 9  ? 10.206  -8.076  -3.472  1.00 0.00 ? 9  ARG A HH22 6  
ATOM 6491  N N    . LYS A 1 10 ? 10.848  -4.528  0.025   1.00 0.00 ? 10 LYS A N    6  
ATOM 6492  C CA   . LYS A 1 10 ? 10.154  -5.752  0.390   1.00 0.00 ? 10 LYS A CA   6  
ATOM 6493  C C    . LYS A 1 10 ? 9.179   -5.459  1.532   1.00 0.00 ? 10 LYS A C    6  
ATOM 6494  O O    . LYS A 1 10 ? 8.117   -6.074  1.618   1.00 0.00 ? 10 LYS A O    6  
ATOM 6495  C CB   . LYS A 1 10 ? 11.158  -6.862  0.708   1.00 0.00 ? 10 LYS A CB   6  
ATOM 6496  C CG   . LYS A 1 10 ? 10.491  -7.995  1.493   1.00 0.00 ? 10 LYS A CG   6  
ATOM 6497  C CD   . LYS A 1 10 ? 9.256   -8.517  0.760   1.00 0.00 ? 10 LYS A CD   6  
ATOM 6498  C CE   . LYS A 1 10 ? 8.078   -8.687  1.721   1.00 0.00 ? 10 LYS A CE   6  
ATOM 6499  N NZ   . LYS A 1 10 ? 6.801   -8.385  1.035   1.00 0.00 ? 10 LYS A NZ   6  
ATOM 6500  H H    . LYS A 1 10 ? 11.822  -4.512  0.251   1.00 0.00 ? 10 LYS A H    6  
ATOM 6501  H HA   . LYS A 1 10 ? 9.582   -6.075  -0.479  1.00 0.00 ? 10 LYS A HA   6  
ATOM 6502  H HB3  . LYS A 1 10 ? 11.987  -6.454  1.285   1.00 0.00 ? 10 LYS A HB3  6  
ATOM 6503  H HG3  . LYS A 1 10 ? 10.207  -7.638  2.484   1.00 0.00 ? 10 LYS A HG3  6  
ATOM 6504  H HD3  . LYS A 1 10 ? 9.486   -9.473  0.288   1.00 0.00 ? 10 LYS A HD3  6  
ATOM 6505  H HE3  . LYS A 1 10 ? 8.203   -8.026  2.578   1.00 0.00 ? 10 LYS A HE3  6  
ATOM 6506  H HZ1  . LYS A 1 10 ? 6.834   -7.457  0.665   1.00 0.00 ? 10 LYS A HZ1  6  
ATOM 6507  H HZ2  . LYS A 1 10 ? 6.661   -9.038  0.290   1.00 0.00 ? 10 LYS A HZ2  6  
ATOM 6508  H HZ3  . LYS A 1 10 ? 6.048   -8.457  1.688   1.00 0.00 ? 10 LYS A HZ3  6  
ATOM 6509  N N    . MET A 1 11 ? 9.573   -4.520  2.379   1.00 0.00 ? 11 MET A N    6  
ATOM 6510  C CA   . MET A 1 11 ? 8.747   -4.138  3.511   1.00 0.00 ? 11 MET A CA   6  
ATOM 6511  C C    . MET A 1 11 ? 7.459   -3.457  3.045   1.00 0.00 ? 11 MET A C    6  
ATOM 6512  O O    . MET A 1 11 ? 6.361   -3.901  3.378   1.00 0.00 ? 11 MET A O    6  
ATOM 6513  C CB   . MET A 1 11 ? 9.529   -3.185  4.417   1.00 0.00 ? 11 MET A CB   6  
ATOM 6514  C CG   . MET A 1 11 ? 10.237  -3.951  5.537   1.00 0.00 ? 11 MET A CG   6  
ATOM 6515  S SD   . MET A 1 11 ? 9.956   -3.141  7.102   1.00 0.00 ? 11 MET A SD   6  
ATOM 6516  C CE   . MET A 1 11 ? 11.175  -1.841  7.001   1.00 0.00 ? 11 MET A CE   6  
ATOM 6517  H H    . MET A 1 11 ? 10.438  -4.024  2.301   1.00 0.00 ? 11 MET A H    6  
ATOM 6518  H HA   . MET A 1 11 ? 8.507   -5.069  4.026   1.00 0.00 ? 11 MET A HA   6  
ATOM 6519  H HB3  . MET A 1 11 ? 8.853   -2.447  4.847   1.00 0.00 ? 11 MET A HB3  6  
ATOM 6520  H HG3  . MET A 1 11 ? 11.307  -4.005  5.332   1.00 0.00 ? 11 MET A HG3  6  
ATOM 6521  H HE1  . MET A 1 11 ? 11.971  -2.032  7.721   1.00 0.00 ? 11 MET A HE1  6  
ATOM 6522  H HE2  . MET A 1 11 ? 11.595  -1.812  5.996   1.00 0.00 ? 11 MET A HE2  6  
ATOM 6523  H HE3  . MET A 1 11 ? 10.705  -0.883  7.226   1.00 0.00 ? 11 MET A HE3  6  
ATOM 6524  N N    . VAL A 1 12 ? 7.636   -2.388  2.282   1.00 0.00 ? 12 VAL A N    6  
ATOM 6525  C CA   . VAL A 1 12 ? 6.501   -1.640  1.766   1.00 0.00 ? 12 VAL A CA   6  
ATOM 6526  C C    . VAL A 1 12 ? 5.672   -2.546  0.852   1.00 0.00 ? 12 VAL A C    6  
ATOM 6527  O O    . VAL A 1 12 ? 4.461   -2.369  0.732   1.00 0.00 ? 12 VAL A O    6  
ATOM 6528  C CB   . VAL A 1 12 ? 6.986   -0.369  1.067   1.00 0.00 ? 12 VAL A CB   6  
ATOM 6529  C CG1  . VAL A 1 12 ? 8.251   -0.640  0.250   1.00 0.00 ? 12 VAL A CG1  6  
ATOM 6530  C CG2  . VAL A 1 12 ? 5.884   0.228   0.189   1.00 0.00 ? 12 VAL A CG2  6  
ATOM 6531  H H    . VAL A 1 12 ? 8.531   -2.033  2.016   1.00 0.00 ? 12 VAL A H    6  
ATOM 6532  H HA   . VAL A 1 12 ? 5.888   -1.345  2.617   1.00 0.00 ? 12 VAL A HA   6  
ATOM 6533  H HB   . VAL A 1 12 ? 7.235   0.363   1.836   1.00 0.00 ? 12 VAL A HB   6  
ATOM 6534  H HG11 . VAL A 1 12 ? 8.387   -1.716  0.138   1.00 0.00 ? 12 VAL A HG11 6  
ATOM 6535  H HG12 . VAL A 1 12 ? 8.154   -0.181  -0.733  1.00 0.00 ? 12 VAL A HG12 6  
ATOM 6536  H HG13 . VAL A 1 12 ? 9.114   -0.219  0.766   1.00 0.00 ? 12 VAL A HG13 6  
ATOM 6537  H HG21 . VAL A 1 12 ? 4.992   0.399   0.792   1.00 0.00 ? 12 VAL A HG21 6  
ATOM 6538  H HG22 . VAL A 1 12 ? 6.227   1.175   -0.229  1.00 0.00 ? 12 VAL A HG22 6  
ATOM 6539  H HG23 . VAL A 1 12 ? 5.650   -0.463  -0.620  1.00 0.00 ? 12 VAL A HG23 6  
ATOM 6540  N N    . GLU A 1 13 ? 6.358   -3.494  0.232   1.00 0.00 ? 13 GLU A N    6  
ATOM 6541  C CA   . GLU A 1 13 ? 5.700   -4.428  -0.666  1.00 0.00 ? 13 GLU A CA   6  
ATOM 6542  C C    . GLU A 1 13 ? 4.514   -5.094  0.034   1.00 0.00 ? 13 GLU A C    6  
ATOM 6543  O O    . GLU A 1 13 ? 3.462   -5.290  -0.571  1.00 0.00 ? 13 GLU A O    6  
ATOM 6544  C CB   . GLU A 1 13 ? 6.686   -5.474  -1.188  1.00 0.00 ? 13 GLU A CB   6  
ATOM 6545  C CG   . GLU A 1 13 ? 7.432   -4.959  -2.421  1.00 0.00 ? 13 GLU A CG   6  
ATOM 6546  C CD   . GLU A 1 13 ? 6.717   -5.380  -3.708  1.00 0.00 ? 13 GLU A CD   6  
ATOM 6547  O OE1  . GLU A 1 13 ? 5.491   -5.608  -3.628  1.00 0.00 ? 13 GLU A OE1  6  
ATOM 6548  O OE2  . GLU A 1 13 ? 7.415   -5.462  -4.742  1.00 0.00 ? 13 GLU A OE2  6  
ATOM 6549  H H    . GLU A 1 13 ? 7.343   -3.631  0.336   1.00 0.00 ? 13 GLU A H    6  
ATOM 6550  H HA   . GLU A 1 13 ? 5.345   -3.824  -1.501  1.00 0.00 ? 13 GLU A HA   6  
ATOM 6551  H HB3  . GLU A 1 13 ? 6.151   -6.390  -1.438  1.00 0.00 ? 13 GLU A HB3  6  
ATOM 6552  H HG3  . GLU A 1 13 ? 8.450   -5.346  -2.423  1.00 0.00 ? 13 GLU A HG3  6  
ATOM 6553  N N    . GLU A 1 14 ? 4.724   -5.423  1.300   1.00 0.00 ? 14 GLU A N    6  
ATOM 6554  C CA   . GLU A 1 14 ? 3.685   -6.062  2.090   1.00 0.00 ? 14 GLU A CA   6  
ATOM 6555  C C    . GLU A 1 14 ? 2.704   -5.015  2.622   1.00 0.00 ? 14 GLU A C    6  
ATOM 6556  O O    . GLU A 1 14 ? 1.492   -5.234  2.612   1.00 0.00 ? 14 GLU A O    6  
ATOM 6557  C CB   . GLU A 1 14 ? 4.290   -6.878  3.234   1.00 0.00 ? 14 GLU A CB   6  
ATOM 6558  C CG   . GLU A 1 14 ? 4.340   -6.058  4.525   1.00 0.00 ? 14 GLU A CG   6  
ATOM 6559  C CD   . GLU A 1 14 ? 5.097   -6.810  5.622   1.00 0.00 ? 14 GLU A CD   6  
ATOM 6560  O OE1  . GLU A 1 14 ? 5.920   -7.675  5.254   1.00 0.00 ? 14 GLU A OE1  6  
ATOM 6561  O OE2  . GLU A 1 14 ? 4.836   -6.501  6.805   1.00 0.00 ? 14 GLU A OE2  6  
ATOM 6562  H H    . GLU A 1 14 ? 5.583   -5.259  1.785   1.00 0.00 ? 14 GLU A H    6  
ATOM 6563  H HA   . GLU A 1 14 ? 3.172   -6.735  1.404   1.00 0.00 ? 14 GLU A HA   6  
ATOM 6564  H HB3  . GLU A 1 14 ? 5.297   -7.199  2.964   1.00 0.00 ? 14 GLU A HB3  6  
ATOM 6565  H HG3  . GLU A 1 14 ? 3.326   -5.841  4.862   1.00 0.00 ? 14 GLU A HG3  6  
ATOM 6566  N N    . VAL A 1 15 ? 3.262   -3.902  3.073   1.00 0.00 ? 15 VAL A N    6  
ATOM 6567  C CA   . VAL A 1 15 ? 2.450   -2.822  3.609   1.00 0.00 ? 15 VAL A CA   6  
ATOM 6568  C C    . VAL A 1 15 ? 1.255   -2.582  2.684   1.00 0.00 ? 15 VAL A C    6  
ATOM 6569  O O    . VAL A 1 15 ? 0.125   -2.933  3.021   1.00 0.00 ? 15 VAL A O    6  
ATOM 6570  C CB   . VAL A 1 15 ? 3.310   -1.572  3.811   1.00 0.00 ? 15 VAL A CB   6  
ATOM 6571  C CG1  . VAL A 1 15 ? 2.437   -0.327  3.976   1.00 0.00 ? 15 VAL A CG1  6  
ATOM 6572  C CG2  . VAL A 1 15 ? 4.253   -1.743  5.004   1.00 0.00 ? 15 VAL A CG2  6  
ATOM 6573  H H    . VAL A 1 15 ? 4.247   -3.732  3.078   1.00 0.00 ? 15 VAL A H    6  
ATOM 6574  H HA   . VAL A 1 15 ? 2.081   -3.139  4.584   1.00 0.00 ? 15 VAL A HA   6  
ATOM 6575  H HB   . VAL A 1 15 ? 3.920   -1.437  2.918   1.00 0.00 ? 15 VAL A HB   6  
ATOM 6576  H HG11 . VAL A 1 15 ? 2.137   0.039   2.994   1.00 0.00 ? 15 VAL A HG11 6  
ATOM 6577  H HG12 . VAL A 1 15 ? 1.549   -0.580  4.556   1.00 0.00 ? 15 VAL A HG12 6  
ATOM 6578  H HG13 . VAL A 1 15 ? 3.002   0.447   4.495   1.00 0.00 ? 15 VAL A HG13 6  
ATOM 6579  H HG21 . VAL A 1 15 ? 5.136   -1.121  4.860   1.00 0.00 ? 15 VAL A HG21 6  
ATOM 6580  H HG22 . VAL A 1 15 ? 3.742   -1.441  5.917   1.00 0.00 ? 15 VAL A HG22 6  
ATOM 6581  H HG23 . VAL A 1 15 ? 4.553   -2.788  5.084   1.00 0.00 ? 15 VAL A HG23 6  
ATOM 6582  N N    . PHE A 1 16 ? 1.544   -1.985  1.538   1.00 0.00 ? 16 PHE A N    6  
ATOM 6583  C CA   . PHE A 1 16 ? 0.508   -1.693  0.563   1.00 0.00 ? 16 PHE A CA   6  
ATOM 6584  C C    . PHE A 1 16 ? -0.464  -2.867  0.428   1.00 0.00 ? 16 PHE A C    6  
ATOM 6585  O O    . PHE A 1 16 ? -1.673  -2.668  0.321   1.00 0.00 ? 16 PHE A O    6  
ATOM 6586  C CB   . PHE A 1 16 ? 1.206   -1.469  -0.780  1.00 0.00 ? 16 PHE A CB   6  
ATOM 6587  C CG   . PHE A 1 16 ? 1.819   -0.076  -0.937  1.00 0.00 ? 16 PHE A CG   6  
ATOM 6588  C CD1  . PHE A 1 16 ? 1.152   1.016   -0.478  1.00 0.00 ? 16 PHE A CD1  6  
ATOM 6589  C CD2  . PHE A 1 16 ? 3.032   0.070   -1.537  1.00 0.00 ? 16 PHE A CD2  6  
ATOM 6590  C CE1  . PHE A 1 16 ? 1.722   2.309   -0.624  1.00 0.00 ? 16 PHE A CE1  6  
ATOM 6591  C CE2  . PHE A 1 16 ? 3.601   1.362   -1.683  1.00 0.00 ? 16 PHE A CE2  6  
ATOM 6592  C CZ   . PHE A 1 16 ? 2.934   2.454   -1.224  1.00 0.00 ? 16 PHE A CZ   6  
ATOM 6593  H H    . PHE A 1 16 ? 2.466   -1.701  1.272   1.00 0.00 ? 16 PHE A H    6  
ATOM 6594  H HA   . PHE A 1 16 ? -0.032  -0.815  0.918   1.00 0.00 ? 16 PHE A HA   6  
ATOM 6595  H HB3  . PHE A 1 16 ? 0.488   -1.631  -1.583  1.00 0.00 ? 16 PHE A HB3  6  
ATOM 6596  H HD1  . PHE A 1 16 ? 0.181   0.899   0.003   1.00 0.00 ? 16 PHE A HD1  6  
ATOM 6597  H HD2  . PHE A 1 16 ? 3.566   -0.807  -1.905  1.00 0.00 ? 16 PHE A HD2  6  
ATOM 6598  H HE1  . PHE A 1 16 ? 1.187   3.185   -0.256  1.00 0.00 ? 16 PHE A HE1  6  
ATOM 6599  H HE2  . PHE A 1 16 ? 4.573   1.478   -2.164  1.00 0.00 ? 16 PHE A HE2  6  
ATOM 6600  H HZ   . PHE A 1 16 ? 3.372   3.447   -1.336  1.00 0.00 ? 16 PHE A HZ   6  
ATOM 6601  N N    . ASP A 1 17 ? 0.101   -4.066  0.440   1.00 0.00 ? 17 ASP A N    6  
ATOM 6602  C CA   . ASP A 1 17 ? -0.701  -5.272  0.321   1.00 0.00 ? 17 ASP A CA   6  
ATOM 6603  C C    . ASP A 1 17 ? -1.605  -5.401  1.549   1.00 0.00 ? 17 ASP A C    6  
ATOM 6604  O O    . ASP A 1 17 ? -2.829  -5.349  1.431   1.00 0.00 ? 17 ASP A O    6  
ATOM 6605  C CB   . ASP A 1 17 ? 0.185   -6.518  0.254   1.00 0.00 ? 17 ASP A CB   6  
ATOM 6606  C CG   . ASP A 1 17 ? 0.480   -7.025  -1.159  1.00 0.00 ? 17 ASP A CG   6  
ATOM 6607  O OD1  . ASP A 1 17 ? 0.504   -6.173  -2.074  1.00 0.00 ? 17 ASP A OD1  6  
ATOM 6608  O OD2  . ASP A 1 17 ? 0.676   -8.252  -1.291  1.00 0.00 ? 17 ASP A OD2  6  
ATOM 6609  H H    . ASP A 1 17 ? 1.085   -4.219  0.529   1.00 0.00 ? 17 ASP A H    6  
ATOM 6610  H HA   . ASP A 1 17 ? -1.266  -5.150  -0.602  1.00 0.00 ? 17 ASP A HA   6  
ATOM 6611  H HB3  . ASP A 1 17 ? -0.295  -7.318  0.817   1.00 0.00 ? 17 ASP A HB3  6  
ATOM 6612  N N    . VAL A 1 18 ? -0.968  -5.567  2.698   1.00 0.00 ? 18 VAL A N    6  
ATOM 6613  C CA   . VAL A 1 18 ? -1.700  -5.704  3.947   1.00 0.00 ? 18 VAL A CA   6  
ATOM 6614  C C    . VAL A 1 18 ? -2.841  -4.686  3.978   1.00 0.00 ? 18 VAL A C    6  
ATOM 6615  O O    . VAL A 1 18 ? -3.999  -5.051  4.173   1.00 0.00 ? 18 VAL A O    6  
ATOM 6616  C CB   . VAL A 1 18 ? -0.743  -5.567  5.132   1.00 0.00 ? 18 VAL A CB   6  
ATOM 6617  C CG1  . VAL A 1 18 ? -1.491  -5.126  6.393   1.00 0.00 ? 18 VAL A CG1  6  
ATOM 6618  C CG2  . VAL A 1 18 ? 0.020   -6.871  5.375   1.00 0.00 ? 18 VAL A CG2  6  
ATOM 6619  H H    . VAL A 1 18 ? 0.027   -5.608  2.786   1.00 0.00 ? 18 VAL A H    6  
ATOM 6620  H HA   . VAL A 1 18 ? -2.125  -6.708  3.970   1.00 0.00 ? 18 VAL A HA   6  
ATOM 6621  H HB   . VAL A 1 18 ? -0.015  -4.793  4.887   1.00 0.00 ? 18 VAL A HB   6  
ATOM 6622  H HG11 . VAL A 1 18 ? -0.926  -5.428  7.274   1.00 0.00 ? 18 VAL A HG11 6  
ATOM 6623  H HG12 . VAL A 1 18 ? -1.605  -4.042  6.387   1.00 0.00 ? 18 VAL A HG12 6  
ATOM 6624  H HG13 . VAL A 1 18 ? -2.475  -5.594  6.413   1.00 0.00 ? 18 VAL A HG13 6  
ATOM 6625  H HG21 . VAL A 1 18 ? 0.097   -7.426  4.440   1.00 0.00 ? 18 VAL A HG21 6  
ATOM 6626  H HG22 . VAL A 1 18 ? 1.020   -6.642  5.745   1.00 0.00 ? 18 VAL A HG22 6  
ATOM 6627  H HG23 . VAL A 1 18 ? -0.512  -7.471  6.112   1.00 0.00 ? 18 VAL A HG23 6  
ATOM 6628  N N    . LEU A 1 19 ? -2.474  -3.427  3.784   1.00 0.00 ? 19 LEU A N    6  
ATOM 6629  C CA   . LEU A 1 19 ? -3.452  -2.353  3.787   1.00 0.00 ? 19 LEU A CA   6  
ATOM 6630  C C    . LEU A 1 19 ? -4.588  -2.700  2.821   1.00 0.00 ? 19 LEU A C    6  
ATOM 6631  O O    . LEU A 1 19 ? -5.747  -2.785  3.224   1.00 0.00 ? 19 LEU A O    6  
ATOM 6632  C CB   . LEU A 1 19 ? -2.778  -1.013  3.489   1.00 0.00 ? 19 LEU A CB   6  
ATOM 6633  C CG   . LEU A 1 19 ? -1.601  -0.638  4.391   1.00 0.00 ? 19 LEU A CG   6  
ATOM 6634  C CD1  . LEU A 1 19 ? -1.273  0.851   4.275   1.00 0.00 ? 19 LEU A CD1  6  
ATOM 6635  C CD2  . LEU A 1 19 ? -1.865  -1.056  5.839   1.00 0.00 ? 19 LEU A CD2  6  
ATOM 6636  H H    . LEU A 1 19 ? -1.530  -3.138  3.626   1.00 0.00 ? 19 LEU A H    6  
ATOM 6637  H HA   . LEU A 1 19 ? -3.864  -2.289  4.795   1.00 0.00 ? 19 LEU A HA   6  
ATOM 6638  H HB3  . LEU A 1 19 ? -3.530  -0.227  3.561   1.00 0.00 ? 19 LEU A HB3  6  
ATOM 6639  H HG   . LEU A 1 19 ? -0.722  -1.189  4.053   1.00 0.00 ? 19 LEU A HG   6  
ATOM 6640  H HD11 . LEU A 1 19 ? -0.206  0.975   4.090   1.00 0.00 ? 19 LEU A HD11 6  
ATOM 6641  H HD12 . LEU A 1 19 ? -1.838  1.285   3.450   1.00 0.00 ? 19 LEU A HD12 6  
ATOM 6642  H HD13 . LEU A 1 19 ? -1.541  1.356   5.204   1.00 0.00 ? 19 LEU A HD13 6  
ATOM 6643  H HD21 . LEU A 1 19 ? -2.929  -0.967  6.055   1.00 0.00 ? 19 LEU A HD21 6  
ATOM 6644  H HD22 . LEU A 1 19 ? -1.550  -2.090  5.982   1.00 0.00 ? 19 LEU A HD22 6  
ATOM 6645  H HD23 . LEU A 1 19 ? -1.303  -0.409  6.512   1.00 0.00 ? 19 LEU A HD23 6  
ATOM 6646  N N    . TYR A 1 20 ? -4.214  -2.889  1.564   1.00 0.00 ? 20 TYR A N    6  
ATOM 6647  C CA   . TYR A 1 20 ? -5.186  -3.224  0.537   1.00 0.00 ? 20 TYR A CA   6  
ATOM 6648  C C    . TYR A 1 20 ? -6.101  -4.360  0.999   1.00 0.00 ? 20 TYR A C    6  
ATOM 6649  O O    . TYR A 1 20 ? -7.324  -4.252  0.912   1.00 0.00 ? 20 TYR A O    6  
ATOM 6650  C CB   . TYR A 1 20 ? -4.377  -3.697  -0.671  1.00 0.00 ? 20 TYR A CB   6  
ATOM 6651  C CG   . TYR A 1 20 ? -5.233  -4.141  -1.859  1.00 0.00 ? 20 TYR A CG   6  
ATOM 6652  C CD1  . TYR A 1 20 ? -6.241  -3.323  -2.326  1.00 0.00 ? 20 TYR A CD1  6  
ATOM 6653  C CD2  . TYR A 1 20 ? -4.996  -5.359  -2.463  1.00 0.00 ? 20 TYR A CD2  6  
ATOM 6654  C CE1  . TYR A 1 20 ? -7.048  -3.741  -3.444  1.00 0.00 ? 20 TYR A CE1  6  
ATOM 6655  C CE2  . TYR A 1 20 ? -5.803  -5.777  -3.581  1.00 0.00 ? 20 TYR A CE2  6  
ATOM 6656  C CZ   . TYR A 1 20 ? -6.788  -4.948  -4.015  1.00 0.00 ? 20 TYR A CZ   6  
ATOM 6657  O OH   . TYR A 1 20 ? -7.550  -5.343  -5.071  1.00 0.00 ? 20 TYR A OH   6  
ATOM 6658  H H    . TYR A 1 20 ? -3.269  -2.818  1.245   1.00 0.00 ? 20 TYR A H    6  
ATOM 6659  H HA   . TYR A 1 20 ? -5.789  -2.338  0.344   1.00 0.00 ? 20 TYR A HA   6  
ATOM 6660  H HB3  . TYR A 1 20 ? -3.738  -4.525  -0.367  1.00 0.00 ? 20 TYR A HB3  6  
ATOM 6661  H HD1  . TYR A 1 20 ? -6.428  -2.361  -1.849  1.00 0.00 ? 20 TYR A HD1  6  
ATOM 6662  H HD2  . TYR A 1 20 ? -4.200  -6.005  -2.094  1.00 0.00 ? 20 TYR A HD2  6  
ATOM 6663  H HE1  . TYR A 1 20 ? -7.848  -3.105  -3.823  1.00 0.00 ? 20 TYR A HE1  6  
ATOM 6664  H HE2  . TYR A 1 20 ? -5.626  -6.737  -4.066  1.00 0.00 ? 20 TYR A HE2  6  
ATOM 6665  H HH   . TYR A 1 20 ? -7.005  -5.902  -5.695  1.00 0.00 ? 20 TYR A HH   6  
ATOM 6666  N N    . SER A 1 21 ? -5.475  -5.425  1.479   1.00 0.00 ? 21 SER A N    6  
ATOM 6667  C CA   . SER A 1 21 ? -6.218  -6.580  1.954   1.00 0.00 ? 21 SER A CA   6  
ATOM 6668  C C    . SER A 1 21 ? -7.150  -6.168  3.095   1.00 0.00 ? 21 SER A C    6  
ATOM 6669  O O    . SER A 1 21 ? -8.289  -6.630  3.167   1.00 0.00 ? 21 SER A O    6  
ATOM 6670  C CB   . SER A 1 21 ? -5.272  -7.690  2.415   1.00 0.00 ? 21 SER A CB   6  
ATOM 6671  O OG   . SER A 1 21 ? -5.977  -8.874  2.778   1.00 0.00 ? 21 SER A OG   6  
ATOM 6672  H H    . SER A 1 21 ? -4.480  -5.505  1.546   1.00 0.00 ? 21 SER A H    6  
ATOM 6673  H HA   . SER A 1 21 ? -6.793  -6.926  1.096   1.00 0.00 ? 21 SER A HA   6  
ATOM 6674  H HB3  . SER A 1 21 ? -4.689  -7.340  3.267   1.00 0.00 ? 21 SER A HB3  6  
ATOM 6675  H HG   . SER A 1 21 ? -5.330  -9.598  3.019   1.00 0.00 ? 21 SER A HG   6  
ATOM 6676  N N    . GLU A 1 22 ? -6.634  -5.306  3.957   1.00 0.00 ? 22 GLU A N    6  
ATOM 6677  C CA   . GLU A 1 22 ? -7.406  -4.827  5.092   1.00 0.00 ? 22 GLU A CA   6  
ATOM 6678  C C    . GLU A 1 22 ? -8.675  -4.119  4.609   1.00 0.00 ? 22 GLU A C    6  
ATOM 6679  O O    . GLU A 1 22 ? -9.772  -4.411  5.083   1.00 0.00 ? 22 GLU A O    6  
ATOM 6680  C CB   . GLU A 1 22 ? -6.567  -3.904  5.977   1.00 0.00 ? 22 GLU A CB   6  
ATOM 6681  C CG   . GLU A 1 22 ? -5.483  -4.691  6.717   1.00 0.00 ? 22 GLU A CG   6  
ATOM 6682  C CD   . GLU A 1 22 ? -5.969  -5.127  8.101   1.00 0.00 ? 22 GLU A CD   6  
ATOM 6683  O OE1  . GLU A 1 22 ? -6.760  -6.094  8.145   1.00 0.00 ? 22 GLU A OE1  6  
ATOM 6684  O OE2  . GLU A 1 22 ? -5.539  -4.483  9.082   1.00 0.00 ? 22 GLU A OE2  6  
ATOM 6685  H H    . GLU A 1 22 ? -5.708  -4.935  3.891   1.00 0.00 ? 22 GLU A H    6  
ATOM 6686  H HA   . GLU A 1 22 ? -7.674  -5.720  5.657   1.00 0.00 ? 22 GLU A HA   6  
ATOM 6687  H HB3  . GLU A 1 22 ? -7.212  -3.401  6.698   1.00 0.00 ? 22 GLU A HB3  6  
ATOM 6688  H HG3  . GLU A 1 22 ? -4.588  -4.078  6.818   1.00 0.00 ? 22 GLU A HG3  6  
ATOM 6689  N N    . ALA A 1 23 ? -8.483  -3.203  3.672   1.00 0.00 ? 23 ALA A N    6  
ATOM 6690  C CA   . ALA A 1 23 ? -9.597  -2.452  3.120   1.00 0.00 ? 23 ALA A CA   6  
ATOM 6691  C C    . ALA A 1 23 ? -10.507 -3.399  2.336   1.00 0.00 ? 23 ALA A C    6  
ATOM 6692  O O    . ALA A 1 23 ? -11.708 -3.161  2.224   1.00 0.00 ? 23 ALA A O    6  
ATOM 6693  C CB   . ALA A 1 23 ? -9.063  -1.307  2.256   1.00 0.00 ? 23 ALA A CB   6  
ATOM 6694  H H    . ALA A 1 23 ? -7.587  -2.972  3.291   1.00 0.00 ? 23 ALA A H    6  
ATOM 6695  H HA   . ALA A 1 23 ? -10.158 -2.030  3.954   1.00 0.00 ? 23 ALA A HA   6  
ATOM 6696  H HB1  . ALA A 1 23 ? -9.555  -0.377  2.541   1.00 0.00 ? 23 ALA A HB1  6  
ATOM 6697  H HB2  . ALA A 1 23 ? -7.988  -1.209  2.406   1.00 0.00 ? 23 ALA A HB2  6  
ATOM 6698  H HB3  . ALA A 1 23 ? -9.266  -1.519  1.206   1.00 0.00 ? 23 ALA A HB3  6  
ATOM 6699  N N    . LEU A 1 24 ? -9.898  -4.454  1.812   1.00 0.00 ? 24 LEU A N    6  
ATOM 6700  C CA   . LEU A 1 24 ? -10.639 -5.438  1.042   1.00 0.00 ? 24 LEU A CA   6  
ATOM 6701  C C    . LEU A 1 24 ? -11.422 -6.343  1.995   1.00 0.00 ? 24 LEU A C    6  
ATOM 6702  O O    . LEU A 1 24 ? -12.405 -6.966  1.598   1.00 0.00 ? 24 LEU A O    6  
ATOM 6703  C CB   . LEU A 1 24 ? -9.701  -6.200  0.103   1.00 0.00 ? 24 LEU A CB   6  
ATOM 6704  C CG   . LEU A 1 24 ? -9.763  -5.804  -1.373  1.00 0.00 ? 24 LEU A CG   6  
ATOM 6705  C CD1  . LEU A 1 24 ? -8.662  -6.502  -2.175  1.00 0.00 ? 24 LEU A CD1  6  
ATOM 6706  C CD2  . LEU A 1 24 ? -11.153 -6.074  -1.954  1.00 0.00 ? 24 LEU A CD2  6  
ATOM 6707  H H    . LEU A 1 24 ? -8.921  -4.640  1.908   1.00 0.00 ? 24 LEU A H    6  
ATOM 6708  H HA   . LEU A 1 24 ? -11.350 -4.897  0.418   1.00 0.00 ? 24 LEU A HA   6  
ATOM 6709  H HB3  . LEU A 1 24 ? -9.923  -7.263  0.184   1.00 0.00 ? 24 LEU A HB3  6  
ATOM 6710  H HG   . LEU A 1 24 ? -9.587  -4.732  -1.448  1.00 0.00 ? 24 LEU A HG   6  
ATOM 6711  H HD11 . LEU A 1 24 ? -8.713  -6.183  -3.216  1.00 0.00 ? 24 LEU A HD11 6  
ATOM 6712  H HD12 . LEU A 1 24 ? -7.689  -6.237  -1.761  1.00 0.00 ? 24 LEU A HD12 6  
ATOM 6713  H HD13 . LEU A 1 24 ? -8.798  -7.581  -2.118  1.00 0.00 ? 24 LEU A HD13 6  
ATOM 6714  H HD21 . LEU A 1 24 ? -11.425 -7.115  -1.777  1.00 0.00 ? 24 LEU A HD21 6  
ATOM 6715  H HD22 . LEU A 1 24 ? -11.881 -5.421  -1.474  1.00 0.00 ? 24 LEU A HD22 6  
ATOM 6716  H HD23 . LEU A 1 24 ? -11.142 -5.880  -3.027  1.00 0.00 ? 24 LEU A HD23 6  
ATOM 6717  N N    . GLY A 1 25 ? -10.956 -6.386  3.235   1.00 0.00 ? 25 GLY A N    6  
ATOM 6718  C CA   . GLY A 1 25 ? -11.601 -7.204  4.248   1.00 0.00 ? 25 GLY A CA   6  
ATOM 6719  C C    . GLY A 1 25 ? -11.464 -8.692  3.920   1.00 0.00 ? 25 GLY A C    6  
ATOM 6720  O O    . GLY A 1 25 ? -12.389 -9.470  4.152   1.00 0.00 ? 25 GLY A O    6  
ATOM 6721  H H    . GLY A 1 25 ? -10.156 -5.876  3.550   1.00 0.00 ? 25 GLY A H    6  
ATOM 6722  H HA2  . GLY A 1 25 ? -11.155 -7.001  5.223   1.00 0.00 ? 25 GLY A HA2  6  
ATOM 6723  H HA3  . GLY A 1 25 ? -12.655 -6.938  4.319   1.00 0.00 ? 25 GLY A HA3  6  
ATOM 6724  N N    . ARG A 1 26 ? -10.304 -9.044  3.386   1.00 0.00 ? 26 ARG A N    6  
ATOM 6725  C CA   . ARG A 1 26 ? -10.035 -10.425 3.024   1.00 0.00 ? 26 ARG A CA   6  
ATOM 6726  C C    . ARG A 1 26 ? -9.374  -11.161 4.191   1.00 0.00 ? 26 ARG A C    6  
ATOM 6727  O O    . ARG A 1 26 ? -9.067  -10.557 5.217   1.00 0.00 ? 26 ARG A O    6  
ATOM 6728  C CB   . ARG A 1 26 ? -9.123  -10.504 1.797   1.00 0.00 ? 26 ARG A CB   6  
ATOM 6729  C CG   . ARG A 1 26 ? -9.803  -9.898  0.569   1.00 0.00 ? 26 ARG A CG   6  
ATOM 6730  C CD   . ARG A 1 26 ? -10.413 -10.988 -0.315  1.00 0.00 ? 26 ARG A CD   6  
ATOM 6731  N NE   . ARG A 1 26 ? -11.816 -10.646 -0.643  1.00 0.00 ? 26 ARG A NE   6  
ATOM 6732  C CZ   . ARG A 1 26 ? -12.670 -11.482 -1.249  1.00 0.00 ? 26 ARG A CZ   6  
ATOM 6733  N NH1  . ARG A 1 26 ? -12.270 -12.713 -1.598  1.00 0.00 ? 26 ARG A NH1  6  
ATOM 6734  N NH2  . ARG A 1 26 ? -13.924 -11.087 -1.507  1.00 0.00 ? 26 ARG A NH2  6  
ATOM 6735  H H    . ARG A 1 26 ? -9.557  -8.405  3.202   1.00 0.00 ? 26 ARG A H    6  
ATOM 6736  H HA   . ARG A 1 26 ? -11.013 -10.848 2.796   1.00 0.00 ? 26 ARG A HA   6  
ATOM 6737  H HB3  . ARG A 1 26 ? -8.865  -11.545 1.598   1.00 0.00 ? 26 ARG A HB3  6  
ATOM 6738  H HG3  . ARG A 1 26 ? -9.076  -9.324  -0.007  1.00 0.00 ? 26 ARG A HG3  6  
ATOM 6739  H HD3  . ARG A 1 26 ? -10.374 -11.948 0.200   1.00 0.00 ? 26 ARG A HD3  6  
ATOM 6740  H HE   . ARG A 1 26 ? -12.146 -9.735  -0.395  1.00 0.00 ? 26 ARG A HE   6  
ATOM 6741  H HH11 . ARG A 1 26 ? -11.334 -13.008 -1.405  1.00 0.00 ? 26 ARG A HH11 6  
ATOM 6742  H HH12 . ARG A 1 26 ? -12.908 -13.336 -2.050  1.00 0.00 ? 26 ARG A HH12 6  
ATOM 6743  H HH21 . ARG A 1 26 ? -14.223 -10.169 -1.247  1.00 0.00 ? 26 ARG A HH21 6  
ATOM 6744  H HH22 . ARG A 1 26 ? -14.561 -11.710 -1.960  1.00 0.00 ? 26 ARG A HH22 6  
ATOM 6745  N N    . ALA A 1 27 ? -9.176  -12.456 3.995   1.00 0.00 ? 27 ALA A N    6  
ATOM 6746  C CA   . ALA A 1 27 ? -8.557  -13.281 5.019   1.00 0.00 ? 27 ALA A CA   6  
ATOM 6747  C C    . ALA A 1 27 ? -7.053  -13.381 4.749   1.00 0.00 ? 27 ALA A C    6  
ATOM 6748  O O    . ALA A 1 27 ? -6.243  -13.214 5.659   1.00 0.00 ? 27 ALA A O    6  
ATOM 6749  C CB   . ALA A 1 27 ? -9.236  -14.653 5.049   1.00 0.00 ? 27 ALA A CB   6  
ATOM 6750  H H    . ALA A 1 27 ? -9.428  -12.941 3.158   1.00 0.00 ? 27 ALA A H    6  
ATOM 6751  H HA   . ALA A 1 27 ? -8.713  -12.791 5.980   1.00 0.00 ? 27 ALA A HA   6  
ATOM 6752  H HB1  . ALA A 1 27 ? -8.551  -15.387 5.471   1.00 0.00 ? 27 ALA A HB1  6  
ATOM 6753  H HB2  . ALA A 1 27 ? -10.134 -14.599 5.664   1.00 0.00 ? 27 ALA A HB2  6  
ATOM 6754  H HB3  . ALA A 1 27 ? -9.506  -14.946 4.035   1.00 0.00 ? 27 ALA A HB3  6  
ATOM 6755  N N    . SER A 1 28 ? -6.727  -13.653 3.494   1.00 0.00 ? 28 SER A N    6  
ATOM 6756  C CA   . SER A 1 28 ? -5.336  -13.777 3.092   1.00 0.00 ? 28 SER A CA   6  
ATOM 6757  C C    . SER A 1 28 ? -4.829  -12.441 2.547   1.00 0.00 ? 28 SER A C    6  
ATOM 6758  O O    . SER A 1 28 ? -5.621  -11.585 2.154   1.00 0.00 ? 28 SER A O    6  
ATOM 6759  C CB   . SER A 1 28 ? -5.161  -14.878 2.045   1.00 0.00 ? 28 SER A CB   6  
ATOM 6760  O OG   . SER A 1 28 ? -5.867  -16.066 2.396   1.00 0.00 ? 28 SER A OG   6  
ATOM 6761  H H    . SER A 1 28 ? -7.392  -13.787 2.759   1.00 0.00 ? 28 SER A H    6  
ATOM 6762  H HA   . SER A 1 28 ? -4.798  -14.050 3.999   1.00 0.00 ? 28 SER A HA   6  
ATOM 6763  H HB3  . SER A 1 28 ? -4.102  -15.106 1.933   1.00 0.00 ? 28 SER A HB3  6  
ATOM 6764  H HG   . SER A 1 28 ? -6.741  -15.831 2.824   1.00 0.00 ? 28 SER A HG   6  
ATOM 6765  N N    . VAL A 1 29 ? -3.511  -12.304 2.539   1.00 0.00 ? 29 VAL A N    6  
ATOM 6766  C CA   . VAL A 1 29 ? -2.888  -11.087 2.048   1.00 0.00 ? 29 VAL A CA   6  
ATOM 6767  C C    . VAL A 1 29 ? -2.758  -11.163 0.526   1.00 0.00 ? 29 VAL A C    6  
ATOM 6768  O O    . VAL A 1 29 ? -2.019  -11.996 0.003   1.00 0.00 ? 29 VAL A O    6  
ATOM 6769  C CB   . VAL A 1 29 ? -1.548  -10.864 2.752   1.00 0.00 ? 29 VAL A CB   6  
ATOM 6770  C CG1  . VAL A 1 29 ? -0.815  -9.653  2.168   1.00 0.00 ? 29 VAL A CG1  6  
ATOM 6771  C CG2  . VAL A 1 29 ? -1.740  -10.713 4.262   1.00 0.00 ? 29 VAL A CG2  6  
ATOM 6772  H H    . VAL A 1 29 ? -2.874  -13.005 2.860   1.00 0.00 ? 29 VAL A H    6  
ATOM 6773  H HA   . VAL A 1 29 ? -3.545  -10.255 2.303   1.00 0.00 ? 29 VAL A HA   6  
ATOM 6774  H HB   . VAL A 1 29 ? -0.928  -11.744 2.580   1.00 0.00 ? 29 VAL A HB   6  
ATOM 6775  H HG11 . VAL A 1 29 ? -1.524  -8.839  2.016   1.00 0.00 ? 29 VAL A HG11 6  
ATOM 6776  H HG12 . VAL A 1 29 ? -0.037  -9.332  2.859   1.00 0.00 ? 29 VAL A HG12 6  
ATOM 6777  H HG13 . VAL A 1 29 ? -0.366  -9.927  1.213   1.00 0.00 ? 29 VAL A HG13 6  
ATOM 6778  H HG21 . VAL A 1 29 ? -1.099  -11.424 4.783   1.00 0.00 ? 29 VAL A HG21 6  
ATOM 6779  H HG22 . VAL A 1 29 ? -1.476  -9.698  4.562   1.00 0.00 ? 29 VAL A HG22 6  
ATOM 6780  H HG23 . VAL A 1 29 ? -2.781  -10.907 4.518   1.00 0.00 ? 29 VAL A HG23 6  
ATOM 6781  N N    . VAL A 1 30 ? -3.487  -10.283 -0.144  1.00 0.00 ? 30 VAL A N    6  
ATOM 6782  C CA   . VAL A 1 30 ? -3.464  -10.241 -1.596  1.00 0.00 ? 30 VAL A CA   6  
ATOM 6783  C C    . VAL A 1 30 ? -2.513  -9.132  -2.054  1.00 0.00 ? 30 VAL A C    6  
ATOM 6784  O O    . VAL A 1 30 ? -2.257  -8.185  -1.314  1.00 0.00 ? 30 VAL A O    6  
ATOM 6785  C CB   . VAL A 1 30 ? -4.884  -10.071 -2.138  1.00 0.00 ? 30 VAL A CB   6  
ATOM 6786  C CG1  . VAL A 1 30 ? -5.634  -11.405 -2.137  1.00 0.00 ? 30 VAL A CG1  6  
ATOM 6787  C CG2  . VAL A 1 30 ? -5.651  -9.011  -1.345  1.00 0.00 ? 30 VAL A CG2  6  
ATOM 6788  H H    . VAL A 1 30 ? -4.087  -9.609  0.289   1.00 0.00 ? 30 VAL A H    6  
ATOM 6789  H HA   . VAL A 1 30 ? -3.081  -11.199 -1.947  1.00 0.00 ? 30 VAL A HA   6  
ATOM 6790  H HB   . VAL A 1 30 ? -4.810  -9.730  -3.171  1.00 0.00 ? 30 VAL A HB   6  
ATOM 6791  H HG11 . VAL A 1 30 ? -5.681  -11.795 -1.121  1.00 0.00 ? 30 VAL A HG11 6  
ATOM 6792  H HG12 . VAL A 1 30 ? -6.645  -11.254 -2.517  1.00 0.00 ? 30 VAL A HG12 6  
ATOM 6793  H HG13 . VAL A 1 30 ? -5.110  -12.117 -2.775  1.00 0.00 ? 30 VAL A HG13 6  
ATOM 6794  H HG21 . VAL A 1 30 ? -6.372  -8.520  -1.999  1.00 0.00 ? 30 VAL A HG21 6  
ATOM 6795  H HG22 . VAL A 1 30 ? -6.176  -9.486  -0.517  1.00 0.00 ? 30 VAL A HG22 6  
ATOM 6796  H HG23 . VAL A 1 30 ? -4.951  -8.271  -0.957  1.00 0.00 ? 30 VAL A HG23 6  
ATOM 6797  N N    . PRO A 1 31 ? -2.002  -9.294  -3.304  1.00 0.00 ? 31 PRO A N    6  
ATOM 6798  C CA   . PRO A 1 31 ? -1.085  -8.320  -3.869  1.00 0.00 ? 31 PRO A CA   6  
ATOM 6799  C C    . PRO A 1 31 ? -1.828  -7.052  -4.299  1.00 0.00 ? 31 PRO A C    6  
ATOM 6800  O O    . PRO A 1 31 ? -3.057  -7.005  -4.257  1.00 0.00 ? 31 PRO A O    6  
ATOM 6801  C CB   . PRO A 1 31 ? -0.414  -9.036  -5.029  1.00 0.00 ? 31 PRO A CB   6  
ATOM 6802  C CG   . PRO A 1 31 ? -1.308  -10.220 -5.360  1.00 0.00 ? 31 PRO A CG   6  
ATOM 6803  C CD   . PRO A 1 31 ? -2.282  -10.405 -4.209  1.00 0.00 ? 31 PRO A CD   6  
ATOM 6804  H HA   . PRO A 1 31 ? -0.421  -8.027  -3.181  1.00 0.00 ? 31 PRO A HA   6  
ATOM 6805  H HB3  . PRO A 1 31 ? 0.588   -9.368  -4.756  1.00 0.00 ? 31 PRO A HB3  6  
ATOM 6806  H HG3  . PRO A 1 31 ? -0.710  -11.121 -5.503  1.00 0.00 ? 31 PRO A HG3  6  
ATOM 6807  H HD3  . PRO A 1 31 ? -2.134  -11.366 -3.715  1.00 0.00 ? 31 PRO A HD3  6  
ATOM 6808  N N    . LEU A 1 32 ? -1.051  -6.058  -4.703  1.00 0.00 ? 32 LEU A N    6  
ATOM 6809  C CA   . LEU A 1 32 ? -1.620  -4.795  -5.140  1.00 0.00 ? 32 LEU A CA   6  
ATOM 6810  C C    . LEU A 1 32 ? -1.241  -4.548  -6.602  1.00 0.00 ? 32 LEU A C    6  
ATOM 6811  O O    . LEU A 1 32 ? -0.120  -4.136  -6.895  1.00 0.00 ? 32 LEU A O    6  
ATOM 6812  C CB   . LEU A 1 32 ? -1.204  -3.664  -4.197  1.00 0.00 ? 32 LEU A CB   6  
ATOM 6813  C CG   . LEU A 1 32 ? -1.409  -2.243  -4.723  1.00 0.00 ? 32 LEU A CG   6  
ATOM 6814  C CD1  . LEU A 1 32 ? -2.760  -2.108  -5.429  1.00 0.00 ? 32 LEU A CD1  6  
ATOM 6815  C CD2  . LEU A 1 32 ? -1.243  -1.213  -3.602  1.00 0.00 ? 32 LEU A CD2  6  
ATOM 6816  H H    . LEU A 1 32 ? -0.053  -6.105  -4.734  1.00 0.00 ? 32 LEU A H    6  
ATOM 6817  H HA   . LEU A 1 32 ? -2.705  -4.885  -5.075  1.00 0.00 ? 32 LEU A HA   6  
ATOM 6818  H HB3  . LEU A 1 32 ? -0.148  -3.791  -3.955  1.00 0.00 ? 32 LEU A HB3  6  
ATOM 6819  H HG   . LEU A 1 32 ? -0.636  -2.037  -5.465  1.00 0.00 ? 32 LEU A HG   6  
ATOM 6820  H HD11 . LEU A 1 32 ? -3.540  -1.933  -4.689  1.00 0.00 ? 32 LEU A HD11 6  
ATOM 6821  H HD12 . LEU A 1 32 ? -2.725  -1.270  -6.125  1.00 0.00 ? 32 LEU A HD12 6  
ATOM 6822  H HD13 . LEU A 1 32 ? -2.977  -3.026  -5.975  1.00 0.00 ? 32 LEU A HD13 6  
ATOM 6823  H HD21 . LEU A 1 32 ? -2.090  -0.528  -3.610  1.00 0.00 ? 32 LEU A HD21 6  
ATOM 6824  H HD22 . LEU A 1 32 ? -1.199  -1.727  -2.642  1.00 0.00 ? 32 LEU A HD22 6  
ATOM 6825  H HD23 . LEU A 1 32 ? -0.321  -0.654  -3.757  1.00 0.00 ? 32 LEU A HD23 6  
ATOM 6826  N N    . PRO A 1 33 ? -2.223  -4.817  -7.504  1.00 0.00 ? 33 PRO A N    6  
ATOM 6827  C CA   . PRO A 1 33 ? -2.004  -4.629  -8.928  1.00 0.00 ? 33 PRO A CA   6  
ATOM 6828  C C    . PRO A 1 33 ? -2.027  -3.144  -9.295  1.00 0.00 ? 33 PRO A C    6  
ATOM 6829  O O    . PRO A 1 33 ? -3.059  -2.618  -9.707  1.00 0.00 ? 33 PRO A O    6  
ATOM 6830  C CB   . PRO A 1 33 ? -3.108  -5.425  -9.605  1.00 0.00 ? 33 PRO A CB   6  
ATOM 6831  C CG   . PRO A 1 33 ? -4.173  -5.646  -8.543  1.00 0.00 ? 33 PRO A CG   6  
ATOM 6832  C CD   . PRO A 1 33 ? -3.563  -5.306  -7.193  1.00 0.00 ? 33 PRO A CD   6  
ATOM 6833  H HA   . PRO A 1 33 ? -1.096  -4.960  -9.186  1.00 0.00 ? 33 PRO A HA   6  
ATOM 6834  H HB3  . PRO A 1 33 ? -2.730  -6.375  -9.981  1.00 0.00 ? 33 PRO A HB3  6  
ATOM 6835  H HG3  . PRO A 1 33 ? -4.518  -6.680  -8.557  1.00 0.00 ? 33 PRO A HG3  6  
ATOM 6836  H HD3  . PRO A 1 33 ? -3.525  -6.181  -6.544  1.00 0.00 ? 33 PRO A HD3  6  
ATOM 6837  N N    . TYR A 1 34 ? -0.875  -2.509  -9.130  1.00 0.00 ? 34 TYR A N    6  
ATOM 6838  C CA   . TYR A 1 34 ? -0.750  -1.094  -9.439  1.00 0.00 ? 34 TYR A CA   6  
ATOM 6839  C C    . TYR A 1 34 ? -1.105  -0.819  -10.901 1.00 0.00 ? 34 TYR A C    6  
ATOM 6840  O O    . TYR A 1 34 ? -1.933  0.044   -11.191 1.00 0.00 ? 34 TYR A O    6  
ATOM 6841  C CB   . TYR A 1 34 ? 0.721   -0.740  -9.208  1.00 0.00 ? 34 TYR A CB   6  
ATOM 6842  C CG   . TYR A 1 34 ? 1.215   -1.032  -7.790  1.00 0.00 ? 34 TYR A CG   6  
ATOM 6843  C CD1  . TYR A 1 34 ? 0.978   -0.126  -6.777  1.00 0.00 ? 34 TYR A CD1  6  
ATOM 6844  C CD2  . TYR A 1 34 ? 1.900   -2.201  -7.524  1.00 0.00 ? 34 TYR A CD2  6  
ATOM 6845  C CE1  . TYR A 1 34 ? 1.443   -0.400  -5.441  1.00 0.00 ? 34 TYR A CE1  6  
ATOM 6846  C CE2  . TYR A 1 34 ? 2.365   -2.474  -6.189  1.00 0.00 ? 34 TYR A CE2  6  
ATOM 6847  C CZ   . TYR A 1 34 ? 2.114   -1.561  -5.214  1.00 0.00 ? 34 TYR A CZ   6  
ATOM 6848  O OH   . TYR A 1 34 ? 2.554   -1.820  -3.953  1.00 0.00 ? 34 TYR A OH   6  
ATOM 6849  H H    . TYR A 1 34 ? -0.040  -2.943  -8.793  1.00 0.00 ? 34 TYR A H    6  
ATOM 6850  H HA   . TYR A 1 34 ? -1.440  -0.548  -8.796  1.00 0.00 ? 34 TYR A HA   6  
ATOM 6851  H HB3  . TYR A 1 34 ? 0.867   0.317   -9.422  1.00 0.00 ? 34 TYR A HB3  6  
ATOM 6852  H HD1  . TYR A 1 34 ? 0.437   0.798   -6.987  1.00 0.00 ? 34 TYR A HD1  6  
ATOM 6853  H HD2  . TYR A 1 34 ? 2.087   -2.916  -8.324  1.00 0.00 ? 34 TYR A HD2  6  
ATOM 6854  H HE1  . TYR A 1 34 ? 1.263   0.307   -4.632  1.00 0.00 ? 34 TYR A HE1  6  
ATOM 6855  H HE2  . TYR A 1 34 ? 2.907   -3.394  -5.965  1.00 0.00 ? 34 TYR A HE2  6  
ATOM 6856  H HH   . TYR A 1 34 ? 2.125   -1.190  -3.305  1.00 0.00 ? 34 TYR A HH   6  
ATOM 6857  N N    . GLU A 1 35 ? -0.461  -1.568  -11.784 1.00 0.00 ? 35 GLU A N    6  
ATOM 6858  C CA   . GLU A 1 35 ? -0.699  -1.415  -13.209 1.00 0.00 ? 35 GLU A CA   6  
ATOM 6859  C C    . GLU A 1 35 ? -2.192  -1.220  -13.481 1.00 0.00 ? 35 GLU A C    6  
ATOM 6860  O O    . GLU A 1 35 ? -2.569  -0.549  -14.440 1.00 0.00 ? 35 GLU A O    6  
ATOM 6861  C CB   . GLU A 1 35 ? -0.152  -2.613  -13.988 1.00 0.00 ? 35 GLU A CB   6  
ATOM 6862  C CG   . GLU A 1 35 ? -0.841  -3.908  -13.556 1.00 0.00 ? 35 GLU A CG   6  
ATOM 6863  C CD   . GLU A 1 35 ? -0.242  -5.116  -14.280 1.00 0.00 ? 35 GLU A CD   6  
ATOM 6864  O OE1  . GLU A 1 35 ? 0.840   -5.563  -13.840 1.00 0.00 ? 35 GLU A OE1  6  
ATOM 6865  O OE2  . GLU A 1 35 ? -0.879  -5.565  -15.257 1.00 0.00 ? 35 GLU A OE2  6  
ATOM 6866  H H    . GLU A 1 35 ? 0.210   -2.268  -11.540 1.00 0.00 ? 35 GLU A H    6  
ATOM 6867  H HA   . GLU A 1 35 ? -0.150  -0.519  -13.501 1.00 0.00 ? 35 GLU A HA   6  
ATOM 6868  H HB3  . GLU A 1 35 ? 0.922   -2.697  -13.826 1.00 0.00 ? 35 GLU A HB3  6  
ATOM 6869  H HG3  . GLU A 1 35 ? -1.908  -3.846  -13.768 1.00 0.00 ? 35 GLU A HG3  6  
ATOM 6870  N N    . ARG A 1 36 ? -3.001  -1.819  -12.620 1.00 0.00 ? 36 ARG A N    6  
ATOM 6871  C CA   . ARG A 1 36 ? -4.445  -1.720  -12.754 1.00 0.00 ? 36 ARG A CA   6  
ATOM 6872  C C    . ARG A 1 36 ? -4.975  -0.548  -11.926 1.00 0.00 ? 36 ARG A C    6  
ATOM 6873  O O    . ARG A 1 36 ? -5.459  0.439   -12.479 1.00 0.00 ? 36 ARG A O    6  
ATOM 6874  C CB   . ARG A 1 36 ? -5.130  -3.009  -12.299 1.00 0.00 ? 36 ARG A CB   6  
ATOM 6875  C CG   . ARG A 1 36 ? -5.376  -3.947  -13.483 1.00 0.00 ? 36 ARG A CG   6  
ATOM 6876  C CD   . ARG A 1 36 ? -6.674  -3.586  -14.207 1.00 0.00 ? 36 ARG A CD   6  
ATOM 6877  N NE   . ARG A 1 36 ? -7.376  -4.818  -14.632 1.00 0.00 ? 36 ARG A NE   6  
ATOM 6878  C CZ   . ARG A 1 36 ? -7.948  -5.686  -13.786 1.00 0.00 ? 36 ARG A CZ   6  
ATOM 6879  N NH1  . ARG A 1 36 ? -7.906  -5.462  -12.466 1.00 0.00 ? 36 ARG A NH1  6  
ATOM 6880  N NH2  . ARG A 1 36 ? -8.563  -6.778  -14.261 1.00 0.00 ? 36 ARG A NH2  6  
ATOM 6881  H H    . ARG A 1 36 ? -2.686  -2.363  -11.842 1.00 0.00 ? 36 ARG A H    6  
ATOM 6882  H HA   . ARG A 1 36 ? -4.613  -1.556  -13.818 1.00 0.00 ? 36 ARG A HA   6  
ATOM 6883  H HB3  . ARG A 1 36 ? -6.078  -2.771  -11.817 1.00 0.00 ? 36 ARG A HB3  6  
ATOM 6884  H HG3  . ARG A 1 36 ? -5.425  -4.977  -13.131 1.00 0.00 ? 36 ARG A HG3  6  
ATOM 6885  H HD3  . ARG A 1 36 ? -6.456  -2.965  -15.076 1.00 0.00 ? 36 ARG A HD3  6  
ATOM 6886  H HE   . ARG A 1 36 ? -7.426  -5.015  -15.611 1.00 0.00 ? 36 ARG A HE   6  
ATOM 6887  H HH11 . ARG A 1 36 ? -7.447  -4.648  -12.111 1.00 0.00 ? 36 ARG A HH11 6  
ATOM 6888  H HH12 . ARG A 1 36 ? -8.333  -6.111  -11.835 1.00 0.00 ? 36 ARG A HH12 6  
ATOM 6889  H HH21 . ARG A 1 36 ? -8.595  -6.945  -15.247 1.00 0.00 ? 36 ARG A HH21 6  
ATOM 6890  H HH22 . ARG A 1 36 ? -8.990  -7.425  -13.631 1.00 0.00 ? 36 ARG A HH22 6  
ATOM 6891  N N    . LEU A 1 37 ? -4.867  -0.696  -10.614 1.00 0.00 ? 37 LEU A N    6  
ATOM 6892  C CA   . LEU A 1 37 ? -5.331  0.338   -9.704  1.00 0.00 ? 37 LEU A CA   6  
ATOM 6893  C C    . LEU A 1 37 ? -4.891  1.707   -10.227 1.00 0.00 ? 37 LEU A C    6  
ATOM 6894  O O    . LEU A 1 37 ? -5.643  2.677   -10.147 1.00 0.00 ? 37 LEU A O    6  
ATOM 6895  C CB   . LEU A 1 37 ? -4.862  0.046   -8.277  1.00 0.00 ? 37 LEU A CB   6  
ATOM 6896  C CG   . LEU A 1 37 ? -5.170  -1.355  -7.744  1.00 0.00 ? 37 LEU A CG   6  
ATOM 6897  C CD1  . LEU A 1 37 ? -5.320  -1.341  -6.222  1.00 0.00 ? 37 LEU A CD1  6  
ATOM 6898  C CD2  . LEU A 1 37 ? -6.398  -1.948  -8.436  1.00 0.00 ? 37 LEU A CD2  6  
ATOM 6899  H H    . LEU A 1 37 ? -4.473  -1.502  -10.172 1.00 0.00 ? 37 LEU A H    6  
ATOM 6900  H HA   . LEU A 1 37 ? -6.420  0.304   -9.698  1.00 0.00 ? 37 LEU A HA   6  
ATOM 6901  H HB3  . LEU A 1 37 ? -5.318  0.776   -7.609  1.00 0.00 ? 37 LEU A HB3  6  
ATOM 6902  H HG   . LEU A 1 37 ? -4.325  -2.002  -7.978  1.00 0.00 ? 37 LEU A HG   6  
ATOM 6903  H HD11 . LEU A 1 37 ? -4.609  -0.636  -5.792  1.00 0.00 ? 37 LEU A HD11 6  
ATOM 6904  H HD12 . LEU A 1 37 ? -6.334  -1.039  -5.959  1.00 0.00 ? 37 LEU A HD12 6  
ATOM 6905  H HD13 . LEU A 1 37 ? -5.125  -2.338  -5.828  1.00 0.00 ? 37 LEU A HD13 6  
ATOM 6906  H HD21 . LEU A 1 37 ? -7.189  -1.199  -8.476  1.00 0.00 ? 37 LEU A HD21 6  
ATOM 6907  H HD22 . LEU A 1 37 ? -6.134  -2.251  -9.449  1.00 0.00 ? 37 LEU A HD22 6  
ATOM 6908  H HD23 . LEU A 1 37 ? -6.747  -2.815  -7.876  1.00 0.00 ? 37 LEU A HD23 6  
ATOM 6909  N N    . LEU A 1 38 ? -3.675  1.741   -10.753 1.00 0.00 ? 38 LEU A N    6  
ATOM 6910  C CA   . LEU A 1 38 ? -3.127  2.975   -11.290 1.00 0.00 ? 38 LEU A CA   6  
ATOM 6911  C C    . LEU A 1 38 ? -4.040  3.492   -12.403 1.00 0.00 ? 38 LEU A C    6  
ATOM 6912  O O    . LEU A 1 38 ? -4.348  4.682   -12.456 1.00 0.00 ? 38 LEU A O    6  
ATOM 6913  C CB   . LEU A 1 38 ? -1.676  2.770   -11.729 1.00 0.00 ? 38 LEU A CB   6  
ATOM 6914  C CG   . LEU A 1 38 ? -0.668  2.496   -10.610 1.00 0.00 ? 38 LEU A CG   6  
ATOM 6915  C CD1  . LEU A 1 38 ? 0.660   1.993   -11.179 1.00 0.00 ? 38 LEU A CD1  6  
ATOM 6916  C CD2  . LEU A 1 38 ? -0.482  3.730   -9.726  1.00 0.00 ? 38 LEU A CD2  6  
ATOM 6917  H H    . LEU A 1 38 ? -3.070  0.948   -10.814 1.00 0.00 ? 38 LEU A H    6  
ATOM 6918  H HA   . LEU A 1 38 ? -3.118  3.707   -10.482 1.00 0.00 ? 38 LEU A HA   6  
ATOM 6919  H HB3  . LEU A 1 38 ? -1.352  3.657   -12.273 1.00 0.00 ? 38 LEU A HB3  6  
ATOM 6920  H HG   . LEU A 1 38 ? -1.068  1.704   -9.977  1.00 0.00 ? 38 LEU A HG   6  
ATOM 6921  H HD11 . LEU A 1 38 ? 0.541   0.965   -11.522 1.00 0.00 ? 38 LEU A HD11 6  
ATOM 6922  H HD12 . LEU A 1 38 ? 0.958   2.623   -12.017 1.00 0.00 ? 38 LEU A HD12 6  
ATOM 6923  H HD13 . LEU A 1 38 ? 1.425   2.031   -10.405 1.00 0.00 ? 38 LEU A HD13 6  
ATOM 6924  H HD21 . LEU A 1 38 ? -0.595  4.631   -10.330 1.00 0.00 ? 38 LEU A HD21 6  
ATOM 6925  H HD22 . LEU A 1 38 ? -1.232  3.727   -8.935  1.00 0.00 ? 38 LEU A HD22 6  
ATOM 6926  H HD23 . LEU A 1 38 ? 0.513   3.713   -9.282  1.00 0.00 ? 38 LEU A HD23 6  
ATOM 6927  N N    . ARG A 1 39 ? -4.445  2.572   -13.266 1.00 0.00 ? 39 ARG A N    6  
ATOM 6928  C CA   . ARG A 1 39 ? -5.316  2.920   -14.376 1.00 0.00 ? 39 ARG A CA   6  
ATOM 6929  C C    . ARG A 1 39 ? -6.595  3.584   -13.860 1.00 0.00 ? 39 ARG A C    6  
ATOM 6930  O O    . ARG A 1 39 ? -7.042  4.590   -14.409 1.00 0.00 ? 39 ARG A O    6  
ATOM 6931  C CB   . ARG A 1 39 ? -5.688  1.682   -15.194 1.00 0.00 ? 39 ARG A CB   6  
ATOM 6932  C CG   . ARG A 1 39 ? -6.648  2.042   -16.330 1.00 0.00 ? 39 ARG A CG   6  
ATOM 6933  C CD   . ARG A 1 39 ? -6.716  0.920   -17.367 1.00 0.00 ? 39 ARG A CD   6  
ATOM 6934  N NE   . ARG A 1 39 ? -7.556  1.339   -18.511 1.00 0.00 ? 39 ARG A NE   6  
ATOM 6935  C CZ   . ARG A 1 39 ? -7.986  0.509   -19.472 1.00 0.00 ? 39 ARG A CZ   6  
ATOM 6936  N NH1  . ARG A 1 39 ? -7.655  -0.790  -19.432 1.00 0.00 ? 39 ARG A NH1  6  
ATOM 6937  N NH2  . ARG A 1 39 ? -8.744  0.977   -20.472 1.00 0.00 ? 39 ARG A NH2  6  
ATOM 6938  H H    . ARG A 1 39 ? -4.189  1.607   -13.217 1.00 0.00 ? 39 ARG A H    6  
ATOM 6939  H HA   . ARG A 1 39 ? -4.732  3.613   -14.983 1.00 0.00 ? 39 ARG A HA   6  
ATOM 6940  H HB3  . ARG A 1 39 ? -6.150  0.938   -14.545 1.00 0.00 ? 39 ARG A HB3  6  
ATOM 6941  H HG3  . ARG A 1 39 ? -6.320  2.966   -16.808 1.00 0.00 ? 39 ARG A HG3  6  
ATOM 6942  H HD3  . ARG A 1 39 ? -7.129  0.018   -16.913 1.00 0.00 ? 39 ARG A HD3  6  
ATOM 6943  H HE   . ARG A 1 39 ? -7.821  2.301   -18.571 1.00 0.00 ? 39 ARG A HE   6  
ATOM 6944  H HH11 . ARG A 1 39 ? -7.089  -1.139  -18.685 1.00 0.00 ? 39 ARG A HH11 6  
ATOM 6945  H HH12 . ARG A 1 39 ? -7.976  -1.409  -20.148 1.00 0.00 ? 39 ARG A HH12 6  
ATOM 6946  H HH21 . ARG A 1 39 ? -8.990  1.946   -20.502 1.00 0.00 ? 39 ARG A HH21 6  
ATOM 6947  H HH22 . ARG A 1 39 ? -9.064  0.357   -21.189 1.00 0.00 ? 39 ARG A HH22 6  
ATOM 6948  N N    . GLU A 1 40 ? -7.147  2.995   -12.809 1.00 0.00 ? 40 GLU A N    6  
ATOM 6949  C CA   . GLU A 1 40 ? -8.364  3.516   -12.213 1.00 0.00 ? 40 GLU A CA   6  
ATOM 6950  C C    . GLU A 1 40 ? -8.111  3.926   -10.760 1.00 0.00 ? 40 GLU A C    6  
ATOM 6951  O O    . GLU A 1 40 ? -8.034  3.074   -9.876  1.00 0.00 ? 40 GLU A O    6  
ATOM 6952  C CB   . GLU A 1 40 ? -9.501  2.495   -12.304 1.00 0.00 ? 40 GLU A CB   6  
ATOM 6953  C CG   . GLU A 1 40 ? -8.952  1.071   -12.392 1.00 0.00 ? 40 GLU A CG   6  
ATOM 6954  C CD   . GLU A 1 40 ? -10.079 0.062   -12.624 1.00 0.00 ? 40 GLU A CD   6  
ATOM 6955  O OE1  . GLU A 1 40 ? -11.142 0.244   -11.990 1.00 0.00 ? 40 GLU A OE1  6  
ATOM 6956  O OE2  . GLU A 1 40 ? -9.853  -0.867  -13.427 1.00 0.00 ? 40 GLU A OE2  6  
ATOM 6957  H H    . GLU A 1 40 ? -6.777  2.177   -12.368 1.00 0.00 ? 40 GLU A H    6  
ATOM 6958  H HA   . GLU A 1 40 ? -8.624  4.394   -12.804 1.00 0.00 ? 40 GLU A HA   6  
ATOM 6959  H HB3  . GLU A 1 40 ? -10.115 2.707   -13.180 1.00 0.00 ? 40 GLU A HB3  6  
ATOM 6960  H HG3  . GLU A 1 40 ? -8.422  0.824   -11.472 1.00 0.00 ? 40 GLU A HG3  6  
ATOM 6961  N N    . PRO A 1 41 ? -7.985  5.264   -10.554 1.00 0.00 ? 41 PRO A N    6  
ATOM 6962  C CA   . PRO A 1 41 ? -7.741  5.796   -9.224  1.00 0.00 ? 41 PRO A CA   6  
ATOM 6963  C C    . PRO A 1 41 ? -9.013  5.750   -8.374  1.00 0.00 ? 41 PRO A C    6  
ATOM 6964  O O    . PRO A 1 41 ? -8.944  5.589   -7.156  1.00 0.00 ? 41 PRO A O    6  
ATOM 6965  C CB   . PRO A 1 41 ? -7.231  7.209   -9.454  1.00 0.00 ? 41 PRO A CB   6  
ATOM 6966  C CG   . PRO A 1 41 ? -7.645  7.578   -10.869 1.00 0.00 ? 41 PRO A CG   6  
ATOM 6967  C CD   . PRO A 1 41 ? -8.070  6.302   -11.577 1.00 0.00 ? 41 PRO A CD   6  
ATOM 6968  H HA   . PRO A 1 41 ? -7.070  5.233   -8.743  1.00 0.00 ? 41 PRO A HA   6  
ATOM 6969  H HB3  . PRO A 1 41 ? -6.148  7.257   -9.338  1.00 0.00 ? 41 PRO A HB3  6  
ATOM 6970  H HG3  . PRO A 1 41 ? -6.818  8.052   -11.398 1.00 0.00 ? 41 PRO A HG3  6  
ATOM 6971  H HD3  . PRO A 1 41 ? -7.416  6.081   -12.420 1.00 0.00 ? 41 PRO A HD3  6  
ATOM 6972  N N    . GLY A 1 42 ? -10.143 5.896   -9.050  1.00 0.00 ? 42 GLY A N    6  
ATOM 6973  C CA   . GLY A 1 42 ? -11.428 5.873   -8.372  1.00 0.00 ? 42 GLY A CA   6  
ATOM 6974  C C    . GLY A 1 42 ? -11.703 4.496   -7.762  1.00 0.00 ? 42 GLY A C    6  
ATOM 6975  O O    . GLY A 1 42 ? -12.462 4.378   -6.802  1.00 0.00 ? 42 GLY A O    6  
ATOM 6976  H H    . GLY A 1 42 ? -10.191 6.027   -10.040 1.00 0.00 ? 42 GLY A H    6  
ATOM 6977  H HA2  . GLY A 1 42 ? -11.443 6.631   -7.588  1.00 0.00 ? 42 GLY A HA2  6  
ATOM 6978  H HA3  . GLY A 1 42 ? -12.220 6.127   -9.076  1.00 0.00 ? 42 GLY A HA3  6  
ATOM 6979  N N    . LEU A 1 43 ? -11.068 3.490   -8.346  1.00 0.00 ? 43 LEU A N    6  
ATOM 6980  C CA   . LEU A 1 43 ? -11.234 2.126   -7.873  1.00 0.00 ? 43 LEU A CA   6  
ATOM 6981  C C    . LEU A 1 43 ? -10.624 1.997   -6.475  1.00 0.00 ? 43 LEU A C    6  
ATOM 6982  O O    . LEU A 1 43 ? -11.206 1.363   -5.597  1.00 0.00 ? 43 LEU A O    6  
ATOM 6983  C CB   . LEU A 1 43 ? -10.661 1.133   -8.887  1.00 0.00 ? 43 LEU A CB   6  
ATOM 6984  C CG   . LEU A 1 43 ? -11.126 -0.317  -8.741  1.00 0.00 ? 43 LEU A CG   6  
ATOM 6985  C CD1  . LEU A 1 43 ? -12.540 -0.498  -9.298  1.00 0.00 ? 43 LEU A CD1  6  
ATOM 6986  C CD2  . LEU A 1 43 ? -10.128 -1.280  -9.388  1.00 0.00 ? 43 LEU A CD2  6  
ATOM 6987  H H    . LEU A 1 43 ? -10.452 3.595   -9.126  1.00 0.00 ? 43 LEU A H    6  
ATOM 6988  H HA   . LEU A 1 43 ? -12.304 1.933   -7.801  1.00 0.00 ? 43 LEU A HA   6  
ATOM 6989  H HB3  . LEU A 1 43 ? -9.574  1.155   -8.812  1.00 0.00 ? 43 LEU A HB3  6  
ATOM 6990  H HG   . LEU A 1 43 ? -11.165 -0.559  -7.679  1.00 0.00 ? 43 LEU A HG   6  
ATOM 6991  H HD11 . LEU A 1 43 ? -12.534 -0.312  -10.371 1.00 0.00 ? 43 LEU A HD11 6  
ATOM 6992  H HD12 . LEU A 1 43 ? -12.877 -1.517  -9.107  1.00 0.00 ? 43 LEU A HD12 6  
ATOM 6993  H HD13 . LEU A 1 43 ? -13.215 0.205   -8.811  1.00 0.00 ? 43 LEU A HD13 6  
ATOM 6994  H HD21 . LEU A 1 43 ? -10.664 -1.992  -10.015 1.00 0.00 ? 43 LEU A HD21 6  
ATOM 6995  H HD22 . LEU A 1 43 ? -9.423  -0.716  -9.998  1.00 0.00 ? 43 LEU A HD22 6  
ATOM 6996  H HD23 . LEU A 1 43 ? -9.586  -1.818  -8.610  1.00 0.00 ? 43 LEU A HD23 6  
ATOM 6997  N N    . LEU A 1 44 ? -9.461  2.611   -6.313  1.00 0.00 ? 44 LEU A N    6  
ATOM 6998  C CA   . LEU A 1 44 ? -8.767  2.573   -5.037  1.00 0.00 ? 44 LEU A CA   6  
ATOM 6999  C C    . LEU A 1 44 ? -7.807  3.761   -4.948  1.00 0.00 ? 44 LEU A C    6  
ATOM 7000  O O    . LEU A 1 44 ? -6.854  3.854   -5.720  1.00 0.00 ? 44 LEU A O    6  
ATOM 7001  C CB   . LEU A 1 44 ? -8.086  1.217   -4.837  1.00 0.00 ? 44 LEU A CB   6  
ATOM 7002  C CG   . LEU A 1 44 ? -6.980  1.171   -3.781  1.00 0.00 ? 44 LEU A CG   6  
ATOM 7003  C CD1  . LEU A 1 44 ? -7.433  1.842   -2.483  1.00 0.00 ? 44 LEU A CD1  6  
ATOM 7004  C CD2  . LEU A 1 44 ? -6.504  -0.264  -3.549  1.00 0.00 ? 44 LEU A CD2  6  
ATOM 7005  H H    . LEU A 1 44 ? -8.996  3.125   -7.033  1.00 0.00 ? 44 LEU A H    6  
ATOM 7006  H HA   . LEU A 1 44 ? -9.517  2.675   -4.253  1.00 0.00 ? 44 LEU A HA   6  
ATOM 7007  H HB3  . LEU A 1 44 ? -7.664  0.901   -5.791  1.00 0.00 ? 44 LEU A HB3  6  
ATOM 7008  H HG   . LEU A 1 44 ? -6.127  1.736   -4.156  1.00 0.00 ? 44 LEU A HG   6  
ATOM 7009  H HD11 . LEU A 1 44 ? -7.412  2.925   -2.608  1.00 0.00 ? 44 LEU A HD11 6  
ATOM 7010  H HD12 . LEU A 1 44 ? -8.447  1.524   -2.244  1.00 0.00 ? 44 LEU A HD12 6  
ATOM 7011  H HD13 . LEU A 1 44 ? -6.762  1.557   -1.673  1.00 0.00 ? 44 LEU A HD13 6  
ATOM 7012  H HD21 . LEU A 1 44 ? -6.411  -0.447  -2.478  1.00 0.00 ? 44 LEU A HD21 6  
ATOM 7013  H HD22 . LEU A 1 44 ? -7.226  -0.960  -3.975  1.00 0.00 ? 44 LEU A HD22 6  
ATOM 7014  H HD23 . LEU A 1 44 ? -5.534  -0.407  -4.027  1.00 0.00 ? 44 LEU A HD23 6  
ATOM 7015  N N    . ALA A 1 45 ? -8.094  4.643   -4.001  1.00 0.00 ? 45 ALA A N    6  
ATOM 7016  C CA   . ALA A 1 45 ? -7.269  5.821   -3.802  1.00 0.00 ? 45 ALA A CA   6  
ATOM 7017  C C    . ALA A 1 45 ? -6.396  5.624   -2.560  1.00 0.00 ? 45 ALA A C    6  
ATOM 7018  O O    . ALA A 1 45 ? -6.891  5.231   -1.505  1.00 0.00 ? 45 ALA A O    6  
ATOM 7019  C CB   . ALA A 1 45 ? -8.162  7.059   -3.695  1.00 0.00 ? 45 ALA A CB   6  
ATOM 7020  H H    . ALA A 1 45 ? -8.871  4.561   -3.378  1.00 0.00 ? 45 ALA A H    6  
ATOM 7021  H HA   . ALA A 1 45 ? -6.625  5.927   -4.675  1.00 0.00 ? 45 ALA A HA   6  
ATOM 7022  H HB1  . ALA A 1 45 ? -8.901  6.906   -2.908  1.00 0.00 ? 45 ALA A HB1  6  
ATOM 7023  H HB2  . ALA A 1 45 ? -7.551  7.929   -3.456  1.00 0.00 ? 45 ALA A HB2  6  
ATOM 7024  H HB3  . ALA A 1 45 ? -8.672  7.221   -4.644  1.00 0.00 ? 45 ALA A HB3  6  
ATOM 7025  N N    . VAL A 1 46 ? -5.112  5.906   -2.727  1.00 0.00 ? 46 VAL A N    6  
ATOM 7026  C CA   . VAL A 1 46 ? -4.167  5.764   -1.633  1.00 0.00 ? 46 VAL A CA   6  
ATOM 7027  C C    . VAL A 1 46 ? -4.011  7.110   -0.921  1.00 0.00 ? 46 VAL A C    6  
ATOM 7028  O O    . VAL A 1 46 ? -3.667  8.110   -1.548  1.00 0.00 ? 46 VAL A O    6  
ATOM 7029  C CB   . VAL A 1 46 ? -2.841  5.207   -2.156  1.00 0.00 ? 46 VAL A CB   6  
ATOM 7030  C CG1  . VAL A 1 46 ? -1.870  4.933   -1.006  1.00 0.00 ? 46 VAL A CG1  6  
ATOM 7031  C CG2  . VAL A 1 46 ? -3.068  3.948   -2.995  1.00 0.00 ? 46 VAL A CG2  6  
ATOM 7032  H H    . VAL A 1 46 ? -4.718  6.226   -3.588  1.00 0.00 ? 46 VAL A H    6  
ATOM 7033  H HA   . VAL A 1 46 ? -4.582  5.041   -0.931  1.00 0.00 ? 46 VAL A HA   6  
ATOM 7034  H HB   . VAL A 1 46 ? -2.391  5.962   -2.801  1.00 0.00 ? 46 VAL A HB   6  
ATOM 7035  H HG11 . VAL A 1 46 ? -2.199  4.052   -0.455  1.00 0.00 ? 46 VAL A HG11 6  
ATOM 7036  H HG12 . VAL A 1 46 ? -0.872  4.758   -1.407  1.00 0.00 ? 46 VAL A HG12 6  
ATOM 7037  H HG13 . VAL A 1 46 ? -1.847  5.793   -0.337  1.00 0.00 ? 46 VAL A HG13 6  
ATOM 7038  H HG21 . VAL A 1 46 ? -2.579  4.062   -3.962  1.00 0.00 ? 46 VAL A HG21 6  
ATOM 7039  H HG22 . VAL A 1 46 ? -2.650  3.085   -2.476  1.00 0.00 ? 46 VAL A HG22 6  
ATOM 7040  H HG23 . VAL A 1 46 ? -4.137  3.798   -3.143  1.00 0.00 ? 46 VAL A HG23 6  
ATOM 7041  N N    . GLN A 1 47 ? -4.271  7.090   0.377   1.00 0.00 ? 47 GLN A N    6  
ATOM 7042  C CA   . GLN A 1 47 ? -4.164  8.296   1.180   1.00 0.00 ? 47 GLN A CA   6  
ATOM 7043  C C    . GLN A 1 47 ? -3.139  8.100   2.300   1.00 0.00 ? 47 GLN A C    6  
ATOM 7044  O O    . GLN A 1 47 ? -2.721  6.976   2.572   1.00 0.00 ? 47 GLN A O    6  
ATOM 7045  C CB   . GLN A 1 47 ? -5.526  8.699   1.749   1.00 0.00 ? 47 GLN A CB   6  
ATOM 7046  C CG   . GLN A 1 47 ? -6.365  9.429   0.698   1.00 0.00 ? 47 GLN A CG   6  
ATOM 7047  C CD   . GLN A 1 47 ? -6.108  10.936  0.742   1.00 0.00 ? 47 GLN A CD   6  
ATOM 7048  O OE1  . GLN A 1 47 ? -6.458  11.625  1.688   1.00 0.00 ? 47 GLN A OE1  6  
ATOM 7049  N NE2  . GLN A 1 47 ? -5.479  11.410  -0.329  1.00 0.00 ? 47 GLN A NE2  6  
ATOM 7050  H H    . GLN A 1 47 ? -4.551  6.271   0.879   1.00 0.00 ? 47 GLN A H    6  
ATOM 7051  H HA   . GLN A 1 47 ? -3.820  9.070   0.496   1.00 0.00 ? 47 GLN A HA   6  
ATOM 7052  H HB3  . GLN A 1 47 ? -5.386  9.342   2.618   1.00 0.00 ? 47 GLN A HB3  6  
ATOM 7053  H HG3  . GLN A 1 47 ? -7.423  9.231   0.871   1.00 0.00 ? 47 GLN A HG3  6  
ATOM 7054  H HE21 . GLN A 1 47 ? -5.219  10.792  -1.071  1.00 0.00 ? 47 GLN A HE21 6  
ATOM 7055  H HE22 . GLN A 1 47 ? -5.266  12.386  -0.394  1.00 0.00 ? 47 GLN A HE22 6  
ATOM 7056  N N    . GLY A 1 48 ? -2.765  9.210   2.917   1.00 0.00 ? 48 GLY A N    6  
ATOM 7057  C CA   . GLY A 1 48 ? -1.797  9.174   4.000   1.00 0.00 ? 48 GLY A CA   6  
ATOM 7058  C C    . GLY A 1 48 ? -0.417  8.752   3.490   1.00 0.00 ? 48 GLY A C    6  
ATOM 7059  O O    . GLY A 1 48 ? 0.362   8.147   4.223   1.00 0.00 ? 48 GLY A O    6  
ATOM 7060  H H    . GLY A 1 48 ? -3.110  10.120  2.690   1.00 0.00 ? 48 GLY A H    6  
ATOM 7061  H HA2  . GLY A 1 48 ? -1.731  10.157  4.467   1.00 0.00 ? 48 GLY A HA2  6  
ATOM 7062  H HA3  . GLY A 1 48 ? -2.132  8.478   4.770   1.00 0.00 ? 48 GLY A HA3  6  
ATOM 7063  N N    . LEU A 1 49 ? -0.158  9.089   2.234   1.00 0.00 ? 49 LEU A N    6  
ATOM 7064  C CA   . LEU A 1 49 ? 1.113   8.753   1.617   1.00 0.00 ? 49 LEU A CA   6  
ATOM 7065  C C    . LEU A 1 49 ? 2.197   9.696   2.146   1.00 0.00 ? 49 LEU A C    6  
ATOM 7066  O O    . LEU A 1 49 ? 1.891   10.719  2.755   1.00 0.00 ? 49 LEU A O    6  
ATOM 7067  C CB   . LEU A 1 49 ? 0.985   8.756   0.093   1.00 0.00 ? 49 LEU A CB   6  
ATOM 7068  C CG   . LEU A 1 49 ? 0.592   7.425   -0.550  1.00 0.00 ? 49 LEU A CG   6  
ATOM 7069  C CD1  . LEU A 1 49 ? -0.063  7.647   -1.915  1.00 0.00 ? 49 LEU A CD1  6  
ATOM 7070  C CD2  . LEU A 1 49 ? 1.794   6.482   -0.638  1.00 0.00 ? 49 LEU A CD2  6  
ATOM 7071  H H    . LEU A 1 49 ? -0.797  9.582   1.644   1.00 0.00 ? 49 LEU A H    6  
ATOM 7072  H HA   . LEU A 1 49 ? 1.364   7.736   1.918   1.00 0.00 ? 49 LEU A HA   6  
ATOM 7073  H HB3  . LEU A 1 49 ? 1.938   9.074   -0.331  1.00 0.00 ? 49 LEU A HB3  6  
ATOM 7074  H HG   . LEU A 1 49 ? -0.149  6.944   0.088   1.00 0.00 ? 49 LEU A HG   6  
ATOM 7075  H HD11 . LEU A 1 49 ? -0.779  8.466   -1.845  1.00 0.00 ? 49 LEU A HD11 6  
ATOM 7076  H HD12 . LEU A 1 49 ? 0.703   7.896   -2.650  1.00 0.00 ? 49 LEU A HD12 6  
ATOM 7077  H HD13 . LEU A 1 49 ? -0.580  6.738   -2.223  1.00 0.00 ? 49 LEU A HD13 6  
ATOM 7078  H HD21 . LEU A 1 49 ? 2.113   6.206   0.367   1.00 0.00 ? 49 LEU A HD21 6  
ATOM 7079  H HD22 . LEU A 1 49 ? 1.512   5.584   -1.189  1.00 0.00 ? 49 LEU A HD22 6  
ATOM 7080  H HD23 . LEU A 1 49 ? 2.612   6.983   -1.154  1.00 0.00 ? 49 LEU A HD23 6  
ATOM 7081  N N    . PRO A 1 50 ? 3.474   9.307   1.885   1.00 0.00 ? 50 PRO A N    6  
ATOM 7082  C CA   . PRO A 1 50 ? 4.604   10.105  2.328   1.00 0.00 ? 50 PRO A CA   6  
ATOM 7083  C C    . PRO A 1 50 ? 4.770   11.352  1.456   1.00 0.00 ? 50 PRO A C    6  
ATOM 7084  O O    . PRO A 1 50 ? 5.283   11.270  0.341   1.00 0.00 ? 50 PRO A O    6  
ATOM 7085  C CB   . PRO A 1 50 ? 5.799   9.168   2.258   1.00 0.00 ? 50 PRO A CB   6  
ATOM 7086  C CG   . PRO A 1 50 ? 5.382   8.028   1.342   1.00 0.00 ? 50 PRO A CG   6  
ATOM 7087  C CD   . PRO A 1 50 ? 3.874   8.101   1.166   1.00 0.00 ? 50 PRO A CD   6  
ATOM 7088  H HA   . PRO A 1 50 ? 4.450   10.440  3.257   1.00 0.00 ? 50 PRO A HA   6  
ATOM 7089  H HB3  . PRO A 1 50 ? 6.063   8.798   3.247   1.00 0.00 ? 50 PRO A HB3  6  
ATOM 7090  H HG3  . PRO A 1 50 ? 5.670   7.069   1.773   1.00 0.00 ? 50 PRO A HG3  6  
ATOM 7091  H HD3  . PRO A 1 50 ? 3.384   7.216   1.573   1.00 0.00 ? 50 PRO A HD3  6  
ATOM 7092  N N    . GLU A 1 51 ? 4.325   12.477  1.997   1.00 0.00 ? 51 GLU A N    6  
ATOM 7093  C CA   . GLU A 1 51 ? 4.417   13.738  1.282   1.00 0.00 ? 51 GLU A CA   6  
ATOM 7094  C C    . GLU A 1 51 ? 5.660   13.753  0.390   1.00 0.00 ? 51 GLU A C    6  
ATOM 7095  O O    . GLU A 1 51 ? 6.688   13.175  0.740   1.00 0.00 ? 51 GLU A O    6  
ATOM 7096  C CB   . GLU A 1 51 ? 4.428   14.920  2.254   1.00 0.00 ? 51 GLU A CB   6  
ATOM 7097  C CG   . GLU A 1 51 ? 5.737   14.969  3.045   1.00 0.00 ? 51 GLU A CG   6  
ATOM 7098  C CD   . GLU A 1 51 ? 5.599   15.863  4.278   1.00 0.00 ? 51 GLU A CD   6  
ATOM 7099  O OE1  . GLU A 1 51 ? 5.220   17.039  4.087   1.00 0.00 ? 51 GLU A OE1  6  
ATOM 7100  O OE2  . GLU A 1 51 ? 5.876   15.351  5.385   1.00 0.00 ? 51 GLU A OE2  6  
ATOM 7101  H H    . GLU A 1 51 ? 3.909   12.534  2.904   1.00 0.00 ? 51 GLU A H    6  
ATOM 7102  H HA   . GLU A 1 51 ? 3.519   13.789  0.667   1.00 0.00 ? 51 GLU A HA   6  
ATOM 7103  H HB3  . GLU A 1 51 ? 3.586   14.835  2.943   1.00 0.00 ? 51 GLU A HB3  6  
ATOM 7104  H HG3  . GLU A 1 51 ? 6.537   15.343  2.407   1.00 0.00 ? 51 GLU A HG3  6  
ATOM 7105  N N    . GLY A 1 52 ? 5.525   14.419  -0.748  1.00 0.00 ? 52 GLY A N    6  
ATOM 7106  C CA   . GLY A 1 52 ? 6.623   14.516  -1.694  1.00 0.00 ? 52 GLY A CA   6  
ATOM 7107  C C    . GLY A 1 52 ? 6.856   13.180  -2.402  1.00 0.00 ? 52 GLY A C    6  
ATOM 7108  O O    . GLY A 1 52 ? 7.997   12.744  -2.552  1.00 0.00 ? 52 GLY A O    6  
ATOM 7109  H H    . GLY A 1 52 ? 4.685   14.885  -1.027  1.00 0.00 ? 52 GLY A H    6  
ATOM 7110  H HA2  . GLY A 1 52 ? 6.405   15.289  -2.431  1.00 0.00 ? 52 GLY A HA2  6  
ATOM 7111  H HA3  . GLY A 1 52 ? 7.531   14.818  -1.172  1.00 0.00 ? 52 GLY A HA3  6  
ATOM 7112  N N    . LEU A 1 53 ? 5.758   12.568  -2.820  1.00 0.00 ? 53 LEU A N    6  
ATOM 7113  C CA   . LEU A 1 53 ? 5.830   11.290  -3.508  1.00 0.00 ? 53 LEU A CA   6  
ATOM 7114  C C    . LEU A 1 53 ? 4.575   11.107  -4.365  1.00 0.00 ? 53 LEU A C    6  
ATOM 7115  O O    . LEU A 1 53 ? 3.800   12.045  -4.545  1.00 0.00 ? 53 LEU A O    6  
ATOM 7116  C CB   . LEU A 1 53 ? 6.063   10.155  -2.509  1.00 0.00 ? 53 LEU A CB   6  
ATOM 7117  C CG   . LEU A 1 53 ? 7.522   9.761   -2.272  1.00 0.00 ? 53 LEU A CG   6  
ATOM 7118  C CD1  . LEU A 1 53 ? 7.639   8.761   -1.118  1.00 0.00 ? 53 LEU A CD1  6  
ATOM 7119  C CD2  . LEU A 1 53 ? 8.163   9.230   -3.555  1.00 0.00 ? 53 LEU A CD2  6  
ATOM 7120  H H    . LEU A 1 53 ? 4.834   12.929  -2.694  1.00 0.00 ? 53 LEU A H    6  
ATOM 7121  H HA   . LEU A 1 53 ? 6.697   11.323  -4.168  1.00 0.00 ? 53 LEU A HA   6  
ATOM 7122  H HB3  . LEU A 1 53 ? 5.521   9.276   -2.856  1.00 0.00 ? 53 LEU A HB3  6  
ATOM 7123  H HG   . LEU A 1 53 ? 8.075   10.654  -1.981  1.00 0.00 ? 53 LEU A HG   6  
ATOM 7124  H HD11 . LEU A 1 53 ? 6.951   7.932   -1.285  1.00 0.00 ? 53 LEU A HD11 6  
ATOM 7125  H HD12 . LEU A 1 53 ? 8.660   8.384   -1.067  1.00 0.00 ? 53 LEU A HD12 6  
ATOM 7126  H HD13 . LEU A 1 53 ? 7.388   9.258   -0.181  1.00 0.00 ? 53 LEU A HD13 6  
ATOM 7127  H HD21 . LEU A 1 53 ? 7.487   8.520   -4.032  1.00 0.00 ? 53 LEU A HD21 6  
ATOM 7128  H HD22 . LEU A 1 53 ? 8.356   10.061  -4.235  1.00 0.00 ? 53 LEU A HD22 6  
ATOM 7129  H HD23 . LEU A 1 53 ? 9.102   8.732   -3.315  1.00 0.00 ? 53 LEU A HD23 6  
ATOM 7130  N N    . ALA A 1 54 ? 4.415   9.893   -4.870  1.00 0.00 ? 54 ALA A N    6  
ATOM 7131  C CA   . ALA A 1 54 ? 3.268   9.576   -5.704  1.00 0.00 ? 54 ALA A CA   6  
ATOM 7132  C C    . ALA A 1 54 ? 2.986   8.074   -5.625  1.00 0.00 ? 54 ALA A C    6  
ATOM 7133  O O    . ALA A 1 54 ? 3.913   7.265   -5.593  1.00 0.00 ? 54 ALA A O    6  
ATOM 7134  C CB   . ALA A 1 54 ? 3.531   10.045  -7.136  1.00 0.00 ? 54 ALA A CB   6  
ATOM 7135  H H    . ALA A 1 54 ? 5.050   9.136   -4.720  1.00 0.00 ? 54 ALA A H    6  
ATOM 7136  H HA   . ALA A 1 54 ? 2.409   10.119  -5.309  1.00 0.00 ? 54 ALA A HA   6  
ATOM 7137  H HB1  . ALA A 1 54 ? 4.061   10.997  -7.115  1.00 0.00 ? 54 ALA A HB1  6  
ATOM 7138  H HB2  . ALA A 1 54 ? 4.138   9.304   -7.656  1.00 0.00 ? 54 ALA A HB2  6  
ATOM 7139  H HB3  . ALA A 1 54 ? 2.582   10.168  -7.658  1.00 0.00 ? 54 ALA A HB3  6  
ATOM 7140  N N    . PHE A 1 55 ? 1.704   7.745   -5.598  1.00 0.00 ? 55 PHE A N    6  
ATOM 7141  C CA   . PHE A 1 55 ? 1.288   6.354   -5.523  1.00 0.00 ? 55 PHE A CA   6  
ATOM 7142  C C    . PHE A 1 55 ? 1.784   5.568   -6.738  1.00 0.00 ? 55 PHE A C    6  
ATOM 7143  O O    . PHE A 1 55 ? 1.333   5.802   -7.859  1.00 0.00 ? 55 PHE A O    6  
ATOM 7144  C CB   . PHE A 1 55 ? -0.242  6.344   -5.514  1.00 0.00 ? 55 PHE A CB   6  
ATOM 7145  C CG   . PHE A 1 55 ? -0.856  4.961   -5.738  1.00 0.00 ? 55 PHE A CG   6  
ATOM 7146  C CD1  . PHE A 1 55 ? -0.415  3.896   -5.017  1.00 0.00 ? 55 PHE A CD1  6  
ATOM 7147  C CD2  . PHE A 1 55 ? -1.843  4.796   -6.660  1.00 0.00 ? 55 PHE A CD2  6  
ATOM 7148  C CE1  . PHE A 1 55 ? -0.985  2.612   -5.225  1.00 0.00 ? 55 PHE A CE1  6  
ATOM 7149  C CE2  . PHE A 1 55 ? -2.413  3.513   -6.868  1.00 0.00 ? 55 PHE A CE2  6  
ATOM 7150  C CZ   . PHE A 1 55 ? -1.972  2.448   -6.146  1.00 0.00 ? 55 PHE A CZ   6  
ATOM 7151  H H    . PHE A 1 55 ? 0.955   8.408   -5.624  1.00 0.00 ? 55 PHE A H    6  
ATOM 7152  H HA   . PHE A 1 55 ? 1.726   5.934   -4.618  1.00 0.00 ? 55 PHE A HA   6  
ATOM 7153  H HB3  . PHE A 1 55 ? -0.604  7.021   -6.287  1.00 0.00 ? 55 PHE A HB3  6  
ATOM 7154  H HD1  . PHE A 1 55 ? 0.375   4.028   -4.278  1.00 0.00 ? 55 PHE A HD1  6  
ATOM 7155  H HD2  . PHE A 1 55 ? -2.197  5.651   -7.238  1.00 0.00 ? 55 PHE A HD2  6  
ATOM 7156  H HE1  . PHE A 1 55 ? -0.632  1.758   -4.646  1.00 0.00 ? 55 PHE A HE1  6  
ATOM 7157  H HE2  . PHE A 1 55 ? -3.204  3.381   -7.606  1.00 0.00 ? 55 PHE A HE2  6  
ATOM 7158  H HZ   . PHE A 1 55 ? -2.410  1.462   -6.306  1.00 0.00 ? 55 PHE A HZ   6  
ATOM 7159  N N    . ARG A 1 56 ? 2.706   4.654   -6.476  1.00 0.00 ? 56 ARG A N    6  
ATOM 7160  C CA   . ARG A 1 56 ? 3.268   3.832   -7.535  1.00 0.00 ? 56 ARG A CA   6  
ATOM 7161  C C    . ARG A 1 56 ? 3.979   2.615   -6.940  1.00 0.00 ? 56 ARG A C    6  
ATOM 7162  O O    . ARG A 1 56 ? 4.198   2.548   -5.731  1.00 0.00 ? 56 ARG A O    6  
ATOM 7163  C CB   . ARG A 1 56 ? 4.260   4.630   -8.383  1.00 0.00 ? 56 ARG A CB   6  
ATOM 7164  C CG   . ARG A 1 56 ? 4.850   5.796   -7.585  1.00 0.00 ? 56 ARG A CG   6  
ATOM 7165  C CD   . ARG A 1 56 ? 6.258   6.139   -8.076  1.00 0.00 ? 56 ARG A CD   6  
ATOM 7166  N NE   . ARG A 1 56 ? 6.648   7.483   -7.596  1.00 0.00 ? 56 ARG A NE   6  
ATOM 7167  C CZ   . ARG A 1 56 ? 7.611   8.230   -8.153  1.00 0.00 ? 56 ARG A CZ   6  
ATOM 7168  N NH1  . ARG A 1 56 ? 8.287   7.769   -9.214  1.00 0.00 ? 56 ARG A NH1  6  
ATOM 7169  N NH2  . ARG A 1 56 ? 7.897   9.438   -7.649  1.00 0.00 ? 56 ARG A NH2  6  
ATOM 7170  H H    . ARG A 1 56 ? 3.068   4.471   -5.561  1.00 0.00 ? 56 ARG A H    6  
ATOM 7171  H HA   . ARG A 1 56 ? 2.412   3.530   -8.137  1.00 0.00 ? 56 ARG A HA   6  
ATOM 7172  H HB3  . ARG A 1 56 ? 3.760   5.010   -9.273  1.00 0.00 ? 56 ARG A HB3  6  
ATOM 7173  H HG3  . ARG A 1 56 ? 4.883   5.537   -6.527  1.00 0.00 ? 56 ARG A HG3  6  
ATOM 7174  H HD3  . ARG A 1 56 ? 6.290   6.110   -9.166  1.00 0.00 ? 56 ARG A HD3  6  
ATOM 7175  H HE   . ARG A 1 56 ? 6.163   7.857   -6.805  1.00 0.00 ? 56 ARG A HE   6  
ATOM 7176  H HH11 . ARG A 1 56 ? 8.074   6.867   -9.589  1.00 0.00 ? 56 ARG A HH11 6  
ATOM 7177  H HH12 . ARG A 1 56 ? 9.006   8.327   -9.629  1.00 0.00 ? 56 ARG A HH12 6  
ATOM 7178  H HH21 . ARG A 1 56 ? 7.392   9.782   -6.858  1.00 0.00 ? 56 ARG A HH21 6  
ATOM 7179  H HH22 . ARG A 1 56 ? 8.616   9.997   -8.065  1.00 0.00 ? 56 ARG A HH22 6  
ATOM 7180  N N    . ARG A 1 57 ? 4.319   1.682   -7.817  1.00 0.00 ? 57 ARG A N    6  
ATOM 7181  C CA   . ARG A 1 57 ? 5.002   0.471   -7.395  1.00 0.00 ? 57 ARG A CA   6  
ATOM 7182  C C    . ARG A 1 57 ? 6.060   0.798   -6.340  1.00 0.00 ? 57 ARG A C    6  
ATOM 7183  O O    . ARG A 1 57 ? 6.646   1.879   -6.357  1.00 0.00 ? 57 ARG A O    6  
ATOM 7184  C CB   . ARG A 1 57 ? 5.671   -0.227  -8.581  1.00 0.00 ? 57 ARG A CB   6  
ATOM 7185  C CG   . ARG A 1 57 ? 4.984   -1.558  -8.893  1.00 0.00 ? 57 ARG A CG   6  
ATOM 7186  C CD   . ARG A 1 57 ? 5.479   -2.133  -10.222 1.00 0.00 ? 57 ARG A CD   6  
ATOM 7187  N NE   . ARG A 1 57 ? 4.346   -2.720  -10.972 1.00 0.00 ? 57 ARG A NE   6  
ATOM 7188  C CZ   . ARG A 1 57 ? 4.480   -3.645  -11.931 1.00 0.00 ? 57 ARG A CZ   6  
ATOM 7189  N NH1  . ARG A 1 57 ? 5.698   -4.094  -12.264 1.00 0.00 ? 57 ARG A NH1  6  
ATOM 7190  N NH2  . ARG A 1 57 ? 3.396   -4.122  -12.559 1.00 0.00 ? 57 ARG A NH2  6  
ATOM 7191  H H    . ARG A 1 57 ? 4.138   1.744   -8.799  1.00 0.00 ? 57 ARG A H    6  
ATOM 7192  H HA   . ARG A 1 57 ? 4.216   -0.160  -6.979  1.00 0.00 ? 57 ARG A HA   6  
ATOM 7193  H HB3  . ARG A 1 57 ? 6.724   -0.401  -8.358  1.00 0.00 ? 57 ARG A HB3  6  
ATOM 7194  H HG3  . ARG A 1 57 ? 3.904   -1.414  -8.934  1.00 0.00 ? 57 ARG A HG3  6  
ATOM 7195  H HD3  . ARG A 1 57 ? 6.238   -2.893  -10.039 1.00 0.00 ? 57 ARG A HD3  6  
ATOM 7196  H HE   . ARG A 1 57 ? 3.423   -2.407  -10.748 1.00 0.00 ? 57 ARG A HE   6  
ATOM 7197  H HH11 . ARG A 1 57 ? 6.507   -3.738  -11.796 1.00 0.00 ? 57 ARG A HH11 6  
ATOM 7198  H HH12 . ARG A 1 57 ? 5.798   -4.785  -12.980 1.00 0.00 ? 57 ARG A HH12 6  
ATOM 7199  H HH21 . ARG A 1 57 ? 2.487   -3.787  -12.311 1.00 0.00 ? 57 ARG A HH21 6  
ATOM 7200  H HH22 . ARG A 1 57 ? 3.496   -4.812  -13.275 1.00 0.00 ? 57 ARG A HH22 6  
ATOM 7201  N N    . PRO A 1 58 ? 6.281   -0.182  -5.424  1.00 0.00 ? 58 PRO A N    6  
ATOM 7202  C CA   . PRO A 1 58 ? 7.260   -0.009  -4.364  1.00 0.00 ? 58 PRO A CA   6  
ATOM 7203  C C    . PRO A 1 58 ? 8.684   -0.147  -4.905  1.00 0.00 ? 58 PRO A C    6  
ATOM 7204  O O    . PRO A 1 58 ? 9.636   0.321   -4.283  1.00 0.00 ? 58 PRO A O    6  
ATOM 7205  C CB   . PRO A 1 58 ? 6.912   -1.068  -3.330  1.00 0.00 ? 58 PRO A CB   6  
ATOM 7206  C CG   . PRO A 1 58 ? 6.051   -2.091  -4.055  1.00 0.00 ? 58 PRO A CG   6  
ATOM 7207  C CD   . PRO A 1 58 ? 5.607   -1.477  -5.372  1.00 0.00 ? 58 PRO A CD   6  
ATOM 7208  H HA   . PRO A 1 58 ? 7.200   0.914   -3.984  1.00 0.00 ? 58 PRO A HA   6  
ATOM 7209  H HB3  . PRO A 1 58 ? 6.373   -0.632  -2.489  1.00 0.00 ? 58 PRO A HB3  6  
ATOM 7210  H HG3  . PRO A 1 58 ? 5.187   -2.360  -3.449  1.00 0.00 ? 58 PRO A HG3  6  
ATOM 7211  H HD3  . PRO A 1 58 ? 4.524   -1.361  -5.411  1.00 0.00 ? 58 PRO A HD3  6  
ATOM 7212  N N    . ALA A 1 59 ? 8.785   -0.793  -6.057  1.00 0.00 ? 59 ALA A N    6  
ATOM 7213  C CA   . ALA A 1 59 ? 10.078  -0.997  -6.690  1.00 0.00 ? 59 ALA A CA   6  
ATOM 7214  C C    . ALA A 1 59 ? 10.425  0.227   -7.538  1.00 0.00 ? 59 ALA A C    6  
ATOM 7215  O O    . ALA A 1 59 ? 11.565  0.379   -7.977  1.00 0.00 ? 59 ALA A O    6  
ATOM 7216  C CB   . ALA A 1 59 ? 10.045  -2.287  -7.511  1.00 0.00 ? 59 ALA A CB   6  
ATOM 7217  H H    . ALA A 1 59 ? 8.006   -1.171  -6.557  1.00 0.00 ? 59 ALA A H    6  
ATOM 7218  H HA   . ALA A 1 59 ? 10.820  -1.105  -5.898  1.00 0.00 ? 59 ALA A HA   6  
ATOM 7219  H HB1  . ALA A 1 59 ? 9.716   -3.113  -6.881  1.00 0.00 ? 59 ALA A HB1  6  
ATOM 7220  H HB2  . ALA A 1 59 ? 9.353   -2.169  -8.345  1.00 0.00 ? 59 ALA A HB2  6  
ATOM 7221  H HB3  . ALA A 1 59 ? 11.043  -2.499  -7.896  1.00 0.00 ? 59 ALA A HB3  6  
ATOM 7222  N N    . GLU A 1 60 ? 9.423   1.068   -7.745  1.00 0.00 ? 60 GLU A N    6  
ATOM 7223  C CA   . GLU A 1 60 ? 9.609   2.274   -8.534  1.00 0.00 ? 60 GLU A CA   6  
ATOM 7224  C C    . GLU A 1 60 ? 9.970   3.451   -7.626  1.00 0.00 ? 60 GLU A C    6  
ATOM 7225  O O    . GLU A 1 60 ? 10.465  4.475   -8.097  1.00 0.00 ? 60 GLU A O    6  
ATOM 7226  C CB   . GLU A 1 60 ? 8.362   2.584   -9.364  1.00 0.00 ? 60 GLU A CB   6  
ATOM 7227  C CG   . GLU A 1 60 ? 8.214   1.595   -10.522 1.00 0.00 ? 60 GLU A CG   6  
ATOM 7228  C CD   . GLU A 1 60 ? 8.149   2.328   -11.863 1.00 0.00 ? 60 GLU A CD   6  
ATOM 7229  O OE1  . GLU A 1 60 ? 9.237   2.634   -12.396 1.00 0.00 ? 60 GLU A OE1  6  
ATOM 7230  O OE2  . GLU A 1 60 ? 7.011   2.567   -12.325 1.00 0.00 ? 60 GLU A OE2  6  
ATOM 7231  H H    . GLU A 1 60 ? 8.500   0.937   -7.385  1.00 0.00 ? 60 GLU A H    6  
ATOM 7232  H HA   . GLU A 1 60 ? 10.439  2.056   -9.206  1.00 0.00 ? 60 GLU A HA   6  
ATOM 7233  H HB3  . GLU A 1 60 ? 8.423   3.600   -9.754  1.00 0.00 ? 60 GLU A HB3  6  
ATOM 7234  H HG3  . GLU A 1 60 ? 7.311   1.001   -10.383 1.00 0.00 ? 60 GLU A HG3  6  
ATOM 7235  N N    . TYR A 1 61 ? 9.711   3.267   -6.340  1.00 0.00 ? 61 TYR A N    6  
ATOM 7236  C CA   . TYR A 1 61 ? 10.003  4.302   -5.362  1.00 0.00 ? 61 TYR A CA   6  
ATOM 7237  C C    . TYR A 1 61 ? 11.508  4.409   -5.110  1.00 0.00 ? 61 TYR A C    6  
ATOM 7238  O O    . TYR A 1 61 ? 12.276  3.549   -5.539  1.00 0.00 ? 61 TYR A O    6  
ATOM 7239  C CB   . TYR A 1 61 ? 9.310   3.866   -4.068  1.00 0.00 ? 61 TYR A CB   6  
ATOM 7240  C CG   . TYR A 1 61 ? 7.895   4.421   -3.904  1.00 0.00 ? 61 TYR A CG   6  
ATOM 7241  C CD1  . TYR A 1 61 ? 7.603   5.705   -4.317  1.00 0.00 ? 61 TYR A CD1  6  
ATOM 7242  C CD2  . TYR A 1 61 ? 6.908   3.637   -3.342  1.00 0.00 ? 61 TYR A CD2  6  
ATOM 7243  C CE1  . TYR A 1 61 ? 6.270   6.227   -4.161  1.00 0.00 ? 61 TYR A CE1  6  
ATOM 7244  C CE2  . TYR A 1 61 ? 5.575   4.158   -3.186  1.00 0.00 ? 61 TYR A CE2  6  
ATOM 7245  C CZ   . TYR A 1 61 ? 5.322   5.428   -3.604  1.00 0.00 ? 61 TYR A CZ   6  
ATOM 7246  O OH   . TYR A 1 61 ? 4.063   5.920   -3.457  1.00 0.00 ? 61 TYR A OH   6  
ATOM 7247  H H    . TYR A 1 61 ? 9.309   2.432   -5.965  1.00 0.00 ? 61 TYR A H    6  
ATOM 7248  H HA   . TYR A 1 61 ? 9.639   5.250   -5.758  1.00 0.00 ? 61 TYR A HA   6  
ATOM 7249  H HB3  . TYR A 1 61 ? 9.915   4.185   -3.220  1.00 0.00 ? 61 TYR A HB3  6  
ATOM 7250  H HD1  . TYR A 1 61 ? 8.383   6.325   -4.760  1.00 0.00 ? 61 TYR A HD1  6  
ATOM 7251  H HD2  . TYR A 1 61 ? 7.137   2.623   -3.016  1.00 0.00 ? 61 TYR A HD2  6  
ATOM 7252  H HE1  . TYR A 1 61 ? 6.027   7.240   -4.483  1.00 0.00 ? 61 TYR A HE1  6  
ATOM 7253  H HE2  . TYR A 1 61 ? 4.785   3.549   -2.745  1.00 0.00 ? 61 TYR A HE2  6  
ATOM 7254  H HH   . TYR A 1 61 ? 3.687   6.170   -4.349  1.00 0.00 ? 61 TYR A HH   6  
ATOM 7255  N N    . ASP A 1 62 ? 11.885  5.472   -4.415  1.00 0.00 ? 62 ASP A N    6  
ATOM 7256  C CA   . ASP A 1 62 ? 13.285  5.702   -4.101  1.00 0.00 ? 62 ASP A CA   6  
ATOM 7257  C C    . ASP A 1 62 ? 13.629  5.002   -2.785  1.00 0.00 ? 62 ASP A C    6  
ATOM 7258  O O    . ASP A 1 62 ? 12.780  4.345   -2.186  1.00 0.00 ? 62 ASP A O    6  
ATOM 7259  C CB   . ASP A 1 62 ? 13.572  7.196   -3.931  1.00 0.00 ? 62 ASP A CB   6  
ATOM 7260  C CG   . ASP A 1 62 ? 12.448  8.127   -4.389  1.00 0.00 ? 62 ASP A CG   6  
ATOM 7261  O OD1  . ASP A 1 62 ? 11.920  7.877   -5.494  1.00 0.00 ? 62 ASP A OD1  6  
ATOM 7262  O OD2  . ASP A 1 62 ? 12.143  9.067   -3.624  1.00 0.00 ? 62 ASP A OD2  6  
ATOM 7263  H H    . ASP A 1 62 ? 11.254  6.167   -4.070  1.00 0.00 ? 62 ASP A H    6  
ATOM 7264  H HA   . ASP A 1 62 ? 13.839  5.297   -4.947  1.00 0.00 ? 62 ASP A HA   6  
ATOM 7265  H HB3  . ASP A 1 62 ? 14.477  7.442   -4.487  1.00 0.00 ? 62 ASP A HB3  6  
ATOM 7266  N N    . PRO A 1 63 ? 14.911  5.171   -2.363  1.00 0.00 ? 63 PRO A N    6  
ATOM 7267  C CA   . PRO A 1 63 ? 15.380  4.562   -1.129  1.00 0.00 ? 63 PRO A CA   6  
ATOM 7268  C C    . PRO A 1 63 ? 14.842  5.314   0.091   1.00 0.00 ? 63 PRO A C    6  
ATOM 7269  O O    . PRO A 1 63 ? 14.442  4.697   1.077   1.00 0.00 ? 63 PRO A O    6  
ATOM 7270  C CB   . PRO A 1 63 ? 16.896  4.594   -1.225  1.00 0.00 ? 63 PRO A CB   6  
ATOM 7271  C CG   . PRO A 1 63 ? 17.225  5.630   -2.287  1.00 0.00 ? 63 PRO A CG   6  
ATOM 7272  C CD   . PRO A 1 63 ? 15.945  5.942   -3.046  1.00 0.00 ? 63 PRO A CD   6  
ATOM 7273  H HA   . PRO A 1 63 ? 15.033  3.628   -1.050  1.00 0.00 ? 63 PRO A HA   6  
ATOM 7274  H HB3  . PRO A 1 63 ? 17.290  3.615   -1.499  1.00 0.00 ? 63 PRO A HB3  6  
ATOM 7275  H HG3  . PRO A 1 63 ? 17.989  5.253   -2.966  1.00 0.00 ? 63 PRO A HG3  6  
ATOM 7276  H HD3  . PRO A 1 63 ? 16.027  5.655   -4.094  1.00 0.00 ? 63 PRO A HD3  6  
ATOM 7277  N N    . LYS A 1 64 ? 14.851  6.634   -0.016  1.00 0.00 ? 64 LYS A N    6  
ATOM 7278  C CA   . LYS A 1 64 ? 14.370  7.475   1.066   1.00 0.00 ? 64 LYS A CA   6  
ATOM 7279  C C    . LYS A 1 64 ? 12.842  7.419   1.109   1.00 0.00 ? 64 LYS A C    6  
ATOM 7280  O O    . LYS A 1 64 ? 12.237  7.674   2.149   1.00 0.00 ? 64 LYS A O    6  
ATOM 7281  C CB   . LYS A 1 64 ? 14.930  8.893   0.932   1.00 0.00 ? 64 LYS A CB   6  
ATOM 7282  C CG   . LYS A 1 64 ? 16.380  8.958   1.414   1.00 0.00 ? 64 LYS A CG   6  
ATOM 7283  C CD   . LYS A 1 64 ? 17.352  8.954   0.231   1.00 0.00 ? 64 LYS A CD   6  
ATOM 7284  C CE   . LYS A 1 64 ? 18.468  9.980   0.435   1.00 0.00 ? 64 LYS A CE   6  
ATOM 7285  N NZ   . LYS A 1 64 ? 18.026  11.322  -0.008  1.00 0.00 ? 64 LYS A NZ   6  
ATOM 7286  H H    . LYS A 1 64 ? 15.179  7.127   -0.822  1.00 0.00 ? 64 LYS A H    6  
ATOM 7287  H HA   . LYS A 1 64 ? 14.757  7.063   1.998   1.00 0.00 ? 64 LYS A HA   6  
ATOM 7288  H HB3  . LYS A 1 64 ? 14.319  9.585   1.511   1.00 0.00 ? 64 LYS A HB3  6  
ATOM 7289  H HG3  . LYS A 1 64 ? 16.589  8.109   2.064   1.00 0.00 ? 64 LYS A HG3  6  
ATOM 7290  H HD3  . LYS A 1 64 ? 16.810  9.177   -0.689  1.00 0.00 ? 64 LYS A HD3  6  
ATOM 7291  H HE3  . LYS A 1 64 ? 19.353  9.679   -0.124  1.00 0.00 ? 64 LYS A HE3  6  
ATOM 7292  H HZ1  . LYS A 1 64 ? 18.512  11.572  -0.845  1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 7293  H HZ2  . LYS A 1 64 ? 17.042  11.306  -0.186  1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 7294  H HZ3  . LYS A 1 64 ? 18.225  11.991  0.707   1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 7295  N N    . ALA A 1 65 ? 12.261  7.085   -0.034  1.00 0.00 ? 65 ALA A N    6  
ATOM 7296  C CA   . ALA A 1 65 ? 10.815  6.992   -0.140  1.00 0.00 ? 65 ALA A CA   6  
ATOM 7297  C C    . ALA A 1 65 ? 10.321  5.812   0.700   1.00 0.00 ? 65 ALA A C    6  
ATOM 7298  O O    . ALA A 1 65 ? 9.526   5.991   1.621   1.00 0.00 ? 65 ALA A O    6  
ATOM 7299  C CB   . ALA A 1 65 ? 10.418  6.866   -1.612  1.00 0.00 ? 65 ALA A CB   6  
ATOM 7300  H H    . ALA A 1 65 ? 12.761  6.880   -0.876  1.00 0.00 ? 65 ALA A H    6  
ATOM 7301  H HA   . ALA A 1 65 ? 10.393  7.914   0.260   1.00 0.00 ? 65 ALA A HA   6  
ATOM 7302  H HB1  . ALA A 1 65 ? 9.394   6.500   -1.683  1.00 0.00 ? 65 ALA A HB1  6  
ATOM 7303  H HB2  . ALA A 1 65 ? 10.489  7.843   -2.092  1.00 0.00 ? 65 ALA A HB2  6  
ATOM 7304  H HB3  . ALA A 1 65 ? 11.089  6.167   -2.111  1.00 0.00 ? 65 ALA A HB3  6  
ATOM 7305  N N    . LEU A 1 66 ? 10.812  4.632   0.351   1.00 0.00 ? 66 LEU A N    6  
ATOM 7306  C CA   . LEU A 1 66 ? 10.431  3.423   1.061   1.00 0.00 ? 66 LEU A CA   6  
ATOM 7307  C C    . LEU A 1 66 ? 10.529  3.669   2.567   1.00 0.00 ? 66 LEU A C    6  
ATOM 7308  O O    . LEU A 1 66 ? 9.671   3.229   3.330   1.00 0.00 ? 66 LEU A O    6  
ATOM 7309  C CB   . LEU A 1 66 ? 11.260  2.232   0.576   1.00 0.00 ? 66 LEU A CB   6  
ATOM 7310  C CG   . LEU A 1 66 ? 11.175  1.919   -0.918  1.00 0.00 ? 66 LEU A CG   6  
ATOM 7311  C CD1  . LEU A 1 66 ? 12.216  0.873   -1.320  1.00 0.00 ? 66 LEU A CD1  6  
ATOM 7312  C CD2  . LEU A 1 66 ? 9.757   1.496   -1.310  1.00 0.00 ? 66 LEU A CD2  6  
ATOM 7313  H H    . LEU A 1 66 ? 11.458  4.495   -0.401  1.00 0.00 ? 66 LEU A H    6  
ATOM 7314  H HA   . LEU A 1 66 ? 9.390   3.213   0.813   1.00 0.00 ? 66 LEU A HA   6  
ATOM 7315  H HB3  . LEU A 1 66 ? 10.948  1.348   1.132   1.00 0.00 ? 66 LEU A HB3  6  
ATOM 7316  H HG   . LEU A 1 66 ? 11.403  2.830   -1.472  1.00 0.00 ? 66 LEU A HG   6  
ATOM 7317  H HD11 . LEU A 1 66 ? 11.716  0.014   -1.766  1.00 0.00 ? 66 LEU A HD11 6  
ATOM 7318  H HD12 . LEU A 1 66 ? 12.906  1.307   -2.044  1.00 0.00 ? 66 LEU A HD12 6  
ATOM 7319  H HD13 . LEU A 1 66 ? 12.770  0.554   -0.437  1.00 0.00 ? 66 LEU A HD13 6  
ATOM 7320  H HD21 . LEU A 1 66 ? 9.777   0.478   -1.700  1.00 0.00 ? 66 LEU A HD21 6  
ATOM 7321  H HD22 . LEU A 1 66 ? 9.111   1.537   -0.433  1.00 0.00 ? 66 LEU A HD22 6  
ATOM 7322  H HD23 . LEU A 1 66 ? 9.375   2.172   -2.075  1.00 0.00 ? 66 LEU A HD23 6  
ATOM 7323  N N    . MET A 1 67 ? 11.585  4.372   2.952   1.00 0.00 ? 67 MET A N    6  
ATOM 7324  C CA   . MET A 1 67 ? 11.807  4.683   4.354   1.00 0.00 ? 67 MET A CA   6  
ATOM 7325  C C    . MET A 1 67 ? 10.762  5.673   4.869   1.00 0.00 ? 67 MET A C    6  
ATOM 7326  O O    . MET A 1 67 ? 10.391  5.638   6.042   1.00 0.00 ? 67 MET A O    6  
ATOM 7327  C CB   . MET A 1 67 ? 13.205  5.278   4.531   1.00 0.00 ? 67 MET A CB   6  
ATOM 7328  C CG   . MET A 1 67 ? 14.237  4.182   4.807   1.00 0.00 ? 67 MET A CG   6  
ATOM 7329  S SD   . MET A 1 67 ? 15.882  4.873   4.783   1.00 0.00 ? 67 MET A SD   6  
ATOM 7330  C CE   . MET A 1 67 ? 16.273  4.686   3.052   1.00 0.00 ? 67 MET A CE   6  
ATOM 7331  H H    . MET A 1 67 ? 12.279  4.727   2.326   1.00 0.00 ? 67 MET A H    6  
ATOM 7332  H HA   . MET A 1 67 ? 11.711  3.734   4.883   1.00 0.00 ? 67 MET A HA   6  
ATOM 7333  H HB3  . MET A 1 67 ? 13.199  5.992   5.353   1.00 0.00 ? 67 MET A HB3  6  
ATOM 7334  H HG3  . MET A 1 67 ? 14.154  3.395   4.058   1.00 0.00 ? 67 MET A HG3  6  
ATOM 7335  H HE1  . MET A 1 67 ? 15.725  3.835   2.645   1.00 0.00 ? 67 MET A HE1  6  
ATOM 7336  H HE2  . MET A 1 67 ? 15.989  5.591   2.515   1.00 0.00 ? 67 MET A HE2  6  
ATOM 7337  H HE3  . MET A 1 67 ? 17.344  4.516   2.937   1.00 0.00 ? 67 MET A HE3  6  
ATOM 7338  N N    . ALA A 1 68 ? 10.314  6.535   3.967   1.00 0.00 ? 68 ALA A N    6  
ATOM 7339  C CA   . ALA A 1 68 ? 9.319   7.534   4.316   1.00 0.00 ? 68 ALA A CA   6  
ATOM 7340  C C    . ALA A 1 68 ? 7.928   6.896   4.277   1.00 0.00 ? 68 ALA A C    6  
ATOM 7341  O O    . ALA A 1 68 ? 6.992   7.404   4.892   1.00 0.00 ? 68 ALA A O    6  
ATOM 7342  C CB   . ALA A 1 68 ? 9.439   8.727   3.366   1.00 0.00 ? 68 ALA A CB   6  
ATOM 7343  H H    . ALA A 1 68 ? 10.620  6.557   3.016   1.00 0.00 ? 68 ALA A H    6  
ATOM 7344  H HA   . ALA A 1 68 ? 9.527   7.870   5.331   1.00 0.00 ? 68 ALA A HA   6  
ATOM 7345  H HB1  . ALA A 1 68 ? 9.970   9.538   3.866   1.00 0.00 ? 68 ALA A HB1  6  
ATOM 7346  H HB2  . ALA A 1 68 ? 9.990   8.429   2.474   1.00 0.00 ? 68 ALA A HB2  6  
ATOM 7347  H HB3  . ALA A 1 68 ? 8.443   9.067   3.082   1.00 0.00 ? 68 ALA A HB3  6  
ATOM 7348  N N    . ILE A 1 69 ? 7.837   5.793   3.549   1.00 0.00 ? 69 ILE A N    6  
ATOM 7349  C CA   . ILE A 1 69 ? 6.577   5.082   3.423   1.00 0.00 ? 69 ILE A CA   6  
ATOM 7350  C C    . ILE A 1 69 ? 6.320   4.279   4.700   1.00 0.00 ? 69 ILE A C    6  
ATOM 7351  O O    . ILE A 1 69 ? 5.198   4.252   5.205   1.00 0.00 ? 69 ILE A O    6  
ATOM 7352  C CB   . ILE A 1 69 ? 6.567   4.232   2.150   1.00 0.00 ? 69 ILE A CB   6  
ATOM 7353  C CG1  . ILE A 1 69 ? 6.703   5.110   0.905   1.00 0.00 ? 69 ILE A CG1  6  
ATOM 7354  C CG2  . ILE A 1 69 ? 5.321   3.345   2.094   1.00 0.00 ? 69 ILE A CG2  6  
ATOM 7355  C CD1  . ILE A 1 69 ? 7.423   4.359   -0.218  1.00 0.00 ? 69 ILE A CD1  6  
ATOM 7356  H H    . ILE A 1 69 ? 8.604   5.387   3.053   1.00 0.00 ? 69 ILE A H    6  
ATOM 7357  H HA   . ILE A 1 69 ? 5.789   5.827   3.319   1.00 0.00 ? 69 ILE A HA   6  
ATOM 7358  H HB   . ILE A 1 69 ? 7.432   3.570   2.175   1.00 0.00 ? 69 ILE A HB   6  
ATOM 7359  H HG13 . ILE A 1 69 ? 7.255   6.017   1.153   1.00 0.00 ? 69 ILE A HG13 6  
ATOM 7360  H HG21 . ILE A 1 69 ? 4.835   3.338   3.069   1.00 0.00 ? 69 ILE A HG21 6  
ATOM 7361  H HG22 . ILE A 1 69 ? 4.630   3.736   1.347   1.00 0.00 ? 69 ILE A HG22 6  
ATOM 7362  H HG23 . ILE A 1 69 ? 5.610   2.330   1.825   1.00 0.00 ? 69 ILE A HG23 6  
ATOM 7363  H HD11 . ILE A 1 69 ? 7.479   3.299   0.032   1.00 0.00 ? 69 ILE A HD11 6  
ATOM 7364  H HD12 . ILE A 1 69 ? 6.871   4.484   -1.149  1.00 0.00 ? 69 ILE A HD12 6  
ATOM 7365  H HD13 . ILE A 1 69 ? 8.429   4.760   -0.336  1.00 0.00 ? 69 ILE A HD13 6  
ATOM 7366  N N    . LEU A 1 70 ? 7.376   3.645   5.186   1.00 0.00 ? 70 LEU A N    6  
ATOM 7367  C CA   . LEU A 1 70 ? 7.278   2.844   6.395   1.00 0.00 ? 70 LEU A CA   6  
ATOM 7368  C C    . LEU A 1 70 ? 7.062   3.766   7.596   1.00 0.00 ? 70 LEU A C    6  
ATOM 7369  O O    . LEU A 1 70 ? 6.472   3.360   8.596   1.00 0.00 ? 70 LEU A O    6  
ATOM 7370  C CB   . LEU A 1 70 ? 8.498   1.930   6.533   1.00 0.00 ? 70 LEU A CB   6  
ATOM 7371  C CG   . LEU A 1 70 ? 8.866   1.111   5.294   1.00 0.00 ? 70 LEU A CG   6  
ATOM 7372  C CD1  . LEU A 1 70 ? 10.378  0.901   5.205   1.00 0.00 ? 70 LEU A CD1  6  
ATOM 7373  C CD2  . LEU A 1 70 ? 8.101   -0.213  5.266   1.00 0.00 ? 70 LEU A CD2  6  
ATOM 7374  H H    . LEU A 1 70 ? 8.285   3.673   4.769   1.00 0.00 ? 70 LEU A H    6  
ATOM 7375  H HA   . LEU A 1 70 ? 6.405   2.201   6.290   1.00 0.00 ? 70 LEU A HA   6  
ATOM 7376  H HB3  . LEU A 1 70 ? 8.321   1.243   7.359   1.00 0.00 ? 70 LEU A HB3  6  
ATOM 7377  H HG   . LEU A 1 70 ? 8.567   1.674   4.411   1.00 0.00 ? 70 LEU A HG   6  
ATOM 7378  H HD11 . LEU A 1 70 ? 10.813  0.959   6.203   1.00 0.00 ? 70 LEU A HD11 6  
ATOM 7379  H HD12 . LEU A 1 70 ? 10.584  -0.080  4.776   1.00 0.00 ? 70 LEU A HD12 6  
ATOM 7380  H HD13 . LEU A 1 70 ? 10.816  1.673   4.573   1.00 0.00 ? 70 LEU A HD13 6  
ATOM 7381  H HD21 . LEU A 1 70 ? 8.194   -0.666  4.279   1.00 0.00 ? 70 LEU A HD21 6  
ATOM 7382  H HD22 . LEU A 1 70 ? 8.513   -0.888  6.016   1.00 0.00 ? 70 LEU A HD22 6  
ATOM 7383  H HD23 . LEU A 1 70 ? 7.048   -0.029  5.483   1.00 0.00 ? 70 LEU A HD23 6  
ATOM 7384  N N    . GLU A 1 71 ? 7.551   4.990   7.459   1.00 0.00 ? 71 GLU A N    6  
ATOM 7385  C CA   . GLU A 1 71 ? 7.418   5.973   8.520   1.00 0.00 ? 71 GLU A CA   6  
ATOM 7386  C C    . GLU A 1 71 ? 6.054   6.662   8.437   1.00 0.00 ? 71 GLU A C    6  
ATOM 7387  O O    . GLU A 1 71 ? 5.429   6.934   9.461   1.00 0.00 ? 71 GLU A O    6  
ATOM 7388  C CB   . GLU A 1 71 ? 8.554   6.996   8.466   1.00 0.00 ? 71 GLU A CB   6  
ATOM 7389  C CG   . GLU A 1 71 ? 9.824   6.440   9.113   1.00 0.00 ? 71 GLU A CG   6  
ATOM 7390  C CD   . GLU A 1 71 ? 10.849  7.550   9.352   1.00 0.00 ? 71 GLU A CD   6  
ATOM 7391  O OE1  . GLU A 1 71 ? 10.656  8.300   10.331  1.00 0.00 ? 71 GLU A OE1  6  
ATOM 7392  O OE2  . GLU A 1 71 ? 11.805  7.622   8.548   1.00 0.00 ? 71 GLU A OE2  6  
ATOM 7393  H H    . GLU A 1 71 ? 8.029   5.312   6.642   1.00 0.00 ? 71 GLU A H    6  
ATOM 7394  H HA   . GLU A 1 71 ? 7.490   5.407   9.449   1.00 0.00 ? 71 GLU A HA   6  
ATOM 7395  H HB3  . GLU A 1 71 ? 8.251   7.909   8.978   1.00 0.00 ? 71 GLU A HB3  6  
ATOM 7396  H HG3  . GLU A 1 71 ? 10.257  5.671   8.472   1.00 0.00 ? 71 GLU A HG3  6  
ATOM 7397  N N    . HIS A 1 72 ? 5.634   6.926   7.209   1.00 0.00 ? 72 HIS A N    6  
ATOM 7398  C CA   . HIS A 1 72 ? 4.357   7.579   6.979   1.00 0.00 ? 72 HIS A CA   6  
ATOM 7399  C C    . HIS A 1 72 ? 3.246   6.529   6.924   1.00 0.00 ? 72 HIS A C    6  
ATOM 7400  O O    . HIS A 1 72 ? 2.064   6.870   6.930   1.00 0.00 ? 72 HIS A O    6  
ATOM 7401  C CB   . HIS A 1 72 ? 4.410   8.452   5.723   1.00 0.00 ? 72 HIS A CB   6  
ATOM 7402  C CG   . HIS A 1 72 ? 5.372   9.611   5.821   1.00 0.00 ? 72 HIS A CG   6  
ATOM 7403  N ND1  . HIS A 1 72 ? 5.040   10.896  5.428   1.00 0.00 ? 72 HIS A ND1  6  
ATOM 7404  C CD2  . HIS A 1 72 ? 6.659   9.667   6.271   1.00 0.00 ? 72 HIS A CD2  6  
ATOM 7405  C CE1  . HIS A 1 72 ? 6.087   11.680  5.636   1.00 0.00 ? 72 HIS A CE1  6  
ATOM 7406  N NE2  . HIS A 1 72 ? 7.089   10.917  6.159   1.00 0.00 ? 72 HIS A NE2  6  
ATOM 7407  H H    . HIS A 1 72 ? 6.149   6.703   6.381   1.00 0.00 ? 72 HIS A H    6  
ATOM 7408  H HA   . HIS A 1 72 ? 4.183   8.236   7.832   1.00 0.00 ? 72 HIS A HA   6  
ATOM 7409  H HB3  . HIS A 1 72 ? 3.412   8.837   5.518   1.00 0.00 ? 72 HIS A HB3  6  
ATOM 7410  H HD1  . HIS A 1 72 ? 4.160   11.183  5.051   1.00 0.00 ? 72 HIS A HD1  6  
ATOM 7411  H HD2  . HIS A 1 72 ? 7.234   8.827   6.659   1.00 0.00 ? 72 HIS A HD2  6  
ATOM 7412  H HE1  . HIS A 1 72 ? 6.139   12.749  5.427   1.00 0.00 ? 72 HIS A HE1  6  
ATOM 7413  N N    . SER A 1 73 ? 3.664   5.273   6.874   1.00 0.00 ? 73 SER A N    6  
ATOM 7414  C CA   . SER A 1 73 ? 2.720   4.171   6.818   1.00 0.00 ? 73 SER A CA   6  
ATOM 7415  C C    . SER A 1 73 ? 1.620   4.371   7.863   1.00 0.00 ? 73 SER A C    6  
ATOM 7416  O O    . SER A 1 73 ? 0.443   4.161   7.577   1.00 0.00 ? 73 SER A O    6  
ATOM 7417  C CB   . SER A 1 73 ? 3.424   2.830   7.041   1.00 0.00 ? 73 SER A CB   6  
ATOM 7418  O OG   . SER A 1 73 ? 3.278   2.365   8.380   1.00 0.00 ? 73 SER A OG   6  
ATOM 7419  H H    . SER A 1 73 ? 4.628   5.005   6.870   1.00 0.00 ? 73 SER A H    6  
ATOM 7420  H HA   . SER A 1 73 ? 2.302   4.199   5.812   1.00 0.00 ? 73 SER A HA   6  
ATOM 7421  H HB3  . SER A 1 73 ? 4.483   2.934   6.806   1.00 0.00 ? 73 SER A HB3  6  
ATOM 7422  H HG   . SER A 1 73 ? 3.097   1.382   8.382   1.00 0.00 ? 73 SER A HG   6  
ATOM 7423  N N    . HIS A 1 74 ? 2.043   4.776   9.051   1.00 0.00 ? 74 HIS A N    6  
ATOM 7424  C CA   . HIS A 1 74 ? 1.108   5.007   10.140  1.00 0.00 ? 74 HIS A CA   6  
ATOM 7425  C C    . HIS A 1 74 ? -0.039  5.895   9.651   1.00 0.00 ? 74 HIS A C    6  
ATOM 7426  O O    . HIS A 1 74 ? -1.129  5.876   10.220  1.00 0.00 ? 74 HIS A O    6  
ATOM 7427  C CB   . HIS A 1 74 ? 1.828   5.586   11.359  1.00 0.00 ? 74 HIS A CB   6  
ATOM 7428  C CG   . HIS A 1 74 ? 1.692   7.084   11.499  1.00 0.00 ? 74 HIS A CG   6  
ATOM 7429  N ND1  . HIS A 1 74 ? 0.540   7.692   11.968  1.00 0.00 ? 74 HIS A ND1  6  
ATOM 7430  C CD2  . HIS A 1 74 ? 2.574   8.088   11.228  1.00 0.00 ? 74 HIS A CD2  6  
ATOM 7431  C CE1  . HIS A 1 74 ? 0.731   9.003   11.974  1.00 0.00 ? 74 HIS A CE1  6  
ATOM 7432  N NE2  . HIS A 1 74 ? 1.993   9.246   11.515  1.00 0.00 ? 74 HIS A NE2  6  
ATOM 7433  H H    . HIS A 1 74 ? 3.003   4.945   9.275   1.00 0.00 ? 74 HIS A H    6  
ATOM 7434  H HA   . HIS A 1 74 ? 0.708   4.033   10.421  1.00 0.00 ? 74 HIS A HA   6  
ATOM 7435  H HB3  . HIS A 1 74 ? 2.886   5.332   11.299  1.00 0.00 ? 74 HIS A HB3  6  
ATOM 7436  H HD1  . HIS A 1 74 ? -0.295  7.222   12.254  1.00 0.00 ? 74 HIS A HD1  6  
ATOM 7437  H HD2  . HIS A 1 74 ? 3.586   7.960   10.842  1.00 0.00 ? 74 HIS A HD2  6  
ATOM 7438  H HE1  . HIS A 1 74 ? 0.009   9.755   12.290  1.00 0.00 ? 74 HIS A HE1  6  
ATOM 7439  N N    . ARG A 1 75 ? 0.248   6.652   8.601   1.00 0.00 ? 75 ARG A N    6  
ATOM 7440  C CA   . ARG A 1 75 ? -0.746  7.545   8.030   1.00 0.00 ? 75 ARG A CA   6  
ATOM 7441  C C    . ARG A 1 75 ? -1.353  6.926   6.769   1.00 0.00 ? 75 ARG A C    6  
ATOM 7442  O O    . ARG A 1 75 ? -2.539  7.100   6.496   1.00 0.00 ? 75 ARG A O    6  
ATOM 7443  C CB   . ARG A 1 75 ? -0.132  8.901   7.680   1.00 0.00 ? 75 ARG A CB   6  
ATOM 7444  C CG   . ARG A 1 75 ? 0.952   9.288   8.687   1.00 0.00 ? 75 ARG A CG   6  
ATOM 7445  C CD   . ARG A 1 75 ? 0.959   10.798  8.933   1.00 0.00 ? 75 ARG A CD   6  
ATOM 7446  N NE   . ARG A 1 75 ? -0.375  11.241  9.398   1.00 0.00 ? 75 ARG A NE   6  
ATOM 7447  C CZ   . ARG A 1 75 ? -0.721  12.523  9.573   1.00 0.00 ? 75 ARG A CZ   6  
ATOM 7448  N NH1  . ARG A 1 75 ? 0.165   13.497  9.324   1.00 0.00 ? 75 ARG A NH1  6  
ATOM 7449  N NH2  . ARG A 1 75 ? -1.955  12.832  9.997   1.00 0.00 ? 75 ARG A NH2  6  
ATOM 7450  H H    . ARG A 1 75 ? 1.137   6.661   8.145   1.00 0.00 ? 75 ARG A H    6  
ATOM 7451  H HA   . ARG A 1 75 ? -1.499  7.660   8.810   1.00 0.00 ? 75 ARG A HA   6  
ATOM 7452  H HB3  . ARG A 1 75 ? -0.910  9.664   7.667   1.00 0.00 ? 75 ARG A HB3  6  
ATOM 7453  H HG3  . ARG A 1 75 ? 1.927   8.973   8.317   1.00 0.00 ? 75 ARG A HG3  6  
ATOM 7454  H HD3  . ARG A 1 75 ? 1.227   11.323  8.016   1.00 0.00 ? 75 ARG A HD3  6  
ATOM 7455  H HE   . ARG A 1 75 ? -1.060  10.540  9.592   1.00 0.00 ? 75 ARG A HE   6  
ATOM 7456  H HH11 . ARG A 1 75 ? 1.086   13.267  9.007   1.00 0.00 ? 75 ARG A HH11 6  
ATOM 7457  H HH12 . ARG A 1 75 ? -0.094  14.455  9.454   1.00 0.00 ? 75 ARG A HH12 6  
ATOM 7458  H HH21 . ARG A 1 75 ? -2.616  12.106  10.183  1.00 0.00 ? 75 ARG A HH21 6  
ATOM 7459  H HH22 . ARG A 1 75 ? -2.213  13.789  10.128  1.00 0.00 ? 75 ARG A HH22 6  
ATOM 7460  N N    . ILE A 1 76 ? -0.510  6.216   6.032   1.00 0.00 ? 76 ILE A N    6  
ATOM 7461  C CA   . ILE A 1 76 ? -0.948  5.571   4.806   1.00 0.00 ? 76 ILE A CA   6  
ATOM 7462  C C    . ILE A 1 76 ? -2.266  4.841   5.062   1.00 0.00 ? 76 ILE A C    6  
ATOM 7463  O O    . ILE A 1 76 ? -2.333  3.949   5.907   1.00 0.00 ? 76 ILE A O    6  
ATOM 7464  C CB   . ILE A 1 76 ? 0.157   4.670   4.251   1.00 0.00 ? 76 ILE A CB   6  
ATOM 7465  C CG1  . ILE A 1 76 ? 1.426   5.475   3.958   1.00 0.00 ? 76 ILE A CG1  6  
ATOM 7466  C CG2  . ILE A 1 76 ? -0.329  3.900   3.022   1.00 0.00 ? 76 ILE A CG2  6  
ATOM 7467  C CD1  . ILE A 1 76 ? 2.489   4.598   3.292   1.00 0.00 ? 76 ILE A CD1  6  
ATOM 7468  H H    . ILE A 1 76 ? 0.454   6.080   6.261   1.00 0.00 ? 76 ILE A H    6  
ATOM 7469  H HA   . ILE A 1 76 ? -1.124  6.355   4.069   1.00 0.00 ? 76 ILE A HA   6  
ATOM 7470  H HB   . ILE A 1 76 ? 0.413   3.933   5.013   1.00 0.00 ? 76 ILE A HB   6  
ATOM 7471  H HG13 . ILE A 1 76 ? 1.820   5.888   4.886   1.00 0.00 ? 76 ILE A HG13 6  
ATOM 7472  H HG21 . ILE A 1 76 ? -1.319  4.258   2.737   1.00 0.00 ? 76 ILE A HG21 6  
ATOM 7473  H HG22 . ILE A 1 76 ? 0.365   4.057   2.197   1.00 0.00 ? 76 ILE A HG22 6  
ATOM 7474  H HG23 . ILE A 1 76 ? -0.380  2.836   3.257   1.00 0.00 ? 76 ILE A HG23 6  
ATOM 7475  H HD11 . ILE A 1 76 ? 2.121   3.575   3.217   1.00 0.00 ? 76 ILE A HD11 6  
ATOM 7476  H HD12 . ILE A 1 76 ? 2.702   4.982   2.294   1.00 0.00 ? 76 ILE A HD12 6  
ATOM 7477  H HD13 . ILE A 1 76 ? 3.400   4.615   3.890   1.00 0.00 ? 76 ILE A HD13 6  
ATOM 7478  N N    . ARG A 1 77 ? -3.285  5.245   4.318   1.00 0.00 ? 77 ARG A N    6  
ATOM 7479  C CA   . ARG A 1 77 ? -4.599  4.640   4.453   1.00 0.00 ? 77 ARG A CA   6  
ATOM 7480  C C    . ARG A 1 77 ? -5.207  4.377   3.075   1.00 0.00 ? 77 ARG A C    6  
ATOM 7481  O O    . ARG A 1 77 ? -5.255  5.272   2.232   1.00 0.00 ? 77 ARG A O    6  
ATOM 7482  C CB   . ARG A 1 77 ? -5.540  5.540   5.256   1.00 0.00 ? 77 ARG A CB   6  
ATOM 7483  C CG   . ARG A 1 77 ? -5.324  5.356   6.760   1.00 0.00 ? 77 ARG A CG   6  
ATOM 7484  C CD   . ARG A 1 77 ? -6.502  4.615   7.396   1.00 0.00 ? 77 ARG A CD   6  
ATOM 7485  N NE   . ARG A 1 77 ? -6.377  4.638   8.870   1.00 0.00 ? 77 ARG A NE   6  
ATOM 7486  C CZ   . ARG A 1 77 ? -7.407  4.480   9.714   1.00 0.00 ? 77 ARG A CZ   6  
ATOM 7487  N NH1  . ARG A 1 77 ? -8.643  4.285   9.234   1.00 0.00 ? 77 ARG A NH1  6  
ATOM 7488  N NH2  . ARG A 1 77 ? -7.200  4.515   11.037  1.00 0.00 ? 77 ARG A NH2  6  
ATOM 7489  H H    . ARG A 1 77 ? -3.223  5.971   3.632   1.00 0.00 ? 77 ARG A H    6  
ATOM 7490  H HA   . ARG A 1 77 ? -4.421  3.706   4.988   1.00 0.00 ? 77 ARG A HA   6  
ATOM 7491  H HB3  . ARG A 1 77 ? -6.574  5.309   5.002   1.00 0.00 ? 77 ARG A HB3  6  
ATOM 7492  H HG3  . ARG A 1 77 ? -5.203  6.330   7.235   1.00 0.00 ? 77 ARG A HG3  6  
ATOM 7493  H HD3  . ARG A 1 77 ? -6.528  3.585   7.041   1.00 0.00 ? 77 ARG A HD3  6  
ATOM 7494  H HE   . ARG A 1 77 ? -5.469  4.781   9.262   1.00 0.00 ? 77 ARG A HE   6  
ATOM 7495  H HH11 . ARG A 1 77 ? -8.797  4.259   8.246   1.00 0.00 ? 77 ARG A HH11 6  
ATOM 7496  H HH12 . ARG A 1 77 ? -9.411  4.168   9.864   1.00 0.00 ? 77 ARG A HH12 6  
ATOM 7497  H HH21 . ARG A 1 77 ? -6.277  4.660   11.396  1.00 0.00 ? 77 ARG A HH21 6  
ATOM 7498  H HH22 . ARG A 1 77 ? -7.968  4.396   11.667  1.00 0.00 ? 77 ARG A HH22 6  
ATOM 7499  N N    . PHE A 1 78 ? -5.659  3.146   2.886   1.00 0.00 ? 78 PHE A N    6  
ATOM 7500  C CA   . PHE A 1 78 ? -6.262  2.755   1.624   1.00 0.00 ? 78 PHE A CA   6  
ATOM 7501  C C    . PHE A 1 78 ? -7.754  3.097   1.600   1.00 0.00 ? 78 PHE A C    6  
ATOM 7502  O O    . PHE A 1 78 ? -8.432  3.006   2.623   1.00 0.00 ? 78 PHE A O    6  
ATOM 7503  C CB   . PHE A 1 78 ? -6.097  1.238   1.500   1.00 0.00 ? 78 PHE A CB   6  
ATOM 7504  C CG   . PHE A 1 78 ? -4.745  0.805   0.931   1.00 0.00 ? 78 PHE A CG   6  
ATOM 7505  C CD1  . PHE A 1 78 ? -3.594  1.214   1.528   1.00 0.00 ? 78 PHE A CD1  6  
ATOM 7506  C CD2  . PHE A 1 78 ? -4.694  0.010   -0.171  1.00 0.00 ? 78 PHE A CD2  6  
ATOM 7507  C CE1  . PHE A 1 78 ? -2.338  0.811   1.000   1.00 0.00 ? 78 PHE A CE1  6  
ATOM 7508  C CE2  . PHE A 1 78 ? -3.439  -0.393  -0.699  1.00 0.00 ? 78 PHE A CE2  6  
ATOM 7509  C CZ   . PHE A 1 78 ? -2.287  0.016   -0.102  1.00 0.00 ? 78 PHE A CZ   6  
ATOM 7510  H H    . PHE A 1 78 ? -5.617  2.424   3.576   1.00 0.00 ? 78 PHE A H    6  
ATOM 7511  H HA   . PHE A 1 78 ? -5.752  3.308   0.836   1.00 0.00 ? 78 PHE A HA   6  
ATOM 7512  H HB3  . PHE A 1 78 ? -6.891  0.848   0.862   1.00 0.00 ? 78 PHE A HB3  6  
ATOM 7513  H HD1  . PHE A 1 78 ? -3.634  1.850   2.412   1.00 0.00 ? 78 PHE A HD1  6  
ATOM 7514  H HD2  . PHE A 1 78 ? -5.617  -0.318  -0.649  1.00 0.00 ? 78 PHE A HD2  6  
ATOM 7515  H HE1  . PHE A 1 78 ? -1.415  1.138   1.479   1.00 0.00 ? 78 PHE A HE1  6  
ATOM 7516  H HE2  . PHE A 1 78 ? -3.399  -1.031  -1.582  1.00 0.00 ? 78 PHE A HE2  6  
ATOM 7517  H HZ   . PHE A 1 78 ? -1.324  -0.294  -0.507  1.00 0.00 ? 78 PHE A HZ   6  
ATOM 7518  N N    . LYS A 1 79 ? -8.221  3.484   0.423   1.00 0.00 ? 79 LYS A N    6  
ATOM 7519  C CA   . LYS A 1 79 ? -9.619  3.840   0.252   1.00 0.00 ? 79 LYS A CA   6  
ATOM 7520  C C    . LYS A 1 79 ? -10.184 3.107   -0.967  1.00 0.00 ? 79 LYS A C    6  
ATOM 7521  O O    . LYS A 1 79 ? -9.737  3.330   -2.091  1.00 0.00 ? 79 LYS A O    6  
ATOM 7522  C CB   . LYS A 1 79 ? -9.780  5.361   0.184   1.00 0.00 ? 79 LYS A CB   6  
ATOM 7523  C CG   . LYS A 1 79 ? -10.009 5.950   1.577   1.00 0.00 ? 79 LYS A CG   6  
ATOM 7524  C CD   . LYS A 1 79 ? -11.500 5.978   1.922   1.00 0.00 ? 79 LYS A CD   6  
ATOM 7525  C CE   . LYS A 1 79 ? -12.201 7.149   1.232   1.00 0.00 ? 79 LYS A CE   6  
ATOM 7526  N NZ   . LYS A 1 79 ? -12.236 8.330   2.124   1.00 0.00 ? 79 LYS A NZ   6  
ATOM 7527  H H    . LYS A 1 79 ? -7.662  3.555   -0.405  1.00 0.00 ? 79 LYS A H    6  
ATOM 7528  H HA   . LYS A 1 79 ? -10.153 3.498   1.139   1.00 0.00 ? 79 LYS A HA   6  
ATOM 7529  H HB3  . LYS A 1 79 ? -10.620 5.612   -0.464  1.00 0.00 ? 79 LYS A HB3  6  
ATOM 7530  H HG3  . LYS A 1 79 ? -9.605  6.962   1.619   1.00 0.00 ? 79 LYS A HG3  6  
ATOM 7531  H HD3  . LYS A 1 79 ? -11.625 6.058   3.001   1.00 0.00 ? 79 LYS A HD3  6  
ATOM 7532  H HE3  . LYS A 1 79 ? -13.217 6.862   0.959   1.00 0.00 ? 79 LYS A HE3  6  
ATOM 7533  H HZ1  . LYS A 1 79 ? -11.444 8.310   2.735   1.00 0.00 ? 79 LYS A HZ1  6  
ATOM 7534  H HZ2  . LYS A 1 79 ? -12.210 9.164   1.573   1.00 0.00 ? 79 LYS A HZ2  6  
ATOM 7535  H HZ3  . LYS A 1 79 ? -13.076 8.313   2.666   1.00 0.00 ? 79 LYS A HZ3  6  
ATOM 7536  N N    . LEU A 1 80 ? -11.155 2.247   -0.702  1.00 0.00 ? 80 LEU A N    6  
ATOM 7537  C CA   . LEU A 1 80 ? -11.785 1.479   -1.763  1.00 0.00 ? 80 LEU A CA   6  
ATOM 7538  C C    . LEU A 1 80 ? -13.012 2.235   -2.273  1.00 0.00 ? 80 LEU A C    6  
ATOM 7539  O O    . LEU A 1 80 ? -13.665 2.952   -1.515  1.00 0.00 ? 80 LEU A O    6  
ATOM 7540  C CB   . LEU A 1 80 ? -12.092 0.058   -1.287  1.00 0.00 ? 80 LEU A CB   6  
ATOM 7541  C CG   . LEU A 1 80 ? -10.942 -0.947  -1.390  1.00 0.00 ? 80 LEU A CG   6  
ATOM 7542  C CD1  . LEU A 1 80 ? -11.403 -2.350  -0.992  1.00 0.00 ? 80 LEU A CD1  6  
ATOM 7543  C CD2  . LEU A 1 80 ? -10.317 -0.924  -2.786  1.00 0.00 ? 80 LEU A CD2  6  
ATOM 7544  H H    . LEU A 1 80 ? -11.512 2.071   0.216   1.00 0.00 ? 80 LEU A H    6  
ATOM 7545  H HA   . LEU A 1 80 ? -11.066 1.398   -2.578  1.00 0.00 ? 80 LEU A HA   6  
ATOM 7546  H HB3  . LEU A 1 80 ? -12.934 -0.324  -1.864  1.00 0.00 ? 80 LEU A HB3  6  
ATOM 7547  H HG   . LEU A 1 80 ? -10.166 -0.651  -0.684  1.00 0.00 ? 80 LEU A HG   6  
ATOM 7548  H HD11 . LEU A 1 80 ? -11.806 -2.327  0.021   1.00 0.00 ? 80 LEU A HD11 6  
ATOM 7549  H HD12 . LEU A 1 80 ? -12.177 -2.688  -1.682  1.00 0.00 ? 80 LEU A HD12 6  
ATOM 7550  H HD13 . LEU A 1 80 ? -10.557 -3.036  -1.031  1.00 0.00 ? 80 LEU A HD13 6  
ATOM 7551  H HD21 . LEU A 1 80 ? -9.398  -0.337  -2.763  1.00 0.00 ? 80 LEU A HD21 6  
ATOM 7552  H HD22 . LEU A 1 80 ? -10.091 -1.943  -3.100  1.00 0.00 ? 80 LEU A HD22 6  
ATOM 7553  H HD23 . LEU A 1 80 ? -11.017 -0.474  -3.490  1.00 0.00 ? 80 LEU A HD23 6  
ATOM 7554  N N    . LYS A 1 81 ? -13.292 2.050   -3.555  1.00 0.00 ? 81 LYS A N    6  
ATOM 7555  C CA   . LYS A 1 81 ? -14.430 2.705   -4.177  1.00 0.00 ? 81 LYS A CA   6  
ATOM 7556  C C    . LYS A 1 81 ? -15.657 2.547   -3.276  1.00 0.00 ? 81 LYS A C    6  
ATOM 7557  O O    . LYS A 1 81 ? -15.858 1.494   -2.673  1.00 0.00 ? 81 LYS A O    6  
ATOM 7558  C CB   . LYS A 1 81 ? -14.640 2.181   -5.599  1.00 0.00 ? 81 LYS A CB   6  
ATOM 7559  C CG   . LYS A 1 81 ? -15.304 0.803   -5.583  1.00 0.00 ? 81 LYS A CG   6  
ATOM 7560  C CD   . LYS A 1 81 ? -14.490 -0.207  -6.395  1.00 0.00 ? 81 LYS A CD   6  
ATOM 7561  C CE   . LYS A 1 81 ? -15.337 -0.822  -7.512  1.00 0.00 ? 81 LYS A CE   6  
ATOM 7562  N NZ   . LYS A 1 81 ? -15.081 -2.276  -7.615  1.00 0.00 ? 81 LYS A NZ   6  
ATOM 7563  H H    . LYS A 1 81 ? -12.756 1.465   -4.166  1.00 0.00 ? 81 LYS A H    6  
ATOM 7564  H HA   . LYS A 1 81 ? -14.193 3.766   -4.255  1.00 0.00 ? 81 LYS A HA   6  
ATOM 7565  H HB3  . LYS A 1 81 ? -13.681 2.120   -6.113  1.00 0.00 ? 81 LYS A HB3  6  
ATOM 7566  H HG3  . LYS A 1 81 ? -16.312 0.876   -5.992  1.00 0.00 ? 81 LYS A HG3  6  
ATOM 7567  H HD3  . LYS A 1 81 ? -14.122 -0.994  -5.737  1.00 0.00 ? 81 LYS A HD3  6  
ATOM 7568  H HE3  . LYS A 1 81 ? -15.106 -0.338  -8.460  1.00 0.00 ? 81 LYS A HE3  6  
ATOM 7569  H HZ1  . LYS A 1 81 ? -14.136 -2.467  -7.348  1.00 0.00 ? 81 LYS A HZ1  6  
ATOM 7570  H HZ2  . LYS A 1 81 ? -15.705 -2.768  -7.008  1.00 0.00 ? 81 LYS A HZ2  6  
ATOM 7571  H HZ3  . LYS A 1 81 ? -15.228 -2.575  -8.558  1.00 0.00 ? 81 LYS A HZ3  6  
ATOM 7572  N N    . ARG A 1 82 ? -16.445 3.610   -3.214  1.00 0.00 ? 82 ARG A N    6  
ATOM 7573  C CA   . ARG A 1 82 ? -17.647 3.604   -2.397  1.00 0.00 ? 82 ARG A CA   6  
ATOM 7574  C C    . ARG A 1 82 ? -17.286 3.421   -0.922  1.00 0.00 ? 82 ARG A C    6  
ATOM 7575  O O    . ARG A 1 82 ? -16.487 2.551   -0.578  1.00 0.00 ? 82 ARG A O    6  
ATOM 7576  C CB   . ARG A 1 82 ? -18.597 2.484   -2.824  1.00 0.00 ? 82 ARG A CB   6  
ATOM 7577  C CG   . ARG A 1 82 ? -20.028 3.006   -2.975  1.00 0.00 ? 82 ARG A CG   6  
ATOM 7578  C CD   . ARG A 1 82 ? -20.858 2.701   -1.726  1.00 0.00 ? 82 ARG A CD   6  
ATOM 7579  N NE   . ARG A 1 82 ? -21.860 3.767   -1.512  1.00 0.00 ? 82 ARG A NE   6  
ATOM 7580  C CZ   . ARG A 1 82 ? -22.974 3.909   -2.244  1.00 0.00 ? 82 ARG A CZ   6  
ATOM 7581  N NH1  . ARG A 1 82 ? -23.234 3.053   -3.241  1.00 0.00 ? 82 ARG A NH1  6  
ATOM 7582  N NH2  . ARG A 1 82 ? -23.828 4.907   -1.977  1.00 0.00 ? 82 ARG A NH2  6  
ATOM 7583  H H    . ARG A 1 82 ? -16.275 4.463   -3.707  1.00 0.00 ? 82 ARG A H    6  
ATOM 7584  H HA   . ARG A 1 82 ? -18.108 4.576   -2.570  1.00 0.00 ? 82 ARG A HA   6  
ATOM 7585  H HB3  . ARG A 1 82 ? -18.575 1.682   -2.087  1.00 0.00 ? 82 ARG A HB3  6  
ATOM 7586  H HG3  . ARG A 1 82 ? -20.496 2.549   -3.848  1.00 0.00 ? 82 ARG A HG3  6  
ATOM 7587  H HD3  . ARG A 1 82 ? -20.205 2.623   -0.856  1.00 0.00 ? 82 ARG A HD3  6  
ATOM 7588  H HE   . ARG A 1 82 ? -21.697 4.423   -0.775  1.00 0.00 ? 82 ARG A HE   6  
ATOM 7589  H HH11 . ARG A 1 82 ? -22.596 2.309   -3.441  1.00 0.00 ? 82 ARG A HH11 6  
ATOM 7590  H HH12 . ARG A 1 82 ? -24.065 3.160   -3.788  1.00 0.00 ? 82 ARG A HH12 6  
ATOM 7591  H HH21 . ARG A 1 82 ? -23.634 5.546   -1.232  1.00 0.00 ? 82 ARG A HH21 6  
ATOM 7592  H HH22 . ARG A 1 82 ? -24.659 5.013   -2.523  1.00 0.00 ? 82 ARG A HH22 6  
ATOM 7593  N N    . PRO A 1 83 ? -17.907 4.276   -0.067  1.00 0.00 ? 83 PRO A N    6  
ATOM 7594  C CA   . PRO A 1 83 ? -17.658 4.218   1.363   1.00 0.00 ? 83 PRO A CA   6  
ATOM 7595  C C    . PRO A 1 83 ? -18.369 3.018   1.994   1.00 0.00 ? 83 PRO A C    6  
ATOM 7596  O O    . PRO A 1 83 ? -19.570 2.834   1.806   1.00 0.00 ? 83 PRO A O    6  
ATOM 7597  C CB   . PRO A 1 83 ? -18.151 5.551   1.904   1.00 0.00 ? 83 PRO A CB   6  
ATOM 7598  C CG   . PRO A 1 83 ? -19.076 6.116   0.839   1.00 0.00 ? 83 PRO A CG   6  
ATOM 7599  C CD   . PRO A 1 83 ? -18.859 5.320   -0.438  1.00 0.00 ? 83 PRO A CD   6  
ATOM 7600  H HA   . PRO A 1 83 ? -16.684 4.083   1.541   1.00 0.00 ? 83 PRO A HA   6  
ATOM 7601  H HB3  . PRO A 1 83 ? -17.318 6.226   2.095   1.00 0.00 ? 83 PRO A HB3  6  
ATOM 7602  H HG3  . PRO A 1 83 ? -18.865 7.172   0.670   1.00 0.00 ? 83 PRO A HG3  6  
ATOM 7603  H HD3  . PRO A 1 83 ? -18.465 5.950   -1.235  1.00 0.00 ? 83 PRO A HD3  6  
ATOM 7604  N N    . SER A 1 84 ? -17.596 2.234   2.730   1.00 0.00 ? 84 SER A N    6  
ATOM 7605  C CA   . SER A 1 84 ? -18.134 1.057   3.390   1.00 0.00 ? 84 SER A CA   6  
ATOM 7606  C C    . SER A 1 84 ? -17.065 0.417   4.277   1.00 0.00 ? 84 SER A C    6  
ATOM 7607  O O    . SER A 1 84 ? -16.245 -0.366  3.800   1.00 0.00 ? 84 SER A O    6  
ATOM 7608  C CB   . SER A 1 84 ? -18.654 0.042   2.368   1.00 0.00 ? 84 SER A CB   6  
ATOM 7609  O OG   . SER A 1 84 ? -17.668 -0.286  1.393   1.00 0.00 ? 84 SER A OG   6  
ATOM 7610  H H    . SER A 1 84 ? -16.619 2.390   2.878   1.00 0.00 ? 84 SER A H    6  
ATOM 7611  H HA   . SER A 1 84 ? -18.966 1.420   3.994   1.00 0.00 ? 84 SER A HA   6  
ATOM 7612  H HB3  . SER A 1 84 ? -19.535 0.447   1.871   1.00 0.00 ? 84 SER A HB3  6  
ATOM 7613  H HG   . SER A 1 84 ? -16.938 -0.826  1.814   1.00 0.00 ? 84 SER A HG   6  
ATOM 7614  N N    . SER A 1 85 ? -17.109 0.774   5.552   1.00 0.00 ? 85 SER A N    6  
ATOM 7615  C CA   . SER A 1 85 ? -16.153 0.244   6.510   1.00 0.00 ? 85 SER A CA   6  
ATOM 7616  C C    . SER A 1 85 ? -16.225 -1.284  6.532   1.00 0.00 ? 85 SER A C    6  
ATOM 7617  O O    . SER A 1 85 ? -17.118 -1.875  5.926   1.00 0.00 ? 85 SER A O    6  
ATOM 7618  C CB   . SER A 1 85 ? -16.407 0.807   7.910   1.00 0.00 ? 85 SER A CB   6  
ATOM 7619  O OG   . SER A 1 85 ? -17.721 0.509   8.375   1.00 0.00 ? 85 SER A OG   6  
ATOM 7620  H H    . SER A 1 85 ? -17.778 1.411   5.931   1.00 0.00 ? 85 SER A H    6  
ATOM 7621  H HA   . SER A 1 85 ? -15.177 0.576   6.158   1.00 0.00 ? 85 SER A HA   6  
ATOM 7622  H HB3  . SER A 1 85 ? -16.263 1.888   7.898   1.00 0.00 ? 85 SER A HB3  6  
ATOM 7623  H HG   . SER A 1 85 ? -18.385 1.117   7.937   1.00 0.00 ? 85 SER A HG   6  
ATOM 7624  N N    . GLY A 1 86 ? -15.274 -1.880  7.234   1.00 0.00 ? 86 GLY A N    6  
ATOM 7625  C CA   . GLY A 1 86 ? -15.217 -3.328  7.342   1.00 0.00 ? 86 GLY A CA   6  
ATOM 7626  C C    . GLY A 1 86 ? -14.575 -3.754  8.664   1.00 0.00 ? 86 GLY A C    6  
ATOM 7627  O O    . GLY A 1 86 ? -14.210 -2.911  9.482   1.00 0.00 ? 86 GLY A O    6  
ATOM 7628  H H    . GLY A 1 86 ? -14.551 -1.391  7.723   1.00 0.00 ? 86 GLY A H    6  
ATOM 7629  H HA2  . GLY A 1 86 ? -16.224 -3.739  7.273   1.00 0.00 ? 86 GLY A HA2  6  
ATOM 7630  H HA3  . GLY A 1 86 ? -14.647 -3.736  6.508   1.00 0.00 ? 86 GLY A HA3  6  
ATOM 7631  N N    . PRO A 1 87 ? -14.452 -5.099  8.835   1.00 0.00 ? 87 PRO A N    6  
ATOM 7632  C CA   . PRO A 1 87 ? -13.860 -5.647  10.043  1.00 0.00 ? 87 PRO A CA   6  
ATOM 7633  C C    . PRO A 1 87 ? -12.340 -5.475  10.035  1.00 0.00 ? 87 PRO A C    6  
ATOM 7634  O O    . PRO A 1 87 ? -11.769 -5.008  9.051   1.00 0.00 ? 87 PRO A O    6  
ATOM 7635  C CB   . PRO A 1 87 ? -14.293 -7.104  10.065  1.00 0.00 ? 87 PRO A CB   6  
ATOM 7636  C CG   . PRO A 1 87 ? -14.718 -7.435  8.645   1.00 0.00 ? 87 PRO A CG   6  
ATOM 7637  C CD   . PRO A 1 87 ? -14.872 -6.126  7.888   1.00 0.00 ? 87 PRO A CD   6  
ATOM 7638  H HA   . PRO A 1 87 ? -14.187 -5.151  10.847  1.00 0.00 ? 87 PRO A HA   6  
ATOM 7639  H HB3  . PRO A 1 87 ? -15.114 -7.257  10.765  1.00 0.00 ? 87 PRO A HB3  6  
ATOM 7640  H HG3  . PRO A 1 87 ? -15.656 -7.989  8.646   1.00 0.00 ? 87 PRO A HG3  6  
ATOM 7641  H HD3  . PRO A 1 87 ? -15.904 -5.973  7.569   1.00 0.00 ? 87 PRO A HD3  6  
ATOM 7642  N N    . SER A 1 88 ? -11.727 -5.861  11.145  1.00 0.00 ? 88 SER A N    6  
ATOM 7643  C CA   . SER A 1 88 ? -10.284 -5.755  11.278  1.00 0.00 ? 88 SER A CA   6  
ATOM 7644  C C    . SER A 1 88 ? -9.779  -6.762  12.314  1.00 0.00 ? 88 SER A C    6  
ATOM 7645  O O    . SER A 1 88 ? -8.983  -7.642  11.992  1.00 0.00 ? 88 SER A O    6  
ATOM 7646  C CB   . SER A 1 88 ? -9.870  -4.336  11.673  1.00 0.00 ? 88 SER A CB   6  
ATOM 7647  O OG   . SER A 1 88 ? -8.459  -4.150  11.596  1.00 0.00 ? 88 SER A OG   6  
ATOM 7648  H H    . SER A 1 88 ? -12.199 -6.240  11.941  1.00 0.00 ? 88 SER A H    6  
ATOM 7649  H HA   . SER A 1 88 ? -9.885  -5.989  10.292  1.00 0.00 ? 88 SER A HA   6  
ATOM 7650  H HB3  . SER A 1 88 ? -10.209 -4.128  12.688  1.00 0.00 ? 88 SER A HB3  6  
ATOM 7651  H HG   . SER A 1 88 ? -8.209  -3.807  10.691  1.00 0.00 ? 88 SER A HG   6  
ATOM 7652  N N    . SER A 1 89 ? -10.263 -6.599  13.537  1.00 0.00 ? 89 SER A N    6  
ATOM 7653  C CA   . SER A 1 89 ? -9.871  -7.483  14.621  1.00 0.00 ? 89 SER A CA   6  
ATOM 7654  C C    . SER A 1 89 ? -10.251 -8.925  14.283  1.00 0.00 ? 89 SER A C    6  
ATOM 7655  O O    . SER A 1 89 ? -11.346 -9.182  13.785  1.00 0.00 ? 89 SER A O    6  
ATOM 7656  C CB   . SER A 1 89 ? -10.519 -7.057  15.940  1.00 0.00 ? 89 SER A CB   6  
ATOM 7657  O OG   . SER A 1 89 ? -9.922  -7.705  17.060  1.00 0.00 ? 89 SER A OG   6  
ATOM 7658  H H    . SER A 1 89 ? -10.910 -5.880  13.790  1.00 0.00 ? 89 SER A H    6  
ATOM 7659  H HA   . SER A 1 89 ? -8.788  -7.380  14.699  1.00 0.00 ? 89 SER A HA   6  
ATOM 7660  H HB3  . SER A 1 89 ? -11.583 -7.288  15.912  1.00 0.00 ? 89 SER A HB3  6  
ATOM 7661  H HG   . SER A 1 89 ? -8.951  -7.474  17.112  1.00 0.00 ? 89 SER A HG   6  
ATOM 7662  N N    . GLY A 1 90 ? -9.326  -9.830  14.569  1.00 0.00 ? 90 GLY A N    6  
ATOM 7663  C CA   . GLY A 1 90 ? -9.550  -11.240 14.302  1.00 0.00 ? 90 GLY A CA   6  
ATOM 7664  C C    . GLY A 1 90 ? -8.225  -11.998 14.204  1.00 0.00 ? 90 GLY A C    6  
ATOM 7665  O O    . GLY A 1 90 ? -7.627  -12.346 15.222  1.00 0.00 ? 90 GLY A O    6  
ATOM 7666  H H    . GLY A 1 90 ? -8.438  -9.613  14.974  1.00 0.00 ? 90 GLY A H    6  
ATOM 7667  H HA2  . GLY A 1 90 ? -10.161 -11.671 15.096  1.00 0.00 ? 90 GLY A HA2  6  
ATOM 7668  H HA3  . GLY A 1 90 ? -10.108 -11.354 13.373  1.00 0.00 ? 90 GLY A HA3  6  
ATOM 7669  N N    . GLY A 1 1  ? 1.995   -17.152 -0.686  1.00 0.00 ? 1  GLY A N    7  
ATOM 7670  C CA   . GLY A 1 1  ? 3.236   -17.772 -0.254  1.00 0.00 ? 1  GLY A CA   7  
ATOM 7671  C C    . GLY A 1 1  ? 4.190   -16.735 0.341   1.00 0.00 ? 1  GLY A C    7  
ATOM 7672  O O    . GLY A 1 1  ? 4.530   -15.751 -0.315  1.00 0.00 ? 1  GLY A O    7  
ATOM 7673  H H1   . GLY A 1 1  ? 2.020   -16.155 -0.746  1.00 0.00 ? 1  GLY A H1   7  
ATOM 7674  H HA2  . GLY A 1 1  ? 3.023   -18.543 0.487   1.00 0.00 ? 1  GLY A HA2  7  
ATOM 7675  H HA3  . GLY A 1 1  ? 3.713   -18.268 -1.100  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 7676  N N    . SER A 1 2  ? 4.595   -16.990 1.577   1.00 0.00 ? 2  SER A N    7  
ATOM 7677  C CA   . SER A 1 2  ? 5.503   -16.089 2.267   1.00 0.00 ? 2  SER A CA   7  
ATOM 7678  C C    . SER A 1 2  ? 5.846   -16.652 3.649   1.00 0.00 ? 2  SER A C    7  
ATOM 7679  O O    . SER A 1 2  ? 5.017   -17.305 4.281   1.00 0.00 ? 2  SER A O    7  
ATOM 7680  C CB   . SER A 1 2  ? 4.898   -14.691 2.399   1.00 0.00 ? 2  SER A CB   7  
ATOM 7681  O OG   . SER A 1 2  ? 3.759   -14.680 3.257   1.00 0.00 ? 2  SER A OG   7  
ATOM 7682  H H    . SER A 1 2  ? 4.314   -17.792 2.103   1.00 0.00 ? 2  SER A H    7  
ATOM 7683  H HA   . SER A 1 2  ? 6.394   -16.042 1.641   1.00 0.00 ? 2  SER A HA   7  
ATOM 7684  H HB3  . SER A 1 2  ? 4.611   -14.325 1.413   1.00 0.00 ? 2  SER A HB3  7  
ATOM 7685  H HG   . SER A 1 2  ? 3.035   -15.250 2.870   1.00 0.00 ? 2  SER A HG   7  
ATOM 7686  N N    . SER A 1 3  ? 7.070   -16.376 4.077   1.00 0.00 ? 3  SER A N    7  
ATOM 7687  C CA   . SER A 1 3  ? 7.533   -16.846 5.371   1.00 0.00 ? 3  SER A CA   7  
ATOM 7688  C C    . SER A 1 3  ? 8.357   -15.755 6.059   1.00 0.00 ? 3  SER A C    7  
ATOM 7689  O O    . SER A 1 3  ? 8.014   -15.312 7.154   1.00 0.00 ? 3  SER A O    7  
ATOM 7690  C CB   . SER A 1 3  ? 8.360   -18.126 5.229   1.00 0.00 ? 3  SER A CB   7  
ATOM 7691  O OG   . SER A 1 3  ? 7.545   -19.259 4.947   1.00 0.00 ? 3  SER A OG   7  
ATOM 7692  H H    . SER A 1 3  ? 7.737   -15.844 3.556   1.00 0.00 ? 3  SER A H    7  
ATOM 7693  H HA   . SER A 1 3  ? 6.629   -17.060 5.941   1.00 0.00 ? 3  SER A HA   7  
ATOM 7694  H HB3  . SER A 1 3  ? 8.918   -18.300 6.149   1.00 0.00 ? 3  SER A HB3  7  
ATOM 7695  H HG   . SER A 1 3  ? 7.908   -20.066 5.412   1.00 0.00 ? 3  SER A HG   7  
ATOM 7696  N N    . GLY A 1 4  ? 9.427   -15.354 5.389   1.00 0.00 ? 4  GLY A N    7  
ATOM 7697  C CA   . GLY A 1 4  ? 10.301  -14.324 5.922   1.00 0.00 ? 4  GLY A CA   7  
ATOM 7698  C C    . GLY A 1 4  ? 11.072  -13.624 4.800   1.00 0.00 ? 4  GLY A C    7  
ATOM 7699  O O    . GLY A 1 4  ? 11.555  -14.274 3.876   1.00 0.00 ? 4  GLY A O    7  
ATOM 7700  H H    . GLY A 1 4  ? 9.698   -15.719 4.498   1.00 0.00 ? 4  GLY A H    7  
ATOM 7701  H HA2  . GLY A 1 4  ? 9.712   -13.592 6.475   1.00 0.00 ? 4  GLY A HA2  7  
ATOM 7702  H HA3  . GLY A 1 4  ? 11.003  -14.768 6.628   1.00 0.00 ? 4  GLY A HA3  7  
ATOM 7703  N N    . SER A 1 5  ? 11.160  -12.307 4.919   1.00 0.00 ? 5  SER A N    7  
ATOM 7704  C CA   . SER A 1 5  ? 11.863  -11.512 3.927   1.00 0.00 ? 5  SER A CA   7  
ATOM 7705  C C    . SER A 1 5  ? 12.279  -10.169 4.531   1.00 0.00 ? 5  SER A C    7  
ATOM 7706  O O    . SER A 1 5  ? 11.753  -9.761  5.566   1.00 0.00 ? 5  SER A O    7  
ATOM 7707  C CB   . SER A 1 5  ? 10.997  -11.291 2.685   1.00 0.00 ? 5  SER A CB   7  
ATOM 7708  O OG   . SER A 1 5  ? 11.780  -10.959 1.541   1.00 0.00 ? 5  SER A OG   7  
ATOM 7709  H H    . SER A 1 5  ? 10.763  -11.786 5.674   1.00 0.00 ? 5  SER A H    7  
ATOM 7710  H HA   . SER A 1 5  ? 12.742  -12.098 3.657   1.00 0.00 ? 5  SER A HA   7  
ATOM 7711  H HB3  . SER A 1 5  ? 10.283  -10.491 2.880   1.00 0.00 ? 5  SER A HB3  7  
ATOM 7712  H HG   . SER A 1 5  ? 11.997  -11.787 1.023   1.00 0.00 ? 5  SER A HG   7  
ATOM 7713  N N    . SER A 1 6  ? 13.218  -9.519  3.860   1.00 0.00 ? 6  SER A N    7  
ATOM 7714  C CA   . SER A 1 6  ? 13.710  -8.231  4.317   1.00 0.00 ? 6  SER A CA   7  
ATOM 7715  C C    . SER A 1 6  ? 13.910  -7.294  3.124   1.00 0.00 ? 6  SER A C    7  
ATOM 7716  O O    . SER A 1 6  ? 13.823  -7.720  1.974   1.00 0.00 ? 6  SER A O    7  
ATOM 7717  C CB   . SER A 1 6  ? 15.017  -8.385  5.096   1.00 0.00 ? 6  SER A CB   7  
ATOM 7718  O OG   . SER A 1 6  ? 14.847  -8.107  6.484   1.00 0.00 ? 6  SER A OG   7  
ATOM 7719  H H    . SER A 1 6  ? 13.640  -9.858  3.019   1.00 0.00 ? 6  SER A H    7  
ATOM 7720  H HA   . SER A 1 6  ? 12.935  -7.846  4.980   1.00 0.00 ? 6  SER A HA   7  
ATOM 7721  H HB3  . SER A 1 6  ? 15.768  -7.715  4.681   1.00 0.00 ? 6  SER A HB3  7  
ATOM 7722  H HG   . SER A 1 6  ? 14.123  -7.429  6.611   1.00 0.00 ? 6  SER A HG   7  
ATOM 7723  N N    . GLY A 1 7  ? 14.176  -6.036  3.440   1.00 0.00 ? 7  GLY A N    7  
ATOM 7724  C CA   . GLY A 1 7  ? 14.391  -5.034  2.409   1.00 0.00 ? 7  GLY A CA   7  
ATOM 7725  C C    . GLY A 1 7  ? 13.415  -3.866  2.567   1.00 0.00 ? 7  GLY A C    7  
ATOM 7726  O O    . GLY A 1 7  ? 12.309  -4.042  3.075   1.00 0.00 ? 7  GLY A O    7  
ATOM 7727  H H    . GLY A 1 7  ? 14.246  -5.697  4.379   1.00 0.00 ? 7  GLY A H    7  
ATOM 7728  H HA2  . GLY A 1 7  ? 15.416  -4.666  2.461   1.00 0.00 ? 7  GLY A HA2  7  
ATOM 7729  H HA3  . GLY A 1 7  ? 14.265  -5.488  1.425   1.00 0.00 ? 7  GLY A HA3  7  
ATOM 7730  N N    . LEU A 1 8  ? 13.861  -2.701  2.123   1.00 0.00 ? 8  LEU A N    7  
ATOM 7731  C CA   . LEU A 1 8  ? 13.041  -1.504  2.208   1.00 0.00 ? 8  LEU A CA   7  
ATOM 7732  C C    . LEU A 1 8  ? 11.775  -1.697  1.370   1.00 0.00 ? 8  LEU A C    7  
ATOM 7733  O O    . LEU A 1 8  ? 10.663  -1.571  1.880   1.00 0.00 ? 8  LEU A O    7  
ATOM 7734  C CB   . LEU A 1 8  ? 13.854  -0.268  1.819   1.00 0.00 ? 8  LEU A CB   7  
ATOM 7735  C CG   . LEU A 1 8  ? 14.541  0.472   2.967   1.00 0.00 ? 8  LEU A CG   7  
ATOM 7736  C CD1  . LEU A 1 8  ? 15.192  1.766   2.474   1.00 0.00 ? 8  LEU A CD1  7  
ATOM 7737  C CD2  . LEU A 1 8  ? 13.566  0.724   4.119   1.00 0.00 ? 8  LEU A CD2  7  
ATOM 7738  H H    . LEU A 1 8  ? 14.762  -2.567  1.710   1.00 0.00 ? 8  LEU A H    7  
ATOM 7739  H HA   . LEU A 1 8  ? 12.749  -1.382  3.252   1.00 0.00 ? 8  LEU A HA   7  
ATOM 7740  H HB3  . LEU A 1 8  ? 13.193  0.430   1.306   1.00 0.00 ? 8  LEU A HB3  7  
ATOM 7741  H HG   . LEU A 1 8  ? 15.339  -0.162  3.353   1.00 0.00 ? 8  LEU A HG   7  
ATOM 7742  H HD11 . LEU A 1 8  ? 14.430  2.412   2.036   1.00 0.00 ? 8  LEU A HD11 7  
ATOM 7743  H HD12 . LEU A 1 8  ? 15.664  2.278   3.313   1.00 0.00 ? 8  LEU A HD12 7  
ATOM 7744  H HD13 . LEU A 1 8  ? 15.945  1.530   1.721   1.00 0.00 ? 8  LEU A HD13 7  
ATOM 7745  H HD21 . LEU A 1 8  ? 13.957  1.514   4.760   1.00 0.00 ? 8  LEU A HD21 7  
ATOM 7746  H HD22 . LEU A 1 8  ? 12.599  1.028   3.716   1.00 0.00 ? 8  LEU A HD22 7  
ATOM 7747  H HD23 . LEU A 1 8  ? 13.446  -0.190  4.699   1.00 0.00 ? 8  LEU A HD23 7  
ATOM 7748  N N    . ARG A 1 9  ? 11.987  -2.001  0.097   1.00 0.00 ? 9  ARG A N    7  
ATOM 7749  C CA   . ARG A 1 9  ? 10.877  -2.212  -0.816  1.00 0.00 ? 9  ARG A CA   7  
ATOM 7750  C C    . ARG A 1 9  ? 10.095  -3.466  -0.419  1.00 0.00 ? 9  ARG A C    7  
ATOM 7751  O O    . ARG A 1 9  ? 8.872   -3.501  -0.535  1.00 0.00 ? 9  ARG A O    7  
ATOM 7752  C CB   . ARG A 1 9  ? 11.370  -2.361  -2.256  1.00 0.00 ? 9  ARG A CB   7  
ATOM 7753  C CG   . ARG A 1 9  ? 10.216  -2.707  -3.199  1.00 0.00 ? 9  ARG A CG   7  
ATOM 7754  C CD   . ARG A 1 9  ? 10.731  -3.363  -4.480  1.00 0.00 ? 9  ARG A CD   7  
ATOM 7755  N NE   . ARG A 1 9  ? 11.009  -4.797  -4.238  1.00 0.00 ? 9  ARG A NE   7  
ATOM 7756  C CZ   . ARG A 1 9  ? 12.212  -5.284  -3.910  1.00 0.00 ? 9  ARG A CZ   7  
ATOM 7757  N NH1  . ARG A 1 9  ? 13.258  -4.457  -3.783  1.00 0.00 ? 9  ARG A NH1  7  
ATOM 7758  N NH2  . ARG A 1 9  ? 12.371  -6.600  -3.710  1.00 0.00 ? 9  ARG A NH2  7  
ATOM 7759  H H    . ARG A 1 9  ? 12.895  -2.101  -0.310  1.00 0.00 ? 9  ARG A H    7  
ATOM 7760  H HA   . ARG A 1 9  ? 10.261  -1.319  -0.718  1.00 0.00 ? 9  ARG A HA   7  
ATOM 7761  H HB3  . ARG A 1 9  ? 12.130  -3.142  -2.306  1.00 0.00 ? 9  ARG A HB3  7  
ATOM 7762  H HG3  . ARG A 1 9  ? 9.662   -1.802  -3.447  1.00 0.00 ? 9  ARG A HG3  7  
ATOM 7763  H HD3  . ARG A 1 9  ? 11.638  -2.861  -4.817  1.00 0.00 ? 9  ARG A HD3  7  
ATOM 7764  H HE   . ARG A 1 9  ? 10.250  -5.443  -4.326  1.00 0.00 ? 9  ARG A HE   7  
ATOM 7765  H HH11 . ARG A 1 9  ? 13.140  -3.474  -3.932  1.00 0.00 ? 9  ARG A HH11 7  
ATOM 7766  H HH12 . ARG A 1 9  ? 14.157  -4.820  -3.537  1.00 0.00 ? 9  ARG A HH12 7  
ATOM 7767  H HH21 . ARG A 1 9  ? 11.590  -7.218  -3.805  1.00 0.00 ? 9  ARG A HH21 7  
ATOM 7768  H HH22 . ARG A 1 9  ? 13.270  -6.963  -3.465  1.00 0.00 ? 9  ARG A HH22 7  
ATOM 7769  N N    . LYS A 1 10 ? 10.834  -4.465  0.040   1.00 0.00 ? 10 LYS A N    7  
ATOM 7770  C CA   . LYS A 1 10 ? 10.226  -5.718  0.455   1.00 0.00 ? 10 LYS A CA   7  
ATOM 7771  C C    . LYS A 1 10 ? 9.283   -5.457  1.631   1.00 0.00 ? 10 LYS A C    7  
ATOM 7772  O O    . LYS A 1 10 ? 8.296   -6.169  1.809   1.00 0.00 ? 10 LYS A O    7  
ATOM 7773  C CB   . LYS A 1 10 ? 11.301  -6.765  0.748   1.00 0.00 ? 10 LYS A CB   7  
ATOM 7774  C CG   . LYS A 1 10 ? 10.728  -7.928  1.561   1.00 0.00 ? 10 LYS A CG   7  
ATOM 7775  C CD   . LYS A 1 10 ? 9.501   -8.526  0.871   1.00 0.00 ? 10 LYS A CD   7  
ATOM 7776  C CE   . LYS A 1 10 ? 8.390   -8.818  1.883   1.00 0.00 ? 10 LYS A CE   7  
ATOM 7777  N NZ   . LYS A 1 10 ? 7.060   -8.663  1.252   1.00 0.00 ? 10 LYS A NZ   7  
ATOM 7778  H H    . LYS A 1 10 ? 11.829  -4.429  0.130   1.00 0.00 ? 10 LYS A H    7  
ATOM 7779  H HA   . LYS A 1 10 ? 9.637   -6.088  -0.385  1.00 0.00 ? 10 LYS A HA   7  
ATOM 7780  H HB3  . LYS A 1 10 ? 12.122  -6.304  1.296   1.00 0.00 ? 10 LYS A HB3  7  
ATOM 7781  H HG3  . LYS A 1 10 ? 10.455  -7.579  2.557   1.00 0.00 ? 10 LYS A HG3  7  
ATOM 7782  H HD3  . LYS A 1 10 ? 9.780   -9.446  0.357   1.00 0.00 ? 10 LYS A HD3  7  
ATOM 7783  H HE3  . LYS A 1 10 ? 8.478   -8.142  2.732   1.00 0.00 ? 10 LYS A HE3  7  
ATOM 7784  H HZ1  . LYS A 1 10 ? 6.366   -8.548  1.962   1.00 0.00 ? 10 LYS A HZ1  7  
ATOM 7785  H HZ2  . LYS A 1 10 ? 7.065   -7.858  0.658   1.00 0.00 ? 10 LYS A HZ2  7  
ATOM 7786  H HZ3  . LYS A 1 10 ? 6.851   -9.477  0.710   1.00 0.00 ? 10 LYS A HZ3  7  
ATOM 7787  N N    . MET A 1 11 ? 9.621   -4.435  2.403   1.00 0.00 ? 11 MET A N    7  
ATOM 7788  C CA   . MET A 1 11 ? 8.817   -4.072  3.558   1.00 0.00 ? 11 MET A CA   7  
ATOM 7789  C C    . MET A 1 11 ? 7.514   -3.394  3.127   1.00 0.00 ? 11 MET A C    7  
ATOM 7790  O O    . MET A 1 11 ? 6.431   -3.809  3.534   1.00 0.00 ? 11 MET A O    7  
ATOM 7791  C CB   . MET A 1 11 ? 9.614   -3.123  4.456   1.00 0.00 ? 11 MET A CB   7  
ATOM 7792  C CG   . MET A 1 11 ? 10.525  -3.904  5.406   1.00 0.00 ? 11 MET A CG   7  
ATOM 7793  S SD   . MET A 1 11 ? 10.287  -3.338  7.082   1.00 0.00 ? 11 MET A SD   7  
ATOM 7794  C CE   . MET A 1 11 ? 11.107  -1.755  6.994   1.00 0.00 ? 11 MET A CE   7  
ATOM 7795  H H    . MET A 1 11 ? 10.426  -3.861  2.250   1.00 0.00 ? 11 MET A H    7  
ATOM 7796  H HA   . MET A 1 11 ? 8.596   -5.009  4.068   1.00 0.00 ? 11 MET A HA   7  
ATOM 7797  H HB3  . MET A 1 11 ? 8.929   -2.501  5.033   1.00 0.00 ? 11 MET A HB3  7  
ATOM 7798  H HG3  . MET A 1 11 ? 11.567  -3.773  5.113   1.00 0.00 ? 11 MET A HG3  7  
ATOM 7799  H HE1  . MET A 1 11 ? 11.634  -1.671  6.044   1.00 0.00 ? 11 MET A HE1  7  
ATOM 7800  H HE2  . MET A 1 11 ? 10.367  -0.958  7.070   1.00 0.00 ? 11 MET A HE2  7  
ATOM 7801  H HE3  . MET A 1 11 ? 11.820  -1.669  7.814   1.00 0.00 ? 11 MET A HE3  7  
ATOM 7802  N N    . VAL A 1 12 ? 7.664   -2.362  2.311   1.00 0.00 ? 12 VAL A N    7  
ATOM 7803  C CA   . VAL A 1 12 ? 6.513   -1.622  1.821   1.00 0.00 ? 12 VAL A CA   7  
ATOM 7804  C C    . VAL A 1 12 ? 5.711   -2.510  0.868   1.00 0.00 ? 12 VAL A C    7  
ATOM 7805  O O    . VAL A 1 12 ? 4.533   -2.254  0.619   1.00 0.00 ? 12 VAL A O    7  
ATOM 7806  C CB   . VAL A 1 12 ? 6.968   -0.311  1.178   1.00 0.00 ? 12 VAL A CB   7  
ATOM 7807  C CG1  . VAL A 1 12 ? 8.212   -0.528  0.314   1.00 0.00 ? 12 VAL A CG1  7  
ATOM 7808  C CG2  . VAL A 1 12 ? 5.838   0.322   0.362   1.00 0.00 ? 12 VAL A CG2  7  
ATOM 7809  H H    . VAL A 1 12 ? 8.549   -2.030  1.985   1.00 0.00 ? 12 VAL A H    7  
ATOM 7810  H HA   . VAL A 1 12 ? 5.889   -1.378  2.681   1.00 0.00 ? 12 VAL A HA   7  
ATOM 7811  H HB   . VAL A 1 12 ? 7.232   0.381   1.977   1.00 0.00 ? 12 VAL A HB   7  
ATOM 7812  H HG11 . VAL A 1 12 ? 8.096   0.006   -0.629  1.00 0.00 ? 12 VAL A HG11 7  
ATOM 7813  H HG12 . VAL A 1 12 ? 9.089   -0.150  0.840   1.00 0.00 ? 12 VAL A HG12 7  
ATOM 7814  H HG13 . VAL A 1 12 ? 8.337   -1.592  0.116   1.00 0.00 ? 12 VAL A HG13 7  
ATOM 7815  H HG21 . VAL A 1 12 ? 4.968   0.470   1.002   1.00 0.00 ? 12 VAL A HG21 7  
ATOM 7816  H HG22 . VAL A 1 12 ? 6.168   1.283   -0.032  1.00 0.00 ? 12 VAL A HG22 7  
ATOM 7817  H HG23 . VAL A 1 12 ? 5.572   -0.338  -0.464  1.00 0.00 ? 12 VAL A HG23 7  
ATOM 7818  N N    . GLU A 1 13 ? 6.380   -3.533  0.358   1.00 0.00 ? 13 GLU A N    7  
ATOM 7819  C CA   . GLU A 1 13 ? 5.744   -4.459  -0.563  1.00 0.00 ? 13 GLU A CA   7  
ATOM 7820  C C    . GLU A 1 13 ? 4.527   -5.112  0.096   1.00 0.00 ? 13 GLU A C    7  
ATOM 7821  O O    . GLU A 1 13 ? 3.475   -5.245  -0.528  1.00 0.00 ? 13 GLU A O    7  
ATOM 7822  C CB   . GLU A 1 13 ? 6.737   -5.516  -1.050  1.00 0.00 ? 13 GLU A CB   7  
ATOM 7823  C CG   . GLU A 1 13 ? 7.589   -4.980  -2.202  1.00 0.00 ? 13 GLU A CG   7  
ATOM 7824  C CD   . GLU A 1 13 ? 7.125   -5.558  -3.541  1.00 0.00 ? 13 GLU A CD   7  
ATOM 7825  O OE1  . GLU A 1 13 ? 5.935   -5.355  -3.865  1.00 0.00 ? 13 GLU A OE1  7  
ATOM 7826  O OE2  . GLU A 1 13 ? 7.972   -6.188  -4.210  1.00 0.00 ? 13 GLU A OE2  7  
ATOM 7827  H H    . GLU A 1 13 ? 7.338   -3.733  0.565   1.00 0.00 ? 13 GLU A H    7  
ATOM 7828  H HA   . GLU A 1 13 ? 5.425   -3.853  -1.410  1.00 0.00 ? 13 GLU A HA   7  
ATOM 7829  H HB3  . GLU A 1 13 ? 6.196   -6.405  -1.376  1.00 0.00 ? 13 GLU A HB3  7  
ATOM 7830  H HG3  . GLU A 1 13 ? 8.634   -5.235  -2.034  1.00 0.00 ? 13 GLU A HG3  7  
ATOM 7831  N N    . GLU A 1 14 ? 4.710   -5.501  1.349   1.00 0.00 ? 14 GLU A N    7  
ATOM 7832  C CA   . GLU A 1 14 ? 3.640   -6.136  2.099   1.00 0.00 ? 14 GLU A CA   7  
ATOM 7833  C C    . GLU A 1 14 ? 2.655   -5.084  2.612   1.00 0.00 ? 14 GLU A C    7  
ATOM 7834  O O    . GLU A 1 14 ? 1.446   -5.312  2.619   1.00 0.00 ? 14 GLU A O    7  
ATOM 7835  C CB   . GLU A 1 14 ? 4.200   -6.971  3.252   1.00 0.00 ? 14 GLU A CB   7  
ATOM 7836  C CG   . GLU A 1 14 ? 4.402   -6.114  4.504   1.00 0.00 ? 14 GLU A CG   7  
ATOM 7837  C CD   . GLU A 1 14 ? 5.303   -6.824  5.516   1.00 0.00 ? 14 GLU A CD   7  
ATOM 7838  O OE1  . GLU A 1 14 ? 4.750   -7.604  6.321   1.00 0.00 ? 14 GLU A OE1  7  
ATOM 7839  O OE2  . GLU A 1 14 ? 6.526   -6.572  5.461   1.00 0.00 ? 14 GLU A OE2  7  
ATOM 7840  H H    . GLU A 1 14 ? 5.569   -5.388  1.850   1.00 0.00 ? 14 GLU A H    7  
ATOM 7841  H HA   . GLU A 1 14 ? 3.141   -6.796  1.390   1.00 0.00 ? 14 GLU A HA   7  
ATOM 7842  H HB3  . GLU A 1 14 ? 5.150   -7.417  2.956   1.00 0.00 ? 14 GLU A HB3  7  
ATOM 7843  H HG3  . GLU A 1 14 ? 3.435   -5.899  4.960   1.00 0.00 ? 14 GLU A HG3  7  
ATOM 7844  N N    . VAL A 1 15 ? 3.208   -3.955  3.030   1.00 0.00 ? 15 VAL A N    7  
ATOM 7845  C CA   . VAL A 1 15 ? 2.393   -2.868  3.543   1.00 0.00 ? 15 VAL A CA   7  
ATOM 7846  C C    . VAL A 1 15 ? 1.201   -2.644  2.611   1.00 0.00 ? 15 VAL A C    7  
ATOM 7847  O O    . VAL A 1 15 ? 0.075   -3.013  2.939   1.00 0.00 ? 15 VAL A O    7  
ATOM 7848  C CB   . VAL A 1 15 ? 3.251   -1.613  3.729   1.00 0.00 ? 15 VAL A CB   7  
ATOM 7849  C CG1  . VAL A 1 15 ? 2.377   -0.389  4.008   1.00 0.00 ? 15 VAL A CG1  7  
ATOM 7850  C CG2  . VAL A 1 15 ? 4.285   -1.815  4.839   1.00 0.00 ? 15 VAL A CG2  7  
ATOM 7851  H H    . VAL A 1 15 ? 4.192   -3.777  3.021   1.00 0.00 ? 15 VAL A H    7  
ATOM 7852  H HA   . VAL A 1 15 ? 2.021   -3.169  4.523   1.00 0.00 ? 15 VAL A HA   7  
ATOM 7853  H HB   . VAL A 1 15 ? 3.789   -1.435  2.797   1.00 0.00 ? 15 VAL A HB   7  
ATOM 7854  H HG11 . VAL A 1 15 ? 2.045   0.044   3.065   1.00 0.00 ? 15 VAL A HG11 7  
ATOM 7855  H HG12 . VAL A 1 15 ? 1.508   -0.688  4.595   1.00 0.00 ? 15 VAL A HG12 7  
ATOM 7856  H HG13 . VAL A 1 15 ? 2.954   0.351   4.564   1.00 0.00 ? 15 VAL A HG13 7  
ATOM 7857  H HG21 . VAL A 1 15 ? 4.469   -2.880  4.974   1.00 0.00 ? 15 VAL A HG21 7  
ATOM 7858  H HG22 . VAL A 1 15 ? 5.214   -1.317  4.563   1.00 0.00 ? 15 VAL A HG22 7  
ATOM 7859  H HG23 . VAL A 1 15 ? 3.906   -1.390  5.769   1.00 0.00 ? 15 VAL A HG23 7  
ATOM 7860  N N    . PHE A 1 16 ? 1.491   -2.043  1.467   1.00 0.00 ? 16 PHE A N    7  
ATOM 7861  C CA   . PHE A 1 16 ? 0.456   -1.766  0.484   1.00 0.00 ? 16 PHE A CA   7  
ATOM 7862  C C    . PHE A 1 16 ? -0.483  -2.964  0.325   1.00 0.00 ? 16 PHE A C    7  
ATOM 7863  O O    . PHE A 1 16 ? -1.679  -2.794  0.093   1.00 0.00 ? 16 PHE A O    7  
ATOM 7864  C CB   . PHE A 1 16 ? 1.161   -1.506  -0.847  1.00 0.00 ? 16 PHE A CB   7  
ATOM 7865  C CG   . PHE A 1 16 ? 1.764   -0.105  -0.970  1.00 0.00 ? 16 PHE A CG   7  
ATOM 7866  C CD1  . PHE A 1 16 ? 1.087   0.970   -0.484  1.00 0.00 ? 16 PHE A CD1  7  
ATOM 7867  C CD2  . PHE A 1 16 ? 2.975   0.065   -1.563  1.00 0.00 ? 16 PHE A CD2  7  
ATOM 7868  C CE1  . PHE A 1 16 ? 1.646   2.271   -0.597  1.00 0.00 ? 16 PHE A CE1  7  
ATOM 7869  C CE2  . PHE A 1 16 ? 3.534   1.367   -1.677  1.00 0.00 ? 16 PHE A CE2  7  
ATOM 7870  C CZ   . PHE A 1 16 ? 2.857   2.441   -1.191  1.00 0.00 ? 16 PHE A CZ   7  
ATOM 7871  H H    . PHE A 1 16 ? 2.410   -1.747  1.207   1.00 0.00 ? 16 PHE A H    7  
ATOM 7872  H HA   . PHE A 1 16 ? -0.112  -0.909  0.844   1.00 0.00 ? 16 PHE A HA   7  
ATOM 7873  H HB3  . PHE A 1 16 ? 0.450   -1.657  -1.660  1.00 0.00 ? 16 PHE A HB3  7  
ATOM 7874  H HD1  . PHE A 1 16 ? 0.116   0.833   -0.008  1.00 0.00 ? 16 PHE A HD1  7  
ATOM 7875  H HD2  . PHE A 1 16 ? 3.518   -0.796  -1.953  1.00 0.00 ? 16 PHE A HD2  7  
ATOM 7876  H HE1  . PHE A 1 16 ? 1.103   3.133   -0.207  1.00 0.00 ? 16 PHE A HE1  7  
ATOM 7877  H HE2  . PHE A 1 16 ? 4.505   1.503   -2.152  1.00 0.00 ? 16 PHE A HE2  7  
ATOM 7878  H HZ   . PHE A 1 16 ? 3.286   3.440   -1.278  1.00 0.00 ? 16 PHE A HZ   7  
ATOM 7879  N N    . ASP A 1 17 ? 0.095   -4.150  0.455   1.00 0.00 ? 17 ASP A N    7  
ATOM 7880  C CA   . ASP A 1 17 ? -0.675  -5.376  0.328   1.00 0.00 ? 17 ASP A CA   7  
ATOM 7881  C C    . ASP A 1 17 ? -1.619  -5.506  1.525   1.00 0.00 ? 17 ASP A C    7  
ATOM 7882  O O    . ASP A 1 17 ? -2.835  -5.562  1.358   1.00 0.00 ? 17 ASP A O    7  
ATOM 7883  C CB   . ASP A 1 17 ? 0.241   -6.602  0.311   1.00 0.00 ? 17 ASP A CB   7  
ATOM 7884  C CG   . ASP A 1 17 ? 0.418   -7.257  -1.060  1.00 0.00 ? 17 ASP A CG   7  
ATOM 7885  O OD1  . ASP A 1 17 ? 0.476   -6.496  -2.050  1.00 0.00 ? 17 ASP A OD1  7  
ATOM 7886  O OD2  . ASP A 1 17 ? 0.492   -8.505  -1.087  1.00 0.00 ? 17 ASP A OD2  7  
ATOM 7887  H H    . ASP A 1 17 ? 1.068   -4.280  0.643   1.00 0.00 ? 17 ASP A H    7  
ATOM 7888  H HA   . ASP A 1 17 ? -1.211  -5.281  -0.617  1.00 0.00 ? 17 ASP A HA   7  
ATOM 7889  H HB3  . ASP A 1 17 ? -0.158  -7.344  1.003   1.00 0.00 ? 17 ASP A HB3  7  
ATOM 7890  N N    . VAL A 1 18 ? -1.020  -5.552  2.707   1.00 0.00 ? 18 VAL A N    7  
ATOM 7891  C CA   . VAL A 1 18 ? -1.793  -5.675  3.932   1.00 0.00 ? 18 VAL A CA   7  
ATOM 7892  C C    . VAL A 1 18 ? -2.892  -4.612  3.946   1.00 0.00 ? 18 VAL A C    7  
ATOM 7893  O O    . VAL A 1 18 ? -4.059  -4.924  4.174   1.00 0.00 ? 18 VAL A O    7  
ATOM 7894  C CB   . VAL A 1 18 ? -0.864  -5.592  5.146   1.00 0.00 ? 18 VAL A CB   7  
ATOM 7895  C CG1  . VAL A 1 18 ? -1.602  -5.027  6.362   1.00 0.00 ? 18 VAL A CG1  7  
ATOM 7896  C CG2  . VAL A 1 18 ? -0.251  -6.957  5.462   1.00 0.00 ? 18 VAL A CG2  7  
ATOM 7897  H H    . VAL A 1 18 ? -0.030  -5.506  2.835   1.00 0.00 ? 18 VAL A H    7  
ATOM 7898  H HA   . VAL A 1 18 ? -2.258  -6.661  3.930   1.00 0.00 ? 18 VAL A HA   7  
ATOM 7899  H HB   . VAL A 1 18 ? -0.052  -4.908  4.900   1.00 0.00 ? 18 VAL A HB   7  
ATOM 7900  H HG11 . VAL A 1 18 ? -2.567  -5.524  6.464   1.00 0.00 ? 18 VAL A HG11 7  
ATOM 7901  H HG12 . VAL A 1 18 ? -1.007  -5.199  7.259   1.00 0.00 ? 18 VAL A HG12 7  
ATOM 7902  H HG13 . VAL A 1 18 ? -1.756  -3.957  6.227   1.00 0.00 ? 18 VAL A HG13 7  
ATOM 7903  H HG21 . VAL A 1 18 ? 0.692   -7.064  4.926   1.00 0.00 ? 18 VAL A HG21 7  
ATOM 7904  H HG22 . VAL A 1 18 ? -0.071  -7.036  6.534   1.00 0.00 ? 18 VAL A HG22 7  
ATOM 7905  H HG23 . VAL A 1 18 ? -0.937  -7.745  5.150   1.00 0.00 ? 18 VAL A HG23 7  
ATOM 7906  N N    . LEU A 1 19 ? -2.480  -3.377  3.698   1.00 0.00 ? 19 LEU A N    7  
ATOM 7907  C CA   . LEU A 1 19 ? -3.416  -2.266  3.680   1.00 0.00 ? 19 LEU A CA   7  
ATOM 7908  C C    . LEU A 1 19 ? -4.597  -2.614  2.771   1.00 0.00 ? 19 LEU A C    7  
ATOM 7909  O O    . LEU A 1 19 ? -5.751  -2.526  3.188   1.00 0.00 ? 19 LEU A O    7  
ATOM 7910  C CB   . LEU A 1 19 ? -2.702  -0.970  3.289   1.00 0.00 ? 19 LEU A CB   7  
ATOM 7911  C CG   . LEU A 1 19 ? -1.518  -0.565  4.169   1.00 0.00 ? 19 LEU A CG   7  
ATOM 7912  C CD1  . LEU A 1 19 ? -1.114  0.887   3.910   1.00 0.00 ? 19 LEU A CD1  7  
ATOM 7913  C CD2  . LEU A 1 19 ? -1.823  -0.820  5.648   1.00 0.00 ? 19 LEU A CD2  7  
ATOM 7914  H H    . LEU A 1 19 ? -1.528  -3.132  3.513   1.00 0.00 ? 19 LEU A H    7  
ATOM 7915  H HA   . LEU A 1 19 ? -3.788  -2.135  4.696   1.00 0.00 ? 19 LEU A HA   7  
ATOM 7916  H HB3  . LEU A 1 19 ? -3.430  -0.160  3.298   1.00 0.00 ? 19 LEU A HB3  7  
ATOM 7917  H HG   . LEU A 1 19 ? -0.665  -1.189  3.904   1.00 0.00 ? 19 LEU A HG   7  
ATOM 7918  H HD11 . LEU A 1 19 ? -1.738  1.303   3.119   1.00 0.00 ? 19 LEU A HD11 7  
ATOM 7919  H HD12 . LEU A 1 19 ? -1.247  1.470   4.822   1.00 0.00 ? 19 LEU A HD12 7  
ATOM 7920  H HD13 . LEU A 1 19 ? -0.068  0.925   3.605   1.00 0.00 ? 19 LEU A HD13 7  
ATOM 7921  H HD21 . LEU A 1 19 ? -2.865  -0.580  5.850   1.00 0.00 ? 19 LEU A HD21 7  
ATOM 7922  H HD22 . LEU A 1 19 ? -1.638  -1.869  5.880   1.00 0.00 ? 19 LEU A HD22 7  
ATOM 7923  H HD23 . LEU A 1 19 ? -1.178  -0.193  6.264   1.00 0.00 ? 19 LEU A HD23 7  
ATOM 7924  N N    . TYR A 1 20 ? -4.268  -3.003  1.548   1.00 0.00 ? 20 TYR A N    7  
ATOM 7925  C CA   . TYR A 1 20 ? -5.287  -3.366  0.579   1.00 0.00 ? 20 TYR A CA   7  
ATOM 7926  C C    . TYR A 1 20 ? -6.224  -4.436  1.142   1.00 0.00 ? 20 TYR A C    7  
ATOM 7927  O O    . TYR A 1 20 ? -7.438  -4.244  1.185   1.00 0.00 ? 20 TYR A O    7  
ATOM 7928  C CB   . TYR A 1 20 ? -4.538  -3.942  -0.624  1.00 0.00 ? 20 TYR A CB   7  
ATOM 7929  C CG   . TYR A 1 20 ? -5.435  -4.255  -1.824  1.00 0.00 ? 20 TYR A CG   7  
ATOM 7930  C CD1  . TYR A 1 20 ? -6.370  -3.332  -2.246  1.00 0.00 ? 20 TYR A CD1  7  
ATOM 7931  C CD2  . TYR A 1 20 ? -5.309  -5.461  -2.484  1.00 0.00 ? 20 TYR A CD2  7  
ATOM 7932  C CE1  . TYR A 1 20 ? -7.214  -3.627  -3.375  1.00 0.00 ? 20 TYR A CE1  7  
ATOM 7933  C CE2  . TYR A 1 20 ? -6.152  -5.755  -3.612  1.00 0.00 ? 20 TYR A CE2  7  
ATOM 7934  C CZ   . TYR A 1 20 ? -7.064  -4.824  -4.003  1.00 0.00 ? 20 TYR A CZ   7  
ATOM 7935  O OH   . TYR A 1 20 ? -7.861  -5.101  -5.069  1.00 0.00 ? 20 TYR A OH   7  
ATOM 7936  H H    . TYR A 1 20 ? -3.326  -3.073  1.218   1.00 0.00 ? 20 TYR A H    7  
ATOM 7937  H HA   . TYR A 1 20 ? -5.866  -2.472  0.349   1.00 0.00 ? 20 TYR A HA   7  
ATOM 7938  H HB3  . TYR A 1 20 ? -4.027  -4.855  -0.319  1.00 0.00 ? 20 TYR A HB3  7  
ATOM 7939  H HD1  . TYR A 1 20 ? -6.470  -2.380  -1.725  1.00 0.00 ? 20 TYR A HD1  7  
ATOM 7940  H HD2  . TYR A 1 20 ? -4.570  -6.190  -2.151  1.00 0.00 ? 20 TYR A HD2  7  
ATOM 7941  H HE1  . TYR A 1 20 ? -7.956  -2.907  -3.719  1.00 0.00 ? 20 TYR A HE1  7  
ATOM 7942  H HE2  . TYR A 1 20 ? -6.063  -6.704  -4.143  1.00 0.00 ? 20 TYR A HE2  7  
ATOM 7943  H HH   . TYR A 1 20 ? -7.320  -5.099  -5.910  1.00 0.00 ? 20 TYR A HH   7  
ATOM 7944  N N    . SER A 1 21 ? -5.625  -5.542  1.559   1.00 0.00 ? 21 SER A N    7  
ATOM 7945  C CA   . SER A 1 21 ? -6.390  -6.643  2.118   1.00 0.00 ? 21 SER A CA   7  
ATOM 7946  C C    . SER A 1 21 ? -7.250  -6.146  3.281   1.00 0.00 ? 21 SER A C    7  
ATOM 7947  O O    . SER A 1 21 ? -8.402  -6.551  3.423   1.00 0.00 ? 21 SER A O    7  
ATOM 7948  C CB   . SER A 1 21 ? -5.469  -7.774  2.583   1.00 0.00 ? 21 SER A CB   7  
ATOM 7949  O OG   . SER A 1 21 ? -6.190  -8.814  3.237   1.00 0.00 ? 21 SER A OG   7  
ATOM 7950  H H    . SER A 1 21 ? -4.636  -5.691  1.520   1.00 0.00 ? 21 SER A H    7  
ATOM 7951  H HA   . SER A 1 21 ? -7.018  -7.001  1.302   1.00 0.00 ? 21 SER A HA   7  
ATOM 7952  H HB3  . SER A 1 21 ? -4.716  -7.372  3.261   1.00 0.00 ? 21 SER A HB3  7  
ATOM 7953  H HG   . SER A 1 21 ? -5.755  -9.696  3.059   1.00 0.00 ? 21 SER A HG   7  
ATOM 7954  N N    . GLU A 1 22 ? -6.656  -5.275  4.083   1.00 0.00 ? 22 GLU A N    7  
ATOM 7955  C CA   . GLU A 1 22 ? -7.354  -4.718  5.230   1.00 0.00 ? 22 GLU A CA   7  
ATOM 7956  C C    . GLU A 1 22 ? -8.597  -3.951  4.775   1.00 0.00 ? 22 GLU A C    7  
ATOM 7957  O O    . GLU A 1 22 ? -9.662  -4.078  5.374   1.00 0.00 ? 22 GLU A O    7  
ATOM 7958  C CB   . GLU A 1 22 ? -6.427  -3.821  6.052   1.00 0.00 ? 22 GLU A CB   7  
ATOM 7959  C CG   . GLU A 1 22 ? -5.410  -4.654  6.836   1.00 0.00 ? 22 GLU A CG   7  
ATOM 7960  C CD   . GLU A 1 22 ? -6.078  -5.366  8.014   1.00 0.00 ? 22 GLU A CD   7  
ATOM 7961  O OE1  . GLU A 1 22 ? -7.007  -4.762  8.591   1.00 0.00 ? 22 GLU A OE1  7  
ATOM 7962  O OE2  . GLU A 1 22 ? -5.642  -6.501  8.311   1.00 0.00 ? 22 GLU A OE2  7  
ATOM 7963  H H    . GLU A 1 22 ? -5.719  -4.950  3.960   1.00 0.00 ? 22 GLU A H    7  
ATOM 7964  H HA   . GLU A 1 22 ? -7.648  -5.576  5.834   1.00 0.00 ? 22 GLU A HA   7  
ATOM 7965  H HB3  . GLU A 1 22 ? -7.017  -3.217  6.743   1.00 0.00 ? 22 GLU A HB3  7  
ATOM 7966  H HG3  . GLU A 1 22 ? -4.611  -4.008  7.202   1.00 0.00 ? 22 GLU A HG3  7  
ATOM 7967  N N    . ALA A 1 23 ? -8.418  -3.173  3.717   1.00 0.00 ? 23 ALA A N    7  
ATOM 7968  C CA   . ALA A 1 23 ? -9.512  -2.385  3.174   1.00 0.00 ? 23 ALA A CA   7  
ATOM 7969  C C    . ALA A 1 23 ? -10.499 -3.314  2.465   1.00 0.00 ? 23 ALA A C    7  
ATOM 7970  O O    . ALA A 1 23 ? -11.702 -3.051  2.447   1.00 0.00 ? 23 ALA A O    7  
ATOM 7971  C CB   . ALA A 1 23 ? -8.953  -1.308  2.242   1.00 0.00 ? 23 ALA A CB   7  
ATOM 7972  H H    . ALA A 1 23 ? -7.548  -3.076  3.235   1.00 0.00 ? 23 ALA A H    7  
ATOM 7973  H HA   . ALA A 1 23 ? -10.018 -1.900  4.009   1.00 0.00 ? 23 ALA A HA   7  
ATOM 7974  H HB1  . ALA A 1 23 ? -7.905  -1.128  2.484   1.00 0.00 ? 23 ALA A HB1  7  
ATOM 7975  H HB2  . ALA A 1 23 ? -9.035  -1.644  1.209   1.00 0.00 ? 23 ALA A HB2  7  
ATOM 7976  H HB3  . ALA A 1 23 ? -9.520  -0.386  2.372   1.00 0.00 ? 23 ALA A HB3  7  
ATOM 7977  N N    . LEU A 1 24 ? -9.956  -4.382  1.897   1.00 0.00 ? 24 LEU A N    7  
ATOM 7978  C CA   . LEU A 1 24 ? -10.775 -5.350  1.188   1.00 0.00 ? 24 LEU A CA   7  
ATOM 7979  C C    . LEU A 1 24 ? -11.501 -6.237  2.202   1.00 0.00 ? 24 LEU A C    7  
ATOM 7980  O O    . LEU A 1 24 ? -12.532 -6.830  1.888   1.00 0.00 ? 24 LEU A O    7  
ATOM 7981  C CB   . LEU A 1 24 ? -9.929  -6.133  0.182   1.00 0.00 ? 24 LEU A CB   7  
ATOM 7982  C CG   . LEU A 1 24 ? -9.979  -5.639  -1.265  1.00 0.00 ? 24 LEU A CG   7  
ATOM 7983  C CD1  . LEU A 1 24 ? -8.959  -6.378  -2.132  1.00 0.00 ? 24 LEU A CD1  7  
ATOM 7984  C CD2  . LEU A 1 24 ? -11.397 -5.745  -1.830  1.00 0.00 ? 24 LEU A CD2  7  
ATOM 7985  H H    . LEU A 1 24 ? -8.978  -4.588  1.916   1.00 0.00 ? 24 LEU A H    7  
ATOM 7986  H HA   . LEU A 1 24 ? -11.520 -4.795  0.619   1.00 0.00 ? 24 LEU A HA   7  
ATOM 7987  H HB3  . LEU A 1 24 ? -10.248 -7.175  0.201   1.00 0.00 ? 24 LEU A HB3  7  
ATOM 7988  H HG   . LEU A 1 24 ? -9.707  -4.583  -1.275  1.00 0.00 ? 24 LEU A HG   7  
ATOM 7989  H HD11 . LEU A 1 24 ? -9.041  -7.451  -1.955  1.00 0.00 ? 24 LEU A HD11 7  
ATOM 7990  H HD12 . LEU A 1 24 ? -9.156  -6.168  -3.184  1.00 0.00 ? 24 LEU A HD12 7  
ATOM 7991  H HD13 . LEU A 1 24 ? -7.954  -6.043  -1.878  1.00 0.00 ? 24 LEU A HD13 7  
ATOM 7992  H HD21 . LEU A 1 24 ? -11.371 -5.586  -2.908  1.00 0.00 ? 24 LEU A HD21 7  
ATOM 7993  H HD22 . LEU A 1 24 ? -11.800 -6.735  -1.619  1.00 0.00 ? 24 LEU A HD22 7  
ATOM 7994  H HD23 . LEU A 1 24 ? -12.030 -4.988  -1.367  1.00 0.00 ? 24 LEU A HD23 7  
ATOM 7995  N N    . GLY A 1 25 ? -10.935 -6.299  3.398   1.00 0.00 ? 25 GLY A N    7  
ATOM 7996  C CA   . GLY A 1 25 ? -11.516 -7.103  4.460   1.00 0.00 ? 25 GLY A CA   7  
ATOM 7997  C C    . GLY A 1 25 ? -11.382 -8.596  4.153   1.00 0.00 ? 25 GLY A C    7  
ATOM 7998  O O    . GLY A 1 25 ? -12.229 -9.393  4.552   1.00 0.00 ? 25 GLY A O    7  
ATOM 7999  H H    . GLY A 1 25 ? -10.097 -5.813  3.647   1.00 0.00 ? 25 GLY A H    7  
ATOM 8000  H HA2  . GLY A 1 25 ? -11.021 -6.876  5.405   1.00 0.00 ? 25 GLY A HA2  7  
ATOM 8001  H HA3  . GLY A 1 25 ? -12.568 -6.846  4.582   1.00 0.00 ? 25 GLY A HA3  7  
ATOM 8002  N N    . ARG A 1 26 ? -10.312 -8.928  3.447   1.00 0.00 ? 26 ARG A N    7  
ATOM 8003  C CA   . ARG A 1 26 ? -10.056 -10.311 3.081   1.00 0.00 ? 26 ARG A CA   7  
ATOM 8004  C C    . ARG A 1 26 ? -9.394  -11.054 4.243   1.00 0.00 ? 26 ARG A C    7  
ATOM 8005  O O    . ARG A 1 26 ? -9.030  -10.443 5.247   1.00 0.00 ? 26 ARG A O    7  
ATOM 8006  C CB   . ARG A 1 26 ? -9.153  -10.398 1.849   1.00 0.00 ? 26 ARG A CB   7  
ATOM 8007  C CG   . ARG A 1 26 ? -9.889  -9.920  0.595   1.00 0.00 ? 26 ARG A CG   7  
ATOM 8008  C CD   . ARG A 1 26 ? -10.411 -11.106 -0.219  1.00 0.00 ? 26 ARG A CD   7  
ATOM 8009  N NE   . ARG A 1 26 ? -11.827 -10.883 -0.586  1.00 0.00 ? 26 ARG A NE   7  
ATOM 8010  C CZ   . ARG A 1 26 ? -12.230 -10.039 -1.545  1.00 0.00 ? 26 ARG A CZ   7  
ATOM 8011  N NH1  . ARG A 1 26 ? -11.328 -9.332  -2.239  1.00 0.00 ? 26 ARG A NH1  7  
ATOM 8012  N NH2  . ARG A 1 26 ? -13.537 -9.901  -1.810  1.00 0.00 ? 26 ARG A NH2  7  
ATOM 8013  H H    . ARG A 1 26 ? -9.628  -8.273  3.125   1.00 0.00 ? 26 ARG A H    7  
ATOM 8014  H HA   . ARG A 1 26 ? -11.040 -10.727 2.860   1.00 0.00 ? 26 ARG A HA   7  
ATOM 8015  H HB3  . ARG A 1 26 ? -8.819  -11.426 1.710   1.00 0.00 ? 26 ARG A HB3  7  
ATOM 8016  H HG3  . ARG A 1 26 ? -9.217  -9.320  -0.018  1.00 0.00 ? 26 ARG A HG3  7  
ATOM 8017  H HD3  . ARG A 1 26 ? -10.317 -12.024 0.360   1.00 0.00 ? 26 ARG A HD3  7  
ATOM 8018  H HE   . ARG A 1 26 ? -12.527 -11.395 -0.087  1.00 0.00 ? 26 ARG A HE   7  
ATOM 8019  H HH11 . ARG A 1 26 ? -10.353 -9.435  -2.041  1.00 0.00 ? 26 ARG A HH11 7  
ATOM 8020  H HH12 . ARG A 1 26 ? -11.629 -8.702  -2.955  1.00 0.00 ? 26 ARG A HH12 7  
ATOM 8021  H HH21 . ARG A 1 26 ? -14.211 -10.428 -1.292  1.00 0.00 ? 26 ARG A HH21 7  
ATOM 8022  H HH22 . ARG A 1 26 ? -13.838 -9.271  -2.526  1.00 0.00 ? 26 ARG A HH22 7  
ATOM 8023  N N    . ALA A 1 27 ? -9.258  -12.360 4.069   1.00 0.00 ? 27 ALA A N    7  
ATOM 8024  C CA   . ALA A 1 27 ? -8.646  -13.192 5.091   1.00 0.00 ? 27 ALA A CA   7  
ATOM 8025  C C    . ALA A 1 27 ? -7.148  -13.322 4.808   1.00 0.00 ? 27 ALA A C    7  
ATOM 8026  O O    . ALA A 1 27 ? -6.329  -13.219 5.720   1.00 0.00 ? 27 ALA A O    7  
ATOM 8027  C CB   . ALA A 1 27 ? -9.351  -14.549 5.135   1.00 0.00 ? 27 ALA A CB   7  
ATOM 8028  H H    . ALA A 1 27 ? -9.557  -12.848 3.249   1.00 0.00 ? 27 ALA A H    7  
ATOM 8029  H HA   . ALA A 1 27 ? -8.785  -12.694 6.051   1.00 0.00 ? 27 ALA A HA   7  
ATOM 8030  H HB1  . ALA A 1 27 ? -9.896  -14.645 6.074   1.00 0.00 ? 27 ALA A HB1  7  
ATOM 8031  H HB2  . ALA A 1 27 ? -10.050 -14.622 4.301   1.00 0.00 ? 27 ALA A HB2  7  
ATOM 8032  H HB3  . ALA A 1 27 ? -8.611  -15.346 5.060   1.00 0.00 ? 27 ALA A HB3  7  
ATOM 8033  N N    . SER A 1 28 ? -6.836  -13.547 3.540   1.00 0.00 ? 28 SER A N    7  
ATOM 8034  C CA   . SER A 1 28 ? -5.451  -13.692 3.124   1.00 0.00 ? 28 SER A CA   7  
ATOM 8035  C C    . SER A 1 28 ? -4.919  -12.356 2.601   1.00 0.00 ? 28 SER A C    7  
ATOM 8036  O O    . SER A 1 28 ? -5.695  -11.481 2.218   1.00 0.00 ? 28 SER A O    7  
ATOM 8037  C CB   . SER A 1 28 ? -5.308  -14.776 2.055   1.00 0.00 ? 28 SER A CB   7  
ATOM 8038  O OG   . SER A 1 28 ? -6.028  -15.958 2.393   1.00 0.00 ? 28 SER A OG   7  
ATOM 8039  H H    . SER A 1 28 ? -7.509  -13.629 2.804   1.00 0.00 ? 28 SER A H    7  
ATOM 8040  H HA   . SER A 1 28 ? -4.911  -13.993 4.022   1.00 0.00 ? 28 SER A HA   7  
ATOM 8041  H HB3  . SER A 1 28 ? -4.253  -15.019 1.924   1.00 0.00 ? 28 SER A HB3  7  
ATOM 8042  H HG   . SER A 1 28 ? -6.809  -15.728 2.973   1.00 0.00 ? 28 SER A HG   7  
ATOM 8043  N N    . VAL A 1 29 ? -3.599  -12.240 2.601   1.00 0.00 ? 29 VAL A N    7  
ATOM 8044  C CA   . VAL A 1 29 ? -2.955  -11.026 2.131   1.00 0.00 ? 29 VAL A CA   7  
ATOM 8045  C C    . VAL A 1 29 ? -2.837  -11.074 0.606   1.00 0.00 ? 29 VAL A C    7  
ATOM 8046  O O    . VAL A 1 29 ? -2.005  -11.801 0.067   1.00 0.00 ? 29 VAL A O    7  
ATOM 8047  C CB   . VAL A 1 29 ? -1.605  -10.846 2.830   1.00 0.00 ? 29 VAL A CB   7  
ATOM 8048  C CG1  . VAL A 1 29 ? -0.901  -9.577  2.344   1.00 0.00 ? 29 VAL A CG1  7  
ATOM 8049  C CG2  . VAL A 1 29 ? -1.772  -10.833 4.351   1.00 0.00 ? 29 VAL A CG2  7  
ATOM 8050  H H    . VAL A 1 29 ? -2.975  -12.956 2.914   1.00 0.00 ? 29 VAL A H    7  
ATOM 8051  H HA   . VAL A 1 29 ? -3.592  -10.186 2.408   1.00 0.00 ? 29 VAL A HA   7  
ATOM 8052  H HB   . VAL A 1 29 ? -0.976  -11.698 2.570   1.00 0.00 ? 29 VAL A HB   7  
ATOM 8053  H HG11 . VAL A 1 29 ? -0.302  -9.808  1.464   1.00 0.00 ? 29 VAL A HG11 7  
ATOM 8054  H HG12 . VAL A 1 29 ? -1.646  -8.824  2.088   1.00 0.00 ? 29 VAL A HG12 7  
ATOM 8055  H HG13 . VAL A 1 29 ? -0.255  -9.195  3.135   1.00 0.00 ? 29 VAL A HG13 7  
ATOM 8056  H HG21 . VAL A 1 29 ? -1.104  -11.571 4.795   1.00 0.00 ? 29 VAL A HG21 7  
ATOM 8057  H HG22 . VAL A 1 29 ? -1.527  -9.843  4.734   1.00 0.00 ? 29 VAL A HG22 7  
ATOM 8058  H HG23 . VAL A 1 29 ? -2.804  -11.076 4.605   1.00 0.00 ? 29 VAL A HG23 7  
ATOM 8059  N N    . VAL A 1 30 ? -3.682  -10.289 -0.046  1.00 0.00 ? 30 VAL A N    7  
ATOM 8060  C CA   . VAL A 1 30 ? -3.683  -10.233 -1.497  1.00 0.00 ? 30 VAL A CA   7  
ATOM 8061  C C    . VAL A 1 30 ? -2.705  -9.152  -1.962  1.00 0.00 ? 30 VAL A C    7  
ATOM 8062  O O    . VAL A 1 30 ? -2.419  -8.209  -1.225  1.00 0.00 ? 30 VAL A O    7  
ATOM 8063  C CB   . VAL A 1 30 ? -5.108  -10.010 -2.011  1.00 0.00 ? 30 VAL A CB   7  
ATOM 8064  C CG1  . VAL A 1 30 ? -5.923  -11.303 -1.940  1.00 0.00 ? 30 VAL A CG1  7  
ATOM 8065  C CG2  . VAL A 1 30 ? -5.798  -8.883  -1.241  1.00 0.00 ? 30 VAL A CG2  7  
ATOM 8066  H H    . VAL A 1 30 ? -4.355  -9.700  0.401   1.00 0.00 ? 30 VAL A H    7  
ATOM 8067  H HA   . VAL A 1 30 ? -3.340  -11.199 -1.864  1.00 0.00 ? 30 VAL A HA   7  
ATOM 8068  H HB   . VAL A 1 30 ? -5.043  -9.711  -3.057  1.00 0.00 ? 30 VAL A HB   7  
ATOM 8069  H HG11 . VAL A 1 30 ? -6.930  -11.118 -2.317  1.00 0.00 ? 30 VAL A HG11 7  
ATOM 8070  H HG12 . VAL A 1 30 ? -5.442  -12.069 -2.549  1.00 0.00 ? 30 VAL A HG12 7  
ATOM 8071  H HG13 . VAL A 1 30 ? -5.979  -11.642 -0.907  1.00 0.00 ? 30 VAL A HG13 7  
ATOM 8072  H HG21 . VAL A 1 30 ? -6.281  -9.292  -0.353  1.00 0.00 ? 30 VAL A HG21 7  
ATOM 8073  H HG22 . VAL A 1 30 ? -5.059  -8.140  -0.944  1.00 0.00 ? 30 VAL A HG22 7  
ATOM 8074  H HG23 . VAL A 1 30 ? -6.549  -8.415  -1.879  1.00 0.00 ? 30 VAL A HG23 7  
ATOM 8075  N N    . PRO A 1 31 ? -2.206  -9.329  -3.215  1.00 0.00 ? 31 PRO A N    7  
ATOM 8076  C CA   . PRO A 1 31 ? -1.266  -8.380  -3.786  1.00 0.00 ? 31 PRO A CA   7  
ATOM 8077  C C    . PRO A 1 31 ? -1.975  -7.095  -4.215  1.00 0.00 ? 31 PRO A C    7  
ATOM 8078  O O    . PRO A 1 31 ? -3.199  -7.000  -4.132  1.00 0.00 ? 31 PRO A O    7  
ATOM 8079  C CB   . PRO A 1 31 ? -0.620  -9.118  -4.949  1.00 0.00 ? 31 PRO A CB   7  
ATOM 8080  C CG   . PRO A 1 31 ? -1.549  -10.277 -5.273  1.00 0.00 ? 31 PRO A CG   7  
ATOM 8081  C CD   . PRO A 1 31 ? -2.521  -10.433 -4.116  1.00 0.00 ? 31 PRO A CD   7  
ATOM 8082  H HA   . PRO A 1 31 ? -0.590  -8.105  -3.102  1.00 0.00 ? 31 PRO A HA   7  
ATOM 8083  H HB3  . PRO A 1 31 ? 0.374   -9.477  -4.681  1.00 0.00 ? 31 PRO A HB3  7  
ATOM 8084  H HG3  . PRO A 1 31 ? -0.978  -11.194 -5.418  1.00 0.00 ? 31 PRO A HG3  7  
ATOM 8085  H HD3  . PRO A 1 31 ? -2.398  -11.396 -3.621  1.00 0.00 ? 31 PRO A HD3  7  
ATOM 8086  N N    . LEU A 1 32 ? -1.177  -6.136  -4.661  1.00 0.00 ? 32 LEU A N    7  
ATOM 8087  C CA   . LEU A 1 32 ? -1.713  -4.859  -5.101  1.00 0.00 ? 32 LEU A CA   7  
ATOM 8088  C C    . LEU A 1 32 ? -1.352  -4.640  -6.571  1.00 0.00 ? 32 LEU A C    7  
ATOM 8089  O O    . LEU A 1 32 ? -0.218  -4.283  -6.889  1.00 0.00 ? 32 LEU A O    7  
ATOM 8090  C CB   . LEU A 1 32 ? -1.245  -3.734  -4.178  1.00 0.00 ? 32 LEU A CB   7  
ATOM 8091  C CG   . LEU A 1 32 ? -1.412  -2.311  -4.716  1.00 0.00 ? 32 LEU A CG   7  
ATOM 8092  C CD1  . LEU A 1 32 ? -2.768  -2.140  -5.402  1.00 0.00 ? 32 LEU A CD1  7  
ATOM 8093  C CD2  . LEU A 1 32 ? -1.195  -1.278  -3.608  1.00 0.00 ? 32 LEU A CD2  7  
ATOM 8094  H H    . LEU A 1 32 ? -0.182  -6.221  -4.724  1.00 0.00 ? 32 LEU A H    7  
ATOM 8095  H HA   . LEU A 1 32 ? -2.799  -4.915  -5.017  1.00 0.00 ? 32 LEU A HA   7  
ATOM 8096  H HB3  . LEU A 1 32 ? -0.191  -3.893  -3.948  1.00 0.00 ? 32 LEU A HB3  7  
ATOM 8097  H HG   . LEU A 1 32 ? -0.645  -2.140  -5.471  1.00 0.00 ? 32 LEU A HG   7  
ATOM 8098  H HD11 . LEU A 1 32 ? -2.716  -1.312  -6.108  1.00 0.00 ? 32 LEU A HD11 7  
ATOM 8099  H HD12 . LEU A 1 32 ? -3.024  -3.056  -5.934  1.00 0.00 ? 32 LEU A HD12 7  
ATOM 8100  H HD13 . LEU A 1 32 ? -3.532  -1.931  -4.653  1.00 0.00 ? 32 LEU A HD13 7  
ATOM 8101  H HD21 . LEU A 1 32 ? -1.359  -1.745  -2.637  1.00 0.00 ? 32 LEU A HD21 7  
ATOM 8102  H HD22 . LEU A 1 32 ? -0.175  -0.898  -3.661  1.00 0.00 ? 32 LEU A HD22 7  
ATOM 8103  H HD23 . LEU A 1 32 ? -1.897  -0.453  -3.739  1.00 0.00 ? 32 LEU A HD23 7  
ATOM 8104  N N    . PRO A 1 33 ? -2.363  -4.866  -7.452  1.00 0.00 ? 33 PRO A N    7  
ATOM 8105  C CA   . PRO A 1 33 ? -2.162  -4.696  -8.881  1.00 0.00 ? 33 PRO A CA   7  
ATOM 8106  C C    . PRO A 1 33 ? -2.121  -3.213  -9.256  1.00 0.00 ? 33 PRO A C    7  
ATOM 8107  O O    . PRO A 1 33 ? -3.129  -2.647  -9.675  1.00 0.00 ? 33 PRO A O    7  
ATOM 8108  C CB   . PRO A 1 33 ? -3.316  -5.441  -9.532  1.00 0.00 ? 33 PRO A CB   7  
ATOM 8109  C CG   . PRO A 1 33 ? -4.370  -5.604  -8.448  1.00 0.00 ? 33 PRO A CG   7  
ATOM 8110  C CD   . PRO A 1 33 ? -3.719  -5.288  -7.113  1.00 0.00 ? 33 PRO A CD   7  
ATOM 8111  H HA   . PRO A 1 33 ? -1.277  -5.072  -9.155  1.00 0.00 ? 33 PRO A HA   7  
ATOM 8112  H HB3  . PRO A 1 33 ? -2.992  -6.410  -9.910  1.00 0.00 ? 33 PRO A HB3  7  
ATOM 8113  H HG3  . PRO A 1 33 ? -4.764  -6.621  -8.450  1.00 0.00 ? 33 PRO A HG3  7  
ATOM 8114  H HD3  . PRO A 1 33 ? -3.709  -6.161  -6.460  1.00 0.00 ? 33 PRO A HD3  7  
ATOM 8115  N N    . TYR A 1 34 ? -0.944  -2.626  -9.092  1.00 0.00 ? 34 TYR A N    7  
ATOM 8116  C CA   . TYR A 1 34 ? -0.759  -1.221  -9.408  1.00 0.00 ? 34 TYR A CA   7  
ATOM 8117  C C    . TYR A 1 34 ? -1.112  -0.935  -10.870 1.00 0.00 ? 34 TYR A C    7  
ATOM 8118  O O    . TYR A 1 34 ? -1.894  -0.032  -11.159 1.00 0.00 ? 34 TYR A O    7  
ATOM 8119  C CB   . TYR A 1 34 ? 0.728   -0.932  -9.190  1.00 0.00 ? 34 TYR A CB   7  
ATOM 8120  C CG   . TYR A 1 34 ? 1.212   -1.207  -7.765  1.00 0.00 ? 34 TYR A CG   7  
ATOM 8121  C CD1  . TYR A 1 34 ? 1.015   -0.266  -6.776  1.00 0.00 ? 34 TYR A CD1  7  
ATOM 8122  C CD2  . TYR A 1 34 ? 1.846   -2.397  -7.470  1.00 0.00 ? 34 TYR A CD2  7  
ATOM 8123  C CE1  . TYR A 1 34 ? 1.472   -0.525  -5.434  1.00 0.00 ? 34 TYR A CE1  7  
ATOM 8124  C CE2  . TYR A 1 34 ? 2.303   -2.656  -6.128  1.00 0.00 ? 34 TYR A CE2  7  
ATOM 8125  C CZ   . TYR A 1 34 ? 2.092   -1.707  -5.177  1.00 0.00 ? 34 TYR A CZ   7  
ATOM 8126  O OH   . TYR A 1 34 ? 2.522   -1.953  -3.910  1.00 0.00 ? 34 TYR A OH   7  
ATOM 8127  H H    . TYR A 1 34 ? -0.129  -3.094  -8.751  1.00 0.00 ? 34 TYR A H    7  
ATOM 8128  H HA   . TYR A 1 34 ? -1.419  -0.640  -8.763  1.00 0.00 ? 34 TYR A HA   7  
ATOM 8129  H HB3  . TYR A 1 34 ? 0.925   0.112   -9.434  1.00 0.00 ? 34 TYR A HB3  7  
ATOM 8130  H HD1  . TYR A 1 34 ? 0.515   0.674   -7.008  1.00 0.00 ? 34 TYR A HD1  7  
ATOM 8131  H HD2  . TYR A 1 34 ? 2.002   -3.141  -8.251  1.00 0.00 ? 34 TYR A HD2  7  
ATOM 8132  H HE1  . TYR A 1 34 ? 1.322   0.210   -4.643  1.00 0.00 ? 34 TYR A HE1  7  
ATOM 8133  H HE2  . TYR A 1 34 ? 2.804   -3.592  -5.882  1.00 0.00 ? 34 TYR A HE2  7  
ATOM 8134  H HH   . TYR A 1 34 ? 1.885   -1.555  -3.250  1.00 0.00 ? 34 TYR A HH   7  
ATOM 8135  N N    . GLU A 1 35 ? -0.517  -1.724  -11.753 1.00 0.00 ? 35 GLU A N    7  
ATOM 8136  C CA   . GLU A 1 35 ? -0.758  -1.568  -13.178 1.00 0.00 ? 35 GLU A CA   7  
ATOM 8137  C C    . GLU A 1 35 ? -2.243  -1.305  -13.438 1.00 0.00 ? 35 GLU A C    7  
ATOM 8138  O O    . GLU A 1 35 ? -2.597  -0.621  -14.397 1.00 0.00 ? 35 GLU A O    7  
ATOM 8139  C CB   . GLU A 1 35 ? -0.274  -2.794  -13.954 1.00 0.00 ? 35 GLU A CB   7  
ATOM 8140  C CG   . GLU A 1 35 ? -1.034  -4.050  -13.524 1.00 0.00 ? 35 GLU A CG   7  
ATOM 8141  C CD   . GLU A 1 35 ? -0.517  -5.284  -14.268 1.00 0.00 ? 35 GLU A CD   7  
ATOM 8142  O OE1  . GLU A 1 35 ? 0.694   -5.559  -14.138 1.00 0.00 ? 35 GLU A OE1  7  
ATOM 8143  O OE2  . GLU A 1 35 ? -1.348  -5.924  -14.949 1.00 0.00 ? 35 GLU A OE2  7  
ATOM 8144  H H    . GLU A 1 35 ? 0.119   -2.456  -11.510 1.00 0.00 ? 35 GLU A H    7  
ATOM 8145  H HA   . GLU A 1 35 ? -0.172  -0.700  -13.478 1.00 0.00 ? 35 GLU A HA   7  
ATOM 8146  H HB3  . GLU A 1 35 ? 0.794   -2.936  -13.786 1.00 0.00 ? 35 GLU A HB3  7  
ATOM 8147  H HG3  . GLU A 1 35 ? -2.097  -3.921  -13.721 1.00 0.00 ? 35 GLU A HG3  7  
ATOM 8148  N N    . ARG A 1 36 ? -3.071  -1.864  -12.568 1.00 0.00 ? 36 ARG A N    7  
ATOM 8149  C CA   . ARG A 1 36 ? -4.509  -1.700  -12.693 1.00 0.00 ? 36 ARG A CA   7  
ATOM 8150  C C    . ARG A 1 36 ? -4.978  -0.494  -11.876 1.00 0.00 ? 36 ARG A C    7  
ATOM 8151  O O    . ARG A 1 36 ? -5.407  0.512   -12.438 1.00 0.00 ? 36 ARG A O    7  
ATOM 8152  C CB   . ARG A 1 36 ? -5.251  -2.950  -12.215 1.00 0.00 ? 36 ARG A CB   7  
ATOM 8153  C CG   . ARG A 1 36 ? -5.329  -3.999  -13.325 1.00 0.00 ? 36 ARG A CG   7  
ATOM 8154  C CD   . ARG A 1 36 ? -6.715  -4.646  -13.372 1.00 0.00 ? 36 ARG A CD   7  
ATOM 8155  N NE   . ARG A 1 36 ? -7.017  -5.094  -14.750 1.00 0.00 ? 36 ARG A NE   7  
ATOM 8156  C CZ   . ARG A 1 36 ? -7.284  -4.264  -15.768 1.00 0.00 ? 36 ARG A CZ   7  
ATOM 8157  N NH1  . ARG A 1 36 ? -7.286  -2.939  -15.570 1.00 0.00 ? 36 ARG A NH1  7  
ATOM 8158  N NH2  . ARG A 1 36 ? -7.547  -4.760  -16.985 1.00 0.00 ? 36 ARG A NH2  7  
ATOM 8159  H H    . ARG A 1 36 ? -2.775  -2.419  -11.792 1.00 0.00 ? 36 ARG A H    7  
ATOM 8160  H HA   . ARG A 1 36 ? -4.681  -1.543  -13.757 1.00 0.00 ? 36 ARG A HA   7  
ATOM 8161  H HB3  . ARG A 1 36 ? -6.257  -2.680  -11.892 1.00 0.00 ? 36 ARG A HB3  7  
ATOM 8162  H HG3  . ARG A 1 36 ? -4.572  -4.766  -13.159 1.00 0.00 ? 36 ARG A HG3  7  
ATOM 8163  H HD3  . ARG A 1 36 ? -7.469  -3.933  -13.039 1.00 0.00 ? 36 ARG A HD3  7  
ATOM 8164  H HE   . ARG A 1 36 ? -7.025  -6.077  -14.932 1.00 0.00 ? 36 ARG A HE   7  
ATOM 8165  H HH11 . ARG A 1 36 ? -7.089  -2.569  -14.662 1.00 0.00 ? 36 ARG A HH11 7  
ATOM 8166  H HH12 . ARG A 1 36 ? -7.484  -2.320  -16.329 1.00 0.00 ? 36 ARG A HH12 7  
ATOM 8167  H HH21 . ARG A 1 36 ? -7.545  -5.749  -17.133 1.00 0.00 ? 36 ARG A HH21 7  
ATOM 8168  H HH22 . ARG A 1 36 ? -7.745  -4.141  -17.745 1.00 0.00 ? 36 ARG A HH22 7  
ATOM 8169  N N    . LEU A 1 37 ? -4.881  -0.635  -10.562 1.00 0.00 ? 37 LEU A N    7  
ATOM 8170  C CA   . LEU A 1 37 ? -5.290  0.430   -9.662  1.00 0.00 ? 37 LEU A CA   7  
ATOM 8171  C C    . LEU A 1 37 ? -4.792  1.770   -10.206 1.00 0.00 ? 37 LEU A C    7  
ATOM 8172  O O    . LEU A 1 37 ? -5.487  2.780   -10.112 1.00 0.00 ? 37 LEU A O    7  
ATOM 8173  C CB   . LEU A 1 37 ? -4.825  0.133   -8.235  1.00 0.00 ? 37 LEU A CB   7  
ATOM 8174  C CG   . LEU A 1 37 ? -5.164  -1.256  -7.694  1.00 0.00 ? 37 LEU A CG   7  
ATOM 8175  C CD1  . LEU A 1 37 ? -5.294  -1.234  -6.169  1.00 0.00 ? 37 LEU A CD1  7  
ATOM 8176  C CD2  . LEU A 1 37 ? -6.419  -1.815  -8.367  1.00 0.00 ? 37 LEU A CD2  7  
ATOM 8177  H H    . LEU A 1 37 ? -4.532  -1.458  -10.113 1.00 0.00 ? 37 LEU A H    7  
ATOM 8178  H HA   . LEU A 1 37 ? -6.380  0.446   -9.649  1.00 0.00 ? 37 LEU A HA   7  
ATOM 8179  H HB3  . LEU A 1 37 ? -5.262  0.878   -7.570  1.00 0.00 ? 37 LEU A HB3  7  
ATOM 8180  H HG   . LEU A 1 37 ? -4.342  -1.929  -7.937  1.00 0.00 ? 37 LEU A HG   7  
ATOM 8181  H HD11 . LEU A 1 37 ? -6.286  -0.875  -5.894  1.00 0.00 ? 37 LEU A HD11 7  
ATOM 8182  H HD12 . LEU A 1 37 ? -5.150  -2.241  -5.778  1.00 0.00 ? 37 LEU A HD12 7  
ATOM 8183  H HD13 . LEU A 1 37 ? -4.538  -0.570  -5.750  1.00 0.00 ? 37 LEU A HD13 7  
ATOM 8184  H HD21 . LEU A 1 37 ? -6.153  -2.244  -9.333  1.00 0.00 ? 37 LEU A HD21 7  
ATOM 8185  H HD22 . LEU A 1 37 ? -6.858  -2.587  -7.735  1.00 0.00 ? 37 LEU A HD22 7  
ATOM 8186  H HD23 . LEU A 1 37 ? -7.142  -1.013  -8.514  1.00 0.00 ? 37 LEU A HD23 7  
ATOM 8187  N N    . LEU A 1 38 ? -3.590  1.736   -10.763 1.00 0.00 ? 38 LEU A N    7  
ATOM 8188  C CA   . LEU A 1 38 ? -2.991  2.936   -11.322 1.00 0.00 ? 38 LEU A CA   7  
ATOM 8189  C C    . LEU A 1 38 ? -3.881  3.471   -12.445 1.00 0.00 ? 38 LEU A C    7  
ATOM 8190  O O    . LEU A 1 38 ? -4.171  4.665   -12.497 1.00 0.00 ? 38 LEU A O    7  
ATOM 8191  C CB   . LEU A 1 38 ? -1.550  2.661   -11.758 1.00 0.00 ? 38 LEU A CB   7  
ATOM 8192  C CG   . LEU A 1 38 ? -0.553  2.368   -10.635 1.00 0.00 ? 38 LEU A CG   7  
ATOM 8193  C CD1  . LEU A 1 38 ? 0.750   1.794   -11.195 1.00 0.00 ? 38 LEU A CD1  7  
ATOM 8194  C CD2  . LEU A 1 38 ? -0.310  3.612   -9.778  1.00 0.00 ? 38 LEU A CD2  7  
ATOM 8195  H H    . LEU A 1 38 ? -3.031  0.911   -10.836 1.00 0.00 ? 38 LEU A H    7  
ATOM 8196  H HA   . LEU A 1 38 ? -2.951  3.682   -10.528 1.00 0.00 ? 38 LEU A HA   7  
ATOM 8197  H HB3  . LEU A 1 38 ? -1.190  3.524   -12.320 1.00 0.00 ? 38 LEU A HB3  7  
ATOM 8198  H HG   . LEU A 1 38 ? -0.986  1.608   -9.984  1.00 0.00 ? 38 LEU A HG   7  
ATOM 8199  H HD11 . LEU A 1 38 ? 1.099   2.419   -12.016 1.00 0.00 ? 38 LEU A HD11 7  
ATOM 8200  H HD12 . LEU A 1 38 ? 1.505   1.773   -10.408 1.00 0.00 ? 38 LEU A HD12 7  
ATOM 8201  H HD13 . LEU A 1 38 ? 0.575   0.781   -11.557 1.00 0.00 ? 38 LEU A HD13 7  
ATOM 8202  H HD21 . LEU A 1 38 ? -1.066  3.666   -8.993  1.00 0.00 ? 38 LEU A HD21 7  
ATOM 8203  H HD22 . LEU A 1 38 ? 0.680   3.555   -9.327  1.00 0.00 ? 38 LEU A HD22 7  
ATOM 8204  H HD23 . LEU A 1 38 ? -0.374  4.502   -10.404 1.00 0.00 ? 38 LEU A HD23 7  
ATOM 8205  N N    . ARG A 1 39 ? -4.291  2.561   -13.317 1.00 0.00 ? 39 ARG A N    7  
ATOM 8206  C CA   . ARG A 1 39 ? -5.143  2.926   -14.435 1.00 0.00 ? 39 ARG A CA   7  
ATOM 8207  C C    . ARG A 1 39 ? -6.382  3.674   -13.937 1.00 0.00 ? 39 ARG A C    7  
ATOM 8208  O O    . ARG A 1 39 ? -6.795  4.665   -14.536 1.00 0.00 ? 39 ARG A O    7  
ATOM 8209  C CB   . ARG A 1 39 ? -5.584  1.689   -15.219 1.00 0.00 ? 39 ARG A CB   7  
ATOM 8210  C CG   . ARG A 1 39 ? -6.186  2.080   -16.570 1.00 0.00 ? 39 ARG A CG   7  
ATOM 8211  C CD   . ARG A 1 39 ? -6.286  0.868   -17.498 1.00 0.00 ? 39 ARG A CD   7  
ATOM 8212  N NE   . ARG A 1 39 ? -6.613  1.308   -18.873 1.00 0.00 ? 39 ARG A NE   7  
ATOM 8213  C CZ   . ARG A 1 39 ? -6.954  0.478   -19.867 1.00 0.00 ? 39 ARG A CZ   7  
ATOM 8214  N NH1  . ARG A 1 39 ? -7.012  -0.843  -19.647 1.00 0.00 ? 39 ARG A NH1  7  
ATOM 8215  N NH2  . ARG A 1 39 ? -7.234  0.966   -21.082 1.00 0.00 ? 39 ARG A NH2  7  
ATOM 8216  H H    . ARG A 1 39 ? -4.051  1.591   -13.267 1.00 0.00 ? 39 ARG A H    7  
ATOM 8217  H HA   . ARG A 1 39 ? -4.523  3.568   -15.060 1.00 0.00 ? 39 ARG A HA   7  
ATOM 8218  H HB3  . ARG A 1 39 ? -6.318  1.128   -14.639 1.00 0.00 ? 39 ARG A HB3  7  
ATOM 8219  H HG3  . ARG A 1 39 ? -5.572  2.850   -17.036 1.00 0.00 ? 39 ARG A HG3  7  
ATOM 8220  H HD3  . ARG A 1 39 ? -7.053  0.184   -17.135 1.00 0.00 ? 39 ARG A HD3  7  
ATOM 8221  H HE   . ARG A 1 39 ? -6.579  2.288   -19.072 1.00 0.00 ? 39 ARG A HE   7  
ATOM 8222  H HH11 . ARG A 1 39 ? -6.802  -1.208  -18.739 1.00 0.00 ? 39 ARG A HH11 7  
ATOM 8223  H HH12 . ARG A 1 39 ? -7.265  -1.462  -20.388 1.00 0.00 ? 39 ARG A HH12 7  
ATOM 8224  H HH21 . ARG A 1 39 ? -7.190  1.952   -21.247 1.00 0.00 ? 39 ARG A HH21 7  
ATOM 8225  H HH22 . ARG A 1 39 ? -7.487  0.347   -21.825 1.00 0.00 ? 39 ARG A HH22 7  
ATOM 8226  N N    . GLU A 1 40 ? -6.938  3.170   -12.845 1.00 0.00 ? 40 GLU A N    7  
ATOM 8227  C CA   . GLU A 1 40 ? -8.121  3.778   -12.260 1.00 0.00 ? 40 GLU A CA   7  
ATOM 8228  C C    . GLU A 1 40 ? -7.854  4.166   -10.804 1.00 0.00 ? 40 GLU A C    7  
ATOM 8229  O O    . GLU A 1 40 ? -7.834  3.307   -9.923  1.00 0.00 ? 40 GLU A O    7  
ATOM 8230  C CB   . GLU A 1 40 ? -9.327  2.843   -12.366 1.00 0.00 ? 40 GLU A CB   7  
ATOM 8231  C CG   . GLU A 1 40 ? -8.884  1.380   -12.425 1.00 0.00 ? 40 GLU A CG   7  
ATOM 8232  C CD   . GLU A 1 40 ? -10.079 0.453   -12.660 1.00 0.00 ? 40 GLU A CD   7  
ATOM 8233  O OE1  . GLU A 1 40 ? -11.095 0.649   -11.958 1.00 0.00 ? 40 GLU A OE1  7  
ATOM 8234  O OE2  . GLU A 1 40 ? -9.949  -0.430  -13.534 1.00 0.00 ? 40 GLU A OE2  7  
ATOM 8235  H H    . GLU A 1 40 ? -6.596  2.364   -12.364 1.00 0.00 ? 40 GLU A H    7  
ATOM 8236  H HA   . GLU A 1 40 ? -8.311  4.673   -12.853 1.00 0.00 ? 40 GLU A HA   7  
ATOM 8237  H HB3  . GLU A 1 40 ? -9.905  3.087   -13.257 1.00 0.00 ? 40 GLU A HB3  7  
ATOM 8238  H HG3  . GLU A 1 40 ? -8.386  1.109   -11.494 1.00 0.00 ? 40 GLU A HG3  7  
ATOM 8239  N N    . PRO A 1 41 ? -7.649  5.493   -10.591 1.00 0.00 ? 41 PRO A N    7  
ATOM 8240  C CA   . PRO A 1 41 ? -7.383  6.004   -9.257  1.00 0.00 ? 41 PRO A CA   7  
ATOM 8241  C C    . PRO A 1 41 ? -8.661  6.032   -8.416  1.00 0.00 ? 41 PRO A C    7  
ATOM 8242  O O    . PRO A 1 41 ? -8.599  6.034   -7.187  1.00 0.00 ? 41 PRO A O    7  
ATOM 8243  C CB   . PRO A 1 41 ? -6.788  7.386   -9.478  1.00 0.00 ? 41 PRO A CB   7  
ATOM 8244  C CG   . PRO A 1 41 ? -7.169  7.783   -10.894 1.00 0.00 ? 41 PRO A CG   7  
ATOM 8245  C CD   . PRO A 1 41 ? -7.664  6.538   -11.610 1.00 0.00 ? 41 PRO A CD   7  
ATOM 8246  H HA   . PRO A 1 41 ? -6.750  5.400   -8.774  1.00 0.00 ? 41 PRO A HA   7  
ATOM 8247  H HB3  . PRO A 1 41 ? -5.705  7.368   -9.355  1.00 0.00 ? 41 PRO A HB3  7  
ATOM 8248  H HG3  . PRO A 1 41 ? -6.312  8.209   -11.415 1.00 0.00 ? 41 PRO A HG3  7  
ATOM 8249  H HD3  . PRO A 1 41 ? -7.019  6.281   -12.450 1.00 0.00 ? 41 PRO A HD3  7  
ATOM 8250  N N    . GLY A 1 42 ? -9.789  6.051   -9.111  1.00 0.00 ? 42 GLY A N    7  
ATOM 8251  C CA   . GLY A 1 42 ? -11.079 6.078   -8.443  1.00 0.00 ? 42 GLY A CA   7  
ATOM 8252  C C    . GLY A 1 42 ? -11.415 4.710   -7.845  1.00 0.00 ? 42 GLY A C    7  
ATOM 8253  O O    . GLY A 1 42 ? -12.168 4.620   -6.877  1.00 0.00 ? 42 GLY A O    7  
ATOM 8254  H H    . GLY A 1 42 ? -9.830  6.049   -10.111 1.00 0.00 ? 42 GLY A H    7  
ATOM 8255  H HA2  . GLY A 1 42 ? -11.069 6.832   -7.655  1.00 0.00 ? 42 GLY A HA2  7  
ATOM 8256  H HA3  . GLY A 1 42 ? -11.853 6.369   -9.153  1.00 0.00 ? 42 GLY A HA3  7  
ATOM 8257  N N    . LEU A 1 43 ? -10.840 3.679   -8.447  1.00 0.00 ? 43 LEU A N    7  
ATOM 8258  C CA   . LEU A 1 43 ? -11.069 2.321   -7.986  1.00 0.00 ? 43 LEU A CA   7  
ATOM 8259  C C    . LEU A 1 43 ? -10.490 2.159   -6.580  1.00 0.00 ? 43 LEU A C    7  
ATOM 8260  O O    . LEU A 1 43 ? -11.112 1.545   -5.714  1.00 0.00 ? 43 LEU A O    7  
ATOM 8261  C CB   . LEU A 1 43 ? -10.520 1.312   -8.997  1.00 0.00 ? 43 LEU A CB   7  
ATOM 8262  C CG   . LEU A 1 43 ? -11.056 -0.116  -8.878  1.00 0.00 ? 43 LEU A CG   7  
ATOM 8263  C CD1  . LEU A 1 43 ? -12.515 -0.193  -9.336  1.00 0.00 ? 43 LEU A CD1  7  
ATOM 8264  C CD2  . LEU A 1 43 ? -10.165 -1.101  -9.637  1.00 0.00 ? 43 LEU A CD2  7  
ATOM 8265  H H    . LEU A 1 43 ? -10.229 3.761   -9.234  1.00 0.00 ? 43 LEU A H    7  
ATOM 8266  H HA   . LEU A 1 43 ? -12.148 2.170   -7.935  1.00 0.00 ? 43 LEU A HA   7  
ATOM 8267  H HB3  . LEU A 1 43 ? -9.435  1.281   -8.896  1.00 0.00 ? 43 LEU A HB3  7  
ATOM 8268  H HG   . LEU A 1 43 ? -11.033 -0.404  -7.827  1.00 0.00 ? 43 LEU A HG   7  
ATOM 8269  H HD11 . LEU A 1 43 ? -13.142 0.367   -8.643  1.00 0.00 ? 43 LEU A HD11 7  
ATOM 8270  H HD12 . LEU A 1 43 ? -12.605 0.233   -10.335 1.00 0.00 ? 43 LEU A HD12 7  
ATOM 8271  H HD13 . LEU A 1 43 ? -12.835 -1.235  -9.355  1.00 0.00 ? 43 LEU A HD13 7  
ATOM 8272  H HD21 . LEU A 1 43 ? -10.785 -1.745  -10.261 1.00 0.00 ? 43 LEU A HD21 7  
ATOM 8273  H HD22 . LEU A 1 43 ? -9.466  -0.549  -10.266 1.00 0.00 ? 43 LEU A HD22 7  
ATOM 8274  H HD23 . LEU A 1 43 ? -9.610  -1.711  -8.926  1.00 0.00 ? 43 LEU A HD23 7  
ATOM 8275  N N    . LEU A 1 44 ? -9.305  2.722   -6.393  1.00 0.00 ? 44 LEU A N    7  
ATOM 8276  C CA   . LEU A 1 44 ? -8.635  2.648   -5.107  1.00 0.00 ? 44 LEU A CA   7  
ATOM 8277  C C    . LEU A 1 44 ? -7.676  3.833   -4.968  1.00 0.00 ? 44 LEU A C    7  
ATOM 8278  O O    . LEU A 1 44 ? -6.656  3.894   -5.652  1.00 0.00 ? 44 LEU A O    7  
ATOM 8279  C CB   . LEU A 1 44 ? -7.959  1.287   -4.932  1.00 0.00 ? 44 LEU A CB   7  
ATOM 8280  C CG   . LEU A 1 44 ? -6.984  1.168   -3.759  1.00 0.00 ? 44 LEU A CG   7  
ATOM 8281  C CD1  . LEU A 1 44 ? -7.585  1.761   -2.483  1.00 0.00 ? 44 LEU A CD1  7  
ATOM 8282  C CD2  . LEU A 1 44 ? -6.537  -0.282  -3.562  1.00 0.00 ? 44 LEU A CD2  7  
ATOM 8283  H H    . LEU A 1 44 ? -8.805  3.220   -7.102  1.00 0.00 ? 44 LEU A H    7  
ATOM 8284  H HA   . LEU A 1 44 ? -9.399  2.731   -4.335  1.00 0.00 ? 44 LEU A HA   7  
ATOM 8285  H HB3  . LEU A 1 44 ? -7.424  1.048   -5.850  1.00 0.00 ? 44 LEU A HB3  7  
ATOM 8286  H HG   . LEU A 1 44 ? -6.092  1.750   -3.996  1.00 0.00 ? 44 LEU A HG   7  
ATOM 8287  H HD11 . LEU A 1 44 ? -7.524  2.849   -2.524  1.00 0.00 ? 44 LEU A HD11 7  
ATOM 8288  H HD12 . LEU A 1 44 ? -8.628  1.458   -2.399  1.00 0.00 ? 44 LEU A HD12 7  
ATOM 8289  H HD13 . LEU A 1 44 ? -7.030  1.398   -1.618  1.00 0.00 ? 44 LEU A HD13 7  
ATOM 8290  H HD21 . LEU A 1 44 ? -7.202  -0.946  -4.115  1.00 0.00 ? 44 LEU A HD21 7  
ATOM 8291  H HD22 . LEU A 1 44 ? -5.517  -0.401  -3.930  1.00 0.00 ? 44 LEU A HD22 7  
ATOM 8292  H HD23 . LEU A 1 44 ? -6.573  -0.533  -2.502  1.00 0.00 ? 44 LEU A HD23 7  
ATOM 8293  N N    . ALA A 1 45 ? -8.037  4.744   -4.075  1.00 0.00 ? 45 ALA A N    7  
ATOM 8294  C CA   . ALA A 1 45 ? -7.222  5.923   -3.837  1.00 0.00 ? 45 ALA A CA   7  
ATOM 8295  C C    . ALA A 1 45 ? -6.352  5.695   -2.600  1.00 0.00 ? 45 ALA A C    7  
ATOM 8296  O O    . ALA A 1 45 ? -6.853  5.298   -1.549  1.00 0.00 ? 45 ALA A O    7  
ATOM 8297  C CB   . ALA A 1 45 ? -8.126  7.149   -3.696  1.00 0.00 ? 45 ALA A CB   7  
ATOM 8298  H H    . ALA A 1 45 ? -8.868  4.685   -3.522  1.00 0.00 ? 45 ALA A H    7  
ATOM 8299  H HA   . ALA A 1 45 ? -6.576  6.061   -4.705  1.00 0.00 ? 45 ALA A HA   7  
ATOM 8300  H HB1  . ALA A 1 45 ? -7.515  8.031   -3.504  1.00 0.00 ? 45 ALA A HB1  7  
ATOM 8301  H HB2  . ALA A 1 45 ? -8.691  7.292   -4.617  1.00 0.00 ? 45 ALA A HB2  7  
ATOM 8302  H HB3  . ALA A 1 45 ? -8.816  6.998   -2.867  1.00 0.00 ? 45 ALA A HB3  7  
ATOM 8303  N N    . VAL A 1 46 ? -5.063  5.954   -2.766  1.00 0.00 ? 46 VAL A N    7  
ATOM 8304  C CA   . VAL A 1 46 ? -4.119  5.782   -1.675  1.00 0.00 ? 46 VAL A CA   7  
ATOM 8305  C C    . VAL A 1 46 ? -4.057  7.070   -0.852  1.00 0.00 ? 46 VAL A C    7  
ATOM 8306  O O    . VAL A 1 46 ? -3.804  8.145   -1.392  1.00 0.00 ? 46 VAL A O    7  
ATOM 8307  C CB   . VAL A 1 46 ? -2.755  5.358   -2.225  1.00 0.00 ? 46 VAL A CB   7  
ATOM 8308  C CG1  . VAL A 1 46 ? -1.712  5.285   -1.108  1.00 0.00 ? 46 VAL A CG1  7  
ATOM 8309  C CG2  . VAL A 1 46 ? -2.855  4.026   -2.972  1.00 0.00 ? 46 VAL A CG2  7  
ATOM 8310  H H    . VAL A 1 46 ? -4.663  6.276   -3.624  1.00 0.00 ? 46 VAL A H    7  
ATOM 8311  H HA   . VAL A 1 46 ? -4.491  4.977   -1.041  1.00 0.00 ? 46 VAL A HA   7  
ATOM 8312  H HB   . VAL A 1 46 ? -2.431  6.117   -2.938  1.00 0.00 ? 46 VAL A HB   7  
ATOM 8313  H HG11 . VAL A 1 46 ? -1.938  4.442   -0.455  1.00 0.00 ? 46 VAL A HG11 7  
ATOM 8314  H HG12 . VAL A 1 46 ? -0.722  5.151   -1.545  1.00 0.00 ? 46 VAL A HG12 7  
ATOM 8315  H HG13 . VAL A 1 46 ? -1.732  6.209   -0.531  1.00 0.00 ? 46 VAL A HG13 7  
ATOM 8316  H HG21 . VAL A 1 46 ? -2.176  3.304   -2.518  1.00 0.00 ? 46 VAL A HG21 7  
ATOM 8317  H HG22 . VAL A 1 46 ? -3.877  3.652   -2.912  1.00 0.00 ? 46 VAL A HG22 7  
ATOM 8318  H HG23 . VAL A 1 46 ? -2.582  4.174   -4.016  1.00 0.00 ? 46 VAL A HG23 7  
ATOM 8319  N N    . GLN A 1 47 ? -4.292  6.918   0.444   1.00 0.00 ? 47 GLN A N    7  
ATOM 8320  C CA   . GLN A 1 47 ? -4.266  8.055   1.347   1.00 0.00 ? 47 GLN A CA   7  
ATOM 8321  C C    . GLN A 1 47 ? -3.236  7.831   2.455   1.00 0.00 ? 47 GLN A C    7  
ATOM 8322  O O    . GLN A 1 47 ? -2.743  6.717   2.633   1.00 0.00 ? 47 GLN A O    7  
ATOM 8323  C CB   . GLN A 1 47 ? -5.654  8.321   1.935   1.00 0.00 ? 47 GLN A CB   7  
ATOM 8324  C CG   . GLN A 1 47 ? -6.608  8.861   0.868   1.00 0.00 ? 47 GLN A CG   7  
ATOM 8325  C CD   . GLN A 1 47 ? -6.576  10.391  0.829   1.00 0.00 ? 47 GLN A CD   7  
ATOM 8326  O OE1  . GLN A 1 47 ? -6.707  11.065  1.837   1.00 0.00 ? 47 GLN A OE1  7  
ATOM 8327  N NE2  . GLN A 1 47 ? -6.395  10.898  -0.387  1.00 0.00 ? 47 GLN A NE2  7  
ATOM 8328  H H    . GLN A 1 47 ? -4.497  6.040   0.876   1.00 0.00 ? 47 GLN A H    7  
ATOM 8329  H HA   . GLN A 1 47 ? -3.970  8.906   0.733   1.00 0.00 ? 47 GLN A HA   7  
ATOM 8330  H HB3  . GLN A 1 47 ? -5.576  9.035   2.754   1.00 0.00 ? 47 GLN A HB3  7  
ATOM 8331  H HG3  . GLN A 1 47 ? -7.622  8.520   1.074   1.00 0.00 ? 47 GLN A HG3  7  
ATOM 8332  H HE21 . GLN A 1 47 ? -6.294  10.287  -1.173  1.00 0.00 ? 47 GLN A HE21 7  
ATOM 8333  H HE22 . GLN A 1 47 ? -6.360  11.889  -0.515  1.00 0.00 ? 47 GLN A HE22 7  
ATOM 8334  N N    . GLY A 1 48 ? -2.940  8.904   3.172   1.00 0.00 ? 48 GLY A N    7  
ATOM 8335  C CA   . GLY A 1 48 ? -1.977  8.838   4.258   1.00 0.00 ? 48 GLY A CA   7  
ATOM 8336  C C    . GLY A 1 48 ? -0.565  8.593   3.723   1.00 0.00 ? 48 GLY A C    7  
ATOM 8337  O O    . GLY A 1 48 ? 0.264   7.986   4.401   1.00 0.00 ? 48 GLY A O    7  
ATOM 8338  H H    . GLY A 1 48 ? -3.345  9.806   3.021   1.00 0.00 ? 48 GLY A H    7  
ATOM 8339  H HA2  . GLY A 1 48 ? -1.998  9.769   4.825   1.00 0.00 ? 48 GLY A HA2  7  
ATOM 8340  H HA3  . GLY A 1 48 ? -2.253  8.039   4.946   1.00 0.00 ? 48 GLY A HA3  7  
ATOM 8341  N N    . LEU A 1 49 ? -0.332  9.079   2.512   1.00 0.00 ? 49 LEU A N    7  
ATOM 8342  C CA   . LEU A 1 49 ? 0.966   8.920   1.879   1.00 0.00 ? 49 LEU A CA   7  
ATOM 8343  C C    . LEU A 1 49 ? 2.026   9.652   2.706   1.00 0.00 ? 49 LEU A C    7  
ATOM 8344  O O    . LEU A 1 49 ? 1.692   10.444  3.586   1.00 0.00 ? 49 LEU A O    7  
ATOM 8345  C CB   . LEU A 1 49 ? 0.909   9.370   0.418   1.00 0.00 ? 49 LEU A CB   7  
ATOM 8346  C CG   . LEU A 1 49 ? 0.550   8.289   -0.603  1.00 0.00 ? 49 LEU A CG   7  
ATOM 8347  C CD1  . LEU A 1 49 ? -0.042  8.907   -1.871  1.00 0.00 ? 49 LEU A CD1  7  
ATOM 8348  C CD2  . LEU A 1 49 ? 1.757   7.401   -0.908  1.00 0.00 ? 49 LEU A CD2  7  
ATOM 8349  H H    . LEU A 1 49 ? -1.010  9.572   1.968   1.00 0.00 ? 49 LEU A H    7  
ATOM 8350  H HA   . LEU A 1 49 ? 1.202   7.856   1.879   1.00 0.00 ? 49 LEU A HA   7  
ATOM 8351  H HB3  . LEU A 1 49 ? 1.878   9.788   0.149   1.00 0.00 ? 49 LEU A HB3  7  
ATOM 8352  H HG   . LEU A 1 49 ? -0.219  7.650   -0.168  1.00 0.00 ? 49 LEU A HG   7  
ATOM 8353  H HD11 . LEU A 1 49 ? 0.693   9.568   -2.331  1.00 0.00 ? 49 LEU A HD11 7  
ATOM 8354  H HD12 . LEU A 1 49 ? -0.307  8.116   -2.572  1.00 0.00 ? 49 LEU A HD12 7  
ATOM 8355  H HD13 . LEU A 1 49 ? -0.935  9.479   -1.615  1.00 0.00 ? 49 LEU A HD13 7  
ATOM 8356  H HD21 . LEU A 1 49 ? 1.499   6.695   -1.697  1.00 0.00 ? 49 LEU A HD21 7  
ATOM 8357  H HD22 . LEU A 1 49 ? 2.592   8.022   -1.235  1.00 0.00 ? 49 LEU A HD22 7  
ATOM 8358  H HD23 . LEU A 1 49 ? 2.042   6.853   -0.010  1.00 0.00 ? 49 LEU A HD23 7  
ATOM 8359  N N    . PRO A 1 50 ? 3.313   9.351   2.387   1.00 0.00 ? 50 PRO A N    7  
ATOM 8360  C CA   . PRO A 1 50 ? 4.423   9.971   3.091   1.00 0.00 ? 50 PRO A CA   7  
ATOM 8361  C C    . PRO A 1 50 ? 4.614   11.422  2.644   1.00 0.00 ? 50 PRO A C    7  
ATOM 8362  O O    . PRO A 1 50 ? 5.586   12.071  3.027   1.00 0.00 ? 50 PRO A O    7  
ATOM 8363  C CB   . PRO A 1 50 ? 5.624   9.092   2.783   1.00 0.00 ? 50 PRO A CB   7  
ATOM 8364  C CG   . PRO A 1 50 ? 5.246   8.285   1.553   1.00 0.00 ? 50 PRO A CG   7  
ATOM 8365  C CD   . PRO A 1 50 ? 3.745   8.417   1.351   1.00 0.00 ? 50 PRO A CD   7  
ATOM 8366  H HA   . PRO A 1 50 ? 4.233   10.010  4.071   1.00 0.00 ? 50 PRO A HA   7  
ATOM 8367  H HB3  . PRO A 1 50 ? 5.854   8.437   3.624   1.00 0.00 ? 50 PRO A HB3  7  
ATOM 8368  H HG3  . PRO A 1 50 ? 5.522   7.238   1.681   1.00 0.00 ? 50 PRO A HG3  7  
ATOM 8369  H HD3  . PRO A 1 50 ? 3.245   7.455   1.453   1.00 0.00 ? 50 PRO A HD3  7  
ATOM 8370  N N    . GLU A 1 51 ? 3.670   11.888  1.839   1.00 0.00 ? 51 GLU A N    7  
ATOM 8371  C CA   . GLU A 1 51 ? 3.722   13.250  1.336   1.00 0.00 ? 51 GLU A CA   7  
ATOM 8372  C C    . GLU A 1 51 ? 4.985   13.458  0.496   1.00 0.00 ? 51 GLU A C    7  
ATOM 8373  O O    . GLU A 1 51 ? 6.032   12.883  0.790   1.00 0.00 ? 51 GLU A O    7  
ATOM 8374  C CB   . GLU A 1 51 ? 3.653   14.262  2.482   1.00 0.00 ? 51 GLU A CB   7  
ATOM 8375  C CG   . GLU A 1 51 ? 2.207   14.483  2.931   1.00 0.00 ? 51 GLU A CG   7  
ATOM 8376  C CD   . GLU A 1 51 ? 1.489   15.466  2.005   1.00 0.00 ? 51 GLU A CD   7  
ATOM 8377  O OE1  . GLU A 1 51 ? 1.925   16.637  1.973   1.00 0.00 ? 51 GLU A OE1  7  
ATOM 8378  O OE2  . GLU A 1 51 ? 0.522   15.024  1.348   1.00 0.00 ? 51 GLU A OE2  7  
ATOM 8379  H H    . GLU A 1 51 ? 2.883   11.355  1.532   1.00 0.00 ? 51 GLU A H    7  
ATOM 8380  H HA   . GLU A 1 51 ? 2.838   13.361  0.708   1.00 0.00 ? 51 GLU A HA   7  
ATOM 8381  H HB3  . GLU A 1 51 ? 4.087   15.209  2.163   1.00 0.00 ? 51 GLU A HB3  7  
ATOM 8382  H HG3  . GLU A 1 51 ? 2.194   14.865  3.952   1.00 0.00 ? 51 GLU A HG3  7  
ATOM 8383  N N    . GLY A 1 52 ? 4.845   14.282  -0.531  1.00 0.00 ? 52 GLY A N    7  
ATOM 8384  C CA   . GLY A 1 52 ? 5.960   14.573  -1.416  1.00 0.00 ? 52 GLY A CA   7  
ATOM 8385  C C    . GLY A 1 52 ? 6.343   13.342  -2.240  1.00 0.00 ? 52 GLY A C    7  
ATOM 8386  O O    . GLY A 1 52 ? 7.509   13.160  -2.585  1.00 0.00 ? 52 GLY A O    7  
ATOM 8387  H H    . GLY A 1 52 ? 3.989   14.747  -0.763  1.00 0.00 ? 52 GLY A H    7  
ATOM 8388  H HA2  . GLY A 1 52 ? 5.696   15.393  -2.083  1.00 0.00 ? 52 GLY A HA2  7  
ATOM 8389  H HA3  . GLY A 1 52 ? 6.817   14.903  -0.828  1.00 0.00 ? 52 GLY A HA3  7  
ATOM 8390  N N    . LEU A 1 53 ? 5.338   12.528  -2.529  1.00 0.00 ? 53 LEU A N    7  
ATOM 8391  C CA   . LEU A 1 53 ? 5.555   11.319  -3.305  1.00 0.00 ? 53 LEU A CA   7  
ATOM 8392  C C    . LEU A 1 53 ? 4.375   11.112  -4.258  1.00 0.00 ? 53 LEU A C    7  
ATOM 8393  O O    . LEU A 1 53 ? 3.534   11.996  -4.411  1.00 0.00 ? 53 LEU A O    7  
ATOM 8394  C CB   . LEU A 1 53 ? 5.815   10.128  -2.382  1.00 0.00 ? 53 LEU A CB   7  
ATOM 8395  C CG   . LEU A 1 53 ? 7.284   9.818   -2.085  1.00 0.00 ? 53 LEU A CG   7  
ATOM 8396  C CD1  . LEU A 1 53 ? 7.410   8.671   -1.080  1.00 0.00 ? 53 LEU A CD1  7  
ATOM 8397  C CD2  . LEU A 1 53 ? 8.056   9.538   -3.375  1.00 0.00 ? 53 LEU A CD2  7  
ATOM 8398  H H    . LEU A 1 53 ? 4.392   12.684  -2.243  1.00 0.00 ? 53 LEU A H    7  
ATOM 8399  H HA   . LEU A 1 53 ? 6.456   11.470  -3.899  1.00 0.00 ? 53 LEU A HA   7  
ATOM 8400  H HB3  . LEU A 1 53 ? 5.360   9.243   -2.825  1.00 0.00 ? 53 LEU A HB3  7  
ATOM 8401  H HG   . LEU A 1 53 ? 7.734   10.699  -1.626  1.00 0.00 ? 53 LEU A HG   7  
ATOM 8402  H HD11 . LEU A 1 53 ? 6.494   8.080   -1.087  1.00 0.00 ? 53 LEU A HD11 7  
ATOM 8403  H HD12 . LEU A 1 53 ? 8.253   8.038   -1.356  1.00 0.00 ? 53 LEU A HD12 7  
ATOM 8404  H HD13 . LEU A 1 53 ? 7.573   9.078   -0.082  1.00 0.00 ? 53 LEU A HD13 7  
ATOM 8405  H HD21 . LEU A 1 53 ? 8.177   10.464  -3.936  1.00 0.00 ? 53 LEU A HD21 7  
ATOM 8406  H HD22 . LEU A 1 53 ? 9.039   9.132   -3.130  1.00 0.00 ? 53 LEU A HD22 7  
ATOM 8407  H HD23 . LEU A 1 53 ? 7.506   8.816   -3.979  1.00 0.00 ? 53 LEU A HD23 7  
ATOM 8408  N N    . ALA A 1 54 ? 4.353   9.939   -4.875  1.00 0.00 ? 54 ALA A N    7  
ATOM 8409  C CA   . ALA A 1 54 ? 3.291   9.605   -5.808  1.00 0.00 ? 54 ALA A CA   7  
ATOM 8410  C C    . ALA A 1 54 ? 2.985   8.109   -5.712  1.00 0.00 ? 54 ALA A C    7  
ATOM 8411  O O    . ALA A 1 54 ? 3.899   7.286   -5.679  1.00 0.00 ? 54 ALA A O    7  
ATOM 8412  C CB   . ALA A 1 54 ? 3.700   10.027  -7.219  1.00 0.00 ? 54 ALA A CB   7  
ATOM 8413  H H    . ALA A 1 54 ? 5.041   9.226   -4.744  1.00 0.00 ? 54 ALA A H    7  
ATOM 8414  H HA   . ALA A 1 54 ? 2.403   10.167  -5.516  1.00 0.00 ? 54 ALA A HA   7  
ATOM 8415  H HB1  . ALA A 1 54 ? 2.819   10.055  -7.861  1.00 0.00 ? 54 ALA A HB1  7  
ATOM 8416  H HB2  . ALA A 1 54 ? 4.155   11.017  -7.185  1.00 0.00 ? 54 ALA A HB2  7  
ATOM 8417  H HB3  . ALA A 1 54 ? 4.417   9.311   -7.620  1.00 0.00 ? 54 ALA A HB3  7  
ATOM 8418  N N    . PHE A 1 55 ? 1.697   7.801   -5.670  1.00 0.00 ? 55 PHE A N    7  
ATOM 8419  C CA   . PHE A 1 55 ? 1.260   6.418   -5.578  1.00 0.00 ? 55 PHE A CA   7  
ATOM 8420  C C    . PHE A 1 55 ? 1.787   5.598   -6.757  1.00 0.00 ? 55 PHE A C    7  
ATOM 8421  O O    . PHE A 1 55 ? 1.360   5.795   -7.895  1.00 0.00 ? 55 PHE A O    7  
ATOM 8422  C CB   . PHE A 1 55 ? -0.269  6.429   -5.621  1.00 0.00 ? 55 PHE A CB   7  
ATOM 8423  C CG   . PHE A 1 55 ? -0.895  5.049   -5.831  1.00 0.00 ? 55 PHE A CG   7  
ATOM 8424  C CD1  . PHE A 1 55 ? -0.494  3.996   -5.068  1.00 0.00 ? 55 PHE A CD1  7  
ATOM 8425  C CD2  . PHE A 1 55 ? -1.852  4.874   -6.781  1.00 0.00 ? 55 PHE A CD2  7  
ATOM 8426  C CE1  . PHE A 1 55 ? -1.075  2.716   -5.264  1.00 0.00 ? 55 PHE A CE1  7  
ATOM 8427  C CE2  . PHE A 1 55 ? -2.433  3.592   -6.976  1.00 0.00 ? 55 PHE A CE2  7  
ATOM 8428  C CZ   . PHE A 1 55 ? -2.032  2.541   -6.213  1.00 0.00 ? 55 PHE A CZ   7  
ATOM 8429  H H    . PHE A 1 55 ? 0.960   8.476   -5.697  1.00 0.00 ? 55 PHE A H    7  
ATOM 8430  H HA   . PHE A 1 55 ? 1.661   6.013   -4.649  1.00 0.00 ? 55 PHE A HA   7  
ATOM 8431  H HB3  . PHE A 1 55 ? -0.595  7.091   -6.424  1.00 0.00 ? 55 PHE A HB3  7  
ATOM 8432  H HD1  . PHE A 1 55 ? 0.274   4.137   -4.308  1.00 0.00 ? 55 PHE A HD1  7  
ATOM 8433  H HD2  . PHE A 1 55 ? -2.174  5.716   -7.392  1.00 0.00 ? 55 PHE A HD2  7  
ATOM 8434  H HE1  . PHE A 1 55 ? -0.752  1.872   -4.652  1.00 0.00 ? 55 PHE A HE1  7  
ATOM 8435  H HE2  . PHE A 1 55 ? -3.201  3.452   -7.737  1.00 0.00 ? 55 PHE A HE2  7  
ATOM 8436  H HZ   . PHE A 1 55 ? -2.477  1.557   -6.363  1.00 0.00 ? 55 PHE A HZ   7  
ATOM 8437  N N    . ARG A 1 56 ? 2.705   4.696   -6.446  1.00 0.00 ? 56 ARG A N    7  
ATOM 8438  C CA   . ARG A 1 56 ? 3.294   3.845   -7.467  1.00 0.00 ? 56 ARG A CA   7  
ATOM 8439  C C    . ARG A 1 56 ? 3.995   2.648   -6.820  1.00 0.00 ? 56 ARG A C    7  
ATOM 8440  O O    . ARG A 1 56 ? 4.176   2.614   -5.604  1.00 0.00 ? 56 ARG A O    7  
ATOM 8441  C CB   . ARG A 1 56 ? 4.303   4.620   -8.315  1.00 0.00 ? 56 ARG A CB   7  
ATOM 8442  C CG   . ARG A 1 56 ? 5.023   5.682   -7.480  1.00 0.00 ? 56 ARG A CG   7  
ATOM 8443  C CD   . ARG A 1 56 ? 6.517   5.716   -7.806  1.00 0.00 ? 56 ARG A CD   7  
ATOM 8444  N NE   . ARG A 1 56 ? 6.717   6.096   -9.223  1.00 0.00 ? 56 ARG A NE   7  
ATOM 8445  C CZ   . ARG A 1 56 ? 7.908   6.384   -9.763  1.00 0.00 ? 56 ARG A CZ   7  
ATOM 8446  N NH1  . ARG A 1 56 ? 9.014   6.339   -9.009  1.00 0.00 ? 56 ARG A NH1  7  
ATOM 8447  N NH2  . ARG A 1 56 ? 7.994   6.719   -11.058 1.00 0.00 ? 56 ARG A NH2  7  
ATOM 8448  H H    . ARG A 1 56 ? 3.047   4.542   -5.519  1.00 0.00 ? 56 ARG A H    7  
ATOM 8449  H HA   . ARG A 1 56 ? 2.453   3.522   -8.080  1.00 0.00 ? 56 ARG A HA   7  
ATOM 8450  H HB3  . ARG A 1 56 ? 3.791   5.097   -9.152  1.00 0.00 ? 56 ARG A HB3  7  
ATOM 8451  H HG3  . ARG A 1 56 ? 4.884   5.469   -6.420  1.00 0.00 ? 56 ARG A HG3  7  
ATOM 8452  H HD3  . ARG A 1 56 ? 6.963   4.740   -7.617  1.00 0.00 ? 56 ARG A HD3  7  
ATOM 8453  H HE   . ARG A 1 56 ? 5.911   6.139   -9.815  1.00 0.00 ? 56 ARG A HE   7  
ATOM 8454  H HH11 . ARG A 1 56 ? 8.950   6.090   -8.042  1.00 0.00 ? 56 ARG A HH11 7  
ATOM 8455  H HH12 . ARG A 1 56 ? 9.904   6.555   -9.411  1.00 0.00 ? 56 ARG A HH12 7  
ATOM 8456  H HH21 . ARG A 1 56 ? 7.169   6.752   -11.622 1.00 0.00 ? 56 ARG A HH21 7  
ATOM 8457  H HH22 . ARG A 1 56 ? 8.884   6.934   -11.461 1.00 0.00 ? 56 ARG A HH22 7  
ATOM 8458  N N    . ARG A 1 57 ? 4.369   1.696   -7.662  1.00 0.00 ? 57 ARG A N    7  
ATOM 8459  C CA   . ARG A 1 57 ? 5.046   0.501   -7.188  1.00 0.00 ? 57 ARG A CA   7  
ATOM 8460  C C    . ARG A 1 57 ? 6.072   0.863   -6.112  1.00 0.00 ? 57 ARG A C    7  
ATOM 8461  O O    . ARG A 1 57 ? 6.612   1.969   -6.112  1.00 0.00 ? 57 ARG A O    7  
ATOM 8462  C CB   . ARG A 1 57 ? 5.753   -0.223  -8.335  1.00 0.00 ? 57 ARG A CB   7  
ATOM 8463  C CG   . ARG A 1 57 ? 4.993   -1.489  -8.737  1.00 0.00 ? 57 ARG A CG   7  
ATOM 8464  C CD   . ARG A 1 57 ? 5.278   -1.859  -10.194 1.00 0.00 ? 57 ARG A CD   7  
ATOM 8465  N NE   . ARG A 1 57 ? 4.137   -2.617  -10.755 1.00 0.00 ? 57 ARG A NE   7  
ATOM 8466  C CZ   . ARG A 1 57 ? 3.873   -3.899  -10.466 1.00 0.00 ? 57 ARG A CZ   7  
ATOM 8467  N NH1  . ARG A 1 57 ? 4.666   -4.573  -9.623  1.00 0.00 ? 57 ARG A NH1  7  
ATOM 8468  N NH2  . ARG A 1 57 ? 2.816   -4.507  -11.022 1.00 0.00 ? 57 ARG A NH2  7  
ATOM 8469  H H    . ARG A 1 57 ? 4.218   1.733   -8.650  1.00 0.00 ? 57 ARG A H    7  
ATOM 8470  H HA   . ARG A 1 57 ? 4.253   -0.124  -6.779  1.00 0.00 ? 57 ARG A HA   7  
ATOM 8471  H HB3  . ARG A 1 57 ? 6.768   -0.484  -8.034  1.00 0.00 ? 57 ARG A HB3  7  
ATOM 8472  H HG3  . ARG A 1 57 ? 3.923   -1.333  -8.599  1.00 0.00 ? 57 ARG A HG3  7  
ATOM 8473  H HD3  . ARG A 1 57 ? 6.187   -2.455  -10.256 1.00 0.00 ? 57 ARG A HD3  7  
ATOM 8474  H HE   . ARG A 1 57 ? 3.525   -2.144  -11.389 1.00 0.00 ? 57 ARG A HE   7  
ATOM 8475  H HH11 . ARG A 1 57 ? 5.455   -4.119  -9.208  1.00 0.00 ? 57 ARG A HH11 7  
ATOM 8476  H HH12 . ARG A 1 57 ? 4.469   -5.529  -9.407  1.00 0.00 ? 57 ARG A HH12 7  
ATOM 8477  H HH21 . ARG A 1 57 ? 2.224   -4.005  -11.653 1.00 0.00 ? 57 ARG A HH21 7  
ATOM 8478  H HH22 . ARG A 1 57 ? 2.619   -5.464  -10.807 1.00 0.00 ? 57 ARG A HH22 7  
ATOM 8479  N N    . PRO A 1 58 ? 6.315   -0.114  -5.198  1.00 0.00 ? 58 PRO A N    7  
ATOM 8480  C CA   . PRO A 1 58 ? 7.267   0.091   -4.119  1.00 0.00 ? 58 PRO A CA   7  
ATOM 8481  C C    . PRO A 1 58 ? 8.706   0.016   -4.635  1.00 0.00 ? 58 PRO A C    7  
ATOM 8482  O O    . PRO A 1 58 ? 9.630   0.491   -3.978  1.00 0.00 ? 58 PRO A O    7  
ATOM 8483  C CB   . PRO A 1 58 ? 6.944   -0.989  -3.100  1.00 0.00 ? 58 PRO A CB   7  
ATOM 8484  C CG   . PRO A 1 58 ? 6.139   -2.040  -3.846  1.00 0.00 ? 58 PRO A CG   7  
ATOM 8485  C CD   . PRO A 1 58 ? 5.694   -1.434  -5.168  1.00 0.00 ? 58 PRO A CD   7  
ATOM 8486  H HA   . PRO A 1 58 ? 7.163   1.008   -3.734  1.00 0.00 ? 58 PRO A HA   7  
ATOM 8487  H HB3  . PRO A 1 58 ? 6.374   -0.580  -2.266  1.00 0.00 ? 58 PRO A HB3  7  
ATOM 8488  H HG3  . PRO A 1 58 ? 5.276   -2.349  -3.258  1.00 0.00 ? 58 PRO A HG3  7  
ATOM 8489  H HD3  . PRO A 1 58 ? 4.608   -1.363  -5.225  1.00 0.00 ? 58 PRO A HD3  7  
ATOM 8490  N N    . ALA A 1 59 ? 8.850   -0.586  -5.808  1.00 0.00 ? 59 ALA A N    7  
ATOM 8491  C CA   . ALA A 1 59 ? 10.160  -0.729  -6.419  1.00 0.00 ? 59 ALA A CA   7  
ATOM 8492  C C    . ALA A 1 59 ? 10.482  0.530   -7.225  1.00 0.00 ? 59 ALA A C    7  
ATOM 8493  O O    . ALA A 1 59 ? 11.639  0.943   -7.302  1.00 0.00 ? 59 ALA A O    7  
ATOM 8494  C CB   . ALA A 1 59 ? 10.185  -1.995  -7.278  1.00 0.00 ? 59 ALA A CB   7  
ATOM 8495  H H    . ALA A 1 59 ? 8.092   -0.969  -6.335  1.00 0.00 ? 59 ALA A H    7  
ATOM 8496  H HA   . ALA A 1 59 ? 10.890  -0.834  -5.617  1.00 0.00 ? 59 ALA A HA   7  
ATOM 8497  H HB1  . ALA A 1 59 ? 11.049  -2.602  -7.006  1.00 0.00 ? 59 ALA A HB1  7  
ATOM 8498  H HB2  . ALA A 1 59 ? 9.273   -2.566  -7.112  1.00 0.00 ? 59 ALA A HB2  7  
ATOM 8499  H HB3  . ALA A 1 59 ? 10.253  -1.718  -8.330  1.00 0.00 ? 59 ALA A HB3  7  
ATOM 8500  N N    . GLU A 1 60 ? 9.439   1.105   -7.806  1.00 0.00 ? 60 GLU A N    7  
ATOM 8501  C CA   . GLU A 1 60 ? 9.597   2.309   -8.605  1.00 0.00 ? 60 GLU A CA   7  
ATOM 8502  C C    . GLU A 1 60 ? 9.955   3.496   -7.708  1.00 0.00 ? 60 GLU A C    7  
ATOM 8503  O O    . GLU A 1 60 ? 10.627  4.429   -8.146  1.00 0.00 ? 60 GLU A O    7  
ATOM 8504  C CB   . GLU A 1 60 ? 8.334   2.598   -9.418  1.00 0.00 ? 60 GLU A CB   7  
ATOM 8505  C CG   . GLU A 1 60 ? 8.194   1.613   -10.581 1.00 0.00 ? 60 GLU A CG   7  
ATOM 8506  C CD   . GLU A 1 60 ? 8.358   2.325   -11.925 1.00 0.00 ? 60 GLU A CD   7  
ATOM 8507  O OE1  . GLU A 1 60 ? 9.306   3.132   -12.028 1.00 0.00 ? 60 GLU A OE1  7  
ATOM 8508  O OE2  . GLU A 1 60 ? 7.530   2.045   -12.819 1.00 0.00 ? 60 GLU A OE2  7  
ATOM 8509  H H    . GLU A 1 60 ? 8.502   0.762   -7.738  1.00 0.00 ? 60 GLU A H    7  
ATOM 8510  H HA   . GLU A 1 60 ? 10.422  2.099   -9.286  1.00 0.00 ? 60 GLU A HA   7  
ATOM 8511  H HB3  . GLU A 1 60 ? 8.370   3.617   -9.803  1.00 0.00 ? 60 GLU A HB3  7  
ATOM 8512  H HG3  . GLU A 1 60 ? 7.219   1.129   -10.537 1.00 0.00 ? 60 GLU A HG3  7  
ATOM 8513  N N    . TYR A 1 61 ? 9.491   3.423   -6.470  1.00 0.00 ? 61 TYR A N    7  
ATOM 8514  C CA   . TYR A 1 61 ? 9.754   4.481   -5.508  1.00 0.00 ? 61 TYR A CA   7  
ATOM 8515  C C    . TYR A 1 61 ? 11.257  4.653   -5.280  1.00 0.00 ? 61 TYR A C    7  
ATOM 8516  O O    . TYR A 1 61 ? 12.057  3.849   -5.755  1.00 0.00 ? 61 TYR A O    7  
ATOM 8517  C CB   . TYR A 1 61 ? 9.100   4.032   -4.200  1.00 0.00 ? 61 TYR A CB   7  
ATOM 8518  C CG   . TYR A 1 61 ? 7.721   4.646   -3.952  1.00 0.00 ? 61 TYR A CG   7  
ATOM 8519  C CD1  . TYR A 1 61 ? 7.479   5.963   -4.291  1.00 0.00 ? 61 TYR A CD1  7  
ATOM 8520  C CD2  . TYR A 1 61 ? 6.718   3.884   -3.389  1.00 0.00 ? 61 TYR A CD2  7  
ATOM 8521  C CE1  . TYR A 1 61 ? 6.181   6.539   -4.058  1.00 0.00 ? 61 TYR A CE1  7  
ATOM 8522  C CE2  . TYR A 1 61 ? 5.419   4.462   -3.155  1.00 0.00 ? 61 TYR A CE2  7  
ATOM 8523  C CZ   . TYR A 1 61 ? 5.214   5.761   -3.501  1.00 0.00 ? 61 TYR A CZ   7  
ATOM 8524  O OH   . TYR A 1 61 ? 3.988   6.307   -3.282  1.00 0.00 ? 61 TYR A OH   7  
ATOM 8525  H H    . TYR A 1 61 ? 8.947   2.661   -6.121  1.00 0.00 ? 61 TYR A H    7  
ATOM 8526  H HA   . TYR A 1 61 ? 9.346   5.409   -5.909  1.00 0.00 ? 61 TYR A HA   7  
ATOM 8527  H HB3  . TYR A 1 61 ? 9.756   4.293   -3.369  1.00 0.00 ? 61 TYR A HB3  7  
ATOM 8528  H HD1  . TYR A 1 61 ? 8.271   6.564   -4.736  1.00 0.00 ? 61 TYR A HD1  7  
ATOM 8529  H HD2  . TYR A 1 61 ? 6.907   2.845   -3.120  1.00 0.00 ? 61 TYR A HD2  7  
ATOM 8530  H HE1  . TYR A 1 61 ? 5.977   7.578   -4.321  1.00 0.00 ? 61 TYR A HE1  7  
ATOM 8531  H HE2  . TYR A 1 61 ? 4.618   3.871   -2.711  1.00 0.00 ? 61 TYR A HE2  7  
ATOM 8532  H HH   . TYR A 1 61 ? 3.976   7.256   -3.595  1.00 0.00 ? 61 TYR A HH   7  
ATOM 8533  N N    . ASP A 1 62 ? 11.596  5.707   -4.552  1.00 0.00 ? 62 ASP A N    7  
ATOM 8534  C CA   . ASP A 1 62 ? 12.988  5.995   -4.255  1.00 0.00 ? 62 ASP A CA   7  
ATOM 8535  C C    . ASP A 1 62 ? 13.411  5.218   -3.007  1.00 0.00 ? 62 ASP A C    7  
ATOM 8536  O O    . ASP A 1 62 ? 12.616  4.472   -2.438  1.00 0.00 ? 62 ASP A O    7  
ATOM 8537  C CB   . ASP A 1 62 ? 13.195  7.486   -3.977  1.00 0.00 ? 62 ASP A CB   7  
ATOM 8538  C CG   . ASP A 1 62 ? 12.009  8.382   -4.338  1.00 0.00 ? 62 ASP A CG   7  
ATOM 8539  O OD1  . ASP A 1 62 ? 11.562  8.290   -5.502  1.00 0.00 ? 62 ASP A OD1  7  
ATOM 8540  O OD2  . ASP A 1 62 ? 11.575  9.139   -3.443  1.00 0.00 ? 62 ASP A OD2  7  
ATOM 8541  H H    . ASP A 1 62 ? 10.939  6.357   -4.169  1.00 0.00 ? 62 ASP A H    7  
ATOM 8542  H HA   . ASP A 1 62 ? 13.540  5.689   -5.144  1.00 0.00 ? 62 ASP A HA   7  
ATOM 8543  H HB3  . ASP A 1 62 ? 14.070  7.825   -4.531  1.00 0.00 ? 62 ASP A HB3  7  
ATOM 8544  N N    . PRO A 1 63 ? 14.695  5.425   -2.608  1.00 0.00 ? 63 PRO A N    7  
ATOM 8545  C CA   . PRO A 1 63 ? 15.232  4.752   -1.438  1.00 0.00 ? 63 PRO A CA   7  
ATOM 8546  C C    . PRO A 1 63 ? 14.693  5.379   -0.150  1.00 0.00 ? 63 PRO A C    7  
ATOM 8547  O O    . PRO A 1 63 ? 14.158  4.679   0.709   1.00 0.00 ? 63 PRO A O    7  
ATOM 8548  C CB   . PRO A 1 63 ? 16.741  4.875   -1.572  1.00 0.00 ? 63 PRO A CB   7  
ATOM 8549  C CG   . PRO A 1 63 ? 16.981  6.004   -2.560  1.00 0.00 ? 63 PRO A CG   7  
ATOM 8550  C CD   . PRO A 1 63 ? 15.664  6.302   -3.258  1.00 0.00 ? 63 PRO A CD   7  
ATOM 8551  H HA   . PRO A 1 63 ? 14.937  3.797   -1.420  1.00 0.00 ? 63 PRO A HA   7  
ATOM 8552  H HB3  . PRO A 1 63 ? 17.177  3.942   -1.931  1.00 0.00 ? 63 PRO A HB3  7  
ATOM 8553  H HG3  . PRO A 1 63 ? 17.743  5.721   -3.286  1.00 0.00 ? 63 PRO A HG3  7  
ATOM 8554  H HD3  . PRO A 1 63 ? 15.728  6.098   -4.327  1.00 0.00 ? 63 PRO A HD3  7  
ATOM 8555  N N    . LYS A 1 64 ? 14.856  6.691   -0.055  1.00 0.00 ? 64 LYS A N    7  
ATOM 8556  C CA   . LYS A 1 64 ? 14.393  7.420   1.114   1.00 0.00 ? 64 LYS A CA   7  
ATOM 8557  C C    . LYS A 1 64 ? 12.864  7.367   1.170   1.00 0.00 ? 64 LYS A C    7  
ATOM 8558  O O    . LYS A 1 64 ? 12.275  7.483   2.243   1.00 0.00 ? 64 LYS A O    7  
ATOM 8559  C CB   . LYS A 1 64 ? 14.960  8.841   1.118   1.00 0.00 ? 64 LYS A CB   7  
ATOM 8560  C CG   . LYS A 1 64 ? 16.410  8.850   1.608   1.00 0.00 ? 64 LYS A CG   7  
ATOM 8561  C CD   . LYS A 1 64 ? 17.377  9.113   0.452   1.00 0.00 ? 64 LYS A CD   7  
ATOM 8562  C CE   . LYS A 1 64 ? 18.826  8.890   0.889   1.00 0.00 ? 64 LYS A CE   7  
ATOM 8563  N NZ   . LYS A 1 64 ? 19.672  8.549   -0.277  1.00 0.00 ? 64 LYS A NZ   7  
ATOM 8564  H H    . LYS A 1 64 ? 15.292  7.252   -0.757  1.00 0.00 ? 64 LYS A H    7  
ATOM 8565  H HA   . LYS A 1 64 ? 14.788  6.912   1.993   1.00 0.00 ? 64 LYS A HA   7  
ATOM 8566  H HB3  . LYS A 1 64 ? 14.352  9.477   1.761   1.00 0.00 ? 64 LYS A HB3  7  
ATOM 8567  H HG3  . LYS A 1 64 ? 16.647  7.894   2.075   1.00 0.00 ? 64 LYS A HG3  7  
ATOM 8568  H HD3  . LYS A 1 64 ? 17.254  10.135  0.096   1.00 0.00 ? 64 LYS A HD3  7  
ATOM 8569  H HE3  . LYS A 1 64 ? 18.871  8.087   1.625   1.00 0.00 ? 64 LYS A HE3  7  
ATOM 8570  H HZ1  . LYS A 1 64 ? 20.442  9.187   -0.329  1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 8571  H HZ2  . LYS A 1 64 ? 20.018  7.616   -0.177  1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 8572  H HZ3  . LYS A 1 64 ? 19.129  8.616   -1.114  1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 8573  N N    . ALA A 1 65 ? 12.267  7.193   0.001   1.00 0.00 ? 65 ALA A N    7  
ATOM 8574  C CA   . ALA A 1 65 ? 10.819  7.124   -0.097  1.00 0.00 ? 65 ALA A CA   7  
ATOM 8575  C C    . ALA A 1 65 ? 10.313  5.934   0.721   1.00 0.00 ? 65 ALA A C    7  
ATOM 8576  O O    . ALA A 1 65 ? 9.571   6.110   1.687   1.00 0.00 ? 65 ALA A O    7  
ATOM 8577  C CB   . ALA A 1 65 ? 10.410  7.036   -1.569  1.00 0.00 ? 65 ALA A CB   7  
ATOM 8578  H H    . ALA A 1 65 ? 12.753  7.099   -0.868  1.00 0.00 ? 65 ALA A H    7  
ATOM 8579  H HA   . ALA A 1 65 ? 10.414  8.043   0.325   1.00 0.00 ? 65 ALA A HA   7  
ATOM 8580  H HB1  . ALA A 1 65 ? 10.221  8.038   -1.954  1.00 0.00 ? 65 ALA A HB1  7  
ATOM 8581  H HB2  . ALA A 1 65 ? 11.212  6.570   -2.142  1.00 0.00 ? 65 ALA A HB2  7  
ATOM 8582  H HB3  . ALA A 1 65 ? 9.504   6.436   -1.659  1.00 0.00 ? 65 ALA A HB3  7  
ATOM 8583  N N    . LEU A 1 66 ? 10.734  4.749   0.305   1.00 0.00 ? 66 LEU A N    7  
ATOM 8584  C CA   . LEU A 1 66 ? 10.333  3.531   0.988   1.00 0.00 ? 66 LEU A CA   7  
ATOM 8585  C C    . LEU A 1 66 ? 10.434  3.741   2.499   1.00 0.00 ? 66 LEU A C    7  
ATOM 8586  O O    . LEU A 1 66 ? 9.542   3.341   3.246   1.00 0.00 ? 66 LEU A O    7  
ATOM 8587  C CB   . LEU A 1 66 ? 11.145  2.339   0.477   1.00 0.00 ? 66 LEU A CB   7  
ATOM 8588  C CG   . LEU A 1 66 ? 11.063  2.065   -1.026  1.00 0.00 ? 66 LEU A CG   7  
ATOM 8589  C CD1  . LEU A 1 66 ? 12.100  1.024   -1.452  1.00 0.00 ? 66 LEU A CD1  7  
ATOM 8590  C CD2  . LEU A 1 66 ? 9.644   1.660   -1.432  1.00 0.00 ? 66 LEU A CD2  7  
ATOM 8591  H H    . LEU A 1 66 ? 11.338  4.615   -0.481  1.00 0.00 ? 66 LEU A H    7  
ATOM 8592  H HA   . LEU A 1 66 ? 9.290   3.343   0.733   1.00 0.00 ? 66 LEU A HA   7  
ATOM 8593  H HB3  . LEU A 1 66 ? 10.815  1.446   1.007   1.00 0.00 ? 66 LEU A HB3  7  
ATOM 8594  H HG   . LEU A 1 66 ? 11.297  2.988   -1.555  1.00 0.00 ? 66 LEU A HG   7  
ATOM 8595  H HD11 . LEU A 1 66 ? 12.161  0.242   -0.695  1.00 0.00 ? 66 LEU A HD11 7  
ATOM 8596  H HD12 . LEU A 1 66 ? 11.804  0.585   -2.405  1.00 0.00 ? 66 LEU A HD12 7  
ATOM 8597  H HD13 . LEU A 1 66 ? 13.073  1.503   -1.559  1.00 0.00 ? 66 LEU A HD13 7  
ATOM 8598  H HD21 . LEU A 1 66 ? 9.313   2.282   -2.263  1.00 0.00 ? 66 LEU A HD21 7  
ATOM 8599  H HD22 . LEU A 1 66 ? 9.638   0.613   -1.736  1.00 0.00 ? 66 LEU A HD22 7  
ATOM 8600  H HD23 . LEU A 1 66 ? 8.970   1.796   -0.586  1.00 0.00 ? 66 LEU A HD23 7  
ATOM 8601  N N    . MET A 1 67 ? 11.528  4.369   2.906   1.00 0.00 ? 67 MET A N    7  
ATOM 8602  C CA   . MET A 1 67 ? 11.757  4.637   4.315   1.00 0.00 ? 67 MET A CA   7  
ATOM 8603  C C    . MET A 1 67 ? 10.698  5.591   4.871   1.00 0.00 ? 67 MET A C    7  
ATOM 8604  O O    . MET A 1 67 ? 10.270  5.452   6.015   1.00 0.00 ? 67 MET A O    7  
ATOM 8605  C CB   . MET A 1 67 ? 13.146  5.252   4.500   1.00 0.00 ? 67 MET A CB   7  
ATOM 8606  C CG   . MET A 1 67 ? 14.218  4.165   4.600   1.00 0.00 ? 67 MET A CG   7  
ATOM 8607  S SD   . MET A 1 67 ? 15.841  4.906   4.597   1.00 0.00 ? 67 MET A SD   7  
ATOM 8608  C CE   . MET A 1 67 ? 16.261  4.726   2.871   1.00 0.00 ? 67 MET A CE   7  
ATOM 8609  H H    . MET A 1 67 ? 12.249  4.690   2.292   1.00 0.00 ? 67 MET A H    7  
ATOM 8610  H HA   . MET A 1 67 ? 11.682  3.670   4.814   1.00 0.00 ? 67 MET A HA   7  
ATOM 8611  H HB3  . MET A 1 67 ? 13.159  5.865   5.400   1.00 0.00 ? 67 MET A HB3  7  
ATOM 8612  H HG3  . MET A 1 67 ? 14.124  3.471   3.764   1.00 0.00 ? 67 MET A HG3  7  
ATOM 8613  H HE1  . MET A 1 67 ? 15.492  4.140   2.369   1.00 0.00 ? 67 MET A HE1  7  
ATOM 8614  H HE2  . MET A 1 67 ? 16.326  5.711   2.409   1.00 0.00 ? 67 MET A HE2  7  
ATOM 8615  H HE3  . MET A 1 67 ? 17.222  4.219   2.782   1.00 0.00 ? 67 MET A HE3  7  
ATOM 8616  N N    . ALA A 1 68 ? 10.306  6.541   4.033   1.00 0.00 ? 68 ALA A N    7  
ATOM 8617  C CA   . ALA A 1 68 ? 9.306   7.518   4.427   1.00 0.00 ? 68 ALA A CA   7  
ATOM 8618  C C    . ALA A 1 68 ? 7.920   6.869   4.386   1.00 0.00 ? 68 ALA A C    7  
ATOM 8619  O O    . ALA A 1 68 ? 7.011   7.291   5.098   1.00 0.00 ? 68 ALA A O    7  
ATOM 8620  C CB   . ALA A 1 68 ? 9.402   8.742   3.514   1.00 0.00 ? 68 ALA A CB   7  
ATOM 8621  H H    . ALA A 1 68 ? 10.658  6.647   3.104   1.00 0.00 ? 68 ALA A H    7  
ATOM 8622  H HA   . ALA A 1 68 ? 9.524   7.825   5.450   1.00 0.00 ? 68 ALA A HA   7  
ATOM 8623  H HB1  . ALA A 1 68 ? 8.404   9.028   3.182   1.00 0.00 ? 68 ALA A HB1  7  
ATOM 8624  H HB2  . ALA A 1 68 ? 9.852   9.570   4.064   1.00 0.00 ? 68 ALA A HB2  7  
ATOM 8625  H HB3  . ALA A 1 68 ? 10.019  8.503   2.649   1.00 0.00 ? 68 ALA A HB3  7  
ATOM 8626  N N    . ILE A 1 69 ? 7.803   5.852   3.544   1.00 0.00 ? 69 ILE A N    7  
ATOM 8627  C CA   . ILE A 1 69 ? 6.544   5.140   3.402   1.00 0.00 ? 69 ILE A CA   7  
ATOM 8628  C C    . ILE A 1 69 ? 6.296   4.296   4.654   1.00 0.00 ? 69 ILE A C    7  
ATOM 8629  O O    . ILE A 1 69 ? 5.197   4.308   5.207   1.00 0.00 ? 69 ILE A O    7  
ATOM 8630  C CB   . ILE A 1 69 ? 6.531   4.332   2.102   1.00 0.00 ? 69 ILE A CB   7  
ATOM 8631  C CG1  . ILE A 1 69 ? 6.676   5.249   0.886   1.00 0.00 ? 69 ILE A CG1  7  
ATOM 8632  C CG2  . ILE A 1 69 ? 5.278   3.458   2.014   1.00 0.00 ? 69 ILE A CG2  7  
ATOM 8633  C CD1  . ILE A 1 69 ? 7.382   4.527   -0.264  1.00 0.00 ? 69 ILE A CD1  7  
ATOM 8634  H H    . ILE A 1 69 ? 8.547   5.514   2.968   1.00 0.00 ? 69 ILE A H    7  
ATOM 8635  H HA   . ILE A 1 69 ? 5.753   5.887   3.326   1.00 0.00 ? 69 ILE A HA   7  
ATOM 8636  H HB   . ILE A 1 69 ? 7.391   3.664   2.106   1.00 0.00 ? 69 ILE A HB   7  
ATOM 8637  H HG13 . ILE A 1 69 ? 7.240   6.140   1.162   1.00 0.00 ? 69 ILE A HG13 7  
ATOM 8638  H HG21 . ILE A 1 69 ? 5.003   3.117   3.012   1.00 0.00 ? 69 ILE A HG21 7  
ATOM 8639  H HG22 . ILE A 1 69 ? 4.459   4.037   1.589   1.00 0.00 ? 69 ILE A HG22 7  
ATOM 8640  H HG23 . ILE A 1 69 ? 5.482   2.595   1.380   1.00 0.00 ? 69 ILE A HG23 7  
ATOM 8641  H HD11 . ILE A 1 69 ? 6.853   4.723   -1.196  1.00 0.00 ? 69 ILE A HD11 7  
ATOM 8642  H HD12 . ILE A 1 69 ? 8.407   4.888   -0.344  1.00 0.00 ? 69 ILE A HD12 7  
ATOM 8643  H HD13 . ILE A 1 69 ? 7.389   3.454   -0.069  1.00 0.00 ? 69 ILE A HD13 7  
ATOM 8644  N N    . LEU A 1 70 ? 7.335   3.582   5.062   1.00 0.00 ? 70 LEU A N    7  
ATOM 8645  C CA   . LEU A 1 70 ? 7.243   2.734   6.238   1.00 0.00 ? 70 LEU A CA   7  
ATOM 8646  C C    . LEU A 1 70 ? 7.133   3.610   7.487   1.00 0.00 ? 70 LEU A C    7  
ATOM 8647  O O    . LEU A 1 70 ? 6.590   3.182   8.504   1.00 0.00 ? 70 LEU A O    7  
ATOM 8648  C CB   . LEU A 1 70 ? 8.413   1.748   6.280   1.00 0.00 ? 70 LEU A CB   7  
ATOM 8649  C CG   . LEU A 1 70 ? 8.758   1.060   4.957   1.00 0.00 ? 70 LEU A CG   7  
ATOM 8650  C CD1  . LEU A 1 70 ? 10.272  0.912   4.795   1.00 0.00 ? 70 LEU A CD1  7  
ATOM 8651  C CD2  . LEU A 1 70 ? 8.034   -0.281  4.830   1.00 0.00 ? 70 LEU A CD2  7  
ATOM 8652  H H    . LEU A 1 70 ? 8.225   3.578   4.606   1.00 0.00 ? 70 LEU A H    7  
ATOM 8653  H HA   . LEU A 1 70 ? 6.330   2.146   6.147   1.00 0.00 ? 70 LEU A HA   7  
ATOM 8654  H HB3  . LEU A 1 70 ? 8.187   0.978   7.018   1.00 0.00 ? 70 LEU A HB3  7  
ATOM 8655  H HG   . LEU A 1 70 ? 8.408   1.693   4.141   1.00 0.00 ? 70 LEU A HG   7  
ATOM 8656  H HD11 . LEU A 1 70 ? 10.591  1.418   3.884   1.00 0.00 ? 70 LEU A HD11 7  
ATOM 8657  H HD12 . LEU A 1 70 ? 10.775  1.357   5.655   1.00 0.00 ? 70 LEU A HD12 7  
ATOM 8658  H HD13 . LEU A 1 70 ? 10.529  -0.145  4.733   1.00 0.00 ? 70 LEU A HD13 7  
ATOM 8659  H HD21 . LEU A 1 70 ? 8.477   -0.858  4.018   1.00 0.00 ? 70 LEU A HD21 7  
ATOM 8660  H HD22 . LEU A 1 70 ? 8.129   -0.836  5.765   1.00 0.00 ? 70 LEU A HD22 7  
ATOM 8661  H HD23 . LEU A 1 70 ? 6.979   -0.106  4.619   1.00 0.00 ? 70 LEU A HD23 7  
ATOM 8662  N N    . GLU A 1 71 ? 7.657   4.821   7.369   1.00 0.00 ? 71 GLU A N    7  
ATOM 8663  C CA   . GLU A 1 71 ? 7.625   5.762   8.476   1.00 0.00 ? 71 GLU A CA   7  
ATOM 8664  C C    . GLU A 1 71 ? 6.270   6.469   8.532   1.00 0.00 ? 71 GLU A C    7  
ATOM 8665  O O    . GLU A 1 71 ? 5.726   6.691   9.613   1.00 0.00 ? 71 GLU A O    7  
ATOM 8666  C CB   . GLU A 1 71 ? 8.768   6.773   8.369   1.00 0.00 ? 71 GLU A CB   7  
ATOM 8667  C CG   . GLU A 1 71 ? 10.045  6.227   9.010   1.00 0.00 ? 71 GLU A CG   7  
ATOM 8668  C CD   . GLU A 1 71 ? 10.931  7.364   9.523   1.00 0.00 ? 71 GLU A CD   7  
ATOM 8669  O OE1  . GLU A 1 71 ? 10.432  8.133   10.374  1.00 0.00 ? 71 GLU A OE1  7  
ATOM 8670  O OE2  . GLU A 1 71 ? 12.087  7.440   9.053   1.00 0.00 ? 71 GLU A OE2  7  
ATOM 8671  H H    . GLU A 1 71 ? 8.097   5.162   6.538   1.00 0.00 ? 71 GLU A H    7  
ATOM 8672  H HA   . GLU A 1 71 ? 7.765   5.159   9.373   1.00 0.00 ? 71 GLU A HA   7  
ATOM 8673  H HB3  . GLU A 1 71 ? 8.480   7.704   8.859   1.00 0.00 ? 71 GLU A HB3  7  
ATOM 8674  H HG3  . GLU A 1 71 ? 10.596  5.633   8.280   1.00 0.00 ? 71 GLU A HG3  7  
ATOM 8675  N N    . HIS A 1 72 ? 5.763   6.804   7.354   1.00 0.00 ? 72 HIS A N    7  
ATOM 8676  C CA   . HIS A 1 72 ? 4.482   7.481   7.256   1.00 0.00 ? 72 HIS A CA   7  
ATOM 8677  C C    . HIS A 1 72 ? 3.357   6.445   7.194   1.00 0.00 ? 72 HIS A C    7  
ATOM 8678  O O    . HIS A 1 72 ? 2.182   6.793   7.304   1.00 0.00 ? 72 HIS A O    7  
ATOM 8679  C CB   . HIS A 1 72 ? 4.467   8.444   6.067   1.00 0.00 ? 72 HIS A CB   7  
ATOM 8680  C CG   . HIS A 1 72 ? 5.442   9.590   6.192   1.00 0.00 ? 72 HIS A CG   7  
ATOM 8681  N ND1  . HIS A 1 72 ? 5.078   10.910  5.990   1.00 0.00 ? 72 HIS A ND1  7  
ATOM 8682  C CD2  . HIS A 1 72 ? 6.770   9.600   6.502   1.00 0.00 ? 72 HIS A CD2  7  
ATOM 8683  C CE1  . HIS A 1 72 ? 6.146   11.671  6.172   1.00 0.00 ? 72 HIS A CE1  7  
ATOM 8684  N NE2  . HIS A 1 72 ? 7.195   10.858  6.489   1.00 0.00 ? 72 HIS A NE2  7  
ATOM 8685  H H    . HIS A 1 72 ? 6.212   6.618   6.480   1.00 0.00 ? 72 HIS A H    7  
ATOM 8686  H HA   . HIS A 1 72 ? 4.370   8.073   8.164   1.00 0.00 ? 72 HIS A HA   7  
ATOM 8687  H HB3  . HIS A 1 72 ? 3.461   8.847   5.952   1.00 0.00 ? 72 HIS A HB3  7  
ATOM 8688  H HD1  . HIS A 1 72 ? 4.163   11.234  5.748   1.00 0.00 ? 72 HIS A HD1  7  
ATOM 8689  H HD2  . HIS A 1 72 ? 7.379   8.723   6.723   1.00 0.00 ? 72 HIS A HD2  7  
ATOM 8690  H HE1  . HIS A 1 72 ? 6.182   12.757  6.084   1.00 0.00 ? 72 HIS A HE1  7  
ATOM 8691  N N    . SER A 1 73 ? 3.757   5.194   7.018   1.00 0.00 ? 73 SER A N    7  
ATOM 8692  C CA   . SER A 1 73 ? 2.797   4.106   6.940   1.00 0.00 ? 73 SER A CA   7  
ATOM 8693  C C    . SER A 1 73 ? 1.787   4.217   8.084   1.00 0.00 ? 73 SER A C    7  
ATOM 8694  O O    . SER A 1 73 ? 0.668   3.717   7.979   1.00 0.00 ? 73 SER A O    7  
ATOM 8695  C CB   . SER A 1 73 ? 3.500   2.748   6.984   1.00 0.00 ? 73 SER A CB   7  
ATOM 8696  O OG   . SER A 1 73 ? 3.380   2.125   8.260   1.00 0.00 ? 73 SER A OG   7  
ATOM 8697  H H    . SER A 1 73 ? 4.715   4.921   6.930   1.00 0.00 ? 73 SER A H    7  
ATOM 8698  H HA   . SER A 1 73 ? 2.301   4.227   5.978   1.00 0.00 ? 73 SER A HA   7  
ATOM 8699  H HB3  . SER A 1 73 ? 4.555   2.878   6.742   1.00 0.00 ? 73 SER A HB3  7  
ATOM 8700  H HG   . SER A 1 73 ? 4.091   2.464   8.874   1.00 0.00 ? 73 SER A HG   7  
ATOM 8701  N N    . HIS A 1 74 ? 2.218   4.876   9.150   1.00 0.00 ? 74 HIS A N    7  
ATOM 8702  C CA   . HIS A 1 74 ? 1.364   5.059   10.312  1.00 0.00 ? 74 HIS A CA   7  
ATOM 8703  C C    . HIS A 1 74 ? 0.116   5.848   9.912   1.00 0.00 ? 74 HIS A C    7  
ATOM 8704  O O    . HIS A 1 74 ? -0.863  5.888   10.656  1.00 0.00 ? 74 HIS A O    7  
ATOM 8705  C CB   . HIS A 1 74 ? 2.139   5.714   11.457  1.00 0.00 ? 74 HIS A CB   7  
ATOM 8706  C CG   . HIS A 1 74 ? 2.476   7.166   11.219  1.00 0.00 ? 74 HIS A CG   7  
ATOM 8707  N ND1  . HIS A 1 74 ? 3.525   7.569   10.411  1.00 0.00 ? 74 HIS A ND1  7  
ATOM 8708  C CD2  . HIS A 1 74 ? 1.892   8.306   11.689  1.00 0.00 ? 74 HIS A CD2  7  
ATOM 8709  C CE1  . HIS A 1 74 ? 3.562   8.893   10.404  1.00 0.00 ? 74 HIS A CE1  7  
ATOM 8710  N NE2  . HIS A 1 74 ? 2.550   9.349   11.196  1.00 0.00 ? 74 HIS A NE2  7  
ATOM 8711  H H    . HIS A 1 74 ? 3.128   5.280   9.227   1.00 0.00 ? 74 HIS A H    7  
ATOM 8712  H HA   . HIS A 1 74 ? 1.065   4.063   10.640  1.00 0.00 ? 74 HIS A HA   7  
ATOM 8713  H HB3  . HIS A 1 74 ? 3.063   5.159   11.621  1.00 0.00 ? 74 HIS A HB3  7  
ATOM 8714  H HD1  . HIS A 1 74 ? 4.150   6.964   9.918   1.00 0.00 ? 74 HIS A HD1  7  
ATOM 8715  H HD2  . HIS A 1 74 ? 1.030   8.352   12.355  1.00 0.00 ? 74 HIS A HD2  7  
ATOM 8716  H HE1  . HIS A 1 74 ? 4.277   9.511   9.860   1.00 0.00 ? 74 HIS A HE1  7  
ATOM 8717  N N    . ARG A 1 75 ? 0.191   6.459   8.739   1.00 0.00 ? 75 ARG A N    7  
ATOM 8718  C CA   . ARG A 1 75 ? -0.921  7.245   8.231   1.00 0.00 ? 75 ARG A CA   7  
ATOM 8719  C C    . ARG A 1 75 ? -1.478  6.615   6.954   1.00 0.00 ? 75 ARG A C    7  
ATOM 8720  O O    . ARG A 1 75 ? -2.682  6.660   6.709   1.00 0.00 ? 75 ARG A O    7  
ATOM 8721  C CB   . ARG A 1 75 ? -0.489  8.683   7.937   1.00 0.00 ? 75 ARG A CB   7  
ATOM 8722  C CG   . ARG A 1 75 ? 0.669   9.105   8.843   1.00 0.00 ? 75 ARG A CG   7  
ATOM 8723  C CD   . ARG A 1 75 ? 0.866   10.622  8.811   1.00 0.00 ? 75 ARG A CD   7  
ATOM 8724  N NE   . ARG A 1 75 ? -0.339  11.300  9.339   1.00 0.00 ? 75 ARG A NE   7  
ATOM 8725  C CZ   . ARG A 1 75 ? -1.370  11.698  8.582   1.00 0.00 ? 75 ARG A CZ   7  
ATOM 8726  N NH1  . ARG A 1 75 ? -1.349  11.487  7.258   1.00 0.00 ? 75 ARG A NH1  7  
ATOM 8727  N NH2  . ARG A 1 75 ? -2.422  12.306  9.147   1.00 0.00 ? 75 ARG A NH2  7  
ATOM 8728  H H    . ARG A 1 75 ? 0.991   6.422   8.139   1.00 0.00 ? 75 ARG A H    7  
ATOM 8729  H HA   . ARG A 1 75 ? -1.661  7.229   9.031   1.00 0.00 ? 75 ARG A HA   7  
ATOM 8730  H HB3  . ARG A 1 75 ? -1.333  9.357   8.080   1.00 0.00 ? 75 ARG A HB3  7  
ATOM 8731  H HG3  . ARG A 1 75 ? 1.585   8.608   8.525   1.00 0.00 ? 75 ARG A HG3  7  
ATOM 8732  H HD3  . ARG A 1 75 ? 1.060   10.950  7.789   1.00 0.00 ? 75 ARG A HD3  7  
ATOM 8733  H HE   . ARG A 1 75 ? -0.387  11.473  10.323  1.00 0.00 ? 75 ARG A HE   7  
ATOM 8734  H HH11 . ARG A 1 75 ? -0.565  11.034  6.836   1.00 0.00 ? 75 ARG A HH11 7  
ATOM 8735  H HH12 . ARG A 1 75 ? -2.120  11.784  6.693   1.00 0.00 ? 75 ARG A HH12 7  
ATOM 8736  H HH21 . ARG A 1 75 ? -2.437  12.464  10.135  1.00 0.00 ? 75 ARG A HH21 7  
ATOM 8737  H HH22 . ARG A 1 75 ? -3.191  12.603  8.581   1.00 0.00 ? 75 ARG A HH22 7  
ATOM 8738  N N    . ILE A 1 76 ? -0.574  6.040   6.173   1.00 0.00 ? 76 ILE A N    7  
ATOM 8739  C CA   . ILE A 1 76 ? -0.960  5.401   4.926   1.00 0.00 ? 76 ILE A CA   7  
ATOM 8740  C C    . ILE A 1 76 ? -2.266  4.634   5.134   1.00 0.00 ? 76 ILE A C    7  
ATOM 8741  O O    . ILE A 1 76 ? -2.326  3.712   5.946   1.00 0.00 ? 76 ILE A O    7  
ATOM 8742  C CB   . ILE A 1 76 ? 0.183   4.537   4.392   1.00 0.00 ? 76 ILE A CB   7  
ATOM 8743  C CG1  . ILE A 1 76 ? 1.387   5.397   4.005   1.00 0.00 ? 76 ILE A CG1  7  
ATOM 8744  C CG2  . ILE A 1 76 ? -0.291  3.658   3.232   1.00 0.00 ? 76 ILE A CG2  7  
ATOM 8745  C CD1  . ILE A 1 76 ? 2.446   4.564   3.280   1.00 0.00 ? 76 ILE A CD1  7  
ATOM 8746  H H    . ILE A 1 76 ? 0.403   6.008   6.380   1.00 0.00 ? 76 ILE A H    7  
ATOM 8747  H HA   . ILE A 1 76 ? -1.136  6.191   4.196   1.00 0.00 ? 76 ILE A HA   7  
ATOM 8748  H HB   . ILE A 1 76 ? 0.508   3.868   5.189   1.00 0.00 ? 76 ILE A HB   7  
ATOM 8749  H HG13 . ILE A 1 76 ? 1.821   5.845   4.898   1.00 0.00 ? 76 ILE A HG13 7  
ATOM 8750  H HG21 . ILE A 1 76 ? 0.426   2.853   3.070   1.00 0.00 ? 76 ILE A HG21 7  
ATOM 8751  H HG22 . ILE A 1 76 ? -1.266  3.234   3.472   1.00 0.00 ? 76 ILE A HG22 7  
ATOM 8752  H HG23 . ILE A 1 76 ? -0.370  4.261   2.328   1.00 0.00 ? 76 ILE A HG23 7  
ATOM 8753  H HD11 . ILE A 1 76 ? 2.057   4.241   2.314   1.00 0.00 ? 76 ILE A HD11 7  
ATOM 8754  H HD12 . ILE A 1 76 ? 3.341   5.166   3.126   1.00 0.00 ? 76 ILE A HD12 7  
ATOM 8755  H HD13 . ILE A 1 76 ? 2.696   3.689   3.881   1.00 0.00 ? 76 ILE A HD13 7  
ATOM 8756  N N    . ARG A 1 77 ? -3.281  5.043   4.388   1.00 0.00 ? 77 ARG A N    7  
ATOM 8757  C CA   . ARG A 1 77 ? -4.584  4.405   4.480   1.00 0.00 ? 77 ARG A CA   7  
ATOM 8758  C C    . ARG A 1 77 ? -5.207  4.267   3.090   1.00 0.00 ? 77 ARG A C    7  
ATOM 8759  O O    . ARG A 1 77 ? -5.277  5.238   2.338   1.00 0.00 ? 77 ARG A O    7  
ATOM 8760  C CB   . ARG A 1 77 ? -5.528  5.209   5.377   1.00 0.00 ? 77 ARG A CB   7  
ATOM 8761  C CG   . ARG A 1 77 ? -5.328  4.843   6.850   1.00 0.00 ? 77 ARG A CG   7  
ATOM 8762  C CD   . ARG A 1 77 ? -6.672  4.713   7.570   1.00 0.00 ? 77 ARG A CD   7  
ATOM 8763  N NE   . ARG A 1 77 ? -6.539  5.160   8.975   1.00 0.00 ? 77 ARG A NE   7  
ATOM 8764  C CZ   . ARG A 1 77 ? -5.961  4.435   9.942   1.00 0.00 ? 77 ARG A CZ   7  
ATOM 8765  N NH1  . ARG A 1 77 ? -5.459  3.224   9.662   1.00 0.00 ? 77 ARG A NH1  7  
ATOM 8766  N NH2  . ARG A 1 77 ? -5.885  4.920   11.189  1.00 0.00 ? 77 ARG A NH2  7  
ATOM 8767  H H    . ARG A 1 77 ? -3.225  5.795   3.730   1.00 0.00 ? 77 ARG A H    7  
ATOM 8768  H HA   . ARG A 1 77 ? -4.385  3.427   4.920   1.00 0.00 ? 77 ARG A HA   7  
ATOM 8769  H HB3  . ARG A 1 77 ? -6.561  5.017   5.088   1.00 0.00 ? 77 ARG A HB3  7  
ATOM 8770  H HG3  . ARG A 1 77 ? -4.722  5.606   7.339   1.00 0.00 ? 77 ARG A HG3  7  
ATOM 8771  H HD3  . ARG A 1 77 ? -7.012  3.678   7.539   1.00 0.00 ? 77 ARG A HD3  7  
ATOM 8772  H HE   . ARG A 1 77 ? -6.904  6.059   9.217   1.00 0.00 ? 77 ARG A HE   7  
ATOM 8773  H HH11 . ARG A 1 77 ? -5.515  2.862   8.732   1.00 0.00 ? 77 ARG A HH11 7  
ATOM 8774  H HH12 . ARG A 1 77 ? -5.027  2.683   10.384  1.00 0.00 ? 77 ARG A HH12 7  
ATOM 8775  H HH21 . ARG A 1 77 ? -6.259  5.823   11.397  1.00 0.00 ? 77 ARG A HH21 7  
ATOM 8776  H HH22 . ARG A 1 77 ? -5.454  4.379   11.910  1.00 0.00 ? 77 ARG A HH22 7  
ATOM 8777  N N    . PHE A 1 78 ? -5.644  3.053   2.791   1.00 0.00 ? 78 PHE A N    7  
ATOM 8778  C CA   . PHE A 1 78 ? -6.261  2.775   1.505   1.00 0.00 ? 78 PHE A CA   7  
ATOM 8779  C C    . PHE A 1 78 ? -7.734  3.184   1.502   1.00 0.00 ? 78 PHE A C    7  
ATOM 8780  O O    . PHE A 1 78 ? -8.370  3.236   2.554   1.00 0.00 ? 78 PHE A O    7  
ATOM 8781  C CB   . PHE A 1 78 ? -6.161  1.265   1.279   1.00 0.00 ? 78 PHE A CB   7  
ATOM 8782  C CG   . PHE A 1 78 ? -4.803  0.802   0.747   1.00 0.00 ? 78 PHE A CG   7  
ATOM 8783  C CD1  . PHE A 1 78 ? -3.659  1.349   1.238   1.00 0.00 ? 78 PHE A CD1  7  
ATOM 8784  C CD2  . PHE A 1 78 ? -4.741  -0.157  -0.216  1.00 0.00 ? 78 PHE A CD2  7  
ATOM 8785  C CE1  . PHE A 1 78 ? -2.399  0.920   0.744   1.00 0.00 ? 78 PHE A CE1  7  
ATOM 8786  C CE2  . PHE A 1 78 ? -3.480  -0.586  -0.709  1.00 0.00 ? 78 PHE A CE2  7  
ATOM 8787  C CZ   . PHE A 1 78 ? -2.336  -0.039  -0.218  1.00 0.00 ? 78 PHE A CZ   7  
ATOM 8788  H H    . PHE A 1 78 ? -5.584  2.268   3.409   1.00 0.00 ? 78 PHE A H    7  
ATOM 8789  H HA   . PHE A 1 78 ? -5.722  3.357   0.756   1.00 0.00 ? 78 PHE A HA   7  
ATOM 8790  H HB3  . PHE A 1 78 ? -6.938  0.962   0.575   1.00 0.00 ? 78 PHE A HB3  7  
ATOM 8791  H HD1  . PHE A 1 78 ? -3.710  2.117   2.009   1.00 0.00 ? 78 PHE A HD1  7  
ATOM 8792  H HD2  . PHE A 1 78 ? -5.658  -0.596  -0.609  1.00 0.00 ? 78 PHE A HD2  7  
ATOM 8793  H HE1  . PHE A 1 78 ? -1.482  1.358   1.138   1.00 0.00 ? 78 PHE A HE1  7  
ATOM 8794  H HE2  . PHE A 1 78 ? -3.429  -1.354  -1.481  1.00 0.00 ? 78 PHE A HE2  7  
ATOM 8795  H HZ   . PHE A 1 78 ? -1.368  -0.369  -0.597  1.00 0.00 ? 78 PHE A HZ   7  
ATOM 8796  N N    . LYS A 1 79 ? -8.236  3.465   0.308   1.00 0.00 ? 79 LYS A N    7  
ATOM 8797  C CA   . LYS A 1 79 ? -9.623  3.867   0.155   1.00 0.00 ? 79 LYS A CA   7  
ATOM 8798  C C    . LYS A 1 79 ? -10.214 3.188   -1.083  1.00 0.00 ? 79 LYS A C    7  
ATOM 8799  O O    . LYS A 1 79 ? -9.762  3.426   -2.202  1.00 0.00 ? 79 LYS A O    7  
ATOM 8800  C CB   . LYS A 1 79 ? -9.739  5.392   0.133   1.00 0.00 ? 79 LYS A CB   7  
ATOM 8801  C CG   . LYS A 1 79 ? -9.900  5.951   1.548   1.00 0.00 ? 79 LYS A CG   7  
ATOM 8802  C CD   . LYS A 1 79 ? -11.375 6.017   1.946   1.00 0.00 ? 79 LYS A CD   7  
ATOM 8803  C CE   . LYS A 1 79 ? -12.000 7.346   1.515   1.00 0.00 ? 79 LYS A CE   7  
ATOM 8804  N NZ   . LYS A 1 79 ? -12.111 8.265   2.669   1.00 0.00 ? 79 LYS A NZ   7  
ATOM 8805  H H    . LYS A 1 79 ? -7.712  3.419   -0.543  1.00 0.00 ? 79 LYS A H    7  
ATOM 8806  H HA   . LYS A 1 79 ? -10.164 3.516   1.033   1.00 0.00 ? 79 LYS A HA   7  
ATOM 8807  H HB3  . LYS A 1 79 ? -10.592 5.687   -0.479  1.00 0.00 ? 79 LYS A HB3  7  
ATOM 8808  H HG3  . LYS A 1 79 ? -9.460  6.947   1.602   1.00 0.00 ? 79 LYS A HG3  7  
ATOM 8809  H HD3  . LYS A 1 79 ? -11.471 5.900   3.026   1.00 0.00 ? 79 LYS A HD3  7  
ATOM 8810  H HE3  . LYS A 1 79 ? -12.987 7.169   1.088   1.00 0.00 ? 79 LYS A HE3  7  
ATOM 8811  H HZ1  . LYS A 1 79 ? -12.703 7.857   3.366   1.00 0.00 ? 79 LYS A HZ1  7  
ATOM 8812  H HZ2  . LYS A 1 79 ? -11.203 8.425   3.057   1.00 0.00 ? 79 LYS A HZ2  7  
ATOM 8813  H HZ3  . LYS A 1 79 ? -12.502 9.134   2.367   1.00 0.00 ? 79 LYS A HZ3  7  
ATOM 8814  N N    . LEU A 1 80 ? -11.214 2.354   -0.840  1.00 0.00 ? 80 LEU A N    7  
ATOM 8815  C CA   . LEU A 1 80 ? -11.871 1.638   -1.920  1.00 0.00 ? 80 LEU A CA   7  
ATOM 8816  C C    . LEU A 1 80 ? -13.035 2.480   -2.451  1.00 0.00 ? 80 LEU A C    7  
ATOM 8817  O O    . LEU A 1 80 ? -13.636 3.252   -1.706  1.00 0.00 ? 80 LEU A O    7  
ATOM 8818  C CB   . LEU A 1 80 ? -12.283 0.238   -1.463  1.00 0.00 ? 80 LEU A CB   7  
ATOM 8819  C CG   . LEU A 1 80 ? -11.190 -0.831  -1.506  1.00 0.00 ? 80 LEU A CG   7  
ATOM 8820  C CD1  . LEU A 1 80 ? -11.744 -2.200  -1.106  1.00 0.00 ? 80 LEU A CD1  7  
ATOM 8821  C CD2  . LEU A 1 80 ? -10.510 -0.866  -2.876  1.00 0.00 ? 80 LEU A CD2  7  
ATOM 8822  H H    . LEU A 1 80 ? -11.576 2.165   0.073   1.00 0.00 ? 80 LEU A H    7  
ATOM 8823  H HA   . LEU A 1 80 ? -11.142 1.515   -2.721  1.00 0.00 ? 80 LEU A HA   7  
ATOM 8824  H HB3  . LEU A 1 80 ? -13.114 -0.096  -2.084  1.00 0.00 ? 80 LEU A HB3  7  
ATOM 8825  H HG   . LEU A 1 80 ? -10.425 -0.567  -0.775  1.00 0.00 ? 80 LEU A HG   7  
ATOM 8826  H HD11 . LEU A 1 80 ? -12.001 -2.192  -0.047  1.00 0.00 ? 80 LEU A HD11 7  
ATOM 8827  H HD12 . LEU A 1 80 ? -12.635 -2.417  -1.694  1.00 0.00 ? 80 LEU A HD12 7  
ATOM 8828  H HD13 . LEU A 1 80 ? -10.991 -2.965  -1.292  1.00 0.00 ? 80 LEU A HD13 7  
ATOM 8829  H HD21 . LEU A 1 80 ? -10.403 -1.900  -3.203  1.00 0.00 ? 80 LEU A HD21 7  
ATOM 8830  H HD22 . LEU A 1 80 ? -11.119 -0.319  -3.597  1.00 0.00 ? 80 LEU A HD22 7  
ATOM 8831  H HD23 . LEU A 1 80 ? -9.526  -0.404  -2.806  1.00 0.00 ? 80 LEU A HD23 7  
ATOM 8832  N N    . LYS A 1 81 ? -13.316 2.300   -3.732  1.00 0.00 ? 81 LYS A N    7  
ATOM 8833  C CA   . LYS A 1 81 ? -14.397 3.033   -4.370  1.00 0.00 ? 81 LYS A CA   7  
ATOM 8834  C C    . LYS A 1 81 ? -15.679 2.853   -3.557  1.00 0.00 ? 81 LYS A C    7  
ATOM 8835  O O    . LYS A 1 81 ? -16.579 3.689   -3.618  1.00 0.00 ? 81 LYS A O    7  
ATOM 8836  C CB   . LYS A 1 81 ? -14.535 2.615   -5.836  1.00 0.00 ? 81 LYS A CB   7  
ATOM 8837  C CG   . LYS A 1 81 ? -15.125 1.207   -5.952  1.00 0.00 ? 81 LYS A CG   7  
ATOM 8838  C CD   . LYS A 1 81 ? -15.985 1.075   -7.210  1.00 0.00 ? 81 LYS A CD   7  
ATOM 8839  C CE   . LYS A 1 81 ? -16.917 -0.134  -7.113  1.00 0.00 ? 81 LYS A CE   7  
ATOM 8840  N NZ   . LYS A 1 81 ? -18.281 0.293   -6.731  1.00 0.00 ? 81 LYS A NZ   7  
ATOM 8841  H H    . LYS A 1 81 ? -12.821 1.669   -4.331  1.00 0.00 ? 81 LYS A H    7  
ATOM 8842  H HA   . LYS A 1 81 ? -14.126 4.088   -4.361  1.00 0.00 ? 81 LYS A HA   7  
ATOM 8843  H HB3  . LYS A 1 81 ? -13.559 2.645   -6.320  1.00 0.00 ? 81 LYS A HB3  7  
ATOM 8844  H HG3  . LYS A 1 81 ? -15.728 0.989   -5.070  1.00 0.00 ? 81 LYS A HG3  7  
ATOM 8845  H HD3  . LYS A 1 81 ? -15.341 0.973   -8.084  1.00 0.00 ? 81 LYS A HD3  7  
ATOM 8846  H HE3  . LYS A 1 81 ? -16.531 -0.839  -6.377  1.00 0.00 ? 81 LYS A HE3  7  
ATOM 8847  H HZ1  . LYS A 1 81 ? -18.747 -0.456  -6.261  1.00 0.00 ? 81 LYS A HZ1  7  
ATOM 8848  H HZ2  . LYS A 1 81 ? -18.225 1.084   -6.123  1.00 0.00 ? 81 LYS A HZ2  7  
ATOM 8849  H HZ3  . LYS A 1 81 ? -18.795 0.541   -7.553  1.00 0.00 ? 81 LYS A HZ3  7  
ATOM 8850  N N    . ARG A 1 82 ? -15.721 1.758   -2.812  1.00 0.00 ? 82 ARG A N    7  
ATOM 8851  C CA   . ARG A 1 82 ? -16.879 1.459   -1.986  1.00 0.00 ? 82 ARG A CA   7  
ATOM 8852  C C    . ARG A 1 82 ? -16.435 1.033   -0.585  1.00 0.00 ? 82 ARG A C    7  
ATOM 8853  O O    . ARG A 1 82 ? -15.336 0.511   -0.410  1.00 0.00 ? 82 ARG A O    7  
ATOM 8854  C CB   . ARG A 1 82 ? -17.725 0.345   -2.607  1.00 0.00 ? 82 ARG A CB   7  
ATOM 8855  C CG   . ARG A 1 82 ? -19.151 0.828   -2.881  1.00 0.00 ? 82 ARG A CG   7  
ATOM 8856  C CD   . ARG A 1 82 ? -20.178 -0.211  -2.427  1.00 0.00 ? 82 ARG A CD   7  
ATOM 8857  N NE   . ARG A 1 82 ? -21.512 0.123   -2.973  1.00 0.00 ? 82 ARG A NE   7  
ATOM 8858  C CZ   . ARG A 1 82 ? -21.839 0.026   -4.269  1.00 0.00 ? 82 ARG A CZ   7  
ATOM 8859  N NH1  . ARG A 1 82 ? -20.930 -0.396  -5.159  1.00 0.00 ? 82 ARG A NH1  7  
ATOM 8860  N NH2  . ARG A 1 82 ? -23.074 0.350   -4.676  1.00 0.00 ? 82 ARG A NH2  7  
ATOM 8861  H H    . ARG A 1 82 ? -14.985 1.083   -2.767  1.00 0.00 ? 82 ARG A H    7  
ATOM 8862  H HA   . ARG A 1 82 ? -17.445 2.389   -1.952  1.00 0.00 ? 82 ARG A HA   7  
ATOM 8863  H HB3  . ARG A 1 82 ? -17.750 -0.514  -1.937  1.00 0.00 ? 82 ARG A HB3  7  
ATOM 8864  H HG3  . ARG A 1 82 ? -19.274 1.024   -3.946  1.00 0.00 ? 82 ARG A HG3  7  
ATOM 8865  H HD3  . ARG A 1 82 ? -20.220 -0.242  -1.337  1.00 0.00 ? 82 ARG A HD3  7  
ATOM 8866  H HE   . ARG A 1 82 ? -22.214 0.442   -2.336  1.00 0.00 ? 82 ARG A HE   7  
ATOM 8867  H HH11 . ARG A 1 82 ? -20.008 -0.639  -4.857  1.00 0.00 ? 82 ARG A HH11 7  
ATOM 8868  H HH12 . ARG A 1 82 ? -21.173 -0.469  -6.126  1.00 0.00 ? 82 ARG A HH12 7  
ATOM 8869  H HH21 . ARG A 1 82 ? -23.752 0.665   -4.012  1.00 0.00 ? 82 ARG A HH21 7  
ATOM 8870  H HH22 . ARG A 1 82 ? -23.317 0.277   -5.643  1.00 0.00 ? 82 ARG A HH22 7  
ATOM 8871  N N    . PRO A 1 83 ? -17.338 1.277   0.402   1.00 0.00 ? 83 PRO A N    7  
ATOM 8872  C CA   . PRO A 1 83 ? -17.051 0.924   1.783   1.00 0.00 ? 83 PRO A CA   7  
ATOM 8873  C C    . PRO A 1 83 ? -17.171 -0.585  1.998   1.00 0.00 ? 83 PRO A C    7  
ATOM 8874  O O    . PRO A 1 83 ? -17.611 -1.311  1.108   1.00 0.00 ? 83 PRO A O    7  
ATOM 8875  C CB   . PRO A 1 83 ? -18.046 1.724   2.608   1.00 0.00 ? 83 PRO A CB   7  
ATOM 8876  C CG   . PRO A 1 83 ? -19.151 2.133   1.647   1.00 0.00 ? 83 PRO A CG   7  
ATOM 8877  C CD   . PRO A 1 83 ? -18.651 1.893   0.231   1.00 0.00 ? 83 PRO A CD   7  
ATOM 8878  H HA   . PRO A 1 83 ? -16.106 1.159   2.011   1.00 0.00 ? 83 PRO A HA   7  
ATOM 8879  H HB3  . PRO A 1 83 ? -17.571 2.599   3.052   1.00 0.00 ? 83 PRO A HB3  7  
ATOM 8880  H HG3  . PRO A 1 83 ? -19.409 3.183   1.788   1.00 0.00 ? 83 PRO A HG3  7  
ATOM 8881  H HD3  . PRO A 1 83 ? -18.580 2.826   -0.327  1.00 0.00 ? 83 PRO A HD3  7  
ATOM 8882  N N    . SER A 1 84 ? -16.774 -1.014  3.188   1.00 0.00 ? 84 SER A N    7  
ATOM 8883  C CA   . SER A 1 84 ? -16.832 -2.424  3.532   1.00 0.00 ? 84 SER A CA   7  
ATOM 8884  C C    . SER A 1 84 ? -16.342 -2.633  4.967   1.00 0.00 ? 84 SER A C    7  
ATOM 8885  O O    . SER A 1 84 ? -15.717 -1.747  5.547   1.00 0.00 ? 84 SER A O    7  
ATOM 8886  C CB   . SER A 1 84 ? -16.000 -3.263  2.561   1.00 0.00 ? 84 SER A CB   7  
ATOM 8887  O OG   . SER A 1 84 ? -14.620 -3.286  2.919   1.00 0.00 ? 84 SER A OG   7  
ATOM 8888  H H    . SER A 1 84 ? -16.418 -0.417  3.907   1.00 0.00 ? 84 SER A H    7  
ATOM 8889  H HA   . SER A 1 84 ? -17.882 -2.701  3.443   1.00 0.00 ? 84 SER A HA   7  
ATOM 8890  H HB3  . SER A 1 84 ? -16.105 -2.862  1.553   1.00 0.00 ? 84 SER A HB3  7  
ATOM 8891  H HG   . SER A 1 84 ? -14.087 -3.727  2.198   1.00 0.00 ? 84 SER A HG   7  
ATOM 8892  N N    . SER A 1 85 ? -16.645 -3.809  5.496   1.00 0.00 ? 85 SER A N    7  
ATOM 8893  C CA   . SER A 1 85 ? -16.244 -4.145  6.852   1.00 0.00 ? 85 SER A CA   7  
ATOM 8894  C C    . SER A 1 85 ? -14.895 -4.867  6.835   1.00 0.00 ? 85 SER A C    7  
ATOM 8895  O O    . SER A 1 85 ? -14.390 -5.221  5.771   1.00 0.00 ? 85 SER A O    7  
ATOM 8896  C CB   . SER A 1 85 ? -17.300 -5.010  7.540   1.00 0.00 ? 85 SER A CB   7  
ATOM 8897  O OG   . SER A 1 85 ? -17.405 -6.301  6.945   1.00 0.00 ? 85 SER A OG   7  
ATOM 8898  H H    . SER A 1 85 ? -17.154 -4.524  5.017   1.00 0.00 ? 85 SER A H    7  
ATOM 8899  H HA   . SER A 1 85 ? -16.160 -3.191  7.373   1.00 0.00 ? 85 SER A HA   7  
ATOM 8900  H HB3  . SER A 1 85 ? -18.267 -4.509  7.493   1.00 0.00 ? 85 SER A HB3  7  
ATOM 8901  H HG   . SER A 1 85 ? -18.197 -6.333  6.334   1.00 0.00 ? 85 SER A HG   7  
ATOM 8902  N N    . GLY A 1 86 ? -14.350 -5.064  8.026   1.00 0.00 ? 86 GLY A N    7  
ATOM 8903  C CA   . GLY A 1 86 ? -13.069 -5.738  8.161   1.00 0.00 ? 86 GLY A CA   7  
ATOM 8904  C C    . GLY A 1 86 ? -12.528 -5.605  9.585   1.00 0.00 ? 86 GLY A C    7  
ATOM 8905  O O    . GLY A 1 86 ? -11.737 -4.707  9.872   1.00 0.00 ? 86 GLY A O    7  
ATOM 8906  H H    . GLY A 1 86 ? -14.767 -4.773  8.887   1.00 0.00 ? 86 GLY A H    7  
ATOM 8907  H HA2  . GLY A 1 86 ? -13.181 -6.792  7.907   1.00 0.00 ? 86 GLY A HA2  7  
ATOM 8908  H HA3  . GLY A 1 86 ? -12.355 -5.314  7.455   1.00 0.00 ? 86 GLY A HA3  7  
ATOM 8909  N N    . PRO A 1 87 ? -12.986 -6.537  10.464  1.00 0.00 ? 87 PRO A N    7  
ATOM 8910  C CA   . PRO A 1 87 ? -12.556 -6.533  11.852  1.00 0.00 ? 87 PRO A CA   7  
ATOM 8911  C C    . PRO A 1 87 ? -11.126 -7.061  11.984  1.00 0.00 ? 87 PRO A C    7  
ATOM 8912  O O    . PRO A 1 87 ? -10.881 -8.025  12.708  1.00 0.00 ? 87 PRO A O    7  
ATOM 8913  C CB   . PRO A 1 87 ? -13.575 -7.390  12.582  1.00 0.00 ? 87 PRO A CB   7  
ATOM 8914  C CG   . PRO A 1 87 ? -14.267 -8.219  11.512  1.00 0.00 ? 87 PRO A CG   7  
ATOM 8915  C CD   . PRO A 1 87 ? -13.922 -7.616  10.160  1.00 0.00 ? 87 PRO A CD   7  
ATOM 8916  H HA   . PRO A 1 87 ? -12.535 -5.597  12.206  1.00 0.00 ? 87 PRO A HA   7  
ATOM 8917  H HB3  . PRO A 1 87 ? -14.293 -6.771  13.122  1.00 0.00 ? 87 PRO A HB3  7  
ATOM 8918  H HG3  . PRO A 1 87 ? -15.346 -8.218  11.666  1.00 0.00 ? 87 PRO A HG3  7  
ATOM 8919  H HD3  . PRO A 1 87 ? -14.812 -7.238  9.657   1.00 0.00 ? 87 PRO A HD3  7  
ATOM 8920  N N    . SER A 1 88 ? -10.219 -6.406  11.274  1.00 0.00 ? 88 SER A N    7  
ATOM 8921  C CA   . SER A 1 88 ? -8.820  -6.797  11.303  1.00 0.00 ? 88 SER A CA   7  
ATOM 8922  C C    . SER A 1 88 ? -8.702  -8.323  11.256  1.00 0.00 ? 88 SER A C    7  
ATOM 8923  O O    . SER A 1 88 ? -8.673  -8.978  12.296  1.00 0.00 ? 88 SER A O    7  
ATOM 8924  C CB   . SER A 1 88 ? -8.121  -6.250  12.548  1.00 0.00 ? 88 SER A CB   7  
ATOM 8925  O OG   . SER A 1 88 ? -6.865  -5.652  12.235  1.00 0.00 ? 88 SER A OG   7  
ATOM 8926  H H    . SER A 1 88 ? -10.427 -5.623  10.688  1.00 0.00 ? 88 SER A H    7  
ATOM 8927  H HA   . SER A 1 88 ? -8.377  -6.351  10.412  1.00 0.00 ? 88 SER A HA   7  
ATOM 8928  H HB3  . SER A 1 88 ? -7.969  -7.057  13.265  1.00 0.00 ? 88 SER A HB3  7  
ATOM 8929  H HG   . SER A 1 88 ? -6.124  -6.301  12.409  1.00 0.00 ? 88 SER A HG   7  
ATOM 8930  N N    . SER A 1 89 ? -8.637  -8.841  10.039  1.00 0.00 ? 89 SER A N    7  
ATOM 8931  C CA   . SER A 1 89 ? -8.524  -10.277 9.843   1.00 0.00 ? 89 SER A CA   7  
ATOM 8932  C C    . SER A 1 89 ? -7.383  -10.584 8.870   1.00 0.00 ? 89 SER A C    7  
ATOM 8933  O O    . SER A 1 89 ? -7.547  -10.462 7.657   1.00 0.00 ? 89 SER A O    7  
ATOM 8934  C CB   . SER A 1 89 ? -9.836  -10.868 9.324   1.00 0.00 ? 89 SER A CB   7  
ATOM 8935  O OG   . SER A 1 89 ? -10.038 -12.202 9.782   1.00 0.00 ? 89 SER A OG   7  
ATOM 8936  H H    . SER A 1 89 ? -8.661  -8.301  9.198   1.00 0.00 ? 89 SER A H    7  
ATOM 8937  H HA   . SER A 1 89 ? -8.307  -10.687 10.829  1.00 0.00 ? 89 SER A HA   7  
ATOM 8938  H HB3  . SER A 1 89 ? -9.834  -10.855 8.234   1.00 0.00 ? 89 SER A HB3  7  
ATOM 8939  H HG   . SER A 1 89 ? -9.658  -12.851 9.123   1.00 0.00 ? 89 SER A HG   7  
ATOM 8940  N N    . GLY A 1 90 ? -6.252  -10.974 9.439   1.00 0.00 ? 90 GLY A N    7  
ATOM 8941  C CA   . GLY A 1 90 ? -5.084  -11.299 8.638   1.00 0.00 ? 90 GLY A CA   7  
ATOM 8942  C C    . GLY A 1 90 ? -4.122  -10.111 8.564   1.00 0.00 ? 90 GLY A C    7  
ATOM 8943  O O    . GLY A 1 90 ? -3.689  -9.725  7.480   1.00 0.00 ? 90 GLY A O    7  
ATOM 8944  H H    . GLY A 1 90 ? -6.127  -11.070 10.426  1.00 0.00 ? 90 GLY A H    7  
ATOM 8945  H HA2  . GLY A 1 90 ? -4.572  -12.160 9.067   1.00 0.00 ? 90 GLY A HA2  7  
ATOM 8946  H HA3  . GLY A 1 90 ? -5.396  -11.581 7.632   1.00 0.00 ? 90 GLY A HA3  7  
ATOM 8947  N N    . GLY A 1 1  ? -1.171  -13.991 7.270   1.00 0.00 ? 1  GLY A N    8  
ATOM 8948  C CA   . GLY A 1 1  ? -0.037  -14.018 8.178   1.00 0.00 ? 1  GLY A CA   8  
ATOM 8949  C C    . GLY A 1 1  ? 1.234   -14.466 7.454   1.00 0.00 ? 1  GLY A C    8  
ATOM 8950  O O    . GLY A 1 1  ? 1.169   -14.986 6.340   1.00 0.00 ? 1  GLY A O    8  
ATOM 8951  H H1   . GLY A 1 1  ? -1.124  -14.645 6.516   1.00 0.00 ? 1  GLY A H1   8  
ATOM 8952  H HA2  . GLY A 1 1  ? 0.115   -13.028 8.606   1.00 0.00 ? 1  GLY A HA2  8  
ATOM 8953  H HA3  . GLY A 1 1  ? -0.245  -14.694 9.006   1.00 0.00 ? 1  GLY A HA3  8  
ATOM 8954  N N    . SER A 1 2  ? 2.362   -14.249 8.115   1.00 0.00 ? 2  SER A N    8  
ATOM 8955  C CA   . SER A 1 2  ? 3.647   -14.624 7.549   1.00 0.00 ? 2  SER A CA   8  
ATOM 8956  C C    . SER A 1 2  ? 4.770   -14.282 8.528   1.00 0.00 ? 2  SER A C    8  
ATOM 8957  O O    . SER A 1 2  ? 4.540   -13.612 9.533   1.00 0.00 ? 2  SER A O    8  
ATOM 8958  C CB   . SER A 1 2  ? 3.881   -13.929 6.206   1.00 0.00 ? 2  SER A CB   8  
ATOM 8959  O OG   . SER A 1 2  ? 4.720   -14.696 5.347   1.00 0.00 ? 2  SER A OG   8  
ATOM 8960  H H    . SER A 1 2  ? 2.407   -13.826 9.020   1.00 0.00 ? 2  SER A H    8  
ATOM 8961  H HA   . SER A 1 2  ? 3.590   -15.702 7.393   1.00 0.00 ? 2  SER A HA   8  
ATOM 8962  H HB3  . SER A 1 2  ? 4.333   -12.952 6.378   1.00 0.00 ? 2  SER A HB3  8  
ATOM 8963  H HG   . SER A 1 2  ? 4.921   -15.580 5.766   1.00 0.00 ? 2  SER A HG   8  
ATOM 8964  N N    . SER A 1 3  ? 5.963   -14.756 8.200   1.00 0.00 ? 3  SER A N    8  
ATOM 8965  C CA   . SER A 1 3  ? 7.124   -14.508 9.038   1.00 0.00 ? 3  SER A CA   8  
ATOM 8966  C C    . SER A 1 3  ? 8.380   -14.393 8.171   1.00 0.00 ? 3  SER A C    8  
ATOM 8967  O O    . SER A 1 3  ? 8.694   -15.299 7.403   1.00 0.00 ? 3  SER A O    8  
ATOM 8968  C CB   . SER A 1 3  ? 7.298   -15.616 10.079  1.00 0.00 ? 3  SER A CB   8  
ATOM 8969  O OG   . SER A 1 3  ? 7.401   -15.094 11.401  1.00 0.00 ? 3  SER A OG   8  
ATOM 8970  H H    . SER A 1 3  ? 6.142   -15.301 7.380   1.00 0.00 ? 3  SER A H    8  
ATOM 8971  H HA   . SER A 1 3  ? 6.919   -13.564 9.543   1.00 0.00 ? 3  SER A HA   8  
ATOM 8972  H HB3  . SER A 1 3  ? 8.192   -16.195 9.847   1.00 0.00 ? 3  SER A HB3  8  
ATOM 8973  H HG   . SER A 1 3  ? 6.940   -14.209 11.456  1.00 0.00 ? 3  SER A HG   8  
ATOM 8974  N N    . GLY A 1 4  ? 9.064   -13.268 8.325   1.00 0.00 ? 4  GLY A N    8  
ATOM 8975  C CA   . GLY A 1 4  ? 10.279  -13.022 7.567   1.00 0.00 ? 4  GLY A CA   8  
ATOM 8976  C C    . GLY A 1 4  ? 10.446  -11.530 7.268   1.00 0.00 ? 4  GLY A C    8  
ATOM 8977  O O    . GLY A 1 4  ? 10.686  -10.736 8.176   1.00 0.00 ? 4  GLY A O    8  
ATOM 8978  H H    . GLY A 1 4  ? 8.802   -12.535 8.953   1.00 0.00 ? 4  GLY A H    8  
ATOM 8979  H HA2  . GLY A 1 4  ? 11.141  -13.384 8.126   1.00 0.00 ? 4  GLY A HA2  8  
ATOM 8980  H HA3  . GLY A 1 4  ? 10.248  -13.582 6.632   1.00 0.00 ? 4  GLY A HA3  8  
ATOM 8981  N N    . SER A 1 5  ? 10.312  -11.196 5.994   1.00 0.00 ? 5  SER A N    8  
ATOM 8982  C CA   . SER A 1 5  ? 10.445  -9.814  5.566   1.00 0.00 ? 5  SER A CA   8  
ATOM 8983  C C    . SER A 1 5  ? 11.876  -9.327  5.804   1.00 0.00 ? 5  SER A C    8  
ATOM 8984  O O    . SER A 1 5  ? 12.415  -9.486  6.898   1.00 0.00 ? 5  SER A O    8  
ATOM 8985  C CB   . SER A 1 5  ? 9.449   -8.911  6.297   1.00 0.00 ? 5  SER A CB   8  
ATOM 8986  O OG   . SER A 1 5  ? 8.109   -9.376  6.163   1.00 0.00 ? 5  SER A OG   8  
ATOM 8987  H H    . SER A 1 5  ? 10.116  -11.848 5.262   1.00 0.00 ? 5  SER A H    8  
ATOM 8988  H HA   . SER A 1 5  ? 10.215  -9.818  4.500   1.00 0.00 ? 5  SER A HA   8  
ATOM 8989  H HB3  . SER A 1 5  ? 9.523   -7.897  5.904   1.00 0.00 ? 5  SER A HB3  8  
ATOM 8990  H HG   . SER A 1 5  ? 7.511   -8.622  5.891   1.00 0.00 ? 5  SER A HG   8  
ATOM 8991  N N    . SER A 1 6  ? 12.451  -8.746  4.761   1.00 0.00 ? 6  SER A N    8  
ATOM 8992  C CA   . SER A 1 6  ? 13.809  -8.235  4.844   1.00 0.00 ? 6  SER A CA   8  
ATOM 8993  C C    . SER A 1 6  ? 14.127  -7.393  3.607   1.00 0.00 ? 6  SER A C    8  
ATOM 8994  O O    . SER A 1 6  ? 14.466  -7.932  2.554   1.00 0.00 ? 6  SER A O    8  
ATOM 8995  C CB   . SER A 1 6  ? 14.819  -9.377  4.983   1.00 0.00 ? 6  SER A CB   8  
ATOM 8996  O OG   . SER A 1 6  ? 14.943  -9.817  6.333   1.00 0.00 ? 6  SER A OG   8  
ATOM 8997  H H    . SER A 1 6  ? 12.006  -8.621  3.875   1.00 0.00 ? 6  SER A H    8  
ATOM 8998  H HA   . SER A 1 6  ? 13.832  -7.620  5.743   1.00 0.00 ? 6  SER A HA   8  
ATOM 8999  H HB3  . SER A 1 6  ? 15.790  -9.047  4.618   1.00 0.00 ? 6  SER A HB3  8  
ATOM 9000  H HG   . SER A 1 6  ? 14.070  -10.181 6.657   1.00 0.00 ? 6  SER A HG   8  
ATOM 9001  N N    . GLY A 1 7  ? 14.007  -6.084  3.774   1.00 0.00 ? 7  GLY A N    8  
ATOM 9002  C CA   . GLY A 1 7  ? 14.278  -5.163  2.685   1.00 0.00 ? 7  GLY A CA   8  
ATOM 9003  C C    . GLY A 1 7  ? 13.311  -3.977  2.716   1.00 0.00 ? 7  GLY A C    8  
ATOM 9004  O O    . GLY A 1 7  ? 12.123  -4.147  2.987   1.00 0.00 ? 7  GLY A O    8  
ATOM 9005  H H    . GLY A 1 7  ? 13.730  -5.653  4.633   1.00 0.00 ? 7  GLY A H    8  
ATOM 9006  H HA2  . GLY A 1 7  ? 15.304  -4.801  2.755   1.00 0.00 ? 7  GLY A HA2  8  
ATOM 9007  H HA3  . GLY A 1 7  ? 14.188  -5.684  1.732   1.00 0.00 ? 7  GLY A HA3  8  
ATOM 9008  N N    . LEU A 1 8  ? 13.857  -2.802  2.438   1.00 0.00 ? 8  LEU A N    8  
ATOM 9009  C CA   . LEU A 1 8  ? 13.058  -1.589  2.431   1.00 0.00 ? 8  LEU A CA   8  
ATOM 9010  C C    . LEU A 1 8  ? 11.854  -1.780  1.508   1.00 0.00 ? 8  LEU A C    8  
ATOM 9011  O O    . LEU A 1 8  ? 10.710  -1.624  1.932   1.00 0.00 ? 8  LEU A O    8  
ATOM 9012  C CB   . LEU A 1 8  ? 13.923  -0.379  2.070   1.00 0.00 ? 8  LEU A CB   8  
ATOM 9013  C CG   . LEU A 1 8  ? 14.577  0.352   3.244   1.00 0.00 ? 8  LEU A CG   8  
ATOM 9014  C CD1  . LEU A 1 8  ? 15.276  1.629   2.774   1.00 0.00 ? 8  LEU A CD1  8  
ATOM 9015  C CD2  . LEU A 1 8  ? 13.558  0.631   4.352   1.00 0.00 ? 8  LEU A CD2  8  
ATOM 9016  H H    . LEU A 1 8  ? 14.824  -2.672  2.219   1.00 0.00 ? 8  LEU A H    8  
ATOM 9017  H HA   . LEU A 1 8  ? 12.693  -1.432  3.446   1.00 0.00 ? 8  LEU A HA   8  
ATOM 9018  H HB3  . LEU A 1 8  ? 13.307  0.333   1.522   1.00 0.00 ? 8  LEU A HB3  8  
ATOM 9019  H HG   . LEU A 1 8  ? 15.344  -0.297  3.668   1.00 0.00 ? 8  LEU A HG   8  
ATOM 9020  H HD11 . LEU A 1 8  ? 15.700  2.148   3.634   1.00 0.00 ? 8  LEU A HD11 8  
ATOM 9021  H HD12 . LEU A 1 8  ? 16.072  1.372   2.076   1.00 0.00 ? 8  LEU A HD12 8  
ATOM 9022  H HD13 . LEU A 1 8  ? 14.553  2.278   2.278   1.00 0.00 ? 8  LEU A HD13 8  
ATOM 9023  H HD21 . LEU A 1 8  ? 13.400  -0.276  4.936   1.00 0.00 ? 8  LEU A HD21 8  
ATOM 9024  H HD22 . LEU A 1 8  ? 13.935  1.420   5.003   1.00 0.00 ? 8  LEU A HD22 8  
ATOM 9025  H HD23 . LEU A 1 8  ? 12.615  0.946   3.907   1.00 0.00 ? 8  LEU A HD23 8  
ATOM 9026  N N    . ARG A 1 9  ? 12.153  -2.117  0.261   1.00 0.00 ? 9  ARG A N    8  
ATOM 9027  C CA   . ARG A 1 9  ? 11.108  -2.331  -0.727  1.00 0.00 ? 9  ARG A CA   8  
ATOM 9028  C C    . ARG A 1 9  ? 10.254  -3.541  -0.343  1.00 0.00 ? 9  ARG A C    8  
ATOM 9029  O O    . ARG A 1 9  ? 9.063   -3.584  -0.640  1.00 0.00 ? 9  ARG A O    8  
ATOM 9030  C CB   . ARG A 1 9  ? 11.704  -2.558  -2.118  1.00 0.00 ? 9  ARG A CB   8  
ATOM 9031  C CG   . ARG A 1 9  ? 10.617  -2.519  -3.193  1.00 0.00 ? 9  ARG A CG   8  
ATOM 9032  C CD   . ARG A 1 9  ? 10.565  -3.837  -3.968  1.00 0.00 ? 9  ARG A CD   8  
ATOM 9033  N NE   . ARG A 1 9  ? 9.330   -3.897  -4.783  1.00 0.00 ? 9  ARG A NE   8  
ATOM 9034  C CZ   . ARG A 1 9  ? 9.015   -4.914  -5.596  1.00 0.00 ? 9  ARG A CZ   8  
ATOM 9035  N NH1  . ARG A 1 9  ? 9.842   -5.962  -5.708  1.00 0.00 ? 9  ARG A NH1  8  
ATOM 9036  N NH2  . ARG A 1 9  ? 7.874   -4.882  -6.298  1.00 0.00 ? 9  ARG A NH2  8  
ATOM 9037  H H    . ARG A 1 9  ? 13.085  -2.240  -0.077  1.00 0.00 ? 9  ARG A H    8  
ATOM 9038  H HA   . ARG A 1 9  ? 10.518  -1.415  -0.713  1.00 0.00 ? 9  ARG A HA   8  
ATOM 9039  H HB3  . ARG A 1 9  ? 12.215  -3.521  -2.147  1.00 0.00 ? 9  ARG A HB3  8  
ATOM 9040  H HG3  . ARG A 1 9  ? 10.810  -1.696  -3.881  1.00 0.00 ? 9  ARG A HG3  8  
ATOM 9041  H HD3  . ARG A 1 9  ? 10.593  -4.678  -3.275  1.00 0.00 ? 9  ARG A HD3  8  
ATOM 9042  H HE   . ARG A 1 9  ? 8.692   -3.129  -4.723  1.00 0.00 ? 9  ARG A HE   8  
ATOM 9043  H HH11 . ARG A 1 9  ? 10.693  -5.986  -5.185  1.00 0.00 ? 9  ARG A HH11 8  
ATOM 9044  H HH12 . ARG A 1 9  ? 9.607   -6.721  -6.315  1.00 0.00 ? 9  ARG A HH12 8  
ATOM 9045  H HH21 . ARG A 1 9  ? 7.258   -4.099  -6.214  1.00 0.00 ? 9  ARG A HH21 8  
ATOM 9046  H HH22 . ARG A 1 9  ? 7.639   -5.641  -6.904  1.00 0.00 ? 9  ARG A HH22 8  
ATOM 9047  N N    . LYS A 1 10 ? 10.899  -4.495  0.314   1.00 0.00 ? 10 LYS A N    8  
ATOM 9048  C CA   . LYS A 1 10 ? 10.214  -5.703  0.743   1.00 0.00 ? 10 LYS A CA   8  
ATOM 9049  C C    . LYS A 1 10 ? 9.283   -5.369  1.910   1.00 0.00 ? 10 LYS A C    8  
ATOM 9050  O O    . LYS A 1 10 ? 8.267   -6.033  2.109   1.00 0.00 ? 10 LYS A O    8  
ATOM 9051  C CB   . LYS A 1 10 ? 11.223  -6.809  1.057   1.00 0.00 ? 10 LYS A CB   8  
ATOM 9052  C CG   . LYS A 1 10 ? 10.546  -7.983  1.768   1.00 0.00 ? 10 LYS A CG   8  
ATOM 9053  C CD   . LYS A 1 10 ? 9.384   -8.529  0.938   1.00 0.00 ? 10 LYS A CD   8  
ATOM 9054  C CE   . LYS A 1 10 ? 9.894   -9.346  -0.250  1.00 0.00 ? 10 LYS A CE   8  
ATOM 9055  N NZ   . LYS A 1 10 ? 8.890   -10.355 -0.657  1.00 0.00 ? 10 LYS A NZ   8  
ATOM 9056  H H    . LYS A 1 10 ? 11.869  -4.452  0.552   1.00 0.00 ? 10 LYS A H    8  
ATOM 9057  H HA   . LYS A 1 10 ? 9.607   -6.049  -0.094  1.00 0.00 ? 10 LYS A HA   8  
ATOM 9058  H HB3  . LYS A 1 10 ? 12.021  -6.410  1.684   1.00 0.00 ? 10 LYS A HB3  8  
ATOM 9059  H HG3  . LYS A 1 10 ? 10.182  -7.660  2.743   1.00 0.00 ? 10 LYS A HG3  8  
ATOM 9060  H HD3  . LYS A 1 10 ? 8.768   -7.704  0.579   1.00 0.00 ? 10 LYS A HD3  8  
ATOM 9061  H HE3  . LYS A 1 10 ? 10.828  -9.841  0.015   1.00 0.00 ? 10 LYS A HE3  8  
ATOM 9062  H HZ1  . LYS A 1 10 ? 8.114   -9.897  -1.089  1.00 0.00 ? 10 LYS A HZ1  8  
ATOM 9063  H HZ2  . LYS A 1 10 ? 9.304   -10.994 -1.305  1.00 0.00 ? 10 LYS A HZ2  8  
ATOM 9064  H HZ3  . LYS A 1 10 ? 8.574   -10.854 0.150   1.00 0.00 ? 10 LYS A HZ3  8  
ATOM 9065  N N    . MET A 1 11 ? 9.664   -4.339  2.653   1.00 0.00 ? 11 MET A N    8  
ATOM 9066  C CA   . MET A 1 11 ? 8.876   -3.909  3.795   1.00 0.00 ? 11 MET A CA   8  
ATOM 9067  C C    . MET A 1 11 ? 7.567   -3.258  3.345   1.00 0.00 ? 11 MET A C    8  
ATOM 9068  O O    . MET A 1 11 ? 6.489   -3.648  3.791   1.00 0.00 ? 11 MET A O    8  
ATOM 9069  C CB   . MET A 1 11 ? 9.684   -2.909  4.626   1.00 0.00 ? 11 MET A CB   8  
ATOM 9070  C CG   . MET A 1 11 ? 10.777  -3.620  5.426   1.00 0.00 ? 11 MET A CG   8  
ATOM 9071  S SD   . MET A 1 11 ? 10.711  -3.109  7.136   1.00 0.00 ? 11 MET A SD   8  
ATOM 9072  C CE   . MET A 1 11 ? 11.807  -1.702  7.081   1.00 0.00 ? 11 MET A CE   8  
ATOM 9073  H H    . MET A 1 11 ? 10.491  -3.803  2.483   1.00 0.00 ? 11 MET A H    8  
ATOM 9074  H HA   . MET A 1 11 ? 8.663   -4.816  4.361   1.00 0.00 ? 11 MET A HA   8  
ATOM 9075  H HB3  . MET A 1 11 ? 9.020   -2.374  5.304   1.00 0.00 ? 11 MET A HB3  8  
ATOM 9076  H HG3  . MET A 1 11 ? 11.756  -3.387  5.006   1.00 0.00 ? 11 MET A HG3  8  
ATOM 9077  H HE1  . MET A 1 11 ? 11.966  -1.326  8.093   1.00 0.00 ? 11 MET A HE1  8  
ATOM 9078  H HE2  . MET A 1 11 ? 12.762  -2.002  6.652   1.00 0.00 ? 11 MET A HE2  8  
ATOM 9079  H HE3  . MET A 1 11 ? 11.363  -0.918  6.468   1.00 0.00 ? 11 MET A HE3  8  
ATOM 9080  N N    . VAL A 1 12 ? 7.702   -2.276  2.465   1.00 0.00 ? 12 VAL A N    8  
ATOM 9081  C CA   . VAL A 1 12 ? 6.544   -1.567  1.949   1.00 0.00 ? 12 VAL A CA   8  
ATOM 9082  C C    . VAL A 1 12 ? 5.704   -2.522  1.099   1.00 0.00 ? 12 VAL A C    8  
ATOM 9083  O O    . VAL A 1 12 ? 4.481   -2.400  1.047   1.00 0.00 ? 12 VAL A O    8  
ATOM 9084  C CB   . VAL A 1 12 ? 6.991   -0.321  1.183   1.00 0.00 ? 12 VAL A CB   8  
ATOM 9085  C CG1  . VAL A 1 12 ? 8.219   -0.620  0.319   1.00 0.00 ? 12 VAL A CG1  8  
ATOM 9086  C CG2  . VAL A 1 12 ? 5.848   0.241   0.336   1.00 0.00 ? 12 VAL A CG2  8  
ATOM 9087  H H    . VAL A 1 12 ? 8.582   -1.965  2.106   1.00 0.00 ? 12 VAL A H    8  
ATOM 9088  H HA   . VAL A 1 12 ? 5.950   -1.243  2.804   1.00 0.00 ? 12 VAL A HA   8  
ATOM 9089  H HB   . VAL A 1 12 ? 7.272   0.439   1.912   1.00 0.00 ? 12 VAL A HB   8  
ATOM 9090  H HG11 . VAL A 1 12 ? 8.333   -1.698  0.212   1.00 0.00 ? 12 VAL A HG11 8  
ATOM 9091  H HG12 . VAL A 1 12 ? 8.090   -0.169  -0.666  1.00 0.00 ? 12 VAL A HG12 8  
ATOM 9092  H HG13 . VAL A 1 12 ? 9.107   -0.206  0.795   1.00 0.00 ? 12 VAL A HG13 8  
ATOM 9093  H HG21 . VAL A 1 12 ? 6.123   1.229   -0.036  1.00 0.00 ? 12 VAL A HG21 8  
ATOM 9094  H HG22 . VAL A 1 12 ? 5.660   -0.424  -0.507  1.00 0.00 ? 12 VAL A HG22 8  
ATOM 9095  H HG23 . VAL A 1 12 ? 4.948   0.319   0.944   1.00 0.00 ? 12 VAL A HG23 8  
ATOM 9096  N N    . GLU A 1 13 ? 6.393   -3.452  0.455   1.00 0.00 ? 13 GLU A N    8  
ATOM 9097  C CA   . GLU A 1 13 ? 5.726   -4.428  -0.390  1.00 0.00 ? 13 GLU A CA   8  
ATOM 9098  C C    . GLU A 1 13 ? 4.540   -5.048  0.351   1.00 0.00 ? 13 GLU A C    8  
ATOM 9099  O O    . GLU A 1 13 ? 3.443   -5.148  -0.198  1.00 0.00 ? 13 GLU A O    8  
ATOM 9100  C CB   . GLU A 1 13 ? 6.703   -5.507  -0.860  1.00 0.00 ? 13 GLU A CB   8  
ATOM 9101  C CG   . GLU A 1 13 ? 7.486   -5.040  -2.090  1.00 0.00 ? 13 GLU A CG   8  
ATOM 9102  C CD   . GLU A 1 13 ? 6.871   -5.597  -3.375  1.00 0.00 ? 13 GLU A CD   8  
ATOM 9103  O OE1  . GLU A 1 13 ? 5.720   -5.209  -3.668  1.00 0.00 ? 13 GLU A OE1  8  
ATOM 9104  O OE2  . GLU A 1 13 ? 7.565   -6.400  -4.035  1.00 0.00 ? 13 GLU A OE2  8  
ATOM 9105  H H    . GLU A 1 13 ? 7.388   -3.545  0.503   1.00 0.00 ? 13 GLU A H    8  
ATOM 9106  H HA   . GLU A 1 13 ? 5.370   -3.868  -1.254  1.00 0.00 ? 13 GLU A HA   8  
ATOM 9107  H HB3  . GLU A 1 13 ? 6.157   -6.420  -1.097  1.00 0.00 ? 13 GLU A HB3  8  
ATOM 9108  H HG3  . GLU A 1 13 ? 8.524   -5.363  -2.009  1.00 0.00 ? 13 GLU A HG3  8  
ATOM 9109  N N    . GLU A 1 14 ? 4.799   -5.451  1.586   1.00 0.00 ? 14 GLU A N    8  
ATOM 9110  C CA   . GLU A 1 14 ? 3.767   -6.058  2.408   1.00 0.00 ? 14 GLU A CA   8  
ATOM 9111  C C    . GLU A 1 14 ? 2.750   -5.004  2.850   1.00 0.00 ? 14 GLU A C    8  
ATOM 9112  O O    . GLU A 1 14 ? 1.548   -5.264  2.865   1.00 0.00 ? 14 GLU A O    8  
ATOM 9113  C CB   . GLU A 1 14 ? 4.377   -6.772  3.617   1.00 0.00 ? 14 GLU A CB   8  
ATOM 9114  C CG   . GLU A 1 14 ? 4.442   -5.839  4.829   1.00 0.00 ? 14 GLU A CG   8  
ATOM 9115  C CD   . GLU A 1 14 ? 5.274   -6.458  5.953   1.00 0.00 ? 14 GLU A CD   8  
ATOM 9116  O OE1  . GLU A 1 14 ? 6.485   -6.660  5.719   1.00 0.00 ? 14 GLU A OE1  8  
ATOM 9117  O OE2  . GLU A 1 14 ? 4.680   -6.716  7.022   1.00 0.00 ? 14 GLU A OE2  8  
ATOM 9118  H H    . GLU A 1 14 ? 5.694   -5.366  2.025   1.00 0.00 ? 14 GLU A H    8  
ATOM 9119  H HA   . GLU A 1 14 ? 3.282   -6.794  1.767   1.00 0.00 ? 14 GLU A HA   8  
ATOM 9120  H HB3  . GLU A 1 14 ? 5.379   -7.122  3.369   1.00 0.00 ? 14 GLU A HB3  8  
ATOM 9121  H HG3  . GLU A 1 14 ? 3.434   -5.633  5.188   1.00 0.00 ? 14 GLU A HG3  8  
ATOM 9122  N N    . VAL A 1 15 ? 3.270   -3.836  3.198   1.00 0.00 ? 15 VAL A N    8  
ATOM 9123  C CA   . VAL A 1 15 ? 2.423   -2.741  3.639   1.00 0.00 ? 15 VAL A CA   8  
ATOM 9124  C C    . VAL A 1 15 ? 1.238   -2.601  2.680   1.00 0.00 ? 15 VAL A C    8  
ATOM 9125  O O    . VAL A 1 15 ? 0.112   -2.959  3.022   1.00 0.00 ? 15 VAL A O    8  
ATOM 9126  C CB   . VAL A 1 15 ? 3.247   -1.458  3.762   1.00 0.00 ? 15 VAL A CB   8  
ATOM 9127  C CG1  . VAL A 1 15 ? 2.341   -0.244  3.982   1.00 0.00 ? 15 VAL A CG1  8  
ATOM 9128  C CG2  . VAL A 1 15 ? 4.283   -1.578  4.880   1.00 0.00 ? 15 VAL A CG2  8  
ATOM 9129  H H    . VAL A 1 15 ? 4.249   -3.633  3.183   1.00 0.00 ? 15 VAL A H    8  
ATOM 9130  H HA   . VAL A 1 15 ? 2.044   -2.996  4.629   1.00 0.00 ? 15 VAL A HA   8  
ATOM 9131  H HB   . VAL A 1 15 ? 3.782   -1.312  2.824   1.00 0.00 ? 15 VAL A HB   8  
ATOM 9132  H HG11 . VAL A 1 15 ? 1.945   0.091   3.023   1.00 0.00 ? 15 VAL A HG11 8  
ATOM 9133  H HG12 . VAL A 1 15 ? 1.518   -0.520  4.640   1.00 0.00 ? 15 VAL A HG12 8  
ATOM 9134  H HG13 . VAL A 1 15 ? 2.918   0.560   4.438   1.00 0.00 ? 15 VAL A HG13 8  
ATOM 9135  H HG21 . VAL A 1 15 ? 5.065   -0.832  4.734   1.00 0.00 ? 15 VAL A HG21 8  
ATOM 9136  H HG22 . VAL A 1 15 ? 3.800   -1.413  5.844   1.00 0.00 ? 15 VAL A HG22 8  
ATOM 9137  H HG23 . VAL A 1 15 ? 4.724   -2.576  4.862   1.00 0.00 ? 15 VAL A HG23 8  
ATOM 9138  N N    . PHE A 1 16 ? 1.532   -2.079  1.499   1.00 0.00 ? 16 PHE A N    8  
ATOM 9139  C CA   . PHE A 1 16 ? 0.507   -1.887  0.488   1.00 0.00 ? 16 PHE A CA   8  
ATOM 9140  C C    . PHE A 1 16 ? -0.391  -3.121  0.378   1.00 0.00 ? 16 PHE A C    8  
ATOM 9141  O O    . PHE A 1 16 ? -1.610  -2.998  0.270   1.00 0.00 ? 16 PHE A O    8  
ATOM 9142  C CB   . PHE A 1 16 ? 1.226   -1.674  -0.846  1.00 0.00 ? 16 PHE A CB   8  
ATOM 9143  C CG   . PHE A 1 16 ? 1.832   -0.279  -1.008  1.00 0.00 ? 16 PHE A CG   8  
ATOM 9144  C CD1  . PHE A 1 16 ? 1.167   0.812   -0.539  1.00 0.00 ? 16 PHE A CD1  8  
ATOM 9145  C CD2  . PHE A 1 16 ? 3.036   -0.128  -1.623  1.00 0.00 ? 16 PHE A CD2  8  
ATOM 9146  C CE1  . PHE A 1 16 ? 1.729   2.106   -0.691  1.00 0.00 ? 16 PHE A CE1  8  
ATOM 9147  C CE2  . PHE A 1 16 ? 3.597   1.168   -1.775  1.00 0.00 ? 16 PHE A CE2  8  
ATOM 9148  C CZ   . PHE A 1 16 ? 2.933   2.257   -1.306  1.00 0.00 ? 16 PHE A CZ   8  
ATOM 9149  H H    . PHE A 1 16 ? 2.451   -1.790  1.228   1.00 0.00 ? 16 PHE A H    8  
ATOM 9150  H HA   . PHE A 1 16 ? -0.093  -1.030  0.795   1.00 0.00 ? 16 PHE A HA   8  
ATOM 9151  H HB3  . PHE A 1 16 ? 0.523   -1.850  -1.659  1.00 0.00 ? 16 PHE A HB3  8  
ATOM 9152  H HD1  . PHE A 1 16 ? 0.202   0.690   -0.047  1.00 0.00 ? 16 PHE A HD1  8  
ATOM 9153  H HD2  . PHE A 1 16 ? 3.569   -1.000  -1.999  1.00 0.00 ? 16 PHE A HD2  8  
ATOM 9154  H HE1  . PHE A 1 16 ? 1.195   2.980   -0.315  1.00 0.00 ? 16 PHE A HE1  8  
ATOM 9155  H HE2  . PHE A 1 16 ? 4.563   1.289   -2.268  1.00 0.00 ? 16 PHE A HE2  8  
ATOM 9156  H HZ   . PHE A 1 16 ? 3.364   3.252   -1.422  1.00 0.00 ? 16 PHE A HZ   8  
ATOM 9157  N N    . ASP A 1 17 ? 0.246   -4.282  0.408   1.00 0.00 ? 17 ASP A N    8  
ATOM 9158  C CA   . ASP A 1 17 ? -0.480  -5.537  0.312   1.00 0.00 ? 17 ASP A CA   8  
ATOM 9159  C C    . ASP A 1 17 ? -1.459  -5.644  1.482   1.00 0.00 ? 17 ASP A C    8  
ATOM 9160  O O    . ASP A 1 17 ? -2.661  -5.810  1.276   1.00 0.00 ? 17 ASP A O    8  
ATOM 9161  C CB   . ASP A 1 17 ? 0.474   -6.732  0.382   1.00 0.00 ? 17 ASP A CB   8  
ATOM 9162  C CG   . ASP A 1 17 ? 1.085   -7.151  -0.957  1.00 0.00 ? 17 ASP A CG   8  
ATOM 9163  O OD1  . ASP A 1 17 ? 0.509   -6.753  -1.993  1.00 0.00 ? 17 ASP A OD1  8  
ATOM 9164  O OD2  . ASP A 1 17 ? 2.113   -7.860  -0.914  1.00 0.00 ? 17 ASP A OD2  8  
ATOM 9165  H H    . ASP A 1 17 ? 1.239   -4.373  0.495   1.00 0.00 ? 17 ASP A H    8  
ATOM 9166  H HA   . ASP A 1 17 ? -0.985  -5.503  -0.653  1.00 0.00 ? 17 ASP A HA   8  
ATOM 9167  H HB3  . ASP A 1 17 ? -0.064  -7.582  0.801   1.00 0.00 ? 17 ASP A HB3  8  
ATOM 9168  N N    . VAL A 1 18 ? -0.910  -5.548  2.683   1.00 0.00 ? 18 VAL A N    8  
ATOM 9169  C CA   . VAL A 1 18 ? -1.721  -5.632  3.886   1.00 0.00 ? 18 VAL A CA   8  
ATOM 9170  C C    . VAL A 1 18 ? -2.839  -4.590  3.816   1.00 0.00 ? 18 VAL A C    8  
ATOM 9171  O O    . VAL A 1 18 ? -4.019  -4.938  3.837   1.00 0.00 ? 18 VAL A O    8  
ATOM 9172  C CB   . VAL A 1 18 ? -0.836  -5.479  5.125   1.00 0.00 ? 18 VAL A CB   8  
ATOM 9173  C CG1  . VAL A 1 18 ? -1.636  -4.920  6.304   1.00 0.00 ? 18 VAL A CG1  8  
ATOM 9174  C CG2  . VAL A 1 18 ? -0.172  -6.806  5.493   1.00 0.00 ? 18 VAL A CG2  8  
ATOM 9175  H H    . VAL A 1 18 ? 0.068   -5.414  2.842   1.00 0.00 ? 18 VAL A H    8  
ATOM 9176  H HA   . VAL A 1 18 ? -2.168  -6.626  3.911   1.00 0.00 ? 18 VAL A HA   8  
ATOM 9177  H HB   . VAL A 1 18 ? -0.048  -4.764  4.888   1.00 0.00 ? 18 VAL A HB   8  
ATOM 9178  H HG11 . VAL A 1 18 ? -2.588  -5.446  6.378   1.00 0.00 ? 18 VAL A HG11 8  
ATOM 9179  H HG12 . VAL A 1 18 ? -1.071  -5.060  7.226   1.00 0.00 ? 18 VAL A HG12 8  
ATOM 9180  H HG13 . VAL A 1 18 ? -1.819  -3.857  6.148   1.00 0.00 ? 18 VAL A HG13 8  
ATOM 9181  H HG21 . VAL A 1 18 ? 0.001   -6.841  6.569   1.00 0.00 ? 18 VAL A HG21 8  
ATOM 9182  H HG22 . VAL A 1 18 ? -0.823  -7.631  5.202   1.00 0.00 ? 18 VAL A HG22 8  
ATOM 9183  H HG23 . VAL A 1 18 ? 0.780   -6.894  4.970   1.00 0.00 ? 18 VAL A HG23 8  
ATOM 9184  N N    . LEU A 1 19 ? -2.429  -3.333  3.736   1.00 0.00 ? 19 LEU A N    8  
ATOM 9185  C CA   . LEU A 1 19 ? -3.381  -2.238  3.663   1.00 0.00 ? 19 LEU A CA   8  
ATOM 9186  C C    . LEU A 1 19 ? -4.533  -2.630  2.737   1.00 0.00 ? 19 LEU A C    8  
ATOM 9187  O O    . LEU A 1 19 ? -5.700  -2.536  3.116   1.00 0.00 ? 19 LEU A O    8  
ATOM 9188  C CB   . LEU A 1 19 ? -2.678  -0.942  3.255   1.00 0.00 ? 19 LEU A CB   8  
ATOM 9189  C CG   . LEU A 1 19 ? -1.526  -0.492  4.155   1.00 0.00 ? 19 LEU A CG   8  
ATOM 9190  C CD1  . LEU A 1 19 ? -1.178  0.977   3.909   1.00 0.00 ? 19 LEU A CD1  8  
ATOM 9191  C CD2  . LEU A 1 19 ? -1.840  -0.768  5.627   1.00 0.00 ? 19 LEU A CD2  8  
ATOM 9192  H H    . LEU A 1 19 ? -1.467  -3.058  3.720   1.00 0.00 ? 19 LEU A H    8  
ATOM 9193  H HA   . LEU A 1 19 ? -3.780  -2.086  4.666   1.00 0.00 ? 19 LEU A HA   8  
ATOM 9194  H HB3  . LEU A 1 19 ? -3.419  -0.145  3.222   1.00 0.00 ? 19 LEU A HB3  8  
ATOM 9195  H HG   . LEU A 1 19 ? -0.643  -1.079  3.900   1.00 0.00 ? 19 LEU A HG   8  
ATOM 9196  H HD11 . LEU A 1 19 ? -1.339  1.547   4.823   1.00 0.00 ? 19 LEU A HD11 8  
ATOM 9197  H HD12 . LEU A 1 19 ? -0.133  1.058   3.608   1.00 0.00 ? 19 LEU A HD12 8  
ATOM 9198  H HD13 . LEU A 1 19 ? -1.815  1.373   3.117   1.00 0.00 ? 19 LEU A HD13 8  
ATOM 9199  H HD21 . LEU A 1 19 ? -2.905  -0.622  5.805   1.00 0.00 ? 19 LEU A HD21 8  
ATOM 9200  H HD22 . LEU A 1 19 ? -1.567  -1.794  5.872   1.00 0.00 ? 19 LEU A HD22 8  
ATOM 9201  H HD23 . LEU A 1 19 ? -1.270  -0.082  6.255   1.00 0.00 ? 19 LEU A HD23 8  
ATOM 9202  N N    . TYR A 1 20 ? -4.166  -3.063  1.539   1.00 0.00 ? 20 TYR A N    8  
ATOM 9203  C CA   . TYR A 1 20 ? -5.154  -3.470  0.554   1.00 0.00 ? 20 TYR A CA   8  
ATOM 9204  C C    . TYR A 1 20 ? -6.066  -4.564  1.114   1.00 0.00 ? 20 TYR A C    8  
ATOM 9205  O O    . TYR A 1 20 ? -7.279  -4.378  1.208   1.00 0.00 ? 20 TYR A O    8  
ATOM 9206  C CB   . TYR A 1 20 ? -4.365  -4.035  -0.627  1.00 0.00 ? 20 TYR A CB   8  
ATOM 9207  C CG   . TYR A 1 20 ? -5.215  -4.314  -1.867  1.00 0.00 ? 20 TYR A CG   8  
ATOM 9208  C CD1  . TYR A 1 20 ? -6.155  -3.393  -2.282  1.00 0.00 ? 20 TYR A CD1  8  
ATOM 9209  C CD2  . TYR A 1 20 ? -5.043  -5.488  -2.573  1.00 0.00 ? 20 TYR A CD2  8  
ATOM 9210  C CE1  . TYR A 1 20 ? -6.956  -3.656  -3.449  1.00 0.00 ? 20 TYR A CE1  8  
ATOM 9211  C CE2  . TYR A 1 20 ? -5.844  -5.751  -3.741  1.00 0.00 ? 20 TYR A CE2  8  
ATOM 9212  C CZ   . TYR A 1 20 ? -6.761  -4.821  -4.121  1.00 0.00 ? 20 TYR A CZ   8  
ATOM 9213  O OH   . TYR A 1 20 ? -7.517  -5.070  -5.224  1.00 0.00 ? 20 TYR A OH   8  
ATOM 9214  H H    . TYR A 1 20 ? -3.215  -3.136  1.239   1.00 0.00 ? 20 TYR A H    8  
ATOM 9215  H HA   . TYR A 1 20 ? -5.758  -2.598  0.303   1.00 0.00 ? 20 TYR A HA   8  
ATOM 9216  H HB3  . TYR A 1 20 ? -3.879  -4.960  -0.317  1.00 0.00 ? 20 TYR A HB3  8  
ATOM 9217  H HD1  . TYR A 1 20 ? -6.292  -2.466  -1.724  1.00 0.00 ? 20 TYR A HD1  8  
ATOM 9218  H HD2  . TYR A 1 20 ? -4.300  -6.216  -2.246  1.00 0.00 ? 20 TYR A HD2  8  
ATOM 9219  H HE1  . TYR A 1 20 ? -7.703  -2.936  -3.787  1.00 0.00 ? 20 TYR A HE1  8  
ATOM 9220  H HE2  . TYR A 1 20 ? -5.717  -6.673  -4.308  1.00 0.00 ? 20 TYR A HE2  8  
ATOM 9221  H HH   . TYR A 1 20 ? -7.155  -4.564  -6.008  1.00 0.00 ? 20 TYR A HH   8  
ATOM 9222  N N    . SER A 1 21 ? -5.448  -5.681  1.470   1.00 0.00 ? 21 SER A N    8  
ATOM 9223  C CA   . SER A 1 21 ? -6.189  -6.804  2.017   1.00 0.00 ? 21 SER A CA   8  
ATOM 9224  C C    . SER A 1 21 ? -7.080  -6.333  3.168   1.00 0.00 ? 21 SER A C    8  
ATOM 9225  O O    . SER A 1 21 ? -8.186  -6.841  3.349   1.00 0.00 ? 21 SER A O    8  
ATOM 9226  C CB   . SER A 1 21 ? -5.242  -7.906  2.496   1.00 0.00 ? 21 SER A CB   8  
ATOM 9227  O OG   . SER A 1 21 ? -5.897  -8.839  3.352   1.00 0.00 ? 21 SER A OG   8  
ATOM 9228  H H    . SER A 1 21 ? -4.461  -5.823  1.391   1.00 0.00 ? 21 SER A H    8  
ATOM 9229  H HA   . SER A 1 21 ? -6.794  -7.180  1.193   1.00 0.00 ? 21 SER A HA   8  
ATOM 9230  H HB3  . SER A 1 21 ? -4.401  -7.458  3.025   1.00 0.00 ? 21 SER A HB3  8  
ATOM 9231  H HG   . SER A 1 21 ? -5.946  -8.474  4.282   1.00 0.00 ? 21 SER A HG   8  
ATOM 9232  N N    . GLU A 1 22 ? -6.566  -5.367  3.915   1.00 0.00 ? 22 GLU A N    8  
ATOM 9233  C CA   . GLU A 1 22 ? -7.302  -4.822  5.044   1.00 0.00 ? 22 GLU A CA   8  
ATOM 9234  C C    . GLU A 1 22 ? -8.564  -4.107  4.558   1.00 0.00 ? 22 GLU A C    8  
ATOM 9235  O O    . GLU A 1 22 ? -9.659  -4.370  5.050   1.00 0.00 ? 22 GLU A O    8  
ATOM 9236  C CB   . GLU A 1 22 ? -6.422  -3.882  5.870   1.00 0.00 ? 22 GLU A CB   8  
ATOM 9237  C CG   . GLU A 1 22 ? -5.340  -4.662  6.621   1.00 0.00 ? 22 GLU A CG   8  
ATOM 9238  C CD   . GLU A 1 22 ? -5.915  -5.332  7.869   1.00 0.00 ? 22 GLU A CD   8  
ATOM 9239  O OE1  . GLU A 1 22 ? -6.483  -6.435  7.711   1.00 0.00 ? 22 GLU A OE1  8  
ATOM 9240  O OE2  . GLU A 1 22 ? -5.773  -4.727  8.954   1.00 0.00 ? 22 GLU A OE2  8  
ATOM 9241  H H    . GLU A 1 22 ? -5.666  -4.960  3.761   1.00 0.00 ? 22 GLU A H    8  
ATOM 9242  H HA   . GLU A 1 22 ? -7.576  -5.683  5.654   1.00 0.00 ? 22 GLU A HA   8  
ATOM 9243  H HB3  . GLU A 1 22 ? -7.038  -3.332  6.580   1.00 0.00 ? 22 GLU A HB3  8  
ATOM 9244  H HG3  . GLU A 1 22 ? -4.532  -3.987  6.905   1.00 0.00 ? 22 GLU A HG3  8  
ATOM 9245  N N    . ALA A 1 23 ? -8.368  -3.216  3.597   1.00 0.00 ? 23 ALA A N    8  
ATOM 9246  C CA   . ALA A 1 23 ? -9.477  -2.460  3.040   1.00 0.00 ? 23 ALA A CA   8  
ATOM 9247  C C    . ALA A 1 23 ? -10.438 -3.419  2.335   1.00 0.00 ? 23 ALA A C    8  
ATOM 9248  O O    . ALA A 1 23 ? -11.644 -3.181  2.302   1.00 0.00 ? 23 ALA A O    8  
ATOM 9249  C CB   . ALA A 1 23 ? -8.937  -1.380  2.100   1.00 0.00 ? 23 ALA A CB   8  
ATOM 9250  H H    . ALA A 1 23 ? -7.473  -3.007  3.202   1.00 0.00 ? 23 ALA A H    8  
ATOM 9251  H HA   . ALA A 1 23 ? -9.999  -1.977  3.866   1.00 0.00 ? 23 ALA A HA   8  
ATOM 9252  H HB1  . ALA A 1 23 ? -9.370  -0.416  2.368   1.00 0.00 ? 23 ALA A HB1  8  
ATOM 9253  H HB2  . ALA A 1 23 ? -7.852  -1.330  2.189   1.00 0.00 ? 23 ALA A HB2  8  
ATOM 9254  H HB3  . ALA A 1 23 ? -9.207  -1.625  1.072   1.00 0.00 ? 23 ALA A HB3  8  
ATOM 9255  N N    . LEU A 1 24 ? -9.867  -4.482  1.788   1.00 0.00 ? 24 LEU A N    8  
ATOM 9256  C CA   . LEU A 1 24 ? -10.659 -5.478  1.085   1.00 0.00 ? 24 LEU A CA   8  
ATOM 9257  C C    . LEU A 1 24 ? -11.372 -6.368  2.105   1.00 0.00 ? 24 LEU A C    8  
ATOM 9258  O O    . LEU A 1 24 ? -12.474 -6.853  1.848   1.00 0.00 ? 24 LEU A O    8  
ATOM 9259  C CB   . LEU A 1 24 ? -9.788  -6.253  0.096   1.00 0.00 ? 24 LEU A CB   8  
ATOM 9260  C CG   . LEU A 1 24 ? -9.781  -5.733  -1.343  1.00 0.00 ? 24 LEU A CG   8  
ATOM 9261  C CD1  . LEU A 1 24 ? -8.736  -6.466  -2.187  1.00 0.00 ? 24 LEU A CD1  8  
ATOM 9262  C CD2  . LEU A 1 24 ? -11.178 -5.815  -1.963  1.00 0.00 ? 24 LEU A CD2  8  
ATOM 9263  H H    . LEU A 1 24 ? -8.885  -4.667  1.818   1.00 0.00 ? 24 LEU A H    8  
ATOM 9264  H HA   . LEU A 1 24 ? -11.412 -4.947  0.504   1.00 0.00 ? 24 LEU A HA   8  
ATOM 9265  H HB3  . LEU A 1 24 ? -10.122 -7.291  0.083   1.00 0.00 ? 24 LEU A HB3  8  
ATOM 9266  H HG   . LEU A 1 24 ? -9.499  -4.681  -1.325  1.00 0.00 ? 24 LEU A HG   8  
ATOM 9267  H HD11 . LEU A 1 24 ? -8.695  -6.022  -3.181  1.00 0.00 ? 24 LEU A HD11 8  
ATOM 9268  H HD12 . LEU A 1 24 ? -7.759  -6.379  -1.710  1.00 0.00 ? 24 LEU A HD12 8  
ATOM 9269  H HD13 . LEU A 1 24 ? -9.008  -7.518  -2.269  1.00 0.00 ? 24 LEU A HD13 8  
ATOM 9270  H HD21 . LEU A 1 24 ? -11.836 -5.101  -1.470  1.00 0.00 ? 24 LEU A HD21 8  
ATOM 9271  H HD22 . LEU A 1 24 ? -11.118 -5.582  -3.026  1.00 0.00 ? 24 LEU A HD22 8  
ATOM 9272  H HD23 . LEU A 1 24 ? -11.573 -6.823  -1.834  1.00 0.00 ? 24 LEU A HD23 8  
ATOM 9273  N N    . GLY A 1 25 ? -10.716 -6.555  3.241   1.00 0.00 ? 25 GLY A N    8  
ATOM 9274  C CA   . GLY A 1 25 ? -11.275 -7.379  4.301   1.00 0.00 ? 25 GLY A CA   8  
ATOM 9275  C C    . GLY A 1 25 ? -11.280 -8.855  3.902   1.00 0.00 ? 25 GLY A C    8  
ATOM 9276  O O    . GLY A 1 25 ? -12.325 -9.505  3.925   1.00 0.00 ? 25 GLY A O    8  
ATOM 9277  H H    . GLY A 1 25 ? -9.822  -6.157  3.442   1.00 0.00 ? 25 GLY A H    8  
ATOM 9278  H HA2  . GLY A 1 25 ? -10.693 -7.247  5.213   1.00 0.00 ? 25 GLY A HA2  8  
ATOM 9279  H HA3  . GLY A 1 25 ? -12.291 -7.054  4.521   1.00 0.00 ? 25 GLY A HA3  8  
ATOM 9280  N N    . ARG A 1 26 ? -10.102 -9.343  3.545   1.00 0.00 ? 26 ARG A N    8  
ATOM 9281  C CA   . ARG A 1 26 ? -9.957  -10.733 3.142   1.00 0.00 ? 26 ARG A CA   8  
ATOM 9282  C C    . ARG A 1 26 ? -9.252  -11.533 4.240   1.00 0.00 ? 26 ARG A C    8  
ATOM 9283  O O    . ARG A 1 26 ? -8.733  -10.959 5.195   1.00 0.00 ? 26 ARG A O    8  
ATOM 9284  C CB   . ARG A 1 26 ? -9.158  -10.849 1.843   1.00 0.00 ? 26 ARG A CB   8  
ATOM 9285  C CG   . ARG A 1 26 ? -9.824  -10.054 0.717   1.00 0.00 ? 26 ARG A CG   8  
ATOM 9286  C CD   . ARG A 1 26 ? -10.312 -10.984 -0.395  1.00 0.00 ? 26 ARG A CD   8  
ATOM 9287  N NE   . ARG A 1 26 ? -11.517 -10.412 -1.039  1.00 0.00 ? 26 ARG A NE   8  
ATOM 9288  C CZ   . ARG A 1 26 ? -12.758 -10.529 -0.548  1.00 0.00 ? 26 ARG A CZ   8  
ATOM 9289  N NH1  . ARG A 1 26 ? -12.966 -11.195 0.596   1.00 0.00 ? 26 ARG A NH1  8  
ATOM 9290  N NH2  . ARG A 1 26 ? -13.791 -9.978  -1.199  1.00 0.00 ? 26 ARG A NH2  8  
ATOM 9291  H H    . ARG A 1 26 ? -9.256  -8.809  3.530   1.00 0.00 ? 26 ARG A H    8  
ATOM 9292  H HA   . ARG A 1 26 ? -10.977 -11.086 2.992   1.00 0.00 ? 26 ARG A HA   8  
ATOM 9293  H HB3  . ARG A 1 26 ? -9.077  -11.896 1.554   1.00 0.00 ? 26 ARG A HB3  8  
ATOM 9294  H HG3  . ARG A 1 26 ? -9.116  -9.332  0.310   1.00 0.00 ? 26 ARG A HG3  8  
ATOM 9295  H HD3  . ARG A 1 26 ? -10.541 -11.967 0.015   1.00 0.00 ? 26 ARG A HD3  8  
ATOM 9296  H HE   . ARG A 1 26 ? -11.397 -9.909  -1.894  1.00 0.00 ? 26 ARG A HE   8  
ATOM 9297  H HH11 . ARG A 1 26 ? -12.195 -11.606 1.082   1.00 0.00 ? 26 ARG A HH11 8  
ATOM 9298  H HH12 . ARG A 1 26 ? -13.893 -11.283 0.963   1.00 0.00 ? 26 ARG A HH12 8  
ATOM 9299  H HH21 . ARG A 1 26 ? -13.635 -9.481  -2.053  1.00 0.00 ? 26 ARG A HH21 8  
ATOM 9300  H HH22 . ARG A 1 26 ? -14.718 -10.066 -0.833  1.00 0.00 ? 26 ARG A HH22 8  
ATOM 9301  N N    . ALA A 1 27 ? -9.257  -12.846 4.065   1.00 0.00 ? 27 ALA A N    8  
ATOM 9302  C CA   . ALA A 1 27 ? -8.624  -13.731 5.028   1.00 0.00 ? 27 ALA A CA   8  
ATOM 9303  C C    . ALA A 1 27 ? -7.222  -14.096 4.534   1.00 0.00 ? 27 ALA A C    8  
ATOM 9304  O O    . ALA A 1 27 ? -6.648  -15.095 4.968   1.00 0.00 ? 27 ALA A O    8  
ATOM 9305  C CB   . ALA A 1 27 ? -9.505  -14.963 5.245   1.00 0.00 ? 27 ALA A CB   8  
ATOM 9306  H H    . ALA A 1 27 ? -9.681  -13.305 3.284   1.00 0.00 ? 27 ALA A H    8  
ATOM 9307  H HA   . ALA A 1 27 ? -8.539  -13.190 5.970   1.00 0.00 ? 27 ALA A HA   8  
ATOM 9308  H HB1  . ALA A 1 27 ? -8.879  -15.813 5.523   1.00 0.00 ? 27 ALA A HB1  8  
ATOM 9309  H HB2  . ALA A 1 27 ? -10.221 -14.762 6.042   1.00 0.00 ? 27 ALA A HB2  8  
ATOM 9310  H HB3  . ALA A 1 27 ? -10.041 -15.194 4.324   1.00 0.00 ? 27 ALA A HB3  8  
ATOM 9311  N N    . SER A 1 28 ? -6.711  -13.268 3.636   1.00 0.00 ? 28 SER A N    8  
ATOM 9312  C CA   . SER A 1 28 ? -5.388  -13.490 3.080   1.00 0.00 ? 28 SER A CA   8  
ATOM 9313  C C    . SER A 1 28 ? -4.815  -12.176 2.547   1.00 0.00 ? 28 SER A C    8  
ATOM 9314  O O    . SER A 1 28 ? -5.558  -11.228 2.294   1.00 0.00 ? 28 SER A O    8  
ATOM 9315  C CB   . SER A 1 28 ? -5.427  -14.541 1.968   1.00 0.00 ? 28 SER A CB   8  
ATOM 9316  O OG   . SER A 1 28 ? -5.442  -15.868 2.488   1.00 0.00 ? 28 SER A OG   8  
ATOM 9317  H H    . SER A 1 28 ? -7.184  -12.457 3.290   1.00 0.00 ? 28 SER A H    8  
ATOM 9318  H HA   . SER A 1 28 ? -4.785  -13.862 3.908   1.00 0.00 ? 28 SER A HA   8  
ATOM 9319  H HB3  . SER A 1 28 ? -4.560  -14.415 1.319   1.00 0.00 ? 28 SER A HB3  8  
ATOM 9320  H HG   . SER A 1 28 ? -5.344  -16.527 1.743   1.00 0.00 ? 28 SER A HG   8  
ATOM 9321  N N    . VAL A 1 29 ? -3.500  -12.159 2.392   1.00 0.00 ? 29 VAL A N    8  
ATOM 9322  C CA   . VAL A 1 29 ? -2.819  -10.976 1.894   1.00 0.00 ? 29 VAL A CA   8  
ATOM 9323  C C    . VAL A 1 29 ? -2.737  -11.044 0.368   1.00 0.00 ? 29 VAL A C    8  
ATOM 9324  O O    . VAL A 1 29 ? -1.953  -11.818 -0.180  1.00 0.00 ? 29 VAL A O    8  
ATOM 9325  C CB   . VAL A 1 29 ? -1.449  -10.839 2.561   1.00 0.00 ? 29 VAL A CB   8  
ATOM 9326  C CG1  . VAL A 1 29 ? -0.681  -9.643  1.997   1.00 0.00 ? 29 VAL A CG1  8  
ATOM 9327  C CG2  . VAL A 1 29 ? -1.588  -10.736 4.081   1.00 0.00 ? 29 VAL A CG2  8  
ATOM 9328  H H    . VAL A 1 29 ? -2.903  -12.933 2.600   1.00 0.00 ? 29 VAL A H    8  
ATOM 9329  H HA   . VAL A 1 29 ? -3.419  -10.110 2.174   1.00 0.00 ? 29 VAL A HA   8  
ATOM 9330  H HB   . VAL A 1 29 ? -0.877  -11.741 2.338   1.00 0.00 ? 29 VAL A HB   8  
ATOM 9331  H HG11 . VAL A 1 29 ? -0.236  -9.915  1.040   1.00 0.00 ? 29 VAL A HG11 8  
ATOM 9332  H HG12 . VAL A 1 29 ? -1.365  -8.806  1.855   1.00 0.00 ? 29 VAL A HG12 8  
ATOM 9333  H HG13 . VAL A 1 29 ? 0.105   -9.354  2.695   1.00 0.00 ? 29 VAL A HG13 8  
ATOM 9334  H HG21 . VAL A 1 29 ? -2.603  -11.005 4.373   1.00 0.00 ? 29 VAL A HG21 8  
ATOM 9335  H HG22 . VAL A 1 29 ? -0.881  -11.414 4.557   1.00 0.00 ? 29 VAL A HG22 8  
ATOM 9336  H HG23 . VAL A 1 29 ? -1.379  -9.713  4.396   1.00 0.00 ? 29 VAL A HG23 8  
ATOM 9337  N N    . VAL A 1 30 ? -3.556  -10.225 -0.275  1.00 0.00 ? 30 VAL A N    8  
ATOM 9338  C CA   . VAL A 1 30 ? -3.586  -10.184 -1.728  1.00 0.00 ? 30 VAL A CA   8  
ATOM 9339  C C    . VAL A 1 30 ? -2.610  -9.115  -2.222  1.00 0.00 ? 30 VAL A C    8  
ATOM 9340  O O    . VAL A 1 30 ? -2.284  -8.181  -1.491  1.00 0.00 ? 30 VAL A O    8  
ATOM 9341  C CB   . VAL A 1 30 ? -5.018  -9.959  -2.216  1.00 0.00 ? 30 VAL A CB   8  
ATOM 9342  C CG1  . VAL A 1 30 ? -5.846  -11.239 -2.093  1.00 0.00 ? 30 VAL A CG1  8  
ATOM 9343  C CG2  . VAL A 1 30 ? -5.679  -8.803  -1.461  1.00 0.00 ? 30 VAL A CG2  8  
ATOM 9344  H H    . VAL A 1 30 ? -4.191  -9.600  0.178   1.00 0.00 ? 30 VAL A H    8  
ATOM 9345  H HA   . VAL A 1 30 ? -3.254  -11.157 -2.091  1.00 0.00 ? 30 VAL A HA   8  
ATOM 9346  H HB   . VAL A 1 30 ? -4.974  -9.688  -3.270  1.00 0.00 ? 30 VAL A HB   8  
ATOM 9347  H HG11 . VAL A 1 30 ? -5.900  -11.539 -1.048  1.00 0.00 ? 30 VAL A HG11 8  
ATOM 9348  H HG12 . VAL A 1 30 ? -6.853  -11.058 -2.470  1.00 0.00 ? 30 VAL A HG12 8  
ATOM 9349  H HG13 . VAL A 1 30 ? -5.378  -12.031 -2.676  1.00 0.00 ? 30 VAL A HG13 8  
ATOM 9350  H HG21 . VAL A 1 30 ? -4.909  -8.160  -1.034  1.00 0.00 ? 30 VAL A HG21 8  
ATOM 9351  H HG22 . VAL A 1 30 ? -6.295  -8.225  -2.149  1.00 0.00 ? 30 VAL A HG22 8  
ATOM 9352  H HG23 . VAL A 1 30 ? -6.303  -9.202  -0.661  1.00 0.00 ? 30 VAL A HG23 8  
ATOM 9353  N N    . PRO A 1 31 ? -2.160  -9.292  -3.493  1.00 0.00 ? 31 PRO A N    8  
ATOM 9354  C CA   . PRO A 1 31 ? -1.228  -8.353  -4.095  1.00 0.00 ? 31 PRO A CA   8  
ATOM 9355  C C    . PRO A 1 31 ? -1.935  -7.055  -4.489  1.00 0.00 ? 31 PRO A C    8  
ATOM 9356  O O    . PRO A 1 31 ? -3.159  -6.960  -4.407  1.00 0.00 ? 31 PRO A O    8  
ATOM 9357  C CB   . PRO A 1 31 ? -0.637  -9.093  -5.284  1.00 0.00 ? 31 PRO A CB   8  
ATOM 9358  C CG   . PRO A 1 31 ? -1.593  -10.237 -5.580  1.00 0.00 ? 31 PRO A CG   8  
ATOM 9359  C CD   . PRO A 1 31 ? -2.524  -10.386 -4.389  1.00 0.00 ? 31 PRO A CD   8  
ATOM 9360  H HA   . PRO A 1 31 ? -0.524  -8.092  -3.434  1.00 0.00 ? 31 PRO A HA   8  
ATOM 9361  H HB3  . PRO A 1 31 ? 0.361   -9.467  -5.056  1.00 0.00 ? 31 PRO A HB3  8  
ATOM 9362  H HG3  . PRO A 1 31 ? -1.041  -11.161 -5.752  1.00 0.00 ? 31 PRO A HG3  8  
ATOM 9363  H HD3  . PRO A 1 31 ? -2.396  -11.354 -3.904  1.00 0.00 ? 31 PRO A HD3  8  
ATOM 9364  N N    . LEU A 1 32 ? -1.134  -6.086  -4.909  1.00 0.00 ? 32 LEU A N    8  
ATOM 9365  C CA   . LEU A 1 32 ? -1.667  -4.798  -5.316  1.00 0.00 ? 32 LEU A CA   8  
ATOM 9366  C C    . LEU A 1 32 ? -1.293  -4.533  -6.775  1.00 0.00 ? 32 LEU A C    8  
ATOM 9367  O O    . LEU A 1 32 ? -0.178  -4.100  -7.065  1.00 0.00 ? 32 LEU A O    8  
ATOM 9368  C CB   . LEU A 1 32 ? -1.210  -3.700  -4.354  1.00 0.00 ? 32 LEU A CB   8  
ATOM 9369  C CG   . LEU A 1 32 ? -1.458  -2.261  -4.812  1.00 0.00 ? 32 LEU A CG   8  
ATOM 9370  C CD1  . LEU A 1 32 ? -2.824  -2.128  -5.487  1.00 0.00 ? 32 LEU A CD1  8  
ATOM 9371  C CD2  . LEU A 1 32 ? -1.295  -1.280  -3.649  1.00 0.00 ? 32 LEU A CD2  8  
ATOM 9372  H H    . LEU A 1 32 ? -0.140  -6.171  -4.973  1.00 0.00 ? 32 LEU A H    8  
ATOM 9373  H HA   . LEU A 1 32 ? -2.754  -4.857  -5.244  1.00 0.00 ? 32 LEU A HA   8  
ATOM 9374  H HB3  . LEU A 1 32 ? -0.142  -3.824  -4.175  1.00 0.00 ? 32 LEU A HB3  8  
ATOM 9375  H HG   . LEU A 1 32 ? -0.704  -2.005  -5.557  1.00 0.00 ? 32 LEU A HG   8  
ATOM 9376  H HD11 . LEU A 1 32 ? -3.602  -2.071  -4.725  1.00 0.00 ? 32 LEU A HD11 8  
ATOM 9377  H HD12 . LEU A 1 32 ? -2.843  -1.223  -6.094  1.00 0.00 ? 32 LEU A HD12 8  
ATOM 9378  H HD13 . LEU A 1 32 ? -3.002  -2.996  -6.122  1.00 0.00 ? 32 LEU A HD13 8  
ATOM 9379  H HD21 . LEU A 1 32 ? -2.183  -0.653  -3.576  1.00 0.00 ? 32 LEU A HD21 8  
ATOM 9380  H HD22 . LEU A 1 32 ? -1.164  -1.836  -2.721  1.00 0.00 ? 32 LEU A HD22 8  
ATOM 9381  H HD23 . LEU A 1 32 ? -0.421  -0.652  -3.823  1.00 0.00 ? 32 LEU A HD23 8  
ATOM 9382  N N    . PRO A 1 33 ? -2.269  -4.812  -7.681  1.00 0.00 ? 33 PRO A N    8  
ATOM 9383  C CA   . PRO A 1 33 ? -2.052  -4.608  -9.102  1.00 0.00 ? 33 PRO A CA   8  
ATOM 9384  C C    . PRO A 1 33 ? -2.100  -3.121  -9.457  1.00 0.00 ? 33 PRO A C    8  
ATOM 9385  O O    . PRO A 1 33 ? -3.128  -2.620  -9.910  1.00 0.00 ? 33 PRO A O    8  
ATOM 9386  C CB   . PRO A 1 33 ? -3.142  -5.417  -9.786  1.00 0.00 ? 33 PRO A CB   8  
ATOM 9387  C CG   . PRO A 1 33 ? -4.204  -5.665  -8.728  1.00 0.00 ? 33 PRO A CG   8  
ATOM 9388  C CD   . PRO A 1 33 ? -3.601  -5.326  -7.374  1.00 0.00 ? 33 PRO A CD   8  
ATOM 9389  H HA   . PRO A 1 33 ? -1.139  -4.922  -9.363  1.00 0.00 ? 33 PRO A HA   8  
ATOM 9390  H HB3  . PRO A 1 33 ? -2.747  -6.358  -10.170 1.00 0.00 ? 33 PRO A HB3  8  
ATOM 9391  H HG3  . PRO A 1 33 ? -4.530  -6.704  -8.751  1.00 0.00 ? 33 PRO A HG3  8  
ATOM 9392  H HD3  . PRO A 1 33 ? -3.548  -6.205  -6.733  1.00 0.00 ? 33 PRO A HD3  8  
ATOM 9393  N N    . TYR A 1 34 ? -0.975  -2.457  -9.238  1.00 0.00 ? 34 TYR A N    8  
ATOM 9394  C CA   . TYR A 1 34 ? -0.875  -1.036  -9.529  1.00 0.00 ? 34 TYR A CA   8  
ATOM 9395  C C    . TYR A 1 34 ? -1.247  -0.747  -10.985 1.00 0.00 ? 34 TYR A C    8  
ATOM 9396  O O    . TYR A 1 34 ? -2.067  0.128   -11.257 1.00 0.00 ? 34 TYR A O    8  
ATOM 9397  C CB   . TYR A 1 34 ? 0.591   -0.662  -9.307  1.00 0.00 ? 34 TYR A CB   8  
ATOM 9398  C CG   . TYR A 1 34 ? 1.081   -0.887  -7.874  1.00 0.00 ? 34 TYR A CG   8  
ATOM 9399  C CD1  . TYR A 1 34 ? 0.796   0.043   -6.895  1.00 0.00 ? 34 TYR A CD1  8  
ATOM 9400  C CD2  . TYR A 1 34 ? 1.808   -2.018  -7.562  1.00 0.00 ? 34 TYR A CD2  8  
ATOM 9401  C CE1  . TYR A 1 34 ? 1.257   -0.169  -5.546  1.00 0.00 ? 34 TYR A CE1  8  
ATOM 9402  C CE2  . TYR A 1 34 ? 2.268   -2.229  -6.214  1.00 0.00 ? 34 TYR A CE2  8  
ATOM 9403  C CZ   . TYR A 1 34 ? 1.970   -1.294  -5.274  1.00 0.00 ? 34 TYR A CZ   8  
ATOM 9404  O OH   . TYR A 1 34 ? 2.405   -1.494  -4.000  1.00 0.00 ? 34 TYR A OH   8  
ATOM 9405  H H    . TYR A 1 34 ? -0.142  -2.872  -8.870  1.00 0.00 ? 34 TYR A H    8  
ATOM 9406  H HA   . TYR A 1 34 ? -1.567  -0.509  -8.872  1.00 0.00 ? 34 TYR A HA   8  
ATOM 9407  H HB3  . TYR A 1 34 ? 0.732   0.387   -9.567  1.00 0.00 ? 34 TYR A HB3  8  
ATOM 9408  H HD1  . TYR A 1 34 ? 0.223   0.935   -7.141  1.00 0.00 ? 34 TYR A HD1  8  
ATOM 9409  H HD2  . TYR A 1 34 ? 2.033   -2.752  -8.337  1.00 0.00 ? 34 TYR A HD2  8  
ATOM 9410  H HE1  . TYR A 1 34 ? 1.038   0.556   -4.763  1.00 0.00 ? 34 TYR A HE1  8  
ATOM 9411  H HE2  . TYR A 1 34 ? 2.843   -3.119  -5.955  1.00 0.00 ? 34 TYR A HE2  8  
ATOM 9412  H HH   . TYR A 1 34 ? 2.447   -2.473  -3.803  1.00 0.00 ? 34 TYR A HH   8  
ATOM 9413  N N    . GLU A 1 35 ? -0.628  -1.500  -11.881 1.00 0.00 ? 35 GLU A N    8  
ATOM 9414  C CA   . GLU A 1 35 ? -0.885  -1.336  -13.302 1.00 0.00 ? 35 GLU A CA   8  
ATOM 9415  C C    . GLU A 1 35 ? -2.373  -1.084  -13.547 1.00 0.00 ? 35 GLU A C    8  
ATOM 9416  O O    . GLU A 1 35 ? -2.742  -0.413  -14.510 1.00 0.00 ? 35 GLU A O    8  
ATOM 9417  C CB   . GLU A 1 35 ? -0.397  -2.553  -14.091 1.00 0.00 ? 35 GLU A CB   8  
ATOM 9418  C CG   . GLU A 1 35 ? -1.219  -3.796  -13.745 1.00 0.00 ? 35 GLU A CG   8  
ATOM 9419  C CD   . GLU A 1 35 ? -0.801  -4.988  -14.608 1.00 0.00 ? 35 GLU A CD   8  
ATOM 9420  O OE1  . GLU A 1 35 ? 0.416   -5.278  -14.625 1.00 0.00 ? 35 GLU A OE1  8  
ATOM 9421  O OE2  . GLU A 1 35 ? -1.706  -5.582  -15.231 1.00 0.00 ? 35 GLU A OE2  8  
ATOM 9422  H H    . GLU A 1 35 ? 0.038   -2.211  -11.651 1.00 0.00 ? 35 GLU A H    8  
ATOM 9423  H HA   . GLU A 1 35 ? -0.307  -0.461  -13.601 1.00 0.00 ? 35 GLU A HA   8  
ATOM 9424  H HB3  . GLU A 1 35 ? 0.655   -2.735  -13.873 1.00 0.00 ? 35 GLU A HB3  8  
ATOM 9425  H HG3  . GLU A 1 35 ? -2.278  -3.589  -13.894 1.00 0.00 ? 35 GLU A HG3  8  
ATOM 9426  N N    . ARG A 1 36 ? -3.188  -1.634  -12.659 1.00 0.00 ? 36 ARG A N    8  
ATOM 9427  C CA   . ARG A 1 36 ? -4.628  -1.477  -12.767 1.00 0.00 ? 36 ARG A CA   8  
ATOM 9428  C C    . ARG A 1 36 ? -5.106  -0.334  -11.869 1.00 0.00 ? 36 ARG A C    8  
ATOM 9429  O O    . ARG A 1 36 ? -5.580  0.690   -12.360 1.00 0.00 ? 36 ARG A O    8  
ATOM 9430  C CB   . ARG A 1 36 ? -5.354  -2.765  -12.371 1.00 0.00 ? 36 ARG A CB   8  
ATOM 9431  C CG   . ARG A 1 36 ? -5.229  -3.824  -13.468 1.00 0.00 ? 36 ARG A CG   8  
ATOM 9432  C CD   . ARG A 1 36 ? -6.530  -4.613  -13.619 1.00 0.00 ? 36 ARG A CD   8  
ATOM 9433  N NE   . ARG A 1 36 ? -6.248  -6.066  -13.589 1.00 0.00 ? 36 ARG A NE   8  
ATOM 9434  C CZ   . ARG A 1 36 ? -7.180  -7.008  -13.391 1.00 0.00 ? 36 ARG A CZ   8  
ATOM 9435  N NH1  . ARG A 1 36 ? -8.460  -6.656  -13.204 1.00 0.00 ? 36 ARG A NH1  8  
ATOM 9436  N NH2  . ARG A 1 36 ? -6.833  -8.302  -13.379 1.00 0.00 ? 36 ARG A NH2  8  
ATOM 9437  H H    . ARG A 1 36 ? -2.879  -2.178  -11.879 1.00 0.00 ? 36 ARG A H    8  
ATOM 9438  H HA   . ARG A 1 36 ? -4.806  -1.251  -13.818 1.00 0.00 ? 36 ARG A HA   8  
ATOM 9439  H HB3  . ARG A 1 36 ? -6.407  -2.551  -12.185 1.00 0.00 ? 36 ARG A HB3  8  
ATOM 9440  H HG3  . ARG A 1 36 ? -4.412  -4.505  -13.229 1.00 0.00 ? 36 ARG A HG3  8  
ATOM 9441  H HD3  . ARG A 1 36 ? -7.020  -4.349  -14.557 1.00 0.00 ? 36 ARG A HD3  8  
ATOM 9442  H HE   . ARG A 1 36 ? -5.304  -6.362  -13.724 1.00 0.00 ? 36 ARG A HE   8  
ATOM 9443  H HH11 . ARG A 1 36 ? -8.719  -5.690  -13.213 1.00 0.00 ? 36 ARG A HH11 8  
ATOM 9444  H HH12 . ARG A 1 36 ? -9.155  -7.360  -13.057 1.00 0.00 ? 36 ARG A HH12 8  
ATOM 9445  H HH21 . ARG A 1 36 ? -5.877  -8.565  -13.518 1.00 0.00 ? 36 ARG A HH21 8  
ATOM 9446  H HH22 . ARG A 1 36 ? -7.527  -9.006  -13.232 1.00 0.00 ? 36 ARG A HH22 8  
ATOM 9447  N N    . LEU A 1 37 ? -4.966  -0.547  -10.569 1.00 0.00 ? 37 LEU A N    8  
ATOM 9448  C CA   . LEU A 1 37 ? -5.377  0.453   -9.598  1.00 0.00 ? 37 LEU A CA   8  
ATOM 9449  C C    . LEU A 1 37 ? -4.894  1.831   -10.056 1.00 0.00 ? 37 LEU A C    8  
ATOM 9450  O O    . LEU A 1 37 ? -5.549  2.839   -9.797  1.00 0.00 ? 37 LEU A O    8  
ATOM 9451  C CB   . LEU A 1 37 ? -4.899  0.068   -8.197  1.00 0.00 ? 37 LEU A CB   8  
ATOM 9452  C CG   . LEU A 1 37 ? -5.249  -1.348  -7.734  1.00 0.00 ? 37 LEU A CG   8  
ATOM 9453  C CD1  . LEU A 1 37 ? -5.419  -1.401  -6.215  1.00 0.00 ? 37 LEU A CD1  8  
ATOM 9454  C CD2  . LEU A 1 37 ? -6.484  -1.875  -8.468  1.00 0.00 ? 37 LEU A CD2  8  
ATOM 9455  H H    . LEU A 1 37 ? -4.580  -1.382  -10.177 1.00 0.00 ? 37 LEU A H    8  
ATOM 9456  H HA   . LEU A 1 37 ? -6.467  0.458   -9.577  1.00 0.00 ? 37 LEU A HA   8  
ATOM 9457  H HB3  . LEU A 1 37 ? -5.320  0.776   -7.484  1.00 0.00 ? 37 LEU A HB3  8  
ATOM 9458  H HG   . LEU A 1 37 ? -4.418  -2.006  -7.989  1.00 0.00 ? 37 LEU A HG   8  
ATOM 9459  H HD11 . LEU A 1 37 ? -6.443  -1.135  -5.953  1.00 0.00 ? 37 LEU A HD11 8  
ATOM 9460  H HD12 . LEU A 1 37 ? -5.205  -2.411  -5.860  1.00 0.00 ? 37 LEU A HD12 8  
ATOM 9461  H HD13 . LEU A 1 37 ? -4.729  -0.698  -5.747  1.00 0.00 ? 37 LEU A HD13 8  
ATOM 9462  H HD21 . LEU A 1 37 ? -7.230  -1.083  -8.539  1.00 0.00 ? 37 LEU A HD21 8  
ATOM 9463  H HD22 . LEU A 1 37 ? -6.201  -2.198  -9.469  1.00 0.00 ? 37 LEU A HD22 8  
ATOM 9464  H HD23 . LEU A 1 37 ? -6.901  -2.718  -7.918  1.00 0.00 ? 37 LEU A HD23 8  
ATOM 9465  N N    . LEU A 1 38 ? -3.753  1.829   -10.728 1.00 0.00 ? 38 LEU A N    8  
ATOM 9466  C CA   . LEU A 1 38 ? -3.174  3.067   -11.224 1.00 0.00 ? 38 LEU A CA   8  
ATOM 9467  C C    . LEU A 1 38 ? -4.114  3.683   -12.263 1.00 0.00 ? 38 LEU A C    8  
ATOM 9468  O O    . LEU A 1 38 ? -4.372  4.885   -12.236 1.00 0.00 ? 38 LEU A O    8  
ATOM 9469  C CB   . LEU A 1 38 ? -1.756  2.825   -11.744 1.00 0.00 ? 38 LEU A CB   8  
ATOM 9470  C CG   . LEU A 1 38 ? -0.702  2.491   -10.687 1.00 0.00 ? 38 LEU A CG   8  
ATOM 9471  C CD1  . LEU A 1 38 ? 0.589   1.993   -11.338 1.00 0.00 ? 38 LEU A CD1  8  
ATOM 9472  C CD2  . LEU A 1 38 ? -0.454  3.685   -9.762  1.00 0.00 ? 38 LEU A CD2  8  
ATOM 9473  H H    . LEU A 1 38 ? -3.226  1.005   -10.934 1.00 0.00 ? 38 LEU A H    8  
ATOM 9474  H HA   . LEU A 1 38 ? -3.096  3.752   -10.380 1.00 0.00 ? 38 LEU A HA   8  
ATOM 9475  H HB3  . LEU A 1 38 ? -1.432  3.715   -12.283 1.00 0.00 ? 38 LEU A HB3  8  
ATOM 9476  H HG   . LEU A 1 38 ? -1.084  1.679   -10.067 1.00 0.00 ? 38 LEU A HG   8  
ATOM 9477  H HD11 . LEU A 1 38 ? 1.392   1.991   -10.601 1.00 0.00 ? 38 LEU A HD11 8  
ATOM 9478  H HD12 . LEU A 1 38 ? 0.439   0.980   -11.714 1.00 0.00 ? 38 LEU A HD12 8  
ATOM 9479  H HD13 . LEU A 1 38 ? 0.857   2.650   -12.165 1.00 0.00 ? 38 LEU A HD13 8  
ATOM 9480  H HD21 . LEU A 1 38 ? -1.219  3.710   -8.987  1.00 0.00 ? 38 LEU A HD21 8  
ATOM 9481  H HD22 . LEU A 1 38 ? 0.528   3.590   -9.301  1.00 0.00 ? 38 LEU A HD22 8  
ATOM 9482  H HD23 . LEU A 1 38 ? -0.495  4.607   -10.343 1.00 0.00 ? 38 LEU A HD23 8  
ATOM 9483  N N    . ARG A 1 39 ? -4.599  2.831   -13.154 1.00 0.00 ? 39 ARG A N    8  
ATOM 9484  C CA   . ARG A 1 39 ? -5.504  3.277   -14.200 1.00 0.00 ? 39 ARG A CA   8  
ATOM 9485  C C    . ARG A 1 39 ? -6.754  3.910   -13.586 1.00 0.00 ? 39 ARG A C    8  
ATOM 9486  O O    . ARG A 1 39 ? -7.178  4.986   -14.004 1.00 0.00 ? 39 ARG A O    8  
ATOM 9487  C CB   . ARG A 1 39 ? -5.920  2.112   -15.101 1.00 0.00 ? 39 ARG A CB   8  
ATOM 9488  C CG   . ARG A 1 39 ? -6.630  2.618   -16.358 1.00 0.00 ? 39 ARG A CG   8  
ATOM 9489  C CD   . ARG A 1 39 ? -7.994  1.944   -16.527 1.00 0.00 ? 39 ARG A CD   8  
ATOM 9490  N NE   . ARG A 1 39 ? -8.214  1.597   -17.948 1.00 0.00 ? 39 ARG A NE   8  
ATOM 9491  C CZ   . ARG A 1 39 ? -8.339  2.499   -18.932 1.00 0.00 ? 39 ARG A CZ   8  
ATOM 9492  N NH1  . ARG A 1 39 ? -8.267  3.807   -18.653 1.00 0.00 ? 39 ARG A NH1  8  
ATOM 9493  N NH2  . ARG A 1 39 ? -8.536  2.091   -20.193 1.00 0.00 ? 39 ARG A NH2  8  
ATOM 9494  H H    . ARG A 1 39 ? -4.383  1.855   -13.169 1.00 0.00 ? 39 ARG A H    8  
ATOM 9495  H HA   . ARG A 1 39 ? -4.932  4.009   -14.769 1.00 0.00 ? 39 ARG A HA   8  
ATOM 9496  H HB3  . ARG A 1 39 ? -6.579  1.441   -14.552 1.00 0.00 ? 39 ARG A HB3  8  
ATOM 9497  H HG3  . ARG A 1 39 ? -6.013  2.421   -17.234 1.00 0.00 ? 39 ARG A HG3  8  
ATOM 9498  H HD3  . ARG A 1 39 ? -8.783  2.611   -16.180 1.00 0.00 ? 39 ARG A HD3  8  
ATOM 9499  H HE   . ARG A 1 39 ? -8.273  0.629   -18.191 1.00 0.00 ? 39 ARG A HE   8  
ATOM 9500  H HH11 . ARG A 1 39 ? -8.118  4.111   -17.712 1.00 0.00 ? 39 ARG A HH11 8  
ATOM 9501  H HH12 . ARG A 1 39 ? -8.360  4.481   -19.387 1.00 0.00 ? 39 ARG A HH12 8  
ATOM 9502  H HH21 . ARG A 1 39 ? -8.591  1.114   -20.401 1.00 0.00 ? 39 ARG A HH21 8  
ATOM 9503  H HH22 . ARG A 1 39 ? -8.630  2.764   -20.926 1.00 0.00 ? 39 ARG A HH22 8  
ATOM 9504  N N    . GLU A 1 40 ? -7.309  3.215   -12.605 1.00 0.00 ? 40 GLU A N    8  
ATOM 9505  C CA   . GLU A 1 40 ? -8.502  3.696   -11.928 1.00 0.00 ? 40 GLU A CA   8  
ATOM 9506  C C    . GLU A 1 40 ? -8.139  4.279   -10.562 1.00 0.00 ? 40 GLU A C    8  
ATOM 9507  O O    . GLU A 1 40 ? -7.834  3.538   -9.628  1.00 0.00 ? 40 GLU A O    8  
ATOM 9508  C CB   . GLU A 1 40 ? -9.542  2.581   -11.790 1.00 0.00 ? 40 GLU A CB   8  
ATOM 9509  C CG   . GLU A 1 40 ? -9.389  1.548   -12.909 1.00 0.00 ? 40 GLU A CG   8  
ATOM 9510  C CD   . GLU A 1 40 ? -10.754 1.034   -13.371 1.00 0.00 ? 40 GLU A CD   8  
ATOM 9511  O OE1  . GLU A 1 40 ? -11.497 1.848   -13.961 1.00 0.00 ? 40 GLU A OE1  8  
ATOM 9512  O OE2  . GLU A 1 40 ? -11.024 -0.162  -13.123 1.00 0.00 ? 40 GLU A OE2  8  
ATOM 9513  H H    . GLU A 1 40 ? -6.958  2.340   -12.270 1.00 0.00 ? 40 GLU A H    8  
ATOM 9514  H HA   . GLU A 1 40 ? -8.903  4.480   -12.571 1.00 0.00 ? 40 GLU A HA   8  
ATOM 9515  H HB3  . GLU A 1 40 ? -10.544 3.007   -11.819 1.00 0.00 ? 40 GLU A HB3  8  
ATOM 9516  H HG3  . GLU A 1 40 ? -8.781  0.714   -12.558 1.00 0.00 ? 40 GLU A HG3  8  
ATOM 9517  N N    . PRO A 1 41 ? -8.186  5.635   -10.485 1.00 0.00 ? 41 PRO A N    8  
ATOM 9518  C CA   . PRO A 1 41 ? -7.866  6.327   -9.247  1.00 0.00 ? 41 PRO A CA   8  
ATOM 9519  C C    . PRO A 1 41 ? -9.006  6.196   -8.236  1.00 0.00 ? 41 PRO A C    8  
ATOM 9520  O O    . PRO A 1 41 ? -8.773  6.197   -7.028  1.00 0.00 ? 41 PRO A O    8  
ATOM 9521  C CB   . PRO A 1 41 ? -7.600  7.765   -9.658  1.00 0.00 ? 41 PRO A CB   8  
ATOM 9522  C CG   . PRO A 1 41 ? -8.230  7.931   -11.031 1.00 0.00 ? 41 PRO A CG   8  
ATOM 9523  C CD   . PRO A 1 41 ? -8.544  6.545   -11.569 1.00 0.00 ? 41 PRO A CD   8  
ATOM 9524  H HA   . PRO A 1 41 ? -7.067  5.911   -8.814  1.00 0.00 ? 41 PRO A HA   8  
ATOM 9525  H HB3  . PRO A 1 41 ? -6.530  7.970   -9.692  1.00 0.00 ? 41 PRO A HB3  8  
ATOM 9526  H HG3  . PRO A 1 41 ? -7.551  8.456   -11.702 1.00 0.00 ? 41 PRO A HG3  8  
ATOM 9527  H HD3  . PRO A 1 41 ? -7.970  6.330   -12.471 1.00 0.00 ? 41 PRO A HD3  8  
ATOM 9528  N N    . GLY A 1 42 ? -10.216 6.086   -8.765  1.00 0.00 ? 42 GLY A N    8  
ATOM 9529  C CA   . GLY A 1 42 ? -11.393 5.954   -7.923  1.00 0.00 ? 42 GLY A CA   8  
ATOM 9530  C C    . GLY A 1 42 ? -11.501 4.539   -7.349  1.00 0.00 ? 42 GLY A C    8  
ATOM 9531  O O    . GLY A 1 42 ? -11.793 4.366   -6.167  1.00 0.00 ? 42 GLY A O    8  
ATOM 9532  H H    . GLY A 1 42 ? -10.398 6.086   -9.748  1.00 0.00 ? 42 GLY A H    8  
ATOM 9533  H HA2  . GLY A 1 42 ? -11.345 6.678   -7.109  1.00 0.00 ? 42 GLY A HA2  8  
ATOM 9534  H HA3  . GLY A 1 42 ? -12.286 6.185   -8.502  1.00 0.00 ? 42 GLY A HA3  8  
ATOM 9535  N N    . LEU A 1 43 ? -11.260 3.565   -8.215  1.00 0.00 ? 43 LEU A N    8  
ATOM 9536  C CA   . LEU A 1 43 ? -11.327 2.171   -7.809  1.00 0.00 ? 43 LEU A CA   8  
ATOM 9537  C C    . LEU A 1 43 ? -10.645 2.007   -6.449  1.00 0.00 ? 43 LEU A C    8  
ATOM 9538  O O    . LEU A 1 43 ? -11.149 1.298   -5.579  1.00 0.00 ? 43 LEU A O    8  
ATOM 9539  C CB   . LEU A 1 43 ? -10.748 1.268   -8.900  1.00 0.00 ? 43 LEU A CB   8  
ATOM 9540  C CG   . LEU A 1 43 ? -11.093 -0.219  -8.792  1.00 0.00 ? 43 LEU A CG   8  
ATOM 9541  C CD1  . LEU A 1 43 ? -12.493 -0.498  -9.344  1.00 0.00 ? 43 LEU A CD1  8  
ATOM 9542  C CD2  . LEU A 1 43 ? -10.027 -1.081  -9.472  1.00 0.00 ? 43 LEU A CD2  8  
ATOM 9543  H H    . LEU A 1 43 ? -11.023 3.715   -9.174  1.00 0.00 ? 43 LEU A H    8  
ATOM 9544  H HA   . LEU A 1 43 ? -12.380 1.912   -7.701  1.00 0.00 ? 43 LEU A HA   8  
ATOM 9545  H HB3  . LEU A 1 43 ? -9.663  1.370   -8.891  1.00 0.00 ? 43 LEU A HB3  8  
ATOM 9546  H HG   . LEU A 1 43 ? -11.103 -0.492  -7.737  1.00 0.00 ? 43 LEU A HG   8  
ATOM 9547  H HD11 . LEU A 1 43 ? -12.771 -1.530  -9.124  1.00 0.00 ? 43 LEU A HD11 8  
ATOM 9548  H HD12 . LEU A 1 43 ? -13.209 0.178   -8.877  1.00 0.00 ? 43 LEU A HD12 8  
ATOM 9549  H HD13 . LEU A 1 43 ? -12.496 -0.343  -10.423 1.00 0.00 ? 43 LEU A HD13 8  
ATOM 9550  H HD21 . LEU A 1 43 ? -10.458 -1.570  -10.344 1.00 0.00 ? 43 LEU A HD21 8  
ATOM 9551  H HD22 . LEU A 1 43 ? -9.195  -0.450  -9.783  1.00 0.00 ? 43 LEU A HD22 8  
ATOM 9552  H HD23 . LEU A 1 43 ? -9.669  -1.835  -8.771  1.00 0.00 ? 43 LEU A HD23 8  
ATOM 9553  N N    . LEU A 1 44 ? -9.509  2.673   -6.308  1.00 0.00 ? 44 LEU A N    8  
ATOM 9554  C CA   . LEU A 1 44 ? -8.753  2.611   -5.068  1.00 0.00 ? 44 LEU A CA   8  
ATOM 9555  C C    . LEU A 1 44 ? -7.791  3.798   -5.002  1.00 0.00 ? 44 LEU A C    8  
ATOM 9556  O O    . LEU A 1 44 ? -6.848  3.883   -5.786  1.00 0.00 ? 44 LEU A O    8  
ATOM 9557  C CB   . LEU A 1 44 ? -8.063  1.253   -4.930  1.00 0.00 ? 44 LEU A CB   8  
ATOM 9558  C CG   . LEU A 1 44 ? -7.053  1.126   -3.788  1.00 0.00 ? 44 LEU A CG   8  
ATOM 9559  C CD1  . LEU A 1 44 ? -7.589  1.770   -2.508  1.00 0.00 ? 44 LEU A CD1  8  
ATOM 9560  C CD2  . LEU A 1 44 ? -6.650  -0.334  -3.571  1.00 0.00 ? 44 LEU A CD2  8  
ATOM 9561  H H    . LEU A 1 44 ? -9.105  3.248   -7.020  1.00 0.00 ? 44 LEU A H    8  
ATOM 9562  H HA   . LEU A 1 44 ? -9.464  2.696   -4.247  1.00 0.00 ? 44 LEU A HA   8  
ATOM 9563  H HB3  . LEU A 1 44 ? -7.552  1.030   -5.868  1.00 0.00 ? 44 LEU A HB3  8  
ATOM 9564  H HG   . LEU A 1 44 ? -6.151  1.671   -4.068  1.00 0.00 ? 44 LEU A HG   8  
ATOM 9565  H HD11 . LEU A 1 44 ? -7.045  1.378   -1.649  1.00 0.00 ? 44 LEU A HD11 8  
ATOM 9566  H HD12 . LEU A 1 44 ? -7.456  2.849   -2.561  1.00 0.00 ? 44 LEU A HD12 8  
ATOM 9567  H HD13 . LEU A 1 44 ? -8.649  1.539   -2.403  1.00 0.00 ? 44 LEU A HD13 8  
ATOM 9568  H HD21 . LEU A 1 44 ? -5.660  -0.504  -3.995  1.00 0.00 ? 44 LEU A HD21 8  
ATOM 9569  H HD22 . LEU A 1 44 ? -6.630  -0.550  -2.504  1.00 0.00 ? 44 LEU A HD22 8  
ATOM 9570  H HD23 . LEU A 1 44 ? -7.372  -0.987  -4.061  1.00 0.00 ? 44 LEU A HD23 8  
ATOM 9571  N N    . ALA A 1 45 ? -8.063  4.687   -4.057  1.00 0.00 ? 45 ALA A N    8  
ATOM 9572  C CA   . ALA A 1 45 ? -7.234  5.866   -3.878  1.00 0.00 ? 45 ALA A CA   8  
ATOM 9573  C C    . ALA A 1 45 ? -6.353  5.682   -2.641  1.00 0.00 ? 45 ALA A C    8  
ATOM 9574  O O    . ALA A 1 45 ? -6.851  5.366   -1.560  1.00 0.00 ? 45 ALA A O    8  
ATOM 9575  C CB   . ALA A 1 45 ? -8.125  7.107   -3.779  1.00 0.00 ? 45 ALA A CB   8  
ATOM 9576  H H    . ALA A 1 45 ? -8.833  4.611   -3.423  1.00 0.00 ? 45 ALA A H    8  
ATOM 9577  H HA   . ALA A 1 45 ? -6.596  5.961   -4.757  1.00 0.00 ? 45 ALA A HA   8  
ATOM 9578  H HB1  . ALA A 1 45 ? -8.843  6.976   -2.970  1.00 0.00 ? 45 ALA A HB1  8  
ATOM 9579  H HB2  . ALA A 1 45 ? -7.507  7.982   -3.579  1.00 0.00 ? 45 ALA A HB2  8  
ATOM 9580  H HB3  . ALA A 1 45 ? -8.658  7.247   -4.719  1.00 0.00 ? 45 ALA A HB3  8  
ATOM 9581  N N    . VAL A 1 46 ? -5.059  5.886   -2.839  1.00 0.00 ? 46 VAL A N    8  
ATOM 9582  C CA   . VAL A 1 46 ? -4.104  5.746   -1.754  1.00 0.00 ? 46 VAL A CA   8  
ATOM 9583  C C    . VAL A 1 46 ? -3.990  7.076   -1.004  1.00 0.00 ? 46 VAL A C    8  
ATOM 9584  O O    . VAL A 1 46 ? -3.656  8.099   -1.599  1.00 0.00 ? 46 VAL A O    8  
ATOM 9585  C CB   . VAL A 1 46 ? -2.763  5.249   -2.297  1.00 0.00 ? 46 VAL A CB   8  
ATOM 9586  C CG1  . VAL A 1 46 ? -1.720  5.155   -1.181  1.00 0.00 ? 46 VAL A CG1  8  
ATOM 9587  C CG2  . VAL A 1 46 ? -2.924  3.906   -3.011  1.00 0.00 ? 46 VAL A CG2  8  
ATOM 9588  H H    . VAL A 1 46 ? -4.662  6.142   -3.721  1.00 0.00 ? 46 VAL A H    8  
ATOM 9589  H HA   . VAL A 1 46 ? -4.492  4.991   -1.070  1.00 0.00 ? 46 VAL A HA   8  
ATOM 9590  H HB   . VAL A 1 46 ? -2.407  5.976   -3.027  1.00 0.00 ? 46 VAL A HB   8  
ATOM 9591  H HG11 . VAL A 1 46 ? -2.042  4.420   -0.444  1.00 0.00 ? 46 VAL A HG11 8  
ATOM 9592  H HG12 . VAL A 1 46 ? -0.762  4.850   -1.604  1.00 0.00 ? 46 VAL A HG12 8  
ATOM 9593  H HG13 . VAL A 1 46 ? -1.612  6.128   -0.701  1.00 0.00 ? 46 VAL A HG13 8  
ATOM 9594  H HG21 . VAL A 1 46 ? -2.437  3.951   -3.985  1.00 0.00 ? 46 VAL A HG21 8  
ATOM 9595  H HG22 . VAL A 1 46 ? -2.466  3.118   -2.412  1.00 0.00 ? 46 VAL A HG22 8  
ATOM 9596  H HG23 . VAL A 1 46 ? -3.984  3.690   -3.144  1.00 0.00 ? 46 VAL A HG23 8  
ATOM 9597  N N    . GLN A 1 47 ? -4.275  7.017   0.288   1.00 0.00 ? 47 GLN A N    8  
ATOM 9598  C CA   . GLN A 1 47 ? -4.209  8.204   1.123   1.00 0.00 ? 47 GLN A CA   8  
ATOM 9599  C C    . GLN A 1 47 ? -3.187  8.007   2.245   1.00 0.00 ? 47 GLN A C    8  
ATOM 9600  O O    . GLN A 1 47 ? -2.750  6.886   2.502   1.00 0.00 ? 47 GLN A O    8  
ATOM 9601  C CB   . GLN A 1 47 ? -5.586  8.551   1.691   1.00 0.00 ? 47 GLN A CB   8  
ATOM 9602  C CG   . GLN A 1 47 ? -6.484  9.168   0.616   1.00 0.00 ? 47 GLN A CG   8  
ATOM 9603  C CD   . GLN A 1 47 ? -6.341  10.691  0.590   1.00 0.00 ? 47 GLN A CD   8  
ATOM 9604  O OE1  . GLN A 1 47 ? -6.549  11.377  1.577   1.00 0.00 ? 47 GLN A OE1  8  
ATOM 9605  N NE2  . GLN A 1 47 ? -5.976  11.179  -0.592  1.00 0.00 ? 47 GLN A NE2  8  
ATOM 9606  H H    . GLN A 1 47 ? -4.546  6.180   0.763   1.00 0.00 ? 47 GLN A H    8  
ATOM 9607  H HA   . GLN A 1 47 ? -3.883  9.006   0.461   1.00 0.00 ? 47 GLN A HA   8  
ATOM 9608  H HB3  . GLN A 1 47 ? -5.476  9.250   2.521   1.00 0.00 ? 47 GLN A HB3  8  
ATOM 9609  H HG3  . GLN A 1 47 ? -7.522  8.900   0.806   1.00 0.00 ? 47 GLN A HG3  8  
ATOM 9610  H HE21 . GLN A 1 47 ? -5.820  10.561  -1.363  1.00 0.00 ? 47 GLN A HE21 8  
ATOM 9611  H HE22 . GLN A 1 47 ? -5.856  12.165  -0.710  1.00 0.00 ? 47 GLN A HE22 8  
ATOM 9612  N N    . GLY A 1 48 ? -2.834  9.114   2.882   1.00 0.00 ? 48 GLY A N    8  
ATOM 9613  C CA   . GLY A 1 48 ? -1.872  9.077   3.969   1.00 0.00 ? 48 GLY A CA   8  
ATOM 9614  C C    . GLY A 1 48 ? -0.468  8.763   3.449   1.00 0.00 ? 48 GLY A C    8  
ATOM 9615  O O    . GLY A 1 48 ? 0.342   8.167   4.159   1.00 0.00 ? 48 GLY A O    8  
ATOM 9616  H H    . GLY A 1 48 ? -3.194  10.022  2.666   1.00 0.00 ? 48 GLY A H    8  
ATOM 9617  H HA2  . GLY A 1 48 ? -1.865  10.037  4.486   1.00 0.00 ? 48 GLY A HA2  8  
ATOM 9618  H HA3  . GLY A 1 48 ? -2.171  8.325   4.699   1.00 0.00 ? 48 GLY A HA3  8  
ATOM 9619  N N    . LEU A 1 49 ? -0.223  9.175   2.214   1.00 0.00 ? 49 LEU A N    8  
ATOM 9620  C CA   . LEU A 1 49 ? 1.070   8.945   1.591   1.00 0.00 ? 49 LEU A CA   8  
ATOM 9621  C C    . LEU A 1 49 ? 2.148   9.703   2.367   1.00 0.00 ? 49 LEU A C    8  
ATOM 9622  O O    . LEU A 1 49 ? 1.837   10.559  3.194   1.00 0.00 ? 49 LEU A O    8  
ATOM 9623  C CB   . LEU A 1 49 ? 1.017   9.300   0.104   1.00 0.00 ? 49 LEU A CB   8  
ATOM 9624  C CG   . LEU A 1 49 ? 0.621   8.165   -0.843  1.00 0.00 ? 49 LEU A CG   8  
ATOM 9625  C CD1  . LEU A 1 49 ? 0.136   8.715   -2.186  1.00 0.00 ? 49 LEU A CD1  8  
ATOM 9626  C CD2  . LEU A 1 49 ? 1.768   7.167   -1.013  1.00 0.00 ? 49 LEU A CD2  8  
ATOM 9627  H H    . LEU A 1 49 ? -0.887  9.659   1.644   1.00 0.00 ? 49 LEU A H    8  
ATOM 9628  H HA   . LEU A 1 49 ? 1.279   7.878   1.660   1.00 0.00 ? 49 LEU A HA   8  
ATOM 9629  H HB3  . LEU A 1 49 ? 1.997   9.670   -0.195  1.00 0.00 ? 49 LEU A HB3  8  
ATOM 9630  H HG   . LEU A 1 49 ? -0.214  7.624   -0.397  1.00 0.00 ? 49 LEU A HG   8  
ATOM 9631  H HD11 . LEU A 1 49 ? 0.928   9.311   -2.641  1.00 0.00 ? 49 LEU A HD11 8  
ATOM 9632  H HD12 . LEU A 1 49 ? -0.120  7.887   -2.847  1.00 0.00 ? 49 LEU A HD12 8  
ATOM 9633  H HD13 . LEU A 1 49 ? -0.744  9.339   -2.027  1.00 0.00 ? 49 LEU A HD13 8  
ATOM 9634  H HD21 . LEU A 1 49 ? 1.477   6.397   -1.728  1.00 0.00 ? 49 LEU A HD21 8  
ATOM 9635  H HD22 . LEU A 1 49 ? 2.652   7.688   -1.380  1.00 0.00 ? 49 LEU A HD22 8  
ATOM 9636  H HD23 . LEU A 1 49 ? 1.991   6.703   -0.052  1.00 0.00 ? 49 LEU A HD23 8  
ATOM 9637  N N    . PRO A 1 50 ? 3.427   9.353   2.065   1.00 0.00 ? 50 PRO A N    8  
ATOM 9638  C CA   . PRO A 1 50 ? 4.553   9.990   2.724   1.00 0.00 ? 50 PRO A CA   8  
ATOM 9639  C C    . PRO A 1 50 ? 4.776   11.404  2.184   1.00 0.00 ? 50 PRO A C    8  
ATOM 9640  O O    . PRO A 1 50 ? 5.764   12.054  2.524   1.00 0.00 ? 50 PRO A O    8  
ATOM 9641  C CB   . PRO A 1 50 ? 5.731   9.065   2.473   1.00 0.00 ? 50 PRO A CB   8  
ATOM 9642  C CG   . PRO A 1 50 ? 5.331   8.188   1.297   1.00 0.00 ? 50 PRO A CG   8  
ATOM 9643  C CD   . PRO A 1 50 ? 3.833   8.343   1.091   1.00 0.00 ? 50 PRO A CD   8  
ATOM 9644  H HA   . PRO A 1 50 ? 4.368   10.098  3.701   1.00 0.00 ? 50 PRO A HA   8  
ATOM 9645  H HB3  . PRO A 1 50 ? 5.950   8.460   3.354   1.00 0.00 ? 50 PRO A HB3  8  
ATOM 9646  H HG3  . PRO A 1 50 ? 5.583   7.147   1.495   1.00 0.00 ? 50 PRO A HG3  8  
ATOM 9647  H HD3  . PRO A 1 50 ? 3.310   7.401   1.258   1.00 0.00 ? 50 PRO A HD3  8  
ATOM 9648  N N    . GLU A 1 51 ? 3.843   11.838  1.350   1.00 0.00 ? 51 GLU A N    8  
ATOM 9649  C CA   . GLU A 1 51 ? 3.926   13.162  0.758   1.00 0.00 ? 51 GLU A CA   8  
ATOM 9650  C C    . GLU A 1 51 ? 5.197   13.290  -0.083  1.00 0.00 ? 51 GLU A C    8  
ATOM 9651  O O    . GLU A 1 51 ? 6.230   12.716  0.256   1.00 0.00 ? 51 GLU A O    8  
ATOM 9652  C CB   . GLU A 1 51 ? 3.869   14.248  1.834   1.00 0.00 ? 51 GLU A CB   8  
ATOM 9653  C CG   . GLU A 1 51 ? 2.437   14.455  2.331   1.00 0.00 ? 51 GLU A CG   8  
ATOM 9654  C CD   . GLU A 1 51 ? 2.075   15.941  2.359   1.00 0.00 ? 51 GLU A CD   8  
ATOM 9655  O OE1  . GLU A 1 51 ? 1.801   16.480  1.265   1.00 0.00 ? 51 GLU A OE1  8  
ATOM 9656  O OE2  . GLU A 1 51 ? 2.083   16.505  3.475   1.00 0.00 ? 51 GLU A OE2  8  
ATOM 9657  H H    . GLU A 1 51 ? 3.043   11.303  1.077   1.00 0.00 ? 51 GLU A H    8  
ATOM 9658  H HA   . GLU A 1 51 ? 3.048   13.249  0.117   1.00 0.00 ? 51 GLU A HA   8  
ATOM 9659  H HB3  . GLU A 1 51 ? 4.257   15.184  1.432   1.00 0.00 ? 51 GLU A HB3  8  
ATOM 9660  H HG3  . GLU A 1 51 ? 2.330   14.032  3.330   1.00 0.00 ? 51 GLU A HG3  8  
ATOM 9661  N N    . GLY A 1 52 ? 5.080   14.046  -1.164  1.00 0.00 ? 52 GLY A N    8  
ATOM 9662  C CA   . GLY A 1 52 ? 6.207   14.257  -2.057  1.00 0.00 ? 52 GLY A CA   8  
ATOM 9663  C C    . GLY A 1 52 ? 6.547   12.976  -2.822  1.00 0.00 ? 52 GLY A C    8  
ATOM 9664  O O    . GLY A 1 52 ? 7.702   12.749  -3.177  1.00 0.00 ? 52 GLY A O    8  
ATOM 9665  H H    . GLY A 1 52 ? 4.236   14.511  -1.434  1.00 0.00 ? 52 GLY A H    8  
ATOM 9666  H HA2  . GLY A 1 52 ? 5.973   15.054  -2.762  1.00 0.00 ? 52 GLY A HA2  8  
ATOM 9667  H HA3  . GLY A 1 52 ? 7.074   14.583  -1.483  1.00 0.00 ? 52 GLY A HA3  8  
ATOM 9668  N N    . LEU A 1 53 ? 5.519   12.173  -3.054  1.00 0.00 ? 53 LEU A N    8  
ATOM 9669  C CA   . LEU A 1 53 ? 5.694   10.921  -3.771  1.00 0.00 ? 53 LEU A CA   8  
ATOM 9670  C C    . LEU A 1 53 ? 4.494   10.693  -4.691  1.00 0.00 ? 53 LEU A C    8  
ATOM 9671  O O    . LEU A 1 53 ? 3.651   11.575  -4.848  1.00 0.00 ? 53 LEU A O    8  
ATOM 9672  C CB   . LEU A 1 53 ? 5.942   9.773   -2.790  1.00 0.00 ? 53 LEU A CB   8  
ATOM 9673  C CG   . LEU A 1 53 ? 7.403   9.514   -2.416  1.00 0.00 ? 53 LEU A CG   8  
ATOM 9674  C CD1  . LEU A 1 53 ? 7.511   8.423   -1.350  1.00 0.00 ? 53 LEU A CD1  8  
ATOM 9675  C CD2  . LEU A 1 53 ? 8.237   9.189   -3.656  1.00 0.00 ? 53 LEU A CD2  8  
ATOM 9676  H H    . LEU A 1 53 ? 4.582   12.365  -2.762  1.00 0.00 ? 53 LEU A H    8  
ATOM 9677  H HA   . LEU A 1 53 ? 6.588   11.019  -4.385  1.00 0.00 ? 53 LEU A HA   8  
ATOM 9678  H HB3  . LEU A 1 53 ? 5.531   8.860   -3.219  1.00 0.00 ? 53 LEU A HB3  8  
ATOM 9679  H HG   . LEU A 1 53 ? 7.812   10.429  -1.983  1.00 0.00 ? 53 LEU A HG   8  
ATOM 9680  H HD11 . LEU A 1 53 ? 6.595   7.833   -1.339  1.00 0.00 ? 53 LEU A HD11 8  
ATOM 9681  H HD12 . LEU A 1 53 ? 8.358   7.775   -1.577  1.00 0.00 ? 53 LEU A HD12 8  
ATOM 9682  H HD13 . LEU A 1 53 ? 7.659   8.883   -0.372  1.00 0.00 ? 53 LEU A HD13 8  
ATOM 9683  H HD21 . LEU A 1 53 ? 7.742   8.409   -4.233  1.00 0.00 ? 53 LEU A HD21 8  
ATOM 9684  H HD22 . LEU A 1 53 ? 8.341   10.084  -4.270  1.00 0.00 ? 53 LEU A HD22 8  
ATOM 9685  H HD23 . LEU A 1 53 ? 9.224   8.843   -3.349  1.00 0.00 ? 53 LEU A HD23 8  
ATOM 9686  N N    . ALA A 1 54 ? 4.456   9.506   -5.278  1.00 0.00 ? 54 ALA A N    8  
ATOM 9687  C CA   . ALA A 1 54 ? 3.374   9.152   -6.181  1.00 0.00 ? 54 ALA A CA   8  
ATOM 9688  C C    . ALA A 1 54 ? 3.052   7.665   -6.025  1.00 0.00 ? 54 ALA A C    8  
ATOM 9689  O O    . ALA A 1 54 ? 3.957   6.832   -5.980  1.00 0.00 ? 54 ALA A O    8  
ATOM 9690  C CB   . ALA A 1 54 ? 3.763   9.518   -7.614  1.00 0.00 ? 54 ALA A CB   8  
ATOM 9691  H H    . ALA A 1 54 ? 5.146   8.794   -5.146  1.00 0.00 ? 54 ALA A H    8  
ATOM 9692  H HA   . ALA A 1 54 ? 2.498   9.736   -5.895  1.00 0.00 ? 54 ALA A HA   8  
ATOM 9693  H HB1  . ALA A 1 54 ? 4.206   10.513  -7.628  1.00 0.00 ? 54 ALA A HB1  8  
ATOM 9694  H HB2  . ALA A 1 54 ? 4.485   8.793   -7.990  1.00 0.00 ? 54 ALA A HB2  8  
ATOM 9695  H HB3  . ALA A 1 54 ? 2.875   9.507   -8.246  1.00 0.00 ? 54 ALA A HB3  8  
ATOM 9696  N N    . PHE A 1 55 ? 1.761   7.375   -5.947  1.00 0.00 ? 55 PHE A N    8  
ATOM 9697  C CA   . PHE A 1 55 ? 1.309   6.003   -5.798  1.00 0.00 ? 55 PHE A CA   8  
ATOM 9698  C C    . PHE A 1 55 ? 1.784   5.138   -6.967  1.00 0.00 ? 55 PHE A C    8  
ATOM 9699  O O    . PHE A 1 55 ? 1.300   5.284   -8.088  1.00 0.00 ? 55 PHE A O    8  
ATOM 9700  C CB   . PHE A 1 55 ? -0.221  6.033   -5.790  1.00 0.00 ? 55 PHE A CB   8  
ATOM 9701  C CG   . PHE A 1 55 ? -0.872  4.660   -5.966  1.00 0.00 ? 55 PHE A CG   8  
ATOM 9702  C CD1  . PHE A 1 55 ? -0.456  3.608   -5.211  1.00 0.00 ? 55 PHE A CD1  8  
ATOM 9703  C CD2  . PHE A 1 55 ? -1.866  4.491   -6.878  1.00 0.00 ? 55 PHE A CD2  8  
ATOM 9704  C CE1  . PHE A 1 55 ? -1.061  2.334   -5.375  1.00 0.00 ? 55 PHE A CE1  8  
ATOM 9705  C CE2  . PHE A 1 55 ? -2.470  3.216   -7.042  1.00 0.00 ? 55 PHE A CE2  8  
ATOM 9706  C CZ   . PHE A 1 55 ? -2.054  2.165   -6.287  1.00 0.00 ? 55 PHE A CZ   8  
ATOM 9707  H H    . PHE A 1 55 ? 1.032   8.059   -5.984  1.00 0.00 ? 55 PHE A H    8  
ATOM 9708  H HA   . PHE A 1 55 ? 1.735   5.621   -4.869  1.00 0.00 ? 55 PHE A HA   8  
ATOM 9709  H HB3  . PHE A 1 55 ? -0.565  6.693   -6.587  1.00 0.00 ? 55 PHE A HB3  8  
ATOM 9710  H HD1  . PHE A 1 55 ? 0.341   3.744   -4.479  1.00 0.00 ? 55 PHE A HD1  8  
ATOM 9711  H HD2  . PHE A 1 55 ? -2.199  5.334   -7.484  1.00 0.00 ? 55 PHE A HD2  8  
ATOM 9712  H HE1  . PHE A 1 55 ? -0.727  1.491   -4.769  1.00 0.00 ? 55 PHE A HE1  8  
ATOM 9713  H HE2  . PHE A 1 55 ? -3.267  3.081   -7.774  1.00 0.00 ? 55 PHE A HE2  8  
ATOM 9714  H HZ   . PHE A 1 55 ? -2.519  1.187   -6.413  1.00 0.00 ? 55 PHE A HZ   8  
ATOM 9715  N N    . ARG A 1 56 ? 2.726   4.257   -6.666  1.00 0.00 ? 56 ARG A N    8  
ATOM 9716  C CA   . ARG A 1 56 ? 3.272   3.369   -7.678  1.00 0.00 ? 56 ARG A CA   8  
ATOM 9717  C C    . ARG A 1 56 ? 4.035   2.218   -7.019  1.00 0.00 ? 56 ARG A C    8  
ATOM 9718  O O    . ARG A 1 56 ? 4.285   2.243   -5.815  1.00 0.00 ? 56 ARG A O    8  
ATOM 9719  C CB   . ARG A 1 56 ? 4.213   4.123   -8.621  1.00 0.00 ? 56 ARG A CB   8  
ATOM 9720  C CG   . ARG A 1 56 ? 4.941   5.249   -7.885  1.00 0.00 ? 56 ARG A CG   8  
ATOM 9721  C CD   . ARG A 1 56 ? 6.384   5.381   -8.375  1.00 0.00 ? 56 ARG A CD   8  
ATOM 9722  N NE   . ARG A 1 56 ? 6.402   5.829   -9.785  1.00 0.00 ? 56 ARG A NE   8  
ATOM 9723  C CZ   . ARG A 1 56 ? 7.501   6.248   -10.427 1.00 0.00 ? 56 ARG A CZ   8  
ATOM 9724  N NH1  . ARG A 1 56 ? 8.679   6.278   -9.788  1.00 0.00 ? 56 ARG A NH1  8  
ATOM 9725  N NH2  . ARG A 1 56 ? 7.423   6.635   -11.707 1.00 0.00 ? 56 ARG A NH2  8  
ATOM 9726  H H    . ARG A 1 56 ? 3.115   4.145   -5.751  1.00 0.00 ? 56 ARG A H    8  
ATOM 9727  H HA   . ARG A 1 56 ? 2.403   3.002   -8.225  1.00 0.00 ? 56 ARG A HA   8  
ATOM 9728  H HB3  . ARG A 1 56 ? 3.646   4.535   -9.454  1.00 0.00 ? 56 ARG A HB3  8  
ATOM 9729  H HG3  . ARG A 1 56 ? 4.933   5.052   -6.813  1.00 0.00 ? 56 ARG A HG3  8  
ATOM 9730  H HD3  . ARG A 1 56 ? 6.897   4.424   -8.282  1.00 0.00 ? 56 ARG A HD3  8  
ATOM 9731  H HE   . ARG A 1 56 ? 5.539   5.819   -10.290 1.00 0.00 ? 56 ARG A HE   8  
ATOM 9732  H HH11 . ARG A 1 56 ? 8.737   5.989   -8.833  1.00 0.00 ? 56 ARG A HH11 8  
ATOM 9733  H HH12 . ARG A 1 56 ? 9.500   6.591   -10.267 1.00 0.00 ? 56 ARG A HH12 8  
ATOM 9734  H HH21 . ARG A 1 56 ? 6.544   6.613   -12.183 1.00 0.00 ? 56 ARG A HH21 8  
ATOM 9735  H HH22 . ARG A 1 56 ? 8.243   6.948   -12.186 1.00 0.00 ? 56 ARG A HH22 8  
ATOM 9736  N N    . ARG A 1 57 ? 4.383   1.236   -7.837  1.00 0.00 ? 57 ARG A N    8  
ATOM 9737  C CA   . ARG A 1 57 ? 5.111   0.078   -7.350  1.00 0.00 ? 57 ARG A CA   8  
ATOM 9738  C C    . ARG A 1 57 ? 6.153   0.504   -6.313  1.00 0.00 ? 57 ARG A C    8  
ATOM 9739  O O    . ARG A 1 57 ? 6.707   1.599   -6.399  1.00 0.00 ? 57 ARG A O    8  
ATOM 9740  C CB   . ARG A 1 57 ? 5.813   -0.655  -8.495  1.00 0.00 ? 57 ARG A CB   8  
ATOM 9741  C CG   . ARG A 1 57 ? 4.955   -1.810  -9.014  1.00 0.00 ? 57 ARG A CG   8  
ATOM 9742  C CD   . ARG A 1 57 ? 4.883   -2.943  -7.988  1.00 0.00 ? 57 ARG A CD   8  
ATOM 9743  N NE   . ARG A 1 57 ? 4.108   -4.077  -8.539  1.00 0.00 ? 57 ARG A NE   8  
ATOM 9744  C CZ   . ARG A 1 57 ? 4.532   -4.860  -9.540  1.00 0.00 ? 57 ARG A CZ   8  
ATOM 9745  N NH1  . ARG A 1 57 ? 5.724   -4.635  -10.108 1.00 0.00 ? 57 ARG A NH1  8  
ATOM 9746  N NH2  . ARG A 1 57 ? 3.761   -5.866  -9.976  1.00 0.00 ? 57 ARG A NH2  8  
ATOM 9747  H H    . ARG A 1 57 ? 4.175   1.223   -8.816  1.00 0.00 ? 57 ARG A H    8  
ATOM 9748  H HA   . ARG A 1 57 ? 4.351   -0.562  -6.902  1.00 0.00 ? 57 ARG A HA   8  
ATOM 9749  H HB3  . ARG A 1 57 ? 6.775   -1.036  -8.153  1.00 0.00 ? 57 ARG A HB3  8  
ATOM 9750  H HG3  . ARG A 1 57 ? 5.372   -2.188  -9.948  1.00 0.00 ? 57 ARG A HG3  8  
ATOM 9751  H HD3  . ARG A 1 57 ? 4.416   -2.584  -7.070  1.00 0.00 ? 57 ARG A HD3  8  
ATOM 9752  H HE   . ARG A 1 57 ? 3.213   -4.271  -8.138  1.00 0.00 ? 57 ARG A HE   8  
ATOM 9753  H HH11 . ARG A 1 57 ? 6.299   -3.885  -9.782  1.00 0.00 ? 57 ARG A HH11 8  
ATOM 9754  H HH12 . ARG A 1 57 ? 6.040   -5.220  -10.856 1.00 0.00 ? 57 ARG A HH12 8  
ATOM 9755  H HH21 . ARG A 1 57 ? 2.870   -6.033  -9.553  1.00 0.00 ? 57 ARG A HH21 8  
ATOM 9756  H HH22 . ARG A 1 57 ? 4.076   -6.450  -10.724 1.00 0.00 ? 57 ARG A HH22 8  
ATOM 9757  N N    . PRO A 1 58 ? 6.392   -0.406  -5.331  1.00 0.00 ? 58 PRO A N    8  
ATOM 9758  C CA   . PRO A 1 58 ? 7.357   -0.136  -4.279  1.00 0.00 ? 58 PRO A CA   8  
ATOM 9759  C C    . PRO A 1 58 ? 8.789   -0.269  -4.800  1.00 0.00 ? 58 PRO A C    8  
ATOM 9760  O O    . PRO A 1 58 ? 9.734   0.184   -4.156  1.00 0.00 ? 58 PRO A O    8  
ATOM 9761  C CB   . PRO A 1 58 ? 7.030   -1.133  -3.179  1.00 0.00 ? 58 PRO A CB   8  
ATOM 9762  C CG   . PRO A 1 58 ? 6.204   -2.225  -3.839  1.00 0.00 ? 58 PRO A CG   8  
ATOM 9763  C CD   . PRO A 1 58 ? 5.754   -1.713  -5.198  1.00 0.00 ? 58 PRO A CD   8  
ATOM 9764  H HA   . PRO A 1 58 ? 7.269   0.808   -3.962  1.00 0.00 ? 58 PRO A HA   8  
ATOM 9765  H HB3  . PRO A 1 58 ? 6.474   -0.656  -2.373  1.00 0.00 ? 58 PRO A HB3  8  
ATOM 9766  H HG3  . PRO A 1 58 ? 5.342   -2.477  -3.222  1.00 0.00 ? 58 PRO A HG3  8  
ATOM 9767  H HD3  . PRO A 1 58 ? 4.668   -1.630  -5.249  1.00 0.00 ? 58 PRO A HD3  8  
ATOM 9768  N N    . ALA A 1 59 ? 8.906   -0.894  -5.963  1.00 0.00 ? 59 ALA A N    8  
ATOM 9769  C CA   . ALA A 1 59 ? 10.207  -1.093  -6.580  1.00 0.00 ? 59 ALA A CA   8  
ATOM 9770  C C    . ALA A 1 59 ? 10.576  0.149   -7.393  1.00 0.00 ? 59 ALA A C    8  
ATOM 9771  O O    . ALA A 1 59 ? 11.755  0.431   -7.601  1.00 0.00 ? 59 ALA A O    8  
ATOM 9772  C CB   . ALA A 1 59 ? 10.179  -2.362  -7.432  1.00 0.00 ? 59 ALA A CB   8  
ATOM 9773  H H    . ALA A 1 59 ? 8.132   -1.259  -6.482  1.00 0.00 ? 59 ALA A H    8  
ATOM 9774  H HA   . ALA A 1 59 ? 10.936  -1.222  -5.779  1.00 0.00 ? 59 ALA A HA   8  
ATOM 9775  H HB1  . ALA A 1 59 ? 10.248  -3.237  -6.784  1.00 0.00 ? 59 ALA A HB1  8  
ATOM 9776  H HB2  . ALA A 1 59 ? 9.248   -2.401  -7.997  1.00 0.00 ? 59 ALA A HB2  8  
ATOM 9777  H HB3  . ALA A 1 59 ? 11.023  -2.355  -8.122  1.00 0.00 ? 59 ALA A HB3  8  
ATOM 9778  N N    . GLU A 1 60 ? 9.546   0.857   -7.833  1.00 0.00 ? 60 GLU A N    8  
ATOM 9779  C CA   . GLU A 1 60 ? 9.747   2.061   -8.620  1.00 0.00 ? 60 GLU A CA   8  
ATOM 9780  C C    . GLU A 1 60 ? 10.103  3.238   -7.709  1.00 0.00 ? 60 GLU A C    8  
ATOM 9781  O O    . GLU A 1 60 ? 10.709  4.212   -8.154  1.00 0.00 ? 60 GLU A O    8  
ATOM 9782  C CB   . GLU A 1 60 ? 8.511   2.377   -9.465  1.00 0.00 ? 60 GLU A CB   8  
ATOM 9783  C CG   . GLU A 1 60 ? 8.204   1.235   -10.435 1.00 0.00 ? 60 GLU A CG   8  
ATOM 9784  C CD   . GLU A 1 60 ? 7.098   1.631   -11.415 1.00 0.00 ? 60 GLU A CD   8  
ATOM 9785  O OE1  . GLU A 1 60 ? 7.431   2.329   -12.396 1.00 0.00 ? 60 GLU A OE1  8  
ATOM 9786  O OE2  . GLU A 1 60 ? 5.943   1.225   -11.160 1.00 0.00 ? 60 GLU A OE2  8  
ATOM 9787  H H    . GLU A 1 60 ? 8.590   0.620   -7.659  1.00 0.00 ? 60 GLU A H    8  
ATOM 9788  H HA   . GLU A 1 60 ? 10.585  1.839   -9.282  1.00 0.00 ? 60 GLU A HA   8  
ATOM 9789  H HB3  . GLU A 1 60 ? 8.673   3.299   -10.023 1.00 0.00 ? 60 GLU A HB3  8  
ATOM 9790  H HG3  . GLU A 1 60 ? 7.901   0.350   -9.876  1.00 0.00 ? 60 GLU A HG3  8  
ATOM 9791  N N    . TYR A 1 61 ? 9.712   3.109   -6.449  1.00 0.00 ? 61 TYR A N    8  
ATOM 9792  C CA   . TYR A 1 61 ? 9.982   4.150   -5.472  1.00 0.00 ? 61 TYR A CA   8  
ATOM 9793  C C    . TYR A 1 61 ? 11.482  4.261   -5.190  1.00 0.00 ? 61 TYR A C    8  
ATOM 9794  O O    . TYR A 1 61 ? 12.251  3.370   -5.547  1.00 0.00 ? 61 TYR A O    8  
ATOM 9795  C CB   . TYR A 1 61 ? 9.265   3.721   -4.190  1.00 0.00 ? 61 TYR A CB   8  
ATOM 9796  C CG   . TYR A 1 61 ? 7.877   4.340   -4.016  1.00 0.00 ? 61 TYR A CG   8  
ATOM 9797  C CD1  . TYR A 1 61 ? 7.649   5.644   -4.407  1.00 0.00 ? 61 TYR A CD1  8  
ATOM 9798  C CD2  . TYR A 1 61 ? 6.852   3.595   -3.468  1.00 0.00 ? 61 TYR A CD2  8  
ATOM 9799  C CE1  . TYR A 1 61 ? 6.343   6.227   -4.244  1.00 0.00 ? 61 TYR A CE1  8  
ATOM 9800  C CE2  . TYR A 1 61 ? 5.546   4.177   -3.305  1.00 0.00 ? 61 TYR A CE2  8  
ATOM 9801  C CZ   . TYR A 1 61 ? 5.356   5.466   -3.700  1.00 0.00 ? 61 TYR A CZ   8  
ATOM 9802  O OH   . TYR A 1 61 ? 4.122   6.015   -3.546  1.00 0.00 ? 61 TYR A OH   8  
ATOM 9803  H H    . TYR A 1 61 ? 9.219   2.315   -6.095  1.00 0.00 ? 61 TYR A H    8  
ATOM 9804  H HA   . TYR A 1 61 ? 9.625   5.096   -5.879  1.00 0.00 ? 61 TYR A HA   8  
ATOM 9805  H HB3  . TYR A 1 61 ? 9.881   3.990   -3.333  1.00 0.00 ? 61 TYR A HB3  8  
ATOM 9806  H HD1  . TYR A 1 61 ? 8.459   6.232   -4.840  1.00 0.00 ? 61 TYR A HD1  8  
ATOM 9807  H HD2  . TYR A 1 61 ? 7.032   2.565   -3.159  1.00 0.00 ? 61 TYR A HD2  8  
ATOM 9808  H HE1  . TYR A 1 61 ? 6.149   7.255   -4.548  1.00 0.00 ? 61 TYR A HE1  8  
ATOM 9809  H HE2  . TYR A 1 61 ? 4.729   3.600   -2.874  1.00 0.00 ? 61 TYR A HE2  8  
ATOM 9810  H HH   . TYR A 1 61 ? 4.098   6.923   -3.965  1.00 0.00 ? 61 TYR A HH   8  
ATOM 9811  N N    . ASP A 1 62 ? 11.851  5.362   -4.553  1.00 0.00 ? 62 ASP A N    8  
ATOM 9812  C CA   . ASP A 1 62 ? 13.245  5.602   -4.220  1.00 0.00 ? 62 ASP A CA   8  
ATOM 9813  C C    . ASP A 1 62 ? 13.584  4.881   -2.914  1.00 0.00 ? 62 ASP A C    8  
ATOM 9814  O O    . ASP A 1 62 ? 12.733  4.207   -2.334  1.00 0.00 ? 62 ASP A O    8  
ATOM 9815  C CB   . ASP A 1 62 ? 13.515  7.095   -4.019  1.00 0.00 ? 62 ASP A CB   8  
ATOM 9816  C CG   . ASP A 1 62 ? 12.390  8.023   -4.480  1.00 0.00 ? 62 ASP A CG   8  
ATOM 9817  O OD1  . ASP A 1 62 ? 11.921  7.823   -5.621  1.00 0.00 ? 62 ASP A OD1  8  
ATOM 9818  O OD2  . ASP A 1 62 ? 12.024  8.911   -3.681  1.00 0.00 ? 62 ASP A OD2  8  
ATOM 9819  H H    . ASP A 1 62 ? 11.219  6.082   -4.267  1.00 0.00 ? 62 ASP A H    8  
ATOM 9820  H HA   . ASP A 1 62 ? 13.813  5.218   -5.068  1.00 0.00 ? 62 ASP A HA   8  
ATOM 9821  H HB3  . ASP A 1 62 ? 14.426  7.359   -4.555  1.00 0.00 ? 62 ASP A HB3  8  
ATOM 9822  N N    . PRO A 1 63 ? 14.861  5.050   -2.478  1.00 0.00 ? 63 PRO A N    8  
ATOM 9823  C CA   . PRO A 1 63 ? 15.323  4.422   -1.251  1.00 0.00 ? 63 PRO A CA   8  
ATOM 9824  C C    . PRO A 1 63 ? 14.770  5.149   -0.023  1.00 0.00 ? 63 PRO A C    8  
ATOM 9825  O O    . PRO A 1 63 ? 14.223  4.519   0.881   1.00 0.00 ? 63 PRO A O    8  
ATOM 9826  C CB   . PRO A 1 63 ? 16.840  4.465   -1.334  1.00 0.00 ? 63 PRO A CB   8  
ATOM 9827  C CG   . PRO A 1 63 ? 17.171  5.522   -2.376  1.00 0.00 ? 63 PRO A CG   8  
ATOM 9828  C CD   . PRO A 1 63 ? 15.896  5.839   -3.140  1.00 0.00 ? 63 PRO A CD   8  
ATOM 9829  H HA   . PRO A 1 63 ? 14.981  3.484   -1.191  1.00 0.00 ? 63 PRO A HA   8  
ATOM 9830  H HB3  . PRO A 1 63 ? 17.242  3.493   -1.623  1.00 0.00 ? 63 PRO A HB3  8  
ATOM 9831  H HG3  . PRO A 1 63 ? 17.943  5.160   -3.055  1.00 0.00 ? 63 PRO A HG3  8  
ATOM 9832  H HD3  . PRO A 1 63 ? 15.987  5.570   -4.191  1.00 0.00 ? 63 PRO A HD3  8  
ATOM 9833  N N    . LYS A 1 64 ? 14.935  6.463   -0.030  1.00 0.00 ? 64 LYS A N    8  
ATOM 9834  C CA   . LYS A 1 64 ? 14.460  7.282   1.073   1.00 0.00 ? 64 LYS A CA   8  
ATOM 9835  C C    . LYS A 1 64 ? 12.929  7.278   1.083   1.00 0.00 ? 64 LYS A C    8  
ATOM 9836  O O    . LYS A 1 64 ? 12.311  7.551   2.111   1.00 0.00 ? 64 LYS A O    8  
ATOM 9837  C CB   . LYS A 1 64 ? 15.071  8.683   1.002   1.00 0.00 ? 64 LYS A CB   8  
ATOM 9838  C CG   . LYS A 1 64 ? 16.441  8.719   1.680   1.00 0.00 ? 64 LYS A CG   8  
ATOM 9839  C CD   . LYS A 1 64 ? 17.523  8.146   0.760   1.00 0.00 ? 64 LYS A CD   8  
ATOM 9840  C CE   . LYS A 1 64 ? 18.920  8.483   1.283   1.00 0.00 ? 64 LYS A CE   8  
ATOM 9841  N NZ   . LYS A 1 64 ? 19.799  8.915   0.173   1.00 0.00 ? 64 LYS A NZ   8  
ATOM 9842  H H    . LYS A 1 64 ? 15.380  6.967   -0.769  1.00 0.00 ? 64 LYS A H    8  
ATOM 9843  H HA   . LYS A 1 64 ? 14.812  6.823   1.996   1.00 0.00 ? 64 LYS A HA   8  
ATOM 9844  H HB3  . LYS A 1 64 ? 14.404  9.399   1.483   1.00 0.00 ? 64 LYS A HB3  8  
ATOM 9845  H HG3  . LYS A 1 64 ? 16.408  8.146   2.607   1.00 0.00 ? 64 LYS A HG3  8  
ATOM 9846  H HD3  . LYS A 1 64 ? 17.400  8.548   -0.246  1.00 0.00 ? 64 LYS A HD3  8  
ATOM 9847  H HE3  . LYS A 1 64 ? 19.351  7.611   1.776   1.00 0.00 ? 64 LYS A HE3  8  
ATOM 9848  H HZ1  . LYS A 1 64 ? 20.133  8.112   -0.320  1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 9849  H HZ2  . LYS A 1 64 ? 19.282  9.499   -0.453  1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 9850  H HZ3  . LYS A 1 64 ? 20.575  9.427   0.541   1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 9851  N N    . ALA A 1 65 ? 12.362  6.966   -0.073  1.00 0.00 ? 65 ALA A N    8  
ATOM 9852  C CA   . ALA A 1 65 ? 10.917  6.923   -0.210  1.00 0.00 ? 65 ALA A CA   8  
ATOM 9853  C C    . ALA A 1 65 ? 10.364  5.765   0.624   1.00 0.00 ? 65 ALA A C    8  
ATOM 9854  O O    . ALA A 1 65 ? 9.534   5.973   1.508   1.00 0.00 ? 65 ALA A O    8  
ATOM 9855  C CB   . ALA A 1 65 ? 10.547  6.803   -1.690  1.00 0.00 ? 65 ALA A CB   8  
ATOM 9856  H H    . ALA A 1 65 ? 12.873  6.744   -0.904  1.00 0.00 ? 65 ALA A H    8  
ATOM 9857  H HA   . ALA A 1 65 ? 10.518  7.861   0.177   1.00 0.00 ? 65 ALA A HA   8  
ATOM 9858  H HB1  . ALA A 1 65 ? 11.359  6.315   -2.229  1.00 0.00 ? 65 ALA A HB1  8  
ATOM 9859  H HB2  . ALA A 1 65 ? 9.637   6.212   -1.791  1.00 0.00 ? 65 ALA A HB2  8  
ATOM 9860  H HB3  . ALA A 1 65 ? 10.382  7.797   -2.104  1.00 0.00 ? 65 ALA A HB3  8  
ATOM 9861  N N    . LEU A 1 66 ? 10.847  4.570   0.314   1.00 0.00 ? 66 LEU A N    8  
ATOM 9862  C CA   . LEU A 1 66 ? 10.410  3.380   1.024   1.00 0.00 ? 66 LEU A CA   8  
ATOM 9863  C C    . LEU A 1 66 ? 10.468  3.640   2.531   1.00 0.00 ? 66 LEU A C    8  
ATOM 9864  O O    . LEU A 1 66 ? 9.553   3.269   3.263   1.00 0.00 ? 66 LEU A O    8  
ATOM 9865  C CB   . LEU A 1 66 ? 11.224  2.163   0.578   1.00 0.00 ? 66 LEU A CB   8  
ATOM 9866  C CG   . LEU A 1 66 ? 11.176  1.834   -0.916  1.00 0.00 ? 66 LEU A CG   8  
ATOM 9867  C CD1  . LEU A 1 66 ? 12.232  0.790   -1.282  1.00 0.00 ? 66 LEU A CD1  8  
ATOM 9868  C CD2  . LEU A 1 66 ? 9.770   1.399   -1.335  1.00 0.00 ? 66 LEU A CD2  8  
ATOM 9869  H H    . LEU A 1 66 ? 11.521  4.410   -0.406  1.00 0.00 ? 66 LEU A H    8  
ATOM 9870  H HA   . LEU A 1 66 ? 9.374   3.194   0.744   1.00 0.00 ? 66 LEU A HA   8  
ATOM 9871  H HB3  . LEU A 1 66 ? 10.873  1.293   1.133   1.00 0.00 ? 66 LEU A HB3  8  
ATOM 9872  H HG   . LEU A 1 66 ? 11.412  2.741   -1.473  1.00 0.00 ? 66 LEU A HG   8  
ATOM 9873  H HD11 . LEU A 1 66 ? 12.558  0.272   -0.380  1.00 0.00 ? 66 LEU A HD11 8  
ATOM 9874  H HD12 . LEU A 1 66 ? 11.805  0.070   -1.979  1.00 0.00 ? 66 LEU A HD12 8  
ATOM 9875  H HD13 . LEU A 1 66 ? 13.086  1.284   -1.746  1.00 0.00 ? 66 LEU A HD13 8  
ATOM 9876  H HD21 . LEU A 1 66 ? 9.453   1.982   -2.201  1.00 0.00 ? 66 LEU A HD21 8  
ATOM 9877  H HD22 . LEU A 1 66 ? 9.779   0.340   -1.594  1.00 0.00 ? 66 LEU A HD22 8  
ATOM 9878  H HD23 . LEU A 1 66 ? 9.077   1.565   -0.512  1.00 0.00 ? 66 LEU A HD23 8  
ATOM 9879  N N    . MET A 1 67 ? 11.554  4.276   2.948   1.00 0.00 ? 67 MET A N    8  
ATOM 9880  C CA   . MET A 1 67 ? 11.742  4.591   4.354   1.00 0.00 ? 67 MET A CA   8  
ATOM 9881  C C    . MET A 1 67 ? 10.691  5.591   4.838   1.00 0.00 ? 67 MET A C    8  
ATOM 9882  O O    . MET A 1 67 ? 10.266  5.541   5.991   1.00 0.00 ? 67 MET A O    8  
ATOM 9883  C CB   . MET A 1 67 ? 13.140  5.176   4.562   1.00 0.00 ? 67 MET A CB   8  
ATOM 9884  C CG   . MET A 1 67 ? 14.178  4.067   4.742   1.00 0.00 ? 67 MET A CG   8  
ATOM 9885  S SD   . MET A 1 67 ? 15.819  4.769   4.794   1.00 0.00 ? 67 MET A SD   8  
ATOM 9886  C CE   . MET A 1 67 ? 16.274  4.620   3.074   1.00 0.00 ? 67 MET A CE   8  
ATOM 9887  H H    . MET A 1 67 ? 12.293  4.575   2.345   1.00 0.00 ? 67 MET A H    8  
ATOM 9888  H HA   . MET A 1 67 ? 11.625  3.644   4.883   1.00 0.00 ? 67 MET A HA   8  
ATOM 9889  H HB3  . MET A 1 67 ? 13.139  5.824   5.439   1.00 0.00 ? 67 MET A HB3  8  
ATOM 9890  H HG3  . MET A 1 67 ? 14.106  3.353   3.922   1.00 0.00 ? 67 MET A HG3  8  
ATOM 9891  H HE1  . MET A 1 67 ? 16.296  5.609   2.617   1.00 0.00 ? 67 MET A HE1  8  
ATOM 9892  H HE2  . MET A 1 67 ? 17.260  4.162   2.998   1.00 0.00 ? 67 MET A HE2  8  
ATOM 9893  H HE3  . MET A 1 67 ? 15.544  3.997   2.558   1.00 0.00 ? 67 MET A HE3  8  
ATOM 9894  N N    . ALA A 1 68 ? 10.302  6.476   3.932   1.00 0.00 ? 68 ALA A N    8  
ATOM 9895  C CA   . ALA A 1 68 ? 9.309   7.487   4.254   1.00 0.00 ? 68 ALA A CA   8  
ATOM 9896  C C    . ALA A 1 68 ? 7.915   6.858   4.212   1.00 0.00 ? 68 ALA A C    8  
ATOM 9897  O O    . ALA A 1 68 ? 7.005   7.312   4.903   1.00 0.00 ? 68 ALA A O    8  
ATOM 9898  C CB   . ALA A 1 68 ? 9.446   8.664   3.283   1.00 0.00 ? 68 ALA A CB   8  
ATOM 9899  H H    . ALA A 1 68 ? 10.653  6.511   2.996   1.00 0.00 ? 68 ALA A H    8  
ATOM 9900  H HA   . ALA A 1 68 ? 9.510   7.842   5.264   1.00 0.00 ? 68 ALA A HA   8  
ATOM 9901  H HB1  . ALA A 1 68 ? 9.893   9.511   3.802   1.00 0.00 ? 68 ALA A HB1  8  
ATOM 9902  H HB2  . ALA A 1 68 ? 10.081  8.373   2.447   1.00 0.00 ? 68 ALA A HB2  8  
ATOM 9903  H HB3  . ALA A 1 68 ? 8.461   8.944   2.911   1.00 0.00 ? 68 ALA A HB3  8  
ATOM 9904  N N    . ILE A 1 69 ? 7.793   5.821   3.397   1.00 0.00 ? 69 ILE A N    8  
ATOM 9905  C CA   . ILE A 1 69 ? 6.525   5.124   3.258   1.00 0.00 ? 69 ILE A CA   8  
ATOM 9906  C C    . ILE A 1 69 ? 6.248   4.319   4.529   1.00 0.00 ? 69 ILE A C    8  
ATOM 9907  O O    . ILE A 1 69 ? 5.129   4.325   5.040   1.00 0.00 ? 69 ILE A O    8  
ATOM 9908  C CB   . ILE A 1 69 ? 6.515   4.280   1.981   1.00 0.00 ? 69 ILE A CB   8  
ATOM 9909  C CG1  . ILE A 1 69 ? 6.720   5.156   0.743   1.00 0.00 ? 69 ILE A CG1  8  
ATOM 9910  C CG2  . ILE A 1 69 ? 5.237   3.443   1.887   1.00 0.00 ? 69 ILE A CG2  8  
ATOM 9911  C CD1  . ILE A 1 69 ? 7.448   4.385   -0.360  1.00 0.00 ? 69 ILE A CD1  8  
ATOM 9912  H H    . ILE A 1 69 ? 8.539   5.457   2.839   1.00 0.00 ? 69 ILE A H    8  
ATOM 9913  H HA   . ILE A 1 69 ? 5.747   5.880   3.150   1.00 0.00 ? 69 ILE A HA   8  
ATOM 9914  H HB   . ILE A 1 69 ? 7.354   3.584   2.026   1.00 0.00 ? 69 ILE A HB   8  
ATOM 9915  H HG13 . ILE A 1 69 ? 7.294   6.042   1.011   1.00 0.00 ? 69 ILE A HG13 8  
ATOM 9916  H HG21 . ILE A 1 69 ? 4.418   4.070   1.537   1.00 0.00 ? 69 ILE A HG21 8  
ATOM 9917  H HG22 . ILE A 1 69 ? 5.392   2.622   1.186   1.00 0.00 ? 69 ILE A HG22 8  
ATOM 9918  H HG23 . ILE A 1 69 ? 4.994   3.042   2.870   1.00 0.00 ? 69 ILE A HG23 8  
ATOM 9919  H HD11 . ILE A 1 69 ? 7.470   3.324   -0.107  1.00 0.00 ? 69 ILE A HD11 8  
ATOM 9920  H HD12 . ILE A 1 69 ? 6.924   4.522   -1.306  1.00 0.00 ? 69 ILE A HD12 8  
ATOM 9921  H HD13 . ILE A 1 69 ? 8.468   4.758   -0.452  1.00 0.00 ? 69 ILE A HD13 8  
ATOM 9922  N N    . LEU A 1 70 ? 7.286   3.646   5.003   1.00 0.00 ? 70 LEU A N    8  
ATOM 9923  C CA   . LEU A 1 70 ? 7.168   2.838   6.205   1.00 0.00 ? 70 LEU A CA   8  
ATOM 9924  C C    . LEU A 1 70 ? 7.005   3.757   7.418   1.00 0.00 ? 70 LEU A C    8  
ATOM 9925  O O    . LEU A 1 70 ? 6.377   3.382   8.406   1.00 0.00 ? 70 LEU A O    8  
ATOM 9926  C CB   . LEU A 1 70 ? 8.349   1.872   6.319   1.00 0.00 ? 70 LEU A CB   8  
ATOM 9927  C CG   . LEU A 1 70 ? 8.704   1.095   5.050   1.00 0.00 ? 70 LEU A CG   8  
ATOM 9928  C CD1  . LEU A 1 70 ? 10.218  0.914   4.925   1.00 0.00 ? 70 LEU A CD1  8  
ATOM 9929  C CD2  . LEU A 1 70 ? 7.961   -0.242  5.000   1.00 0.00 ? 70 LEU A CD2  8  
ATOM 9930  H H    . LEU A 1 70 ? 8.193   3.647   4.581   1.00 0.00 ? 70 LEU A H    8  
ATOM 9931  H HA   . LEU A 1 70 ? 6.266   2.234   6.105   1.00 0.00 ? 70 LEU A HA   8  
ATOM 9932  H HB3  . LEU A 1 70 ? 8.132   1.156   7.112   1.00 0.00 ? 70 LEU A HB3  8  
ATOM 9933  H HG   . LEU A 1 70 ? 8.378   1.678   4.190   1.00 0.00 ? 70 LEU A HG   8  
ATOM 9934  H HD11 . LEU A 1 70 ? 10.707  1.299   5.820   1.00 0.00 ? 70 LEU A HD11 8  
ATOM 9935  H HD12 . LEU A 1 70 ? 10.450  -0.146  4.812   1.00 0.00 ? 70 LEU A HD12 8  
ATOM 9936  H HD13 . LEU A 1 70 ? 10.578  1.458   4.052   1.00 0.00 ? 70 LEU A HD13 8  
ATOM 9937  H HD21 . LEU A 1 70 ? 8.078   -0.758  5.953   1.00 0.00 ? 70 LEU A HD21 8  
ATOM 9938  H HD22 . LEU A 1 70 ? 6.903   -0.061  4.812   1.00 0.00 ? 70 LEU A HD22 8  
ATOM 9939  H HD23 . LEU A 1 70 ? 8.373   -0.857  4.200   1.00 0.00 ? 70 LEU A HD23 8  
ATOM 9940  N N    . GLU A 1 71 ? 7.584   4.944   7.303   1.00 0.00 ? 71 GLU A N    8  
ATOM 9941  C CA   . GLU A 1 71 ? 7.511   5.919   8.378   1.00 0.00 ? 71 GLU A CA   8  
ATOM 9942  C C    . GLU A 1 71 ? 6.159   6.634   8.354   1.00 0.00 ? 71 GLU A C    8  
ATOM 9943  O O    . GLU A 1 71 ? 5.555   6.862   9.401   1.00 0.00 ? 71 GLU A O    8  
ATOM 9944  C CB   . GLU A 1 71 ? 8.664   6.921   8.288   1.00 0.00 ? 71 GLU A CB   8  
ATOM 9945  C CG   . GLU A 1 71 ? 9.944   6.339   8.890   1.00 0.00 ? 71 GLU A CG   8  
ATOM 9946  C CD   . GLU A 1 71 ? 11.043  7.400   8.970   1.00 0.00 ? 71 GLU A CD   8  
ATOM 9947  O OE1  . GLU A 1 71 ? 10.879  8.328   9.791   1.00 0.00 ? 71 GLU A OE1  8  
ATOM 9948  O OE2  . GLU A 1 71 ? 12.025  7.259   8.208   1.00 0.00 ? 71 GLU A OE2  8  
ATOM 9949  H H    . GLU A 1 71 ? 8.094   5.241   6.496   1.00 0.00 ? 71 GLU A H    8  
ATOM 9950  H HA   . GLU A 1 71 ? 7.609   5.344   9.299   1.00 0.00 ? 71 GLU A HA   8  
ATOM 9951  H HB3  . GLU A 1 71 ? 8.395   7.838   8.812   1.00 0.00 ? 71 GLU A HB3  8  
ATOM 9952  H HG3  . GLU A 1 71 ? 10.287  5.500   8.285   1.00 0.00 ? 71 GLU A HG3  8  
ATOM 9953  N N    . HIS A 1 72 ? 5.724   6.969   7.148   1.00 0.00 ? 72 HIS A N    8  
ATOM 9954  C CA   . HIS A 1 72 ? 4.454   7.654   6.975   1.00 0.00 ? 72 HIS A CA   8  
ATOM 9955  C C    . HIS A 1 72 ? 3.322   6.627   6.901   1.00 0.00 ? 72 HIS A C    8  
ATOM 9956  O O    . HIS A 1 72 ? 2.148   6.987   6.960   1.00 0.00 ? 72 HIS A O    8  
ATOM 9957  C CB   . HIS A 1 72 ? 4.497   8.578   5.756   1.00 0.00 ? 72 HIS A CB   8  
ATOM 9958  C CG   . HIS A 1 72 ? 5.499   9.702   5.873   1.00 0.00 ? 72 HIS A CG   8  
ATOM 9959  N ND1  . HIS A 1 72 ? 5.172   11.025  5.629   1.00 0.00 ? 72 HIS A ND1  8  
ATOM 9960  C CD2  . HIS A 1 72 ? 6.820   9.687   6.210   1.00 0.00 ? 72 HIS A CD2  8  
ATOM 9961  C CE1  . HIS A 1 72 ? 6.257   11.764  5.813   1.00 0.00 ? 72 HIS A CE1  8  
ATOM 9962  N NE2  . HIS A 1 72 ? 7.277   10.933  6.172   1.00 0.00 ? 72 HIS A NE2  8  
ATOM 9963  H H    . HIS A 1 72 ? 6.221   6.780   6.302   1.00 0.00 ? 72 HIS A H    8  
ATOM 9964  H HA   . HIS A 1 72 ? 4.311   8.277   7.858   1.00 0.00 ? 72 HIS A HA   8  
ATOM 9965  H HB3  . HIS A 1 72 ? 3.506   9.003   5.599   1.00 0.00 ? 72 HIS A HB3  8  
ATOM 9966  H HD1  . HIS A 1 72 ? 4.272   11.366  5.359   1.00 0.00 ? 72 HIS A HD1  8  
ATOM 9967  H HD2  . HIS A 1 72 ? 7.403   8.803   6.467   1.00 0.00 ? 72 HIS A HD2  8  
ATOM 9968  H HE1  . HIS A 1 72 ? 6.322   12.846  5.697   1.00 0.00 ? 72 HIS A HE1  8  
ATOM 9969  N N    . SER A 1 73 ? 3.716   5.369   6.773   1.00 0.00 ? 73 SER A N    8  
ATOM 9970  C CA   . SER A 1 73 ? 2.749   4.287   6.690   1.00 0.00 ? 73 SER A CA   8  
ATOM 9971  C C    . SER A 1 73 ? 1.678   4.460   7.768   1.00 0.00 ? 73 SER A C    8  
ATOM 9972  O O    . SER A 1 73 ? 0.508   4.153   7.540   1.00 0.00 ? 73 SER A O    8  
ATOM 9973  C CB   . SER A 1 73 ? 3.433   2.926   6.834   1.00 0.00 ? 73 SER A CB   8  
ATOM 9974  O OG   . SER A 1 73 ? 3.173   2.329   8.101   1.00 0.00 ? 73 SER A OG   8  
ATOM 9975  H H    . SER A 1 73 ? 4.674   5.085   6.725   1.00 0.00 ? 73 SER A H    8  
ATOM 9976  H HA   . SER A 1 73 ? 2.309   4.369   5.696   1.00 0.00 ? 73 SER A HA   8  
ATOM 9977  H HB3  . SER A 1 73 ? 4.508   3.045   6.702   1.00 0.00 ? 73 SER A HB3  8  
ATOM 9978  H HG   . SER A 1 73 ? 3.643   2.837   8.822   1.00 0.00 ? 73 SER A HG   8  
ATOM 9979  N N    . HIS A 1 74 ? 2.115   4.950   8.919   1.00 0.00 ? 74 HIS A N    8  
ATOM 9980  C CA   . HIS A 1 74 ? 1.208   5.166   10.033  1.00 0.00 ? 74 HIS A CA   8  
ATOM 9981  C C    . HIS A 1 74 ? -0.003  5.973   9.559   1.00 0.00 ? 74 HIS A C    8  
ATOM 9982  O O    . HIS A 1 74 ? -1.060  5.941   10.188  1.00 0.00 ? 74 HIS A O    8  
ATOM 9983  C CB   . HIS A 1 74 ? 1.935   5.824   11.207  1.00 0.00 ? 74 HIS A CB   8  
ATOM 9984  C CG   . HIS A 1 74 ? 1.790   7.327   11.256  1.00 0.00 ? 74 HIS A CG   8  
ATOM 9985  N ND1  . HIS A 1 74 ? 0.672   7.954   11.778  1.00 0.00 ? 74 HIS A ND1  8  
ATOM 9986  C CD2  . HIS A 1 74 ? 2.632   8.317   10.845  1.00 0.00 ? 74 HIS A CD2  8  
ATOM 9987  C CE1  . HIS A 1 74 ? 0.845   9.264   11.679  1.00 0.00 ? 74 HIS A CE1  8  
ATOM 9988  N NE2  . HIS A 1 74 ? 2.059   9.487   11.100  1.00 0.00 ? 74 HIS A NE2  8  
ATOM 9989  H H    . HIS A 1 74 ? 3.068   5.197   9.096   1.00 0.00 ? 74 HIS A H    8  
ATOM 9990  H HA   . HIS A 1 74 ? 0.872   4.183   10.359  1.00 0.00 ? 74 HIS A HA   8  
ATOM 9991  H HB3  . HIS A 1 74 ? 2.995   5.574   11.150  1.00 0.00 ? 74 HIS A HB3  8  
ATOM 9992  H HD1  . HIS A 1 74 ? -0.128  7.497   12.164  1.00 0.00 ? 74 HIS A HD1  8  
ATOM 9993  H HD2  . HIS A 1 74 ? 3.609   8.173   10.384  1.00 0.00 ? 74 HIS A HD2  8  
ATOM 9994  H HE1  . HIS A 1 74 ? 0.139   10.030  12.003  1.00 0.00 ? 74 HIS A HE1  8  
ATOM 9995  N N    . ARG A 1 75 ? 0.192   6.678   8.454   1.00 0.00 ? 75 ARG A N    8  
ATOM 9996  C CA   . ARG A 1 75 ? -0.871  7.492   7.889   1.00 0.00 ? 75 ARG A CA   8  
ATOM 9997  C C    . ARG A 1 75 ? -1.461  6.811   6.653   1.00 0.00 ? 75 ARG A C    8  
ATOM 9998  O O    . ARG A 1 75 ? -2.670  6.857   6.432   1.00 0.00 ? 75 ARG A O    8  
ATOM 9999  C CB   . ARG A 1 75 ? -0.355  8.879   7.502   1.00 0.00 ? 75 ARG A CB   8  
ATOM 10000 C CG   . ARG A 1 75 ? 0.830   9.289   8.378   1.00 0.00 ? 75 ARG A CG   8  
ATOM 10001 C CD   . ARG A 1 75 ? 0.856   10.803  8.594   1.00 0.00 ? 75 ARG A CD   8  
ATOM 10002 N NE   . ARG A 1 75 ? -0.400  11.243  9.241   1.00 0.00 ? 75 ARG A NE   8  
ATOM 10003 C CZ   . ARG A 1 75 ? -0.623  12.490  9.678   1.00 0.00 ? 75 ARG A CZ   8  
ATOM 10004 N NH1  . ARG A 1 75 ? 0.323   13.428  9.540   1.00 0.00 ? 75 ARG A NH1  8  
ATOM 10005 N NH2  . ARG A 1 75 ? -1.794  12.798  10.253  1.00 0.00 ? 75 ARG A NH2  8  
ATOM 10006 H H    . ARG A 1 75 ? 1.054   6.699   7.949   1.00 0.00 ? 75 ARG A H    8  
ATOM 10007 H HA   . ARG A 1 75 ? -1.613  7.573   8.683   1.00 0.00 ? 75 ARG A HA   8  
ATOM 10008 H HB3  . ARG A 1 75 ? -1.157  9.612   7.603   1.00 0.00 ? 75 ARG A HB3  8  
ATOM 10009 H HG3  . ARG A 1 75 ? 1.761   8.969   7.909   1.00 0.00 ? 75 ARG A HG3  8  
ATOM 10010 H HD3  . ARG A 1 75 ? 0.981   11.313  7.640   1.00 0.00 ? 75 ARG A HD3  8  
ATOM 10011 H HE   . ARG A 1 75 ? -1.128  10.567  9.360   1.00 0.00 ? 75 ARG A HE   8  
ATOM 10012 H HH11 . ARG A 1 75 ? 1.197   13.198  9.110   1.00 0.00 ? 75 ARG A HH11 8  
ATOM 10013 H HH12 . ARG A 1 75 ? 0.156   14.359  9.866   1.00 0.00 ? 75 ARG A HH12 8  
ATOM 10014 H HH21 . ARG A 1 75 ? -2.501  12.099  10.356  1.00 0.00 ? 75 ARG A HH21 8  
ATOM 10015 H HH22 . ARG A 1 75 ? -1.961  13.730  10.579  1.00 0.00 ? 75 ARG A HH22 8  
ATOM 10016 N N    . ILE A 1 76 ? -0.579  6.196   5.878   1.00 0.00 ? 76 ILE A N    8  
ATOM 10017 C CA   . ILE A 1 76 ? -0.997  5.506   4.669   1.00 0.00 ? 76 ILE A CA   8  
ATOM 10018 C C    . ILE A 1 76 ? -2.308  4.764   4.939   1.00 0.00 ? 76 ILE A C    8  
ATOM 10019 O O    . ILE A 1 76 ? -2.374  3.917   5.828   1.00 0.00 ? 76 ILE A O    8  
ATOM 10020 C CB   . ILE A 1 76 ? 0.125   4.604   4.152   1.00 0.00 ? 76 ILE A CB   8  
ATOM 10021 C CG1  . ILE A 1 76 ? 1.338   5.431   3.722   1.00 0.00 ? 76 ILE A CG1  8  
ATOM 10022 C CG2  . ILE A 1 76 ? -0.377  3.695   3.028   1.00 0.00 ? 76 ILE A CG2  8  
ATOM 10023 C CD1  . ILE A 1 76 ? 2.415   4.541   3.097   1.00 0.00 ? 76 ILE A CD1  8  
ATOM 10024 H H    . ILE A 1 76 ? 0.403   6.164   6.066   1.00 0.00 ? 76 ILE A H    8  
ATOM 10025 H HA   . ILE A 1 76 ? -1.179  6.263   3.908   1.00 0.00 ? 76 ILE A HA   8  
ATOM 10026 H HB   . ILE A 1 76 ? 0.448   3.958   4.968   1.00 0.00 ? 76 ILE A HB   8  
ATOM 10027 H HG13 . ILE A 1 76 ? 1.750   5.954   4.586   1.00 0.00 ? 76 ILE A HG13 8  
ATOM 10028 H HG21 . ILE A 1 76 ? 0.318   2.867   2.893   1.00 0.00 ? 76 ILE A HG21 8  
ATOM 10029 H HG22 . ILE A 1 76 ? -1.361  3.305   3.288   1.00 0.00 ? 76 ILE A HG22 8  
ATOM 10030 H HG23 . ILE A 1 76 ? -0.445  4.267   2.102   1.00 0.00 ? 76 ILE A HG23 8  
ATOM 10031 H HD11 . ILE A 1 76 ? 2.224   3.501   3.361   1.00 0.00 ? 76 ILE A HD11 8  
ATOM 10032 H HD12 . ILE A 1 76 ? 2.391   4.650   2.013   1.00 0.00 ? 76 ILE A HD12 8  
ATOM 10033 H HD13 . ILE A 1 76 ? 3.394   4.837   3.471   1.00 0.00 ? 76 ILE A HD13 8  
ATOM 10034 N N    . ARG A 1 77 ? -3.318  5.109   4.154   1.00 0.00 ? 77 ARG A N    8  
ATOM 10035 C CA   . ARG A 1 77 ? -4.624  4.486   4.297   1.00 0.00 ? 77 ARG A CA   8  
ATOM 10036 C C    . ARG A 1 77 ? -5.250  4.246   2.922   1.00 0.00 ? 77 ARG A C    8  
ATOM 10037 O O    . ARG A 1 77 ? -5.286  5.149   2.087   1.00 0.00 ? 77 ARG A O    8  
ATOM 10038 C CB   . ARG A 1 77 ? -5.562  5.359   5.132   1.00 0.00 ? 77 ARG A CB   8  
ATOM 10039 C CG   . ARG A 1 77 ? -5.502  4.969   6.611   1.00 0.00 ? 77 ARG A CG   8  
ATOM 10040 C CD   . ARG A 1 77 ? -6.908  4.790   7.188   1.00 0.00 ? 77 ARG A CD   8  
ATOM 10041 N NE   . ARG A 1 77 ? -7.216  5.894   8.123   1.00 0.00 ? 77 ARG A NE   8  
ATOM 10042 C CZ   . ARG A 1 77 ? -8.414  6.085   8.692   1.00 0.00 ? 77 ARG A CZ   8  
ATOM 10043 N NH1  . ARG A 1 77 ? -9.424  5.246   8.424   1.00 0.00 ? 77 ARG A NH1  8  
ATOM 10044 N NH2  . ARG A 1 77 ? -8.603  7.115   9.528   1.00 0.00 ? 77 ARG A NH2  8  
ATOM 10045 H H    . ARG A 1 77 ? -3.256  5.799   3.433   1.00 0.00 ? 77 ARG A H    8  
ATOM 10046 H HA   . ARG A 1 77 ? -4.428  3.543   4.808   1.00 0.00 ? 77 ARG A HA   8  
ATOM 10047 H HB3  . ARG A 1 77 ? -6.583  5.254   4.767   1.00 0.00 ? 77 ARG A HB3  8  
ATOM 10048 H HG3  . ARG A 1 77 ? -4.971  5.737   7.172   1.00 0.00 ? 77 ARG A HG3  8  
ATOM 10049 H HD3  . ARG A 1 77 ? -6.977  3.833   7.706   1.00 0.00 ? 77 ARG A HD3  8  
ATOM 10050 H HE   . ARG A 1 77 ? -6.484  6.539   8.345   1.00 0.00 ? 77 ARG A HE   8  
ATOM 10051 H HH11 . ARG A 1 77 ? -9.284  4.478   7.800   1.00 0.00 ? 77 ARG A HH11 8  
ATOM 10052 H HH12 . ARG A 1 77 ? -10.318 5.389   8.848   1.00 0.00 ? 77 ARG A HH12 8  
ATOM 10053 H HH21 . ARG A 1 77 ? -7.848  7.740   9.729   1.00 0.00 ? 77 ARG A HH21 8  
ATOM 10054 H HH22 . ARG A 1 77 ? -9.497  7.257   9.953   1.00 0.00 ? 77 ARG A HH22 8  
ATOM 10055 N N    . PHE A 1 78 ? -5.728  3.026   2.729   1.00 0.00 ? 78 PHE A N    8  
ATOM 10056 C CA   . PHE A 1 78 ? -6.351  2.656   1.470   1.00 0.00 ? 78 PHE A CA   8  
ATOM 10057 C C    . PHE A 1 78 ? -7.840  3.008   1.471   1.00 0.00 ? 78 PHE A C    8  
ATOM 10058 O O    . PHE A 1 78 ? -8.509  2.888   2.497   1.00 0.00 ? 78 PHE A O    8  
ATOM 10059 C CB   . PHE A 1 78 ? -6.197  1.141   1.322   1.00 0.00 ? 78 PHE A CB   8  
ATOM 10060 C CG   . PHE A 1 78 ? -4.833  0.703   0.784   1.00 0.00 ? 78 PHE A CG   8  
ATOM 10061 C CD1  . PHE A 1 78 ? -3.697  1.281   1.261   1.00 0.00 ? 78 PHE A CD1  8  
ATOM 10062 C CD2  . PHE A 1 78 ? -4.756  -0.263  -0.170  1.00 0.00 ? 78 PHE A CD2  8  
ATOM 10063 C CE1  . PHE A 1 78 ? -2.431  0.875   0.762   1.00 0.00 ? 78 PHE A CE1  8  
ATOM 10064 C CE2  . PHE A 1 78 ? -3.489  -0.668  -0.669  1.00 0.00 ? 78 PHE A CE2  8  
ATOM 10065 C CZ   . PHE A 1 78 ? -2.354  -0.091  -0.192  1.00 0.00 ? 78 PHE A CZ   8  
ATOM 10066 H H    . PHE A 1 78 ? -5.694  2.297   3.414   1.00 0.00 ? 78 PHE A H    8  
ATOM 10067 H HA   . PHE A 1 78 ? -5.848  3.217   0.682   1.00 0.00 ? 78 PHE A HA   8  
ATOM 10068 H HB3  . PHE A 1 78 ? -6.975  0.770   0.654   1.00 0.00 ? 78 PHE A HB3  8  
ATOM 10069 H HD1  . PHE A 1 78 ? -3.759  2.056   2.026   1.00 0.00 ? 78 PHE A HD1  8  
ATOM 10070 H HD2  . PHE A 1 78 ? -5.665  -0.725  -0.551  1.00 0.00 ? 78 PHE A HD2  8  
ATOM 10071 H HE1  . PHE A 1 78 ? -1.521  1.338   1.144   1.00 0.00 ? 78 PHE A HE1  8  
ATOM 10072 H HE2  . PHE A 1 78 ? -3.427  -1.442  -1.433  1.00 0.00 ? 78 PHE A HE2  8  
ATOM 10073 H HZ   . PHE A 1 78 ? -1.382  -0.402  -0.574  1.00 0.00 ? 78 PHE A HZ   8  
ATOM 10074 N N    . LYS A 1 79 ? -8.316  3.434   0.310   1.00 0.00 ? 79 LYS A N    8  
ATOM 10075 C CA   . LYS A 1 79 ? -9.713  3.804   0.164   1.00 0.00 ? 79 LYS A CA   8  
ATOM 10076 C C    . LYS A 1 79 ? -10.288 3.125   -1.080  1.00 0.00 ? 79 LYS A C    8  
ATOM 10077 O O    . LYS A 1 79 ? -9.846  3.390   -2.197  1.00 0.00 ? 79 LYS A O    8  
ATOM 10078 C CB   . LYS A 1 79 ? -9.867  5.326   0.161   1.00 0.00 ? 79 LYS A CB   8  
ATOM 10079 C CG   . LYS A 1 79 ? -10.178 5.847   1.566   1.00 0.00 ? 79 LYS A CG   8  
ATOM 10080 C CD   . LYS A 1 79 ? -11.687 5.908   1.807   1.00 0.00 ? 79 LYS A CD   8  
ATOM 10081 C CE   . LYS A 1 79 ? -12.263 7.248   1.346   1.00 0.00 ? 79 LYS A CE   8  
ATOM 10082 N NZ   . LYS A 1 79 ? -12.214 8.239   2.445   1.00 0.00 ? 79 LYS A NZ   8  
ATOM 10083 H H    . LYS A 1 79 ? -7.765  3.528   -0.519  1.00 0.00 ? 79 LYS A H    8  
ATOM 10084 H HA   . LYS A 1 79 ? -10.244 3.427   1.039   1.00 0.00 ? 79 LYS A HA   8  
ATOM 10085 H HB3  . LYS A 1 79 ? -10.666 5.612   -0.522  1.00 0.00 ? 79 LYS A HB3  8  
ATOM 10086 H HG3  . LYS A 1 79 ? -9.745  6.840   1.692   1.00 0.00 ? 79 LYS A HG3  8  
ATOM 10087 H HD3  . LYS A 1 79 ? -11.895 5.764   2.867   1.00 0.00 ? 79 LYS A HD3  8  
ATOM 10088 H HE3  . LYS A 1 79 ? -13.293 7.115   1.015   1.00 0.00 ? 79 LYS A HE3  8  
ATOM 10089 H HZ1  . LYS A 1 79 ? -13.003 8.850   2.378   1.00 0.00 ? 79 LYS A HZ1  8  
ATOM 10090 H HZ2  . LYS A 1 79 ? -12.234 7.763   3.324   1.00 0.00 ? 79 LYS A HZ2  8  
ATOM 10091 H HZ3  . LYS A 1 79 ? -11.372 8.773   2.375   1.00 0.00 ? 79 LYS A HZ3  8  
ATOM 10092 N N    . LEU A 1 80 ? -11.267 2.262   -0.846  1.00 0.00 ? 80 LEU A N    8  
ATOM 10093 C CA   . LEU A 1 80 ? -11.906 1.543   -1.935  1.00 0.00 ? 80 LEU A CA   8  
ATOM 10094 C C    . LEU A 1 80 ? -13.117 2.341   -2.424  1.00 0.00 ? 80 LEU A C    8  
ATOM 10095 O O    . LEU A 1 80 ? -13.707 3.108   -1.665  1.00 0.00 ? 80 LEU A O    8  
ATOM 10096 C CB   . LEU A 1 80 ? -12.244 0.114   -1.507  1.00 0.00 ? 80 LEU A CB   8  
ATOM 10097 C CG   . LEU A 1 80 ? -11.096 -0.896  -1.577  1.00 0.00 ? 80 LEU A CG   8  
ATOM 10098 C CD1  . LEU A 1 80 ? -11.576 -2.299  -1.200  1.00 0.00 ? 80 LEU A CD1  8  
ATOM 10099 C CD2  . LEU A 1 80 ? -10.426 -0.870  -2.952  1.00 0.00 ? 80 LEU A CD2  8  
ATOM 10100 H H    . LEU A 1 80 ? -11.620 2.052   0.065   1.00 0.00 ? 80 LEU A H    8  
ATOM 10101 H HA   . LEU A 1 80 ? -11.186 1.474   -2.749  1.00 0.00 ? 80 LEU A HA   8  
ATOM 10102 H HB3  . LEU A 1 80 ? -13.059 -0.249  -2.134  1.00 0.00 ? 80 LEU A HB3  8  
ATOM 10103 H HG   . LEU A 1 80 ? -10.342 -0.606  -0.845  1.00 0.00 ? 80 LEU A HG   8  
ATOM 10104 H HD11 . LEU A 1 80 ? -12.078 -2.263  -0.233  1.00 0.00 ? 80 LEU A HD11 8  
ATOM 10105 H HD12 . LEU A 1 80 ? -12.271 -2.661  -1.957  1.00 0.00 ? 80 LEU A HD12 8  
ATOM 10106 H HD13 . LEU A 1 80 ? -10.721 -2.972  -1.140  1.00 0.00 ? 80 LEU A HD13 8  
ATOM 10107 H HD21 . LEU A 1 80 ? -11.094 -0.399  -3.673  1.00 0.00 ? 80 LEU A HD21 8  
ATOM 10108 H HD22 . LEU A 1 80 ? -9.497  -0.302  -2.893  1.00 0.00 ? 80 LEU A HD22 8  
ATOM 10109 H HD23 . LEU A 1 80 ? -10.209 -1.890  -3.270  1.00 0.00 ? 80 LEU A HD23 8  
ATOM 10110 N N    . LYS A 1 81 ? -13.452 2.131   -3.689  1.00 0.00 ? 81 LYS A N    8  
ATOM 10111 C CA   . LYS A 1 81 ? -14.581 2.821   -4.288  1.00 0.00 ? 81 LYS A CA   8  
ATOM 10112 C C    . LYS A 1 81 ? -15.817 2.628   -3.407  1.00 0.00 ? 81 LYS A C    8  
ATOM 10113 O O    . LYS A 1 81 ? -16.032 1.547   -2.861  1.00 0.00 ? 81 LYS A O    8  
ATOM 10114 C CB   . LYS A 1 81 ? -14.781 2.365   -5.735  1.00 0.00 ? 81 LYS A CB   8  
ATOM 10115 C CG   . LYS A 1 81 ? -15.412 0.972   -5.789  1.00 0.00 ? 81 LYS A CG   8  
ATOM 10116 C CD   . LYS A 1 81 ? -14.602 0.038   -6.690  1.00 0.00 ? 81 LYS A CD   8  
ATOM 10117 C CE   . LYS A 1 81 ? -14.881 -1.428  -6.352  1.00 0.00 ? 81 LYS A CE   8  
ATOM 10118 N NZ   . LYS A 1 81 ? -15.443 -2.132  -7.527  1.00 0.00 ? 81 LYS A NZ   8  
ATOM 10119 H H    . LYS A 1 81 ? -12.967 1.504   -4.299  1.00 0.00 ? 81 LYS A H    8  
ATOM 10120 H HA   . LYS A 1 81 ? -14.338 3.883   -4.316  1.00 0.00 ? 81 LYS A HA   8  
ATOM 10121 H HB3  . LYS A 1 81 ? -13.821 2.354   -6.253  1.00 0.00 ? 81 LYS A HB3  8  
ATOM 10122 H HG3  . LYS A 1 81 ? -16.433 1.046   -6.161  1.00 0.00 ? 81 LYS A HG3  8  
ATOM 10123 H HD3  . LYS A 1 81 ? -13.538 0.246   -6.572  1.00 0.00 ? 81 LYS A HD3  8  
ATOM 10124 H HE3  . LYS A 1 81 ? -15.580 -1.488  -5.518  1.00 0.00 ? 81 LYS A HE3  8  
ATOM 10125 H HZ1  . LYS A 1 81 ? -15.247 -3.110  -7.455  1.00 0.00 ? 81 LYS A HZ1  8  
ATOM 10126 H HZ2  . LYS A 1 81 ? -16.433 -1.992  -7.558  1.00 0.00 ? 81 LYS A HZ2  8  
ATOM 10127 H HZ3  . LYS A 1 81 ? -15.029 -1.770  -8.362  1.00 0.00 ? 81 LYS A HZ3  8  
ATOM 10128 N N    . ARG A 1 82 ? -16.596 3.694   -3.295  1.00 0.00 ? 82 ARG A N    8  
ATOM 10129 C CA   . ARG A 1 82 ? -17.805 3.656   -2.489  1.00 0.00 ? 82 ARG A CA   8  
ATOM 10130 C C    . ARG A 1 82 ? -18.974 4.278   -3.256  1.00 0.00 ? 82 ARG A C    8  
ATOM 10131 O O    . ARG A 1 82 ? -18.845 5.366   -3.816  1.00 0.00 ? 82 ARG A O    8  
ATOM 10132 C CB   . ARG A 1 82 ? -17.611 4.406   -1.170  1.00 0.00 ? 82 ARG A CB   8  
ATOM 10133 C CG   . ARG A 1 82 ? -16.848 3.550   -0.159  1.00 0.00 ? 82 ARG A CG   8  
ATOM 10134 C CD   . ARG A 1 82 ? -16.263 4.414   0.961   1.00 0.00 ? 82 ARG A CD   8  
ATOM 10135 N NE   . ARG A 1 82 ? -17.160 4.392   2.138   1.00 0.00 ? 82 ARG A NE   8  
ATOM 10136 C CZ   . ARG A 1 82 ? -16.879 4.986   3.306   1.00 0.00 ? 82 ARG A CZ   8  
ATOM 10137 N NH1  . ARG A 1 82 ? -15.727 5.650   3.461   1.00 0.00 ? 82 ARG A NH1  8  
ATOM 10138 N NH2  . ARG A 1 82 ? -17.753 4.914   4.320   1.00 0.00 ? 82 ARG A NH2  8  
ATOM 10139 H H    . ARG A 1 82 ? -16.415 4.570   -3.742  1.00 0.00 ? 82 ARG A H    8  
ATOM 10140 H HA   . ARG A 1 82 ? -17.981 2.597   -2.299  1.00 0.00 ? 82 ARG A HA   8  
ATOM 10141 H HB3  . ARG A 1 82 ? -18.583 4.683   -0.759  1.00 0.00 ? 82 ARG A HB3  8  
ATOM 10142 H HG3  . ARG A 1 82 ? -16.046 3.012   -0.664  1.00 0.00 ? 82 ARG A HG3  8  
ATOM 10143 H HD3  . ARG A 1 82 ? -16.133 5.438   0.611   1.00 0.00 ? 82 ARG A HD3  8  
ATOM 10144 H HE   . ARG A 1 82 ? -18.028 3.904   2.055   1.00 0.00 ? 82 ARG A HE   8  
ATOM 10145 H HH11 . ARG A 1 82 ? -15.075 5.704   2.704   1.00 0.00 ? 82 ARG A HH11 8  
ATOM 10146 H HH12 . ARG A 1 82 ? -15.518 6.094   4.333   1.00 0.00 ? 82 ARG A HH12 8  
ATOM 10147 H HH21 . ARG A 1 82 ? -18.614 4.417   4.204   1.00 0.00 ? 82 ARG A HH21 8  
ATOM 10148 H HH22 . ARG A 1 82 ? -17.544 5.356   5.193   1.00 0.00 ? 82 ARG A HH22 8  
ATOM 10149 N N    . PRO A 1 83 ? -20.118 3.542   -3.256  1.00 0.00 ? 83 PRO A N    8  
ATOM 10150 C CA   . PRO A 1 83 ? -21.308 4.011   -3.944  1.00 0.00 ? 83 PRO A CA   8  
ATOM 10151 C C    . PRO A 1 83 ? -21.990 5.134   -3.160  1.00 0.00 ? 83 PRO A C    8  
ATOM 10152 O O    . PRO A 1 83 ? -22.315 6.180   -3.720  1.00 0.00 ? 83 PRO A O    8  
ATOM 10153 C CB   . PRO A 1 83 ? -22.185 2.778   -4.098  1.00 0.00 ? 83 PRO A CB   8  
ATOM 10154 C CG   . PRO A 1 83 ? -21.665 1.769   -3.087  1.00 0.00 ? 83 PRO A CG   8  
ATOM 10155 C CD   . PRO A 1 83 ? -20.307 2.251   -2.603  1.00 0.00 ? 83 PRO A CD   8  
ATOM 10156 H HA   . PRO A 1 83 ? -21.065 4.406   -4.830  1.00 0.00 ? 83 PRO A HA   8  
ATOM 10157 H HB3  . PRO A 1 83 ? -22.126 2.381   -5.111  1.00 0.00 ? 83 PRO A HB3  8  
ATOM 10158 H HG3  . PRO A 1 83 ? -21.581 0.782   -3.541  1.00 0.00 ? 83 PRO A HG3  8  
ATOM 10159 H HD3  . PRO A 1 83 ? -19.519 1.550   -2.876  1.00 0.00 ? 83 PRO A HD3  8  
ATOM 10160 N N    . SER A 1 84 ? -22.186 4.880   -1.874  1.00 0.00 ? 84 SER A N    8  
ATOM 10161 C CA   . SER A 1 84 ? -22.823 5.855   -1.006  1.00 0.00 ? 84 SER A CA   8  
ATOM 10162 C C    . SER A 1 84 ? -22.233 5.768   0.402   1.00 0.00 ? 84 SER A C    8  
ATOM 10163 O O    . SER A 1 84 ? -21.757 6.765   0.944   1.00 0.00 ? 84 SER A O    8  
ATOM 10164 C CB   . SER A 1 84 ? -24.338 5.647   -0.961  1.00 0.00 ? 84 SER A CB   8  
ATOM 10165 O OG   . SER A 1 84 ? -25.026 6.540   -1.834  1.00 0.00 ? 84 SER A OG   8  
ATOM 10166 H H    . SER A 1 84 ? -21.919 4.026   -1.425  1.00 0.00 ? 84 SER A H    8  
ATOM 10167 H HA   . SER A 1 84 ? -22.603 6.826   -1.453  1.00 0.00 ? 84 SER A HA   8  
ATOM 10168 H HB3  . SER A 1 84 ? -24.693 5.792   0.059   1.00 0.00 ? 84 SER A HB3  8  
ATOM 10169 H HG   . SER A 1 84 ? -24.427 6.809   -2.588  1.00 0.00 ? 84 SER A HG   8  
ATOM 10170 N N    . SER A 1 85 ? -22.281 4.565   0.956   1.00 0.00 ? 85 SER A N    8  
ATOM 10171 C CA   . SER A 1 85 ? -21.758 4.334   2.291   1.00 0.00 ? 85 SER A CA   8  
ATOM 10172 C C    . SER A 1 85 ? -20.666 3.262   2.247   1.00 0.00 ? 85 SER A C    8  
ATOM 10173 O O    . SER A 1 85 ? -19.508 3.538   2.554   1.00 0.00 ? 85 SER A O    8  
ATOM 10174 C CB   . SER A 1 85 ? -22.870 3.917   3.255   1.00 0.00 ? 85 SER A CB   8  
ATOM 10175 O OG   . SER A 1 85 ? -22.724 4.526   4.536   1.00 0.00 ? 85 SER A OG   8  
ATOM 10176 H H    . SER A 1 85 ? -22.670 3.759   0.509   1.00 0.00 ? 85 SER A H    8  
ATOM 10177 H HA   . SER A 1 85 ? -21.343 5.291   2.608   1.00 0.00 ? 85 SER A HA   8  
ATOM 10178 H HB3  . SER A 1 85 ? -22.866 2.833   3.368   1.00 0.00 ? 85 SER A HB3  8  
ATOM 10179 H HG   . SER A 1 85 ? -21.993 5.209   4.508   1.00 0.00 ? 85 SER A HG   8  
ATOM 10180 N N    . GLY A 1 86 ? -21.074 2.062   1.862   1.00 0.00 ? 86 GLY A N    8  
ATOM 10181 C CA   . GLY A 1 86 ? -20.145 0.948   1.773   1.00 0.00 ? 86 GLY A CA   8  
ATOM 10182 C C    . GLY A 1 86 ? -19.298 0.840   3.042   1.00 0.00 ? 86 GLY A C    8  
ATOM 10183 O O    . GLY A 1 86 ? -18.173 1.335   3.086   1.00 0.00 ? 86 GLY A O    8  
ATOM 10184 H H    . GLY A 1 86 ? -22.019 1.846   1.612   1.00 0.00 ? 86 GLY A H    8  
ATOM 10185 H HA2  . GLY A 1 86 ? -20.697 0.022   1.619   1.00 0.00 ? 86 GLY A HA2  8  
ATOM 10186 H HA3  . GLY A 1 86 ? -19.495 1.081   0.908   1.00 0.00 ? 86 GLY A HA3  8  
ATOM 10187 N N    . PRO A 1 87 ? -19.886 0.169   4.069   1.00 0.00 ? 87 PRO A N    8  
ATOM 10188 C CA   . PRO A 1 87 ? -19.196 -0.011  5.336   1.00 0.00 ? 87 PRO A CA   8  
ATOM 10189 C C    . PRO A 1 87 ? -18.105 -1.078  5.219   1.00 0.00 ? 87 PRO A C    8  
ATOM 10190 O O    . PRO A 1 87 ? -17.920 -1.668  4.157   1.00 0.00 ? 87 PRO A O    8  
ATOM 10191 C CB   . PRO A 1 87 ? -20.287 -0.383  6.327   1.00 0.00 ? 87 PRO A CB   8  
ATOM 10192 C CG   . PRO A 1 87 ? -21.468 -0.851  5.492   1.00 0.00 ? 87 PRO A CG   8  
ATOM 10193 C CD   . PRO A 1 87 ? -21.215 -0.431  4.053   1.00 0.00 ? 87 PRO A CD   8  
ATOM 10194 H HA   . PRO A 1 87 ? -18.727 0.832   5.600   1.00 0.00 ? 87 PRO A HA   8  
ATOM 10195 H HB3  . PRO A 1 87 ? -20.560 0.472   6.946   1.00 0.00 ? 87 PRO A HB3  8  
ATOM 10196 H HG3  . PRO A 1 87 ? -22.394 -0.410  5.861   1.00 0.00 ? 87 PRO A HG3  8  
ATOM 10197 H HD3  . PRO A 1 87 ? -21.967 0.280   3.710   1.00 0.00 ? 87 PRO A HD3  8  
ATOM 10198 N N    . SER A 1 88 ? -17.410 -1.291  6.327   1.00 0.00 ? 88 SER A N    8  
ATOM 10199 C CA   . SER A 1 88 ? -16.343 -2.276  6.362   1.00 0.00 ? 88 SER A CA   8  
ATOM 10200 C C    . SER A 1 88 ? -15.720 -2.322  7.759   1.00 0.00 ? 88 SER A C    8  
ATOM 10201 O O    . SER A 1 88 ? -15.195 -1.321  8.243   1.00 0.00 ? 88 SER A O    8  
ATOM 10202 C CB   . SER A 1 88 ? -15.272 -1.965  5.314   1.00 0.00 ? 88 SER A CB   8  
ATOM 10203 O OG   . SER A 1 88 ? -14.983 -3.096  4.496   1.00 0.00 ? 88 SER A OG   8  
ATOM 10204 H H    . SER A 1 88 ? -17.567 -0.806  7.188   1.00 0.00 ? 88 SER A H    8  
ATOM 10205 H HA   . SER A 1 88 ? -16.819 -3.226  6.124   1.00 0.00 ? 88 SER A HA   8  
ATOM 10206 H HB3  . SER A 1 88 ? -14.361 -1.636  5.813   1.00 0.00 ? 88 SER A HB3  8  
ATOM 10207 H HG   . SER A 1 88 ? -14.126 -2.950  4.001   1.00 0.00 ? 88 SER A HG   8  
ATOM 10208 N N    . SER A 1 89 ? -15.799 -3.496  8.368   1.00 0.00 ? 89 SER A N    8  
ATOM 10209 C CA   . SER A 1 89 ? -15.250 -3.687  9.701   1.00 0.00 ? 89 SER A CA   8  
ATOM 10210 C C    . SER A 1 89 ? -14.006 -4.574  9.631   1.00 0.00 ? 89 SER A C    8  
ATOM 10211 O O    . SER A 1 89 ? -13.865 -5.381  8.713   1.00 0.00 ? 89 SER A O    8  
ATOM 10212 C CB   . SER A 1 89 ? -16.288 -4.301  10.641  1.00 0.00 ? 89 SER A CB   8  
ATOM 10213 O OG   . SER A 1 89 ? -16.353 -5.718  10.514  1.00 0.00 ? 89 SER A OG   8  
ATOM 10214 H H    . SER A 1 89 ? -16.228 -4.307  7.968   1.00 0.00 ? 89 SER A H    8  
ATOM 10215 H HA   . SER A 1 89 ? -14.989 -2.689  10.050  1.00 0.00 ? 89 SER A HA   8  
ATOM 10216 H HB3  . SER A 1 89 ? -17.268 -3.873  10.430  1.00 0.00 ? 89 SER A HB3  8  
ATOM 10217 H HG   . SER A 1 89 ? -15.918 -6.153  11.302  1.00 0.00 ? 89 SER A HG   8  
ATOM 10218 N N    . GLY A 1 90 ? -13.134 -4.395  10.614  1.00 0.00 ? 90 GLY A N    8  
ATOM 10219 C CA   . GLY A 1 90 ? -11.906 -5.170  10.675  1.00 0.00 ? 90 GLY A CA   8  
ATOM 10220 C C    . GLY A 1 90 ? -10.766 -4.448  9.954   1.00 0.00 ? 90 GLY A C    8  
ATOM 10221 O O    . GLY A 1 90 ? -9.681  -5.003  9.792   1.00 0.00 ? 90 GLY A O    8  
ATOM 10222 H H    . GLY A 1 90 ? -13.257 -3.736  11.356  1.00 0.00 ? 90 GLY A H    8  
ATOM 10223 H HA2  . GLY A 1 90 ? -11.633 -5.340  11.717  1.00 0.00 ? 90 GLY A HA2  8  
ATOM 10224 H HA3  . GLY A 1 90 ? -12.067 -6.149  10.223  1.00 0.00 ? 90 GLY A HA3  8  
ATOM 10225 N N    . GLY A 1 1  ? 19.192  -19.953 13.633  1.00 0.00 ? 1  GLY A N    9  
ATOM 10226 C CA   . GLY A 1 1  ? 17.878  -20.052 13.021  1.00 0.00 ? 1  GLY A CA   9  
ATOM 10227 C C    . GLY A 1 1  ? 17.869  -19.404 11.635  1.00 0.00 ? 1  GLY A C    9  
ATOM 10228 O O    . GLY A 1 1  ? 18.613  -18.458 11.383  1.00 0.00 ? 1  GLY A O    9  
ATOM 10229 H H1   . GLY A 1 1  ? 19.223  -19.428 14.484  1.00 0.00 ? 1  GLY A H1   9  
ATOM 10230 H HA2  . GLY A 1 1  ? 17.588  -21.099 12.939  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 10231 H HA3  . GLY A 1 1  ? 17.138  -19.566 13.658  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 10232 N N    . SER A 1 2  ? 17.018  -19.940 10.772  1.00 0.00 ? 2  SER A N    9  
ATOM 10233 C CA   . SER A 1 2  ? 16.903  -19.426 9.418   1.00 0.00 ? 2  SER A CA   9  
ATOM 10234 C C    . SER A 1 2  ? 15.859  -18.309 9.369   1.00 0.00 ? 2  SER A C    9  
ATOM 10235 O O    . SER A 1 2  ? 14.658  -18.574 9.404   1.00 0.00 ? 2  SER A O    9  
ATOM 10236 C CB   . SER A 1 2  ? 16.533  -20.540 8.436   1.00 0.00 ? 2  SER A CB   9  
ATOM 10237 O OG   . SER A 1 2  ? 17.415  -20.579 7.317   1.00 0.00 ? 2  SER A OG   9  
ATOM 10238 H H    . SER A 1 2  ? 16.415  -20.709 10.985  1.00 0.00 ? 2  SER A H    9  
ATOM 10239 H HA   . SER A 1 2  ? 17.891  -19.038 9.171   1.00 0.00 ? 2  SER A HA   9  
ATOM 10240 H HB3  . SER A 1 2  ? 15.512  -20.392 8.087   1.00 0.00 ? 2  SER A HB3  9  
ATOM 10241 H HG   . SER A 1 2  ? 17.651  -21.526 7.101   1.00 0.00 ? 2  SER A HG   9  
ATOM 10242 N N    . SER A 1 3  ? 16.354  -17.082 9.290   1.00 0.00 ? 3  SER A N    9  
ATOM 10243 C CA   . SER A 1 3  ? 15.480  -15.924 9.235   1.00 0.00 ? 3  SER A CA   9  
ATOM 10244 C C    . SER A 1 3  ? 15.813  -15.073 8.009   1.00 0.00 ? 3  SER A C    9  
ATOM 10245 O O    . SER A 1 3  ? 16.968  -14.704 7.800   1.00 0.00 ? 3  SER A O    9  
ATOM 10246 C CB   . SER A 1 3  ? 15.596  -15.086 10.510  1.00 0.00 ? 3  SER A CB   9  
ATOM 10247 O OG   . SER A 1 3  ? 16.944  -14.713 10.784  1.00 0.00 ? 3  SER A OG   9  
ATOM 10248 H H    . SER A 1 3  ? 17.332  -16.876 9.262   1.00 0.00 ? 3  SER A H    9  
ATOM 10249 H HA   . SER A 1 3  ? 14.470  -16.328 9.158   1.00 0.00 ? 3  SER A HA   9  
ATOM 10250 H HB3  . SER A 1 3  ? 15.199  -15.652 11.354  1.00 0.00 ? 3  SER A HB3  9  
ATOM 10251 H HG   . SER A 1 3  ? 17.052  -13.724 10.685  1.00 0.00 ? 3  SER A HG   9  
ATOM 10252 N N    . GLY A 1 4  ? 14.781  -14.784 7.229   1.00 0.00 ? 4  GLY A N    9  
ATOM 10253 C CA   . GLY A 1 4  ? 14.950  -13.984 6.029   1.00 0.00 ? 4  GLY A CA   9  
ATOM 10254 C C    . GLY A 1 4  ? 15.701  -12.686 6.337   1.00 0.00 ? 4  GLY A C    9  
ATOM 10255 O O    . GLY A 1 4  ? 16.044  -12.421 7.488   1.00 0.00 ? 4  GLY A O    9  
ATOM 10256 H H    . GLY A 1 4  ? 13.845  -15.089 7.406   1.00 0.00 ? 4  GLY A H    9  
ATOM 10257 H HA2  . GLY A 1 4  ? 15.498  -14.556 5.280   1.00 0.00 ? 4  GLY A HA2  9  
ATOM 10258 H HA3  . GLY A 1 4  ? 13.975  -13.752 5.602   1.00 0.00 ? 4  GLY A HA3  9  
ATOM 10259 N N    . SER A 1 5  ? 15.934  -11.912 5.288   1.00 0.00 ? 5  SER A N    9  
ATOM 10260 C CA   . SER A 1 5  ? 16.637  -10.648 5.432   1.00 0.00 ? 5  SER A CA   9  
ATOM 10261 C C    . SER A 1 5  ? 15.683  -9.484  5.156   1.00 0.00 ? 5  SER A C    9  
ATOM 10262 O O    . SER A 1 5  ? 15.169  -9.348  4.046   1.00 0.00 ? 5  SER A O    9  
ATOM 10263 C CB   . SER A 1 5  ? 17.843  -10.580 4.494   1.00 0.00 ? 5  SER A CB   9  
ATOM 10264 O OG   . SER A 1 5  ? 18.688  -9.471  4.789   1.00 0.00 ? 5  SER A OG   9  
ATOM 10265 H H    . SER A 1 5  ? 15.651  -12.134 4.355   1.00 0.00 ? 5  SER A H    9  
ATOM 10266 H HA   . SER A 1 5  ? 16.980  -10.625 6.466   1.00 0.00 ? 5  SER A HA   9  
ATOM 10267 H HB3  . SER A 1 5  ? 17.498  -10.507 3.462   1.00 0.00 ? 5  SER A HB3  9  
ATOM 10268 H HG   . SER A 1 5  ? 18.152  -8.735  5.206   1.00 0.00 ? 5  SER A HG   9  
ATOM 10269 N N    . SER A 1 6  ? 15.476  -8.674  6.184   1.00 0.00 ? 6  SER A N    9  
ATOM 10270 C CA   . SER A 1 6  ? 14.594  -7.526  6.066   1.00 0.00 ? 6  SER A CA   9  
ATOM 10271 C C    . SER A 1 6  ? 14.990  -6.684  4.852   1.00 0.00 ? 6  SER A C    9  
ATOM 10272 O O    . SER A 1 6  ? 16.111  -6.793  4.356   1.00 0.00 ? 6  SER A O    9  
ATOM 10273 C CB   . SER A 1 6  ? 14.625  -6.674  7.336   1.00 0.00 ? 6  SER A CB   9  
ATOM 10274 O OG   . SER A 1 6  ? 13.360  -6.078  7.611   1.00 0.00 ? 6  SER A OG   9  
ATOM 10275 H H    . SER A 1 6  ? 15.898  -8.792  7.082   1.00 0.00 ? 6  SER A H    9  
ATOM 10276 H HA   . SER A 1 6  ? 13.595  -7.942  5.933   1.00 0.00 ? 6  SER A HA   9  
ATOM 10277 H HB3  . SER A 1 6  ? 15.379  -5.894  7.231   1.00 0.00 ? 6  SER A HB3  9  
ATOM 10278 H HG   . SER A 1 6  ? 12.648  -6.780  7.630   1.00 0.00 ? 6  SER A HG   9  
ATOM 10279 N N    . GLY A 1 7  ? 14.050  -5.862  4.408   1.00 0.00 ? 7  GLY A N    9  
ATOM 10280 C CA   . GLY A 1 7  ? 14.287  -5.002  3.262   1.00 0.00 ? 7  GLY A CA   9  
ATOM 10281 C C    . GLY A 1 7  ? 13.427  -3.738  3.338   1.00 0.00 ? 7  GLY A C    9  
ATOM 10282 O O    . GLY A 1 7  ? 12.592  -3.604  4.231   1.00 0.00 ? 7  GLY A O    9  
ATOM 10283 H H    . GLY A 1 7  ? 13.142  -5.780  4.819   1.00 0.00 ? 7  GLY A H    9  
ATOM 10284 H HA2  . GLY A 1 7  ? 15.342  -4.726  3.222   1.00 0.00 ? 7  GLY A HA2  9  
ATOM 10285 H HA3  . GLY A 1 7  ? 14.064  -5.544  2.344   1.00 0.00 ? 7  GLY A HA3  9  
ATOM 10286 N N    . LEU A 1 8  ? 13.661  -2.844  2.388   1.00 0.00 ? 8  LEU A N    9  
ATOM 10287 C CA   . LEU A 1 8  ? 12.918  -1.597  2.335   1.00 0.00 ? 8  LEU A CA   9  
ATOM 10288 C C    . LEU A 1 8  ? 11.729  -1.755  1.385   1.00 0.00 ? 8  LEU A C    9  
ATOM 10289 O O    . LEU A 1 8  ? 10.580  -1.589  1.788   1.00 0.00 ? 8  LEU A O    9  
ATOM 10290 C CB   . LEU A 1 8  ? 13.845  -0.436  1.972   1.00 0.00 ? 8  LEU A CB   9  
ATOM 10291 C CG   . LEU A 1 8  ? 14.467  0.319   3.148   1.00 0.00 ? 8  LEU A CG   9  
ATOM 10292 C CD1  . LEU A 1 8  ? 15.205  1.570   2.668   1.00 0.00 ? 8  LEU A CD1  9  
ATOM 10293 C CD2  . LEU A 1 8  ? 13.413  0.646   4.208   1.00 0.00 ? 8  LEU A CD2  9  
ATOM 10294 H H    . LEU A 1 8  ? 14.341  -2.961  1.665   1.00 0.00 ? 8  LEU A H    9  
ATOM 10295 H HA   . LEU A 1 8  ? 12.535  -1.402  3.337   1.00 0.00 ? 8  LEU A HA   9  
ATOM 10296 H HB3  . LEU A 1 8  ? 13.283  0.275   1.365   1.00 0.00 ? 8  LEU A HB3  9  
ATOM 10297 H HG   . LEU A 1 8  ? 15.206  -0.330  3.618   1.00 0.00 ? 8  LEU A HG   9  
ATOM 10298 H HD11 . LEU A 1 8  ? 14.495  2.256   2.205   1.00 0.00 ? 8  LEU A HD11 9  
ATOM 10299 H HD12 . LEU A 1 8  ? 15.682  2.060   3.517   1.00 0.00 ? 8  LEU A HD12 9  
ATOM 10300 H HD13 . LEU A 1 8  ? 15.964  1.287   1.938   1.00 0.00 ? 8  LEU A HD13 9  
ATOM 10301 H HD21 . LEU A 1 8  ? 13.405  -0.136  4.966   1.00 0.00 ? 8  LEU A HD21 9  
ATOM 10302 H HD22 . LEU A 1 8  ? 13.653  1.602   4.675   1.00 0.00 ? 8  LEU A HD22 9  
ATOM 10303 H HD23 . LEU A 1 8  ? 12.432  0.707   3.738   1.00 0.00 ? 8  LEU A HD23 9  
ATOM 10304 N N    . ARG A 1 9  ? 12.047  -2.076  0.139   1.00 0.00 ? 9  ARG A N    9  
ATOM 10305 C CA   . ARG A 1 9  ? 11.021  -2.260  -0.873  1.00 0.00 ? 9  ARG A CA   9  
ATOM 10306 C C    . ARG A 1 9  ? 10.197  -3.514  -0.572  1.00 0.00 ? 9  ARG A C    9  
ATOM 10307 O O    . ARG A 1 9  ? 9.023   -3.590  -0.930  1.00 0.00 ? 9  ARG A O    9  
ATOM 10308 C CB   . ARG A 1 9  ? 11.637  -2.385  -2.267  1.00 0.00 ? 9  ARG A CB   9  
ATOM 10309 C CG   . ARG A 1 9  ? 10.552  -2.436  -3.344  1.00 0.00 ? 9  ARG A CG   9  
ATOM 10310 C CD   . ARG A 1 9  ? 10.423  -3.844  -3.928  1.00 0.00 ? 9  ARG A CD   9  
ATOM 10311 N NE   . ARG A 1 9  ? 11.759  -4.362  -4.299  1.00 0.00 ? 9  ARG A NE   9  
ATOM 10312 C CZ   . ARG A 1 9  ? 12.030  -5.656  -4.516  1.00 0.00 ? 9  ARG A CZ   9  
ATOM 10313 N NH1  . ARG A 1 9  ? 11.059  -6.572  -4.399  1.00 0.00 ? 9  ARG A NH1  9  
ATOM 10314 N NH2  . ARG A 1 9  ? 13.271  -6.035  -4.850  1.00 0.00 ? 9  ARG A NH2  9  
ATOM 10315 H H    . ARG A 1 9  ? 12.986  -2.211  -0.182  1.00 0.00 ? 9  ARG A H    9  
ATOM 10316 H HA   . ARG A 1 9  ? 10.405  -1.363  -0.811  1.00 0.00 ? 9  ARG A HA   9  
ATOM 10317 H HB3  . ARG A 1 9  ? 12.248  -3.286  -2.319  1.00 0.00 ? 9  ARG A HB3  9  
ATOM 10318 H HG3  . ARG A 1 9  ? 10.790  -1.729  -4.139  1.00 0.00 ? 9  ARG A HG3  9  
ATOM 10319 H HD3  . ARG A 1 9  ? 9.775   -3.826  -4.803  1.00 0.00 ? 9  ARG A HD3  9  
ATOM 10320 H HE   . ARG A 1 9  ? 12.506  -3.705  -4.396  1.00 0.00 ? 9  ARG A HE   9  
ATOM 10321 H HH11 . ARG A 1 9  ? 10.132  -6.290  -4.149  1.00 0.00 ? 9  ARG A HH11 9  
ATOM 10322 H HH12 . ARG A 1 9  ? 11.261  -7.538  -4.560  1.00 0.00 ? 9  ARG A HH12 9  
ATOM 10323 H HH21 . ARG A 1 9  ? 13.995  -5.351  -4.937  1.00 0.00 ? 9  ARG A HH21 9  
ATOM 10324 H HH22 . ARG A 1 9  ? 13.473  -7.001  -5.011  1.00 0.00 ? 9  ARG A HH22 9  
ATOM 10325 N N    . LYS A 1 10 ? 10.846  -4.466  0.083   1.00 0.00 ? 10 LYS A N    9  
ATOM 10326 C CA   . LYS A 1 10 ? 10.188  -5.712  0.436   1.00 0.00 ? 10 LYS A CA   9  
ATOM 10327 C C    . LYS A 1 10 ? 9.180   -5.453  1.557   1.00 0.00 ? 10 LYS A C    9  
ATOM 10328 O O    . LYS A 1 10 ? 8.109   -6.059  1.587   1.00 0.00 ? 10 LYS A O    9  
ATOM 10329 C CB   . LYS A 1 10 ? 11.223  -6.786  0.777   1.00 0.00 ? 10 LYS A CB   9  
ATOM 10330 C CG   . LYS A 1 10 ? 10.586  -7.930  1.570   1.00 0.00 ? 10 LYS A CG   9  
ATOM 10331 C CD   . LYS A 1 10 ? 9.346   -8.469  0.855   1.00 0.00 ? 10 LYS A CD   9  
ATOM 10332 C CE   . LYS A 1 10 ? 8.173   -8.615  1.827   1.00 0.00 ? 10 LYS A CE   9  
ATOM 10333 N NZ   . LYS A 1 10 ? 7.875   -10.045 2.068   1.00 0.00 ? 10 LYS A NZ   9  
ATOM 10334 H H    . LYS A 1 10 ? 11.801  -4.395  0.371   1.00 0.00 ? 10 LYS A H    9  
ATOM 10335 H HA   . LYS A 1 10 ? 9.645   -6.056  -0.445  1.00 0.00 ? 10 LYS A HA   9  
ATOM 10336 H HB3  . LYS A 1 10 ? 12.034  -6.345  1.355   1.00 0.00 ? 10 LYS A HB3  9  
ATOM 10337 H HG3  . LYS A 1 10 ? 10.312  -7.578  2.565   1.00 0.00 ? 10 LYS A HG3  9  
ATOM 10338 H HD3  . LYS A 1 10 ? 9.573   -9.436  0.405   1.00 0.00 ? 10 LYS A HD3  9  
ATOM 10339 H HE3  . LYS A 1 10 ? 7.293   -8.118  1.420   1.00 0.00 ? 10 LYS A HE3  9  
ATOM 10340 H HZ1  . LYS A 1 10 ? 6.969   -10.132 2.480   1.00 0.00 ? 10 LYS A HZ1  9  
ATOM 10341 H HZ2  . LYS A 1 10 ? 7.896   -10.541 1.200   1.00 0.00 ? 10 LYS A HZ2  9  
ATOM 10342 H HZ3  . LYS A 1 10 ? 8.561   -10.428 2.687   1.00 0.00 ? 10 LYS A HZ3  9  
ATOM 10343 N N    . MET A 1 11 ? 9.556   -4.551  2.452   1.00 0.00 ? 11 MET A N    9  
ATOM 10344 C CA   . MET A 1 11 ? 8.699   -4.203  3.572   1.00 0.00 ? 11 MET A CA   9  
ATOM 10345 C C    . MET A 1 11 ? 7.416   -3.523  3.089   1.00 0.00 ? 11 MET A C    9  
ATOM 10346 O O    . MET A 1 11 ? 6.317   -4.017  3.334   1.00 0.00 ? 11 MET A O    9  
ATOM 10347 C CB   . MET A 1 11 ? 9.450   -3.264  4.518   1.00 0.00 ? 11 MET A CB   9  
ATOM 10348 C CG   . MET A 1 11 ? 9.993   -4.027  5.729   1.00 0.00 ? 11 MET A CG   9  
ATOM 10349 S SD   . MET A 1 11 ? 9.858   -3.019  7.195   1.00 0.00 ? 11 MET A SD   9  
ATOM 10350 C CE   . MET A 1 11 ? 11.374  -2.085  7.071   1.00 0.00 ? 11 MET A CE   9  
ATOM 10351 H H    . MET A 1 11 ? 10.429  -4.062  2.419   1.00 0.00 ? 11 MET A H    9  
ATOM 10352 H HA   . MET A 1 11 ? 8.456   -5.148  4.059   1.00 0.00 ? 11 MET A HA   9  
ATOM 10353 H HB3  . MET A 1 11 ? 8.783   -2.471  4.853   1.00 0.00 ? 11 MET A HB3  9  
ATOM 10354 H HG3  . MET A 1 11 ? 11.035  -4.300  5.560   1.00 0.00 ? 11 MET A HG3  9  
ATOM 10355 H HE1  . MET A 1 11 ? 11.717  -2.085  6.036   1.00 0.00 ? 11 MET A HE1  9  
ATOM 10356 H HE2  . MET A 1 11 ? 11.198  -1.060  7.396   1.00 0.00 ? 11 MET A HE2  9  
ATOM 10357 H HE3  . MET A 1 11 ? 12.135  -2.542  7.705   1.00 0.00 ? 11 MET A HE3  9  
ATOM 10358 N N    . VAL A 1 12 ? 7.600   -2.399  2.412   1.00 0.00 ? 12 VAL A N    9  
ATOM 10359 C CA   . VAL A 1 12 ? 6.470   -1.646  1.893   1.00 0.00 ? 12 VAL A CA   9  
ATOM 10360 C C    . VAL A 1 12 ? 5.642   -2.546  0.974   1.00 0.00 ? 12 VAL A C    9  
ATOM 10361 O O    . VAL A 1 12 ? 4.420   -2.419  0.913   1.00 0.00 ? 12 VAL A O    9  
ATOM 10362 C CB   . VAL A 1 12 ? 6.964   -0.374  1.199   1.00 0.00 ? 12 VAL A CB   9  
ATOM 10363 C CG1  . VAL A 1 12 ? 8.256   -0.640  0.423   1.00 0.00 ? 12 VAL A CG1  9  
ATOM 10364 C CG2  . VAL A 1 12 ? 5.885   0.204   0.283   1.00 0.00 ? 12 VAL A CG2  9  
ATOM 10365 H H    . VAL A 1 12 ? 8.497   -2.004  2.217   1.00 0.00 ? 12 VAL A H    9  
ATOM 10366 H HA   . VAL A 1 12 ? 5.854   -1.349  2.742   1.00 0.00 ? 12 VAL A HA   9  
ATOM 10367 H HB   . VAL A 1 12 ? 7.181   0.365   1.969   1.00 0.00 ? 12 VAL A HB   9  
ATOM 10368 H HG11 . VAL A 1 12 ? 8.407   -1.715  0.325   1.00 0.00 ? 12 VAL A HG11 9  
ATOM 10369 H HG12 . VAL A 1 12 ? 8.184   -0.191  -0.567  1.00 0.00 ? 12 VAL A HG12 9  
ATOM 10370 H HG13 . VAL A 1 12 ? 9.098   -0.203  0.961   1.00 0.00 ? 12 VAL A HG13 9  
ATOM 10371 H HG21 . VAL A 1 12 ? 4.973   0.373   0.857   1.00 0.00 ? 12 VAL A HG21 9  
ATOM 10372 H HG22 . VAL A 1 12 ? 6.231   1.151   -0.134  1.00 0.00 ? 12 VAL A HG22 9  
ATOM 10373 H HG23 . VAL A 1 12 ? 5.680   -0.496  -0.527  1.00 0.00 ? 12 VAL A HG23 9  
ATOM 10374 N N    . GLU A 1 13 ? 6.340   -3.433  0.281   1.00 0.00 ? 13 GLU A N    9  
ATOM 10375 C CA   . GLU A 1 13 ? 5.684   -4.353  -0.632  1.00 0.00 ? 13 GLU A CA   9  
ATOM 10376 C C    . GLU A 1 13 ? 4.473   -4.999  0.044   1.00 0.00 ? 13 GLU A C    9  
ATOM 10377 O O    . GLU A 1 13 ? 3.404   -5.101  -0.556  1.00 0.00 ? 13 GLU A O    9  
ATOM 10378 C CB   . GLU A 1 13 ? 6.662   -5.417  -1.136  1.00 0.00 ? 13 GLU A CB   9  
ATOM 10379 C CG   . GLU A 1 13 ? 7.302   -4.989  -2.458  1.00 0.00 ? 13 GLU A CG   9  
ATOM 10380 C CD   . GLU A 1 13 ? 6.410   -5.359  -3.645  1.00 0.00 ? 13 GLU A CD   9  
ATOM 10381 O OE1  . GLU A 1 13 ? 5.249   -5.741  -3.384  1.00 0.00 ? 13 GLU A OE1  9  
ATOM 10382 O OE2  . GLU A 1 13 ? 6.909   -5.252  -4.786  1.00 0.00 ? 13 GLU A OE2  9  
ATOM 10383 H H    . GLU A 1 13 ? 7.333   -3.529  0.336   1.00 0.00 ? 13 GLU A H    9  
ATOM 10384 H HA   . GLU A 1 13 ? 5.356   -3.742  -1.473  1.00 0.00 ? 13 GLU A HA   9  
ATOM 10385 H HB3  . GLU A 1 13 ? 6.139   -6.363  -1.270  1.00 0.00 ? 13 GLU A HB3  9  
ATOM 10386 H HG3  . GLU A 1 13 ? 8.275   -5.469  -2.567  1.00 0.00 ? 13 GLU A HG3  9  
ATOM 10387 N N    . GLU A 1 14 ? 4.681   -5.418  1.284   1.00 0.00 ? 14 GLU A N    9  
ATOM 10388 C CA   . GLU A 1 14 ? 3.619   -6.050  2.048   1.00 0.00 ? 14 GLU A CA   9  
ATOM 10389 C C    . GLU A 1 14 ? 2.651   -4.996  2.587   1.00 0.00 ? 14 GLU A C    9  
ATOM 10390 O O    . GLU A 1 14 ? 1.438   -5.192  2.565   1.00 0.00 ? 14 GLU A O    9  
ATOM 10391 C CB   . GLU A 1 14 ? 4.193   -6.900  3.183   1.00 0.00 ? 14 GLU A CB   9  
ATOM 10392 C CG   . GLU A 1 14 ? 4.259   -6.101  4.487   1.00 0.00 ? 14 GLU A CG   9  
ATOM 10393 C CD   . GLU A 1 14 ? 5.025   -6.871  5.564   1.00 0.00 ? 14 GLU A CD   9  
ATOM 10394 O OE1  . GLU A 1 14 ? 4.555   -7.976  5.913   1.00 0.00 ? 14 GLU A OE1  9  
ATOM 10395 O OE2  . GLU A 1 14 ? 6.062   -6.339  6.014   1.00 0.00 ? 14 GLU A OE2  9  
ATOM 10396 H H    . GLU A 1 14 ? 5.553   -5.331  1.764   1.00 0.00 ? 14 GLU A H    9  
ATOM 10397 H HA   . GLU A 1 14 ? 3.102   -6.701  1.342   1.00 0.00 ? 14 GLU A HA   9  
ATOM 10398 H HB3  . GLU A 1 14 ? 5.191   -7.248  2.915   1.00 0.00 ? 14 GLU A HB3  9  
ATOM 10399 H HG3  . GLU A 1 14 ? 3.249   -5.886  4.836   1.00 0.00 ? 14 GLU A HG3  9  
ATOM 10400 N N    . VAL A 1 15 ? 3.226   -3.899  3.060   1.00 0.00 ? 15 VAL A N    9  
ATOM 10401 C CA   . VAL A 1 15 ? 2.429   -2.812  3.604   1.00 0.00 ? 15 VAL A CA   9  
ATOM 10402 C C    . VAL A 1 15 ? 1.234   -2.551  2.684   1.00 0.00 ? 15 VAL A C    9  
ATOM 10403 O O    . VAL A 1 15 ? 0.098   -2.865  3.034   1.00 0.00 ? 15 VAL A O    9  
ATOM 10404 C CB   . VAL A 1 15 ? 3.305   -1.575  3.811   1.00 0.00 ? 15 VAL A CB   9  
ATOM 10405 C CG1  . VAL A 1 15 ? 2.447   -0.328  4.042   1.00 0.00 ? 15 VAL A CG1  9  
ATOM 10406 C CG2  . VAL A 1 15 ? 4.287   -1.785  4.966   1.00 0.00 ? 15 VAL A CG2  9  
ATOM 10407 H H    . VAL A 1 15 ? 4.214   -3.747  3.074   1.00 0.00 ? 15 VAL A H    9  
ATOM 10408 H HA   . VAL A 1 15 ? 2.059   -3.131  4.578   1.00 0.00 ? 15 VAL A HA   9  
ATOM 10409 H HB   . VAL A 1 15 ? 3.886   -1.419  2.903   1.00 0.00 ? 15 VAL A HB   9  
ATOM 10410 H HG11 . VAL A 1 15 ? 1.985   -0.027  3.102   1.00 0.00 ? 15 VAL A HG11 9  
ATOM 10411 H HG12 . VAL A 1 15 ? 1.671   -0.552  4.773   1.00 0.00 ? 15 VAL A HG12 9  
ATOM 10412 H HG13 . VAL A 1 15 ? 3.075   0.481   4.415   1.00 0.00 ? 15 VAL A HG13 9  
ATOM 10413 H HG21 . VAL A 1 15 ? 3.839   -1.431  5.894   1.00 0.00 ? 15 VAL A HG21 9  
ATOM 10414 H HG22 . VAL A 1 15 ? 4.518   -2.847  5.057   1.00 0.00 ? 15 VAL A HG22 9  
ATOM 10415 H HG23 . VAL A 1 15 ? 5.204   -1.230  4.769   1.00 0.00 ? 15 VAL A HG23 9  
ATOM 10416 N N    . PHE A 1 16 ? 1.533   -1.981  1.527   1.00 0.00 ? 16 PHE A N    9  
ATOM 10417 C CA   . PHE A 1 16 ? 0.497   -1.674  0.554   1.00 0.00 ? 16 PHE A CA   9  
ATOM 10418 C C    . PHE A 1 16 ? -0.463  -2.853  0.386   1.00 0.00 ? 16 PHE A C    9  
ATOM 10419 O O    . PHE A 1 16 ? -1.654  -2.658  0.143   1.00 0.00 ? 16 PHE A O    9  
ATOM 10420 C CB   . PHE A 1 16 ? 1.199   -1.409  -0.779  1.00 0.00 ? 16 PHE A CB   9  
ATOM 10421 C CG   . PHE A 1 16 ? 1.793   -0.004  -0.901  1.00 0.00 ? 16 PHE A CG   9  
ATOM 10422 C CD1  . PHE A 1 16 ? 1.106   1.068   -0.426  1.00 0.00 ? 16 PHE A CD1  9  
ATOM 10423 C CD2  . PHE A 1 16 ? 3.009   0.172   -1.486  1.00 0.00 ? 16 PHE A CD2  9  
ATOM 10424 C CE1  . PHE A 1 16 ? 1.657   2.372   -0.540  1.00 0.00 ? 16 PHE A CE1  9  
ATOM 10425 C CE2  . PHE A 1 16 ? 3.560   1.475   -1.600  1.00 0.00 ? 16 PHE A CE2  9  
ATOM 10426 C CZ   . PHE A 1 16 ? 2.872   2.548   -1.124  1.00 0.00 ? 16 PHE A CZ   9  
ATOM 10427 H H    . PHE A 1 16 ? 2.460   -1.728  1.250   1.00 0.00 ? 16 PHE A H    9  
ATOM 10428 H HA   . PHE A 1 16 ? -0.053  -0.810  0.929   1.00 0.00 ? 16 PHE A HA   9  
ATOM 10429 H HB3  . PHE A 1 16 ? 0.487   -1.563  -1.590  1.00 0.00 ? 16 PHE A HB3  9  
ATOM 10430 H HD1  . PHE A 1 16 ? 0.132   0.927   0.043   1.00 0.00 ? 16 PHE A HD1  9  
ATOM 10431 H HD2  . PHE A 1 16 ? 3.559   -0.688  -1.868  1.00 0.00 ? 16 PHE A HD2  9  
ATOM 10432 H HE1  . PHE A 1 16 ? 1.105   3.232   -0.158  1.00 0.00 ? 16 PHE A HE1  9  
ATOM 10433 H HE2  . PHE A 1 16 ? 4.533   1.616   -2.068  1.00 0.00 ? 16 PHE A HE2  9  
ATOM 10434 H HZ   . PHE A 1 16 ? 3.295   3.549   -1.212  1.00 0.00 ? 16 PHE A HZ   9  
ATOM 10435 N N    . ASP A 1 17 ? 0.089   -4.050  0.523   1.00 0.00 ? 17 ASP A N    9  
ATOM 10436 C CA   . ASP A 1 17 ? -0.703  -5.259  0.389   1.00 0.00 ? 17 ASP A CA   9  
ATOM 10437 C C    . ASP A 1 17 ? -1.623  -5.399  1.604   1.00 0.00 ? 17 ASP A C    9  
ATOM 10438 O O    . ASP A 1 17 ? -2.845  -5.409  1.464   1.00 0.00 ? 17 ASP A O    9  
ATOM 10439 C CB   . ASP A 1 17 ? 0.191   -6.499  0.329   1.00 0.00 ? 17 ASP A CB   9  
ATOM 10440 C CG   . ASP A 1 17 ? 0.276   -7.169  -1.045  1.00 0.00 ? 17 ASP A CG   9  
ATOM 10441 O OD1  . ASP A 1 17 ? 0.384   -6.415  -2.037  1.00 0.00 ? 17 ASP A OD1  9  
ATOM 10442 O OD2  . ASP A 1 17 ? 0.231   -8.418  -1.071  1.00 0.00 ? 17 ASP A OD2  9  
ATOM 10443 H H    . ASP A 1 17 ? 1.058   -4.198  0.721   1.00 0.00 ? 17 ASP A H    9  
ATOM 10444 H HA   . ASP A 1 17 ? -1.258  -5.138  -0.541  1.00 0.00 ? 17 ASP A HA   9  
ATOM 10445 H HB3  . ASP A 1 17 ? -0.177  -7.229  1.050   1.00 0.00 ? 17 ASP A HB3  9  
ATOM 10446 N N    . VAL A 1 18 ? -1.000  -5.502  2.769   1.00 0.00 ? 18 VAL A N    9  
ATOM 10447 C CA   . VAL A 1 18 ? -1.746  -5.640  4.008   1.00 0.00 ? 18 VAL A CA   9  
ATOM 10448 C C    . VAL A 1 18 ? -2.865  -4.597  4.043   1.00 0.00 ? 18 VAL A C    9  
ATOM 10449 O O    . VAL A 1 18 ? -4.033  -4.938  4.223   1.00 0.00 ? 18 VAL A O    9  
ATOM 10450 C CB   . VAL A 1 18 ? -0.799  -5.541  5.205   1.00 0.00 ? 18 VAL A CB   9  
ATOM 10451 C CG1  . VAL A 1 18 ? -1.548  -5.101  6.463   1.00 0.00 ? 18 VAL A CG1  9  
ATOM 10452 C CG2  . VAL A 1 18 ? -0.068  -6.866  5.436   1.00 0.00 ? 18 VAL A CG2  9  
ATOM 10453 H H    . VAL A 1 18 ? -0.005  -5.493  2.875   1.00 0.00 ? 18 VAL A H    9  
ATOM 10454 H HA   . VAL A 1 18 ? -2.194  -6.634  4.013   1.00 0.00 ? 18 VAL A HA   9  
ATOM 10455 H HB   . VAL A 1 18 ? -0.051  -4.782  4.977   1.00 0.00 ? 18 VAL A HB   9  
ATOM 10456 H HG11 . VAL A 1 18 ? -1.697  -4.021  6.439   1.00 0.00 ? 18 VAL A HG11 9  
ATOM 10457 H HG12 . VAL A 1 18 ? -2.518  -5.599  6.502   1.00 0.00 ? 18 VAL A HG12 9  
ATOM 10458 H HG13 . VAL A 1 18 ? -0.966  -5.369  7.345   1.00 0.00 ? 18 VAL A HG13 9  
ATOM 10459 H HG21 . VAL A 1 18 ? -0.131  -7.478  4.536   1.00 0.00 ? 18 VAL A HG21 9  
ATOM 10460 H HG22 . VAL A 1 18 ? 0.977   -6.668  5.669   1.00 0.00 ? 18 VAL A HG22 9  
ATOM 10461 H HG23 . VAL A 1 18 ? -0.532  -7.396  6.269   1.00 0.00 ? 18 VAL A HG23 9  
ATOM 10462 N N    . LEU A 1 19 ? -2.467  -3.344  3.870   1.00 0.00 ? 19 LEU A N    9  
ATOM 10463 C CA   . LEU A 1 19 ? -3.422  -2.248  3.879   1.00 0.00 ? 19 LEU A CA   9  
ATOM 10464 C C    . LEU A 1 19 ? -4.557  -2.558  2.901   1.00 0.00 ? 19 LEU A C    9  
ATOM 10465 O O    . LEU A 1 19 ? -5.729  -2.508  3.269   1.00 0.00 ? 19 LEU A O    9  
ATOM 10466 C CB   . LEU A 1 19 ? -2.715  -0.921  3.601   1.00 0.00 ? 19 LEU A CB   9  
ATOM 10467 C CG   . LEU A 1 19 ? -1.570  -0.559  4.549   1.00 0.00 ? 19 LEU A CG   9  
ATOM 10468 C CD1  . LEU A 1 19 ? -1.231  0.930   4.457   1.00 0.00 ? 19 LEU A CD1  9  
ATOM 10469 C CD2  . LEU A 1 19 ? -1.889  -0.986  5.982   1.00 0.00 ? 19 LEU A CD2  9  
ATOM 10470 H H    . LEU A 1 19 ? -1.516  -3.075  3.724   1.00 0.00 ? 19 LEU A H    9  
ATOM 10471 H HA   . LEU A 1 19 ? -3.839  -2.187  4.884   1.00 0.00 ? 19 LEU A HA   9  
ATOM 10472 H HB3  . LEU A 1 19 ? -3.456  -0.122  3.638   1.00 0.00 ? 19 LEU A HB3  9  
ATOM 10473 H HG   . LEU A 1 19 ? -0.682  -1.110  4.239   1.00 0.00 ? 19 LEU A HG   9  
ATOM 10474 H HD11 . LEU A 1 19 ? -0.157  1.068   4.595   1.00 0.00 ? 19 LEU A HD11 9  
ATOM 10475 H HD12 . LEU A 1 19 ? -1.522  1.309   3.477   1.00 0.00 ? 19 LEU A HD12 9  
ATOM 10476 H HD13 . LEU A 1 19 ? -1.770  1.474   5.232   1.00 0.00 ? 19 LEU A HD13 9  
ATOM 10477 H HD21 . LEU A 1 19 ? -1.694  -2.053  6.096   1.00 0.00 ? 19 LEU A HD21 9  
ATOM 10478 H HD22 . LEU A 1 19 ? -1.262  -0.426  6.677   1.00 0.00 ? 19 LEU A HD22 9  
ATOM 10479 H HD23 . LEU A 1 19 ? -2.938  -0.784  6.197   1.00 0.00 ? 19 LEU A HD23 9  
ATOM 10480 N N    . TYR A 1 20 ? -4.169  -2.868  1.673   1.00 0.00 ? 20 TYR A N    9  
ATOM 10481 C CA   . TYR A 1 20 ? -5.139  -3.186  0.639   1.00 0.00 ? 20 TYR A CA   9  
ATOM 10482 C C    . TYR A 1 20 ? -6.042  -4.343  1.070   1.00 0.00 ? 20 TYR A C    9  
ATOM 10483 O O    . TYR A 1 20 ? -7.266  -4.231  1.024   1.00 0.00 ? 20 TYR A O    9  
ATOM 10484 C CB   . TYR A 1 20 ? -4.327  -3.617  -0.584  1.00 0.00 ? 20 TYR A CB   9  
ATOM 10485 C CG   . TYR A 1 20 ? -5.181  -4.056  -1.775  1.00 0.00 ? 20 TYR A CG   9  
ATOM 10486 C CD1  . TYR A 1 20 ? -6.131  -3.200  -2.295  1.00 0.00 ? 20 TYR A CD1  9  
ATOM 10487 C CD2  . TYR A 1 20 ? -5.001  -5.307  -2.329  1.00 0.00 ? 20 TYR A CD2  9  
ATOM 10488 C CE1  . TYR A 1 20 ? -6.935  -3.613  -3.416  1.00 0.00 ? 20 TYR A CE1  9  
ATOM 10489 C CE2  . TYR A 1 20 ? -5.805  -5.720  -3.451  1.00 0.00 ? 20 TYR A CE2  9  
ATOM 10490 C CZ   . TYR A 1 20 ? -6.732  -4.853  -3.938  1.00 0.00 ? 20 TYR A CZ   9  
ATOM 10491 O OH   . TYR A 1 20 ? -7.491  -5.244  -4.997  1.00 0.00 ? 20 TYR A OH   9  
ATOM 10492 H H    . TYR A 1 20 ? -3.212  -2.906  1.381   1.00 0.00 ? 20 TYR A H    9  
ATOM 10493 H HA   . TYR A 1 20 ? -5.752  -2.301  0.470   1.00 0.00 ? 20 TYR A HA   9  
ATOM 10494 H HB3  . TYR A 1 20 ? -3.669  -4.438  -0.300  1.00 0.00 ? 20 TYR A HB3  9  
ATOM 10495 H HD1  . TYR A 1 20 ? -6.273  -2.213  -1.857  1.00 0.00 ? 20 TYR A HD1  9  
ATOM 10496 H HD2  . TYR A 1 20 ? -4.251  -5.982  -1.918  1.00 0.00 ? 20 TYR A HD2  9  
ATOM 10497 H HE1  . TYR A 1 20 ? -7.690  -2.948  -3.837  1.00 0.00 ? 20 TYR A HE1  9  
ATOM 10498 H HE2  . TYR A 1 20 ? -5.673  -6.705  -3.898  1.00 0.00 ? 20 TYR A HE2  9  
ATOM 10499 H HH   . TYR A 1 20 ? -6.938  -5.777  -5.636  1.00 0.00 ? 20 TYR A HH   9  
ATOM 10500 N N    . SER A 1 21 ? -5.403  -5.429  1.480   1.00 0.00 ? 21 SER A N    9  
ATOM 10501 C CA   . SER A 1 21 ? -6.133  -6.606  1.920   1.00 0.00 ? 21 SER A CA   9  
ATOM 10502 C C    . SER A 1 21 ? -7.070  -6.240  3.073   1.00 0.00 ? 21 SER A C    9  
ATOM 10503 O O    . SER A 1 21 ? -8.195  -6.732  3.143   1.00 0.00 ? 21 SER A O    9  
ATOM 10504 C CB   . SER A 1 21 ? -5.176  -7.720  2.347   1.00 0.00 ? 21 SER A CB   9  
ATOM 10505 O OG   . SER A 1 21 ? -5.872  -8.862  2.839   1.00 0.00 ? 21 SER A OG   9  
ATOM 10506 H H    . SER A 1 21 ? -4.407  -5.512  1.515   1.00 0.00 ? 21 SER A H    9  
ATOM 10507 H HA   . SER A 1 21 ? -6.705  -6.932  1.051   1.00 0.00 ? 21 SER A HA   9  
ATOM 10508 H HB3  . SER A 1 21 ? -4.503  -7.346  3.118   1.00 0.00 ? 21 SER A HB3  9  
ATOM 10509 H HG   . SER A 1 21 ? -6.848  -8.780  2.639   1.00 0.00 ? 21 SER A HG   9  
ATOM 10510 N N    . GLU A 1 22 ? -6.570  -5.380  3.949   1.00 0.00 ? 22 GLU A N    9  
ATOM 10511 C CA   . GLU A 1 22 ? -7.349  -4.943  5.095   1.00 0.00 ? 22 GLU A CA   9  
ATOM 10512 C C    . GLU A 1 22 ? -8.597  -4.190  4.633   1.00 0.00 ? 22 GLU A C    9  
ATOM 10513 O O    . GLU A 1 22 ? -9.695  -4.438  5.127   1.00 0.00 ? 22 GLU A O    9  
ATOM 10514 C CB   . GLU A 1 22 ? -6.504  -4.080  6.034   1.00 0.00 ? 22 GLU A CB   9  
ATOM 10515 C CG   . GLU A 1 22 ? -5.595  -4.948  6.907   1.00 0.00 ? 22 GLU A CG   9  
ATOM 10516 C CD   . GLU A 1 22 ? -5.214  -4.218  8.197   1.00 0.00 ? 22 GLU A CD   9  
ATOM 10517 O OE1  . GLU A 1 22 ? -4.641  -3.114  8.076   1.00 0.00 ? 22 GLU A OE1  9  
ATOM 10518 O OE2  . GLU A 1 22 ? -5.503  -4.782  9.274   1.00 0.00 ? 22 GLU A OE2  9  
ATOM 10519 H H    . GLU A 1 22 ? -5.654  -4.985  3.884   1.00 0.00 ? 22 GLU A H    9  
ATOM 10520 H HA   . GLU A 1 22 ? -7.639  -5.857  5.614   1.00 0.00 ? 22 GLU A HA   9  
ATOM 10521 H HB3  . GLU A 1 22 ? -7.157  -3.479  6.667   1.00 0.00 ? 22 GLU A HB3  9  
ATOM 10522 H HG3  . GLU A 1 22 ? -4.694  -5.209  6.352   1.00 0.00 ? 22 GLU A HG3  9  
ATOM 10523 N N    . ALA A 1 23 ? -8.387  -3.283  3.689   1.00 0.00 ? 23 ALA A N    9  
ATOM 10524 C CA   . ALA A 1 23 ? -9.483  -2.492  3.155   1.00 0.00 ? 23 ALA A CA   9  
ATOM 10525 C C    . ALA A 1 23 ? -10.412 -3.397  2.345   1.00 0.00 ? 23 ALA A C    9  
ATOM 10526 O O    . ALA A 1 23 ? -11.611 -3.137  2.251   1.00 0.00 ? 23 ALA A O    9  
ATOM 10527 C CB   . ALA A 1 23 ? -8.920  -1.338  2.322   1.00 0.00 ? 23 ALA A CB   9  
ATOM 10528 H H    . ALA A 1 23 ? -7.491  -3.087  3.293   1.00 0.00 ? 23 ALA A H    9  
ATOM 10529 H HA   . ALA A 1 23 ? -10.035 -2.078  3.999   1.00 0.00 ? 23 ALA A HA   9  
ATOM 10530 H HB1  . ALA A 1 23 ? -9.132  -1.515  1.268   1.00 0.00 ? 23 ALA A HB1  9  
ATOM 10531 H HB2  . ALA A 1 23 ? -9.384  -0.404  2.634   1.00 0.00 ? 23 ALA A HB2  9  
ATOM 10532 H HB3  . ALA A 1 23 ? -7.841  -1.276  2.469   1.00 0.00 ? 23 ALA A HB3  9  
ATOM 10533 N N    . LEU A 1 24 ? -9.824  -4.441  1.779   1.00 0.00 ? 24 LEU A N    9  
ATOM 10534 C CA   . LEU A 1 24 ? -10.586 -5.386  0.981   1.00 0.00 ? 24 LEU A CA   9  
ATOM 10535 C C    . LEU A 1 24 ? -11.422 -6.272  1.906   1.00 0.00 ? 24 LEU A C    9  
ATOM 10536 O O    . LEU A 1 24 ? -12.464 -6.787  1.502   1.00 0.00 ? 24 LEU A O    9  
ATOM 10537 C CB   . LEU A 1 24 ? -9.657  -6.171  0.050   1.00 0.00 ? 24 LEU A CB   9  
ATOM 10538 C CG   . LEU A 1 24 ? -9.630  -5.717  -1.410  1.00 0.00 ? 24 LEU A CG   9  
ATOM 10539 C CD1  . LEU A 1 24 ? -8.539  -6.450  -2.192  1.00 0.00 ? 24 LEU A CD1  9  
ATOM 10540 C CD2  . LEU A 1 24 ? -11.006 -5.875  -2.060  1.00 0.00 ? 24 LEU A CD2  9  
ATOM 10541 H H    . LEU A 1 24 ? -8.849  -4.645  1.860   1.00 0.00 ? 24 LEU A H    9  
ATOM 10542 H HA   . LEU A 1 24 ? -11.262 -4.810  0.349   1.00 0.00 ? 24 LEU A HA   9  
ATOM 10543 H HB3  . LEU A 1 24 ? -9.951  -7.221  0.078   1.00 0.00 ? 24 LEU A HB3  9  
ATOM 10544 H HG   . LEU A 1 24 ? -9.385  -4.655  -1.433  1.00 0.00 ? 24 LEU A HG   9  
ATOM 10545 H HD11 . LEU A 1 24 ? -7.559  -6.124  -1.841  1.00 0.00 ? 24 LEU A HD11 9  
ATOM 10546 H HD12 . LEU A 1 24 ? -8.641  -7.524  -2.038  1.00 0.00 ? 24 LEU A HD12 9  
ATOM 10547 H HD13 . LEU A 1 24 ? -8.638  -6.224  -3.253  1.00 0.00 ? 24 LEU A HD13 9  
ATOM 10548 H HD21 . LEU A 1 24 ? -11.356 -6.900  -1.924  1.00 0.00 ? 24 LEU A HD21 9  
ATOM 10549 H HD22 . LEU A 1 24 ? -11.710 -5.187  -1.593  1.00 0.00 ? 24 LEU A HD22 9  
ATOM 10550 H HD23 . LEU A 1 24 ? -10.933 -5.654  -3.124  1.00 0.00 ? 24 LEU A HD23 9  
ATOM 10551 N N    . GLY A 1 25 ? -10.935 -6.423  3.128   1.00 0.00 ? 25 GLY A N    9  
ATOM 10552 C CA   . GLY A 1 25 ? -11.624 -7.238  4.114   1.00 0.00 ? 25 GLY A CA   9  
ATOM 10553 C C    . GLY A 1 25 ? -11.567 -8.719  3.737   1.00 0.00 ? 25 GLY A C    9  
ATOM 10554 O O    . GLY A 1 25 ? -12.517 -9.462  3.978   1.00 0.00 ? 25 GLY A O    9  
ATOM 10555 H H    . GLY A 1 25 ? -10.086 -6.000  3.448   1.00 0.00 ? 25 GLY A H    9  
ATOM 10556 H HA2  . GLY A 1 25 ? -11.172 -7.090  5.095   1.00 0.00 ? 25 GLY A HA2  9  
ATOM 10557 H HA3  . GLY A 1 25 ? -12.664 -6.918  4.191   1.00 0.00 ? 25 GLY A HA3  9  
ATOM 10558 N N    . ARG A 1 26 ? -10.441 -9.106  3.154   1.00 0.00 ? 26 ARG A N    9  
ATOM 10559 C CA   . ARG A 1 26 ? -10.247 -10.485 2.742   1.00 0.00 ? 26 ARG A CA   9  
ATOM 10560 C C    . ARG A 1 26 ? -9.657  -11.304 3.891   1.00 0.00 ? 26 ARG A C    9  
ATOM 10561 O O    . ARG A 1 26 ? -9.366  -10.765 4.958   1.00 0.00 ? 26 ARG A O    9  
ATOM 10562 C CB   . ARG A 1 26 ? -9.315  -10.573 1.531   1.00 0.00 ? 26 ARG A CB   9  
ATOM 10563 C CG   . ARG A 1 26 ? -9.963  -9.948  0.294   1.00 0.00 ? 26 ARG A CG   9  
ATOM 10564 C CD   . ARG A 1 26 ? -10.508 -11.026 -0.643  1.00 0.00 ? 26 ARG A CD   9  
ATOM 10565 N NE   . ARG A 1 26 ? -11.985 -10.942 -0.707  1.00 0.00 ? 26 ARG A NE   9  
ATOM 10566 C CZ   . ARG A 1 26 ? -12.655 -10.037 -1.434  1.00 0.00 ? 26 ARG A CZ   9  
ATOM 10567 N NH1  . ARG A 1 26 ? -11.985 -9.133  -2.161  1.00 0.00 ? 26 ARG A NH1  9  
ATOM 10568 N NH2  . ARG A 1 26 ? -13.994 -10.036 -1.431  1.00 0.00 ? 26 ARG A NH2  9  
ATOM 10569 H H    . ARG A 1 26 ? -9.673  -8.495  2.962   1.00 0.00 ? 26 ARG A H    9  
ATOM 10570 H HA   . ARG A 1 26 ? -11.244 -10.840 2.478   1.00 0.00 ? 26 ARG A HA   9  
ATOM 10571 H HB3  . ARG A 1 26 ? -9.071  -11.616 1.331   1.00 0.00 ? 26 ARG A HB3  9  
ATOM 10572 H HG3  . ARG A 1 26 ? -9.230  -9.338  -0.235  1.00 0.00 ? 26 ARG A HG3  9  
ATOM 10573 H HD3  . ARG A 1 26 ? -10.207 -12.013 -0.290  1.00 0.00 ? 26 ARG A HD3  9  
ATOM 10574 H HE   . ARG A 1 26 ? -12.515 -11.602 -0.175  1.00 0.00 ? 26 ARG A HE   9  
ATOM 10575 H HH11 . ARG A 1 26 ? -10.984 -9.135  -2.163  1.00 0.00 ? 26 ARG A HH11 9  
ATOM 10576 H HH12 . ARG A 1 26 ? -12.484 -8.458  -2.703  1.00 0.00 ? 26 ARG A HH12 9  
ATOM 10577 H HH21 . ARG A 1 26 ? -14.495 -10.710 -0.887  1.00 0.00 ? 26 ARG A HH21 9  
ATOM 10578 H HH22 . ARG A 1 26 ? -14.494 -9.360  -1.973  1.00 0.00 ? 26 ARG A HH22 9  
ATOM 10579 N N    . ALA A 1 27 ? -9.499  -12.595 3.636   1.00 0.00 ? 27 ALA A N    9  
ATOM 10580 C CA   . ALA A 1 27 ? -8.949  -13.494 4.636   1.00 0.00 ? 27 ALA A CA   9  
ATOM 10581 C C    . ALA A 1 27 ? -7.430  -13.566 4.472   1.00 0.00 ? 27 ALA A C    9  
ATOM 10582 O O    . ALA A 1 27 ? -6.690  -13.446 5.447   1.00 0.00 ? 27 ALA A O    9  
ATOM 10583 C CB   . ALA A 1 27 ? -9.614  -14.866 4.511   1.00 0.00 ? 27 ALA A CB   9  
ATOM 10584 H H    . ALA A 1 27 ? -9.739  -13.027 2.766   1.00 0.00 ? 27 ALA A H    9  
ATOM 10585 H HA   . ALA A 1 27 ? -9.181  -13.080 5.618   1.00 0.00 ? 27 ALA A HA   9  
ATOM 10586 H HB1  . ALA A 1 27 ? -8.848  -15.632 4.396   1.00 0.00 ? 27 ALA A HB1  9  
ATOM 10587 H HB2  . ALA A 1 27 ? -10.200 -15.069 5.407   1.00 0.00 ? 27 ALA A HB2  9  
ATOM 10588 H HB3  . ALA A 1 27 ? -10.270 -14.874 3.639   1.00 0.00 ? 27 ALA A HB3  9  
ATOM 10589 N N    . SER A 1 28 ? -7.010  -13.760 3.230   1.00 0.00 ? 28 SER A N    9  
ATOM 10590 C CA   . SER A 1 28 ? -5.592  -13.848 2.925   1.00 0.00 ? 28 SER A CA   9  
ATOM 10591 C C    . SER A 1 28 ? -5.085  -12.505 2.398   1.00 0.00 ? 28 SER A C    9  
ATOM 10592 O O    . SER A 1 28 ? -5.876  -11.655 1.991   1.00 0.00 ? 28 SER A O    9  
ATOM 10593 C CB   . SER A 1 28 ? -5.316  -14.957 1.907   1.00 0.00 ? 28 SER A CB   9  
ATOM 10594 O OG   . SER A 1 28 ? -6.016  -16.157 2.222   1.00 0.00 ? 28 SER A OG   9  
ATOM 10595 H H    . SER A 1 28 ? -7.618  -13.856 2.442   1.00 0.00 ? 28 SER A H    9  
ATOM 10596 H HA   . SER A 1 28 ? -5.109  -14.096 3.870   1.00 0.00 ? 28 SER A HA   9  
ATOM 10597 H HB3  . SER A 1 28 ? -4.245  -15.159 1.872   1.00 0.00 ? 28 SER A HB3  9  
ATOM 10598 H HG   . SER A 1 28 ? -5.451  -16.739 2.805   1.00 0.00 ? 28 SER A HG   9  
ATOM 10599 N N    . VAL A 1 29 ? -3.769  -12.354 2.422   1.00 0.00 ? 29 VAL A N    9  
ATOM 10600 C CA   . VAL A 1 29 ? -3.148  -11.128 1.952   1.00 0.00 ? 29 VAL A CA   9  
ATOM 10601 C C    . VAL A 1 29 ? -2.960  -11.206 0.435   1.00 0.00 ? 29 VAL A C    9  
ATOM 10602 O O    . VAL A 1 29 ? -2.175  -12.016 -0.056  1.00 0.00 ? 29 VAL A O    9  
ATOM 10603 C CB   . VAL A 1 29 ? -1.838  -10.883 2.704   1.00 0.00 ? 29 VAL A CB   9  
ATOM 10604 C CG1  . VAL A 1 29 ? -1.050  -9.733  2.073   1.00 0.00 ? 29 VAL A CG1  9  
ATOM 10605 C CG2  . VAL A 1 29 ? -2.100  -10.620 4.188   1.00 0.00 ? 29 VAL A CG2  9  
ATOM 10606 H H    . VAL A 1 29 ? -3.133  -13.050 2.755   1.00 0.00 ? 29 VAL A H    9  
ATOM 10607 H HA   . VAL A 1 29 ? -3.826  -10.306 2.179   1.00 0.00 ? 29 VAL A HA   9  
ATOM 10608 H HB   . VAL A 1 29 ? -1.232  -11.786 2.627   1.00 0.00 ? 29 VAL A HB   9  
ATOM 10609 H HG11 . VAL A 1 29 ? -0.423  -9.263  2.832   1.00 0.00 ? 29 VAL A HG11 9  
ATOM 10610 H HG12 . VAL A 1 29 ? -0.421  -10.119 1.271   1.00 0.00 ? 29 VAL A HG12 9  
ATOM 10611 H HG13 . VAL A 1 29 ? -1.744  -8.996  1.669   1.00 0.00 ? 29 VAL A HG13 9  
ATOM 10612 H HG21 . VAL A 1 29 ? -1.826  -9.593  4.429   1.00 0.00 ? 29 VAL A HG21 9  
ATOM 10613 H HG22 . VAL A 1 29 ? -3.157  -10.774 4.404   1.00 0.00 ? 29 VAL A HG22 9  
ATOM 10614 H HG23 . VAL A 1 29 ? -1.503  -11.305 4.790   1.00 0.00 ? 29 VAL A HG23 9  
ATOM 10615 N N    . VAL A 1 30 ? -3.691  -10.352 -0.265  1.00 0.00 ? 30 VAL A N    9  
ATOM 10616 C CA   . VAL A 1 30 ? -3.616  -10.314 -1.715  1.00 0.00 ? 30 VAL A CA   9  
ATOM 10617 C C    . VAL A 1 30 ? -2.655  -9.203  -2.142  1.00 0.00 ? 30 VAL A C    9  
ATOM 10618 O O    . VAL A 1 30 ? -2.425  -8.255  -1.394  1.00 0.00 ? 30 VAL A O    9  
ATOM 10619 C CB   . VAL A 1 30 ? -5.017  -10.153 -2.309  1.00 0.00 ? 30 VAL A CB   9  
ATOM 10620 C CG1  . VAL A 1 30 ? -5.749  -11.496 -2.357  1.00 0.00 ? 30 VAL A CG1  9  
ATOM 10621 C CG2  . VAL A 1 30 ? -5.826  -9.115  -1.530  1.00 0.00 ? 30 VAL A CG2  9  
ATOM 10622 H H    . VAL A 1 30 ? -4.327  -9.696  0.143   1.00 0.00 ? 30 VAL A H    9  
ATOM 10623 H HA   . VAL A 1 30 ? -3.216  -11.272 -2.048  1.00 0.00 ? 30 VAL A HA   9  
ATOM 10624 H HB   . VAL A 1 30 ? -4.907  -9.794  -3.332  1.00 0.00 ? 30 VAL A HB   9  
ATOM 10625 H HG11 . VAL A 1 30 ? -5.176  -12.200 -2.960  1.00 0.00 ? 30 VAL A HG11 9  
ATOM 10626 H HG12 . VAL A 1 30 ? -5.857  -11.887 -1.345  1.00 0.00 ? 30 VAL A HG12 9  
ATOM 10627 H HG13 . VAL A 1 30 ? -6.735  -11.357 -2.800  1.00 0.00 ? 30 VAL A HG13 9  
ATOM 10628 H HG21 . VAL A 1 30 ? -5.148  -8.398  -1.067  1.00 0.00 ? 30 VAL A HG21 9  
ATOM 10629 H HG22 . VAL A 1 30 ? -6.498  -8.592  -2.211  1.00 0.00 ? 30 VAL A HG22 9  
ATOM 10630 H HG23 . VAL A 1 30 ? -6.410  -9.614  -0.757  1.00 0.00 ? 30 VAL A HG23 9  
ATOM 10631 N N    . PRO A 1 31 ? -2.105  -9.361  -3.376  1.00 0.00 ? 31 PRO A N    9  
ATOM 10632 C CA   . PRO A 1 31 ? -1.174  -8.383  -3.911  1.00 0.00 ? 31 PRO A CA   9  
ATOM 10633 C C    . PRO A 1 31 ? -1.906  -7.118  -4.363  1.00 0.00 ? 31 PRO A C    9  
ATOM 10634 O O    . PRO A 1 31 ? -3.135  -7.092  -4.411  1.00 0.00 ? 31 PRO A O    9  
ATOM 10635 C CB   . PRO A 1 31 ? -0.465  -9.097  -5.051  1.00 0.00 ? 31 PRO A CB   9  
ATOM 10636 C CG   . PRO A 1 31 ? -1.344  -10.283 -5.411  1.00 0.00 ? 31 PRO A CG   9  
ATOM 10637 C CD   . PRO A 1 31 ? -2.354  -10.472 -4.290  1.00 0.00 ? 31 PRO A CD   9  
ATOM 10638 H HA   . PRO A 1 31 ? -0.533  -8.089  -3.203  1.00 0.00 ? 31 PRO A HA   9  
ATOM 10639 H HB3  . PRO A 1 31 ? 0.529   -9.426  -4.747  1.00 0.00 ? 31 PRO A HB3  9  
ATOM 10640 H HG3  . PRO A 1 31 ? -0.741  -11.182 -5.537  1.00 0.00 ? 31 PRO A HG3  9  
ATOM 10641 H HD3  . PRO A 1 31 ? -2.218  -11.432 -3.793  1.00 0.00 ? 31 PRO A HD3  9  
ATOM 10642 N N    . LEU A 1 32 ? -1.122  -6.099  -4.682  1.00 0.00 ? 32 LEU A N    9  
ATOM 10643 C CA   . LEU A 1 32 ? -1.681  -4.834  -5.127  1.00 0.00 ? 32 LEU A CA   9  
ATOM 10644 C C    . LEU A 1 32 ? -1.309  -4.606  -6.594  1.00 0.00 ? 32 LEU A C    9  
ATOM 10645 O O    . LEU A 1 32 ? -0.184  -4.217  -6.900  1.00 0.00 ? 32 LEU A O    9  
ATOM 10646 C CB   . LEU A 1 32 ? -1.245  -3.699  -4.199  1.00 0.00 ? 32 LEU A CB   9  
ATOM 10647 C CG   . LEU A 1 32 ? -1.447  -2.280  -4.734  1.00 0.00 ? 32 LEU A CG   9  
ATOM 10648 C CD1  . LEU A 1 32 ? -2.797  -2.148  -5.440  1.00 0.00 ? 32 LEU A CD1  9  
ATOM 10649 C CD2  . LEU A 1 32 ? -1.279  -1.245  -3.620  1.00 0.00 ? 32 LEU A CD2  9  
ATOM 10650 H H    . LEU A 1 32 ? -0.123  -6.128  -4.640  1.00 0.00 ? 32 LEU A H    9  
ATOM 10651 H HA   . LEU A 1 32 ? -2.765  -4.913  -5.054  1.00 0.00 ? 32 LEU A HA   9  
ATOM 10652 H HB3  . LEU A 1 32 ? -0.188  -3.832  -3.967  1.00 0.00 ? 32 LEU A HB3  9  
ATOM 10653 H HG   . LEU A 1 32 ? -0.674  -2.082  -5.476  1.00 0.00 ? 32 LEU A HG   9  
ATOM 10654 H HD11 . LEU A 1 32 ? -2.750  -1.337  -6.167  1.00 0.00 ? 32 LEU A HD11 9  
ATOM 10655 H HD12 . LEU A 1 32 ? -3.033  -3.080  -5.953  1.00 0.00 ? 32 LEU A HD12 9  
ATOM 10656 H HD13 . LEU A 1 32 ? -3.573  -1.932  -4.706  1.00 0.00 ? 32 LEU A HD13 9  
ATOM 10657 H HD21 . LEU A 1 32 ? -1.179  -1.755  -2.662  1.00 0.00 ? 32 LEU A HD21 9  
ATOM 10658 H HD22 . LEU A 1 32 ? -0.387  -0.649  -3.810  1.00 0.00 ? 32 LEU A HD22 9  
ATOM 10659 H HD23 . LEU A 1 32 ? -2.152  -0.593  -3.595  1.00 0.00 ? 32 LEU A HD23 9  
ATOM 10660 N N    . PRO A 1 33 ? -2.304  -4.865  -7.486  1.00 0.00 ? 33 PRO A N    9  
ATOM 10661 C CA   . PRO A 1 33 ? -2.093  -4.692  -8.913  1.00 0.00 ? 33 PRO A CA   9  
ATOM 10662 C C    . PRO A 1 33 ? -2.092  -3.209  -9.291  1.00 0.00 ? 33 PRO A C    9  
ATOM 10663 O O    . PRO A 1 33 ? -3.088  -2.693  -9.796  1.00 0.00 ? 33 PRO A O    9  
ATOM 10664 C CB   . PRO A 1 33 ? -3.217  -5.473  -9.574  1.00 0.00 ? 33 PRO A CB   9  
ATOM 10665 C CG   . PRO A 1 33 ? -4.277  -5.666  -8.502  1.00 0.00 ? 33 PRO A CG   9  
ATOM 10666 C CD   . PRO A 1 33 ? -3.649  -5.327  -7.159  1.00 0.00 ? 33 PRO A CD   9  
ATOM 10667 H HA   . PRO A 1 33 ? -1.194  -5.041  -9.176  1.00 0.00 ? 33 PRO A HA   9  
ATOM 10668 H HB3  . PRO A 1 33 ? -2.859  -6.432  -9.947  1.00 0.00 ? 33 PRO A HB3  9  
ATOM 10669 H HG3  . PRO A 1 33 ? -4.640  -6.694  -8.505  1.00 0.00 ? 33 PRO A HG3  9  
ATOM 10670 H HD3  . PRO A 1 33 ? -3.621  -6.198  -6.504  1.00 0.00 ? 33 PRO A HD3  9  
ATOM 10671 N N    . TYR A 1 34 ? -0.964  -2.566  -9.032  1.00 0.00 ? 34 TYR A N    9  
ATOM 10672 C CA   . TYR A 1 34 ? -0.820  -1.153  -9.339  1.00 0.00 ? 34 TYR A CA   9  
ATOM 10673 C C    . TYR A 1 34 ? -1.140  -0.876  -10.809 1.00 0.00 ? 34 TYR A C    9  
ATOM 10674 O O    . TYR A 1 34 ? -1.998  -0.050  -11.117 1.00 0.00 ? 34 TYR A O    9  
ATOM 10675 C CB   . TYR A 1 34 ? 0.647   -0.810  -9.076  1.00 0.00 ? 34 TYR A CB   9  
ATOM 10676 C CG   . TYR A 1 34 ? 1.115   -1.129  -7.655  1.00 0.00 ? 34 TYR A CG   9  
ATOM 10677 C CD1  . TYR A 1 34 ? 0.968   -0.191  -6.653  1.00 0.00 ? 34 TYR A CD1  9  
ATOM 10678 C CD2  . TYR A 1 34 ? 1.685   -2.354  -7.374  1.00 0.00 ? 34 TYR A CD2  9  
ATOM 10679 C CE1  . TYR A 1 34 ? 1.408   -0.490  -5.315  1.00 0.00 ? 34 TYR A CE1  9  
ATOM 10680 C CE2  . TYR A 1 34 ? 2.125   -2.654  -6.036  1.00 0.00 ? 34 TYR A CE2  9  
ATOM 10681 C CZ   . TYR A 1 34 ? 1.965   -1.707  -5.073  1.00 0.00 ? 34 TYR A CZ   9  
ATOM 10682 O OH   . TYR A 1 34 ? 2.381   -1.990  -3.809  1.00 0.00 ? 34 TYR A OH   9  
ATOM 10683 H H    . TYR A 1 34 ? -0.158  -2.993  -8.621  1.00 0.00 ? 34 TYR A H    9  
ATOM 10684 H HA   . TYR A 1 34 ? -1.520  -0.600  -8.712  1.00 0.00 ? 34 TYR A HA   9  
ATOM 10685 H HB3  . TYR A 1 34 ? 0.804   0.251   -9.270  1.00 0.00 ? 34 TYR A HB3  9  
ATOM 10686 H HD1  . TYR A 1 34 ? 0.518   0.776   -6.875  1.00 0.00 ? 34 TYR A HD1  9  
ATOM 10687 H HD2  . TYR A 1 34 ? 1.802   -3.096  -8.165  1.00 0.00 ? 34 TYR A HD2  9  
ATOM 10688 H HE1  . TYR A 1 34 ? 1.297   0.241   -4.515  1.00 0.00 ? 34 TYR A HE1  9  
ATOM 10689 H HE2  . TYR A 1 34 ? 2.577   -3.617  -5.800  1.00 0.00 ? 34 TYR A HE2  9  
ATOM 10690 H HH   . TYR A 1 34 ? 3.269   -1.563  -3.638  1.00 0.00 ? 34 TYR A HH   9  
ATOM 10691 N N    . GLU A 1 35 ? -0.434  -1.583  -11.679 1.00 0.00 ? 35 GLU A N    9  
ATOM 10692 C CA   . GLU A 1 35 ? -0.631  -1.424  -13.110 1.00 0.00 ? 35 GLU A CA   9  
ATOM 10693 C C    . GLU A 1 35 ? -2.116  -1.227  -13.422 1.00 0.00 ? 35 GLU A C    9  
ATOM 10694 O O    . GLU A 1 35 ? -2.468  -0.548  -14.385 1.00 0.00 ? 35 GLU A O    9  
ATOM 10695 C CB   . GLU A 1 35 ? -0.064  -2.619  -13.878 1.00 0.00 ? 35 GLU A CB   9  
ATOM 10696 C CG   . GLU A 1 35 ? -1.059  -3.781  -13.899 1.00 0.00 ? 35 GLU A CG   9  
ATOM 10697 C CD   . GLU A 1 35 ? -0.498  -4.969  -14.684 1.00 0.00 ? 35 GLU A CD   9  
ATOM 10698 O OE1  . GLU A 1 35 ? -0.246  -4.779  -15.894 1.00 0.00 ? 35 GLU A OE1  9  
ATOM 10699 O OE2  . GLU A 1 35 ? -0.336  -6.038  -14.058 1.00 0.00 ? 35 GLU A OE2  9  
ATOM 10700 H H    . GLU A 1 35 ? 0.262   -2.253  -11.421 1.00 0.00 ? 35 GLU A H    9  
ATOM 10701 H HA   . GLU A 1 35 ? -0.075  -0.527  -13.381 1.00 0.00 ? 35 GLU A HA   9  
ATOM 10702 H HB3  . GLU A 1 35 ? 0.870   -2.942  -13.417 1.00 0.00 ? 35 GLU A HB3  9  
ATOM 10703 H HG3  . GLU A 1 35 ? -1.996  -3.453  -14.347 1.00 0.00 ? 35 GLU A HG3  9  
ATOM 10704 N N    . ARG A 1 36 ? -2.949  -1.834  -12.588 1.00 0.00 ? 36 ARG A N    9  
ATOM 10705 C CA   . ARG A 1 36 ? -4.387  -1.734  -12.763 1.00 0.00 ? 36 ARG A CA   9  
ATOM 10706 C C    . ARG A 1 36 ? -4.940  -0.557  -11.955 1.00 0.00 ? 36 ARG A C    9  
ATOM 10707 O O    . ARG A 1 36 ? -5.425  0.418   -12.527 1.00 0.00 ? 36 ARG A O    9  
ATOM 10708 C CB   . ARG A 1 36 ? -5.087  -3.021  -12.319 1.00 0.00 ? 36 ARG A CB   9  
ATOM 10709 C CG   . ARG A 1 36 ? -5.343  -3.945  -13.511 1.00 0.00 ? 36 ARG A CG   9  
ATOM 10710 C CD   . ARG A 1 36 ? -6.758  -3.751  -14.061 1.00 0.00 ? 36 ARG A CD   9  
ATOM 10711 N NE   . ARG A 1 36 ? -7.226  -4.998  -14.705 1.00 0.00 ? 36 ARG A NE   9  
ATOM 10712 C CZ   . ARG A 1 36 ? -8.504  -5.246  -15.024 1.00 0.00 ? 36 ARG A CZ   9  
ATOM 10713 N NH1  . ARG A 1 36 ? -9.449  -4.333  -14.759 1.00 0.00 ? 36 ARG A NH1  9  
ATOM 10714 N NH2  . ARG A 1 36 ? -8.838  -6.405  -15.607 1.00 0.00 ? 36 ARG A NH2  9  
ATOM 10715 H H    . ARG A 1 36 ? -2.655  -2.385  -11.806 1.00 0.00 ? 36 ARG A H    9  
ATOM 10716 H HA   . ARG A 1 36 ? -4.529  -1.577  -13.832 1.00 0.00 ? 36 ARG A HA   9  
ATOM 10717 H HB3  . ARG A 1 36 ? -6.032  -2.777  -11.834 1.00 0.00 ? 36 ARG A HB3  9  
ATOM 10718 H HG3  . ARG A 1 36 ? -5.207  -4.983  -13.208 1.00 0.00 ? 36 ARG A HG3  9  
ATOM 10719 H HD3  . ARG A 1 36 ? -6.768  -2.933  -14.782 1.00 0.00 ? 36 ARG A HD3  9  
ATOM 10720 H HE   . ARG A 1 36 ? -6.546  -5.700  -14.917 1.00 0.00 ? 36 ARG A HE   9  
ATOM 10721 H HH11 . ARG A 1 36 ? -9.201  -3.467  -14.324 1.00 0.00 ? 36 ARG A HH11 9  
ATOM 10722 H HH12 . ARG A 1 36 ? -10.403 -4.517  -14.997 1.00 0.00 ? 36 ARG A HH12 9  
ATOM 10723 H HH21 . ARG A 1 36 ? -8.132  -7.086  -15.805 1.00 0.00 ? 36 ARG A HH21 9  
ATOM 10724 H HH22 . ARG A 1 36 ? -9.791  -6.589  -15.845 1.00 0.00 ? 36 ARG A HH22 9  
ATOM 10725 N N    . LEU A 1 37 ? -4.848  -0.688  -10.640 1.00 0.00 ? 37 LEU A N    9  
ATOM 10726 C CA   . LEU A 1 37 ? -5.333  0.352   -9.750  1.00 0.00 ? 37 LEU A CA   9  
ATOM 10727 C C    . LEU A 1 37 ? -4.895  1.718   -10.282 1.00 0.00 ? 37 LEU A C    9  
ATOM 10728 O O    . LEU A 1 37 ? -5.648  2.688   -10.205 1.00 0.00 ? 37 LEU A O    9  
ATOM 10729 C CB   . LEU A 1 37 ? -4.883  0.079   -8.312  1.00 0.00 ? 37 LEU A CB   9  
ATOM 10730 C CG   . LEU A 1 37 ? -5.166  -1.326  -7.777  1.00 0.00 ? 37 LEU A CG   9  
ATOM 10731 C CD1  . LEU A 1 37 ? -5.330  -1.310  -6.256  1.00 0.00 ? 37 LEU A CD1  9  
ATOM 10732 C CD2  . LEU A 1 37 ? -6.376  -1.947  -8.478  1.00 0.00 ? 37 LEU A CD2  9  
ATOM 10733 H H    . LEU A 1 37 ? -4.453  -1.485  -10.184 1.00 0.00 ? 37 LEU A H    9  
ATOM 10734 H HA   . LEU A 1 37 ? -6.422  0.310   -9.760  1.00 0.00 ? 37 LEU A HA   9  
ATOM 10735 H HB3  . LEU A 1 37 ? -5.371  0.801   -7.657  1.00 0.00 ? 37 LEU A HB3  9  
ATOM 10736 H HG   . LEU A 1 37 ? -4.305  -1.957  -8.001  1.00 0.00 ? 37 LEU A HG   9  
ATOM 10737 H HD11 . LEU A 1 37 ? -4.607  -0.622  -5.819  1.00 0.00 ? 37 LEU A HD11 9  
ATOM 10738 H HD12 . LEU A 1 37 ? -6.339  -0.985  -6.002  1.00 0.00 ? 37 LEU A HD12 9  
ATOM 10739 H HD13 . LEU A 1 37 ? -5.162  -2.312  -5.862  1.00 0.00 ? 37 LEU A HD13 9  
ATOM 10740 H HD21 . LEU A 1 37 ? -6.086  -2.284  -9.473  1.00 0.00 ? 37 LEU A HD21 9  
ATOM 10741 H HD22 . LEU A 1 37 ? -6.736  -2.797  -7.897  1.00 0.00 ? 37 LEU A HD22 9  
ATOM 10742 H HD23 . LEU A 1 37 ? -7.168  -1.203  -8.563  1.00 0.00 ? 37 LEU A HD23 9  
ATOM 10743 N N    . LEU A 1 38 ? -3.680  1.751   -10.809 1.00 0.00 ? 38 LEU A N    9  
ATOM 10744 C CA   . LEU A 1 38 ? -3.133  2.982   -11.353 1.00 0.00 ? 38 LEU A CA   9  
ATOM 10745 C C    . LEU A 1 38 ? -4.061  3.504   -12.451 1.00 0.00 ? 38 LEU A C    9  
ATOM 10746 O O    . LEU A 1 38 ? -4.369  4.694   -12.495 1.00 0.00 ? 38 LEU A O    9  
ATOM 10747 C CB   . LEU A 1 38 ? -1.691  2.768   -11.817 1.00 0.00 ? 38 LEU A CB   9  
ATOM 10748 C CG   . LEU A 1 38 ? -0.674  2.449   -10.720 1.00 0.00 ? 38 LEU A CG   9  
ATOM 10749 C CD1  . LEU A 1 38 ? 0.624   1.900   -11.316 1.00 0.00 ? 38 LEU A CD1  9  
ATOM 10750 C CD2  . LEU A 1 38 ? -0.424  3.670   -9.832  1.00 0.00 ? 38 LEU A CD2  9  
ATOM 10751 H H    . LEU A 1 38 ? -3.074  0.957   -10.866 1.00 0.00 ? 38 LEU A H    9  
ATOM 10752 H HA   . LEU A 1 38 ? -3.107  3.713   -10.546 1.00 0.00 ? 38 LEU A HA   9  
ATOM 10753 H HB3  . LEU A 1 38 ? -1.361  3.666   -12.340 1.00 0.00 ? 38 LEU A HB3  9  
ATOM 10754 H HG   . LEU A 1 38 ? -1.090  1.668   -10.083 1.00 0.00 ? 38 LEU A HG   9  
ATOM 10755 H HD11 . LEU A 1 38 ? 0.930   2.524   -12.157 1.00 0.00 ? 38 LEU A HD11 9  
ATOM 10756 H HD12 . LEU A 1 38 ? 1.405   1.906   -10.556 1.00 0.00 ? 38 LEU A HD12 9  
ATOM 10757 H HD13 . LEU A 1 38 ? 0.461   0.880   -11.662 1.00 0.00 ? 38 LEU A HD13 9  
ATOM 10758 H HD21 . LEU A 1 38 ? -1.212  3.741   -9.082  1.00 0.00 ? 38 LEU A HD21 9  
ATOM 10759 H HD22 . LEU A 1 38 ? 0.541   3.569   -9.336  1.00 0.00 ? 38 LEU A HD22 9  
ATOM 10760 H HD23 . LEU A 1 38 ? -0.425  4.571   -10.445 1.00 0.00 ? 38 LEU A HD23 9  
ATOM 10761 N N    . ARG A 1 39 ? -4.481  2.589   -13.313 1.00 0.00 ? 39 ARG A N    9  
ATOM 10762 C CA   . ARG A 1 39 ? -5.367  2.943   -14.408 1.00 0.00 ? 39 ARG A CA   9  
ATOM 10763 C C    . ARG A 1 39 ? -6.584  3.707   -13.881 1.00 0.00 ? 39 ARG A C    9  
ATOM 10764 O O    . ARG A 1 39 ? -6.996  4.706   -14.468 1.00 0.00 ? 39 ARG A O    9  
ATOM 10765 C CB   . ARG A 1 39 ? -5.842  1.697   -15.158 1.00 0.00 ? 39 ARG A CB   9  
ATOM 10766 C CG   . ARG A 1 39 ? -6.827  2.066   -16.268 1.00 0.00 ? 39 ARG A CG   9  
ATOM 10767 C CD   . ARG A 1 39 ? -6.876  0.978   -17.343 1.00 0.00 ? 39 ARG A CD   9  
ATOM 10768 N NE   . ARG A 1 39 ? -7.863  1.339   -18.385 1.00 0.00 ? 39 ARG A NE   9  
ATOM 10769 C CZ   . ARG A 1 39 ? -9.191  1.263   -18.220 1.00 0.00 ? 39 ARG A CZ   9  
ATOM 10770 N NH1  . ARG A 1 39 ? -9.697  0.840   -17.054 1.00 0.00 ? 39 ARG A NH1  9  
ATOM 10771 N NH2  . ARG A 1 39 ? -10.011 1.611   -19.220 1.00 0.00 ? 39 ARG A NH2  9  
ATOM 10772 H H    . ARG A 1 39 ? -4.226  1.623   -13.271 1.00 0.00 ? 39 ARG A H    9  
ATOM 10773 H HA   . ARG A 1 39 ? -4.764  3.571   -15.064 1.00 0.00 ? 39 ARG A HA   9  
ATOM 10774 H HB3  . ARG A 1 39 ? -6.317  1.007   -14.460 1.00 0.00 ? 39 ARG A HB3  9  
ATOM 10775 H HG3  . ARG A 1 39 ? -6.534  3.015   -16.718 1.00 0.00 ? 39 ARG A HG3  9  
ATOM 10776 H HD3  . ARG A 1 39 ? -7.142  0.022   -16.893 1.00 0.00 ? 39 ARG A HD3  9  
ATOM 10777 H HE   . ARG A 1 39 ? -7.517  1.660   -19.267 1.00 0.00 ? 39 ARG A HE   9  
ATOM 10778 H HH11 . ARG A 1 39 ? -9.085  0.579   -16.307 1.00 0.00 ? 39 ARG A HH11 9  
ATOM 10779 H HH12 . ARG A 1 39 ? -10.688 0.782   -16.931 1.00 0.00 ? 39 ARG A HH12 9  
ATOM 10780 H HH21 . ARG A 1 39 ? -9.633  1.928   -20.090 1.00 0.00 ? 39 ARG A HH21 9  
ATOM 10781 H HH22 . ARG A 1 39 ? -11.002 1.555   -19.097 1.00 0.00 ? 39 ARG A HH22 9  
ATOM 10782 N N    . GLU A 1 40 ? -7.124  3.207   -12.780 1.00 0.00 ? 40 GLU A N    9  
ATOM 10783 C CA   . GLU A 1 40 ? -8.285  3.830   -12.167 1.00 0.00 ? 40 GLU A CA   9  
ATOM 10784 C C    . GLU A 1 40 ? -7.960  4.268   -10.737 1.00 0.00 ? 40 GLU A C    9  
ATOM 10785 O O    . GLU A 1 40 ? -7.899  3.439   -9.830  1.00 0.00 ? 40 GLU A O    9  
ATOM 10786 C CB   . GLU A 1 40 ? -9.490  2.888   -12.191 1.00 0.00 ? 40 GLU A CB   9  
ATOM 10787 C CG   . GLU A 1 40 ? -9.041  1.425   -12.200 1.00 0.00 ? 40 GLU A CG   9  
ATOM 10788 C CD   . GLU A 1 40 ? -10.236 0.486   -12.382 1.00 0.00 ? 40 GLU A CD   9  
ATOM 10789 O OE1  . GLU A 1 40 ? -11.337 0.876   -11.935 1.00 0.00 ? 40 GLU A OE1  9  
ATOM 10790 O OE2  . GLU A 1 40 ? -10.022 -0.598  -12.965 1.00 0.00 ? 40 GLU A OE2  9  
ATOM 10791 H H    . GLU A 1 40 ? -6.782  2.394   -12.308 1.00 0.00 ? 40 GLU A H    9  
ATOM 10792 H HA   . GLU A 1 40 ? -8.502  4.705   -12.781 1.00 0.00 ? 40 GLU A HA   9  
ATOM 10793 H HB3  . GLU A 1 40 ? -10.098 3.091   -13.073 1.00 0.00 ? 40 GLU A HB3  9  
ATOM 10794 H HG3  . GLU A 1 40 ? -8.531  1.192   -11.266 1.00 0.00 ? 40 GLU A HG3  9  
ATOM 10795 N N    . PRO A 1 41 ? -7.754  5.602   -10.577 1.00 0.00 ? 41 PRO A N    9  
ATOM 10796 C CA   . PRO A 1 41 ? -7.437  6.159   -9.273  1.00 0.00 ? 41 PRO A CA   9  
ATOM 10797 C C    . PRO A 1 41 ? -8.679  6.209   -8.381  1.00 0.00 ? 41 PRO A C    9  
ATOM 10798 O O    . PRO A 1 41 ? -8.568  6.206   -7.155  1.00 0.00 ? 41 PRO A O    9  
ATOM 10799 C CB   . PRO A 1 41 ? -6.858  7.535   -9.563  1.00 0.00 ? 41 PRO A CB   9  
ATOM 10800 C CG   . PRO A 1 41 ? -7.300  7.883   -10.975 1.00 0.00 ? 41 PRO A CG   9  
ATOM 10801 C CD   . PRO A 1 41 ? -7.817  6.613   -11.629 1.00 0.00 ? 41 PRO A CD   9  
ATOM 10802 H HA   . PRO A 1 41 ? -6.780  5.574   -8.796  1.00 0.00 ? 41 PRO A HA   9  
ATOM 10803 H HB3  . PRO A 1 41 ? -5.772  7.526   -9.485  1.00 0.00 ? 41 PRO A HB3  9  
ATOM 10804 H HG3  . PRO A 1 41 ? -6.468  8.295   -11.545 1.00 0.00 ? 41 PRO A HG3  9  
ATOM 10805 H HD3  . PRO A 1 41 ? -7.205  6.331   -12.486 1.00 0.00 ? 41 PRO A HD3  9  
ATOM 10806 N N    . GLY A 1 42 ? -9.833  6.254   -9.031  1.00 0.00 ? 42 GLY A N    9  
ATOM 10807 C CA   . GLY A 1 42 ? -11.094 6.304   -8.311  1.00 0.00 ? 42 GLY A CA   9  
ATOM 10808 C C    . GLY A 1 42 ? -11.435 4.942   -7.705  1.00 0.00 ? 42 GLY A C    9  
ATOM 10809 O O    . GLY A 1 42 ? -12.038 4.867   -6.636  1.00 0.00 ? 42 GLY A O    9  
ATOM 10810 H H    . GLY A 1 42 ? -9.913  6.257   -10.027 1.00 0.00 ? 42 GLY A H    9  
ATOM 10811 H HA2  . GLY A 1 42 ? -11.037 7.054   -7.521  1.00 0.00 ? 42 GLY A HA2  9  
ATOM 10812 H HA3  . GLY A 1 42 ? -11.890 6.615   -8.988  1.00 0.00 ? 42 GLY A HA3  9  
ATOM 10813 N N    . LEU A 1 43 ? -11.034 3.897   -8.415  1.00 0.00 ? 43 LEU A N    9  
ATOM 10814 C CA   . LEU A 1 43 ? -11.289 2.541   -7.960  1.00 0.00 ? 43 LEU A CA   9  
ATOM 10815 C C    . LEU A 1 43 ? -10.677 2.351   -6.570  1.00 0.00 ? 43 LEU A C    9  
ATOM 10816 O O    . LEU A 1 43 ? -11.293 1.743   -5.695  1.00 0.00 ? 43 LEU A O    9  
ATOM 10817 C CB   . LEU A 1 43 ? -10.793 1.528   -8.994  1.00 0.00 ? 43 LEU A CB   9  
ATOM 10818 C CG   . LEU A 1 43 ? -11.270 0.086   -8.801  1.00 0.00 ? 43 LEU A CG   9  
ATOM 10819 C CD1  . LEU A 1 43 ? -12.715 -0.081  -9.273  1.00 0.00 ? 43 LEU A CD1  9  
ATOM 10820 C CD2  . LEU A 1 43 ? -10.324 -0.900  -9.489  1.00 0.00 ? 43 LEU A CD2  9  
ATOM 10821 H H    . LEU A 1 43 ? -10.543 3.966   -9.283  1.00 0.00 ? 43 LEU A H    9  
ATOM 10822 H HA   . LEU A 1 43 ? -12.369 2.421   -7.882  1.00 0.00 ? 43 LEU A HA   9  
ATOM 10823 H HB3  . LEU A 1 43 ? -9.704  1.533   -8.986  1.00 0.00 ? 43 LEU A HB3  9  
ATOM 10824 H HG   . LEU A 1 43 ? -11.251 -0.140  -7.735  1.00 0.00 ? 43 LEU A HG   9  
ATOM 10825 H HD11 . LEU A 1 43 ? -12.885 -1.118  -9.564  1.00 0.00 ? 43 LEU A HD11 9  
ATOM 10826 H HD12 . LEU A 1 43 ? -13.395 0.185   -8.463  1.00 0.00 ? 43 LEU A HD12 9  
ATOM 10827 H HD13 . LEU A 1 43 ? -12.896 0.570   -10.128 1.00 0.00 ? 43 LEU A HD13 9  
ATOM 10828 H HD21 . LEU A 1 43 ? -10.902 -1.587  -10.107 1.00 0.00 ? 43 LEU A HD21 9  
ATOM 10829 H HD22 . LEU A 1 43 ? -9.620  -0.352  -10.117 1.00 0.00 ? 43 LEU A HD22 9  
ATOM 10830 H HD23 . LEU A 1 43 ? -9.775  -1.464  -8.735  1.00 0.00 ? 43 LEU A HD23 9  
ATOM 10831 N N    . LEU A 1 44 ? -9.473  2.879   -6.411  1.00 0.00 ? 44 LEU A N    9  
ATOM 10832 C CA   . LEU A 1 44 ? -8.771  2.776   -5.142  1.00 0.00 ? 44 LEU A CA   9  
ATOM 10833 C C    . LEU A 1 44 ? -7.814  3.959   -4.995  1.00 0.00 ? 44 LEU A C    9  
ATOM 10834 O O    . LEU A 1 44 ? -6.828  4.060   -5.724  1.00 0.00 ? 44 LEU A O    9  
ATOM 10835 C CB   . LEU A 1 44 ? -8.087  1.412   -5.019  1.00 0.00 ? 44 LEU A CB   9  
ATOM 10836 C CG   . LEU A 1 44 ? -7.051  1.280   -3.901  1.00 0.00 ? 44 LEU A CG   9  
ATOM 10837 C CD1  . LEU A 1 44 ? -7.558  1.919   -2.606  1.00 0.00 ? 44 LEU A CD1  9  
ATOM 10838 C CD2  . LEU A 1 44 ? -6.645  -0.181  -3.700  1.00 0.00 ? 44 LEU A CD2  9  
ATOM 10839 H H    . LEU A 1 44 ? -8.979  3.371   -7.128  1.00 0.00 ? 44 LEU A H    9  
ATOM 10840 H HA   . LEU A 1 44 ? -9.517  2.834   -4.350  1.00 0.00 ? 44 LEU A HA   9  
ATOM 10841 H HB3  . LEU A 1 44 ? -7.601  1.185   -5.967  1.00 0.00 ? 44 LEU A HB3  9  
ATOM 10842 H HG   . LEU A 1 44 ? -6.155  1.825   -4.199  1.00 0.00 ? 44 LEU A HG   9  
ATOM 10843 H HD11 . LEU A 1 44 ? -8.554  1.538   -2.380  1.00 0.00 ? 44 LEU A HD11 9  
ATOM 10844 H HD12 . LEU A 1 44 ? -6.881  1.670   -1.789  1.00 0.00 ? 44 LEU A HD12 9  
ATOM 10845 H HD13 . LEU A 1 44 ? -7.600  3.001   -2.727  1.00 0.00 ? 44 LEU A HD13 9  
ATOM 10846 H HD21 . LEU A 1 44 ? -5.622  -0.325  -4.046  1.00 0.00 ? 44 LEU A HD21 9  
ATOM 10847 H HD22 . LEU A 1 44 ? -6.710  -0.433  -2.640  1.00 0.00 ? 44 LEU A HD22 9  
ATOM 10848 H HD23 . LEU A 1 44 ? -7.316  -0.826  -4.267  1.00 0.00 ? 44 LEU A HD23 9  
ATOM 10849 N N    . ALA A 1 45 ? -8.137  4.826   -4.047  1.00 0.00 ? 45 ALA A N    9  
ATOM 10850 C CA   . ALA A 1 45 ? -7.317  6.000   -3.794  1.00 0.00 ? 45 ALA A CA   9  
ATOM 10851 C C    . ALA A 1 45 ? -6.455  5.757   -2.554  1.00 0.00 ? 45 ALA A C    9  
ATOM 10852 O O    . ALA A 1 45 ? -6.977  5.471   -1.477  1.00 0.00 ? 45 ALA A O    9  
ATOM 10853 C CB   . ALA A 1 45 ? -8.217  7.229   -3.649  1.00 0.00 ? 45 ALA A CB   9  
ATOM 10854 H H    . ALA A 1 45 ? -8.940  4.737   -3.458  1.00 0.00 ? 45 ALA A H    9  
ATOM 10855 H HA   . ALA A 1 45 ? -6.667  6.141   -4.657  1.00 0.00 ? 45 ALA A HA   9  
ATOM 10856 H HB1  . ALA A 1 45 ? -8.764  7.391   -4.578  1.00 0.00 ? 45 ALA A HB1  9  
ATOM 10857 H HB2  . ALA A 1 45 ? -8.924  7.067   -2.834  1.00 0.00 ? 45 ALA A HB2  9  
ATOM 10858 H HB3  . ALA A 1 45 ? -7.604  8.102   -3.430  1.00 0.00 ? 45 ALA A HB3  9  
ATOM 10859 N N    . VAL A 1 46 ? -5.150  5.879   -2.746  1.00 0.00 ? 46 VAL A N    9  
ATOM 10860 C CA   . VAL A 1 46 ? -4.211  5.678   -1.656  1.00 0.00 ? 46 VAL A CA   9  
ATOM 10861 C C    . VAL A 1 46 ? -4.035  6.990   -0.890  1.00 0.00 ? 46 VAL A C    9  
ATOM 10862 O O    . VAL A 1 46 ? -3.534  7.970   -1.439  1.00 0.00 ? 46 VAL A O    9  
ATOM 10863 C CB   . VAL A 1 46 ? -2.893  5.120   -2.198  1.00 0.00 ? 46 VAL A CB   9  
ATOM 10864 C CG1  . VAL A 1 46 ? -1.920  4.811   -1.058  1.00 0.00 ? 46 VAL A CG1  9  
ATOM 10865 C CG2  . VAL A 1 46 ? -3.136  3.882   -3.063  1.00 0.00 ? 46 VAL A CG2  9  
ATOM 10866 H H    . VAL A 1 46 ? -4.734  6.113   -3.625  1.00 0.00 ? 46 VAL A H    9  
ATOM 10867 H HA   . VAL A 1 46 ? -4.642  4.935   -0.985  1.00 0.00 ? 46 VAL A HA   9  
ATOM 10868 H HB   . VAL A 1 46 ? -2.440  5.885   -2.828  1.00 0.00 ? 46 VAL A HB   9  
ATOM 10869 H HG11 . VAL A 1 46 ? -0.905  4.752   -1.454  1.00 0.00 ? 46 VAL A HG11 9  
ATOM 10870 H HG12 . VAL A 1 46 ? -1.973  5.602   -0.311  1.00 0.00 ? 46 VAL A HG12 9  
ATOM 10871 H HG13 . VAL A 1 46 ? -2.186  3.859   -0.601  1.00 0.00 ? 46 VAL A HG13 9  
ATOM 10872 H HG21 . VAL A 1 46 ? -4.203  3.780   -3.259  1.00 0.00 ? 46 VAL A HG21 9  
ATOM 10873 H HG22 . VAL A 1 46 ? -2.600  3.988   -4.007  1.00 0.00 ? 46 VAL A HG22 9  
ATOM 10874 H HG23 . VAL A 1 46 ? -2.776  2.996   -2.538  1.00 0.00 ? 46 VAL A HG23 9  
ATOM 10875 N N    . GLN A 1 47 ? -4.457  6.967   0.366   1.00 0.00 ? 47 GLN A N    9  
ATOM 10876 C CA   . GLN A 1 47 ? -4.352  8.142   1.213   1.00 0.00 ? 47 GLN A CA   9  
ATOM 10877 C C    . GLN A 1 47 ? -3.319  7.911   2.317   1.00 0.00 ? 47 GLN A C    9  
ATOM 10878 O O    . GLN A 1 47 ? -2.899  6.779   2.551   1.00 0.00 ? 47 GLN A O    9  
ATOM 10879 C CB   . GLN A 1 47 ? -5.713  8.515   1.805   1.00 0.00 ? 47 GLN A CB   9  
ATOM 10880 C CG   . GLN A 1 47 ? -6.519  9.372   0.828   1.00 0.00 ? 47 GLN A CG   9  
ATOM 10881 C CD   . GLN A 1 47 ? -5.871  10.746  0.639   1.00 0.00 ? 47 GLN A CD   9  
ATOM 10882 O OE1  . GLN A 1 47 ? -5.655  11.493  1.578   1.00 0.00 ? 47 GLN A OE1  9  
ATOM 10883 N NE2  . GLN A 1 47 ? -5.573  11.034  -0.625  1.00 0.00 ? 47 GLN A NE2  9  
ATOM 10884 H H    . GLN A 1 47 ? -4.863  6.164   0.804   1.00 0.00 ? 47 GLN A H    9  
ATOM 10885 H HA   . GLN A 1 47 ? -4.018  8.945   0.555   1.00 0.00 ? 47 GLN A HA   9  
ATOM 10886 H HB3  . GLN A 1 47 ? -5.571  9.058   2.739   1.00 0.00 ? 47 GLN A HB3  9  
ATOM 10887 H HG3  . GLN A 1 47 ? -7.537  9.496   1.200   1.00 0.00 ? 47 GLN A HG3  9  
ATOM 10888 H HE21 . GLN A 1 47 ? -5.777  10.375  -1.349  1.00 0.00 ? 47 GLN A HE21 9  
ATOM 10889 H HE22 . GLN A 1 47 ? -5.146  11.910  -0.851  1.00 0.00 ? 47 GLN A HE22 9  
ATOM 10890 N N    . GLY A 1 48 ? -2.939  9.002   2.965   1.00 0.00 ? 48 GLY A N    9  
ATOM 10891 C CA   . GLY A 1 48 ? -1.962  8.932   4.039   1.00 0.00 ? 48 GLY A CA   9  
ATOM 10892 C C    . GLY A 1 48 ? -0.579  8.560   3.499   1.00 0.00 ? 48 GLY A C    9  
ATOM 10893 O O    . GLY A 1 48 ? 0.218   7.939   4.201   1.00 0.00 ? 48 GLY A O    9  
ATOM 10894 H H    . GLY A 1 48 ? -3.284  9.920   2.767   1.00 0.00 ? 48 GLY A H    9  
ATOM 10895 H HA2  . GLY A 1 48 ? -1.909  9.893   4.550   1.00 0.00 ? 48 GLY A HA2  9  
ATOM 10896 H HA3  . GLY A 1 48 ? -2.279  8.196   4.776   1.00 0.00 ? 48 GLY A HA3  9  
ATOM 10897 N N    . LEU A 1 49 ? -0.338  8.953   2.257   1.00 0.00 ? 49 LEU A N    9  
ATOM 10898 C CA   . LEU A 1 49 ? 0.934   8.667   1.616   1.00 0.00 ? 49 LEU A CA   9  
ATOM 10899 C C    . LEU A 1 49 ? 1.997   9.629   2.151   1.00 0.00 ? 49 LEU A C    9  
ATOM 10900 O O    . LEU A 1 49 ? 1.671   10.628  2.790   1.00 0.00 ? 49 LEU A O    9  
ATOM 10901 C CB   . LEU A 1 49 ? 0.786   8.701   0.093   1.00 0.00 ? 49 LEU A CB   9  
ATOM 10902 C CG   . LEU A 1 49 ? 0.419   7.373   -0.574  1.00 0.00 ? 49 LEU A CG   9  
ATOM 10903 C CD1  . LEU A 1 49 ? -0.222  7.606   -1.944  1.00 0.00 ? 49 LEU A CD1  9  
ATOM 10904 C CD2  . LEU A 1 49 ? 1.634   6.448   -0.659  1.00 0.00 ? 49 LEU A CD2  9  
ATOM 10905 H H    . LEU A 1 49 ? -0.992  9.457   1.693   1.00 0.00 ? 49 LEU A H    9  
ATOM 10906 H HA   . LEU A 1 49 ? 1.218   7.652   1.891   1.00 0.00 ? 49 LEU A HA   9  
ATOM 10907 H HB3  . LEU A 1 49 ? 1.724   9.052   -0.335  1.00 0.00 ? 49 LEU A HB3  9  
ATOM 10908 H HG   . LEU A 1 49 ? -0.325  6.873   0.048   1.00 0.00 ? 49 LEU A HG   9  
ATOM 10909 H HD11 . LEU A 1 49 ? 0.497   8.096   -2.602  1.00 0.00 ? 49 LEU A HD11 9  
ATOM 10910 H HD12 . LEU A 1 49 ? -0.516  6.650   -2.374  1.00 0.00 ? 49 LEU A HD12 9  
ATOM 10911 H HD13 . LEU A 1 49 ? -1.101  8.240   -1.830  1.00 0.00 ? 49 LEU A HD13 9  
ATOM 10912 H HD21 . LEU A 1 49 ? 1.361   5.538   -1.193  1.00 0.00 ? 49 LEU A HD21 9  
ATOM 10913 H HD22 . LEU A 1 49 ? 2.439   6.953   -1.191  1.00 0.00 ? 49 LEU A HD22 9  
ATOM 10914 H HD23 . LEU A 1 49 ? 1.967   6.192   0.347   1.00 0.00 ? 49 LEU A HD23 9  
ATOM 10915 N N    . PRO A 1 50 ? 3.281   9.284   1.863   1.00 0.00 ? 50 PRO A N    9  
ATOM 10916 C CA   . PRO A 1 50 ? 4.394   10.106  2.308   1.00 0.00 ? 50 PRO A CA   9  
ATOM 10917 C C    . PRO A 1 50 ? 4.510   11.377  1.465   1.00 0.00 ? 50 PRO A C    9  
ATOM 10918 O O    . PRO A 1 50 ? 5.038   11.343  0.354   1.00 0.00 ? 50 PRO A O    9  
ATOM 10919 C CB   . PRO A 1 50 ? 5.614   9.206   2.198   1.00 0.00 ? 50 PRO A CB   9  
ATOM 10920 C CG   . PRO A 1 50 ? 5.217   8.076   1.263   1.00 0.00 ? 50 PRO A CG   9  
ATOM 10921 C CD   . PRO A 1 50 ? 3.706   8.108   1.109   1.00 0.00 ? 50 PRO A CD   9  
ATOM 10922 H HA   . PRO A 1 50 ? 4.244   10.413  3.248   1.00 0.00 ? 50 PRO A HA   9  
ATOM 10923 H HB3  . PRO A 1 50 ? 5.905   8.821   3.175   1.00 0.00 ? 50 PRO A HB3  9  
ATOM 10924 H HG3  . PRO A 1 50 ? 5.539   7.116   1.666   1.00 0.00 ? 50 PRO A HG3  9  
ATOM 10925 H HD3  . PRO A 1 50 ? 3.248   7.200   1.502   1.00 0.00 ? 50 PRO A HD3  9  
ATOM 10926 N N    . GLU A 1 51 ? 4.007   12.468  2.024   1.00 0.00 ? 51 GLU A N    9  
ATOM 10927 C CA   . GLU A 1 51 ? 4.048   13.747  1.337   1.00 0.00 ? 51 GLU A CA   9  
ATOM 10928 C C    . GLU A 1 51 ? 5.291   13.834  0.450   1.00 0.00 ? 51 GLU A C    9  
ATOM 10929 O O    . GLU A 1 51 ? 6.341   13.294  0.792   1.00 0.00 ? 51 GLU A O    9  
ATOM 10930 C CB   . GLU A 1 51 ? 4.003   14.907  2.334   1.00 0.00 ? 51 GLU A CB   9  
ATOM 10931 C CG   . GLU A 1 51 ? 2.627   15.007  2.996   1.00 0.00 ? 51 GLU A CG   9  
ATOM 10932 C CD   . GLU A 1 51 ? 2.642   16.025  4.138   1.00 0.00 ? 51 GLU A CD   9  
ATOM 10933 O OE1  . GLU A 1 51 ? 3.379   15.772  5.116   1.00 0.00 ? 51 GLU A OE1  9  
ATOM 10934 O OE2  . GLU A 1 51 ? 1.916   17.035  4.009   1.00 0.00 ? 51 GLU A OE2  9  
ATOM 10935 H H    . GLU A 1 51 ? 3.579   12.486  2.928   1.00 0.00 ? 51 GLU A H    9  
ATOM 10936 H HA   . GLU A 1 51 ? 3.150   13.772  0.719   1.00 0.00 ? 51 GLU A HA   9  
ATOM 10937 H HB3  . GLU A 1 51 ? 4.232   15.840  1.822   1.00 0.00 ? 51 GLU A HB3  9  
ATOM 10938 H HG3  . GLU A 1 51 ? 2.331   14.031  3.380   1.00 0.00 ? 51 GLU A HG3  9  
ATOM 10939 N N    . GLY A 1 52 ? 5.131   14.520  -0.673  1.00 0.00 ? 52 GLY A N    9  
ATOM 10940 C CA   . GLY A 1 52 ? 6.228   14.684  -1.611  1.00 0.00 ? 52 GLY A CA   9  
ATOM 10941 C C    . GLY A 1 52 ? 6.516   13.378  -2.353  1.00 0.00 ? 52 GLY A C    9  
ATOM 10942 O O    . GLY A 1 52 ? 7.674   13.009  -2.541  1.00 0.00 ? 52 GLY A O    9  
ATOM 10943 H H    . GLY A 1 52 ? 4.273   14.957  -0.944  1.00 0.00 ? 52 GLY A H    9  
ATOM 10944 H HA2  . GLY A 1 52 ? 5.982   15.467  -2.329  1.00 0.00 ? 52 GLY A HA2  9  
ATOM 10945 H HA3  . GLY A 1 52 ? 7.121   15.009  -1.079  1.00 0.00 ? 52 GLY A HA3  9  
ATOM 10946 N N    . LEU A 1 53 ? 5.443   12.712  -2.755  1.00 0.00 ? 53 LEU A N    9  
ATOM 10947 C CA   . LEU A 1 53 ? 5.566   11.456  -3.471  1.00 0.00 ? 53 LEU A CA   9  
ATOM 10948 C C    . LEU A 1 53 ? 4.318   11.237  -4.329  1.00 0.00 ? 53 LEU A C    9  
ATOM 10949 O O    . LEU A 1 53 ? 3.499   12.142  -4.482  1.00 0.00 ? 53 LEU A O    9  
ATOM 10950 C CB   . LEU A 1 53 ? 5.851   10.309  -2.498  1.00 0.00 ? 53 LEU A CB   9  
ATOM 10951 C CG   . LEU A 1 53 ? 7.326   10.008  -2.229  1.00 0.00 ? 53 LEU A CG   9  
ATOM 10952 C CD1  . LEU A 1 53 ? 7.483   9.023   -1.070  1.00 0.00 ? 53 LEU A CD1  9  
ATOM 10953 C CD2  . LEU A 1 53 ? 8.025   9.516   -3.499  1.00 0.00 ? 53 LEU A CD2  9  
ATOM 10954 H H    . LEU A 1 53 ? 4.503   13.019  -2.598  1.00 0.00 ? 53 LEU A H    9  
ATOM 10955 H HA   . LEU A 1 53 ? 6.429   11.538  -4.132  1.00 0.00 ? 53 LEU A HA   9  
ATOM 10956 H HB3  . LEU A 1 53 ? 5.381   9.405   -2.885  1.00 0.00 ? 53 LEU A HB3  9  
ATOM 10957 H HG   . LEU A 1 53 ? 7.816   10.937  -1.933  1.00 0.00 ? 53 LEU A HG   9  
ATOM 10958 H HD11 . LEU A 1 53 ? 8.535   8.762   -0.955  1.00 0.00 ? 53 LEU A HD11 9  
ATOM 10959 H HD12 . LEU A 1 53 ? 7.121   9.484   -0.150  1.00 0.00 ? 53 LEU A HD12 9  
ATOM 10960 H HD13 . LEU A 1 53 ? 6.904   8.123   -1.277  1.00 0.00 ? 53 LEU A HD13 9  
ATOM 10961 H HD21 . LEU A 1 53 ? 8.182   10.354  -4.177  1.00 0.00 ? 53 LEU A HD21 9  
ATOM 10962 H HD22 . LEU A 1 53 ? 8.987   9.076   -3.236  1.00 0.00 ? 53 LEU A HD22 9  
ATOM 10963 H HD23 . LEU A 1 53 ? 7.404   8.765   -3.987  1.00 0.00 ? 53 LEU A HD23 9  
ATOM 10964 N N    . ALA A 1 54 ? 4.212   10.031  -4.867  1.00 0.00 ? 54 ALA A N    9  
ATOM 10965 C CA   . ALA A 1 54 ? 3.077   9.683   -5.705  1.00 0.00 ? 54 ALA A CA   9  
ATOM 10966 C C    . ALA A 1 54 ? 2.829   8.176   -5.620  1.00 0.00 ? 54 ALA A C    9  
ATOM 10967 O O    . ALA A 1 54 ? 3.773   7.389   -5.570  1.00 0.00 ? 54 ALA A O    9  
ATOM 10968 C CB   . ALA A 1 54 ? 3.339   10.150  -7.139  1.00 0.00 ? 54 ALA A CB   9  
ATOM 10969 H H    . ALA A 1 54 ? 4.883   9.300   -4.739  1.00 0.00 ? 54 ALA A H    9  
ATOM 10970 H HA   . ALA A 1 54 ? 2.205   10.210  -5.319  1.00 0.00 ? 54 ALA A HA   9  
ATOM 10971 H HB1  . ALA A 1 54 ? 2.403   10.150  -7.698  1.00 0.00 ? 54 ALA A HB1  9  
ATOM 10972 H HB2  . ALA A 1 54 ? 3.753   11.159  -7.123  1.00 0.00 ? 54 ALA A HB2  9  
ATOM 10973 H HB3  . ALA A 1 54 ? 4.048   9.475   -7.617  1.00 0.00 ? 54 ALA A HB3  9  
ATOM 10974 N N    . PHE A 1 55 ? 1.553   7.819   -5.605  1.00 0.00 ? 55 PHE A N    9  
ATOM 10975 C CA   . PHE A 1 55 ? 1.168   6.420   -5.527  1.00 0.00 ? 55 PHE A CA   9  
ATOM 10976 C C    . PHE A 1 55 ? 1.702   5.635   -6.726  1.00 0.00 ? 55 PHE A C    9  
ATOM 10977 O O    . PHE A 1 55 ? 1.308   5.889   -7.864  1.00 0.00 ? 55 PHE A O    9  
ATOM 10978 C CB   . PHE A 1 55 ? -0.361  6.375   -5.543  1.00 0.00 ? 55 PHE A CB   9  
ATOM 10979 C CG   . PHE A 1 55 ? -0.940  4.976   -5.766  1.00 0.00 ? 55 PHE A CG   9  
ATOM 10980 C CD1  . PHE A 1 55 ? -0.489  3.927   -5.026  1.00 0.00 ? 55 PHE A CD1  9  
ATOM 10981 C CD2  . PHE A 1 55 ? -1.906  4.781   -6.703  1.00 0.00 ? 55 PHE A CD2  9  
ATOM 10982 C CE1  . PHE A 1 55 ? -1.027  2.630   -5.232  1.00 0.00 ? 55 PHE A CE1  9  
ATOM 10983 C CE2  . PHE A 1 55 ? -2.443  3.483   -6.910  1.00 0.00 ? 55 PHE A CE2  9  
ATOM 10984 C CZ   . PHE A 1 55 ? -1.992  2.435   -6.171  1.00 0.00 ? 55 PHE A CZ   9  
ATOM 10985 H H    . PHE A 1 55 ? 0.791   8.465   -5.646  1.00 0.00 ? 55 PHE A H    9  
ATOM 10986 H HA   . PHE A 1 55 ? 1.600   6.017   -4.610  1.00 0.00 ? 55 PHE A HA   9  
ATOM 10987 H HB3  . PHE A 1 55 ? -0.725  7.037   -6.329  1.00 0.00 ? 55 PHE A HB3  9  
ATOM 10988 H HD1  . PHE A 1 55 ? 0.285   4.084   -4.274  1.00 0.00 ? 55 PHE A HD1  9  
ATOM 10989 H HD2  . PHE A 1 55 ? -2.266  5.622   -7.296  1.00 0.00 ? 55 PHE A HD2  9  
ATOM 10990 H HE1  . PHE A 1 55 ? -0.665  1.790   -4.640  1.00 0.00 ? 55 PHE A HE1  9  
ATOM 10991 H HE2  . PHE A 1 55 ? -3.216  3.327   -7.662  1.00 0.00 ? 55 PHE A HE2  9  
ATOM 10992 H HZ   . PHE A 1 55 ? -2.404  1.439   -6.329  1.00 0.00 ? 55 PHE A HZ   9  
ATOM 10993 N N    . ARG A 1 56 ? 2.592   4.699   -6.432  1.00 0.00 ? 56 ARG A N    9  
ATOM 10994 C CA   . ARG A 1 56 ? 3.185   3.876   -7.473  1.00 0.00 ? 56 ARG A CA   9  
ATOM 10995 C C    . ARG A 1 56 ? 3.847   2.641   -6.860  1.00 0.00 ? 56 ARG A C    9  
ATOM 10996 O O    . ARG A 1 56 ? 4.016   2.561   -5.644  1.00 0.00 ? 56 ARG A O    9  
ATOM 10997 C CB   . ARG A 1 56 ? 4.228   4.663   -8.270  1.00 0.00 ? 56 ARG A CB   9  
ATOM 10998 C CG   . ARG A 1 56 ? 4.808   5.806   -7.435  1.00 0.00 ? 56 ARG A CG   9  
ATOM 10999 C CD   . ARG A 1 56 ? 6.276   6.052   -7.789  1.00 0.00 ? 56 ARG A CD   9  
ATOM 11000 N NE   . ARG A 1 56 ? 6.372   6.776   -9.077  1.00 0.00 ? 56 ARG A NE   9  
ATOM 11001 C CZ   . ARG A 1 56 ? 7.508   6.929   -9.771  1.00 0.00 ? 56 ARG A CZ   9  
ATOM 11002 N NH1  . ARG A 1 56 ? 8.651   6.409   -9.305  1.00 0.00 ? 56 ARG A NH1  9  
ATOM 11003 N NH2  . ARG A 1 56 ? 7.500   7.601   -10.929 1.00 0.00 ? 56 ARG A NH2  9  
ATOM 11004 H H    . ARG A 1 56 ? 2.908   4.499   -5.504  1.00 0.00 ? 56 ARG A H    9  
ATOM 11005 H HA   . ARG A 1 56 ? 2.350   3.596   -8.116  1.00 0.00 ? 56 ARG A HA   9  
ATOM 11006 H HB3  . ARG A 1 56 ? 3.771   5.064   -9.175  1.00 0.00 ? 56 ARG A HB3  9  
ATOM 11007 H HG3  . ARG A 1 56 ? 4.721   5.567   -6.375  1.00 0.00 ? 56 ARG A HG3  9  
ATOM 11008 H HD3  . ARG A 1 56 ? 6.808   5.103   -7.857  1.00 0.00 ? 56 ARG A HD3  9  
ATOM 11009 H HE   . ARG A 1 56 ? 5.536   7.177   -9.452  1.00 0.00 ? 56 ARG A HE   9  
ATOM 11010 H HH11 . ARG A 1 56 ? 8.657   5.908   -8.440  1.00 0.00 ? 56 ARG A HH11 9  
ATOM 11011 H HH12 . ARG A 1 56 ? 9.500   6.523   -9.823  1.00 0.00 ? 56 ARG A HH12 9  
ATOM 11012 H HH21 . ARG A 1 56 ? 6.646   7.989   -11.277 1.00 0.00 ? 56 ARG A HH21 9  
ATOM 11013 H HH22 . ARG A 1 56 ? 8.348   7.715   -11.447 1.00 0.00 ? 56 ARG A HH22 9  
ATOM 11014 N N    . ARG A 1 57 ? 4.205   1.707   -7.730  1.00 0.00 ? 57 ARG A N    9  
ATOM 11015 C CA   . ARG A 1 57 ? 4.845   0.480   -7.290  1.00 0.00 ? 57 ARG A CA   9  
ATOM 11016 C C    . ARG A 1 57 ? 5.922   0.786   -6.248  1.00 0.00 ? 57 ARG A C    9  
ATOM 11017 O O    . ARG A 1 57 ? 6.514   1.864   -6.261  1.00 0.00 ? 57 ARG A O    9  
ATOM 11018 C CB   . ARG A 1 57 ? 5.481   -0.262  -8.466  1.00 0.00 ? 57 ARG A CB   9  
ATOM 11019 C CG   . ARG A 1 57 ? 4.762   -1.587  -8.732  1.00 0.00 ? 57 ARG A CG   9  
ATOM 11020 C CD   . ARG A 1 57 ? 4.896   -1.999  -10.199 1.00 0.00 ? 57 ARG A CD   9  
ATOM 11021 N NE   . ARG A 1 57 ? 4.796   -3.470  -10.323 1.00 0.00 ? 57 ARG A NE   9  
ATOM 11022 C CZ   . ARG A 1 57 ? 4.759   -4.125  -11.492 1.00 0.00 ? 57 ARG A CZ   9  
ATOM 11023 N NH1  . ARG A 1 57 ? 4.813   -3.443  -12.644 1.00 0.00 ? 57 ARG A NH1  9  
ATOM 11024 N NH2  . ARG A 1 57 ? 4.667   -5.462  -11.509 1.00 0.00 ? 57 ARG A NH2  9  
ATOM 11025 H H    . ARG A 1 57 ? 4.064   1.780   -8.718  1.00 0.00 ? 57 ARG A H    9  
ATOM 11026 H HA   . ARG A 1 57 ? 4.040   -0.115  -6.858  1.00 0.00 ? 57 ARG A HA   9  
ATOM 11027 H HB3  . ARG A 1 57 ? 6.534   -0.451  -8.256  1.00 0.00 ? 57 ARG A HB3  9  
ATOM 11028 H HG3  . ARG A 1 57 ? 3.708   -1.492  -8.472  1.00 0.00 ? 57 ARG A HG3  9  
ATOM 11029 H HD3  . ARG A 1 57 ? 5.851   -1.656  -10.597 1.00 0.00 ? 57 ARG A HD3  9  
ATOM 11030 H HE   . ARG A 1 57 ? 4.754   -4.010  -9.483  1.00 0.00 ? 57 ARG A HE   9  
ATOM 11031 H HH11 . ARG A 1 57 ? 4.880   -2.445  -12.631 1.00 0.00 ? 57 ARG A HH11 9  
ATOM 11032 H HH12 . ARG A 1 57 ? 4.785   -3.931  -13.516 1.00 0.00 ? 57 ARG A HH12 9  
ATOM 11033 H HH21 . ARG A 1 57 ? 4.627   -5.971  -10.649 1.00 0.00 ? 57 ARG A HH21 9  
ATOM 11034 H HH22 . ARG A 1 57 ? 4.640   -5.950  -12.380 1.00 0.00 ? 57 ARG A HH22 9  
ATOM 11035 N N    . PRO A 1 58 ? 6.148   -0.206  -5.345  1.00 0.00 ? 58 PRO A N    9  
ATOM 11036 C CA   . PRO A 1 58 ? 7.143   -0.052  -4.298  1.00 0.00 ? 58 PRO A CA   9  
ATOM 11037 C C    . PRO A 1 58 ? 8.559   -0.194  -4.861  1.00 0.00 ? 58 PRO A C    9  
ATOM 11038 O O    . PRO A 1 58 ? 9.530   0.198   -4.216  1.00 0.00 ? 58 PRO A O    9  
ATOM 11039 C CB   . PRO A 1 58 ? 6.803   -1.120  -3.271  1.00 0.00 ? 58 PRO A CB   9  
ATOM 11040 C CG   . PRO A 1 58 ? 5.924   -2.128  -3.995  1.00 0.00 ? 58 PRO A CG   9  
ATOM 11041 C CD   . PRO A 1 58 ? 5.465   -1.495  -5.299  1.00 0.00 ? 58 PRO A CD   9  
ATOM 11042 H HA   . PRO A 1 58 ? 7.096   0.868   -3.906  1.00 0.00 ? 58 PRO A HA   9  
ATOM 11043 H HB3  . PRO A 1 58 ? 6.281   -0.688  -2.417  1.00 0.00 ? 58 PRO A HB3  9  
ATOM 11044 H HG3  . PRO A 1 58 ? 5.066   -2.398  -3.378  1.00 0.00 ? 58 PRO A HG3  9  
ATOM 11045 H HD3  . PRO A 1 58 ? 4.383   -1.371  -5.319  1.00 0.00 ? 58 PRO A HD3  9  
ATOM 11046 N N    . ALA A 1 59 ? 8.631   -0.756  -6.059  1.00 0.00 ? 59 ALA A N    9  
ATOM 11047 C CA   . ALA A 1 59 ? 9.911   -0.955  -6.717  1.00 0.00 ? 59 ALA A CA   9  
ATOM 11048 C C    . ALA A 1 59 ? 10.245  0.280   -7.557  1.00 0.00 ? 59 ALA A C    9  
ATOM 11049 O O    . ALA A 1 59 ? 11.398  0.485   -7.936  1.00 0.00 ? 59 ALA A O    9  
ATOM 11050 C CB   . ALA A 1 59 ? 9.862   -2.233  -7.555  1.00 0.00 ? 59 ALA A CB   9  
ATOM 11051 H H    . ALA A 1 59 ? 7.836   -1.071  -6.578  1.00 0.00 ? 59 ALA A H    9  
ATOM 11052 H HA   . ALA A 1 59 ? 10.668  -1.071  -5.941  1.00 0.00 ? 59 ALA A HA   9  
ATOM 11053 H HB1  . ALA A 1 59 ? 9.110   -2.128  -8.336  1.00 0.00 ? 59 ALA A HB1  9  
ATOM 11054 H HB2  . ALA A 1 59 ? 10.837  -2.407  -8.010  1.00 0.00 ? 59 ALA A HB2  9  
ATOM 11055 H HB3  . ALA A 1 59 ? 9.604   -3.077  -6.914  1.00 0.00 ? 59 ALA A HB3  9  
ATOM 11056 N N    . GLU A 1 60 ? 9.216   1.071   -7.823  1.00 0.00 ? 60 GLU A N    9  
ATOM 11057 C CA   . GLU A 1 60 ? 9.386   2.280   -8.612  1.00 0.00 ? 60 GLU A CA   9  
ATOM 11058 C C    . GLU A 1 60 ? 9.759   3.456   -7.706  1.00 0.00 ? 60 GLU A C    9  
ATOM 11059 O O    . GLU A 1 60 ? 10.260  4.474   -8.181  1.00 0.00 ? 60 GLU A O    9  
ATOM 11060 C CB   . GLU A 1 60 ? 8.125   2.589   -9.420  1.00 0.00 ? 60 GLU A CB   9  
ATOM 11061 C CG   . GLU A 1 60 ? 7.928   1.568   -10.543 1.00 0.00 ? 60 GLU A CG   9  
ATOM 11062 C CD   . GLU A 1 60 ? 8.007   2.241   -11.915 1.00 0.00 ? 60 GLU A CD   9  
ATOM 11063 O OE1  . GLU A 1 60 ? 7.123   3.080   -12.187 1.00 0.00 ? 60 GLU A OE1  9  
ATOM 11064 O OE2  . GLU A 1 60 ? 8.950   1.898   -12.661 1.00 0.00 ? 60 GLU A OE2  9  
ATOM 11065 H H    . GLU A 1 60 ? 8.282   0.898   -7.511  1.00 0.00 ? 60 GLU A H    9  
ATOM 11066 H HA   . GLU A 1 60 ? 10.206  2.067   -9.297  1.00 0.00 ? 60 GLU A HA   9  
ATOM 11067 H HB3  . GLU A 1 60 ? 8.196   3.591   -9.843  1.00 0.00 ? 60 GLU A HB3  9  
ATOM 11068 H HG3  . GLU A 1 60 ? 6.961   1.078   -10.429 1.00 0.00 ? 60 GLU A HG3  9  
ATOM 11069 N N    . TYR A 1 61 ? 9.500   3.276   -6.420  1.00 0.00 ? 61 TYR A N    9  
ATOM 11070 C CA   . TYR A 1 61 ? 9.802   4.310   -5.444  1.00 0.00 ? 61 TYR A CA   9  
ATOM 11071 C C    . TYR A 1 61 ? 11.310  4.413   -5.204  1.00 0.00 ? 61 TYR A C    9  
ATOM 11072 O O    . TYR A 1 61 ? 12.068  3.528   -5.599  1.00 0.00 ? 61 TYR A O    9  
ATOM 11073 C CB   . TYR A 1 61 ? 9.120   3.876   -4.146  1.00 0.00 ? 61 TYR A CB   9  
ATOM 11074 C CG   . TYR A 1 61 ? 7.730   4.483   -3.940  1.00 0.00 ? 61 TYR A CG   9  
ATOM 11075 C CD1  . TYR A 1 61 ? 7.495   5.800   -4.282  1.00 0.00 ? 61 TYR A CD1  9  
ATOM 11076 C CD2  . TYR A 1 61 ? 6.712   3.715   -3.413  1.00 0.00 ? 61 TYR A CD2  9  
ATOM 11077 C CE1  . TYR A 1 61 ? 6.188   6.371   -4.089  1.00 0.00 ? 61 TYR A CE1  9  
ATOM 11078 C CE2  . TYR A 1 61 ? 5.405   4.286   -3.220  1.00 0.00 ? 61 TYR A CE2  9  
ATOM 11079 C CZ   . TYR A 1 61 ? 5.207   5.586   -3.568  1.00 0.00 ? 61 TYR A CZ   9  
ATOM 11080 O OH   . TYR A 1 61 ? 3.971   6.126   -3.385  1.00 0.00 ? 61 TYR A OH   9  
ATOM 11081 H H    . TYR A 1 61 ? 9.093   2.445   -6.042  1.00 0.00 ? 61 TYR A H    9  
ATOM 11082 H HA   . TYR A 1 61 ? 9.439   5.259   -5.837  1.00 0.00 ? 61 TYR A HA   9  
ATOM 11083 H HB3  . TYR A 1 61 ? 9.754   4.154   -3.303  1.00 0.00 ? 61 TYR A HB3  9  
ATOM 11084 H HD1  . TYR A 1 61 ? 8.300   6.406   -4.699  1.00 0.00 ? 61 TYR A HD1  9  
ATOM 11085 H HD2  . TYR A 1 61 ? 6.899   2.675   -3.142  1.00 0.00 ? 61 TYR A HD2  9  
ATOM 11086 H HE1  . TYR A 1 61 ? 5.988   7.409   -4.356  1.00 0.00 ? 61 TYR A HE1  9  
ATOM 11087 H HE2  . TYR A 1 61 ? 4.592   3.691   -2.805  1.00 0.00 ? 61 TYR A HE2  9  
ATOM 11088 H HH   . TYR A 1 61 ? 3.948   7.055   -3.751  1.00 0.00 ? 61 TYR A HH   9  
ATOM 11089 N N    . ASP A 1 62 ? 11.701  5.501   -4.557  1.00 0.00 ? 62 ASP A N    9  
ATOM 11090 C CA   . ASP A 1 62 ? 13.105  5.731   -4.260  1.00 0.00 ? 62 ASP A CA   9  
ATOM 11091 C C    . ASP A 1 62 ? 13.472  5.006   -2.964  1.00 0.00 ? 62 ASP A C    9  
ATOM 11092 O O    . ASP A 1 62 ? 12.633  4.337   -2.363  1.00 0.00 ? 62 ASP A O    9  
ATOM 11093 C CB   . ASP A 1 62 ? 13.389  7.222   -4.064  1.00 0.00 ? 62 ASP A CB   9  
ATOM 11094 C CG   . ASP A 1 62 ? 12.256  8.157   -4.491  1.00 0.00 ? 62 ASP A CG   9  
ATOM 11095 O OD1  . ASP A 1 62 ? 12.235  8.513   -5.689  1.00 0.00 ? 62 ASP A OD1  9  
ATOM 11096 O OD2  . ASP A 1 62 ? 11.437  8.496   -3.609  1.00 0.00 ? 62 ASP A OD2  9  
ATOM 11097 H H    . ASP A 1 62 ? 11.078  6.216   -4.239  1.00 0.00 ? 62 ASP A H    9  
ATOM 11098 H HA   . ASP A 1 62 ? 13.647  5.344   -5.123  1.00 0.00 ? 62 ASP A HA   9  
ATOM 11099 H HB3  . ASP A 1 62 ? 14.286  7.482   -4.626  1.00 0.00 ? 62 ASP A HB3  9  
ATOM 11100 N N    . PRO A 1 63 ? 14.761  5.168   -2.560  1.00 0.00 ? 63 PRO A N    9  
ATOM 11101 C CA   . PRO A 1 63 ? 15.250  4.537   -1.346  1.00 0.00 ? 63 PRO A CA   9  
ATOM 11102 C C    . PRO A 1 63 ? 14.733  5.263   -0.104  1.00 0.00 ? 63 PRO A C    9  
ATOM 11103 O O    . PRO A 1 63 ? 14.273  4.630   0.845   1.00 0.00 ? 63 PRO A O    9  
ATOM 11104 C CB   . PRO A 1 63 ? 16.765  4.571   -1.467  1.00 0.00 ? 63 PRO A CB   9  
ATOM 11105 C CG   . PRO A 1 63 ? 17.075  5.629   -2.515  1.00 0.00 ? 63 PRO A CG   9  
ATOM 11106 C CD   . PRO A 1 63 ? 15.783  5.954   -3.246  1.00 0.00 ? 63 PRO A CD   9  
ATOM 11107 H HA   . PRO A 1 63 ? 14.905  3.600   -1.279  1.00 0.00 ? 63 PRO A HA   9  
ATOM 11108 H HB3  . PRO A 1 63 ? 17.155  3.599   -1.767  1.00 0.00 ? 63 PRO A HB3  9  
ATOM 11109 H HG3  . PRO A 1 63 ? 17.828  5.265   -3.213  1.00 0.00 ? 63 PRO A HG3  9  
ATOM 11110 H HD3  . PRO A 1 63 ? 15.847  5.686   -4.300  1.00 0.00 ? 63 PRO A HD3  9  
ATOM 11111 N N    . LYS A 1 64 ? 14.826  6.585   -0.148  1.00 0.00 ? 64 LYS A N    9  
ATOM 11112 C CA   . LYS A 1 64 ? 14.373  7.404   0.963   1.00 0.00 ? 64 LYS A CA   9  
ATOM 11113 C C    . LYS A 1 64 ? 12.844  7.374   1.024   1.00 0.00 ? 64 LYS A C    9  
ATOM 11114 O O    . LYS A 1 64 ? 12.258  7.613   2.078   1.00 0.00 ? 64 LYS A O    9  
ATOM 11115 C CB   . LYS A 1 64 ? 14.956  8.815   0.860   1.00 0.00 ? 64 LYS A CB   9  
ATOM 11116 C CG   . LYS A 1 64 ? 16.384  8.860   1.407   1.00 0.00 ? 64 LYS A CG   9  
ATOM 11117 C CD   . LYS A 1 64 ? 17.396  8.468   0.330   1.00 0.00 ? 64 LYS A CD   9  
ATOM 11118 C CE   . LYS A 1 64 ? 18.647  9.346   0.406   1.00 0.00 ? 64 LYS A CE   9  
ATOM 11119 N NZ   . LYS A 1 64 ? 18.502  10.535  -0.463  1.00 0.00 ? 64 LYS A NZ   9  
ATOM 11120 H H    . LYS A 1 64 ? 15.202  7.093   -0.923  1.00 0.00 ? 64 LYS A H    9  
ATOM 11121 H HA   . LYS A 1 64 ? 14.764  6.961   1.878   1.00 0.00 ? 64 LYS A HA   9  
ATOM 11122 H HB3  . LYS A 1 64 ? 14.328  9.514   1.413   1.00 0.00 ? 64 LYS A HB3  9  
ATOM 11123 H HG3  . LYS A 1 64 ? 16.473  8.185   2.257   1.00 0.00 ? 64 LYS A HG3  9  
ATOM 11124 H HD3  . LYS A 1 64 ? 16.941  8.566   -0.656  1.00 0.00 ? 64 LYS A HD3  9  
ATOM 11125 H HE3  . LYS A 1 64 ? 19.522  8.772   0.104   1.00 0.00 ? 64 LYS A HE3  9  
ATOM 11126 H HZ1  . LYS A 1 64 ? 18.609  11.364  0.085   1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 11127 H HZ2  . LYS A 1 64 ? 19.203  10.514  -1.176  1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 11128 H HZ3  . LYS A 1 64 ? 17.595  10.529  -0.885  1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 11129 N N    . ALA A 1 65 ? 12.244  7.077   -0.118  1.00 0.00 ? 65 ALA A N    9  
ATOM 11130 C CA   . ALA A 1 65 ? 10.796  7.012   -0.208  1.00 0.00 ? 65 ALA A CA   9  
ATOM 11131 C C    . ALA A 1 65 ? 10.288  5.845   0.642   1.00 0.00 ? 65 ALA A C    9  
ATOM 11132 O O    . ALA A 1 65 ? 9.451   6.032   1.522   1.00 0.00 ? 65 ALA A O    9  
ATOM 11133 C CB   . ALA A 1 65 ? 10.379  6.889   -1.676  1.00 0.00 ? 65 ALA A CB   9  
ATOM 11134 H H    . ALA A 1 65 ? 12.729  6.885   -0.972  1.00 0.00 ? 65 ALA A H    9  
ATOM 11135 H HA   . ALA A 1 65 ? 10.396  7.944   0.193   1.00 0.00 ? 65 ALA A HA   9  
ATOM 11136 H HB1  . ALA A 1 65 ? 11.256  6.670   -2.285  1.00 0.00 ? 65 ALA A HB1  9  
ATOM 11137 H HB2  . ALA A 1 65 ? 9.653   6.083   -1.781  1.00 0.00 ? 65 ALA A HB2  9  
ATOM 11138 H HB3  . ALA A 1 65 ? 9.932   7.827   -2.006  1.00 0.00 ? 65 ALA A HB3  9  
ATOM 11139 N N    . LEU A 1 66 ? 10.817  4.667   0.347   1.00 0.00 ? 66 LEU A N    9  
ATOM 11140 C CA   . LEU A 1 66 ? 10.429  3.469   1.073   1.00 0.00 ? 66 LEU A CA   9  
ATOM 11141 C C    . LEU A 1 66 ? 10.565  3.723   2.575   1.00 0.00 ? 66 LEU A C    9  
ATOM 11142 O O    . LEU A 1 66 ? 9.691   3.343   3.354   1.00 0.00 ? 66 LEU A O    9  
ATOM 11143 C CB   . LEU A 1 66 ? 11.227  2.261   0.579   1.00 0.00 ? 66 LEU A CB   9  
ATOM 11144 C CG   . LEU A 1 66 ? 11.111  1.945   -0.913  1.00 0.00 ? 66 LEU A CG   9  
ATOM 11145 C CD1  . LEU A 1 66 ? 12.122  0.874   -1.328  1.00 0.00 ? 66 LEU A CD1  9  
ATOM 11146 C CD2  . LEU A 1 66 ? 9.679   1.554   -1.282  1.00 0.00 ? 66 LEU A CD2  9  
ATOM 11147 H H    . LEU A 1 66 ? 11.499  4.523   -0.372  1.00 0.00 ? 66 LEU A H    9  
ATOM 11148 H HA   . LEU A 1 66 ? 9.380   3.277   0.849   1.00 0.00 ? 66 LEU A HA   9  
ATOM 11149 H HB3  . LEU A 1 66 ? 10.906  1.384   1.142   1.00 0.00 ? 66 LEU A HB3  9  
ATOM 11150 H HG   . LEU A 1 66 ? 11.353  2.848   -1.473  1.00 0.00 ? 66 LEU A HG   9  
ATOM 11151 H HD11 . LEU A 1 66 ? 12.165  0.100   -0.562  1.00 0.00 ? 66 LEU A HD11 9  
ATOM 11152 H HD12 . LEU A 1 66 ? 11.815  0.431   -2.275  1.00 0.00 ? 66 LEU A HD12 9  
ATOM 11153 H HD13 . LEU A 1 66 ? 13.106  1.329   -1.442  1.00 0.00 ? 66 LEU A HD13 9  
ATOM 11154 H HD21 . LEU A 1 66 ? 9.670   0.541   -1.683  1.00 0.00 ? 66 LEU A HD21 9  
ATOM 11155 H HD22 . LEU A 1 66 ? 9.050   1.599   -0.392  1.00 0.00 ? 66 LEU A HD22 9  
ATOM 11156 H HD23 . LEU A 1 66 ? 9.295   2.246   -2.034  1.00 0.00 ? 66 LEU A HD23 9  
ATOM 11157 N N    . MET A 1 67 ? 11.667  4.362   2.938   1.00 0.00 ? 67 MET A N    9  
ATOM 11158 C CA   . MET A 1 67 ? 11.928  4.672   4.334   1.00 0.00 ? 67 MET A CA   9  
ATOM 11159 C C    . MET A 1 67 ? 10.896  5.662   4.879   1.00 0.00 ? 67 MET A C    9  
ATOM 11160 O O    . MET A 1 67 ? 10.586  5.648   6.068   1.00 0.00 ? 67 MET A O    9  
ATOM 11161 C CB   . MET A 1 67 ? 13.331  5.268   4.472   1.00 0.00 ? 67 MET A CB   9  
ATOM 11162 C CG   . MET A 1 67 ? 14.384  4.166   4.596   1.00 0.00 ? 67 MET A CG   9  
ATOM 11163 S SD   . MET A 1 67 ? 16.021  4.872   4.506   1.00 0.00 ? 67 MET A SD   9  
ATOM 11164 C CE   . MET A 1 67 ? 16.356  4.659   2.766   1.00 0.00 ? 67 MET A CE   9  
ATOM 11165 H H    . MET A 1 67 ? 12.373  4.668   2.299   1.00 0.00 ? 67 MET A H    9  
ATOM 11166 H HA   . MET A 1 67 ? 11.846  3.723   4.864   1.00 0.00 ? 67 MET A HA   9  
ATOM 11167 H HB3  . MET A 1 67 ? 13.370  5.914   5.348   1.00 0.00 ? 67 MET A HB3  9  
ATOM 11168 H HG3  . MET A 1 67 ? 14.252  3.433   3.800   1.00 0.00 ? 67 MET A HG3  9  
ATOM 11169 H HE1  . MET A 1 67 ? 16.190  5.604   2.246   1.00 0.00 ? 67 MET A HE1  9  
ATOM 11170 H HE2  . MET A 1 67 ? 17.391  4.347   2.631   1.00 0.00 ? 67 MET A HE2  9  
ATOM 11171 H HE3  . MET A 1 67 ? 15.691  3.899   2.358   1.00 0.00 ? 67 MET A HE3  9  
ATOM 11172 N N    . ALA A 1 68 ? 10.397  6.499   3.982   1.00 0.00 ? 68 ALA A N    9  
ATOM 11173 C CA   . ALA A 1 68 ? 9.407   7.494   4.358   1.00 0.00 ? 68 ALA A CA   9  
ATOM 11174 C C    . ALA A 1 68 ? 8.018   6.850   4.366   1.00 0.00 ? 68 ALA A C    9  
ATOM 11175 O O    . ALA A 1 68 ? 7.131   7.291   5.094   1.00 0.00 ? 68 ALA A O    9  
ATOM 11176 C CB   . ALA A 1 68 ? 9.490   8.685   3.400   1.00 0.00 ? 68 ALA A CB   9  
ATOM 11177 H H    . ALA A 1 68 ? 10.655  6.504   3.015   1.00 0.00 ? 68 ALA A H    9  
ATOM 11178 H HA   . ALA A 1 68 ? 9.645   7.837   5.364   1.00 0.00 ? 68 ALA A HA   9  
ATOM 11179 H HB1  . ALA A 1 68 ? 8.501   9.127   3.282   1.00 0.00 ? 68 ALA A HB1  9  
ATOM 11180 H HB2  . ALA A 1 68 ? 10.175  9.430   3.805   1.00 0.00 ? 68 ALA A HB2  9  
ATOM 11181 H HB3  . ALA A 1 68 ? 9.856   8.346   2.430   1.00 0.00 ? 68 ALA A HB3  9  
ATOM 11182 N N    . ILE A 1 69 ? 7.876   5.818   3.549   1.00 0.00 ? 69 ILE A N    9  
ATOM 11183 C CA   . ILE A 1 69 ? 6.611   5.108   3.453   1.00 0.00 ? 69 ILE A CA   9  
ATOM 11184 C C    . ILE A 1 69 ? 6.379   4.314   4.740   1.00 0.00 ? 69 ILE A C    9  
ATOM 11185 O O    . ILE A 1 69 ? 5.279   4.328   5.291   1.00 0.00 ? 69 ILE A O    9  
ATOM 11186 C CB   . ILE A 1 69 ? 6.572   4.251   2.186   1.00 0.00 ? 69 ILE A CB   9  
ATOM 11187 C CG1  . ILE A 1 69 ? 6.660   5.122   0.931   1.00 0.00 ? 69 ILE A CG1  9  
ATOM 11188 C CG2  . ILE A 1 69 ? 5.337   3.349   2.172   1.00 0.00 ? 69 ILE A CG2  9  
ATOM 11189 C CD1  . ILE A 1 69 ? 7.389   4.389   -0.196  1.00 0.00 ? 69 ILE A CD1  9  
ATOM 11190 H H    . ILE A 1 69 ? 8.603   5.466   2.959   1.00 0.00 ? 69 ILE A H    9  
ATOM 11191 H HA   . ILE A 1 69 ? 5.824   5.856   3.360   1.00 0.00 ? 69 ILE A HA   9  
ATOM 11192 H HB   . ILE A 1 69 ? 7.446   3.600   2.187   1.00 0.00 ? 69 ILE A HB   9  
ATOM 11193 H HG13 . ILE A 1 69 ? 7.183   6.050   1.164   1.00 0.00 ? 69 ILE A HG13 9  
ATOM 11194 H HG21 . ILE A 1 69 ? 4.458   3.940   1.915   1.00 0.00 ? 69 ILE A HG21 9  
ATOM 11195 H HG22 . ILE A 1 69 ? 5.473   2.559   1.433   1.00 0.00 ? 69 ILE A HG22 9  
ATOM 11196 H HG23 . ILE A 1 69 ? 5.201   2.904   3.158   1.00 0.00 ? 69 ILE A HG23 9  
ATOM 11197 H HD11 . ILE A 1 69 ? 6.797   4.448   -1.110  1.00 0.00 ? 69 ILE A HD11 9  
ATOM 11198 H HD12 . ILE A 1 69 ? 8.361   4.852   -0.363  1.00 0.00 ? 69 ILE A HD12 9  
ATOM 11199 H HD13 . ILE A 1 69 ? 7.526   3.343   0.080   1.00 0.00 ? 69 ILE A HD13 9  
ATOM 11200 N N    . LEU A 1 70 ? 7.431   3.642   5.181   1.00 0.00 ? 70 LEU A N    9  
ATOM 11201 C CA   . LEU A 1 70 ? 7.354   2.844   6.393   1.00 0.00 ? 70 LEU A CA   9  
ATOM 11202 C C    . LEU A 1 70 ? 7.049   3.757   7.582   1.00 0.00 ? 70 LEU A C    9  
ATOM 11203 O O    . LEU A 1 70 ? 6.303   3.380   8.484   1.00 0.00 ? 70 LEU A O    9  
ATOM 11204 C CB   . LEU A 1 70 ? 8.627   2.011   6.567   1.00 0.00 ? 70 LEU A CB   9  
ATOM 11205 C CG   . LEU A 1 70 ? 9.076   1.208   5.345   1.00 0.00 ? 70 LEU A CG   9  
ATOM 11206 C CD1  . LEU A 1 70 ? 10.602  1.144   5.261   1.00 0.00 ? 70 LEU A CD1  9  
ATOM 11207 C CD2  . LEU A 1 70 ? 8.442   -0.185  5.342   1.00 0.00 ? 70 LEU A CD2  9  
ATOM 11208 H H    . LEU A 1 70 ? 8.322   3.637   4.727   1.00 0.00 ? 70 LEU A H    9  
ATOM 11209 H HA   . LEU A 1 70 ? 6.527   2.145   6.272   1.00 0.00 ? 70 LEU A HA   9  
ATOM 11210 H HB3  . LEU A 1 70 ? 8.474   1.320   7.396   1.00 0.00 ? 70 LEU A HB3  9  
ATOM 11211 H HG   . LEU A 1 70 ? 8.725   1.722   4.451   1.00 0.00 ? 70 LEU A HG   9  
ATOM 11212 H HD11 . LEU A 1 70 ? 10.909  0.136   4.983   1.00 0.00 ? 70 LEU A HD11 9  
ATOM 11213 H HD12 . LEU A 1 70 ? 10.954  1.852   4.511   1.00 0.00 ? 70 LEU A HD12 9  
ATOM 11214 H HD13 . LEU A 1 70 ? 11.029  1.399   6.231   1.00 0.00 ? 70 LEU A HD13 9  
ATOM 11215 H HD21 . LEU A 1 70 ? 7.421   -0.120  5.716   1.00 0.00 ? 70 LEU A HD21 9  
ATOM 11216 H HD22 . LEU A 1 70 ? 8.433   -0.578  4.325   1.00 0.00 ? 70 LEU A HD22 9  
ATOM 11217 H HD23 . LEU A 1 70 ? 9.022   -0.849  5.982   1.00 0.00 ? 70 LEU A HD23 9  
ATOM 11218 N N    . GLU A 1 71 ? 7.642   4.941   7.545   1.00 0.00 ? 71 GLU A N    9  
ATOM 11219 C CA   . GLU A 1 71 ? 7.443   5.912   8.607   1.00 0.00 ? 71 GLU A CA   9  
ATOM 11220 C C    . GLU A 1 71 ? 6.047   6.530   8.508   1.00 0.00 ? 71 GLU A C    9  
ATOM 11221 O O    . GLU A 1 71 ? 5.347   6.654   9.511   1.00 0.00 ? 71 GLU A O    9  
ATOM 11222 C CB   . GLU A 1 71 ? 8.525   6.994   8.571   1.00 0.00 ? 71 GLU A CB   9  
ATOM 11223 C CG   . GLU A 1 71 ? 9.727   6.595   9.432   1.00 0.00 ? 71 GLU A CG   9  
ATOM 11224 C CD   . GLU A 1 71 ? 10.531  7.827   9.854   1.00 0.00 ? 71 GLU A CD   9  
ATOM 11225 O OE1  . GLU A 1 71 ? 11.339  8.289   9.021   1.00 0.00 ? 71 GLU A OE1  9  
ATOM 11226 O OE2  . GLU A 1 71 ? 10.318  8.277   11.000  1.00 0.00 ? 71 GLU A OE2  9  
ATOM 11227 H H    . GLU A 1 71 ? 8.248   5.241   6.806   1.00 0.00 ? 71 GLU A H    9  
ATOM 11228 H HA   . GLU A 1 71 ? 7.533   5.347   9.536   1.00 0.00 ? 71 GLU A HA   9  
ATOM 11229 H HB3  . GLU A 1 71 ? 8.113   7.937   8.931   1.00 0.00 ? 71 GLU A HB3  9  
ATOM 11230 H HG3  . GLU A 1 71 ? 10.367  5.912   8.873   1.00 0.00 ? 71 GLU A HG3  9  
ATOM 11231 N N    . HIS A 1 72 ? 5.684   6.900   7.288   1.00 0.00 ? 72 HIS A N    9  
ATOM 11232 C CA   . HIS A 1 72 ? 4.384   7.501   7.045   1.00 0.00 ? 72 HIS A CA   9  
ATOM 11233 C C    . HIS A 1 72 ? 3.306   6.414   7.055   1.00 0.00 ? 72 HIS A C    9  
ATOM 11234 O O    . HIS A 1 72 ? 2.114   6.718   7.072   1.00 0.00 ? 72 HIS A O    9  
ATOM 11235 C CB   . HIS A 1 72 ? 4.396   8.313   5.748   1.00 0.00 ? 72 HIS A CB   9  
ATOM 11236 C CG   . HIS A 1 72 ? 5.270   9.543   5.801   1.00 0.00 ? 72 HIS A CG   9  
ATOM 11237 N ND1  . HIS A 1 72 ? 4.825   10.796  5.418   1.00 0.00 ? 72 HIS A ND1  9  
ATOM 11238 C CD2  . HIS A 1 72 ? 6.565   9.699   6.198   1.00 0.00 ? 72 HIS A CD2  9  
ATOM 11239 C CE1  . HIS A 1 72 ? 5.818   11.659  5.579   1.00 0.00 ? 72 HIS A CE1  9  
ATOM 11240 N NE2  . HIS A 1 72 ? 6.895   10.977  6.063   1.00 0.00 ? 72 HIS A NE2  9  
ATOM 11241 H H    . HIS A 1 72 ? 6.259   6.794   6.478   1.00 0.00 ? 72 HIS A H    9  
ATOM 11242 H HA   . HIS A 1 72 ? 4.199   8.191   7.868   1.00 0.00 ? 72 HIS A HA   9  
ATOM 11243 H HB3  . HIS A 1 72 ? 3.375   8.615   5.512   1.00 0.00 ? 72 HIS A HB3  9  
ATOM 11244 H HD1  . HIS A 1 72 ? 3.911   11.012  5.076   1.00 0.00 ? 72 HIS A HD1  9  
ATOM 11245 H HD2  . HIS A 1 72 ? 7.219   8.907   6.565   1.00 0.00 ? 72 HIS A HD2  9  
ATOM 11246 H HE1  . HIS A 1 72 ? 5.780   12.727  5.364   1.00 0.00 ? 72 HIS A HE1  9  
ATOM 11247 N N    . SER A 1 73 ? 3.764   5.171   7.043   1.00 0.00 ? 73 SER A N    9  
ATOM 11248 C CA   . SER A 1 73 ? 2.854   4.039   7.049   1.00 0.00 ? 73 SER A CA   9  
ATOM 11249 C C    . SER A 1 73 ? 1.879   4.159   8.222   1.00 0.00 ? 73 SER A C    9  
ATOM 11250 O O    . SER A 1 73 ? 0.852   3.481   8.252   1.00 0.00 ? 73 SER A O    9  
ATOM 11251 C CB   . SER A 1 73 ? 3.620   2.717   7.131   1.00 0.00 ? 73 SER A CB   9  
ATOM 11252 O OG   . SER A 1 73 ? 3.650   2.197   8.457   1.00 0.00 ? 73 SER A OG   9  
ATOM 11253 H H    . SER A 1 73 ? 4.735   4.933   7.028   1.00 0.00 ? 73 SER A H    9  
ATOM 11254 H HA   . SER A 1 73 ? 2.320   4.092   6.100   1.00 0.00 ? 73 SER A HA   9  
ATOM 11255 H HB3  . SER A 1 73 ? 4.641   2.867   6.777   1.00 0.00 ? 73 SER A HB3  9  
ATOM 11256 H HG   . SER A 1 73 ? 3.118   1.351   8.505   1.00 0.00 ? 73 SER A HG   9  
ATOM 11257 N N    . HIS A 1 74 ? 2.232   5.028   9.158   1.00 0.00 ? 74 HIS A N    9  
ATOM 11258 C CA   . HIS A 1 74 ? 1.400   5.245   10.329  1.00 0.00 ? 74 HIS A CA   9  
ATOM 11259 C C    . HIS A 1 74 ? 0.097   5.932   9.913   1.00 0.00 ? 74 HIS A C    9  
ATOM 11260 O O    . HIS A 1 74 ? -0.886  5.906   10.652  1.00 0.00 ? 74 HIS A O    9  
ATOM 11261 C CB   . HIS A 1 74 ? 2.164   6.024   11.401  1.00 0.00 ? 74 HIS A CB   9  
ATOM 11262 C CG   . HIS A 1 74 ? 2.325   7.494   11.096  1.00 0.00 ? 74 HIS A CG   9  
ATOM 11263 N ND1  . HIS A 1 74 ? 3.518   8.042   10.655  1.00 0.00 ? 74 HIS A ND1  9  
ATOM 11264 C CD2  . HIS A 1 74 ? 1.433   8.523   11.172  1.00 0.00 ? 74 HIS A CD2  9  
ATOM 11265 C CE1  . HIS A 1 74 ? 3.339   9.343   10.476  1.00 0.00 ? 74 HIS A CE1  9  
ATOM 11266 N NE2  . HIS A 1 74 ? 2.047   9.638   10.798  1.00 0.00 ? 74 HIS A NE2  9  
ATOM 11267 H H    . HIS A 1 74 ? 3.068   5.575   9.125   1.00 0.00 ? 74 HIS A H    9  
ATOM 11268 H HA   . HIS A 1 74 ? 1.168   4.261   10.735  1.00 0.00 ? 74 HIS A HA   9  
ATOM 11269 H HB3  . HIS A 1 74 ? 3.151   5.578   11.524  1.00 0.00 ? 74 HIS A HB3  9  
ATOM 11270 H HD1  . HIS A 1 74 ? 4.368   7.541   10.497  1.00 0.00 ? 74 HIS A HD1  9  
ATOM 11271 H HD2  . HIS A 1 74 ? 0.393   8.442   11.486  1.00 0.00 ? 74 HIS A HD2  9  
ATOM 11272 H HE1  . HIS A 1 74 ? 4.092   10.052  10.133  1.00 0.00 ? 74 HIS A HE1  9  
ATOM 11273 N N    . ARG A 1 75 ? 0.133   6.531   8.732   1.00 0.00 ? 75 ARG A N    9  
ATOM 11274 C CA   . ARG A 1 75 ? -1.031  7.224   8.208   1.00 0.00 ? 75 ARG A CA   9  
ATOM 11275 C C    . ARG A 1 75 ? -1.512  6.557   6.918   1.00 0.00 ? 75 ARG A C    9  
ATOM 11276 O O    . ARG A 1 75 ? -2.701  6.583   6.607   1.00 0.00 ? 75 ARG A O    9  
ATOM 11277 C CB   . ARG A 1 75 ? -0.717  8.695   7.927   1.00 0.00 ? 75 ARG A CB   9  
ATOM 11278 C CG   . ARG A 1 75 ? 0.758   8.881   7.565   1.00 0.00 ? 75 ARG A CG   9  
ATOM 11279 C CD   . ARG A 1 75 ? 1.126   10.365  7.510   1.00 0.00 ? 75 ARG A CD   9  
ATOM 11280 N NE   . ARG A 1 75 ? 0.882   10.897  6.151   1.00 0.00 ? 75 ARG A NE   9  
ATOM 11281 C CZ   . ARG A 1 75 ? 0.828   12.203  5.853   1.00 0.00 ? 75 ARG A CZ   9  
ATOM 11282 N NH1  . ARG A 1 75 ? 1.001   13.117  6.817   1.00 0.00 ? 75 ARG A NH1  9  
ATOM 11283 N NH2  . ARG A 1 75 ? 0.603   12.594  4.591   1.00 0.00 ? 75 ARG A NH2  9  
ATOM 11284 H H    . ARG A 1 75 ? 0.937   6.548   8.138   1.00 0.00 ? 75 ARG A H    9  
ATOM 11285 H HA   . ARG A 1 75 ? -1.782  7.142   8.995   1.00 0.00 ? 75 ARG A HA   9  
ATOM 11286 H HB3  . ARG A 1 75 ? -0.959  9.297   8.803   1.00 0.00 ? 75 ARG A HB3  9  
ATOM 11287 H HG3  . ARG A 1 75 ? 0.960   8.417   6.600   1.00 0.00 ? 75 ARG A HG3  9  
ATOM 11288 H HD3  . ARG A 1 75 ? 2.174   10.499  7.779   1.00 0.00 ? 75 ARG A HD3  9  
ATOM 11289 H HE   . ARG A 1 75 ? 0.749   10.242  5.408   1.00 0.00 ? 75 ARG A HE   9  
ATOM 11290 H HH11 . ARG A 1 75 ? 1.170   12.825  7.759   1.00 0.00 ? 75 ARG A HH11 9  
ATOM 11291 H HH12 . ARG A 1 75 ? 0.961   14.091  6.596   1.00 0.00 ? 75 ARG A HH12 9  
ATOM 11292 H HH21 . ARG A 1 75 ? 0.474   11.911  3.872   1.00 0.00 ? 75 ARG A HH21 9  
ATOM 11293 H HH22 . ARG A 1 75 ? 0.563   13.568  4.369   1.00 0.00 ? 75 ARG A HH22 9  
ATOM 11294 N N    . ILE A 1 76 ? -0.561  5.975   6.202   1.00 0.00 ? 76 ILE A N    9  
ATOM 11295 C CA   . ILE A 1 76 ? -0.872  5.301   4.953   1.00 0.00 ? 76 ILE A CA   9  
ATOM 11296 C C    . ILE A 1 76 ? -2.179  4.520   5.111   1.00 0.00 ? 76 ILE A C    9  
ATOM 11297 O O    . ILE A 1 76 ? -2.235  3.540   5.852   1.00 0.00 ? 76 ILE A O    9  
ATOM 11298 C CB   . ILE A 1 76 ? 0.308   4.438   4.501   1.00 0.00 ? 76 ILE A CB   9  
ATOM 11299 C CG1  . ILE A 1 76 ? 1.534   5.303   4.196   1.00 0.00 ? 76 ILE A CG1  9  
ATOM 11300 C CG2  . ILE A 1 76 ? -0.081  3.555   3.314   1.00 0.00 ? 76 ILE A CG2  9  
ATOM 11301 C CD1  . ILE A 1 76 ? 2.641   4.473   3.543   1.00 0.00 ? 76 ILE A CD1  9  
ATOM 11302 H H    . ILE A 1 76 ? 0.404   5.958   6.463   1.00 0.00 ? 76 ILE A H    9  
ATOM 11303 H HA   . ILE A 1 76 ? -1.019  6.070   4.195   1.00 0.00 ? 76 ILE A HA   9  
ATOM 11304 H HB   . ILE A 1 76 ? 0.579   3.774   5.321   1.00 0.00 ? 76 ILE A HB   9  
ATOM 11305 H HG13 . ILE A 1 76 ? 1.905   5.751   5.117   1.00 0.00 ? 76 ILE A HG13 9  
ATOM 11306 H HG21 . ILE A 1 76 ? 0.502   2.635   3.339   1.00 0.00 ? 76 ILE A HG21 9  
ATOM 11307 H HG22 . ILE A 1 76 ? -1.142  3.315   3.372   1.00 0.00 ? 76 ILE A HG22 9  
ATOM 11308 H HG23 . ILE A 1 76 ? 0.121   4.087   2.384   1.00 0.00 ? 76 ILE A HG23 9  
ATOM 11309 H HD11 . ILE A 1 76 ? 2.232   3.927   2.693   1.00 0.00 ? 76 ILE A HD11 9  
ATOM 11310 H HD12 . ILE A 1 76 ? 3.437   5.134   3.200   1.00 0.00 ? 76 ILE A HD12 9  
ATOM 11311 H HD13 . ILE A 1 76 ? 3.042   3.767   4.269   1.00 0.00 ? 76 ILE A HD13 9  
ATOM 11312 N N    . ARG A 1 77 ? -3.197  4.985   4.402   1.00 0.00 ? 77 ARG A N    9  
ATOM 11313 C CA   . ARG A 1 77 ? -4.500  4.343   4.454   1.00 0.00 ? 77 ARG A CA   9  
ATOM 11314 C C    . ARG A 1 77 ? -5.061  4.165   3.042   1.00 0.00 ? 77 ARG A C    9  
ATOM 11315 O O    . ARG A 1 77 ? -4.901  5.040   2.191   1.00 0.00 ? 77 ARG A O    9  
ATOM 11316 C CB   . ARG A 1 77 ? -5.486  5.164   5.287   1.00 0.00 ? 77 ARG A CB   9  
ATOM 11317 C CG   . ARG A 1 77 ? -5.766  4.488   6.630   1.00 0.00 ? 77 ARG A CG   9  
ATOM 11318 C CD   . ARG A 1 77 ? -6.902  3.470   6.503   1.00 0.00 ? 77 ARG A CD   9  
ATOM 11319 N NE   . ARG A 1 77 ? -7.749  3.505   7.717   1.00 0.00 ? 77 ARG A NE   9  
ATOM 11320 C CZ   . ARG A 1 77 ? -8.896  2.824   7.852   1.00 0.00 ? 77 ARG A CZ   9  
ATOM 11321 N NH1  . ARG A 1 77 ? -9.340  2.053   6.851   1.00 0.00 ? 77 ARG A NH1  9  
ATOM 11322 N NH2  . ARG A 1 77 ? -9.599  2.916   8.989   1.00 0.00 ? 77 ARG A NH2  9  
ATOM 11323 H H    . ARG A 1 77 ? -3.143  5.783   3.802   1.00 0.00 ? 77 ARG A H    9  
ATOM 11324 H HA   . ARG A 1 77 ? -4.316  3.379   4.927   1.00 0.00 ? 77 ARG A HA   9  
ATOM 11325 H HB3  . ARG A 1 77 ? -6.418  5.288   4.736   1.00 0.00 ? 77 ARG A HB3  9  
ATOM 11326 H HG3  . ARG A 1 77 ? -6.028  5.240   7.373   1.00 0.00 ? 77 ARG A HG3  9  
ATOM 11327 H HD3  . ARG A 1 77 ? -6.492  2.470   6.365   1.00 0.00 ? 77 ARG A HD3  9  
ATOM 11328 H HE   . ARG A 1 77 ? -7.447  4.071   8.484   1.00 0.00 ? 77 ARG A HE   9  
ATOM 11329 H HH11 . ARG A 1 77 ? -8.815  1.985   6.002   1.00 0.00 ? 77 ARG A HH11 9  
ATOM 11330 H HH12 . ARG A 1 77 ? -10.196 1.546   6.951   1.00 0.00 ? 77 ARG A HH12 9  
ATOM 11331 H HH21 . ARG A 1 77 ? -9.268  3.492   9.737   1.00 0.00 ? 77 ARG A HH21 9  
ATOM 11332 H HH22 . ARG A 1 77 ? -10.455 2.409   9.090   1.00 0.00 ? 77 ARG A HH22 9  
ATOM 11333 N N    . PHE A 1 78 ? -5.705  3.026   2.835   1.00 0.00 ? 78 PHE A N    9  
ATOM 11334 C CA   . PHE A 1 78 ? -6.290  2.722   1.540   1.00 0.00 ? 78 PHE A CA   9  
ATOM 11335 C C    . PHE A 1 78 ? -7.773  3.099   1.506   1.00 0.00 ? 78 PHE A C    9  
ATOM 11336 O O    . PHE A 1 78 ? -8.449  3.067   2.534   1.00 0.00 ? 78 PHE A O    9  
ATOM 11337 C CB   . PHE A 1 78 ? -6.155  1.213   1.331   1.00 0.00 ? 78 PHE A CB   9  
ATOM 11338 C CG   . PHE A 1 78 ? -4.786  0.778   0.806   1.00 0.00 ? 78 PHE A CG   9  
ATOM 11339 C CD1  . PHE A 1 78 ? -3.655  1.157   1.459   1.00 0.00 ? 78 PHE A CD1  9  
ATOM 11340 C CD2  . PHE A 1 78 ? -4.699  0.011   -0.314  1.00 0.00 ? 78 PHE A CD2  9  
ATOM 11341 C CE1  . PHE A 1 78 ? -2.384  0.754   0.973   1.00 0.00 ? 78 PHE A CE1  9  
ATOM 11342 C CE2  . PHE A 1 78 ? -3.428  -0.392  -0.802  1.00 0.00 ? 78 PHE A CE2  9  
ATOM 11343 C CZ   . PHE A 1 78 ? -2.297  -0.012  -0.148  1.00 0.00 ? 78 PHE A CZ   9  
ATOM 11344 H H    . PHE A 1 78 ? -5.831  2.320   3.531   1.00 0.00 ? 78 PHE A H    9  
ATOM 11345 H HA   . PHE A 1 78 ? -5.752  3.308   0.796   1.00 0.00 ? 78 PHE A HA   9  
ATOM 11346 H HB3  . PHE A 1 78 ? -6.923  0.883   0.631   1.00 0.00 ? 78 PHE A HB3  9  
ATOM 11347 H HD1  . PHE A 1 78 ? -3.724  1.771   2.358   1.00 0.00 ? 78 PHE A HD1  9  
ATOM 11348 H HD2  . PHE A 1 78 ? -5.605  -0.293  -0.838  1.00 0.00 ? 78 PHE A HD2  9  
ATOM 11349 H HE1  . PHE A 1 78 ? -1.478  1.057   1.496   1.00 0.00 ? 78 PHE A HE1  9  
ATOM 11350 H HE2  . PHE A 1 78 ? -3.358  -1.006  -1.699  1.00 0.00 ? 78 PHE A HE2  9  
ATOM 11351 H HZ   . PHE A 1 78 ? -1.321  -0.323  -0.522  1.00 0.00 ? 78 PHE A HZ   9  
ATOM 11352 N N    . LYS A 1 79 ? -8.235  3.446   0.314   1.00 0.00 ? 79 LYS A N    9  
ATOM 11353 C CA   . LYS A 1 79 ? -9.626  3.828   0.133   1.00 0.00 ? 79 LYS A CA   9  
ATOM 11354 C C    . LYS A 1 79 ? -10.180 3.142   -1.117  1.00 0.00 ? 79 LYS A C    9  
ATOM 11355 O O    . LYS A 1 79 ? -9.714  3.396   -2.226  1.00 0.00 ? 79 LYS A O    9  
ATOM 11356 C CB   . LYS A 1 79 ? -9.765  5.352   0.111   1.00 0.00 ? 79 LYS A CB   9  
ATOM 11357 C CG   . LYS A 1 79 ? -9.930  5.908   1.527   1.00 0.00 ? 79 LYS A CG   9  
ATOM 11358 C CD   . LYS A 1 79 ? -11.407 5.982   1.919   1.00 0.00 ? 79 LYS A CD   9  
ATOM 11359 C CE   . LYS A 1 79 ? -12.069 7.230   1.332   1.00 0.00 ? 79 LYS A CE   9  
ATOM 11360 N NZ   . LYS A 1 79 ? -13.445 6.924   0.882   1.00 0.00 ? 79 LYS A NZ   9  
ATOM 11361 H H    . LYS A 1 79 ? -7.680  3.469   -0.516  1.00 0.00 ? 79 LYS A H    9  
ATOM 11362 H HA   . LYS A 1 79 ? -10.180 3.467   1.000   1.00 0.00 ? 79 LYS A HA   9  
ATOM 11363 H HB3  . LYS A 1 79 ? -10.624 5.634   -0.497  1.00 0.00 ? 79 LYS A HB3  9  
ATOM 11364 H HG3  . LYS A 1 79 ? -9.484  6.901   1.586   1.00 0.00 ? 79 LYS A HG3  9  
ATOM 11365 H HD3  . LYS A 1 79 ? -11.498 5.993   3.004   1.00 0.00 ? 79 LYS A HD3  9  
ATOM 11366 H HE3  . LYS A 1 79 ? -11.479 7.600   0.492   1.00 0.00 ? 79 LYS A HE3  9  
ATOM 11367 H HZ1  . LYS A 1 79 ? -13.518 7.086   -0.102  1.00 0.00 ? 79 LYS A HZ1  9  
ATOM 11368 H HZ2  . LYS A 1 79 ? -13.655 5.967   1.079   1.00 0.00 ? 79 LYS A HZ2  9  
ATOM 11369 H HZ3  . LYS A 1 79 ? -14.092 7.514   1.365   1.00 0.00 ? 79 LYS A HZ3  9  
ATOM 11370 N N    . LEU A 1 80 ? -11.168 2.287   -0.895  1.00 0.00 ? 80 LEU A N    9  
ATOM 11371 C CA   . LEU A 1 80 ? -11.790 1.562   -1.990  1.00 0.00 ? 80 LEU A CA   9  
ATOM 11372 C C    . LEU A 1 80 ? -13.064 2.292   -2.419  1.00 0.00 ? 80 LEU A C    9  
ATOM 11373 O O    . LEU A 1 80 ? -13.739 2.908   -1.595  1.00 0.00 ? 80 LEU A O    9  
ATOM 11374 C CB   . LEU A 1 80 ? -12.020 0.100   -1.602  1.00 0.00 ? 80 LEU A CB   9  
ATOM 11375 C CG   . LEU A 1 80 ? -10.813 -0.830  -1.744  1.00 0.00 ? 80 LEU A CG   9  
ATOM 11376 C CD1  . LEU A 1 80 ? -11.174 -2.262  -1.346  1.00 0.00 ? 80 LEU A CD1  9  
ATOM 11377 C CD2  . LEU A 1 80 ? -10.229 -0.757  -3.156  1.00 0.00 ? 80 LEU A CD2  9  
ATOM 11378 H H    . LEU A 1 80 ? -11.540 2.086   0.012   1.00 0.00 ? 80 LEU A H    9  
ATOM 11379 H HA   . LEU A 1 80 ? -11.091 1.568   -2.825  1.00 0.00 ? 80 LEU A HA   9  
ATOM 11380 H HB3  . LEU A 1 80 ? -12.832 -0.294  -2.214  1.00 0.00 ? 80 LEU A HB3  9  
ATOM 11381 H HG   . LEU A 1 80 ? -10.038 -0.491  -1.058  1.00 0.00 ? 80 LEU A HG   9  
ATOM 11382 H HD11 . LEU A 1 80 ? -12.161 -2.510  -1.738  1.00 0.00 ? 80 LEU A HD11 9  
ATOM 11383 H HD12 . LEU A 1 80 ? -10.436 -2.951  -1.757  1.00 0.00 ? 80 LEU A HD12 9  
ATOM 11384 H HD13 . LEU A 1 80 ? -11.184 -2.345  -0.259  1.00 0.00 ? 80 LEU A HD13 9  
ATOM 11385 H HD21 . LEU A 1 80 ? -10.908 -0.200  -3.802  1.00 0.00 ? 80 LEU A HD21 9  
ATOM 11386 H HD22 . LEU A 1 80 ? -9.263  -0.253  -3.125  1.00 0.00 ? 80 LEU A HD22 9  
ATOM 11387 H HD23 . LEU A 1 80 ? -10.100 -1.766  -3.548  1.00 0.00 ? 80 LEU A HD23 9  
ATOM 11388 N N    . LYS A 1 81 ? -13.355 2.199   -3.708  1.00 0.00 ? 81 LYS A N    9  
ATOM 11389 C CA   . LYS A 1 81 ? -14.536 2.843   -4.257  1.00 0.00 ? 81 LYS A CA   9  
ATOM 11390 C C    . LYS A 1 81 ? -15.766 2.413   -3.455  1.00 0.00 ? 81 LYS A C    9  
ATOM 11391 O O    . LYS A 1 81 ? -15.704 1.459   -2.681  1.00 0.00 ? 81 LYS A O    9  
ATOM 11392 C CB   . LYS A 1 81 ? -14.651 2.562   -5.757  1.00 0.00 ? 81 LYS A CB   9  
ATOM 11393 C CG   . LYS A 1 81 ? -15.068 3.822   -6.520  1.00 0.00 ? 81 LYS A CG   9  
ATOM 11394 C CD   . LYS A 1 81 ? -15.698 3.462   -7.868  1.00 0.00 ? 81 LYS A CD   9  
ATOM 11395 C CE   . LYS A 1 81 ? -17.203 3.233   -7.726  1.00 0.00 ? 81 LYS A CE   9  
ATOM 11396 N NZ   . LYS A 1 81 ? -17.912 4.523   -7.569  1.00 0.00 ? 81 LYS A NZ   9  
ATOM 11397 H H    . LYS A 1 81 ? -12.801 1.696   -4.371  1.00 0.00 ? 81 LYS A H    9  
ATOM 11398 H HA   . LYS A 1 81 ? -14.406 3.919   -4.140  1.00 0.00 ? 81 LYS A HA   9  
ATOM 11399 H HB3  . LYS A 1 81 ? -15.382 1.772   -5.927  1.00 0.00 ? 81 LYS A HB3  9  
ATOM 11400 H HG3  . LYS A 1 81 ? -14.199 4.459   -6.679  1.00 0.00 ? 81 LYS A HG3  9  
ATOM 11401 H HD3  . LYS A 1 81 ? -15.225 2.564   -8.266  1.00 0.00 ? 81 LYS A HD3  9  
ATOM 11402 H HE3  . LYS A 1 81 ? -17.400 2.596   -6.863  1.00 0.00 ? 81 LYS A HE3  9  
ATOM 11403 H HZ1  . LYS A 1 81 ? -18.391 4.746   -8.418  1.00 0.00 ? 81 LYS A HZ1  9  
ATOM 11404 H HZ2  . LYS A 1 81 ? -18.572 4.452   -6.822  1.00 0.00 ? 81 LYS A HZ2  9  
ATOM 11405 H HZ3  . LYS A 1 81 ? -17.251 5.243   -7.360  1.00 0.00 ? 81 LYS A HZ3  9  
ATOM 11406 N N    . ARG A 1 82 ? -16.854 3.138   -3.666  1.00 0.00 ? 82 ARG A N    9  
ATOM 11407 C CA   . ARG A 1 82 ? -18.097 2.844   -2.973  1.00 0.00 ? 82 ARG A CA   9  
ATOM 11408 C C    . ARG A 1 82 ? -18.342 1.334   -2.942  1.00 0.00 ? 82 ARG A C    9  
ATOM 11409 O O    . ARG A 1 82 ? -17.969 0.621   -3.872  1.00 0.00 ? 82 ARG A O    9  
ATOM 11410 C CB   . ARG A 1 82 ? -19.283 3.533   -3.649  1.00 0.00 ? 82 ARG A CB   9  
ATOM 11411 C CG   . ARG A 1 82 ? -19.458 4.961   -3.127  1.00 0.00 ? 82 ARG A CG   9  
ATOM 11412 C CD   . ARG A 1 82 ? -20.940 5.313   -2.982  1.00 0.00 ? 82 ARG A CD   9  
ATOM 11413 N NE   . ARG A 1 82 ? -21.242 6.551   -3.736  1.00 0.00 ? 82 ARG A NE   9  
ATOM 11414 C CZ   . ARG A 1 82 ? -20.782 7.765   -3.403  1.00 0.00 ? 82 ARG A CZ   9  
ATOM 11415 N NH1  . ARG A 1 82 ? -19.997 7.911   -2.327  1.00 0.00 ? 82 ARG A NH1  9  
ATOM 11416 N NH2  . ARG A 1 82 ? -21.108 8.832   -4.146  1.00 0.00 ? 82 ARG A NH2  9  
ATOM 11417 H H    . ARG A 1 82 ? -16.896 3.913   -4.297  1.00 0.00 ? 82 ARG A H    9  
ATOM 11418 H HA   . ARG A 1 82 ? -17.954 3.238   -1.966  1.00 0.00 ? 82 ARG A HA   9  
ATOM 11419 H HB3  . ARG A 1 82 ? -20.193 2.961   -3.468  1.00 0.00 ? 82 ARG A HB3  9  
ATOM 11420 H HG3  . ARG A 1 82 ? -18.979 5.663   -3.810  1.00 0.00 ? 82 ARG A HG3  9  
ATOM 11421 H HD3  . ARG A 1 82 ? -21.189 5.449   -1.930  1.00 0.00 ? 82 ARG A HD3  9  
ATOM 11422 H HE   . ARG A 1 82 ? -21.826 6.477   -4.545  1.00 0.00 ? 82 ARG A HE   9  
ATOM 11423 H HH11 . ARG A 1 82 ? -19.753 7.115   -1.774  1.00 0.00 ? 82 ARG A HH11 9  
ATOM 11424 H HH12 . ARG A 1 82 ? -19.653 8.817   -2.079  1.00 0.00 ? 82 ARG A HH12 9  
ATOM 11425 H HH21 . ARG A 1 82 ? -21.694 8.722   -4.948  1.00 0.00 ? 82 ARG A HH21 9  
ATOM 11426 H HH22 . ARG A 1 82 ? -20.764 9.737   -3.897  1.00 0.00 ? 82 ARG A HH22 9  
ATOM 11427 N N    . PRO A 1 83 ? -18.985 0.879   -1.833  1.00 0.00 ? 83 PRO A N    9  
ATOM 11428 C CA   . PRO A 1 83 ? -19.286 -0.534  -1.670  1.00 0.00 ? 83 PRO A CA   9  
ATOM 11429 C C    . PRO A 1 83 ? -20.455 -0.953  -2.563  1.00 0.00 ? 83 PRO A C    9  
ATOM 11430 O O    . PRO A 1 83 ? -21.249 -0.114  -2.986  1.00 0.00 ? 83 PRO A O    9  
ATOM 11431 C CB   . PRO A 1 83 ? -19.580 -0.704  -0.188  1.00 0.00 ? 83 PRO A CB   9  
ATOM 11432 C CG   . PRO A 1 83 ? -19.888 0.688   0.339   1.00 0.00 ? 83 PRO A CG   9  
ATOM 11433 C CD   . PRO A 1 83 ? -19.442 1.693   -0.711  1.00 0.00 ? 83 PRO A CD   9  
ATOM 11434 H HA   . PRO A 1 83 ? -18.507 -1.090  -1.960  1.00 0.00 ? 83 PRO A HA   9  
ATOM 11435 H HB3  . PRO A 1 83 ? -18.725 -1.138  0.332   1.00 0.00 ? 83 PRO A HB3  9  
ATOM 11436 H HG3  . PRO A 1 83 ? -19.369 0.865   1.280   1.00 0.00 ? 83 PRO A HG3  9  
ATOM 11437 H HD3  . PRO A 1 83 ? -18.644 2.332   -0.334  1.00 0.00 ? 83 PRO A HD3  9  
ATOM 11438 N N    . SER A 1 84 ? -20.523 -2.250  -2.824  1.00 0.00 ? 84 SER A N    9  
ATOM 11439 C CA   . SER A 1 84 ? -21.582 -2.791  -3.659  1.00 0.00 ? 84 SER A CA   9  
ATOM 11440 C C    . SER A 1 84 ? -22.206 -4.015  -2.986  1.00 0.00 ? 84 SER A C    9  
ATOM 11441 O O    . SER A 1 84 ? -21.494 -4.874  -2.468  1.00 0.00 ? 84 SER A O    9  
ATOM 11442 C CB   . SER A 1 84 ? -21.054 -3.160  -5.047  1.00 0.00 ? 84 SER A CB   9  
ATOM 11443 O OG   . SER A 1 84 ? -21.883 -2.646  -6.086  1.00 0.00 ? 84 SER A OG   9  
ATOM 11444 H H    . SER A 1 84 ? -19.873 -2.925  -2.475  1.00 0.00 ? 84 SER A H    9  
ATOM 11445 H HA   . SER A 1 84 ? -22.315 -1.990  -3.750  1.00 0.00 ? 84 SER A HA   9  
ATOM 11446 H HB3  . SER A 1 84 ? -20.993 -4.244  -5.135  1.00 0.00 ? 84 SER A HB3  9  
ATOM 11447 H HG   . SER A 1 84 ? -21.317 -2.313  -6.842  1.00 0.00 ? 84 SER A HG   9  
ATOM 11448 N N    . SER A 1 85 ? -23.530 -4.056  -3.015  1.00 0.00 ? 85 SER A N    9  
ATOM 11449 C CA   . SER A 1 85 ? -24.258 -5.161  -2.415  1.00 0.00 ? 85 SER A CA   9  
ATOM 11450 C C    . SER A 1 85 ? -23.992 -6.449  -3.195  1.00 0.00 ? 85 SER A C    9  
ATOM 11451 O O    . SER A 1 85 ? -23.990 -6.444  -4.425  1.00 0.00 ? 85 SER A O    9  
ATOM 11452 C CB   . SER A 1 85 ? -25.759 -4.869  -2.366  1.00 0.00 ? 85 SER A CB   9  
ATOM 11453 O OG   . SER A 1 85 ? -26.526 -6.053  -2.156  1.00 0.00 ? 85 SER A OG   9  
ATOM 11454 H H    . SER A 1 85 ? -24.102 -3.354  -3.438  1.00 0.00 ? 85 SER A H    9  
ATOM 11455 H HA   . SER A 1 85 ? -23.871 -5.243  -1.399  1.00 0.00 ? 85 SER A HA   9  
ATOM 11456 H HB3  . SER A 1 85 ? -26.067 -4.399  -3.298  1.00 0.00 ? 85 SER A HB3  9  
ATOM 11457 H HG   . SER A 1 85 ? -26.881 -6.068  -1.221  1.00 0.00 ? 85 SER A HG   9  
ATOM 11458 N N    . GLY A 1 86 ? -23.774 -7.522  -2.449  1.00 0.00 ? 86 GLY A N    9  
ATOM 11459 C CA   . GLY A 1 86 ? -23.507 -8.815  -3.056  1.00 0.00 ? 86 GLY A CA   9  
ATOM 11460 C C    . GLY A 1 86 ? -22.941 -9.797  -2.028  1.00 0.00 ? 86 GLY A C    9  
ATOM 11461 O O    . GLY A 1 86 ? -23.059 -9.577  -0.824  1.00 0.00 ? 86 GLY A O    9  
ATOM 11462 H H    . GLY A 1 86 ? -23.776 -7.517  -1.449  1.00 0.00 ? 86 GLY A H    9  
ATOM 11463 H HA2  . GLY A 1 86 ? -24.427 -9.217  -3.481  1.00 0.00 ? 86 GLY A HA2  9  
ATOM 11464 H HA3  . GLY A 1 86 ? -22.802 -8.696  -3.878  1.00 0.00 ? 86 GLY A HA3  9  
ATOM 11465 N N    . PRO A 1 87 ? -22.321 -10.886 -2.555  1.00 0.00 ? 87 PRO A N    9  
ATOM 11466 C CA   . PRO A 1 87 ? -21.736 -11.902 -1.698  1.00 0.00 ? 87 PRO A CA   9  
ATOM 11467 C C    . PRO A 1 87 ? -20.424 -11.412 -1.082  1.00 0.00 ? 87 PRO A C    9  
ATOM 11468 O O    . PRO A 1 87 ? -19.963 -10.314 -1.390  1.00 0.00 ? 87 PRO A O    9  
ATOM 11469 C CB   . PRO A 1 87 ? -21.554 -13.117 -2.595  1.00 0.00 ? 87 PRO A CB   9  
ATOM 11470 C CG   . PRO A 1 87 ? -21.609 -12.594 -4.021  1.00 0.00 ? 87 PRO A CG   9  
ATOM 11471 C CD   . PRO A 1 87 ? -22.162 -11.179 -3.978  1.00 0.00 ? 87 PRO A CD   9  
ATOM 11472 H HA   . PRO A 1 87 ? -22.343 -12.098 -0.927  1.00 0.00 ? 87 PRO A HA   9  
ATOM 11473 H HB3  . PRO A 1 87 ? -22.337 -13.854 -2.418  1.00 0.00 ? 87 PRO A HB3  9  
ATOM 11474 H HG3  . PRO A 1 87 ? -22.242 -13.233 -4.637  1.00 0.00 ? 87 PRO A HG3  9  
ATOM 11475 H HD3  . PRO A 1 87 ? -23.113 -11.109 -4.505  1.00 0.00 ? 87 PRO A HD3  9  
ATOM 11476 N N    . SER A 1 88 ? -19.861 -12.249 -0.225  1.00 0.00 ? 88 SER A N    9  
ATOM 11477 C CA   . SER A 1 88 ? -18.611 -11.914 0.436   1.00 0.00 ? 88 SER A CA   9  
ATOM 11478 C C    . SER A 1 88 ? -17.599 -13.047 0.248   1.00 0.00 ? 88 SER A C    9  
ATOM 11479 O O    . SER A 1 88 ? -17.900 -14.205 0.530   1.00 0.00 ? 88 SER A O    9  
ATOM 11480 C CB   . SER A 1 88 ? -18.831 -11.642 1.926   1.00 0.00 ? 88 SER A CB   9  
ATOM 11481 O OG   . SER A 1 88 ? -17.618 -11.302 2.592   1.00 0.00 ? 88 SER A OG   9  
ATOM 11482 H H    . SER A 1 88 ? -20.242 -13.141 0.020   1.00 0.00 ? 88 SER A H    9  
ATOM 11483 H HA   . SER A 1 88 ? -18.261 -11.004 -0.051  1.00 0.00 ? 88 SER A HA   9  
ATOM 11484 H HB3  . SER A 1 88 ? -19.267 -12.524 2.395   1.00 0.00 ? 88 SER A HB3  9  
ATOM 11485 H HG   . SER A 1 88 ? -16.860 -11.833 2.213   1.00 0.00 ? 88 SER A HG   9  
ATOM 11486 N N    . SER A 1 89 ? -16.421 -12.671 -0.227  1.00 0.00 ? 89 SER A N    9  
ATOM 11487 C CA   . SER A 1 89 ? -15.362 -13.641 -0.456  1.00 0.00 ? 89 SER A CA   9  
ATOM 11488 C C    . SER A 1 89 ? -15.937 -14.897 -1.115  1.00 0.00 ? 89 SER A C    9  
ATOM 11489 O O    . SER A 1 89 ? -16.295 -15.853 -0.428  1.00 0.00 ? 89 SER A O    9  
ATOM 11490 C CB   . SER A 1 89 ? -14.654 -14.003 0.850   1.00 0.00 ? 89 SER A CB   9  
ATOM 11491 O OG   . SER A 1 89 ? -13.247 -14.140 0.675   1.00 0.00 ? 89 SER A OG   9  
ATOM 11492 H H    . SER A 1 89 ? -16.184 -11.727 -0.453  1.00 0.00 ? 89 SER A H    9  
ATOM 11493 H HA   . SER A 1 89 ? -14.659 -13.147 -1.125  1.00 0.00 ? 89 SER A HA   9  
ATOM 11494 H HB3  . SER A 1 89 ? -15.064 -14.936 1.238   1.00 0.00 ? 89 SER A HB3  9  
ATOM 11495 H HG   . SER A 1 89 ? -12.765 -13.471 1.242   1.00 0.00 ? 89 SER A HG   9  
ATOM 11496 N N    . GLY A 1 90 ? -16.009 -14.853 -2.437  1.00 0.00 ? 90 GLY A N    9  
ATOM 11497 C CA   . GLY A 1 90 ? -16.534 -15.975 -3.195  1.00 0.00 ? 90 GLY A CA   9  
ATOM 11498 C C    . GLY A 1 90 ? -15.622 -16.314 -4.376  1.00 0.00 ? 90 GLY A C    9  
ATOM 11499 O O    . GLY A 1 90 ? -14.753 -15.525 -4.740  1.00 0.00 ? 90 GLY A O    9  
ATOM 11500 H H    . GLY A 1 90 ? -15.716 -14.072 -2.987  1.00 0.00 ? 90 GLY A H    9  
ATOM 11501 H HA2  . GLY A 1 90 ? -16.631 -16.845 -2.545  1.00 0.00 ? 90 GLY A HA2  9  
ATOM 11502 H HA3  . GLY A 1 90 ? -17.533 -15.738 -3.559  1.00 0.00 ? 90 GLY A HA3  9  
ATOM 11503 N N    . GLY A 1 1  ? 7.489   -18.867 3.412   1.00 0.00 ? 1  GLY A N    10 
ATOM 11504 C CA   . GLY A 1 1  ? 8.369   -18.367 4.454   1.00 0.00 ? 1  GLY A CA   10 
ATOM 11505 C C    . GLY A 1 1  ? 9.770   -18.968 4.323   1.00 0.00 ? 1  GLY A C    10 
ATOM 11506 O O    . GLY A 1 1  ? 9.917   -20.176 4.135   1.00 0.00 ? 1  GLY A O    10 
ATOM 11507 H H1   . GLY A 1 1  ? 7.799   -19.704 2.962   1.00 0.00 ? 1  GLY A H1   10 
ATOM 11508 H HA2  . GLY A 1 1  ? 8.430   -17.281 4.395   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 11509 H HA3  . GLY A 1 1  ? 7.955   -18.610 5.433   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 11510 N N    . SER A 1 2  ? 10.765  -18.100 4.428   1.00 0.00 ? 2  SER A N    10 
ATOM 11511 C CA   . SER A 1 2  ? 12.149  -18.530 4.324   1.00 0.00 ? 2  SER A CA   10 
ATOM 11512 C C    . SER A 1 2  ? 13.062  -17.531 5.038   1.00 0.00 ? 2  SER A C    10 
ATOM 11513 O O    . SER A 1 2  ? 13.241  -16.407 4.574   1.00 0.00 ? 2  SER A O    10 
ATOM 11514 C CB   . SER A 1 2  ? 12.569  -18.681 2.861   1.00 0.00 ? 2  SER A CB   10 
ATOM 11515 O OG   . SER A 1 2  ? 11.871  -19.740 2.211   1.00 0.00 ? 2  SER A OG   10 
ATOM 11516 H H    . SER A 1 2  ? 10.637  -17.119 4.581   1.00 0.00 ? 2  SER A H    10 
ATOM 11517 H HA   . SER A 1 2  ? 12.186  -19.502 4.814   1.00 0.00 ? 2  SER A HA   10 
ATOM 11518 H HB3  . SER A 1 2  ? 13.642  -18.869 2.809   1.00 0.00 ? 2  SER A HB3  10 
ATOM 11519 H HG   . SER A 1 2  ? 11.533  -19.433 1.323   1.00 0.00 ? 2  SER A HG   10 
ATOM 11520 N N    . SER A 1 3  ? 13.617  -17.980 6.155   1.00 0.00 ? 3  SER A N    10 
ATOM 11521 C CA   . SER A 1 3  ? 14.508  -17.140 6.937   1.00 0.00 ? 3  SER A CA   10 
ATOM 11522 C C    . SER A 1 3  ? 13.730  -15.966 7.534   1.00 0.00 ? 3  SER A C    10 
ATOM 11523 O O    . SER A 1 3  ? 13.489  -15.925 8.739   1.00 0.00 ? 3  SER A O    10 
ATOM 11524 C CB   . SER A 1 3  ? 15.671  -16.628 6.086   1.00 0.00 ? 3  SER A CB   10 
ATOM 11525 O OG   . SER A 1 3  ? 16.377  -17.691 5.451   1.00 0.00 ? 3  SER A OG   10 
ATOM 11526 H H    . SER A 1 3  ? 13.467  -18.897 6.525   1.00 0.00 ? 3  SER A H    10 
ATOM 11527 H HA   . SER A 1 3  ? 14.893  -17.785 7.726   1.00 0.00 ? 3  SER A HA   10 
ATOM 11528 H HB3  . SER A 1 3  ? 16.358  -16.060 6.713   1.00 0.00 ? 3  SER A HB3  10 
ATOM 11529 H HG   . SER A 1 3  ? 16.636  -17.424 4.523   1.00 0.00 ? 3  SER A HG   10 
ATOM 11530 N N    . GLY A 1 4  ? 13.359  -15.039 6.662   1.00 0.00 ? 4  GLY A N    10 
ATOM 11531 C CA   . GLY A 1 4  ? 12.612  -13.867 7.089   1.00 0.00 ? 4  GLY A CA   10 
ATOM 11532 C C    . GLY A 1 4  ? 12.681  -12.761 6.034   1.00 0.00 ? 4  GLY A C    10 
ATOM 11533 O O    . GLY A 1 4  ? 13.766  -12.298 5.685   1.00 0.00 ? 4  GLY A O    10 
ATOM 11534 H H    . GLY A 1 4  ? 13.559  -15.080 5.684   1.00 0.00 ? 4  GLY A H    10 
ATOM 11535 H HA2  . GLY A 1 4  ? 11.573  -14.139 7.269   1.00 0.00 ? 4  GLY A HA2  10 
ATOM 11536 H HA3  . GLY A 1 4  ? 13.014  -13.500 8.033   1.00 0.00 ? 4  GLY A HA3  10 
ATOM 11537 N N    . SER A 1 5  ? 11.510  -12.369 5.557   1.00 0.00 ? 5  SER A N    10 
ATOM 11538 C CA   . SER A 1 5  ? 11.422  -11.325 4.550   1.00 0.00 ? 5  SER A CA   10 
ATOM 11539 C C    . SER A 1 5  ? 12.223  -10.099 4.996   1.00 0.00 ? 5  SER A C    10 
ATOM 11540 O O    . SER A 1 5  ? 12.186  -9.721  6.166   1.00 0.00 ? 5  SER A O    10 
ATOM 11541 C CB   . SER A 1 5  ? 9.967   -10.938 4.281   1.00 0.00 ? 5  SER A CB   10 
ATOM 11542 O OG   . SER A 1 5  ? 9.679   -10.879 2.886   1.00 0.00 ? 5  SER A OG   10 
ATOM 11543 H H    . SER A 1 5  ? 10.631  -12.751 5.846   1.00 0.00 ? 5  SER A H    10 
ATOM 11544 H HA   . SER A 1 5  ? 11.855  -11.758 3.647   1.00 0.00 ? 5  SER A HA   10 
ATOM 11545 H HB3  . SER A 1 5  ? 9.759   -9.970  4.736   1.00 0.00 ? 5  SER A HB3  10 
ATOM 11546 H HG   . SER A 1 5  ? 9.862   -9.960  2.538   1.00 0.00 ? 5  SER A HG   10 
ATOM 11547 N N    . SER A 1 6  ? 12.929  -9.514  4.039   1.00 0.00 ? 6  SER A N    10 
ATOM 11548 C CA   . SER A 1 6  ? 13.738  -8.339  4.319   1.00 0.00 ? 6  SER A CA   10 
ATOM 11549 C C    . SER A 1 6  ? 13.894  -7.498  3.051   1.00 0.00 ? 6  SER A C    10 
ATOM 11550 O O    . SER A 1 6  ? 13.890  -8.032  1.943   1.00 0.00 ? 6  SER A O    10 
ATOM 11551 C CB   . SER A 1 6  ? 15.111  -8.734  4.867   1.00 0.00 ? 6  SER A CB   10 
ATOM 11552 O OG   . SER A 1 6  ? 15.022  -9.304  6.170   1.00 0.00 ? 6  SER A OG   10 
ATOM 11553 H H    . SER A 1 6  ? 12.955  -9.828  3.090   1.00 0.00 ? 6  SER A H    10 
ATOM 11554 H HA   . SER A 1 6  ? 13.189  -7.786  5.080   1.00 0.00 ? 6  SER A HA   10 
ATOM 11555 H HB3  . SER A 1 6  ? 15.754  -7.854  4.898   1.00 0.00 ? 6  SER A HB3  10 
ATOM 11556 H HG   . SER A 1 6  ? 15.760  -8.954  6.746   1.00 0.00 ? 6  SER A HG   10 
ATOM 11557 N N    . GLY A 1 7  ? 14.027  -6.196  3.255   1.00 0.00 ? 7  GLY A N    10 
ATOM 11558 C CA   . GLY A 1 7  ? 14.184  -5.275  2.142   1.00 0.00 ? 7  GLY A CA   10 
ATOM 11559 C C    . GLY A 1 7  ? 13.225  -4.090  2.271   1.00 0.00 ? 7  GLY A C    10 
ATOM 11560 O O    . GLY A 1 7  ? 12.049  -4.270  2.584   1.00 0.00 ? 7  GLY A O    10 
ATOM 11561 H H    . GLY A 1 7  ? 14.029  -5.769  4.160   1.00 0.00 ? 7  GLY A H    10 
ATOM 11562 H HA2  . GLY A 1 7  ? 15.212  -4.913  2.107   1.00 0.00 ? 7  GLY A HA2  10 
ATOM 11563 H HA3  . GLY A 1 7  ? 13.998  -5.798  1.205   1.00 0.00 ? 7  GLY A HA3  10 
ATOM 11564 N N    . LEU A 1 8  ? 13.763  -2.904  2.024   1.00 0.00 ? 8  LEU A N    10 
ATOM 11565 C CA   . LEU A 1 8  ? 12.969  -1.691  2.109   1.00 0.00 ? 8  LEU A CA   10 
ATOM 11566 C C    . LEU A 1 8  ? 11.763  -1.809  1.176   1.00 0.00 ? 8  LEU A C    10 
ATOM 11567 O O    . LEU A 1 8  ? 10.621  -1.659  1.609   1.00 0.00 ? 8  LEU A O    10 
ATOM 11568 C CB   . LEU A 1 8  ? 13.840  -0.462  1.836   1.00 0.00 ? 8  LEU A CB   10 
ATOM 11569 C CG   . LEU A 1 8  ? 14.468  0.201   3.063   1.00 0.00 ? 8  LEU A CG   10 
ATOM 11570 C CD1  . LEU A 1 8  ? 15.208  1.482   2.676   1.00 0.00 ? 8  LEU A CD1  10 
ATOM 11571 C CD2  . LEU A 1 8  ? 13.418  0.452   4.148   1.00 0.00 ? 8  LEU A CD2  10 
ATOM 11572 H H    . LEU A 1 8  ? 14.720  -2.767  1.770   1.00 0.00 ? 8  LEU A H    10 
ATOM 11573 H HA   . LEU A 1 8  ? 12.607  -1.608  3.133   1.00 0.00 ? 8  LEU A HA   10 
ATOM 11574 H HB3  . LEU A 1 8  ? 13.233  0.280   1.317   1.00 0.00 ? 8  LEU A HB3  10 
ATOM 11575 H HG   . LEU A 1 8  ? 15.206  -0.484  3.481   1.00 0.00 ? 8  LEU A HG   10 
ATOM 11576 H HD11 . LEU A 1 8  ? 14.515  2.171   2.193   1.00 0.00 ? 8  LEU A HD11 10 
ATOM 11577 H HD12 . LEU A 1 8  ? 15.621  1.949   3.570   1.00 0.00 ? 8  LEU A HD12 10 
ATOM 11578 H HD13 . LEU A 1 8  ? 16.018  1.240   1.987   1.00 0.00 ? 8  LEU A HD13 10 
ATOM 11579 H HD21 . LEU A 1 8  ? 13.718  1.308   4.752   1.00 0.00 ? 8  LEU A HD21 10 
ATOM 11580 H HD22 . LEU A 1 8  ? 12.454  0.656   3.682   1.00 0.00 ? 8  LEU A HD22 10 
ATOM 11581 H HD23 . LEU A 1 8  ? 13.336  -0.429  4.784   1.00 0.00 ? 8  LEU A HD23 10 
ATOM 11582 N N    . ARG A 1 9  ? 12.056  -2.076  -0.088  1.00 0.00 ? 9  ARG A N    10 
ATOM 11583 C CA   . ARG A 1 9  ? 11.010  -2.217  -1.086  1.00 0.00 ? 9  ARG A CA   10 
ATOM 11584 C C    . ARG A 1 9  ? 10.113  -3.410  -0.751  1.00 0.00 ? 9  ARG A C    10 
ATOM 11585 O O    . ARG A 1 9  ? 8.922   -3.403  -1.060  1.00 0.00 ? 9  ARG A O    10 
ATOM 11586 C CB   . ARG A 1 9  ? 11.603  -2.410  -2.484  1.00 0.00 ? 9  ARG A CB   10 
ATOM 11587 C CG   . ARG A 1 9  ? 10.520  -2.300  -3.559  1.00 0.00 ? 9  ARG A CG   10 
ATOM 11588 C CD   . ARG A 1 9  ? 10.462  -3.570  -4.410  1.00 0.00 ? 9  ARG A CD   10 
ATOM 11589 N NE   . ARG A 1 9  ? 9.247   -3.557  -5.256  1.00 0.00 ? 9  ARG A NE   10 
ATOM 11590 C CZ   . ARG A 1 9  ? 8.868   -4.575  -6.041  1.00 0.00 ? 9  ARG A CZ   10 
ATOM 11591 N NH1  . ARG A 1 9  ? 9.604   -5.693  -6.092  1.00 0.00 ? 9  ARG A NH1  10 
ATOM 11592 N NH2  . ARG A 1 9  ? 7.750   -4.475  -6.774  1.00 0.00 ? 9  ARG A NH2  10 
ATOM 11593 H H    . ARG A 1 9  ? 12.988  -2.196  -0.433  1.00 0.00 ? 9  ARG A H    10 
ATOM 11594 H HA   . ARG A 1 9  ? 10.452  -1.282  -1.039  1.00 0.00 ? 9  ARG A HA   10 
ATOM 11595 H HB3  . ARG A 1 9  ? 12.085  -3.387  -2.546  1.00 0.00 ? 9  ARG A HB3  10 
ATOM 11596 H HG3  . ARG A 1 9  ? 10.722  -1.440  -4.197  1.00 0.00 ? 9  ARG A HG3  10 
ATOM 11597 H HD3  . ARG A 1 9  ? 10.457  -4.450  -3.766  1.00 0.00 ? 9  ARG A HD3  10 
ATOM 11598 H HE   . ARG A 1 9  ? 8.675   -2.738  -5.242  1.00 0.00 ? 9  ARG A HE   10 
ATOM 11599 H HH11 . ARG A 1 9  ? 10.438  -5.768  -5.544  1.00 0.00 ? 9  ARG A HH11 10 
ATOM 11600 H HH12 . ARG A 1 9  ? 9.321   -6.452  -6.677  1.00 0.00 ? 9  ARG A HH12 10 
ATOM 11601 H HH21 . ARG A 1 9  ? 7.201   -3.640  -6.737  1.00 0.00 ? 9  ARG A HH21 10 
ATOM 11602 H HH22 . ARG A 1 9  ? 7.467   -5.234  -7.360  1.00 0.00 ? 9  ARG A HH22 10 
ATOM 11603 N N    . LYS A 1 10 ? 10.719  -4.406  -0.123  1.00 0.00 ? 10 LYS A N    10 
ATOM 11604 C CA   . LYS A 1 10 ? 9.990   -5.605  0.258   1.00 0.00 ? 10 LYS A CA   10 
ATOM 11605 C C    . LYS A 1 10 ? 9.114   -5.299  1.475   1.00 0.00 ? 10 LYS A C    10 
ATOM 11606 O O    . LYS A 1 10 ? 8.049   -5.890  1.643   1.00 0.00 ? 10 LYS A O    10 
ATOM 11607 C CB   . LYS A 1 10 ? 10.955  -6.773  0.473   1.00 0.00 ? 10 LYS A CB   10 
ATOM 11608 C CG   . LYS A 1 10 ? 10.297  -7.883  1.296   1.00 0.00 ? 10 LYS A CG   10 
ATOM 11609 C CD   . LYS A 1 10 ? 8.989   -8.344  0.647   1.00 0.00 ? 10 LYS A CD   10 
ATOM 11610 C CE   . LYS A 1 10 ? 7.873   -8.463  1.687   1.00 0.00 ? 10 LYS A CE   10 
ATOM 11611 N NZ   . LYS A 1 10 ? 7.413   -9.865  1.797   1.00 0.00 ? 10 LYS A NZ   10 
ATOM 11612 H H    . LYS A 1 10 ? 11.688  -4.404  0.125   1.00 0.00 ? 10 LYS A H    10 
ATOM 11613 H HA   . LYS A 1 10 ? 9.341   -5.871  -0.575  1.00 0.00 ? 10 LYS A HA   10 
ATOM 11614 H HB3  . LYS A 1 10 ? 11.851  -6.421  0.982   1.00 0.00 ? 10 LYS A HB3  10 
ATOM 11615 H HG3  . LYS A 1 10 ? 10.099  -7.523  2.305   1.00 0.00 ? 10 LYS A HG3  10 
ATOM 11616 H HD3  . LYS A 1 10 ? 9.140   -9.307  0.160   1.00 0.00 ? 10 LYS A HD3  10 
ATOM 11617 H HE3  . LYS A 1 10 ? 7.039   -7.820  1.408   1.00 0.00 ? 10 LYS A HE3  10 
ATOM 11618 H HZ1  . LYS A 1 10 ? 7.527   -10.323 0.914   1.00 0.00 ? 10 LYS A HZ1  10 
ATOM 11619 H HZ2  . LYS A 1 10 ? 7.953   -10.340 2.491   1.00 0.00 ? 10 LYS A HZ2  10 
ATOM 11620 H HZ3  . LYS A 1 10 ? 6.448   -9.880  2.058   1.00 0.00 ? 10 LYS A HZ3  10 
ATOM 11621 N N    . MET A 1 11 ? 9.596   -4.373  2.293   1.00 0.00 ? 11 MET A N    10 
ATOM 11622 C CA   . MET A 1 11 ? 8.870   -3.981  3.489   1.00 0.00 ? 11 MET A CA   10 
ATOM 11623 C C    . MET A 1 11 ? 7.544   -3.307  3.130   1.00 0.00 ? 11 MET A C    10 
ATOM 11624 O O    . MET A 1 11 ? 6.492   -3.690  3.636   1.00 0.00 ? 11 MET A O    10 
ATOM 11625 C CB   . MET A 1 11 ? 9.727   -3.018  4.313   1.00 0.00 ? 11 MET A CB   10 
ATOM 11626 C CG   . MET A 1 11 ? 10.874  -3.759  5.003   1.00 0.00 ? 11 MET A CG   10 
ATOM 11627 S SD   . MET A 1 11 ? 10.833  -3.447  6.761   1.00 0.00 ? 11 MET A SD   10 
ATOM 11628 C CE   . MET A 1 11 ? 11.894  -2.014  6.846   1.00 0.00 ? 11 MET A CE   10 
ATOM 11629 H H    . MET A 1 11 ? 10.463  -3.897  2.149   1.00 0.00 ? 11 MET A H    10 
ATOM 11630 H HA   . MET A 1 11 ? 8.679   -4.907  4.031   1.00 0.00 ? 11 MET A HA   10 
ATOM 11631 H HB3  . MET A 1 11 ? 9.107   -2.524  5.061   1.00 0.00 ? 11 MET A HB3  10 
ATOM 11632 H HG3  . MET A 1 11 ? 11.829  -3.433  4.590   1.00 0.00 ? 11 MET A HG3  10 
ATOM 11633 H HE1  . MET A 1 11 ? 11.875  -1.490  5.889   1.00 0.00 ? 11 MET A HE1  10 
ATOM 11634 H HE2  . MET A 1 11 ? 11.540  -1.346  7.631   1.00 0.00 ? 11 MET A HE2  10 
ATOM 11635 H HE3  . MET A 1 11 ? 12.913  -2.329  7.067   1.00 0.00 ? 11 MET A HE3  10 
ATOM 11636 N N    . VAL A 1 12 ? 7.641   -2.312  2.259   1.00 0.00 ? 12 VAL A N    10 
ATOM 11637 C CA   . VAL A 1 12 ? 6.463   -1.581  1.826   1.00 0.00 ? 12 VAL A CA   10 
ATOM 11638 C C    . VAL A 1 12 ? 5.582   -2.497  0.975   1.00 0.00 ? 12 VAL A C    10 
ATOM 11639 O O    . VAL A 1 12 ? 4.357   -2.390  1.005   1.00 0.00 ? 12 VAL A O    10 
ATOM 11640 C CB   . VAL A 1 12 ? 6.879   -0.303  1.094   1.00 0.00 ? 12 VAL A CB   10 
ATOM 11641 C CG1  . VAL A 1 12 ? 8.098   -0.555  0.203   1.00 0.00 ? 12 VAL A CG1  10 
ATOM 11642 C CG2  . VAL A 1 12 ? 5.715   0.268   0.282   1.00 0.00 ? 12 VAL A CG2  10 
ATOM 11643 H H    . VAL A 1 12 ? 8.501   -2.007  1.852   1.00 0.00 ? 12 VAL A H    10 
ATOM 11644 H HA   . VAL A 1 12 ? 5.908   -1.291  2.719   1.00 0.00 ? 12 VAL A HA   10 
ATOM 11645 H HB   . VAL A 1 12 ? 7.159   0.437   1.844   1.00 0.00 ? 12 VAL A HB   10 
ATOM 11646 H HG11 . VAL A 1 12 ? 9.000   -0.225  0.720   1.00 0.00 ? 12 VAL A HG11 10 
ATOM 11647 H HG12 . VAL A 1 12 ? 8.174   -1.620  -0.017  1.00 0.00 ? 12 VAL A HG12 10 
ATOM 11648 H HG13 . VAL A 1 12 ? 7.989   0.001   -0.728  1.00 0.00 ? 12 VAL A HG13 10 
ATOM 11649 H HG21 . VAL A 1 12 ? 5.919   1.311   0.041   1.00 0.00 ? 12 VAL A HG21 10 
ATOM 11650 H HG22 . VAL A 1 12 ? 5.601   -0.302  -0.640  1.00 0.00 ? 12 VAL A HG22 10 
ATOM 11651 H HG23 . VAL A 1 12 ? 4.798   0.202   0.866   1.00 0.00 ? 12 VAL A HG23 10 
ATOM 11652 N N    . GLU A 1 13 ? 6.240   -3.378  0.236   1.00 0.00 ? 13 GLU A N    10 
ATOM 11653 C CA   . GLU A 1 13 ? 5.533   -4.313  -0.622  1.00 0.00 ? 13 GLU A CA   10 
ATOM 11654 C C    . GLU A 1 13 ? 4.358   -4.940  0.131   1.00 0.00 ? 13 GLU A C    10 
ATOM 11655 O O    . GLU A 1 13 ? 3.237   -4.971  -0.375  1.00 0.00 ? 13 GLU A O    10 
ATOM 11656 C CB   . GLU A 1 13 ? 6.478   -5.391  -1.157  1.00 0.00 ? 13 GLU A CB   10 
ATOM 11657 C CG   . GLU A 1 13 ? 7.182   -4.918  -2.431  1.00 0.00 ? 13 GLU A CG   10 
ATOM 11658 C CD   . GLU A 1 13 ? 6.634   -5.644  -3.662  1.00 0.00 ? 13 GLU A CD   10 
ATOM 11659 O OE1  . GLU A 1 13 ? 6.778   -6.885  -3.700  1.00 0.00 ? 13 GLU A OE1  10 
ATOM 11660 O OE2  . GLU A 1 13 ? 6.081   -4.942  -4.535  1.00 0.00 ? 13 GLU A OE2  10 
ATOM 11661 H H    . GLU A 1 13 ? 7.236   -3.458  0.218   1.00 0.00 ? 13 GLU A H    10 
ATOM 11662 H HA   . GLU A 1 13 ? 5.162   -3.717  -1.457  1.00 0.00 ? 13 GLU A HA   10 
ATOM 11663 H HB3  . GLU A 1 13 ? 5.918   -6.302  -1.364  1.00 0.00 ? 13 GLU A HB3  10 
ATOM 11664 H HG3  . GLU A 1 13 ? 8.254   -5.098  -2.346  1.00 0.00 ? 13 GLU A HG3  10 
ATOM 11665 N N    . GLU A 1 14 ? 4.654   -5.423  1.328   1.00 0.00 ? 14 GLU A N    10 
ATOM 11666 C CA   . GLU A 1 14 ? 3.635   -6.047  2.156   1.00 0.00 ? 14 GLU A CA   10 
ATOM 11667 C C    . GLU A 1 14 ? 2.677   -4.989  2.707   1.00 0.00 ? 14 GLU A C    10 
ATOM 11668 O O    . GLU A 1 14 ? 1.478   -5.237  2.832   1.00 0.00 ? 14 GLU A O    10 
ATOM 11669 C CB   . GLU A 1 14 ? 4.270   -6.855  3.290   1.00 0.00 ? 14 GLU A CB   10 
ATOM 11670 C CG   . GLU A 1 14 ? 4.527   -5.973  4.514   1.00 0.00 ? 14 GLU A CG   10 
ATOM 11671 C CD   . GLU A 1 14 ? 5.609   -6.579  5.410   1.00 0.00 ? 14 GLU A CD   10 
ATOM 11672 O OE1  . GLU A 1 14 ? 6.499   -7.254  4.847   1.00 0.00 ? 14 GLU A OE1  10 
ATOM 11673 O OE2  . GLU A 1 14 ? 5.522   -6.355  6.637   1.00 0.00 ? 14 GLU A OE2  10 
ATOM 11674 H H    . GLU A 1 14 ? 5.567   -5.393  1.733   1.00 0.00 ? 14 GLU A H    10 
ATOM 11675 H HA   . GLU A 1 14 ? 3.098   -6.724  1.493   1.00 0.00 ? 14 GLU A HA   10 
ATOM 11676 H HB3  . GLU A 1 14 ? 5.209   -7.292  2.950   1.00 0.00 ? 14 GLU A HB3  10 
ATOM 11677 H HG3  . GLU A 1 14 ? 3.605   -5.854  5.082   1.00 0.00 ? 14 GLU A HG3  10 
ATOM 11678 N N    . VAL A 1 15 ? 3.241   -3.832  3.020   1.00 0.00 ? 15 VAL A N    10 
ATOM 11679 C CA   . VAL A 1 15 ? 2.450   -2.735  3.554   1.00 0.00 ? 15 VAL A CA   10 
ATOM 11680 C C    . VAL A 1 15 ? 1.282   -2.447  2.610   1.00 0.00 ? 15 VAL A C    10 
ATOM 11681 O O    . VAL A 1 15 ? 0.130   -2.728  2.939   1.00 0.00 ? 15 VAL A O    10 
ATOM 11682 C CB   . VAL A 1 15 ? 3.342   -1.515  3.790   1.00 0.00 ? 15 VAL A CB   10 
ATOM 11683 C CG1  . VAL A 1 15 ? 2.501   -0.256  4.011   1.00 0.00 ? 15 VAL A CG1  10 
ATOM 11684 C CG2  . VAL A 1 15 ? 4.295   -1.750  4.964   1.00 0.00 ? 15 VAL A CG2  10 
ATOM 11685 H H    . VAL A 1 15 ? 4.216   -3.638  2.915   1.00 0.00 ? 15 VAL A H    10 
ATOM 11686 H HA   . VAL A 1 15 ? 2.052   -3.054  4.518   1.00 0.00 ? 15 VAL A HA   10 
ATOM 11687 H HB   . VAL A 1 15 ? 3.946   -1.361  2.896   1.00 0.00 ? 15 VAL A HB   10 
ATOM 11688 H HG11 . VAL A 1 15 ? 1.751   -0.450  4.778   1.00 0.00 ? 15 VAL A HG11 10 
ATOM 11689 H HG12 . VAL A 1 15 ? 3.147   0.562   4.333   1.00 0.00 ? 15 VAL A HG12 10 
ATOM 11690 H HG13 . VAL A 1 15 ? 2.006   0.018   3.079   1.00 0.00 ? 15 VAL A HG13 10 
ATOM 11691 H HG21 . VAL A 1 15 ? 4.729   -2.747  4.885   1.00 0.00 ? 15 VAL A HG21 10 
ATOM 11692 H HG22 . VAL A 1 15 ? 5.089   -1.005  4.943   1.00 0.00 ? 15 VAL A HG22 10 
ATOM 11693 H HG23 . VAL A 1 15 ? 3.744   -1.667  5.901   1.00 0.00 ? 15 VAL A HG23 10 
ATOM 11694 N N    . PHE A 1 16 ? 1.618   -1.891  1.454   1.00 0.00 ? 16 PHE A N    10 
ATOM 11695 C CA   . PHE A 1 16 ? 0.611   -1.562  0.461   1.00 0.00 ? 16 PHE A CA   10 
ATOM 11696 C C    . PHE A 1 16 ? -0.374  -2.718  0.275   1.00 0.00 ? 16 PHE A C    10 
ATOM 11697 O O    . PHE A 1 16 ? -1.520  -2.506  -0.119  1.00 0.00 ? 16 PHE A O    10 
ATOM 11698 C CB   . PHE A 1 16 ? 1.347   -1.320  -0.857  1.00 0.00 ? 16 PHE A CB   10 
ATOM 11699 C CG   . PHE A 1 16 ? 1.969   0.073   -0.976  1.00 0.00 ? 16 PHE A CG   10 
ATOM 11700 C CD1  . PHE A 1 16 ? 1.303   1.159   -0.497  1.00 0.00 ? 16 PHE A CD1  10 
ATOM 11701 C CD2  . PHE A 1 16 ? 3.187   0.227   -1.561  1.00 0.00 ? 16 PHE A CD2  10 
ATOM 11702 C CE1  . PHE A 1 16 ? 1.881   2.451   -0.607  1.00 0.00 ? 16 PHE A CE1  10 
ATOM 11703 C CE2  . PHE A 1 16 ? 3.765   1.519   -1.670  1.00 0.00 ? 16 PHE A CE2  10 
ATOM 11704 C CZ   . PHE A 1 16 ? 3.100   2.604   -1.190  1.00 0.00 ? 16 PHE A CZ   10 
ATOM 11705 H H    . PHE A 1 16 ? 2.557   -1.667  1.196   1.00 0.00 ? 16 PHE A H    10 
ATOM 11706 H HA   . PHE A 1 16 ? 0.075   -0.685  0.821   1.00 0.00 ? 16 PHE A HA   10 
ATOM 11707 H HB3  . PHE A 1 16 ? 0.650   -1.466  -1.683  1.00 0.00 ? 16 PHE A HB3  10 
ATOM 11708 H HD1  . PHE A 1 16 ? 0.326   1.035   -0.029  1.00 0.00 ? 16 PHE A HD1  10 
ATOM 11709 H HD2  . PHE A 1 16 ? 3.721   -0.643  -1.945  1.00 0.00 ? 16 PHE A HD2  10 
ATOM 11710 H HE1  . PHE A 1 16 ? 1.347   3.320   -0.223  1.00 0.00 ? 16 PHE A HE1  10 
ATOM 11711 H HE2  . PHE A 1 16 ? 4.741   1.642   -2.137  1.00 0.00 ? 16 PHE A HE2  10 
ATOM 11712 H HZ   . PHE A 1 16 ? 3.543   3.596   -1.274  1.00 0.00 ? 16 PHE A HZ   10 
ATOM 11713 N N    . ASP A 1 17 ? 0.107   -3.917  0.570   1.00 0.00 ? 17 ASP A N    10 
ATOM 11714 C CA   . ASP A 1 17 ? -0.717  -5.107  0.440   1.00 0.00 ? 17 ASP A CA   10 
ATOM 11715 C C    . ASP A 1 17 ? -1.622  -5.230  1.668   1.00 0.00 ? 17 ASP A C    10 
ATOM 11716 O O    . ASP A 1 17 ? -2.844  -5.137  1.555   1.00 0.00 ? 17 ASP A O    10 
ATOM 11717 C CB   . ASP A 1 17 ? 0.146   -6.368  0.360   1.00 0.00 ? 17 ASP A CB   10 
ATOM 11718 C CG   . ASP A 1 17 ? 0.517   -6.808  -1.057  1.00 0.00 ? 17 ASP A CG   10 
ATOM 11719 O OD1  . ASP A 1 17 ? 0.310   -5.988  -1.978  1.00 0.00 ? 17 ASP A OD1  10 
ATOM 11720 O OD2  . ASP A 1 17 ? 0.998   -7.954  -1.189  1.00 0.00 ? 17 ASP A OD2  10 
ATOM 11721 H H    . ASP A 1 17 ? 1.041   -4.082  0.889   1.00 0.00 ? 17 ASP A H    10 
ATOM 11722 H HA   . ASP A 1 17 ? -1.281  -4.966  -0.482  1.00 0.00 ? 17 ASP A HA   10 
ATOM 11723 H HB3  . ASP A 1 17 ? -0.385  -7.185  0.850   1.00 0.00 ? 17 ASP A HB3  10 
ATOM 11724 N N    . VAL A 1 18 ? -0.988  -5.439  2.812   1.00 0.00 ? 18 VAL A N    10 
ATOM 11725 C CA   . VAL A 1 18 ? -1.720  -5.577  4.059   1.00 0.00 ? 18 VAL A CA   10 
ATOM 11726 C C    . VAL A 1 18 ? -2.846  -4.542  4.101   1.00 0.00 ? 18 VAL A C    10 
ATOM 11727 O O    . VAL A 1 18 ? -3.989  -4.874  4.416   1.00 0.00 ? 18 VAL A O    10 
ATOM 11728 C CB   . VAL A 1 18 ? -0.761  -5.465  5.246   1.00 0.00 ? 18 VAL A CB   10 
ATOM 11729 C CG1  . VAL A 1 18 ? -1.498  -5.006  6.506   1.00 0.00 ? 18 VAL A CG1  10 
ATOM 11730 C CG2  . VAL A 1 18 ? -0.032  -6.788  5.488   1.00 0.00 ? 18 VAL A CG2  10 
ATOM 11731 H H    . VAL A 1 18 ? 0.005   -5.515  2.895   1.00 0.00 ? 18 VAL A H    10 
ATOM 11732 H HA   . VAL A 1 18 ? -2.161  -6.574  4.074   1.00 0.00 ? 18 VAL A HA   10 
ATOM 11733 H HB   . VAL A 1 18 ? -0.013  -4.711  5.001   1.00 0.00 ? 18 VAL A HB   10 
ATOM 11734 H HG11 . VAL A 1 18 ? -2.458  -5.518  6.572   1.00 0.00 ? 18 VAL A HG11 10 
ATOM 11735 H HG12 . VAL A 1 18 ? -0.897  -5.243  7.384   1.00 0.00 ? 18 VAL A HG12 10 
ATOM 11736 H HG13 . VAL A 1 18 ? -1.663  -3.929  6.457   1.00 0.00 ? 18 VAL A HG13 10 
ATOM 11737 H HG21 . VAL A 1 18 ? -0.240  -7.137  6.500   1.00 0.00 ? 18 VAL A HG21 10 
ATOM 11738 H HG22 . VAL A 1 18 ? -0.378  -7.531  4.768   1.00 0.00 ? 18 VAL A HG22 10 
ATOM 11739 H HG23 . VAL A 1 18 ? 1.041   -6.639  5.369   1.00 0.00 ? 18 VAL A HG23 10 
ATOM 11740 N N    . LEU A 1 19 ? -2.485  -3.309  3.779   1.00 0.00 ? 19 LEU A N    10 
ATOM 11741 C CA   . LEU A 1 19 ? -3.451  -2.223  3.776   1.00 0.00 ? 19 LEU A CA   10 
ATOM 11742 C C    . LEU A 1 19 ? -4.571  -2.545  2.785   1.00 0.00 ? 19 LEU A C    10 
ATOM 11743 O O    . LEU A 1 19 ? -5.748  -2.511  3.139   1.00 0.00 ? 19 LEU A O    10 
ATOM 11744 C CB   . LEU A 1 19 ? -2.755  -0.888  3.505   1.00 0.00 ? 19 LEU A CB   10 
ATOM 11745 C CG   . LEU A 1 19 ? -1.596  -0.534  4.439   1.00 0.00 ? 19 LEU A CG   10 
ATOM 11746 C CD1  . LEU A 1 19 ? -1.228  0.947   4.320   1.00 0.00 ? 19 LEU A CD1  10 
ATOM 11747 C CD2  . LEU A 1 19 ? -1.914  -0.931  5.882   1.00 0.00 ? 19 LEU A CD2  10 
ATOM 11748 H H    . LEU A 1 19 ? -1.554  -3.047  3.523   1.00 0.00 ? 19 LEU A H    10 
ATOM 11749 H HA   . LEU A 1 19 ? -3.881  -2.165  4.776   1.00 0.00 ? 19 LEU A HA   10 
ATOM 11750 H HB3  . LEU A 1 19 ? -3.500  -0.094  3.565   1.00 0.00 ? 19 LEU A HB3  10 
ATOM 11751 H HG   . LEU A 1 19 ? -0.722  -1.109  4.133   1.00 0.00 ? 19 LEU A HG   10 
ATOM 11752 H HD11 . LEU A 1 19 ? -1.542  1.472   5.221   1.00 0.00 ? 19 LEU A HD11 10 
ATOM 11753 H HD12 . LEU A 1 19 ? -0.149  1.044   4.199   1.00 0.00 ? 19 LEU A HD12 10 
ATOM 11754 H HD13 . LEU A 1 19 ? -1.730  1.377   3.454   1.00 0.00 ? 19 LEU A HD13 10 
ATOM 11755 H HD21 . LEU A 1 19 ? -2.978  -0.788  6.073   1.00 0.00 ? 19 LEU A HD21 10 
ATOM 11756 H HD22 . LEU A 1 19 ? -1.655  -1.978  6.037   1.00 0.00 ? 19 LEU A HD22 10 
ATOM 11757 H HD23 . LEU A 1 19 ? -1.336  -0.309  6.566   1.00 0.00 ? 19 LEU A HD23 10 
ATOM 11758 N N    . TYR A 1 20 ? -4.165  -2.850  1.560   1.00 0.00 ? 20 TYR A N    10 
ATOM 11759 C CA   . TYR A 1 20 ? -5.119  -3.177  0.514   1.00 0.00 ? 20 TYR A CA   10 
ATOM 11760 C C    . TYR A 1 20 ? -6.036  -4.324  0.949   1.00 0.00 ? 20 TYR A C    10 
ATOM 11761 O O    . TYR A 1 20 ? -7.254  -4.238  0.800   1.00 0.00 ? 20 TYR A O    10 
ATOM 11762 C CB   . TYR A 1 20 ? -4.288  -3.632  -0.687  1.00 0.00 ? 20 TYR A CB   10 
ATOM 11763 C CG   . TYR A 1 20 ? -5.123  -4.149  -1.861  1.00 0.00 ? 20 TYR A CG   10 
ATOM 11764 C CD1  . TYR A 1 20 ? -6.185  -3.404  -2.333  1.00 0.00 ? 20 TYR A CD1  10 
ATOM 11765 C CD2  . TYR A 1 20 ? -4.814  -5.359  -2.447  1.00 0.00 ? 20 TYR A CD2  10 
ATOM 11766 C CE1  . TYR A 1 20 ? -6.970  -3.890  -3.438  1.00 0.00 ? 20 TYR A CE1  10 
ATOM 11767 C CE2  . TYR A 1 20 ? -5.599  -5.845  -3.552  1.00 0.00 ? 20 TYR A CE2  10 
ATOM 11768 C CZ   . TYR A 1 20 ? -6.638  -5.086  -3.993  1.00 0.00 ? 20 TYR A CZ   10 
ATOM 11769 O OH   . TYR A 1 20 ? -7.381  -5.545  -5.036  1.00 0.00 ? 20 TYR A OH   10 
ATOM 11770 H H    . TYR A 1 20 ? -3.205  -2.874  1.280   1.00 0.00 ? 20 TYR A H    10 
ATOM 11771 H HA   . TYR A 1 20 ? -5.724  -2.291  0.321   1.00 0.00 ? 20 TYR A HA   10 
ATOM 11772 H HB3  . TYR A 1 20 ? -3.605  -4.418  -0.367  1.00 0.00 ? 20 TYR A HB3  10 
ATOM 11773 H HD1  . TYR A 1 20 ? -6.429  -2.449  -1.869  1.00 0.00 ? 20 TYR A HD1  10 
ATOM 11774 H HD2  . TYR A 1 20 ? -3.975  -5.946  -2.075  1.00 0.00 ? 20 TYR A HD2  10 
ATOM 11775 H HE1  . TYR A 1 20 ? -7.812  -3.312  -3.820  1.00 0.00 ? 20 TYR A HE1  10 
ATOM 11776 H HE2  . TYR A 1 20 ? -5.366  -6.799  -4.025  1.00 0.00 ? 20 TYR A HE2  10 
ATOM 11777 H HH   . TYR A 1 20 ? -8.307  -5.171  -4.988  1.00 0.00 ? 20 TYR A HH   10 
ATOM 11778 N N    . SER A 1 21 ? -5.415  -5.368  1.477   1.00 0.00 ? 21 SER A N    10 
ATOM 11779 C CA   . SER A 1 21 ? -6.160  -6.529  1.933   1.00 0.00 ? 21 SER A CA   10 
ATOM 11780 C C    . SER A 1 21 ? -7.095  -6.134  3.079   1.00 0.00 ? 21 SER A C    10 
ATOM 11781 O O    . SER A 1 21 ? -8.230  -6.601  3.147   1.00 0.00 ? 21 SER A O    10 
ATOM 11782 C CB   . SER A 1 21 ? -5.217  -7.647  2.380   1.00 0.00 ? 21 SER A CB   10 
ATOM 11783 O OG   . SER A 1 21 ? -5.692  -8.933  1.991   1.00 0.00 ? 21 SER A OG   10 
ATOM 11784 H H    . SER A 1 21 ? -4.424  -5.428  1.595   1.00 0.00 ? 21 SER A H    10 
ATOM 11785 H HA   . SER A 1 21 ? -6.734  -6.861  1.069   1.00 0.00 ? 21 SER A HA   10 
ATOM 11786 H HB3  . SER A 1 21 ? -5.104  -7.615  3.464   1.00 0.00 ? 21 SER A HB3  10 
ATOM 11787 H HG   . SER A 1 21 ? -5.655  -9.561  2.769   1.00 0.00 ? 21 SER A HG   10 
ATOM 11788 N N    . GLU A 1 22 ? -6.582  -5.276  3.949   1.00 0.00 ? 22 GLU A N    10 
ATOM 11789 C CA   . GLU A 1 22 ? -7.357  -4.813  5.088   1.00 0.00 ? 22 GLU A CA   10 
ATOM 11790 C C    . GLU A 1 22 ? -8.645  -4.138  4.614   1.00 0.00 ? 22 GLU A C    10 
ATOM 11791 O O    . GLU A 1 22 ? -9.734  -4.471  5.079   1.00 0.00 ? 22 GLU A O    10 
ATOM 11792 C CB   . GLU A 1 22 ? -6.533  -3.868  5.964   1.00 0.00 ? 22 GLU A CB   10 
ATOM 11793 C CG   . GLU A 1 22 ? -5.511  -4.645  6.797   1.00 0.00 ? 22 GLU A CG   10 
ATOM 11794 C CD   . GLU A 1 22 ? -5.878  -4.615  8.282   1.00 0.00 ? 22 GLU A CD   10 
ATOM 11795 O OE1  . GLU A 1 22 ? -5.568  -3.588  8.924   1.00 0.00 ? 22 GLU A OE1  10 
ATOM 11796 O OE2  . GLU A 1 22 ? -6.461  -5.621  8.743   1.00 0.00 ? 22 GLU A OE2  10 
ATOM 11797 H H    . GLU A 1 22 ? -5.658  -4.901  3.887   1.00 0.00 ? 22 GLU A H    10 
ATOM 11798 H HA   . GLU A 1 22 ? -7.598  -5.710  5.659   1.00 0.00 ? 22 GLU A HA   10 
ATOM 11799 H HB3  . GLU A 1 22 ? -7.195  -3.308  6.625   1.00 0.00 ? 22 GLU A HB3  10 
ATOM 11800 H HG3  . GLU A 1 22 ? -4.519  -4.215  6.656   1.00 0.00 ? 22 GLU A HG3  10 
ATOM 11801 N N    . ALA A 1 23 ? -8.479  -3.198  3.694   1.00 0.00 ? 23 ALA A N    10 
ATOM 11802 C CA   . ALA A 1 23 ? -9.615  -2.472  3.151   1.00 0.00 ? 23 ALA A CA   10 
ATOM 11803 C C    . ALA A 1 23 ? -10.511 -3.440  2.377   1.00 0.00 ? 23 ALA A C    10 
ATOM 11804 O O    . ALA A 1 23 ? -11.710 -3.205  2.235   1.00 0.00 ? 23 ALA A O    10 
ATOM 11805 C CB   . ALA A 1 23 ? -9.114  -1.318  2.281   1.00 0.00 ? 23 ALA A CB   10 
ATOM 11806 H H    . ALA A 1 23 ? -7.591  -2.932  3.321   1.00 0.00 ? 23 ALA A H    10 
ATOM 11807 H HA   . ALA A 1 23 ? -10.177 -2.061  3.990   1.00 0.00 ? 23 ALA A HA   10 
ATOM 11808 H HB1  . ALA A 1 23 ? -9.685  -0.417  2.509   1.00 0.00 ? 23 ALA A HB1  10 
ATOM 11809 H HB2  . ALA A 1 23 ? -8.059  -1.140  2.485   1.00 0.00 ? 23 ALA A HB2  10 
ATOM 11810 H HB3  . ALA A 1 23 ? -9.244  -1.573  1.230   1.00 0.00 ? 23 ALA A HB3  10 
ATOM 11811 N N    . LEU A 1 24 ? -9.895  -4.510  1.896   1.00 0.00 ? 24 LEU A N    10 
ATOM 11812 C CA   . LEU A 1 24 ? -10.621 -5.515  1.139   1.00 0.00 ? 24 LEU A CA   10 
ATOM 11813 C C    . LEU A 1 24 ? -11.395 -6.414  2.104   1.00 0.00 ? 24 LEU A C    10 
ATOM 11814 O O    . LEU A 1 24 ? -12.405 -7.008  1.731   1.00 0.00 ? 24 LEU A O    10 
ATOM 11815 C CB   . LEU A 1 24 ? -9.671  -6.279  0.214   1.00 0.00 ? 24 LEU A CB   10 
ATOM 11816 C CG   . LEU A 1 24 ? -9.65