data_2D9H
# 
_entry.id   2D9H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D9H         
RCSB  RCSB025152   
WWPDB D_1000025152 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002004816.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D9H 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-09 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.P.'                                            1 
'Nagasima, T.'                                           2 
'Hayashi, F.'                                            3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the forth and fifth zf-C2H2 domains of zinc finger protein 692' 
_citation.journal_abbrev            'to be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, H.P.'   1 
primary 'Nagashima, T.' 2 
primary 'Hayashi, F.'   3 
primary 'Yokoyama, S.'  4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Zinc finger protein 692' 8371.428 1 ? ? 'zf-C2H2 domain' ? 
2 non-polymer syn 'ZINC ION'                65.409   2 ? ? ?                ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGLQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQESSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002004816.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  LEU n 
1 9  GLN n 
1 10 CYS n 
1 11 GLU n 
1 12 ILE n 
1 13 CYS n 
1 14 GLY n 
1 15 PHE n 
1 16 THR n 
1 17 CYS n 
1 18 ARG n 
1 19 GLN n 
1 20 LYS n 
1 21 ALA n 
1 22 SER n 
1 23 LEU n 
1 24 ASN n 
1 25 TRP n 
1 26 HIS n 
1 27 GLN n 
1 28 ARG n 
1 29 LYS n 
1 30 HIS n 
1 31 ALA n 
1 32 GLU n 
1 33 THR n 
1 34 VAL n 
1 35 ALA n 
1 36 ALA n 
1 37 LEU n 
1 38 ARG n 
1 39 PHE n 
1 40 PRO n 
1 41 CYS n 
1 42 GLU n 
1 43 PHE n 
1 44 CYS n 
1 45 GLY n 
1 46 LYS n 
1 47 ARG n 
1 48 PHE n 
1 49 GLU n 
1 50 LYS n 
1 51 PRO n 
1 52 ASP n 
1 53 SER n 
1 54 VAL n 
1 55 ALA n 
1 56 ALA n 
1 57 HIS n 
1 58 ARG n 
1 59 SER n 
1 60 LYS n 
1 61 SER n 
1 62 HIS n 
1 63 PRO n 
1 64 ALA n 
1 65 LEU n 
1 66 LEU n 
1 67 LEU n 
1 68 ALA n 
1 69 PRO n 
1 70 GLN n 
1 71 GLU n 
1 72 SER n 
1 73 SER n 
1 74 GLY n 
1 75 PRO n 
1 76 SER n 
1 77 SER n 
1 78 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ZNF692 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050302-52 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    NP_060335 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LQCEICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQES 
_struct_ref.pdbx_align_begin           417 
_struct_ref.pdbx_db_accession          21361766 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2D9H 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             21361766 
_struct_ref_seq.db_align_beg                  417 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  481 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       72 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2D9H GLY A 1  ? GB 21361766 ? ? 'CLONING ARTIFACT' 1  1  
1 2D9H SER A 2  ? GB 21361766 ? ? 'CLONING ARTIFACT' 2  2  
1 2D9H SER A 3  ? GB 21361766 ? ? 'CLONING ARTIFACT' 3  3  
1 2D9H GLY A 4  ? GB 21361766 ? ? 'CLONING ARTIFACT' 4  4  
1 2D9H SER A 5  ? GB 21361766 ? ? 'CLONING ARTIFACT' 5  5  
1 2D9H SER A 6  ? GB 21361766 ? ? 'CLONING ARTIFACT' 6  6  
1 2D9H GLY A 7  ? GB 21361766 ? ? 'CLONING ARTIFACT' 7  7  
1 2D9H SER A 73 ? GB 21361766 ? ? 'CLONING ARTIFACT' 73 8  
1 2D9H GLY A 74 ? GB 21361766 ? ? 'CLONING ARTIFACT' 74 9  
1 2D9H PRO A 75 ? GB 21361766 ? ? 'CLONING ARTIFACT' 75 10 
1 2D9H SER A 76 ? GB 21361766 ? ? 'CLONING ARTIFACT' 76 11 
1 2D9H SER A 77 ? GB 21361766 ? ? 'CLONING ARTIFACT' 77 12 
1 2D9H GLY A 78 ? GB 21361766 ? ? 'CLONING ARTIFACT' 78 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.25mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 50uM ZnCl2+1mM IDA' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2D9H 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2D9H 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function, structures with the lowest energy, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2D9H 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR    6.1C     Varian         1 
processing           NMRPipe 20031121 'Delaglio, F.' 2 
'data analysis'      NMRview 5.04     Johnson,B.A.   3 
'data analysis'      Kujira  0.93191  Kobayashi,N.   4 
'structure solution' CYANA   2.0.17   Guntent,P.     5 
refinement           CYANA   2.0.17   Guntent,P.     6 
# 
_exptl.entry_id          2D9H 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2D9H 
_struct.title                     'Solution structure of the forth and fifth zf-C2H2 domains of zinc finger protein 692' 
_struct.pdbx_descriptor           'Zinc finger protein 692' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D9H 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;zf-C2H2 domain, Zinc finger protein 692, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA binding protein
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 19 ? VAL A 34 ? GLN A 19 VAL A 34 1 ? 16 
HELX_P HELX_P2 2 LYS A 50 ? SER A 61 ? LYS A 50 SER A 61 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 10 SG  ? ? A ZN 201 A CYS 10 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 13 SG  ? ? A ZN 201 A CYS 13 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 26 NE2 ? ? A ZN 201 A HIS 26 1_555 ? ? ? ? ? ? ? 2.053 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 30 NE2 ? ? A ZN 201 A HIS 30 1_555 ? ? ? ? ? ? ? 2.013 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 41 SG  ? ? A ZN 401 A CYS 41 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 44 SG  ? ? A ZN 401 A CYS 44 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 57 NE2 ? ? A ZN 401 A HIS 57 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 62 NE2 ? ? A ZN 401 A HIS 62 1_555 ? ? ? ? ? ? ? 2.043 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 8  ? GLN A 9  ? LEU A 8  GLN A 9  
A 2 THR A 16 ? CYS A 17 ? THR A 16 CYS A 17 
B 1 PHE A 39 ? PRO A 40 ? PHE A 39 PRO A 40 
B 2 ARG A 47 ? PHE A 48 ? ARG A 47 PHE A 48 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 8  ? N LEU A 8  O CYS A 17 ? O CYS A 17 
B 1 2 N PHE A 39 ? N PHE A 39 O PHE A 48 ? O PHE A 48 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 10 ? CYS A 10 . ? 1_555 ? 
2 AC1 4 CYS A 13 ? CYS A 13 . ? 1_555 ? 
3 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 
4 AC1 4 HIS A 30 ? HIS A 30 . ? 1_555 ? 
5 AC2 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 
6 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
7 AC2 4 HIS A 57 ? HIS A 57 . ? 1_555 ? 
8 AC2 4 HIS A 62 ? HIS A 62 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2D9H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D9H 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? -14.970 -21.360 17.561  1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? -15.533 -20.244 16.824  1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? -15.853 -20.600 15.386  1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? -15.867 -21.775 15.019  1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? -14.470 -21.197 18.388  1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? -16.439 -19.923 17.315  1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? -14.824 -19.429 16.831  1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? -16.112 -19.584 14.570  1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? -16.439 -19.796 13.164  1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? -15.182 -19.754 12.302  1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? -14.449 -18.765 12.300  1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? -17.436 -18.739 12.685  1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? -18.768 -19.130 12.966  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? -16.085 -18.669 14.922  1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? -16.891 -20.773 13.073  1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? -17.234 -17.805 13.187  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? -17.329 -18.605 11.619  1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? -18.790 -19.628 13.786  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . SER A 1 3  ? -14.938 -20.836 11.569  1.00 0.00 ? 3   SER A N    1  
ATOM   20    C  CA   . SER A 1 3  ? -13.767 -20.926 10.704  1.00 0.00 ? 3   SER A CA   1  
ATOM   21    C  C    . SER A 1 3  ? -14.081 -20.395 9.309   1.00 0.00 ? 3   SER A C    1  
ATOM   22    O  O    . SER A 1 3  ? -15.191 -20.559 8.805   1.00 0.00 ? 3   SER A O    1  
ATOM   23    C  CB   . SER A 1 3  ? -13.283 -22.374 10.614  1.00 0.00 ? 3   SER A CB   1  
ATOM   24    O  OG   . SER A 1 3  ? -12.758 -22.815 11.854  1.00 0.00 ? 3   SER A OG   1  
ATOM   25    H  H    . SER A 1 3  ? -15.559 -21.593 11.613  1.00 0.00 ? 3   SER A H    1  
ATOM   26    H  HA   . SER A 1 3  ? -12.986 -20.321 11.140  1.00 0.00 ? 3   SER A HA   1  
ATOM   27    H  HB2  . SER A 1 3  ? -14.111 -23.011 10.341  1.00 0.00 ? 3   SER A HB2  1  
ATOM   28    H  HB3  . SER A 1 3  ? -12.510 -22.446 9.863   1.00 0.00 ? 3   SER A HB3  1  
ATOM   29    H  HG   . SER A 1 3  ? -12.273 -23.633 11.724  1.00 0.00 ? 3   SER A HG   1  
ATOM   30    N  N    . GLY A 1 4  ? -13.092 -19.756 8.689   1.00 0.00 ? 4   GLY A N    1  
ATOM   31    C  CA   . GLY A 1 4  ? -13.281 -19.210 7.358   1.00 0.00 ? 4   GLY A CA   1  
ATOM   32    C  C    . GLY A 1 4  ? -12.427 -17.983 7.108   1.00 0.00 ? 4   GLY A C    1  
ATOM   33    O  O    . GLY A 1 4  ? -11.203 -18.078 7.020   1.00 0.00 ? 4   GLY A O    1  
ATOM   34    H  H    . GLY A 1 4  ? -12.228 -19.655 9.140   1.00 0.00 ? 4   GLY A H    1  
ATOM   35    H  HA2  . GLY A 1 4  ? -13.028 -19.966 6.631   1.00 0.00 ? 4   GLY A HA2  1  
ATOM   36    H  HA3  . GLY A 1 4  ? -14.321 -18.941 7.236   1.00 0.00 ? 4   GLY A HA3  1  
ATOM   37    N  N    . SER A 1 5  ? -13.074 -16.827 6.993   1.00 0.00 ? 5   SER A N    1  
ATOM   38    C  CA   . SER A 1 5  ? -12.366 -15.576 6.746   1.00 0.00 ? 5   SER A CA   1  
ATOM   39    C  C    . SER A 1 5  ? -11.745 -15.040 8.032   1.00 0.00 ? 5   SER A C    1  
ATOM   40    O  O    . SER A 1 5  ? -12.365 -15.075 9.095   1.00 0.00 ? 5   SER A O    1  
ATOM   41    C  CB   . SER A 1 5  ? -13.317 -14.535 6.153   1.00 0.00 ? 5   SER A CB   1  
ATOM   42    O  OG   . SER A 1 5  ? -13.366 -14.635 4.740   1.00 0.00 ? 5   SER A OG   1  
ATOM   43    H  H    . SER A 1 5  ? -14.051 -16.816 7.073   1.00 0.00 ? 5   SER A H    1  
ATOM   44    H  HA   . SER A 1 5  ? -11.577 -15.777 6.036   1.00 0.00 ? 5   SER A HA   1  
ATOM   45    H  HB2  . SER A 1 5  ? -14.310 -14.693 6.547   1.00 0.00 ? 5   SER A HB2  1  
ATOM   46    H  HB3  . SER A 1 5  ? -12.976 -13.546 6.421   1.00 0.00 ? 5   SER A HB3  1  
ATOM   47    H  HG   . SER A 1 5  ? -12.569 -15.065 4.422   1.00 0.00 ? 5   SER A HG   1  
ATOM   48    N  N    . SER A 1 6  ? -10.516 -14.545 7.927   1.00 0.00 ? 6   SER A N    1  
ATOM   49    C  CA   . SER A 1 6  ? -9.809  -14.004 9.082   1.00 0.00 ? 6   SER A CA   1  
ATOM   50    C  C    . SER A 1 6  ? -10.152 -12.532 9.290   1.00 0.00 ? 6   SER A C    1  
ATOM   51    O  O    . SER A 1 6  ? -10.641 -12.141 10.349  1.00 0.00 ? 6   SER A O    1  
ATOM   52    C  CB   . SER A 1 6  ? -8.298  -14.166 8.903   1.00 0.00 ? 6   SER A CB   1  
ATOM   53    O  OG   . SER A 1 6  ? -7.884  -15.482 9.228   1.00 0.00 ? 6   SER A OG   1  
ATOM   54    H  H    . SER A 1 6  ? -10.074 -14.545 7.052   1.00 0.00 ? 6   SER A H    1  
ATOM   55    H  HA   . SER A 1 6  ? -10.121 -14.561 9.953   1.00 0.00 ? 6   SER A HA   1  
ATOM   56    H  HB2  . SER A 1 6  ? -8.036  -13.963 7.876   1.00 0.00 ? 6   SER A HB2  1  
ATOM   57    H  HB3  . SER A 1 6  ? -7.785  -13.470 9.550   1.00 0.00 ? 6   SER A HB3  1  
ATOM   58    H  HG   . SER A 1 6  ? -7.254  -15.450 9.952   1.00 0.00 ? 6   SER A HG   1  
ATOM   59    N  N    . GLY A 1 7  ? -9.893  -11.721 8.269   1.00 0.00 ? 7   GLY A N    1  
ATOM   60    C  CA   . GLY A 1 7  ? -10.181 -10.301 8.359   1.00 0.00 ? 7   GLY A CA   1  
ATOM   61    C  C    . GLY A 1 7  ? -10.072 -9.602  7.019   1.00 0.00 ? 7   GLY A C    1  
ATOM   62    O  O    . GLY A 1 7  ? -9.351  -10.056 6.129   1.00 0.00 ? 7   GLY A O    1  
ATOM   63    H  H    . GLY A 1 7  ? -9.503  -12.089 7.449   1.00 0.00 ? 7   GLY A H    1  
ATOM   64    H  HA2  . GLY A 1 7  ? -11.182 -10.171 8.741   1.00 0.00 ? 7   GLY A HA2  1  
ATOM   65    H  HA3  . GLY A 1 7  ? -9.482  -9.847  9.047   1.00 0.00 ? 7   GLY A HA3  1  
ATOM   66    N  N    . LEU A 1 8  ? -10.791 -8.494  6.871   1.00 0.00 ? 8   LEU A N    1  
ATOM   67    C  CA   . LEU A 1 8  ? -10.774 -7.731  5.628   1.00 0.00 ? 8   LEU A CA   1  
ATOM   68    C  C    . LEU A 1 8  ? -9.440  -7.014  5.448   1.00 0.00 ? 8   LEU A C    1  
ATOM   69    O  O    . LEU A 1 8  ? -8.797  -6.625  6.422   1.00 0.00 ? 8   LEU A O    1  
ATOM   70    C  CB   . LEU A 1 8  ? -11.917 -6.715  5.615   1.00 0.00 ? 8   LEU A CB   1  
ATOM   71    C  CG   . LEU A 1 8  ? -13.322 -7.283  5.818   1.00 0.00 ? 8   LEU A CG   1  
ATOM   72    C  CD1  . LEU A 1 8  ? -14.245 -6.228  6.408   1.00 0.00 ? 8   LEU A CD1  1  
ATOM   73    C  CD2  . LEU A 1 8  ? -13.881 -7.807  4.504   1.00 0.00 ? 8   LEU A CD2  1  
ATOM   74    H  H    . LEU A 1 8  ? -11.347 -8.182  7.615   1.00 0.00 ? 8   LEU A H    1  
ATOM   75    H  HA   . LEU A 1 8  ? -10.910 -8.424  4.812   1.00 0.00 ? 8   LEU A HA   1  
ATOM   76    H  HB2  . LEU A 1 8  ? -11.733 -5.999  6.401   1.00 0.00 ? 8   LEU A HB2  1  
ATOM   77    H  HB3  . LEU A 1 8  ? -11.899 -6.210  4.660   1.00 0.00 ? 8   LEU A HB3  1  
ATOM   78    H  HG   . LEU A 1 8  ? -13.273 -8.109  6.515   1.00 0.00 ? 8   LEU A HG   1  
ATOM   79    H  HD11 . LEU A 1 8  ? -13.737 -5.714  7.211   1.00 0.00 ? 8   LEU A HD11 1  
ATOM   80    H  HD12 . LEU A 1 8  ? -15.136 -6.702  6.791   1.00 0.00 ? 8   LEU A HD12 1  
ATOM   81    H  HD13 . LEU A 1 8  ? -14.517 -5.518  5.641   1.00 0.00 ? 8   LEU A HD13 1  
ATOM   82    H  HD21 . LEU A 1 8  ? -13.741 -7.065  3.732   1.00 0.00 ? 8   LEU A HD21 1  
ATOM   83    H  HD22 . LEU A 1 8  ? -14.936 -8.013  4.617   1.00 0.00 ? 8   LEU A HD22 1  
ATOM   84    H  HD23 . LEU A 1 8  ? -13.364 -8.715  4.229   1.00 0.00 ? 8   LEU A HD23 1  
ATOM   85    N  N    . GLN A 1 9  ? -9.031  -6.842  4.195   1.00 0.00 ? 9   GLN A N    1  
ATOM   86    C  CA   . GLN A 1 9  ? -7.774  -6.171  3.887   1.00 0.00 ? 9   GLN A CA   1  
ATOM   87    C  C    . GLN A 1 9  ? -7.989  -5.048  2.878   1.00 0.00 ? 9   GLN A C    1  
ATOM   88    O  O    . GLN A 1 9  ? -8.551  -5.263  1.804   1.00 0.00 ? 9   GLN A O    1  
ATOM   89    C  CB   . GLN A 1 9  ? -6.756  -7.174  3.342   1.00 0.00 ? 9   GLN A CB   1  
ATOM   90    C  CG   . GLN A 1 9  ? -5.364  -6.590  3.158   1.00 0.00 ? 9   GLN A CG   1  
ATOM   91    C  CD   . GLN A 1 9  ? -4.511  -6.711  4.406   1.00 0.00 ? 9   GLN A CD   1  
ATOM   92    O  OE1  . GLN A 1 9  ? -4.461  -7.766  5.038   1.00 0.00 ? 9   GLN A OE1  1  
ATOM   93    N  NE2  . GLN A 1 9  ? -3.834  -5.627  4.768   1.00 0.00 ? 9   GLN A NE2  1  
ATOM   94    H  H    . GLN A 1 9  ? -9.587  -7.175  3.460   1.00 0.00 ? 9   GLN A H    1  
ATOM   95    H  HA   . GLN A 1 9  ? -7.392  -5.747  4.803   1.00 0.00 ? 9   GLN A HA   1  
ATOM   96    H  HB2  . GLN A 1 9  ? -6.686  -8.006  4.026   1.00 0.00 ? 9   GLN A HB2  1  
ATOM   97    H  HB3  . GLN A 1 9  ? -7.100  -7.533  2.383   1.00 0.00 ? 9   GLN A HB3  1  
ATOM   98    H  HG2  . GLN A 1 9  ? -4.871  -7.113  2.352   1.00 0.00 ? 9   GLN A HG2  1  
ATOM   99    H  HG3  . GLN A 1 9  ? -5.458  -5.544  2.904   1.00 0.00 ? 9   GLN A HG3  1  
ATOM   100   H  HE21 . GLN A 1 9  ? -3.923  -4.821  4.217   1.00 0.00 ? 9   GLN A HE21 1  
ATOM   101   H  HE22 . GLN A 1 9  ? -3.276  -5.677  5.570   1.00 0.00 ? 9   GLN A HE22 1  
ATOM   102   N  N    . CYS A 1 10 ? -7.540  -3.848  3.231   1.00 0.00 ? 10  CYS A N    1  
ATOM   103   C  CA   . CYS A 1 10 ? -7.684  -2.689  2.358   1.00 0.00 ? 10  CYS A CA   1  
ATOM   104   C  C    . CYS A 1 10 ? -6.634  -2.710  1.250   1.00 0.00 ? 10  CYS A C    1  
ATOM   105   O  O    . CYS A 1 10 ? -5.536  -3.233  1.433   1.00 0.00 ? 10  CYS A O    1  
ATOM   106   C  CB   . CYS A 1 10 ? -7.563  -1.396  3.167   1.00 0.00 ? 10  CYS A CB   1  
ATOM   107   S  SG   . CYS A 1 10 ? -7.101  0.060   2.175   1.00 0.00 ? 10  CYS A SG   1  
ATOM   108   H  H    . CYS A 1 10 ? -7.101  -3.738  4.101   1.00 0.00 ? 10  CYS A H    1  
ATOM   109   H  HA   . CYS A 1 10 ? -8.664  -2.732  1.908   1.00 0.00 ? 10  CYS A HA   1  
ATOM   110   H  HB2  . CYS A 1 10 ? -8.512  -1.185  3.637   1.00 0.00 ? 10  CYS A HB2  1  
ATOM   111   H  HB3  . CYS A 1 10 ? -6.810  -1.527  3.930   1.00 0.00 ? 10  CYS A HB3  1  
ATOM   112   N  N    . GLU A 1 11 ? -6.982  -2.136  0.102   1.00 0.00 ? 11  GLU A N    1  
ATOM   113   C  CA   . GLU A 1 11 ? -6.070  -2.089  -1.034  1.00 0.00 ? 11  GLU A CA   1  
ATOM   114   C  C    . GLU A 1 11 ? -5.372  -0.735  -1.116  1.00 0.00 ? 11  GLU A C    1  
ATOM   115   O  O    . GLU A 1 11 ? -4.234  -0.638  -1.576  1.00 0.00 ? 11  GLU A O    1  
ATOM   116   C  CB   . GLU A 1 11 ? -6.827  -2.365  -2.336  1.00 0.00 ? 11  GLU A CB   1  
ATOM   117   C  CG   . GLU A 1 11 ? -7.844  -1.292  -2.687  1.00 0.00 ? 11  GLU A CG   1  
ATOM   118   C  CD   . GLU A 1 11 ? -8.576  -1.585  -3.982  1.00 0.00 ? 11  GLU A CD   1  
ATOM   119   O  OE1  . GLU A 1 11 ? -9.541  -2.377  -3.951  1.00 0.00 ? 11  GLU A OE1  1  
ATOM   120   O  OE2  . GLU A 1 11 ? -8.185  -1.022  -5.026  1.00 0.00 ? 11  GLU A OE2  1  
ATOM   121   H  H    . GLU A 1 11 ? -7.873  -1.736  0.018   1.00 0.00 ? 11  GLU A H    1  
ATOM   122   H  HA   . GLU A 1 11 ? -5.324  -2.857  -0.893  1.00 0.00 ? 11  GLU A HA   1  
ATOM   123   H  HB2  . GLU A 1 11 ? -6.114  -2.436  -3.144  1.00 0.00 ? 11  GLU A HB2  1  
ATOM   124   H  HB3  . GLU A 1 11 ? -7.347  -3.307  -2.242  1.00 0.00 ? 11  GLU A HB3  1  
ATOM   125   H  HG2  . GLU A 1 11 ? -8.568  -1.225  -1.890  1.00 0.00 ? 11  GLU A HG2  1  
ATOM   126   H  HG3  . GLU A 1 11 ? -7.331  -0.347  -2.787  1.00 0.00 ? 11  GLU A HG3  1  
ATOM   127   N  N    . ILE A 1 12 ? -6.063  0.308   -0.668  1.00 0.00 ? 12  ILE A N    1  
ATOM   128   C  CA   . ILE A 1 12 ? -5.510  1.657   -0.690  1.00 0.00 ? 12  ILE A CA   1  
ATOM   129   C  C    . ILE A 1 12 ? -4.166  1.711   0.028   1.00 0.00 ? 12  ILE A C    1  
ATOM   130   O  O    . ILE A 1 12 ? -3.121  1.891   -0.600  1.00 0.00 ? 12  ILE A O    1  
ATOM   131   C  CB   . ILE A 1 12 ? -6.469  2.669   -0.037  1.00 0.00 ? 12  ILE A CB   1  
ATOM   132   C  CG1  . ILE A 1 12 ? -7.869  2.543   -0.643  1.00 0.00 ? 12  ILE A CG1  1  
ATOM   133   C  CG2  . ILE A 1 12 ? -5.940  4.085   -0.205  1.00 0.00 ? 12  ILE A CG2  1  
ATOM   134   C  CD1  . ILE A 1 12 ? -7.898  2.738   -2.142  1.00 0.00 ? 12  ILE A CD1  1  
ATOM   135   H  H    . ILE A 1 12 ? -6.965  0.167   -0.313  1.00 0.00 ? 12  ILE A H    1  
ATOM   136   H  HA   . ILE A 1 12 ? -5.367  1.941   -1.723  1.00 0.00 ? 12  ILE A HA   1  
ATOM   137   H  HB   . ILE A 1 12 ? -6.521  2.453   1.019   1.00 0.00 ? 12  ILE A HB   1  
ATOM   138   H  HG12 . ILE A 1 12 ? -8.260  1.561   -0.429  1.00 0.00 ? 12  ILE A HG12 1  
ATOM   139   H  HG13 . ILE A 1 12 ? -8.514  3.287   -0.198  1.00 0.00 ? 12  ILE A HG13 1  
ATOM   140   H  HG21 . ILE A 1 12 ? -5.583  4.218   -1.216  1.00 0.00 ? 12  ILE A HG21 1  
ATOM   141   H  HG22 . ILE A 1 12 ? -6.732  4.792   -0.009  1.00 0.00 ? 12  ILE A HG22 1  
ATOM   142   H  HG23 . ILE A 1 12 ? -5.129  4.251   0.488   1.00 0.00 ? 12  ILE A HG23 1  
ATOM   143   H  HD11 . ILE A 1 12 ? -7.352  3.633   -2.400  1.00 0.00 ? 12  ILE A HD11 1  
ATOM   144   H  HD12 . ILE A 1 12 ? -7.444  1.886   -2.626  1.00 0.00 ? 12  ILE A HD12 1  
ATOM   145   H  HD13 . ILE A 1 12 ? -8.923  2.835   -2.473  1.00 0.00 ? 12  ILE A HD13 1  
ATOM   146   N  N    . CYS A 1 13 ? -4.199  1.554   1.347   1.00 0.00 ? 13  CYS A N    1  
ATOM   147   C  CA   . CYS A 1 13 ? -2.983  1.584   2.151   1.00 0.00 ? 13  CYS A CA   1  
ATOM   148   C  C    . CYS A 1 13 ? -2.539  0.171   2.517   1.00 0.00 ? 13  CYS A C    1  
ATOM   149   O  O    . CYS A 1 13 ? -1.348  -0.138  2.511   1.00 0.00 ? 13  CYS A O    1  
ATOM   150   C  CB   . CYS A 1 13 ? -3.208  2.405   3.422   1.00 0.00 ? 13  CYS A CB   1  
ATOM   151   S  SG   . CYS A 1 13 ? -4.539  1.770   4.492   1.00 0.00 ? 13  CYS A SG   1  
ATOM   152   H  H    . CYS A 1 13 ? -5.062  1.415   1.791   1.00 0.00 ? 13  CYS A H    1  
ATOM   153   H  HA   . CYS A 1 13 ? -2.207  2.051   1.564   1.00 0.00 ? 13  CYS A HA   1  
ATOM   154   H  HB2  . CYS A 1 13 ? -2.297  2.413   4.002   1.00 0.00 ? 13  CYS A HB2  1  
ATOM   155   H  HB3  . CYS A 1 13 ? -3.462  3.418   3.147   1.00 0.00 ? 13  CYS A HB3  1  
ATOM   156   N  N    . GLY A 1 14 ? -3.506  -0.684  2.837   1.00 0.00 ? 14  GLY A N    1  
ATOM   157   C  CA   . GLY A 1 14 ? -3.195  -2.054  3.201   1.00 0.00 ? 14  GLY A CA   1  
ATOM   158   C  C    . GLY A 1 14 ? -3.548  -2.365  4.643   1.00 0.00 ? 14  GLY A C    1  
ATOM   159   O  O    . GLY A 1 14 ? -2.885  -3.176  5.290   1.00 0.00 ? 14  GLY A O    1  
ATOM   160   H  H    . GLY A 1 14 ? -4.438  -0.382  2.825   1.00 0.00 ? 14  GLY A H    1  
ATOM   161   H  HA2  . GLY A 1 14 ? -3.745  -2.721  2.555   1.00 0.00 ? 14  GLY A HA2  1  
ATOM   162   H  HA3  . GLY A 1 14 ? -2.137  -2.221  3.058   1.00 0.00 ? 14  GLY A HA3  1  
ATOM   163   N  N    . PHE A 1 15 ? -4.593  -1.718  5.147   1.00 0.00 ? 15  PHE A N    1  
ATOM   164   C  CA   . PHE A 1 15 ? -5.031  -1.928  6.522   1.00 0.00 ? 15  PHE A CA   1  
ATOM   165   C  C    . PHE A 1 15 ? -5.865  -3.200  6.639   1.00 0.00 ? 15  PHE A C    1  
ATOM   166   O  O    . PHE A 1 15 ? -6.176  -3.847  5.638   1.00 0.00 ? 15  PHE A O    1  
ATOM   167   C  CB   . PHE A 1 15 ? -5.843  -0.726  7.010   1.00 0.00 ? 15  PHE A CB   1  
ATOM   168   C  CG   . PHE A 1 15 ? -6.032  -0.695  8.499   1.00 0.00 ? 15  PHE A CG   1  
ATOM   169   C  CD1  . PHE A 1 15 ? -4.953  -0.493  9.344   1.00 0.00 ? 15  PHE A CD1  1  
ATOM   170   C  CD2  . PHE A 1 15 ? -7.290  -0.869  9.055   1.00 0.00 ? 15  PHE A CD2  1  
ATOM   171   C  CE1  . PHE A 1 15 ? -5.123  -0.464  10.715  1.00 0.00 ? 15  PHE A CE1  1  
ATOM   172   C  CE2  . PHE A 1 15 ? -7.466  -0.840  10.426  1.00 0.00 ? 15  PHE A CE2  1  
ATOM   173   C  CZ   . PHE A 1 15 ? -6.382  -0.639  11.257  1.00 0.00 ? 15  PHE A CZ   1  
ATOM   174   H  H    . PHE A 1 15 ? -5.081  -1.083  4.581   1.00 0.00 ? 15  PHE A H    1  
ATOM   175   H  HA   . PHE A 1 15 ? -4.151  -2.030  7.137   1.00 0.00 ? 15  PHE A HA   1  
ATOM   176   H  HB2  . PHE A 1 15 ? -5.337  0.183   6.721   1.00 0.00 ? 15  PHE A HB2  1  
ATOM   177   H  HB3  . PHE A 1 15 ? -6.820  -0.750  6.550   1.00 0.00 ? 15  PHE A HB3  1  
ATOM   178   H  HD1  . PHE A 1 15 ? -3.967  -0.356  8.921   1.00 0.00 ? 15  PHE A HD1  1  
ATOM   179   H  HD2  . PHE A 1 15 ? -8.139  -1.028  8.407   1.00 0.00 ? 15  PHE A HD2  1  
ATOM   180   H  HE1  . PHE A 1 15 ? -4.273  -0.306  11.362  1.00 0.00 ? 15  PHE A HE1  1  
ATOM   181   H  HE2  . PHE A 1 15 ? -8.451  -0.978  10.846  1.00 0.00 ? 15  PHE A HE2  1  
ATOM   182   H  HZ   . PHE A 1 15 ? -6.517  -0.616  12.328  1.00 0.00 ? 15  PHE A HZ   1  
ATOM   183   N  N    . THR A 1 16 ? -6.224  -3.555  7.869   1.00 0.00 ? 16  THR A N    1  
ATOM   184   C  CA   . THR A 1 16 ? -7.020  -4.750  8.119   1.00 0.00 ? 16  THR A CA   1  
ATOM   185   C  C    . THR A 1 16 ? -7.996  -4.530  9.268   1.00 0.00 ? 16  THR A C    1  
ATOM   186   O  O    . THR A 1 16 ? -7.618  -4.032  10.329  1.00 0.00 ? 16  THR A O    1  
ATOM   187   C  CB   . THR A 1 16 ? -6.126  -5.962  8.443   1.00 0.00 ? 16  THR A CB   1  
ATOM   188   O  OG1  . THR A 1 16 ? -4.975  -5.538  9.182   1.00 0.00 ? 16  THR A OG1  1  
ATOM   189   C  CG2  . THR A 1 16 ? -5.686  -6.667  7.169   1.00 0.00 ? 16  THR A CG2  1  
ATOM   190   H  H    . THR A 1 16 ? -5.946  -2.998  8.626   1.00 0.00 ? 16  THR A H    1  
ATOM   191   H  HA   . THR A 1 16 ? -7.579  -4.972  7.221   1.00 0.00 ? 16  THR A HA   1  
ATOM   192   H  HB   . THR A 1 16 ? -6.694  -6.657  9.045   1.00 0.00 ? 16  THR A HB   1  
ATOM   193   H  HG1  . THR A 1 16 ? -5.160  -5.590  10.122  1.00 0.00 ? 16  THR A HG1  1  
ATOM   194   H  HG21 . THR A 1 16 ? -4.922  -6.082  6.679   1.00 0.00 ? 16  THR A HG21 1  
ATOM   195   H  HG22 . THR A 1 16 ? -6.533  -6.778  6.509   1.00 0.00 ? 16  THR A HG22 1  
ATOM   196   H  HG23 . THR A 1 16 ? -5.291  -7.641  7.415   1.00 0.00 ? 16  THR A HG23 1  
ATOM   197   N  N    . CYS A 1 17 ? -9.252  -4.905  9.051   1.00 0.00 ? 17  CYS A N    1  
ATOM   198   C  CA   . CYS A 1 17 ? -10.283 -4.749  10.071  1.00 0.00 ? 17  CYS A CA   1  
ATOM   199   C  C    . CYS A 1 17 ? -11.230 -5.945  10.075  1.00 0.00 ? 17  CYS A C    1  
ATOM   200   O  O    . CYS A 1 17 ? -11.472 -6.561  9.037   1.00 0.00 ? 17  CYS A O    1  
ATOM   201   C  CB   . CYS A 1 17 ? -11.072 -3.460  9.834   1.00 0.00 ? 17  CYS A CB   1  
ATOM   202   S  SG   . CYS A 1 17 ? -12.131 -3.501  8.370   1.00 0.00 ? 17  CYS A SG   1  
ATOM   203   H  H    . CYS A 1 17 ? -9.492  -5.296  8.185   1.00 0.00 ? 17  CYS A H    1  
ATOM   204   H  HA   . CYS A 1 17 ? -9.793  -4.690  11.031  1.00 0.00 ? 17  CYS A HA   1  
ATOM   205   H  HB2  . CYS A 1 17 ? -11.703 -3.271  10.690  1.00 0.00 ? 17  CYS A HB2  1  
ATOM   206   H  HB3  . CYS A 1 17 ? -10.380 -2.639  9.718   1.00 0.00 ? 17  CYS A HB3  1  
ATOM   207   H  HG   . CYS A 1 17 ? -12.133 -4.739  7.901   1.00 0.00 ? 17  CYS A HG   1  
ATOM   208   N  N    . ARG A 1 18 ? -11.761 -6.269  11.249  1.00 0.00 ? 18  ARG A N    1  
ATOM   209   C  CA   . ARG A 1 18 ? -12.678 -7.393  11.389  1.00 0.00 ? 18  ARG A CA   1  
ATOM   210   C  C    . ARG A 1 18 ? -14.082 -7.009  10.930  1.00 0.00 ? 18  ARG A C    1  
ATOM   211   O  O    . ARG A 1 18 ? -14.661 -7.662  10.062  1.00 0.00 ? 18  ARG A O    1  
ATOM   212   C  CB   . ARG A 1 18 ? -12.717 -7.870  12.842  1.00 0.00 ? 18  ARG A CB   1  
ATOM   213   C  CG   . ARG A 1 18 ? -11.506 -8.694  13.245  1.00 0.00 ? 18  ARG A CG   1  
ATOM   214   C  CD   . ARG A 1 18 ? -10.294 -7.812  13.504  1.00 0.00 ? 18  ARG A CD   1  
ATOM   215   N  NE   . ARG A 1 18 ? -9.041  -8.553  13.382  1.00 0.00 ? 18  ARG A NE   1  
ATOM   216   C  CZ   . ARG A 1 18 ? -7.903  -8.171  13.950  1.00 0.00 ? 18  ARG A CZ   1  
ATOM   217   N  NH1  . ARG A 1 18 ? -7.859  -7.063  14.675  1.00 0.00 ? 18  ARG A NH1  1  
ATOM   218   N  NH2  . ARG A 1 18 ? -6.805  -8.899  13.792  1.00 0.00 ? 18  ARG A NH2  1  
ATOM   219   H  H    . ARG A 1 18 ? -11.530 -5.739  12.041  1.00 0.00 ? 18  ARG A H    1  
ATOM   220   H  HA   . ARG A 1 18 ? -12.316 -8.197  10.765  1.00 0.00 ? 18  ARG A HA   1  
ATOM   221   H  HB2  . ARG A 1 18 ? -12.771 -7.007  13.490  1.00 0.00 ? 18  ARG A HB2  1  
ATOM   222   H  HB3  . ARG A 1 18 ? -13.600 -8.474  12.986  1.00 0.00 ? 18  ARG A HB3  1  
ATOM   223   H  HG2  . ARG A 1 18 ? -11.738 -9.241  14.147  1.00 0.00 ? 18  ARG A HG2  1  
ATOM   224   H  HG3  . ARG A 1 18 ? -11.273 -9.387  12.451  1.00 0.00 ? 18  ARG A HG3  1  
ATOM   225   H  HD2  . ARG A 1 18 ? -10.294 -7.004  12.789  1.00 0.00 ? 18  ARG A HD2  1  
ATOM   226   H  HD3  . ARG A 1 18 ? -10.366 -7.408  14.503  1.00 0.00 ? 18  ARG A HD3  1  
ATOM   227   H  HE   . ARG A 1 18 ? -9.051  -9.376  12.850  1.00 0.00 ? 18  ARG A HE   1  
ATOM   228   H  HH11 . ARG A 1 18 ? -8.686  -6.513  14.797  1.00 0.00 ? 18  ARG A HH11 1  
ATOM   229   H  HH12 . ARG A 1 18 ? -7.001  -6.778  15.103  1.00 0.00 ? 18  ARG A HH12 1  
ATOM   230   H  HH21 . ARG A 1 18 ? -6.834  -9.736  13.246  1.00 0.00 ? 18  ARG A HH21 1  
ATOM   231   H  HH22 . ARG A 1 18 ? -5.948  -8.611  14.220  1.00 0.00 ? 18  ARG A HH22 1  
ATOM   232   N  N    . GLN A 1 19 ? -14.622 -5.948  11.520  1.00 0.00 ? 19  GLN A N    1  
ATOM   233   C  CA   . GLN A 1 19 ? -15.959 -5.479  11.173  1.00 0.00 ? 19  GLN A CA   1  
ATOM   234   C  C    . GLN A 1 19 ? -15.954 -4.777  9.818   1.00 0.00 ? 19  GLN A C    1  
ATOM   235   O  O    . GLN A 1 19 ? -15.038 -4.018  9.504   1.00 0.00 ? 19  GLN A O    1  
ATOM   236   C  CB   . GLN A 1 19 ? -16.485 -4.530  12.250  1.00 0.00 ? 19  GLN A CB   1  
ATOM   237   C  CG   . GLN A 1 19 ? -16.959 -5.240  13.508  1.00 0.00 ? 19  GLN A CG   1  
ATOM   238   C  CD   . GLN A 1 19 ? -18.211 -6.062  13.277  1.00 0.00 ? 19  GLN A CD   1  
ATOM   239   O  OE1  . GLN A 1 19 ? -18.220 -6.986  12.464  1.00 0.00 ? 19  GLN A OE1  1  
ATOM   240   N  NE2  . GLN A 1 19 ? -19.279 -5.729  13.994  1.00 0.00 ? 19  GLN A NE2  1  
ATOM   241   H  H    . GLN A 1 19 ? -14.111 -5.470  12.205  1.00 0.00 ? 19  GLN A H    1  
ATOM   242   H  HA   . GLN A 1 19 ? -16.608 -6.340  11.116  1.00 0.00 ? 19  GLN A HA   1  
ATOM   243   H  HB2  . GLN A 1 19 ? -15.698 -3.844  12.525  1.00 0.00 ? 19  GLN A HB2  1  
ATOM   244   H  HB3  . GLN A 1 19 ? -17.315 -3.969  11.845  1.00 0.00 ? 19  GLN A HB3  1  
ATOM   245   H  HG2  . GLN A 1 19 ? -16.174 -5.897  13.852  1.00 0.00 ? 19  GLN A HG2  1  
ATOM   246   H  HG3  . GLN A 1 19 ? -17.166 -4.500  14.267  1.00 0.00 ? 19  GLN A HG3  1  
ATOM   247   H  HE21 . GLN A 1 19 ? -19.199 -4.980  14.622  1.00 0.00 ? 19  GLN A HE21 1  
ATOM   248   H  HE22 . GLN A 1 19 ? -20.102 -6.243  13.865  1.00 0.00 ? 19  GLN A HE22 1  
ATOM   249   N  N    . LYS A 1 20 ? -16.984 -5.037  9.020   1.00 0.00 ? 20  LYS A N    1  
ATOM   250   C  CA   . LYS A 1 20 ? -17.100 -4.430  7.699   1.00 0.00 ? 20  LYS A CA   1  
ATOM   251   C  C    . LYS A 1 20 ? -17.152 -2.909  7.802   1.00 0.00 ? 20  LYS A C    1  
ATOM   252   O  O    . LYS A 1 20 ? -16.450 -2.205  7.077   1.00 0.00 ? 20  LYS A O    1  
ATOM   253   C  CB   . LYS A 1 20 ? -18.352 -4.947  6.987   1.00 0.00 ? 20  LYS A CB   1  
ATOM   254   C  CG   . LYS A 1 20 ? -18.356 -4.677  5.492   1.00 0.00 ? 20  LYS A CG   1  
ATOM   255   C  CD   . LYS A 1 20 ? -17.410 -5.610  4.754   1.00 0.00 ? 20  LYS A CD   1  
ATOM   256   C  CE   . LYS A 1 20 ? -17.983 -7.015  4.648   1.00 0.00 ? 20  LYS A CE   1  
ATOM   257   N  NZ   . LYS A 1 20 ? -19.073 -7.094  3.636   1.00 0.00 ? 20  LYS A NZ   1  
ATOM   258   H  H    . LYS A 1 20 ? -17.684 -5.651  9.327   1.00 0.00 ? 20  LYS A H    1  
ATOM   259   H  HA   . LYS A 1 20 ? -16.229 -4.711  7.127   1.00 0.00 ? 20  LYS A HA   1  
ATOM   260   H  HB2  . LYS A 1 20 ? -18.424 -6.014  7.139   1.00 0.00 ? 20  LYS A HB2  1  
ATOM   261   H  HB3  . LYS A 1 20 ? -19.220 -4.471  7.419   1.00 0.00 ? 20  LYS A HB3  1  
ATOM   262   H  HG2  . LYS A 1 20 ? -19.357 -4.822  5.112   1.00 0.00 ? 20  LYS A HG2  1  
ATOM   263   H  HG3  . LYS A 1 20 ? -18.048 -3.656  5.319   1.00 0.00 ? 20  LYS A HG3  1  
ATOM   264   H  HD2  . LYS A 1 20 ? -17.243 -5.226  3.759   1.00 0.00 ? 20  LYS A HD2  1  
ATOM   265   H  HD3  . LYS A 1 20 ? -16.472 -5.653  5.289   1.00 0.00 ? 20  LYS A HD3  1  
ATOM   266   H  HE2  . LYS A 1 20 ? -17.192 -7.692  4.365   1.00 0.00 ? 20  LYS A HE2  1  
ATOM   267   H  HE3  . LYS A 1 20 ? -18.377 -7.303  5.611   1.00 0.00 ? 20  LYS A HE3  1  
ATOM   268   H  HZ1  . LYS A 1 20 ? -19.413 -8.074  3.553   1.00 0.00 ? 20  LYS A HZ1  1  
ATOM   269   H  HZ2  . LYS A 1 20 ? -18.723 -6.782  2.708   1.00 0.00 ? 20  LYS A HZ2  1  
ATOM   270   H  HZ3  . LYS A 1 20 ? -19.868 -6.486  3.917   1.00 0.00 ? 20  LYS A HZ3  1  
ATOM   271   N  N    . ALA A 1 21 ? -17.988 -2.410  8.707   1.00 0.00 ? 21  ALA A N    1  
ATOM   272   C  CA   . ALA A 1 21 ? -18.128 -0.973  8.906   1.00 0.00 ? 21  ALA A CA   1  
ATOM   273   C  C    . ALA A 1 21 ? -16.766 -0.290  8.954   1.00 0.00 ? 21  ALA A C    1  
ATOM   274   O  O    . ALA A 1 21 ? -16.516 0.670   8.225   1.00 0.00 ? 21  ALA A O    1  
ATOM   275   C  CB   . ALA A 1 21 ? -18.908 -0.691  10.182  1.00 0.00 ? 21  ALA A CB   1  
ATOM   276   H  H    . ALA A 1 21 ? -18.521 -3.023  9.254   1.00 0.00 ? 21  ALA A H    1  
ATOM   277   H  HA   . ALA A 1 21 ? -18.690 -0.574  8.074   1.00 0.00 ? 21  ALA A HA   1  
ATOM   278   H  HB1  . ALA A 1 21 ? -18.760 0.339   10.472  1.00 0.00 ? 21  ALA A HB1  1  
ATOM   279   H  HB2  . ALA A 1 21 ? -19.958 -0.869  10.008  1.00 0.00 ? 21  ALA A HB2  1  
ATOM   280   H  HB3  . ALA A 1 21 ? -18.557 -1.341  10.969  1.00 0.00 ? 21  ALA A HB3  1  
ATOM   281   N  N    . SER A 1 22 ? -15.888 -0.790  9.818   1.00 0.00 ? 22  SER A N    1  
ATOM   282   C  CA   . SER A 1 22 ? -14.552 -0.224  9.965   1.00 0.00 ? 22  SER A CA   1  
ATOM   283   C  C    . SER A 1 22 ? -13.939 0.081   8.601   1.00 0.00 ? 22  SER A C    1  
ATOM   284   O  O    . SER A 1 22 ? -13.513 1.206   8.337   1.00 0.00 ? 22  SER A O    1  
ATOM   285   C  CB   . SER A 1 22 ? -13.650 -1.188  10.738  1.00 0.00 ? 22  SER A CB   1  
ATOM   286   O  OG   . SER A 1 22 ? -14.156 -1.427  12.040  1.00 0.00 ? 22  SER A OG   1  
ATOM   287   H  H    . SER A 1 22 ? -16.147 -1.556  10.372  1.00 0.00 ? 22  SER A H    1  
ATOM   288   H  HA   . SER A 1 22 ? -14.641 0.697   10.521  1.00 0.00 ? 22  SER A HA   1  
ATOM   289   H  HB2  . SER A 1 22 ? -13.592 -2.127  10.209  1.00 0.00 ? 22  SER A HB2  1  
ATOM   290   H  HB3  . SER A 1 22 ? -12.661 -0.761  10.822  1.00 0.00 ? 22  SER A HB3  1  
ATOM   291   H  HG   . SER A 1 22 ? -14.745 -0.711  12.291  1.00 0.00 ? 22  SER A HG   1  
ATOM   292   N  N    . LEU A 1 23 ? -13.897 -0.929  7.739   1.00 0.00 ? 23  LEU A N    1  
ATOM   293   C  CA   . LEU A 1 23 ? -13.336 -0.770  6.402   1.00 0.00 ? 23  LEU A CA   1  
ATOM   294   C  C    . LEU A 1 23 ? -13.963 0.422   5.686   1.00 0.00 ? 23  LEU A C    1  
ATOM   295   O  O    . LEU A 1 23 ? -13.262 1.328   5.239   1.00 0.00 ? 23  LEU A O    1  
ATOM   296   C  CB   . LEU A 1 23 ? -13.554 -2.043  5.582   1.00 0.00 ? 23  LEU A CB   1  
ATOM   297   C  CG   . LEU A 1 23 ? -12.560 -2.289  4.447   1.00 0.00 ? 23  LEU A CG   1  
ATOM   298   C  CD1  . LEU A 1 23 ? -11.145 -2.407  4.993   1.00 0.00 ? 23  LEU A CD1  1  
ATOM   299   C  CD2  . LEU A 1 23 ? -12.938 -3.540  3.667   1.00 0.00 ? 23  LEU A CD2  1  
ATOM   300   H  H    . LEU A 1 23 ? -14.252 -1.802  8.007   1.00 0.00 ? 23  LEU A H    1  
ATOM   301   H  HA   . LEU A 1 23 ? -12.276 -0.596  6.506   1.00 0.00 ? 23  LEU A HA   1  
ATOM   302   H  HB2  . LEU A 1 23 ? -13.500 -2.884  6.256   1.00 0.00 ? 23  LEU A HB2  1  
ATOM   303   H  HB3  . LEU A 1 23 ? -14.544 -1.993  5.151   1.00 0.00 ? 23  LEU A HB3  1  
ATOM   304   H  HG   . LEU A 1 23 ? -12.585 -1.449  3.766   1.00 0.00 ? 23  LEU A HG   1  
ATOM   305   H  HD11 . LEU A 1 23 ? -10.674 -3.287  4.583   1.00 0.00 ? 23  LEU A HD11 1  
ATOM   306   H  HD12 . LEU A 1 23 ? -11.180 -2.485  6.069   1.00 0.00 ? 23  LEU A HD12 1  
ATOM   307   H  HD13 . LEU A 1 23 ? -10.578 -1.531  4.714   1.00 0.00 ? 23  LEU A HD13 1  
ATOM   308   H  HD21 . LEU A 1 23 ? -13.880 -3.378  3.164   1.00 0.00 ? 23  LEU A HD21 1  
ATOM   309   H  HD22 . LEU A 1 23 ? -13.033 -4.373  4.348   1.00 0.00 ? 23  LEU A HD22 1  
ATOM   310   H  HD23 . LEU A 1 23 ? -12.172 -3.755  2.938   1.00 0.00 ? 23  LEU A HD23 1  
ATOM   311   N  N    . ASN A 1 24 ? -15.288 0.416   5.585   1.00 0.00 ? 24  ASN A N    1  
ATOM   312   C  CA   . ASN A 1 24 ? -16.010 1.498   4.926   1.00 0.00 ? 24  ASN A CA   1  
ATOM   313   C  C    . ASN A 1 24 ? -15.623 2.850   5.518   1.00 0.00 ? 24  ASN A C    1  
ATOM   314   O  O    . ASN A 1 24 ? -15.251 3.773   4.794   1.00 0.00 ? 24  ASN A O    1  
ATOM   315   C  CB   . ASN A 1 24 ? -17.519 1.285   5.054   1.00 0.00 ? 24  ASN A CB   1  
ATOM   316   C  CG   . ASN A 1 24 ? -18.021 0.158   4.171   1.00 0.00 ? 24  ASN A CG   1  
ATOM   317   O  OD1  . ASN A 1 24 ? -18.277 0.353   2.983   1.00 0.00 ? 24  ASN A OD1  1  
ATOM   318   N  ND2  . ASN A 1 24 ? -18.165 -1.028  4.751   1.00 0.00 ? 24  ASN A ND2  1  
ATOM   319   H  H    . ASN A 1 24 ? -15.793 -0.335  5.962   1.00 0.00 ? 24  ASN A H    1  
ATOM   320   H  HA   . ASN A 1 24 ? -15.741 1.486   3.880   1.00 0.00 ? 24  ASN A HA   1  
ATOM   321   H  HB2  . ASN A 1 24 ? -17.757 1.045   6.080   1.00 0.00 ? 24  ASN A HB2  1  
ATOM   322   H  HB3  . ASN A 1 24 ? -18.031 2.193   4.773   1.00 0.00 ? 24  ASN A HB3  1  
ATOM   323   H  HD21 . ASN A 1 24 ? -17.942 -1.109  5.702   1.00 0.00 ? 24  ASN A HD21 1  
ATOM   324   H  HD22 . ASN A 1 24 ? -18.487 -1.774  4.203   1.00 0.00 ? 24  ASN A HD22 1  
ATOM   325   N  N    . TRP A 1 25 ? -15.714 2.958   6.839   1.00 0.00 ? 25  TRP A N    1  
ATOM   326   C  CA   . TRP A 1 25 ? -15.373 4.196   7.530   1.00 0.00 ? 25  TRP A CA   1  
ATOM   327   C  C    . TRP A 1 25 ? -13.898 4.534   7.346   1.00 0.00 ? 25  TRP A C    1  
ATOM   328   O  O    . TRP A 1 25 ? -13.507 5.700   7.399   1.00 0.00 ? 25  TRP A O    1  
ATOM   329   C  CB   . TRP A 1 25 ? -15.701 4.081   9.019   1.00 0.00 ? 25  TRP A CB   1  
ATOM   330   C  CG   . TRP A 1 25 ? -15.618 5.387   9.749   1.00 0.00 ? 25  TRP A CG   1  
ATOM   331   C  CD1  . TRP A 1 25 ? -14.486 6.096   10.033  1.00 0.00 ? 25  TRP A CD1  1  
ATOM   332   C  CD2  . TRP A 1 25 ? -16.710 6.139   10.289  1.00 0.00 ? 25  TRP A CD2  1  
ATOM   333   N  NE1  . TRP A 1 25 ? -14.809 7.243   10.717  1.00 0.00 ? 25  TRP A NE1  1  
ATOM   334   C  CE2  . TRP A 1 25 ? -16.167 7.293   10.885  1.00 0.00 ? 25  TRP A CE2  1  
ATOM   335   C  CE3  . TRP A 1 25 ? -18.094 5.950   10.324  1.00 0.00 ? 25  TRP A CE3  1  
ATOM   336   C  CZ2  . TRP A 1 25 ? -16.961 8.251   11.510  1.00 0.00 ? 25  TRP A CZ2  1  
ATOM   337   C  CZ3  . TRP A 1 25 ? -18.881 6.902   10.945  1.00 0.00 ? 25  TRP A CZ3  1  
ATOM   338   C  CH2  . TRP A 1 25 ? -18.313 8.041   11.530  1.00 0.00 ? 25  TRP A CH2  1  
ATOM   339   H  H    . TRP A 1 25 ? -16.017 2.186   7.363   1.00 0.00 ? 25  TRP A H    1  
ATOM   340   H  HA   . TRP A 1 25 ? -15.968 4.989   7.100   1.00 0.00 ? 25  TRP A HA   1  
ATOM   341   H  HB2  . TRP A 1 25 ? -16.705 3.700   9.132   1.00 0.00 ? 25  TRP A HB2  1  
ATOM   342   H  HB3  . TRP A 1 25 ? -15.006 3.395   9.481   1.00 0.00 ? 25  TRP A HB3  1  
ATOM   343   H  HD1  . TRP A 1 25 ? -13.489 5.787   9.756   1.00 0.00 ? 25  TRP A HD1  1  
ATOM   344   H  HE1  . TRP A 1 25 ? -14.169 7.917   11.031  1.00 0.00 ? 25  TRP A HE1  1  
ATOM   345   H  HE3  . TRP A 1 25 ? -18.551 5.078   9.878   1.00 0.00 ? 25  TRP A HE3  1  
ATOM   346   H  HZ2  . TRP A 1 25 ? -16.538 9.135   11.966  1.00 0.00 ? 25  TRP A HZ2  1  
ATOM   347   H  HZ3  . TRP A 1 25 ? -19.953 6.773   10.982  1.00 0.00 ? 25  TRP A HZ3  1  
ATOM   348   H  HH2  . TRP A 1 25 ? -18.965 8.758   12.004  1.00 0.00 ? 25  TRP A HH2  1  
ATOM   349   N  N    . HIS A 1 26 ? -13.083 3.507   7.130   1.00 0.00 ? 26  HIS A N    1  
ATOM   350   C  CA   . HIS A 1 26 ? -11.649 3.696   6.937   1.00 0.00 ? 26  HIS A CA   1  
ATOM   351   C  C    . HIS A 1 26 ? -11.338 4.046   5.485   1.00 0.00 ? 26  HIS A C    1  
ATOM   352   O  O    . HIS A 1 26 ? -10.259 4.552   5.178   1.00 0.00 ? 26  HIS A O    1  
ATOM   353   C  CB   . HIS A 1 26 ? -10.888 2.434   7.344   1.00 0.00 ? 26  HIS A CB   1  
ATOM   354   C  CG   . HIS A 1 26 ? -9.619  2.226   6.576   1.00 0.00 ? 26  HIS A CG   1  
ATOM   355   N  ND1  . HIS A 1 26 ? -8.432  2.848   6.899   1.00 0.00 ? 26  HIS A ND1  1  
ATOM   356   C  CD2  . HIS A 1 26 ? -9.356  1.456   5.493   1.00 0.00 ? 26  HIS A CD2  1  
ATOM   357   C  CE1  . HIS A 1 26 ? -7.494  2.472   6.048   1.00 0.00 ? 26  HIS A CE1  1  
ATOM   358   N  NE2  . HIS A 1 26 ? -8.029  1.628   5.185   1.00 0.00 ? 26  HIS A NE2  1  
ATOM   359   H  H    . HIS A 1 26 ? -13.454 2.600   7.098   1.00 0.00 ? 26  HIS A H    1  
ATOM   360   H  HA   . HIS A 1 26 ? -11.335 4.514   7.567   1.00 0.00 ? 26  HIS A HA   1  
ATOM   361   H  HB2  . HIS A 1 26 ? -10.633 2.497   8.392   1.00 0.00 ? 26  HIS A HB2  1  
ATOM   362   H  HB3  . HIS A 1 26 ? -11.520 1.572   7.184   1.00 0.00 ? 26  HIS A HB3  1  
ATOM   363   H  HD1  . HIS A 1 26 ? -8.298  3.474   7.641   1.00 0.00 ? 26  HIS A HD1  1  
ATOM   364   H  HD2  . HIS A 1 26 ? -10.059 0.825   4.968   1.00 0.00 ? 26  HIS A HD2  1  
ATOM   365   H  HE1  . HIS A 1 26 ? -6.465  2.799   6.056   1.00 0.00 ? 26  HIS A HE1  1  
ATOM   366   N  N    . GLN A 1 27 ? -12.289 3.772   4.598   1.00 0.00 ? 27  GLN A N    1  
ATOM   367   C  CA   . GLN A 1 27 ? -12.114 4.057   3.179   1.00 0.00 ? 27  GLN A CA   1  
ATOM   368   C  C    . GLN A 1 27 ? -12.612 5.458   2.840   1.00 0.00 ? 27  GLN A C    1  
ATOM   369   O  O    . GLN A 1 27 ? -12.011 6.161   2.027   1.00 0.00 ? 27  GLN A O    1  
ATOM   370   C  CB   . GLN A 1 27 ? -12.856 3.021   2.334   1.00 0.00 ? 27  GLN A CB   1  
ATOM   371   C  CG   . GLN A 1 27 ? -12.183 1.658   2.312   1.00 0.00 ? 27  GLN A CG   1  
ATOM   372   C  CD   . GLN A 1 27 ? -12.559 0.840   1.093   1.00 0.00 ? 27  GLN A CD   1  
ATOM   373   O  OE1  . GLN A 1 27 ? -13.450 1.215   0.330   1.00 0.00 ? 27  GLN A OE1  1  
ATOM   374   N  NE2  . GLN A 1 27 ? -11.880 -0.285  0.902   1.00 0.00 ? 27  GLN A NE2  1  
ATOM   375   H  H    . GLN A 1 27 ? -13.127 3.369   4.905   1.00 0.00 ? 27  GLN A H    1  
ATOM   376   H  HA   . GLN A 1 27 ? -11.059 4.000   2.957   1.00 0.00 ? 27  GLN A HA   1  
ATOM   377   H  HB2  . GLN A 1 27 ? -13.854 2.899   2.728   1.00 0.00 ? 27  GLN A HB2  1  
ATOM   378   H  HB3  . GLN A 1 27 ? -12.921 3.382   1.318   1.00 0.00 ? 27  GLN A HB3  1  
ATOM   379   H  HG2  . GLN A 1 27 ? -11.112 1.799   2.315   1.00 0.00 ? 27  GLN A HG2  1  
ATOM   380   H  HG3  . GLN A 1 27 ? -12.474 1.113   3.198   1.00 0.00 ? 27  GLN A HG3  1  
ATOM   381   H  HE21 . GLN A 1 27 ? -11.184 -0.521  1.551   1.00 0.00 ? 27  GLN A HE21 1  
ATOM   382   H  HE22 . GLN A 1 27 ? -12.103 -0.834  0.122   1.00 0.00 ? 27  GLN A HE22 1  
ATOM   383   N  N    . ARG A 1 28 ? -13.714 5.857   3.467   1.00 0.00 ? 28  ARG A N    1  
ATOM   384   C  CA   . ARG A 1 28 ? -14.293 7.174   3.231   1.00 0.00 ? 28  ARG A CA   1  
ATOM   385   C  C    . ARG A 1 28 ? -13.221 8.258   3.289   1.00 0.00 ? 28  ARG A C    1  
ATOM   386   O  O    . ARG A 1 28 ? -13.281 9.246   2.556   1.00 0.00 ? 28  ARG A O    1  
ATOM   387   C  CB   . ARG A 1 28 ? -15.386 7.466   4.261   1.00 0.00 ? 28  ARG A CB   1  
ATOM   388   C  CG   . ARG A 1 28 ? -14.851 7.977   5.588   1.00 0.00 ? 28  ARG A CG   1  
ATOM   389   C  CD   . ARG A 1 28 ? -15.911 7.917   6.677   1.00 0.00 ? 28  ARG A CD   1  
ATOM   390   N  NE   . ARG A 1 28 ? -16.763 9.104   6.676   1.00 0.00 ? 28  ARG A NE   1  
ATOM   391   C  CZ   . ARG A 1 28 ? -16.462 10.225  7.322   1.00 0.00 ? 28  ARG A CZ   1  
ATOM   392   N  NH1  . ARG A 1 28 ? -15.336 10.312  8.017   1.00 0.00 ? 28  ARG A NH1  1  
ATOM   393   N  NH2  . ARG A 1 28 ? -17.288 11.262  7.274   1.00 0.00 ? 28  ARG A NH2  1  
ATOM   394   H  H    . ARG A 1 28 ? -14.147 5.252   4.104   1.00 0.00 ? 28  ARG A H    1  
ATOM   395   H  HA   . ARG A 1 28 ? -14.732 7.171   2.244   1.00 0.00 ? 28  ARG A HA   1  
ATOM   396   H  HB2  . ARG A 1 28 ? -16.055 8.211   3.857   1.00 0.00 ? 28  ARG A HB2  1  
ATOM   397   H  HB3  . ARG A 1 28 ? -15.941 6.559   4.446   1.00 0.00 ? 28  ARG A HB3  1  
ATOM   398   H  HG2  . ARG A 1 28 ? -14.010 7.367   5.886   1.00 0.00 ? 28  ARG A HG2  1  
ATOM   399   H  HG3  . ARG A 1 28 ? -14.530 9.001   5.466   1.00 0.00 ? 28  ARG A HG3  1  
ATOM   400   H  HD2  . ARG A 1 28 ? -16.526 7.045   6.514   1.00 0.00 ? 28  ARG A HD2  1  
ATOM   401   H  HD3  . ARG A 1 28 ? -15.420 7.838   7.635   1.00 0.00 ? 28  ARG A HD3  1  
ATOM   402   H  HE   . ARG A 1 28 ? -17.600 9.061   6.170   1.00 0.00 ? 28  ARG A HE   1  
ATOM   403   H  HH11 . ARG A 1 28 ? -14.711 9.532   8.053   1.00 0.00 ? 28  ARG A HH11 1  
ATOM   404   H  HH12 . ARG A 1 28 ? -15.111 11.157  8.501   1.00 0.00 ? 28  ARG A HH12 1  
ATOM   405   H  HH21 . ARG A 1 28 ? -18.138 11.200  6.752   1.00 0.00 ? 28  ARG A HH21 1  
ATOM   406   H  HH22 . ARG A 1 28 ? -17.061 12.105  7.761   1.00 0.00 ? 28  ARG A HH22 1  
ATOM   407   N  N    . LYS A 1 29 ? -12.241 8.068   4.165   1.00 0.00 ? 29  LYS A N    1  
ATOM   408   C  CA   . LYS A 1 29 ? -11.155 9.028   4.320   1.00 0.00 ? 29  LYS A CA   1  
ATOM   409   C  C    . LYS A 1 29 ? -10.205 8.971   3.128   1.00 0.00 ? 29  LYS A C    1  
ATOM   410   O  O    . LYS A 1 29 ? -9.704  9.999   2.671   1.00 0.00 ? 29  LYS A O    1  
ATOM   411   C  CB   . LYS A 1 29 ? -10.384 8.753   5.613   1.00 0.00 ? 29  LYS A CB   1  
ATOM   412   C  CG   . LYS A 1 29 ? -9.824  7.344   5.700   1.00 0.00 ? 29  LYS A CG   1  
ATOM   413   C  CD   . LYS A 1 29 ? -8.689  7.256   6.707   1.00 0.00 ? 29  LYS A CD   1  
ATOM   414   C  CE   . LYS A 1 29 ? -8.696  5.923   7.439   1.00 0.00 ? 29  LYS A CE   1  
ATOM   415   N  NZ   . LYS A 1 29 ? -7.901  5.977   8.697   1.00 0.00 ? 29  LYS A NZ   1  
ATOM   416   H  H    . LYS A 1 29 ? -12.248 7.260   4.722   1.00 0.00 ? 29  LYS A H    1  
ATOM   417   H  HA   . LYS A 1 29 ? -11.589 10.015  4.372   1.00 0.00 ? 29  LYS A HA   1  
ATOM   418   H  HB2  . LYS A 1 29 ? -9.562  9.450   5.683   1.00 0.00 ? 29  LYS A HB2  1  
ATOM   419   H  HB3  . LYS A 1 29 ? -11.047 8.907   6.453   1.00 0.00 ? 29  LYS A HB3  1  
ATOM   420   H  HG2  . LYS A 1 29 ? -10.612 6.671   6.003   1.00 0.00 ? 29  LYS A HG2  1  
ATOM   421   H  HG3  . LYS A 1 29 ? -9.454  7.053   4.727   1.00 0.00 ? 29  LYS A HG3  1  
ATOM   422   H  HD2  . LYS A 1 29 ? -7.749  7.363   6.187   1.00 0.00 ? 29  LYS A HD2  1  
ATOM   423   H  HD3  . LYS A 1 29 ? -8.797  8.054   7.428   1.00 0.00 ? 29  LYS A HD3  1  
ATOM   424   H  HE2  . LYS A 1 29 ? -9.716  5.664   7.679   1.00 0.00 ? 29  LYS A HE2  1  
ATOM   425   H  HE3  . LYS A 1 29 ? -8.277  5.169   6.790   1.00 0.00 ? 29  LYS A HE3  1  
ATOM   426   H  HZ1  . LYS A 1 29 ? -7.395  5.080   8.838   1.00 0.00 ? 29  LYS A HZ1  1  
ATOM   427   H  HZ2  . LYS A 1 29 ? -8.529  6.140   9.510   1.00 0.00 ? 29  LYS A HZ2  1  
ATOM   428   H  HZ3  . LYS A 1 29 ? -7.207  6.750   8.648   1.00 0.00 ? 29  LYS A HZ3  1  
ATOM   429   N  N    . HIS A 1 30 ? -9.962  7.764   2.627   1.00 0.00 ? 30  HIS A N    1  
ATOM   430   C  CA   . HIS A 1 30 ? -9.074  7.574   1.486   1.00 0.00 ? 30  HIS A CA   1  
ATOM   431   C  C    . HIS A 1 30 ? -9.503  8.449   0.312   1.00 0.00 ? 30  HIS A C    1  
ATOM   432   O  O    . HIS A 1 30 ? -8.667  9.016   -0.390  1.00 0.00 ? 30  HIS A O    1  
ATOM   433   C  CB   . HIS A 1 30 ? -9.058  6.105   1.064   1.00 0.00 ? 30  HIS A CB   1  
ATOM   434   C  CG   . HIS A 1 30 ? -8.129  5.258   1.877   1.00 0.00 ? 30  HIS A CG   1  
ATOM   435   N  ND1  . HIS A 1 30 ? -6.977  5.747   2.456   1.00 0.00 ? 30  HIS A ND1  1  
ATOM   436   C  CD2  . HIS A 1 30 ? -8.188  3.947   2.210   1.00 0.00 ? 30  HIS A CD2  1  
ATOM   437   C  CE1  . HIS A 1 30 ? -6.366  4.773   3.107   1.00 0.00 ? 30  HIS A CE1  1  
ATOM   438   N  NE2  . HIS A 1 30 ? -7.081  3.670   2.974   1.00 0.00 ? 30  HIS A NE2  1  
ATOM   439   H  H    . HIS A 1 30 ? -10.391 6.983   3.034   1.00 0.00 ? 30  HIS A H    1  
ATOM   440   H  HA   . HIS A 1 30 ? -8.079  7.864   1.789   1.00 0.00 ? 30  HIS A HA   1  
ATOM   441   H  HB2  . HIS A 1 30 ? -10.053 5.697   1.166   1.00 0.00 ? 30  HIS A HB2  1  
ATOM   442   H  HB3  . HIS A 1 30 ? -8.751  6.037   0.030   1.00 0.00 ? 30  HIS A HB3  1  
ATOM   443   H  HD1  . HIS A 1 30 ? -6.654  6.670   2.396   1.00 0.00 ? 30  HIS A HD1  1  
ATOM   444   H  HD2  . HIS A 1 30 ? -8.962  3.247   1.927   1.00 0.00 ? 30  HIS A HD2  1  
ATOM   445   H  HE1  . HIS A 1 30 ? -5.441  4.862   3.656   1.00 0.00 ? 30  HIS A HE1  1  
ATOM   446   N  N    . ALA A 1 31 ? -10.812 8.552   0.104   1.00 0.00 ? 31  ALA A N    1  
ATOM   447   C  CA   . ALA A 1 31 ? -11.352 9.357   -0.984  1.00 0.00 ? 31  ALA A CA   1  
ATOM   448   C  C    . ALA A 1 31 ? -10.807 10.781  -0.935  1.00 0.00 ? 31  ALA A C    1  
ATOM   449   O  O    . ALA A 1 31 ? -10.538 11.387  -1.972  1.00 0.00 ? 31  ALA A O    1  
ATOM   450   C  CB   . ALA A 1 31 ? -12.873 9.370   -0.927  1.00 0.00 ? 31  ALA A CB   1  
ATOM   451   H  H    . ALA A 1 31 ? -11.429 8.075   0.698   1.00 0.00 ? 31  ALA A H    1  
ATOM   452   H  HA   . ALA A 1 31 ? -11.055 8.901   -1.917  1.00 0.00 ? 31  ALA A HA   1  
ATOM   453   H  HB1  . ALA A 1 31 ? -13.268 9.523   -1.921  1.00 0.00 ? 31  ALA A HB1  1  
ATOM   454   H  HB2  . ALA A 1 31 ? -13.226 8.426   -0.540  1.00 0.00 ? 31  ALA A HB2  1  
ATOM   455   H  HB3  . ALA A 1 31 ? -13.202 10.170  -0.281  1.00 0.00 ? 31  ALA A HB3  1  
ATOM   456   N  N    . GLU A 1 32 ? -10.648 11.308  0.275   1.00 0.00 ? 32  GLU A N    1  
ATOM   457   C  CA   . GLU A 1 32 ? -10.137 12.661  0.456   1.00 0.00 ? 32  GLU A CA   1  
ATOM   458   C  C    . GLU A 1 32 ? -8.612  12.662  0.528   1.00 0.00 ? 32  GLU A C    1  
ATOM   459   O  O    . GLU A 1 32 ? -7.959  13.614  0.101   1.00 0.00 ? 32  GLU A O    1  
ATOM   460   C  CB   . GLU A 1 32 ? -10.718 13.284  1.727   1.00 0.00 ? 32  GLU A CB   1  
ATOM   461   C  CG   . GLU A 1 32 ? -10.224 12.631  3.007   1.00 0.00 ? 32  GLU A CG   1  
ATOM   462   C  CD   . GLU A 1 32 ? -10.244 13.578  4.191   1.00 0.00 ? 32  GLU A CD   1  
ATOM   463   O  OE1  . GLU A 1 32 ? -11.296 13.671  4.857   1.00 0.00 ? 32  GLU A OE1  1  
ATOM   464   O  OE2  . GLU A 1 32 ? -9.209  14.225  4.451   1.00 0.00 ? 32  GLU A OE2  1  
ATOM   465   H  H    . GLU A 1 32 ? -10.880 10.775  1.063   1.00 0.00 ? 32  GLU A H    1  
ATOM   466   H  HA   . GLU A 1 32 ? -10.445 13.249  -0.395  1.00 0.00 ? 32  GLU A HA   1  
ATOM   467   H  HB2  . GLU A 1 32 ? -10.453 14.331  1.755   1.00 0.00 ? 32  GLU A HB2  1  
ATOM   468   H  HB3  . GLU A 1 32 ? -11.794 13.196  1.696   1.00 0.00 ? 32  GLU A HB3  1  
ATOM   469   H  HG2  . GLU A 1 32 ? -10.856 11.785  3.231   1.00 0.00 ? 32  GLU A HG2  1  
ATOM   470   H  HG3  . GLU A 1 32 ? -9.210  12.291  2.854   1.00 0.00 ? 32  GLU A HG3  1  
ATOM   471   N  N    . THR A 1 33 ? -8.051  11.587  1.073   1.00 0.00 ? 33  THR A N    1  
ATOM   472   C  CA   . THR A 1 33 ? -6.605  11.463  1.204   1.00 0.00 ? 33  THR A CA   1  
ATOM   473   C  C    . THR A 1 33 ? -5.936  11.368  -0.162  1.00 0.00 ? 33  THR A C    1  
ATOM   474   O  O    . THR A 1 33 ? -4.860  11.927  -0.378  1.00 0.00 ? 33  THR A O    1  
ATOM   475   C  CB   . THR A 1 33 ? -6.220  10.226  2.038   1.00 0.00 ? 33  THR A CB   1  
ATOM   476   O  OG1  . THR A 1 33 ? -6.945  10.224  3.273   1.00 0.00 ? 33  THR A OG1  1  
ATOM   477   C  CG2  . THR A 1 33 ? -4.725  10.208  2.321   1.00 0.00 ? 33  THR A CG2  1  
ATOM   478   H  H    . THR A 1 33 ? -8.625  10.861  1.395   1.00 0.00 ? 33  THR A H    1  
ATOM   479   H  HA   . THR A 1 33 ? -6.239  12.343  1.713   1.00 0.00 ? 33  THR A HA   1  
ATOM   480   H  HB   . THR A 1 33 ? -6.476  9.339   1.477   1.00 0.00 ? 33  THR A HB   1  
ATOM   481   H  HG1  . THR A 1 33 ? -6.995  9.327   3.613   1.00 0.00 ? 33  THR A HG1  1  
ATOM   482   H  HG21 . THR A 1 33 ? -4.294  11.158  2.041   1.00 0.00 ? 33  THR A HG21 1  
ATOM   483   H  HG22 . THR A 1 33 ? -4.260  9.419   1.750   1.00 0.00 ? 33  THR A HG22 1  
ATOM   484   H  HG23 . THR A 1 33 ? -4.561  10.035  3.374   1.00 0.00 ? 33  THR A HG23 1  
ATOM   485   N  N    . VAL A 1 34 ? -6.579  10.657  -1.083  1.00 0.00 ? 34  VAL A N    1  
ATOM   486   C  CA   . VAL A 1 34 ? -6.046  10.491  -2.431  1.00 0.00 ? 34  VAL A CA   1  
ATOM   487   C  C    . VAL A 1 34 ? -5.423  11.786  -2.939  1.00 0.00 ? 34  VAL A C    1  
ATOM   488   O  O    . VAL A 1 34 ? -4.418  11.767  -3.648  1.00 0.00 ? 34  VAL A O    1  
ATOM   489   C  CB   . VAL A 1 34 ? -7.141  10.040  -3.415  1.00 0.00 ? 34  VAL A CB   1  
ATOM   490   C  CG1  . VAL A 1 34 ? -7.668  8.665   -3.035  1.00 0.00 ? 34  VAL A CG1  1  
ATOM   491   C  CG2  . VAL A 1 34 ? -8.270  11.059  -3.459  1.00 0.00 ? 34  VAL A CG2  1  
ATOM   492   H  H    . VAL A 1 34 ? -7.432  10.235  -0.852  1.00 0.00 ? 34  VAL A H    1  
ATOM   493   H  HA   . VAL A 1 34 ? -5.285  9.726   -2.396  1.00 0.00 ? 34  VAL A HA   1  
ATOM   494   H  HB   . VAL A 1 34 ? -6.705  9.975   -4.401  1.00 0.00 ? 34  VAL A HB   1  
ATOM   495   H  HG11 . VAL A 1 34 ? -7.684  8.032   -3.911  1.00 0.00 ? 34  VAL A HG11 1  
ATOM   496   H  HG12 . VAL A 1 34 ? -7.025  8.227   -2.285  1.00 0.00 ? 34  VAL A HG12 1  
ATOM   497   H  HG13 . VAL A 1 34 ? -8.669  8.759   -2.642  1.00 0.00 ? 34  VAL A HG13 1  
ATOM   498   H  HG21 . VAL A 1 34 ? -8.266  11.639  -2.548  1.00 0.00 ? 34  VAL A HG21 1  
ATOM   499   H  HG22 . VAL A 1 34 ? -8.130  11.716  -4.305  1.00 0.00 ? 34  VAL A HG22 1  
ATOM   500   H  HG23 . VAL A 1 34 ? -9.215  10.546  -3.555  1.00 0.00 ? 34  VAL A HG23 1  
ATOM   501   N  N    . ALA A 1 35 ? -6.027  12.911  -2.570  1.00 0.00 ? 35  ALA A N    1  
ATOM   502   C  CA   . ALA A 1 35 ? -5.530  14.217  -2.987  1.00 0.00 ? 35  ALA A CA   1  
ATOM   503   C  C    . ALA A 1 35 ? -4.075  14.408  -2.572  1.00 0.00 ? 35  ALA A C    1  
ATOM   504   O  O    . ALA A 1 35 ? -3.232  14.786  -3.386  1.00 0.00 ? 35  ALA A O    1  
ATOM   505   C  CB   . ALA A 1 35 ? -6.396  15.323  -2.403  1.00 0.00 ? 35  ALA A CB   1  
ATOM   506   H  H    . ALA A 1 35 ? -6.825  12.862  -2.004  1.00 0.00 ? 35  ALA A H    1  
ATOM   507   H  HA   . ALA A 1 35 ? -5.597  14.272  -4.064  1.00 0.00 ? 35  ALA A HA   1  
ATOM   508   H  HB1  . ALA A 1 35 ? -6.656  15.075  -1.384  1.00 0.00 ? 35  ALA A HB1  1  
ATOM   509   H  HB2  . ALA A 1 35 ? -5.851  16.254  -2.419  1.00 0.00 ? 35  ALA A HB2  1  
ATOM   510   H  HB3  . ALA A 1 35 ? -7.297  15.422  -2.990  1.00 0.00 ? 35  ALA A HB3  1  
ATOM   511   N  N    . ALA A 1 36 ? -3.787  14.145  -1.302  1.00 0.00 ? 36  ALA A N    1  
ATOM   512   C  CA   . ALA A 1 36 ? -2.433  14.287  -0.780  1.00 0.00 ? 36  ALA A CA   1  
ATOM   513   C  C    . ALA A 1 36 ? -1.407  13.712  -1.751  1.00 0.00 ? 36  ALA A C    1  
ATOM   514   O  O    . ALA A 1 36 ? -0.561  14.436  -2.277  1.00 0.00 ? 36  ALA A O    1  
ATOM   515   C  CB   . ALA A 1 36 ? -2.317  13.608  0.577   1.00 0.00 ? 36  ALA A CB   1  
ATOM   516   H  H    . ALA A 1 36 ? -4.501  13.846  -0.702  1.00 0.00 ? 36  ALA A H    1  
ATOM   517   H  HA   . ALA A 1 36 ? -2.236  15.341  -0.646  1.00 0.00 ? 36  ALA A HA   1  
ATOM   518   H  HB1  . ALA A 1 36 ? -3.182  12.983  0.741   1.00 0.00 ? 36  ALA A HB1  1  
ATOM   519   H  HB2  . ALA A 1 36 ? -1.424  13.001  0.600   1.00 0.00 ? 36  ALA A HB2  1  
ATOM   520   H  HB3  . ALA A 1 36 ? -2.262  14.359  1.351   1.00 0.00 ? 36  ALA A HB3  1  
ATOM   521   N  N    . LEU A 1 37 ? -1.487  12.406  -1.984  1.00 0.00 ? 37  LEU A N    1  
ATOM   522   C  CA   . LEU A 1 37 ? -0.565  11.733  -2.892  1.00 0.00 ? 37  LEU A CA   1  
ATOM   523   C  C    . LEU A 1 37 ? -0.528  12.432  -4.248  1.00 0.00 ? 37  LEU A C    1  
ATOM   524   O  O    . LEU A 1 37 ? -1.563  12.620  -4.889  1.00 0.00 ? 37  LEU A O    1  
ATOM   525   C  CB   . LEU A 1 37 ? -0.971  10.270  -3.071  1.00 0.00 ? 37  LEU A CB   1  
ATOM   526   C  CG   . LEU A 1 37 ? -1.443  9.545   -1.810  1.00 0.00 ? 37  LEU A CG   1  
ATOM   527   C  CD1  . LEU A 1 37 ? -0.685  10.047  -0.591  1.00 0.00 ? 37  LEU A CD1  1  
ATOM   528   C  CD2  . LEU A 1 37 ? -2.942  9.725   -1.620  1.00 0.00 ? 37  LEU A CD2  1  
ATOM   529   H  H    . LEU A 1 37 ? -2.183  11.882  -1.536  1.00 0.00 ? 37  LEU A H    1  
ATOM   530   H  HA   . LEU A 1 37 ? 0.421   11.774  -2.453  1.00 0.00 ? 37  LEU A HA   1  
ATOM   531   H  HB2  . LEU A 1 37 ? -1.774  10.235  -3.791  1.00 0.00 ? 37  LEU A HB2  1  
ATOM   532   H  HB3  . LEU A 1 37 ? -0.117  9.735   -3.462  1.00 0.00 ? 37  LEU A HB3  1  
ATOM   533   H  HG   . LEU A 1 37 ? -1.243  8.487   -1.914  1.00 0.00 ? 37  LEU A HG   1  
ATOM   534   H  HD11 . LEU A 1 37 ? -0.536  9.232   0.101   1.00 0.00 ? 37  LEU A HD11 1  
ATOM   535   H  HD12 . LEU A 1 37 ? -1.254  10.829  -0.111  1.00 0.00 ? 37  LEU A HD12 1  
ATOM   536   H  HD13 . LEU A 1 37 ? 0.274   10.438  -0.899  1.00 0.00 ? 37  LEU A HD13 1  
ATOM   537   H  HD21 . LEU A 1 37 ? -3.410  8.757   -1.515  1.00 0.00 ? 37  LEU A HD21 1  
ATOM   538   H  HD22 . LEU A 1 37 ? -3.355  10.234  -2.479  1.00 0.00 ? 37  LEU A HD22 1  
ATOM   539   H  HD23 . LEU A 1 37 ? -3.124  10.311  -0.731  1.00 0.00 ? 37  LEU A HD23 1  
ATOM   540   N  N    . ARG A 1 38 ? 0.670   12.813  -4.679  1.00 0.00 ? 38  ARG A N    1  
ATOM   541   C  CA   . ARG A 1 38 ? 0.841   13.490  -5.959  1.00 0.00 ? 38  ARG A CA   1  
ATOM   542   C  C    . ARG A 1 38 ? 1.714   12.663  -6.898  1.00 0.00 ? 38  ARG A C    1  
ATOM   543   O  O    . ARG A 1 38 ? 1.548   12.708  -8.117  1.00 0.00 ? 38  ARG A O    1  
ATOM   544   C  CB   . ARG A 1 38 ? 1.464   14.872  -5.750  1.00 0.00 ? 38  ARG A CB   1  
ATOM   545   C  CG   . ARG A 1 38 ? 0.969   15.580  -4.499  1.00 0.00 ? 38  ARG A CG   1  
ATOM   546   C  CD   . ARG A 1 38 ? 1.873   15.305  -3.308  1.00 0.00 ? 38  ARG A CD   1  
ATOM   547   N  NE   . ARG A 1 38 ? 1.393   15.959  -2.094  1.00 0.00 ? 38  ARG A NE   1  
ATOM   548   C  CZ   . ARG A 1 38 ? 1.702   17.207  -1.760  1.00 0.00 ? 38  ARG A CZ   1  
ATOM   549   N  NH1  . ARG A 1 38 ? 2.486   17.932  -2.545  1.00 0.00 ? 38  ARG A NH1  1  
ATOM   550   N  NH2  . ARG A 1 38 ? 1.225   17.733  -0.638  1.00 0.00 ? 38  ARG A NH2  1  
ATOM   551   H  H    . ARG A 1 38 ? 1.457   12.636  -4.123  1.00 0.00 ? 38  ARG A H    1  
ATOM   552   H  HA   . ARG A 1 38 ? -0.135  13.609  -6.405  1.00 0.00 ? 38  ARG A HA   1  
ATOM   553   H  HB2  . ARG A 1 38 ? 2.536   14.763  -5.674  1.00 0.00 ? 38  ARG A HB2  1  
ATOM   554   H  HB3  . ARG A 1 38 ? 1.233   15.490  -6.603  1.00 0.00 ? 38  ARG A HB3  1  
ATOM   555   H  HG2  . ARG A 1 38 ? 0.949   16.644  -4.684  1.00 0.00 ? 38  ARG A HG2  1  
ATOM   556   H  HG3  . ARG A 1 38 ? -0.028  15.233  -4.272  1.00 0.00 ? 38  ARG A HG3  1  
ATOM   557   H  HD2  . ARG A 1 38 ? 1.911   14.239  -3.140  1.00 0.00 ? 38  ARG A HD2  1  
ATOM   558   H  HD3  . ARG A 1 38 ? 2.864   15.669  -3.534  1.00 0.00 ? 38  ARG A HD3  1  
ATOM   559   H  HE   . ARG A 1 38 ? 0.811   15.442  -1.499  1.00 0.00 ? 38  ARG A HE   1  
ATOM   560   H  HH11 . ARG A 1 38 ? 2.846   17.539  -3.391  1.00 0.00 ? 38  ARG A HH11 1  
ATOM   561   H  HH12 . ARG A 1 38 ? 2.716   18.872  -2.292  1.00 0.00 ? 38  ARG A HH12 1  
ATOM   562   H  HH21 . ARG A 1 38 ? 0.633   17.189  -0.044  1.00 0.00 ? 38  ARG A HH21 1  
ATOM   563   H  HH22 . ARG A 1 38 ? 1.458   18.672  -0.388  1.00 0.00 ? 38  ARG A HH22 1  
ATOM   564   N  N    . PHE A 1 39 ? 2.645   11.910  -6.322  1.00 0.00 ? 39  PHE A N    1  
ATOM   565   C  CA   . PHE A 1 39 ? 3.546   11.074  -7.108  1.00 0.00 ? 39  PHE A CA   1  
ATOM   566   C  C    . PHE A 1 39 ? 3.067   9.626   -7.126  1.00 0.00 ? 39  PHE A C    1  
ATOM   567   O  O    . PHE A 1 39 ? 3.247   8.874   -6.168  1.00 0.00 ? 39  PHE A O    1  
ATOM   568   C  CB   . PHE A 1 39 ? 4.966   11.147  -6.543  1.00 0.00 ? 39  PHE A CB   1  
ATOM   569   C  CG   . PHE A 1 39 ? 5.414   12.545  -6.224  1.00 0.00 ? 39  PHE A CG   1  
ATOM   570   C  CD1  . PHE A 1 39 ? 4.931   13.201  -5.103  1.00 0.00 ? 39  PHE A CD1  1  
ATOM   571   C  CD2  . PHE A 1 39 ? 6.317   13.201  -7.043  1.00 0.00 ? 39  PHE A CD2  1  
ATOM   572   C  CE1  . PHE A 1 39 ? 5.341   14.488  -4.807  1.00 0.00 ? 39  PHE A CE1  1  
ATOM   573   C  CE2  . PHE A 1 39 ? 6.730   14.488  -6.752  1.00 0.00 ? 39  PHE A CE2  1  
ATOM   574   C  CZ   . PHE A 1 39 ? 6.242   15.131  -5.632  1.00 0.00 ? 39  PHE A CZ   1  
ATOM   575   H  H    . PHE A 1 39 ? 2.729   11.917  -5.346  1.00 0.00 ? 39  PHE A H    1  
ATOM   576   H  HA   . PHE A 1 39 ? 3.550   11.452  -8.119  1.00 0.00 ? 39  PHE A HA   1  
ATOM   577   H  HB2  . PHE A 1 39 ? 5.014   10.568  -5.633  1.00 0.00 ? 39  PHE A HB2  1  
ATOM   578   H  HB3  . PHE A 1 39 ? 5.654   10.733  -7.265  1.00 0.00 ? 39  PHE A HB3  1  
ATOM   579   H  HD1  . PHE A 1 39 ? 4.227   12.699  -4.456  1.00 0.00 ? 39  PHE A HD1  1  
ATOM   580   H  HD2  . PHE A 1 39 ? 6.700   12.698  -7.920  1.00 0.00 ? 39  PHE A HD2  1  
ATOM   581   H  HE1  . PHE A 1 39 ? 4.958   14.989  -3.931  1.00 0.00 ? 39  PHE A HE1  1  
ATOM   582   H  HE2  . PHE A 1 39 ? 7.436   14.988  -7.400  1.00 0.00 ? 39  PHE A HE2  1  
ATOM   583   H  HZ   . PHE A 1 39 ? 6.563   16.137  -5.403  1.00 0.00 ? 39  PHE A HZ   1  
ATOM   584   N  N    . PRO A 1 40 ? 2.441   9.224   -8.242  1.00 0.00 ? 40  PRO A N    1  
ATOM   585   C  CA   . PRO A 1 40 ? 1.922   7.863   -8.412  1.00 0.00 ? 40  PRO A CA   1  
ATOM   586   C  C    . PRO A 1 40 ? 3.036   6.831   -8.549  1.00 0.00 ? 40  PRO A C    1  
ATOM   587   O  O    . PRO A 1 40 ? 4.208   7.183   -8.695  1.00 0.00 ? 40  PRO A O    1  
ATOM   588   C  CB   . PRO A 1 40 ? 1.113   7.952   -9.709  1.00 0.00 ? 40  PRO A CB   1  
ATOM   589   C  CG   . PRO A 1 40 ? 1.726   9.083   -10.461 1.00 0.00 ? 40  PRO A CG   1  
ATOM   590   C  CD   . PRO A 1 40 ? 2.191   10.067  -9.423  1.00 0.00 ? 40  PRO A CD   1  
ATOM   591   H  HA   . PRO A 1 40 ? 1.270   7.582   -7.598  1.00 0.00 ? 40  PRO A HA   1  
ATOM   592   H  HB2  . PRO A 1 40 ? 1.199   7.022   -10.253 1.00 0.00 ? 40  PRO A HB2  1  
ATOM   593   H  HB3  . PRO A 1 40 ? 0.077   8.147   -9.478  1.00 0.00 ? 40  PRO A HB3  1  
ATOM   594   H  HG2  . PRO A 1 40 ? 2.563   8.727   -11.042 1.00 0.00 ? 40  PRO A HG2  1  
ATOM   595   H  HG3  . PRO A 1 40 ? 0.987   9.538   -11.104 1.00 0.00 ? 40  PRO A HG3  1  
ATOM   596   H  HD2  . PRO A 1 40 ? 3.097   10.556  -9.747  1.00 0.00 ? 40  PRO A HD2  1  
ATOM   597   H  HD3  . PRO A 1 40 ? 1.418   10.794  -9.220  1.00 0.00 ? 40  PRO A HD3  1  
ATOM   598   N  N    . CYS A 1 41 ? 2.665   5.556   -8.501  1.00 0.00 ? 41  CYS A N    1  
ATOM   599   C  CA   . CYS A 1 41 ? 3.633   4.472   -8.619  1.00 0.00 ? 41  CYS A CA   1  
ATOM   600   C  C    . CYS A 1 41 ? 3.557   3.824   -9.998  1.00 0.00 ? 41  CYS A C    1  
ATOM   601   O  O    . CYS A 1 41 ? 2.616   3.089   -10.299 1.00 0.00 ? 41  CYS A O    1  
ATOM   602   C  CB   . CYS A 1 41 ? 3.387   3.421   -7.535  1.00 0.00 ? 41  CYS A CB   1  
ATOM   603   S  SG   . CYS A 1 41 ? 4.746   2.224   -7.339  1.00 0.00 ? 41  CYS A SG   1  
ATOM   604   H  H    . CYS A 1 41 ? 1.716   5.339   -8.383  1.00 0.00 ? 41  CYS A H    1  
ATOM   605   H  HA   . CYS A 1 41 ? 4.618   4.891   -8.486  1.00 0.00 ? 41  CYS A HA   1  
ATOM   606   H  HB2  . CYS A 1 41 ? 3.250   3.919   -6.586  1.00 0.00 ? 41  CYS A HB2  1  
ATOM   607   H  HB3  . CYS A 1 41 ? 2.493   2.867   -7.778  1.00 0.00 ? 41  CYS A HB3  1  
ATOM   608   N  N    . GLU A 1 42 ? 4.554   4.101   -10.832 1.00 0.00 ? 42  GLU A N    1  
ATOM   609   C  CA   . GLU A 1 42 ? 4.600   3.545   -12.180 1.00 0.00 ? 42  GLU A CA   1  
ATOM   610   C  C    . GLU A 1 42 ? 4.795   2.032   -12.137 1.00 0.00 ? 42  GLU A C    1  
ATOM   611   O  O    . GLU A 1 42 ? 4.832   1.370   -13.175 1.00 0.00 ? 42  GLU A O    1  
ATOM   612   C  CB   . GLU A 1 42 ? 5.728   4.193   -12.985 1.00 0.00 ? 42  GLU A CB   1  
ATOM   613   C  CG   . GLU A 1 42 ? 7.117   3.838   -12.481 1.00 0.00 ? 42  GLU A CG   1  
ATOM   614   C  CD   . GLU A 1 42 ? 7.430   4.470   -11.139 1.00 0.00 ? 42  GLU A CD   1  
ATOM   615   O  OE1  . GLU A 1 42 ? 6.910   5.573   -10.867 1.00 0.00 ? 42  GLU A OE1  1  
ATOM   616   O  OE2  . GLU A 1 42 ? 8.194   3.863   -10.360 1.00 0.00 ? 42  GLU A OE2  1  
ATOM   617   H  H    . GLU A 1 42 ? 5.276   4.694   -10.535 1.00 0.00 ? 42  GLU A H    1  
ATOM   618   H  HA   . GLU A 1 42 ? 3.658   3.761   -12.660 1.00 0.00 ? 42  GLU A HA   1  
ATOM   619   H  HB2  . GLU A 1 42 ? 5.648   3.875   -14.014 1.00 0.00 ? 42  GLU A HB2  1  
ATOM   620   H  HB3  . GLU A 1 42 ? 5.615   5.266   -12.940 1.00 0.00 ? 42  GLU A HB3  1  
ATOM   621   H  HG2  . GLU A 1 42 ? 7.187   2.765   -12.382 1.00 0.00 ? 42  GLU A HG2  1  
ATOM   622   H  HG3  . GLU A 1 42 ? 7.845   4.180   -13.202 1.00 0.00 ? 42  GLU A HG3  1  
ATOM   623   N  N    . PHE A 1 43 ? 4.919   1.491   -10.930 1.00 0.00 ? 43  PHE A N    1  
ATOM   624   C  CA   . PHE A 1 43 ? 5.112   0.057   -10.751 1.00 0.00 ? 43  PHE A CA   1  
ATOM   625   C  C    . PHE A 1 43 ? 3.772   -0.655  -10.581 1.00 0.00 ? 43  PHE A C    1  
ATOM   626   O  O    . PHE A 1 43 ? 3.483   -1.632  -11.273 1.00 0.00 ? 43  PHE A O    1  
ATOM   627   C  CB   . PHE A 1 43 ? 6.002   -0.213  -9.537  1.00 0.00 ? 43  PHE A CB   1  
ATOM   628   C  CG   . PHE A 1 43 ? 7.457   -0.358  -9.881  1.00 0.00 ? 43  PHE A CG   1  
ATOM   629   C  CD1  . PHE A 1 43 ? 7.955   -1.563  -10.350 1.00 0.00 ? 43  PHE A CD1  1  
ATOM   630   C  CD2  . PHE A 1 43 ? 8.327   0.711   -9.734  1.00 0.00 ? 43  PHE A CD2  1  
ATOM   631   C  CE1  . PHE A 1 43 ? 9.293   -1.699  -10.668 1.00 0.00 ? 43  PHE A CE1  1  
ATOM   632   C  CE2  . PHE A 1 43 ? 9.666   0.580   -10.051 1.00 0.00 ? 43  PHE A CE2  1  
ATOM   633   C  CZ   . PHE A 1 43 ? 10.150  -0.627  -10.517 1.00 0.00 ? 43  PHE A CZ   1  
ATOM   634   H  H    . PHE A 1 43 ? 4.881   2.071   -10.140 1.00 0.00 ? 43  PHE A H    1  
ATOM   635   H  HA   . PHE A 1 43 ? 5.598   -0.324  -11.636 1.00 0.00 ? 43  PHE A HA   1  
ATOM   636   H  HB2  . PHE A 1 43 ? 5.907   0.607   -8.841  1.00 0.00 ? 43  PHE A HB2  1  
ATOM   637   H  HB3  . PHE A 1 43 ? 5.680   -1.125  -9.058  1.00 0.00 ? 43  PHE A HB3  1  
ATOM   638   H  HD1  . PHE A 1 43 ? 7.285   -2.403  -10.468 1.00 0.00 ? 43  PHE A HD1  1  
ATOM   639   H  HD2  . PHE A 1 43 ? 7.951   1.655   -9.369  1.00 0.00 ? 43  PHE A HD2  1  
ATOM   640   H  HE1  . PHE A 1 43 ? 9.668   -2.644  -11.032 1.00 0.00 ? 43  PHE A HE1  1  
ATOM   641   H  HE2  . PHE A 1 43 ? 10.334  1.420   -9.932  1.00 0.00 ? 43  PHE A HE2  1  
ATOM   642   H  HZ   . PHE A 1 43 ? 11.196  -0.731  -10.766 1.00 0.00 ? 43  PHE A HZ   1  
ATOM   643   N  N    . CYS A 1 44 ? 2.959   -0.158  -9.656  1.00 0.00 ? 44  CYS A N    1  
ATOM   644   C  CA   . CYS A 1 44 ? 1.650   -0.745  -9.393  1.00 0.00 ? 44  CYS A CA   1  
ATOM   645   C  C    . CYS A 1 44 ? 0.536   0.256   -9.684  1.00 0.00 ? 44  CYS A C    1  
ATOM   646   O  O    . CYS A 1 44 ? -0.534  -0.112  -10.167 1.00 0.00 ? 44  CYS A O    1  
ATOM   647   C  CB   . CYS A 1 44 ? 1.562   -1.215  -7.939  1.00 0.00 ? 44  CYS A CB   1  
ATOM   648   S  SG   . CYS A 1 44 ? 1.834   0.105   -6.714  1.00 0.00 ? 44  CYS A SG   1  
ATOM   649   H  H    . CYS A 1 44 ? 3.245   0.623   -9.136  1.00 0.00 ? 44  CYS A H    1  
ATOM   650   H  HA   . CYS A 1 44 ? 1.531   -1.597  -10.045 1.00 0.00 ? 44  CYS A HA   1  
ATOM   651   H  HB2  . CYS A 1 44 ? 0.580   -1.629  -7.762  1.00 0.00 ? 44  CYS A HB2  1  
ATOM   652   H  HB3  . CYS A 1 44 ? 2.305   -1.980  -7.771  1.00 0.00 ? 44  CYS A HB3  1  
ATOM   653   N  N    . GLY A 1 45 ? 0.796   1.526   -9.386  1.00 0.00 ? 45  GLY A N    1  
ATOM   654   C  CA   . GLY A 1 45 ? -0.193  2.561   -9.623  1.00 0.00 ? 45  GLY A CA   1  
ATOM   655   C  C    . GLY A 1 45 ? -0.504  3.361   -8.373  1.00 0.00 ? 45  GLY A C    1  
ATOM   656   O  O    . GLY A 1 45 ? -1.198  4.376   -8.434  1.00 0.00 ? 45  GLY A O    1  
ATOM   657   H  H    . GLY A 1 45 ? 1.667   1.761   -9.003  1.00 0.00 ? 45  GLY A H    1  
ATOM   658   H  HA2  . GLY A 1 45 ? 0.178   3.231   -10.384 1.00 0.00 ? 45  GLY A HA2  1  
ATOM   659   H  HA3  . GLY A 1 45 ? -1.103  2.099   -9.976  1.00 0.00 ? 45  GLY A HA3  1  
ATOM   660   N  N    . LYS A 1 46 ? 0.008   2.904   -7.236  1.00 0.00 ? 46  LYS A N    1  
ATOM   661   C  CA   . LYS A 1 46 ? -0.218  3.583   -5.966  1.00 0.00 ? 46  LYS A CA   1  
ATOM   662   C  C    . LYS A 1 46 ? 0.137   5.062   -6.069  1.00 0.00 ? 46  LYS A C    1  
ATOM   663   O  O    . LYS A 1 46 ? 0.524   5.545   -7.134  1.00 0.00 ? 46  LYS A O    1  
ATOM   664   C  CB   . LYS A 1 46 ? 0.607   2.925   -4.858  1.00 0.00 ? 46  LYS A CB   1  
ATOM   665   C  CG   . LYS A 1 46 ? -0.099  1.764   -4.181  1.00 0.00 ? 46  LYS A CG   1  
ATOM   666   C  CD   . LYS A 1 46 ? 0.724   1.203   -3.033  1.00 0.00 ? 46  LYS A CD   1  
ATOM   667   C  CE   . LYS A 1 46 ? 0.751   2.157   -1.849  1.00 0.00 ? 46  LYS A CE   1  
ATOM   668   N  NZ   . LYS A 1 46 ? 1.356   1.527   -0.643  1.00 0.00 ? 46  LYS A NZ   1  
ATOM   669   H  H    . LYS A 1 46 ? 0.554   2.089   -7.252  1.00 0.00 ? 46  LYS A H    1  
ATOM   670   H  HA   . LYS A 1 46 ? -1.266  3.492   -5.724  1.00 0.00 ? 46  LYS A HA   1  
ATOM   671   H  HB2  . LYS A 1 46 ? 1.531   2.559   -5.282  1.00 0.00 ? 46  LYS A HB2  1  
ATOM   672   H  HB3  . LYS A 1 46 ? 0.836   3.668   -4.107  1.00 0.00 ? 46  LYS A HB3  1  
ATOM   673   H  HG2  . LYS A 1 46 ? -1.048  2.107   -3.795  1.00 0.00 ? 46  LYS A HG2  1  
ATOM   674   H  HG3  . LYS A 1 46 ? -0.266  0.982   -4.908  1.00 0.00 ? 46  LYS A HG3  1  
ATOM   675   H  HD2  . LYS A 1 46 ? 0.292   0.266   -2.715  1.00 0.00 ? 46  LYS A HD2  1  
ATOM   676   H  HD3  . LYS A 1 46 ? 1.736   1.038   -3.374  1.00 0.00 ? 46  LYS A HD3  1  
ATOM   677   H  HE2  . LYS A 1 46 ? 1.329   3.028   -2.118  1.00 0.00 ? 46  LYS A HE2  1  
ATOM   678   H  HE3  . LYS A 1 46 ? -0.262  2.454   -1.619  1.00 0.00 ? 46  LYS A HE3  1  
ATOM   679   H  HZ1  . LYS A 1 46 ? 0.615   1.297   0.050   1.00 0.00 ? 46  LYS A HZ1  1  
ATOM   680   H  HZ2  . LYS A 1 46 ? 2.036   2.179   -0.202  1.00 0.00 ? 46  LYS A HZ2  1  
ATOM   681   H  HZ3  . LYS A 1 46 ? 1.852   0.652   -0.907  1.00 0.00 ? 46  LYS A HZ3  1  
ATOM   682   N  N    . ARG A 1 47 ? 0.004   5.777   -4.957  1.00 0.00 ? 47  ARG A N    1  
ATOM   683   C  CA   . ARG A 1 47 ? 0.311   7.202   -4.923  1.00 0.00 ? 47  ARG A CA   1  
ATOM   684   C  C    . ARG A 1 47 ? 0.820   7.616   -3.545  1.00 0.00 ? 47  ARG A C    1  
ATOM   685   O  O    . ARG A 1 47 ? 0.361   7.106   -2.523  1.00 0.00 ? 47  ARG A O    1  
ATOM   686   C  CB   . ARG A 1 47 ? -0.928  8.022   -5.287  1.00 0.00 ? 47  ARG A CB   1  
ATOM   687   C  CG   . ARG A 1 47 ? -1.460  7.734   -6.682  1.00 0.00 ? 47  ARG A CG   1  
ATOM   688   C  CD   . ARG A 1 47 ? -2.860  8.297   -6.871  1.00 0.00 ? 47  ARG A CD   1  
ATOM   689   N  NE   . ARG A 1 47 ? -3.124  8.650   -8.263  1.00 0.00 ? 47  ARG A NE   1  
ATOM   690   C  CZ   . ARG A 1 47 ? -3.634  7.804   -9.152  1.00 0.00 ? 47  ARG A CZ   1  
ATOM   691   N  NH1  . ARG A 1 47 ? -3.934  6.563   -8.795  1.00 0.00 ? 47  ARG A NH1  1  
ATOM   692   N  NH2  . ARG A 1 47 ? -3.846  8.200   -10.401 1.00 0.00 ? 47  ARG A NH2  1  
ATOM   693   H  H    . ARG A 1 47 ? -0.310  5.336   -4.140  1.00 0.00 ? 47  ARG A H    1  
ATOM   694   H  HA   . ARG A 1 47 ? 1.085   7.392   -5.652  1.00 0.00 ? 47  ARG A HA   1  
ATOM   695   H  HB2  . ARG A 1 47 ? -1.711  7.805   -4.576  1.00 0.00 ? 47  ARG A HB2  1  
ATOM   696   H  HB3  . ARG A 1 47 ? -0.680  9.071   -5.230  1.00 0.00 ? 47  ARG A HB3  1  
ATOM   697   H  HG2  . ARG A 1 47 ? -0.801  8.185   -7.409  1.00 0.00 ? 47  ARG A HG2  1  
ATOM   698   H  HG3  . ARG A 1 47 ? -1.488  6.665   -6.833  1.00 0.00 ? 47  ARG A HG3  1  
ATOM   699   H  HD2  . ARG A 1 47 ? -3.578  7.555   -6.556  1.00 0.00 ? 47  ARG A HD2  1  
ATOM   700   H  HD3  . ARG A 1 47 ? -2.963  9.181   -6.259  1.00 0.00 ? 47  ARG A HD3  1  
ATOM   701   H  HE   . ARG A 1 47 ? -2.910  9.562   -8.549  1.00 0.00 ? 47  ARG A HE   1  
ATOM   702   H  HH11 . ARG A 1 47 ? -3.776  6.263   -7.854  1.00 0.00 ? 47  ARG A HH11 1  
ATOM   703   H  HH12 . ARG A 1 47 ? -4.319  5.929   -9.465  1.00 0.00 ? 47  ARG A HH12 1  
ATOM   704   H  HH21 . ARG A 1 47 ? -3.622  9.135   -10.673 1.00 0.00 ? 47  ARG A HH21 1  
ATOM   705   H  HH22 . ARG A 1 47 ? -4.230  7.563   -11.068 1.00 0.00 ? 47  ARG A HH22 1  
ATOM   706   N  N    . PHE A 1 48 ? 1.773   8.542   -3.526  1.00 0.00 ? 48  PHE A N    1  
ATOM   707   C  CA   . PHE A 1 48 ? 2.346   9.023   -2.274  1.00 0.00 ? 48  PHE A CA   1  
ATOM   708   C  C    . PHE A 1 48 ? 2.394   10.548  -2.249  1.00 0.00 ? 48  PHE A C    1  
ATOM   709   O  O    . PHE A 1 48 ? 2.412   11.196  -3.295  1.00 0.00 ? 48  PHE A O    1  
ATOM   710   C  CB   . PHE A 1 48 ? 3.753   8.454   -2.081  1.00 0.00 ? 48  PHE A CB   1  
ATOM   711   C  CG   . PHE A 1 48 ? 3.793   6.953   -2.052  1.00 0.00 ? 48  PHE A CG   1  
ATOM   712   C  CD1  . PHE A 1 48 ? 3.375   6.214   -3.147  1.00 0.00 ? 48  PHE A CD1  1  
ATOM   713   C  CD2  . PHE A 1 48 ? 4.250   6.280   -0.929  1.00 0.00 ? 48  PHE A CD2  1  
ATOM   714   C  CE1  . PHE A 1 48 ? 3.411   4.833   -3.122  1.00 0.00 ? 48  PHE A CE1  1  
ATOM   715   C  CE2  . PHE A 1 48 ? 4.288   4.899   -0.899  1.00 0.00 ? 48  PHE A CE2  1  
ATOM   716   C  CZ   . PHE A 1 48 ? 3.869   4.174   -1.997  1.00 0.00 ? 48  PHE A CZ   1  
ATOM   717   H  H    . PHE A 1 48 ? 2.098   8.911   -4.374  1.00 0.00 ? 48  PHE A H    1  
ATOM   718   H  HA   . PHE A 1 48 ? 1.715   8.681   -1.469  1.00 0.00 ? 48  PHE A HA   1  
ATOM   719   H  HB2  . PHE A 1 48 ? 4.383   8.786   -2.892  1.00 0.00 ? 48  PHE A HB2  1  
ATOM   720   H  HB3  . PHE A 1 48 ? 4.155   8.816   -1.147  1.00 0.00 ? 48  PHE A HB3  1  
ATOM   721   H  HD1  . PHE A 1 48 ? 3.018   6.727   -4.027  1.00 0.00 ? 48  PHE A HD1  1  
ATOM   722   H  HD2  . PHE A 1 48 ? 4.578   6.847   -0.069  1.00 0.00 ? 48  PHE A HD2  1  
ATOM   723   H  HE1  . PHE A 1 48 ? 3.083   4.268   -3.982  1.00 0.00 ? 48  PHE A HE1  1  
ATOM   724   H  HE2  . PHE A 1 48 ? 4.647   4.388   -0.018  1.00 0.00 ? 48  PHE A HE2  1  
ATOM   725   H  HZ   . PHE A 1 48 ? 3.897   3.095   -1.976  1.00 0.00 ? 48  PHE A HZ   1  
ATOM   726   N  N    . GLU A 1 49 ? 2.415   11.114  -1.046  1.00 0.00 ? 49  GLU A N    1  
ATOM   727   C  CA   . GLU A 1 49 ? 2.460   12.562  -0.884  1.00 0.00 ? 49  GLU A CA   1  
ATOM   728   C  C    . GLU A 1 49 ? 3.781   13.127  -1.398  1.00 0.00 ? 49  GLU A C    1  
ATOM   729   O  O    . GLU A 1 49 ? 3.900   14.325  -1.654  1.00 0.00 ? 49  GLU A O    1  
ATOM   730   C  CB   . GLU A 1 49 ? 2.269   12.940  0.586   1.00 0.00 ? 49  GLU A CB   1  
ATOM   731   C  CG   . GLU A 1 49 ? 3.084   12.088  1.544   1.00 0.00 ? 49  GLU A CG   1  
ATOM   732   C  CD   . GLU A 1 49 ? 3.493   12.844  2.794   1.00 0.00 ? 49  GLU A CD   1  
ATOM   733   O  OE1  . GLU A 1 49 ? 4.451   13.641  2.717   1.00 0.00 ? 49  GLU A OE1  1  
ATOM   734   O  OE2  . GLU A 1 49 ? 2.855   12.638  3.847   1.00 0.00 ? 49  GLU A OE2  1  
ATOM   735   H  H    . GLU A 1 49 ? 2.399   10.544  -0.249  1.00 0.00 ? 49  GLU A H    1  
ATOM   736   H  HA   . GLU A 1 49 ? 1.652   12.985  -1.462  1.00 0.00 ? 49  GLU A HA   1  
ATOM   737   H  HB2  . GLU A 1 49 ? 2.556   13.972  0.721   1.00 0.00 ? 49  GLU A HB2  1  
ATOM   738   H  HB3  . GLU A 1 49 ? 1.225   12.830  0.840   1.00 0.00 ? 49  GLU A HB3  1  
ATOM   739   H  HG2  . GLU A 1 49 ? 2.494   11.232  1.837   1.00 0.00 ? 49  GLU A HG2  1  
ATOM   740   H  HG3  . GLU A 1 49 ? 3.977   11.752  1.037   1.00 0.00 ? 49  GLU A HG3  1  
ATOM   741   N  N    . LYS A 1 50 ? 4.772   12.254  -1.546  1.00 0.00 ? 50  LYS A N    1  
ATOM   742   C  CA   . LYS A 1 50 ? 6.086   12.663  -2.030  1.00 0.00 ? 50  LYS A CA   1  
ATOM   743   C  C    . LYS A 1 50 ? 6.805   11.497  -2.701  1.00 0.00 ? 50  LYS A C    1  
ATOM   744   O  O    . LYS A 1 50 ? 6.451   10.332  -2.522  1.00 0.00 ? 50  LYS A O    1  
ATOM   745   C  CB   . LYS A 1 50 ? 6.932   13.202  -0.874  1.00 0.00 ? 50  LYS A CB   1  
ATOM   746   C  CG   . LYS A 1 50 ? 6.571   12.604  0.475   1.00 0.00 ? 50  LYS A CG   1  
ATOM   747   C  CD   . LYS A 1 50 ? 7.552   13.031  1.554   1.00 0.00 ? 50  LYS A CD   1  
ATOM   748   C  CE   . LYS A 1 50 ? 7.708   11.958  2.621   1.00 0.00 ? 50  LYS A CE   1  
ATOM   749   N  NZ   . LYS A 1 50 ? 6.477   11.812  3.446   1.00 0.00 ? 50  LYS A NZ   1  
ATOM   750   H  H    . LYS A 1 50 ? 4.616   11.311  -1.325  1.00 0.00 ? 50  LYS A H    1  
ATOM   751   H  HA   . LYS A 1 50 ? 5.942   13.448  -2.756  1.00 0.00 ? 50  LYS A HA   1  
ATOM   752   H  HB2  . LYS A 1 50 ? 7.972   12.985  -1.074  1.00 0.00 ? 50  LYS A HB2  1  
ATOM   753   H  HB3  . LYS A 1 50 ? 6.801   14.273  -0.817  1.00 0.00 ? 50  LYS A HB3  1  
ATOM   754   H  HG2  . LYS A 1 50 ? 5.581   12.935  0.751   1.00 0.00 ? 50  LYS A HG2  1  
ATOM   755   H  HG3  . LYS A 1 50 ? 6.584   11.526  0.395   1.00 0.00 ? 50  LYS A HG3  1  
ATOM   756   H  HD2  . LYS A 1 50 ? 8.515   13.215  1.101   1.00 0.00 ? 50  LYS A HD2  1  
ATOM   757   H  HD3  . LYS A 1 50 ? 7.190   13.938  2.018   1.00 0.00 ? 50  LYS A HD3  1  
ATOM   758   H  HE2  . LYS A 1 50 ? 7.921   11.017  2.138   1.00 0.00 ? 50  LYS A HE2  1  
ATOM   759   H  HE3  . LYS A 1 50 ? 8.532   12.227  3.265   1.00 0.00 ? 50  LYS A HE3  1  
ATOM   760   H  HZ1  . LYS A 1 50 ? 6.140   10.829  3.413   1.00 0.00 ? 50  LYS A HZ1  1  
ATOM   761   H  HZ2  . LYS A 1 50 ? 5.728   12.436  3.082   1.00 0.00 ? 50  LYS A HZ2  1  
ATOM   762   H  HZ3  . LYS A 1 50 ? 6.676   12.067  4.434   1.00 0.00 ? 50  LYS A HZ3  1  
ATOM   763   N  N    . PRO A 1 51 ? 7.841   11.816  -3.491  1.00 0.00 ? 51  PRO A N    1  
ATOM   764   C  CA   . PRO A 1 51 ? 8.633   10.808  -4.203  1.00 0.00 ? 51  PRO A CA   1  
ATOM   765   C  C    . PRO A 1 51 ? 9.486   9.968   -3.258  1.00 0.00 ? 51  PRO A C    1  
ATOM   766   O  O    . PRO A 1 51 ? 9.587   8.751   -3.414  1.00 0.00 ? 51  PRO A O    1  
ATOM   767   C  CB   . PRO A 1 51 ? 9.523   11.644  -5.126  1.00 0.00 ? 51  PRO A CB   1  
ATOM   768   C  CG   . PRO A 1 51 ? 9.632   12.968  -4.451  1.00 0.00 ? 51  PRO A CG   1  
ATOM   769   C  CD   . PRO A 1 51 ? 8.319   13.184  -3.750  1.00 0.00 ? 51  PRO A CD   1  
ATOM   770   H  HA   . PRO A 1 51 ? 8.007   10.158  -4.795  1.00 0.00 ? 51  PRO A HA   1  
ATOM   771   H  HB2  . PRO A 1 51 ? 10.489  11.170  -5.225  1.00 0.00 ? 51  PRO A HB2  1  
ATOM   772   H  HB3  . PRO A 1 51 ? 9.058   11.733  -6.096  1.00 0.00 ? 51  PRO A HB3  1  
ATOM   773   H  HG2  . PRO A 1 51 ? 10.440  12.950  -3.736  1.00 0.00 ? 51  PRO A HG2  1  
ATOM   774   H  HG3  . PRO A 1 51 ? 9.796   13.742  -5.186  1.00 0.00 ? 51  PRO A HG3  1  
ATOM   775   H  HD2  . PRO A 1 51 ? 8.469   13.722  -2.826  1.00 0.00 ? 51  PRO A HD2  1  
ATOM   776   H  HD3  . PRO A 1 51 ? 7.632   13.717  -4.391  1.00 0.00 ? 51  PRO A HD3  1  
ATOM   777   N  N    . ASP A 1 52 ? 10.097  10.625  -2.278  1.00 0.00 ? 52  ASP A N    1  
ATOM   778   C  CA   . ASP A 1 52 ? 10.940  9.937   -1.307  1.00 0.00 ? 52  ASP A CA   1  
ATOM   779   C  C    . ASP A 1 52 ? 10.271  8.657   -0.816  1.00 0.00 ? 52  ASP A C    1  
ATOM   780   O  O    . ASP A 1 52 ? 10.939  7.656   -0.558  1.00 0.00 ? 52  ASP A O    1  
ATOM   781   C  CB   . ASP A 1 52 ? 11.243  10.856  -0.122  1.00 0.00 ? 52  ASP A CB   1  
ATOM   782   C  CG   . ASP A 1 52 ? 12.580  10.547  0.523   1.00 0.00 ? 52  ASP A CG   1  
ATOM   783   O  OD1  . ASP A 1 52 ? 12.739  9.427   1.052   1.00 0.00 ? 52  ASP A OD1  1  
ATOM   784   O  OD2  . ASP A 1 52 ? 13.468  11.426  0.499   1.00 0.00 ? 52  ASP A OD2  1  
ATOM   785   H  H    . ASP A 1 52 ? 9.978   11.595  -2.206  1.00 0.00 ? 52  ASP A H    1  
ATOM   786   H  HA   . ASP A 1 52 ? 11.867  9.679   -1.797  1.00 0.00 ? 52  ASP A HA   1  
ATOM   787   H  HB2  . ASP A 1 52 ? 11.258  11.881  -0.464  1.00 0.00 ? 52  ASP A HB2  1  
ATOM   788   H  HB3  . ASP A 1 52 ? 10.469  10.740  0.622   1.00 0.00 ? 52  ASP A HB3  1  
ATOM   789   N  N    . SER A 1 53 ? 8.949   8.698   -0.688  1.00 0.00 ? 53  SER A N    1  
ATOM   790   C  CA   . SER A 1 53 ? 8.190   7.543   -0.224  1.00 0.00 ? 53  SER A CA   1  
ATOM   791   C  C    . SER A 1 53 ? 7.904   6.582   -1.374  1.00 0.00 ? 53  SER A C    1  
ATOM   792   O  O    . SER A 1 53 ? 7.786   5.373   -1.173  1.00 0.00 ? 53  SER A O    1  
ATOM   793   C  CB   . SER A 1 53 ? 6.876   7.994   0.417   1.00 0.00 ? 53  SER A CB   1  
ATOM   794   O  OG   . SER A 1 53 ? 6.462   7.087   1.424   1.00 0.00 ? 53  SER A OG   1  
ATOM   795   H  H    . SER A 1 53 ? 8.473   9.526   -0.910  1.00 0.00 ? 53  SER A H    1  
ATOM   796   H  HA   . SER A 1 53 ? 8.785   7.032   0.518   1.00 0.00 ? 53  SER A HA   1  
ATOM   797   H  HB2  . SER A 1 53 ? 7.011   8.969   0.862   1.00 0.00 ? 53  SER A HB2  1  
ATOM   798   H  HB3  . SER A 1 53 ? 6.108   8.047   -0.341  1.00 0.00 ? 53  SER A HB3  1  
ATOM   799   H  HG   . SER A 1 53 ? 6.141   6.280   1.015   1.00 0.00 ? 53  SER A HG   1  
ATOM   800   N  N    . VAL A 1 54 ? 7.794   7.129   -2.580  1.00 0.00 ? 54  VAL A N    1  
ATOM   801   C  CA   . VAL A 1 54 ? 7.524   6.322   -3.764  1.00 0.00 ? 54  VAL A CA   1  
ATOM   802   C  C    . VAL A 1 54 ? 8.747   5.505   -4.164  1.00 0.00 ? 54  VAL A C    1  
ATOM   803   O  O    . VAL A 1 54 ? 8.624   4.424   -4.737  1.00 0.00 ? 54  VAL A O    1  
ATOM   804   C  CB   . VAL A 1 54 ? 7.094   7.199   -4.955  1.00 0.00 ? 54  VAL A CB   1  
ATOM   805   C  CG1  . VAL A 1 54 ? 7.560   6.585   -6.266  1.00 0.00 ? 54  VAL A CG1  1  
ATOM   806   C  CG2  . VAL A 1 54 ? 5.585   7.394   -4.955  1.00 0.00 ? 54  VAL A CG2  1  
ATOM   807   H  H    . VAL A 1 54 ? 7.899   8.099   -2.677  1.00 0.00 ? 54  VAL A H    1  
ATOM   808   H  HA   . VAL A 1 54 ? 6.713   5.647   -3.529  1.00 0.00 ? 54  VAL A HA   1  
ATOM   809   H  HB   . VAL A 1 54 ? 7.561   8.167   -4.850  1.00 0.00 ? 54  VAL A HB   1  
ATOM   810   H  HG11 . VAL A 1 54 ? 7.175   5.578   -6.348  1.00 0.00 ? 54  VAL A HG11 1  
ATOM   811   H  HG12 . VAL A 1 54 ? 7.196   7.179   -7.092  1.00 0.00 ? 54  VAL A HG12 1  
ATOM   812   H  HG13 . VAL A 1 54 ? 8.639   6.559   -6.288  1.00 0.00 ? 54  VAL A HG13 1  
ATOM   813   H  HG21 . VAL A 1 54 ? 5.349   8.370   -5.353  1.00 0.00 ? 54  VAL A HG21 1  
ATOM   814   H  HG22 . VAL A 1 54 ? 5.123   6.634   -5.567  1.00 0.00 ? 54  VAL A HG22 1  
ATOM   815   H  HG23 . VAL A 1 54 ? 5.212   7.318   -3.944  1.00 0.00 ? 54  VAL A HG23 1  
ATOM   816   N  N    . ALA A 1 55 ? 9.929   6.031   -3.856  1.00 0.00 ? 55  ALA A N    1  
ATOM   817   C  CA   . ALA A 1 55 ? 11.176  5.349   -4.181  1.00 0.00 ? 55  ALA A CA   1  
ATOM   818   C  C    . ALA A 1 55 ? 11.432  4.189   -3.226  1.00 0.00 ? 55  ALA A C    1  
ATOM   819   O  O    . ALA A 1 55 ? 11.922  3.135   -3.632  1.00 0.00 ? 55  ALA A O    1  
ATOM   820   C  CB   . ALA A 1 55 ? 12.338  6.331   -4.146  1.00 0.00 ? 55  ALA A CB   1  
ATOM   821   H  H    . ALA A 1 55 ? 9.962   6.897   -3.399  1.00 0.00 ? 55  ALA A H    1  
ATOM   822   H  HA   . ALA A 1 55 ? 11.093  4.963   -5.187  1.00 0.00 ? 55  ALA A HA   1  
ATOM   823   H  HB1  . ALA A 1 55 ? 12.158  7.074   -3.383  1.00 0.00 ? 55  ALA A HB1  1  
ATOM   824   H  HB2  . ALA A 1 55 ? 13.251  5.799   -3.923  1.00 0.00 ? 55  ALA A HB2  1  
ATOM   825   H  HB3  . ALA A 1 55 ? 12.428  6.815   -5.107  1.00 0.00 ? 55  ALA A HB3  1  
ATOM   826   N  N    . ALA A 1 56 ? 11.098  4.389   -1.955  1.00 0.00 ? 56  ALA A N    1  
ATOM   827   C  CA   . ALA A 1 56 ? 11.291  3.359   -0.943  1.00 0.00 ? 56  ALA A CA   1  
ATOM   828   C  C    . ALA A 1 56 ? 10.248  2.254   -1.077  1.00 0.00 ? 56  ALA A C    1  
ATOM   829   O  O    . ALA A 1 56 ? 10.555  1.073   -0.916  1.00 0.00 ? 56  ALA A O    1  
ATOM   830   C  CB   . ALA A 1 56 ? 11.238  3.970   0.449   1.00 0.00 ? 56  ALA A CB   1  
ATOM   831   H  H    . ALA A 1 56 ? 10.711  5.250   -1.693  1.00 0.00 ? 56  ALA A H    1  
ATOM   832   H  HA   . ALA A 1 56 ? 12.273  2.931   -1.085  1.00 0.00 ? 56  ALA A HA   1  
ATOM   833   H  HB1  . ALA A 1 56 ? 10.737  3.289   1.122   1.00 0.00 ? 56  ALA A HB1  1  
ATOM   834   H  HB2  . ALA A 1 56 ? 12.243  4.150   0.801   1.00 0.00 ? 56  ALA A HB2  1  
ATOM   835   H  HB3  . ALA A 1 56 ? 10.697  4.903   0.412   1.00 0.00 ? 56  ALA A HB3  1  
ATOM   836   N  N    . HIS A 1 57 ? 9.013   2.647   -1.374  1.00 0.00 ? 57  HIS A N    1  
ATOM   837   C  CA   . HIS A 1 57 ? 7.923   1.689   -1.530  1.00 0.00 ? 57  HIS A CA   1  
ATOM   838   C  C    . HIS A 1 57 ? 8.296   0.602   -2.534  1.00 0.00 ? 57  HIS A C    1  
ATOM   839   O  O    . HIS A 1 57 ? 7.930   -0.562  -2.366  1.00 0.00 ? 57  HIS A O    1  
ATOM   840   C  CB   . HIS A 1 57 ? 6.650   2.403   -1.984  1.00 0.00 ? 57  HIS A CB   1  
ATOM   841   C  CG   . HIS A 1 57 ? 5.722   1.531   -2.772  1.00 0.00 ? 57  HIS A CG   1  
ATOM   842   N  ND1  . HIS A 1 57 ? 5.058   0.452   -2.228  1.00 0.00 ? 57  HIS A ND1  1  
ATOM   843   C  CD2  . HIS A 1 57 ? 5.349   1.584   -4.072  1.00 0.00 ? 57  HIS A CD2  1  
ATOM   844   C  CE1  . HIS A 1 57 ? 4.317   -0.122  -3.159  1.00 0.00 ? 57  HIS A CE1  1  
ATOM   845   N  NE2  . HIS A 1 57 ? 4.476   0.546   -4.287  1.00 0.00 ? 57  HIS A NE2  1  
ATOM   846   H  H    . HIS A 1 57 ? 8.830   3.602   -1.491  1.00 0.00 ? 57  HIS A H    1  
ATOM   847   H  HA   . HIS A 1 57 ? 7.746   1.230   -0.570  1.00 0.00 ? 57  HIS A HA   1  
ATOM   848   H  HB2  . HIS A 1 57 ? 6.114   2.755   -1.115  1.00 0.00 ? 57  HIS A HB2  1  
ATOM   849   H  HB3  . HIS A 1 57 ? 6.919   3.248   -2.602  1.00 0.00 ? 57  HIS A HB3  1  
ATOM   850   H  HD1  . HIS A 1 57 ? 5.122   0.151   -1.298  1.00 0.00 ? 57  HIS A HD1  1  
ATOM   851   H  HD2  . HIS A 1 57 ? 5.676   2.307   -4.806  1.00 0.00 ? 57  HIS A HD2  1  
ATOM   852   H  HE1  . HIS A 1 57 ? 3.689   -0.989  -3.022  1.00 0.00 ? 57  HIS A HE1  1  
ATOM   853   N  N    . ARG A 1 58 ? 9.024   0.989   -3.576  1.00 0.00 ? 58  ARG A N    1  
ATOM   854   C  CA   . ARG A 1 58 ? 9.443   0.047   -4.607  1.00 0.00 ? 58  ARG A CA   1  
ATOM   855   C  C    . ARG A 1 58 ? 10.468  -0.940  -4.056  1.00 0.00 ? 58  ARG A C    1  
ATOM   856   O  O    . ARG A 1 58 ? 10.671  -2.017  -4.618  1.00 0.00 ? 58  ARG A O    1  
ATOM   857   C  CB   . ARG A 1 58 ? 10.033  0.797   -5.802  1.00 0.00 ? 58  ARG A CB   1  
ATOM   858   C  CG   . ARG A 1 58 ? 9.065   1.777   -6.444  1.00 0.00 ? 58  ARG A CG   1  
ATOM   859   C  CD   . ARG A 1 58 ? 9.796   2.962   -7.057  1.00 0.00 ? 58  ARG A CD   1  
ATOM   860   N  NE   . ARG A 1 58 ? 10.793  2.542   -8.038  1.00 0.00 ? 58  ARG A NE   1  
ATOM   861   C  CZ   . ARG A 1 58 ? 11.349  3.366   -8.920  1.00 0.00 ? 58  ARG A CZ   1  
ATOM   862   N  NH1  . ARG A 1 58 ? 11.006  4.646   -8.943  1.00 0.00 ? 58  ARG A NH1  1  
ATOM   863   N  NH2  . ARG A 1 58 ? 12.249  2.909   -9.781  1.00 0.00 ? 58  ARG A NH2  1  
ATOM   864   H  H    . ARG A 1 58 ? 9.284   1.930   -3.654  1.00 0.00 ? 58  ARG A H    1  
ATOM   865   H  HA   . ARG A 1 58 ? 8.571   -0.500  -4.931  1.00 0.00 ? 58  ARG A HA   1  
ATOM   866   H  HB2  . ARG A 1 58 ? 10.903  1.347   -5.474  1.00 0.00 ? 58  ARG A HB2  1  
ATOM   867   H  HB3  . ARG A 1 58 ? 10.333  0.078   -6.550  1.00 0.00 ? 58  ARG A HB3  1  
ATOM   868   H  HG2  . ARG A 1 58 ? 8.514   1.268   -7.221  1.00 0.00 ? 58  ARG A HG2  1  
ATOM   869   H  HG3  . ARG A 1 58 ? 8.380   2.138   -5.691  1.00 0.00 ? 58  ARG A HG3  1  
ATOM   870   H  HD2  . ARG A 1 58 ? 9.074   3.601   -7.543  1.00 0.00 ? 58  ARG A HD2  1  
ATOM   871   H  HD3  . ARG A 1 58 ? 10.289  3.510   -6.268  1.00 0.00 ? 58  ARG A HD3  1  
ATOM   872   H  HE   . ARG A 1 58 ? 11.061  1.600   -8.038  1.00 0.00 ? 58  ARG A HE   1  
ATOM   873   H  HH11 . ARG A 1 58 ? 10.329  4.994   -8.295  1.00 0.00 ? 58  ARG A HH11 1  
ATOM   874   H  HH12 . ARG A 1 58 ? 11.427  5.265   -9.607  1.00 0.00 ? 58  ARG A HH12 1  
ATOM   875   H  HH21 . ARG A 1 58 ? 12.510  1.944   -9.766  1.00 0.00 ? 58  ARG A HH21 1  
ATOM   876   H  HH22 . ARG A 1 58 ? 12.666  3.529   -10.444 1.00 0.00 ? 58  ARG A HH22 1  
ATOM   877   N  N    . SER A 1 59 ? 11.111  -0.566  -2.955  1.00 0.00 ? 59  SER A N    1  
ATOM   878   C  CA   . SER A 1 59 ? 12.118  -1.417  -2.331  1.00 0.00 ? 59  SER A CA   1  
ATOM   879   C  C    . SER A 1 59 ? 11.491  -2.303  -1.259  1.00 0.00 ? 59  SER A C    1  
ATOM   880   O  O    . SER A 1 59 ? 12.159  -3.155  -0.672  1.00 0.00 ? 59  SER A O    1  
ATOM   881   C  CB   . SER A 1 59 ? 13.228  -0.562  -1.717  1.00 0.00 ? 59  SER A CB   1  
ATOM   882   O  OG   . SER A 1 59 ? 14.088  -0.046  -2.718  1.00 0.00 ? 59  SER A OG   1  
ATOM   883   H  H    . SER A 1 59 ? 10.905  0.304   -2.554  1.00 0.00 ? 59  SER A H    1  
ATOM   884   H  HA   . SER A 1 59 ? 12.542  -2.046  -3.099  1.00 0.00 ? 59  SER A HA   1  
ATOM   885   H  HB2  . SER A 1 59 ? 12.788  0.262   -1.178  1.00 0.00 ? 59  SER A HB2  1  
ATOM   886   H  HB3  . SER A 1 59 ? 13.810  -1.168  -1.037  1.00 0.00 ? 59  SER A HB3  1  
ATOM   887   H  HG   . SER A 1 59 ? 14.825  0.409   -2.305  1.00 0.00 ? 59  SER A HG   1  
ATOM   888   N  N    . LYS A 1 60 ? 10.203  -2.097  -1.009  1.00 0.00 ? 60  LYS A N    1  
ATOM   889   C  CA   . LYS A 1 60 ? 9.482   -2.877  -0.009  1.00 0.00 ? 60  LYS A CA   1  
ATOM   890   C  C    . LYS A 1 60 ? 8.349   -3.671  -0.651  1.00 0.00 ? 60  LYS A C    1  
ATOM   891   O  O    . LYS A 1 60 ? 8.003   -4.758  -0.190  1.00 0.00 ? 60  LYS A O    1  
ATOM   892   C  CB   . LYS A 1 60 ? 8.923   -1.957  1.079   1.00 0.00 ? 60  LYS A CB   1  
ATOM   893   C  CG   . LYS A 1 60 ? 9.979   -1.102  1.756   1.00 0.00 ? 60  LYS A CG   1  
ATOM   894   C  CD   . LYS A 1 60 ? 10.567  -1.800  2.971   1.00 0.00 ? 60  LYS A CD   1  
ATOM   895   C  CE   . LYS A 1 60 ? 12.008  -1.378  3.214   1.00 0.00 ? 60  LYS A CE   1  
ATOM   896   N  NZ   . LYS A 1 60 ? 12.093  -0.151  4.054   1.00 0.00 ? 60  LYS A NZ   1  
ATOM   897   H  H    . LYS A 1 60 ? 9.724   -1.403  -1.510  1.00 0.00 ? 60  LYS A H    1  
ATOM   898   H  HA   . LYS A 1 60 ? 10.181  -3.567  0.440   1.00 0.00 ? 60  LYS A HA   1  
ATOM   899   H  HB2  . LYS A 1 60 ? 8.188   -1.301  0.636   1.00 0.00 ? 60  LYS A HB2  1  
ATOM   900   H  HB3  . LYS A 1 60 ? 8.442   -2.563  1.834   1.00 0.00 ? 60  LYS A HB3  1  
ATOM   901   H  HG2  . LYS A 1 60 ? 10.773  -0.901  1.051   1.00 0.00 ? 60  LYS A HG2  1  
ATOM   902   H  HG3  . LYS A 1 60 ? 9.529   -0.171  2.069   1.00 0.00 ? 60  LYS A HG3  1  
ATOM   903   H  HD2  . LYS A 1 60 ? 9.978   -1.546  3.841   1.00 0.00 ? 60  LYS A HD2  1  
ATOM   904   H  HD3  . LYS A 1 60 ? 10.536  -2.868  2.812   1.00 0.00 ? 60  LYS A HD3  1  
ATOM   905   H  HE2  . LYS A 1 60 ? 12.526  -2.182  3.713   1.00 0.00 ? 60  LYS A HE2  1  
ATOM   906   H  HE3  . LYS A 1 60 ? 12.478  -1.184  2.261   1.00 0.00 ? 60  LYS A HE3  1  
ATOM   907   H  HZ1  . LYS A 1 60 ? 12.669  0.570   3.576   1.00 0.00 ? 60  LYS A HZ1  1  
ATOM   908   H  HZ2  . LYS A 1 60 ? 12.529  -0.375  4.971   1.00 0.00 ? 60  LYS A HZ2  1  
ATOM   909   H  HZ3  . LYS A 1 60 ? 11.141  0.235   4.221   1.00 0.00 ? 60  LYS A HZ3  1  
ATOM   910   N  N    . SER A 1 61 ? 7.778   -3.121  -1.717  1.00 0.00 ? 61  SER A N    1  
ATOM   911   C  CA   . SER A 1 61 ? 6.682   -3.777  -2.421  1.00 0.00 ? 61  SER A CA   1  
ATOM   912   C  C    . SER A 1 61 ? 7.129   -4.250  -3.801  1.00 0.00 ? 61  SER A C    1  
ATOM   913   O  O    . SER A 1 61 ? 6.624   -5.245  -4.323  1.00 0.00 ? 61  SER A O    1  
ATOM   914   C  CB   . SER A 1 61 ? 5.492   -2.826  -2.556  1.00 0.00 ? 61  SER A CB   1  
ATOM   915   O  OG   . SER A 1 61 ? 4.271   -3.542  -2.619  1.00 0.00 ? 61  SER A OG   1  
ATOM   916   H  H    . SER A 1 61 ? 8.099   -2.252  -2.037  1.00 0.00 ? 61  SER A H    1  
ATOM   917   H  HA   . SER A 1 61 ? 6.381   -4.636  -1.839  1.00 0.00 ? 61  SER A HA   1  
ATOM   918   H  HB2  . SER A 1 61 ? 5.464   -2.164  -1.704  1.00 0.00 ? 61  SER A HB2  1  
ATOM   919   H  HB3  . SER A 1 61 ? 5.601   -2.244  -3.460  1.00 0.00 ? 61  SER A HB3  1  
ATOM   920   H  HG   . SER A 1 61 ? 4.169   -3.926  -3.493  1.00 0.00 ? 61  SER A HG   1  
ATOM   921   N  N    . HIS A 1 62 ? 8.080   -3.530  -4.387  1.00 0.00 ? 62  HIS A N    1  
ATOM   922   C  CA   . HIS A 1 62 ? 8.597   -3.875  -5.707  1.00 0.00 ? 62  HIS A CA   1  
ATOM   923   C  C    . HIS A 1 62 ? 10.084  -4.207  -5.638  1.00 0.00 ? 62  HIS A C    1  
ATOM   924   O  O    . HIS A 1 62 ? 10.843  -3.963  -6.576  1.00 0.00 ? 62  HIS A O    1  
ATOM   925   C  CB   . HIS A 1 62 ? 8.363   -2.725  -6.686  1.00 0.00 ? 62  HIS A CB   1  
ATOM   926   C  CG   . HIS A 1 62 ? 6.917   -2.387  -6.881  1.00 0.00 ? 62  HIS A CG   1  
ATOM   927   N  ND1  . HIS A 1 62 ? 6.015   -3.251  -7.466  1.00 0.00 ? 62  HIS A ND1  1  
ATOM   928   C  CD2  . HIS A 1 62 ? 6.217   -1.274  -6.562  1.00 0.00 ? 62  HIS A CD2  1  
ATOM   929   C  CE1  . HIS A 1 62 ? 4.823   -2.682  -7.500  1.00 0.00 ? 62  HIS A CE1  1  
ATOM   930   N  NE2  . HIS A 1 62 ? 4.919   -1.481  -6.957  1.00 0.00 ? 62  HIS A NE2  1  
ATOM   931   H  H    . HIS A 1 62 ? 8.443   -2.748  -3.921  1.00 0.00 ? 62  HIS A H    1  
ATOM   932   H  HA   . HIS A 1 62 ? 8.062   -4.746  -6.055  1.00 0.00 ? 62  HIS A HA   1  
ATOM   933   H  HB2  . HIS A 1 62 ? 8.863   -1.841  -6.318  1.00 0.00 ? 62  HIS A HB2  1  
ATOM   934   H  HB3  . HIS A 1 62 ? 8.775   -2.991  -7.649  1.00 0.00 ? 62  HIS A HB3  1  
ATOM   935   H  HD1  . HIS A 1 62 ? 6.219   -4.146  -7.807  1.00 0.00 ? 62  HIS A HD1  1  
ATOM   936   H  HD2  . HIS A 1 62 ? 6.607   -0.385  -6.085  1.00 0.00 ? 62  HIS A HD2  1  
ATOM   937   H  HE1  . HIS A 1 62 ? 3.924   -3.122  -7.903  1.00 0.00 ? 62  HIS A HE1  1  
ATOM   938   N  N    . PRO A 1 63 ? 10.512  -4.776  -4.502  1.00 0.00 ? 63  PRO A N    1  
ATOM   939   C  CA   . PRO A 1 63 ? 11.912  -5.153  -4.283  1.00 0.00 ? 63  PRO A CA   1  
ATOM   940   C  C    . PRO A 1 63 ? 12.336  -6.334  -5.150  1.00 0.00 ? 63  PRO A C    1  
ATOM   941   O  O    . PRO A 1 63 ? 13.517  -6.675  -5.216  1.00 0.00 ? 63  PRO A O    1  
ATOM   942   C  CB   . PRO A 1 63 ? 11.950  -5.536  -2.802  1.00 0.00 ? 63  PRO A CB   1  
ATOM   943   C  CG   . PRO A 1 63 ? 10.554  -5.949  -2.482  1.00 0.00 ? 63  PRO A CG   1  
ATOM   944   C  CD   . PRO A 1 63 ? 9.663   -5.097  -3.342  1.00 0.00 ? 63  PRO A CD   1  
ATOM   945   H  HA   . PRO A 1 63 ? 12.579  -4.322  -4.459  1.00 0.00 ? 63  PRO A HA   1  
ATOM   946   H  HB2  . PRO A 1 63 ? 12.646  -6.350  -2.655  1.00 0.00 ? 63  PRO A HB2  1  
ATOM   947   H  HB3  . PRO A 1 63 ? 12.254  -4.684  -2.213  1.00 0.00 ? 63  PRO A HB3  1  
ATOM   948   H  HG2  . PRO A 1 63 ? 10.417  -6.993  -2.718  1.00 0.00 ? 63  PRO A HG2  1  
ATOM   949   H  HG3  . PRO A 1 63 ? 10.349  -5.769  -1.437  1.00 0.00 ? 63  PRO A HG3  1  
ATOM   950   H  HD2  . PRO A 1 63 ? 8.788   -5.652  -3.647  1.00 0.00 ? 63  PRO A HD2  1  
ATOM   951   H  HD3  . PRO A 1 63 ? 9.377   -4.198  -2.815  1.00 0.00 ? 63  PRO A HD3  1  
ATOM   952   N  N    . ALA A 1 64 ? 11.366  -6.954  -5.814  1.00 0.00 ? 64  ALA A N    1  
ATOM   953   C  CA   . ALA A 1 64 ? 11.640  -8.095  -6.678  1.00 0.00 ? 64  ALA A CA   1  
ATOM   954   C  C    . ALA A 1 64 ? 11.711  -7.671  -8.141  1.00 0.00 ? 64  ALA A C    1  
ATOM   955   O  O    . ALA A 1 64 ? 12.138  -8.442  -9.002  1.00 0.00 ? 64  ALA A O    1  
ATOM   956   C  CB   . ALA A 1 64 ? 10.577  -9.168  -6.489  1.00 0.00 ? 64  ALA A CB   1  
ATOM   957   H  H    . ALA A 1 64 ? 10.444  -6.635  -5.721  1.00 0.00 ? 64  ALA A H    1  
ATOM   958   H  HA   . ALA A 1 64 ? 12.593  -8.512  -6.388  1.00 0.00 ? 64  ALA A HA   1  
ATOM   959   H  HB1  . ALA A 1 64 ? 11.021  -10.033 -6.019  1.00 0.00 ? 64  ALA A HB1  1  
ATOM   960   H  HB2  . ALA A 1 64 ? 9.786   -8.783  -5.863  1.00 0.00 ? 64  ALA A HB2  1  
ATOM   961   H  HB3  . ALA A 1 64 ? 10.173  -9.447  -7.450  1.00 0.00 ? 64  ALA A HB3  1  
ATOM   962   N  N    . LEU A 1 65 ? 11.290  -6.442  -8.417  1.00 0.00 ? 65  LEU A N    1  
ATOM   963   C  CA   . LEU A 1 65 ? 11.305  -5.915  -9.777  1.00 0.00 ? 65  LEU A CA   1  
ATOM   964   C  C    . LEU A 1 65 ? 12.576  -5.111  -10.035 1.00 0.00 ? 65  LEU A C    1  
ATOM   965   O  O    . LEU A 1 65 ? 13.232  -5.280  -11.064 1.00 0.00 ? 65  LEU A O    1  
ATOM   966   C  CB   . LEU A 1 65 ? 10.075  -5.038  -10.020 1.00 0.00 ? 65  LEU A CB   1  
ATOM   967   C  CG   . LEU A 1 65 ? 8.719   -5.718  -9.830  1.00 0.00 ? 65  LEU A CG   1  
ATOM   968   C  CD1  . LEU A 1 65 ? 7.603   -4.685  -9.809  1.00 0.00 ? 65  LEU A CD1  1  
ATOM   969   C  CD2  . LEU A 1 65 ? 8.478   -6.744  -10.928 1.00 0.00 ? 65  LEU A CD2  1  
ATOM   970   H  H    . LEU A 1 65 ? 10.960  -5.874  -7.690  1.00 0.00 ? 65  LEU A H    1  
ATOM   971   H  HA   . LEU A 1 65 ? 11.280  -6.753  -10.457 1.00 0.00 ? 65  LEU A HA   1  
ATOM   972   H  HB2  . LEU A 1 65 ? 10.125  -4.203  -9.338  1.00 0.00 ? 65  LEU A HB2  1  
ATOM   973   H  HB3  . LEU A 1 65 ? 10.125  -4.674  -11.036 1.00 0.00 ? 65  LEU A HB3  1  
ATOM   974   H  HG   . LEU A 1 65 ? 8.712   -6.236  -8.881  1.00 0.00 ? 65  LEU A HG   1  
ATOM   975   H  HD11 . LEU A 1 65 ? 6.720   -5.118  -9.362  1.00 0.00 ? 65  LEU A HD11 1  
ATOM   976   H  HD12 . LEU A 1 65 ? 7.380   -4.375  -10.819 1.00 0.00 ? 65  LEU A HD12 1  
ATOM   977   H  HD13 . LEU A 1 65 ? 7.916   -3.829  -9.230  1.00 0.00 ? 65  LEU A HD13 1  
ATOM   978   H  HD21 . LEU A 1 65 ? 9.144   -7.582  -10.789 1.00 0.00 ? 65  LEU A HD21 1  
ATOM   979   H  HD22 . LEU A 1 65 ? 8.666   -6.291  -11.891 1.00 0.00 ? 65  LEU A HD22 1  
ATOM   980   H  HD23 . LEU A 1 65 ? 7.455   -7.085  -10.884 1.00 0.00 ? 65  LEU A HD23 1  
ATOM   981   N  N    . LEU A 1 66 ? 12.918  -4.237  -9.095  1.00 0.00 ? 66  LEU A N    1  
ATOM   982   C  CA   . LEU A 1 66 ? 14.112  -3.408  -9.218  1.00 0.00 ? 66  LEU A CA   1  
ATOM   983   C  C    . LEU A 1 66 ? 15.321  -4.250  -9.615  1.00 0.00 ? 66  LEU A C    1  
ATOM   984   O  O    . LEU A 1 66 ? 16.041  -3.916  -10.557 1.00 0.00 ? 66  LEU A O    1  
ATOM   985   C  CB   . LEU A 1 66 ? 14.392  -2.682  -7.901  1.00 0.00 ? 66  LEU A CB   1  
ATOM   986   C  CG   . LEU A 1 66 ? 13.225  -1.890  -7.311  1.00 0.00 ? 66  LEU A CG   1  
ATOM   987   C  CD1  . LEU A 1 66 ? 13.327  -1.840  -5.794  1.00 0.00 ? 66  LEU A CD1  1  
ATOM   988   C  CD2  . LEU A 1 66 ? 13.187  -0.484  -7.891  1.00 0.00 ? 66  LEU A CD2  1  
ATOM   989   H  H    . LEU A 1 66 ? 12.356  -4.147  -8.297  1.00 0.00 ? 66  LEU A H    1  
ATOM   990   H  HA   . LEU A 1 66 ? 13.928  -2.677  -9.991  1.00 0.00 ? 66  LEU A HA   1  
ATOM   991   H  HB2  . LEU A 1 66 ? 14.691  -3.421  -7.174  1.00 0.00 ? 66  LEU A HB2  1  
ATOM   992   H  HB3  . LEU A 1 66 ? 15.208  -1.995  -8.071  1.00 0.00 ? 66  LEU A HB3  1  
ATOM   993   H  HG   . LEU A 1 66 ? 12.297  -2.383  -7.566  1.00 0.00 ? 66  LEU A HG   1  
ATOM   994   H  HD11 . LEU A 1 66 ? 13.074  -0.849  -5.449  1.00 0.00 ? 66  LEU A HD11 1  
ATOM   995   H  HD12 . LEU A 1 66 ? 14.336  -2.079  -5.493  1.00 0.00 ? 66  LEU A HD12 1  
ATOM   996   H  HD13 . LEU A 1 66 ? 12.644  -2.558  -5.364  1.00 0.00 ? 66  LEU A HD13 1  
ATOM   997   H  HD21 . LEU A 1 66 ? 12.241  -0.325  -8.388  1.00 0.00 ? 66  LEU A HD21 1  
ATOM   998   H  HD22 . LEU A 1 66 ? 13.991  -0.367  -8.603  1.00 0.00 ? 66  LEU A HD22 1  
ATOM   999   H  HD23 . LEU A 1 66 ? 13.302  0.237   -7.096  1.00 0.00 ? 66  LEU A HD23 1  
ATOM   1000  N  N    . LEU A 1 67 ? 15.536  -5.343  -8.893  1.00 0.00 ? 67  LEU A N    1  
ATOM   1001  C  CA   . LEU A 1 67 ? 16.657  -6.235  -9.170  1.00 0.00 ? 67  LEU A CA   1  
ATOM   1002  C  C    . LEU A 1 67 ? 16.589  -6.766  -10.599 1.00 0.00 ? 67  LEU A C    1  
ATOM   1003  O  O    . LEU A 1 67 ? 15.545  -6.702  -11.246 1.00 0.00 ? 67  LEU A O    1  
ATOM   1004  C  CB   . LEU A 1 67 ? 16.663  -7.401  -8.181  1.00 0.00 ? 67  LEU A CB   1  
ATOM   1005  C  CG   . LEU A 1 67 ? 17.355  -7.142  -6.842  1.00 0.00 ? 67  LEU A CG   1  
ATOM   1006  C  CD1  . LEU A 1 67 ? 17.093  -8.286  -5.875  1.00 0.00 ? 67  LEU A CD1  1  
ATOM   1007  C  CD2  . LEU A 1 67 ? 18.850  -6.944  -7.044  1.00 0.00 ? 67  LEU A CD2  1  
ATOM   1008  H  H    . LEU A 1 67 ? 14.928  -5.557  -8.155  1.00 0.00 ? 67  LEU A H    1  
ATOM   1009  H  HA   . LEU A 1 67 ? 17.568  -5.668  -9.052  1.00 0.00 ? 67  LEU A HA   1  
ATOM   1010  H  HB2  . LEU A 1 67 ? 15.638  -7.667  -7.976  1.00 0.00 ? 67  LEU A HB2  1  
ATOM   1011  H  HB3  . LEU A 1 67 ? 17.162  -8.234  -8.656  1.00 0.00 ? 67  LEU A HB3  1  
ATOM   1012  H  HG   . LEU A 1 67 ? 16.953  -6.238  -6.405  1.00 0.00 ? 67  LEU A HG   1  
ATOM   1013  H  HD11 . LEU A 1 67 ? 18.001  -8.520  -5.340  1.00 0.00 ? 67  LEU A HD11 1  
ATOM   1014  H  HD12 . LEU A 1 67 ? 16.765  -9.155  -6.426  1.00 0.00 ? 67  LEU A HD12 1  
ATOM   1015  H  HD13 . LEU A 1 67 ? 16.326  -7.994  -5.173  1.00 0.00 ? 67  LEU A HD13 1  
ATOM   1016  H  HD21 . LEU A 1 67 ? 19.033  -6.585  -8.046  1.00 0.00 ? 67  LEU A HD21 1  
ATOM   1017  H  HD22 . LEU A 1 67 ? 19.361  -7.885  -6.900  1.00 0.00 ? 67  LEU A HD22 1  
ATOM   1018  H  HD23 . LEU A 1 67 ? 19.218  -6.221  -6.330  1.00 0.00 ? 67  LEU A HD23 1  
ATOM   1019  N  N    . ALA A 1 68 ? 17.710  -7.291  -11.083 1.00 0.00 ? 68  ALA A N    1  
ATOM   1020  C  CA   . ALA A 1 68 ? 17.777  -7.837  -12.433 1.00 0.00 ? 68  ALA A CA   1  
ATOM   1021  C  C    . ALA A 1 68 ? 16.780  -8.977  -12.614 1.00 0.00 ? 68  ALA A C    1  
ATOM   1022  O  O    . ALA A 1 68 ? 16.714  -9.909  -11.813 1.00 0.00 ? 68  ALA A O    1  
ATOM   1023  C  CB   . ALA A 1 68 ? 19.189  -8.314  -12.740 1.00 0.00 ? 68  ALA A CB   1  
ATOM   1024  H  H    . ALA A 1 68 ? 18.510  -7.313  -10.518 1.00 0.00 ? 68  ALA A H    1  
ATOM   1025  H  HA   . ALA A 1 68 ? 17.533  -7.045  -13.126 1.00 0.00 ? 68  ALA A HA   1  
ATOM   1026  H  HB1  . ALA A 1 68 ? 19.672  -8.618  -11.822 1.00 0.00 ? 68  ALA A HB1  1  
ATOM   1027  H  HB2  . ALA A 1 68 ? 19.145  -9.153  -13.419 1.00 0.00 ? 68  ALA A HB2  1  
ATOM   1028  H  HB3  . ALA A 1 68 ? 19.749  -7.511  -13.194 1.00 0.00 ? 68  ALA A HB3  1  
ATOM   1029  N  N    . PRO A 1 69 ? 15.985  -8.902  -13.692 1.00 0.00 ? 69  PRO A N    1  
ATOM   1030  C  CA   . PRO A 1 69 ? 14.976  -9.920  -14.003 1.00 0.00 ? 69  PRO A CA   1  
ATOM   1031  C  C    . PRO A 1 69 ? 15.601  -11.242 -14.434 1.00 0.00 ? 69  PRO A C    1  
ATOM   1032  O  O    . PRO A 1 69 ? 16.822  -11.396 -14.418 1.00 0.00 ? 69  PRO A O    1  
ATOM   1033  C  CB   . PRO A 1 69 ? 14.190  -9.297  -15.160 1.00 0.00 ? 69  PRO A CB   1  
ATOM   1034  C  CG   . PRO A 1 69 ? 15.144  -8.349  -15.800 1.00 0.00 ? 69  PRO A CG   1  
ATOM   1035  C  CD   . PRO A 1 69 ? 16.009  -7.819  -14.689 1.00 0.00 ? 69  PRO A CD   1  
ATOM   1036  H  HA   . PRO A 1 69 ? 14.314  -10.091 -13.167 1.00 0.00 ? 69  PRO A HA   1  
ATOM   1037  H  HB2  . PRO A 1 69 ? 13.882  -10.073 -15.847 1.00 0.00 ? 69  PRO A HB2  1  
ATOM   1038  H  HB3  . PRO A 1 69 ? 13.322  -8.784  -14.775 1.00 0.00 ? 69  PRO A HB3  1  
ATOM   1039  H  HG2  . PRO A 1 69 ? 15.747  -8.870  -16.528 1.00 0.00 ? 69  PRO A HG2  1  
ATOM   1040  H  HG3  . PRO A 1 69 ? 14.601  -7.542  -16.268 1.00 0.00 ? 69  PRO A HG3  1  
ATOM   1041  H  HD2  . PRO A 1 69 ? 17.014  -7.644  -15.044 1.00 0.00 ? 69  PRO A HD2  1  
ATOM   1042  H  HD3  . PRO A 1 69 ? 15.587  -6.912  -14.283 1.00 0.00 ? 69  PRO A HD3  1  
ATOM   1043  N  N    . GLN A 1 70 ? 14.756  -12.193 -14.819 1.00 0.00 ? 70  GLN A N    1  
ATOM   1044  C  CA   . GLN A 1 70 ? 15.227  -13.502 -15.254 1.00 0.00 ? 70  GLN A CA   1  
ATOM   1045  C  C    . GLN A 1 70 ? 16.216  -13.370 -16.407 1.00 0.00 ? 70  GLN A C    1  
ATOM   1046  O  O    . GLN A 1 70 ? 16.457  -12.271 -16.907 1.00 0.00 ? 70  GLN A O    1  
ATOM   1047  C  CB   . GLN A 1 70 ? 14.046  -14.377 -15.678 1.00 0.00 ? 70  GLN A CB   1  
ATOM   1048  C  CG   . GLN A 1 70 ? 13.301  -13.846 -16.892 1.00 0.00 ? 70  GLN A CG   1  
ATOM   1049  C  CD   . GLN A 1 70 ? 12.542  -12.567 -16.598 1.00 0.00 ? 70  GLN A CD   1  
ATOM   1050  O  OE1  . GLN A 1 70 ? 12.143  -12.316 -15.460 1.00 0.00 ? 70  GLN A OE1  1  
ATOM   1051  N  NE2  . GLN A 1 70 ? 12.337  -11.750 -17.624 1.00 0.00 ? 70  GLN A NE2  1  
ATOM   1052  H  H    . GLN A 1 70 ? 13.794  -12.010 -14.810 1.00 0.00 ? 70  GLN A H    1  
ATOM   1053  H  HA   . GLN A 1 70 ? 15.727  -13.969 -14.419 1.00 0.00 ? 70  GLN A HA   1  
ATOM   1054  H  HB2  . GLN A 1 70 ? 14.411  -15.366 -15.911 1.00 0.00 ? 70  GLN A HB2  1  
ATOM   1055  H  HB3  . GLN A 1 70 ? 13.349  -14.444 -14.856 1.00 0.00 ? 70  GLN A HB3  1  
ATOM   1056  H  HG2  . GLN A 1 70 ? 14.014  -13.650 -17.679 1.00 0.00 ? 70  GLN A HG2  1  
ATOM   1057  H  HG3  . GLN A 1 70 ? 12.598  -14.597 -17.224 1.00 0.00 ? 70  GLN A HG3  1  
ATOM   1058  H  HE21 . GLN A 1 70 ? 12.683  -12.016 -18.503 1.00 0.00 ? 70  GLN A HE21 1  
ATOM   1059  H  HE22 . GLN A 1 70 ? 11.849  -10.917 -17.463 1.00 0.00 ? 70  GLN A HE22 1  
ATOM   1060  N  N    . GLU A 1 71 ? 16.787  -14.496 -16.823 1.00 0.00 ? 71  GLU A N    1  
ATOM   1061  C  CA   . GLU A 1 71 ? 17.752  -14.504 -17.916 1.00 0.00 ? 71  GLU A CA   1  
ATOM   1062  C  C    . GLU A 1 71 ? 17.292  -13.598 -19.054 1.00 0.00 ? 71  GLU A C    1  
ATOM   1063  O  O    . GLU A 1 71 ? 18.090  -12.868 -19.643 1.00 0.00 ? 71  GLU A O    1  
ATOM   1064  C  CB   . GLU A 1 71 ? 17.957  -15.928 -18.435 1.00 0.00 ? 71  GLU A CB   1  
ATOM   1065  C  CG   . GLU A 1 71 ? 16.693  -16.562 -18.990 1.00 0.00 ? 71  GLU A CG   1  
ATOM   1066  C  CD   . GLU A 1 71 ? 15.693  -16.916 -17.906 1.00 0.00 ? 71  GLU A CD   1  
ATOM   1067  O  OE1  . GLU A 1 71 ? 16.121  -17.148 -16.756 1.00 0.00 ? 71  GLU A OE1  1  
ATOM   1068  O  OE2  . GLU A 1 71 ? 14.482  -16.961 -18.209 1.00 0.00 ? 71  GLU A OE2  1  
ATOM   1069  H  H    . GLU A 1 71 ? 16.555  -15.341 -16.384 1.00 0.00 ? 71  GLU A H    1  
ATOM   1070  H  HA   . GLU A 1 71 ? 18.690  -14.131 -17.533 1.00 0.00 ? 71  GLU A HA   1  
ATOM   1071  H  HB2  . GLU A 1 71 ? 18.701  -15.910 -19.218 1.00 0.00 ? 71  GLU A HB2  1  
ATOM   1072  H  HB3  . GLU A 1 71 ? 18.317  -16.545 -17.624 1.00 0.00 ? 71  GLU A HB3  1  
ATOM   1073  H  HG2  . GLU A 1 71 ? 16.228  -15.867 -19.674 1.00 0.00 ? 71  GLU A HG2  1  
ATOM   1074  H  HG3  . GLU A 1 71 ? 16.960  -17.464 -19.521 1.00 0.00 ? 71  GLU A HG3  1  
ATOM   1075  N  N    . SER A 1 72 ? 15.999  -13.650 -19.359 1.00 0.00 ? 72  SER A N    1  
ATOM   1076  C  CA   . SER A 1 72 ? 15.432  -12.838 -20.430 1.00 0.00 ? 72  SER A CA   1  
ATOM   1077  C  C    . SER A 1 72 ? 15.480  -11.356 -20.071 1.00 0.00 ? 72  SER A C    1  
ATOM   1078  O  O    . SER A 1 72 ? 14.728  -10.888 -19.216 1.00 0.00 ? 72  SER A O    1  
ATOM   1079  C  CB   . SER A 1 72 ? 13.988  -13.261 -20.709 1.00 0.00 ? 72  SER A CB   1  
ATOM   1080  O  OG   . SER A 1 72 ? 13.935  -14.573 -21.240 1.00 0.00 ? 72  SER A OG   1  
ATOM   1081  H  H    . SER A 1 72 ? 15.413  -14.252 -18.853 1.00 0.00 ? 72  SER A H    1  
ATOM   1082  H  HA   . SER A 1 72 ? 16.024  -13.001 -21.318 1.00 0.00 ? 72  SER A HA   1  
ATOM   1083  H  HB2  . SER A 1 72 ? 13.424  -13.234 -19.789 1.00 0.00 ? 72  SER A HB2  1  
ATOM   1084  H  HB3  . SER A 1 72 ? 13.548  -12.578 -21.421 1.00 0.00 ? 72  SER A HB3  1  
ATOM   1085  H  HG   . SER A 1 72 ? 14.251  -15.198 -20.583 1.00 0.00 ? 72  SER A HG   1  
ATOM   1086  N  N    . SER A 1 73 ? 16.371  -10.623 -20.731 1.00 0.00 ? 73  SER A N    1  
ATOM   1087  C  CA   . SER A 1 73 ? 16.522  -9.194  -20.480 1.00 0.00 ? 73  SER A CA   1  
ATOM   1088  C  C    . SER A 1 73 ? 15.227  -8.449  -20.789 1.00 0.00 ? 73  SER A C    1  
ATOM   1089  O  O    . SER A 1 73 ? 14.259  -9.037  -21.270 1.00 0.00 ? 73  SER A O    1  
ATOM   1090  C  CB   . SER A 1 73 ? 17.665  -8.625  -21.322 1.00 0.00 ? 73  SER A CB   1  
ATOM   1091  O  OG   . SER A 1 73 ? 18.186  -7.442  -20.741 1.00 0.00 ? 73  SER A OG   1  
ATOM   1092  H  H    . SER A 1 73 ? 16.943  -11.054 -21.400 1.00 0.00 ? 73  SER A H    1  
ATOM   1093  H  HA   . SER A 1 73 ? 16.757  -9.065  -19.434 1.00 0.00 ? 73  SER A HA   1  
ATOM   1094  H  HB2  . SER A 1 73 ? 18.456  -9.356  -21.392 1.00 0.00 ? 73  SER A HB2  1  
ATOM   1095  H  HB3  . SER A 1 73 ? 17.298  -8.394  -22.312 1.00 0.00 ? 73  SER A HB3  1  
ATOM   1096  H  HG   . SER A 1 73 ? 18.008  -7.443  -19.798 1.00 0.00 ? 73  SER A HG   1  
ATOM   1097  N  N    . GLY A 1 74 ? 15.217  -7.150  -20.507 1.00 0.00 ? 74  GLY A N    1  
ATOM   1098  C  CA   . GLY A 1 74 ? 14.037  -6.344  -20.761 1.00 0.00 ? 74  GLY A CA   1  
ATOM   1099  C  C    . GLY A 1 74 ? 14.366  -4.876  -20.946 1.00 0.00 ? 74  GLY A C    1  
ATOM   1100  O  O    . GLY A 1 74 ? 15.418  -4.396  -20.525 1.00 0.00 ? 74  GLY A O    1  
ATOM   1101  H  H    . GLY A 1 74 ? 16.018  -6.735  -20.124 1.00 0.00 ? 74  GLY A H    1  
ATOM   1102  H  HA2  . GLY A 1 74 ? 13.550  -6.709  -21.653 1.00 0.00 ? 74  GLY A HA2  1  
ATOM   1103  H  HA3  . GLY A 1 74 ? 13.359  -6.447  -19.926 1.00 0.00 ? 74  GLY A HA3  1  
ATOM   1104  N  N    . PRO A 1 75 ? 13.451  -4.138  -21.592 1.00 0.00 ? 75  PRO A N    1  
ATOM   1105  C  CA   . PRO A 1 75 ? 13.627  -2.706  -21.848 1.00 0.00 ? 75  PRO A CA   1  
ATOM   1106  C  C    . PRO A 1 75 ? 13.541  -1.874  -20.573 1.00 0.00 ? 75  PRO A C    1  
ATOM   1107  O  O    . PRO A 1 75 ? 12.465  -1.710  -19.999 1.00 0.00 ? 75  PRO A O    1  
ATOM   1108  C  CB   . PRO A 1 75 ? 12.466  -2.367  -22.786 1.00 0.00 ? 75  PRO A CB   1  
ATOM   1109  C  CG   . PRO A 1 75 ? 11.427  -3.392  -22.487 1.00 0.00 ? 75  PRO A CG   1  
ATOM   1110  C  CD   . PRO A 1 75 ? 12.174  -4.645  -22.121 1.00 0.00 ? 75  PRO A CD   1  
ATOM   1111  H  HA   . PRO A 1 75 ? 14.565  -2.504  -22.346 1.00 0.00 ? 75  PRO A HA   1  
ATOM   1112  H  HB2  . PRO A 1 75 ? 12.109  -1.369  -22.576 1.00 0.00 ? 75  PRO A HB2  1  
ATOM   1113  H  HB3  . PRO A 1 75 ? 12.797  -2.429  -23.812 1.00 0.00 ? 75  PRO A HB3  1  
ATOM   1114  H  HG2  . PRO A 1 75 ? 10.815  -3.065  -21.660 1.00 0.00 ? 75  PRO A HG2  1  
ATOM   1115  H  HG3  . PRO A 1 75 ? 10.817  -3.562  -23.363 1.00 0.00 ? 75  PRO A HG3  1  
ATOM   1116  H  HD2  . PRO A 1 75 ? 11.635  -5.198  -21.366 1.00 0.00 ? 75  PRO A HD2  1  
ATOM   1117  H  HD3  . PRO A 1 75 ? 12.336  -5.257  -22.996 1.00 0.00 ? 75  PRO A HD3  1  
ATOM   1118  N  N    . SER A 1 76 ? 14.682  -1.350  -20.135 1.00 0.00 ? 76  SER A N    1  
ATOM   1119  C  CA   . SER A 1 76 ? 14.736  -0.538  -18.926 1.00 0.00 ? 76  SER A CA   1  
ATOM   1120  C  C    . SER A 1 76 ? 14.838  0.945   -19.271 1.00 0.00 ? 76  SER A C    1  
ATOM   1121  O  O    . SER A 1 76 ? 15.644  1.343   -20.112 1.00 0.00 ? 76  SER A O    1  
ATOM   1122  C  CB   . SER A 1 76 ? 15.925  -0.954  -18.059 1.00 0.00 ? 76  SER A CB   1  
ATOM   1123  O  OG   . SER A 1 76 ? 17.148  -0.515  -18.625 1.00 0.00 ? 76  SER A OG   1  
ATOM   1124  H  H    . SER A 1 76 ? 15.507  -1.517  -20.637 1.00 0.00 ? 76  SER A H    1  
ATOM   1125  H  HA   . SER A 1 76 ? 13.823  -0.704  -18.374 1.00 0.00 ? 76  SER A HA   1  
ATOM   1126  H  HB2  . SER A 1 76 ? 15.821  -0.520  -17.076 1.00 0.00 ? 76  SER A HB2  1  
ATOM   1127  H  HB3  . SER A 1 76 ? 15.947  -2.031  -17.976 1.00 0.00 ? 76  SER A HB3  1  
ATOM   1128  H  HG   . SER A 1 76 ? 17.288  -0.956  -19.465 1.00 0.00 ? 76  SER A HG   1  
ATOM   1129  N  N    . SER A 1 77 ? 14.015  1.757   -18.616 1.00 0.00 ? 77  SER A N    1  
ATOM   1130  C  CA   . SER A 1 77 ? 14.009  3.196   -18.856 1.00 0.00 ? 77  SER A CA   1  
ATOM   1131  C  C    . SER A 1 77 ? 14.508  3.953   -17.629 1.00 0.00 ? 77  SER A C    1  
ATOM   1132  O  O    . SER A 1 77 ? 13.933  3.850   -16.546 1.00 0.00 ? 77  SER A O    1  
ATOM   1133  C  CB   . SER A 1 77 ? 12.601  3.667   -19.223 1.00 0.00 ? 77  SER A CB   1  
ATOM   1134  O  OG   . SER A 1 77 ? 12.349  3.493   -20.607 1.00 0.00 ? 77  SER A OG   1  
ATOM   1135  H  H    . SER A 1 77 ? 13.395  1.379   -17.958 1.00 0.00 ? 77  SER A H    1  
ATOM   1136  H  HA   . SER A 1 77 ? 14.674  3.396   -19.683 1.00 0.00 ? 77  SER A HA   1  
ATOM   1137  H  HB2  . SER A 1 77 ? 11.876  3.097   -18.663 1.00 0.00 ? 77  SER A HB2  1  
ATOM   1138  H  HB3  . SER A 1 77 ? 12.500  4.715   -18.979 1.00 0.00 ? 77  SER A HB3  1  
ATOM   1139  H  HG   . SER A 1 77 ? 11.974  4.300   -20.968 1.00 0.00 ? 77  SER A HG   1  
ATOM   1140  N  N    . GLY A 1 78 ? 15.583  4.715   -17.807 1.00 0.00 ? 78  GLY A N    1  
ATOM   1141  C  CA   . GLY A 1 78 ? 16.142  5.478   -16.707 1.00 0.00 ? 78  GLY A CA   1  
ATOM   1142  C  C    . GLY A 1 78 ? 16.876  6.719   -17.177 1.00 0.00 ? 78  GLY A C    1  
ATOM   1143  O  O    . GLY A 1 78 ? 17.811  6.598   -17.967 1.00 0.00 ? 78  GLY A O    1  
ATOM   1144  H  H    . GLY A 1 78 ? 15.999  4.758   -18.693 1.00 0.00 ? 78  GLY A H    1  
ATOM   1145  H  HA2  . GLY A 1 78 ? 15.341  5.775   -16.046 1.00 0.00 ? 78  GLY A HA2  1  
ATOM   1146  H  HA3  . GLY A 1 78 ? 16.832  4.851   -16.162 1.00 0.00 ? 78  GLY A HA3  1  
HETATM 1147  ZN ZN   . ZN  B 2 .  ? -6.672  1.821   3.657   1.00 0.00 ? 201 ZN  A ZN   1  
HETATM 1148  ZN ZN   . ZN  C 2 .  ? 4.094   0.254   -6.261  1.00 0.00 ? 401 ZN  A ZN   1  
ATOM   1149  N  N    . GLY A 1 1  ? -2.616  -25.604 13.053  1.00 0.00 ? 1   GLY A N    2  
ATOM   1150  C  CA   . GLY A 1 1  ? -2.748  -24.618 14.109  1.00 0.00 ? 1   GLY A CA   2  
ATOM   1151  C  C    . GLY A 1 1  ? -4.191  -24.389 14.512  1.00 0.00 ? 1   GLY A C    2  
ATOM   1152  O  O    . GLY A 1 1  ? -5.012  -25.305 14.453  1.00 0.00 ? 1   GLY A O    2  
ATOM   1153  H  H1   . GLY A 1 1  ? -3.335  -26.252 12.898  1.00 0.00 ? 1   GLY A H1   2  
ATOM   1154  H  HA2  . GLY A 1 1  ? -2.193  -24.953 14.972  1.00 0.00 ? 1   GLY A HA2  2  
ATOM   1155  H  HA3  . GLY A 1 1  ? -2.330  -23.682 13.766  1.00 0.00 ? 1   GLY A HA3  2  
ATOM   1156  N  N    . SER A 1 2  ? -4.502  -23.164 14.924  1.00 0.00 ? 2   SER A N    2  
ATOM   1157  C  CA   . SER A 1 2  ? -5.855  -22.820 15.344  1.00 0.00 ? 2   SER A CA   2  
ATOM   1158  C  C    . SER A 1 2  ? -6.783  -22.695 14.139  1.00 0.00 ? 2   SER A C    2  
ATOM   1159  O  O    . SER A 1 2  ? -7.910  -23.189 14.157  1.00 0.00 ? 2   SER A O    2  
ATOM   1160  C  CB   . SER A 1 2  ? -5.848  -21.510 16.135  1.00 0.00 ? 2   SER A CB   2  
ATOM   1161  O  OG   . SER A 1 2  ? -5.323  -20.448 15.357  1.00 0.00 ? 2   SER A OG   2  
ATOM   1162  H  H    . SER A 1 2  ? -3.804  -22.477 14.949  1.00 0.00 ? 2   SER A H    2  
ATOM   1163  H  HA   . SER A 1 2  ? -6.217  -23.613 15.981  1.00 0.00 ? 2   SER A HA   2  
ATOM   1164  H  HB2  . SER A 1 2  ? -6.858  -21.262 16.425  1.00 0.00 ? 2   SER A HB2  2  
ATOM   1165  H  HB3  . SER A 1 2  ? -5.239  -21.629 17.019  1.00 0.00 ? 2   SER A HB3  2  
ATOM   1166  H  HG   . SER A 1 2  ? -5.248  -19.660 15.901  1.00 0.00 ? 2   SER A HG   2  
ATOM   1167  N  N    . SER A 1 3  ? -6.299  -22.031 13.094  1.00 0.00 ? 3   SER A N    2  
ATOM   1168  C  CA   . SER A 1 3  ? -7.085  -21.837 11.881  1.00 0.00 ? 3   SER A CA   2  
ATOM   1169  C  C    . SER A 1 3  ? -8.454  -21.248 12.209  1.00 0.00 ? 3   SER A C    2  
ATOM   1170  O  O    . SER A 1 3  ? -9.464  -21.628 11.618  1.00 0.00 ? 3   SER A O    2  
ATOM   1171  C  CB   . SER A 1 3  ? -7.254  -23.165 11.140  1.00 0.00 ? 3   SER A CB   2  
ATOM   1172  O  OG   . SER A 1 3  ? -8.338  -23.910 11.667  1.00 0.00 ? 3   SER A OG   2  
ATOM   1173  H  H    . SER A 1 3  ? -5.393  -21.661 13.141  1.00 0.00 ? 3   SER A H    2  
ATOM   1174  H  HA   . SER A 1 3  ? -6.551  -21.146 11.247  1.00 0.00 ? 3   SER A HA   2  
ATOM   1175  H  HB2  . SER A 1 3  ? -7.441  -22.970 10.095  1.00 0.00 ? 3   SER A HB2  2  
ATOM   1176  H  HB3  . SER A 1 3  ? -6.349  -23.748 11.241  1.00 0.00 ? 3   SER A HB3  2  
ATOM   1177  H  HG   . SER A 1 3  ? -8.214  -24.032 12.611  1.00 0.00 ? 3   SER A HG   2  
ATOM   1178  N  N    . GLY A 1 4  ? -8.478  -20.316 13.158  1.00 0.00 ? 4   GLY A N    2  
ATOM   1179  C  CA   . GLY A 1 4  ? -9.727  -19.689 13.549  1.00 0.00 ? 4   GLY A CA   2  
ATOM   1180  C  C    . GLY A 1 4  ? -9.626  -18.177 13.597  1.00 0.00 ? 4   GLY A C    2  
ATOM   1181  O  O    . GLY A 1 4  ? -9.999  -17.554 14.591  1.00 0.00 ? 4   GLY A O    2  
ATOM   1182  H  H    . GLY A 1 4  ? -7.641  -20.053 13.595  1.00 0.00 ? 4   GLY A H    2  
ATOM   1183  H  HA2  . GLY A 1 4  ? -10.494 -19.966 12.841  1.00 0.00 ? 4   GLY A HA2  2  
ATOM   1184  H  HA3  . GLY A 1 4  ? -10.007 -20.050 14.528  1.00 0.00 ? 4   GLY A HA3  2  
ATOM   1185  N  N    . SER A 1 5  ? -9.119  -17.585 12.520  1.00 0.00 ? 5   SER A N    2  
ATOM   1186  C  CA   . SER A 1 5  ? -8.965  -16.137 12.445  1.00 0.00 ? 5   SER A CA   2  
ATOM   1187  C  C    . SER A 1 5  ? -9.326  -15.623 11.054  1.00 0.00 ? 5   SER A C    2  
ATOM   1188  O  O    . SER A 1 5  ? -8.636  -15.911 10.076  1.00 0.00 ? 5   SER A O    2  
ATOM   1189  C  CB   . SER A 1 5  ? -7.530  -15.737 12.793  1.00 0.00 ? 5   SER A CB   2  
ATOM   1190  O  OG   . SER A 1 5  ? -7.320  -14.352 12.577  1.00 0.00 ? 5   SER A OG   2  
ATOM   1191  H  H    . SER A 1 5  ? -8.840  -18.136 11.759  1.00 0.00 ? 5   SER A H    2  
ATOM   1192  H  HA   . SER A 1 5  ? -9.637  -15.694 13.165  1.00 0.00 ? 5   SER A HA   2  
ATOM   1193  H  HB2  . SER A 1 5  ? -7.338  -15.960 13.831  1.00 0.00 ? 5   SER A HB2  2  
ATOM   1194  H  HB3  . SER A 1 5  ? -6.844  -16.294 12.171  1.00 0.00 ? 5   SER A HB3  2  
ATOM   1195  H  HG   . SER A 1 5  ? -6.852  -13.978 13.327  1.00 0.00 ? 5   SER A HG   2  
ATOM   1196  N  N    . SER A 1 6  ? -10.412 -14.861 10.975  1.00 0.00 ? 6   SER A N    2  
ATOM   1197  C  CA   . SER A 1 6  ? -10.867 -14.310 9.704   1.00 0.00 ? 6   SER A CA   2  
ATOM   1198  C  C    . SER A 1 6  ? -11.026 -12.795 9.795   1.00 0.00 ? 6   SER A C    2  
ATOM   1199  O  O    . SER A 1 6  ? -11.730 -12.284 10.665  1.00 0.00 ? 6   SER A O    2  
ATOM   1200  C  CB   . SER A 1 6  ? -12.195 -14.949 9.294   1.00 0.00 ? 6   SER A CB   2  
ATOM   1201  O  OG   . SER A 1 6  ? -13.279 -14.372 10.001  1.00 0.00 ? 6   SER A OG   2  
ATOM   1202  H  H    . SER A 1 6  ? -10.920 -14.667 11.791  1.00 0.00 ? 6   SER A H    2  
ATOM   1203  H  HA   . SER A 1 6  ? -10.122 -14.538 8.957   1.00 0.00 ? 6   SER A HA   2  
ATOM   1204  H  HB2  . SER A 1 6  ? -12.352 -14.800 8.236   1.00 0.00 ? 6   SER A HB2  2  
ATOM   1205  H  HB3  . SER A 1 6  ? -12.163 -16.007 9.508   1.00 0.00 ? 6   SER A HB3  2  
ATOM   1206  H  HG   . SER A 1 6  ? -12.947 -13.910 10.775  1.00 0.00 ? 6   SER A HG   2  
ATOM   1207  N  N    . GLY A 1 7  ? -10.364 -12.082 8.888   1.00 0.00 ? 7   GLY A N    2  
ATOM   1208  C  CA   . GLY A 1 7  ? -10.443 -10.633 8.883   1.00 0.00 ? 7   GLY A CA   2  
ATOM   1209  C  C    . GLY A 1 7  ? -10.170 -10.043 7.513   1.00 0.00 ? 7   GLY A C    2  
ATOM   1210  O  O    . GLY A 1 7  ? -9.373  -10.581 6.744   1.00 0.00 ? 7   GLY A O    2  
ATOM   1211  H  H    . GLY A 1 7  ? -9.818  -12.543 8.218   1.00 0.00 ? 7   GLY A H    2  
ATOM   1212  H  HA2  . GLY A 1 7  ? -11.432 -10.336 9.201   1.00 0.00 ? 7   GLY A HA2  2  
ATOM   1213  H  HA3  . GLY A 1 7  ? -9.718  -10.241 9.581   1.00 0.00 ? 7   GLY A HA3  2  
ATOM   1214  N  N    . LEU A 1 8  ? -10.834 -8.934  7.206   1.00 0.00 ? 8   LEU A N    2  
ATOM   1215  C  CA   . LEU A 1 8  ? -10.661 -8.270  5.918   1.00 0.00 ? 8   LEU A CA   2  
ATOM   1216  C  C    . LEU A 1 8  ? -9.292  -7.603  5.830   1.00 0.00 ? 8   LEU A C    2  
ATOM   1217  O  O    . LEU A 1 8  ? -8.660  -7.325  6.848   1.00 0.00 ? 8   LEU A O    2  
ATOM   1218  C  CB   . LEU A 1 8  ? -11.762 -7.230  5.705   1.00 0.00 ? 8   LEU A CB   2  
ATOM   1219  C  CG   . LEU A 1 8  ? -13.197 -7.726  5.887   1.00 0.00 ? 8   LEU A CG   2  
ATOM   1220  C  CD1  . LEU A 1 8  ? -14.128 -6.565  6.199   1.00 0.00 ? 8   LEU A CD1  2  
ATOM   1221  C  CD2  . LEU A 1 8  ? -13.666 -8.469  4.644   1.00 0.00 ? 8   LEU A CD2  2  
ATOM   1222  H  H    . LEU A 1 8  ? -11.456 -8.551  7.859   1.00 0.00 ? 8   LEU A H    2  
ATOM   1223  H  HA   . LEU A 1 8  ? -10.732 -9.022  5.146   1.00 0.00 ? 8   LEU A HA   2  
ATOM   1224  H  HB2  . LEU A 1 8  ? -11.599 -6.428  6.407   1.00 0.00 ? 8   LEU A HB2  2  
ATOM   1225  H  HB3  . LEU A 1 8  ? -11.667 -6.851  4.698   1.00 0.00 ? 8   LEU A HB3  2  
ATOM   1226  H  HG   . LEU A 1 8  ? -13.231 -8.414  6.721   1.00 0.00 ? 8   LEU A HG   2  
ATOM   1227  H  HD11 . LEU A 1 8  ? -13.640 -5.635  5.948   1.00 0.00 ? 8   LEU A HD11 2  
ATOM   1228  H  HD12 . LEU A 1 8  ? -14.371 -6.571  7.251   1.00 0.00 ? 8   LEU A HD12 2  
ATOM   1229  H  HD13 . LEU A 1 8  ? -15.034 -6.664  5.619   1.00 0.00 ? 8   LEU A HD13 2  
ATOM   1230  H  HD21 . LEU A 1 8  ? -13.471 -9.524  4.760   1.00 0.00 ? 8   LEU A HD21 2  
ATOM   1231  H  HD22 . LEU A 1 8  ? -13.133 -8.097  3.780   1.00 0.00 ? 8   LEU A HD22 2  
ATOM   1232  H  HD23 . LEU A 1 8  ? -14.726 -8.311  4.509   1.00 0.00 ? 8   LEU A HD23 2  
ATOM   1233  N  N    . GLN A 1 9  ? -8.842  -7.347  4.605   1.00 0.00 ? 9   GLN A N    2  
ATOM   1234  C  CA   . GLN A 1 9  ? -7.549  -6.711  4.385   1.00 0.00 ? 9   GLN A CA   2  
ATOM   1235  C  C    . GLN A 1 9  ? -7.615  -5.735  3.214   1.00 0.00 ? 9   GLN A C    2  
ATOM   1236  O  O    . GLN A 1 9  ? -7.714  -6.144  2.057   1.00 0.00 ? 9   GLN A O    2  
ATOM   1237  C  CB   . GLN A 1 9  ? -6.475  -7.768  4.123   1.00 0.00 ? 9   GLN A CB   2  
ATOM   1238  C  CG   . GLN A 1 9  ? -5.093  -7.184  3.876   1.00 0.00 ? 9   GLN A CG   2  
ATOM   1239  C  CD   . GLN A 1 9  ? -4.280  -7.050  5.148   1.00 0.00 ? 9   GLN A CD   2  
ATOM   1240  O  OE1  . GLN A 1 9  ? -4.052  -8.030  5.859   1.00 0.00 ? 9   GLN A OE1  2  
ATOM   1241  N  NE2  . GLN A 1 9  ? -3.837  -5.834  5.443   1.00 0.00 ? 9   GLN A NE2  2  
ATOM   1242  H  H    . GLN A 1 9  ? -9.392  -7.592  3.833   1.00 0.00 ? 9   GLN A H    2  
ATOM   1243  H  HA   . GLN A 1 9  ? -7.292  -6.164  5.279   1.00 0.00 ? 9   GLN A HA   2  
ATOM   1244  H  HB2  . GLN A 1 9  ? -6.417  -8.425  4.978   1.00 0.00 ? 9   GLN A HB2  2  
ATOM   1245  H  HB3  . GLN A 1 9  ? -6.758  -8.345  3.255   1.00 0.00 ? 9   GLN A HB3  2  
ATOM   1246  H  HG2  . GLN A 1 9  ? -4.560  -7.829  3.193   1.00 0.00 ? 9   GLN A HG2  2  
ATOM   1247  H  HG3  . GLN A 1 9  ? -5.205  -6.205  3.433   1.00 0.00 ? 9   GLN A HG3  2  
ATOM   1248  H  HE21 . GLN A 1 9  ? -4.058  -5.100  4.831   1.00 0.00 ? 9   GLN A HE21 2  
ATOM   1249  H  HE22 . GLN A 1 9  ? -3.309  -5.718  6.260   1.00 0.00 ? 9   GLN A HE22 2  
ATOM   1250  N  N    . CYS A 1 10 ? -7.559  -4.444  3.523   1.00 0.00 ? 10  CYS A N    2  
ATOM   1251  C  CA   . CYS A 1 10 ? -7.613  -3.409  2.498   1.00 0.00 ? 10  CYS A CA   2  
ATOM   1252  C  C    . CYS A 1 10 ? -6.468  -3.570  1.502   1.00 0.00 ? 10  CYS A C    2  
ATOM   1253  O  O    . CYS A 1 10 ? -5.383  -4.027  1.858   1.00 0.00 ? 10  CYS A O    2  
ATOM   1254  C  CB   . CYS A 1 10 ? -7.554  -2.022  3.140   1.00 0.00 ? 10  CYS A CB   2  
ATOM   1255  S  SG   . CYS A 1 10 ? -7.041  -0.696  2.001   1.00 0.00 ? 10  CYS A SG   2  
ATOM   1256  H  H    . CYS A 1 10 ? -7.479  -4.180  4.465   1.00 0.00 ? 10  CYS A H    2  
ATOM   1257  H  HA   . CYS A 1 10 ? -8.549  -3.513  1.971   1.00 0.00 ? 10  CYS A HA   2  
ATOM   1258  H  HB2  . CYS A 1 10 ? -8.533  -1.767  3.519   1.00 0.00 ? 10  CYS A HB2  2  
ATOM   1259  H  HB3  . CYS A 1 10 ? -6.851  -2.043  3.960   1.00 0.00 ? 10  CYS A HB3  2  
ATOM   1260  N  N    . GLU A 1 11 ? -6.719  -3.189  0.253   1.00 0.00 ? 11  GLU A N    2  
ATOM   1261  C  CA   . GLU A 1 11 ? -5.709  -3.292  -0.794  1.00 0.00 ? 11  GLU A CA   2  
ATOM   1262  C  C    . GLU A 1 11 ? -5.031  -1.945  -1.029  1.00 0.00 ? 11  GLU A C    2  
ATOM   1263  O  O    . GLU A 1 11 ? -3.852  -1.885  -1.378  1.00 0.00 ? 11  GLU A O    2  
ATOM   1264  C  CB   . GLU A 1 11 ? -6.341  -3.791  -2.095  1.00 0.00 ? 11  GLU A CB   2  
ATOM   1265  C  CG   . GLU A 1 11 ? -7.221  -2.759  -2.779  1.00 0.00 ? 11  GLU A CG   2  
ATOM   1266  C  CD   . GLU A 1 11 ? -7.940  -3.318  -3.992  1.00 0.00 ? 11  GLU A CD   2  
ATOM   1267  O  OE1  . GLU A 1 11 ? -8.877  -4.124  -3.807  1.00 0.00 ? 11  GLU A OE1  2  
ATOM   1268  O  OE2  . GLU A 1 11 ? -7.567  -2.950  -5.125  1.00 0.00 ? 11  GLU A OE2  2  
ATOM   1269  H  H    . GLU A 1 11 ? -7.604  -2.832  0.031   1.00 0.00 ? 11  GLU A H    2  
ATOM   1270  H  HA   . GLU A 1 11 ? -4.966  -4.004  -0.469  1.00 0.00 ? 11  GLU A HA   2  
ATOM   1271  H  HB2  . GLU A 1 11 ? -5.553  -4.073  -2.778  1.00 0.00 ? 11  GLU A HB2  2  
ATOM   1272  H  HB3  . GLU A 1 11 ? -6.944  -4.660  -1.877  1.00 0.00 ? 11  GLU A HB3  2  
ATOM   1273  H  HG2  . GLU A 1 11 ? -7.959  -2.409  -2.073  1.00 0.00 ? 11  GLU A HG2  2  
ATOM   1274  H  HG3  . GLU A 1 11 ? -6.605  -1.931  -3.095  1.00 0.00 ? 11  GLU A HG3  2  
ATOM   1275  N  N    . ILE A 1 12 ? -5.785  -0.868  -0.836  1.00 0.00 ? 12  ILE A N    2  
ATOM   1276  C  CA   . ILE A 1 12 ? -5.256  0.477   -1.026  1.00 0.00 ? 12  ILE A CA   2  
ATOM   1277  C  C    . ILE A 1 12 ? -3.949  0.667   -0.265  1.00 0.00 ? 12  ILE A C    2  
ATOM   1278  O  O    . ILE A 1 12 ? -2.895  0.887   -0.864  1.00 0.00 ? 12  ILE A O    2  
ATOM   1279  C  CB   . ILE A 1 12 ? -6.264  1.548   -0.568  1.00 0.00 ? 12  ILE A CB   2  
ATOM   1280  C  CG1  . ILE A 1 12 ? -7.500  1.536   -1.471  1.00 0.00 ? 12  ILE A CG1  2  
ATOM   1281  C  CG2  . ILE A 1 12 ? -5.614  2.923   -0.569  1.00 0.00 ? 12  ILE A CG2  2  
ATOM   1282  C  CD1  . ILE A 1 12 ? -8.638  0.702   -0.926  1.00 0.00 ? 12  ILE A CD1  2  
ATOM   1283  H  H    . ILE A 1 12 ? -6.717  -0.981  -0.558  1.00 0.00 ? 12  ILE A H    2  
ATOM   1284  H  HA   . ILE A 1 12 ? -5.070  0.615   -2.081  1.00 0.00 ? 12  ILE A HA   2  
ATOM   1285  H  HB   . ILE A 1 12 ? -6.564  1.318   0.443   1.00 0.00 ? 12  ILE A HB   2  
ATOM   1286  H  HG12 . ILE A 1 12 ? -7.858  2.546   -1.593  1.00 0.00 ? 12  ILE A HG12 2  
ATOM   1287  H  HG13 . ILE A 1 12 ? -7.226  1.136   -2.436  1.00 0.00 ? 12  ILE A HG13 2  
ATOM   1288  H  HG21 . ILE A 1 12 ? -5.171  3.111   -1.536  1.00 0.00 ? 12  ILE A HG21 2  
ATOM   1289  H  HG22 . ILE A 1 12 ? -6.361  3.674   -0.364  1.00 0.00 ? 12  ILE A HG22 2  
ATOM   1290  H  HG23 . ILE A 1 12 ? -4.848  2.959   0.191   1.00 0.00 ? 12  ILE A HG23 2  
ATOM   1291  H  HD11 . ILE A 1 12 ? -8.260  0.020   -0.179  1.00 0.00 ? 12  ILE A HD11 2  
ATOM   1292  H  HD12 . ILE A 1 12 ? -9.379  1.350   -0.482  1.00 0.00 ? 12  ILE A HD12 2  
ATOM   1293  H  HD13 . ILE A 1 12 ? -9.089  0.139   -1.731  1.00 0.00 ? 12  ILE A HD13 2  
ATOM   1294  N  N    . CYS A 1 13 ? -4.023  0.579   1.059   1.00 0.00 ? 13  CYS A N    2  
ATOM   1295  C  CA   . CYS A 1 13 ? -2.846  0.740   1.904   1.00 0.00 ? 13  CYS A CA   2  
ATOM   1296  C  C    . CYS A 1 13 ? -2.398  -0.603  2.474   1.00 0.00 ? 13  CYS A C    2  
ATOM   1297  O  O    . CYS A 1 13 ? -1.205  -0.890  2.550   1.00 0.00 ? 13  CYS A O    2  
ATOM   1298  C  CB   . CYS A 1 13 ? -3.139  1.718   3.043   1.00 0.00 ? 13  CYS A CB   2  
ATOM   1299  S  SG   . CYS A 1 13 ? -4.454  1.167   4.177   1.00 0.00 ? 13  CYS A SG   2  
ATOM   1300  H  H    . CYS A 1 13 ? -4.892  0.402   1.479   1.00 0.00 ? 13  CYS A H    2  
ATOM   1301  H  HA   . CYS A 1 13 ? -2.051  1.140   1.293   1.00 0.00 ? 13  CYS A HA   2  
ATOM   1302  H  HB2  . CYS A 1 13 ? -2.241  1.859   3.626   1.00 0.00 ? 13  CYS A HB2  2  
ATOM   1303  H  HB3  . CYS A 1 13 ? -3.442  2.666   2.624   1.00 0.00 ? 13  CYS A HB3  2  
ATOM   1304  N  N    . GLY A 1 14 ? -3.366  -1.422  2.875   1.00 0.00 ? 14  GLY A N    2  
ATOM   1305  C  CA   . GLY A 1 14 ? -3.053  -2.724  3.433   1.00 0.00 ? 14  GLY A CA   2  
ATOM   1306  C  C    . GLY A 1 14 ? -3.499  -2.859  4.875   1.00 0.00 ? 14  GLY A C    2  
ATOM   1307  O  O    . GLY A 1 14 ? -2.854  -3.542  5.671   1.00 0.00 ? 14  GLY A O    2  
ATOM   1308  H  H    . GLY A 1 14 ? -4.301  -1.139  2.790   1.00 0.00 ? 14  GLY A H    2  
ATOM   1309  H  HA2  . GLY A 1 14 ? -3.542  -3.484  2.843   1.00 0.00 ? 14  GLY A HA2  2  
ATOM   1310  H  HA3  . GLY A 1 14 ? -1.985  -2.876  3.384   1.00 0.00 ? 14  GLY A HA3  2  
ATOM   1311  N  N    . PHE A 1 15 ? -4.606  -2.206  5.214   1.00 0.00 ? 15  PHE A N    2  
ATOM   1312  C  CA   . PHE A 1 15 ? -5.137  -2.254  6.572   1.00 0.00 ? 15  PHE A CA   2  
ATOM   1313  C  C    . PHE A 1 15 ? -5.936  -3.534  6.798   1.00 0.00 ? 15  PHE A C    2  
ATOM   1314  O  O    . PHE A 1 15 ? -6.143  -4.323  5.875   1.00 0.00 ? 15  PHE A O    2  
ATOM   1315  C  CB   . PHE A 1 15 ? -6.020  -1.034  6.840   1.00 0.00 ? 15  PHE A CB   2  
ATOM   1316  C  CG   . PHE A 1 15 ? -6.324  -0.823  8.296   1.00 0.00 ? 15  PHE A CG   2  
ATOM   1317  C  CD1  . PHE A 1 15 ? -5.337  -0.396  9.169   1.00 0.00 ? 15  PHE A CD1  2  
ATOM   1318  C  CD2  . PHE A 1 15 ? -7.598  -1.053  8.791   1.00 0.00 ? 15  PHE A CD2  2  
ATOM   1319  C  CE1  . PHE A 1 15 ? -5.614  -0.201  10.509  1.00 0.00 ? 15  PHE A CE1  2  
ATOM   1320  C  CE2  . PHE A 1 15 ? -7.881  -0.859  10.130  1.00 0.00 ? 15  PHE A CE2  2  
ATOM   1321  C  CZ   . PHE A 1 15 ? -6.888  -0.434  10.990  1.00 0.00 ? 15  PHE A CZ   2  
ATOM   1322  H  H    . PHE A 1 15 ? -5.077  -1.679  4.535   1.00 0.00 ? 15  PHE A H    2  
ATOM   1323  H  HA   . PHE A 1 15 ? -4.301  -2.241  7.254   1.00 0.00 ? 15  PHE A HA   2  
ATOM   1324  H  HB2  . PHE A 1 15 ? -5.520  -0.150  6.475   1.00 0.00 ? 15  PHE A HB2  2  
ATOM   1325  H  HB3  . PHE A 1 15 ? -6.957  -1.155  6.318   1.00 0.00 ? 15  PHE A HB3  2  
ATOM   1326  H  HD1  . PHE A 1 15 ? -4.340  -0.214  8.794   1.00 0.00 ? 15  PHE A HD1  2  
ATOM   1327  H  HD2  . PHE A 1 15 ? -8.375  -1.387  8.120   1.00 0.00 ? 15  PHE A HD2  2  
ATOM   1328  H  HE1  . PHE A 1 15 ? -4.835  0.132   11.179  1.00 0.00 ? 15  PHE A HE1  2  
ATOM   1329  H  HE2  . PHE A 1 15 ? -8.877  -1.042  10.504  1.00 0.00 ? 15  PHE A HE2  2  
ATOM   1330  H  HZ   . PHE A 1 15 ? -7.106  -0.281  12.036  1.00 0.00 ? 15  PHE A HZ   2  
ATOM   1331  N  N    . THR A 1 16 ? -6.384  -3.735  8.034   1.00 0.00 ? 16  THR A N    2  
ATOM   1332  C  CA   . THR A 1 16 ? -7.159  -4.919  8.383   1.00 0.00 ? 16  THR A CA   2  
ATOM   1333  C  C    . THR A 1 16 ? -8.236  -4.587  9.409   1.00 0.00 ? 16  THR A C    2  
ATOM   1334  O  O    . THR A 1 16 ? -7.963  -3.946  10.424  1.00 0.00 ? 16  THR A O    2  
ATOM   1335  C  CB   . THR A 1 16 ? -6.257  -6.035  8.944   1.00 0.00 ? 16  THR A CB   2  
ATOM   1336  O  OG1  . THR A 1 16 ? -5.161  -5.463  9.666   1.00 0.00 ? 16  THR A OG1  2  
ATOM   1337  C  CG2  . THR A 1 16 ? -5.728  -6.917  7.823   1.00 0.00 ? 16  THR A CG2  2  
ATOM   1338  H  H    . THR A 1 16 ? -6.186  -3.070  8.726   1.00 0.00 ? 16  THR A H    2  
ATOM   1339  H  HA   . THR A 1 16 ? -7.632  -5.285  7.483   1.00 0.00 ? 16  THR A HA   2  
ATOM   1340  H  HB   . THR A 1 16 ? -6.843  -6.645  9.617   1.00 0.00 ? 16  THR A HB   2  
ATOM   1341  H  HG1  . THR A 1 16 ? -5.344  -4.537  9.844   1.00 0.00 ? 16  THR A HG1  2  
ATOM   1342  H  HG21 . THR A 1 16 ? -4.900  -6.423  7.336   1.00 0.00 ? 16  THR A HG21 2  
ATOM   1343  H  HG22 . THR A 1 16 ? -6.514  -7.096  7.105   1.00 0.00 ? 16  THR A HG22 2  
ATOM   1344  H  HG23 . THR A 1 16 ? -5.394  -7.858  8.234   1.00 0.00 ? 16  THR A HG23 2  
ATOM   1345  N  N    . CYS A 1 17 ? -9.459  -5.029  9.139   1.00 0.00 ? 17  CYS A N    2  
ATOM   1346  C  CA   . CYS A 1 17 ? -10.579 -4.779  10.040  1.00 0.00 ? 17  CYS A CA   2  
ATOM   1347  C  C    . CYS A 1 17 ? -11.542 -5.961  10.052  1.00 0.00 ? 17  CYS A C    2  
ATOM   1348  O  O    . CYS A 1 17 ? -11.788 -6.584  9.019   1.00 0.00 ? 17  CYS A O    2  
ATOM   1349  C  CB   . CYS A 1 17 ? -11.319 -3.506  9.627   1.00 0.00 ? 17  CYS A CB   2  
ATOM   1350  S  SG   . CYS A 1 17 ? -12.154 -3.625  8.028   1.00 0.00 ? 17  CYS A SG   2  
ATOM   1351  H  H    . CYS A 1 17 ? -9.614  -5.535  8.314   1.00 0.00 ? 17  CYS A H    2  
ATOM   1352  H  HA   . CYS A 1 17 ? -10.180 -4.646  11.034  1.00 0.00 ? 17  CYS A HA   2  
ATOM   1353  H  HB2  . CYS A 1 17 ? -12.067 -3.275  10.371  1.00 0.00 ? 17  CYS A HB2  2  
ATOM   1354  H  HB3  . CYS A 1 17 ? -10.613 -2.691  9.571   1.00 0.00 ? 17  CYS A HB3  2  
ATOM   1355  H  HG   . CYS A 1 17 ? -11.702 -4.705  7.409   1.00 0.00 ? 17  CYS A HG   2  
ATOM   1356  N  N    . ARG A 1 18 ? -12.084 -6.265  11.227  1.00 0.00 ? 18  ARG A N    2  
ATOM   1357  C  CA   . ARG A 1 18 ? -13.018 -7.375  11.373  1.00 0.00 ? 18  ARG A CA   2  
ATOM   1358  C  C    . ARG A 1 18 ? -14.411 -6.980  10.891  1.00 0.00 ? 18  ARG A C    2  
ATOM   1359  O  O    . ARG A 1 18 ? -15.050 -7.716  10.140  1.00 0.00 ? 18  ARG A O    2  
ATOM   1360  C  CB   . ARG A 1 18 ? -13.082 -7.827  12.833  1.00 0.00 ? 18  ARG A CB   2  
ATOM   1361  C  CG   . ARG A 1 18 ? -12.050 -8.885  13.188  1.00 0.00 ? 18  ARG A CG   2  
ATOM   1362  C  CD   . ARG A 1 18 ? -12.499 -10.270 12.749  1.00 0.00 ? 18  ARG A CD   2  
ATOM   1363  N  NE   . ARG A 1 18 ? -11.862 -11.325 13.533  1.00 0.00 ? 18  ARG A NE   2  
ATOM   1364  C  CZ   . ARG A 1 18 ? -10.565 -11.604 13.474  1.00 0.00 ? 18  ARG A CZ   2  
ATOM   1365  N  NH1  . ARG A 1 18 ? -9.770  -10.908 12.672  1.00 0.00 ? 18  ARG A NH1  2  
ATOM   1366  N  NH2  . ARG A 1 18 ? -10.060 -12.580 14.218  1.00 0.00 ? 18  ARG A NH2  2  
ATOM   1367  H  H    . ARG A 1 18 ? -11.849 -5.731  12.014  1.00 0.00 ? 18  ARG A H    2  
ATOM   1368  H  HA   . ARG A 1 18 ? -12.659 -8.193  10.767  1.00 0.00 ? 18  ARG A HA   2  
ATOM   1369  H  HB2  . ARG A 1 18 ? -12.920 -6.970  13.470  1.00 0.00 ? 18  ARG A HB2  2  
ATOM   1370  H  HB3  . ARG A 1 18 ? -14.063 -8.231  13.029  1.00 0.00 ? 18  ARG A HB3  2  
ATOM   1371  H  HG2  . ARG A 1 18 ? -11.119 -8.647  12.695  1.00 0.00 ? 18  ARG A HG2  2  
ATOM   1372  H  HG3  . ARG A 1 18 ? -11.903 -8.886  14.258  1.00 0.00 ? 18  ARG A HG3  2  
ATOM   1373  H  HD2  . ARG A 1 18 ? -13.569 -10.342 12.869  1.00 0.00 ? 18  ARG A HD2  2  
ATOM   1374  H  HD3  . ARG A 1 18 ? -12.243 -10.403 11.708  1.00 0.00 ? 18  ARG A HD3  2  
ATOM   1375  H  HE   . ARG A 1 18 ? -12.432 -11.852 14.131  1.00 0.00 ? 18  ARG A HE   2  
ATOM   1376  H  HH11 . ARG A 1 18 ? -10.147 -10.172 12.111  1.00 0.00 ? 18  ARG A HH11 2  
ATOM   1377  H  HH12 . ARG A 1 18 ? -8.793  -11.119 12.631  1.00 0.00 ? 18  ARG A HH12 2  
ATOM   1378  H  HH21 . ARG A 1 18 ? -10.657 -13.106 14.823  1.00 0.00 ? 18  ARG A HH21 2  
ATOM   1379  H  HH22 . ARG A 1 18 ? -9.084  -12.789 14.173  1.00 0.00 ? 18  ARG A HH22 2  
ATOM   1380  N  N    . GLN A 1 19 ? -14.875 -5.813  11.328  1.00 0.00 ? 19  GLN A N    2  
ATOM   1381  C  CA   . GLN A 1 19 ? -16.192 -5.322  10.942  1.00 0.00 ? 19  GLN A CA   2  
ATOM   1382  C  C    . GLN A 1 19 ? -16.174 -4.778  9.517   1.00 0.00 ? 19  GLN A C    2  
ATOM   1383  O  O    . GLN A 1 19 ? -15.339 -3.943  9.170   1.00 0.00 ? 19  GLN A O    2  
ATOM   1384  C  CB   . GLN A 1 19 ? -16.657 -4.233  11.910  1.00 0.00 ? 19  GLN A CB   2  
ATOM   1385  C  CG   . GLN A 1 19 ? -16.778 -4.709  13.349  1.00 0.00 ? 19  GLN A CG   2  
ATOM   1386  C  CD   . GLN A 1 19 ? -17.261 -3.619  14.285  1.00 0.00 ? 19  GLN A CD   2  
ATOM   1387  O  OE1  . GLN A 1 19 ? -18.148 -2.837  13.941  1.00 0.00 ? 19  GLN A OE1  2  
ATOM   1388  N  NE2  . GLN A 1 19 ? -16.680 -3.562  15.478  1.00 0.00 ? 19  GLN A NE2  2  
ATOM   1389  H  H    . GLN A 1 19 ? -14.318 -5.272  11.925  1.00 0.00 ? 19  GLN A H    2  
ATOM   1390  H  HA   . GLN A 1 19 ? -16.882 -6.151  10.989  1.00 0.00 ? 19  GLN A HA   2  
ATOM   1391  H  HB2  . GLN A 1 19 ? -15.951 -3.416  11.881  1.00 0.00 ? 19  GLN A HB2  2  
ATOM   1392  H  HB3  . GLN A 1 19 ? -17.624 -3.874  11.591  1.00 0.00 ? 19  GLN A HB3  2  
ATOM   1393  H  HG2  . GLN A 1 19 ? -17.478 -5.530  13.386  1.00 0.00 ? 19  GLN A HG2  2  
ATOM   1394  H  HG3  . GLN A 1 19 ? -15.809 -5.048  13.684  1.00 0.00 ? 19  GLN A HG3  2  
ATOM   1395  H  HE21 . GLN A 1 19 ? -15.980 -4.218  15.683  1.00 0.00 ? 19  GLN A HE21 2  
ATOM   1396  H  HE22 . GLN A 1 19 ? -16.973 -2.868  16.103  1.00 0.00 ? 19  GLN A HE22 2  
ATOM   1397  N  N    . LYS A 1 20 ? -17.100 -5.258  8.694   1.00 0.00 ? 20  LYS A N    2  
ATOM   1398  C  CA   . LYS A 1 20 ? -17.192 -4.821  7.307   1.00 0.00 ? 20  LYS A CA   2  
ATOM   1399  C  C    . LYS A 1 20 ? -17.312 -3.303  7.221   1.00 0.00 ? 20  LYS A C    2  
ATOM   1400  O  O    . LYS A 1 20 ? -16.614 -2.659  6.439   1.00 0.00 ? 20  LYS A O    2  
ATOM   1401  C  CB   . LYS A 1 20 ? -18.394 -5.477  6.622   1.00 0.00 ? 20  LYS A CB   2  
ATOM   1402  C  CG   . LYS A 1 20 ? -18.596 -5.027  5.185   1.00 0.00 ? 20  LYS A CG   2  
ATOM   1403  C  CD   . LYS A 1 20 ? -17.835 -5.912  4.212   1.00 0.00 ? 20  LYS A CD   2  
ATOM   1404  C  CE   . LYS A 1 20 ? -18.250 -5.644  2.774   1.00 0.00 ? 20  LYS A CE   2  
ATOM   1405  N  NZ   . LYS A 1 20 ? -19.582 -6.233  2.462   1.00 0.00 ? 20  LYS A NZ   2  
ATOM   1406  H  H    . LYS A 1 20 ? -17.738 -5.923  9.029   1.00 0.00 ? 20  LYS A H    2  
ATOM   1407  H  HA   . LYS A 1 20 ? -16.289 -5.128  6.801   1.00 0.00 ? 20  LYS A HA   2  
ATOM   1408  H  HB2  . LYS A 1 20 ? -18.255 -6.548  6.626   1.00 0.00 ? 20  LYS A HB2  2  
ATOM   1409  H  HB3  . LYS A 1 20 ? -19.287 -5.236  7.181   1.00 0.00 ? 20  LYS A HB3  2  
ATOM   1410  H  HG2  . LYS A 1 20 ? -19.648 -5.072  4.948   1.00 0.00 ? 20  LYS A HG2  2  
ATOM   1411  H  HG3  . LYS A 1 20 ? -18.245 -4.010  5.084   1.00 0.00 ? 20  LYS A HG3  2  
ATOM   1412  H  HD2  . LYS A 1 20 ? -16.777 -5.716  4.312   1.00 0.00 ? 20  LYS A HD2  2  
ATOM   1413  H  HD3  . LYS A 1 20 ? -18.034 -6.947  4.449   1.00 0.00 ? 20  LYS A HD3  2  
ATOM   1414  H  HE2  . LYS A 1 20 ? -18.293 -4.577  2.618   1.00 0.00 ? 20  LYS A HE2  2  
ATOM   1415  H  HE3  . LYS A 1 20 ? -17.512 -6.075  2.114   1.00 0.00 ? 20  LYS A HE3  2  
ATOM   1416  H  HZ1  . LYS A 1 20 ? -20.337 -5.574  2.740   1.00 0.00 ? 20  LYS A HZ1  2  
ATOM   1417  H  HZ2  . LYS A 1 20 ? -19.708 -7.125  2.980   1.00 0.00 ? 20  LYS A HZ2  2  
ATOM   1418  H  HZ3  . LYS A 1 20 ? -19.659 -6.423  1.443   1.00 0.00 ? 20  LYS A HZ3  2  
ATOM   1419  N  N    . ALA A 1 21 ? -18.200 -2.737  8.033   1.00 0.00 ? 21  ALA A N    2  
ATOM   1420  C  CA   . ALA A 1 21 ? -18.407 -1.295  8.051   1.00 0.00 ? 21  ALA A CA   2  
ATOM   1421  C  C    . ALA A 1 21 ? -17.082 -0.551  8.181   1.00 0.00 ? 21  ALA A C    2  
ATOM   1422  O  O    . ALA A 1 21 ? -16.833 0.422   7.468   1.00 0.00 ? 21  ALA A O    2  
ATOM   1423  C  CB   . ALA A 1 21 ? -19.343 -0.911  9.188   1.00 0.00 ? 21  ALA A CB   2  
ATOM   1424  H  H    . ALA A 1 21 ? -18.726 -3.304  8.634   1.00 0.00 ? 21  ALA A H    2  
ATOM   1425  H  HA   . ALA A 1 21 ? -18.877 -1.013  7.120   1.00 0.00 ? 21  ALA A HA   2  
ATOM   1426  H  HB1  . ALA A 1 21 ? -19.500 0.158   9.179   1.00 0.00 ? 21  ALA A HB1  2  
ATOM   1427  H  HB2  . ALA A 1 21 ? -20.290 -1.414  9.060   1.00 0.00 ? 21  ALA A HB2  2  
ATOM   1428  H  HB3  . ALA A 1 21 ? -18.904 -1.202  10.130  1.00 0.00 ? 21  ALA A HB3  2  
ATOM   1429  N  N    . SER A 1 22 ? -16.236 -1.014  9.095   1.00 0.00 ? 22  SER A N    2  
ATOM   1430  C  CA   . SER A 1 22 ? -14.938 -0.389  9.320   1.00 0.00 ? 22  SER A CA   2  
ATOM   1431  C  C    . SER A 1 22 ? -14.172 -0.239  8.009   1.00 0.00 ? 22  SER A C    2  
ATOM   1432  O  O    . SER A 1 22 ? -13.593 0.813   7.731   1.00 0.00 ? 22  SER A O    2  
ATOM   1433  C  CB   . SER A 1 22 ? -14.116 -1.215  10.312  1.00 0.00 ? 22  SER A CB   2  
ATOM   1434  O  OG   . SER A 1 22 ? -14.480 -0.917  11.649  1.00 0.00 ? 22  SER A OG   2  
ATOM   1435  H  H    . SER A 1 22 ? -16.492 -1.793  9.632   1.00 0.00 ? 22  SER A H    2  
ATOM   1436  H  HA   . SER A 1 22 ? -15.110 0.592   9.737   1.00 0.00 ? 22  SER A HA   2  
ATOM   1437  H  HB2  . SER A 1 22 ? -14.287 -2.265  10.131  1.00 0.00 ? 22  SER A HB2  2  
ATOM   1438  H  HB3  . SER A 1 22 ? -13.067 -0.992  10.179  1.00 0.00 ? 22  SER A HB3  2  
ATOM   1439  H  HG   . SER A 1 22 ? -14.306 0.010   11.829  1.00 0.00 ? 22  SER A HG   2  
ATOM   1440  N  N    . LEU A 1 23 ? -14.173 -1.297  7.206   1.00 0.00 ? 23  LEU A N    2  
ATOM   1441  C  CA   . LEU A 1 23 ? -13.479 -1.285  5.923   1.00 0.00 ? 23  LEU A CA   2  
ATOM   1442  C  C    . LEU A 1 23 ? -13.960 -0.127  5.055   1.00 0.00 ? 23  LEU A C    2  
ATOM   1443  O  O    . LEU A 1 23 ? -13.159 0.659   4.551   1.00 0.00 ? 23  LEU A O    2  
ATOM   1444  C  CB   . LEU A 1 23 ? -13.695 -2.611  5.192   1.00 0.00 ? 23  LEU A CB   2  
ATOM   1445  C  CG   . LEU A 1 23 ? -12.664 -2.960  4.117   1.00 0.00 ? 23  LEU A CG   2  
ATOM   1446  C  CD1  . LEU A 1 23 ? -11.293 -3.169  4.741   1.00 0.00 ? 23  LEU A CD1  2  
ATOM   1447  C  CD2  . LEU A 1 23 ? -13.096 -4.200  3.347   1.00 0.00 ? 23  LEU A CD2  2  
ATOM   1448  H  H    . LEU A 1 23 ? -14.651 -2.106  7.482   1.00 0.00 ? 23  LEU A H    2  
ATOM   1449  H  HA   . LEU A 1 23 ? -12.424 -1.158  6.119   1.00 0.00 ? 23  LEU A HA   2  
ATOM   1450  H  HB2  . LEU A 1 23 ? -13.686 -3.400  5.928   1.00 0.00 ? 23  LEU A HB2  2  
ATOM   1451  H  HB3  . LEU A 1 23 ? -14.666 -2.572  4.720   1.00 0.00 ? 23  LEU A HB3  2  
ATOM   1452  H  HG   . LEU A 1 23 ? -12.591 -2.139  3.417   1.00 0.00 ? 23  LEU A HG   2  
ATOM   1453  H  HD11 . LEU A 1 23 ? -10.545 -2.674  4.140   1.00 0.00 ? 23  LEU A HD11 2  
ATOM   1454  H  HD12 . LEU A 1 23 ? -11.076 -4.225  4.788   1.00 0.00 ? 23  LEU A HD12 2  
ATOM   1455  H  HD13 . LEU A 1 23 ? -11.285 -2.755  5.739   1.00 0.00 ? 23  LEU A HD13 2  
ATOM   1456  H  HD21 . LEU A 1 23 ? -14.164 -4.329  3.444   1.00 0.00 ? 23  LEU A HD21 2  
ATOM   1457  H  HD22 . LEU A 1 23 ? -12.591 -5.067  3.748   1.00 0.00 ? 23  LEU A HD22 2  
ATOM   1458  H  HD23 . LEU A 1 23 ? -12.840 -4.083  2.305   1.00 0.00 ? 23  LEU A HD23 2  
ATOM   1459  N  N    . ASN A 1 24 ? -15.275 -0.028  4.886   1.00 0.00 ? 24  ASN A N    2  
ATOM   1460  C  CA   . ASN A 1 24 ? -15.863 1.035   4.079   1.00 0.00 ? 24  ASN A CA   2  
ATOM   1461  C  C    . ASN A 1 24 ? -15.447 2.408   4.601   1.00 0.00 ? 24  ASN A C    2  
ATOM   1462  O  O    . ASN A 1 24 ? -14.982 3.257   3.840   1.00 0.00 ? 24  ASN A O    2  
ATOM   1463  C  CB   . ASN A 1 24 ? -17.389 0.919   4.079   1.00 0.00 ? 24  ASN A CB   2  
ATOM   1464  C  CG   . ASN A 1 24 ? -17.871 -0.354  3.410   1.00 0.00 ? 24  ASN A CG   2  
ATOM   1465  O  OD1  . ASN A 1 24 ? -17.287 -0.813  2.429   1.00 0.00 ? 24  ASN A OD1  2  
ATOM   1466  N  ND2  . ASN A 1 24 ? -18.943 -0.931  3.941   1.00 0.00 ? 24  ASN A ND2  2  
ATOM   1467  H  H    . ASN A 1 24 ? -15.863 -0.685  5.313   1.00 0.00 ? 24  ASN A H    2  
ATOM   1468  H  HA   . ASN A 1 24 ? -15.502 0.923   3.068   1.00 0.00 ? 24  ASN A HA   2  
ATOM   1469  H  HB2  . ASN A 1 24 ? -17.744 0.923   5.099   1.00 0.00 ? 24  ASN A HB2  2  
ATOM   1470  H  HB3  . ASN A 1 24 ? -17.809 1.762   3.552   1.00 0.00 ? 24  ASN A HB3  2  
ATOM   1471  H  HD21 . ASN A 1 24 ? -19.357 -0.510  4.723   1.00 0.00 ? 24  ASN A HD21 2  
ATOM   1472  H  HD22 . ASN A 1 24 ? -19.276 -1.756  3.529   1.00 0.00 ? 24  ASN A HD22 2  
ATOM   1473  N  N    . TRP A 1 25 ? -15.618 2.616   5.901   1.00 0.00 ? 25  TRP A N    2  
ATOM   1474  C  CA   . TRP A 1 25 ? -15.259 3.885   6.525   1.00 0.00 ? 25  TRP A CA   2  
ATOM   1475  C  C    . TRP A 1 25 ? -13.758 4.135   6.426   1.00 0.00 ? 25  TRP A C    2  
ATOM   1476  O  O    . TRP A 1 25 ? -13.307 5.281   6.450   1.00 0.00 ? 25  TRP A O    2  
ATOM   1477  C  CB   . TRP A 1 25 ? -15.696 3.898   7.990   1.00 0.00 ? 25  TRP A CB   2  
ATOM   1478  C  CG   . TRP A 1 25 ? -15.251 5.122   8.732   1.00 0.00 ? 25  TRP A CG   2  
ATOM   1479  C  CD1  . TRP A 1 25 ? -14.153 5.240   9.536   1.00 0.00 ? 25  TRP A CD1  2  
ATOM   1480  C  CD2  . TRP A 1 25 ? -15.895 6.401   8.740   1.00 0.00 ? 25  TRP A CD2  2  
ATOM   1481  N  NE1  . TRP A 1 25 ? -14.076 6.514   10.043  1.00 0.00 ? 25  TRP A NE1  2  
ATOM   1482  C  CE2  . TRP A 1 25 ? -15.132 7.246   9.569   1.00 0.00 ? 25  TRP A CE2  2  
ATOM   1483  C  CE3  . TRP A 1 25 ? -17.040 6.914   8.126   1.00 0.00 ? 25  TRP A CE3  2  
ATOM   1484  C  CZ2  . TRP A 1 25 ? -15.480 8.575   9.798   1.00 0.00 ? 25  TRP A CZ2  2  
ATOM   1485  C  CZ3  . TRP A 1 25 ? -17.384 8.233   8.355   1.00 0.00 ? 25  TRP A CZ3  2  
ATOM   1486  C  CH2  . TRP A 1 25 ? -16.606 9.051   9.184   1.00 0.00 ? 25  TRP A CH2  2  
ATOM   1487  H  H    . TRP A 1 25 ? -15.993 1.900   6.456   1.00 0.00 ? 25  TRP A H    2  
ATOM   1488  H  HA   . TRP A 1 25 ? -15.779 4.671   5.997   1.00 0.00 ? 25  TRP A HA   2  
ATOM   1489  H  HB2  . TRP A 1 25 ? -16.774 3.852   8.039   1.00 0.00 ? 25  TRP A HB2  2  
ATOM   1490  H  HB3  . TRP A 1 25 ? -15.280 3.035   8.490   1.00 0.00 ? 25  TRP A HB3  2  
ATOM   1491  H  HD1  . TRP A 1 25 ? -13.458 4.439   9.736   1.00 0.00 ? 25  TRP A HD1  2  
ATOM   1492  H  HE1  . TRP A 1 25 ? -13.376 6.846   10.645  1.00 0.00 ? 25  TRP A HE1  2  
ATOM   1493  H  HE3  . TRP A 1 25 ? -17.653 6.300   7.483   1.00 0.00 ? 25  TRP A HE3  2  
ATOM   1494  H  HZ2  . TRP A 1 25 ? -14.890 9.219   10.435  1.00 0.00 ? 25  TRP A HZ2  2  
ATOM   1495  H  HZ3  . TRP A 1 25 ? -18.267 8.647   7.889   1.00 0.00 ? 25  TRP A HZ3  2  
ATOM   1496  H  HH2  . TRP A 1 25 ? -16.913 10.075  9.335   1.00 0.00 ? 25  TRP A HH2  2  
ATOM   1497  N  N    . HIS A 1 26 ? -12.989 3.057   6.316   1.00 0.00 ? 26  HIS A N    2  
ATOM   1498  C  CA   . HIS A 1 26 ? -11.538 3.161   6.213   1.00 0.00 ? 26  HIS A CA   2  
ATOM   1499  C  C    . HIS A 1 26 ? -11.105 3.310   4.757   1.00 0.00 ? 26  HIS A C    2  
ATOM   1500  O  O    . HIS A 1 26 ? -9.991  3.748   4.474   1.00 0.00 ? 26  HIS A O    2  
ATOM   1501  C  CB   . HIS A 1 26 ? -10.872 1.931   6.831   1.00 0.00 ? 26  HIS A CB   2  
ATOM   1502  C  CG   . HIS A 1 26 ? -9.533  1.614   6.240   1.00 0.00 ? 26  HIS A CG   2  
ATOM   1503  N  ND1  . HIS A 1 26 ? -8.352  2.122   6.738   1.00 0.00 ? 26  HIS A ND1  2  
ATOM   1504  C  CD2  . HIS A 1 26 ? -9.191  0.834   5.188   1.00 0.00 ? 26  HIS A CD2  2  
ATOM   1505  C  CE1  . HIS A 1 26 ? -7.342  1.670   6.017   1.00 0.00 ? 26  HIS A CE1  2  
ATOM   1506  N  NE2  . HIS A 1 26 ? -7.824  0.886   5.069   1.00 0.00 ? 26  HIS A NE2  2  
ATOM   1507  H  H    . HIS A 1 26 ? -13.407 2.171   6.302   1.00 0.00 ? 26  HIS A H    2  
ATOM   1508  H  HA   . HIS A 1 26 ? -11.228 4.039   6.759   1.00 0.00 ? 26  HIS A HA   2  
ATOM   1509  H  HB2  . HIS A 1 26 ? -10.737 2.096   7.889   1.00 0.00 ? 26  HIS A HB2  2  
ATOM   1510  H  HB3  . HIS A 1 26 ? -11.512 1.072   6.685   1.00 0.00 ? 26  HIS A HB3  2  
ATOM   1511  H  HD1  . HIS A 1 26 ? -8.266  2.725   7.505   1.00 0.00 ? 26  HIS A HD1  2  
ATOM   1512  H  HD2  . HIS A 1 26 ? -9.868  0.276   4.556   1.00 0.00 ? 26  HIS A HD2  2  
ATOM   1513  H  HE1  . HIS A 1 26 ? -6.299  1.900   6.174   1.00 0.00 ? 26  HIS A HE1  2  
ATOM   1514  N  N    . GLN A 1 27 ? -11.994 2.943   3.840   1.00 0.00 ? 27  GLN A N    2  
ATOM   1515  C  CA   . GLN A 1 27 ? -11.703 3.035   2.414   1.00 0.00 ? 27  GLN A CA   2  
ATOM   1516  C  C    . GLN A 1 27 ? -12.058 4.416   1.875   1.00 0.00 ? 27  GLN A C    2  
ATOM   1517  O  O    . GLN A 1 27 ? -11.403 4.924   0.964   1.00 0.00 ? 27  GLN A O    2  
ATOM   1518  C  CB   . GLN A 1 27 ? -12.473 1.960   1.645   1.00 0.00 ? 27  GLN A CB   2  
ATOM   1519  C  CG   . GLN A 1 27 ? -11.866 0.572   1.767   1.00 0.00 ? 27  GLN A CG   2  
ATOM   1520  C  CD   . GLN A 1 27 ? -12.629 -0.470  0.972   1.00 0.00 ? 27  GLN A CD   2  
ATOM   1521  O  OE1  . GLN A 1 27 ? -13.512 -0.140  0.180   1.00 0.00 ? 27  GLN A OE1  2  
ATOM   1522  N  NE2  . GLN A 1 27 ? -12.291 -1.737  1.180   1.00 0.00 ? 27  GLN A NE2  2  
ATOM   1523  H  H    . GLN A 1 27 ? -12.866 2.601   4.129   1.00 0.00 ? 27  GLN A H    2  
ATOM   1524  H  HA   . GLN A 1 27 ? -10.645 2.871   2.281   1.00 0.00 ? 27  GLN A HA   2  
ATOM   1525  H  HB2  . GLN A 1 27 ? -13.485 1.922   2.019   1.00 0.00 ? 27  GLN A HB2  2  
ATOM   1526  H  HB3  . GLN A 1 27 ? -12.494 2.229   0.599   1.00 0.00 ? 27  GLN A HB3  2  
ATOM   1527  H  HG2  . GLN A 1 27 ? -10.849 0.604   1.405   1.00 0.00 ? 27  GLN A HG2  2  
ATOM   1528  H  HG3  . GLN A 1 27 ? -11.868 0.283   2.807   1.00 0.00 ? 27  GLN A HG3  2  
ATOM   1529  H  HE21 . GLN A 1 27 ? -11.578 -1.926  1.827   1.00 0.00 ? 27  GLN A HE21 2  
ATOM   1530  H  HE22 . GLN A 1 27 ? -12.767 -2.431  0.680   1.00 0.00 ? 27  GLN A HE22 2  
ATOM   1531  N  N    . ARG A 1 28 ? -13.098 5.019   2.442   1.00 0.00 ? 28  ARG A N    2  
ATOM   1532  C  CA   . ARG A 1 28 ? -13.541 6.341   2.016   1.00 0.00 ? 28  ARG A CA   2  
ATOM   1533  C  C    . ARG A 1 28 ? -12.469 7.390   2.299   1.00 0.00 ? 28  ARG A C    2  
ATOM   1534  O  O    . ARG A 1 28 ? -12.318 8.357   1.552   1.00 0.00 ? 28  ARG A O    2  
ATOM   1535  C  CB   . ARG A 1 28 ? -14.841 6.720   2.727   1.00 0.00 ? 28  ARG A CB   2  
ATOM   1536  C  CG   . ARG A 1 28 ? -14.636 7.214   4.150   1.00 0.00 ? 28  ARG A CG   2  
ATOM   1537  C  CD   . ARG A 1 28 ? -15.955 7.311   4.901   1.00 0.00 ? 28  ARG A CD   2  
ATOM   1538  N  NE   . ARG A 1 28 ? -16.571 8.628   4.757   1.00 0.00 ? 28  ARG A NE   2  
ATOM   1539  C  CZ   . ARG A 1 28 ? -17.357 8.964   3.740   1.00 0.00 ? 28  ARG A CZ   2  
ATOM   1540  N  NH1  . ARG A 1 28 ? -17.622 8.085   2.784   1.00 0.00 ? 28  ARG A NH1  2  
ATOM   1541  N  NH2  . ARG A 1 28 ? -17.880 10.182  3.679   1.00 0.00 ? 28  ARG A NH2  2  
ATOM   1542  H  H    . ARG A 1 28 ? -13.580 4.563   3.163   1.00 0.00 ? 28  ARG A H    2  
ATOM   1543  H  HA   . ARG A 1 28 ? -13.720 6.305   0.952   1.00 0.00 ? 28  ARG A HA   2  
ATOM   1544  H  HB2  . ARG A 1 28 ? -15.330 7.502   2.165   1.00 0.00 ? 28  ARG A HB2  2  
ATOM   1545  H  HB3  . ARG A 1 28 ? -15.485 5.854   2.758   1.00 0.00 ? 28  ARG A HB3  2  
ATOM   1546  H  HG2  . ARG A 1 28 ? -13.989 6.524   4.670   1.00 0.00 ? 28  ARG A HG2  2  
ATOM   1547  H  HG3  . ARG A 1 28 ? -14.176 8.190   4.119   1.00 0.00 ? 28  ARG A HG3  2  
ATOM   1548  H  HD2  . ARG A 1 28 ? -16.631 6.564   4.513   1.00 0.00 ? 28  ARG A HD2  2  
ATOM   1549  H  HD3  . ARG A 1 28 ? -15.772 7.122   5.948   1.00 0.00 ? 28  ARG A HD3  2  
ATOM   1550  H  HE   . ARG A 1 28 ? -16.388 9.293   5.452   1.00 0.00 ? 28  ARG A HE   2  
ATOM   1551  H  HH11 . ARG A 1 28 ? -17.230 7.166   2.828   1.00 0.00 ? 28  ARG A HH11 2  
ATOM   1552  H  HH12 . ARG A 1 28 ? -18.216 8.340   2.020   1.00 0.00 ? 28  ARG A HH12 2  
ATOM   1553  H  HH21 . ARG A 1 28 ? -17.683 10.847  4.399   1.00 0.00 ? 28  ARG A HH21 2  
ATOM   1554  H  HH22 . ARG A 1 28 ? -18.472 10.434  2.914   1.00 0.00 ? 28  ARG A HH22 2  
ATOM   1555  N  N    . LYS A 1 29 ? -11.728 7.193   3.384   1.00 0.00 ? 29  LYS A N    2  
ATOM   1556  C  CA   . LYS A 1 29 ? -10.670 8.121   3.767   1.00 0.00 ? 29  LYS A CA   2  
ATOM   1557  C  C    . LYS A 1 29 ? -9.566  8.151   2.715   1.00 0.00 ? 29  LYS A C    2  
ATOM   1558  O  O    . LYS A 1 29 ? -8.839  9.137   2.592   1.00 0.00 ? 29  LYS A O    2  
ATOM   1559  C  CB   . LYS A 1 29 ? -10.085 7.726   5.125   1.00 0.00 ? 29  LYS A CB   2  
ATOM   1560  C  CG   . LYS A 1 29 ? -8.944  6.728   5.029   1.00 0.00 ? 29  LYS A CG   2  
ATOM   1561  C  CD   . LYS A 1 29 ? -8.339  6.440   6.392   1.00 0.00 ? 29  LYS A CD   2  
ATOM   1562  C  CE   . LYS A 1 29 ? -7.804  5.018   6.476   1.00 0.00 ? 29  LYS A CE   2  
ATOM   1563  N  NZ   . LYS A 1 29 ? -6.376  4.937   6.060   1.00 0.00 ? 29  LYS A NZ   2  
ATOM   1564  H  H    . LYS A 1 29 ? -11.896 6.404   3.941   1.00 0.00 ? 29  LYS A H    2  
ATOM   1565  H  HA   . LYS A 1 29 ? -11.104 9.106   3.845   1.00 0.00 ? 29  LYS A HA   2  
ATOM   1566  H  HB2  . LYS A 1 29 ? -9.717  8.615   5.617   1.00 0.00 ? 29  LYS A HB2  2  
ATOM   1567  H  HB3  . LYS A 1 29 ? -10.868 7.289   5.728   1.00 0.00 ? 29  LYS A HB3  2  
ATOM   1568  H  HG2  . LYS A 1 29 ? -9.319  5.805   4.611   1.00 0.00 ? 29  LYS A HG2  2  
ATOM   1569  H  HG3  . LYS A 1 29 ? -8.177  7.132   4.383   1.00 0.00 ? 29  LYS A HG3  2  
ATOM   1570  H  HD2  . LYS A 1 29 ? -7.526  7.128   6.569   1.00 0.00 ? 29  LYS A HD2  2  
ATOM   1571  H  HD3  . LYS A 1 29 ? -9.098  6.574   7.150   1.00 0.00 ? 29  LYS A HD3  2  
ATOM   1572  H  HE2  . LYS A 1 29 ? -7.893  4.673   7.494   1.00 0.00 ? 29  LYS A HE2  2  
ATOM   1573  H  HE3  . LYS A 1 29 ? -8.395  4.387   5.829   1.00 0.00 ? 29  LYS A HE3  2  
ATOM   1574  H  HZ1  . LYS A 1 29 ? -6.239  5.436   5.157   1.00 0.00 ? 29  LYS A HZ1  2  
ATOM   1575  H  HZ2  . LYS A 1 29 ? -6.095  3.943   5.939   1.00 0.00 ? 29  LYS A HZ2  2  
ATOM   1576  H  HZ3  . LYS A 1 29 ? -5.768  5.373   6.782   1.00 0.00 ? 29  LYS A HZ3  2  
ATOM   1577  N  N    . HIS A 1 30 ? -9.446  7.065   1.958   1.00 0.00 ? 30  HIS A N    2  
ATOM   1578  C  CA   . HIS A 1 30 ? -8.432  6.969   0.915   1.00 0.00 ? 30  HIS A CA   2  
ATOM   1579  C  C    . HIS A 1 30 ? -8.760  7.898   -0.250  1.00 0.00 ? 30  HIS A C    2  
ATOM   1580  O  O    . HIS A 1 30 ? -7.874  8.302   -1.003  1.00 0.00 ? 30  HIS A O    2  
ATOM   1581  C  CB   . HIS A 1 30 ? -8.318  5.528   0.416   1.00 0.00 ? 30  HIS A CB   2  
ATOM   1582  C  CG   . HIS A 1 30 ? -7.690  4.598   1.408   1.00 0.00 ? 30  HIS A CG   2  
ATOM   1583  N  ND1  . HIS A 1 30 ? -6.611  4.950   2.191   1.00 0.00 ? 30  HIS A ND1  2  
ATOM   1584  C  CD2  . HIS A 1 30 ? -7.998  3.324   1.745   1.00 0.00 ? 30  HIS A CD2  2  
ATOM   1585  C  CE1  . HIS A 1 30 ? -6.280  3.931   2.964   1.00 0.00 ? 30  HIS A CE1  2  
ATOM   1586  N  NE2  . HIS A 1 30 ? -7.106  2.932   2.714   1.00 0.00 ? 30  HIS A NE2  2  
ATOM   1587  H  H    . HIS A 1 30 ? -10.055 6.311   2.104   1.00 0.00 ? 30  HIS A H    2  
ATOM   1588  H  HA   . HIS A 1 30 ? -7.487  7.268   1.342   1.00 0.00 ? 30  HIS A HA   2  
ATOM   1589  H  HB2  . HIS A 1 30 ? -9.305  5.153   0.190   1.00 0.00 ? 30  HIS A HB2  2  
ATOM   1590  H  HB3  . HIS A 1 30 ? -7.717  5.511   -0.482  1.00 0.00 ? 30  HIS A HB3  2  
ATOM   1591  H  HD1  . HIS A 1 30 ? -6.154  5.816   2.179   1.00 0.00 ? 30  HIS A HD1  2  
ATOM   1592  H  HD2  . HIS A 1 30 ? -8.796  2.725   1.329   1.00 0.00 ? 30  HIS A HD2  2  
ATOM   1593  H  HE1  . HIS A 1 30 ? -5.472  3.918   3.680   1.00 0.00 ? 30  HIS A HE1  2  
ATOM   1594  N  N    . ALA A 1 31 ? -10.038 8.232   -0.392  1.00 0.00 ? 31  ALA A N    2  
ATOM   1595  C  CA   . ALA A 1 31 ? -10.483 9.114   -1.464  1.00 0.00 ? 31  ALA A CA   2  
ATOM   1596  C  C    . ALA A 1 31 ? -10.116 10.565  -1.169  1.00 0.00 ? 31  ALA A C    2  
ATOM   1597  O  O    . ALA A 1 31 ? -9.885  11.354  -2.084  1.00 0.00 ? 31  ALA A O    2  
ATOM   1598  C  CB   . ALA A 1 31 ? -11.984 8.979   -1.670  1.00 0.00 ? 31  ALA A CB   2  
ATOM   1599  H  H    . ALA A 1 31 ? -10.698 7.878   0.240   1.00 0.00 ? 31  ALA A H    2  
ATOM   1600  H  HA   . ALA A 1 31 ? -9.990  8.807   -2.375  1.00 0.00 ? 31  ALA A HA   2  
ATOM   1601  H  HB1  . ALA A 1 31 ? -12.311 8.016   -1.307  1.00 0.00 ? 31  ALA A HB1  2  
ATOM   1602  H  HB2  . ALA A 1 31 ? -12.494 9.761   -1.126  1.00 0.00 ? 31  ALA A HB2  2  
ATOM   1603  H  HB3  . ALA A 1 31 ? -12.212 9.065   -2.722  1.00 0.00 ? 31  ALA A HB3  2  
ATOM   1604  N  N    . GLU A 1 32 ? -10.065 10.908  0.115   1.00 0.00 ? 32  GLU A N    2  
ATOM   1605  C  CA   . GLU A 1 32 ? -9.727  12.265  0.529   1.00 0.00 ? 32  GLU A CA   2  
ATOM   1606  C  C    . GLU A 1 32 ? -8.218  12.425  0.691   1.00 0.00 ? 32  GLU A C    2  
ATOM   1607  O  O    . GLU A 1 32 ? -7.662  13.491  0.424   1.00 0.00 ? 32  GLU A O    2  
ATOM   1608  C  CB   . GLU A 1 32 ? -10.432 12.612  1.842   1.00 0.00 ? 32  GLU A CB   2  
ATOM   1609  C  CG   . GLU A 1 32 ? -9.984  11.759  3.017   1.00 0.00 ? 32  GLU A CG   2  
ATOM   1610  C  CD   . GLU A 1 32 ? -10.147 12.466  4.348   1.00 0.00 ? 32  GLU A CD   2  
ATOM   1611  O  OE1  . GLU A 1 32 ? -11.201 13.105  4.554   1.00 0.00 ? 32  GLU A OE1  2  
ATOM   1612  O  OE2  . GLU A 1 32 ? -9.223  12.382  5.183   1.00 0.00 ? 32  GLU A OE2  2  
ATOM   1613  H  H    . GLU A 1 32 ? -10.259 10.234  0.798   1.00 0.00 ? 32  GLU A H    2  
ATOM   1614  H  HA   . GLU A 1 32 ? -10.067 12.941  -0.241  1.00 0.00 ? 32  GLU A HA   2  
ATOM   1615  H  HB2  . GLU A 1 32 ? -10.236 13.647  2.079   1.00 0.00 ? 32  GLU A HB2  2  
ATOM   1616  H  HB3  . GLU A 1 32 ? -11.495 12.477  1.712   1.00 0.00 ? 32  GLU A HB3  2  
ATOM   1617  H  HG2  . GLU A 1 32 ? -10.572 10.853  3.033   1.00 0.00 ? 32  GLU A HG2  2  
ATOM   1618  H  HG3  . GLU A 1 32 ? -8.942  11.507  2.885   1.00 0.00 ? 32  GLU A HG3  2  
ATOM   1619  N  N    . THR A 1 33 ? -7.560  11.357  1.131   1.00 0.00 ? 33  THR A N    2  
ATOM   1620  C  CA   . THR A 1 33 ? -6.116  11.377  1.332   1.00 0.00 ? 33  THR A CA   2  
ATOM   1621  C  C    . THR A 1 33 ? -5.382  11.604  0.015   1.00 0.00 ? 33  THR A C    2  
ATOM   1622  O  O    . THR A 1 33 ? -4.310  12.207  -0.013  1.00 0.00 ? 33  THR A O    2  
ATOM   1623  C  CB   . THR A 1 33 ? -5.618  10.065  1.965   1.00 0.00 ? 33  THR A CB   2  
ATOM   1624  O  OG1  . THR A 1 33 ? -4.403  10.299  2.686   1.00 0.00 ? 33  THR A OG1  2  
ATOM   1625  C  CG2  . THR A 1 33 ? -5.386  9.004   0.900   1.00 0.00 ? 33  THR A CG2  2  
ATOM   1626  H  H    . THR A 1 33 ? -8.059  10.536  1.327   1.00 0.00 ? 33  THR A H    2  
ATOM   1627  H  HA   . THR A 1 33 ? -5.885  12.189  2.006   1.00 0.00 ? 33  THR A HA   2  
ATOM   1628  H  HB   . THR A 1 33 ? -6.371  9.706   2.652   1.00 0.00 ? 33  THR A HB   2  
ATOM   1629  H  HG1  . THR A 1 33 ? -4.493  11.095  3.215   1.00 0.00 ? 33  THR A HG1  2  
ATOM   1630  H  HG21 . THR A 1 33 ? -4.432  9.174   0.424   1.00 0.00 ? 33  THR A HG21 2  
ATOM   1631  H  HG22 . THR A 1 33 ? -6.172  9.057   0.162   1.00 0.00 ? 33  THR A HG22 2  
ATOM   1632  H  HG23 . THR A 1 33 ? -5.389  8.027   1.359   1.00 0.00 ? 33  THR A HG23 2  
ATOM   1633  N  N    . VAL A 1 34 ? -5.966  11.116  -1.075  1.00 0.00 ? 34  VAL A N    2  
ATOM   1634  C  CA   . VAL A 1 34 ? -5.368  11.267  -2.396  1.00 0.00 ? 34  VAL A CA   2  
ATOM   1635  C  C    . VAL A 1 34 ? -4.882  12.694  -2.619  1.00 0.00 ? 34  VAL A C    2  
ATOM   1636  O  O    . VAL A 1 34 ? -3.855  12.918  -3.259  1.00 0.00 ? 34  VAL A O    2  
ATOM   1637  C  CB   . VAL A 1 34 ? -6.365  10.895  -3.509  1.00 0.00 ? 34  VAL A CB   2  
ATOM   1638  C  CG1  . VAL A 1 34 ? -6.801  9.444   -3.374  1.00 0.00 ? 34  VAL A CG1  2  
ATOM   1639  C  CG2  . VAL A 1 34 ? -7.568  11.826  -3.479  1.00 0.00 ? 34  VAL A CG2  2  
ATOM   1640  H  H    . VAL A 1 34 ? -6.821  10.644  -0.988  1.00 0.00 ? 34  VAL A H    2  
ATOM   1641  H  HA   . VAL A 1 34 ? -4.524  10.595  -2.459  1.00 0.00 ? 34  VAL A HA   2  
ATOM   1642  H  HB   . VAL A 1 34 ? -5.870  11.012  -4.462  1.00 0.00 ? 34  VAL A HB   2  
ATOM   1643  H  HG11 . VAL A 1 34 ? -6.854  8.992   -4.354  1.00 0.00 ? 34  VAL A HG11 2  
ATOM   1644  H  HG12 . VAL A 1 34 ? -6.086  8.908   -2.767  1.00 0.00 ? 34  VAL A HG12 2  
ATOM   1645  H  HG13 . VAL A 1 34 ? -7.773  9.402   -2.906  1.00 0.00 ? 34  VAL A HG13 2  
ATOM   1646  H  HG21 . VAL A 1 34 ? -8.442  11.295  -3.826  1.00 0.00 ? 34  VAL A HG21 2  
ATOM   1647  H  HG22 . VAL A 1 34 ? -7.733  12.169  -2.468  1.00 0.00 ? 34  VAL A HG22 2  
ATOM   1648  H  HG23 . VAL A 1 34 ? -7.383  12.675  -4.121  1.00 0.00 ? 34  VAL A HG23 2  
ATOM   1649  N  N    . ALA A 1 35 ? -5.627  13.657  -2.087  1.00 0.00 ? 35  ALA A N    2  
ATOM   1650  C  CA   . ALA A 1 35 ? -5.271  15.064  -2.226  1.00 0.00 ? 35  ALA A CA   2  
ATOM   1651  C  C    . ALA A 1 35 ? -3.796  15.290  -1.911  1.00 0.00 ? 35  ALA A C    2  
ATOM   1652  O  O    . ALA A 1 35 ? -3.067  15.884  -2.705  1.00 0.00 ? 35  ALA A O    2  
ATOM   1653  C  CB   . ALA A 1 35 ? -6.144  15.921  -1.321  1.00 0.00 ? 35  ALA A CB   2  
ATOM   1654  H  H    . ALA A 1 35 ? -6.435  13.416  -1.588  1.00 0.00 ? 35  ALA A H    2  
ATOM   1655  H  HA   . ALA A 1 35 ? -5.460  15.356  -3.249  1.00 0.00 ? 35  ALA A HA   2  
ATOM   1656  H  HB1  . ALA A 1 35 ? -6.569  15.304  -0.542  1.00 0.00 ? 35  ALA A HB1  2  
ATOM   1657  H  HB2  . ALA A 1 35 ? -5.543  16.700  -0.875  1.00 0.00 ? 35  ALA A HB2  2  
ATOM   1658  H  HB3  . ALA A 1 35 ? -6.938  16.365  -1.902  1.00 0.00 ? 35  ALA A HB3  2  
ATOM   1659  N  N    . ALA A 1 36 ? -3.364  14.814  -0.749  1.00 0.00 ? 36  ALA A N    2  
ATOM   1660  C  CA   . ALA A 1 36 ? -1.976  14.963  -0.330  1.00 0.00 ? 36  ALA A CA   2  
ATOM   1661  C  C    . ALA A 1 36 ? -1.025  14.349  -1.352  1.00 0.00 ? 36  ALA A C    2  
ATOM   1662  O  O    . ALA A 1 36 ? -0.267  15.058  -2.015  1.00 0.00 ? 36  ALA A O    2  
ATOM   1663  C  CB   . ALA A 1 36 ? -1.765  14.330  1.037   1.00 0.00 ? 36  ALA A CB   2  
ATOM   1664  H  H    . ALA A 1 36 ? -3.993  14.349  -0.159  1.00 0.00 ? 36  ALA A H    2  
ATOM   1665  H  HA   . ALA A 1 36 ? -1.764  16.020  -0.247  1.00 0.00 ? 36  ALA A HA   2  
ATOM   1666  H  HB1  . ALA A 1 36 ? -1.716  15.105  1.788   1.00 0.00 ? 36  ALA A HB1  2  
ATOM   1667  H  HB2  . ALA A 1 36 ? -2.588  13.667  1.257   1.00 0.00 ? 36  ALA A HB2  2  
ATOM   1668  H  HB3  . ALA A 1 36 ? -0.842  13.771  1.036   1.00 0.00 ? 36  ALA A HB3  2  
ATOM   1669  N  N    . LEU A 1 37 ? -1.070  13.027  -1.475  1.00 0.00 ? 37  LEU A N    2  
ATOM   1670  C  CA   . LEU A 1 37 ? -0.212  12.316  -2.416  1.00 0.00 ? 37  LEU A CA   2  
ATOM   1671  C  C    . LEU A 1 37 ? -0.349  12.893  -3.821  1.00 0.00 ? 37  LEU A C    2  
ATOM   1672  O  O    . LEU A 1 37 ? -1.458  13.048  -4.334  1.00 0.00 ? 37  LEU A O    2  
ATOM   1673  C  CB   . LEU A 1 37 ? -0.559  10.826  -2.428  1.00 0.00 ? 37  LEU A CB   2  
ATOM   1674  C  CG   . LEU A 1 37 ? -0.858  10.195  -1.068  1.00 0.00 ? 37  LEU A CG   2  
ATOM   1675  C  CD1  . LEU A 1 37 ? 0.003   10.828  0.015   1.00 0.00 ? 37  LEU A CD1  2  
ATOM   1676  C  CD2  . LEU A 1 37 ? -2.335  10.336  -0.728  1.00 0.00 ? 37  LEU A CD2  2  
ATOM   1677  H  H    . LEU A 1 37 ? -1.695  12.516  -0.919  1.00 0.00 ? 37  LEU A H    2  
ATOM   1678  H  HA   . LEU A 1 37 ? 0.810   12.436  -2.089  1.00 0.00 ? 37  LEU A HA   2  
ATOM   1679  H  HB2  . LEU A 1 37 ? -1.430  10.695  -3.052  1.00 0.00 ? 37  LEU A HB2  2  
ATOM   1680  H  HB3  . LEU A 1 37 ? 0.276   10.296  -2.864  1.00 0.00 ? 37  LEU A HB3  2  
ATOM   1681  H  HG   . LEU A 1 37 ? -0.622  9.141   -1.107  1.00 0.00 ? 37  LEU A HG   2  
ATOM   1682  H  HD11 . LEU A 1 37 ? 1.015   10.931  -0.346  1.00 0.00 ? 37  LEU A HD11 2  
ATOM   1683  H  HD12 . LEU A 1 37 ? -0.005  10.200  0.893   1.00 0.00 ? 37  LEU A HD12 2  
ATOM   1684  H  HD13 . LEU A 1 37 ? -0.392  11.801  0.266   1.00 0.00 ? 37  LEU A HD13 2  
ATOM   1685  H  HD21 . LEU A 1 37 ? -2.797  9.360   -0.721  1.00 0.00 ? 37  LEU A HD21 2  
ATOM   1686  H  HD22 . LEU A 1 37 ? -2.817  10.958  -1.468  1.00 0.00 ? 37  LEU A HD22 2  
ATOM   1687  H  HD23 . LEU A 1 37 ? -2.438  10.790  0.247   1.00 0.00 ? 37  LEU A HD23 2  
ATOM   1688  N  N    . ARG A 1 38 ? 0.784   13.209  -4.439  1.00 0.00 ? 38  ARG A N    2  
ATOM   1689  C  CA   . ARG A 1 38 ? 0.790   13.768  -5.785  1.00 0.00 ? 38  ARG A CA   2  
ATOM   1690  C  C    . ARG A 1 38 ? 1.521   12.843  -6.755  1.00 0.00 ? 38  ARG A C    2  
ATOM   1691  O  O    . ARG A 1 38 ? 1.181   12.771  -7.936  1.00 0.00 ? 38  ARG A O    2  
ATOM   1692  C  CB   . ARG A 1 38 ? 1.451   15.148  -5.784  1.00 0.00 ? 38  ARG A CB   2  
ATOM   1693  C  CG   . ARG A 1 38 ? 1.106   15.987  -4.565  1.00 0.00 ? 38  ARG A CG   2  
ATOM   1694  C  CD   . ARG A 1 38 ? 2.138   15.816  -3.461  1.00 0.00 ? 38  ARG A CD   2  
ATOM   1695  N  NE   . ARG A 1 38 ? 1.723   16.461  -2.219  1.00 0.00 ? 38  ARG A NE   2  
ATOM   1696  C  CZ   . ARG A 1 38 ? 1.938   17.744  -1.949  1.00 0.00 ? 38  ARG A CZ   2  
ATOM   1697  N  NH1  . ARG A 1 38 ? 2.559   18.515  -2.830  1.00 0.00 ? 38  ARG A NH1  2  
ATOM   1698  N  NH2  . ARG A 1 38 ? 1.529   18.258  -0.795  1.00 0.00 ? 38  ARG A NH2  2  
ATOM   1699  H  H    . ARG A 1 38 ? 1.637   13.062  -3.978  1.00 0.00 ? 38  ARG A H    2  
ATOM   1700  H  HA   . ARG A 1 38 ? -0.235  13.869  -6.107  1.00 0.00 ? 38  ARG A HA   2  
ATOM   1701  H  HB2  . ARG A 1 38 ? 2.523   15.021  -5.815  1.00 0.00 ? 38  ARG A HB2  2  
ATOM   1702  H  HB3  . ARG A 1 38 ? 1.134   15.685  -6.665  1.00 0.00 ? 38  ARG A HB3  2  
ATOM   1703  H  HG2  . ARG A 1 38 ? 1.072   17.027  -4.853  1.00 0.00 ? 38  ARG A HG2  2  
ATOM   1704  H  HG3  . ARG A 1 38 ? 0.139   15.683  -4.192  1.00 0.00 ? 38  ARG A HG3  2  
ATOM   1705  H  HD2  . ARG A 1 38 ? 2.280   14.762  -3.279  1.00 0.00 ? 38  ARG A HD2  2  
ATOM   1706  H  HD3  . ARG A 1 38 ? 3.070   16.253  -3.789  1.00 0.00 ? 38  ARG A HD3  2  
ATOM   1707  H  HE   . ARG A 1 38 ? 1.262   15.909  -1.553  1.00 0.00 ? 38  ARG A HE   2  
ATOM   1708  H  HH11 . ARG A 1 38 ? 2.867   18.131  -3.700  1.00 0.00 ? 38  ARG A HH11 2  
ATOM   1709  H  HH12 . ARG A 1 38 ? 2.718   19.481  -2.625  1.00 0.00 ? 38  ARG A HH12 2  
ATOM   1710  H  HH21 . ARG A 1 38 ? 1.060   17.679  -0.129  1.00 0.00 ? 38  ARG A HH21 2  
ATOM   1711  H  HH22 . ARG A 1 38 ? 1.691   19.223  -0.593  1.00 0.00 ? 38  ARG A HH22 2  
ATOM   1712  N  N    . PHE A 1 39 ? 2.527   12.138  -6.247  1.00 0.00 ? 39  PHE A N    2  
ATOM   1713  C  CA   . PHE A 1 39 ? 3.307   11.219  -7.068  1.00 0.00 ? 39  PHE A CA   2  
ATOM   1714  C  C    . PHE A 1 39 ? 2.823   9.783   -6.887  1.00 0.00 ? 39  PHE A C    2  
ATOM   1715  O  O    . PHE A 1 39 ? 3.130   9.118   -5.897  1.00 0.00 ? 39  PHE A O    2  
ATOM   1716  C  CB   . PHE A 1 39 ? 4.791   11.318  -6.711  1.00 0.00 ? 39  PHE A CB   2  
ATOM   1717  C  CG   . PHE A 1 39 ? 5.290   12.731  -6.606  1.00 0.00 ? 39  PHE A CG   2  
ATOM   1718  C  CD1  . PHE A 1 39 ? 4.983   13.507  -5.500  1.00 0.00 ? 39  PHE A CD1  2  
ATOM   1719  C  CD2  . PHE A 1 39 ? 6.066   13.282  -7.613  1.00 0.00 ? 39  PHE A CD2  2  
ATOM   1720  C  CE1  . PHE A 1 39 ? 5.440   14.808  -5.402  1.00 0.00 ? 39  PHE A CE1  2  
ATOM   1721  C  CE2  . PHE A 1 39 ? 6.526   14.582  -7.519  1.00 0.00 ? 39  PHE A CE2  2  
ATOM   1722  C  CZ   . PHE A 1 39 ? 6.214   15.346  -6.412  1.00 0.00 ? 39  PHE A CZ   2  
ATOM   1723  H  H    . PHE A 1 39 ? 2.750   12.239  -5.298  1.00 0.00 ? 39  PHE A H    2  
ATOM   1724  H  HA   . PHE A 1 39 ? 3.174   11.504  -8.100  1.00 0.00 ? 39  PHE A HA   2  
ATOM   1725  H  HB2  . PHE A 1 39 ? 4.959   10.836  -5.760  1.00 0.00 ? 39  PHE A HB2  2  
ATOM   1726  H  HB3  . PHE A 1 39 ? 5.371   10.816  -7.471  1.00 0.00 ? 39  PHE A HB3  2  
ATOM   1727  H  HD1  . PHE A 1 39 ? 4.379   13.088  -4.709  1.00 0.00 ? 39  PHE A HD1  2  
ATOM   1728  H  HD2  . PHE A 1 39 ? 6.312   12.685  -8.480  1.00 0.00 ? 39  PHE A HD2  2  
ATOM   1729  H  HE1  . PHE A 1 39 ? 5.194   15.403  -4.535  1.00 0.00 ? 39  PHE A HE1  2  
ATOM   1730  H  HE2  . PHE A 1 39 ? 7.131   14.999  -8.311  1.00 0.00 ? 39  PHE A HE2  2  
ATOM   1731  H  HZ   . PHE A 1 39 ? 6.571   16.362  -6.337  1.00 0.00 ? 39  PHE A HZ   2  
ATOM   1732  N  N    . PRO A 1 40 ? 2.047   9.293   -7.865  1.00 0.00 ? 40  PRO A N    2  
ATOM   1733  C  CA   . PRO A 1 40 ? 1.504   7.932   -7.838  1.00 0.00 ? 40  PRO A CA   2  
ATOM   1734  C  C    . PRO A 1 40 ? 2.584   6.873   -8.029  1.00 0.00 ? 40  PRO A C    2  
ATOM   1735  O  O    . PRO A 1 40 ? 3.731   7.191   -8.344  1.00 0.00 ? 40  PRO A O    2  
ATOM   1736  C  CB   . PRO A 1 40 ? 0.525   7.917   -9.014  1.00 0.00 ? 40  PRO A CB   2  
ATOM   1737  C  CG   . PRO A 1 40 ? 1.034   8.964   -9.944  1.00 0.00 ? 40  PRO A CG   2  
ATOM   1738  C  CD   . PRO A 1 40 ? 1.641   10.030  -9.074  1.00 0.00 ? 40  PRO A CD   2  
ATOM   1739  H  HA   . PRO A 1 40 ? 0.969   7.737   -6.920  1.00 0.00 ? 40  PRO A HA   2  
ATOM   1740  H  HB2  . PRO A 1 40 ? 0.530   6.940   -9.477  1.00 0.00 ? 40  PRO A HB2  2  
ATOM   1741  H  HB3  . PRO A 1 40 ? -0.469  8.150   -8.663  1.00 0.00 ? 40  PRO A HB3  2  
ATOM   1742  H  HG2  . PRO A 1 40 ? 1.781   8.543   -10.598 1.00 0.00 ? 40  PRO A HG2  2  
ATOM   1743  H  HG3  . PRO A 1 40 ? 0.216   9.372   -10.519 1.00 0.00 ? 40  PRO A HG3  2  
ATOM   1744  H  HD2  . PRO A 1 40 ? 2.497   10.472  -9.562  1.00 0.00 ? 40  PRO A HD2  2  
ATOM   1745  H  HD3  . PRO A 1 40 ? 0.908   10.786  -8.836  1.00 0.00 ? 40  PRO A HD3  2  
ATOM   1746  N  N    . CYS A 1 41 ? 2.210   5.612   -7.838  1.00 0.00 ? 41  CYS A N    2  
ATOM   1747  C  CA   . CYS A 1 41 ? 3.146   4.505   -7.990  1.00 0.00 ? 41  CYS A CA   2  
ATOM   1748  C  C    . CYS A 1 41 ? 2.875   3.736   -9.279  1.00 0.00 ? 41  CYS A C    2  
ATOM   1749  O  O    . CYS A 1 41 ? 1.899   2.992   -9.376  1.00 0.00 ? 41  CYS A O    2  
ATOM   1750  C  CB   . CYS A 1 41 ? 3.051   3.560   -6.790  1.00 0.00 ? 41  CYS A CB   2  
ATOM   1751  S  SG   . CYS A 1 41 ? 4.378   2.314   -6.717  1.00 0.00 ? 41  CYS A SG   2  
ATOM   1752  H  H    . CYS A 1 41 ? 1.281   5.421   -7.588  1.00 0.00 ? 41  CYS A H    2  
ATOM   1753  H  HA   . CYS A 1 41 ? 4.143   4.917   -8.034  1.00 0.00 ? 41  CYS A HA   2  
ATOM   1754  H  HB2  . CYS A 1 41 ? 3.096   4.141   -5.880  1.00 0.00 ? 41  CYS A HB2  2  
ATOM   1755  H  HB3  . CYS A 1 41 ? 2.108   3.035   -6.829  1.00 0.00 ? 41  CYS A HB3  2  
ATOM   1756  N  N    . GLU A 1 42 ? 3.745   3.921   -10.267 1.00 0.00 ? 42  GLU A N    2  
ATOM   1757  C  CA   . GLU A 1 42 ? 3.599   3.245   -11.550 1.00 0.00 ? 42  GLU A CA   2  
ATOM   1758  C  C    . GLU A 1 42 ? 3.802   1.740   -11.399 1.00 0.00 ? 42  GLU A C    2  
ATOM   1759  O  O    . GLU A 1 42 ? 3.707   0.989   -12.370 1.00 0.00 ? 42  GLU A O    2  
ATOM   1760  C  CB   . GLU A 1 42 ? 4.597   3.806   -12.565 1.00 0.00 ? 42  GLU A CB   2  
ATOM   1761  C  CG   . GLU A 1 42 ? 6.027   3.352   -12.327 1.00 0.00 ? 42  GLU A CG   2  
ATOM   1762  C  CD   . GLU A 1 42 ? 7.008   3.981   -13.297 1.00 0.00 ? 42  GLU A CD   2  
ATOM   1763  O  OE1  . GLU A 1 42 ? 7.495   5.095   -13.012 1.00 0.00 ? 42  GLU A OE1  2  
ATOM   1764  O  OE2  . GLU A 1 42 ? 7.288   3.358   -14.343 1.00 0.00 ? 42  GLU A OE2  2  
ATOM   1765  H  H    . GLU A 1 42 ? 4.503   4.527   -10.129 1.00 0.00 ? 42  GLU A H    2  
ATOM   1766  H  HA   . GLU A 1 42 ? 2.596   3.426   -11.908 1.00 0.00 ? 42  GLU A HA   2  
ATOM   1767  H  HB2  . GLU A 1 42 ? 4.301   3.492   -13.555 1.00 0.00 ? 42  GLU A HB2  2  
ATOM   1768  H  HB3  . GLU A 1 42 ? 4.571   4.885   -12.517 1.00 0.00 ? 42  GLU A HB3  2  
ATOM   1769  H  HG2  . GLU A 1 42 ? 6.315   3.624   -11.322 1.00 0.00 ? 42  GLU A HG2  2  
ATOM   1770  H  HG3  . GLU A 1 42 ? 6.074   2.279   -12.435 1.00 0.00 ? 42  GLU A HG3  2  
ATOM   1771  N  N    . PHE A 1 43 ? 4.084   1.307   -10.175 1.00 0.00 ? 43  PHE A N    2  
ATOM   1772  C  CA   . PHE A 1 43 ? 4.304   -0.107  -9.895  1.00 0.00 ? 43  PHE A CA   2  
ATOM   1773  C  C    . PHE A 1 43 ? 3.004   -0.786  -9.473  1.00 0.00 ? 43  PHE A C    2  
ATOM   1774  O  O    . PHE A 1 43 ? 2.615   -1.811  -10.033 1.00 0.00 ? 43  PHE A O    2  
ATOM   1775  C  CB   . PHE A 1 43 ? 5.359   -0.275  -8.801  1.00 0.00 ? 43  PHE A CB   2  
ATOM   1776  C  CG   . PHE A 1 43 ? 6.743   -0.516  -9.334  1.00 0.00 ? 43  PHE A CG   2  
ATOM   1777  C  CD1  . PHE A 1 43 ? 7.080   -1.738  -9.893  1.00 0.00 ? 43  PHE A CD1  2  
ATOM   1778  C  CD2  . PHE A 1 43 ? 7.705   0.479   -9.274  1.00 0.00 ? 43  PHE A CD2  2  
ATOM   1779  C  CE1  . PHE A 1 43 ? 8.352   -1.963  -10.385 1.00 0.00 ? 43  PHE A CE1  2  
ATOM   1780  C  CE2  . PHE A 1 43 ? 8.979   0.259   -9.765  1.00 0.00 ? 43  PHE A CE2  2  
ATOM   1781  C  CZ   . PHE A 1 43 ? 9.303   -0.963  -10.320 1.00 0.00 ? 43  PHE A CZ   2  
ATOM   1782  H  H    . PHE A 1 43 ? 4.147   1.955   -9.441  1.00 0.00 ? 43  PHE A H    2  
ATOM   1783  H  HA   . PHE A 1 43 ? 4.660   -0.572  -10.802 1.00 0.00 ? 43  PHE A HA   2  
ATOM   1784  H  HB2  . PHE A 1 43 ? 5.388   0.620   -8.198  1.00 0.00 ? 43  PHE A HB2  2  
ATOM   1785  H  HB3  . PHE A 1 43 ? 5.091   -1.115  -8.178  1.00 0.00 ? 43  PHE A HB3  2  
ATOM   1786  H  HD1  . PHE A 1 43 ? 6.337   -2.521  -9.945  1.00 0.00 ? 43  PHE A HD1  2  
ATOM   1787  H  HD2  . PHE A 1 43 ? 7.454   1.435   -8.840  1.00 0.00 ? 43  PHE A HD2  2  
ATOM   1788  H  HE1  . PHE A 1 43 ? 8.602   -2.920  -10.818 1.00 0.00 ? 43  PHE A HE1  2  
ATOM   1789  H  HE2  . PHE A 1 43 ? 9.720   1.043   -9.712  1.00 0.00 ? 43  PHE A HE2  2  
ATOM   1790  H  HZ   . PHE A 1 43 ? 10.297  -1.137  -10.704 1.00 0.00 ? 43  PHE A HZ   2  
ATOM   1791  N  N    . CYS A 1 44 ? 2.337   -0.207  -8.480  1.00 0.00 ? 44  CYS A N    2  
ATOM   1792  C  CA   . CYS A 1 44 ? 1.082   -0.754  -7.980  1.00 0.00 ? 44  CYS A CA   2  
ATOM   1793  C  C    . CYS A 1 44 ? -0.063  0.234   -8.184  1.00 0.00 ? 44  CYS A C    2  
ATOM   1794  O  O    . CYS A 1 44 ? -1.193  -0.159  -8.469  1.00 0.00 ? 44  CYS A O    2  
ATOM   1795  C  CB   . CYS A 1 44 ? 1.209   -1.105  -6.496  1.00 0.00 ? 44  CYS A CB   2  
ATOM   1796  S  SG   . CYS A 1 44 ? 1.622   0.314   -5.430  1.00 0.00 ? 44  CYS A SG   2  
ATOM   1797  H  H    . CYS A 1 44 ? 2.698   0.609   -8.073  1.00 0.00 ? 44  CYS A H    2  
ATOM   1798  H  HA   . CYS A 1 44 ? 0.867   -1.654  -8.536  1.00 0.00 ? 44  CYS A HA   2  
ATOM   1799  H  HB2  . CYS A 1 44 ? 0.271   -1.513  -6.149  1.00 0.00 ? 44  CYS A HB2  2  
ATOM   1800  H  HB3  . CYS A 1 44 ? 1.986   -1.845  -6.374  1.00 0.00 ? 44  CYS A HB3  2  
ATOM   1801  N  N    . GLY A 1 45 ? 0.240   1.521   -8.036  1.00 0.00 ? 45  GLY A N    2  
ATOM   1802  C  CA   . GLY A 1 45 ? -0.773  2.546   -8.208  1.00 0.00 ? 45  GLY A CA   2  
ATOM   1803  C  C    . GLY A 1 45 ? -0.878  3.464   -7.006  1.00 0.00 ? 45  GLY A C    2  
ATOM   1804  O  O    . GLY A 1 45 ? -1.576  4.476   -7.048  1.00 0.00 ? 45  GLY A O    2  
ATOM   1805  H  H    . GLY A 1 45 ? 1.159   1.775   -7.809  1.00 0.00 ? 45  GLY A H    2  
ATOM   1806  H  HA2  . GLY A 1 45 ? -0.528  3.136   -9.078  1.00 0.00 ? 45  GLY A HA2  2  
ATOM   1807  H  HA3  . GLY A 1 45 ? -1.728  2.068   -8.366  1.00 0.00 ? 45  GLY A HA3  2  
ATOM   1808  N  N    . LYS A 1 46 ? -0.184  3.109   -5.930  1.00 0.00 ? 46  LYS A N    2  
ATOM   1809  C  CA   . LYS A 1 46 ? -0.201  3.907   -4.710  1.00 0.00 ? 46  LYS A CA   2  
ATOM   1810  C  C    . LYS A 1 46 ? 0.129   5.366   -5.009  1.00 0.00 ? 46  LYS A C    2  
ATOM   1811  O  O    . LYS A 1 46 ? 0.359   5.736   -6.161  1.00 0.00 ? 46  LYS A O    2  
ATOM   1812  C  CB   . LYS A 1 46 ? 0.796   3.346   -3.694  1.00 0.00 ? 46  LYS A CB   2  
ATOM   1813  C  CG   . LYS A 1 46 ? 0.276   2.137   -2.935  1.00 0.00 ? 46  LYS A CG   2  
ATOM   1814  C  CD   . LYS A 1 46 ? 1.326   1.577   -1.991  1.00 0.00 ? 46  LYS A CD   2  
ATOM   1815  C  CE   . LYS A 1 46 ? 1.270   2.255   -0.630  1.00 0.00 ? 46  LYS A CE   2  
ATOM   1816  N  NZ   . LYS A 1 46 ? 1.804   1.378   0.449   1.00 0.00 ? 46  LYS A NZ   2  
ATOM   1817  H  H    . LYS A 1 46 ? 0.355   2.290   -5.958  1.00 0.00 ? 46  LYS A H    2  
ATOM   1818  H  HA   . LYS A 1 46 ? -1.196  3.854   -4.293  1.00 0.00 ? 46  LYS A HA   2  
ATOM   1819  H  HB2  . LYS A 1 46 ? 1.698   3.058   -4.214  1.00 0.00 ? 46  LYS A HB2  2  
ATOM   1820  H  HB3  . LYS A 1 46 ? 1.035   4.119   -2.978  1.00 0.00 ? 46  LYS A HB3  2  
ATOM   1821  H  HG2  . LYS A 1 46 ? -0.590  2.430   -2.360  1.00 0.00 ? 46  LYS A HG2  2  
ATOM   1822  H  HG3  . LYS A 1 46 ? -0.003  1.371   -3.644  1.00 0.00 ? 46  LYS A HG3  2  
ATOM   1823  H  HD2  . LYS A 1 46 ? 1.154   0.519   -1.860  1.00 0.00 ? 46  LYS A HD2  2  
ATOM   1824  H  HD3  . LYS A 1 46 ? 2.305   1.734   -2.421  1.00 0.00 ? 46  LYS A HD3  2  
ATOM   1825  H  HE2  . LYS A 1 46 ? 1.856   3.160   -0.669  1.00 0.00 ? 46  LYS A HE2  2  
ATOM   1826  H  HE3  . LYS A 1 46 ? 0.242   2.500   -0.407  1.00 0.00 ? 46  LYS A HE3  2  
ATOM   1827  H  HZ1  . LYS A 1 46 ? 1.159   0.578   0.611   1.00 0.00 ? 46  LYS A HZ1  2  
ATOM   1828  H  HZ2  . LYS A 1 46 ? 1.898   1.917   1.333   1.00 0.00 ? 46  LYS A HZ2  2  
ATOM   1829  H  HZ3  . LYS A 1 46 ? 2.738   1.008   0.179   1.00 0.00 ? 46  LYS A HZ3  2  
ATOM   1830  N  N    . ARG A 1 47 ? 0.152   6.189   -3.966  1.00 0.00 ? 47  ARG A N    2  
ATOM   1831  C  CA   . ARG A 1 47 ? 0.454   7.607   -4.118  1.00 0.00 ? 47  ARG A CA   2  
ATOM   1832  C  C    . ARG A 1 47 ? 1.183   8.142   -2.889  1.00 0.00 ? 47  ARG A C    2  
ATOM   1833  O  O    . ARG A 1 47 ? 0.913   7.725   -1.763  1.00 0.00 ? 47  ARG A O    2  
ATOM   1834  C  CB   . ARG A 1 47 ? -0.832  8.403   -4.348  1.00 0.00 ? 47  ARG A CB   2  
ATOM   1835  C  CG   . ARG A 1 47 ? -1.558  8.030   -5.630  1.00 0.00 ? 47  ARG A CG   2  
ATOM   1836  C  CD   . ARG A 1 47 ? -2.857  8.806   -5.781  1.00 0.00 ? 47  ARG A CD   2  
ATOM   1837  N  NE   . ARG A 1 47 ? -3.193  9.044   -7.182  1.00 0.00 ? 47  ARG A NE   2  
ATOM   1838  C  CZ   . ARG A 1 47 ? -2.763  10.094  -7.873  1.00 0.00 ? 47  ARG A CZ   2  
ATOM   1839  N  NH1  . ARG A 1 47 ? -1.983  10.997  -7.296  1.00 0.00 ? 47  ARG A NH1  2  
ATOM   1840  N  NH2  . ARG A 1 47 ? -3.112  10.241  -9.145  1.00 0.00 ? 47  ARG A NH2  2  
ATOM   1841  H  H    . ARG A 1 47 ? -0.040  5.835   -3.073  1.00 0.00 ? 47  ARG A H    2  
ATOM   1842  H  HA   . ARG A 1 47 ? 1.095   7.719   -4.980  1.00 0.00 ? 47  ARG A HA   2  
ATOM   1843  H  HB2  . ARG A 1 47 ? -1.501  8.231   -3.518  1.00 0.00 ? 47  ARG A HB2  2  
ATOM   1844  H  HB3  . ARG A 1 47 ? -0.588  9.454   -4.391  1.00 0.00 ? 47  ARG A HB3  2  
ATOM   1845  H  HG2  . ARG A 1 47 ? -0.919  8.252   -6.472  1.00 0.00 ? 47  ARG A HG2  2  
ATOM   1846  H  HG3  . ARG A 1 47 ? -1.780  6.973   -5.612  1.00 0.00 ? 47  ARG A HG3  2  
ATOM   1847  H  HD2  . ARG A 1 47 ? -3.654  8.241   -5.320  1.00 0.00 ? 47  ARG A HD2  2  
ATOM   1848  H  HD3  . ARG A 1 47 ? -2.753  9.756   -5.279  1.00 0.00 ? 47  ARG A HD3  2  
ATOM   1849  H  HE   . ARG A 1 47 ? -3.768  8.389   -7.628  1.00 0.00 ? 47  ARG A HE   2  
ATOM   1850  H  HH11 . ARG A 1 47 ? -1.718  10.889  -6.338  1.00 0.00 ? 47  ARG A HH11 2  
ATOM   1851  H  HH12 . ARG A 1 47 ? -1.659  11.786  -7.819  1.00 0.00 ? 47  ARG A HH12 2  
ATOM   1852  H  HH21 . ARG A 1 47 ? -3.699  9.561   -9.584  1.00 0.00 ? 47  ARG A HH21 2  
ATOM   1853  H  HH22 . ARG A 1 47 ? -2.787  11.031  -9.664  1.00 0.00 ? 47  ARG A HH22 2  
ATOM   1854  N  N    . PHE A 1 48 ? 2.110   9.068   -3.114  1.00 0.00 ? 48  PHE A N    2  
ATOM   1855  C  CA   . PHE A 1 48 ? 2.879   9.660   -2.025  1.00 0.00 ? 48  PHE A CA   2  
ATOM   1856  C  C    . PHE A 1 48 ? 2.938   11.178  -2.163  1.00 0.00 ? 48  PHE A C    2  
ATOM   1857  O  O    . PHE A 1 48 ? 2.892   11.713  -3.270  1.00 0.00 ? 48  PHE A O    2  
ATOM   1858  C  CB   . PHE A 1 48 ? 4.297   9.083   -2.003  1.00 0.00 ? 48  PHE A CB   2  
ATOM   1859  C  CG   . PHE A 1 48 ? 4.335   7.592   -1.833  1.00 0.00 ? 48  PHE A CG   2  
ATOM   1860  C  CD1  . PHE A 1 48 ? 3.724   6.760   -2.758  1.00 0.00 ? 48  PHE A CD1  2  
ATOM   1861  C  CD2  . PHE A 1 48 ? 4.982   7.021   -0.749  1.00 0.00 ? 48  PHE A CD2  2  
ATOM   1862  C  CE1  . PHE A 1 48 ? 3.757   5.387   -2.603  1.00 0.00 ? 48  PHE A CE1  2  
ATOM   1863  C  CE2  . PHE A 1 48 ? 5.018   5.648   -0.589  1.00 0.00 ? 48  PHE A CE2  2  
ATOM   1864  C  CZ   . PHE A 1 48 ? 4.406   4.830   -1.519  1.00 0.00 ? 48  PHE A CZ   2  
ATOM   1865  H  H    . PHE A 1 48 ? 2.280   9.360   -4.034  1.00 0.00 ? 48  PHE A H    2  
ATOM   1866  H  HA   . PHE A 1 48 ? 2.385   9.413   -1.099  1.00 0.00 ? 48  PHE A HA   2  
ATOM   1867  H  HB2  . PHE A 1 48 ? 4.790   9.324   -2.933  1.00 0.00 ? 48  PHE A HB2  2  
ATOM   1868  H  HB3  . PHE A 1 48 ? 4.844   9.526   -1.185  1.00 0.00 ? 48  PHE A HB3  2  
ATOM   1869  H  HD1  . PHE A 1 48 ? 3.217   7.194   -3.607  1.00 0.00 ? 48  PHE A HD1  2  
ATOM   1870  H  HD2  . PHE A 1 48 ? 5.462   7.660   -0.021  1.00 0.00 ? 48  PHE A HD2  2  
ATOM   1871  H  HE1  . PHE A 1 48 ? 3.278   4.750   -3.331  1.00 0.00 ? 48  PHE A HE1  2  
ATOM   1872  H  HE2  . PHE A 1 48 ? 5.527   5.217   0.260   1.00 0.00 ? 48  PHE A HE2  2  
ATOM   1873  H  HZ   . PHE A 1 48 ? 4.433   3.758   -1.395  1.00 0.00 ? 48  PHE A HZ   2  
ATOM   1874  N  N    . GLU A 1 49 ? 3.037   11.866  -1.029  1.00 0.00 ? 49  GLU A N    2  
ATOM   1875  C  CA   . GLU A 1 49 ? 3.100   13.322  -1.023  1.00 0.00 ? 49  GLU A CA   2  
ATOM   1876  C  C    . GLU A 1 49 ? 4.348   13.816  -1.751  1.00 0.00 ? 49  GLU A C    2  
ATOM   1877  O  O    . GLU A 1 49 ? 4.431   14.979  -2.146  1.00 0.00 ? 49  GLU A O    2  
ATOM   1878  C  CB   . GLU A 1 49 ? 3.092   13.850  0.413   1.00 0.00 ? 49  GLU A CB   2  
ATOM   1879  C  CG   . GLU A 1 49 ? 3.991   13.066  1.354   1.00 0.00 ? 49  GLU A CG   2  
ATOM   1880  C  CD   . GLU A 1 49 ? 4.518   13.912  2.497   1.00 0.00 ? 49  GLU A CD   2  
ATOM   1881  O  OE1  . GLU A 1 49 ? 4.734   15.125  2.286   1.00 0.00 ? 49  GLU A OE1  2  
ATOM   1882  O  OE2  . GLU A 1 49 ? 4.716   13.364  3.600   1.00 0.00 ? 49  GLU A OE2  2  
ATOM   1883  H  H    . GLU A 1 49 ? 3.069   11.382  -0.178  1.00 0.00 ? 49  GLU A H    2  
ATOM   1884  H  HA   . GLU A 1 49 ? 2.227   13.694  -1.539  1.00 0.00 ? 49  GLU A HA   2  
ATOM   1885  H  HB2  . GLU A 1 49 ? 3.419   14.879  0.408   1.00 0.00 ? 49  GLU A HB2  2  
ATOM   1886  H  HB3  . GLU A 1 49 ? 2.082   13.805  0.794   1.00 0.00 ? 49  GLU A HB3  2  
ATOM   1887  H  HG2  . GLU A 1 49 ? 3.428   12.242  1.767   1.00 0.00 ? 49  GLU A HG2  2  
ATOM   1888  H  HG3  . GLU A 1 49 ? 4.830   12.682  0.793   1.00 0.00 ? 49  GLU A HG3  2  
ATOM   1889  N  N    . LYS A 1 50 ? 5.317   12.924  -1.923  1.00 0.00 ? 50  LYS A N    2  
ATOM   1890  C  CA   . LYS A 1 50 ? 6.561   13.266  -2.602  1.00 0.00 ? 50  LYS A CA   2  
ATOM   1891  C  C    . LYS A 1 50 ? 7.163   12.042  -3.284  1.00 0.00 ? 50  LYS A C    2  
ATOM   1892  O  O    . LYS A 1 50 ? 6.810   10.900  -2.988  1.00 0.00 ? 50  LYS A O    2  
ATOM   1893  C  CB   . LYS A 1 50 ? 7.564   13.855  -1.608  1.00 0.00 ? 50  LYS A CB   2  
ATOM   1894  C  CG   . LYS A 1 50 ? 7.319   13.427  -0.171  1.00 0.00 ? 50  LYS A CG   2  
ATOM   1895  C  CD   . LYS A 1 50 ? 8.442   13.881  0.746   1.00 0.00 ? 50  LYS A CD   2  
ATOM   1896  C  CE   . LYS A 1 50 ? 9.535   12.828  0.852   1.00 0.00 ? 50  LYS A CE   2  
ATOM   1897  N  NZ   . LYS A 1 50 ? 10.798  13.392  1.403   1.00 0.00 ? 50  LYS A NZ   2  
ATOM   1898  H  H    . LYS A 1 50 ? 5.192   12.012  -1.585  1.00 0.00 ? 50  LYS A H    2  
ATOM   1899  H  HA   . LYS A 1 50 ? 6.335   14.007  -3.354  1.00 0.00 ? 50  LYS A HA   2  
ATOM   1900  H  HB2  . LYS A 1 50 ? 8.558   13.541  -1.890  1.00 0.00 ? 50  LYS A HB2  2  
ATOM   1901  H  HB3  . LYS A 1 50 ? 7.509   14.933  -1.655  1.00 0.00 ? 50  LYS A HB3  2  
ATOM   1902  H  HG2  . LYS A 1 50 ? 6.392   13.862  0.171   1.00 0.00 ? 50  LYS A HG2  2  
ATOM   1903  H  HG3  . LYS A 1 50 ? 7.248   12.349  -0.133  1.00 0.00 ? 50  LYS A HG3  2  
ATOM   1904  H  HD2  . LYS A 1 50 ? 8.872   14.790  0.352   1.00 0.00 ? 50  LYS A HD2  2  
ATOM   1905  H  HD3  . LYS A 1 50 ? 8.038   14.068  1.730   1.00 0.00 ? 50  LYS A HD3  2  
ATOM   1906  H  HE2  . LYS A 1 50 ? 9.192   12.036  1.499   1.00 0.00 ? 50  LYS A HE2  2  
ATOM   1907  H  HE3  . LYS A 1 50 ? 9.728   12.429  -0.133  1.00 0.00 ? 50  LYS A HE3  2  
ATOM   1908  H  HZ1  . LYS A 1 50 ? 11.420  13.699  0.628   1.00 0.00 ? 50  LYS A HZ1  2  
ATOM   1909  H  HZ2  . LYS A 1 50 ? 11.294  12.673  1.967   1.00 0.00 ? 50  LYS A HZ2  2  
ATOM   1910  H  HZ3  . LYS A 1 50 ? 10.589  14.210  2.010   1.00 0.00 ? 50  LYS A HZ3  2  
ATOM   1911  N  N    . PRO A 1 51 ? 8.096   12.282  -4.217  1.00 0.00 ? 51  PRO A N    2  
ATOM   1912  C  CA   . PRO A 1 51 ? 8.768   11.211  -4.959  1.00 0.00 ? 51  PRO A CA   2  
ATOM   1913  C  C    . PRO A 1 51 ? 9.717   10.404  -4.078  1.00 0.00 ? 51  PRO A C    2  
ATOM   1914  O  O    . PRO A 1 51 ? 9.686   9.173   -4.081  1.00 0.00 ? 51  PRO A O    2  
ATOM   1915  C  CB   . PRO A 1 51 ? 9.550   11.963  -6.038  1.00 0.00 ? 51  PRO A CB   2  
ATOM   1916  C  CG   . PRO A 1 51 ? 9.773   13.321  -5.468  1.00 0.00 ? 51  PRO A CG   2  
ATOM   1917  C  CD   . PRO A 1 51 ? 8.566   13.618  -4.621  1.00 0.00 ? 51  PRO A CD   2  
ATOM   1918  H  HA   . PRO A 1 51 ? 8.057   10.544  -5.425  1.00 0.00 ? 51  PRO A HA   2  
ATOM   1919  H  HB2  . PRO A 1 51 ? 10.485  11.455  -6.229  1.00 0.00 ? 51  PRO A HB2  2  
ATOM   1920  H  HB3  . PRO A 1 51 ? 8.967   12.007  -6.946  1.00 0.00 ? 51  PRO A HB3  2  
ATOM   1921  H  HG2  . PRO A 1 51 ? 10.666  13.323  -4.861  1.00 0.00 ? 51  PRO A HG2  2  
ATOM   1922  H  HG3  . PRO A 1 51 ? 9.858   14.044  -6.265  1.00 0.00 ? 51  PRO A HG3  2  
ATOM   1923  H  HD2  . PRO A 1 51 ? 8.845   14.205  -3.759  1.00 0.00 ? 51  PRO A HD2  2  
ATOM   1924  H  HD3  . PRO A 1 51 ? 7.814   14.131  -5.203  1.00 0.00 ? 51  PRO A HD3  2  
ATOM   1925  N  N    . ASP A 1 52 ? 10.558  11.105  -3.326  1.00 0.00 ? 52  ASP A N    2  
ATOM   1926  C  CA   . ASP A 1 52 ? 11.515  10.453  -2.440  1.00 0.00 ? 52  ASP A CA   2  
ATOM   1927  C  C    . ASP A 1 52 ? 10.875  9.266   -1.727  1.00 0.00 ? 52  ASP A C    2  
ATOM   1928  O  O    . ASP A 1 52 ? 11.525  8.247   -1.490  1.00 0.00 ? 52  ASP A O    2  
ATOM   1929  C  CB   . ASP A 1 52 ? 12.052  11.451  -1.412  1.00 0.00 ? 52  ASP A CB   2  
ATOM   1930  C  CG   . ASP A 1 52 ? 13.369  12.069  -1.839  1.00 0.00 ? 52  ASP A CG   2  
ATOM   1931  O  OD1  . ASP A 1 52 ? 13.506  12.410  -3.033  1.00 0.00 ? 52  ASP A OD1  2  
ATOM   1932  O  OD2  . ASP A 1 52 ? 14.263  12.213  -0.979  1.00 0.00 ? 52  ASP A OD2  2  
ATOM   1933  H  H    . ASP A 1 52 ? 10.535  12.084  -3.368  1.00 0.00 ? 52  ASP A H    2  
ATOM   1934  H  HA   . ASP A 1 52 ? 12.336  10.095  -3.043  1.00 0.00 ? 52  ASP A HA   2  
ATOM   1935  H  HB2  . ASP A 1 52 ? 11.331  12.244  -1.279  1.00 0.00 ? 52  ASP A HB2  2  
ATOM   1936  H  HB3  . ASP A 1 52 ? 12.201  10.943  -0.471  1.00 0.00 ? 52  ASP A HB3  2  
ATOM   1937  N  N    . SER A 1 53 ? 9.598   9.405   -1.387  1.00 0.00 ? 53  SER A N    2  
ATOM   1938  C  CA   . SER A 1 53 ? 8.871   8.346   -0.697  1.00 0.00 ? 53  SER A CA   2  
ATOM   1939  C  C    . SER A 1 53 ? 8.414   7.272   -1.679  1.00 0.00 ? 53  SER A C    2  
ATOM   1940  O  O    . SER A 1 53 ? 8.312   6.096   -1.329  1.00 0.00 ? 53  SER A O    2  
ATOM   1941  C  CB   . SER A 1 53 ? 7.662   8.925   0.041   1.00 0.00 ? 53  SER A CB   2  
ATOM   1942  O  OG   . SER A 1 53 ? 7.313   8.123   1.156   1.00 0.00 ? 53  SER A OG   2  
ATOM   1943  H  H    . SER A 1 53 ? 9.134   10.241  -1.603  1.00 0.00 ? 53  SER A H    2  
ATOM   1944  H  HA   . SER A 1 53 ? 9.540   7.898   0.022   1.00 0.00 ? 53  SER A HA   2  
ATOM   1945  H  HB2  . SER A 1 53 ? 7.898   9.919   0.389   1.00 0.00 ? 53  SER A HB2  2  
ATOM   1946  H  HB3  . SER A 1 53 ? 6.819   8.970   -0.633  1.00 0.00 ? 53  SER A HB3  2  
ATOM   1947  H  HG   . SER A 1 53 ? 7.216   7.210   0.876   1.00 0.00 ? 53  SER A HG   2  
ATOM   1948  N  N    . VAL A 1 54 ? 8.139   7.685   -2.913  1.00 0.00 ? 54  VAL A N    2  
ATOM   1949  C  CA   . VAL A 1 54 ? 7.694   6.759   -3.948  1.00 0.00 ? 54  VAL A CA   2  
ATOM   1950  C  C    . VAL A 1 54 ? 8.831   5.849   -4.397  1.00 0.00 ? 54  VAL A C    2  
ATOM   1951  O  O    . VAL A 1 54 ? 8.631   4.657   -4.630  1.00 0.00 ? 54  VAL A O    2  
ATOM   1952  C  CB   . VAL A 1 54 ? 7.139   7.511   -5.172  1.00 0.00 ? 54  VAL A CB   2  
ATOM   1953  C  CG1  . VAL A 1 54 ? 7.417   6.732   -6.448  1.00 0.00 ? 54  VAL A CG1  2  
ATOM   1954  C  CG2  . VAL A 1 54 ? 5.648   7.767   -5.008  1.00 0.00 ? 54  VAL A CG2  2  
ATOM   1955  H  H    . VAL A 1 54 ? 8.239   8.634   -3.132  1.00 0.00 ? 54  VAL A H    2  
ATOM   1956  H  HA   . VAL A 1 54 ? 6.901   6.152   -3.534  1.00 0.00 ? 54  VAL A HA   2  
ATOM   1957  H  HB   . VAL A 1 54 ? 7.641   8.465   -5.242  1.00 0.00 ? 54  VAL A HB   2  
ATOM   1958  H  HG11 . VAL A 1 54 ? 8.359   7.054   -6.868  1.00 0.00 ? 54  VAL A HG11 2  
ATOM   1959  H  HG12 . VAL A 1 54 ? 7.464   5.677   -6.224  1.00 0.00 ? 54  VAL A HG12 2  
ATOM   1960  H  HG13 . VAL A 1 54 ? 6.625   6.914   -7.161  1.00 0.00 ? 54  VAL A HG13 2  
ATOM   1961  H  HG21 . VAL A 1 54 ? 5.093   7.013   -5.545  1.00 0.00 ? 54  VAL A HG21 2  
ATOM   1962  H  HG22 . VAL A 1 54 ? 5.388   7.727   -3.960  1.00 0.00 ? 54  VAL A HG22 2  
ATOM   1963  H  HG23 . VAL A 1 54 ? 5.405   8.743   -5.402  1.00 0.00 ? 54  VAL A HG23 2  
ATOM   1964  N  N    . ALA A 1 55 ? 10.026  6.418   -4.516  1.00 0.00 ? 55  ALA A N    2  
ATOM   1965  C  CA   . ALA A 1 55 ? 11.196  5.658   -4.935  1.00 0.00 ? 55  ALA A CA   2  
ATOM   1966  C  C    . ALA A 1 55 ? 11.581  4.620   -3.886  1.00 0.00 ? 55  ALA A C    2  
ATOM   1967  O  O    . ALA A 1 55 ? 11.986  3.507   -4.220  1.00 0.00 ? 55  ALA A O    2  
ATOM   1968  C  CB   . ALA A 1 55 ? 12.365  6.594   -5.208  1.00 0.00 ? 55  ALA A CB   2  
ATOM   1969  H  H    . ALA A 1 55 ? 10.122  7.373   -4.317  1.00 0.00 ? 55  ALA A H    2  
ATOM   1970  H  HA   . ALA A 1 55 ? 10.952  5.149   -5.857  1.00 0.00 ? 55  ALA A HA   2  
ATOM   1971  H  HB1  . ALA A 1 55 ? 12.447  6.765   -6.271  1.00 0.00 ? 55  ALA A HB1  2  
ATOM   1972  H  HB2  . ALA A 1 55 ? 12.197  7.534   -4.703  1.00 0.00 ? 55  ALA A HB2  2  
ATOM   1973  H  HB3  . ALA A 1 55 ? 13.277  6.146   -4.843  1.00 0.00 ? 55  ALA A HB3  2  
ATOM   1974  N  N    . ALA A 1 56 ? 11.453  4.993   -2.617  1.00 0.00 ? 56  ALA A N    2  
ATOM   1975  C  CA   . ALA A 1 56 ? 11.786  4.093   -1.519  1.00 0.00 ? 56  ALA A CA   2  
ATOM   1976  C  C    . ALA A 1 56 ? 10.754  2.978   -1.391  1.00 0.00 ? 56  ALA A C    2  
ATOM   1977  O  O    . ALA A 1 56 ? 11.102  1.821   -1.149  1.00 0.00 ? 56  ALA A O    2  
ATOM   1978  C  CB   . ALA A 1 56 ? 11.891  4.869   -0.215  1.00 0.00 ? 56  ALA A CB   2  
ATOM   1979  H  H    . ALA A 1 56 ? 11.125  5.893   -2.414  1.00 0.00 ? 56  ALA A H    2  
ATOM   1980  H  HA   . ALA A 1 56 ? 12.751  3.655   -1.728  1.00 0.00 ? 56  ALA A HA   2  
ATOM   1981  H  HB1  . ALA A 1 56 ? 12.931  5.071   0.000   1.00 0.00 ? 56  ALA A HB1  2  
ATOM   1982  H  HB2  . ALA A 1 56 ? 11.355  5.802   -0.307  1.00 0.00 ? 56  ALA A HB2  2  
ATOM   1983  H  HB3  . ALA A 1 56 ? 11.465  4.285   0.587   1.00 0.00 ? 56  ALA A HB3  2  
ATOM   1984  N  N    . HIS A 1 57 ? 9.483   3.332   -1.555  1.00 0.00 ? 57  HIS A N    2  
ATOM   1985  C  CA   . HIS A 1 57 ? 8.400   2.359   -1.457  1.00 0.00 ? 57  HIS A CA   2  
ATOM   1986  C  C    . HIS A 1 57 ? 8.613   1.209   -2.436  1.00 0.00 ? 57  HIS A C    2  
ATOM   1987  O  O    . HIS A 1 57 ? 8.245   0.068   -2.158  1.00 0.00 ? 57  HIS A O    2  
ATOM   1988  C  CB   . HIS A 1 57 ? 7.055   3.034   -1.729  1.00 0.00 ? 57  HIS A CB   2  
ATOM   1989  C  CG   . HIS A 1 57 ? 6.020   2.103   -2.282  1.00 0.00 ? 57  HIS A CG   2  
ATOM   1990  N  ND1  . HIS A 1 57 ? 5.426   1.108   -1.535  1.00 0.00 ? 57  HIS A ND1  2  
ATOM   1991  C  CD2  . HIS A 1 57 ? 5.471   2.023   -3.517  1.00 0.00 ? 57  HIS A CD2  2  
ATOM   1992  C  CE1  . HIS A 1 57 ? 4.559   0.454   -2.287  1.00 0.00 ? 57  HIS A CE1  2  
ATOM   1993  N  NE2  . HIS A 1 57 ? 4.566   0.990   -3.494  1.00 0.00 ? 57  HIS A NE2  2  
ATOM   1994  H  H    . HIS A 1 57 ? 9.269   4.268   -1.746  1.00 0.00 ? 57  HIS A H    2  
ATOM   1995  H  HA   . HIS A 1 57 ? 8.398   1.965   -0.452  1.00 0.00 ? 57  HIS A HA   2  
ATOM   1996  H  HB2  . HIS A 1 57 ? 6.672   3.444   -0.806  1.00 0.00 ? 57  HIS A HB2  2  
ATOM   1997  H  HB3  . HIS A 1 57 ? 7.198   3.834   -2.441  1.00 0.00 ? 57  HIS A HB3  2  
ATOM   1998  H  HD1  . HIS A 1 57 ? 5.615   0.909   -0.595  1.00 0.00 ? 57  HIS A HD1  2  
ATOM   1999  H  HD2  . HIS A 1 57 ? 5.701   2.654   -4.364  1.00 0.00 ? 57  HIS A HD2  2  
ATOM   2000  H  HE1  . HIS A 1 57 ? 3.947   -0.377  -1.969  1.00 0.00 ? 57  HIS A HE1  2  
ATOM   2001  N  N    . ARG A 1 58 ? 9.208   1.518   -3.584  1.00 0.00 ? 58  ARG A N    2  
ATOM   2002  C  CA   . ARG A 1 58 ? 9.468   0.510   -4.605  1.00 0.00 ? 58  ARG A CA   2  
ATOM   2003  C  C    . ARG A 1 58 ? 10.627  -0.393  -4.195  1.00 0.00 ? 58  ARG A C    2  
ATOM   2004  O  O    . ARG A 1 58 ? 10.772  -1.505  -4.704  1.00 0.00 ? 58  ARG A O    2  
ATOM   2005  C  CB   . ARG A 1 58 ? 9.777   1.179   -5.945  1.00 0.00 ? 58  ARG A CB   2  
ATOM   2006  C  CG   . ARG A 1 58 ? 8.690   2.131   -6.416  1.00 0.00 ? 58  ARG A CG   2  
ATOM   2007  C  CD   . ARG A 1 58 ? 9.237   3.166   -7.387  1.00 0.00 ? 58  ARG A CD   2  
ATOM   2008  N  NE   . ARG A 1 58 ? 8.190   4.047   -7.896  1.00 0.00 ? 58  ARG A NE   2  
ATOM   2009  C  CZ   . ARG A 1 58 ? 8.272   4.694   -9.053  1.00 0.00 ? 58  ARG A CZ   2  
ATOM   2010  N  NH1  . ARG A 1 58 ? 9.347   4.559   -9.817  1.00 0.00 ? 58  ARG A NH1  2  
ATOM   2011  N  NH2  . ARG A 1 58 ? 7.277   5.478   -9.448  1.00 0.00 ? 58  ARG A NH2  2  
ATOM   2012  H  H    . ARG A 1 58 ? 9.478   2.445   -3.748  1.00 0.00 ? 58  ARG A H    2  
ATOM   2013  H  HA   . ARG A 1 58 ? 8.578   -0.093  -4.710  1.00 0.00 ? 58  ARG A HA   2  
ATOM   2014  H  HB2  . ARG A 1 58 ? 10.697  1.737   -5.852  1.00 0.00 ? 58  ARG A HB2  2  
ATOM   2015  H  HB3  . ARG A 1 58 ? 9.904   0.413   -6.695  1.00 0.00 ? 58  ARG A HB3  2  
ATOM   2016  H  HG2  . ARG A 1 58 ? 7.916   1.563   -6.911  1.00 0.00 ? 58  ARG A HG2  2  
ATOM   2017  H  HG3  . ARG A 1 58 ? 8.274   2.639   -5.559  1.00 0.00 ? 58  ARG A HG3  2  
ATOM   2018  H  HD2  . ARG A 1 58 ? 9.979   3.762   -6.877  1.00 0.00 ? 58  ARG A HD2  2  
ATOM   2019  H  HD3  . ARG A 1 58 ? 9.698   2.652   -8.217  1.00 0.00 ? 58  ARG A HD3  2  
ATOM   2020  H  HE   . ARG A 1 58 ? 7.386   4.161   -7.347  1.00 0.00 ? 58  ARG A HE   2  
ATOM   2021  H  HH11 . ARG A 1 58 ? 10.098  3.968   -9.522  1.00 0.00 ? 58  ARG A HH11 2  
ATOM   2022  H  HH12 . ARG A 1 58 ? 9.406   5.047   -10.689 1.00 0.00 ? 58  ARG A HH12 2  
ATOM   2023  H  HH21 . ARG A 1 58 ? 6.465   5.582   -8.875  1.00 0.00 ? 58  ARG A HH21 2  
ATOM   2024  H  HH22 . ARG A 1 58 ? 7.340   5.965   -10.319 1.00 0.00 ? 58  ARG A HH22 2  
ATOM   2025  N  N    . SER A 1 59 ? 11.452  0.093   -3.273  1.00 0.00 ? 59  SER A N    2  
ATOM   2026  C  CA   . SER A 1 59 ? 12.602  -0.668  -2.798  1.00 0.00 ? 59  SER A CA   2  
ATOM   2027  C  C    . SER A 1 59 ? 12.238  -1.487  -1.563  1.00 0.00 ? 59  SER A C    2  
ATOM   2028  O  O    . SER A 1 59 ? 13.025  -2.312  -1.097  1.00 0.00 ? 59  SER A O    2  
ATOM   2029  C  CB   . SER A 1 59 ? 13.765  0.273   -2.476  1.00 0.00 ? 59  SER A CB   2  
ATOM   2030  O  OG   . SER A 1 59 ? 14.906  -0.454  -2.054  1.00 0.00 ? 59  SER A OG   2  
ATOM   2031  H  H    . SER A 1 59 ? 11.284  0.986   -2.905  1.00 0.00 ? 59  SER A H    2  
ATOM   2032  H  HA   . SER A 1 59 ? 12.902  -1.342  -3.586  1.00 0.00 ? 59  SER A HA   2  
ATOM   2033  H  HB2  . SER A 1 59 ? 14.020  0.840   -3.358  1.00 0.00 ? 59  SER A HB2  2  
ATOM   2034  H  HB3  . SER A 1 59 ? 13.470  0.948   -1.686  1.00 0.00 ? 59  SER A HB3  2  
ATOM   2035  H  HG   . SER A 1 59 ? 14.779  -1.387  -2.242  1.00 0.00 ? 59  SER A HG   2  
ATOM   2036  N  N    . LYS A 1 60 ? 11.041  -1.253  -1.037  1.00 0.00 ? 60  LYS A N    2  
ATOM   2037  C  CA   . LYS A 1 60 ? 10.570  -1.968  0.143   1.00 0.00 ? 60  LYS A CA   2  
ATOM   2038  C  C    . LYS A 1 60 ? 9.321   -2.783  -0.177  1.00 0.00 ? 60  LYS A C    2  
ATOM   2039  O  O    . LYS A 1 60 ? 9.049   -3.797  0.466   1.00 0.00 ? 60  LYS A O    2  
ATOM   2040  C  CB   . LYS A 1 60 ? 10.273  -0.983  1.277   1.00 0.00 ? 60  LYS A CB   2  
ATOM   2041  C  CG   . LYS A 1 60 ? 11.509  -0.549  2.045   1.00 0.00 ? 60  LYS A CG   2  
ATOM   2042  C  CD   . LYS A 1 60 ? 11.181  -0.232  3.495   1.00 0.00 ? 60  LYS A CD   2  
ATOM   2043  C  CE   . LYS A 1 60 ? 12.160  0.774   4.080   1.00 0.00 ? 60  LYS A CE   2  
ATOM   2044  N  NZ   . LYS A 1 60 ? 11.566  1.529   5.218   1.00 0.00 ? 60  LYS A NZ   2  
ATOM   2045  H  H    . LYS A 1 60 ? 10.459  -0.583  -1.454  1.00 0.00 ? 60  LYS A H    2  
ATOM   2046  H  HA   . LYS A 1 60 ? 11.354  -2.640  0.458   1.00 0.00 ? 60  LYS A HA   2  
ATOM   2047  H  HB2  . LYS A 1 60 ? 9.806   -0.103  0.859   1.00 0.00 ? 60  LYS A HB2  2  
ATOM   2048  H  HB3  . LYS A 1 60 ? 9.588   -1.449  1.971   1.00 0.00 ? 60  LYS A HB3  2  
ATOM   2049  H  HG2  . LYS A 1 60 ? 12.237  -1.347  2.019   1.00 0.00 ? 60  LYS A HG2  2  
ATOM   2050  H  HG3  . LYS A 1 60 ? 11.921  0.333   1.577   1.00 0.00 ? 60  LYS A HG3  2  
ATOM   2051  H  HD2  . LYS A 1 60 ? 10.184  0.181   3.548   1.00 0.00 ? 60  LYS A HD2  2  
ATOM   2052  H  HD3  . LYS A 1 60 ? 11.226  -1.144  4.073   1.00 0.00 ? 60  LYS A HD3  2  
ATOM   2053  H  HE2  . LYS A 1 60 ? 13.034  0.246   4.427   1.00 0.00 ? 60  LYS A HE2  2  
ATOM   2054  H  HE3  . LYS A 1 60 ? 12.444  1.472   3.306   1.00 0.00 ? 60  LYS A HE3  2  
ATOM   2055  H  HZ1  . LYS A 1 60 ? 10.818  2.165   4.873   1.00 0.00 ? 60  LYS A HZ1  2  
ATOM   2056  H  HZ2  . LYS A 1 60 ? 12.297  2.097   5.691   1.00 0.00 ? 60  LYS A HZ2  2  
ATOM   2057  H  HZ3  . LYS A 1 60 ? 11.154  0.869   5.908   1.00 0.00 ? 60  LYS A HZ3  2  
ATOM   2058  N  N    . SER A 1 61 ? 8.567   -2.335  -1.175  1.00 0.00 ? 61  SER A N    2  
ATOM   2059  C  CA   . SER A 1 61 ? 7.346   -3.022  -1.579  1.00 0.00 ? 61  SER A CA   2  
ATOM   2060  C  C    . SER A 1 61 ? 7.509   -3.654  -2.958  1.00 0.00 ? 61  SER A C    2  
ATOM   2061  O  O    . SER A 1 61 ? 6.916   -4.692  -3.252  1.00 0.00 ? 61  SER A O    2  
ATOM   2062  C  CB   . SER A 1 61 ? 6.166   -2.048  -1.587  1.00 0.00 ? 61  SER A CB   2  
ATOM   2063  O  OG   . SER A 1 61 ? 4.944   -2.726  -1.355  1.00 0.00 ? 61  SER A OG   2  
ATOM   2064  H  H    . SER A 1 61 ? 8.837   -1.521  -1.649  1.00 0.00 ? 61  SER A H    2  
ATOM   2065  H  HA   . SER A 1 61 ? 7.152   -3.804  -0.859  1.00 0.00 ? 61  SER A HA   2  
ATOM   2066  H  HB2  . SER A 1 61 ? 6.307   -1.310  -0.812  1.00 0.00 ? 61  SER A HB2  2  
ATOM   2067  H  HB3  . SER A 1 61 ? 6.116   -1.557  -2.548  1.00 0.00 ? 61  SER A HB3  2  
ATOM   2068  H  HG   . SER A 1 61 ? 4.737   -2.704  -0.418  1.00 0.00 ? 61  SER A HG   2  
ATOM   2069  N  N    . HIS A 1 62 ? 8.316   -3.018  -3.801  1.00 0.00 ? 62  HIS A N    2  
ATOM   2070  C  CA   . HIS A 1 62 ? 8.558   -3.517  -5.150  1.00 0.00 ? 62  HIS A CA   2  
ATOM   2071  C  C    . HIS A 1 62 ? 10.032  -3.861  -5.346  1.00 0.00 ? 62  HIS A C    2  
ATOM   2072  O  O    . HIS A 1 62 ? 10.584  -3.735  -6.439  1.00 0.00 ? 62  HIS A O    2  
ATOM   2073  C  CB   . HIS A 1 62 ? 8.123   -2.479  -6.186  1.00 0.00 ? 62  HIS A CB   2  
ATOM   2074  C  CG   . HIS A 1 62 ? 6.655   -2.185  -6.159  1.00 0.00 ? 62  HIS A CG   2  
ATOM   2075  N  ND1  . HIS A 1 62 ? 5.699   -3.089  -6.572  1.00 0.00 ? 62  HIS A ND1  2  
ATOM   2076  C  CD2  . HIS A 1 62 ? 5.981   -1.080  -5.763  1.00 0.00 ? 62  HIS A CD2  2  
ATOM   2077  C  CE1  . HIS A 1 62 ? 4.500   -2.552  -6.433  1.00 0.00 ? 62  HIS A CE1  2  
ATOM   2078  N  NE2  . HIS A 1 62 ? 4.643   -1.334  -5.944  1.00 0.00 ? 62  HIS A NE2  2  
ATOM   2079  H  H    . HIS A 1 62 ? 8.760   -2.195  -3.509  1.00 0.00 ? 62  HIS A H    2  
ATOM   2080  H  HA   . HIS A 1 62 ? 7.971   -4.413  -5.283  1.00 0.00 ? 62  HIS A HA   2  
ATOM   2081  H  HB2  . HIS A 1 62 ? 8.650   -1.554  -6.002  1.00 0.00 ? 62  HIS A HB2  2  
ATOM   2082  H  HB3  . HIS A 1 62 ? 8.373   -2.840  -7.174  1.00 0.00 ? 62  HIS A HB3  2  
ATOM   2083  H  HD1  . HIS A 1 62 ? 5.873   -3.989  -6.917  1.00 0.00 ? 62  HIS A HD1  2  
ATOM   2084  H  HD2  . HIS A 1 62 ? 6.413   -0.168  -5.378  1.00 0.00 ? 62  HIS A HD2  2  
ATOM   2085  H  HE1  . HIS A 1 62 ? 3.562   -3.028  -6.677  1.00 0.00 ? 62  HIS A HE1  2  
ATOM   2086  N  N    . PRO A 1 63 ? 10.685  -4.306  -4.262  1.00 0.00 ? 63  PRO A N    2  
ATOM   2087  C  CA   . PRO A 1 63 ? 12.103  -4.678  -4.290  1.00 0.00 ? 63  PRO A CA   2  
ATOM   2088  C  C    . PRO A 1 63 ? 12.352  -5.954  -5.085  1.00 0.00 ? 63  PRO A C    2  
ATOM   2089  O  O    . PRO A 1 63 ? 13.497  -6.310  -5.363  1.00 0.00 ? 63  PRO A O    2  
ATOM   2090  C  CB   . PRO A 1 63 ? 12.442  -4.893  -2.813  1.00 0.00 ? 63  PRO A CB   2  
ATOM   2091  C  CG   . PRO A 1 63 ? 11.143  -5.246  -2.173  1.00 0.00 ? 63  PRO A CG   2  
ATOM   2092  C  CD   . PRO A 1 63 ? 10.090  -4.481  -2.927  1.00 0.00 ? 63  PRO A CD   2  
ATOM   2093  H  HA   . PRO A 1 63 ? 12.714  -3.881  -4.689  1.00 0.00 ? 63  PRO A HA   2  
ATOM   2094  H  HB2  . PRO A 1 63 ? 13.160  -5.695  -2.719  1.00 0.00 ? 63  PRO A HB2  2  
ATOM   2095  H  HB3  . PRO A 1 63 ? 12.852  -3.985  -2.398  1.00 0.00 ? 63  PRO A HB3  2  
ATOM   2096  H  HG2  . PRO A 1 63 ? 10.969  -6.307  -2.258  1.00 0.00 ? 63  PRO A HG2  2  
ATOM   2097  H  HG3  . PRO A 1 63 ? 11.152  -4.947  -1.136  1.00 0.00 ? 63  PRO A HG3  2  
ATOM   2098  H  HD2  . PRO A 1 63 ? 9.176   -5.054  -2.984  1.00 0.00 ? 63  PRO A HD2  2  
ATOM   2099  H  HD3  . PRO A 1 63 ? 9.909   -3.526  -2.458  1.00 0.00 ? 63  PRO A HD3  2  
ATOM   2100  N  N    . ALA A 1 64 ? 11.273  -6.640  -5.448  1.00 0.00 ? 64  ALA A N    2  
ATOM   2101  C  CA   . ALA A 1 64 ? 11.376  -7.876  -6.214  1.00 0.00 ? 64  ALA A CA   2  
ATOM   2102  C  C    . ALA A 1 64 ? 11.255  -7.607  -7.710  1.00 0.00 ? 64  ALA A C    2  
ATOM   2103  O  O    . ALA A 1 64 ? 11.512  -8.487  -8.533  1.00 0.00 ? 64  ALA A O    2  
ATOM   2104  C  CB   . ALA A 1 64 ? 10.309  -8.865  -5.766  1.00 0.00 ? 64  ALA A CB   2  
ATOM   2105  H  H    . ALA A 1 64 ? 10.388  -6.306  -5.197  1.00 0.00 ? 64  ALA A H    2  
ATOM   2106  H  HA   . ALA A 1 64 ? 12.344  -8.313  -6.014  1.00 0.00 ? 64  ALA A HA   2  
ATOM   2107  H  HB1  . ALA A 1 64 ? 10.464  -9.113  -4.726  1.00 0.00 ? 64  ALA A HB1  2  
ATOM   2108  H  HB2  . ALA A 1 64 ? 9.333   -8.421  -5.889  1.00 0.00 ? 64  ALA A HB2  2  
ATOM   2109  H  HB3  . ALA A 1 64 ? 10.376  -9.761  -6.364  1.00 0.00 ? 64  ALA A HB3  2  
ATOM   2110  N  N    . LEU A 1 65 ? 10.862  -6.386  -8.057  1.00 0.00 ? 65  LEU A N    2  
ATOM   2111  C  CA   . LEU A 1 65 ? 10.706  -6.001  -9.455  1.00 0.00 ? 65  LEU A CA   2  
ATOM   2112  C  C    . LEU A 1 65 ? 11.948  -5.275  -9.961  1.00 0.00 ? 65  LEU A C    2  
ATOM   2113  O  O    . LEU A 1 65 ? 12.525  -5.648  -10.984 1.00 0.00 ? 65  LEU A O    2  
ATOM   2114  C  CB   . LEU A 1 65 ? 9.475   -5.108  -9.625  1.00 0.00 ? 65  LEU A CB   2  
ATOM   2115  C  CG   . LEU A 1 65 ? 8.121   -5.785  -9.409  1.00 0.00 ? 65  LEU A CG   2  
ATOM   2116  C  CD1  . LEU A 1 65 ? 6.996   -4.766  -9.496  1.00 0.00 ? 65  LEU A CD1  2  
ATOM   2117  C  CD2  . LEU A 1 65 ? 7.914   -6.900  -10.423 1.00 0.00 ? 65  LEU A CD2  2  
ATOM   2118  H  H    . LEU A 1 65 ? 10.672  -5.728  -7.357  1.00 0.00 ? 65  LEU A H    2  
ATOM   2119  H  HA   . LEU A 1 65 ? 10.570  -6.902  -10.034 1.00 0.00 ? 65  LEU A HA   2  
ATOM   2120  H  HB2  . LEU A 1 65 ? 9.556   -4.297  -8.918  1.00 0.00 ? 65  LEU A HB2  2  
ATOM   2121  H  HB3  . LEU A 1 65 ? 9.492   -4.712  -10.630 1.00 0.00 ? 65  LEU A HB3  2  
ATOM   2122  H  HG   . LEU A 1 65 ? 8.098   -6.223  -8.420  1.00 0.00 ? 65  LEU A HG   2  
ATOM   2123  H  HD11 . LEU A 1 65 ? 6.050   -5.258  -9.324  1.00 0.00 ? 65  LEU A HD11 2  
ATOM   2124  H  HD12 . LEU A 1 65 ? 6.994   -4.315  -10.478 1.00 0.00 ? 65  LEU A HD12 2  
ATOM   2125  H  HD13 . LEU A 1 65 ? 7.145   -4.000  -8.749  1.00 0.00 ? 65  LEU A HD13 2  
ATOM   2126  H  HD21 . LEU A 1 65 ? 8.732   -7.602  -10.358 1.00 0.00 ? 65  LEU A HD21 2  
ATOM   2127  H  HD22 . LEU A 1 65 ? 7.880   -6.479  -11.418 1.00 0.00 ? 65  LEU A HD22 2  
ATOM   2128  H  HD23 . LEU A 1 65 ? 6.985   -7.408  -10.214 1.00 0.00 ? 65  LEU A HD23 2  
ATOM   2129  N  N    . LEU A 1 66 ? 12.357  -4.237  -9.239  1.00 0.00 ? 66  LEU A N    2  
ATOM   2130  C  CA   . LEU A 1 66 ? 13.533  -3.459  -9.613  1.00 0.00 ? 66  LEU A CA   2  
ATOM   2131  C  C    . LEU A 1 66 ? 14.667  -4.372  -10.068 1.00 0.00 ? 66  LEU A C    2  
ATOM   2132  O  O    . LEU A 1 66 ? 15.244  -4.177  -11.138 1.00 0.00 ? 66  LEU A O    2  
ATOM   2133  C  CB   . LEU A 1 66 ? 13.995  -2.599  -8.436  1.00 0.00 ? 66  LEU A CB   2  
ATOM   2134  C  CG   . LEU A 1 66 ? 12.944  -1.667  -7.832  1.00 0.00 ? 66  LEU A CG   2  
ATOM   2135  C  CD1  . LEU A 1 66 ? 13.284  -1.346  -6.385  1.00 0.00 ? 66  LEU A CD1  2  
ATOM   2136  C  CD2  . LEU A 1 66 ? 12.830  -0.390  -8.651  1.00 0.00 ? 66  LEU A CD2  2  
ATOM   2137  H  H    . LEU A 1 66 ? 11.856  -3.988  -8.435  1.00 0.00 ? 66  LEU A H    2  
ATOM   2138  H  HA   . LEU A 1 66 ? 13.255  -2.814  -10.433 1.00 0.00 ? 66  LEU A HA   2  
ATOM   2139  H  HB2  . LEU A 1 66 ? 14.337  -3.262  -7.656  1.00 0.00 ? 66  LEU A HB2  2  
ATOM   2140  H  HB3  . LEU A 1 66 ? 14.821  -1.991  -8.777  1.00 0.00 ? 66  LEU A HB3  2  
ATOM   2141  H  HG   . LEU A 1 66 ? 11.983  -2.162  -7.846  1.00 0.00 ? 66  LEU A HG   2  
ATOM   2142  H  HD11 . LEU A 1 66 ? 14.164  -0.722  -6.352  1.00 0.00 ? 66  LEU A HD11 2  
ATOM   2143  H  HD12 . LEU A 1 66 ? 13.473  -2.264  -5.847  1.00 0.00 ? 66  LEU A HD12 2  
ATOM   2144  H  HD13 . LEU A 1 66 ? 12.455  -0.826  -5.927  1.00 0.00 ? 66  LEU A HD13 2  
ATOM   2145  H  HD21 . LEU A 1 66 ? 13.312  0.420   -8.123  1.00 0.00 ? 66  LEU A HD21 2  
ATOM   2146  H  HD22 . LEU A 1 66 ? 11.787  -0.151  -8.800  1.00 0.00 ? 66  LEU A HD22 2  
ATOM   2147  H  HD23 . LEU A 1 66 ? 13.308  -0.532  -9.608  1.00 0.00 ? 66  LEU A HD23 2  
ATOM   2148  N  N    . LEU A 1 67 ? 14.981  -5.370  -9.249  1.00 0.00 ? 67  LEU A N    2  
ATOM   2149  C  CA   . LEU A 1 67 ? 16.045  -6.315  -9.567  1.00 0.00 ? 67  LEU A CA   2  
ATOM   2150  C  C    . LEU A 1 67 ? 15.776  -7.010  -10.898 1.00 0.00 ? 67  LEU A C    2  
ATOM   2151  O  O    . LEU A 1 67 ? 14.728  -6.813  -11.511 1.00 0.00 ? 67  LEU A O    2  
ATOM   2152  C  CB   . LEU A 1 67 ? 16.180  -7.355  -8.454  1.00 0.00 ? 67  LEU A CB   2  
ATOM   2153  C  CG   . LEU A 1 67 ? 16.622  -6.825  -7.090  1.00 0.00 ? 67  LEU A CG   2  
ATOM   2154  C  CD1  . LEU A 1 67 ? 16.426  -7.884  -6.016  1.00 0.00 ? 67  LEU A CD1  2  
ATOM   2155  C  CD2  . LEU A 1 67 ? 18.075  -6.374  -7.138  1.00 0.00 ? 67  LEU A CD2  2  
ATOM   2156  H  H    . LEU A 1 67 ? 14.486  -5.474  -8.410  1.00 0.00 ? 67  LEU A H    2  
ATOM   2157  H  HA   . LEU A 1 67 ? 16.969  -5.760  -9.644  1.00 0.00 ? 67  LEU A HA   2  
ATOM   2158  H  HB2  . LEU A 1 67 ? 15.220  -7.831  -8.328  1.00 0.00 ? 67  LEU A HB2  2  
ATOM   2159  H  HB3  . LEU A 1 67 ? 16.905  -8.090  -8.775  1.00 0.00 ? 67  LEU A HB3  2  
ATOM   2160  H  HG   . LEU A 1 67 ? 16.014  -5.970  -6.829  1.00 0.00 ? 67  LEU A HG   2  
ATOM   2161  H  HD11 . LEU A 1 67 ? 16.105  -7.413  -5.100  1.00 0.00 ? 67  LEU A HD11 2  
ATOM   2162  H  HD12 . LEU A 1 67 ? 17.359  -8.402  -5.847  1.00 0.00 ? 67  LEU A HD12 2  
ATOM   2163  H  HD13 . LEU A 1 67 ? 15.676  -8.591  -6.341  1.00 0.00 ? 67  LEU A HD13 2  
ATOM   2164  H  HD21 . LEU A 1 67 ? 18.218  -5.550  -6.454  1.00 0.00 ? 67  LEU A HD21 2  
ATOM   2165  H  HD22 . LEU A 1 67 ? 18.320  -6.055  -8.141  1.00 0.00 ? 67  LEU A HD22 2  
ATOM   2166  H  HD23 . LEU A 1 67 ? 18.716  -7.195  -6.853  1.00 0.00 ? 67  LEU A HD23 2  
ATOM   2167  N  N    . ALA A 1 68 ? 16.730  -7.824  -11.338 1.00 0.00 ? 68  ALA A N    2  
ATOM   2168  C  CA   . ALA A 1 68 ? 16.594  -8.551  -12.594 1.00 0.00 ? 68  ALA A CA   2  
ATOM   2169  C  C    . ALA A 1 68 ? 15.403  -9.502  -12.552 1.00 0.00 ? 68  ALA A C    2  
ATOM   2170  O  O    . ALA A 1 68 ? 15.340  -10.422 -11.736 1.00 0.00 ? 68  ALA A O    2  
ATOM   2171  C  CB   . ALA A 1 68 ? 17.873  -9.318  -12.901 1.00 0.00 ? 68  ALA A CB   2  
ATOM   2172  H  H    . ALA A 1 68 ? 17.544  -7.939  -10.805 1.00 0.00 ? 68  ALA A H    2  
ATOM   2173  H  HA   . ALA A 1 68 ? 16.438  -7.829  -13.383 1.00 0.00 ? 68  ALA A HA   2  
ATOM   2174  H  HB1  . ALA A 1 68 ? 17.621  -10.301 -13.270 1.00 0.00 ? 68  ALA A HB1  2  
ATOM   2175  H  HB2  . ALA A 1 68 ? 18.440  -8.786  -13.650 1.00 0.00 ? 68  ALA A HB2  2  
ATOM   2176  H  HB3  . ALA A 1 68 ? 18.461  -9.410  -12.001 1.00 0.00 ? 68  ALA A HB3  2  
ATOM   2177  N  N    . PRO A 1 69 ? 14.433  -9.276  -13.450 1.00 0.00 ? 69  PRO A N    2  
ATOM   2178  C  CA   . PRO A 1 69 ? 13.225  -10.102 -13.535 1.00 0.00 ? 69  PRO A CA   2  
ATOM   2179  C  C    . PRO A 1 69 ? 13.517  -11.505 -14.058 1.00 0.00 ? 69  PRO A C    2  
ATOM   2180  O  O    . PRO A 1 69 ? 14.194  -11.670 -15.072 1.00 0.00 ? 69  PRO A O    2  
ATOM   2181  C  CB   . PRO A 1 69 ? 12.341  -9.337  -14.523 1.00 0.00 ? 69  PRO A CB   2  
ATOM   2182  C  CG   . PRO A 1 69 ? 13.295  -8.555  -15.358 1.00 0.00 ? 69  PRO A CG   2  
ATOM   2183  C  CD   . PRO A 1 69 ? 14.441  -8.197  -14.453 1.00 0.00 ? 69  PRO A CD   2  
ATOM   2184  H  HA   . PRO A 1 69 ? 12.724  -10.172 -12.581 1.00 0.00 ? 69  PRO A HA   2  
ATOM   2185  H  HB2  . PRO A 1 69 ? 11.774  -10.038 -15.121 1.00 0.00 ? 69  PRO A HB2  2  
ATOM   2186  H  HB3  . PRO A 1 69 ? 11.667  -8.689  -13.983 1.00 0.00 ? 69  PRO A HB3  2  
ATOM   2187  H  HG2  . PRO A 1 69 ? 13.642  -9.159  -16.182 1.00 0.00 ? 69  PRO A HG2  2  
ATOM   2188  H  HG3  . PRO A 1 69 ? 12.814  -7.660  -15.724 1.00 0.00 ? 69  PRO A HG3  2  
ATOM   2189  H  HD2  . PRO A 1 69 ? 15.369  -8.190  -15.004 1.00 0.00 ? 69  PRO A HD2  2  
ATOM   2190  H  HD3  . PRO A 1 69 ? 14.269  -7.238  -13.987 1.00 0.00 ? 69  PRO A HD3  2  
ATOM   2191  N  N    . GLN A 1 70 ? 13.002  -12.511 -13.358 1.00 0.00 ? 70  GLN A N    2  
ATOM   2192  C  CA   . GLN A 1 70 ? 13.209  -13.899 -13.753 1.00 0.00 ? 70  GLN A CA   2  
ATOM   2193  C  C    . GLN A 1 70 ? 12.218  -14.311 -14.836 1.00 0.00 ? 70  GLN A C    2  
ATOM   2194  O  O    . GLN A 1 70 ? 12.599  -14.894 -15.850 1.00 0.00 ? 70  GLN A O    2  
ATOM   2195  C  CB   . GLN A 1 70 ? 13.071  -14.822 -12.541 1.00 0.00 ? 70  GLN A CB   2  
ATOM   2196  C  CG   . GLN A 1 70 ? 13.100  -16.300 -12.895 1.00 0.00 ? 70  GLN A CG   2  
ATOM   2197  C  CD   . GLN A 1 70 ? 12.880  -17.193 -11.690 1.00 0.00 ? 70  GLN A CD   2  
ATOM   2198  O  OE1  . GLN A 1 70 ? 13.479  -16.989 -10.633 1.00 0.00 ? 70  GLN A OE1  2  
ATOM   2199  N  NE2  . GLN A 1 70 ? 12.016  -18.190 -11.842 1.00 0.00 ? 70  GLN A NE2  2  
ATOM   2200  H  H    . GLN A 1 70 ? 12.472  -12.315 -12.559 1.00 0.00 ? 70  GLN A H    2  
ATOM   2201  H  HA   . GLN A 1 70 ? 14.210  -13.986 -14.147 1.00 0.00 ? 70  GLN A HA   2  
ATOM   2202  H  HB2  . GLN A 1 70 ? 13.882  -14.621 -11.856 1.00 0.00 ? 70  GLN A HB2  2  
ATOM   2203  H  HB3  . GLN A 1 70 ? 12.134  -14.611 -12.048 1.00 0.00 ? 70  GLN A HB3  2  
ATOM   2204  H  HG2  . GLN A 1 70 ? 12.324  -16.499 -13.618 1.00 0.00 ? 70  GLN A HG2  2  
ATOM   2205  H  HG3  . GLN A 1 70 ? 14.062  -16.534 -13.327 1.00 0.00 ? 70  GLN A HG3  2  
ATOM   2206  H  HE21 . GLN A 1 70 ? 11.577  -18.293 -12.713 1.00 0.00 ? 70  GLN A HE21 2  
ATOM   2207  H  HE22 . GLN A 1 70 ? 11.855  -18.783 -11.080 1.00 0.00 ? 70  GLN A HE22 2  
ATOM   2208  N  N    . GLU A 1 71 ? 10.944  -14.004 -14.613 1.00 0.00 ? 71  GLU A N    2  
ATOM   2209  C  CA   . GLU A 1 71 ? 9.898   -14.344 -15.570 1.00 0.00 ? 71  GLU A CA   2  
ATOM   2210  C  C    . GLU A 1 71 ? 9.200   -13.087 -16.083 1.00 0.00 ? 71  GLU A C    2  
ATOM   2211  O  O    . GLU A 1 71 ? 9.131   -12.074 -15.386 1.00 0.00 ? 71  GLU A O    2  
ATOM   2212  C  CB   . GLU A 1 71 ? 8.874   -15.282 -14.929 1.00 0.00 ? 71  GLU A CB   2  
ATOM   2213  C  CG   . GLU A 1 71 ? 9.344   -16.724 -14.837 1.00 0.00 ? 71  GLU A CG   2  
ATOM   2214  C  CD   . GLU A 1 71 ? 9.066   -17.511 -16.103 1.00 0.00 ? 71  GLU A CD   2  
ATOM   2215  O  OE1  . GLU A 1 71 ? 9.831   -17.355 -17.078 1.00 0.00 ? 71  GLU A OE1  2  
ATOM   2216  O  OE2  . GLU A 1 71 ? 8.083   -18.280 -16.120 1.00 0.00 ? 71  GLU A OE2  2  
ATOM   2217  H  H    . GLU A 1 71 ? 10.702  -13.538 -13.785 1.00 0.00 ? 71  GLU A H    2  
ATOM   2218  H  HA   . GLU A 1 71 ? 10.362  -14.848 -16.404 1.00 0.00 ? 71  GLU A HA   2  
ATOM   2219  H  HB2  . GLU A 1 71 ? 8.657   -14.932 -13.930 1.00 0.00 ? 71  GLU A HB2  2  
ATOM   2220  H  HB3  . GLU A 1 71 ? 7.966   -15.259 -15.513 1.00 0.00 ? 71  GLU A HB3  2  
ATOM   2221  H  HG2  . GLU A 1 71 ? 10.408  -16.732 -14.654 1.00 0.00 ? 71  GLU A HG2  2  
ATOM   2222  H  HG3  . GLU A 1 71 ? 8.835   -17.204 -14.014 1.00 0.00 ? 71  GLU A HG3  2  
ATOM   2223  N  N    . SER A 1 72 ? 8.685   -13.160 -17.306 1.00 0.00 ? 72  SER A N    2  
ATOM   2224  C  CA   . SER A 1 72 ? 7.997   -12.028 -17.915 1.00 0.00 ? 72  SER A CA   2  
ATOM   2225  C  C    . SER A 1 72 ? 6.705   -11.712 -17.167 1.00 0.00 ? 72  SER A C    2  
ATOM   2226  O  O    . SER A 1 72 ? 5.828   -12.565 -17.031 1.00 0.00 ? 72  SER A O    2  
ATOM   2227  C  CB   . SER A 1 72 ? 7.689   -12.322 -19.385 1.00 0.00 ? 72  SER A CB   2  
ATOM   2228  O  OG   . SER A 1 72 ? 7.205   -11.165 -20.045 1.00 0.00 ? 72  SER A OG   2  
ATOM   2229  H  H    . SER A 1 72 ? 8.773   -13.996 -17.812 1.00 0.00 ? 72  SER A H    2  
ATOM   2230  H  HA   . SER A 1 72 ? 8.652   -11.172 -17.857 1.00 0.00 ? 72  SER A HA   2  
ATOM   2231  H  HB2  . SER A 1 72 ? 8.590   -12.653 -19.879 1.00 0.00 ? 72  SER A HB2  2  
ATOM   2232  H  HB3  . SER A 1 72 ? 6.939   -13.097 -19.445 1.00 0.00 ? 72  SER A HB3  2  
ATOM   2233  H  HG   . SER A 1 72 ? 7.946   -10.652 -20.378 1.00 0.00 ? 72  SER A HG   2  
ATOM   2234  N  N    . SER A 1 73 ? 6.596   -10.478 -16.683 1.00 0.00 ? 73  SER A N    2  
ATOM   2235  C  CA   . SER A 1 73 ? 5.414   -10.048 -15.945 1.00 0.00 ? 73  SER A CA   2  
ATOM   2236  C  C    . SER A 1 73 ? 4.966   -8.662  -16.398 1.00 0.00 ? 73  SER A C    2  
ATOM   2237  O  O    . SER A 1 73 ? 5.784   -7.762  -16.583 1.00 0.00 ? 73  SER A O    2  
ATOM   2238  C  CB   . SER A 1 73 ? 5.701   -10.039 -14.442 1.00 0.00 ? 73  SER A CB   2  
ATOM   2239  O  OG   . SER A 1 73 ? 4.555   -9.646  -13.707 1.00 0.00 ? 73  SER A OG   2  
ATOM   2240  H  H    . SER A 1 73 ? 7.330   -9.843  -16.824 1.00 0.00 ? 73  SER A H    2  
ATOM   2241  H  HA   . SER A 1 73 ? 4.622   -10.754 -16.147 1.00 0.00 ? 73  SER A HA   2  
ATOM   2242  H  HB2  . SER A 1 73 ? 5.994   -11.029 -14.128 1.00 0.00 ? 73  SER A HB2  2  
ATOM   2243  H  HB3  . SER A 1 73 ? 6.502   -9.344  -14.236 1.00 0.00 ? 73  SER A HB3  2  
ATOM   2244  H  HG   . SER A 1 73 ? 4.067   -8.985  -14.204 1.00 0.00 ? 73  SER A HG   2  
ATOM   2245  N  N    . GLY A 1 74 ? 3.658   -8.498  -16.574 1.00 0.00 ? 74  GLY A N    2  
ATOM   2246  C  CA   . GLY A 1 74 ? 3.122   -7.220  -17.003 1.00 0.00 ? 74  GLY A CA   2  
ATOM   2247  C  C    . GLY A 1 74 ? 3.109   -6.193  -15.889 1.00 0.00 ? 74  GLY A C    2  
ATOM   2248  O  O    . GLY A 1 74 ? 3.107   -6.530  -14.705 1.00 0.00 ? 74  GLY A O    2  
ATOM   2249  H  H    . GLY A 1 74 ? 3.052   -9.252  -16.411 1.00 0.00 ? 74  GLY A H    2  
ATOM   2250  H  HA2  . GLY A 1 74 ? 3.723   -6.845  -17.818 1.00 0.00 ? 74  GLY A HA2  2  
ATOM   2251  H  HA3  . GLY A 1 74 ? 2.110   -7.367  -17.353 1.00 0.00 ? 74  GLY A HA3  2  
ATOM   2252  N  N    . PRO A 1 75 ? 3.102   -4.905  -16.266 1.00 0.00 ? 75  PRO A N    2  
ATOM   2253  C  CA   . PRO A 1 75 ? 3.091   -3.799  -15.304 1.00 0.00 ? 75  PRO A CA   2  
ATOM   2254  C  C    . PRO A 1 75 ? 1.764   -3.690  -14.561 1.00 0.00 ? 75  PRO A C    2  
ATOM   2255  O  O    . PRO A 1 75 ? 1.728   -3.321  -13.387 1.00 0.00 ? 75  PRO A O    2  
ATOM   2256  C  CB   . PRO A 1 75 ? 3.316   -2.565  -16.181 1.00 0.00 ? 75  PRO A CB   2  
ATOM   2257  C  CG   . PRO A 1 75 ? 2.817   -2.961  -17.528 1.00 0.00 ? 75  PRO A CG   2  
ATOM   2258  C  CD   . PRO A 1 75 ? 3.104   -4.431  -17.660 1.00 0.00 ? 75  PRO A CD   2  
ATOM   2259  H  HA   . PRO A 1 75 ? 3.897   -3.886  -14.590 1.00 0.00 ? 75  PRO A HA   2  
ATOM   2260  H  HB2  . PRO A 1 75 ? 2.757   -1.730  -15.782 1.00 0.00 ? 75  PRO A HB2  2  
ATOM   2261  H  HB3  . PRO A 1 75 ? 4.368   -2.322  -16.206 1.00 0.00 ? 75  PRO A HB3  2  
ATOM   2262  H  HG2  . PRO A 1 75 ? 1.755   -2.779  -17.594 1.00 0.00 ? 75  PRO A HG2  2  
ATOM   2263  H  HG3  . PRO A 1 75 ? 3.342   -2.406  -18.291 1.00 0.00 ? 75  PRO A HG3  2  
ATOM   2264  H  HD2  . PRO A 1 75 ? 2.329   -4.917  -18.234 1.00 0.00 ? 75  PRO A HD2  2  
ATOM   2265  H  HD3  . PRO A 1 75 ? 4.069   -4.587  -18.118 1.00 0.00 ? 75  PRO A HD3  2  
ATOM   2266  N  N    . SER A 1 76 ? 0.676   -4.014  -15.252 1.00 0.00 ? 76  SER A N    2  
ATOM   2267  C  CA   . SER A 1 76 ? -0.654  -3.949  -14.658 1.00 0.00 ? 76  SER A CA   2  
ATOM   2268  C  C    . SER A 1 76 ? -1.491  -5.158  -15.066 1.00 0.00 ? 76  SER A C    2  
ATOM   2269  O  O    . SER A 1 76 ? -1.208  -5.812  -16.069 1.00 0.00 ? 76  SER A O    2  
ATOM   2270  C  CB   . SER A 1 76 ? -1.362  -2.660  -15.078 1.00 0.00 ? 76  SER A CB   2  
ATOM   2271  O  OG   . SER A 1 76 ? -2.476  -2.394  -14.244 1.00 0.00 ? 76  SER A OG   2  
ATOM   2272  H  H    . SER A 1 76 ? 0.770   -4.301  -16.185 1.00 0.00 ? 76  SER A H    2  
ATOM   2273  H  HA   . SER A 1 76 ? -0.538  -3.953  -13.584 1.00 0.00 ? 76  SER A HA   2  
ATOM   2274  H  HB2  . SER A 1 76 ? -0.670  -1.834  -15.009 1.00 0.00 ? 76  SER A HB2  2  
ATOM   2275  H  HB3  . SER A 1 76 ? -1.705  -2.757  -16.098 1.00 0.00 ? 76  SER A HB3  2  
ATOM   2276  H  HG   . SER A 1 76 ? -2.550  -1.447  -14.101 1.00 0.00 ? 76  SER A HG   2  
ATOM   2277  N  N    . SER A 1 77 ? -2.522  -5.448  -14.279 1.00 0.00 ? 77  SER A N    2  
ATOM   2278  C  CA   . SER A 1 77 ? -3.399  -6.581  -14.555 1.00 0.00 ? 77  SER A CA   2  
ATOM   2279  C  C    . SER A 1 77 ? -4.586  -6.152  -15.413 1.00 0.00 ? 77  SER A C    2  
ATOM   2280  O  O    . SER A 1 77 ? -4.760  -6.627  -16.534 1.00 0.00 ? 77  SER A O    2  
ATOM   2281  C  CB   . SER A 1 77 ? -3.897  -7.198  -13.247 1.00 0.00 ? 77  SER A CB   2  
ATOM   2282  O  OG   . SER A 1 77 ? -4.687  -8.348  -13.494 1.00 0.00 ? 77  SER A OG   2  
ATOM   2283  H  H    . SER A 1 77 ? -2.696  -4.889  -13.493 1.00 0.00 ? 77  SER A H    2  
ATOM   2284  H  HA   . SER A 1 77 ? -2.827  -7.319  -15.097 1.00 0.00 ? 77  SER A HA   2  
ATOM   2285  H  HB2  . SER A 1 77 ? -3.050  -7.481  -12.640 1.00 0.00 ? 77  SER A HB2  2  
ATOM   2286  H  HB3  . SER A 1 77 ? -4.495  -6.473  -12.715 1.00 0.00 ? 77  SER A HB3  2  
ATOM   2287  H  HG   . SER A 1 77 ? -5.519  -8.273  -13.022 1.00 0.00 ? 77  SER A HG   2  
ATOM   2288  N  N    . GLY A 1 78 ? -5.401  -5.249  -14.875 1.00 0.00 ? 78  GLY A N    2  
ATOM   2289  C  CA   . GLY A 1 78 ? -6.562  -4.771  -15.604 1.00 0.00 ? 78  GLY A CA   2  
ATOM   2290  C  C    . GLY A 1 78 ? -7.493  -3.949  -14.735 1.00 0.00 ? 78  GLY A C    2  
ATOM   2291  O  O    . GLY A 1 78 ? -8.174  -4.516  -13.882 1.00 0.00 ? 78  GLY A O    2  
ATOM   2292  H  H    . GLY A 1 78 ? -5.213  -4.906  -13.977 1.00 0.00 ? 78  GLY A H    2  
ATOM   2293  H  HA2  . GLY A 1 78 ? -6.229  -4.164  -16.432 1.00 0.00 ? 78  GLY A HA2  2  
ATOM   2294  H  HA3  . GLY A 1 78 ? -7.106  -5.621  -15.989 1.00 0.00 ? 78  GLY A HA3  2  
HETATM 2295  ZN ZN   . ZN  B 2 .  ? -6.581  1.098   3.451   1.00 0.00 ? 201 ZN  A ZN   2  
HETATM 2296  ZN ZN   . ZN  C 2 .  ? 3.886   0.473   -5.351  1.00 0.00 ? 401 ZN  A ZN   2  
ATOM   2297  N  N    . GLY A 1 1  ? -14.268 -19.050 21.250  1.00 0.00 ? 1   GLY A N    3  
ATOM   2298  C  CA   . GLY A 1 1  ? -14.565 -17.953 20.347  1.00 0.00 ? 1   GLY A CA   3  
ATOM   2299  C  C    . GLY A 1 1  ? -14.594 -18.389 18.896  1.00 0.00 ? 1   GLY A C    3  
ATOM   2300  O  O    . GLY A 1 1  ? -13.644 -18.150 18.150  1.00 0.00 ? 1   GLY A O    3  
ATOM   2301  H  H1   . GLY A 1 1  ? -14.103 -19.947 20.891  1.00 0.00 ? 1   GLY A H1   3  
ATOM   2302  H  HA2  . GLY A 1 1  ? -15.527 -17.538 20.607  1.00 0.00 ? 1   GLY A HA2  3  
ATOM   2303  H  HA3  . GLY A 1 1  ? -13.810 -17.190 20.467  1.00 0.00 ? 1   GLY A HA3  3  
ATOM   2304  N  N    . SER A 1 2  ? -15.686 -19.032 18.494  1.00 0.00 ? 2   SER A N    3  
ATOM   2305  C  CA   . SER A 1 2  ? -15.832 -19.507 17.123  1.00 0.00 ? 2   SER A CA   3  
ATOM   2306  C  C    . SER A 1 2  ? -15.688 -18.357 16.131  1.00 0.00 ? 2   SER A C    3  
ATOM   2307  O  O    . SER A 1 2  ? -16.224 -17.269 16.343  1.00 0.00 ? 2   SER A O    3  
ATOM   2308  C  CB   . SER A 1 2  ? -17.191 -20.186 16.939  1.00 0.00 ? 2   SER A CB   3  
ATOM   2309  O  OG   . SER A 1 2  ? -17.212 -20.973 15.761  1.00 0.00 ? 2   SER A OG   3  
ATOM   2310  H  H    . SER A 1 2  ? -16.409 -19.192 19.136  1.00 0.00 ? 2   SER A H    3  
ATOM   2311  H  HA   . SER A 1 2  ? -15.051 -20.228 16.937  1.00 0.00 ? 2   SER A HA   3  
ATOM   2312  H  HB2  . SER A 1 2  ? -17.389 -20.824 17.787  1.00 0.00 ? 2   SER A HB2  3  
ATOM   2313  H  HB3  . SER A 1 2  ? -17.961 -19.432 16.868  1.00 0.00 ? 2   SER A HB3  3  
ATOM   2314  H  HG   . SER A 1 2  ? -18.080 -20.918 15.354  1.00 0.00 ? 2   SER A HG   3  
ATOM   2315  N  N    . SER A 1 3  ? -14.959 -18.606 15.048  1.00 0.00 ? 3   SER A N    3  
ATOM   2316  C  CA   . SER A 1 3  ? -14.740 -17.591 14.024  1.00 0.00 ? 3   SER A CA   3  
ATOM   2317  C  C    . SER A 1 3  ? -15.152 -18.109 12.649  1.00 0.00 ? 3   SER A C    3  
ATOM   2318  O  O    . SER A 1 3  ? -14.553 -19.045 12.121  1.00 0.00 ? 3   SER A O    3  
ATOM   2319  C  CB   . SER A 1 3  ? -13.270 -17.167 14.003  1.00 0.00 ? 3   SER A CB   3  
ATOM   2320  O  OG   . SER A 1 3  ? -13.114 -15.898 13.391  1.00 0.00 ? 3   SER A OG   3  
ATOM   2321  H  H    . SER A 1 3  ? -14.557 -19.493 14.936  1.00 0.00 ? 3   SER A H    3  
ATOM   2322  H  HA   . SER A 1 3  ? -15.349 -16.735 14.270  1.00 0.00 ? 3   SER A HA   3  
ATOM   2323  H  HB2  . SER A 1 3  ? -12.899 -17.113 15.015  1.00 0.00 ? 3   SER A HB2  3  
ATOM   2324  H  HB3  . SER A 1 3  ? -12.697 -17.895 13.447  1.00 0.00 ? 3   SER A HB3  3  
ATOM   2325  H  HG   . SER A 1 3  ? -13.793 -15.779 12.723  1.00 0.00 ? 3   SER A HG   3  
ATOM   2326  N  N    . GLY A 1 4  ? -16.180 -17.491 12.075  1.00 0.00 ? 4   GLY A N    3  
ATOM   2327  C  CA   . GLY A 1 4  ? -16.655 -17.903 10.767  1.00 0.00 ? 4   GLY A CA   3  
ATOM   2328  C  C    . GLY A 1 4  ? -16.298 -16.907 9.681   1.00 0.00 ? 4   GLY A C    3  
ATOM   2329  O  O    . GLY A 1 4  ? -15.793 -17.286 8.624   1.00 0.00 ? 4   GLY A O    3  
ATOM   2330  H  H    . GLY A 1 4  ? -16.619 -16.751 12.543  1.00 0.00 ? 4   GLY A H    3  
ATOM   2331  H  HA2  . GLY A 1 4  ? -16.219 -18.860 10.521  1.00 0.00 ? 4   GLY A HA2  3  
ATOM   2332  H  HA3  . GLY A 1 4  ? -17.729 -18.007 10.803  1.00 0.00 ? 4   GLY A HA3  3  
ATOM   2333  N  N    . SER A 1 5  ? -16.562 -15.631 9.940   1.00 0.00 ? 5   SER A N    3  
ATOM   2334  C  CA   . SER A 1 5  ? -16.270 -14.578 8.974   1.00 0.00 ? 5   SER A CA   3  
ATOM   2335  C  C    . SER A 1 5  ? -14.878 -13.997 9.207   1.00 0.00 ? 5   SER A C    3  
ATOM   2336  O  O    . SER A 1 5  ? -14.606 -13.411 10.255  1.00 0.00 ? 5   SER A O    3  
ATOM   2337  C  CB   . SER A 1 5  ? -17.319 -13.469 9.064   1.00 0.00 ? 5   SER A CB   3  
ATOM   2338  O  OG   . SER A 1 5  ? -18.619 -13.976 8.816   1.00 0.00 ? 5   SER A OG   3  
ATOM   2339  H  H    . SER A 1 5  ? -16.965 -15.392 10.801  1.00 0.00 ? 5   SER A H    3  
ATOM   2340  H  HA   . SER A 1 5  ? -16.304 -15.015 7.987   1.00 0.00 ? 5   SER A HA   3  
ATOM   2341  H  HB2  . SER A 1 5  ? -17.297 -13.035 10.051  1.00 0.00 ? 5   SER A HB2  3  
ATOM   2342  H  HB3  . SER A 1 5  ? -17.097 -12.707 8.330   1.00 0.00 ? 5   SER A HB3  3  
ATOM   2343  H  HG   . SER A 1 5  ? -18.682 -14.265 7.903   1.00 0.00 ? 5   SER A HG   3  
ATOM   2344  N  N    . SER A 1 6  ? -14.001 -14.165 8.222   1.00 0.00 ? 6   SER A N    3  
ATOM   2345  C  CA   . SER A 1 6  ? -12.636 -13.661 8.320   1.00 0.00 ? 6   SER A CA   3  
ATOM   2346  C  C    . SER A 1 6  ? -12.624 -12.138 8.405   1.00 0.00 ? 6   SER A C    3  
ATOM   2347  O  O    . SER A 1 6  ? -13.224 -11.454 7.577   1.00 0.00 ? 6   SER A O    3  
ATOM   2348  C  CB   . SER A 1 6  ? -11.812 -14.123 7.117   1.00 0.00 ? 6   SER A CB   3  
ATOM   2349  O  OG   . SER A 1 6  ? -10.458 -13.724 7.243   1.00 0.00 ? 6   SER A OG   3  
ATOM   2350  H  H    . SER A 1 6  ? -14.279 -14.641 7.412   1.00 0.00 ? 6   SER A H    3  
ATOM   2351  H  HA   . SER A 1 6  ? -12.199 -14.064 9.222   1.00 0.00 ? 6   SER A HA   3  
ATOM   2352  H  HB2  . SER A 1 6  ? -11.853 -15.200 7.048   1.00 0.00 ? 6   SER A HB2  3  
ATOM   2353  H  HB3  . SER A 1 6  ? -12.221 -13.689 6.216   1.00 0.00 ? 6   SER A HB3  3  
ATOM   2354  H  HG   . SER A 1 6  ? -9.964  -14.408 7.701   1.00 0.00 ? 6   SER A HG   3  
ATOM   2355  N  N    . GLY A 1 7  ? -11.935 -11.613 9.414   1.00 0.00 ? 7   GLY A N    3  
ATOM   2356  C  CA   . GLY A 1 7  ? -11.857 -10.175 9.590   1.00 0.00 ? 7   GLY A CA   3  
ATOM   2357  C  C    . GLY A 1 7  ? -11.452 -9.457  8.318   1.00 0.00 ? 7   GLY A C    3  
ATOM   2358  O  O    . GLY A 1 7  ? -10.531 -9.884  7.621   1.00 0.00 ? 7   GLY A O    3  
ATOM   2359  H  H    . GLY A 1 7  ? -11.476 -12.208 10.044  1.00 0.00 ? 7   GLY A H    3  
ATOM   2360  H  HA2  . GLY A 1 7  ? -12.822 -9.809  9.906   1.00 0.00 ? 7   GLY A HA2  3  
ATOM   2361  H  HA3  . GLY A 1 7  ? -11.131 -9.957  10.360  1.00 0.00 ? 7   GLY A HA3  3  
ATOM   2362  N  N    . LEU A 1 8  ? -12.141 -8.363  8.014   1.00 0.00 ? 8   LEU A N    3  
ATOM   2363  C  CA   . LEU A 1 8  ? -11.849 -7.583  6.815   1.00 0.00 ? 8   LEU A CA   3  
ATOM   2364  C  C    . LEU A 1 8  ? -10.542 -6.813  6.972   1.00 0.00 ? 8   LEU A C    3  
ATOM   2365  O  O    . LEU A 1 8  ? -10.179 -6.405  8.075   1.00 0.00 ? 8   LEU A O    3  
ATOM   2366  C  CB   . LEU A 1 8  ? -12.994 -6.613  6.523   1.00 0.00 ? 8   LEU A CB   3  
ATOM   2367  C  CG   . LEU A 1 8  ? -14.394 -7.225  6.464   1.00 0.00 ? 8   LEU A CG   3  
ATOM   2368  C  CD1  . LEU A 1 8  ? -15.455 -6.148  6.633   1.00 0.00 ? 8   LEU A CD1  3  
ATOM   2369  C  CD2  . LEU A 1 8  ? -14.594 -7.972  5.153   1.00 0.00 ? 8   LEU A CD2  3  
ATOM   2370  H  H    . LEU A 1 8  ? -12.863 -8.071  8.608   1.00 0.00 ? 8   LEU A H    3  
ATOM   2371  H  HA   . LEU A 1 8  ? -11.750 -8.271  5.989   1.00 0.00 ? 8   LEU A HA   3  
ATOM   2372  H  HB2  . LEU A 1 8  ? -12.995 -5.860  7.296   1.00 0.00 ? 8   LEU A HB2  3  
ATOM   2373  H  HB3  . LEU A 1 8  ? -12.795 -6.146  5.568   1.00 0.00 ? 8   LEU A HB3  3  
ATOM   2374  H  HG   . LEU A 1 8  ? -14.505 -7.932  7.274   1.00 0.00 ? 8   LEU A HG   3  
ATOM   2375  H  HD11 . LEU A 1 8  ? -15.055 -5.339  7.225   1.00 0.00 ? 8   LEU A HD11 3  
ATOM   2376  H  HD12 . LEU A 1 8  ? -16.317 -6.567  7.131   1.00 0.00 ? 8   LEU A HD12 3  
ATOM   2377  H  HD13 . LEU A 1 8  ? -15.747 -5.775  5.662   1.00 0.00 ? 8   LEU A HD13 3  
ATOM   2378  H  HD21 . LEU A 1 8  ? -13.655 -8.026  4.623   1.00 0.00 ? 8   LEU A HD21 3  
ATOM   2379  H  HD22 . LEU A 1 8  ? -15.320 -7.449  4.548   1.00 0.00 ? 8   LEU A HD22 3  
ATOM   2380  H  HD23 . LEU A 1 8  ? -14.949 -8.971  5.360   1.00 0.00 ? 8   LEU A HD23 3  
ATOM   2381  N  N    . GLN A 1 9  ? -9.840  -6.616  5.861   1.00 0.00 ? 9   GLN A N    3  
ATOM   2382  C  CA   . GLN A 1 9  ? -8.574  -5.892  5.875   1.00 0.00 ? 9   GLN A CA   3  
ATOM   2383  C  C    . GLN A 1 9  ? -8.495  -4.909  4.712   1.00 0.00 ? 9   GLN A C    3  
ATOM   2384  O  O    . GLN A 1 9  ? -8.643  -5.292  3.551   1.00 0.00 ? 9   GLN A O    3  
ATOM   2385  C  CB   . GLN A 1 9  ? -7.402  -6.873  5.810   1.00 0.00 ? 9   GLN A CB   3  
ATOM   2386  C  CG   . GLN A 1 9  ? -6.047  -6.194  5.680   1.00 0.00 ? 9   GLN A CG   3  
ATOM   2387  C  CD   . GLN A 1 9  ? -4.944  -6.953  6.389   1.00 0.00 ? 9   GLN A CD   3  
ATOM   2388  O  OE1  . GLN A 1 9  ? -4.645  -8.099  6.050   1.00 0.00 ? 9   GLN A OE1  3  
ATOM   2389  N  NE2  . GLN A 1 9  ? -4.330  -6.317  7.380   1.00 0.00 ? 9   GLN A NE2  3  
ATOM   2390  H  H    . GLN A 1 9  ? -10.181 -6.965  5.012   1.00 0.00 ? 9   GLN A H    3  
ATOM   2391  H  HA   . GLN A 1 9  ? -8.518  -5.340  6.801   1.00 0.00 ? 9   GLN A HA   3  
ATOM   2392  H  HB2  . GLN A 1 9  ? -7.396  -7.469  6.710   1.00 0.00 ? 9   GLN A HB2  3  
ATOM   2393  H  HB3  . GLN A 1 9  ? -7.538  -7.522  4.958   1.00 0.00 ? 9   GLN A HB3  3  
ATOM   2394  H  HG2  . GLN A 1 9  ? -5.796  -6.120  4.632   1.00 0.00 ? 9   GLN A HG2  3  
ATOM   2395  H  HG3  . GLN A 1 9  ? -6.114  -5.203  6.104   1.00 0.00 ? 9   GLN A HG3  3  
ATOM   2396  H  HE21 . GLN A 1 9  ? -4.622  -5.406  7.596   1.00 0.00 ? 9   GLN A HE21 3  
ATOM   2397  H  HE22 . GLN A 1 9  ? -3.614  -6.784  7.857   1.00 0.00 ? 9   GLN A HE22 3  
ATOM   2398  N  N    . CYS A 1 10 ? -8.262  -3.641  5.031   1.00 0.00 ? 10  CYS A N    3  
ATOM   2399  C  CA   . CYS A 1 10 ? -8.164  -2.601  4.013   1.00 0.00 ? 10  CYS A CA   3  
ATOM   2400  C  C    . CYS A 1 10 ? -6.865  -2.733  3.224   1.00 0.00 ? 10  CYS A C    3  
ATOM   2401  O  O    . CYS A 1 10 ? -5.847  -3.176  3.755   1.00 0.00 ? 10  CYS A O    3  
ATOM   2402  C  CB   . CYS A 1 10 ? -8.243  -1.217  4.659   1.00 0.00 ? 10  CYS A CB   3  
ATOM   2403  S  SG   . CYS A 1 10 ? -7.544  0.121   3.639   1.00 0.00 ? 10  CYS A SG   3  
ATOM   2404  H  H    . CYS A 1 10 ? -8.153  -3.397  5.974   1.00 0.00 ? 10  CYS A H    3  
ATOM   2405  H  HA   . CYS A 1 10 ? -8.996  -2.721  3.335   1.00 0.00 ? 10  CYS A HA   3  
ATOM   2406  H  HB2  . CYS A 1 10 ? -9.279  -0.976  4.850   1.00 0.00 ? 10  CYS A HB2  3  
ATOM   2407  H  HB3  . CYS A 1 10 ? -7.705  -1.233  5.595   1.00 0.00 ? 10  CYS A HB3  3  
ATOM   2408  N  N    . GLU A 1 11 ? -6.909  -2.346  1.953   1.00 0.00 ? 11  GLU A N    3  
ATOM   2409  C  CA   . GLU A 1 11 ? -5.735  -2.421  1.091   1.00 0.00 ? 11  GLU A CA   3  
ATOM   2410  C  C    . GLU A 1 11 ? -5.058  -1.059  0.973   1.00 0.00 ? 11  GLU A C    3  
ATOM   2411  O  O    . GLU A 1 11 ? -3.837  -0.970  0.847   1.00 0.00 ? 11  GLU A O    3  
ATOM   2412  C  CB   . GLU A 1 11 ? -6.127  -2.931  -0.298  1.00 0.00 ? 11  GLU A CB   3  
ATOM   2413  C  CG   . GLU A 1 11 ? -6.851  -1.897  -1.144  1.00 0.00 ? 11  GLU A CG   3  
ATOM   2414  C  CD   . GLU A 1 11 ? -6.858  -2.251  -2.618  1.00 0.00 ? 11  GLU A CD   3  
ATOM   2415  O  OE1  . GLU A 1 11 ? -5.824  -2.743  -3.116  1.00 0.00 ? 11  GLU A OE1  3  
ATOM   2416  O  OE2  . GLU A 1 11 ? -7.899  -2.036  -3.274  1.00 0.00 ? 11  GLU A OE2  3  
ATOM   2417  H  H    . GLU A 1 11 ? -7.750  -2.002  1.586   1.00 0.00 ? 11  GLU A H    3  
ATOM   2418  H  HA   . GLU A 1 11 ? -5.041  -3.117  1.537   1.00 0.00 ? 11  GLU A HA   3  
ATOM   2419  H  HB2  . GLU A 1 11 ? -5.232  -3.233  -0.823  1.00 0.00 ? 11  GLU A HB2  3  
ATOM   2420  H  HB3  . GLU A 1 11 ? -6.773  -3.789  -0.184  1.00 0.00 ? 11  GLU A HB3  3  
ATOM   2421  H  HG2  . GLU A 1 11 ? -7.873  -1.823  -0.802  1.00 0.00 ? 11  GLU A HG2  3  
ATOM   2422  H  HG3  . GLU A 1 11 ? -6.361  -0.942  -1.020  1.00 0.00 ? 11  GLU A HG3  3  
ATOM   2423  N  N    . ILE A 1 12 ? -5.861  -0.001  1.013   1.00 0.00 ? 12  ILE A N    3  
ATOM   2424  C  CA   . ILE A 1 12 ? -5.340  1.357   0.910   1.00 0.00 ? 12  ILE A CA   3  
ATOM   2425  C  C    . ILE A 1 12 ? -4.156  1.563   1.848   1.00 0.00 ? 12  ILE A C    3  
ATOM   2426  O  O    . ILE A 1 12 ? -3.047  1.871   1.408   1.00 0.00 ? 12  ILE A O    3  
ATOM   2427  C  CB   . ILE A 1 12 ? -6.424  2.402   1.234   1.00 0.00 ? 12  ILE A CB   3  
ATOM   2428  C  CG1  . ILE A 1 12 ? -7.520  2.379   0.165   1.00 0.00 ? 12  ILE A CG1  3  
ATOM   2429  C  CG2  . ILE A 1 12 ? -5.809  3.789   1.339   1.00 0.00 ? 12  ILE A CG2  3  
ATOM   2430  C  CD1  . ILE A 1 12 ? -8.707  1.517   0.536   1.00 0.00 ? 12  ILE A CD1  3  
ATOM   2431  H  H    . ILE A 1 12 ? -6.826  -0.136  1.114   1.00 0.00 ? 12  ILE A H    3  
ATOM   2432  H  HA   . ILE A 1 12 ? -5.011  1.511   -0.107  1.00 0.00 ? 12  ILE A HA   3  
ATOM   2433  H  HB   . ILE A 1 12 ? -6.859  2.153   2.190   1.00 0.00 ? 12  ILE A HB   3  
ATOM   2434  H  HG12 . ILE A 1 12 ? -7.878  3.383   0.004   1.00 0.00 ? 12  ILE A HG12 3  
ATOM   2435  H  HG13 . ILE A 1 12 ? -7.105  1.996   -0.756  1.00 0.00 ? 12  ILE A HG13 3  
ATOM   2436  H  HG21 . ILE A 1 12 ? -4.932  3.842   0.710   1.00 0.00 ? 12  ILE A HG21 3  
ATOM   2437  H  HG22 . ILE A 1 12 ? -6.527  4.527   1.016   1.00 0.00 ? 12  ILE A HG22 3  
ATOM   2438  H  HG23 . ILE A 1 12 ? -5.529  3.982   2.364   1.00 0.00 ? 12  ILE A HG23 3  
ATOM   2439  H  HD11 . ILE A 1 12 ? -9.053  0.986   -0.339  1.00 0.00 ? 12  ILE A HD11 3  
ATOM   2440  H  HD12 . ILE A 1 12 ? -8.415  0.809   1.296   1.00 0.00 ? 12  ILE A HD12 3  
ATOM   2441  H  HD13 . ILE A 1 12 ? -9.502  2.143   0.913   1.00 0.00 ? 12  ILE A HD13 3  
ATOM   2442  N  N    . CYS A 1 13 ? -4.396  1.390   3.144   1.00 0.00 ? 13  CYS A N    3  
ATOM   2443  C  CA   . CYS A 1 13 ? -3.350  1.556   4.145   1.00 0.00 ? 13  CYS A CA   3  
ATOM   2444  C  C    . CYS A 1 13 ? -2.953  0.210   4.745   1.00 0.00 ? 13  CYS A C    3  
ATOM   2445  O  O    . CYS A 1 13 ? -1.780  -0.038  5.019   1.00 0.00 ? 13  CYS A O    3  
ATOM   2446  C  CB   . CYS A 1 13 ? -3.821  2.501   5.253   1.00 0.00 ? 13  CYS A CB   3  
ATOM   2447  S  SG   . CYS A 1 13 ? -5.259  1.891   6.189   1.00 0.00 ? 13  CYS A SG   3  
ATOM   2448  H  H    . CYS A 1 13 ? -5.301  1.145   3.434   1.00 0.00 ? 13  CYS A H    3  
ATOM   2449  H  HA   . CYS A 1 13 ? -2.489  1.987   3.658   1.00 0.00 ? 13  CYS A HA   3  
ATOM   2450  H  HB2  . CYS A 1 13 ? -3.013  2.651   5.954   1.00 0.00 ? 13  CYS A HB2  3  
ATOM   2451  H  HB3  . CYS A 1 13 ? -4.091  3.450   4.815   1.00 0.00 ? 13  CYS A HB3  3  
ATOM   2452  N  N    . GLY A 1 14 ? -3.941  -0.657  4.945   1.00 0.00 ? 14  GLY A N    3  
ATOM   2453  C  CA   . GLY A 1 14 ? -3.675  -1.967  5.510   1.00 0.00 ? 14  GLY A CA   3  
ATOM   2454  C  C    . GLY A 1 14 ? -4.302  -2.147  6.879   1.00 0.00 ? 14  GLY A C    3  
ATOM   2455  O  O    . GLY A 1 14 ? -3.709  -2.760  7.766   1.00 0.00 ? 14  GLY A O    3  
ATOM   2456  H  H    . GLY A 1 14 ? -4.858  -0.405  4.708   1.00 0.00 ? 14  GLY A H    3  
ATOM   2457  H  HA2  . GLY A 1 14 ? -4.067  -2.721  4.844   1.00 0.00 ? 14  GLY A HA2  3  
ATOM   2458  H  HA3  . GLY A 1 14 ? -2.606  -2.099  5.597   1.00 0.00 ? 14  GLY A HA3  3  
ATOM   2459  N  N    . PHE A 1 15 ? -5.505  -1.608  7.052   1.00 0.00 ? 15  PHE A N    3  
ATOM   2460  C  CA   . PHE A 1 15 ? -6.212  -1.710  8.323   1.00 0.00 ? 15  PHE A CA   3  
ATOM   2461  C  C    . PHE A 1 15 ? -7.058  -2.979  8.375   1.00 0.00 ? 15  PHE A C    3  
ATOM   2462  O  O    . PHE A 1 15 ? -7.126  -3.735  7.405   1.00 0.00 ? 15  PHE A O    3  
ATOM   2463  C  CB   . PHE A 1 15 ? -7.101  -0.482  8.536   1.00 0.00 ? 15  PHE A CB   3  
ATOM   2464  C  CG   . PHE A 1 15 ? -7.543  -0.302  9.960   1.00 0.00 ? 15  PHE A CG   3  
ATOM   2465  C  CD1  . PHE A 1 15 ? -6.657  0.153   10.922  1.00 0.00 ? 15  PHE A CD1  3  
ATOM   2466  C  CD2  . PHE A 1 15 ? -8.846  -0.589  10.336  1.00 0.00 ? 15  PHE A CD2  3  
ATOM   2467  C  CE1  . PHE A 1 15 ? -7.061  0.320   12.233  1.00 0.00 ? 15  PHE A CE1  3  
ATOM   2468  C  CE2  . PHE A 1 15 ? -9.256  -0.423  11.645  1.00 0.00 ? 15  PHE A CE2  3  
ATOM   2469  C  CZ   . PHE A 1 15 ? -8.362  0.030   12.595  1.00 0.00 ? 15  PHE A CZ   3  
ATOM   2470  H  H    . PHE A 1 15 ? -5.927  -1.131  6.306   1.00 0.00 ? 15  PHE A H    3  
ATOM   2471  H  HA   . PHE A 1 15 ? -5.475  -1.750  9.109   1.00 0.00 ? 15  PHE A HA   3  
ATOM   2472  H  HB2  . PHE A 1 15 ? -6.556  0.403   8.244   1.00 0.00 ? 15  PHE A HB2  3  
ATOM   2473  H  HB3  . PHE A 1 15 ? -7.984  -0.576  7.922   1.00 0.00 ? 15  PHE A HB3  3  
ATOM   2474  H  HD1  . PHE A 1 15 ? -5.638  0.380   10.640  1.00 0.00 ? 15  PHE A HD1  3  
ATOM   2475  H  HD2  . PHE A 1 15 ? -9.546  -0.945  9.594   1.00 0.00 ? 15  PHE A HD2  3  
ATOM   2476  H  HE1  . PHE A 1 15 ? -6.359  0.675   12.974  1.00 0.00 ? 15  PHE A HE1  3  
ATOM   2477  H  HE2  . PHE A 1 15 ? -10.273 -0.651  11.926  1.00 0.00 ? 15  PHE A HE2  3  
ATOM   2478  H  HZ   . PHE A 1 15 ? -8.680  0.161   13.619  1.00 0.00 ? 15  PHE A HZ   3  
ATOM   2479  N  N    . THR A 1 16 ? -7.701  -3.208  9.516   1.00 0.00 ? 16  THR A N    3  
ATOM   2480  C  CA   . THR A 1 16 ? -8.541  -4.385  9.697   1.00 0.00 ? 16  THR A CA   3  
ATOM   2481  C  C    . THR A 1 16 ? -9.735  -4.076  10.592  1.00 0.00 ? 16  THR A C    3  
ATOM   2482  O  O    . THR A 1 16 ? -9.589  -3.457  11.647  1.00 0.00 ? 16  THR A O    3  
ATOM   2483  C  CB   . THR A 1 16 ? -7.745  -5.554  10.307  1.00 0.00 ? 16  THR A CB   3  
ATOM   2484  O  OG1  . THR A 1 16 ? -6.723  -5.051  11.175  1.00 0.00 ? 16  THR A OG1  3  
ATOM   2485  C  CG2  . THR A 1 16 ? -7.116  -6.408  9.216   1.00 0.00 ? 16  THR A CG2  3  
ATOM   2486  H  H    . THR A 1 16 ? -7.607  -2.569  10.253  1.00 0.00 ? 16  THR A H    3  
ATOM   2487  H  HA   . THR A 1 16 ? -8.901  -4.691  8.725   1.00 0.00 ? 16  THR A HA   3  
ATOM   2488  H  HB   . THR A 1 16 ? -8.423  -6.171  10.880  1.00 0.00 ? 16  THR A HB   3  
ATOM   2489  H  HG1  . THR A 1 16 ? -5.890  -5.484  10.974  1.00 0.00 ? 16  THR A HG1  3  
ATOM   2490  H  HG21 . THR A 1 16 ? -6.794  -7.349  9.636   1.00 0.00 ? 16  THR A HG21 3  
ATOM   2491  H  HG22 . THR A 1 16 ? -6.265  -5.890  8.800   1.00 0.00 ? 16  THR A HG22 3  
ATOM   2492  H  HG23 . THR A 1 16 ? -7.842  -6.591  8.439   1.00 0.00 ? 16  THR A HG23 3  
ATOM   2493  N  N    . CYS A 1 17 ? -10.916 -4.512  10.167  1.00 0.00 ? 17  CYS A N    3  
ATOM   2494  C  CA   . CYS A 1 17 ? -12.137 -4.281  10.931  1.00 0.00 ? 17  CYS A CA   3  
ATOM   2495  C  C    . CYS A 1 17 ? -13.084 -5.471  10.815  1.00 0.00 ? 17  CYS A C    3  
ATOM   2496  O  O    . CYS A 1 17 ? -13.259 -6.034  9.734   1.00 0.00 ? 17  CYS A O    3  
ATOM   2497  C  CB   . CYS A 1 17 ? -12.834 -3.009  10.447  1.00 0.00 ? 17  CYS A CB   3  
ATOM   2498  S  SG   . CYS A 1 17 ? -13.775 -2.150  11.729  1.00 0.00 ? 17  CYS A SG   3  
ATOM   2499  H  H    . CYS A 1 17 ? -10.969 -5.000  9.318   1.00 0.00 ? 17  CYS A H    3  
ATOM   2500  H  HA   . CYS A 1 17 ? -11.860 -4.158  11.967  1.00 0.00 ? 17  CYS A HA   3  
ATOM   2501  H  HB2  . CYS A 1 17 ? -12.091 -2.322  10.069  1.00 0.00 ? 17  CYS A HB2  3  
ATOM   2502  H  HB3  . CYS A 1 17 ? -13.517 -3.264  9.650   1.00 0.00 ? 17  CYS A HB3  3  
ATOM   2503  H  HG   . CYS A 1 17 ? -13.696 -2.863  12.842  1.00 0.00 ? 17  CYS A HG   3  
ATOM   2504  N  N    . ARG A 1 18 ? -13.692 -5.849  11.934  1.00 0.00 ? 18  ARG A N    3  
ATOM   2505  C  CA   . ARG A 1 18 ? -14.619 -6.974  11.958  1.00 0.00 ? 18  ARG A CA   3  
ATOM   2506  C  C    . ARG A 1 18 ? -15.899 -6.639  11.199  1.00 0.00 ? 18  ARG A C    3  
ATOM   2507  O  O    . ARG A 1 18 ? -16.259 -7.322  10.240  1.00 0.00 ? 18  ARG A O    3  
ATOM   2508  C  CB   . ARG A 1 18 ? -14.954 -7.355  13.401  1.00 0.00 ? 18  ARG A CB   3  
ATOM   2509  C  CG   . ARG A 1 18 ? -14.012 -8.391  13.993  1.00 0.00 ? 18  ARG A CG   3  
ATOM   2510  C  CD   . ARG A 1 18 ? -12.690 -7.767  14.411  1.00 0.00 ? 18  ARG A CD   3  
ATOM   2511  N  NE   . ARG A 1 18 ? -11.855 -8.703  15.158  1.00 0.00 ? 18  ARG A NE   3  
ATOM   2512  C  CZ   . ARG A 1 18 ? -11.864 -8.801  16.483  1.00 0.00 ? 18  ARG A CZ   3  
ATOM   2513  N  NH1  . ARG A 1 18 ? -12.662 -8.025  17.203  1.00 0.00 ? 18  ARG A NH1  3  
ATOM   2514  N  NH2  . ARG A 1 18 ? -11.075 -9.678  17.090  1.00 0.00 ? 18  ARG A NH2  3  
ATOM   2515  H  H    . ARG A 1 18 ? -13.511 -5.361  12.765  1.00 0.00 ? 18  ARG A H    3  
ATOM   2516  H  HA   . ARG A 1 18 ? -14.137 -7.812  11.477  1.00 0.00 ? 18  ARG A HA   3  
ATOM   2517  H  HB2  . ARG A 1 18 ? -14.909 -6.468  14.016  1.00 0.00 ? 18  ARG A HB2  3  
ATOM   2518  H  HB3  . ARG A 1 18 ? -15.957 -7.754  13.432  1.00 0.00 ? 18  ARG A HB3  3  
ATOM   2519  H  HG2  . ARG A 1 18 ? -14.478 -8.835  14.860  1.00 0.00 ? 18  ARG A HG2  3  
ATOM   2520  H  HG3  . ARG A 1 18 ? -13.822 -9.154  13.253  1.00 0.00 ? 18  ARG A HG3  3  
ATOM   2521  H  HD2  . ARG A 1 18 ? -12.159 -7.453  13.525  1.00 0.00 ? 18  ARG A HD2  3  
ATOM   2522  H  HD3  . ARG A 1 18 ? -12.894 -6.907  15.031  1.00 0.00 ? 18  ARG A HD3  3  
ATOM   2523  H  HE   . ARG A 1 18 ? -11.257 -9.287  14.646  1.00 0.00 ? 18  ARG A HE   3  
ATOM   2524  H  HH11 . ARG A 1 18 ? -13.259 -7.364  16.748  1.00 0.00 ? 18  ARG A HH11 3  
ATOM   2525  H  HH12 . ARG A 1 18 ? -12.668 -8.101  18.200  1.00 0.00 ? 18  ARG A HH12 3  
ATOM   2526  H  HH21 . ARG A 1 18 ? -10.472 -10.266 16.551  1.00 0.00 ? 18  ARG A HH21 3  
ATOM   2527  H  HH22 . ARG A 1 18 ? -11.083 -9.751  18.087  1.00 0.00 ? 18  ARG A HH22 3  
ATOM   2528  N  N    . GLN A 1 19 ? -16.581 -5.585  11.634  1.00 0.00 ? 19  GLN A N    3  
ATOM   2529  C  CA   . GLN A 1 19 ? -17.821 -5.161  10.995  1.00 0.00 ? 19  GLN A CA   3  
ATOM   2530  C  C    . GLN A 1 19 ? -17.547 -4.543  9.629   1.00 0.00 ? 19  GLN A C    3  
ATOM   2531  O  O    . GLN A 1 19 ? -16.586 -3.793  9.457   1.00 0.00 ? 19  GLN A O    3  
ATOM   2532  C  CB   . GLN A 1 19 ? -18.560 -4.158  11.883  1.00 0.00 ? 19  GLN A CB   3  
ATOM   2533  C  CG   . GLN A 1 19 ? -18.860 -4.685  13.277  1.00 0.00 ? 19  GLN A CG   3  
ATOM   2534  C  CD   . GLN A 1 19 ? -19.470 -6.073  13.258  1.00 0.00 ? 19  GLN A CD   3  
ATOM   2535  O  OE1  . GLN A 1 19 ? -18.769 -7.069  13.080  1.00 0.00 ? 19  GLN A OE1  3  
ATOM   2536  N  NE2  . GLN A 1 19 ? -20.783 -6.145  13.441  1.00 0.00 ? 19  GLN A NE2  3  
ATOM   2537  H  H    . GLN A 1 19 ? -16.243 -5.081  12.403  1.00 0.00 ? 19  GLN A H    3  
ATOM   2538  H  HA   . GLN A 1 19 ? -18.441 -6.035  10.863  1.00 0.00 ? 19  GLN A HA   3  
ATOM   2539  H  HB2  . GLN A 1 19 ? -17.956 -3.268  11.980  1.00 0.00 ? 19  GLN A HB2  3  
ATOM   2540  H  HB3  . GLN A 1 19 ? -19.496 -3.899  11.411  1.00 0.00 ? 19  GLN A HB3  3  
ATOM   2541  H  HG2  . GLN A 1 19 ? -17.940 -4.721  13.840  1.00 0.00 ? 19  GLN A HG2  3  
ATOM   2542  H  HG3  . GLN A 1 19 ? -19.551 -4.011  13.761  1.00 0.00 ? 19  GLN A HG3  3  
ATOM   2543  H  HE21 . GLN A 1 19 ? -21.278 -5.310  13.575  1.00 0.00 ? 19  GLN A HE21 3  
ATOM   2544  H  HE22 . GLN A 1 19 ? -21.204 -7.030  13.432  1.00 0.00 ? 19  GLN A HE22 3  
ATOM   2545  N  N    . LYS A 1 20 ? -18.396 -4.863  8.658   1.00 0.00 ? 20  LYS A N    3  
ATOM   2546  C  CA   . LYS A 1 20 ? -18.246 -4.339  7.306   1.00 0.00 ? 20  LYS A CA   3  
ATOM   2547  C  C    . LYS A 1 20 ? -18.478 -2.831  7.278   1.00 0.00 ? 20  LYS A C    3  
ATOM   2548  O  O    . LYS A 1 20 ? -17.614 -2.069  6.847   1.00 0.00 ? 20  LYS A O    3  
ATOM   2549  C  CB   . LYS A 1 20 ? -19.225 -5.033  6.356   1.00 0.00 ? 20  LYS A CB   3  
ATOM   2550  C  CG   . LYS A 1 20 ? -18.688 -6.328  5.771   1.00 0.00 ? 20  LYS A CG   3  
ATOM   2551  C  CD   . LYS A 1 20 ? -18.545 -7.404  6.834   1.00 0.00 ? 20  LYS A CD   3  
ATOM   2552  C  CE   . LYS A 1 20 ? -19.815 -8.230  6.965   1.00 0.00 ? 20  LYS A CE   3  
ATOM   2553  N  NZ   . LYS A 1 20 ? -20.828 -7.557  7.823   1.00 0.00 ? 20  LYS A NZ   3  
ATOM   2554  H  H    . LYS A 1 20 ? -19.143 -5.466  8.857   1.00 0.00 ? 20  LYS A H    3  
ATOM   2555  H  HA   . LYS A 1 20 ? -17.237 -4.541  6.981   1.00 0.00 ? 20  LYS A HA   3  
ATOM   2556  H  HB2  . LYS A 1 20 ? -20.134 -5.256  6.895   1.00 0.00 ? 20  LYS A HB2  3  
ATOM   2557  H  HB3  . LYS A 1 20 ? -19.454 -4.362  5.541   1.00 0.00 ? 20  LYS A HB3  3  
ATOM   2558  H  HG2  . LYS A 1 20 ? -19.369 -6.678  5.009   1.00 0.00 ? 20  LYS A HG2  3  
ATOM   2559  H  HG3  . LYS A 1 20 ? -17.719 -6.139  5.330   1.00 0.00 ? 20  LYS A HG3  3  
ATOM   2560  H  HD2  . LYS A 1 20 ? -17.729 -8.059  6.564   1.00 0.00 ? 20  LYS A HD2  3  
ATOM   2561  H  HD3  . LYS A 1 20 ? -18.332 -6.933  7.783   1.00 0.00 ? 20  LYS A HD3  3  
ATOM   2562  H  HE2  . LYS A 1 20 ? -20.232 -8.383  5.982   1.00 0.00 ? 20  LYS A HE2  3  
ATOM   2563  H  HE3  . LYS A 1 20 ? -19.563 -9.185  7.402   1.00 0.00 ? 20  LYS A HE3  3  
ATOM   2564  H  HZ1  . LYS A 1 20 ? -21.088 -8.173  8.620   1.00 0.00 ? 20  LYS A HZ1  3  
ATOM   2565  H  HZ2  . LYS A 1 20 ? -21.683 -7.348  7.269   1.00 0.00 ? 20  LYS A HZ2  3  
ATOM   2566  H  HZ3  . LYS A 1 20 ? -20.445 -6.666  8.198   1.00 0.00 ? 20  LYS A HZ3  3  
ATOM   2567  N  N    . ALA A 1 21 ? -19.649 -2.409  7.742   1.00 0.00 ? 21  ALA A N    3  
ATOM   2568  C  CA   . ALA A 1 21 ? -19.993 -0.992  7.773   1.00 0.00 ? 21  ALA A CA   3  
ATOM   2569  C  C    . ALA A 1 21 ? -18.795 -0.146  8.191   1.00 0.00 ? 21  ALA A C    3  
ATOM   2570  O  O    . ALA A 1 21 ? -18.426 0.807   7.504   1.00 0.00 ? 21  ALA A O    3  
ATOM   2571  C  CB   . ALA A 1 21 ? -21.164 -0.754  8.715   1.00 0.00 ? 21  ALA A CB   3  
ATOM   2572  H  H    . ALA A 1 21 ? -20.297 -3.065  8.073   1.00 0.00 ? 21  ALA A H    3  
ATOM   2573  H  HA   . ALA A 1 21 ? -20.297 -0.701  6.778   1.00 0.00 ? 21  ALA A HA   3  
ATOM   2574  H  HB1  . ALA A 1 21 ? -22.090 -0.920  8.185   1.00 0.00 ? 21  ALA A HB1  3  
ATOM   2575  H  HB2  . ALA A 1 21 ? -21.098 -1.435  9.550   1.00 0.00 ? 21  ALA A HB2  3  
ATOM   2576  H  HB3  . ALA A 1 21 ? -21.133 0.263   9.076   1.00 0.00 ? 21  ALA A HB3  3  
ATOM   2577  N  N    . SER A 1 22 ? -18.191 -0.500  9.321   1.00 0.00 ? 22  SER A N    3  
ATOM   2578  C  CA   . SER A 1 22 ? -17.037 0.230   9.832   1.00 0.00 ? 22  SER A CA   3  
ATOM   2579  C  C    . SER A 1 22 ? -15.986 0.417   8.742   1.00 0.00 ? 22  SER A C    3  
ATOM   2580  O  O    . SER A 1 22 ? -15.456 1.513   8.555   1.00 0.00 ? 22  SER A O    3  
ATOM   2581  C  CB   . SER A 1 22 ? -16.427 -0.509  11.025  1.00 0.00 ? 22  SER A CB   3  
ATOM   2582  O  OG   . SER A 1 22 ? -17.338 -0.568  12.108  1.00 0.00 ? 22  SER A OG   3  
ATOM   2583  H  H    . SER A 1 22 ? -18.532 -1.269  9.824   1.00 0.00 ? 22  SER A H    3  
ATOM   2584  H  HA   . SER A 1 22 ? -17.377 1.202   10.158  1.00 0.00 ? 22  SER A HA   3  
ATOM   2585  H  HB2  . SER A 1 22 ? -16.171 -1.515  10.729  1.00 0.00 ? 22  SER A HB2  3  
ATOM   2586  H  HB3  . SER A 1 22 ? -15.535 0.009   11.347  1.00 0.00 ? 22  SER A HB3  3  
ATOM   2587  H  HG   . SER A 1 22 ? -16.862 -0.773  12.916  1.00 0.00 ? 22  SER A HG   3  
ATOM   2588  N  N    . LEU A 1 23 ? -15.688 -0.662  8.026   1.00 0.00 ? 23  LEU A N    3  
ATOM   2589  C  CA   . LEU A 1 23 ? -14.700 -0.619  6.954   1.00 0.00 ? 23  LEU A CA   3  
ATOM   2590  C  C    . LEU A 1 23 ? -15.045 0.464   5.938   1.00 0.00 ? 23  LEU A C    3  
ATOM   2591  O  O    . LEU A 1 23 ? -14.236 1.348   5.658   1.00 0.00 ? 23  LEU A O    3  
ATOM   2592  C  CB   . LEU A 1 23 ? -14.615 -1.979  6.258   1.00 0.00 ? 23  LEU A CB   3  
ATOM   2593  C  CG   . LEU A 1 23 ? -13.572 -2.100  5.146   1.00 0.00 ? 23  LEU A CG   3  
ATOM   2594  C  CD1  . LEU A 1 23 ? -12.167 -1.985  5.717   1.00 0.00 ? 23  LEU A CD1  3  
ATOM   2595  C  CD2  . LEU A 1 23 ? -13.739 -3.415  4.399   1.00 0.00 ? 23  LEU A CD2  3  
ATOM   2596  H  H    . LEU A 1 23 ? -16.143 -1.507  8.222   1.00 0.00 ? 23  LEU A H    3  
ATOM   2597  H  HA   . LEU A 1 23 ? -13.742 -0.390  7.396   1.00 0.00 ? 23  LEU A HA   3  
ATOM   2598  H  HB2  . LEU A 1 23 ? -14.386 -2.720  7.008   1.00 0.00 ? 23  LEU A HB2  3  
ATOM   2599  H  HB3  . LEU A 1 23 ? -15.584 -2.191  5.829   1.00 0.00 ? 23  LEU A HB3  3  
ATOM   2600  H  HG   . LEU A 1 23 ? -13.712 -1.293  4.441   1.00 0.00 ? 23  LEU A HG   3  
ATOM   2601  H  HD11 . LEU A 1 23 ? -11.497 -1.621  4.954   1.00 0.00 ? 23  LEU A HD11 3  
ATOM   2602  H  HD12 . LEU A 1 23 ? -11.835 -2.955  6.056   1.00 0.00 ? 23  LEU A HD12 3  
ATOM   2603  H  HD13 . LEU A 1 23 ? -12.172 -1.296  6.550   1.00 0.00 ? 23  LEU A HD13 3  
ATOM   2604  H  HD21 . LEU A 1 23 ? -12.906 -4.064  4.622   1.00 0.00 ? 23  LEU A HD21 3  
ATOM   2605  H  HD22 . LEU A 1 23 ? -13.771 -3.223  3.336   1.00 0.00 ? 23  LEU A HD22 3  
ATOM   2606  H  HD23 . LEU A 1 23 ? -14.659 -3.889  4.707   1.00 0.00 ? 23  LEU A HD23 3  
ATOM   2607  N  N    . ASN A 1 24 ? -16.254 0.390   5.389   1.00 0.00 ? 24  ASN A N    3  
ATOM   2608  C  CA   . ASN A 1 24 ? -16.707 1.366   4.404   1.00 0.00 ? 24  ASN A CA   3  
ATOM   2609  C  C    . ASN A 1 24 ? -16.423 2.788   4.877   1.00 0.00 ? 24  ASN A C    3  
ATOM   2610  O  O    . ASN A 1 24 ? -15.982 3.635   4.100   1.00 0.00 ? 24  ASN A O    3  
ATOM   2611  C  CB   . ASN A 1 24 ? -18.204 1.195   4.138   1.00 0.00 ? 24  ASN A CB   3  
ATOM   2612  C  CG   . ASN A 1 24 ? -18.572 -0.238  3.803   1.00 0.00 ? 24  ASN A CG   3  
ATOM   2613  O  OD1  . ASN A 1 24 ? -17.865 -0.913  3.054   1.00 0.00 ? 24  ASN A OD1  3  
ATOM   2614  N  ND2  . ASN A 1 24 ? -19.683 -0.709  4.358   1.00 0.00 ? 24  ASN A ND2  3  
ATOM   2615  H  H    . ASN A 1 24 ? -16.855 -0.338  5.652   1.00 0.00 ? 24  ASN A H    3  
ATOM   2616  H  HA   . ASN A 1 24 ? -16.165 1.188   3.488   1.00 0.00 ? 24  ASN A HA   3  
ATOM   2617  H  HB2  . ASN A 1 24 ? -18.756 1.491   5.018   1.00 0.00 ? 24  ASN A HB2  3  
ATOM   2618  H  HB3  . ASN A 1 24 ? -18.491 1.824   3.310   1.00 0.00 ? 24  ASN A HB3  3  
ATOM   2619  H  HD21 . ASN A 1 24 ? -20.196 -0.114  4.944   1.00 0.00 ? 24  ASN A HD21 3  
ATOM   2620  H  HD22 . ASN A 1 24 ? -19.943 -1.632  4.159   1.00 0.00 ? 24  ASN A HD22 3  
ATOM   2621  N  N    . TRP A 1 25 ? -16.677 3.042   6.156   1.00 0.00 ? 25  TRP A N    3  
ATOM   2622  C  CA   . TRP A 1 25 ? -16.448 4.362   6.733   1.00 0.00 ? 25  TRP A CA   3  
ATOM   2623  C  C    . TRP A 1 25 ? -14.957 4.667   6.820   1.00 0.00 ? 25  TRP A C    3  
ATOM   2624  O  O    . TRP A 1 25 ? -14.547 5.828   6.792   1.00 0.00 ? 25  TRP A O    3  
ATOM   2625  C  CB   . TRP A 1 25 ? -17.081 4.451   8.122   1.00 0.00 ? 25  TRP A CB   3  
ATOM   2626  C  CG   . TRP A 1 25 ? -17.005 5.822   8.723   1.00 0.00 ? 25  TRP A CG   3  
ATOM   2627  C  CD1  . TRP A 1 25 ? -15.914 6.402   9.305   1.00 0.00 ? 25  TRP A CD1  3  
ATOM   2628  C  CD2  . TRP A 1 25 ? -18.064 6.783   8.802   1.00 0.00 ? 25  TRP A CD2  3  
ATOM   2629  N  NE1  . TRP A 1 25 ? -16.231 7.666   9.741   1.00 0.00 ? 25  TRP A NE1  3  
ATOM   2630  C  CE2  . TRP A 1 25 ? -17.543 7.924   9.444   1.00 0.00 ? 25  TRP A CE2  3  
ATOM   2631  C  CE3  . TRP A 1 25 ? -19.399 6.792   8.392   1.00 0.00 ? 25  TRP A CE3  3  
ATOM   2632  C  CZ2  . TRP A 1 25 ? -18.313 9.059   9.685   1.00 0.00 ? 25  TRP A CZ2  3  
ATOM   2633  C  CZ3  . TRP A 1 25 ? -20.163 7.918   8.631   1.00 0.00 ? 25  TRP A CZ3  3  
ATOM   2634  C  CH2  . TRP A 1 25 ? -19.618 9.040   9.272   1.00 0.00 ? 25  TRP A CH2  3  
ATOM   2635  H  H    . TRP A 1 25 ? -17.028 2.326   6.726   1.00 0.00 ? 25  TRP A H    3  
ATOM   2636  H  HA   . TRP A 1 25 ? -16.915 5.091   6.087   1.00 0.00 ? 25  TRP A HA   3  
ATOM   2637  H  HB2  . TRP A 1 25 ? -18.123 4.174   8.055   1.00 0.00 ? 25  TRP A HB2  3  
ATOM   2638  H  HB3  . TRP A 1 25 ? -16.573 3.767   8.786   1.00 0.00 ? 25  TRP A HB3  3  
ATOM   2639  H  HD1  . TRP A 1 25 ? -14.951 5.925   9.403   1.00 0.00 ? 25  TRP A HD1  3  
ATOM   2640  H  HE1  . TRP A 1 25 ? -15.616 8.283   10.191  1.00 0.00 ? 25  TRP A HE1  3  
ATOM   2641  H  HE3  . TRP A 1 25 ? -19.837 5.938   7.896   1.00 0.00 ? 25  TRP A HE3  3  
ATOM   2642  H  HZ2  . TRP A 1 25 ? -17.908 9.931   10.177  1.00 0.00 ? 25  TRP A HZ2  3  
ATOM   2643  H  HZ3  . TRP A 1 25 ? -21.197 7.943   8.322   1.00 0.00 ? 25  TRP A HZ3  3  
ATOM   2644  H  HH2  . TRP A 1 25 ? -20.251 9.897   9.439   1.00 0.00 ? 25  TRP A HH2  3  
ATOM   2645  N  N    . HIS A 1 26 ? -14.148 3.617   6.924   1.00 0.00 ? 26  HIS A N    3  
ATOM   2646  C  CA   . HIS A 1 26 ? -12.700 3.773   7.014   1.00 0.00 ? 26  HIS A CA   3  
ATOM   2647  C  C    . HIS A 1 26 ? -12.078 3.879   5.625   1.00 0.00 ? 26  HIS A C    3  
ATOM   2648  O  O    . HIS A 1 26 ? -10.954 4.358   5.474   1.00 0.00 ? 26  HIS A O    3  
ATOM   2649  C  CB   . HIS A 1 26 ? -12.086 2.597   7.773   1.00 0.00 ? 26  HIS A CB   3  
ATOM   2650  C  CG   . HIS A 1 26 ? -10.653 2.338   7.419   1.00 0.00 ? 26  HIS A CG   3  
ATOM   2651  N  ND1  . HIS A 1 26 ? -9.598  2.743   8.209   1.00 0.00 ? 26  HIS A ND1  3  
ATOM   2652  C  CD2  . HIS A 1 26 ? -10.104 1.710   6.353   1.00 0.00 ? 26  HIS A CD2  3  
ATOM   2653  C  CE1  . HIS A 1 26 ? -8.462  2.377   7.643   1.00 0.00 ? 26  HIS A CE1  3  
ATOM   2654  N  NE2  . HIS A 1 26 ? -8.741  1.748   6.516   1.00 0.00 ? 26  HIS A NE2  3  
ATOM   2655  H  H    . HIS A 1 26 ? -14.533 2.717   6.941   1.00 0.00 ? 26  HIS A H    3  
ATOM   2656  H  HA   . HIS A 1 26 ? -12.498 4.685   7.556   1.00 0.00 ? 26  HIS A HA   3  
ATOM   2657  H  HB2  . HIS A 1 26 ? -12.134 2.797   8.834   1.00 0.00 ? 26  HIS A HB2  3  
ATOM   2658  H  HB3  . HIS A 1 26 ? -12.649 1.701   7.554   1.00 0.00 ? 26  HIS A HB3  3  
ATOM   2659  H  HD1  . HIS A 1 26 ? -9.671  3.228   9.057   1.00 0.00 ? 26  HIS A HD1  3  
ATOM   2660  H  HD2  . HIS A 1 26 ? -10.639 1.262   5.527   1.00 0.00 ? 26  HIS A HD2  3  
ATOM   2661  H  HE1  . HIS A 1 26 ? -7.473  2.560   8.035   1.00 0.00 ? 26  HIS A HE1  3  
ATOM   2662  N  N    . GLN A 1 27 ? -12.815 3.429   4.616   1.00 0.00 ? 27  GLN A N    3  
ATOM   2663  C  CA   . GLN A 1 27 ? -12.334 3.472   3.240   1.00 0.00 ? 27  GLN A CA   3  
ATOM   2664  C  C    . GLN A 1 27 ? -12.737 4.778   2.563   1.00 0.00 ? 27  GLN A C    3  
ATOM   2665  O  O    . GLN A 1 27 ? -11.956 5.368   1.817   1.00 0.00 ? 27  GLN A O    3  
ATOM   2666  C  CB   . GLN A 1 27 ? -12.881 2.283   2.448   1.00 0.00 ? 27  GLN A CB   3  
ATOM   2667  C  CG   . GLN A 1 27 ? -12.550 0.935   3.068   1.00 0.00 ? 27  GLN A CG   3  
ATOM   2668  C  CD   . GLN A 1 27 ? -11.123 0.502   2.795   1.00 0.00 ? 27  GLN A CD   3  
ATOM   2669  O  OE1  . GLN A 1 27 ? -10.183 1.281   2.961   1.00 0.00 ? 27  GLN A OE1  3  
ATOM   2670  N  NE2  . GLN A 1 27 ? -10.953 -0.745  2.373   1.00 0.00 ? 27  GLN A NE2  3  
ATOM   2671  H  H    . GLN A 1 27 ? -13.703 3.059   4.800   1.00 0.00 ? 27  GLN A H    3  
ATOM   2672  H  HA   . GLN A 1 27 ? -11.257 3.411   3.264   1.00 0.00 ? 27  GLN A HA   3  
ATOM   2673  H  HB2  . GLN A 1 27 ? -13.956 2.372   2.385   1.00 0.00 ? 27  GLN A HB2  3  
ATOM   2674  H  HB3  . GLN A 1 27 ? -12.467 2.308   1.452   1.00 0.00 ? 27  GLN A HB3  3  
ATOM   2675  H  HG2  . GLN A 1 27 ? -12.691 1.000   4.137   1.00 0.00 ? 27  GLN A HG2  3  
ATOM   2676  H  HG3  . GLN A 1 27 ? -13.220 0.192   2.661   1.00 0.00 ? 27  GLN A HG3  3  
ATOM   2677  H  HE21 . GLN A 1 27 ? -11.748 -1.308  2.262   1.00 0.00 ? 27  GLN A HE21 3  
ATOM   2678  H  HE22 . GLN A 1 27 ? -10.041 -1.051  2.188   1.00 0.00 ? 27  GLN A HE22 3  
ATOM   2679  N  N    . ARG A 1 28 ? -13.961 5.222   2.828   1.00 0.00 ? 28  ARG A N    3  
ATOM   2680  C  CA   . ARG A 1 28 ? -14.469 6.458   2.243   1.00 0.00 ? 28  ARG A CA   3  
ATOM   2681  C  C    . ARG A 1 28 ? -13.502 7.613   2.488   1.00 0.00 ? 28  ARG A C    3  
ATOM   2682  O  O    . ARG A 1 28 ? -13.314 8.473   1.627   1.00 0.00 ? 28  ARG A O    3  
ATOM   2683  C  CB   . ARG A 1 28 ? -15.843 6.796   2.824   1.00 0.00 ? 28  ARG A CB   3  
ATOM   2684  C  CG   . ARG A 1 28 ? -15.796 7.243   4.276   1.00 0.00 ? 28  ARG A CG   3  
ATOM   2685  C  CD   . ARG A 1 28 ? -17.167 7.679   4.769   1.00 0.00 ? 28  ARG A CD   3  
ATOM   2686  N  NE   . ARG A 1 28 ? -17.404 9.102   4.540   1.00 0.00 ? 28  ARG A NE   3  
ATOM   2687  C  CZ   . ARG A 1 28 ? -16.790 10.067  5.215   1.00 0.00 ? 28  ARG A CZ   3  
ATOM   2688  N  NH1  . ARG A 1 28 ? -15.906 9.765   6.156   1.00 0.00 ? 28  ARG A NH1  3  
ATOM   2689  N  NH2  . ARG A 1 28 ? -17.059 11.339  4.948   1.00 0.00 ? 28  ARG A NH2  3  
ATOM   2690  H  H    . ARG A 1 28 ? -14.538 4.707   3.430   1.00 0.00 ? 28  ARG A H    3  
ATOM   2691  H  HA   . ARG A 1 28 ? -14.566 6.305   1.178   1.00 0.00 ? 28  ARG A HA   3  
ATOM   2692  H  HB2  . ARG A 1 28 ? -16.282 7.591   2.240   1.00 0.00 ? 28  ARG A HB2  3  
ATOM   2693  H  HB3  . ARG A 1 28 ? -16.473 5.922   2.760   1.00 0.00 ? 28  ARG A HB3  3  
ATOM   2694  H  HG2  . ARG A 1 28 ? -15.451 6.420   4.886   1.00 0.00 ? 28  ARG A HG2  3  
ATOM   2695  H  HG3  . ARG A 1 28 ? -15.110 8.072   4.366   1.00 0.00 ? 28  ARG A HG3  3  
ATOM   2696  H  HD2  . ARG A 1 28 ? -17.920 7.109   4.247   1.00 0.00 ? 28  ARG A HD2  3  
ATOM   2697  H  HD3  . ARG A 1 28 ? -17.234 7.478   5.828   1.00 0.00 ? 28  ARG A HD3  3  
ATOM   2698  H  HE   . ARG A 1 28 ? -18.053 9.348   3.849   1.00 0.00 ? 28  ARG A HE   3  
ATOM   2699  H  HH11 . ARG A 1 28 ? -15.701 8.807   6.358   1.00 0.00 ? 28  ARG A HH11 3  
ATOM   2700  H  HH12 . ARG A 1 28 ? -15.445 10.494  6.662   1.00 0.00 ? 28  ARG A HH12 3  
ATOM   2701  H  HH21 . ARG A 1 28 ? -17.724 11.571  4.239   1.00 0.00 ? 28  ARG A HH21 3  
ATOM   2702  H  HH22 . ARG A 1 28 ? -16.597 12.065  5.456   1.00 0.00 ? 28  ARG A HH22 3  
ATOM   2703  N  N    . LYS A 1 29 ? -12.892 7.626   3.668   1.00 0.00 ? 29  LYS A N    3  
ATOM   2704  C  CA   . LYS A 1 29 ? -11.944 8.674   4.028   1.00 0.00 ? 29  LYS A CA   3  
ATOM   2705  C  C    . LYS A 1 29 ? -10.747 8.673   3.082   1.00 0.00 ? 29  LYS A C    3  
ATOM   2706  O  O    . LYS A 1 29 ? -10.276 9.730   2.660   1.00 0.00 ? 29  LYS A O    3  
ATOM   2707  C  CB   . LYS A 1 29 ? -11.468 8.486   5.470   1.00 0.00 ? 29  LYS A CB   3  
ATOM   2708  C  CG   . LYS A 1 29 ? -10.314 7.507   5.607   1.00 0.00 ? 29  LYS A CG   3  
ATOM   2709  C  CD   . LYS A 1 29 ? -9.804  7.444   7.037   1.00 0.00 ? 29  LYS A CD   3  
ATOM   2710  C  CE   . LYS A 1 29 ? -10.619 6.472   7.877   1.00 0.00 ? 29  LYS A CE   3  
ATOM   2711  N  NZ   . LYS A 1 29 ? -10.631 6.858   9.315   1.00 0.00 ? 29  LYS A NZ   3  
ATOM   2712  H  H    . LYS A 1 29 ? -13.083 6.912   4.313   1.00 0.00 ? 29  LYS A H    3  
ATOM   2713  H  HA   . LYS A 1 29 ? -12.452 9.623   3.946   1.00 0.00 ? 29  LYS A HA   3  
ATOM   2714  H  HB2  . LYS A 1 29 ? -11.150 9.442   5.859   1.00 0.00 ? 29  LYS A HB2  3  
ATOM   2715  H  HB3  . LYS A 1 29 ? -12.294 8.122   6.065   1.00 0.00 ? 29  LYS A HB3  3  
ATOM   2716  H  HG2  . LYS A 1 29 ? -10.651 6.524   5.313   1.00 0.00 ? 29  LYS A HG2  3  
ATOM   2717  H  HG3  . LYS A 1 29 ? -9.508  7.823   4.960   1.00 0.00 ? 29  LYS A HG3  3  
ATOM   2718  H  HD2  . LYS A 1 29 ? -8.774  7.118   7.028   1.00 0.00 ? 29  LYS A HD2  3  
ATOM   2719  H  HD3  . LYS A 1 29 ? -9.868  8.429   7.477   1.00 0.00 ? 29  LYS A HD3  3  
ATOM   2720  H  HE2  . LYS A 1 29 ? -11.633 6.460   7.508   1.00 0.00 ? 29  LYS A HE2  3  
ATOM   2721  H  HE3  . LYS A 1 29 ? -10.189 5.486   7.781   1.00 0.00 ? 29  LYS A HE3  3  
ATOM   2722  H  HZ1  . LYS A 1 29 ? -11.537 7.307   9.557   1.00 0.00 ? 29  LYS A HZ1  3  
ATOM   2723  H  HZ2  . LYS A 1 29 ? -9.861  7.529   9.512   1.00 0.00 ? 29  LYS A HZ2  3  
ATOM   2724  H  HZ3  . LYS A 1 29 ? -10.503 6.016   9.912   1.00 0.00 ? 29  LYS A HZ3  3  
ATOM   2725  N  N    . HIS A 1 30 ? -10.260 7.481   2.752   1.00 0.00 ? 30  HIS A N    3  
ATOM   2726  C  CA   . HIS A 1 30 ? -9.120  7.344   1.853   1.00 0.00 ? 30  HIS A CA   3  
ATOM   2727  C  C    . HIS A 1 30 ? -9.357  8.106   0.553   1.00 0.00 ? 30  HIS A C    3  
ATOM   2728  O  O    . HIS A 1 30 ? -8.472  8.807   0.063   1.00 0.00 ? 30  HIS A O    3  
ATOM   2729  C  CB   . HIS A 1 30 ? -8.856  5.868   1.552   1.00 0.00 ? 30  HIS A CB   3  
ATOM   2730  C  CG   . HIS A 1 30 ? -8.164  5.144   2.665   1.00 0.00 ? 30  HIS A CG   3  
ATOM   2731  N  ND1  . HIS A 1 30 ? -7.065  5.652   3.325   1.00 0.00 ? 30  HIS A ND1  3  
ATOM   2732  C  CD2  . HIS A 1 30 ? -8.422  3.944   3.235   1.00 0.00 ? 30  HIS A CD2  3  
ATOM   2733  C  CE1  . HIS A 1 30 ? -6.676  4.795   4.252   1.00 0.00 ? 30  HIS A CE1  3  
ATOM   2734  N  NE2  . HIS A 1 30 ? -7.483  3.750   4.219   1.00 0.00 ? 30  HIS A NE2  3  
ATOM   2735  H  H    . HIS A 1 30 ? -10.679 6.676   3.120   1.00 0.00 ? 30  HIS A H    3  
ATOM   2736  H  HA   . HIS A 1 30 ? -8.256  7.761   2.348   1.00 0.00 ? 30  HIS A HA   3  
ATOM   2737  H  HB2  . HIS A 1 30 ? -9.797  5.371   1.368   1.00 0.00 ? 30  HIS A HB2  3  
ATOM   2738  H  HB3  . HIS A 1 30 ? -8.236  5.793   0.670   1.00 0.00 ? 30  HIS A HB3  3  
ATOM   2739  H  HD1  . HIS A 1 30 ? -6.634  6.512   3.141   1.00 0.00 ? 30  HIS A HD1  3  
ATOM   2740  H  HD2  . HIS A 1 30 ? -9.218  3.263   2.967   1.00 0.00 ? 30  HIS A HD2  3  
ATOM   2741  H  HE1  . HIS A 1 30 ? -5.841  4.925   4.924   1.00 0.00 ? 30  HIS A HE1  3  
ATOM   2742  N  N    . ALA A 1 31 ? -10.557 7.964   0.000   1.00 0.00 ? 31  ALA A N    3  
ATOM   2743  C  CA   . ALA A 1 31 ? -10.910 8.640   -1.242  1.00 0.00 ? 31  ALA A CA   3  
ATOM   2744  C  C    . ALA A 1 31 ? -10.549 10.121  -1.183  1.00 0.00 ? 31  ALA A C    3  
ATOM   2745  O  O    . ALA A 1 31 ? -10.272 10.742  -2.209  1.00 0.00 ? 31  ALA A O    3  
ATOM   2746  C  CB   . ALA A 1 31 ? -12.394 8.468   -1.533  1.00 0.00 ? 31  ALA A CB   3  
ATOM   2747  H  H    . ALA A 1 31 ? -11.220 7.392   0.438   1.00 0.00 ? 31  ALA A H    3  
ATOM   2748  H  HA   . ALA A 1 31 ? -10.355 8.176   -2.044  1.00 0.00 ? 31  ALA A HA   3  
ATOM   2749  H  HB1  . ALA A 1 31 ? -12.517 7.893   -2.439  1.00 0.00 ? 31  ALA A HB1  3  
ATOM   2750  H  HB2  . ALA A 1 31 ? -12.864 7.951   -0.710  1.00 0.00 ? 31  ALA A HB2  3  
ATOM   2751  H  HB3  . ALA A 1 31 ? -12.851 9.439   -1.657  1.00 0.00 ? 31  ALA A HB3  3  
ATOM   2752  N  N    . GLU A 1 32 ? -10.555 10.679  0.023   1.00 0.00 ? 32  GLU A N    3  
ATOM   2753  C  CA   . GLU A 1 32 ? -10.229 12.088  0.214   1.00 0.00 ? 32  GLU A CA   3  
ATOM   2754  C  C    . GLU A 1 32 ? -8.757  12.261  0.576   1.00 0.00 ? 32  GLU A C    3  
ATOM   2755  O  O    . GLU A 1 32 ? -8.082  13.159  0.071   1.00 0.00 ? 32  GLU A O    3  
ATOM   2756  C  CB   . GLU A 1 32 ? -11.110 12.694  1.308   1.00 0.00 ? 32  GLU A CB   3  
ATOM   2757  C  CG   . GLU A 1 32 ? -12.554 12.901  0.882   1.00 0.00 ? 32  GLU A CG   3  
ATOM   2758  C  CD   . GLU A 1 32 ? -12.723 14.089  -0.046  1.00 0.00 ? 32  GLU A CD   3  
ATOM   2759  O  OE1  . GLU A 1 32 ? -11.763 14.412  -0.776  1.00 0.00 ? 32  GLU A OE1  3  
ATOM   2760  O  OE2  . GLU A 1 32 ? -13.816 14.694  -0.042  1.00 0.00 ? 32  GLU A OE2  3  
ATOM   2761  H  H    . GLU A 1 32 ? -10.784 10.131  0.803   1.00 0.00 ? 32  GLU A H    3  
ATOM   2762  H  HA   . GLU A 1 32 ? -10.421 12.601  -0.716  1.00 0.00 ? 32  GLU A HA   3  
ATOM   2763  H  HB2  . GLU A 1 32 ? -11.099 12.039  2.166   1.00 0.00 ? 32  GLU A HB2  3  
ATOM   2764  H  HB3  . GLU A 1 32 ? -10.700 13.652  1.593   1.00 0.00 ? 32  GLU A HB3  3  
ATOM   2765  H  HG2  . GLU A 1 32 ? -12.896 12.013  0.371   1.00 0.00 ? 32  GLU A HG2  3  
ATOM   2766  H  HG3  . GLU A 1 32 ? -13.156 13.063  1.764   1.00 0.00 ? 32  GLU A HG3  3  
ATOM   2767  N  N    . THR A 1 33 ? -8.264  11.396  1.457   1.00 0.00 ? 33  THR A N    3  
ATOM   2768  C  CA   . THR A 1 33 ? -6.873  11.453  1.889   1.00 0.00 ? 33  THR A CA   3  
ATOM   2769  C  C    . THR A 1 33 ? -5.923  11.332  0.703   1.00 0.00 ? 33  THR A C    3  
ATOM   2770  O  O    . THR A 1 33 ? -4.925  12.048  0.620   1.00 0.00 ? 33  THR A O    3  
ATOM   2771  C  CB   . THR A 1 33 ? -6.554  10.339  2.904   1.00 0.00 ? 33  THR A CB   3  
ATOM   2772  O  OG1  . THR A 1 33 ? -7.533  10.332  3.948   1.00 0.00 ? 33  THR A OG1  3  
ATOM   2773  C  CG2  . THR A 1 33 ? -5.169  10.532  3.502   1.00 0.00 ? 33  THR A CG2  3  
ATOM   2774  H  H    . THR A 1 33 ? -8.852  10.703  1.824   1.00 0.00 ? 33  THR A H    3  
ATOM   2775  H  HA   . THR A 1 33 ? -6.713  12.407  2.371   1.00 0.00 ? 33  THR A HA   3  
ATOM   2776  H  HB   . THR A 1 33 ? -6.579  9.388   2.391   1.00 0.00 ? 33  THR A HB   3  
ATOM   2777  H  HG1  . THR A 1 33 ? -7.262  9.720   4.637   1.00 0.00 ? 33  THR A HG1  3  
ATOM   2778  H  HG21 . THR A 1 33 ? -4.810  11.523  3.265   1.00 0.00 ? 33  THR A HG21 3  
ATOM   2779  H  HG22 . THR A 1 33 ? -4.494  9.797   3.091   1.00 0.00 ? 33  THR A HG22 3  
ATOM   2780  H  HG23 . THR A 1 33 ? -5.221  10.415  4.574   1.00 0.00 ? 33  THR A HG23 3  
ATOM   2781  N  N    . VAL A 1 34 ? -6.240  10.423  -0.213  1.00 0.00 ? 34  VAL A N    3  
ATOM   2782  C  CA   . VAL A 1 34 ? -5.415  10.210  -1.396  1.00 0.00 ? 34  VAL A CA   3  
ATOM   2783  C  C    . VAL A 1 34 ? -4.863  11.529  -1.926  1.00 0.00 ? 34  VAL A C    3  
ATOM   2784  O  O    . VAL A 1 34 ? -3.749  11.583  -2.444  1.00 0.00 ? 34  VAL A O    3  
ATOM   2785  C  CB   . VAL A 1 34 ? -6.210  9.512   -2.516  1.00 0.00 ? 34  VAL A CB   3  
ATOM   2786  C  CG1  . VAL A 1 34 ? -6.681  8.139   -2.060  1.00 0.00 ? 34  VAL A CG1  3  
ATOM   2787  C  CG2  . VAL A 1 34 ? -7.387  10.372  -2.949  1.00 0.00 ? 34  VAL A CG2  3  
ATOM   2788  H  H    . VAL A 1 34 ? -7.049  9.883   -0.090  1.00 0.00 ? 34  VAL A H    3  
ATOM   2789  H  HA   . VAL A 1 34 ? -4.590  9.571   -1.117  1.00 0.00 ? 34  VAL A HA   3  
ATOM   2790  H  HB   . VAL A 1 34 ? -5.556  9.380   -3.365  1.00 0.00 ? 34  VAL A HB   3  
ATOM   2791  H  HG11 . VAL A 1 34 ? -6.234  7.904   -1.105  1.00 0.00 ? 34  VAL A HG11 3  
ATOM   2792  H  HG12 . VAL A 1 34 ? -7.757  8.141   -1.965  1.00 0.00 ? 34  VAL A HG12 3  
ATOM   2793  H  HG13 . VAL A 1 34 ? -6.385  7.398   -2.788  1.00 0.00 ? 34  VAL A HG13 3  
ATOM   2794  H  HG21 . VAL A 1 34 ? -7.864  9.923   -3.807  1.00 0.00 ? 34  VAL A HG21 3  
ATOM   2795  H  HG22 . VAL A 1 34 ? -8.098  10.445  -2.139  1.00 0.00 ? 34  VAL A HG22 3  
ATOM   2796  H  HG23 . VAL A 1 34 ? -7.036  11.360  -3.208  1.00 0.00 ? 34  VAL A HG23 3  
ATOM   2797  N  N    . ALA A 1 35 ? -5.652  12.590  -1.791  1.00 0.00 ? 35  ALA A N    3  
ATOM   2798  C  CA   . ALA A 1 35 ? -5.241  13.910  -2.254  1.00 0.00 ? 35  ALA A CA   3  
ATOM   2799  C  C    . ALA A 1 35 ? -3.764  14.158  -1.966  1.00 0.00 ? 35  ALA A C    3  
ATOM   2800  O  O    . ALA A 1 35 ? -3.038  14.685  -2.808  1.00 0.00 ? 35  ALA A O    3  
ATOM   2801  C  CB   . ALA A 1 35 ? -6.096  14.987  -1.603  1.00 0.00 ? 35  ALA A CB   3  
ATOM   2802  H  H    . ALA A 1 35 ? -6.530  12.483  -1.370  1.00 0.00 ? 35  ALA A H    3  
ATOM   2803  H  HA   . ALA A 1 35 ? -5.401  13.954  -3.322  1.00 0.00 ? 35  ALA A HA   3  
ATOM   2804  H  HB1  . ALA A 1 35 ? -5.720  15.193  -0.611  1.00 0.00 ? 35  ALA A HB1  3  
ATOM   2805  H  HB2  . ALA A 1 35 ? -6.054  15.888  -2.198  1.00 0.00 ? 35  ALA A HB2  3  
ATOM   2806  H  HB3  . ALA A 1 35 ? -7.118  14.645  -1.538  1.00 0.00 ? 35  ALA A HB3  3  
ATOM   2807  N  N    . ALA A 1 36 ? -3.327  13.774  -0.771  1.00 0.00 ? 36  ALA A N    3  
ATOM   2808  C  CA   . ALA A 1 36 ? -1.936  13.954  -0.373  1.00 0.00 ? 36  ALA A CA   3  
ATOM   2809  C  C    . ALA A 1 36 ? -0.986  13.413  -1.436  1.00 0.00 ? 36  ALA A C    3  
ATOM   2810  O  O    . ALA A 1 36 ? -0.272  14.174  -2.090  1.00 0.00 ? 36  ALA A O    3  
ATOM   2811  C  CB   . ALA A 1 36 ? -1.678  13.274  0.964   1.00 0.00 ? 36  ALA A CB   3  
ATOM   2812  H  H    . ALA A 1 36 ? -3.954  13.359  -0.143  1.00 0.00 ? 36  ALA A H    3  
ATOM   2813  H  HA   . ALA A 1 36 ? -1.758  15.013  -0.250  1.00 0.00 ? 36  ALA A HA   3  
ATOM   2814  H  HB1  . ALA A 1 36 ? -0.897  13.802  1.490   1.00 0.00 ? 36  ALA A HB1  3  
ATOM   2815  H  HB2  . ALA A 1 36 ? -2.582  13.285  1.554   1.00 0.00 ? 36  ALA A HB2  3  
ATOM   2816  H  HB3  . ALA A 1 36 ? -1.371  12.253  0.794   1.00 0.00 ? 36  ALA A HB3  3  
ATOM   2817  N  N    . LEU A 1 37 ? -0.982  12.095  -1.604  1.00 0.00 ? 37  LEU A N    3  
ATOM   2818  C  CA   . LEU A 1 37 ? -0.119  11.452  -2.588  1.00 0.00 ? 37  LEU A CA   3  
ATOM   2819  C  C    . LEU A 1 37 ? -0.304  12.078  -3.967  1.00 0.00 ? 37  LEU A C    3  
ATOM   2820  O  O    . LEU A 1 37 ? -1.422  12.158  -4.478  1.00 0.00 ? 37  LEU A O    3  
ATOM   2821  C  CB   . LEU A 1 37 ? -0.414  9.953   -2.652  1.00 0.00 ? 37  LEU A CB   3  
ATOM   2822  C  CG   . LEU A 1 37 ? -0.674  9.262   -1.313  1.00 0.00 ? 37  LEU A CG   3  
ATOM   2823  C  CD1  . LEU A 1 37 ? 0.175   9.887   -0.216  1.00 0.00 ? 37  LEU A CD1  3  
ATOM   2824  C  CD2  . LEU A 1 37 ? -2.150  9.333   -0.953  1.00 0.00 ? 37  LEU A CD2  3  
ATOM   2825  H  H    . LEU A 1 37 ? -1.573  11.541  -1.053  1.00 0.00 ? 37  LEU A H    3  
ATOM   2826  H  HA   . LEU A 1 37 ? 0.905   11.596  -2.275  1.00 0.00 ? 37  LEU A HA   3  
ATOM   2827  H  HB2  . LEU A 1 37 ? -1.288  9.814   -3.270  1.00 0.00 ? 37  LEU A HB2  3  
ATOM   2828  H  HB3  . LEU A 1 37 ? 0.434   9.469   -3.116  1.00 0.00 ? 37  LEU A HB3  3  
ATOM   2829  H  HG   . LEU A 1 37 ? -0.398  8.219   -1.393  1.00 0.00 ? 37  LEU A HG   3  
ATOM   2830  H  HD11 . LEU A 1 37 ? 0.584   9.109   0.410   1.00 0.00 ? 37  LEU A HD11 3  
ATOM   2831  H  HD12 . LEU A 1 37 ? -0.438  10.545  0.382   1.00 0.00 ? 37  LEU A HD12 3  
ATOM   2832  H  HD13 . LEU A 1 37 ? 0.980   10.453  -0.663  1.00 0.00 ? 37  LEU A HD13 3  
ATOM   2833  H  HD21 . LEU A 1 37 ? -2.699  9.771   -1.774  1.00 0.00 ? 37  LEU A HD21 3  
ATOM   2834  H  HD22 . LEU A 1 37 ? -2.277  9.943   -0.070  1.00 0.00 ? 37  LEU A HD22 3  
ATOM   2835  H  HD23 . LEU A 1 37 ? -2.523  8.338   -0.761  1.00 0.00 ? 37  LEU A HD23 3  
ATOM   2836  N  N    . ARG A 1 38 ? 0.798   12.518  -4.564  1.00 0.00 ? 38  ARG A N    3  
ATOM   2837  C  CA   . ARG A 1 38 ? 0.757   13.136  -5.884  1.00 0.00 ? 38  ARG A CA   3  
ATOM   2838  C  C    . ARG A 1 38 ? 1.566   12.323  -6.890  1.00 0.00 ? 38  ARG A C    3  
ATOM   2839  O  O    . ARG A 1 38 ? 1.244   12.287  -8.078  1.00 0.00 ? 38  ARG A O    3  
ATOM   2840  C  CB   . ARG A 1 38 ? 1.294   14.567  -5.818  1.00 0.00 ? 38  ARG A CB   3  
ATOM   2841  C  CG   . ARG A 1 38 ? 0.865   15.322  -4.571  1.00 0.00 ? 38  ARG A CG   3  
ATOM   2842  C  CD   . ARG A 1 38 ? 1.914   15.228  -3.474  1.00 0.00 ? 38  ARG A CD   3  
ATOM   2843  N  NE   . ARG A 1 38 ? 1.473   15.871  -2.239  1.00 0.00 ? 38  ARG A NE   3  
ATOM   2844  C  CZ   . ARG A 1 38 ? 2.288   16.529  -1.422  1.00 0.00 ? 38  ARG A CZ   3  
ATOM   2845  N  NH1  . ARG A 1 38 ? 3.579   16.631  -1.708  1.00 0.00 ? 38  ARG A NH1  3  
ATOM   2846  N  NH2  . ARG A 1 38 ? 1.812   17.088  -0.317  1.00 0.00 ? 38  ARG A NH2  3  
ATOM   2847  H  H    . ARG A 1 38 ? 1.660   12.427  -4.106  1.00 0.00 ? 38  ARG A H    3  
ATOM   2848  H  HA   . ARG A 1 38 ? -0.273  13.162  -6.206  1.00 0.00 ? 38  ARG A HA   3  
ATOM   2849  H  HB2  . ARG A 1 38 ? 2.374   14.535  -5.839  1.00 0.00 ? 38  ARG A HB2  3  
ATOM   2850  H  HB3  . ARG A 1 38 ? 0.942   15.111  -6.681  1.00 0.00 ? 38  ARG A HB3  3  
ATOM   2851  H  HG2  . ARG A 1 38 ? 0.717   16.361  -4.824  1.00 0.00 ? 38  ARG A HG2  3  
ATOM   2852  H  HG3  . ARG A 1 38 ? -0.062  14.902  -4.209  1.00 0.00 ? 38  ARG A HG3  3  
ATOM   2853  H  HD2  . ARG A 1 38 ? 2.114   14.186  -3.274  1.00 0.00 ? 38  ARG A HD2  3  
ATOM   2854  H  HD3  . ARG A 1 38 ? 2.818   15.709  -3.817  1.00 0.00 ? 38  ARG A HD3  3  
ATOM   2855  H  HE   . ARG A 1 38 ? 0.523   15.808  -2.008  1.00 0.00 ? 38  ARG A HE   3  
ATOM   2856  H  HH11 . ARG A 1 38 ? 3.940   16.212  -2.541  1.00 0.00 ? 38  ARG A HH11 3  
ATOM   2857  H  HH12 . ARG A 1 38 ? 4.190   17.129  -1.092  1.00 0.00 ? 38  ARG A HH12 3  
ATOM   2858  H  HH21 . ARG A 1 38 ? 0.840   17.014  -0.098  1.00 0.00 ? 38  ARG A HH21 3  
ATOM   2859  H  HH22 . ARG A 1 38 ? 2.426   17.583  0.297   1.00 0.00 ? 38  ARG A HH22 3  
ATOM   2860  N  N    . PHE A 1 39 ? 2.619   11.672  -6.407  1.00 0.00 ? 39  PHE A N    3  
ATOM   2861  C  CA   . PHE A 1 39 ? 3.476   10.860  -7.263  1.00 0.00 ? 39  PHE A CA   3  
ATOM   2862  C  C    . PHE A 1 39 ? 3.096   9.385   -7.172  1.00 0.00 ? 39  PHE A C    3  
ATOM   2863  O  O    . PHE A 1 39 ? 3.436   8.688   -6.216  1.00 0.00 ? 39  PHE A O    3  
ATOM   2864  C  CB   . PHE A 1 39 ? 4.944   11.045  -6.874  1.00 0.00 ? 39  PHE A CB   3  
ATOM   2865  C  CG   . PHE A 1 39 ? 5.337   12.482  -6.681  1.00 0.00 ? 39  PHE A CG   3  
ATOM   2866  C  CD1  . PHE A 1 39 ? 4.966   13.167  -5.535  1.00 0.00 ? 39  PHE A CD1  3  
ATOM   2867  C  CD2  . PHE A 1 39 ? 6.077   13.147  -7.646  1.00 0.00 ? 39  PHE A CD2  3  
ATOM   2868  C  CE1  . PHE A 1 39 ? 5.326   14.490  -5.356  1.00 0.00 ? 39  PHE A CE1  3  
ATOM   2869  C  CE2  . PHE A 1 39 ? 6.440   14.469  -7.471  1.00 0.00 ? 39  PHE A CE2  3  
ATOM   2870  C  CZ   . PHE A 1 39 ? 6.064   15.141  -6.325  1.00 0.00 ? 39  PHE A CZ   3  
ATOM   2871  H  H    . PHE A 1 39 ? 2.825   11.739  -5.450  1.00 0.00 ? 39  PHE A H    3  
ATOM   2872  H  HA   . PHE A 1 39 ? 3.337   11.193  -8.280  1.00 0.00 ? 39  PHE A HA   3  
ATOM   2873  H  HB2  . PHE A 1 39 ? 5.132   10.523  -5.948  1.00 0.00 ? 39  PHE A HB2  3  
ATOM   2874  H  HB3  . PHE A 1 39 ? 5.569   10.630  -7.650  1.00 0.00 ? 39  PHE A HB3  3  
ATOM   2875  H  HD1  . PHE A 1 39 ? 4.390   12.659  -4.777  1.00 0.00 ? 39  PHE A HD1  3  
ATOM   2876  H  HD2  . PHE A 1 39 ? 6.371   12.622  -8.543  1.00 0.00 ? 39  PHE A HD2  3  
ATOM   2877  H  HE1  . PHE A 1 39 ? 5.032   15.013  -4.458  1.00 0.00 ? 39  PHE A HE1  3  
ATOM   2878  H  HE2  . PHE A 1 39 ? 7.017   14.975  -8.231  1.00 0.00 ? 39  PHE A HE2  3  
ATOM   2879  H  HZ   . PHE A 1 39 ? 6.346   16.174  -6.187  1.00 0.00 ? 39  PHE A HZ   3  
ATOM   2880  N  N    . PRO A 1 40 ? 2.372   8.897   -8.191  1.00 0.00 ? 40  PRO A N    3  
ATOM   2881  C  CA   . PRO A 1 40 ? 1.929   7.501   -8.250  1.00 0.00 ? 40  PRO A CA   3  
ATOM   2882  C  C    . PRO A 1 40 ? 3.086   6.535   -8.481  1.00 0.00 ? 40  PRO A C    3  
ATOM   2883  O  O    . PRO A 1 40 ? 4.213   6.953   -8.748  1.00 0.00 ? 40  PRO A O    3  
ATOM   2884  C  CB   . PRO A 1 40 ? 0.971   7.483   -9.444  1.00 0.00 ? 40  PRO A CB   3  
ATOM   2885  C  CG   . PRO A 1 40 ? 1.415   8.616   -10.303 1.00 0.00 ? 40  PRO A CG   3  
ATOM   2886  C  CD   . PRO A 1 40 ? 1.931   9.671   -9.363  1.00 0.00 ? 40  PRO A CD   3  
ATOM   2887  H  HA   . PRO A 1 40 ? 1.397   7.216   -7.354  1.00 0.00 ? 40  PRO A HA   3  
ATOM   2888  H  HB2  . PRO A 1 40 ? 1.054   6.538   -9.961  1.00 0.00 ? 40  PRO A HB2  3  
ATOM   2889  H  HB3  . PRO A 1 40 ? -0.042  7.623   -9.099  1.00 0.00 ? 40  PRO A HB3  3  
ATOM   2890  H  HG2  . PRO A 1 40 ? 2.201   8.288   -10.966 1.00 0.00 ? 40  PRO A HG2  3  
ATOM   2891  H  HG3  . PRO A 1 40 ? 0.578   8.997   -10.870 1.00 0.00 ? 40  PRO A HG3  3  
ATOM   2892  H  HD2  . PRO A 1 40 ? 2.759   10.201  -9.809  1.00 0.00 ? 40  PRO A HD2  3  
ATOM   2893  H  HD3  . PRO A 1 40 ? 1.141   10.357  -9.096  1.00 0.00 ? 40  PRO A HD3  3  
ATOM   2894  N  N    . CYS A 1 41 ? 2.801   5.242   -8.377  1.00 0.00 ? 41  CYS A N    3  
ATOM   2895  C  CA   . CYS A 1 41 ? 3.817   4.216   -8.574  1.00 0.00 ? 41  CYS A CA   3  
ATOM   2896  C  C    . CYS A 1 41 ? 3.645   3.533   -9.928  1.00 0.00 ? 41  CYS A C    3  
ATOM   2897  O  O    . CYS A 1 41 ? 2.690   2.787   -10.140 1.00 0.00 ? 41  CYS A O    3  
ATOM   2898  C  CB   . CYS A 1 41 ? 3.747   3.176   -7.454  1.00 0.00 ? 41  CYS A CB   3  
ATOM   2899  S  SG   . CYS A 1 41 ? 5.182   2.056   -7.388  1.00 0.00 ? 41  CYS A SG   3  
ATOM   2900  H  H    . CYS A 1 41 ? 1.883   4.970   -8.161  1.00 0.00 ? 41  CYS A H    3  
ATOM   2901  H  HA   . CYS A 1 41 ? 4.784   4.696   -8.548  1.00 0.00 ? 41  CYS A HA   3  
ATOM   2902  H  HB2  . CYS A 1 41 ? 3.686   3.686   -6.503  1.00 0.00 ? 41  CYS A HB2  3  
ATOM   2903  H  HB3  . CYS A 1 41 ? 2.863   2.571   -7.589  1.00 0.00 ? 41  CYS A HB3  3  
ATOM   2904  N  N    . GLU A 1 42 ? 4.577   3.794   -10.839 1.00 0.00 ? 42  GLU A N    3  
ATOM   2905  C  CA   . GLU A 1 42 ? 4.527   3.205   -12.172 1.00 0.00 ? 42  GLU A CA   3  
ATOM   2906  C  C    . GLU A 1 42 ? 4.777   1.700   -12.112 1.00 0.00 ? 42  GLU A C    3  
ATOM   2907  O  O    . GLU A 1 42 ? 4.801   1.022   -13.139 1.00 0.00 ? 42  GLU A O    3  
ATOM   2908  C  CB   . GLU A 1 42 ? 5.560   3.868   -13.086 1.00 0.00 ? 42  GLU A CB   3  
ATOM   2909  C  CG   . GLU A 1 42 ? 6.998   3.578   -12.691 1.00 0.00 ? 42  GLU A CG   3  
ATOM   2910  C  CD   . GLU A 1 42 ? 7.999   4.109   -13.699 1.00 0.00 ? 42  GLU A CD   3  
ATOM   2911  O  OE1  . GLU A 1 42 ? 8.238   3.422   -14.714 1.00 0.00 ? 42  GLU A OE1  3  
ATOM   2912  O  OE2  . GLU A 1 42 ? 8.542   5.210   -13.472 1.00 0.00 ? 42  GLU A OE2  3  
ATOM   2913  H  H    . GLU A 1 42 ? 5.315   4.397   -10.610 1.00 0.00 ? 42  GLU A H    3  
ATOM   2914  H  HA   . GLU A 1 42 ? 3.541   3.378   -12.575 1.00 0.00 ? 42  GLU A HA   3  
ATOM   2915  H  HB2  . GLU A 1 42 ? 5.408   3.517   -14.096 1.00 0.00 ? 42  GLU A HB2  3  
ATOM   2916  H  HB3  . GLU A 1 42 ? 5.411   4.937   -13.060 1.00 0.00 ? 42  GLU A HB3  3  
ATOM   2917  H  HG2  . GLU A 1 42 ? 7.195   4.039   -11.734 1.00 0.00 ? 42  GLU A HG2  3  
ATOM   2918  H  HG3  . GLU A 1 42 ? 7.126   2.509   -12.607 1.00 0.00 ? 42  GLU A HG3  3  
ATOM   2919  N  N    . PHE A 1 43 ? 4.963   1.186   -10.901 1.00 0.00 ? 43  PHE A N    3  
ATOM   2920  C  CA   . PHE A 1 43 ? 5.213   -0.238  -10.705 1.00 0.00 ? 43  PHE A CA   3  
ATOM   2921  C  C    . PHE A 1 43 ? 3.920   -0.976  -10.370 1.00 0.00 ? 43  PHE A C    3  
ATOM   2922  O  O    . PHE A 1 43 ? 3.529   -1.914  -11.064 1.00 0.00 ? 43  PHE A O    3  
ATOM   2923  C  CB   . PHE A 1 43 ? 6.238   -0.449  -9.589  1.00 0.00 ? 43  PHE A CB   3  
ATOM   2924  C  CG   . PHE A 1 43 ? 7.650   -0.565  -10.087 1.00 0.00 ? 43  PHE A CG   3  
ATOM   2925  C  CD1  . PHE A 1 43 ? 8.119   -1.759  -10.609 1.00 0.00 ? 43  PHE A CD1  3  
ATOM   2926  C  CD2  . PHE A 1 43 ? 8.509   0.521   -10.033 1.00 0.00 ? 43  PHE A CD2  3  
ATOM   2927  C  CE1  . PHE A 1 43 ? 9.418   -1.869  -11.068 1.00 0.00 ? 43  PHE A CE1  3  
ATOM   2928  C  CE2  . PHE A 1 43 ? 9.809   0.418   -10.491 1.00 0.00 ? 43  PHE A CE2  3  
ATOM   2929  C  CZ   . PHE A 1 43 ? 10.264  -0.780  -11.008 1.00 0.00 ? 43  PHE A CZ   3  
ATOM   2930  H  H    . PHE A 1 43 ? 4.932   1.778   -10.120 1.00 0.00 ? 43  PHE A H    3  
ATOM   2931  H  HA   . PHE A 1 43 ? 5.610   -0.633  -11.627 1.00 0.00 ? 43  PHE A HA   3  
ATOM   2932  H  HB2  . PHE A 1 43 ? 6.194   0.387   -8.908  1.00 0.00 ? 43  PHE A HB2  3  
ATOM   2933  H  HB3  . PHE A 1 43 ? 5.997   -1.356  -9.056  1.00 0.00 ? 43  PHE A HB3  3  
ATOM   2934  H  HD1  . PHE A 1 43 ? 7.458   -2.613  -10.656 1.00 0.00 ? 43  PHE A HD1  3  
ATOM   2935  H  HD2  . PHE A 1 43 ? 8.155   1.458   -9.628  1.00 0.00 ? 43  PHE A HD2  3  
ATOM   2936  H  HE1  . PHE A 1 43 ? 9.771   -2.807  -11.471 1.00 0.00 ? 43  PHE A HE1  3  
ATOM   2937  H  HE2  . PHE A 1 43 ? 10.469  1.271   -10.443 1.00 0.00 ? 43  PHE A HE2  3  
ATOM   2938  H  HZ   . PHE A 1 43 ? 11.279  -0.863  -11.367 1.00 0.00 ? 43  PHE A HZ   3  
ATOM   2939  N  N    . CYS A 1 44 ? 3.261   -0.545  -9.299  1.00 0.00 ? 44  CYS A N    3  
ATOM   2940  C  CA   . CYS A 1 44 ? 2.013   -1.164  -8.869  1.00 0.00 ? 44  CYS A CA   3  
ATOM   2941  C  C    . CYS A 1 44 ? 0.837   -0.211  -9.067  1.00 0.00 ? 44  CYS A C    3  
ATOM   2942  O  O    . CYS A 1 44 ? -0.277  -0.638  -9.370  1.00 0.00 ? 44  CYS A O    3  
ATOM   2943  C  CB   . CYS A 1 44 ? 2.105   -1.578  -7.399  1.00 0.00 ? 44  CYS A CB   3  
ATOM   2944  S  SG   . CYS A 1 44 ? 2.453   -0.201  -6.258  1.00 0.00 ? 44  CYS A SG   3  
ATOM   2945  H  H    . CYS A 1 44 ? 3.623   0.208   -8.785  1.00 0.00 ? 44  CYS A H    3  
ATOM   2946  H  HA   . CYS A 1 44 ? 1.853   -2.044  -9.473  1.00 0.00 ? 44  CYS A HA   3  
ATOM   2947  H  HB2  . CYS A 1 44 ? 1.167   -2.023  -7.099  1.00 0.00 ? 44  CYS A HB2  3  
ATOM   2948  H  HB3  . CYS A 1 44 ? 2.895   -2.306  -7.287  1.00 0.00 ? 44  CYS A HB3  3  
ATOM   2949  N  N    . GLY A 1 45 ? 1.094   1.082   -8.894  1.00 0.00 ? 45  GLY A N    3  
ATOM   2950  C  CA   . GLY A 1 45 ? 0.048   2.074   -9.058  1.00 0.00 ? 45  GLY A CA   3  
ATOM   2951  C  C    . GLY A 1 45 ? -0.172  2.897   -7.804  1.00 0.00 ? 45  GLY A C    3  
ATOM   2952  O  O    . GLY A 1 45 ? -0.918  3.877   -7.818  1.00 0.00 ? 45  GLY A O    3  
ATOM   2953  H  H    . GLY A 1 45 ? 2.001   1.364   -8.652  1.00 0.00 ? 45  GLY A H    3  
ATOM   2954  H  HA2  . GLY A 1 45 ? 0.318   2.736   -9.867  1.00 0.00 ? 45  GLY A HA2  3  
ATOM   2955  H  HA3  . GLY A 1 45 ? -0.874  1.571   -9.310  1.00 0.00 ? 45  GLY A HA3  3  
ATOM   2956  N  N    . LYS A 1 46 ? 0.477   2.499   -6.715  1.00 0.00 ? 46  LYS A N    3  
ATOM   2957  C  CA   . LYS A 1 46 ? 0.349   3.206   -5.446  1.00 0.00 ? 46  LYS A CA   3  
ATOM   2958  C  C    . LYS A 1 46 ? 0.620   4.696   -5.624  1.00 0.00 ? 46  LYS A C    3  
ATOM   2959  O  O    . LYS A 1 46 ? 0.898   5.159   -6.731  1.00 0.00 ? 46  LYS A O    3  
ATOM   2960  C  CB   . LYS A 1 46 ? 1.316   2.621   -4.414  1.00 0.00 ? 46  LYS A CB   3  
ATOM   2961  C  CG   . LYS A 1 46 ? 0.730   1.466   -3.619  1.00 0.00 ? 46  LYS A CG   3  
ATOM   2962  C  CD   . LYS A 1 46 ? 1.699   0.972   -2.557  1.00 0.00 ? 46  LYS A CD   3  
ATOM   2963  C  CE   . LYS A 1 46 ? 1.573   1.774   -1.271  1.00 0.00 ? 46  LYS A CE   3  
ATOM   2964  N  NZ   . LYS A 1 46 ? 0.382   1.364   -0.476  1.00 0.00 ? 46  LYS A NZ   3  
ATOM   2965  H  H    . LYS A 1 46 ? 1.058   1.710   -6.767  1.00 0.00 ? 46  LYS A H    3  
ATOM   2966  H  HA   . LYS A 1 46 ? -0.663  3.075   -5.094  1.00 0.00 ? 46  LYS A HA   3  
ATOM   2967  H  HB2  . LYS A 1 46 ? 2.199   2.267   -4.925  1.00 0.00 ? 46  LYS A HB2  3  
ATOM   2968  H  HB3  . LYS A 1 46 ? 1.599   3.400   -3.721  1.00 0.00 ? 46  LYS A HB3  3  
ATOM   2969  H  HG2  . LYS A 1 46 ? -0.177  1.797   -3.136  1.00 0.00 ? 46  LYS A HG2  3  
ATOM   2970  H  HG3  . LYS A 1 46 ? 0.505   0.653   -4.294  1.00 0.00 ? 46  LYS A HG3  3  
ATOM   2971  H  HD2  . LYS A 1 46 ? 1.487   -0.065  -2.344  1.00 0.00 ? 46  LYS A HD2  3  
ATOM   2972  H  HD3  . LYS A 1 46 ? 2.708   1.066   -2.932  1.00 0.00 ? 46  LYS A HD3  3  
ATOM   2973  H  HE2  . LYS A 1 46 ? 2.461   1.621   -0.678  1.00 0.00 ? 46  LYS A HE2  3  
ATOM   2974  H  HE3  . LYS A 1 46 ? 1.484   2.821   -1.522  1.00 0.00 ? 46  LYS A HE3  3  
ATOM   2975  H  HZ1  . LYS A 1 46 ? -0.029  2.191   0.003   1.00 0.00 ? 46  LYS A HZ1  3  
ATOM   2976  H  HZ2  . LYS A 1 46 ? 0.656   0.663   0.241   1.00 0.00 ? 46  LYS A HZ2  3  
ATOM   2977  H  HZ3  . LYS A 1 46 ? -0.336  0.944   -1.099  1.00 0.00 ? 46  LYS A HZ3  3  
ATOM   2978  N  N    . ARG A 1 47 ? 0.538   5.443   -4.528  1.00 0.00 ? 47  ARG A N    3  
ATOM   2979  C  CA   . ARG A 1 47 ? 0.775   6.881   -4.563  1.00 0.00 ? 47  ARG A CA   3  
ATOM   2980  C  C    . ARG A 1 47 ? 1.431   7.356   -3.270  1.00 0.00 ? 47  ARG A C    3  
ATOM   2981  O  O    . ARG A 1 47 ? 1.128   6.856   -2.187  1.00 0.00 ? 47  ARG A O    3  
ATOM   2982  C  CB   . ARG A 1 47 ? -0.541  7.630   -4.784  1.00 0.00 ? 47  ARG A CB   3  
ATOM   2983  C  CG   . ARG A 1 47 ? -1.221  7.291   -6.101  1.00 0.00 ? 47  ARG A CG   3  
ATOM   2984  C  CD   . ARG A 1 47 ? -2.644  7.825   -6.146  1.00 0.00 ? 47  ARG A CD   3  
ATOM   2985  N  NE   . ARG A 1 47 ? -2.681  9.285   -6.142  1.00 0.00 ? 47  ARG A NE   3  
ATOM   2986  C  CZ   . ARG A 1 47 ? -2.583  10.026  -7.241  1.00 0.00 ? 47  ARG A CZ   3  
ATOM   2987  N  NH1  . ARG A 1 47 ? -2.443  9.446   -8.425  1.00 0.00 ? 47  ARG A NH1  3  
ATOM   2988  N  NH2  . ARG A 1 47 ? -2.625  11.349  -7.156  1.00 0.00 ? 47  ARG A NH2  3  
ATOM   2989  H  H    . ARG A 1 47 ? 0.312   5.017   -3.674  1.00 0.00 ? 47  ARG A H    3  
ATOM   2990  H  HA   . ARG A 1 47 ? 1.440   7.088   -5.388  1.00 0.00 ? 47  ARG A HA   3  
ATOM   2991  H  HB2  . ARG A 1 47 ? -1.220  7.387   -3.981  1.00 0.00 ? 47  ARG A HB2  3  
ATOM   2992  H  HB3  . ARG A 1 47 ? -0.343  8.691   -4.769  1.00 0.00 ? 47  ARG A HB3  3  
ATOM   2993  H  HG2  . ARG A 1 47 ? -0.657  7.731   -6.910  1.00 0.00 ? 47  ARG A HG2  3  
ATOM   2994  H  HG3  . ARG A 1 47 ? -1.244  6.218   -6.217  1.00 0.00 ? 47  ARG A HG3  3  
ATOM   2995  H  HD2  . ARG A 1 47 ? -3.121  7.465   -7.046  1.00 0.00 ? 47  ARG A HD2  3  
ATOM   2996  H  HD3  . ARG A 1 47 ? -3.179  7.458   -5.284  1.00 0.00 ? 47  ARG A HD3  3  
ATOM   2997  H  HE   . ARG A 1 47 ? -2.784  9.734   -5.278  1.00 0.00 ? 47  ARG A HE   3  
ATOM   2998  H  HH11 . ARG A 1 47 ? -2.412  8.449   -8.492  1.00 0.00 ? 47  ARG A HH11 3  
ATOM   2999  H  HH12 . ARG A 1 47 ? -2.370  10.006  -9.251  1.00 0.00 ? 47  ARG A HH12 3  
ATOM   3000  H  HH21 . ARG A 1 47 ? -2.731  11.790  -6.265  1.00 0.00 ? 47  ARG A HH21 3  
ATOM   3001  H  HH22 . ARG A 1 47 ? -2.551  11.906  -7.983  1.00 0.00 ? 47  ARG A HH22 3  
ATOM   3002  N  N    . PHE A 1 48 ? 2.334   8.324   -3.392  1.00 0.00 ? 48  PHE A N    3  
ATOM   3003  C  CA   . PHE A 1 48 ? 3.035   8.866   -2.234  1.00 0.00 ? 48  PHE A CA   3  
ATOM   3004  C  C    . PHE A 1 48 ? 3.005   10.391  -2.244  1.00 0.00 ? 48  PHE A C    3  
ATOM   3005  O  O    . PHE A 1 48 ? 2.893   11.012  -3.300  1.00 0.00 ? 48  PHE A O    3  
ATOM   3006  C  CB   . PHE A 1 48 ? 4.484   8.373   -2.212  1.00 0.00 ? 48  PHE A CB   3  
ATOM   3007  C  CG   . PHE A 1 48 ? 4.608   6.878   -2.159  1.00 0.00 ? 48  PHE A CG   3  
ATOM   3008  C  CD1  . PHE A 1 48 ? 4.153   6.093   -3.207  1.00 0.00 ? 48  PHE A CD1  3  
ATOM   3009  C  CD2  . PHE A 1 48 ? 5.180   6.255   -1.061  1.00 0.00 ? 48  PHE A CD2  3  
ATOM   3010  C  CE1  . PHE A 1 48 ? 4.265   4.717   -3.159  1.00 0.00 ? 48  PHE A CE1  3  
ATOM   3011  C  CE2  . PHE A 1 48 ? 5.295   4.879   -1.008  1.00 0.00 ? 48  PHE A CE2  3  
ATOM   3012  C  CZ   . PHE A 1 48 ? 4.838   4.109   -2.059  1.00 0.00 ? 48  PHE A CZ   3  
ATOM   3013  H  H    . PHE A 1 48 ? 2.533   8.682   -4.283  1.00 0.00 ? 48  PHE A H    3  
ATOM   3014  H  HA   . PHE A 1 48 ? 2.531   8.513   -1.348  1.00 0.00 ? 48  PHE A HA   3  
ATOM   3015  H  HB2  . PHE A 1 48 ? 4.986   8.716   -3.105  1.00 0.00 ? 48  PHE A HB2  3  
ATOM   3016  H  HB3  . PHE A 1 48 ? 4.981   8.780   -1.345  1.00 0.00 ? 48  PHE A HB3  3  
ATOM   3017  H  HD1  . PHE A 1 48 ? 3.705   6.567   -4.068  1.00 0.00 ? 48  PHE A HD1  3  
ATOM   3018  H  HD2  . PHE A 1 48 ? 5.538   6.858   -0.238  1.00 0.00 ? 48  PHE A HD2  3  
ATOM   3019  H  HE1  . PHE A 1 48 ? 3.907   4.117   -3.983  1.00 0.00 ? 48  PHE A HE1  3  
ATOM   3020  H  HE2  . PHE A 1 48 ? 5.744   4.407   -0.146  1.00 0.00 ? 48  PHE A HE2  3  
ATOM   3021  H  HZ   . PHE A 1 48 ? 4.927   3.033   -2.020  1.00 0.00 ? 48  PHE A HZ   3  
ATOM   3022  N  N    . GLU A 1 49 ? 3.104   10.987  -1.060  1.00 0.00 ? 49  GLU A N    3  
ATOM   3023  C  CA   . GLU A 1 49 ? 3.086   12.439  -0.933  1.00 0.00 ? 49  GLU A CA   3  
ATOM   3024  C  C    . GLU A 1 49 ? 4.255   13.066  -1.687  1.00 0.00 ? 49  GLU A C    3  
ATOM   3025  O  O    . GLU A 1 49 ? 4.230   14.251  -2.021  1.00 0.00 ? 49  GLU A O    3  
ATOM   3026  C  CB   . GLU A 1 49 ? 3.141   12.845  0.542   1.00 0.00 ? 49  GLU A CB   3  
ATOM   3027  C  CG   . GLU A 1 49 ? 4.143   12.045  1.356   1.00 0.00 ? 49  GLU A CG   3  
ATOM   3028  C  CD   . GLU A 1 49 ? 4.556   12.753  2.632   1.00 0.00 ? 49  GLU A CD   3  
ATOM   3029  O  OE1  . GLU A 1 49 ? 5.003   13.916  2.547   1.00 0.00 ? 49  GLU A OE1  3  
ATOM   3030  O  OE2  . GLU A 1 49 ? 4.431   12.145  3.716   1.00 0.00 ? 49  GLU A OE2  3  
ATOM   3031  H  H    . GLU A 1 49 ? 3.190   10.437  -0.253  1.00 0.00 ? 49  GLU A H    3  
ATOM   3032  H  HA   . GLU A 1 49 ? 2.163   12.799  -1.361  1.00 0.00 ? 49  GLU A HA   3  
ATOM   3033  H  HB2  . GLU A 1 49 ? 3.407   13.890  0.606   1.00 0.00 ? 49  GLU A HB2  3  
ATOM   3034  H  HB3  . GLU A 1 49 ? 2.162   12.705  0.977   1.00 0.00 ? 49  GLU A HB3  3  
ATOM   3035  H  HG2  . GLU A 1 49 ? 3.701   11.096  1.617   1.00 0.00 ? 49  GLU A HG2  3  
ATOM   3036  H  HG3  . GLU A 1 49 ? 5.024   11.877  0.754   1.00 0.00 ? 49  GLU A HG3  3  
ATOM   3037  N  N    . LYS A 1 50 ? 5.279   12.262  -1.953  1.00 0.00 ? 50  LYS A N    3  
ATOM   3038  C  CA   . LYS A 1 50 ? 6.458   12.736  -2.669  1.00 0.00 ? 50  LYS A CA   3  
ATOM   3039  C  C    . LYS A 1 50 ? 7.171   11.581  -3.366  1.00 0.00 ? 50  LYS A C    3  
ATOM   3040  O  O    . LYS A 1 50 ? 6.927   10.408  -3.083  1.00 0.00 ? 50  LYS A O    3  
ATOM   3041  C  CB   . LYS A 1 50 ? 7.419   13.434  -1.704  1.00 0.00 ? 50  LYS A CB   3  
ATOM   3042  C  CG   . LYS A 1 50 ? 7.234   13.020  -0.255  1.00 0.00 ? 50  LYS A CG   3  
ATOM   3043  C  CD   . LYS A 1 50 ? 8.258   13.685  0.650   1.00 0.00 ? 50  LYS A CD   3  
ATOM   3044  C  CE   . LYS A 1 50 ? 9.598   12.967  0.596   1.00 0.00 ? 50  LYS A CE   3  
ATOM   3045  N  NZ   . LYS A 1 50 ? 10.579  13.551  1.553   1.00 0.00 ? 50  LYS A NZ   3  
ATOM   3046  H  H    . LYS A 1 50 ? 5.240   11.327  -1.661  1.00 0.00 ? 50  LYS A H    3  
ATOM   3047  H  HA   . LYS A 1 50 ? 6.131   13.444  -3.415  1.00 0.00 ? 50  LYS A HA   3  
ATOM   3048  H  HB2  . LYS A 1 50 ? 8.433   13.205  -1.996  1.00 0.00 ? 50  LYS A HB2  3  
ATOM   3049  H  HB3  . LYS A 1 50 ? 7.267   14.502  -1.774  1.00 0.00 ? 50  LYS A HB3  3  
ATOM   3050  H  HG2  . LYS A 1 50 ? 6.245   13.307  0.069   1.00 0.00 ? 50  LYS A HG2  3  
ATOM   3051  H  HG3  . LYS A 1 50 ? 7.343   11.948  -0.180  1.00 0.00 ? 50  LYS A HG3  3  
ATOM   3052  H  HD2  . LYS A 1 50 ? 8.398   14.707  0.332   1.00 0.00 ? 50  LYS A HD2  3  
ATOM   3053  H  HD3  . LYS A 1 50 ? 7.892   13.669  1.666   1.00 0.00 ? 50  LYS A HD3  3  
ATOM   3054  H  HE2  . LYS A 1 50 ? 9.445   11.927  0.841   1.00 0.00 ? 50  LYS A HE2  3  
ATOM   3055  H  HE3  . LYS A 1 50 ? 9.994   13.047  -0.406  1.00 0.00 ? 50  LYS A HE3  3  
ATOM   3056  H  HZ1  . LYS A 1 50 ? 10.161  13.605  2.504   1.00 0.00 ? 50  LYS A HZ1  3  
ATOM   3057  H  HZ2  . LYS A 1 50 ? 10.847  14.509  1.250   1.00 0.00 ? 50  LYS A HZ2  3  
ATOM   3058  H  HZ3  . LYS A 1 50 ? 11.434  12.960  1.594   1.00 0.00 ? 50  LYS A HZ3  3  
ATOM   3059  N  N    . PRO A 1 51 ? 8.074   11.919  -4.298  1.00 0.00 ? 51  PRO A N    3  
ATOM   3060  C  CA   . PRO A 1 51 ? 8.843   10.924  -5.053  1.00 0.00 ? 51  PRO A CA   3  
ATOM   3061  C  C    . PRO A 1 51 ? 9.865   10.200  -4.184  1.00 0.00 ? 51  PRO A C    3  
ATOM   3062  O  O    . PRO A 1 51 ? 10.008  8.980   -4.264  1.00 0.00 ? 51  PRO A O    3  
ATOM   3063  C  CB   . PRO A 1 51 ? 9.548   11.760  -6.124  1.00 0.00 ? 51  PRO A CB   3  
ATOM   3064  C  CG   . PRO A 1 51 ? 9.644   13.126  -5.537  1.00 0.00 ? 51  PRO A CG   3  
ATOM   3065  C  CD   . PRO A 1 51 ? 8.416   13.298  -4.686  1.00 0.00 ? 51  PRO A CD   3  
ATOM   3066  H  HA   . PRO A 1 51 ? 8.196   10.200  -5.526  1.00 0.00 ? 51  PRO A HA   3  
ATOM   3067  H  HB2  . PRO A 1 51 ? 10.526  11.344  -6.322  1.00 0.00 ? 51  PRO A HB2  3  
ATOM   3068  H  HB3  . PRO A 1 51 ? 8.961   11.760  -7.030  1.00 0.00 ? 51  PRO A HB3  3  
ATOM   3069  H  HG2  . PRO A 1 51 ? 10.534  13.204  -4.932  1.00 0.00 ? 51  PRO A HG2  3  
ATOM   3070  H  HG3  . PRO A 1 51 ? 9.659   13.863  -6.326  1.00 0.00 ? 51  PRO A HG3  3  
ATOM   3071  H  HD2  . PRO A 1 51 ? 8.641   13.898  -3.817  1.00 0.00 ? 51  PRO A HD2  3  
ATOM   3072  H  HD3  . PRO A 1 51 ? 7.618   13.745  -5.260  1.00 0.00 ? 51  PRO A HD3  3  
ATOM   3073  N  N    . ASP A 1 52 ? 10.572  10.958  -3.354  1.00 0.00 ? 52  ASP A N    3  
ATOM   3074  C  CA   . ASP A 1 52 ? 11.581  10.388  -2.468  1.00 0.00 ? 52  ASP A CA   3  
ATOM   3075  C  C    . ASP A 1 52 ? 11.081  9.090   -1.840  1.00 0.00 ? 52  ASP A C    3  
ATOM   3076  O  O    . ASP A 1 52 ? 11.845  8.143   -1.658  1.00 0.00 ? 52  ASP A O    3  
ATOM   3077  C  CB   . ASP A 1 52 ? 11.953  11.388  -1.373  1.00 0.00 ? 52  ASP A CB   3  
ATOM   3078  C  CG   . ASP A 1 52 ? 13.223  11.000  -0.641  1.00 0.00 ? 52  ASP A CG   3  
ATOM   3079  O  OD1  . ASP A 1 52 ? 13.545  9.794   -0.612  1.00 0.00 ? 52  ASP A OD1  3  
ATOM   3080  O  OD2  . ASP A 1 52 ? 13.895  11.902  -0.098  1.00 0.00 ? 52  ASP A OD2  3  
ATOM   3081  H  H    . ASP A 1 52 ? 10.412  11.925  -3.336  1.00 0.00 ? 52  ASP A H    3  
ATOM   3082  H  HA   . ASP A 1 52 ? 12.458  10.172  -3.059  1.00 0.00 ? 52  ASP A HA   3  
ATOM   3083  H  HB2  . ASP A 1 52 ? 12.100  12.361  -1.818  1.00 0.00 ? 52  ASP A HB2  3  
ATOM   3084  H  HB3  . ASP A 1 52 ? 11.148  11.443  -0.655  1.00 0.00 ? 52  ASP A HB3  3  
ATOM   3085  N  N    . SER A 1 53 ? 9.794   9.055   -1.511  1.00 0.00 ? 53  SER A N    3  
ATOM   3086  C  CA   . SER A 1 53 ? 9.193   7.876   -0.899  1.00 0.00 ? 53  SER A CA   3  
ATOM   3087  C  C    . SER A 1 53 ? 8.830   6.840   -1.958  1.00 0.00 ? 53  SER A C    3  
ATOM   3088  O  O    . SER A 1 53 ? 8.832   5.637   -1.694  1.00 0.00 ? 53  SER A O    3  
ATOM   3089  C  CB   . SER A 1 53 ? 7.946   8.267   -0.104  1.00 0.00 ? 53  SER A CB   3  
ATOM   3090  O  OG   . SER A 1 53 ? 8.296   8.929   1.100   1.00 0.00 ? 53  SER A OG   3  
ATOM   3091  H  H    . SER A 1 53 ? 9.235   9.843   -1.682  1.00 0.00 ? 53  SER A H    3  
ATOM   3092  H  HA   . SER A 1 53 ? 9.919   7.446   -0.226  1.00 0.00 ? 53  SER A HA   3  
ATOM   3093  H  HB2  . SER A 1 53 ? 7.335   8.928   -0.699  1.00 0.00 ? 53  SER A HB2  3  
ATOM   3094  H  HB3  . SER A 1 53 ? 7.383   7.377   0.139   1.00 0.00 ? 53  SER A HB3  3  
ATOM   3095  H  HG   . SER A 1 53 ? 8.313   9.877   0.950   1.00 0.00 ? 53  SER A HG   3  
ATOM   3096  N  N    . VAL A 1 54 ? 8.517   7.315   -3.160  1.00 0.00 ? 54  VAL A N    3  
ATOM   3097  C  CA   . VAL A 1 54 ? 8.152   6.431   -4.261  1.00 0.00 ? 54  VAL A CA   3  
ATOM   3098  C  C    . VAL A 1 54 ? 9.360   5.645   -4.758  1.00 0.00 ? 54  VAL A C    3  
ATOM   3099  O  O    . VAL A 1 54 ? 9.233   4.501   -5.192  1.00 0.00 ? 54  VAL A O    3  
ATOM   3100  C  CB   . VAL A 1 54 ? 7.547   7.220   -5.437  1.00 0.00 ? 54  VAL A CB   3  
ATOM   3101  C  CG1  . VAL A 1 54 ? 7.917   6.571   -6.762  1.00 0.00 ? 54  VAL A CG1  3  
ATOM   3102  C  CG2  . VAL A 1 54 ? 6.037   7.324   -5.288  1.00 0.00 ? 54  VAL A CG2  3  
ATOM   3103  H  H    . VAL A 1 54 ? 8.533   8.283   -3.310  1.00 0.00 ? 54  VAL A H    3  
ATOM   3104  H  HA   . VAL A 1 54 ? 7.408   5.737   -3.899  1.00 0.00 ? 54  VAL A HA   3  
ATOM   3105  H  HB   . VAL A 1 54 ? 7.959   8.219   -5.424  1.00 0.00 ? 54  VAL A HB   3  
ATOM   3106  H  HG11 . VAL A 1 54 ? 8.958   6.760   -6.977  1.00 0.00 ? 54  VAL A HG11 3  
ATOM   3107  H  HG12 . VAL A 1 54 ? 7.748   5.506   -6.701  1.00 0.00 ? 54  VAL A HG12 3  
ATOM   3108  H  HG13 . VAL A 1 54 ? 7.306   6.988   -7.549  1.00 0.00 ? 54  VAL A HG13 3  
ATOM   3109  H  HG21 . VAL A 1 54 ? 5.696   8.250   -5.725  1.00 0.00 ? 54  VAL A HG21 3  
ATOM   3110  H  HG22 . VAL A 1 54 ? 5.567   6.493   -5.793  1.00 0.00 ? 54  VAL A HG22 3  
ATOM   3111  H  HG23 . VAL A 1 54 ? 5.776   7.302   -4.240  1.00 0.00 ? 54  VAL A HG23 3  
ATOM   3112  N  N    . ALA A 1 55 ? 10.533  6.268   -4.690  1.00 0.00 ? 55  ALA A N    3  
ATOM   3113  C  CA   . ALA A 1 55 ? 11.765  5.626   -5.131  1.00 0.00 ? 55  ALA A CA   3  
ATOM   3114  C  C    . ALA A 1 55 ? 12.179  4.515   -4.172  1.00 0.00 ? 55  ALA A C    3  
ATOM   3115  O  O    . ALA A 1 55 ? 12.648  3.459   -4.595  1.00 0.00 ? 55  ALA A O    3  
ATOM   3116  C  CB   . ALA A 1 55 ? 12.878  6.655   -5.263  1.00 0.00 ? 55  ALA A CB   3  
ATOM   3117  H  H    . ALA A 1 55 ? 10.570  7.180   -4.334  1.00 0.00 ? 55  ALA A H    3  
ATOM   3118  H  HA   . ALA A 1 55 ? 11.587  5.197   -6.107  1.00 0.00 ? 55  ALA A HA   3  
ATOM   3119  H  HB1  . ALA A 1 55 ? 12.652  7.510   -4.642  1.00 0.00 ? 55  ALA A HB1  3  
ATOM   3120  H  HB2  . ALA A 1 55 ? 13.813  6.216   -4.946  1.00 0.00 ? 55  ALA A HB2  3  
ATOM   3121  H  HB3  . ALA A 1 55 ? 12.958  6.968   -6.293  1.00 0.00 ? 55  ALA A HB3  3  
ATOM   3122  N  N    . ALA A 1 56 ? 12.004  4.762   -2.878  1.00 0.00 ? 56  ALA A N    3  
ATOM   3123  C  CA   . ALA A 1 56 ? 12.358  3.782   -1.859  1.00 0.00 ? 56  ALA A CA   3  
ATOM   3124  C  C    . ALA A 1 56 ? 11.362  2.627   -1.837  1.00 0.00 ? 56  ALA A C    3  
ATOM   3125  O  O    . ALA A 1 56 ? 11.742  1.470   -1.656  1.00 0.00 ? 56  ALA A O    3  
ATOM   3126  C  CB   . ALA A 1 56 ? 12.430  4.445   -0.491  1.00 0.00 ? 56  ALA A CB   3  
ATOM   3127  H  H    . ALA A 1 56 ? 11.626  5.623   -2.602  1.00 0.00 ? 56  ALA A H    3  
ATOM   3128  H  HA   . ALA A 1 56 ? 13.339  3.394   -2.095  1.00 0.00 ? 56  ALA A HA   3  
ATOM   3129  H  HB1  . ALA A 1 56 ? 13.462  4.645   -0.243  1.00 0.00 ? 56  ALA A HB1  3  
ATOM   3130  H  HB2  . ALA A 1 56 ? 11.878  5.373   -0.512  1.00 0.00 ? 56  ALA A HB2  3  
ATOM   3131  H  HB3  . ALA A 1 56 ? 12.002  3.787   0.250   1.00 0.00 ? 56  ALA A HB3  3  
ATOM   3132  N  N    . HIS A 1 57 ? 10.086  2.949   -2.022  1.00 0.00 ? 57  HIS A N    3  
ATOM   3133  C  CA   . HIS A 1 57 ? 9.035   1.938   -2.024  1.00 0.00 ? 57  HIS A CA   3  
ATOM   3134  C  C    . HIS A 1 57 ? 9.334   0.845   -3.046  1.00 0.00 ? 57  HIS A C    3  
ATOM   3135  O  O    . HIS A 1 57 ? 9.007   -0.322  -2.835  1.00 0.00 ? 57  HIS A O    3  
ATOM   3136  C  CB   . HIS A 1 57 ? 7.681   2.580   -2.328  1.00 0.00 ? 57  HIS A CB   3  
ATOM   3137  C  CG   . HIS A 1 57 ? 6.697   1.637   -2.949  1.00 0.00 ? 57  HIS A CG   3  
ATOM   3138  N  ND1  . HIS A 1 57 ? 6.157   0.562   -2.275  1.00 0.00 ? 57  HIS A ND1  3  
ATOM   3139  C  CD2  . HIS A 1 57 ? 6.154   1.613   -4.188  1.00 0.00 ? 57  HIS A CD2  3  
ATOM   3140  C  CE1  . HIS A 1 57 ? 5.326   -0.084  -3.074  1.00 0.00 ? 57  HIS A CE1  3  
ATOM   3141  N  NE2  . HIS A 1 57 ? 5.306   0.535   -4.241  1.00 0.00 ? 57  HIS A NE2  3  
ATOM   3142  H  H    . HIS A 1 57 ? 9.846   3.889   -2.161  1.00 0.00 ? 57  HIS A H    3  
ATOM   3143  H  HA   . HIS A 1 57 ? 9.001   1.494   -1.041  1.00 0.00 ? 57  HIS A HA   3  
ATOM   3144  H  HB2  . HIS A 1 57 ? 7.251   2.949   -1.408  1.00 0.00 ? 57  HIS A HB2  3  
ATOM   3145  H  HB3  . HIS A 1 57 ? 7.826   3.406   -3.009  1.00 0.00 ? 57  HIS A HB3  3  
ATOM   3146  H  HD1  . HIS A 1 57 ? 6.354   0.308   -1.350  1.00 0.00 ? 57  HIS A HD1  3  
ATOM   3147  H  HD2  . HIS A 1 57 ? 6.352   2.313   -4.989  1.00 0.00 ? 57  HIS A HD2  3  
ATOM   3148  H  HE1  . HIS A 1 57 ? 4.759   -0.966  -2.818  1.00 0.00 ? 57  HIS A HE1  3  
ATOM   3149  N  N    . ARG A 1 58 ? 9.957   1.233   -4.154  1.00 0.00 ? 58  ARG A N    3  
ATOM   3150  C  CA   . ARG A 1 58 ? 10.298  0.287   -5.210  1.00 0.00 ? 58  ARG A CA   3  
ATOM   3151  C  C    . ARG A 1 58 ? 11.471  -0.595  -4.792  1.00 0.00 ? 58  ARG A C    3  
ATOM   3152  O  O    . ARG A 1 58 ? 11.693  -1.662  -5.363  1.00 0.00 ? 58  ARG A O    3  
ATOM   3153  C  CB   . ARG A 1 58 ? 10.641  1.032   -6.501  1.00 0.00 ? 58  ARG A CB   3  
ATOM   3154  C  CG   . ARG A 1 58 ? 9.518   1.923   -7.007  1.00 0.00 ? 58  ARG A CG   3  
ATOM   3155  C  CD   . ARG A 1 58 ? 10.060  3.140   -7.741  1.00 0.00 ? 58  ARG A CD   3  
ATOM   3156  N  NE   . ARG A 1 58 ? 10.949  2.767   -8.837  1.00 0.00 ? 58  ARG A NE   3  
ATOM   3157  C  CZ   . ARG A 1 58 ? 11.281  3.589   -9.827  1.00 0.00 ? 58  ARG A CZ   3  
ATOM   3158  N  NH1  . ARG A 1 58 ? 10.799  4.824   -9.856  1.00 0.00 ? 58  ARG A NH1  3  
ATOM   3159  N  NH2  . ARG A 1 58 ? 12.096  3.176   -10.789 1.00 0.00 ? 58  ARG A NH2  3  
ATOM   3160  H  H    . ARG A 1 58 ? 10.192  2.178   -4.265  1.00 0.00 ? 58  ARG A H    3  
ATOM   3161  H  HA   . ARG A 1 58 ? 9.436   -0.340  -5.385  1.00 0.00 ? 58  ARG A HA   3  
ATOM   3162  H  HB2  . ARG A 1 58 ? 11.510  1.650   -6.326  1.00 0.00 ? 58  ARG A HB2  3  
ATOM   3163  H  HB3  . ARG A 1 58 ? 10.872  0.310   -7.269  1.00 0.00 ? 58  ARG A HB3  3  
ATOM   3164  H  HG2  . ARG A 1 58 ? 8.898   1.354   -7.685  1.00 0.00 ? 58  ARG A HG2  3  
ATOM   3165  H  HG3  . ARG A 1 58 ? 8.927   2.253   -6.166  1.00 0.00 ? 58  ARG A HG3  3  
ATOM   3166  H  HD2  . ARG A 1 58 ? 9.229   3.702   -8.139  1.00 0.00 ? 58  ARG A HD2  3  
ATOM   3167  H  HD3  . ARG A 1 58 ? 10.605  3.753   -7.039  1.00 0.00 ? 58  ARG A HD3  3  
ATOM   3168  H  HE   . ARG A 1 58 ? 11.317  1.859   -8.835  1.00 0.00 ? 58  ARG A HE   3  
ATOM   3169  H  HH11 . ARG A 1 58 ? 10.185  5.138   -9.132  1.00 0.00 ? 58  ARG A HH11 3  
ATOM   3170  H  HH12 . ARG A 1 58 ? 11.051  5.441   -10.602 1.00 0.00 ? 58  ARG A HH12 3  
ATOM   3171  H  HH21 . ARG A 1 58 ? 12.461  2.246   -10.769 1.00 0.00 ? 58  ARG A HH21 3  
ATOM   3172  H  HH22 . ARG A 1 58 ? 12.345  3.795   -11.533 1.00 0.00 ? 58  ARG A HH22 3  
ATOM   3173  N  N    . SER A 1 59 ? 12.219  -0.140  -3.792  1.00 0.00 ? 59  SER A N    3  
ATOM   3174  C  CA   . SER A 1 59 ? 13.372  -0.885  -3.300  1.00 0.00 ? 59  SER A CA   3  
ATOM   3175  C  C    . SER A 1 59 ? 12.978  -1.791  -2.138  1.00 0.00 ? 59  SER A C    3  
ATOM   3176  O  O    . SER A 1 59 ? 13.780  -2.596  -1.662  1.00 0.00 ? 59  SER A O    3  
ATOM   3177  C  CB   . SER A 1 59 ? 14.477  0.077   -2.859  1.00 0.00 ? 59  SER A CB   3  
ATOM   3178  O  OG   . SER A 1 59 ? 15.501  -0.608  -2.159  1.00 0.00 ? 59  SER A OG   3  
ATOM   3179  H  H    . SER A 1 59 ? 11.992  0.719   -3.377  1.00 0.00 ? 59  SER A H    3  
ATOM   3180  H  HA   . SER A 1 59 ? 13.742  -1.497  -4.109  1.00 0.00 ? 59  SER A HA   3  
ATOM   3181  H  HB2  . SER A 1 59 ? 14.907  0.551   -3.729  1.00 0.00 ? 59  SER A HB2  3  
ATOM   3182  H  HB3  . SER A 1 59 ? 14.056  0.831   -2.210  1.00 0.00 ? 59  SER A HB3  3  
ATOM   3183  H  HG   . SER A 1 59 ? 16.141  0.025   -1.827  1.00 0.00 ? 59  SER A HG   3  
ATOM   3184  N  N    . LYS A 1 60 ? 11.737  -1.655  -1.684  1.00 0.00 ? 60  LYS A N    3  
ATOM   3185  C  CA   . LYS A 1 60 ? 11.233  -2.461  -0.578  1.00 0.00 ? 60  LYS A CA   3  
ATOM   3186  C  C    . LYS A 1 60 ? 10.059  -3.325  -1.027  1.00 0.00 ? 60  LYS A C    3  
ATOM   3187  O  O    . LYS A 1 60 ? 9.854   -4.425  -0.513  1.00 0.00 ? 60  LYS A O    3  
ATOM   3188  C  CB   . LYS A 1 60 ? 10.803  -1.560  0.582   1.00 0.00 ? 60  LYS A CB   3  
ATOM   3189  C  CG   . LYS A 1 60 ? 11.960  -1.079  1.440   1.00 0.00 ? 60  LYS A CG   3  
ATOM   3190  C  CD   . LYS A 1 60 ? 11.470  -0.356  2.683   1.00 0.00 ? 60  LYS A CD   3  
ATOM   3191  C  CE   . LYS A 1 60 ? 10.854  -1.322  3.684   1.00 0.00 ? 60  LYS A CE   3  
ATOM   3192  N  NZ   . LYS A 1 60 ? 10.687  -0.698  5.026   1.00 0.00 ? 60  LYS A NZ   3  
ATOM   3193  H  H    . LYS A 1 60 ? 11.144  -0.996  -2.104  1.00 0.00 ? 60  LYS A H    3  
ATOM   3194  H  HA   . LYS A 1 60 ? 12.032  -3.105  -0.246  1.00 0.00 ? 60  LYS A HA   3  
ATOM   3195  H  HB2  . LYS A 1 60 ? 10.295  -0.695  0.181   1.00 0.00 ? 60  LYS A HB2  3  
ATOM   3196  H  HB3  . LYS A 1 60 ? 10.118  -2.108  1.213   1.00 0.00 ? 60  LYS A HB3  3  
ATOM   3197  H  HG2  . LYS A 1 60 ? 12.551  -1.931  1.742   1.00 0.00 ? 60  LYS A HG2  3  
ATOM   3198  H  HG3  . LYS A 1 60 ? 12.571  -0.403  0.858   1.00 0.00 ? 60  LYS A HG3  3  
ATOM   3199  H  HD2  . LYS A 1 60 ? 12.304  0.146   3.150   1.00 0.00 ? 60  LYS A HD2  3  
ATOM   3200  H  HD3  . LYS A 1 60 ? 10.725  0.373   2.395   1.00 0.00 ? 60  LYS A HD3  3  
ATOM   3201  H  HE2  . LYS A 1 60 ? 9.888   -1.632  3.317   1.00 0.00 ? 60  LYS A HE2  3  
ATOM   3202  H  HE3  . LYS A 1 60 ? 11.498  -2.184  3.774   1.00 0.00 ? 60  LYS A HE3  3  
ATOM   3203  H  HZ1  . LYS A 1 60 ? 11.519  -0.898  5.618   1.00 0.00 ? 60  LYS A HZ1  3  
ATOM   3204  H  HZ2  . LYS A 1 60 ? 9.842   -1.081  5.495   1.00 0.00 ? 60  LYS A HZ2  3  
ATOM   3205  H  HZ3  . LYS A 1 60 ? 10.582  0.332   4.931   1.00 0.00 ? 60  LYS A HZ3  3  
ATOM   3206  N  N    . SER A 1 61 ? 9.291   -2.821  -1.988  1.00 0.00 ? 61  SER A N    3  
ATOM   3207  C  CA   . SER A 1 61 ? 8.136   -3.547  -2.503  1.00 0.00 ? 61  SER A CA   3  
ATOM   3208  C  C    . SER A 1 61 ? 8.406   -4.068  -3.912  1.00 0.00 ? 61  SER A C    3  
ATOM   3209  O  O    . SER A 1 61 ? 7.894   -5.116  -4.308  1.00 0.00 ? 61  SER A O    3  
ATOM   3210  C  CB   . SER A 1 61 ? 6.901   -2.645  -2.509  1.00 0.00 ? 61  SER A CB   3  
ATOM   3211  O  OG   . SER A 1 61 ? 6.196   -2.737  -1.283  1.00 0.00 ? 61  SER A OG   3  
ATOM   3212  H  H    . SER A 1 61 ? 9.506   -1.939  -2.357  1.00 0.00 ? 61  SER A H    3  
ATOM   3213  H  HA   . SER A 1 61 ? 7.954   -4.388  -1.850  1.00 0.00 ? 61  SER A HA   3  
ATOM   3214  H  HB2  . SER A 1 61 ? 7.207   -1.620  -2.657  1.00 0.00 ? 61  SER A HB2  3  
ATOM   3215  H  HB3  . SER A 1 61 ? 6.244   -2.944  -3.313  1.00 0.00 ? 61  SER A HB3  3  
ATOM   3216  H  HG   . SER A 1 61 ? 5.283   -2.472  -1.418  1.00 0.00 ? 61  SER A HG   3  
ATOM   3217  N  N    . HIS A 1 62 ? 9.215   -3.328  -4.664  1.00 0.00 ? 62  HIS A N    3  
ATOM   3218  C  CA   . HIS A 1 62 ? 9.554   -3.715  -6.029  1.00 0.00 ? 62  HIS A CA   3  
ATOM   3219  C  C    . HIS A 1 62 ? 11.054  -3.958  -6.168  1.00 0.00 ? 62  HIS A C    3  
ATOM   3220  O  O    . HIS A 1 62 ? 11.657  -3.695  -7.208  1.00 0.00 ? 62  HIS A O    3  
ATOM   3221  C  CB   . HIS A 1 62 ? 9.109   -2.633  -7.014  1.00 0.00 ? 62  HIS A CB   3  
ATOM   3222  C  CG   . HIS A 1 62 ? 7.631   -2.391  -7.009  1.00 0.00 ? 62  HIS A CG   3  
ATOM   3223  N  ND1  . HIS A 1 62 ? 6.712   -3.334  -7.419  1.00 0.00 ? 62  HIS A ND1  3  
ATOM   3224  C  CD2  . HIS A 1 62 ? 6.913   -1.305  -6.638  1.00 0.00 ? 62  HIS A CD2  3  
ATOM   3225  C  CE1  . HIS A 1 62 ? 5.493   -2.837  -7.303  1.00 0.00 ? 62  HIS A CE1  3  
ATOM   3226  N  NE2  . HIS A 1 62 ? 5.587   -1.608  -6.830  1.00 0.00 ? 62  HIS A NE2  3  
ATOM   3227  H  H    . HIS A 1 62 ? 9.592   -2.504  -4.293  1.00 0.00 ? 62  HIS A H    3  
ATOM   3228  H  HA   . HIS A 1 62 ? 9.031   -4.632  -6.254  1.00 0.00 ? 62  HIS A HA   3  
ATOM   3229  H  HB2  . HIS A 1 62 ? 9.598   -1.703  -6.762  1.00 0.00 ? 62  HIS A HB2  3  
ATOM   3230  H  HB3  . HIS A 1 62 ? 9.394   -2.926  -8.014  1.00 0.00 ? 62  HIS A HB3  3  
ATOM   3231  H  HD1  . HIS A 1 62 ? 6.922   -4.232  -7.749  1.00 0.00 ? 62  HIS A HD1  3  
ATOM   3232  H  HD2  . HIS A 1 62 ? 7.308   -0.372  -6.260  1.00 0.00 ? 62  HIS A HD2  3  
ATOM   3233  H  HE1  . HIS A 1 62 ? 4.576   -3.350  -7.551  1.00 0.00 ? 62  HIS A HE1  3  
ATOM   3234  N  N    . PRO A 1 63 ? 11.672  -4.472  -5.094  1.00 0.00 ? 63  PRO A N    3  
ATOM   3235  C  CA   . PRO A 1 63 ? 13.109  -4.763  -5.071  1.00 0.00 ? 63  PRO A CA   3  
ATOM   3236  C  C    . PRO A 1 63 ? 13.477  -5.939  -5.968  1.00 0.00 ? 63  PRO A C    3  
ATOM   3237  O  O    . PRO A 1 63 ? 14.645  -6.136  -6.301  1.00 0.00 ? 63  PRO A O    3  
ATOM   3238  C  CB   . PRO A 1 63 ? 13.378  -5.104  -3.603  1.00 0.00 ? 63  PRO A CB   3  
ATOM   3239  C  CG   . PRO A 1 63 ? 12.070  -5.588  -3.080  1.00 0.00 ? 63  PRO A CG   3  
ATOM   3240  C  CD   . PRO A 1 63 ? 11.016  -4.810  -3.820  1.00 0.00 ? 63  PRO A CD   3  
ATOM   3241  H  HA   . PRO A 1 63 ? 13.693  -3.899  -5.354  1.00 0.00 ? 63  PRO A HA   3  
ATOM   3242  H  HB2  . PRO A 1 63 ? 14.137  -5.872  -3.543  1.00 0.00 ? 63  PRO A HB2  3  
ATOM   3243  H  HB3  . PRO A 1 63 ? 13.711  -4.221  -3.080  1.00 0.00 ? 63  PRO A HB3  3  
ATOM   3244  H  HG2  . PRO A 1 63 ? 11.964  -6.644  -3.276  1.00 0.00 ? 63  PRO A HG2  3  
ATOM   3245  H  HG3  . PRO A 1 63 ? 12.004  -5.393  -2.020  1.00 0.00 ? 63  PRO A HG3  3  
ATOM   3246  H  HD2  . PRO A 1 63 ? 10.143  -5.423  -3.986  1.00 0.00 ? 63  PRO A HD2  3  
ATOM   3247  H  HD3  . PRO A 1 63 ? 10.753  -3.917  -3.273  1.00 0.00 ? 63  PRO A HD3  3  
ATOM   3248  N  N    . ALA A 1 64 ? 12.473  -6.719  -6.356  1.00 0.00 ? 64  ALA A N    3  
ATOM   3249  C  CA   . ALA A 1 64 ? 12.691  -7.874  -7.217  1.00 0.00 ? 64  ALA A CA   3  
ATOM   3250  C  C    . ALA A 1 64 ? 12.531  -7.502  -8.687  1.00 0.00 ? 64  ALA A C    3  
ATOM   3251  O  O    . ALA A 1 64 ? 12.886  -8.277  -9.576  1.00 0.00 ? 64  ALA A O    3  
ATOM   3252  C  CB   . ALA A 1 64 ? 11.733  -8.997  -6.847  1.00 0.00 ? 64  ALA A CB   3  
ATOM   3253  H  H    . ALA A 1 64 ? 11.563  -6.510  -6.057  1.00 0.00 ? 64  ALA A H    3  
ATOM   3254  H  HA   . ALA A 1 64 ? 13.699  -8.227  -7.053  1.00 0.00 ? 64  ALA A HA   3  
ATOM   3255  H  HB1  . ALA A 1 64 ? 11.648  -9.684  -7.676  1.00 0.00 ? 64  ALA A HB1  3  
ATOM   3256  H  HB2  . ALA A 1 64 ? 12.109  -9.520  -5.981  1.00 0.00 ? 64  ALA A HB2  3  
ATOM   3257  H  HB3  . ALA A 1 64 ? 10.762  -8.581  -6.623  1.00 0.00 ? 64  ALA A HB3  3  
ATOM   3258  N  N    . LEU A 1 65 ? 11.995  -6.313  -8.936  1.00 0.00 ? 65  LEU A N    3  
ATOM   3259  C  CA   . LEU A 1 65 ? 11.787  -5.838  -10.300 1.00 0.00 ? 65  LEU A CA   3  
ATOM   3260  C  C    . LEU A 1 65 ? 12.938  -4.942  -10.746 1.00 0.00 ? 65  LEU A C    3  
ATOM   3261  O  O    . LEU A 1 65 ? 13.544  -5.167  -11.794 1.00 0.00 ? 65  LEU A O    3  
ATOM   3262  C  CB   . LEU A 1 65 ? 10.464  -5.075  -10.399 1.00 0.00 ? 65  LEU A CB   3  
ATOM   3263  C  CG   . LEU A 1 65 ? 9.202   -5.876  -10.076 1.00 0.00 ? 65  LEU A CG   3  
ATOM   3264  C  CD1  . LEU A 1 65 ? 7.983   -4.967  -10.057 1.00 0.00 ? 65  LEU A CD1  3  
ATOM   3265  C  CD2  . LEU A 1 65 ? 9.014   -7.003  -11.080 1.00 0.00 ? 65  LEU A CD2  3  
ATOM   3266  H  H    . LEU A 1 65 ? 11.732  -5.740  -8.186  1.00 0.00 ? 65  LEU A H    3  
ATOM   3267  H  HA   . LEU A 1 65 ? 11.746  -6.700  -10.948 1.00 0.00 ? 65  LEU A HA   3  
ATOM   3268  H  HB2  . LEU A 1 65 ? 10.511  -4.242  -9.715  1.00 0.00 ? 65  LEU A HB2  3  
ATOM   3269  H  HB3  . LEU A 1 65 ? 10.372  -4.705  -11.410 1.00 0.00 ? 65  LEU A HB3  3  
ATOM   3270  H  HG   . LEU A 1 65 ? 9.305   -6.316  -9.093  1.00 0.00 ? 65  LEU A HG   3  
ATOM   3271  H  HD11 . LEU A 1 65 ? 7.723   -4.693  -11.068 1.00 0.00 ? 65  LEU A HD11 3  
ATOM   3272  H  HD12 . LEU A 1 65 ? 8.208   -4.076  -9.489  1.00 0.00 ? 65  LEU A HD12 3  
ATOM   3273  H  HD13 . LEU A 1 65 ? 7.154   -5.486  -9.598  1.00 0.00 ? 65  LEU A HD13 3  
ATOM   3274  H  HD21 . LEU A 1 65 ? 9.166   -6.623  -12.080 1.00 0.00 ? 65  LEU A HD21 3  
ATOM   3275  H  HD22 . LEU A 1 65 ? 8.012   -7.398  -10.994 1.00 0.00 ? 65  LEU A HD22 3  
ATOM   3276  H  HD23 . LEU A 1 65 ? 9.729   -7.787  -10.881 1.00 0.00 ? 65  LEU A HD23 3  
ATOM   3277  N  N    . LEU A 1 66 ? 13.236  -3.927  -9.942  1.00 0.00 ? 66  LEU A N    3  
ATOM   3278  C  CA   . LEU A 1 66 ? 14.317  -2.997  -10.252 1.00 0.00 ? 66  LEU A CA   3  
ATOM   3279  C  C    . LEU A 1 66 ? 15.527  -3.737  -10.814 1.00 0.00 ? 66  LEU A C    3  
ATOM   3280  O  O    . LEU A 1 66 ? 16.057  -3.374  -11.865 1.00 0.00 ? 66  LEU A O    3  
ATOM   3281  C  CB   . LEU A 1 66 ? 14.719  -2.215  -9.000  1.00 0.00 ? 66  LEU A CB   3  
ATOM   3282  C  CG   . LEU A 1 66 ? 13.603  -1.424  -8.316  1.00 0.00 ? 66  LEU A CG   3  
ATOM   3283  C  CD1  . LEU A 1 66 ? 13.962  -1.141  -6.866  1.00 0.00 ? 66  LEU A CD1  3  
ATOM   3284  C  CD2  . LEU A 1 66 ? 13.335  -0.126  -9.064  1.00 0.00 ? 66  LEU A CD2  3  
ATOM   3285  H  H    . LEU A 1 66 ? 12.718  -3.799  -9.120  1.00 0.00 ? 66  LEU A H    3  
ATOM   3286  H  HA   . LEU A 1 66 ? 13.955  -2.306  -10.998 1.00 0.00 ? 66  LEU A HA   3  
ATOM   3287  H  HB2  . LEU A 1 66 ? 15.112  -2.919  -8.283  1.00 0.00 ? 66  LEU A HB2  3  
ATOM   3288  H  HB3  . LEU A 1 66 ? 15.496  -1.519  -9.282  1.00 0.00 ? 66  LEU A HB3  3  
ATOM   3289  H  HG   . LEU A 1 66 ? 12.695  -2.011  -8.327  1.00 0.00 ? 66  LEU A HG   3  
ATOM   3290  H  HD11 . LEU A 1 66 ? 13.996  -2.070  -6.316  1.00 0.00 ? 66  LEU A HD11 3  
ATOM   3291  H  HD12 . LEU A 1 66 ? 13.216  -0.493  -6.431  1.00 0.00 ? 66  LEU A HD12 3  
ATOM   3292  H  HD13 . LEU A 1 66 ? 14.928  -0.660  -6.821  1.00 0.00 ? 66  LEU A HD13 3  
ATOM   3293  H  HD21 . LEU A 1 66 ? 12.664  0.490   -8.484  1.00 0.00 ? 66  LEU A HD21 3  
ATOM   3294  H  HD22 . LEU A 1 66 ? 12.883  -0.349  -10.020 1.00 0.00 ? 66  LEU A HD22 3  
ATOM   3295  H  HD23 . LEU A 1 66 ? 14.265  0.400   -9.218  1.00 0.00 ? 66  LEU A HD23 3  
ATOM   3296  N  N    . LEU A 1 67 ? 15.958  -4.777  -10.108 1.00 0.00 ? 67  LEU A N    3  
ATOM   3297  C  CA   . LEU A 1 67 ? 17.104  -5.570  -10.537 1.00 0.00 ? 67  LEU A CA   3  
ATOM   3298  C  C    . LEU A 1 67 ? 16.880  -6.140  -11.934 1.00 0.00 ? 67  LEU A C    3  
ATOM   3299  O  O    . LEU A 1 67 ? 15.801  -5.996  -12.508 1.00 0.00 ? 67  LEU A O    3  
ATOM   3300  C  CB   . LEU A 1 67 ? 17.363  -6.706  -9.546  1.00 0.00 ? 67  LEU A CB   3  
ATOM   3301  C  CG   . LEU A 1 67 ? 17.853  -6.288  -8.159  1.00 0.00 ? 67  LEU A CG   3  
ATOM   3302  C  CD1  . LEU A 1 67 ? 17.872  -7.482  -7.217  1.00 0.00 ? 67  LEU A CD1  3  
ATOM   3303  C  CD2  . LEU A 1 67 ? 19.235  -5.657  -8.250  1.00 0.00 ? 67  LEU A CD2  3  
ATOM   3304  H  H    . LEU A 1 67 ? 15.495  -5.018  -9.279  1.00 0.00 ? 67  LEU A H    3  
ATOM   3305  H  HA   . LEU A 1 67 ? 17.967  -4.920  -10.561 1.00 0.00 ? 67  LEU A HA   3  
ATOM   3306  H  HB2  . LEU A 1 67 ? 16.440  -7.251  -9.420  1.00 0.00 ? 67  LEU A HB2  3  
ATOM   3307  H  HB3  . LEU A 1 67 ? 18.108  -7.359  -9.979  1.00 0.00 ? 67  LEU A HB3  3  
ATOM   3308  H  HG   . LEU A 1 67 ? 17.175  -5.552  -7.751  1.00 0.00 ? 67  LEU A HG   3  
ATOM   3309  H  HD11 . LEU A 1 67 ? 17.056  -8.146  -7.461  1.00 0.00 ? 67  LEU A HD11 3  
ATOM   3310  H  HD12 . LEU A 1 67 ? 17.765  -7.139  -6.199  1.00 0.00 ? 67  LEU A HD12 3  
ATOM   3311  H  HD13 . LEU A 1 67 ? 18.809  -8.010  -7.323  1.00 0.00 ? 67  LEU A HD13 3  
ATOM   3312  H  HD21 . LEU A 1 67 ? 19.160  -4.598  -8.053  1.00 0.00 ? 67  LEU A HD21 3  
ATOM   3313  H  HD22 . LEU A 1 67 ? 19.637  -5.811  -9.241  1.00 0.00 ? 67  LEU A HD22 3  
ATOM   3314  H  HD23 . LEU A 1 67 ? 19.888  -6.113  -7.521  1.00 0.00 ? 67  LEU A HD23 3  
ATOM   3315  N  N    . ALA A 1 68 ? 17.906  -6.789  -12.474 1.00 0.00 ? 68  ALA A N    3  
ATOM   3316  C  CA   . ALA A 1 68 ? 17.820  -7.385  -13.802 1.00 0.00 ? 68  ALA A CA   3  
ATOM   3317  C  C    . ALA A 1 68 ? 16.984  -8.660  -13.778 1.00 0.00 ? 68  ALA A C    3  
ATOM   3318  O  O    . ALA A 1 68 ? 17.252  -9.592  -13.020 1.00 0.00 ? 68  ALA A O    3  
ATOM   3319  C  CB   . ALA A 1 68 ? 19.213  -7.674  -14.343 1.00 0.00 ? 68  ALA A CB   3  
ATOM   3320  H  H    . ALA A 1 68 ? 18.741  -6.871  -11.967 1.00 0.00 ? 68  ALA A H    3  
ATOM   3321  H  HA   . ALA A 1 68 ? 17.347  -6.669  -14.459 1.00 0.00 ? 68  ALA A HA   3  
ATOM   3322  H  HB1  . ALA A 1 68 ? 19.950  -7.386  -13.607 1.00 0.00 ? 68  ALA A HB1  3  
ATOM   3323  H  HB2  . ALA A 1 68 ? 19.305  -8.729  -14.552 1.00 0.00 ? 68  ALA A HB2  3  
ATOM   3324  H  HB3  . ALA A 1 68 ? 19.370  -7.111  -15.250 1.00 0.00 ? 68  ALA A HB3  3  
ATOM   3325  N  N    . PRO A 1 69 ? 15.947  -8.704  -14.627 1.00 0.00 ? 69  PRO A N    3  
ATOM   3326  C  CA   . PRO A 1 69 ? 15.051  -9.861  -14.722 1.00 0.00 ? 69  PRO A CA   3  
ATOM   3327  C  C    . PRO A 1 69 ? 15.735  -11.075 -15.341 1.00 0.00 ? 69  PRO A C    3  
ATOM   3328  O  O    . PRO A 1 69 ? 16.937  -11.054 -15.602 1.00 0.00 ? 69  PRO A O    3  
ATOM   3329  C  CB   . PRO A 1 69 ? 13.923  -9.362  -15.630 1.00 0.00 ? 69  PRO A CB   3  
ATOM   3330  C  CG   . PRO A 1 69 ? 14.544  -8.282  -16.447 1.00 0.00 ? 69  PRO A CG   3  
ATOM   3331  C  CD   . PRO A 1 69 ? 15.569  -7.629  -15.560 1.00 0.00 ? 69  PRO A CD   3  
ATOM   3332  H  HA   . PRO A 1 69 ? 14.646  -10.129 -13.757 1.00 0.00 ? 69  PRO A HA   3  
ATOM   3333  H  HB2  . PRO A 1 69 ? 13.571  -10.174 -16.250 1.00 0.00 ? 69  PRO A HB2  3  
ATOM   3334  H  HB3  . PRO A 1 69 ? 13.112  -8.984  -15.027 1.00 0.00 ? 69  PRO A HB3  3  
ATOM   3335  H  HG2  . PRO A 1 69 ? 15.018  -8.707  -17.318 1.00 0.00 ? 69  PRO A HG2  3  
ATOM   3336  H  HG3  . PRO A 1 69 ? 13.792  -7.565  -16.739 1.00 0.00 ? 69  PRO A HG3  3  
ATOM   3337  H  HD2  . PRO A 1 69 ? 16.420  -7.306  -16.141 1.00 0.00 ? 69  PRO A HD2  3  
ATOM   3338  H  HD3  . PRO A 1 69 ? 15.133  -6.795  -15.030 1.00 0.00 ? 69  PRO A HD3  3  
ATOM   3339  N  N    . GLN A 1 70 ? 14.961  -12.130 -15.572 1.00 0.00 ? 70  GLN A N    3  
ATOM   3340  C  CA   . GLN A 1 70 ? 15.494  -13.354 -16.160 1.00 0.00 ? 70  GLN A CA   3  
ATOM   3341  C  C    . GLN A 1 70 ? 14.988  -13.537 -17.587 1.00 0.00 ? 70  GLN A C    3  
ATOM   3342  O  O    . GLN A 1 70 ? 13.805  -13.792 -17.808 1.00 0.00 ? 70  GLN A O    3  
ATOM   3343  C  CB   . GLN A 1 70 ? 15.106  -14.564 -15.310 1.00 0.00 ? 70  GLN A CB   3  
ATOM   3344  C  CG   . GLN A 1 70 ? 15.475  -15.896 -15.943 1.00 0.00 ? 70  GLN A CG   3  
ATOM   3345  C  CD   . GLN A 1 70 ? 15.746  -16.976 -14.914 1.00 0.00 ? 70  GLN A CD   3  
ATOM   3346  O  OE1  . GLN A 1 70 ? 16.848  -17.073 -14.374 1.00 0.00 ? 70  GLN A OE1  3  
ATOM   3347  N  NE2  . GLN A 1 70 ? 14.739  -17.797 -14.638 1.00 0.00 ? 70  GLN A NE2  3  
ATOM   3348  H  H    . GLN A 1 70 ? 14.010  -12.085 -15.342 1.00 0.00 ? 70  GLN A H    3  
ATOM   3349  H  HA   . GLN A 1 70 ? 16.570  -13.270 -16.181 1.00 0.00 ? 70  GLN A HA   3  
ATOM   3350  H  HB2  . GLN A 1 70 ? 15.605  -14.493 -14.355 1.00 0.00 ? 70  GLN A HB2  3  
ATOM   3351  H  HB3  . GLN A 1 70 ? 14.038  -14.550 -15.151 1.00 0.00 ? 70  GLN A HB3  3  
ATOM   3352  H  HG2  . GLN A 1 70 ? 14.660  -16.218 -16.574 1.00 0.00 ? 70  GLN A HG2  3  
ATOM   3353  H  HG3  . GLN A 1 70 ? 16.362  -15.760 -16.544 1.00 0.00 ? 70  GLN A HG3  3  
ATOM   3354  H  HE21 . GLN A 1 70 ? 13.889  -17.661 -15.108 1.00 0.00 ? 70  GLN A HE21 3  
ATOM   3355  H  HE22 . GLN A 1 70 ? 14.886  -18.504 -13.978 1.00 0.00 ? 70  GLN A HE22 3  
ATOM   3356  N  N    . GLU A 1 71 ? 15.893  -13.405 -18.552 1.00 0.00 ? 71  GLU A N    3  
ATOM   3357  C  CA   . GLU A 1 71 ? 15.537  -13.555 -19.958 1.00 0.00 ? 71  GLU A CA   3  
ATOM   3358  C  C    . GLU A 1 71 ? 16.662  -14.234 -20.735 1.00 0.00 ? 71  GLU A C    3  
ATOM   3359  O  O    . GLU A 1 71 ? 17.808  -13.787 -20.707 1.00 0.00 ? 71  GLU A O    3  
ATOM   3360  C  CB   . GLU A 1 71 ? 15.228  -12.190 -20.577 1.00 0.00 ? 71  GLU A CB   3  
ATOM   3361  C  CG   . GLU A 1 71 ? 14.270  -12.259 -21.755 1.00 0.00 ? 71  GLU A CG   3  
ATOM   3362  C  CD   . GLU A 1 71 ? 14.169  -10.944 -22.502 1.00 0.00 ? 71  GLU A CD   3  
ATOM   3363  O  OE1  . GLU A 1 71 ? 15.026  -10.690 -23.375 1.00 0.00 ? 71  GLU A OE1  3  
ATOM   3364  O  OE2  . GLU A 1 71 ? 13.234  -10.168 -22.215 1.00 0.00 ? 71  GLU A OE2  3  
ATOM   3365  H  H    . GLU A 1 71 ? 16.821  -13.201 -18.313 1.00 0.00 ? 71  GLU A H    3  
ATOM   3366  H  HA   . GLU A 1 71 ? 14.654  -14.173 -20.013 1.00 0.00 ? 71  GLU A HA   3  
ATOM   3367  H  HB2  . GLU A 1 71 ? 14.791  -11.555 -19.820 1.00 0.00 ? 71  GLU A HB2  3  
ATOM   3368  H  HB3  . GLU A 1 71 ? 16.151  -11.745 -20.918 1.00 0.00 ? 71  GLU A HB3  3  
ATOM   3369  H  HG2  . GLU A 1 71 ? 14.615  -13.019 -22.440 1.00 0.00 ? 71  GLU A HG2  3  
ATOM   3370  H  HG3  . GLU A 1 71 ? 13.289  -12.525 -21.389 1.00 0.00 ? 71  GLU A HG3  3  
ATOM   3371  N  N    . SER A 1 72 ? 16.324  -15.318 -21.426 1.00 0.00 ? 72  SER A N    3  
ATOM   3372  C  CA   . SER A 1 72 ? 17.305  -16.063 -22.207 1.00 0.00 ? 72  SER A CA   3  
ATOM   3373  C  C    . SER A 1 72 ? 18.112  -15.126 -23.101 1.00 0.00 ? 72  SER A C    3  
ATOM   3374  O  O    . SER A 1 72 ? 19.338  -15.214 -23.164 1.00 0.00 ? 72  SER A O    3  
ATOM   3375  C  CB   . SER A 1 72 ? 16.609  -17.126 -23.059 1.00 0.00 ? 72  SER A CB   3  
ATOM   3376  O  OG   . SER A 1 72 ? 17.553  -17.915 -23.762 1.00 0.00 ? 72  SER A OG   3  
ATOM   3377  H  H    . SER A 1 72 ? 15.393  -15.625 -21.409 1.00 0.00 ? 72  SER A H    3  
ATOM   3378  H  HA   . SER A 1 72 ? 17.977  -16.550 -21.516 1.00 0.00 ? 72  SER A HA   3  
ATOM   3379  H  HB2  . SER A 1 72 ? 16.025  -17.770 -22.420 1.00 0.00 ? 72  SER A HB2  3  
ATOM   3380  H  HB3  . SER A 1 72 ? 15.959  -16.642 -23.774 1.00 0.00 ? 72  SER A HB3  3  
ATOM   3381  H  HG   . SER A 1 72 ? 18.221  -17.345 -24.151 1.00 0.00 ? 72  SER A HG   3  
ATOM   3382  N  N    . SER A 1 73 ? 17.414  -14.230 -23.791 1.00 0.00 ? 73  SER A N    3  
ATOM   3383  C  CA   . SER A 1 73 ? 18.064  -13.279 -24.685 1.00 0.00 ? 73  SER A CA   3  
ATOM   3384  C  C    . SER A 1 73 ? 17.127  -12.123 -25.023 1.00 0.00 ? 73  SER A C    3  
ATOM   3385  O  O    . SER A 1 73 ? 15.906  -12.270 -24.991 1.00 0.00 ? 73  SER A O    3  
ATOM   3386  C  CB   . SER A 1 73 ? 18.514  -13.979 -25.969 1.00 0.00 ? 73  SER A CB   3  
ATOM   3387  O  OG   . SER A 1 73 ? 17.400  -14.410 -26.731 1.00 0.00 ? 73  SER A OG   3  
ATOM   3388  H  H    . SER A 1 73 ? 16.439  -14.209 -23.698 1.00 0.00 ? 73  SER A H    3  
ATOM   3389  H  HA   . SER A 1 73 ? 18.932  -12.886 -24.176 1.00 0.00 ? 73  SER A HA   3  
ATOM   3390  H  HB2  . SER A 1 73 ? 19.098  -13.293 -26.564 1.00 0.00 ? 73  SER A HB2  3  
ATOM   3391  H  HB3  . SER A 1 73 ? 19.116  -14.839 -25.715 1.00 0.00 ? 73  SER A HB3  3  
ATOM   3392  H  HG   . SER A 1 73 ? 16.759  -13.697 -26.794 1.00 0.00 ? 73  SER A HG   3  
ATOM   3393  N  N    . GLY A 1 74 ? 17.709  -10.973 -25.348 1.00 0.00 ? 74  GLY A N    3  
ATOM   3394  C  CA   . GLY A 1 74 ? 16.913  -9.808  -25.688 1.00 0.00 ? 74  GLY A CA   3  
ATOM   3395  C  C    . GLY A 1 74 ? 17.064  -9.407  -27.141 1.00 0.00 ? 74  GLY A C    3  
ATOM   3396  O  O    . GLY A 1 74 ? 18.162  -9.115  -27.616 1.00 0.00 ? 74  GLY A O    3  
ATOM   3397  H  H    . GLY A 1 74 ? 18.688  -10.914 -25.357 1.00 0.00 ? 74  GLY A H    3  
ATOM   3398  H  HA2  . GLY A 1 74 ? 15.874  -10.027 -25.491 1.00 0.00 ? 74  GLY A HA2  3  
ATOM   3399  H  HA3  . GLY A 1 74 ? 17.221  -8.982  -25.064 1.00 0.00 ? 74  GLY A HA3  3  
ATOM   3400  N  N    . PRO A 1 75 ? 15.940  -9.389  -27.874 1.00 0.00 ? 75  PRO A N    3  
ATOM   3401  C  CA   . PRO A 1 75 ? 15.927  -9.023  -29.294 1.00 0.00 ? 75  PRO A CA   3  
ATOM   3402  C  C    . PRO A 1 75 ? 16.209  -7.541  -29.513 1.00 0.00 ? 75  PRO A C    3  
ATOM   3403  O  O    . PRO A 1 75 ? 16.413  -6.790  -28.558 1.00 0.00 ? 75  PRO A O    3  
ATOM   3404  C  CB   . PRO A 1 75 ? 14.502  -9.367  -29.735 1.00 0.00 ? 75  PRO A CB   3  
ATOM   3405  C  CG   . PRO A 1 75 ? 13.690  -9.286  -28.489 1.00 0.00 ? 75  PRO A CG   3  
ATOM   3406  C  CD   . PRO A 1 75 ? 14.597  -9.725  -27.374 1.00 0.00 ? 75  PRO A CD   3  
ATOM   3407  H  HA   . PRO A 1 75 ? 16.633  -9.611  -29.862 1.00 0.00 ? 75  PRO A HA   3  
ATOM   3408  H  HB2  . PRO A 1 75 ? 14.169  -8.651  -30.473 1.00 0.00 ? 75  PRO A HB2  3  
ATOM   3409  H  HB3  . PRO A 1 75 ? 14.482  -10.361 -30.156 1.00 0.00 ? 75  PRO A HB3  3  
ATOM   3410  H  HG2  . PRO A 1 75 ? 13.363  -8.270  -28.329 1.00 0.00 ? 75  PRO A HG2  3  
ATOM   3411  H  HG3  . PRO A 1 75 ? 12.839  -9.948  -28.563 1.00 0.00 ? 75  PRO A HG3  3  
ATOM   3412  H  HD2  . PRO A 1 75 ? 14.375  -9.179  -26.469 1.00 0.00 ? 75  PRO A HD2  3  
ATOM   3413  H  HD3  . PRO A 1 75 ? 14.503  -10.788 -27.207 1.00 0.00 ? 75  PRO A HD3  3  
ATOM   3414  N  N    . SER A 1 76 ? 16.219  -7.125  -30.775 1.00 0.00 ? 76  SER A N    3  
ATOM   3415  C  CA   . SER A 1 76 ? 16.480  -5.732  -31.119 1.00 0.00 ? 76  SER A CA   3  
ATOM   3416  C  C    . SER A 1 76 ? 15.748  -5.343  -32.400 1.00 0.00 ? 76  SER A C    3  
ATOM   3417  O  O    . SER A 1 76 ? 15.196  -6.195  -33.096 1.00 0.00 ? 76  SER A O    3  
ATOM   3418  C  CB   . SER A 1 76 ? 17.983  -5.499  -31.286 1.00 0.00 ? 76  SER A CB   3  
ATOM   3419  O  OG   . SER A 1 76 ? 18.508  -6.287  -32.340 1.00 0.00 ? 76  SER A OG   3  
ATOM   3420  H  H    . SER A 1 76 ? 16.050  -7.772  -31.492 1.00 0.00 ? 76  SER A H    3  
ATOM   3421  H  HA   . SER A 1 76 ? 16.116  -5.117  -30.310 1.00 0.00 ? 76  SER A HA   3  
ATOM   3422  H  HB2  . SER A 1 76 ? 18.160  -4.458  -31.509 1.00 0.00 ? 76  SER A HB2  3  
ATOM   3423  H  HB3  . SER A 1 76 ? 18.489  -5.762  -30.368 1.00 0.00 ? 76  SER A HB3  3  
ATOM   3424  H  HG   . SER A 1 76 ? 18.950  -7.057  -31.974 1.00 0.00 ? 76  SER A HG   3  
ATOM   3425  N  N    . SER A 1 77 ? 15.749  -4.049  -32.705 1.00 0.00 ? 77  SER A N    3  
ATOM   3426  C  CA   . SER A 1 77 ? 15.083  -3.545  -33.900 1.00 0.00 ? 77  SER A CA   3  
ATOM   3427  C  C    . SER A 1 77 ? 16.066  -3.425  -35.061 1.00 0.00 ? 77  SER A C    3  
ATOM   3428  O  O    . SER A 1 77 ? 15.757  -3.799  -36.191 1.00 0.00 ? 77  SER A O    3  
ATOM   3429  C  CB   . SER A 1 77 ? 14.442  -2.185  -33.617 1.00 0.00 ? 77  SER A CB   3  
ATOM   3430  O  OG   . SER A 1 77 ? 15.421  -1.162  -33.562 1.00 0.00 ? 77  SER A OG   3  
ATOM   3431  H  H    . SER A 1 77 ? 16.207  -3.419  -32.110 1.00 0.00 ? 77  SER A H    3  
ATOM   3432  H  HA   . SER A 1 77 ? 14.309  -4.249  -34.170 1.00 0.00 ? 77  SER A HA   3  
ATOM   3433  H  HB2  . SER A 1 77 ? 13.739  -1.951  -34.401 1.00 0.00 ? 77  SER A HB2  3  
ATOM   3434  H  HB3  . SER A 1 77 ? 13.925  -2.224  -32.669 1.00 0.00 ? 77  SER A HB3  3  
ATOM   3435  H  HG   . SER A 1 77 ? 15.654  -0.893  -34.453 1.00 0.00 ? 77  SER A HG   3  
ATOM   3436  N  N    . GLY A 1 78 ? 17.253  -2.901  -34.771 1.00 0.00 ? 78  GLY A N    3  
ATOM   3437  C  CA   . GLY A 1 78 ? 18.264  -2.740  -35.800 1.00 0.00 ? 78  GLY A CA   3  
ATOM   3438  C  C    . GLY A 1 78 ? 19.285  -3.860  -35.789 1.00 0.00 ? 78  GLY A C    3  
ATOM   3439  O  O    . GLY A 1 78 ? 19.367  -4.606  -36.763 1.00 0.00 ? 78  GLY A O    3  
ATOM   3440  H  H    . GLY A 1 78 ? 17.443  -2.620  -33.852 1.00 0.00 ? 78  GLY A H    3  
ATOM   3441  H  HA2  . GLY A 1 78 ? 17.779  -2.718  -36.765 1.00 0.00 ? 78  GLY A HA2  3  
ATOM   3442  H  HA3  . GLY A 1 78 ? 18.774  -1.801  -35.643 1.00 0.00 ? 78  GLY A HA3  3  
HETATM 3443  ZN ZN   . ZN  B 2 .  ? -7.257  1.930   5.108   1.00 0.00 ? 201 ZN  A ZN   3  
HETATM 3444  ZN ZN   . ZN  C 2 .  ? 4.762   0.134   -6.159  1.00 0.00 ? 401 ZN  A ZN   3  
ATOM   3445  N  N    . GLY A 1 1  ? -2.395  -27.110 18.067  1.00 0.00 ? 1   GLY A N    4  
ATOM   3446  C  CA   . GLY A 1 1  ? -3.026  -26.359 16.998  1.00 0.00 ? 1   GLY A CA   4  
ATOM   3447  C  C    . GLY A 1 1  ? -3.709  -25.101 17.498  1.00 0.00 ? 1   GLY A C    4  
ATOM   3448  O  O    . GLY A 1 1  ? -4.522  -25.153 18.421  1.00 0.00 ? 1   GLY A O    4  
ATOM   3449  H  H1   . GLY A 1 1  ? -2.094  -26.648 18.877  1.00 0.00 ? 1   GLY A H1   4  
ATOM   3450  H  HA2  . GLY A 1 1  ? -2.275  -26.084 16.273  1.00 0.00 ? 1   GLY A HA2  4  
ATOM   3451  H  HA3  . GLY A 1 1  ? -3.762  -26.987 16.518  1.00 0.00 ? 1   GLY A HA3  4  
ATOM   3452  N  N    . SER A 1 2  ? -3.377  -23.968 16.888  1.00 0.00 ? 2   SER A N    4  
ATOM   3453  C  CA   . SER A 1 2  ? -3.960  -22.690 17.281  1.00 0.00 ? 2   SER A CA   4  
ATOM   3454  C  C    . SER A 1 2  ? -4.846  -22.133 16.170  1.00 0.00 ? 2   SER A C    4  
ATOM   3455  O  O    . SER A 1 2  ? -4.753  -22.554 15.017  1.00 0.00 ? 2   SER A O    4  
ATOM   3456  C  CB   . SER A 1 2  ? -2.858  -21.685 17.621  1.00 0.00 ? 2   SER A CB   4  
ATOM   3457  O  OG   . SER A 1 2  ? -1.930  -21.566 16.556  1.00 0.00 ? 2   SER A OG   4  
ATOM   3458  H  H    . SER A 1 2  ? -2.723  -23.991 16.159  1.00 0.00 ? 2   SER A H    4  
ATOM   3459  H  HA   . SER A 1 2  ? -4.566  -22.858 18.159  1.00 0.00 ? 2   SER A HA   4  
ATOM   3460  H  HB2  . SER A 1 2  ? -3.300  -20.719 17.808  1.00 0.00 ? 2   SER A HB2  4  
ATOM   3461  H  HB3  . SER A 1 2  ? -2.332  -22.018 18.505  1.00 0.00 ? 2   SER A HB3  4  
ATOM   3462  H  HG   . SER A 1 2  ? -2.228  -22.093 15.811  1.00 0.00 ? 2   SER A HG   4  
ATOM   3463  N  N    . SER A 1 3  ? -5.705  -21.184 16.527  1.00 0.00 ? 3   SER A N    4  
ATOM   3464  C  CA   . SER A 1 3  ? -6.611  -20.571 15.563  1.00 0.00 ? 3   SER A CA   4  
ATOM   3465  C  C    . SER A 1 3  ? -6.840  -19.098 15.892  1.00 0.00 ? 3   SER A C    4  
ATOM   3466  O  O    . SER A 1 3  ? -6.636  -18.665 17.025  1.00 0.00 ? 3   SER A O    4  
ATOM   3467  C  CB   . SER A 1 3  ? -7.948  -21.314 15.544  1.00 0.00 ? 3   SER A CB   4  
ATOM   3468  O  OG   . SER A 1 3  ? -7.895  -22.437 14.682  1.00 0.00 ? 3   SER A OG   4  
ATOM   3469  H  H    . SER A 1 3  ? -5.732  -20.890 17.462  1.00 0.00 ? 3   SER A H    4  
ATOM   3470  H  HA   . SER A 1 3  ? -6.155  -20.643 14.587  1.00 0.00 ? 3   SER A HA   4  
ATOM   3471  H  HB2  . SER A 1 3  ? -8.184  -21.652 16.541  1.00 0.00 ? 3   SER A HB2  4  
ATOM   3472  H  HB3  . SER A 1 3  ? -8.723  -20.646 15.198  1.00 0.00 ? 3   SER A HB3  4  
ATOM   3473  H  HG   . SER A 1 3  ? -7.292  -22.256 13.957  1.00 0.00 ? 3   SER A HG   4  
ATOM   3474  N  N    . GLY A 1 4  ? -7.265  -18.334 14.891  1.00 0.00 ? 4   GLY A N    4  
ATOM   3475  C  CA   . GLY A 1 4  ? -7.514  -16.918 15.093  1.00 0.00 ? 4   GLY A CA   4  
ATOM   3476  C  C    . GLY A 1 4  ? -7.697  -16.170 13.787  1.00 0.00 ? 4   GLY A C    4  
ATOM   3477  O  O    . GLY A 1 4  ? -7.010  -16.446 12.804  1.00 0.00 ? 4   GLY A O    4  
ATOM   3478  H  H    . GLY A 1 4  ? -7.410  -18.734 14.008  1.00 0.00 ? 4   GLY A H    4  
ATOM   3479  H  HA2  . GLY A 1 4  ? -8.406  -16.803 15.690  1.00 0.00 ? 4   GLY A HA2  4  
ATOM   3480  H  HA3  . GLY A 1 4  ? -6.678  -16.490 15.625  1.00 0.00 ? 4   GLY A HA3  4  
ATOM   3481  N  N    . SER A 1 5  ? -8.629  -15.222 13.776  1.00 0.00 ? 5   SER A N    4  
ATOM   3482  C  CA   . SER A 1 5  ? -8.905  -14.435 12.580  1.00 0.00 ? 5   SER A CA   4  
ATOM   3483  C  C    . SER A 1 5  ? -7.687  -13.605 12.182  1.00 0.00 ? 5   SER A C    4  
ATOM   3484  O  O    . SER A 1 5  ? -7.101  -12.907 13.010  1.00 0.00 ? 5   SER A O    4  
ATOM   3485  C  CB   . SER A 1 5  ? -10.107 -13.518 12.813  1.00 0.00 ? 5   SER A CB   4  
ATOM   3486  O  OG   . SER A 1 5  ? -11.325 -14.218 12.626  1.00 0.00 ? 5   SER A OG   4  
ATOM   3487  H  H    . SER A 1 5  ? -9.144  -15.049 14.592  1.00 0.00 ? 5   SER A H    4  
ATOM   3488  H  HA   . SER A 1 5  ? -9.135  -15.121 11.778  1.00 0.00 ? 5   SER A HA   4  
ATOM   3489  H  HB2  . SER A 1 5  ? -10.076 -13.137 13.822  1.00 0.00 ? 5   SER A HB2  4  
ATOM   3490  H  HB3  . SER A 1 5  ? -10.068 -12.694 12.115  1.00 0.00 ? 5   SER A HB3  4  
ATOM   3491  H  HG   . SER A 1 5  ? -11.337 -14.614 11.752  1.00 0.00 ? 5   SER A HG   4  
ATOM   3492  N  N    . SER A 1 6  ? -7.313  -13.688 10.910  1.00 0.00 ? 6   SER A N    4  
ATOM   3493  C  CA   . SER A 1 6  ? -6.163  -12.948 10.402  1.00 0.00 ? 6   SER A CA   4  
ATOM   3494  C  C    . SER A 1 6  ? -6.457  -11.452 10.356  1.00 0.00 ? 6   SER A C    4  
ATOM   3495  O  O    . SER A 1 6  ? -5.657  -10.636 10.812  1.00 0.00 ? 6   SER A O    4  
ATOM   3496  C  CB   . SER A 1 6  ? -5.784  -13.448 9.007   1.00 0.00 ? 6   SER A CB   4  
ATOM   3497  O  OG   . SER A 1 6  ? -5.248  -14.759 9.063   1.00 0.00 ? 6   SER A OG   4  
ATOM   3498  H  H    . SER A 1 6  ? -7.821  -14.262 10.299  1.00 0.00 ? 6   SER A H    4  
ATOM   3499  H  HA   . SER A 1 6  ? -5.336  -13.120 11.074  1.00 0.00 ? 6   SER A HA   4  
ATOM   3500  H  HB2  . SER A 1 6  ? -6.663  -13.459 8.380   1.00 0.00 ? 6   SER A HB2  4  
ATOM   3501  H  HB3  . SER A 1 6  ? -5.045  -12.787 8.579   1.00 0.00 ? 6   SER A HB3  4  
ATOM   3502  H  HG   . SER A 1 6  ? -4.292  -14.710 9.136   1.00 0.00 ? 6   SER A HG   4  
ATOM   3503  N  N    . GLY A 1 7  ? -7.613  -11.099 9.800   1.00 0.00 ? 7   GLY A N    4  
ATOM   3504  C  CA   . GLY A 1 7  ? -7.993  -9.701  9.704   1.00 0.00 ? 7   GLY A CA   4  
ATOM   3505  C  C    . GLY A 1 7  ? -8.054  -9.215  8.269   1.00 0.00 ? 7   GLY A C    4  
ATOM   3506  O  O    . GLY A 1 7  ? -7.416  -9.786  7.384   1.00 0.00 ? 7   GLY A O    4  
ATOM   3507  H  H    . GLY A 1 7  ? -8.211  -11.793 9.453   1.00 0.00 ? 7   GLY A H    4  
ATOM   3508  H  HA2  . GLY A 1 7  ? -8.964  -9.572  10.159  1.00 0.00 ? 7   GLY A HA2  4  
ATOM   3509  H  HA3  . GLY A 1 7  ? -7.271  -9.106  10.243  1.00 0.00 ? 7   GLY A HA3  4  
ATOM   3510  N  N    . LEU A 1 8  ? -8.826  -8.159  8.037   1.00 0.00 ? 8   LEU A N    4  
ATOM   3511  C  CA   . LEU A 1 8  ? -8.970  -7.596  6.699   1.00 0.00 ? 8   LEU A CA   4  
ATOM   3512  C  C    . LEU A 1 8  ? -7.729  -6.799  6.307   1.00 0.00 ? 8   LEU A C    4  
ATOM   3513  O  O    . LEU A 1 8  ? -6.946  -6.391  7.164   1.00 0.00 ? 8   LEU A O    4  
ATOM   3514  C  CB   . LEU A 1 8  ? -10.208 -6.700  6.632   1.00 0.00 ? 8   LEU A CB   4  
ATOM   3515  C  CG   . LEU A 1 8  ? -11.534 -7.358  7.014   1.00 0.00 ? 8   LEU A CG   4  
ATOM   3516  C  CD1  . LEU A 1 8  ? -12.486 -6.333  7.610   1.00 0.00 ? 8   LEU A CD1  4  
ATOM   3517  C  CD2  . LEU A 1 8  ? -12.163 -8.033  5.804   1.00 0.00 ? 8   LEU A CD2  4  
ATOM   3518  H  H    . LEU A 1 8  ? -9.310  -7.747  8.782   1.00 0.00 ? 8   LEU A H    4  
ATOM   3519  H  HA   . LEU A 1 8  ? -9.090  -8.415  6.006   1.00 0.00 ? 8   LEU A HA   4  
ATOM   3520  H  HB2  . LEU A 1 8  ? -10.049 -5.866  7.297   1.00 0.00 ? 8   LEU A HB2  4  
ATOM   3521  H  HB3  . LEU A 1 8  ? -10.298 -6.337  5.618   1.00 0.00 ? 8   LEU A HB3  4  
ATOM   3522  H  HG   . LEU A 1 8  ? -11.349 -8.116  7.763   1.00 0.00 ? 8   LEU A HG   4  
ATOM   3523  H  HD11 . LEU A 1 8  ? -12.009 -5.842  8.445   1.00 0.00 ? 8   LEU A HD11 4  
ATOM   3524  H  HD12 . LEU A 1 8  ? -13.383 -6.830  7.949   1.00 0.00 ? 8   LEU A HD12 4  
ATOM   3525  H  HD13 . LEU A 1 8  ? -12.742 -5.600  6.859   1.00 0.00 ? 8   LEU A HD13 4  
ATOM   3526  H  HD21 . LEU A 1 8  ? -12.910 -8.740  6.134   1.00 0.00 ? 8   LEU A HD21 4  
ATOM   3527  H  HD22 . LEU A 1 8  ? -11.399 -8.552  5.243   1.00 0.00 ? 8   LEU A HD22 4  
ATOM   3528  H  HD23 . LEU A 1 8  ? -12.627 -7.286  5.176   1.00 0.00 ? 8   LEU A HD23 4  
ATOM   3529  N  N    . GLN A 1 9  ? -7.560  -6.580  5.007   1.00 0.00 ? 9   GLN A N    4  
ATOM   3530  C  CA   . GLN A 1 9  ? -6.415  -5.830  4.502   1.00 0.00 ? 9   GLN A CA   4  
ATOM   3531  C  C    . GLN A 1 9  ? -6.843  -4.851  3.414   1.00 0.00 ? 9   GLN A C    4  
ATOM   3532  O  O    . GLN A 1 9  ? -7.357  -5.253  2.370   1.00 0.00 ? 9   GLN A O    4  
ATOM   3533  C  CB   . GLN A 1 9  ? -5.353  -6.786  3.957   1.00 0.00 ? 9   GLN A CB   4  
ATOM   3534  C  CG   . GLN A 1 9  ? -4.031  -6.107  3.635   1.00 0.00 ? 9   GLN A CG   4  
ATOM   3535  C  CD   . GLN A 1 9  ? -3.072  -6.113  4.809   1.00 0.00 ? 9   GLN A CD   4  
ATOM   3536  O  OE1  . GLN A 1 9  ? -2.713  -7.170  5.327   1.00 0.00 ? 9   GLN A OE1  4  
ATOM   3537  N  NE2  . GLN A 1 9  ? -2.650  -4.928  5.235   1.00 0.00 ? 9   GLN A NE2  4  
ATOM   3538  H  H    . GLN A 1 9  ? -8.218  -6.931  4.373   1.00 0.00 ? 9   GLN A H    4  
ATOM   3539  H  HA   . GLN A 1 9  ? -5.996  -5.272  5.326   1.00 0.00 ? 9   GLN A HA   4  
ATOM   3540  H  HB2  . GLN A 1 9  ? -5.169  -7.557  4.690   1.00 0.00 ? 9   GLN A HB2  4  
ATOM   3541  H  HB3  . GLN A 1 9  ? -5.728  -7.243  3.052   1.00 0.00 ? 9   GLN A HB3  4  
ATOM   3542  H  HG2  . GLN A 1 9  ? -3.567  -6.625  2.808   1.00 0.00 ? 9   GLN A HG2  4  
ATOM   3543  H  HG3  . GLN A 1 9  ? -4.227  -5.083  3.353   1.00 0.00 ? 9   GLN A HG3  4  
ATOM   3544  H  HE21 . GLN A 1 9  ? -2.980  -4.127  4.774   1.00 0.00 ? 9   GLN A HE21 4  
ATOM   3545  H  HE22 . GLN A 1 9  ? -2.030  -4.902  5.992   1.00 0.00 ? 9   GLN A HE22 4  
ATOM   3546  N  N    . CYS A 1 10 ? -6.628  -3.564  3.665   1.00 0.00 ? 10  CYS A N    4  
ATOM   3547  C  CA   . CYS A 1 10 ? -6.992  -2.527  2.707   1.00 0.00 ? 10  CYS A CA   4  
ATOM   3548  C  C    . CYS A 1 10 ? -6.031  -2.519  1.522   1.00 0.00 ? 10  CYS A C    4  
ATOM   3549  O  O    . CYS A 1 10 ? -4.854  -2.851  1.663   1.00 0.00 ? 10  CYS A O    4  
ATOM   3550  C  CB   . CYS A 1 10 ? -6.994  -1.155  3.385   1.00 0.00 ? 10  CYS A CB   4  
ATOM   3551  S  SG   . CYS A 1 10 ? -6.882  0.247   2.228   1.00 0.00 ? 10  CYS A SG   4  
ATOM   3552  H  H    . CYS A 1 10 ? -6.215  -3.305  4.516   1.00 0.00 ? 10  CYS A H    4  
ATOM   3553  H  HA   . CYS A 1 10 ? -7.987  -2.742  2.347   1.00 0.00 ? 10  CYS A HA   4  
ATOM   3554  H  HB2  . CYS A 1 10 ? -7.908  -1.042  3.950   1.00 0.00 ? 10  CYS A HB2  4  
ATOM   3555  H  HB3  . CYS A 1 10 ? -6.151  -1.094  4.059   1.00 0.00 ? 10  CYS A HB3  4  
ATOM   3556  N  N    . GLU A 1 11 ? -6.542  -2.138  0.355   1.00 0.00 ? 11  GLU A N    4  
ATOM   3557  C  CA   . GLU A 1 11 ? -5.728  -2.088  -0.854  1.00 0.00 ? 11  GLU A CA   4  
ATOM   3558  C  C    . GLU A 1 11 ? -5.248  -0.666  -1.128  1.00 0.00 ? 11  GLU A C    4  
ATOM   3559  O  O    . GLU A 1 11 ? -4.179  -0.461  -1.705  1.00 0.00 ? 11  GLU A O    4  
ATOM   3560  C  CB   . GLU A 1 11 ? -6.524  -2.609  -2.052  1.00 0.00 ? 11  GLU A CB   4  
ATOM   3561  C  CG   . GLU A 1 11 ? -7.587  -1.641  -2.544  1.00 0.00 ? 11  GLU A CG   4  
ATOM   3562  C  CD   . GLU A 1 11 ? -8.402  -2.204  -3.692  1.00 0.00 ? 11  GLU A CD   4  
ATOM   3563  O  OE1  . GLU A 1 11 ? -7.826  -2.428  -4.777  1.00 0.00 ? 11  GLU A OE1  4  
ATOM   3564  O  OE2  . GLU A 1 11 ? -9.618  -2.422  -3.505  1.00 0.00 ? 11  GLU A OE2  4  
ATOM   3565  H  H    . GLU A 1 11 ? -7.487  -1.885  0.307   1.00 0.00 ? 11  GLU A H    4  
ATOM   3566  H  HA   . GLU A 1 11 ? -4.868  -2.723  -0.702  1.00 0.00 ? 11  GLU A HA   4  
ATOM   3567  H  HB2  . GLU A 1 11 ? -5.841  -2.806  -2.865  1.00 0.00 ? 11  GLU A HB2  4  
ATOM   3568  H  HB3  . GLU A 1 11 ? -7.010  -3.532  -1.772  1.00 0.00 ? 11  GLU A HB3  4  
ATOM   3569  H  HG2  . GLU A 1 11 ? -8.255  -1.414  -1.727  1.00 0.00 ? 11  GLU A HG2  4  
ATOM   3570  H  HG3  . GLU A 1 11 ? -7.104  -0.734  -2.876  1.00 0.00 ? 11  GLU A HG3  4  
ATOM   3571  N  N    . ILE A 1 12 ? -6.045  0.312   -0.711  1.00 0.00 ? 12  ILE A N    4  
ATOM   3572  C  CA   . ILE A 1 12 ? -5.701  1.714   -0.911  1.00 0.00 ? 12  ILE A CA   4  
ATOM   3573  C  C    . ILE A 1 12 ? -4.340  2.038   -0.305  1.00 0.00 ? 12  ILE A C    4  
ATOM   3574  O  O    . ILE A 1 12 ? -3.376  2.305   -1.023  1.00 0.00 ? 12  ILE A O    4  
ATOM   3575  C  CB   . ILE A 1 12 ? -6.760  2.647   -0.294  1.00 0.00 ? 12  ILE A CB   4  
ATOM   3576  C  CG1  . ILE A 1 12 ? -8.152  2.293   -0.822  1.00 0.00 ? 12  ILE A CG1  4  
ATOM   3577  C  CG2  . ILE A 1 12 ? -6.427  4.100   -0.597  1.00 0.00 ? 12  ILE A CG2  4  
ATOM   3578  C  CD1  . ILE A 1 12 ? -8.249  2.311   -2.331  1.00 0.00 ? 12  ILE A CD1  4  
ATOM   3579  H  H    . ILE A 1 12 ? -6.883  0.085   -0.258  1.00 0.00 ? 12  ILE A H    4  
ATOM   3580  H  HA   . ILE A 1 12 ? -5.663  1.900   -1.975  1.00 0.00 ? 12  ILE A HA   4  
ATOM   3581  H  HB   . ILE A 1 12 ? -6.744  2.514   0.777   1.00 0.00 ? 12  ILE A HB   4  
ATOM   3582  H  HG12 . ILE A 1 12 ? -8.417  1.303   -0.485  1.00 0.00 ? 12  ILE A HG12 4  
ATOM   3583  H  HG13 . ILE A 1 12 ? -8.867  3.004   -0.434  1.00 0.00 ? 12  ILE A HG13 4  
ATOM   3584  H  HG21 . ILE A 1 12 ? -5.870  4.521   0.228   1.00 0.00 ? 12  ILE A HG21 4  
ATOM   3585  H  HG22 . ILE A 1 12 ? -5.831  4.153   -1.496  1.00 0.00 ? 12  ILE A HG22 4  
ATOM   3586  H  HG23 . ILE A 1 12 ? -7.340  4.658   -0.736  1.00 0.00 ? 12  ILE A HG23 4  
ATOM   3587  H  HD11 . ILE A 1 12 ? -9.286  2.260   -2.627  1.00 0.00 ? 12  ILE A HD11 4  
ATOM   3588  H  HD12 . ILE A 1 12 ? -7.810  3.223   -2.710  1.00 0.00 ? 12  ILE A HD12 4  
ATOM   3589  H  HD13 . ILE A 1 12 ? -7.718  1.462   -2.736  1.00 0.00 ? 12  ILE A HD13 4  
ATOM   3590  N  N    . CYS A 1 13 ? -4.267  2.012   1.021   1.00 0.00 ? 13  CYS A N    4  
ATOM   3591  C  CA   . CYS A 1 13 ? -3.024  2.301   1.726   1.00 0.00 ? 13  CYS A CA   4  
ATOM   3592  C  C    . CYS A 1 13 ? -2.344  1.013   2.181   1.00 0.00 ? 13  CYS A C    4  
ATOM   3593  O  O    . CYS A 1 13 ? -1.125  0.877   2.090   1.00 0.00 ? 13  CYS A O    4  
ATOM   3594  C  CB   . CYS A 1 13 ? -3.295  3.202   2.933   1.00 0.00 ? 13  CYS A CB   4  
ATOM   3595  S  SG   . CYS A 1 13 ? -4.399  2.463   4.179   1.00 0.00 ? 13  CYS A SG   4  
ATOM   3596  H  H    . CYS A 1 13 ? -5.070  1.793   1.540   1.00 0.00 ? 13  CYS A H    4  
ATOM   3597  H  HA   . CYS A 1 13 ? -2.368  2.818   1.042   1.00 0.00 ? 13  CYS A HA   4  
ATOM   3598  H  HB2  . CYS A 1 13 ? -2.358  3.430   3.419   1.00 0.00 ? 13  CYS A HB2  4  
ATOM   3599  H  HB3  . CYS A 1 13 ? -3.751  4.120   2.592   1.00 0.00 ? 13  CYS A HB3  4  
ATOM   3600  N  N    . GLY A 1 14 ? -3.143  0.070   2.672   1.00 0.00 ? 14  GLY A N    4  
ATOM   3601  C  CA   . GLY A 1 14 ? -2.601  -1.194  3.133   1.00 0.00 ? 14  GLY A CA   4  
ATOM   3602  C  C    . GLY A 1 14 ? -2.819  -1.411  4.618   1.00 0.00 ? 14  GLY A C    4  
ATOM   3603  O  O    . GLY A 1 14 ? -2.022  -2.077  5.279   1.00 0.00 ? 14  GLY A O    4  
ATOM   3604  H  H    . GLY A 1 14 ? -4.108  0.235   2.720   1.00 0.00 ? 14  GLY A H    4  
ATOM   3605  H  HA2  . GLY A 1 14 ? -3.077  -1.997  2.590   1.00 0.00 ? 14  GLY A HA2  4  
ATOM   3606  H  HA3  . GLY A 1 14 ? -1.541  -1.214  2.931   1.00 0.00 ? 14  GLY A HA3  4  
ATOM   3607  N  N    . PHE A 1 15 ? -3.900  -0.845  5.144   1.00 0.00 ? 15  PHE A N    4  
ATOM   3608  C  CA   . PHE A 1 15 ? -4.219  -0.977  6.561   1.00 0.00 ? 15  PHE A CA   4  
ATOM   3609  C  C    . PHE A 1 15 ? -4.843  -2.339  6.854   1.00 0.00 ? 15  PHE A C    4  
ATOM   3610  O  O    . PHE A 1 15 ? -5.101  -3.125  5.942   1.00 0.00 ? 15  PHE A O    4  
ATOM   3611  C  CB   . PHE A 1 15 ? -5.173  0.137   6.997   1.00 0.00 ? 15  PHE A CB   4  
ATOM   3612  C  CG   . PHE A 1 15 ? -5.284  0.281   8.488   1.00 0.00 ? 15  PHE A CG   4  
ATOM   3613  C  CD1  . PHE A 1 15 ? -4.200  0.705   9.240   1.00 0.00 ? 15  PHE A CD1  4  
ATOM   3614  C  CD2  . PHE A 1 15 ? -6.473  -0.008  9.138   1.00 0.00 ? 15  PHE A CD2  4  
ATOM   3615  C  CE1  . PHE A 1 15 ? -4.300  0.839   10.612  1.00 0.00 ? 15  PHE A CE1  4  
ATOM   3616  C  CE2  . PHE A 1 15 ? -6.579  0.125   10.510  1.00 0.00 ? 15  PHE A CE2  4  
ATOM   3617  C  CZ   . PHE A 1 15 ? -5.491  0.548   11.248  1.00 0.00 ? 15  PHE A CZ   4  
ATOM   3618  H  H    . PHE A 1 15 ? -4.498  -0.326  4.566   1.00 0.00 ? 15  PHE A H    4  
ATOM   3619  H  HA   . PHE A 1 15 ? -3.298  -0.889  7.117   1.00 0.00 ? 15  PHE A HA   4  
ATOM   3620  H  HB2  . PHE A 1 15 ? -4.822  1.077   6.599   1.00 0.00 ? 15  PHE A HB2  4  
ATOM   3621  H  HB3  . PHE A 1 15 ? -6.158  -0.069  6.608   1.00 0.00 ? 15  PHE A HB3  4  
ATOM   3622  H  HD1  . PHE A 1 15 ? -3.267  0.933   8.743   1.00 0.00 ? 15  PHE A HD1  4  
ATOM   3623  H  HD2  . PHE A 1 15 ? -7.325  -0.339  8.563   1.00 0.00 ? 15  PHE A HD2  4  
ATOM   3624  H  HE1  . PHE A 1 15 ? -3.447  1.170   11.185  1.00 0.00 ? 15  PHE A HE1  4  
ATOM   3625  H  HE2  . PHE A 1 15 ? -7.511  -0.104  11.005  1.00 0.00 ? 15  PHE A HE2  4  
ATOM   3626  H  HZ   . PHE A 1 15 ? -5.571  0.652   12.319  1.00 0.00 ? 15  PHE A HZ   4  
ATOM   3627  N  N    . THR A 1 16 ? -5.081  -2.611  8.133   1.00 0.00 ? 16  THR A N    4  
ATOM   3628  C  CA   . THR A 1 16 ? -5.672  -3.877  8.547   1.00 0.00 ? 16  THR A CA   4  
ATOM   3629  C  C    . THR A 1 16 ? -6.729  -3.664  9.625   1.00 0.00 ? 16  THR A C    4  
ATOM   3630  O  O    . THR A 1 16 ? -6.499  -2.947  10.600  1.00 0.00 ? 16  THR A O    4  
ATOM   3631  C  CB   . THR A 1 16 ? -4.602  -4.850  9.078   1.00 0.00 ? 16  THR A CB   4  
ATOM   3632  O  OG1  . THR A 1 16 ? -3.569  -4.122  9.752   1.00 0.00 ? 16  THR A OG1  4  
ATOM   3633  C  CG2  . THR A 1 16 ? -3.999  -5.663  7.943   1.00 0.00 ? 16  THR A CG2  4  
ATOM   3634  H  H    . THR A 1 16 ? -4.853  -1.944  8.813   1.00 0.00 ? 16  THR A H    4  
ATOM   3635  H  HA   . THR A 1 16 ? -6.139  -4.326  7.683   1.00 0.00 ? 16  THR A HA   4  
ATOM   3636  H  HB   . THR A 1 16 ? -5.069  -5.528  9.778   1.00 0.00 ? 16  THR A HB   4  
ATOM   3637  H  HG1  . THR A 1 16 ? -3.217  -3.448  9.164   1.00 0.00 ? 16  THR A HG1  4  
ATOM   3638  H  HG21 . THR A 1 16 ? -3.312  -5.045  7.383   1.00 0.00 ? 16  THR A HG21 4  
ATOM   3639  H  HG22 . THR A 1 16 ? -4.786  -6.009  7.290   1.00 0.00 ? 16  THR A HG22 4  
ATOM   3640  H  HG23 . THR A 1 16 ? -3.469  -6.511  8.350   1.00 0.00 ? 16  THR A HG23 4  
ATOM   3641  N  N    . CYS A 1 17 ? -7.886  -4.291  9.445   1.00 0.00 ? 17  CYS A N    4  
ATOM   3642  C  CA   . CYS A 1 17 ? -8.979  -4.170  10.404  1.00 0.00 ? 17  CYS A CA   4  
ATOM   3643  C  C    . CYS A 1 17 ? -9.777  -5.467  10.485  1.00 0.00 ? 17  CYS A C    4  
ATOM   3644  O  O    . CYS A 1 17 ? -9.901  -6.194  9.499   1.00 0.00 ? 17  CYS A O    4  
ATOM   3645  C  CB   . CYS A 1 17 ? -9.900  -3.013  10.014  1.00 0.00 ? 17  CYS A CB   4  
ATOM   3646  S  SG   . CYS A 1 17 ? -10.799 -2.285  11.404  1.00 0.00 ? 17  CYS A SG   4  
ATOM   3647  H  H    . CYS A 1 17 ? -8.009  -4.849  8.648   1.00 0.00 ? 17  CYS A H    4  
ATOM   3648  H  HA   . CYS A 1 17 ? -8.548  -3.965  11.372  1.00 0.00 ? 17  CYS A HA   4  
ATOM   3649  H  HB2  . CYS A 1 17 ? -9.310  -2.230  9.560   1.00 0.00 ? 17  CYS A HB2  4  
ATOM   3650  H  HB3  . CYS A 1 17 ? -10.628 -3.367  9.299   1.00 0.00 ? 17  CYS A HB3  4  
ATOM   3651  H  HG   . CYS A 1 17 ? -10.775 -3.152  12.405  1.00 0.00 ? 17  CYS A HG   4  
ATOM   3652  N  N    . ARG A 1 18 ? -10.315 -5.751  11.666  1.00 0.00 ? 18  ARG A N    4  
ATOM   3653  C  CA   . ARG A 1 18 ? -11.099 -6.962  11.877  1.00 0.00 ? 18  ARG A CA   4  
ATOM   3654  C  C    . ARG A 1 18 ? -12.541 -6.763  11.419  1.00 0.00 ? 18  ARG A C    4  
ATOM   3655  O  O    . ARG A 1 18 ? -13.035 -7.493  10.560  1.00 0.00 ? 18  ARG A O    4  
ATOM   3656  C  CB   . ARG A 1 18 ? -11.073 -7.361  13.354  1.00 0.00 ? 18  ARG A CB   4  
ATOM   3657  C  CG   . ARG A 1 18 ? -9.748  -7.958  13.800  1.00 0.00 ? 18  ARG A CG   4  
ATOM   3658  C  CD   . ARG A 1 18 ? -8.752  -6.876  14.188  1.00 0.00 ? 18  ARG A CD   4  
ATOM   3659  N  NE   . ARG A 1 18 ? -7.371  -7.320  14.024  1.00 0.00 ? 18  ARG A NE   4  
ATOM   3660  C  CZ   . ARG A 1 18 ? -6.327  -6.498  14.050  1.00 0.00 ? 18  ARG A CZ   4  
ATOM   3661  N  NH1  . ARG A 1 18 ? -6.508  -5.198  14.234  1.00 0.00 ? 18  ARG A NH1  4  
ATOM   3662  N  NH2  . ARG A 1 18 ? -5.100  -6.978  13.893  1.00 0.00 ? 18  ARG A NH2  4  
ATOM   3663  H  H    . ARG A 1 18 ? -10.181 -5.132  12.414  1.00 0.00 ? 18  ARG A H    4  
ATOM   3664  H  HA   . ARG A 1 18 ? -10.654 -7.752  11.292  1.00 0.00 ? 18  ARG A HA   4  
ATOM   3665  H  HB2  . ARG A 1 18 ? -11.269 -6.486  13.955  1.00 0.00 ? 18  ARG A HB2  4  
ATOM   3666  H  HB3  . ARG A 1 18 ? -11.849 -8.091  13.530  1.00 0.00 ? 18  ARG A HB3  4  
ATOM   3667  H  HG2  . ARG A 1 18 ? -9.921  -8.596  14.654  1.00 0.00 ? 18  ARG A HG2  4  
ATOM   3668  H  HG3  . ARG A 1 18 ? -9.336  -8.541  12.989  1.00 0.00 ? 18  ARG A HG3  4  
ATOM   3669  H  HD2  . ARG A 1 18 ? -8.919  -6.011  13.563  1.00 0.00 ? 18  ARG A HD2  4  
ATOM   3670  H  HD3  . ARG A 1 18 ? -8.915  -6.611  15.222  1.00 0.00 ? 18  ARG A HD3  4  
ATOM   3671  H  HE   . ARG A 1 18 ? -7.214  -8.277  13.887  1.00 0.00 ? 18  ARG A HE   4  
ATOM   3672  H  HH11 . ARG A 1 18 ? -7.431  -4.834  14.353  1.00 0.00 ? 18  ARG A HH11 4  
ATOM   3673  H  HH12 . ARG A 1 18 ? -5.720  -4.581  14.254  1.00 0.00 ? 18  ARG A HH12 4  
ATOM   3674  H  HH21 . ARG A 1 18 ? -4.960  -7.958  13.755  1.00 0.00 ? 18  ARG A HH21 4  
ATOM   3675  H  HH22 . ARG A 1 18 ? -4.315  -6.359  13.913  1.00 0.00 ? 18  ARG A HH22 4  
ATOM   3676  N  N    . GLN A 1 19 ? -13.209 -5.771  11.998  1.00 0.00 ? 19  GLN A N    4  
ATOM   3677  C  CA   . GLN A 1 19 ? -14.594 -5.477  11.650  1.00 0.00 ? 19  GLN A CA   4  
ATOM   3678  C  C    . GLN A 1 19 ? -14.686 -4.855  10.260  1.00 0.00 ? 19  GLN A C    4  
ATOM   3679  O  O    . GLN A 1 19 ? -13.809 -4.094  9.850   1.00 0.00 ? 19  GLN A O    4  
ATOM   3680  C  CB   . GLN A 1 19 ? -15.214 -4.537  12.685  1.00 0.00 ? 19  GLN A CB   4  
ATOM   3681  C  CG   . GLN A 1 19 ? -15.407 -5.177  14.050  1.00 0.00 ? 19  GLN A CG   4  
ATOM   3682  C  CD   . GLN A 1 19 ? -16.459 -6.268  14.039  1.00 0.00 ? 19  GLN A CD   4  
ATOM   3683  O  OE1  . GLN A 1 19 ? -16.327 -7.268  13.332  1.00 0.00 ? 19  GLN A OE1  4  
ATOM   3684  N  NE2  . GLN A 1 19 ? -17.513 -6.083  14.826  1.00 0.00 ? 19  GLN A NE2  4  
ATOM   3685  H  H    . GLN A 1 19 ? -12.761 -5.224  12.676  1.00 0.00 ? 19  GLN A H    4  
ATOM   3686  H  HA   . GLN A 1 19 ? -15.140 -6.408  11.650  1.00 0.00 ? 19  GLN A HA   4  
ATOM   3687  H  HB2  . GLN A 1 19 ? -14.573 -3.676  12.801  1.00 0.00 ? 19  GLN A HB2  4  
ATOM   3688  H  HB3  . GLN A 1 19 ? -16.179 -4.211  12.325  1.00 0.00 ? 19  GLN A HB3  4  
ATOM   3689  H  HG2  . GLN A 1 19 ? -14.469 -5.607  14.368  1.00 0.00 ? 19  GLN A HG2  4  
ATOM   3690  H  HG3  . GLN A 1 19 ? -15.708 -4.413  14.752  1.00 0.00 ? 19  GLN A HG3  4  
ATOM   3691  H  HE21 . GLN A 1 19 ? -17.552 -5.262  15.361  1.00 0.00 ? 19  GLN A HE21 4  
ATOM   3692  H  HE22 . GLN A 1 19 ? -18.209 -6.772  14.838  1.00 0.00 ? 19  GLN A HE22 4  
ATOM   3693  N  N    . LYS A 1 20 ? -15.752 -5.183  9.539   1.00 0.00 ? 20  LYS A N    4  
ATOM   3694  C  CA   . LYS A 1 20 ? -15.960 -4.657  8.196   1.00 0.00 ? 20  LYS A CA   4  
ATOM   3695  C  C    . LYS A 1 20 ? -16.292 -3.168  8.240   1.00 0.00 ? 20  LYS A C    4  
ATOM   3696  O  O    . LYS A 1 20 ? -15.598 -2.350  7.637   1.00 0.00 ? 20  LYS A O    4  
ATOM   3697  C  CB   . LYS A 1 20 ? -17.086 -5.420  7.495   1.00 0.00 ? 20  LYS A CB   4  
ATOM   3698  C  CG   . LYS A 1 20 ? -16.860 -6.921  7.438   1.00 0.00 ? 20  LYS A CG   4  
ATOM   3699  C  CD   . LYS A 1 20 ? -15.850 -7.292  6.365   1.00 0.00 ? 20  LYS A CD   4  
ATOM   3700  C  CE   . LYS A 1 20 ? -15.612 -8.794  6.319   1.00 0.00 ? 20  LYS A CE   4  
ATOM   3701  N  NZ   . LYS A 1 20 ? -14.859 -9.273  7.511   1.00 0.00 ? 20  LYS A NZ   4  
ATOM   3702  H  H    . LYS A 1 20 ? -16.417 -5.795  9.921   1.00 0.00 ? 20  LYS A H    4  
ATOM   3703  H  HA   . LYS A 1 20 ? -15.045 -4.793  7.641   1.00 0.00 ? 20  LYS A HA   4  
ATOM   3704  H  HB2  . LYS A 1 20 ? -18.011 -5.236  8.021   1.00 0.00 ? 20  LYS A HB2  4  
ATOM   3705  H  HB3  . LYS A 1 20 ? -17.179 -5.052  6.483   1.00 0.00 ? 20  LYS A HB3  4  
ATOM   3706  H  HG2  . LYS A 1 20 ? -16.491 -7.257  8.395   1.00 0.00 ? 20  LYS A HG2  4  
ATOM   3707  H  HG3  . LYS A 1 20 ? -17.799 -7.409  7.220   1.00 0.00 ? 20  LYS A HG3  4  
ATOM   3708  H  HD2  . LYS A 1 20 ? -16.223 -6.968  5.404   1.00 0.00 ? 20  LYS A HD2  4  
ATOM   3709  H  HD3  . LYS A 1 20 ? -14.914 -6.794  6.576   1.00 0.00 ? 20  LYS A HD3  4  
ATOM   3710  H  HE2  . LYS A 1 20 ? -16.567 -9.295  6.281   1.00 0.00 ? 20  LYS A HE2  4  
ATOM   3711  H  HE3  . LYS A 1 20 ? -15.048 -9.028  5.428   1.00 0.00 ? 20  LYS A HE3  4  
ATOM   3712  H  HZ1  . LYS A 1 20 ? -14.232 -8.521  7.863   1.00 0.00 ? 20  LYS A HZ1  4  
ATOM   3713  H  HZ2  . LYS A 1 20 ? -14.282 -10.100 7.260   1.00 0.00 ? 20  LYS A HZ2  4  
ATOM   3714  H  HZ3  . LYS A 1 20 ? -15.520 -9.541  8.267   1.00 0.00 ? 20  LYS A HZ3  4  
ATOM   3715  N  N    . ALA A 1 21 ? -17.355 -2.825  8.960   1.00 0.00 ? 21  ALA A N    4  
ATOM   3716  C  CA   . ALA A 1 21 ? -17.775 -1.435  9.085   1.00 0.00 ? 21  ALA A CA   4  
ATOM   3717  C  C    . ALA A 1 21 ? -16.572 -0.499  9.127   1.00 0.00 ? 21  ALA A C    4  
ATOM   3718  O  O    . ALA A 1 21 ? -16.574 0.559   8.498   1.00 0.00 ? 21  ALA A O    4  
ATOM   3719  C  CB   . ALA A 1 21 ? -18.632 -1.253  10.330  1.00 0.00 ? 21  ALA A CB   4  
ATOM   3720  H  H    . ALA A 1 21 ? -17.868 -3.523  9.418   1.00 0.00 ? 21  ALA A H    4  
ATOM   3721  H  HA   . ALA A 1 21 ? -18.379 -1.190  8.223   1.00 0.00 ? 21  ALA A HA   4  
ATOM   3722  H  HB1  . ALA A 1 21 ? -19.491 -1.906  10.273  1.00 0.00 ? 21  ALA A HB1  4  
ATOM   3723  H  HB2  . ALA A 1 21 ? -18.050 -1.498  11.206  1.00 0.00 ? 21  ALA A HB2  4  
ATOM   3724  H  HB3  . ALA A 1 21 ? -18.963 -0.227  10.392  1.00 0.00 ? 21  ALA A HB3  4  
ATOM   3725  N  N    . SER A 1 22 ? -15.546 -0.895  9.874   1.00 0.00 ? 22  SER A N    4  
ATOM   3726  C  CA   . SER A 1 22 ? -14.338 -0.089  10.002  1.00 0.00 ? 22  SER A CA   4  
ATOM   3727  C  C    . SER A 1 22 ? -13.649 0.076   8.650   1.00 0.00 ? 22  SER A C    4  
ATOM   3728  O  O    . SER A 1 22 ? -13.418 1.195   8.191   1.00 0.00 ? 22  SER A O    4  
ATOM   3729  C  CB   . SER A 1 22 ? -13.375 -0.730  11.003  1.00 0.00 ? 22  SER A CB   4  
ATOM   3730  O  OG   . SER A 1 22 ? -13.807 -0.517  12.335  1.00 0.00 ? 22  SER A OG   4  
ATOM   3731  H  H    . SER A 1 22 ? -15.605 -1.749  10.352  1.00 0.00 ? 22  SER A H    4  
ATOM   3732  H  HA   . SER A 1 22 ? -14.626 0.886   10.367  1.00 0.00 ? 22  SER A HA   4  
ATOM   3733  H  HB2  . SER A 1 22 ? -13.324 -1.793  10.819  1.00 0.00 ? 22  SER A HB2  4  
ATOM   3734  H  HB3  . SER A 1 22 ? -12.393 -0.297  10.882  1.00 0.00 ? 22  SER A HB3  4  
ATOM   3735  H  HG   . SER A 1 22 ? -14.716 -0.814  12.428  1.00 0.00 ? 22  SER A HG   4  
ATOM   3736  N  N    . LEU A 1 23 ? -13.324 -1.046  8.019   1.00 0.00 ? 23  LEU A N    4  
ATOM   3737  C  CA   . LEU A 1 23 ? -12.662 -1.028  6.719   1.00 0.00 ? 23  LEU A CA   4  
ATOM   3738  C  C    . LEU A 1 23 ? -13.346 -0.047  5.773   1.00 0.00 ? 23  LEU A C    4  
ATOM   3739  O  O    . LEU A 1 23 ? -12.690 0.780   5.140   1.00 0.00 ? 23  LEU A O    4  
ATOM   3740  C  CB   . LEU A 1 23 ? -12.661 -2.429  6.105   1.00 0.00 ? 23  LEU A CB   4  
ATOM   3741  C  CG   . LEU A 1 23 ? -11.596 -2.695  5.040   1.00 0.00 ? 23  LEU A CG   4  
ATOM   3742  C  CD1  . LEU A 1 23 ? -10.219 -2.797  5.676   1.00 0.00 ? 23  LEU A CD1  4  
ATOM   3743  C  CD2  . LEU A 1 23 ? -11.923 -3.963  4.265   1.00 0.00 ? 23  LEU A CD2  4  
ATOM   3744  H  H    . LEU A 1 23 ? -13.534 -1.908  8.435   1.00 0.00 ? 23  LEU A H    4  
ATOM   3745  H  HA   . LEU A 1 23 ? -11.641 -0.710  6.872   1.00 0.00 ? 23  LEU A HA   4  
ATOM   3746  H  HB2  . LEU A 1 23 ? -12.513 -3.140  6.904   1.00 0.00 ? 23  LEU A HB2  4  
ATOM   3747  H  HB3  . LEU A 1 23 ? -13.629 -2.593  5.655   1.00 0.00 ? 23  LEU A HB3  4  
ATOM   3748  H  HG   . LEU A 1 23 ? -11.581 -1.870  4.342   1.00 0.00 ? 23  LEU A HG   4  
ATOM   3749  H  HD11 . LEU A 1 23 ? -10.318 -2.807  6.751   1.00 0.00 ? 23  LEU A HD11 4  
ATOM   3750  H  HD12 . LEU A 1 23 ? -9.621  -1.948  5.378   1.00 0.00 ? 23  LEU A HD12 4  
ATOM   3751  H  HD13 . LEU A 1 23 ? -9.738  -3.707  5.349   1.00 0.00 ? 23  LEU A HD13 4  
ATOM   3752  H  HD21 . LEU A 1 23 ? -11.462 -4.810  4.751   1.00 0.00 ? 23  LEU A HD21 4  
ATOM   3753  H  HD22 . LEU A 1 23 ? -11.543 -3.877  3.257   1.00 0.00 ? 23  LEU A HD22 4  
ATOM   3754  H  HD23 . LEU A 1 23 ? -12.993 -4.102  4.236   1.00 0.00 ? 23  LEU A HD23 4  
ATOM   3755  N  N    . ASN A 1 24 ? -14.668 -0.143  5.683   1.00 0.00 ? 24  ASN A N    4  
ATOM   3756  C  CA   . ASN A 1 24 ? -15.442 0.737   4.815   1.00 0.00 ? 24  ASN A CA   4  
ATOM   3757  C  C    . ASN A 1 24 ? -15.214 2.200   5.183   1.00 0.00 ? 24  ASN A C    4  
ATOM   3758  O  O    . ASN A 1 24 ? -14.847 3.014   4.335   1.00 0.00 ? 24  ASN A O    4  
ATOM   3759  C  CB   . ASN A 1 24 ? -16.932 0.401   4.910   1.00 0.00 ? 24  ASN A CB   4  
ATOM   3760  C  CG   . ASN A 1 24 ? -17.192 -1.092  4.859   1.00 0.00 ? 24  ASN A CG   4  
ATOM   3761  O  OD1  . ASN A 1 24 ? -16.607 -1.808  4.047   1.00 0.00 ? 24  ASN A OD1  4  
ATOM   3762  N  ND2  . ASN A 1 24 ? -18.074 -1.568  5.730   1.00 0.00 ? 24  ASN A ND2  4  
ATOM   3763  H  H    . ASN A 1 24 ? -15.135 -0.823  6.213   1.00 0.00 ? 24  ASN A H    4  
ATOM   3764  H  HA   . ASN A 1 24 ? -15.110 0.577   3.800   1.00 0.00 ? 24  ASN A HA   4  
ATOM   3765  H  HB2  . ASN A 1 24 ? -17.322 0.783   5.843   1.00 0.00 ? 24  ASN A HB2  4  
ATOM   3766  H  HB3  . ASN A 1 24 ? -17.453 0.868   4.088   1.00 0.00 ? 24  ASN A HB3  4  
ATOM   3767  H  HD21 . ASN A 1 24 ? -18.502 -0.939  6.348   1.00 0.00 ? 24  ASN A HD21 4  
ATOM   3768  H  HD22 . ASN A 1 24 ? -18.261 -2.530  5.719   1.00 0.00 ? 24  ASN A HD22 4  
ATOM   3769  N  N    . TRP A 1 25 ? -15.435 2.527   6.451   1.00 0.00 ? 25  TRP A N    4  
ATOM   3770  C  CA   . TRP A 1 25 ? -15.253 3.892   6.932   1.00 0.00 ? 25  TRP A CA   4  
ATOM   3771  C  C    . TRP A 1 25 ? -13.800 4.331   6.788   1.00 0.00 ? 25  TRP A C    4  
ATOM   3772  O  O    . TRP A 1 25 ? -13.510 5.522   6.670   1.00 0.00 ? 25  TRP A O    4  
ATOM   3773  C  CB   . TRP A 1 25 ? -15.690 4.002   8.393   1.00 0.00 ? 25  TRP A CB   4  
ATOM   3774  C  CG   . TRP A 1 25 ? -15.210 5.254   9.063   1.00 0.00 ? 25  TRP A CG   4  
ATOM   3775  C  CD1  . TRP A 1 25 ? -13.978 5.470   9.612   1.00 0.00 ? 25  TRP A CD1  4  
ATOM   3776  C  CD2  . TRP A 1 25 ? -15.955 6.461   9.257   1.00 0.00 ? 25  TRP A CD2  4  
ATOM   3777  N  NE1  . TRP A 1 25 ? -13.913 6.739   10.135  1.00 0.00 ? 25  TRP A NE1  4  
ATOM   3778  C  CE2  . TRP A 1 25 ? -15.112 7.368   9.930   1.00 0.00 ? 25  TRP A CE2  4  
ATOM   3779  C  CE3  . TRP A 1 25 ? -17.252 6.866   8.927   1.00 0.00 ? 25  TRP A CE3  4  
ATOM   3780  C  CZ2  . TRP A 1 25 ? -15.526 8.651   10.277  1.00 0.00 ? 25  TRP A CZ2  4  
ATOM   3781  C  CZ3  . TRP A 1 25 ? -17.660 8.140   9.273   1.00 0.00 ? 25  TRP A CZ3  4  
ATOM   3782  C  CH2  . TRP A 1 25 ? -16.800 9.020   9.941   1.00 0.00 ? 25  TRP A CH2  4  
ATOM   3783  H  H    . TRP A 1 25 ? -15.726 1.833   7.080   1.00 0.00 ? 25  TRP A H    4  
ATOM   3784  H  HA   . TRP A 1 25 ? -15.874 4.539   6.330   1.00 0.00 ? 25  TRP A HA   4  
ATOM   3785  H  HB2  . TRP A 1 25 ? -16.768 3.990   8.443   1.00 0.00 ? 25  TRP A HB2  4  
ATOM   3786  H  HB3  . TRP A 1 25 ? -15.298 3.158   8.943   1.00 0.00 ? 25  TRP A HB3  4  
ATOM   3787  H  HD1  . TRP A 1 25 ? -13.183 4.741   9.627   1.00 0.00 ? 25  TRP A HD1  4  
ATOM   3788  H  HE1  . TRP A 1 25 ? -13.132 7.131   10.581  1.00 0.00 ? 25  TRP A HE1  4  
ATOM   3789  H  HE3  . TRP A 1 25 ? -17.929 6.201   8.412   1.00 0.00 ? 25  TRP A HE3  4  
ATOM   3790  H  HZ2  . TRP A 1 25 ? -14.874 9.342   10.792  1.00 0.00 ? 25  TRP A HZ2  4  
ATOM   3791  H  HZ3  . TRP A 1 25 ? -18.659 8.470   9.026   1.00 0.00 ? 25  TRP A HZ3  4  
ATOM   3792  H  HH2  . TRP A 1 25 ? -17.162 10.006  10.192  1.00 0.00 ? 25  TRP A HH2  4  
ATOM   3793  N  N    . HIS A 1 26 ? -12.890 3.362   6.797   1.00 0.00 ? 26  HIS A N    4  
ATOM   3794  C  CA   . HIS A 1 26 ? -11.466 3.650   6.666   1.00 0.00 ? 26  HIS A CA   4  
ATOM   3795  C  C    . HIS A 1 26 ? -11.077 3.813   5.200   1.00 0.00 ? 26  HIS A C    4  
ATOM   3796  O  O    . HIS A 1 26 ? -10.007 4.335   4.887   1.00 0.00 ? 26  HIS A O    4  
ATOM   3797  C  CB   . HIS A 1 26 ? -10.638 2.534   7.304   1.00 0.00 ? 26  HIS A CB   4  
ATOM   3798  C  CG   . HIS A 1 26 ? -9.306  2.329   6.651   1.00 0.00 ? 26  HIS A CG   4  
ATOM   3799  N  ND1  . HIS A 1 26 ? -8.145  2.914   7.110   1.00 0.00 ? 26  HIS A ND1  4  
ATOM   3800  C  CD2  . HIS A 1 26 ? -8.954  1.595   5.570   1.00 0.00 ? 26  HIS A CD2  4  
ATOM   3801  C  CE1  . HIS A 1 26 ? -7.136  2.551   6.337   1.00 0.00 ? 26  HIS A CE1  4  
ATOM   3802  N  NE2  . HIS A 1 26 ? -7.601  1.750   5.395   1.00 0.00 ? 26  HIS A NE2  4  
ATOM   3803  H  H    . HIS A 1 26 ? -13.183 2.432   6.893   1.00 0.00 ? 26  HIS A H    4  
ATOM   3804  H  HA   . HIS A 1 26 ? -11.266 4.576   7.184   1.00 0.00 ? 26  HIS A HA   4  
ATOM   3805  H  HB2  . HIS A 1 26 ? -10.464 2.774   8.343   1.00 0.00 ? 26  HIS A HB2  4  
ATOM   3806  H  HB3  . HIS A 1 26 ? -11.187 1.606   7.240   1.00 0.00 ? 26  HIS A HB3  4  
ATOM   3807  H  HD1  . HIS A 1 26 ? -8.071  3.509   7.885   1.00 0.00 ? 26  HIS A HD1  4  
ATOM   3808  H  HD2  . HIS A 1 26 ? -9.615  0.998   4.956   1.00 0.00 ? 26  HIS A HD2  4  
ATOM   3809  H  HE1  . HIS A 1 26 ? -6.107  2.857   6.455   1.00 0.00 ? 26  HIS A HE1  4  
ATOM   3810  N  N    . GLN A 1 27 ? -11.952 3.363   4.307   1.00 0.00 ? 27  GLN A N    4  
ATOM   3811  C  CA   . GLN A 1 27 ? -11.699 3.458   2.874   1.00 0.00 ? 27  GLN A CA   4  
ATOM   3812  C  C    . GLN A 1 27 ? -12.260 4.758   2.307   1.00 0.00 ? 27  GLN A C    4  
ATOM   3813  O  O    . GLN A 1 27 ? -11.582 5.465   1.561   1.00 0.00 ? 27  GLN A O    4  
ATOM   3814  C  CB   . GLN A 1 27 ? -12.314 2.262   2.145   1.00 0.00 ? 27  GLN A CB   4  
ATOM   3815  C  CG   . GLN A 1 27 ? -11.451 1.012   2.191   1.00 0.00 ? 27  GLN A CG   4  
ATOM   3816  C  CD   . GLN A 1 27 ? -11.950 -0.076  1.260   1.00 0.00 ? 27  GLN A CD   4  
ATOM   3817  O  OE1  . GLN A 1 27 ? -12.631 0.200   0.273   1.00 0.00 ? 27  GLN A OE1  4  
ATOM   3818  N  NE2  . GLN A 1 27 ? -11.613 -1.322  1.572   1.00 0.00 ? 27  GLN A NE2  4  
ATOM   3819  H  H    . GLN A 1 27 ? -12.787 2.957   4.618   1.00 0.00 ? 27  GLN A H    4  
ATOM   3820  H  HA   . GLN A 1 27 ? -10.630 3.447   2.725   1.00 0.00 ? 27  GLN A HA   4  
ATOM   3821  H  HB2  . GLN A 1 27 ? -13.268 2.032   2.597   1.00 0.00 ? 27  GLN A HB2  4  
ATOM   3822  H  HB3  . GLN A 1 27 ? -12.470 2.528   1.110   1.00 0.00 ? 27  GLN A HB3  4  
ATOM   3823  H  HG2  . GLN A 1 27 ? -10.443 1.275   1.903   1.00 0.00 ? 27  GLN A HG2  4  
ATOM   3824  H  HG3  . GLN A 1 27 ? -11.448 0.629   3.200   1.00 0.00 ? 27  GLN A HG3  4  
ATOM   3825  H  HE21 . GLN A 1 27 ? -11.069 -1.467  2.375   1.00 0.00 ? 27  GLN A HE21 4  
ATOM   3826  H  HE22 . GLN A 1 27 ? -11.923 -2.045  0.989   1.00 0.00 ? 27  GLN A HE22 4  
ATOM   3827  N  N    . ARG A 1 28 ? -13.502 5.067   2.666   1.00 0.00 ? 28  ARG A N    4  
ATOM   3828  C  CA   . ARG A 1 28 ? -14.154 6.281   2.191   1.00 0.00 ? 28  ARG A CA   4  
ATOM   3829  C  C    . ARG A 1 28 ? -13.260 7.499   2.408   1.00 0.00 ? 28  ARG A C    4  
ATOM   3830  O  O    . ARG A 1 28 ? -13.229 8.414   1.585   1.00 0.00 ? 28  ARG A O    4  
ATOM   3831  C  CB   . ARG A 1 28 ? -15.490 6.482   2.909   1.00 0.00 ? 28  ARG A CB   4  
ATOM   3832  C  CG   . ARG A 1 28 ? -15.352 6.666   4.411   1.00 0.00 ? 28  ARG A CG   4  
ATOM   3833  C  CD   . ARG A 1 28 ? -16.703 6.899   5.070   1.00 0.00 ? 28  ARG A CD   4  
ATOM   3834  N  NE   . ARG A 1 28 ? -17.640 5.813   4.796   1.00 0.00 ? 28  ARG A NE   4  
ATOM   3835  C  CZ   . ARG A 1 28 ? -18.956 5.980   4.719   1.00 0.00 ? 28  ARG A CZ   4  
ATOM   3836  N  NH1  . ARG A 1 28 ? -19.487 7.182   4.894   1.00 0.00 ? 28  ARG A NH1  4  
ATOM   3837  N  NH2  . ARG A 1 28 ? -19.743 4.942   4.465   1.00 0.00 ? 28  ARG A NH2  4  
ATOM   3838  H  H    . ARG A 1 28 ? -13.991 4.464   3.263   1.00 0.00 ? 28  ARG A H    4  
ATOM   3839  H  HA   . ARG A 1 28 ? -14.338 6.168   1.133   1.00 0.00 ? 28  ARG A HA   4  
ATOM   3840  H  HB2  . ARG A 1 28 ? -15.975 7.357   2.504   1.00 0.00 ? 28  ARG A HB2  4  
ATOM   3841  H  HB3  . ARG A 1 28 ? -16.114 5.619   2.730   1.00 0.00 ? 28  ARG A HB3  4  
ATOM   3842  H  HG2  . ARG A 1 28 ? -14.906 5.778   4.835   1.00 0.00 ? 28  ARG A HG2  4  
ATOM   3843  H  HG3  . ARG A 1 28 ? -14.716 7.518   4.603   1.00 0.00 ? 28  ARG A HG3  4  
ATOM   3844  H  HD2  . ARG A 1 28 ? -16.559 6.976   6.138   1.00 0.00 ? 28  ARG A HD2  4  
ATOM   3845  H  HD3  . ARG A 1 28 ? -17.117 7.823   4.695   1.00 0.00 ? 28  ARG A HD3  4  
ATOM   3846  H  HE   . ARG A 1 28 ? -17.269 4.916   4.663   1.00 0.00 ? 28  ARG A HE   4  
ATOM   3847  H  HH11 . ARG A 1 28 ? -18.895 7.966   5.084   1.00 0.00 ? 28  ARG A HH11 4  
ATOM   3848  H  HH12 . ARG A 1 28 ? -20.478 7.305   4.834   1.00 0.00 ? 28  ARG A HH12 4  
ATOM   3849  H  HH21 . ARG A 1 28 ? -19.347 4.035   4.332   1.00 0.00 ? 28  ARG A HH21 4  
ATOM   3850  H  HH22 . ARG A 1 28 ? -20.733 5.069   4.408   1.00 0.00 ? 28  ARG A HH22 4  
ATOM   3851  N  N    . LYS A 1 29 ? -12.535 7.504   3.521   1.00 0.00 ? 29  LYS A N    4  
ATOM   3852  C  CA   . LYS A 1 29 ? -11.640 8.607   3.847   1.00 0.00 ? 29  LYS A CA   4  
ATOM   3853  C  C    . LYS A 1 29 ? -10.594 8.801   2.754   1.00 0.00 ? 29  LYS A C    4  
ATOM   3854  O  O    . LYS A 1 29 ? -10.260 9.930   2.392   1.00 0.00 ? 29  LYS A O    4  
ATOM   3855  C  CB   . LYS A 1 29 ? -10.949 8.352   5.189   1.00 0.00 ? 29  LYS A CB   4  
ATOM   3856  C  CG   . LYS A 1 29 ? -9.662  7.556   5.068   1.00 0.00 ? 29  LYS A CG   4  
ATOM   3857  C  CD   . LYS A 1 29 ? -8.891  7.541   6.377   1.00 0.00 ? 29  LYS A CD   4  
ATOM   3858  C  CE   . LYS A 1 29 ? -9.342  6.400   7.277   1.00 0.00 ? 29  LYS A CE   4  
ATOM   3859  N  NZ   . LYS A 1 29 ? -10.515 6.782   8.110   1.00 0.00 ? 29  LYS A NZ   4  
ATOM   3860  H  H    . LYS A 1 29 ? -12.603 6.745   4.139   1.00 0.00 ? 29  LYS A H    4  
ATOM   3861  H  HA   . LYS A 1 29 ? -12.234 9.505   3.923   1.00 0.00 ? 29  LYS A HA   4  
ATOM   3862  H  HB2  . LYS A 1 29 ? -10.719 9.302   5.648   1.00 0.00 ? 29  LYS A HB2  4  
ATOM   3863  H  HB3  . LYS A 1 29 ? -11.627 7.806   5.830   1.00 0.00 ? 29  LYS A HB3  4  
ATOM   3864  H  HG2  . LYS A 1 29 ? -9.902  6.539   4.793   1.00 0.00 ? 29  LYS A HG2  4  
ATOM   3865  H  HG3  . LYS A 1 29 ? -9.044  8.002   4.302   1.00 0.00 ? 29  LYS A HG3  4  
ATOM   3866  H  HD2  . LYS A 1 29 ? -7.839  7.422   6.164   1.00 0.00 ? 29  LYS A HD2  4  
ATOM   3867  H  HD3  . LYS A 1 29 ? -9.052  8.478   6.891   1.00 0.00 ? 29  LYS A HD3  4  
ATOM   3868  H  HE2  . LYS A 1 29 ? -9.609  5.556   6.660   1.00 0.00 ? 29  LYS A HE2  4  
ATOM   3869  H  HE3  . LYS A 1 29 ? -8.523  6.126   7.926   1.00 0.00 ? 29  LYS A HE3  4  
ATOM   3870  H  HZ1  . LYS A 1 29 ? -11.346 6.942   7.505   1.00 0.00 ? 29  LYS A HZ1  4  
ATOM   3871  H  HZ2  . LYS A 1 29 ? -10.311 7.655   8.637   1.00 0.00 ? 29  LYS A HZ2  4  
ATOM   3872  H  HZ3  . LYS A 1 29 ? -10.734 6.024   8.788   1.00 0.00 ? 29  LYS A HZ3  4  
ATOM   3873  N  N    . HIS A 1 30 ? -10.081 7.692   2.229   1.00 0.00 ? 30  HIS A N    4  
ATOM   3874  C  CA   . HIS A 1 30 ? -9.074  7.740   1.175   1.00 0.00 ? 30  HIS A CA   4  
ATOM   3875  C  C    . HIS A 1 30 ? -9.529  8.640   0.030   1.00 0.00 ? 30  HIS A C    4  
ATOM   3876  O  O    . HIS A 1 30 ? -8.763  9.466   -0.465  1.00 0.00 ? 30  HIS A O    4  
ATOM   3877  C  CB   . HIS A 1 30 ? -8.787  6.333   0.650   1.00 0.00 ? 30  HIS A CB   4  
ATOM   3878  C  CG   . HIS A 1 30 ? -8.090  5.454   1.643   1.00 0.00 ? 30  HIS A CG   4  
ATOM   3879  N  ND1  . HIS A 1 30 ? -7.068  5.899   2.454   1.00 0.00 ? 30  HIS A ND1  4  
ATOM   3880  C  CD2  . HIS A 1 30 ? -8.275  4.150   1.954   1.00 0.00 ? 30  HIS A CD2  4  
ATOM   3881  C  CE1  . HIS A 1 30 ? -6.653  4.906   3.220   1.00 0.00 ? 30  HIS A CE1  4  
ATOM   3882  N  NE2  . HIS A 1 30 ? -7.370  3.833   2.936   1.00 0.00 ? 30  HIS A NE2  4  
ATOM   3883  H  H    . HIS A 1 30 ? -10.387 6.822   2.558   1.00 0.00 ? 30  HIS A H    4  
ATOM   3884  H  HA   . HIS A 1 30 ? -8.169  8.148   1.599   1.00 0.00 ? 30  HIS A HA   4  
ATOM   3885  H  HB2  . HIS A 1 30 ? -9.720  5.858   0.384   1.00 0.00 ? 30  HIS A HB2  4  
ATOM   3886  H  HB3  . HIS A 1 30 ? -8.162  6.404   -0.228  1.00 0.00 ? 30  HIS A HB3  4  
ATOM   3887  H  HD1  . HIS A 1 30 ? -6.699  6.807   2.465   1.00 0.00 ? 30  HIS A HD1  4  
ATOM   3888  H  HD2  . HIS A 1 30 ? -9.001  3.481   1.512   1.00 0.00 ? 30  HIS A HD2  4  
ATOM   3889  H  HE1  . HIS A 1 30 ? -5.862  4.960   3.953   1.00 0.00 ? 30  HIS A HE1  4  
ATOM   3890  N  N    . ALA A 1 31 ? -10.780 8.473   -0.387  1.00 0.00 ? 31  ALA A N    4  
ATOM   3891  C  CA   . ALA A 1 31 ? -11.337 9.270   -1.472  1.00 0.00 ? 31  ALA A CA   4  
ATOM   3892  C  C    . ALA A 1 31 ? -10.947 10.738  -1.331  1.00 0.00 ? 31  ALA A C    4  
ATOM   3893  O  O    . ALA A 1 31 ? -10.862 11.464  -2.321  1.00 0.00 ? 31  ALA A O    4  
ATOM   3894  C  CB   . ALA A 1 31 ? -12.851 9.126   -1.510  1.00 0.00 ? 31  ALA A CB   4  
ATOM   3895  H  H    . ALA A 1 31 ? -11.342 7.798   0.048   1.00 0.00 ? 31  ALA A H    4  
ATOM   3896  H  HA   . ALA A 1 31 ? -10.941 8.890   -2.403  1.00 0.00 ? 31  ALA A HA   4  
ATOM   3897  H  HB1  . ALA A 1 31 ? -13.198 9.244   -2.526  1.00 0.00 ? 31  ALA A HB1  4  
ATOM   3898  H  HB2  . ALA A 1 31 ? -13.129 8.149   -1.145  1.00 0.00 ? 31  ALA A HB2  4  
ATOM   3899  H  HB3  . ALA A 1 31 ? -13.300 9.885   -0.886  1.00 0.00 ? 31  ALA A HB3  4  
ATOM   3900  N  N    . GLU A 1 32 ? -10.710 11.167  -0.095  1.00 0.00 ? 32  GLU A N    4  
ATOM   3901  C  CA   . GLU A 1 32 ? -10.331 12.549  0.173   1.00 0.00 ? 32  GLU A CA   4  
ATOM   3902  C  C    . GLU A 1 32 ? -8.814  12.688  0.262   1.00 0.00 ? 32  GLU A C    4  
ATOM   3903  O  O    . GLU A 1 32 ? -8.240  13.671  -0.210  1.00 0.00 ? 32  GLU A O    4  
ATOM   3904  C  CB   . GLU A 1 32 ? -10.976 13.035  1.473   1.00 0.00 ? 32  GLU A CB   4  
ATOM   3905  C  CG   . GLU A 1 32 ? -12.347 13.659  1.275   1.00 0.00 ? 32  GLU A CG   4  
ATOM   3906  C  CD   . GLU A 1 32 ? -12.299 14.916  0.429   1.00 0.00 ? 32  GLU A CD   4  
ATOM   3907  O  OE1  . GLU A 1 32 ? -12.031 15.999  0.989   1.00 0.00 ? 32  GLU A OE1  4  
ATOM   3908  O  OE2  . GLU A 1 32 ? -12.531 14.816  -0.794  1.00 0.00 ? 32  GLU A OE2  4  
ATOM   3909  H  H    . GLU A 1 32 ? -10.794 10.540  0.653   1.00 0.00 ? 32  GLU A H    4  
ATOM   3910  H  HA   . GLU A 1 32 ? -10.689 13.156  -0.644  1.00 0.00 ? 32  GLU A HA   4  
ATOM   3911  H  HB2  . GLU A 1 32 ? -11.077 12.196  2.146   1.00 0.00 ? 32  GLU A HB2  4  
ATOM   3912  H  HB3  . GLU A 1 32 ? -10.330 13.772  1.926   1.00 0.00 ? 32  GLU A HB3  4  
ATOM   3913  H  HG2  . GLU A 1 32 ? -12.989 12.940  0.788   1.00 0.00 ? 32  GLU A HG2  4  
ATOM   3914  H  HG3  . GLU A 1 32 ? -12.757 13.909  2.243   1.00 0.00 ? 32  GLU A HG3  4  
ATOM   3915  N  N    . THR A 1 33 ? -8.169  11.699  0.872   1.00 0.00 ? 33  THR A N    4  
ATOM   3916  C  CA   . THR A 1 33 ? -6.719  11.711  1.025   1.00 0.00 ? 33  THR A CA   4  
ATOM   3917  C  C    . THR A 1 33 ? -6.023  11.710  -0.331  1.00 0.00 ? 33  THR A C    4  
ATOM   3918  O  O    . THR A 1 33 ? -4.984  12.346  -0.507  1.00 0.00 ? 33  THR A O    4  
ATOM   3919  C  CB   . THR A 1 33 ? -6.231  10.499  1.841   1.00 0.00 ? 33  THR A CB   4  
ATOM   3920  O  OG1  . THR A 1 33 ? -6.983  10.390  3.054   1.00 0.00 ? 33  THR A OG1  4  
ATOM   3921  C  CG2  . THR A 1 33 ? -4.750  10.628  2.167   1.00 0.00 ? 33  THR A CG2  4  
ATOM   3922  H  H    . THR A 1 33 ? -8.681  10.943  1.227   1.00 0.00 ? 33  THR A H    4  
ATOM   3923  H  HA   . THR A 1 33 ? -6.448  12.610  1.558   1.00 0.00 ? 33  THR A HA   4  
ATOM   3924  H  HB   . THR A 1 33 ? -6.378  9.605   1.252   1.00 0.00 ? 33  THR A HB   4  
ATOM   3925  H  HG1  . THR A 1 33 ? -7.016  11.245  3.489   1.00 0.00 ? 33  THR A HG1  4  
ATOM   3926  H  HG21 . THR A 1 33 ? -4.434  9.774   2.747   1.00 0.00 ? 33  THR A HG21 4  
ATOM   3927  H  HG22 . THR A 1 33 ? -4.584  11.531  2.734   1.00 0.00 ? 33  THR A HG22 4  
ATOM   3928  H  HG23 . THR A 1 33 ? -4.183  10.669  1.249   1.00 0.00 ? 33  THR A HG23 4  
ATOM   3929  N  N    . VAL A 1 34 ? -6.603  10.993  -1.288  1.00 0.00 ? 34  VAL A N    4  
ATOM   3930  C  CA   . VAL A 1 34 ? -6.039  10.911  -2.630  1.00 0.00 ? 34  VAL A CA   4  
ATOM   3931  C  C    . VAL A 1 34 ? -5.370  12.223  -3.026  1.00 0.00 ? 34  VAL A C    4  
ATOM   3932  O  O    . VAL A 1 34 ? -4.343  12.228  -3.704  1.00 0.00 ? 34  VAL A O    4  
ATOM   3933  C  CB   . VAL A 1 34 ? -7.118  10.563  -3.673  1.00 0.00 ? 34  VAL A CB   4  
ATOM   3934  C  CG1  . VAL A 1 34 ? -7.723  9.199   -3.379  1.00 0.00 ? 34  VAL A CG1  4  
ATOM   3935  C  CG2  . VAL A 1 34 ? -8.194  11.638  -3.705  1.00 0.00 ? 34  VAL A CG2  4  
ATOM   3936  H  H    . VAL A 1 34 ? -7.430  10.508  -1.088  1.00 0.00 ? 34  VAL A H    4  
ATOM   3937  H  HA   . VAL A 1 34 ? -5.297  10.125  -2.634  1.00 0.00 ? 34  VAL A HA   4  
ATOM   3938  H  HB   . VAL A 1 34 ? -6.650  10.522  -4.646  1.00 0.00 ? 34  VAL A HB   4  
ATOM   3939  H  HG11 . VAL A 1 34 ? -8.095  8.765   -4.296  1.00 0.00 ? 34  VAL A HG11 4  
ATOM   3940  H  HG12 . VAL A 1 34 ? -6.969  8.553   -2.954  1.00 0.00 ? 34  VAL A HG12 4  
ATOM   3941  H  HG13 . VAL A 1 34 ? -8.538  9.311   -2.679  1.00 0.00 ? 34  VAL A HG13 4  
ATOM   3942  H  HG21 . VAL A 1 34 ? -8.714  11.653  -2.759  1.00 0.00 ? 34  VAL A HG21 4  
ATOM   3943  H  HG22 . VAL A 1 34 ? -7.736  12.601  -3.879  1.00 0.00 ? 34  VAL A HG22 4  
ATOM   3944  H  HG23 . VAL A 1 34 ? -8.893  11.424  -4.499  1.00 0.00 ? 34  VAL A HG23 4  
ATOM   3945  N  N    . ALA A 1 35 ? -5.960  13.334  -2.598  1.00 0.00 ? 35  ALA A N    4  
ATOM   3946  C  CA   . ALA A 1 35 ? -5.420  14.653  -2.905  1.00 0.00 ? 35  ALA A CA   4  
ATOM   3947  C  C    . ALA A 1 35 ? -3.974  14.777  -2.436  1.00 0.00 ? 35  ALA A C    4  
ATOM   3948  O  O    . ALA A 1 35 ? -3.099  15.190  -3.196  1.00 0.00 ? 35  ALA A O    4  
ATOM   3949  C  CB   . ALA A 1 35 ? -6.278  15.736  -2.269  1.00 0.00 ? 35  ALA A CB   4  
ATOM   3950  H  H    . ALA A 1 35 ? -6.777  13.265  -2.061  1.00 0.00 ? 35  ALA A H    4  
ATOM   3951  H  HA   . ALA A 1 35 ? -5.452  14.785  -3.977  1.00 0.00 ? 35  ALA A HA   4  
ATOM   3952  H  HB1  . ALA A 1 35 ? -7.198  15.299  -1.908  1.00 0.00 ? 35  ALA A HB1  4  
ATOM   3953  H  HB2  . ALA A 1 35 ? -5.743  16.181  -1.444  1.00 0.00 ? 35  ALA A HB2  4  
ATOM   3954  H  HB3  . ALA A 1 35 ? -6.504  16.494  -3.004  1.00 0.00 ? 35  ALA A HB3  4  
ATOM   3955  N  N    . ALA A 1 36 ? -3.732  14.418  -1.179  1.00 0.00 ? 36  ALA A N    4  
ATOM   3956  C  CA   . ALA A 1 36 ? -2.392  14.489  -0.610  1.00 0.00 ? 36  ALA A CA   4  
ATOM   3957  C  C    . ALA A 1 36 ? -1.370  13.825  -1.526  1.00 0.00 ? 36  ALA A C    4  
ATOM   3958  O  O    . ALA A 1 36 ? -0.257  14.324  -1.696  1.00 0.00 ? 36  ALA A O    4  
ATOM   3959  C  CB   . ALA A 1 36 ? -2.369  13.840  0.767   1.00 0.00 ? 36  ALA A CB   4  
ATOM   3960  H  H    . ALA A 1 36 ? -4.472  14.098  -0.623  1.00 0.00 ? 36  ALA A H    4  
ATOM   3961  H  HA   . ALA A 1 36 ? -2.133  15.532  -0.494  1.00 0.00 ? 36  ALA A HA   4  
ATOM   3962  H  HB1  . ALA A 1 36 ? -1.543  14.239  1.338   1.00 0.00 ? 36  ALA A HB1  4  
ATOM   3963  H  HB2  . ALA A 1 36 ? -3.296  14.050  1.279   1.00 0.00 ? 36  ALA A HB2  4  
ATOM   3964  H  HB3  . ALA A 1 36 ? -2.250  12.773  0.659   1.00 0.00 ? 36  ALA A HB3  4  
ATOM   3965  N  N    . LEU A 1 37 ? -1.754  12.698  -2.115  1.00 0.00 ? 37  LEU A N    4  
ATOM   3966  C  CA   . LEU A 1 37 ? -0.871  11.965  -3.015  1.00 0.00 ? 37  LEU A CA   4  
ATOM   3967  C  C    . LEU A 1 37 ? -0.633  12.748  -4.302  1.00 0.00 ? 37  LEU A C    4  
ATOM   3968  O  O    . LEU A 1 37 ? -1.556  12.968  -5.086  1.00 0.00 ? 37  LEU A O    4  
ATOM   3969  C  CB   . LEU A 1 37 ? -1.466  10.594  -3.341  1.00 0.00 ? 37  LEU A CB   4  
ATOM   3970  C  CG   . LEU A 1 37 ? -2.237  9.911   -2.211  1.00 0.00 ? 37  LEU A CG   4  
ATOM   3971  C  CD1  . LEU A 1 37 ? -2.793  8.574   -2.677  1.00 0.00 ? 37  LEU A CD1  4  
ATOM   3972  C  CD2  . LEU A 1 37 ? -1.344  9.725   -0.993  1.00 0.00 ? 37  LEU A CD2  4  
ATOM   3973  H  H    . LEU A 1 37 ? -2.653  12.350  -1.941  1.00 0.00 ? 37  LEU A H    4  
ATOM   3974  H  HA   . LEU A 1 37 ? 0.075   11.827  -2.511  1.00 0.00 ? 37  LEU A HA   4  
ATOM   3975  H  HB2  . LEU A 1 37 ? -2.141  10.717  -4.175  1.00 0.00 ? 37  LEU A HB2  4  
ATOM   3976  H  HB3  . LEU A 1 37 ? -0.654  9.942   -3.631  1.00 0.00 ? 37  LEU A HB3  4  
ATOM   3977  H  HG   . LEU A 1 37 ? -3.071  10.536  -1.924  1.00 0.00 ? 37  LEU A HG   4  
ATOM   3978  H  HD11 . LEU A 1 37 ? -2.275  8.261   -3.571  1.00 0.00 ? 37  LEU A HD11 4  
ATOM   3979  H  HD12 . LEU A 1 37 ? -3.847  8.676   -2.887  1.00 0.00 ? 37  LEU A HD12 4  
ATOM   3980  H  HD13 . LEU A 1 37 ? -2.651  7.836   -1.901  1.00 0.00 ? 37  LEU A HD13 4  
ATOM   3981  H  HD21 . LEU A 1 37 ? -1.055  8.687   -0.915  1.00 0.00 ? 37  LEU A HD21 4  
ATOM   3982  H  HD22 . LEU A 1 37 ? -1.884  10.016  -0.104  1.00 0.00 ? 37  LEU A HD22 4  
ATOM   3983  H  HD23 . LEU A 1 37 ? -0.461  10.338  -1.097  1.00 0.00 ? 37  LEU A HD23 4  
ATOM   3984  N  N    . ARG A 1 38 ? 0.611   13.166  -4.513  1.00 0.00 ? 38  ARG A N    4  
ATOM   3985  C  CA   . ARG A 1 38 ? 0.971   13.923  -5.705  1.00 0.00 ? 38  ARG A CA   4  
ATOM   3986  C  C    . ARG A 1 38 ? 1.995   13.164  -6.544  1.00 0.00 ? 38  ARG A C    4  
ATOM   3987  O  O    . ARG A 1 38 ? 2.090   13.362  -7.756  1.00 0.00 ? 38  ARG A O    4  
ATOM   3988  C  CB   . ARG A 1 38 ? 1.531   15.293  -5.316  1.00 0.00 ? 38  ARG A CB   4  
ATOM   3989  C  CG   . ARG A 1 38 ? 1.087   15.763  -3.940  1.00 0.00 ? 38  ARG A CG   4  
ATOM   3990  C  CD   . ARG A 1 38 ? 2.129   15.446  -2.880  1.00 0.00 ? 38  ARG A CD   4  
ATOM   3991  N  NE   . ARG A 1 38 ? 3.186   16.453  -2.832  1.00 0.00 ? 38  ARG A NE   4  
ATOM   3992  C  CZ   . ARG A 1 38 ? 3.137   17.533  -2.060  1.00 0.00 ? 38  ARG A CZ   4  
ATOM   3993  N  NH1  . ARG A 1 38 ? 2.090   17.744  -1.274  1.00 0.00 ? 38  ARG A NH1  4  
ATOM   3994  N  NH2  . ARG A 1 38 ? 4.138   18.404  -2.071  1.00 0.00 ? 38  ARG A NH2  4  
ATOM   3995  H  H    . ARG A 1 38 ? 1.304   12.960  -3.851  1.00 0.00 ? 38  ARG A H    4  
ATOM   3996  H  HA   . ARG A 1 38 ? 0.076   14.064  -6.292  1.00 0.00 ? 38  ARG A HA   4  
ATOM   3997  H  HB2  . ARG A 1 38 ? 2.610   15.243  -5.324  1.00 0.00 ? 38  ARG A HB2  4  
ATOM   3998  H  HB3  . ARG A 1 38 ? 1.206   16.021  -6.043  1.00 0.00 ? 38  ARG A HB3  4  
ATOM   3999  H  HG2  . ARG A 1 38 ? 0.932   16.832  -3.968  1.00 0.00 ? 38  ARG A HG2  4  
ATOM   4000  H  HG3  . ARG A 1 38 ? 0.162   15.270  -3.683  1.00 0.00 ? 38  ARG A HG3  4  
ATOM   4001  H  HD2  . ARG A 1 38 ? 1.643   15.403  -1.917  1.00 0.00 ? 38  ARG A HD2  4  
ATOM   4002  H  HD3  . ARG A 1 38 ? 2.570   14.486  -3.103  1.00 0.00 ? 38  ARG A HD3  4  
ATOM   4003  H  HE   . ARG A 1 38 ? 3.969   16.317  -3.404  1.00 0.00 ? 38  ARG A HE   4  
ATOM   4004  H  HH11 . ARG A 1 38 ? 1.335   17.089  -1.263  1.00 0.00 ? 38  ARG A HH11 4  
ATOM   4005  H  HH12 . ARG A 1 38 ? 2.057   18.557  -0.693  1.00 0.00 ? 38  ARG A HH12 4  
ATOM   4006  H  HH21 . ARG A 1 38 ? 4.929   18.248  -2.662  1.00 0.00 ? 38  ARG A HH21 4  
ATOM   4007  H  HH22 . ARG A 1 38 ? 4.101   19.216  -1.490  1.00 0.00 ? 38  ARG A HH22 4  
ATOM   4008  N  N    . PHE A 1 39 ? 2.758   12.294  -5.892  1.00 0.00 ? 39  PHE A N    4  
ATOM   4009  C  CA   . PHE A 1 39 ? 3.775   11.505  -6.577  1.00 0.00 ? 39  PHE A CA   4  
ATOM   4010  C  C    . PHE A 1 39 ? 3.258   10.104  -6.891  1.00 0.00 ? 39  PHE A C    4  
ATOM   4011  O  O    . PHE A 1 39 ? 3.198   9.229   -6.028  1.00 0.00 ? 39  PHE A O    4  
ATOM   4012  C  CB   . PHE A 1 39 ? 5.041   11.413  -5.722  1.00 0.00 ? 39  PHE A CB   4  
ATOM   4013  C  CG   . PHE A 1 39 ? 5.449   12.723  -5.112  1.00 0.00 ? 39  PHE A CG   4  
ATOM   4014  C  CD1  . PHE A 1 39 ? 4.802   13.210  -3.987  1.00 0.00 ? 39  PHE A CD1  4  
ATOM   4015  C  CD2  . PHE A 1 39 ? 6.479   13.469  -5.662  1.00 0.00 ? 39  PHE A CD2  4  
ATOM   4016  C  CE1  . PHE A 1 39 ? 5.175   14.416  -3.424  1.00 0.00 ? 39  PHE A CE1  4  
ATOM   4017  C  CE2  . PHE A 1 39 ? 6.856   14.675  -5.103  1.00 0.00 ? 39  PHE A CE2  4  
ATOM   4018  C  CZ   . PHE A 1 39 ? 6.204   15.149  -3.982  1.00 0.00 ? 39  PHE A CZ   4  
ATOM   4019  H  H    . PHE A 1 39 ? 2.634   12.180  -4.926  1.00 0.00 ? 39  PHE A H    4  
ATOM   4020  H  HA   . PHE A 1 39 ? 4.013   12.004  -7.503  1.00 0.00 ? 39  PHE A HA   4  
ATOM   4021  H  HB2  . PHE A 1 39 ? 4.874   10.711  -4.919  1.00 0.00 ? 39  PHE A HB2  4  
ATOM   4022  H  HB3  . PHE A 1 39 ? 5.857   11.063  -6.336  1.00 0.00 ? 39  PHE A HB3  4  
ATOM   4023  H  HD1  . PHE A 1 39 ? 3.998   12.637  -3.548  1.00 0.00 ? 39  PHE A HD1  4  
ATOM   4024  H  HD2  . PHE A 1 39 ? 6.990   13.099  -6.540  1.00 0.00 ? 39  PHE A HD2  4  
ATOM   4025  H  HE1  . PHE A 1 39 ? 4.664   14.784  -2.547  1.00 0.00 ? 39  PHE A HE1  4  
ATOM   4026  H  HE2  . PHE A 1 39 ? 7.661   15.246  -5.543  1.00 0.00 ? 39  PHE A HE2  4  
ATOM   4027  H  HZ   . PHE A 1 39 ? 6.497   16.091  -3.544  1.00 0.00 ? 39  PHE A HZ   4  
ATOM   4028  N  N    . PRO A 1 40 ? 2.874   9.887   -8.158  1.00 0.00 ? 40  PRO A N    4  
ATOM   4029  C  CA   . PRO A 1 40 ? 2.354   8.595   -8.616  1.00 0.00 ? 40  PRO A CA   4  
ATOM   4030  C  C    . PRO A 1 40 ? 3.432   7.517   -8.655  1.00 0.00 ? 40  PRO A C    4  
ATOM   4031  O  O    . PRO A 1 40 ? 4.618   7.805   -8.491  1.00 0.00 ? 40  PRO A O    4  
ATOM   4032  C  CB   . PRO A 1 40 ? 1.849   8.897   -10.030 1.00 0.00 ? 40  PRO A CB   4  
ATOM   4033  C  CG   . PRO A 1 40 ? 2.652   10.071  -10.476 1.00 0.00 ? 40  PRO A CG   4  
ATOM   4034  C  CD   . PRO A 1 40 ? 2.917   10.885  -9.240  1.00 0.00 ? 40  PRO A CD   4  
ATOM   4035  H  HA   . PRO A 1 40 ? 1.531   8.258   -8.003  1.00 0.00 ? 40  PRO A HA   4  
ATOM   4036  H  HB2  . PRO A 1 40 ? 2.016   8.039   -10.665 1.00 0.00 ? 40  PRO A HB2  4  
ATOM   4037  H  HB3  . PRO A 1 40 ? 0.795   9.130   -9.997  1.00 0.00 ? 40  PRO A HB3  4  
ATOM   4038  H  HG2  . PRO A 1 40 ? 3.581   9.736   -10.911 1.00 0.00 ? 40  PRO A HG2  4  
ATOM   4039  H  HG3  . PRO A 1 40 ? 2.088   10.650  -11.192 1.00 0.00 ? 40  PRO A HG3  4  
ATOM   4040  H  HD2  . PRO A 1 40 ? 3.890   11.350  -9.296  1.00 0.00 ? 40  PRO A HD2  4  
ATOM   4041  H  HD3  . PRO A 1 40 ? 2.147   11.631  -9.107  1.00 0.00 ? 40  PRO A HD3  4  
ATOM   4042  N  N    . CYS A 1 41 ? 3.013   6.275   -8.873  1.00 0.00 ? 41  CYS A N    4  
ATOM   4043  C  CA   . CYS A 1 41 ? 3.942   5.154   -8.934  1.00 0.00 ? 41  CYS A CA   4  
ATOM   4044  C  C    . CYS A 1 41 ? 4.136   4.685   -10.373 1.00 0.00 ? 41  CYS A C    4  
ATOM   4045  O  O    . CYS A 1 41 ? 3.250   4.063   -10.958 1.00 0.00 ? 41  CYS A O    4  
ATOM   4046  C  CB   . CYS A 1 41 ? 3.433   3.996   -8.073  1.00 0.00 ? 41  CYS A CB   4  
ATOM   4047  S  SG   . CYS A 1 41 ? 4.649   2.663   -7.825  1.00 0.00 ? 41  CYS A SG   4  
ATOM   4048  H  H    . CYS A 1 41 ? 2.054   6.109   -8.997  1.00 0.00 ? 41  CYS A H    4  
ATOM   4049  H  HA   . CYS A 1 41 ? 4.892   5.488   -8.546  1.00 0.00 ? 41  CYS A HA   4  
ATOM   4050  H  HB2  . CYS A 1 41 ? 3.159   4.375   -7.099  1.00 0.00 ? 41  CYS A HB2  4  
ATOM   4051  H  HB3  . CYS A 1 41 ? 2.562   3.563   -8.543  1.00 0.00 ? 41  CYS A HB3  4  
ATOM   4052  N  N    . GLU A 1 42 ? 5.301   4.988   -10.936 1.00 0.00 ? 42  GLU A N    4  
ATOM   4053  C  CA   . GLU A 1 42 ? 5.611   4.598   -12.307 1.00 0.00 ? 42  GLU A CA   4  
ATOM   4054  C  C    . GLU A 1 42 ? 5.717   3.080   -12.430 1.00 0.00 ? 42  GLU A C    4  
ATOM   4055  O  O    . GLU A 1 42 ? 5.962   2.550   -13.513 1.00 0.00 ? 42  GLU A O    4  
ATOM   4056  C  CB   . GLU A 1 42 ? 6.918   5.250   -12.763 1.00 0.00 ? 42  GLU A CB   4  
ATOM   4057  C  CG   . GLU A 1 42 ? 8.135   4.785   -11.981 1.00 0.00 ? 42  GLU A CG   4  
ATOM   4058  C  CD   . GLU A 1 42 ? 8.712   3.488   -12.516 1.00 0.00 ? 42  GLU A CD   4  
ATOM   4059  O  OE1  . GLU A 1 42 ? 8.236   2.412   -12.099 1.00 0.00 ? 42  GLU A OE1  4  
ATOM   4060  O  OE2  . GLU A 1 42 ? 9.638   3.550   -13.352 1.00 0.00 ? 42  GLU A OE2  4  
ATOM   4061  H  H    . GLU A 1 42 ? 5.968   5.485   -10.418 1.00 0.00 ? 42  GLU A H    4  
ATOM   4062  H  HA   . GLU A 1 42 ? 4.807   4.943   -12.939 1.00 0.00 ? 42  GLU A HA   4  
ATOM   4063  H  HB2  . GLU A 1 42 ? 7.076   5.020   -13.807 1.00 0.00 ? 42  GLU A HB2  4  
ATOM   4064  H  HB3  . GLU A 1 42 ? 6.830   6.320   -12.649 1.00 0.00 ? 42  GLU A HB3  4  
ATOM   4065  H  HG2  . GLU A 1 42 ? 8.896   5.549   -12.037 1.00 0.00 ? 42  GLU A HG2  4  
ATOM   4066  H  HG3  . GLU A 1 42 ? 7.850   4.637   -10.950 1.00 0.00 ? 42  GLU A HG3  4  
ATOM   4067  N  N    . PHE A 1 43 ? 5.530   2.387   -11.311 1.00 0.00 ? 43  PHE A N    4  
ATOM   4068  C  CA   . PHE A 1 43 ? 5.605   0.931   -11.293 1.00 0.00 ? 43  PHE A CA   4  
ATOM   4069  C  C    . PHE A 1 43 ? 4.224   0.312   -11.487 1.00 0.00 ? 43  PHE A C    4  
ATOM   4070  O  O    . PHE A 1 43 ? 4.029   -0.539  -12.355 1.00 0.00 ? 43  PHE A O    4  
ATOM   4071  C  CB   . PHE A 1 43 ? 6.212   0.448   -9.974  1.00 0.00 ? 43  PHE A CB   4  
ATOM   4072  C  CG   . PHE A 1 43 ? 7.695   0.218   -10.045 1.00 0.00 ? 43  PHE A CG   4  
ATOM   4073  C  CD1  . PHE A 1 43 ? 8.206   -0.902  -10.681 1.00 0.00 ? 43  PHE A CD1  4  
ATOM   4074  C  CD2  . PHE A 1 43 ? 8.578   1.121   -9.474  1.00 0.00 ? 43  PHE A CD2  4  
ATOM   4075  C  CE1  . PHE A 1 43 ? 9.570   -1.116  -10.749 1.00 0.00 ? 43  PHE A CE1  4  
ATOM   4076  C  CE2  . PHE A 1 43 ? 9.942   0.912   -9.539  1.00 0.00 ? 43  PHE A CE2  4  
ATOM   4077  C  CZ   . PHE A 1 43 ? 10.439  -0.208  -10.176 1.00 0.00 ? 43  PHE A CZ   4  
ATOM   4078  H  H    . PHE A 1 43 ? 5.337   2.867   -10.478 1.00 0.00 ? 43  PHE A H    4  
ATOM   4079  H  HA   . PHE A 1 43 ? 6.243   0.623   -12.107 1.00 0.00 ? 43  PHE A HA   4  
ATOM   4080  H  HB2  . PHE A 1 43 ? 6.028   1.187   -9.209  1.00 0.00 ? 43  PHE A HB2  4  
ATOM   4081  H  HB3  . PHE A 1 43 ? 5.744   -0.482  -9.690  1.00 0.00 ? 43  PHE A HB3  4  
ATOM   4082  H  HD1  . PHE A 1 43 ? 7.526   -1.613  -11.130 1.00 0.00 ? 43  PHE A HD1  4  
ATOM   4083  H  HD2  . PHE A 1 43 ? 8.191   1.997   -8.975  1.00 0.00 ? 43  PHE A HD2  4  
ATOM   4084  H  HE1  . PHE A 1 43 ? 9.955   -1.993  -11.247 1.00 0.00 ? 43  PHE A HE1  4  
ATOM   4085  H  HE2  . PHE A 1 43 ? 10.620  1.623   -9.090  1.00 0.00 ? 43  PHE A HE2  4  
ATOM   4086  H  HZ   . PHE A 1 43 ? 11.505  -0.373  -10.228 1.00 0.00 ? 43  PHE A HZ   4  
ATOM   4087  N  N    . CYS A 1 44 ? 3.268   0.746   -10.672 1.00 0.00 ? 44  CYS A N    4  
ATOM   4088  C  CA   . CYS A 1 44 ? 1.905   0.236   -10.752 1.00 0.00 ? 44  CYS A CA   4  
ATOM   4089  C  C    . CYS A 1 44 ? 0.926   1.352   -11.101 1.00 0.00 ? 44  CYS A C    4  
ATOM   4090  O  O    . CYS A 1 44 ? -0.048  1.136   -11.821 1.00 0.00 ? 44  CYS A O    4  
ATOM   4091  C  CB   . CYS A 1 44 ? 1.503   -0.414  -9.426  1.00 0.00 ? 44  CYS A CB   4  
ATOM   4092  S  SG   . CYS A 1 44 ? 1.578   0.709   -7.995  1.00 0.00 ? 44  CYS A SG   4  
ATOM   4093  H  H    . CYS A 1 44 ? 3.485   1.427   -10.000 1.00 0.00 ? 44  CYS A H    4  
ATOM   4094  H  HA   . CYS A 1 44 ? 1.875   -0.510  -11.532 1.00 0.00 ? 44  CYS A HA   4  
ATOM   4095  H  HB2  . CYS A 1 44 ? 0.489   -0.778  -9.505  1.00 0.00 ? 44  CYS A HB2  4  
ATOM   4096  H  HB3  . CYS A 1 44 ? 2.163   -1.246  -9.227  1.00 0.00 ? 44  CYS A HB3  4  
ATOM   4097  N  N    . GLY A 1 45 ? 1.192   2.548   -10.584 1.00 0.00 ? 45  GLY A N    4  
ATOM   4098  C  CA   . GLY A 1 45 ? 0.325   3.681   -10.852 1.00 0.00 ? 45  GLY A CA   4  
ATOM   4099  C  C    . GLY A 1 45 ? -0.183  4.336   -9.583  1.00 0.00 ? 45  GLY A C    4  
ATOM   4100  O  O    . GLY A 1 45 ? -0.810  5.394   -9.629  1.00 0.00 ? 45  GLY A O    4  
ATOM   4101  H  H    . GLY A 1 45 ? 1.982   2.662   -10.017 1.00 0.00 ? 45  GLY A H    4  
ATOM   4102  H  HA2  . GLY A 1 45 ? 0.874   4.412   -11.427 1.00 0.00 ? 45  GLY A HA2  4  
ATOM   4103  H  HA3  . GLY A 1 45 ? -0.521  3.344   -11.433 1.00 0.00 ? 45  GLY A HA3  4  
ATOM   4104  N  N    . LYS A 1 46 ? 0.087   3.705   -8.445  1.00 0.00 ? 46  LYS A N    4  
ATOM   4105  C  CA   . LYS A 1 46 ? -0.347  4.231   -7.157  1.00 0.00 ? 46  LYS A CA   4  
ATOM   4106  C  C    . LYS A 1 46 ? 0.085   5.684   -6.989  1.00 0.00 ? 46  LYS A C    4  
ATOM   4107  O  O    . LYS A 1 46 ? 0.720   6.259   -7.873  1.00 0.00 ? 46  LYS A O    4  
ATOM   4108  C  CB   . LYS A 1 46 ? 0.224   3.383   -6.018  1.00 0.00 ? 46  LYS A CB   4  
ATOM   4109  C  CG   . LYS A 1 46 ? -0.554  2.104   -5.762  1.00 0.00 ? 46  LYS A CG   4  
ATOM   4110  C  CD   . LYS A 1 46 ? 0.107   1.254   -4.690  1.00 0.00 ? 46  LYS A CD   4  
ATOM   4111  C  CE   . LYS A 1 46 ? -0.373  1.639   -3.299  1.00 0.00 ? 46  LYS A CE   4  
ATOM   4112  N  NZ   . LYS A 1 46 ? 0.627   1.293   -2.252  1.00 0.00 ? 46  LYS A NZ   4  
ATOM   4113  H  H    . LYS A 1 46 ? 0.591   2.864   -8.473  1.00 0.00 ? 46  LYS A H    4  
ATOM   4114  H  HA   . LYS A 1 46 ? -1.425  4.182   -7.124  1.00 0.00 ? 46  LYS A HA   4  
ATOM   4115  H  HB2  . LYS A 1 46 ? 1.243   3.118   -6.259  1.00 0.00 ? 46  LYS A HB2  4  
ATOM   4116  H  HB3  . LYS A 1 46 ? 0.219   3.970   -5.111  1.00 0.00 ? 46  LYS A HB3  4  
ATOM   4117  H  HG2  . LYS A 1 46 ? -1.552  2.360   -5.439  1.00 0.00 ? 46  LYS A HG2  4  
ATOM   4118  H  HG3  . LYS A 1 46 ? -0.605  1.535   -6.679  1.00 0.00 ? 46  LYS A HG3  4  
ATOM   4119  H  HD2  . LYS A 1 46 ? -0.133  0.216   -4.867  1.00 0.00 ? 46  LYS A HD2  4  
ATOM   4120  H  HD3  . LYS A 1 46 ? 1.178   1.392   -4.743  1.00 0.00 ? 46  LYS A HD3  4  
ATOM   4121  H  HE2  . LYS A 1 46 ? -0.552  2.703   -3.275  1.00 0.00 ? 46  LYS A HE2  4  
ATOM   4122  H  HE3  . LYS A 1 46 ? -1.294  1.114   -3.092  1.00 0.00 ? 46  LYS A HE3  4  
ATOM   4123  H  HZ1  . LYS A 1 46 ? 1.012   0.342   -2.426  1.00 0.00 ? 46  LYS A HZ1  4  
ATOM   4124  H  HZ2  . LYS A 1 46 ? 0.181   1.306   -1.313  1.00 0.00 ? 46  LYS A HZ2  4  
ATOM   4125  H  HZ3  . LYS A 1 46 ? 1.409   1.979   -2.263  1.00 0.00 ? 46  LYS A HZ3  4  
ATOM   4126  N  N    . ARG A 1 47 ? -0.262  6.272   -5.848  1.00 0.00 ? 47  ARG A N    4  
ATOM   4127  C  CA   . ARG A 1 47 ? 0.090   7.658   -5.565  1.00 0.00 ? 47  ARG A CA   4  
ATOM   4128  C  C    . ARG A 1 47 ? 0.369   7.855   -4.078  1.00 0.00 ? 47  ARG A C    4  
ATOM   4129  O  O    . ARG A 1 47 ? -0.340  7.318   -3.227  1.00 0.00 ? 47  ARG A O    4  
ATOM   4130  C  CB   . ARG A 1 47 ? -1.033  8.594   -6.013  1.00 0.00 ? 47  ARG A CB   4  
ATOM   4131  C  CG   . ARG A 1 47 ? -1.286  8.569   -7.512  1.00 0.00 ? 47  ARG A CG   4  
ATOM   4132  C  CD   . ARG A 1 47 ? -2.675  9.089   -7.851  1.00 0.00 ? 47  ARG A CD   4  
ATOM   4133  N  NE   . ARG A 1 47 ? -3.707  8.080   -7.627  1.00 0.00 ? 47  ARG A NE   4  
ATOM   4134  C  CZ   . ARG A 1 47 ? -4.991  8.268   -7.910  1.00 0.00 ? 47  ARG A CZ   4  
ATOM   4135  N  NH1  . ARG A 1 47 ? -5.399  9.419   -8.425  1.00 0.00 ? 47  ARG A NH1  4  
ATOM   4136  N  NH2  . ARG A 1 47 ? -5.871  7.301   -7.678  1.00 0.00 ? 47  ARG A NH2  4  
ATOM   4137  H  H    . ARG A 1 47 ? -0.768  5.762   -5.182  1.00 0.00 ? 47  ARG A H    4  
ATOM   4138  H  HA   . ARG A 1 47 ? 0.986   7.893   -6.121  1.00 0.00 ? 47  ARG A HA   4  
ATOM   4139  H  HB2  . ARG A 1 47 ? -1.946  8.308   -5.512  1.00 0.00 ? 47  ARG A HB2  4  
ATOM   4140  H  HB3  . ARG A 1 47 ? -0.778  9.604   -5.730  1.00 0.00 ? 47  ARG A HB3  4  
ATOM   4141  H  HG2  . ARG A 1 47 ? -0.552  9.190   -8.002  1.00 0.00 ? 47  ARG A HG2  4  
ATOM   4142  H  HG3  . ARG A 1 47 ? -1.195  7.553   -7.865  1.00 0.00 ? 47  ARG A HG3  4  
ATOM   4143  H  HD2  . ARG A 1 47 ? -2.884  9.948   -7.232  1.00 0.00 ? 47  ARG A HD2  4  
ATOM   4144  H  HD3  . ARG A 1 47 ? -2.690  9.382   -8.890  1.00 0.00 ? 47  ARG A HD3  4  
ATOM   4145  H  HE   . ARG A 1 47 ? -3.427  7.221   -7.247  1.00 0.00 ? 47  ARG A HE   4  
ATOM   4146  H  HH11 . ARG A 1 47 ? -4.738  10.148  -8.602  1.00 0.00 ? 47  ARG A HH11 4  
ATOM   4147  H  HH12 . ARG A 1 47 ? -6.366  9.557   -8.638  1.00 0.00 ? 47  ARG A HH12 4  
ATOM   4148  H  HH21 . ARG A 1 47 ? -5.567  6.432   -7.290  1.00 0.00 ? 47  ARG A HH21 4  
ATOM   4149  H  HH22 . ARG A 1 47 ? -6.837  7.444   -7.891  1.00 0.00 ? 47  ARG A HH22 4  
ATOM   4150  N  N    . PHE A 1 48 ? 1.405   8.629   -3.773  1.00 0.00 ? 48  PHE A N    4  
ATOM   4151  C  CA   . PHE A 1 48 ? 1.778   8.896   -2.389  1.00 0.00 ? 48  PHE A CA   4  
ATOM   4152  C  C    . PHE A 1 48 ? 1.882   10.397  -2.133  1.00 0.00 ? 48  PHE A C    4  
ATOM   4153  O  O    . PHE A 1 48 ? 2.097   11.180  -3.058  1.00 0.00 ? 48  PHE A O    4  
ATOM   4154  C  CB   . PHE A 1 48 ? 3.109   8.218   -2.057  1.00 0.00 ? 48  PHE A CB   4  
ATOM   4155  C  CG   . PHE A 1 48 ? 3.086   6.728   -2.246  1.00 0.00 ? 48  PHE A CG   4  
ATOM   4156  C  CD1  . PHE A 1 48 ? 2.869   6.179   -3.500  1.00 0.00 ? 48  PHE A CD1  4  
ATOM   4157  C  CD2  . PHE A 1 48 ? 3.281   5.877   -1.171  1.00 0.00 ? 48  PHE A CD2  4  
ATOM   4158  C  CE1  . PHE A 1 48 ? 2.847   4.808   -3.676  1.00 0.00 ? 48  PHE A CE1  4  
ATOM   4159  C  CE2  . PHE A 1 48 ? 3.260   4.505   -1.341  1.00 0.00 ? 48  PHE A CE2  4  
ATOM   4160  C  CZ   . PHE A 1 48 ? 3.044   3.970   -2.596  1.00 0.00 ? 48  PHE A CZ   4  
ATOM   4161  H  H    . PHE A 1 48 ? 1.932   9.030   -4.496  1.00 0.00 ? 48  PHE A H    4  
ATOM   4162  H  HA   . PHE A 1 48 ? 1.008   8.488   -1.754  1.00 0.00 ? 48  PHE A HA   4  
ATOM   4163  H  HB2  . PHE A 1 48 ? 3.880   8.621   -2.697  1.00 0.00 ? 48  PHE A HB2  4  
ATOM   4164  H  HB3  . PHE A 1 48 ? 3.360   8.419   -1.027  1.00 0.00 ? 48  PHE A HB3  4  
ATOM   4165  H  HD1  . PHE A 1 48 ? 2.716   6.833   -4.346  1.00 0.00 ? 48  PHE A HD1  4  
ATOM   4166  H  HD2  . PHE A 1 48 ? 3.451   6.294   -0.188  1.00 0.00 ? 48  PHE A HD2  4  
ATOM   4167  H  HE1  . PHE A 1 48 ? 2.677   4.393   -4.659  1.00 0.00 ? 48  PHE A HE1  4  
ATOM   4168  H  HE2  . PHE A 1 48 ? 3.415   3.853   -0.494  1.00 0.00 ? 48  PHE A HE2  4  
ATOM   4169  H  HZ   . PHE A 1 48 ? 3.026   2.899   -2.732  1.00 0.00 ? 48  PHE A HZ   4  
ATOM   4170  N  N    . GLU A 1 49 ? 1.727   10.789  -0.873  1.00 0.00 ? 49  GLU A N    4  
ATOM   4171  C  CA   . GLU A 1 49 ? 1.802   12.196  -0.496  1.00 0.00 ? 49  GLU A CA   4  
ATOM   4172  C  C    . GLU A 1 49 ? 3.226   12.723  -0.643  1.00 0.00 ? 49  GLU A C    4  
ATOM   4173  O  O    . GLU A 1 49 ? 3.461   13.931  -0.598  1.00 0.00 ? 49  GLU A O    4  
ATOM   4174  C  CB   . GLU A 1 49 ? 1.321   12.387  0.944   1.00 0.00 ? 49  GLU A CB   4  
ATOM   4175  C  CG   . GLU A 1 49 ? 1.862   11.346  1.910   1.00 0.00 ? 49  GLU A CG   4  
ATOM   4176  C  CD   . GLU A 1 49 ? 2.055   11.894  3.310   1.00 0.00 ? 49  GLU A CD   4  
ATOM   4177  O  OE1  . GLU A 1 49 ? 2.267   13.118  3.444   1.00 0.00 ? 49  GLU A OE1  4  
ATOM   4178  O  OE2  . GLU A 1 49 ? 1.995   11.100  4.272   1.00 0.00 ? 49  GLU A OE2  4  
ATOM   4179  H  H    . GLU A 1 49 ? 1.558   10.117  -0.180  1.00 0.00 ? 49  GLU A H    4  
ATOM   4180  H  HA   . GLU A 1 49 ? 1.155   12.751  -1.158  1.00 0.00 ? 49  GLU A HA   4  
ATOM   4181  H  HB2  . GLU A 1 49 ? 1.631   13.363  1.288   1.00 0.00 ? 49  GLU A HB2  4  
ATOM   4182  H  HB3  . GLU A 1 49 ? 0.243   12.337  0.960   1.00 0.00 ? 49  GLU A HB3  4  
ATOM   4183  H  HG2  . GLU A 1 49 ? 1.167   10.521  1.955   1.00 0.00 ? 49  GLU A HG2  4  
ATOM   4184  H  HG3  . GLU A 1 49 ? 2.814   10.993  1.543   1.00 0.00 ? 49  GLU A HG3  4  
ATOM   4185  N  N    . LYS A 1 50 ? 4.174   11.809  -0.818  1.00 0.00 ? 50  LYS A N    4  
ATOM   4186  C  CA   . LYS A 1 50 ? 5.576   12.179  -0.973  1.00 0.00 ? 50  LYS A CA   4  
ATOM   4187  C  C    . LYS A 1 50 ? 6.352   11.083  -1.696  1.00 0.00 ? 50  LYS A C    4  
ATOM   4188  O  O    . LYS A 1 50 ? 5.934   9.926   -1.751  1.00 0.00 ? 50  LYS A O    4  
ATOM   4189  C  CB   . LYS A 1 50 ? 6.207   12.449  0.395   1.00 0.00 ? 50  LYS A CB   4  
ATOM   4190  C  CG   . LYS A 1 50 ? 5.594   11.632  1.519   1.00 0.00 ? 50  LYS A CG   4  
ATOM   4191  C  CD   . LYS A 1 50 ? 6.338   11.838  2.828   1.00 0.00 ? 50  LYS A CD   4  
ATOM   4192  C  CE   . LYS A 1 50 ? 6.047   13.207  3.425   1.00 0.00 ? 50  LYS A CE   4  
ATOM   4193  N  NZ   . LYS A 1 50 ? 4.839   13.187  4.295   1.00 0.00 ? 50  LYS A NZ   4  
ATOM   4194  H  H    . LYS A 1 50 ? 3.925   10.861  -0.845  1.00 0.00 ? 50  LYS A H    4  
ATOM   4195  H  HA   . LYS A 1 50 ? 5.618   13.082  -1.563  1.00 0.00 ? 50  LYS A HA   4  
ATOM   4196  H  HB2  . LYS A 1 50 ? 7.261   12.218  0.344   1.00 0.00 ? 50  LYS A HB2  4  
ATOM   4197  H  HB3  . LYS A 1 50 ? 6.088   13.496  0.633   1.00 0.00 ? 50  LYS A HB3  4  
ATOM   4198  H  HG2  . LYS A 1 50 ? 4.566   11.932  1.651   1.00 0.00 ? 50  LYS A HG2  4  
ATOM   4199  H  HG3  . LYS A 1 50 ? 5.635   10.585  1.254   1.00 0.00 ? 50  LYS A HG3  4  
ATOM   4200  H  HD2  . LYS A 1 50 ? 6.029   11.079  3.532   1.00 0.00 ? 50  LYS A HD2  4  
ATOM   4201  H  HD3  . LYS A 1 50 ? 7.400   11.753  2.646   1.00 0.00 ? 50  LYS A HD3  4  
ATOM   4202  H  HE2  . LYS A 1 50 ? 6.898   13.518  4.011   1.00 0.00 ? 50  LYS A HE2  4  
ATOM   4203  H  HE3  . LYS A 1 50 ? 5.889   13.909  2.620   1.00 0.00 ? 50  LYS A HE3  4  
ATOM   4204  H  HZ1  . LYS A 1 50 ? 4.576   12.206  4.518   1.00 0.00 ? 50  LYS A HZ1  4  
ATOM   4205  H  HZ2  . LYS A 1 50 ? 4.041   13.646  3.810   1.00 0.00 ? 50  LYS A HZ2  4  
ATOM   4206  H  HZ3  . LYS A 1 50 ? 5.029   13.694  5.183   1.00 0.00 ? 50  LYS A HZ3  4  
ATOM   4207  N  N    . PRO A 1 51 ? 7.510   11.452  -2.262  1.00 0.00 ? 51  PRO A N    4  
ATOM   4208  C  CA   . PRO A 1 51 ? 8.370   10.514  -2.990  1.00 0.00 ? 51  PRO A CA   4  
ATOM   4209  C  C    . PRO A 1 51 ? 9.033   9.498   -2.066  1.00 0.00 ? 51  PRO A C    4  
ATOM   4210  O  O    . PRO A 1 51 ? 9.127   8.315   -2.393  1.00 0.00 ? 51  PRO A O    4  
ATOM   4211  C  CB   . PRO A 1 51 ? 9.423   11.421  -3.631  1.00 0.00 ? 51  PRO A CB   4  
ATOM   4212  C  CG   . PRO A 1 51 ? 9.469   12.625  -2.754  1.00 0.00 ? 51  PRO A CG   4  
ATOM   4213  C  CD   . PRO A 1 51 ? 8.070   12.814  -2.236  1.00 0.00 ? 51  PRO A CD   4  
ATOM   4214  H  HA   . PRO A 1 51 ? 7.823   9.993   -3.763  1.00 0.00 ? 51  PRO A HA   4  
ATOM   4215  H  HB2  . PRO A 1 51 ? 10.376  10.911  -3.653  1.00 0.00 ? 51  PRO A HB2  4  
ATOM   4216  H  HB3  . PRO A 1 51 ? 9.121   11.676  -4.635  1.00 0.00 ? 51  PRO A HB3  4  
ATOM   4217  H  HG2  . PRO A 1 51 ? 10.153  12.458  -1.936  1.00 0.00 ? 51  PRO A HG2  4  
ATOM   4218  H  HG3  . PRO A 1 51 ? 9.774   13.486  -3.330  1.00 0.00 ? 51  PRO A HG3  4  
ATOM   4219  H  HD2  . PRO A 1 51 ? 8.090   13.203  -1.229  1.00 0.00 ? 51  PRO A HD2  4  
ATOM   4220  H  HD3  . PRO A 1 51 ? 7.513   13.472  -2.886  1.00 0.00 ? 51  PRO A HD3  4  
ATOM   4221  N  N    . ASP A 1 52 ? 9.490   9.968   -0.910  1.00 0.00 ? 52  ASP A N    4  
ATOM   4222  C  CA   . ASP A 1 52 ? 10.143  9.100   0.063   1.00 0.00 ? 52  ASP A CA   4  
ATOM   4223  C  C    . ASP A 1 52 ? 9.353   7.810   0.257   1.00 0.00 ? 52  ASP A C    4  
ATOM   4224  O  O    . ASP A 1 52 ? 9.930   6.734   0.418   1.00 0.00 ? 52  ASP A O    4  
ATOM   4225  C  CB   . ASP A 1 52 ? 10.298  9.824   1.401   1.00 0.00 ? 52  ASP A CB   4  
ATOM   4226  C  CG   . ASP A 1 52 ? 10.520  8.866   2.555   1.00 0.00 ? 52  ASP A CG   4  
ATOM   4227  O  OD1  . ASP A 1 52 ? 11.639  8.324   2.670   1.00 0.00 ? 52  ASP A OD1  4  
ATOM   4228  O  OD2  . ASP A 1 52 ? 9.575   8.660   3.345   1.00 0.00 ? 52  ASP A OD2  4  
ATOM   4229  H  H    . ASP A 1 52 ? 9.385   10.921  -0.706  1.00 0.00 ? 52  ASP A H    4  
ATOM   4230  H  HA   . ASP A 1 52 ? 11.123  8.853   -0.317  1.00 0.00 ? 52  ASP A HA   4  
ATOM   4231  H  HB2  . ASP A 1 52 ? 11.144  10.493  1.345   1.00 0.00 ? 52  ASP A HB2  4  
ATOM   4232  H  HB3  . ASP A 1 52 ? 9.404   10.397  1.599   1.00 0.00 ? 52  ASP A HB3  4  
ATOM   4233  N  N    . SER A 1 53 ? 8.029   7.925   0.242   1.00 0.00 ? 53  SER A N    4  
ATOM   4234  C  CA   . SER A 1 53 ? 7.159   6.768   0.421   1.00 0.00 ? 53  SER A CA   4  
ATOM   4235  C  C    . SER A 1 53 ? 7.038   5.973   -0.876  1.00 0.00 ? 53  SER A C    4  
ATOM   4236  O  O    . SER A 1 53 ? 6.866   4.754   -0.856  1.00 0.00 ? 53  SER A O    4  
ATOM   4237  C  CB   . SER A 1 53 ? 5.772   7.215   0.889   1.00 0.00 ? 53  SER A CB   4  
ATOM   4238  O  OG   . SER A 1 53 ? 5.201   6.263   1.770   1.00 0.00 ? 53  SER A OG   4  
ATOM   4239  H  H    . SER A 1 53 ? 7.628   8.809   0.109   1.00 0.00 ? 53  SER A H    4  
ATOM   4240  H  HA   . SER A 1 53 ? 7.599   6.136   1.177   1.00 0.00 ? 53  SER A HA   4  
ATOM   4241  H  HB2  . SER A 1 53 ? 5.856   8.159   1.405   1.00 0.00 ? 53  SER A HB2  4  
ATOM   4242  H  HB3  . SER A 1 53 ? 5.125   7.328   0.032   1.00 0.00 ? 53  SER A HB3  4  
ATOM   4243  H  HG   . SER A 1 53 ? 4.607   5.689   1.281   1.00 0.00 ? 53  SER A HG   4  
ATOM   4244  N  N    . VAL A 1 54 ? 7.130   6.673   -2.002  1.00 0.00 ? 54  VAL A N    4  
ATOM   4245  C  CA   . VAL A 1 54 ? 7.033   6.033   -3.309  1.00 0.00 ? 54  VAL A CA   4  
ATOM   4246  C  C    . VAL A 1 54 ? 8.251   5.160   -3.586  1.00 0.00 ? 54  VAL A C    4  
ATOM   4247  O  O    . VAL A 1 54 ? 8.160   4.153   -4.287  1.00 0.00 ? 54  VAL A O    4  
ATOM   4248  C  CB   . VAL A 1 54 ? 6.895   7.075   -4.435  1.00 0.00 ? 54  VAL A CB   4  
ATOM   4249  C  CG1  . VAL A 1 54 ? 7.600   6.597   -5.695  1.00 0.00 ? 54  VAL A CG1  4  
ATOM   4250  C  CG2  . VAL A 1 54 ? 5.428   7.368   -4.713  1.00 0.00 ? 54  VAL A CG2  4  
ATOM   4251  H  H    . VAL A 1 54 ? 7.267   7.642   -1.953  1.00 0.00 ? 54  VAL A H    4  
ATOM   4252  H  HA   . VAL A 1 54 ? 6.149   5.412   -3.312  1.00 0.00 ? 54  VAL A HA   4  
ATOM   4253  H  HB   . VAL A 1 54 ? 7.367   7.991   -4.110  1.00 0.00 ? 54  VAL A HB   4  
ATOM   4254  H  HG11 . VAL A 1 54 ? 7.407   5.544   -5.837  1.00 0.00 ? 54  VAL A HG11 4  
ATOM   4255  H  HG12 . VAL A 1 54 ? 7.232   7.151   -6.546  1.00 0.00 ? 54  VAL A HG12 4  
ATOM   4256  H  HG13 . VAL A 1 54 ? 8.664   6.756   -5.594  1.00 0.00 ? 54  VAL A HG13 4  
ATOM   4257  H  HG21 . VAL A 1 54 ? 5.054   6.664   -5.442  1.00 0.00 ? 54  VAL A HG21 4  
ATOM   4258  H  HG22 . VAL A 1 54 ? 4.862   7.274   -3.798  1.00 0.00 ? 54  VAL A HG22 4  
ATOM   4259  H  HG23 . VAL A 1 54 ? 5.327   8.372   -5.097  1.00 0.00 ? 54  VAL A HG23 4  
ATOM   4260  N  N    . ALA A 1 55 ? 9.393   5.553   -3.030  1.00 0.00 ? 55  ALA A N    4  
ATOM   4261  C  CA   . ALA A 1 55 ? 10.630  4.805   -3.215  1.00 0.00 ? 55  ALA A CA   4  
ATOM   4262  C  C    . ALA A 1 55 ? 10.633  3.533   -2.373  1.00 0.00 ? 55  ALA A C    4  
ATOM   4263  O  O    . ALA A 1 55 ? 11.128  2.493   -2.806  1.00 0.00 ? 55  ALA A O    4  
ATOM   4264  C  CB   . ALA A 1 55 ? 11.829  5.674   -2.865  1.00 0.00 ? 55  ALA A CB   4  
ATOM   4265  H  H    . ALA A 1 55 ? 9.402   6.365   -2.481  1.00 0.00 ? 55  ALA A H    4  
ATOM   4266  H  HA   . ALA A 1 55 ? 10.704  4.535   -4.258  1.00 0.00 ? 55  ALA A HA   4  
ATOM   4267  H  HB1  . ALA A 1 55 ? 12.555  5.084   -2.325  1.00 0.00 ? 55  ALA A HB1  4  
ATOM   4268  H  HB2  . ALA A 1 55 ? 12.276  6.052   -3.773  1.00 0.00 ? 55  ALA A HB2  4  
ATOM   4269  H  HB3  . ALA A 1 55 ? 11.507  6.501   -2.250  1.00 0.00 ? 55  ALA A HB3  4  
ATOM   4270  N  N    . ALA A 1 56 ? 10.078  3.624   -1.169  1.00 0.00 ? 56  ALA A N    4  
ATOM   4271  C  CA   . ALA A 1 56 ? 10.016  2.480   -0.268  1.00 0.00 ? 56  ALA A CA   4  
ATOM   4272  C  C    . ALA A 1 56 ? 8.955   1.482   -0.721  1.00 0.00 ? 56  ALA A C    4  
ATOM   4273  O  O    . ALA A 1 56 ? 9.156   0.269   -0.641  1.00 0.00 ? 56  ALA A O    4  
ATOM   4274  C  CB   . ALA A 1 56 ? 9.735   2.943   1.154   1.00 0.00 ? 56  ALA A CB   4  
ATOM   4275  H  H    . ALA A 1 56 ? 9.700   4.481   -0.881  1.00 0.00 ? 56  ALA A H    4  
ATOM   4276  H  HA   . ALA A 1 56 ? 10.981  1.994   -0.279  1.00 0.00 ? 56  ALA A HA   4  
ATOM   4277  H  HB1  . ALA A 1 56 ? 9.520   4.001   1.151   1.00 0.00 ? 56  ALA A HB1  4  
ATOM   4278  H  HB2  . ALA A 1 56 ? 8.886   2.404   1.546   1.00 0.00 ? 56  ALA A HB2  4  
ATOM   4279  H  HB3  . ALA A 1 56 ? 10.600  2.752   1.771   1.00 0.00 ? 56  ALA A HB3  4  
ATOM   4280  N  N    . HIS A 1 57 ? 7.827   1.999   -1.196  1.00 0.00 ? 57  HIS A N    4  
ATOM   4281  C  CA   . HIS A 1 57 ? 6.734   1.152   -1.661  1.00 0.00 ? 57  HIS A CA   4  
ATOM   4282  C  C    . HIS A 1 57 ? 7.213   0.197   -2.751  1.00 0.00 ? 57  HIS A C    4  
ATOM   4283  O  O    . HIS A 1 57 ? 6.741   -0.936  -2.848  1.00 0.00 ? 57  HIS A O    4  
ATOM   4284  C  CB   . HIS A 1 57 ? 5.585   2.011   -2.189  1.00 0.00 ? 57  HIS A CB   4  
ATOM   4285  C  CG   . HIS A 1 57 ? 4.770   1.335   -3.249  1.00 0.00 ? 57  HIS A CG   4  
ATOM   4286  N  ND1  . HIS A 1 57 ? 3.982   0.231   -3.003  1.00 0.00 ? 57  HIS A ND1  4  
ATOM   4287  C  CD2  . HIS A 1 57 ? 4.623   1.614   -4.565  1.00 0.00 ? 57  HIS A CD2  4  
ATOM   4288  C  CE1  . HIS A 1 57 ? 3.386   -0.141  -4.122  1.00 0.00 ? 57  HIS A CE1  4  
ATOM   4289  N  NE2  . HIS A 1 57 ? 3.759   0.683   -5.086  1.00 0.00 ? 57  HIS A NE2  4  
ATOM   4290  H  H    . HIS A 1 57 ? 7.727   2.973   -1.235  1.00 0.00 ? 57  HIS A H    4  
ATOM   4291  H  HA   . HIS A 1 57 ? 6.383   0.572   -0.821  1.00 0.00 ? 57  HIS A HA   4  
ATOM   4292  H  HB2  . HIS A 1 57 ? 4.924   2.258   -1.371  1.00 0.00 ? 57  HIS A HB2  4  
ATOM   4293  H  HB3  . HIS A 1 57 ? 5.987   2.921   -2.609  1.00 0.00 ? 57  HIS A HB3  4  
ATOM   4294  H  HD1  . HIS A 1 57 ? 3.875   -0.215  -2.137  1.00 0.00 ? 57  HIS A HD1  4  
ATOM   4295  H  HD2  . HIS A 1 57 ? 5.098   2.420   -5.107  1.00 0.00 ? 57  HIS A HD2  4  
ATOM   4296  H  HE1  . HIS A 1 57 ? 2.710   -0.975  -4.232  1.00 0.00 ? 57  HIS A HE1  4  
ATOM   4297  N  N    . ARG A 1 58 ? 8.153   0.662   -3.567  1.00 0.00 ? 58  ARG A N    4  
ATOM   4298  C  CA   . ARG A 1 58 ? 8.694   -0.150  -4.651  1.00 0.00 ? 58  ARG A CA   4  
ATOM   4299  C  C    . ARG A 1 58 ? 9.598   -1.251  -4.105  1.00 0.00 ? 58  ARG A C    4  
ATOM   4300  O  O    . ARG A 1 58 ? 9.852   -2.250  -4.778  1.00 0.00 ? 58  ARG A O    4  
ATOM   4301  C  CB   . ARG A 1 58 ? 9.474   0.726   -5.633  1.00 0.00 ? 58  ARG A CB   4  
ATOM   4302  C  CG   . ARG A 1 58 ? 8.662   1.880   -6.197  1.00 0.00 ? 58  ARG A CG   4  
ATOM   4303  C  CD   . ARG A 1 58 ? 9.555   3.040   -6.609  1.00 0.00 ? 58  ARG A CD   4  
ATOM   4304  N  NE   . ARG A 1 58 ? 8.786   4.156   -7.155  1.00 0.00 ? 58  ARG A NE   4  
ATOM   4305  C  CZ   . ARG A 1 58 ? 9.335   5.188   -7.786  1.00 0.00 ? 58  ARG A CZ   4  
ATOM   4306  N  NH1  . ARG A 1 58 ? 10.649  5.245   -7.951  1.00 0.00 ? 58  ARG A NH1  4  
ATOM   4307  N  NH2  . ARG A 1 58 ? 8.568   6.165   -8.254  1.00 0.00 ? 58  ARG A NH2  4  
ATOM   4308  H  H    . ARG A 1 58 ? 8.489   1.573   -3.439  1.00 0.00 ? 58  ARG A H    4  
ATOM   4309  H  HA   . ARG A 1 58 ? 7.864   -0.606  -5.170  1.00 0.00 ? 58  ARG A HA   4  
ATOM   4310  H  HB2  . ARG A 1 58 ? 10.336  1.135   -5.126  1.00 0.00 ? 58  ARG A HB2  4  
ATOM   4311  H  HB3  . ARG A 1 58 ? 9.808   0.113   -6.456  1.00 0.00 ? 58  ARG A HB3  4  
ATOM   4312  H  HG2  . ARG A 1 58 ? 8.116   1.535   -7.063  1.00 0.00 ? 58  ARG A HG2  4  
ATOM   4313  H  HG3  . ARG A 1 58 ? 7.967   2.221   -5.444  1.00 0.00 ? 58  ARG A HG3  4  
ATOM   4314  H  HD2  . ARG A 1 58 ? 10.101  3.382   -5.743  1.00 0.00 ? 58  ARG A HD2  4  
ATOM   4315  H  HD3  . ARG A 1 58 ? 10.249  2.693   -7.359  1.00 0.00 ? 58  ARG A HD3  4  
ATOM   4316  H  HE   . ARG A 1 58 ? 7.813   4.133   -7.044  1.00 0.00 ? 58  ARG A HE   4  
ATOM   4317  H  HH11 . ARG A 1 58 ? 11.229  4.510   -7.600  1.00 0.00 ? 58  ARG A HH11 4  
ATOM   4318  H  HH12 . ARG A 1 58 ? 11.060  6.023   -8.427  1.00 0.00 ? 58  ARG A HH12 4  
ATOM   4319  H  HH21 . ARG A 1 58 ? 7.577   6.124   -8.131  1.00 0.00 ? 58  ARG A HH21 4  
ATOM   4320  H  HH22 . ARG A 1 58 ? 8.982   6.941   -8.728  1.00 0.00 ? 58  ARG A HH22 4  
ATOM   4321  N  N    . SER A 1 59 ? 10.081  -1.061  -2.882  1.00 0.00 ? 59  SER A N    4  
ATOM   4322  C  CA   . SER A 1 59 ? 10.961  -2.036  -2.247  1.00 0.00 ? 59  SER A CA   4  
ATOM   4323  C  C    . SER A 1 59 ? 10.159  -3.026  -1.408  1.00 0.00 ? 59  SER A C    4  
ATOM   4324  O  O    . SER A 1 59 ? 10.701  -4.005  -0.895  1.00 0.00 ? 59  SER A O    4  
ATOM   4325  C  CB   . SER A 1 59 ? 11.995  -1.326  -1.370  1.00 0.00 ? 59  SER A CB   4  
ATOM   4326  O  OG   . SER A 1 59 ? 12.815  -2.261  -0.691  1.00 0.00 ? 59  SER A OG   4  
ATOM   4327  H  H    . SER A 1 59 ? 9.842   -0.244  -2.395  1.00 0.00 ? 59  SER A H    4  
ATOM   4328  H  HA   . SER A 1 59 ? 11.474  -2.577  -3.028  1.00 0.00 ? 59  SER A HA   4  
ATOM   4329  H  HB2  . SER A 1 59 ? 12.620  -0.701  -1.989  1.00 0.00 ? 59  SER A HB2  4  
ATOM   4330  H  HB3  . SER A 1 59 ? 11.485  -0.715  -0.640  1.00 0.00 ? 59  SER A HB3  4  
ATOM   4331  H  HG   . SER A 1 59 ? 12.599  -3.149  -0.984  1.00 0.00 ? 59  SER A HG   4  
ATOM   4332  N  N    . LYS A 1 60 ? 8.864   -2.763  -1.272  1.00 0.00 ? 60  LYS A N    4  
ATOM   4333  C  CA   . LYS A 1 60 ? 7.984   -3.630  -0.496  1.00 0.00 ? 60  LYS A CA   4  
ATOM   4334  C  C    . LYS A 1 60 ? 6.893   -4.228  -1.379  1.00 0.00 ? 60  LYS A C    4  
ATOM   4335  O  O    . LYS A 1 60 ? 6.376   -5.308  -1.096  1.00 0.00 ? 60  LYS A O    4  
ATOM   4336  C  CB   . LYS A 1 60 ? 7.351   -2.848  0.657   1.00 0.00 ? 60  LYS A CB   4  
ATOM   4337  C  CG   . LYS A 1 60 ? 8.333   -2.485  1.758   1.00 0.00 ? 60  LYS A CG   4  
ATOM   4338  C  CD   . LYS A 1 60 ? 7.614   -2.063  3.028   1.00 0.00 ? 60  LYS A CD   4  
ATOM   4339  C  CE   . LYS A 1 60 ? 7.411   -3.240  3.971   1.00 0.00 ? 60  LYS A CE   4  
ATOM   4340  N  NZ   . LYS A 1 60 ? 6.101   -3.911  3.745   1.00 0.00 ? 60  LYS A NZ   4  
ATOM   4341  H  H    . LYS A 1 60 ? 8.490   -1.967  -1.705  1.00 0.00 ? 60  LYS A H    4  
ATOM   4342  H  HA   . LYS A 1 60 ? 8.582   -4.432  -0.090  1.00 0.00 ? 60  LYS A HA   4  
ATOM   4343  H  HB2  . LYS A 1 60 ? 6.927   -1.935  0.266   1.00 0.00 ? 60  LYS A HB2  4  
ATOM   4344  H  HB3  . LYS A 1 60 ? 6.561   -3.445  1.090   1.00 0.00 ? 60  LYS A HB3  4  
ATOM   4345  H  HG2  . LYS A 1 60 ? 8.950   -3.344  1.975   1.00 0.00 ? 60  LYS A HG2  4  
ATOM   4346  H  HG3  . LYS A 1 60 ? 8.955   -1.669  1.418   1.00 0.00 ? 60  LYS A HG3  4  
ATOM   4347  H  HD2  . LYS A 1 60 ? 8.203   -1.311  3.532   1.00 0.00 ? 60  LYS A HD2  4  
ATOM   4348  H  HD3  . LYS A 1 60 ? 6.650   -1.652  2.767   1.00 0.00 ? 60  LYS A HD3  4  
ATOM   4349  H  HE2  . LYS A 1 60 ? 8.204   -3.954  3.810   1.00 0.00 ? 60  LYS A HE2  4  
ATOM   4350  H  HE3  . LYS A 1 60 ? 7.451   -2.880  4.988   1.00 0.00 ? 60  LYS A HE3  4  
ATOM   4351  H  HZ1  . LYS A 1 60 ? 5.393   -3.548  4.415   1.00 0.00 ? 60  LYS A HZ1  4  
ATOM   4352  H  HZ2  . LYS A 1 60 ? 6.197   -4.937  3.882   1.00 0.00 ? 60  LYS A HZ2  4  
ATOM   4353  H  HZ3  . LYS A 1 60 ? 5.769   -3.731  2.776   1.00 0.00 ? 60  LYS A HZ3  4  
ATOM   4354  N  N    . SER A 1 61 ? 6.550   -3.519  -2.450  1.00 0.00 ? 61  SER A N    4  
ATOM   4355  C  CA   . SER A 1 61 ? 5.519   -3.979  -3.372  1.00 0.00 ? 61  SER A CA   4  
ATOM   4356  C  C    . SER A 1 61 ? 6.120   -4.320  -4.732  1.00 0.00 ? 61  SER A C    4  
ATOM   4357  O  O    . SER A 1 61 ? 5.623   -5.195  -5.442  1.00 0.00 ? 61  SER A O    4  
ATOM   4358  C  CB   . SER A 1 61 ? 4.436   -2.911  -3.534  1.00 0.00 ? 61  SER A CB   4  
ATOM   4359  O  OG   . SER A 1 61 ? 3.433   -3.047  -2.542  1.00 0.00 ? 61  SER A OG   4  
ATOM   4360  H  H    . SER A 1 61 ? 6.999   -2.665  -2.621  1.00 0.00 ? 61  SER A H    4  
ATOM   4361  H  HA   . SER A 1 61 ? 5.074   -4.870  -2.955  1.00 0.00 ? 61  SER A HA   4  
ATOM   4362  H  HB2  . SER A 1 61 ? 4.883   -1.932  -3.445  1.00 0.00 ? 61  SER A HB2  4  
ATOM   4363  H  HB3  . SER A 1 61 ? 3.978   -3.011  -4.508  1.00 0.00 ? 61  SER A HB3  4  
ATOM   4364  H  HG   . SER A 1 61 ? 3.371   -2.233  -2.036  1.00 0.00 ? 61  SER A HG   4  
ATOM   4365  N  N    . HIS A 1 62 ? 7.194   -3.623  -5.090  1.00 0.00 ? 62  HIS A N    4  
ATOM   4366  C  CA   . HIS A 1 62 ? 7.865   -3.851  -6.364  1.00 0.00 ? 62  HIS A CA   4  
ATOM   4367  C  C    . HIS A 1 62 ? 9.300   -4.320  -6.147  1.00 0.00 ? 62  HIS A C    4  
ATOM   4368  O  O    . HIS A 1 62 ? 10.194  -4.053  -6.950  1.00 0.00 ? 62  HIS A O    4  
ATOM   4369  C  CB   . HIS A 1 62 ? 7.855   -2.574  -7.206  1.00 0.00 ? 62  HIS A CB   4  
ATOM   4370  C  CG   . HIS A 1 62 ? 6.480   -2.118  -7.586  1.00 0.00 ? 62  HIS A CG   4  
ATOM   4371  N  ND1  . HIS A 1 62 ? 5.667   -2.817  -8.452  1.00 0.00 ? 62  HIS A ND1  4  
ATOM   4372  C  CD2  . HIS A 1 62 ? 5.775   -1.025  -7.210  1.00 0.00 ? 62  HIS A CD2  4  
ATOM   4373  C  CE1  . HIS A 1 62 ? 4.522   -2.174  -8.595  1.00 0.00 ? 62  HIS A CE1  4  
ATOM   4374  N  NE2  . HIS A 1 62 ? 4.561   -1.083  -7.851  1.00 0.00 ? 62  HIS A NE2  4  
ATOM   4375  H  H    . HIS A 1 62 ? 7.543   -2.939  -4.481  1.00 0.00 ? 62  HIS A H    4  
ATOM   4376  H  HA   . HIS A 1 62 ? 7.323   -4.622  -6.891  1.00 0.00 ? 62  HIS A HA   4  
ATOM   4377  H  HB2  . HIS A 1 62 ? 8.325   -1.779  -6.646  1.00 0.00 ? 62  HIS A HB2  4  
ATOM   4378  H  HB3  . HIS A 1 62 ? 8.412   -2.746  -8.116  1.00 0.00 ? 62  HIS A HB3  4  
ATOM   4379  H  HD1  . HIS A 1 62 ? 5.896   -3.659  -8.898  1.00 0.00 ? 62  HIS A HD1  4  
ATOM   4380  H  HD2  . HIS A 1 62 ? 6.104   -0.250  -6.532  1.00 0.00 ? 62  HIS A HD2  4  
ATOM   4381  H  HE1  . HIS A 1 62 ? 3.694   -2.486  -9.213  1.00 0.00 ? 62  HIS A HE1  4  
ATOM   4382  N  N    . PRO A 1 63 ? 9.527   -5.035  -5.035  1.00 0.00 ? 63  PRO A N    4  
ATOM   4383  C  CA   . PRO A 1 63 ? 10.853  -5.556  -4.686  1.00 0.00 ? 63  PRO A CA   4  
ATOM   4384  C  C    . PRO A 1 63 ? 11.298  -6.679  -5.617  1.00 0.00 ? 63  PRO A C    4  
ATOM   4385  O  O    . PRO A 1 63 ? 12.463  -7.074  -5.615  1.00 0.00 ? 63  PRO A O    4  
ATOM   4386  C  CB   . PRO A 1 63 ? 10.662  -6.085  -3.262  1.00 0.00 ? 63  PRO A CB   4  
ATOM   4387  C  CG   . PRO A 1 63 ? 9.209   -6.400  -3.167  1.00 0.00 ? 63  PRO A CG   4  
ATOM   4388  C  CD   . PRO A 1 63 ? 8.508   -5.390  -4.033  1.00 0.00 ? 63  PRO A CD   4  
ATOM   4389  H  HA   . PRO A 1 63 ? 11.598  -4.774  -4.684  1.00 0.00 ? 63  PRO A HA   4  
ATOM   4390  H  HB2  . PRO A 1 63 ? 11.269  -6.968  -3.120  1.00 0.00 ? 63  PRO A HB2  4  
ATOM   4391  H  HB3  . PRO A 1 63 ? 10.949  -5.326  -2.551  1.00 0.00 ? 63  PRO A HB3  4  
ATOM   4392  H  HG2  . PRO A 1 63 ? 9.025   -7.399  -3.531  1.00 0.00 ? 63  PRO A HG2  4  
ATOM   4393  H  HG3  . PRO A 1 63 ? 8.880   -6.307  -2.142  1.00 0.00 ? 63  PRO A HG3  4  
ATOM   4394  H  HD2  . PRO A 1 63 ? 7.643   -5.833  -4.504  1.00 0.00 ? 63  PRO A HD2  4  
ATOM   4395  H  HD3  . PRO A 1 63 ? 8.223   -4.526  -3.451  1.00 0.00 ? 63  PRO A HD3  4  
ATOM   4396  N  N    . ALA A 1 64 ? 10.362  -7.188  -6.411  1.00 0.00 ? 64  ALA A N    4  
ATOM   4397  C  CA   . ALA A 1 64 ? 10.659  -8.264  -7.349  1.00 0.00 ? 64  ALA A CA   4  
ATOM   4398  C  C    . ALA A 1 64 ? 11.045  -7.710  -8.716  1.00 0.00 ? 64  ALA A C    4  
ATOM   4399  O  O    . ALA A 1 64 ? 11.521  -8.444  -9.583  1.00 0.00 ? 64  ALA A O    4  
ATOM   4400  C  CB   . ALA A 1 64 ? 9.466   -9.200  -7.474  1.00 0.00 ? 64  ALA A CB   4  
ATOM   4401  H  H    . ALA A 1 64 ? 9.451   -6.831  -6.366  1.00 0.00 ? 64  ALA A H    4  
ATOM   4402  H  HA   . ALA A 1 64 ? 11.490  -8.831  -6.954  1.00 0.00 ? 64  ALA A HA   4  
ATOM   4403  H  HB1  . ALA A 1 64 ? 8.891   -9.173  -6.559  1.00 0.00 ? 64  ALA A HB1  4  
ATOM   4404  H  HB2  . ALA A 1 64 ? 8.846   -8.883  -8.299  1.00 0.00 ? 64  ALA A HB2  4  
ATOM   4405  H  HB3  . ALA A 1 64 ? 9.815   -10.206 -7.651  1.00 0.00 ? 64  ALA A HB3  4  
ATOM   4406  N  N    . LEU A 1 65 ? 10.837  -6.411  -8.903  1.00 0.00 ? 65  LEU A N    4  
ATOM   4407  C  CA   . LEU A 1 65 ? 11.162  -5.758  -10.166 1.00 0.00 ? 65  LEU A CA   4  
ATOM   4408  C  C    . LEU A 1 65 ? 12.563  -5.154  -10.122 1.00 0.00 ? 65  LEU A C    4  
ATOM   4409  O  O    . LEU A 1 65 ? 13.377  -5.383  -11.017 1.00 0.00 ? 65  LEU A O    4  
ATOM   4410  C  CB   . LEU A 1 65 ? 10.135  -4.669  -10.479 1.00 0.00 ? 65  LEU A CB   4  
ATOM   4411  C  CG   . LEU A 1 65 ? 8.721   -5.153  -10.803 1.00 0.00 ? 65  LEU A CG   4  
ATOM   4412  C  CD1  . LEU A 1 65 ? 7.782   -3.971  -10.989 1.00 0.00 ? 65  LEU A CD1  4  
ATOM   4413  C  CD2  . LEU A 1 65 ? 8.730   -6.030  -12.046 1.00 0.00 ? 65  LEU A CD2  4  
ATOM   4414  H  H    . LEU A 1 65 ? 10.455  -5.878  -8.175  1.00 0.00 ? 65  LEU A H    4  
ATOM   4415  H  HA   . LEU A 1 65 ? 11.130  -6.506  -10.944 1.00 0.00 ? 65  LEU A HA   4  
ATOM   4416  H  HB2  . LEU A 1 65 ? 10.073  -4.017  -9.622  1.00 0.00 ? 65  LEU A HB2  4  
ATOM   4417  H  HB3  . LEU A 1 65 ? 10.497  -4.109  -11.330 1.00 0.00 ? 65  LEU A HB3  4  
ATOM   4418  H  HG   . LEU A 1 65 ? 8.352   -5.745  -9.977  1.00 0.00 ? 65  LEU A HG   4  
ATOM   4419  H  HD11 . LEU A 1 65 ? 8.113   -3.376  -11.826 1.00 0.00 ? 65  LEU A HD11 4  
ATOM   4420  H  HD12 . LEU A 1 65 ? 7.783   -3.367  -10.094 1.00 0.00 ? 65  LEU A HD12 4  
ATOM   4421  H  HD13 . LEU A 1 65 ? 6.782   -4.333  -11.177 1.00 0.00 ? 65  LEU A HD13 4  
ATOM   4422  H  HD21 . LEU A 1 65 ? 7.714   -6.203  -12.371 1.00 0.00 ? 65  LEU A HD21 4  
ATOM   4423  H  HD22 . LEU A 1 65 ? 9.200   -6.976  -11.816 1.00 0.00 ? 65  LEU A HD22 4  
ATOM   4424  H  HD23 . LEU A 1 65 ? 9.280   -5.536  -12.832 1.00 0.00 ? 65  LEU A HD23 4  
ATOM   4425  N  N    . LEU A 1 66 ? 12.837  -4.386  -9.074  1.00 0.00 ? 66  LEU A N    4  
ATOM   4426  C  CA   . LEU A 1 66 ? 14.140  -3.751  -8.911  1.00 0.00 ? 66  LEU A CA   4  
ATOM   4427  C  C    . LEU A 1 66 ? 15.266  -4.732  -9.220  1.00 0.00 ? 66  LEU A C    4  
ATOM   4428  O  O    . LEU A 1 66 ? 16.174  -4.428  -9.995  1.00 0.00 ? 66  LEU A O    4  
ATOM   4429  C  CB   . LEU A 1 66 ? 14.293  -3.213  -7.487  1.00 0.00 ? 66  LEU A CB   4  
ATOM   4430  C  CG   . LEU A 1 66 ? 13.177  -2.292  -6.994  1.00 0.00 ? 66  LEU A CG   4  
ATOM   4431  C  CD1  . LEU A 1 66 ? 13.034  -2.388  -5.483  1.00 0.00 ? 66  LEU A CD1  4  
ATOM   4432  C  CD2  . LEU A 1 66 ? 13.445  -0.855  -7.416  1.00 0.00 ? 66  LEU A CD2  4  
ATOM   4433  H  H    . LEU A 1 66 ? 12.148  -4.241  -8.393  1.00 0.00 ? 66  LEU A H    4  
ATOM   4434  H  HA   . LEU A 1 66 ? 14.196  -2.927  -9.606  1.00 0.00 ? 66  LEU A HA   4  
ATOM   4435  H  HB2  . LEU A 1 66 ? 14.344  -4.058  -6.818  1.00 0.00 ? 66  LEU A HB2  4  
ATOM   4436  H  HB3  . LEU A 1 66 ? 15.222  -2.663  -7.440  1.00 0.00 ? 66  LEU A HB3  4  
ATOM   4437  H  HG   . LEU A 1 66 ? 12.241  -2.602  -7.437  1.00 0.00 ? 66  LEU A HG   4  
ATOM   4438  H  HD11 . LEU A 1 66 ? 13.557  -1.566  -5.019  1.00 0.00 ? 66  LEU A HD11 4  
ATOM   4439  H  HD12 . LEU A 1 66 ? 13.454  -3.322  -5.140  1.00 0.00 ? 66  LEU A HD12 4  
ATOM   4440  H  HD13 . LEU A 1 66 ? 11.988  -2.346  -5.217  1.00 0.00 ? 66  LEU A HD13 4  
ATOM   4441  H  HD21 . LEU A 1 66 ? 14.501  -0.644  -7.323  1.00 0.00 ? 66  LEU A HD21 4  
ATOM   4442  H  HD22 . LEU A 1 66 ? 12.888  -0.183  -6.780  1.00 0.00 ? 66  LEU A HD22 4  
ATOM   4443  H  HD23 . LEU A 1 66 ? 13.139  -0.718  -8.442  1.00 0.00 ? 66  LEU A HD23 4  
ATOM   4444  N  N    . LEU A 1 67 ? 15.201  -5.910  -8.610  1.00 0.00 ? 67  LEU A N    4  
ATOM   4445  C  CA   . LEU A 1 67 ? 16.214  -6.939  -8.821  1.00 0.00 ? 67  LEU A CA   4  
ATOM   4446  C  C    . LEU A 1 67 ? 16.317  -7.306  -10.298 1.00 0.00 ? 67  LEU A C    4  
ATOM   4447  O  O    . LEU A 1 67 ? 15.341  -7.212  -11.041 1.00 0.00 ? 67  LEU A O    4  
ATOM   4448  C  CB   . LEU A 1 67 ? 15.885  -8.184  -7.996  1.00 0.00 ? 67  LEU A CB   4  
ATOM   4449  C  CG   . LEU A 1 67 ? 16.607  -9.469  -8.403  1.00 0.00 ? 67  LEU A CG   4  
ATOM   4450  C  CD1  . LEU A 1 67 ? 17.946  -9.577  -7.690  1.00 0.00 ? 67  LEU A CD1  4  
ATOM   4451  C  CD2  . LEU A 1 67 ? 15.742  -10.684 -8.104  1.00 0.00 ? 67  LEU A CD2  4  
ATOM   4452  H  H    . LEU A 1 67 ? 14.454  -6.094  -8.003  1.00 0.00 ? 67  LEU A H    4  
ATOM   4453  H  HA   . LEU A 1 67 ? 17.163  -6.540  -8.494  1.00 0.00 ? 67  LEU A HA   4  
ATOM   4454  H  HB2  . LEU A 1 67 ? 16.137  -7.975  -6.968  1.00 0.00 ? 67  LEU A HB2  4  
ATOM   4455  H  HB3  . LEU A 1 67 ? 14.822  -8.361  -8.076  1.00 0.00 ? 67  LEU A HB3  4  
ATOM   4456  H  HG   . LEU A 1 67 ? 16.797  -9.446  -9.467  1.00 0.00 ? 67  LEU A HG   4  
ATOM   4457  H  HD11 . LEU A 1 67 ? 18.526  -10.372 -8.133  1.00 0.00 ? 67  LEU A HD11 4  
ATOM   4458  H  HD12 . LEU A 1 67 ? 17.781  -9.791  -6.645  1.00 0.00 ? 67  LEU A HD12 4  
ATOM   4459  H  HD13 . LEU A 1 67 ? 18.481  -8.644  -7.786  1.00 0.00 ? 67  LEU A HD13 4  
ATOM   4460  H  HD21 . LEU A 1 67 ? 15.795  -11.376 -8.932  1.00 0.00 ? 67  LEU A HD21 4  
ATOM   4461  H  HD22 . LEU A 1 67 ? 14.718  -10.371 -7.962  1.00 0.00 ? 67  LEU A HD22 4  
ATOM   4462  H  HD23 . LEU A 1 67 ? 16.099  -11.168 -7.207  1.00 0.00 ? 67  LEU A HD23 4  
ATOM   4463  N  N    . ALA A 1 68 ? 17.507  -7.727  -10.716 1.00 0.00 ? 68  ALA A N    4  
ATOM   4464  C  CA   . ALA A 1 68 ? 17.737  -8.112  -12.103 1.00 0.00 ? 68  ALA A CA   4  
ATOM   4465  C  C    . ALA A 1 68 ? 16.812  -9.252  -12.516 1.00 0.00 ? 68  ALA A C    4  
ATOM   4466  O  O    . ALA A 1 68 ? 16.276  -9.982  -11.682 1.00 0.00 ? 68  ALA A O    4  
ATOM   4467  C  CB   . ALA A 1 68 ? 19.191  -8.510  -12.306 1.00 0.00 ? 68  ALA A CB   4  
ATOM   4468  H  H    . ALA A 1 68 ? 18.247  -7.780  -10.076 1.00 0.00 ? 68  ALA A H    4  
ATOM   4469  H  HA   . ALA A 1 68 ? 17.533  -7.253  -12.726 1.00 0.00 ? 68  ALA A HA   4  
ATOM   4470  H  HB1  . ALA A 1 68 ? 19.733  -8.373  -11.382 1.00 0.00 ? 68  ALA A HB1  4  
ATOM   4471  H  HB2  . ALA A 1 68 ? 19.242  -9.547  -12.604 1.00 0.00 ? 68  ALA A HB2  4  
ATOM   4472  H  HB3  . ALA A 1 68 ? 19.629  -7.892  -13.075 1.00 0.00 ? 68  ALA A HB3  4  
ATOM   4473  N  N    . PRO A 1 69 ? 16.618  -9.410  -13.834 1.00 0.00 ? 69  PRO A N    4  
ATOM   4474  C  CA   . PRO A 1 69 ? 15.757  -10.459 -14.387 1.00 0.00 ? 69  PRO A CA   4  
ATOM   4475  C  C    . PRO A 1 69 ? 16.353  -11.852 -14.209 1.00 0.00 ? 69  PRO A C    4  
ATOM   4476  O  O    . PRO A 1 69 ? 17.004  -12.378 -15.112 1.00 0.00 ? 69  PRO A O    4  
ATOM   4477  C  CB   . PRO A 1 69 ? 15.671  -10.101 -15.873 1.00 0.00 ? 69  PRO A CB   4  
ATOM   4478  C  CG   . PRO A 1 69 ? 16.915  -9.329  -16.149 1.00 0.00 ? 69  PRO A CG   4  
ATOM   4479  C  CD   . PRO A 1 69 ? 17.224  -8.576  -14.885 1.00 0.00 ? 69  PRO A CD   4  
ATOM   4480  H  HA   . PRO A 1 69 ? 14.769  -10.433 -13.951 1.00 0.00 ? 69  PRO A HA   4  
ATOM   4481  H  HB2  . PRO A 1 69 ? 15.627  -11.006 -16.462 1.00 0.00 ? 69  PRO A HB2  4  
ATOM   4482  H  HB3  . PRO A 1 69 ? 14.789  -9.505  -16.052 1.00 0.00 ? 69  PRO A HB3  4  
ATOM   4483  H  HG2  . PRO A 1 69 ? 17.721  -10.006 -16.389 1.00 0.00 ? 69  PRO A HG2  4  
ATOM   4484  H  HG3  . PRO A 1 69 ? 16.746  -8.640  -16.964 1.00 0.00 ? 69  PRO A HG3  4  
ATOM   4485  H  HD2  . PRO A 1 69 ? 18.292  -8.495  -14.745 1.00 0.00 ? 69  PRO A HD2  4  
ATOM   4486  H  HD3  . PRO A 1 69 ? 16.770  -7.596  -14.909 1.00 0.00 ? 69  PRO A HD3  4  
ATOM   4487  N  N    . GLN A 1 70 ? 16.125  -12.443 -13.040 1.00 0.00 ? 70  GLN A N    4  
ATOM   4488  C  CA   . GLN A 1 70 ? 16.641  -13.774 -12.745 1.00 0.00 ? 70  GLN A CA   4  
ATOM   4489  C  C    . GLN A 1 70 ? 15.577  -14.838 -12.996 1.00 0.00 ? 70  GLN A C    4  
ATOM   4490  O  O    . GLN A 1 70 ? 15.810  -15.803 -13.722 1.00 0.00 ? 70  GLN A O    4  
ATOM   4491  C  CB   . GLN A 1 70 ? 17.121  -13.848 -11.295 1.00 0.00 ? 70  GLN A CB   4  
ATOM   4492  C  CG   . GLN A 1 70 ? 18.575  -13.441 -11.114 1.00 0.00 ? 70  GLN A CG   4  
ATOM   4493  C  CD   . GLN A 1 70 ? 18.932  -13.183 -9.663  1.00 0.00 ? 70  GLN A CD   4  
ATOM   4494  O  OE1  . GLN A 1 70 ? 19.338  -12.079 -9.299  1.00 0.00 ? 70  GLN A OE1  4  
ATOM   4495  N  NE2  . GLN A 1 70 ? 18.782  -14.202 -8.826  1.00 0.00 ? 70  GLN A NE2  4  
ATOM   4496  H  H    . GLN A 1 70 ? 15.599  -11.972 -12.361 1.00 0.00 ? 70  GLN A H    4  
ATOM   4497  H  HA   . GLN A 1 70 ? 17.478  -13.959 -13.402 1.00 0.00 ? 70  GLN A HA   4  
ATOM   4498  H  HB2  . GLN A 1 70 ? 16.509  -13.195 -10.692 1.00 0.00 ? 70  GLN A HB2  4  
ATOM   4499  H  HB3  . GLN A 1 70 ? 17.008  -14.863 -10.942 1.00 0.00 ? 70  GLN A HB3  4  
ATOM   4500  H  HG2  . GLN A 1 70 ? 19.206  -14.233 -11.488 1.00 0.00 ? 70  GLN A HG2  4  
ATOM   4501  H  HG3  . GLN A 1 70 ? 18.755  -12.540 -11.680 1.00 0.00 ? 70  GLN A HG3  4  
ATOM   4502  H  HE21 . GLN A 1 70 ? 18.455  -15.053 -9.187  1.00 0.00 ? 70  GLN A HE21 4  
ATOM   4503  H  HE22 . GLN A 1 70 ? 19.007  -14.063 -7.883  1.00 0.00 ? 70  GLN A HE22 4  
ATOM   4504  N  N    . GLU A 1 71 ? 14.408  -14.653 -12.389 1.00 0.00 ? 71  GLU A N    4  
ATOM   4505  C  CA   . GLU A 1 71 ? 13.309  -15.599 -12.546 1.00 0.00 ? 71  GLU A CA   4  
ATOM   4506  C  C    . GLU A 1 71 ? 12.117  -14.937 -13.232 1.00 0.00 ? 71  GLU A C    4  
ATOM   4507  O  O    . GLU A 1 71 ? 10.996  -15.443 -13.175 1.00 0.00 ? 71  GLU A O    4  
ATOM   4508  C  CB   . GLU A 1 71 ? 12.885  -16.153 -11.185 1.00 0.00 ? 71  GLU A CB   4  
ATOM   4509  C  CG   . GLU A 1 71 ? 13.777  -17.275 -10.680 1.00 0.00 ? 71  GLU A CG   4  
ATOM   4510  C  CD   . GLU A 1 71 ? 13.418  -18.621 -11.280 1.00 0.00 ? 71  GLU A CD   4  
ATOM   4511  O  OE1  . GLU A 1 71 ? 12.242  -19.025 -11.170 1.00 0.00 ? 71  GLU A OE1  4  
ATOM   4512  O  OE2  . GLU A 1 71 ? 14.314  -19.269 -11.859 1.00 0.00 ? 71  GLU A OE2  4  
ATOM   4513  H  H    . GLU A 1 71 ? 14.283  -13.864 -11.822 1.00 0.00 ? 71  GLU A H    4  
ATOM   4514  H  HA   . GLU A 1 71 ? 13.658  -16.413 -13.163 1.00 0.00 ? 71  GLU A HA   4  
ATOM   4515  H  HB2  . GLU A 1 71 ? 12.905  -15.352 -10.461 1.00 0.00 ? 71  GLU A HB2  4  
ATOM   4516  H  HB3  . GLU A 1 71 ? 11.877  -16.531 -11.262 1.00 0.00 ? 71  GLU A HB3  4  
ATOM   4517  H  HG2  . GLU A 1 71 ? 14.801  -17.046 -10.935 1.00 0.00 ? 71  GLU A HG2  4  
ATOM   4518  H  HG3  . GLU A 1 71 ? 13.681  -17.339 -9.606  1.00 0.00 ? 71  GLU A HG3  4  
ATOM   4519  N  N    . SER A 1 72 ? 12.368  -13.804 -13.879 1.00 0.00 ? 72  SER A N    4  
ATOM   4520  C  CA   . SER A 1 72 ? 11.315  -13.070 -14.572 1.00 0.00 ? 72  SER A CA   4  
ATOM   4521  C  C    . SER A 1 72 ? 10.604  -13.965 -15.583 1.00 0.00 ? 72  SER A C    4  
ATOM   4522  O  O    . SER A 1 72 ? 9.376   -14.040 -15.606 1.00 0.00 ? 72  SER A O    4  
ATOM   4523  C  CB   . SER A 1 72 ? 11.899  -11.846 -15.280 1.00 0.00 ? 72  SER A CB   4  
ATOM   4524  O  OG   . SER A 1 72 ? 10.882  -10.917 -15.613 1.00 0.00 ? 72  SER A OG   4  
ATOM   4525  H  H    . SER A 1 72 ? 13.283  -13.452 -13.889 1.00 0.00 ? 72  SER A H    4  
ATOM   4526  H  HA   . SER A 1 72 ? 10.599  -12.741 -13.834 1.00 0.00 ? 72  SER A HA   4  
ATOM   4527  H  HB2  . SER A 1 72 ? 12.612  -11.364 -14.630 1.00 0.00 ? 72  SER A HB2  4  
ATOM   4528  H  HB3  . SER A 1 72 ? 12.394  -12.161 -16.188 1.00 0.00 ? 72  SER A HB3  4  
ATOM   4529  H  HG   . SER A 1 72 ? 10.408  -11.225 -16.389 1.00 0.00 ? 72  SER A HG   4  
ATOM   4530  N  N    . SER A 1 73 ? 11.386  -14.643 -16.417 1.00 0.00 ? 73  SER A N    4  
ATOM   4531  C  CA   . SER A 1 73 ? 10.833  -15.531 -17.433 1.00 0.00 ? 73  SER A CA   4  
ATOM   4532  C  C    . SER A 1 73 ? 9.614   -16.276 -16.897 1.00 0.00 ? 73  SER A C    4  
ATOM   4533  O  O    . SER A 1 73 ? 8.551   -16.277 -17.516 1.00 0.00 ? 73  SER A O    4  
ATOM   4534  C  CB   . SER A 1 73 ? 11.893  -16.530 -17.899 1.00 0.00 ? 73  SER A CB   4  
ATOM   4535  O  OG   . SER A 1 73 ? 12.341  -17.337 -16.824 1.00 0.00 ? 73  SER A OG   4  
ATOM   4536  H  H    . SER A 1 73 ? 12.359  -14.541 -16.349 1.00 0.00 ? 73  SER A H    4  
ATOM   4537  H  HA   . SER A 1 73 ? 10.528  -14.924 -18.273 1.00 0.00 ? 73  SER A HA   4  
ATOM   4538  H  HB2  . SER A 1 73 ? 11.471  -17.169 -18.661 1.00 0.00 ? 73  SER A HB2  4  
ATOM   4539  H  HB3  . SER A 1 73 ? 12.736  -15.992 -18.307 1.00 0.00 ? 73  SER A HB3  4  
ATOM   4540  H  HG   . SER A 1 73 ? 12.708  -16.777 -16.135 1.00 0.00 ? 73  SER A HG   4  
ATOM   4541  N  N    . GLY A 1 74 ? 9.779   -16.912 -15.741 1.00 0.00 ? 74  GLY A N    4  
ATOM   4542  C  CA   . GLY A 1 74 ? 8.685   -17.653 -15.140 1.00 0.00 ? 74  GLY A CA   4  
ATOM   4543  C  C    . GLY A 1 74 ? 7.569   -16.749 -14.655 1.00 0.00 ? 74  GLY A C    4  
ATOM   4544  O  O    . GLY A 1 74 ? 7.614   -15.530 -14.817 1.00 0.00 ? 74  GLY A O    4  
ATOM   4545  H  H    . GLY A 1 74 ? 10.649  -16.877 -15.292 1.00 0.00 ? 74  GLY A H    4  
ATOM   4546  H  HA2  . GLY A 1 74 ? 8.286   -18.341 -15.871 1.00 0.00 ? 74  GLY A HA2  4  
ATOM   4547  H  HA3  . GLY A 1 74 ? 9.066   -18.217 -14.301 1.00 0.00 ? 74  GLY A HA3  4  
ATOM   4548  N  N    . PRO A 1 75 ? 6.537   -17.352 -14.046 1.00 0.00 ? 75  PRO A N    4  
ATOM   4549  C  CA   . PRO A 1 75 ? 5.384   -16.612 -13.525 1.00 0.00 ? 75  PRO A CA   4  
ATOM   4550  C  C    . PRO A 1 75 ? 5.739   -15.769 -12.305 1.00 0.00 ? 75  PRO A C    4  
ATOM   4551  O  O    . PRO A 1 75 ? 6.370   -16.254 -11.366 1.00 0.00 ? 75  PRO A O    4  
ATOM   4552  C  CB   . PRO A 1 75 ? 4.396   -17.717 -13.143 1.00 0.00 ? 75  PRO A CB   4  
ATOM   4553  C  CG   . PRO A 1 75 ? 5.247   -18.911 -12.879 1.00 0.00 ? 75  PRO A CG   4  
ATOM   4554  C  CD   . PRO A 1 75 ? 6.416   -18.802 -13.819 1.00 0.00 ? 75  PRO A CD   4  
ATOM   4555  H  HA   . PRO A 1 75 ? 4.943   -15.979 -14.282 1.00 0.00 ? 75  PRO A HA   4  
ATOM   4556  H  HB2  . PRO A 1 75 ? 3.845   -17.421 -12.261 1.00 0.00 ? 75  PRO A HB2  4  
ATOM   4557  H  HB3  . PRO A 1 75 ? 3.713   -17.893 -13.960 1.00 0.00 ? 75  PRO A HB3  4  
ATOM   4558  H  HG2  . PRO A 1 75 ? 5.587   -18.901 -11.855 1.00 0.00 ? 75  PRO A HG2  4  
ATOM   4559  H  HG3  . PRO A 1 75 ? 4.688   -19.812 -13.081 1.00 0.00 ? 75  PRO A HG3  4  
ATOM   4560  H  HD2  . PRO A 1 75 ? 7.310   -19.195 -13.357 1.00 0.00 ? 75  PRO A HD2  4  
ATOM   4561  H  HD3  . PRO A 1 75 ? 6.207   -19.320 -14.743 1.00 0.00 ? 75  PRO A HD3  4  
ATOM   4562  N  N    . SER A 1 76 ? 5.328   -14.505 -12.325 1.00 0.00 ? 76  SER A N    4  
ATOM   4563  C  CA   . SER A 1 76 ? 5.607   -13.594 -11.221 1.00 0.00 ? 76  SER A CA   4  
ATOM   4564  C  C    . SER A 1 76 ? 4.323   -13.231 -10.480 1.00 0.00 ? 76  SER A C    4  
ATOM   4565  O  O    . SER A 1 76 ? 3.232   -13.274 -11.047 1.00 0.00 ? 76  SER A O    4  
ATOM   4566  C  CB   . SER A 1 76 ? 6.286   -12.325 -11.738 1.00 0.00 ? 76  SER A CB   4  
ATOM   4567  O  OG   . SER A 1 76 ? 5.525   -11.722 -12.770 1.00 0.00 ? 76  SER A OG   4  
ATOM   4568  H  H    . SER A 1 76 ? 4.829   -14.177 -13.102 1.00 0.00 ? 76  SER A H    4  
ATOM   4569  H  HA   . SER A 1 76 ? 6.274   -14.096 -10.537 1.00 0.00 ? 76  SER A HA   4  
ATOM   4570  H  HB2  . SER A 1 76 ? 6.392   -11.620 -10.928 1.00 0.00 ? 76  SER A HB2  4  
ATOM   4571  H  HB3  . SER A 1 76 ? 7.263   -12.575 -12.127 1.00 0.00 ? 76  SER A HB3  4  
ATOM   4572  H  HG   . SER A 1 76 ? 5.478   -12.317 -13.523 1.00 0.00 ? 76  SER A HG   4  
ATOM   4573  N  N    . SER A 1 77 ? 4.464   -12.873 -9.207  1.00 0.00 ? 77  SER A N    4  
ATOM   4574  C  CA   . SER A 1 77 ? 3.316   -12.506 -8.386  1.00 0.00 ? 77  SER A CA   4  
ATOM   4575  C  C    . SER A 1 77 ? 2.467   -11.446 -9.080  1.00 0.00 ? 77  SER A C    4  
ATOM   4576  O  O    . SER A 1 77 ? 1.244   -11.560 -9.149  1.00 0.00 ? 77  SER A O    4  
ATOM   4577  C  CB   . SER A 1 77 ? 3.782   -11.990 -7.023  1.00 0.00 ? 77  SER A CB   4  
ATOM   4578  O  OG   . SER A 1 77 ? 2.684   -11.563 -6.236  1.00 0.00 ? 77  SER A OG   4  
ATOM   4579  H  H    . SER A 1 77 ? 5.360   -12.858 -8.811  1.00 0.00 ? 77  SER A H    4  
ATOM   4580  H  HA   . SER A 1 77 ? 2.716   -13.392 -8.240  1.00 0.00 ? 77  SER A HA   4  
ATOM   4581  H  HB2  . SER A 1 77 ? 4.298   -12.780 -6.499  1.00 0.00 ? 77  SER A HB2  4  
ATOM   4582  H  HB3  . SER A 1 77 ? 4.453   -11.156 -7.167  1.00 0.00 ? 77  SER A HB3  4  
ATOM   4583  H  HG   . SER A 1 77 ? 3.001   -11.024 -5.508  1.00 0.00 ? 77  SER A HG   4  
ATOM   4584  N  N    . GLY A 1 78 ? 3.127   -10.412 -9.595  1.00 0.00 ? 78  GLY A N    4  
ATOM   4585  C  CA   . GLY A 1 78 ? 2.418   -9.346  -10.278 1.00 0.00 ? 78  GLY A CA   4  
ATOM   4586  C  C    . GLY A 1 78 ? 2.816   -7.972  -9.776  1.00 0.00 ? 78  GLY A C    4  
ATOM   4587  O  O    . GLY A 1 78 ? 3.991   -7.618  -9.866  1.00 0.00 ? 78  GLY A O    4  
ATOM   4588  H  H    . GLY A 1 78 ? 4.103   -10.374 -9.511  1.00 0.00 ? 78  GLY A H    4  
ATOM   4589  H  HA2  . GLY A 1 78 ? 2.630   -9.407  -11.335 1.00 0.00 ? 78  GLY A HA2  4  
ATOM   4590  H  HA3  . GLY A 1 78 ? 1.357   -9.479  -10.125 1.00 0.00 ? 78  GLY A HA3  4  
HETATM 4591  ZN ZN   . ZN  B 2 .  ? -6.558  2.089   3.657   1.00 0.00 ? 201 ZN  A ZN   4  
HETATM 4592  ZN ZN   . ZN  C 2 .  ? 3.734   0.641   -7.133  1.00 0.00 ? 401 ZN  A ZN   4  
ATOM   4593  N  N    . GLY A 1 1  ? -12.718 -20.737 22.127  1.00 0.00 ? 1   GLY A N    5  
ATOM   4594  C  CA   . GLY A 1 1  ? -14.025 -20.356 22.631  1.00 0.00 ? 1   GLY A CA   5  
ATOM   4595  C  C    . GLY A 1 1  ? -14.688 -19.294 21.777  1.00 0.00 ? 1   GLY A C    5  
ATOM   4596  O  O    . GLY A 1 1  ? -14.717 -18.120 22.145  1.00 0.00 ? 1   GLY A O    5  
ATOM   4597  H  H1   . GLY A 1 1  ? -11.991 -20.080 22.109  1.00 0.00 ? 1   GLY A H1   5  
ATOM   4598  H  HA2  . GLY A 1 1  ? -14.658 -21.230 22.656  1.00 0.00 ? 1   GLY A HA2  5  
ATOM   4599  H  HA3  . GLY A 1 1  ? -13.913 -19.975 23.636  1.00 0.00 ? 1   GLY A HA3  5  
ATOM   4600  N  N    . SER A 1 2  ? -15.222 -19.707 20.631  1.00 0.00 ? 2   SER A N    5  
ATOM   4601  C  CA   . SER A 1 2  ? -15.883 -18.781 19.719  1.00 0.00 ? 2   SER A CA   5  
ATOM   4602  C  C    . SER A 1 2  ? -14.898 -17.744 19.189  1.00 0.00 ? 2   SER A C    5  
ATOM   4603  O  O    . SER A 1 2  ? -15.218 -16.559 19.095  1.00 0.00 ? 2   SER A O    5  
ATOM   4604  C  CB   . SER A 1 2  ? -17.047 -18.082 20.424  1.00 0.00 ? 2   SER A CB   5  
ATOM   4605  O  OG   . SER A 1 2  ? -17.837 -17.350 19.502  1.00 0.00 ? 2   SER A OG   5  
ATOM   4606  H  H    . SER A 1 2  ? -15.166 -20.656 20.393  1.00 0.00 ? 2   SER A H    5  
ATOM   4607  H  HA   . SER A 1 2  ? -16.268 -19.353 18.888  1.00 0.00 ? 2   SER A HA   5  
ATOM   4608  H  HB2  . SER A 1 2  ? -17.669 -18.821 20.905  1.00 0.00 ? 2   SER A HB2  5  
ATOM   4609  H  HB3  . SER A 1 2  ? -16.658 -17.400 21.167  1.00 0.00 ? 2   SER A HB3  5  
ATOM   4610  H  HG   . SER A 1 2  ? -18.454 -17.943 19.068  1.00 0.00 ? 2   SER A HG   5  
ATOM   4611  N  N    . SER A 1 3  ? -13.698 -18.199 18.843  1.00 0.00 ? 3   SER A N    5  
ATOM   4612  C  CA   . SER A 1 3  ? -12.664 -17.311 18.326  1.00 0.00 ? 3   SER A CA   5  
ATOM   4613  C  C    . SER A 1 3  ? -12.442 -17.546 16.835  1.00 0.00 ? 3   SER A C    5  
ATOM   4614  O  O    . SER A 1 3  ? -12.766 -18.610 16.308  1.00 0.00 ? 3   SER A O    5  
ATOM   4615  C  CB   . SER A 1 3  ? -11.353 -17.521 19.087  1.00 0.00 ? 3   SER A CB   5  
ATOM   4616  O  OG   . SER A 1 3  ? -10.325 -16.696 18.570  1.00 0.00 ? 3   SER A OG   5  
ATOM   4617  H  H    . SER A 1 3  ? -13.503 -19.155 18.941  1.00 0.00 ? 3   SER A H    5  
ATOM   4618  H  HA   . SER A 1 3  ? -12.996 -16.294 18.472  1.00 0.00 ? 3   SER A HA   5  
ATOM   4619  H  HB2  . SER A 1 3  ? -11.503 -17.279 20.128  1.00 0.00 ? 3   SER A HB2  5  
ATOM   4620  H  HB3  . SER A 1 3  ? -11.050 -18.554 18.997  1.00 0.00 ? 3   SER A HB3  5  
ATOM   4621  H  HG   . SER A 1 3  ? -9.591  -17.242 18.279  1.00 0.00 ? 3   SER A HG   5  
ATOM   4622  N  N    . GLY A 1 4  ? -11.886 -16.545 16.160  1.00 0.00 ? 4   GLY A N    5  
ATOM   4623  C  CA   . GLY A 1 4  ? -11.630 -16.661 14.736  1.00 0.00 ? 4   GLY A CA   5  
ATOM   4624  C  C    . GLY A 1 4  ? -12.834 -16.280 13.897  1.00 0.00 ? 4   GLY A C    5  
ATOM   4625  O  O    . GLY A 1 4  ? -13.537 -17.148 13.379  1.00 0.00 ? 4   GLY A O    5  
ATOM   4626  H  H    . GLY A 1 4  ? -11.648 -15.720 16.632  1.00 0.00 ? 4   GLY A H    5  
ATOM   4627  H  HA2  . GLY A 1 4  ? -10.804 -16.016 14.476  1.00 0.00 ? 4   GLY A HA2  5  
ATOM   4628  H  HA3  . GLY A 1 4  ? -11.359 -17.683 14.513  1.00 0.00 ? 4   GLY A HA3  5  
ATOM   4629  N  N    . SER A 1 5  ? -13.073 -14.980 13.764  1.00 0.00 ? 5   SER A N    5  
ATOM   4630  C  CA   . SER A 1 5  ? -14.204 -14.486 12.987  1.00 0.00 ? 5   SER A CA   5  
ATOM   4631  C  C    . SER A 1 5  ? -13.744 -13.966 11.628  1.00 0.00 ? 5   SER A C    5  
ATOM   4632  O  O    . SER A 1 5  ? -12.779 -13.207 11.536  1.00 0.00 ? 5   SER A O    5  
ATOM   4633  C  CB   . SER A 1 5  ? -14.930 -13.377 13.751  1.00 0.00 ? 5   SER A CB   5  
ATOM   4634  O  OG   . SER A 1 5  ? -14.249 -12.141 13.624  1.00 0.00 ? 5   SER A OG   5  
ATOM   4635  H  H    . SER A 1 5  ? -12.476 -14.337 14.201  1.00 0.00 ? 5   SER A H    5  
ATOM   4636  H  HA   . SER A 1 5  ? -14.884 -15.310 12.832  1.00 0.00 ? 5   SER A HA   5  
ATOM   4637  H  HB2  . SER A 1 5  ? -15.928 -13.266 13.357  1.00 0.00 ? 5   SER A HB2  5  
ATOM   4638  H  HB3  . SER A 1 5  ? -14.983 -13.640 14.798  1.00 0.00 ? 5   SER A HB3  5  
ATOM   4639  H  HG   . SER A 1 5  ? -13.399 -12.197 14.067  1.00 0.00 ? 5   SER A HG   5  
ATOM   4640  N  N    . SER A 1 6  ? -14.441 -14.381 10.576  1.00 0.00 ? 6   SER A N    5  
ATOM   4641  C  CA   . SER A 1 6  ? -14.103 -13.961 9.221   1.00 0.00 ? 6   SER A CA   5  
ATOM   4642  C  C    . SER A 1 6  ? -13.709 -12.487 9.191   1.00 0.00 ? 6   SER A C    5  
ATOM   4643  O  O    . SER A 1 6  ? -12.627 -12.131 8.727   1.00 0.00 ? 6   SER A O    5  
ATOM   4644  C  CB   . SER A 1 6  ? -15.284 -14.204 8.279   1.00 0.00 ? 6   SER A CB   5  
ATOM   4645  O  OG   . SER A 1 6  ? -15.643 -15.575 8.254   1.00 0.00 ? 6   SER A OG   5  
ATOM   4646  H  H    . SER A 1 6  ? -15.200 -14.986 10.714  1.00 0.00 ? 6   SER A H    5  
ATOM   4647  H  HA   . SER A 1 6  ? -13.262 -14.553 8.890   1.00 0.00 ? 6   SER A HA   5  
ATOM   4648  H  HB2  . SER A 1 6  ? -16.133 -13.628 8.615   1.00 0.00 ? 6   SER A HB2  5  
ATOM   4649  H  HB3  . SER A 1 6  ? -15.012 -13.897 7.279   1.00 0.00 ? 6   SER A HB3  5  
ATOM   4650  H  HG   . SER A 1 6  ? -15.816 -15.876 9.149   1.00 0.00 ? 6   SER A HG   5  
ATOM   4651  N  N    . GLY A 1 7  ? -14.597 -11.634 9.691   1.00 0.00 ? 7   GLY A N    5  
ATOM   4652  C  CA   . GLY A 1 7  ? -14.325 -10.208 9.713   1.00 0.00 ? 7   GLY A CA   5  
ATOM   4653  C  C    . GLY A 1 7  ? -14.146 -9.631  8.323   1.00 0.00 ? 7   GLY A C    5  
ATOM   4654  O  O    . GLY A 1 7  ? -13.610 -10.292 7.433   1.00 0.00 ? 7   GLY A O    5  
ATOM   4655  H  H    . GLY A 1 7  ? -15.444 -11.974 10.048  1.00 0.00 ? 7   GLY A H    5  
ATOM   4656  H  HA2  . GLY A 1 7  ? -15.148 -9.703  10.198  1.00 0.00 ? 7   GLY A HA2  5  
ATOM   4657  H  HA3  . GLY A 1 7  ? -13.424 -10.034 10.282  1.00 0.00 ? 7   GLY A HA3  5  
ATOM   4658  N  N    . LEU A 1 8  ? -14.595 -8.395  8.135   1.00 0.00 ? 8   LEU A N    5  
ATOM   4659  C  CA   . LEU A 1 8  ? -14.483 -7.729  6.842   1.00 0.00 ? 8   LEU A CA   5  
ATOM   4660  C  C    . LEU A 1 8  ? -13.042 -7.308  6.570   1.00 0.00 ? 8   LEU A C    5  
ATOM   4661  O  O    . LEU A 1 8  ? -12.216 -7.266  7.481   1.00 0.00 ? 8   LEU A O    5  
ATOM   4662  C  CB   . LEU A 1 8  ? -15.401 -6.507  6.795   1.00 0.00 ? 8   LEU A CB   5  
ATOM   4663  C  CG   . LEU A 1 8  ? -16.848 -6.737  7.231   1.00 0.00 ? 8   LEU A CG   5  
ATOM   4664  C  CD1  . LEU A 1 8  ? -17.443 -5.460  7.805   1.00 0.00 ? 8   LEU A CD1  5  
ATOM   4665  C  CD2  . LEU A 1 8  ? -17.685 -7.239  6.063   1.00 0.00 ? 8   LEU A CD2  5  
ATOM   4666  H  H    . LEU A 1 8  ? -15.013 -7.919  8.882   1.00 0.00 ? 8   LEU A H    5  
ATOM   4667  H  HA   . LEU A 1 8  ? -14.790 -8.430  6.080   1.00 0.00 ? 8   LEU A HA   5  
ATOM   4668  H  HB2  . LEU A 1 8  ? -14.978 -5.750  7.438   1.00 0.00 ? 8   LEU A HB2  5  
ATOM   4669  H  HB3  . LEU A 1 8  ? -15.416 -6.144  5.776   1.00 0.00 ? 8   LEU A HB3  5  
ATOM   4670  H  HG   . LEU A 1 8  ? -16.868 -7.491  8.006   1.00 0.00 ? 8   LEU A HG   5  
ATOM   4671  H  HD11 . LEU A 1 8  ? -18.519 -5.536  7.813   1.00 0.00 ? 8   LEU A HD11 5  
ATOM   4672  H  HD12 . LEU A 1 8  ? -17.146 -4.619  7.195   1.00 0.00 ? 8   LEU A HD12 5  
ATOM   4673  H  HD13 . LEU A 1 8  ? -17.083 -5.317  8.813   1.00 0.00 ? 8   LEU A HD13 5  
ATOM   4674  H  HD21 . LEU A 1 8  ? -17.033 -7.521  5.250   1.00 0.00 ? 8   LEU A HD21 5  
ATOM   4675  H  HD22 . LEU A 1 8  ? -18.352 -6.455  5.735   1.00 0.00 ? 8   LEU A HD22 5  
ATOM   4676  H  HD23 . LEU A 1 8  ? -18.262 -8.096  6.376   1.00 0.00 ? 8   LEU A HD23 5  
ATOM   4677  N  N    . GLN A 1 9  ? -12.750 -6.994  5.312   1.00 0.00 ? 9   GLN A N    5  
ATOM   4678  C  CA   . GLN A 1 9  ? -11.410 -6.574  4.921   1.00 0.00 ? 9   GLN A CA   5  
ATOM   4679  C  C    . GLN A 1 9  ? -11.469 -5.524  3.816   1.00 0.00 ? 9   GLN A C    5  
ATOM   4680  O  O    . GLN A 1 9  ? -12.269 -5.630  2.887   1.00 0.00 ? 9   GLN A O    5  
ATOM   4681  C  CB   . GLN A 1 9  ? -10.592 -7.779  4.453   1.00 0.00 ? 9   GLN A CB   5  
ATOM   4682  C  CG   . GLN A 1 9  ? -9.262  -7.402  3.820   1.00 0.00 ? 9   GLN A CG   5  
ATOM   4683  C  CD   . GLN A 1 9  ? -8.198  -8.464  4.021   1.00 0.00 ? 9   GLN A CD   5  
ATOM   4684  O  OE1  . GLN A 1 9  ? -8.281  -9.556  3.459   1.00 0.00 ? 9   GLN A OE1  5  
ATOM   4685  N  NE2  . GLN A 1 9  ? -7.190  -8.147  4.826   1.00 0.00 ? 9   GLN A NE2  5  
ATOM   4686  H  H    . GLN A 1 9  ? -13.452 -7.046  4.631   1.00 0.00 ? 9   GLN A H    5  
ATOM   4687  H  HA   . GLN A 1 9  ? -10.933 -6.141  5.787   1.00 0.00 ? 9   GLN A HA   5  
ATOM   4688  H  HB2  . GLN A 1 9  ? -10.395 -8.417  5.301   1.00 0.00 ? 9   GLN A HB2  5  
ATOM   4689  H  HB3  . GLN A 1 9  ? -11.168 -8.329  3.724   1.00 0.00 ? 9   GLN A HB3  5  
ATOM   4690  H  HG2  . GLN A 1 9  ? -9.409  -7.259  2.760   1.00 0.00 ? 9   GLN A HG2  5  
ATOM   4691  H  HG3  . GLN A 1 9  ? -8.916  -6.479  4.262   1.00 0.00 ? 9   GLN A HG3  5  
ATOM   4692  H  HE21 . GLN A 1 9  ? -7.191  -7.259  5.240   1.00 0.00 ? 9   GLN A HE21 5  
ATOM   4693  H  HE22 . GLN A 1 9  ? -6.490  -8.815  4.975   1.00 0.00 ? 9   GLN A HE22 5  
ATOM   4694  N  N    . CYS A 1 10 ? -10.616 -4.510  3.925   1.00 0.00 ? 10  CYS A N    5  
ATOM   4695  C  CA   . CYS A 1 10 ? -10.571 -3.440  2.936   1.00 0.00 ? 10  CYS A CA   5  
ATOM   4696  C  C    . CYS A 1 10 ? -9.665  -3.817  1.767   1.00 0.00 ? 10  CYS A C    5  
ATOM   4697  O  O    . CYS A 1 10 ? -8.715  -4.582  1.928   1.00 0.00 ? 10  CYS A O    5  
ATOM   4698  C  CB   . CYS A 1 10 ? -10.078 -2.143  3.580   1.00 0.00 ? 10  CYS A CB   5  
ATOM   4699  S  SG   . CYS A 1 10 ? -9.431  -0.922  2.393   1.00 0.00 ? 10  CYS A SG   5  
ATOM   4700  H  H    . CYS A 1 10 ? -10.002 -4.481  4.689   1.00 0.00 ? 10  CYS A H    5  
ATOM   4701  H  HA   . CYS A 1 10 ? -11.573 -3.289  2.564   1.00 0.00 ? 10  CYS A HA   5  
ATOM   4702  H  HB2  . CYS A 1 10 ? -10.897 -1.681  4.113   1.00 0.00 ? 10  CYS A HB2  5  
ATOM   4703  H  HB3  . CYS A 1 10 ? -9.287  -2.374  4.278   1.00 0.00 ? 10  CYS A HB3  5  
ATOM   4704  N  N    . GLU A 1 11 ? -9.966  -3.273  0.593   1.00 0.00 ? 11  GLU A N    5  
ATOM   4705  C  CA   . GLU A 1 11 ? -9.179  -3.552  -0.603  1.00 0.00 ? 11  GLU A CA   5  
ATOM   4706  C  C    . GLU A 1 11 ? -8.205  -2.414  -0.891  1.00 0.00 ? 11  GLU A C    5  
ATOM   4707  O  O    . GLU A 1 11 ? -7.111  -2.636  -1.411  1.00 0.00 ? 11  GLU A O    5  
ATOM   4708  C  CB   . GLU A 1 11 ? -10.098 -3.769  -1.807  1.00 0.00 ? 11  GLU A CB   5  
ATOM   4709  C  CG   . GLU A 1 11 ? -10.815 -2.508  -2.260  1.00 0.00 ? 11  GLU A CG   5  
ATOM   4710  C  CD   . GLU A 1 11 ? -12.107 -2.804  -2.997  1.00 0.00 ? 11  GLU A CD   5  
ATOM   4711  O  OE1  . GLU A 1 11 ? -12.810 -3.757  -2.600  1.00 0.00 ? 11  GLU A OE1  5  
ATOM   4712  O  OE2  . GLU A 1 11 ? -12.414 -2.084  -3.970  1.00 0.00 ? 11  GLU A OE2  5  
ATOM   4713  H  H    . GLU A 1 11 ? -10.736 -2.670  0.528   1.00 0.00 ? 11  GLU A H    5  
ATOM   4714  H  HA   . GLU A 1 11 ? -8.616  -4.456  -0.425  1.00 0.00 ? 11  GLU A HA   5  
ATOM   4715  H  HB2  . GLU A 1 11 ? -9.509  -4.140  -2.632  1.00 0.00 ? 11  GLU A HB2  5  
ATOM   4716  H  HB3  . GLU A 1 11 ? -10.843 -4.507  -1.547  1.00 0.00 ? 11  GLU A HB3  5  
ATOM   4717  H  HG2  . GLU A 1 11 ? -11.044 -1.908  -1.392  1.00 0.00 ? 11  GLU A HG2  5  
ATOM   4718  H  HG3  . GLU A 1 11 ? -10.161 -1.954  -2.917  1.00 0.00 ? 11  GLU A HG3  5  
ATOM   4719  N  N    . ILE A 1 12 ? -8.610  -1.195  -0.551  1.00 0.00 ? 12  ILE A N    5  
ATOM   4720  C  CA   . ILE A 1 12 ? -7.774  -0.022  -0.772  1.00 0.00 ? 12  ILE A CA   5  
ATOM   4721  C  C    . ILE A 1 12 ? -6.374  -0.230  -0.204  1.00 0.00 ? 12  ILE A C    5  
ATOM   4722  O  O    . ILE A 1 12 ? -5.385  -0.211  -0.938  1.00 0.00 ? 12  ILE A O    5  
ATOM   4723  C  CB   . ILE A 1 12 ? -8.391  1.238   -0.138  1.00 0.00 ? 12  ILE A CB   5  
ATOM   4724  C  CG1  . ILE A 1 12 ? -9.716  1.582   -0.821  1.00 0.00 ? 12  ILE A CG1  5  
ATOM   4725  C  CG2  . ILE A 1 12 ? -7.422  2.407   -0.230  1.00 0.00 ? 12  ILE A CG2  5  
ATOM   4726  C  CD1  . ILE A 1 12 ? -10.921 0.955   -0.155  1.00 0.00 ? 12  ILE A CD1  5  
ATOM   4727  H  H    . ILE A 1 12 ? -9.493  -1.082  -0.140  1.00 0.00 ? 12  ILE A H    5  
ATOM   4728  H  HA   . ILE A 1 12 ? -7.698  0.136   -1.839  1.00 0.00 ? 12  ILE A HA   5  
ATOM   4729  H  HB   . ILE A 1 12 ? -8.575  1.035   0.906   1.00 0.00 ? 12  ILE A HB   5  
ATOM   4730  H  HG12 . ILE A 1 12 ? -9.852  2.652   -0.811  1.00 0.00 ? 12  ILE A HG12 5  
ATOM   4731  H  HG13 . ILE A 1 12 ? -9.685  1.238   -1.845  1.00 0.00 ? 12  ILE A HG13 5  
ATOM   4732  H  HG21 . ILE A 1 12 ? -7.977  3.333   -0.266  1.00 0.00 ? 12  ILE A HG21 5  
ATOM   4733  H  HG22 . ILE A 1 12 ? -6.777  2.408   0.636   1.00 0.00 ? 12  ILE A HG22 5  
ATOM   4734  H  HG23 . ILE A 1 12 ? -6.825  2.310   -1.124  1.00 0.00 ? 12  ILE A HG23 5  
ATOM   4735  H  HD11 . ILE A 1 12 ? -11.165 0.027   -0.652  1.00 0.00 ? 12  ILE A HD11 5  
ATOM   4736  H  HD12 . ILE A 1 12 ? -10.698 0.761   0.883   1.00 0.00 ? 12  ILE A HD12 5  
ATOM   4737  H  HD13 . ILE A 1 12 ? -11.762 1.630   -0.223  1.00 0.00 ? 12  ILE A HD13 5  
ATOM   4738  N  N    . CYS A 1 13 ? -6.298  -0.430  1.107   1.00 0.00 ? 13  CYS A N    5  
ATOM   4739  C  CA   . CYS A 1 13 ? -5.020  -0.644  1.776   1.00 0.00 ? 13  CYS A CA   5  
ATOM   4740  C  C    . CYS A 1 13 ? -4.864  -2.101  2.199   1.00 0.00 ? 13  CYS A C    5  
ATOM   4741  O  O    . CYS A 1 13 ? -3.780  -2.675  2.102   1.00 0.00 ? 13  CYS A O    5  
ATOM   4742  C  CB   . CYS A 1 13 ? -4.901  0.270   2.997   1.00 0.00 ? 13  CYS A CB   5  
ATOM   4743  S  SG   . CYS A 1 13 ? -6.177  -0.015  4.266   1.00 0.00 ? 13  CYS A SG   5  
ATOM   4744  H  H    . CYS A 1 13 ? -7.122  -0.434  1.639   1.00 0.00 ? 13  CYS A H    5  
ATOM   4745  H  HA   . CYS A 1 13 ? -4.235  -0.399  1.077   1.00 0.00 ? 13  CYS A HA   5  
ATOM   4746  H  HB2  . CYS A 1 13 ? -3.937  0.114   3.461   1.00 0.00 ? 13  CYS A HB2  5  
ATOM   4747  H  HB3  . CYS A 1 13 ? -4.978  1.298   2.677   1.00 0.00 ? 13  CYS A HB3  5  
ATOM   4748  N  N    . GLY A 1 14 ? -5.957  -2.695  2.670   1.00 0.00 ? 14  GLY A N    5  
ATOM   4749  C  CA   . GLY A 1 14 ? -5.921  -4.080  3.101   1.00 0.00 ? 14  GLY A CA   5  
ATOM   4750  C  C    . GLY A 1 14 ? -6.158  -4.230  4.591   1.00 0.00 ? 14  GLY A C    5  
ATOM   4751  O  O    . GLY A 1 14 ? -5.578  -5.105  5.234   1.00 0.00 ? 14  GLY A O    5  
ATOM   4752  H  H    . GLY A 1 14 ? -6.794  -2.189  2.724   1.00 0.00 ? 14  GLY A H    5  
ATOM   4753  H  HA2  . GLY A 1 14 ? -6.682  -4.632  2.569   1.00 0.00 ? 14  GLY A HA2  5  
ATOM   4754  H  HA3  . GLY A 1 14 ? -4.954  -4.496  2.859   1.00 0.00 ? 14  GLY A HA3  5  
ATOM   4755  N  N    . PHE A 1 15 ? -7.012  -3.374  5.141   1.00 0.00 ? 15  PHE A N    5  
ATOM   4756  C  CA   . PHE A 1 15 ? -7.323  -3.413  6.565   1.00 0.00 ? 15  PHE A CA   5  
ATOM   4757  C  C    . PHE A 1 15 ? -8.443  -4.410  6.851   1.00 0.00 ? 15  PHE A C    5  
ATOM   4758  O  O    . PHE A 1 15 ? -8.959  -5.059  5.941   1.00 0.00 ? 15  PHE A O    5  
ATOM   4759  C  CB   . PHE A 1 15 ? -7.725  -2.022  7.060   1.00 0.00 ? 15  PHE A CB   5  
ATOM   4760  C  CG   . PHE A 1 15 ? -7.627  -1.864  8.550   1.00 0.00 ? 15  PHE A CG   5  
ATOM   4761  C  CD1  . PHE A 1 15 ? -6.393  -1.871  9.181   1.00 0.00 ? 15  PHE A CD1  5  
ATOM   4762  C  CD2  . PHE A 1 15 ? -8.768  -1.709  9.320   1.00 0.00 ? 15  PHE A CD2  5  
ATOM   4763  C  CE1  . PHE A 1 15 ? -6.300  -1.726  10.553  1.00 0.00 ? 15  PHE A CE1  5  
ATOM   4764  C  CE2  . PHE A 1 15 ? -8.681  -1.563  10.692  1.00 0.00 ? 15  PHE A CE2  5  
ATOM   4765  C  CZ   . PHE A 1 15 ? -7.445  -1.572  11.309  1.00 0.00 ? 15  PHE A CZ   5  
ATOM   4766  H  H    . PHE A 1 15 ? -7.444  -2.699  4.576   1.00 0.00 ? 15  PHE A H    5  
ATOM   4767  H  HA   . PHE A 1 15 ? -6.434  -3.729  7.089   1.00 0.00 ? 15  PHE A HA   5  
ATOM   4768  H  HB2  . PHE A 1 15 ? -7.079  -1.286  6.606   1.00 0.00 ? 15  PHE A HB2  5  
ATOM   4769  H  HB3  . PHE A 1 15 ? -8.746  -1.826  6.770   1.00 0.00 ? 15  PHE A HB3  5  
ATOM   4770  H  HD1  . PHE A 1 15 ? -5.496  -1.991  8.590   1.00 0.00 ? 15  PHE A HD1  5  
ATOM   4771  H  HD2  . PHE A 1 15 ? -9.735  -1.703  8.839   1.00 0.00 ? 15  PHE A HD2  5  
ATOM   4772  H  HE1  . PHE A 1 15 ? -5.332  -1.733  11.032  1.00 0.00 ? 15  PHE A HE1  5  
ATOM   4773  H  HE2  . PHE A 1 15 ? -9.578  -1.444  11.281  1.00 0.00 ? 15  PHE A HE2  5  
ATOM   4774  H  HZ   . PHE A 1 15 ? -7.374  -1.458  12.380  1.00 0.00 ? 15  PHE A HZ   5  
ATOM   4775  N  N    . THR A 1 16 ? -8.813  -4.526  8.122   1.00 0.00 ? 16  THR A N    5  
ATOM   4776  C  CA   . THR A 1 16 ? -9.870  -5.444  8.529   1.00 0.00 ? 16  THR A CA   5  
ATOM   4777  C  C    . THR A 1 16 ? -10.752 -4.823  9.606   1.00 0.00 ? 16  THR A C    5  
ATOM   4778  O  O    . THR A 1 16 ? -10.255 -4.226  10.562  1.00 0.00 ? 16  THR A O    5  
ATOM   4779  C  CB   . THR A 1 16 ? -9.290  -6.769  9.057   1.00 0.00 ? 16  THR A CB   5  
ATOM   4780  O  OG1  . THR A 1 16 ? -8.026  -6.534  9.689   1.00 0.00 ? 16  THR A OG1  5  
ATOM   4781  C  CG2  . THR A 1 16 ? -9.119  -7.773  7.928   1.00 0.00 ? 16  THR A CG2  5  
ATOM   4782  H  H    . THR A 1 16 ? -8.364  -3.981  8.802   1.00 0.00 ? 16  THR A H    5  
ATOM   4783  H  HA   . THR A 1 16 ? -10.476 -5.661  7.661   1.00 0.00 ? 16  THR A HA   5  
ATOM   4784  H  HB   . THR A 1 16 ? -9.976  -7.181  9.784   1.00 0.00 ? 16  THR A HB   5  
ATOM   4785  H  HG1  . THR A 1 16 ? -7.466  -6.020  9.103   1.00 0.00 ? 16  THR A HG1  5  
ATOM   4786  H  HG21 . THR A 1 16 ? -9.999  -7.765  7.302   1.00 0.00 ? 16  THR A HG21 5  
ATOM   4787  H  HG22 . THR A 1 16 ? -8.980  -8.761  8.342   1.00 0.00 ? 16  THR A HG22 5  
ATOM   4788  H  HG23 . THR A 1 16 ? -8.255  -7.506  7.337   1.00 0.00 ? 16  THR A HG23 5  
ATOM   4789  N  N    . CYS A 1 17 ? -12.063 -4.969  9.447   1.00 0.00 ? 17  CYS A N    5  
ATOM   4790  C  CA   . CYS A 1 17 ? -13.015 -4.422  10.407  1.00 0.00 ? 17  CYS A CA   5  
ATOM   4791  C  C    . CYS A 1 17 ? -14.187 -5.376  10.614  1.00 0.00 ? 17  CYS A C    5  
ATOM   4792  O  O    . CYS A 1 17 ? -14.781 -5.864  9.652   1.00 0.00 ? 17  CYS A O    5  
ATOM   4793  C  CB   . CYS A 1 17 ? -13.528 -3.062  9.930   1.00 0.00 ? 17  CYS A CB   5  
ATOM   4794  S  SG   . CYS A 1 17 ? -12.220 -1.899  9.474   1.00 0.00 ? 17  CYS A SG   5  
ATOM   4795  H  H    . CYS A 1 17 ? -12.399 -5.455  8.665   1.00 0.00 ? 17  CYS A H    5  
ATOM   4796  H  HA   . CYS A 1 17 ? -12.501 -4.294  11.347  1.00 0.00 ? 17  CYS A HA   5  
ATOM   4797  H  HB2  . CYS A 1 17 ? -14.155 -3.206  9.063   1.00 0.00 ? 17  CYS A HB2  5  
ATOM   4798  H  HB3  . CYS A 1 17 ? -14.112 -2.610  10.718  1.00 0.00 ? 17  CYS A HB3  5  
ATOM   4799  H  HG   . CYS A 1 17 ? -11.348 -1.855  10.470  1.00 0.00 ? 17  CYS A HG   5  
ATOM   4800  N  N    . ARG A 1 18 ? -14.513 -5.639  11.875  1.00 0.00 ? 18  ARG A N    5  
ATOM   4801  C  CA   . ARG A 1 18 ? -15.612 -6.538  12.209  1.00 0.00 ? 18  ARG A CA   5  
ATOM   4802  C  C    . ARG A 1 18 ? -16.958 -5.888  11.903  1.00 0.00 ? 18  ARG A C    5  
ATOM   4803  O  O    . ARG A 1 18 ? -17.858 -6.529  11.363  1.00 0.00 ? 18  ARG A O    5  
ATOM   4804  C  CB   . ARG A 1 18 ? -15.547 -6.931  13.686  1.00 0.00 ? 18  ARG A CB   5  
ATOM   4805  C  CG   . ARG A 1 18 ? -14.271 -7.663  14.066  1.00 0.00 ? 18  ARG A CG   5  
ATOM   4806  C  CD   . ARG A 1 18 ? -14.464 -8.507  15.317  1.00 0.00 ? 18  ARG A CD   5  
ATOM   4807  N  NE   . ARG A 1 18 ? -14.781 -7.689  16.485  1.00 0.00 ? 18  ARG A NE   5  
ATOM   4808  C  CZ   . ARG A 1 18 ? -13.863 -7.202  17.312  1.00 0.00 ? 18  ARG A CZ   5  
ATOM   4809  N  NH1  . ARG A 1 18 ? -12.577 -7.448  17.100  1.00 0.00 ? 18  ARG A NH1  5  
ATOM   4810  N  NH2  . ARG A 1 18 ? -14.230 -6.466  18.353  1.00 0.00 ? 18  ARG A NH2  5  
ATOM   4811  H  H    . ARG A 1 18 ? -14.002 -5.220  12.599  1.00 0.00 ? 18  ARG A H    5  
ATOM   4812  H  HA   . ARG A 1 18 ? -15.509 -7.427  11.605  1.00 0.00 ? 18  ARG A HA   5  
ATOM   4813  H  HB2  . ARG A 1 18 ? -15.615 -6.036  14.288  1.00 0.00 ? 18  ARG A HB2  5  
ATOM   4814  H  HB3  . ARG A 1 18 ? -16.385 -7.572  13.913  1.00 0.00 ? 18  ARG A HB3  5  
ATOM   4815  H  HG2  . ARG A 1 18 ? -13.981 -8.310  13.251  1.00 0.00 ? 18  ARG A HG2  5  
ATOM   4816  H  HG3  . ARG A 1 18 ? -13.491 -6.939  14.248  1.00 0.00 ? 18  ARG A HG3  5  
ATOM   4817  H  HD2  . ARG A 1 18 ? -15.273 -9.201  15.145  1.00 0.00 ? 18  ARG A HD2  5  
ATOM   4818  H  HD3  . ARG A 1 18 ? -13.554 -9.055  15.509  1.00 0.00 ? 18  ARG A HD3  5  
ATOM   4819  H  HE   . ARG A 1 18 ? -15.725 -7.494  16.660  1.00 0.00 ? 18  ARG A HE   5  
ATOM   4820  H  HH11 . ARG A 1 18 ? -12.298 -8.002  16.316  1.00 0.00 ? 18  ARG A HH11 5  
ATOM   4821  H  HH12 . ARG A 1 18 ? -11.888 -7.079  17.724  1.00 0.00 ? 18  ARG A HH12 5  
ATOM   4822  H  HH21 . ARG A 1 18 ? -15.198 -6.278  18.516  1.00 0.00 ? 18  ARG A HH21 5  
ATOM   4823  H  HH22 . ARG A 1 18 ? -13.539 -6.100  18.975  1.00 0.00 ? 18  ARG A HH22 5  
ATOM   4824  N  N    . GLN A 1 19 ? -17.086 -4.612  12.253  1.00 0.00 ? 19  GLN A N    5  
ATOM   4825  C  CA   . GLN A 1 19 ? -18.322 -3.876  12.017  1.00 0.00 ? 19  GLN A CA   5  
ATOM   4826  C  C    . GLN A 1 19 ? -18.318 -3.233  10.634  1.00 0.00 ? 19  GLN A C    5  
ATOM   4827  O  O    . GLN A 1 19 ? -17.399 -2.491  10.285  1.00 0.00 ? 19  GLN A O    5  
ATOM   4828  C  CB   . GLN A 1 19 ? -18.515 -2.803  13.090  1.00 0.00 ? 19  GLN A CB   5  
ATOM   4829  C  CG   . GLN A 1 19 ? -18.760 -3.370  14.479  1.00 0.00 ? 19  GLN A CG   5  
ATOM   4830  C  CD   . GLN A 1 19 ? -18.832 -2.293  15.544  1.00 0.00 ? 19  GLN A CD   5  
ATOM   4831  O  OE1  . GLN A 1 19 ? -19.916 -1.849  15.923  1.00 0.00 ? 19  GLN A OE1  5  
ATOM   4832  N  NE2  . GLN A 1 19 ? -17.674 -1.866  16.034  1.00 0.00 ? 19  GLN A NE2  5  
ATOM   4833  H  H    . GLN A 1 19 ? -16.332 -4.155  12.680  1.00 0.00 ? 19  GLN A H    5  
ATOM   4834  H  HA   . GLN A 1 19 ? -19.141 -4.578  12.071  1.00 0.00 ? 19  GLN A HA   5  
ATOM   4835  H  HB2  . GLN A 1 19 ? -17.631 -2.185  13.127  1.00 0.00 ? 19  GLN A HB2  5  
ATOM   4836  H  HB3  . GLN A 1 19 ? -19.363 -2.190  12.821  1.00 0.00 ? 19  GLN A HB3  5  
ATOM   4837  H  HG2  . GLN A 1 19 ? -19.695 -3.911  14.474  1.00 0.00 ? 19  GLN A HG2  5  
ATOM   4838  H  HG3  . GLN A 1 19 ? -17.955 -4.046  14.725  1.00 0.00 ? 19  GLN A HG3  5  
ATOM   4839  H  HE21 . GLN A 1 19 ? -16.849 -2.265  15.684  1.00 0.00 ? 19  GLN A HE21 5  
ATOM   4840  H  HE22 . GLN A 1 19 ? -17.690 -1.171  16.722  1.00 0.00 ? 19  GLN A HE22 5  
ATOM   4841  N  N    . LYS A 1 20 ? -19.349 -3.523  9.848   1.00 0.00 ? 20  LYS A N    5  
ATOM   4842  C  CA   . LYS A 1 20 ? -19.466 -2.974  8.503   1.00 0.00 ? 20  LYS A CA   5  
ATOM   4843  C  C    . LYS A 1 20 ? -19.264 -1.462  8.514   1.00 0.00 ? 20  LYS A C    5  
ATOM   4844  O  O    . LYS A 1 20 ? -18.366 -0.941  7.853   1.00 0.00 ? 20  LYS A O    5  
ATOM   4845  C  CB   . LYS A 1 20 ? -20.835 -3.312  7.908   1.00 0.00 ? 20  LYS A CB   5  
ATOM   4846  C  CG   . LYS A 1 20 ? -20.893 -3.172  6.397   1.00 0.00 ? 20  LYS A CG   5  
ATOM   4847  C  CD   . LYS A 1 20 ? -20.413 -4.434  5.700   1.00 0.00 ? 20  LYS A CD   5  
ATOM   4848  C  CE   . LYS A 1 20 ? -19.887 -4.135  4.305   1.00 0.00 ? 20  LYS A CE   5  
ATOM   4849  N  NZ   . LYS A 1 20 ? -19.874 -5.351  3.445   1.00 0.00 ? 20  LYS A NZ   5  
ATOM   4850  H  H    . LYS A 1 20 ? -20.051 -4.122  10.183  1.00 0.00 ? 20  LYS A H    5  
ATOM   4851  H  HA   . LYS A 1 20 ? -18.697 -3.423  7.893   1.00 0.00 ? 20  LYS A HA   5  
ATOM   4852  H  HB2  . LYS A 1 20 ? -21.082 -4.332  8.164   1.00 0.00 ? 20  LYS A HB2  5  
ATOM   4853  H  HB3  . LYS A 1 20 ? -21.574 -2.652  8.339   1.00 0.00 ? 20  LYS A HB3  5  
ATOM   4854  H  HG2  . LYS A 1 20 ? -21.913 -2.976  6.101   1.00 0.00 ? 20  LYS A HG2  5  
ATOM   4855  H  HG3  . LYS A 1 20 ? -20.264 -2.345  6.097   1.00 0.00 ? 20  LYS A HG3  5  
ATOM   4856  H  HD2  . LYS A 1 20 ? -19.619 -4.878  6.284   1.00 0.00 ? 20  LYS A HD2  5  
ATOM   4857  H  HD3  . LYS A 1 20 ? -21.238 -5.128  5.624   1.00 0.00 ? 20  LYS A HD3  5  
ATOM   4858  H  HE2  . LYS A 1 20 ? -20.520 -3.389  3.848   1.00 0.00 ? 20  LYS A HE2  5  
ATOM   4859  H  HE3  . LYS A 1 20 ? -18.881 -3.752  4.388   1.00 0.00 ? 20  LYS A HE3  5  
ATOM   4860  H  HZ1  . LYS A 1 20 ? -18.916 -5.516  3.074   1.00 0.00 ? 20  LYS A HZ1  5  
ATOM   4861  H  HZ2  . LYS A 1 20 ? -20.527 -5.230  2.645   1.00 0.00 ? 20  LYS A HZ2  5  
ATOM   4862  H  HZ3  . LYS A 1 20 ? -20.168 -6.182  3.996   1.00 0.00 ? 20  LYS A HZ3  5  
ATOM   4863  N  N    . ALA A 1 21 ? -20.106 -0.763  9.269   1.00 0.00 ? 21  ALA A N    5  
ATOM   4864  C  CA   . ALA A 1 21 ? -20.017 0.689   9.368   1.00 0.00 ? 21  ALA A CA   5  
ATOM   4865  C  C    . ALA A 1 21 ? -18.564 1.147   9.433   1.00 0.00 ? 21  ALA A C    5  
ATOM   4866  O  O    . ALA A 1 21 ? -18.182 2.126   8.791   1.00 0.00 ? 21  ALA A O    5  
ATOM   4867  C  CB   . ALA A 1 21 ? -20.783 1.182   10.586  1.00 0.00 ? 21  ALA A CB   5  
ATOM   4868  H  H    . ALA A 1 21 ? -20.801 -1.235  9.772   1.00 0.00 ? 21  ALA A H    5  
ATOM   4869  H  HA   . ALA A 1 21 ? -20.478 1.112   8.487   1.00 0.00 ? 21  ALA A HA   5  
ATOM   4870  H  HB1  . ALA A 1 21 ? -20.285 0.847   11.484  1.00 0.00 ? 21  ALA A HB1  5  
ATOM   4871  H  HB2  . ALA A 1 21 ? -20.820 2.261   10.576  1.00 0.00 ? 21  ALA A HB2  5  
ATOM   4872  H  HB3  . ALA A 1 21 ? -21.788 0.788   10.563  1.00 0.00 ? 21  ALA A HB3  5  
ATOM   4873  N  N    . SER A 1 22 ? -17.758 0.434   10.213  1.00 0.00 ? 22  SER A N    5  
ATOM   4874  C  CA   . SER A 1 22 ? -16.347 0.771   10.366  1.00 0.00 ? 22  SER A CA   5  
ATOM   4875  C  C    . SER A 1 22 ? -15.631 0.733   9.019   1.00 0.00 ? 22  SER A C    5  
ATOM   4876  O  O    . SER A 1 22 ? -14.971 1.696   8.626   1.00 0.00 ? 22  SER A O    5  
ATOM   4877  C  CB   . SER A 1 22 ? -15.673 -0.195  11.342  1.00 0.00 ? 22  SER A CB   5  
ATOM   4878  O  OG   . SER A 1 22 ? -14.543 0.403   11.953  1.00 0.00 ? 22  SER A OG   5  
ATOM   4879  H  H    . SER A 1 22 ? -18.122 -0.335  10.700  1.00 0.00 ? 22  SER A H    5  
ATOM   4880  H  HA   . SER A 1 22 ? -16.287 1.773   10.764  1.00 0.00 ? 22  SER A HA   5  
ATOM   4881  H  HB2  . SER A 1 22 ? -16.377 -0.474  12.112  1.00 0.00 ? 22  SER A HB2  5  
ATOM   4882  H  HB3  . SER A 1 22 ? -15.354 -1.078  10.808  1.00 0.00 ? 22  SER A HB3  5  
ATOM   4883  H  HG   . SER A 1 22 ? -13.853 -0.255  12.063  1.00 0.00 ? 22  SER A HG   5  
ATOM   4884  N  N    . LEU A 1 23 ? -15.766 -0.386  8.316   1.00 0.00 ? 23  LEU A N    5  
ATOM   4885  C  CA   . LEU A 1 23 ? -15.132 -0.552  7.013   1.00 0.00 ? 23  LEU A CA   5  
ATOM   4886  C  C    . LEU A 1 23 ? -15.456 0.623   6.096   1.00 0.00 ? 23  LEU A C    5  
ATOM   4887  O  O    . LEU A 1 23 ? -14.561 1.329   5.634   1.00 0.00 ? 23  LEU A O    5  
ATOM   4888  C  CB   . LEU A 1 23 ? -15.588 -1.860  6.365   1.00 0.00 ? 23  LEU A CB   5  
ATOM   4889  C  CG   . LEU A 1 23 ? -14.682 -2.416  5.265   1.00 0.00 ? 23  LEU A CG   5  
ATOM   4890  C  CD1  . LEU A 1 23 ? -13.327 -2.806  5.836   1.00 0.00 ? 23  LEU A CD1  5  
ATOM   4891  C  CD2  . LEU A 1 23 ? -15.339 -3.608  4.585   1.00 0.00 ? 23  LEU A CD2  5  
ATOM   4892  H  H    . LEU A 1 23 ? -16.303 -1.119  8.681   1.00 0.00 ? 23  LEU A H    5  
ATOM   4893  H  HA   . LEU A 1 23 ? -14.064 -0.589  7.166   1.00 0.00 ? 23  LEU A HA   5  
ATOM   4894  H  HB2  . LEU A 1 23 ? -15.661 -2.606  7.141   1.00 0.00 ? 23  LEU A HB2  5  
ATOM   4895  H  HB3  . LEU A 1 23 ? -16.566 -1.693  5.936   1.00 0.00 ? 23  LEU A HB3  5  
ATOM   4896  H  HG   . LEU A 1 23 ? -14.521 -1.650  4.519   1.00 0.00 ? 23  LEU A HG   5  
ATOM   4897  H  HD11 . LEU A 1 23 ? -12.795 -1.917  6.139   1.00 0.00 ? 23  LEU A HD11 5  
ATOM   4898  H  HD12 . LEU A 1 23 ? -12.756 -3.328  5.083   1.00 0.00 ? 23  LEU A HD12 5  
ATOM   4899  H  HD13 . LEU A 1 23 ? -13.469 -3.451  6.691   1.00 0.00 ? 23  LEU A HD13 5  
ATOM   4900  H  HD21 . LEU A 1 23 ? -15.886 -3.270  3.717   1.00 0.00 ? 23  LEU A HD21 5  
ATOM   4901  H  HD22 . LEU A 1 23 ? -16.019 -4.087  5.275   1.00 0.00 ? 23  LEU A HD22 5  
ATOM   4902  H  HD23 . LEU A 1 23 ? -14.579 -4.313  4.281   1.00 0.00 ? 23  LEU A HD23 5  
ATOM   4903  N  N    . ASN A 1 24 ? -16.744 0.828   5.839   1.00 0.00 ? 24  ASN A N    5  
ATOM   4904  C  CA   . ASN A 1 24 ? -17.188 1.919   4.979   1.00 0.00 ? 24  ASN A CA   5  
ATOM   4905  C  C    . ASN A 1 24 ? -16.601 3.250   5.442   1.00 0.00 ? 24  ASN A C    5  
ATOM   4906  O  O    . ASN A 1 24 ? -16.079 4.023   4.639   1.00 0.00 ? 24  ASN A O    5  
ATOM   4907  C  CB   . ASN A 1 24 ? -18.716 1.999   4.968   1.00 0.00 ? 24  ASN A CB   5  
ATOM   4908  C  CG   . ASN A 1 24 ? -19.345 0.907   4.125   1.00 0.00 ? 24  ASN A CG   5  
ATOM   4909  O  OD1  . ASN A 1 24 ? -18.924 0.658   2.995   1.00 0.00 ? 24  ASN A OD1  5  
ATOM   4910  N  ND2  . ASN A 1 24 ? -20.360 0.248   4.673   1.00 0.00 ? 24  ASN A ND2  5  
ATOM   4911  H  H    . ASN A 1 24 ? -17.412 0.232   6.237   1.00 0.00 ? 24  ASN A H    5  
ATOM   4912  H  HA   . ASN A 1 24 ? -16.839 1.715   3.978   1.00 0.00 ? 24  ASN A HA   5  
ATOM   4913  H  HB2  . ASN A 1 24 ? -19.082 1.903   5.979   1.00 0.00 ? 24  ASN A HB2  5  
ATOM   4914  H  HB3  . ASN A 1 24 ? -19.018 2.956   4.569   1.00 0.00 ? 24  ASN A HB3  5  
ATOM   4915  H  HD21 . ASN A 1 24 ? -20.642 0.500   5.577   1.00 0.00 ? 24  ASN A HD21 5  
ATOM   4916  H  HD22 . ASN A 1 24 ? -20.785 -0.464  4.150   1.00 0.00 ? 24  ASN A HD22 5  
ATOM   4917  N  N    . TRP A 1 25 ? -16.691 3.509   6.741   1.00 0.00 ? 25  TRP A N    5  
ATOM   4918  C  CA   . TRP A 1 25 ? -16.169 4.746   7.312   1.00 0.00 ? 25  TRP A CA   5  
ATOM   4919  C  C    . TRP A 1 25 ? -14.649 4.795   7.205   1.00 0.00 ? 25  TRP A C    5  
ATOM   4920  O  O    . TRP A 1 25 ? -14.055 5.873   7.163   1.00 0.00 ? 25  TRP A O    5  
ATOM   4921  C  CB   . TRP A 1 25 ? -16.595 4.876   8.775   1.00 0.00 ? 25  TRP A CB   5  
ATOM   4922  C  CG   . TRP A 1 25 ? -16.359 6.243   9.343   1.00 0.00 ? 25  TRP A CG   5  
ATOM   4923  C  CD1  . TRP A 1 25 ? -15.154 6.801   9.663   1.00 0.00 ? 25  TRP A CD1  5  
ATOM   4924  C  CD2  . TRP A 1 25 ? -17.353 7.224   9.659   1.00 0.00 ? 25  TRP A CD2  5  
ATOM   4925  N  NE1  . TRP A 1 25 ? -15.339 8.068   10.159  1.00 0.00 ? 25  TRP A NE1  5  
ATOM   4926  C  CE2  . TRP A 1 25 ? -16.679 8.352   10.166  1.00 0.00 ? 25  TRP A CE2  5  
ATOM   4927  C  CE3  . TRP A 1 25 ? -18.747 7.259   9.561   1.00 0.00 ? 25  TRP A CE3  5  
ATOM   4928  C  CZ2  . TRP A 1 25 ? -17.353 9.500   10.574  1.00 0.00 ? 25  TRP A CZ2  5  
ATOM   4929  C  CZ3  . TRP A 1 25 ? -19.414 8.399   9.967   1.00 0.00 ? 25  TRP A CZ3  5  
ATOM   4930  C  CH2  . TRP A 1 25 ? -18.717 9.507   10.468  1.00 0.00 ? 25  TRP A CH2  5  
ATOM   4931  H  H    . TRP A 1 25 ? -17.119 2.854   7.332   1.00 0.00 ? 25  TRP A H    5  
ATOM   4932  H  HA   . TRP A 1 25 ? -16.585 5.570   6.750   1.00 0.00 ? 25  TRP A HA   5  
ATOM   4933  H  HB2  . TRP A 1 25 ? -17.649 4.659   8.857   1.00 0.00 ? 25  TRP A HB2  5  
ATOM   4934  H  HB3  . TRP A 1 25 ? -16.037 4.167   9.369   1.00 0.00 ? 25  TRP A HB3  5  
ATOM   4935  H  HD1  . TRP A 1 25 ? -14.203 6.305   9.540   1.00 0.00 ? 25  TRP A HD1  5  
ATOM   4936  H  HE1  . TRP A 1 25 ? -14.627 8.672   10.458  1.00 0.00 ? 25  TRP A HE1  5  
ATOM   4937  H  HE3  . TRP A 1 25 ? -19.301 6.415   9.178   1.00 0.00 ? 25  TRP A HE3  5  
ATOM   4938  H  HZ2  . TRP A 1 25 ? -16.830 10.362  10.962  1.00 0.00 ? 25  TRP A HZ2  5  
ATOM   4939  H  HZ3  . TRP A 1 25 ? -20.491 8.445   9.899   1.00 0.00 ? 25  TRP A HZ3  5  
ATOM   4940  H  HH2  . TRP A 1 25 ? -19.279 10.376  10.773  1.00 0.00 ? 25  TRP A HH2  5  
ATOM   4941  N  N    . HIS A 1 26 ? -14.025 3.622   7.162   1.00 0.00 ? 26  HIS A N    5  
ATOM   4942  C  CA   . HIS A 1 26 ? -12.573 3.533   7.060   1.00 0.00 ? 26  HIS A CA   5  
ATOM   4943  C  C    . HIS A 1 26 ? -12.116 3.737   5.618   1.00 0.00 ? 26  HIS A C    5  
ATOM   4944  O  O    . HIS A 1 26 ? -11.086 4.363   5.367   1.00 0.00 ? 26  HIS A O    5  
ATOM   4945  C  CB   . HIS A 1 26 ? -12.087 2.177   7.573   1.00 0.00 ? 26  HIS A CB   5  
ATOM   4946  C  CG   . HIS A 1 26 ? -10.837 1.696   6.903   1.00 0.00 ? 26  HIS A CG   5  
ATOM   4947  N  ND1  . HIS A 1 26 ? -9.575  1.919   7.413   1.00 0.00 ? 26  HIS A ND1  5  
ATOM   4948  C  CD2  . HIS A 1 26 ? -10.660 0.997   5.757   1.00 0.00 ? 26  HIS A CD2  5  
ATOM   4949  C  CE1  . HIS A 1 26 ? -8.676  1.380   6.609   1.00 0.00 ? 26  HIS A CE1  5  
ATOM   4950  N  NE2  . HIS A 1 26 ? -9.308  0.814   5.597   1.00 0.00 ? 26  HIS A NE2  5  
ATOM   4951  H  H    . HIS A 1 26 ? -14.553 2.798   7.199   1.00 0.00 ? 26  HIS A H    5  
ATOM   4952  H  HA   . HIS A 1 26 ? -12.148 4.313   7.673   1.00 0.00 ? 26  HIS A HA   5  
ATOM   4953  H  HB2  . HIS A 1 26 ? -11.887 2.251   8.632   1.00 0.00 ? 26  HIS A HB2  5  
ATOM   4954  H  HB3  . HIS A 1 26 ? -12.858 1.439   7.408   1.00 0.00 ? 26  HIS A HB3  5  
ATOM   4955  H  HD1  . HIS A 1 26 ? -9.370  2.401   8.240   1.00 0.00 ? 26  HIS A HD1  5  
ATOM   4956  H  HD2  . HIS A 1 26 ? -11.437 0.649   5.091   1.00 0.00 ? 26  HIS A HD2  5  
ATOM   4957  H  HE1  . HIS A 1 26 ? -7.606  1.398   6.754   1.00 0.00 ? 26  HIS A HE1  5  
ATOM   4958  N  N    . GLN A 1 27 ? -12.889 3.206   4.677   1.00 0.00 ? 27  GLN A N    5  
ATOM   4959  C  CA   . GLN A 1 27 ? -12.562 3.329   3.261   1.00 0.00 ? 27  GLN A CA   5  
ATOM   4960  C  C    . GLN A 1 27 ? -12.531 4.793   2.835   1.00 0.00 ? 27  GLN A C    5  
ATOM   4961  O  O    . GLN A 1 27 ? -11.517 5.284   2.337   1.00 0.00 ? 27  GLN A O    5  
ATOM   4962  C  CB   . GLN A 1 27 ? -13.576 2.560   2.413   1.00 0.00 ? 27  GLN A CB   5  
ATOM   4963  C  CG   . GLN A 1 27 ? -13.616 1.071   2.713   1.00 0.00 ? 27  GLN A CG   5  
ATOM   4964  C  CD   . GLN A 1 27 ? -13.986 0.240   1.500   1.00 0.00 ? 27  GLN A CD   5  
ATOM   4965  O  OE1  . GLN A 1 27 ? -14.641 0.726   0.577   1.00 0.00 ? 27  GLN A OE1  5  
ATOM   4966  N  NE2  . GLN A 1 27 ? -13.567 -1.020  1.495   1.00 0.00 ? 27  GLN A NE2  5  
ATOM   4967  H  H    . GLN A 1 27 ? -13.697 2.719   4.940   1.00 0.00 ? 27  GLN A H    5  
ATOM   4968  H  HA   . GLN A 1 27 ? -11.582 2.902   3.109   1.00 0.00 ? 27  GLN A HA   5  
ATOM   4969  H  HB2  . GLN A 1 27 ? -14.560 2.969   2.591   1.00 0.00 ? 27  GLN A HB2  5  
ATOM   4970  H  HB3  . GLN A 1 27 ? -13.326 2.688   1.370   1.00 0.00 ? 27  GLN A HB3  5  
ATOM   4971  H  HG2  . GLN A 1 27 ? -12.642 0.760   3.059   1.00 0.00 ? 27  GLN A HG2  5  
ATOM   4972  H  HG3  . GLN A 1 27 ? -14.346 0.893   3.489   1.00 0.00 ? 27  GLN A HG3  5  
ATOM   4973  H  HE21 . GLN A 1 27 ? -13.050 -1.338  2.265   1.00 0.00 ? 27  GLN A HE21 5  
ATOM   4974  H  HE22 . GLN A 1 27 ? -13.792 -1.579  0.724   1.00 0.00 ? 27  GLN A HE22 5  
ATOM   4975  N  N    . ARG A 1 28 ? -13.647 5.486   3.035   1.00 0.00 ? 28  ARG A N    5  
ATOM   4976  C  CA   . ARG A 1 28 ? -13.748 6.894   2.670   1.00 0.00 ? 28  ARG A CA   5  
ATOM   4977  C  C    . ARG A 1 28 ? -12.464 7.640   3.021   1.00 0.00 ? 28  ARG A C    5  
ATOM   4978  O  O    . ARG A 1 28 ? -12.031 8.531   2.291   1.00 0.00 ? 28  ARG A O    5  
ATOM   4979  C  CB   . ARG A 1 28 ? -14.938 7.543   3.379   1.00 0.00 ? 28  ARG A CB   5  
ATOM   4980  C  CG   . ARG A 1 28 ? -14.939 7.331   4.885   1.00 0.00 ? 28  ARG A CG   5  
ATOM   4981  C  CD   . ARG A 1 28 ? -16.213 7.863   5.521   1.00 0.00 ? 28  ARG A CD   5  
ATOM   4982  N  NE   . ARG A 1 28 ? -17.398 7.149   5.053   1.00 0.00 ? 28  ARG A NE   5  
ATOM   4983  C  CZ   . ARG A 1 28 ? -18.637 7.465   5.413   1.00 0.00 ? 28  ARG A CZ   5  
ATOM   4984  N  NH1  . ARG A 1 28 ? -18.852 8.478   6.240   1.00 0.00 ? 28  ARG A NH1  5  
ATOM   4985  N  NH2  . ARG A 1 28 ? -19.664 6.768   4.944   1.00 0.00 ? 28  ARG A NH2  5  
ATOM   4986  H  H    . ARG A 1 28 ? -14.422 5.040   3.436   1.00 0.00 ? 28  ARG A H    5  
ATOM   4987  H  HA   . ARG A 1 28 ? -13.902 6.950   1.603   1.00 0.00 ? 28  ARG A HA   5  
ATOM   4988  H  HB2  . ARG A 1 28 ? -14.921 8.606   3.188   1.00 0.00 ? 28  ARG A HB2  5  
ATOM   4989  H  HB3  . ARG A 1 28 ? -15.850 7.127   2.979   1.00 0.00 ? 28  ARG A HB3  5  
ATOM   4990  H  HG2  . ARG A 1 28 ? -14.861 6.274   5.090   1.00 0.00 ? 28  ARG A HG2  5  
ATOM   4991  H  HG3  . ARG A 1 28 ? -14.091 7.847   5.311   1.00 0.00 ? 28  ARG A HG3  5  
ATOM   4992  H  HD2  . ARG A 1 28 ? -16.138 7.752   6.593   1.00 0.00 ? 28  ARG A HD2  5  
ATOM   4993  H  HD3  . ARG A 1 28 ? -16.314 8.909   5.274   1.00 0.00 ? 28  ARG A HD3  5  
ATOM   4994  H  HE   . ARG A 1 28 ? -17.262 6.396   4.440   1.00 0.00 ? 28  ARG A HE   5  
ATOM   4995  H  HH11 . ARG A 1 28 ? -18.080 9.006   6.594   1.00 0.00 ? 28  ARG A HH11 5  
ATOM   4996  H  HH12 . ARG A 1 28 ? -19.786 8.715   6.509   1.00 0.00 ? 28  ARG A HH12 5  
ATOM   4997  H  HH21 . ARG A 1 28 ? -19.505 6.003   4.319   1.00 0.00 ? 28  ARG A HH21 5  
ATOM   4998  H  HH22 . ARG A 1 28 ? -20.596 7.006   5.215   1.00 0.00 ? 28  ARG A HH22 5  
ATOM   4999  N  N    . LYS A 1 29 ? -11.860 7.270   4.145   1.00 0.00 ? 29  LYS A N    5  
ATOM   5000  C  CA   . LYS A 1 29 ? -10.625 7.902   4.595   1.00 0.00 ? 29  LYS A CA   5  
ATOM   5001  C  C    . LYS A 1 29 ? -9.609  7.981   3.459   1.00 0.00 ? 29  LYS A C    5  
ATOM   5002  O  O    . LYS A 1 29 ? -8.967  9.012   3.257   1.00 0.00 ? 29  LYS A O    5  
ATOM   5003  C  CB   . LYS A 1 29 ? -10.030 7.127   5.773   1.00 0.00 ? 29  LYS A CB   5  
ATOM   5004  C  CG   . LYS A 1 29 ? -10.973 7.004   6.957   1.00 0.00 ? 29  LYS A CG   5  
ATOM   5005  C  CD   . LYS A 1 29 ? -10.399 6.099   8.034   1.00 0.00 ? 29  LYS A CD   5  
ATOM   5006  C  CE   . LYS A 1 29 ? -11.291 6.064   9.266   1.00 0.00 ? 29  LYS A CE   5  
ATOM   5007  N  NZ   . LYS A 1 29 ? -11.120 7.279   10.109  1.00 0.00 ? 29  LYS A NZ   5  
ATOM   5008  H  H    . LYS A 1 29 ? -12.254 6.553   4.686   1.00 0.00 ? 29  LYS A H    5  
ATOM   5009  H  HA   . LYS A 1 29 ? -10.864 8.904   4.918   1.00 0.00 ? 29  LYS A HA   5  
ATOM   5010  H  HB2  . LYS A 1 29 ? -9.772  6.133   5.440   1.00 0.00 ? 29  LYS A HB2  5  
ATOM   5011  H  HB3  . LYS A 1 29 ? -9.134  7.632   6.104   1.00 0.00 ? 29  LYS A HB3  5  
ATOM   5012  H  HG2  . LYS A 1 29 ? -11.138 7.985   7.378   1.00 0.00 ? 29  LYS A HG2  5  
ATOM   5013  H  HG3  . LYS A 1 29 ? -11.913 6.593   6.617   1.00 0.00 ? 29  LYS A HG3  5  
ATOM   5014  H  HD2  . LYS A 1 29 ? -10.309 5.097   7.640   1.00 0.00 ? 29  LYS A HD2  5  
ATOM   5015  H  HD3  . LYS A 1 29 ? -9.422  6.465   8.318   1.00 0.00 ? 29  LYS A HD3  5  
ATOM   5016  H  HE2  . LYS A 1 29 ? -12.320 5.998   8.948   1.00 0.00 ? 29  LYS A HE2  5  
ATOM   5017  H  HE3  . LYS A 1 29 ? -11.039 5.192   9.852   1.00 0.00 ? 29  LYS A HE3  5  
ATOM   5018  H  HZ1  . LYS A 1 29 ? -12.049 7.691   10.334  1.00 0.00 ? 29  LYS A HZ1  5  
ATOM   5019  H  HZ2  . LYS A 1 29 ? -10.553 7.989   9.603   1.00 0.00 ? 29  LYS A HZ2  5  
ATOM   5020  H  HZ3  . LYS A 1 29 ? -10.638 7.034   10.997  1.00 0.00 ? 29  LYS A HZ3  5  
ATOM   5021  N  N    . HIS A 1 30 ? -9.470  6.885   2.720   1.00 0.00 ? 30  HIS A N    5  
ATOM   5022  C  CA   . HIS A 1 30 ? -8.533  6.831   1.603   1.00 0.00 ? 30  HIS A CA   5  
ATOM   5023  C  C    . HIS A 1 30 ? -8.851  7.912   0.574   1.00 0.00 ? 30  HIS A C    5  
ATOM   5024  O  O    . HIS A 1 30 ? -7.949  8.506   -0.015  1.00 0.00 ? 30  HIS A O    5  
ATOM   5025  C  CB   . HIS A 1 30 ? -8.575  5.453   0.941   1.00 0.00 ? 30  HIS A CB   5  
ATOM   5026  C  CG   . HIS A 1 30 ? -8.289  4.327   1.885   1.00 0.00 ? 30  HIS A CG   5  
ATOM   5027  N  ND1  . HIS A 1 30 ? -7.114  4.222   2.599   1.00 0.00 ? 30  HIS A ND1  5  
ATOM   5028  C  CD2  . HIS A 1 30 ? -9.035  3.252   2.233   1.00 0.00 ? 30  HIS A CD2  5  
ATOM   5029  C  CE1  . HIS A 1 30 ? -7.149  3.131   3.343   1.00 0.00 ? 30  HIS A CE1  5  
ATOM   5030  N  NE2  . HIS A 1 30 ? -8.304  2.525   3.140   1.00 0.00 ? 30  HIS A NE2  5  
ATOM   5031  H  H    . HIS A 1 30 ? -10.009 6.095   2.930   1.00 0.00 ? 30  HIS A H    5  
ATOM   5032  H  HA   . HIS A 1 30 ? -7.542  7.004   1.993   1.00 0.00 ? 30  HIS A HA   5  
ATOM   5033  H  HB2  . HIS A 1 30 ? -9.557  5.293   0.521   1.00 0.00 ? 30  HIS A HB2  5  
ATOM   5034  H  HB3  . HIS A 1 30 ? -7.840  5.419   0.150   1.00 0.00 ? 30  HIS A HB3  5  
ATOM   5035  H  HD1  . HIS A 1 30 ? -6.365  4.853   2.564   1.00 0.00 ? 30  HIS A HD1  5  
ATOM   5036  H  HD2  . HIS A 1 30 ? -10.022 3.010   1.865   1.00 0.00 ? 30  HIS A HD2  5  
ATOM   5037  H  HE1  . HIS A 1 30 ? -6.366  2.793   4.006   1.00 0.00 ? 30  HIS A HE1  5  
ATOM   5038  N  N    . ALA A 1 31 ? -10.139 8.161   0.364   1.00 0.00 ? 31  ALA A N    5  
ATOM   5039  C  CA   . ALA A 1 31 ? -10.576 9.172   -0.592  1.00 0.00 ? 31  ALA A CA   5  
ATOM   5040  C  C    . ALA A 1 31 ? -10.003 10.541  -0.244  1.00 0.00 ? 31  ALA A C    5  
ATOM   5041  O  O    . ALA A 1 31 ? -9.681  11.332  -1.130  1.00 0.00 ? 31  ALA A O    5  
ATOM   5042  C  CB   . ALA A 1 31 ? -12.096 9.230   -0.641  1.00 0.00 ? 31  ALA A CB   5  
ATOM   5043  H  H    . ALA A 1 31 ? -10.812 7.655   0.865   1.00 0.00 ? 31  ALA A H    5  
ATOM   5044  H  HA   . ALA A 1 31 ? -10.220 8.881   -1.570  1.00 0.00 ? 31  ALA A HA   5  
ATOM   5045  H  HB1  . ALA A 1 31 ? -12.491 8.228   -0.717  1.00 0.00 ? 31  ALA A HB1  5  
ATOM   5046  H  HB2  . ALA A 1 31 ? -12.467 9.697   0.259   1.00 0.00 ? 31  ALA A HB2  5  
ATOM   5047  H  HB3  . ALA A 1 31 ? -12.406 9.806   -1.500  1.00 0.00 ? 31  ALA A HB3  5  
ATOM   5048  N  N    . GLU A 1 32 ? -9.878  10.814  1.051   1.00 0.00 ? 32  GLU A N    5  
ATOM   5049  C  CA   . GLU A 1 32 ? -9.345  12.089  1.515   1.00 0.00 ? 32  GLU A CA   5  
ATOM   5050  C  C    . GLU A 1 32 ? -7.830  12.018  1.681   1.00 0.00 ? 32  GLU A C    5  
ATOM   5051  O  O    . GLU A 1 32 ? -7.121  12.997  1.446   1.00 0.00 ? 32  GLU A O    5  
ATOM   5052  C  CB   . GLU A 1 32 ? -9.996  12.487  2.841   1.00 0.00 ? 32  GLU A CB   5  
ATOM   5053  C  CG   . GLU A 1 32 ? -9.644  11.562  3.994   1.00 0.00 ? 32  GLU A CG   5  
ATOM   5054  C  CD   . GLU A 1 32 ? -9.887  12.199  5.349   1.00 0.00 ? 32  GLU A CD   5  
ATOM   5055  O  OE1  . GLU A 1 32 ? -11.062 12.281  5.763   1.00 0.00 ? 32  GLU A OE1  5  
ATOM   5056  O  OE2  . GLU A 1 32 ? -8.902  12.616  5.994   1.00 0.00 ? 32  GLU A OE2  5  
ATOM   5057  H  H    . GLU A 1 32 ? -10.152 10.142  1.710   1.00 0.00 ? 32  GLU A H    5  
ATOM   5058  H  HA   . GLU A 1 32 ? -9.579  12.836  0.772   1.00 0.00 ? 32  GLU A HA   5  
ATOM   5059  H  HB2  . GLU A 1 32 ? -9.678  13.487  3.099   1.00 0.00 ? 32  GLU A HB2  5  
ATOM   5060  H  HB3  . GLU A 1 32 ? -11.069 12.481  2.718   1.00 0.00 ? 32  GLU A HB3  5  
ATOM   5061  H  HG2  . GLU A 1 32 ? -10.247 10.670  3.920   1.00 0.00 ? 32  GLU A HG2  5  
ATOM   5062  H  HG3  . GLU A 1 32 ? -8.600  11.296  3.920   1.00 0.00 ? 32  GLU A HG3  5  
ATOM   5063  N  N    . THR A 1 33 ? -7.339  10.850  2.087   1.00 0.00 ? 33  THR A N    5  
ATOM   5064  C  CA   . THR A 1 33 ? -5.910  10.650  2.286   1.00 0.00 ? 33  THR A CA   5  
ATOM   5065  C  C    . THR A 1 33 ? -5.154  10.733  0.965   1.00 0.00 ? 33  THR A C    5  
ATOM   5066  O  O    . THR A 1 33 ? -4.163  11.454  0.849   1.00 0.00 ? 33  THR A O    5  
ATOM   5067  C  CB   . THR A 1 33 ? -5.620  9.289   2.946   1.00 0.00 ? 33  THR A CB   5  
ATOM   5068  O  OG1  . THR A 1 33 ? -6.444  9.121   4.104   1.00 0.00 ? 33  THR A OG1  5  
ATOM   5069  C  CG2  . THR A 1 33 ? -4.154  9.179   3.339   1.00 0.00 ? 33  THR A CG2  5  
ATOM   5070  H  H    . THR A 1 33 ? -7.955  10.108  2.257   1.00 0.00 ? 33  THR A H    5  
ATOM   5071  H  HA   . THR A 1 33 ? -5.552  11.429  2.944   1.00 0.00 ? 33  THR A HA   5  
ATOM   5072  H  HB   . THR A 1 33 ? -5.846  8.506   2.236   1.00 0.00 ? 33  THR A HB   5  
ATOM   5073  H  HG1  . THR A 1 33 ? -6.956  9.919   4.251   1.00 0.00 ? 33  THR A HG1  5  
ATOM   5074  H  HG21 . THR A 1 33 ? -4.025  9.535   4.351   1.00 0.00 ? 33  THR A HG21 5  
ATOM   5075  H  HG22 . THR A 1 33 ? -3.556  9.777   2.668   1.00 0.00 ? 33  THR A HG22 5  
ATOM   5076  H  HG23 . THR A 1 33 ? -3.842  8.148   3.279   1.00 0.00 ? 33  THR A HG23 5  
ATOM   5077  N  N    . VAL A 1 34 ? -5.628  9.990   -0.031  1.00 0.00 ? 34  VAL A N    5  
ATOM   5078  C  CA   . VAL A 1 34 ? -4.997  9.981   -1.345  1.00 0.00 ? 34  VAL A CA   5  
ATOM   5079  C  C    . VAL A 1 34 ? -4.436  11.355  -1.695  1.00 0.00 ? 34  VAL A C    5  
ATOM   5080  O  O    . VAL A 1 34 ? -3.377  11.465  -2.312  1.00 0.00 ? 34  VAL A O    5  
ATOM   5081  C  CB   . VAL A 1 34 ? -5.990  9.550   -2.441  1.00 0.00 ? 34  VAL A CB   5  
ATOM   5082  C  CG1  . VAL A 1 34 ? -6.405  8.100   -2.246  1.00 0.00 ? 34  VAL A CG1  5  
ATOM   5083  C  CG2  . VAL A 1 34 ? -7.206  10.464  -2.447  1.00 0.00 ? 34  VAL A CG2  5  
ATOM   5084  H  H    . VAL A 1 34 ? -6.421  9.435   0.123   1.00 0.00 ? 34  VAL A H    5  
ATOM   5085  H  HA   . VAL A 1 34 ? -4.187  9.267   -1.322  1.00 0.00 ? 34  VAL A HA   5  
ATOM   5086  H  HB   . VAL A 1 34 ? -5.497  9.635   -3.399  1.00 0.00 ? 34  VAL A HB   5  
ATOM   5087  H  HG11 . VAL A 1 34 ? -5.971  7.722   -1.331  1.00 0.00 ? 34  VAL A HG11 5  
ATOM   5088  H  HG12 . VAL A 1 34 ? -7.481  8.037   -2.189  1.00 0.00 ? 34  VAL A HG12 5  
ATOM   5089  H  HG13 . VAL A 1 34 ? -6.053  7.510   -3.080  1.00 0.00 ? 34  VAL A HG13 5  
ATOM   5090  H  HG21 . VAL A 1 34 ? -7.778  10.295  -3.347  1.00 0.00 ? 34  VAL A HG21 5  
ATOM   5091  H  HG22 . VAL A 1 34 ? -7.821  10.252  -1.584  1.00 0.00 ? 34  VAL A HG22 5  
ATOM   5092  H  HG23 . VAL A 1 34 ? -6.883  11.494  -2.414  1.00 0.00 ? 34  VAL A HG23 5  
ATOM   5093  N  N    . ALA A 1 35 ? -5.153  12.400  -1.296  1.00 0.00 ? 35  ALA A N    5  
ATOM   5094  C  CA   . ALA A 1 35 ? -4.725  13.767  -1.564  1.00 0.00 ? 35  ALA A CA   5  
ATOM   5095  C  C    . ALA A 1 35 ? -3.234  13.939  -1.295  1.00 0.00 ? 35  ALA A C    5  
ATOM   5096  O  O    . ALA A 1 35 ? -2.458  14.223  -2.206  1.00 0.00 ? 35  ALA A O    5  
ATOM   5097  C  CB   . ALA A 1 35 ? -5.532  14.747  -0.725  1.00 0.00 ? 35  ALA A CB   5  
ATOM   5098  H  H    . ALA A 1 35 ? -5.988  12.248  -0.807  1.00 0.00 ? 35  ALA A H    5  
ATOM   5099  H  HA   . ALA A 1 35 ? -4.919  13.979  -2.606  1.00 0.00 ? 35  ALA A HA   5  
ATOM   5100  H  HB1  . ALA A 1 35 ? -6.410  15.053  -1.275  1.00 0.00 ? 35  ALA A HB1  5  
ATOM   5101  H  HB2  . ALA A 1 35 ? -5.831  14.270  0.196   1.00 0.00 ? 35  ALA A HB2  5  
ATOM   5102  H  HB3  . ALA A 1 35 ? -4.926  15.613  -0.502  1.00 0.00 ? 35  ALA A HB3  5  
ATOM   5103  N  N    . ALA A 1 36 ? -2.841  13.766  -0.037  1.00 0.00 ? 36  ALA A N    5  
ATOM   5104  C  CA   . ALA A 1 36 ? -1.443  13.901  0.352   1.00 0.00 ? 36  ALA A CA   5  
ATOM   5105  C  C    . ALA A 1 36 ? -0.518  13.334  -0.720  1.00 0.00 ? 36  ALA A C    5  
ATOM   5106  O  O    . ALA A 1 36 ? 0.464   13.969  -1.106  1.00 0.00 ? 36  ALA A O    5  
ATOM   5107  C  CB   . ALA A 1 36 ? -1.197  13.209  1.684   1.00 0.00 ? 36  ALA A CB   5  
ATOM   5108  H  H    . ALA A 1 36 ? -3.507  13.541  0.645   1.00 0.00 ? 36  ALA A H    5  
ATOM   5109  H  HA   . ALA A 1 36 ? -1.231  14.953  0.476   1.00 0.00 ? 36  ALA A HA   5  
ATOM   5110  H  HB1  . ALA A 1 36 ? -0.464  12.425  1.552   1.00 0.00 ? 36  ALA A HB1  5  
ATOM   5111  H  HB2  . ALA A 1 36 ? -0.829  13.928  2.401   1.00 0.00 ? 36  ALA A HB2  5  
ATOM   5112  H  HB3  . ALA A 1 36 ? -2.121  12.781  2.044   1.00 0.00 ? 36  ALA A HB3  5  
ATOM   5113  N  N    . LEU A 1 37 ? -0.837  12.135  -1.196  1.00 0.00 ? 37  LEU A N    5  
ATOM   5114  C  CA   . LEU A 1 37 ? -0.034  11.482  -2.224  1.00 0.00 ? 37  LEU A CA   5  
ATOM   5115  C  C    . LEU A 1 37 ? -0.475  11.916  -3.618  1.00 0.00 ? 37  LEU A C    5  
ATOM   5116  O  O    . LEU A 1 37 ? -1.656  11.841  -3.957  1.00 0.00 ? 37  LEU A O    5  
ATOM   5117  C  CB   . LEU A 1 37 ? -0.140  9.962   -2.092  1.00 0.00 ? 37  LEU A CB   5  
ATOM   5118  C  CG   . LEU A 1 37 ? -0.111  9.407   -0.667  1.00 0.00 ? 37  LEU A CG   5  
ATOM   5119  C  CD1  . LEU A 1 37 ? 0.873   10.188  0.189   1.00 0.00 ? 37  LEU A CD1  5  
ATOM   5120  C  CD2  . LEU A 1 37 ? -1.502  9.444   -0.052  1.00 0.00 ? 37  LEU A CD2  5  
ATOM   5121  H  H    . LEU A 1 37 ? -1.631  11.678  -0.850  1.00 0.00 ? 37  LEU A H    5  
ATOM   5122  H  HA   . LEU A 1 37 ? 0.995   11.776  -2.077  1.00 0.00 ? 37  LEU A HA   5  
ATOM   5123  H  HB2  . LEU A 1 37 ? -1.070  9.655   -2.547  1.00 0.00 ? 37  LEU A HB2  5  
ATOM   5124  H  HB3  . LEU A 1 37 ? 0.685   9.525   -2.636  1.00 0.00 ? 37  LEU A HB3  5  
ATOM   5125  H  HG   . LEU A 1 37 ? 0.216   8.377   -0.695  1.00 0.00 ? 37  LEU A HG   5  
ATOM   5126  H  HD11 . LEU A 1 37 ? 0.723   11.246  0.036   1.00 0.00 ? 37  LEU A HD11 5  
ATOM   5127  H  HD12 . LEU A 1 37 ? 1.882   9.924   -0.091  1.00 0.00 ? 37  LEU A HD12 5  
ATOM   5128  H  HD13 . LEU A 1 37 ? 0.714   9.948   1.230   1.00 0.00 ? 37  LEU A HD13 5  
ATOM   5129  H  HD21 . LEU A 1 37 ? -1.607  8.629   0.648   1.00 0.00 ? 37  LEU A HD21 5  
ATOM   5130  H  HD22 . LEU A 1 37 ? -2.244  9.346   -0.832  1.00 0.00 ? 37  LEU A HD22 5  
ATOM   5131  H  HD23 . LEU A 1 37 ? -1.643  10.382  0.463   1.00 0.00 ? 37  LEU A HD23 5  
ATOM   5132  N  N    . ARG A 1 38 ? 0.482   12.367  -4.422  1.00 0.00 ? 38  ARG A N    5  
ATOM   5133  C  CA   . ARG A 1 38 ? 0.192   12.811  -5.780  1.00 0.00 ? 38  ARG A CA   5  
ATOM   5134  C  C    . ARG A 1 38 ? 0.926   11.949  -6.803  1.00 0.00 ? 38  ARG A C    5  
ATOM   5135  O  O    . ARG A 1 38 ? 0.457   11.766  -7.927  1.00 0.00 ? 38  ARG A O    5  
ATOM   5136  C  CB   . ARG A 1 38 ? 0.589   14.278  -5.955  1.00 0.00 ? 38  ARG A CB   5  
ATOM   5137  C  CG   . ARG A 1 38 ? 0.276   15.142  -4.744  1.00 0.00 ? 38  ARG A CG   5  
ATOM   5138  C  CD   . ARG A 1 38 ? 1.473   15.250  -3.813  1.00 0.00 ? 38  ARG A CD   5  
ATOM   5139  N  NE   . ARG A 1 38 ? 1.513   16.535  -3.119  1.00 0.00 ? 38  ARG A NE   5  
ATOM   5140  C  CZ   . ARG A 1 38 ? 0.596   16.925  -2.241  1.00 0.00 ? 38  ARG A CZ   5  
ATOM   5141  N  NH1  . ARG A 1 38 ? -0.428  16.134  -1.951  1.00 0.00 ? 38  ARG A NH1  5  
ATOM   5142  N  NH2  . ARG A 1 38 ? 0.702   18.109  -1.652  1.00 0.00 ? 38  ARG A NH2  5  
ATOM   5143  H  H    . ARG A 1 38 ? 1.405   12.402  -4.095  1.00 0.00 ? 38  ARG A H    5  
ATOM   5144  H  HA   . ARG A 1 38 ? -0.871  12.714  -5.941  1.00 0.00 ? 38  ARG A HA   5  
ATOM   5145  H  HB2  . ARG A 1 38 ? 1.651   14.332  -6.143  1.00 0.00 ? 38  ARG A HB2  5  
ATOM   5146  H  HB3  . ARG A 1 38 ? 0.060   14.683  -6.805  1.00 0.00 ? 38  ARG A HB3  5  
ATOM   5147  H  HG2  . ARG A 1 38 ? 0.005   16.133  -5.080  1.00 0.00 ? 38  ARG A HG2  5  
ATOM   5148  H  HG3  . ARG A 1 38 ? -0.551  14.704  -4.205  1.00 0.00 ? 38  ARG A HG3  5  
ATOM   5149  H  HD2  . ARG A 1 38 ? 1.415   14.458  -3.080  1.00 0.00 ? 38  ARG A HD2  5  
ATOM   5150  H  HD3  . ARG A 1 38 ? 2.376   15.137  -4.394  1.00 0.00 ? 38  ARG A HD3  5  
ATOM   5151  H  HE   . ARG A 1 38 ? 2.261   17.135  -3.319  1.00 0.00 ? 38  ARG A HE   5  
ATOM   5152  H  HH11 . ARG A 1 38 ? -0.509  15.241  -2.393  1.00 0.00 ? 38  ARG A HH11 5  
ATOM   5153  H  HH12 . ARG A 1 38 ? -1.116  16.430  -1.289  1.00 0.00 ? 38  ARG A HH12 5  
ATOM   5154  H  HH21 . ARG A 1 38 ? 1.472   18.708  -1.868  1.00 0.00 ? 38  ARG A HH21 5  
ATOM   5155  H  HH22 . ARG A 1 38 ? 0.011   18.402  -0.991  1.00 0.00 ? 38  ARG A HH22 5  
ATOM   5156  N  N    . PHE A 1 39 ? 2.079   11.422  -6.406  1.00 0.00 ? 39  PHE A N    5  
ATOM   5157  C  CA   . PHE A 1 39 ? 2.879   10.581  -7.288  1.00 0.00 ? 39  PHE A CA   5  
ATOM   5158  C  C    . PHE A 1 39 ? 2.665   9.103   -6.972  1.00 0.00 ? 39  PHE A C    5  
ATOM   5159  O  O    . PHE A 1 39 ? 3.209   8.564   -6.008  1.00 0.00 ? 39  PHE A O    5  
ATOM   5160  C  CB   . PHE A 1 39 ? 4.363   10.933  -7.156  1.00 0.00 ? 39  PHE A CB   5  
ATOM   5161  C  CG   . PHE A 1 39 ? 4.619   12.405  -7.011  1.00 0.00 ? 39  PHE A CG   5  
ATOM   5162  C  CD1  . PHE A 1 39 ? 4.373   13.049  -5.808  1.00 0.00 ? 39  PHE A CD1  5  
ATOM   5163  C  CD2  . PHE A 1 39 ? 5.106   13.146  -8.075  1.00 0.00 ? 39  PHE A CD2  5  
ATOM   5164  C  CE1  . PHE A 1 39 ? 4.607   14.404  -5.672  1.00 0.00 ? 39  PHE A CE1  5  
ATOM   5165  C  CE2  . PHE A 1 39 ? 5.343   14.501  -7.945  1.00 0.00 ? 39  PHE A CE2  5  
ATOM   5166  C  CZ   . PHE A 1 39 ? 5.094   15.131  -6.741  1.00 0.00 ? 39  PHE A CZ   5  
ATOM   5167  H  H    . PHE A 1 39 ? 2.401   11.605  -5.498  1.00 0.00 ? 39  PHE A H    5  
ATOM   5168  H  HA   . PHE A 1 39 ? 2.562   10.769  -8.302  1.00 0.00 ? 39  PHE A HA   5  
ATOM   5169  H  HB2  . PHE A 1 39 ? 4.767   10.438  -6.286  1.00 0.00 ? 39  PHE A HB2  5  
ATOM   5170  H  HB3  . PHE A 1 39 ? 4.886   10.589  -8.036  1.00 0.00 ? 39  PHE A HB3  5  
ATOM   5171  H  HD1  . PHE A 1 39 ? 3.993   12.482  -4.971  1.00 0.00 ? 39  PHE A HD1  5  
ATOM   5172  H  HD2  . PHE A 1 39 ? 5.302   12.654  -9.018  1.00 0.00 ? 39  PHE A HD2  5  
ATOM   5173  H  HE1  . PHE A 1 39 ? 4.412   14.894  -4.730  1.00 0.00 ? 39  PHE A HE1  5  
ATOM   5174  H  HE2  . PHE A 1 39 ? 5.723   15.066  -8.783  1.00 0.00 ? 39  PHE A HE2  5  
ATOM   5175  H  HZ   . PHE A 1 39 ? 5.277   16.190  -6.637  1.00 0.00 ? 39  PHE A HZ   5  
ATOM   5176  N  N    . PRO A 1 40 ? 1.854   8.433   -7.803  1.00 0.00 ? 40  PRO A N    5  
ATOM   5177  C  CA   . PRO A 1 40 ? 1.548   7.009   -7.633  1.00 0.00 ? 40  PRO A CA   5  
ATOM   5178  C  C    . PRO A 1 40 ? 2.750   6.119   -7.931  1.00 0.00 ? 40  PRO A C    5  
ATOM   5179  O  O    . PRO A 1 40 ? 3.796   6.597   -8.372  1.00 0.00 ? 40  PRO A O    5  
ATOM   5180  C  CB   . PRO A 1 40 ? 0.434   6.761   -8.653  1.00 0.00 ? 40  PRO A CB   5  
ATOM   5181  C  CG   . PRO A 1 40 ? 0.633   7.808   -9.694  1.00 0.00 ? 40  PRO A CG   5  
ATOM   5182  C  CD   . PRO A 1 40 ? 1.172   9.012   -8.972  1.00 0.00 ? 40  PRO A CD   5  
ATOM   5183  H  HA   . PRO A 1 40 ? 1.183   6.797   -6.639  1.00 0.00 ? 40  PRO A HA   5  
ATOM   5184  H  HB2  . PRO A 1 40 ? 0.535   5.767   -9.066  1.00 0.00 ? 40  PRO A HB2  5  
ATOM   5185  H  HB3  . PRO A 1 40 ? -0.527  6.861   -8.172  1.00 0.00 ? 40  PRO A HB3  5  
ATOM   5186  H  HG2  . PRO A 1 40 ? 1.343   7.463   -10.430 1.00 0.00 ? 40  PRO A HG2  5  
ATOM   5187  H  HG3  . PRO A 1 40 ? -0.311  8.044   -10.162 1.00 0.00 ? 40  PRO A HG3  5  
ATOM   5188  H  HD2  . PRO A 1 40 ? 1.870   9.547   -9.599  1.00 0.00 ? 40  PRO A HD2  5  
ATOM   5189  H  HD3  . PRO A 1 40 ? 0.365   9.660   -8.665  1.00 0.00 ? 40  PRO A HD3  5  
ATOM   5190  N  N    . CYS A 1 41 ? 2.595   4.822   -7.688  1.00 0.00 ? 41  CYS A N    5  
ATOM   5191  C  CA   . CYS A 1 41 ? 3.667   3.864   -7.929  1.00 0.00 ? 41  CYS A CA   5  
ATOM   5192  C  C    . CYS A 1 41 ? 3.379   3.028   -9.173  1.00 0.00 ? 41  CYS A C    5  
ATOM   5193  O  O    . CYS A 1 41 ? 2.521   2.147   -9.156  1.00 0.00 ? 41  CYS A O    5  
ATOM   5194  C  CB   . CYS A 1 41 ? 3.844   2.949   -6.717  1.00 0.00 ? 41  CYS A CB   5  
ATOM   5195  S  SG   . CYS A 1 41 ? 5.367   1.949   -6.756  1.00 0.00 ? 41  CYS A SG   5  
ATOM   5196  H  H    . CYS A 1 41 ? 1.737   4.500   -7.336  1.00 0.00 ? 41  CYS A H    5  
ATOM   5197  H  HA   . CYS A 1 41 ? 4.579   4.419   -8.087  1.00 0.00 ? 41  CYS A HA   5  
ATOM   5198  H  HB2  . CYS A 1 41 ? 3.872   3.552   -5.821  1.00 0.00 ? 41  CYS A HB2  5  
ATOM   5199  H  HB3  . CYS A 1 41 ? 3.006   2.270   -6.661  1.00 0.00 ? 41  CYS A HB3  5  
ATOM   5200  N  N    . GLU A 1 42 ? 4.104   3.313   -10.251 1.00 0.00 ? 42  GLU A N    5  
ATOM   5201  C  CA   . GLU A 1 42 ? 3.925   2.588   -11.504 1.00 0.00 ? 42  GLU A CA   5  
ATOM   5202  C  C    . GLU A 1 42 ? 4.331   1.125   -11.348 1.00 0.00 ? 42  GLU A C    5  
ATOM   5203  O  O    . GLU A 1 42 ? 4.207   0.332   -12.282 1.00 0.00 ? 42  GLU A O    5  
ATOM   5204  C  CB   . GLU A 1 42 ? 4.746   3.241   -12.618 1.00 0.00 ? 42  GLU A CB   5  
ATOM   5205  C  CG   . GLU A 1 42 ? 6.247   3.161   -12.395 1.00 0.00 ? 42  GLU A CG   5  
ATOM   5206  C  CD   . GLU A 1 42 ? 6.737   4.160   -11.365 1.00 0.00 ? 42  GLU A CD   5  
ATOM   5207  O  OE1  . GLU A 1 42 ? 6.376   5.350   -11.474 1.00 0.00 ? 42  GLU A OE1  5  
ATOM   5208  O  OE2  . GLU A 1 42 ? 7.482   3.752   -10.449 1.00 0.00 ? 42  GLU A OE2  5  
ATOM   5209  H  H    . GLU A 1 42 ? 4.773   4.027   -10.203 1.00 0.00 ? 42  GLU A H    5  
ATOM   5210  H  HA   . GLU A 1 42 ? 2.879   2.632   -11.767 1.00 0.00 ? 42  GLU A HA   5  
ATOM   5211  H  HB2  . GLU A 1 42 ? 4.515   2.752   -13.553 1.00 0.00 ? 42  GLU A HB2  5  
ATOM   5212  H  HB3  . GLU A 1 42 ? 4.469   4.282   -12.689 1.00 0.00 ? 42  GLU A HB3  5  
ATOM   5213  H  HG2  . GLU A 1 42 ? 6.495   2.167   -12.056 1.00 0.00 ? 42  GLU A HG2  5  
ATOM   5214  H  HG3  . GLU A 1 42 ? 6.748   3.357   -13.331 1.00 0.00 ? 42  GLU A HG3  5  
ATOM   5215  N  N    . PHE A 1 43 ? 4.818   0.775   -10.162 1.00 0.00 ? 43  PHE A N    5  
ATOM   5216  C  CA   . PHE A 1 43 ? 5.244   -0.591  -9.883  1.00 0.00 ? 43  PHE A CA   5  
ATOM   5217  C  C    . PHE A 1 43 ? 4.095   -1.412  -9.305  1.00 0.00 ? 43  PHE A C    5  
ATOM   5218  O  O    . PHE A 1 43 ? 3.773   -2.490  -9.807  1.00 0.00 ? 43  PHE A O    5  
ATOM   5219  C  CB   . PHE A 1 43 ? 6.425   -0.591  -8.911  1.00 0.00 ? 43  PHE A CB   5  
ATOM   5220  C  CG   . PHE A 1 43 ? 7.763   -0.645  -9.593  1.00 0.00 ? 43  PHE A CG   5  
ATOM   5221  C  CD1  . PHE A 1 43 ? 8.417   0.522   -9.955  1.00 0.00 ? 43  PHE A CD1  5  
ATOM   5222  C  CD2  . PHE A 1 43 ? 8.365   -1.861  -9.871  1.00 0.00 ? 43  PHE A CD2  5  
ATOM   5223  C  CE1  . PHE A 1 43 ? 9.648   0.475   -10.583 1.00 0.00 ? 43  PHE A CE1  5  
ATOM   5224  C  CE2  . PHE A 1 43 ? 9.596   -1.913  -10.498 1.00 0.00 ? 43  PHE A CE2  5  
ATOM   5225  C  CZ   . PHE A 1 43 ? 10.238  -0.744  -10.854 1.00 0.00 ? 43  PHE A CZ   5  
ATOM   5226  H  H    . PHE A 1 43 ? 4.892   1.453   -9.457  1.00 0.00 ? 43  PHE A H    5  
ATOM   5227  H  HA   . PHE A 1 43 ? 5.556   -1.037  -10.815 1.00 0.00 ? 43  PHE A HA   5  
ATOM   5228  H  HB2  . PHE A 1 43 ? 6.393   0.309   -8.316  1.00 0.00 ? 43  PHE A HB2  5  
ATOM   5229  H  HB3  . PHE A 1 43 ? 6.348   -1.450  -8.262  1.00 0.00 ? 43  PHE A HB3  5  
ATOM   5230  H  HD1  . PHE A 1 43 ? 7.957   1.476   -9.743  1.00 0.00 ? 43  PHE A HD1  5  
ATOM   5231  H  HD2  . PHE A 1 43 ? 7.864   -2.777  -9.592  1.00 0.00 ? 43  PHE A HD2  5  
ATOM   5232  H  HE1  . PHE A 1 43 ? 10.148  1.391   -10.860 1.00 0.00 ? 43  PHE A HE1  5  
ATOM   5233  H  HE2  . PHE A 1 43 ? 10.055  -2.868  -10.708 1.00 0.00 ? 43  PHE A HE2  5  
ATOM   5234  H  HZ   . PHE A 1 43 ? 11.199  -0.783  -11.345 1.00 0.00 ? 43  PHE A HZ   5  
ATOM   5235  N  N    . CYS A 1 44 ? 3.480   -0.895  -8.247  1.00 0.00 ? 44  CYS A N    5  
ATOM   5236  C  CA   . CYS A 1 44 ? 2.368   -1.578  -7.598  1.00 0.00 ? 44  CYS A CA   5  
ATOM   5237  C  C    . CYS A 1 44 ? 1.094   -0.741  -7.677  1.00 0.00 ? 44  CYS A C    5  
ATOM   5238  O  O    . CYS A 1 44 ? -0.011  -1.277  -7.740  1.00 0.00 ? 44  CYS A O    5  
ATOM   5239  C  CB   . CYS A 1 44 ? 2.707   -1.875  -6.136  1.00 0.00 ? 44  CYS A CB   5  
ATOM   5240  S  SG   . CYS A 1 44 ? 3.082   -0.394  -5.145  1.00 0.00 ? 44  CYS A SG   5  
ATOM   5241  H  H    . CYS A 1 44 ? 3.782   -0.031  -7.893  1.00 0.00 ? 44  CYS A H    5  
ATOM   5242  H  HA   . CYS A 1 44 ? 2.203   -2.511  -8.117  1.00 0.00 ? 44  CYS A HA   5  
ATOM   5243  H  HB2  . CYS A 1 44 ? 1.867   -2.374  -5.674  1.00 0.00 ? 44  CYS A HB2  5  
ATOM   5244  H  HB3  . CYS A 1 44 ? 3.569   -2.524  -6.099  1.00 0.00 ? 44  CYS A HB3  5  
ATOM   5245  N  N    . GLY A 1 45 ? 1.259   0.579   -7.673  1.00 0.00 ? 45  GLY A N    5  
ATOM   5246  C  CA   . GLY A 1 45 ? 0.115   1.469   -7.744  1.00 0.00 ? 45  GLY A CA   5  
ATOM   5247  C  C    . GLY A 1 45 ? -0.001  2.362   -6.524  1.00 0.00 ? 45  GLY A C    5  
ATOM   5248  O  O    . GLY A 1 45 ? -0.865  3.238   -6.467  1.00 0.00 ? 45  GLY A O    5  
ATOM   5249  H  H    . GLY A 1 45 ? 2.165   0.950   -7.620  1.00 0.00 ? 45  GLY A H    5  
ATOM   5250  H  HA2  . GLY A 1 45 ? 0.210   2.089   -8.623  1.00 0.00 ? 45  GLY A HA2  5  
ATOM   5251  H  HA3  . GLY A 1 45 ? -0.783  0.876   -7.829  1.00 0.00 ? 45  GLY A HA3  5  
ATOM   5252  N  N    . LYS A 1 46 ? 0.869   2.139   -5.545  1.00 0.00 ? 46  LYS A N    5  
ATOM   5253  C  CA   . LYS A 1 46 ? 0.861   2.929   -4.320  1.00 0.00 ? 46  LYS A CA   5  
ATOM   5254  C  C    . LYS A 1 46 ? 0.932   4.421   -4.633  1.00 0.00 ? 46  LYS A C    5  
ATOM   5255  O  O    . LYS A 1 46 ? 0.982   4.818   -5.797  1.00 0.00 ? 46  LYS A O    5  
ATOM   5256  C  CB   . LYS A 1 46 ? 2.034   2.529   -3.423  1.00 0.00 ? 46  LYS A CB   5  
ATOM   5257  C  CG   . LYS A 1 46 ? 1.723   1.366   -2.497  1.00 0.00 ? 46  LYS A CG   5  
ATOM   5258  C  CD   . LYS A 1 46 ? 2.914   1.019   -1.619  1.00 0.00 ? 46  LYS A CD   5  
ATOM   5259  C  CE   . LYS A 1 46 ? 2.897   1.808   -0.319  1.00 0.00 ? 46  LYS A CE   5  
ATOM   5260  N  NZ   . LYS A 1 46 ? 2.135   1.103   0.748   1.00 0.00 ? 46  LYS A NZ   5  
ATOM   5261  H  H    . LYS A 1 46 ? 1.534   1.426   -5.650  1.00 0.00 ? 46  LYS A H    5  
ATOM   5262  H  HA   . LYS A 1 46 ? -0.064  2.727   -3.800  1.00 0.00 ? 46  LYS A HA   5  
ATOM   5263  H  HB2  . LYS A 1 46 ? 2.871   2.252   -4.047  1.00 0.00 ? 46  LYS A HB2  5  
ATOM   5264  H  HB3  . LYS A 1 46 ? 2.315   3.379   -2.817  1.00 0.00 ? 46  LYS A HB3  5  
ATOM   5265  H  HG2  . LYS A 1 46 ? 0.890   1.634   -1.864  1.00 0.00 ? 46  LYS A HG2  5  
ATOM   5266  H  HG3  . LYS A 1 46 ? 1.463   0.503   -3.093  1.00 0.00 ? 46  LYS A HG3  5  
ATOM   5267  H  HD2  . LYS A 1 46 ? 2.884   -0.036  -1.387  1.00 0.00 ? 46  LYS A HD2  5  
ATOM   5268  H  HD3  . LYS A 1 46 ? 3.824   1.245   -2.156  1.00 0.00 ? 46  LYS A HD3  5  
ATOM   5269  H  HE2  . LYS A 1 46 ? 3.914   1.952   0.013   1.00 0.00 ? 46  LYS A HE2  5  
ATOM   5270  H  HE3  . LYS A 1 46 ? 2.439   2.768   -0.502  1.00 0.00 ? 46  LYS A HE3  5  
ATOM   5271  H  HZ1  . LYS A 1 46 ? 1.131   1.032   0.483   1.00 0.00 ? 46  LYS A HZ1  5  
ATOM   5272  H  HZ2  . LYS A 1 46 ? 2.208   1.625   1.645   1.00 0.00 ? 46  LYS A HZ2  5  
ATOM   5273  H  HZ3  . LYS A 1 46 ? 2.514   0.144   0.886   1.00 0.00 ? 46  LYS A HZ3  5  
ATOM   5274  N  N    . ARG A 1 47 ? 0.937   5.241   -3.587  1.00 0.00 ? 47  ARG A N    5  
ATOM   5275  C  CA   . ARG A 1 47 ? 1.003   6.688   -3.752  1.00 0.00 ? 47  ARG A CA   5  
ATOM   5276  C  C    . ARG A 1 47 ? 1.803   7.328   -2.621  1.00 0.00 ? 47  ARG A C    5  
ATOM   5277  O  O    . ARG A 1 47 ? 1.695   6.923   -1.464  1.00 0.00 ? 47  ARG A O    5  
ATOM   5278  C  CB   . ARG A 1 47 ? -0.406  7.282   -3.793  1.00 0.00 ? 47  ARG A CB   5  
ATOM   5279  C  CG   . ARG A 1 47 ? -1.238  6.797   -4.970  1.00 0.00 ? 47  ARG A CG   5  
ATOM   5280  C  CD   . ARG A 1 47 ? -2.615  7.441   -4.982  1.00 0.00 ? 47  ARG A CD   5  
ATOM   5281  N  NE   . ARG A 1 47 ? -3.183  7.495   -6.326  1.00 0.00 ? 47  ARG A NE   5  
ATOM   5282  C  CZ   . ARG A 1 47 ? -2.954  8.486   -7.181  1.00 0.00 ? 47  ARG A CZ   5  
ATOM   5283  N  NH1  . ARG A 1 47 ? -2.174  9.500   -6.832  1.00 0.00 ? 47  ARG A NH1  5  
ATOM   5284  N  NH2  . ARG A 1 47 ? -3.507  8.464   -8.387  1.00 0.00 ? 47  ARG A NH2  5  
ATOM   5285  H  H    . ARG A 1 47 ? 0.895   4.864   -2.684  1.00 0.00 ? 47  ARG A H    5  
ATOM   5286  H  HA   . ARG A 1 47 ? 1.498   6.893   -4.689  1.00 0.00 ? 47  ARG A HA   5  
ATOM   5287  H  HB2  . ARG A 1 47 ? -0.923  7.018   -2.883  1.00 0.00 ? 47  ARG A HB2  5  
ATOM   5288  H  HB3  . ARG A 1 47 ? -0.329  8.357   -3.854  1.00 0.00 ? 47  ARG A HB3  5  
ATOM   5289  H  HG2  . ARG A 1 47 ? -0.727  7.049   -5.888  1.00 0.00 ? 47  ARG A HG2  5  
ATOM   5290  H  HG3  . ARG A 1 47 ? -1.351  5.725   -4.901  1.00 0.00 ? 47  ARG A HG3  5  
ATOM   5291  H  HD2  . ARG A 1 47 ? -3.273  6.865   -4.347  1.00 0.00 ? 47  ARG A HD2  5  
ATOM   5292  H  HD3  . ARG A 1 47 ? -2.531  8.446   -4.595  1.00 0.00 ? 47  ARG A HD3  5  
ATOM   5293  H  HE   . ARG A 1 47 ? -3.762  6.756   -6.604  1.00 0.00 ? 47  ARG A HE   5  
ATOM   5294  H  HH11 . ARG A 1 47 ? -1.756  9.519   -5.924  1.00 0.00 ? 47  ARG A HH11 5  
ATOM   5295  H  HH12 . ARG A 1 47 ? -2.003  10.244  -7.478  1.00 0.00 ? 47  ARG A HH12 5  
ATOM   5296  H  HH21 . ARG A 1 47 ? -4.095  7.701   -8.653  1.00 0.00 ? 47  ARG A HH21 5  
ATOM   5297  H  HH22 . ARG A 1 47 ? -3.334  9.210   -9.029  1.00 0.00 ? 47  ARG A HH22 5  
ATOM   5298  N  N    . PHE A 1 48 ? 2.607   8.329   -2.965  1.00 0.00 ? 48  PHE A N    5  
ATOM   5299  C  CA   . PHE A 1 48 ? 3.427   9.024   -1.980  1.00 0.00 ? 48  PHE A CA   5  
ATOM   5300  C  C    . PHE A 1 48 ? 3.231   10.534  -2.078  1.00 0.00 ? 48  PHE A C    5  
ATOM   5301  O  O    . PHE A 1 48 ? 2.833   11.052  -3.121  1.00 0.00 ? 48  PHE A O    5  
ATOM   5302  C  CB   . PHE A 1 48 ? 4.903   8.676   -2.177  1.00 0.00 ? 48  PHE A CB   5  
ATOM   5303  C  CG   . PHE A 1 48 ? 5.196   7.208   -2.045  1.00 0.00 ? 48  PHE A CG   5  
ATOM   5304  C  CD1  . PHE A 1 48 ? 4.719   6.306   -2.981  1.00 0.00 ? 48  PHE A CD1  5  
ATOM   5305  C  CD2  . PHE A 1 48 ? 5.949   6.732   -0.984  1.00 0.00 ? 48  PHE A CD2  5  
ATOM   5306  C  CE1  . PHE A 1 48 ? 4.986   4.955   -2.861  1.00 0.00 ? 48  PHE A CE1  5  
ATOM   5307  C  CE2  . PHE A 1 48 ? 6.220   5.382   -0.858  1.00 0.00 ? 48  PHE A CE2  5  
ATOM   5308  C  CZ   . PHE A 1 48 ? 5.738   4.493   -1.799  1.00 0.00 ? 48  PHE A CZ   5  
ATOM   5309  H  H    . PHE A 1 48 ? 2.649   8.606   -3.905  1.00 0.00 ? 48  PHE A H    5  
ATOM   5310  H  HA   . PHE A 1 48 ? 3.116   8.696   -1.000  1.00 0.00 ? 48  PHE A HA   5  
ATOM   5311  H  HB2  . PHE A 1 48 ? 5.211   8.987   -3.165  1.00 0.00 ? 48  PHE A HB2  5  
ATOM   5312  H  HB3  . PHE A 1 48 ? 5.491   9.201   -1.440  1.00 0.00 ? 48  PHE A HB3  5  
ATOM   5313  H  HD1  . PHE A 1 48 ? 4.131   6.666   -3.813  1.00 0.00 ? 48  PHE A HD1  5  
ATOM   5314  H  HD2  . PHE A 1 48 ? 6.327   7.427   -0.247  1.00 0.00 ? 48  PHE A HD2  5  
ATOM   5315  H  HE1  . PHE A 1 48 ? 4.609   4.262   -3.598  1.00 0.00 ? 48  PHE A HE1  5  
ATOM   5316  H  HE2  . PHE A 1 48 ? 6.809   5.025   -0.027  1.00 0.00 ? 48  PHE A HE2  5  
ATOM   5317  H  HZ   . PHE A 1 48 ? 5.948   3.438   -1.703  1.00 0.00 ? 48  PHE A HZ   5  
ATOM   5318  N  N    . GLU A 1 49 ? 3.514   11.234  -0.984  1.00 0.00 ? 49  GLU A N    5  
ATOM   5319  C  CA   . GLU A 1 49 ? 3.368   12.684  -0.946  1.00 0.00 ? 49  GLU A CA   5  
ATOM   5320  C  C    . GLU A 1 49 ? 4.441   13.361  -1.794  1.00 0.00 ? 49  GLU A C    5  
ATOM   5321  O  O    . GLU A 1 49 ? 4.453   14.584  -1.942  1.00 0.00 ? 49  GLU A O    5  
ATOM   5322  C  CB   . GLU A 1 49 ? 3.449   13.190  0.496   1.00 0.00 ? 49  GLU A CB   5  
ATOM   5323  C  CG   . GLU A 1 49 ? 4.553   12.536  1.310   1.00 0.00 ? 49  GLU A CG   5  
ATOM   5324  C  CD   . GLU A 1 49 ? 5.108   13.452  2.382   1.00 0.00 ? 49  GLU A CD   5  
ATOM   5325  O  OE1  . GLU A 1 49 ? 5.872   14.377  2.034   1.00 0.00 ? 49  GLU A OE1  5  
ATOM   5326  O  OE2  . GLU A 1 49 ? 4.779   13.246  3.569   1.00 0.00 ? 49  GLU A OE2  5  
ATOM   5327  H  H    . GLU A 1 49 ? 3.828   10.764  -0.183  1.00 0.00 ? 49  GLU A H    5  
ATOM   5328  H  HA   . GLU A 1 49 ? 2.398   12.930  -1.350  1.00 0.00 ? 49  GLU A HA   5  
ATOM   5329  H  HB2  . GLU A 1 49 ? 3.623   14.256  0.482   1.00 0.00 ? 49  GLU A HB2  5  
ATOM   5330  H  HB3  . GLU A 1 49 ? 2.506   12.995  0.986   1.00 0.00 ? 49  GLU A HB3  5  
ATOM   5331  H  HG2  . GLU A 1 49 ? 4.156   11.651  1.784   1.00 0.00 ? 49  GLU A HG2  5  
ATOM   5332  H  HG3  . GLU A 1 49 ? 5.356   12.257  0.644   1.00 0.00 ? 49  GLU A HG3  5  
ATOM   5333  N  N    . LYS A 1 50 ? 5.341   12.558  -2.350  1.00 0.00 ? 50  LYS A N    5  
ATOM   5334  C  CA   . LYS A 1 50 ? 6.419   13.077  -3.185  1.00 0.00 ? 50  LYS A CA   5  
ATOM   5335  C  C    . LYS A 1 50 ? 7.110   11.949  -3.944  1.00 0.00 ? 50  LYS A C    5  
ATOM   5336  O  O    . LYS A 1 50 ? 7.020   10.776  -3.580  1.00 0.00 ? 50  LYS A O    5  
ATOM   5337  C  CB   . LYS A 1 50 ? 7.439   13.829  -2.327  1.00 0.00 ? 50  LYS A CB   5  
ATOM   5338  C  CG   . LYS A 1 50 ? 7.536   13.310  -0.903  1.00 0.00 ? 50  LYS A CG   5  
ATOM   5339  C  CD   . LYS A 1 50 ? 8.590   14.061  -0.107  1.00 0.00 ? 50  LYS A CD   5  
ATOM   5340  C  CE   . LYS A 1 50 ? 8.812   13.430  1.259   1.00 0.00 ? 50  LYS A CE   5  
ATOM   5341  N  NZ   . LYS A 1 50 ? 9.787   14.204  2.076   1.00 0.00 ? 50  LYS A NZ   5  
ATOM   5342  H  H    . LYS A 1 50 ? 5.279   11.591  -2.196  1.00 0.00 ? 50  LYS A H    5  
ATOM   5343  H  HA   . LYS A 1 50 ? 5.985   13.762  -3.898  1.00 0.00 ? 50  LYS A HA   5  
ATOM   5344  H  HB2  . LYS A 1 50 ? 8.412   13.742  -2.788  1.00 0.00 ? 50  LYS A HB2  5  
ATOM   5345  H  HB3  . LYS A 1 50 ? 7.160   14.872  -2.290  1.00 0.00 ? 50  LYS A HB3  5  
ATOM   5346  H  HG2  . LYS A 1 50 ? 6.579   13.433  -0.418  1.00 0.00 ? 50  LYS A HG2  5  
ATOM   5347  H  HG3  . LYS A 1 50 ? 7.797   12.261  -0.929  1.00 0.00 ? 50  LYS A HG3  5  
ATOM   5348  H  HD2  . LYS A 1 50 ? 9.522   14.045  -0.654  1.00 0.00 ? 50  LYS A HD2  5  
ATOM   5349  H  HD3  . LYS A 1 50 ? 8.267   15.084  0.027   1.00 0.00 ? 50  LYS A HD3  5  
ATOM   5350  H  HE2  . LYS A 1 50 ? 7.868   13.392  1.781   1.00 0.00 ? 50  LYS A HE2  5  
ATOM   5351  H  HE3  . LYS A 1 50 ? 9.187   12.426  1.120   1.00 0.00 ? 50  LYS A HE3  5  
ATOM   5352  H  HZ1  . LYS A 1 50 ? 9.909   13.755  3.007   1.00 0.00 ? 50  LYS A HZ1  5  
ATOM   5353  H  HZ2  . LYS A 1 50 ? 9.445   15.176  2.215   1.00 0.00 ? 50  LYS A HZ2  5  
ATOM   5354  H  HZ3  . LYS A 1 50 ? 10.709  14.237  1.596   1.00 0.00 ? 50  LYS A HZ3  5  
ATOM   5355  N  N    . PRO A 1 51 ? 7.818   12.309  -5.025  1.00 0.00 ? 51  PRO A N    5  
ATOM   5356  C  CA   . PRO A 1 51 ? 8.540   11.342  -5.857  1.00 0.00 ? 51  PRO A CA   5  
ATOM   5357  C  C    . PRO A 1 51 ? 9.749   10.750  -5.140  1.00 0.00 ? 51  PRO A C    5  
ATOM   5358  O  O    . PRO A 1 51 ? 10.014  9.552   -5.236  1.00 0.00 ? 51  PRO A O    5  
ATOM   5359  C  CB   . PRO A 1 51 ? 8.987   12.174  -7.062  1.00 0.00 ? 51  PRO A CB   5  
ATOM   5360  C  CG   . PRO A 1 51 ? 9.054   13.572  -6.553  1.00 0.00 ? 51  PRO A CG   5  
ATOM   5361  C  CD   . PRO A 1 51 ? 7.969   13.689  -5.518  1.00 0.00 ? 51  PRO A CD   5  
ATOM   5362  H  HA   . PRO A 1 51 ? 7.893   10.543  -6.189  1.00 0.00 ? 51  PRO A HA   5  
ATOM   5363  H  HB2  . PRO A 1 51 ? 9.953   11.829  -7.402  1.00 0.00 ? 51  PRO A HB2  5  
ATOM   5364  H  HB3  . PRO A 1 51 ? 8.264   12.078  -7.858  1.00 0.00 ? 51  PRO A HB3  5  
ATOM   5365  H  HG2  . PRO A 1 51 ? 10.019  13.755  -6.106  1.00 0.00 ? 51  PRO A HG2  5  
ATOM   5366  H  HG3  . PRO A 1 51 ? 8.875   14.266  -7.361  1.00 0.00 ? 51  PRO A HG3  5  
ATOM   5367  H  HD2  . PRO A 1 51 ? 8.276   14.351  -4.722  1.00 0.00 ? 51  PRO A HD2  5  
ATOM   5368  H  HD3  . PRO A 1 51 ? 7.052   14.038  -5.970  1.00 0.00 ? 51  PRO A HD3  5  
ATOM   5369  N  N    . ASP A 1 52 ? 10.479  11.597  -4.423  1.00 0.00 ? 52  ASP A N    5  
ATOM   5370  C  CA   . ASP A 1 52 ? 11.660  11.158  -3.689  1.00 0.00 ? 52  ASP A CA   5  
ATOM   5371  C  C    . ASP A 1 52 ? 11.379  9.863   -2.932  1.00 0.00 ? 52  ASP A C    5  
ATOM   5372  O  O    . ASP A 1 52 ? 12.250  9.003   -2.809  1.00 0.00 ? 52  ASP A O    5  
ATOM   5373  C  CB   . ASP A 1 52 ? 12.115  12.245  -2.714  1.00 0.00 ? 52  ASP A CB   5  
ATOM   5374  C  CG   . ASP A 1 52 ? 12.153  13.618  -3.355  1.00 0.00 ? 52  ASP A CG   5  
ATOM   5375  O  OD1  . ASP A 1 52 ? 13.168  13.940  -4.006  1.00 0.00 ? 52  ASP A OD1  5  
ATOM   5376  O  OD2  . ASP A 1 52 ? 11.168  14.371  -3.204  1.00 0.00 ? 52  ASP A OD2  5  
ATOM   5377  H  H    . ASP A 1 52 ? 10.217  12.541  -4.386  1.00 0.00 ? 52  ASP A H    5  
ATOM   5378  H  HA   . ASP A 1 52 ? 12.447  10.977  -4.405  1.00 0.00 ? 52  ASP A HA   5  
ATOM   5379  H  HB2  . ASP A 1 52 ? 11.432  12.277  -1.877  1.00 0.00 ? 52  ASP A HB2  5  
ATOM   5380  H  HB3  . ASP A 1 52 ? 13.105  12.006  -2.356  1.00 0.00 ? 52  ASP A HB3  5  
ATOM   5381  N  N    . SER A 1 53 ? 10.156  9.734   -2.426  1.00 0.00 ? 53  SER A N    5  
ATOM   5382  C  CA   . SER A 1 53 ? 9.761   8.547   -1.677  1.00 0.00 ? 53  SER A CA   5  
ATOM   5383  C  C    . SER A 1 53 ? 9.329   7.428   -2.620  1.00 0.00 ? 53  SER A C    5  
ATOM   5384  O  O    . SER A 1 53 ? 9.479   6.246   -2.309  1.00 0.00 ? 53  SER A O    5  
ATOM   5385  C  CB   . SER A 1 53 ? 8.624   8.883   -0.711  1.00 0.00 ? 53  SER A CB   5  
ATOM   5386  O  OG   . SER A 1 53 ? 9.090   9.670   0.372   1.00 0.00 ? 53  SER A OG   5  
ATOM   5387  H  H    . SER A 1 53 ? 9.506   10.455  -2.558  1.00 0.00 ? 53  SER A H    5  
ATOM   5388  H  HA   . SER A 1 53 ? 10.617  8.213   -1.109  1.00 0.00 ? 53  SER A HA   5  
ATOM   5389  H  HB2  . SER A 1 53 ? 7.859   9.433   -1.237  1.00 0.00 ? 53  SER A HB2  5  
ATOM   5390  H  HB3  . SER A 1 53 ? 8.205   7.967   -0.320  1.00 0.00 ? 53  SER A HB3  5  
ATOM   5391  H  HG   . SER A 1 53 ? 9.745   10.296  0.054   1.00 0.00 ? 53  SER A HG   5  
ATOM   5392  N  N    . VAL A 1 54 ? 8.792   7.810   -3.774  1.00 0.00 ? 54  VAL A N    5  
ATOM   5393  C  CA   . VAL A 1 54 ? 8.338   6.840   -4.764  1.00 0.00 ? 54  VAL A CA   5  
ATOM   5394  C  C    . VAL A 1 54 ? 9.518   6.130   -5.418  1.00 0.00 ? 54  VAL A C    5  
ATOM   5395  O  O    . VAL A 1 54 ? 9.421   4.962   -5.794  1.00 0.00 ? 54  VAL A O    5  
ATOM   5396  C  CB   . VAL A 1 54 ? 7.487   7.512   -5.858  1.00 0.00 ? 54  VAL A CB   5  
ATOM   5397  C  CG1  . VAL A 1 54 ? 7.686   6.812   -7.194  1.00 0.00 ? 54  VAL A CG1  5  
ATOM   5398  C  CG2  . VAL A 1 54 ? 6.018   7.516   -5.462  1.00 0.00 ? 54  VAL A CG2  5  
ATOM   5399  H  H    . VAL A 1 54 ? 8.699   8.767   -3.964  1.00 0.00 ? 54  VAL A H    5  
ATOM   5400  H  HA   . VAL A 1 54 ? 7.725   6.109   -4.258  1.00 0.00 ? 54  VAL A HA   5  
ATOM   5401  H  HB   . VAL A 1 54 ? 7.813   8.536   -5.961  1.00 0.00 ? 54  VAL A HB   5  
ATOM   5402  H  HG11 . VAL A 1 54 ? 7.654   5.743   -7.048  1.00 0.00 ? 54  VAL A HG11 5  
ATOM   5403  H  HG12 . VAL A 1 54 ? 6.902   7.107   -7.875  1.00 0.00 ? 54  VAL A HG12 5  
ATOM   5404  H  HG13 . VAL A 1 54 ? 8.645   7.090   -7.606  1.00 0.00 ? 54  VAL A HG13 5  
ATOM   5405  H  HG21 . VAL A 1 54 ? 5.935   7.623   -4.391  1.00 0.00 ? 54  VAL A HG21 5  
ATOM   5406  H  HG22 . VAL A 1 54 ? 5.516   8.341   -5.947  1.00 0.00 ? 54  VAL A HG22 5  
ATOM   5407  H  HG23 . VAL A 1 54 ? 5.560   6.587   -5.768  1.00 0.00 ? 54  VAL A HG23 5  
ATOM   5408  N  N    . ALA A 1 55 ? 10.632  6.842   -5.549  1.00 0.00 ? 55  ALA A N    5  
ATOM   5409  C  CA   . ALA A 1 55 ? 11.832  6.279   -6.155  1.00 0.00 ? 55  ALA A CA   5  
ATOM   5410  C  C    . ALA A 1 55 ? 12.542  5.334   -5.192  1.00 0.00 ? 55  ALA A C    5  
ATOM   5411  O  O    . ALA A 1 55 ? 13.082  4.306   -5.601  1.00 0.00 ? 55  ALA A O    5  
ATOM   5412  C  CB   . ALA A 1 55 ? 12.773  7.391   -6.596  1.00 0.00 ? 55  ALA A CB   5  
ATOM   5413  H  H    . ALA A 1 55 ? 10.647  7.768   -5.230  1.00 0.00 ? 55  ALA A H    5  
ATOM   5414  H  HA   . ALA A 1 55 ? 11.534  5.725   -7.034  1.00 0.00 ? 55  ALA A HA   5  
ATOM   5415  H  HB1  . ALA A 1 55 ? 12.510  7.708   -7.595  1.00 0.00 ? 55  ALA A HB1  5  
ATOM   5416  H  HB2  . ALA A 1 55 ? 12.684  8.227   -5.918  1.00 0.00 ? 55  ALA A HB2  5  
ATOM   5417  H  HB3  . ALA A 1 55 ? 13.789  7.027   -6.589  1.00 0.00 ? 55  ALA A HB3  5  
ATOM   5418  N  N    . ALA A 1 56 ? 12.538  5.689   -3.911  1.00 0.00 ? 56  ALA A N    5  
ATOM   5419  C  CA   . ALA A 1 56 ? 13.181  4.872   -2.890  1.00 0.00 ? 56  ALA A CA   5  
ATOM   5420  C  C    . ALA A 1 56 ? 12.334  3.649   -2.552  1.00 0.00 ? 56  ALA A C    5  
ATOM   5421  O  O    . ALA A 1 56 ? 12.860  2.557   -2.338  1.00 0.00 ? 56  ALA A O    5  
ATOM   5422  C  CB   . ALA A 1 56 ? 13.441  5.698   -1.639  1.00 0.00 ? 56  ALA A CB   5  
ATOM   5423  H  H    . ALA A 1 56 ? 12.091  6.520   -3.647  1.00 0.00 ? 56  ALA A H    5  
ATOM   5424  H  HA   . ALA A 1 56 ? 14.133  4.541   -3.278  1.00 0.00 ? 56  ALA A HA   5  
ATOM   5425  H  HB1  . ALA A 1 56 ? 12.589  5.626   -0.978  1.00 0.00 ? 56  ALA A HB1  5  
ATOM   5426  H  HB2  . ALA A 1 56 ? 14.320  5.323   -1.137  1.00 0.00 ? 56  ALA A HB2  5  
ATOM   5427  H  HB3  . ALA A 1 56 ? 13.596  6.730   -1.916  1.00 0.00 ? 56  ALA A HB3  5  
ATOM   5428  N  N    . HIS A 1 57 ? 11.019  3.840   -2.506  1.00 0.00 ? 57  HIS A N    5  
ATOM   5429  C  CA   . HIS A 1 57 ? 10.099  2.752   -2.193  1.00 0.00 ? 57  HIS A CA   5  
ATOM   5430  C  C    . HIS A 1 57 ? 10.344  1.555   -3.107  1.00 0.00 ? 57  HIS A C    5  
ATOM   5431  O  O    . HIS A 1 57 ? 10.254  0.405   -2.676  1.00 0.00 ? 57  HIS A O    5  
ATOM   5432  C  CB   . HIS A 1 57 ? 8.651   3.226   -2.330  1.00 0.00 ? 57  HIS A CB   5  
ATOM   5433  C  CG   . HIS A 1 57 ? 7.693   2.128   -2.675  1.00 0.00 ? 57  HIS A CG   5  
ATOM   5434  N  ND1  . HIS A 1 57 ? 7.413   1.078   -1.826  1.00 0.00 ? 57  HIS A ND1  5  
ATOM   5435  C  CD2  . HIS A 1 57 ? 6.946   1.922   -3.785  1.00 0.00 ? 57  HIS A CD2  5  
ATOM   5436  C  CE1  . HIS A 1 57 ? 6.536   0.273   -2.399  1.00 0.00 ? 57  HIS A CE1  5  
ATOM   5437  N  NE2  . HIS A 1 57 ? 6.236   0.762   -3.589  1.00 0.00 ? 57  HIS A NE2  5  
ATOM   5438  H  H    . HIS A 1 57 ? 10.659  4.734   -2.686  1.00 0.00 ? 57  HIS A H    5  
ATOM   5439  H  HA   . HIS A 1 57 ? 10.275  2.452   -1.172  1.00 0.00 ? 57  HIS A HA   5  
ATOM   5440  H  HB2  . HIS A 1 57 ? 8.333   3.662   -1.395  1.00 0.00 ? 57  HIS A HB2  5  
ATOM   5441  H  HB3  . HIS A 1 57 ? 8.596   3.973   -3.108  1.00 0.00 ? 57  HIS A HB3  5  
ATOM   5442  H  HD1  . HIS A 1 57 ? 7.800   0.943   -0.937  1.00 0.00 ? 57  HIS A HD1  5  
ATOM   5443  H  HD2  . HIS A 1 57 ? 6.914   2.551   -4.663  1.00 0.00 ? 57  HIS A HD2  5  
ATOM   5444  H  HE1  . HIS A 1 57 ? 6.133   -0.632  -1.969  1.00 0.00 ? 57  HIS A HE1  5  
ATOM   5445  N  N    . ARG A 1 58 ? 10.651  1.833   -4.369  1.00 0.00 ? 58  ARG A N    5  
ATOM   5446  C  CA   . ARG A 1 58 ? 10.907  0.779   -5.344  1.00 0.00 ? 58  ARG A CA   5  
ATOM   5447  C  C    . ARG A 1 58 ? 12.187  0.022   -5.003  1.00 0.00 ? 58  ARG A C    5  
ATOM   5448  O  O    . ARG A 1 58 ? 12.390  -1.106  -5.450  1.00 0.00 ? 58  ARG A O    5  
ATOM   5449  C  CB   . ARG A 1 58 ? 11.010  1.370   -6.751  1.00 0.00 ? 58  ARG A CB   5  
ATOM   5450  C  CG   . ARG A 1 58 ? 9.767   2.130   -7.185  1.00 0.00 ? 58  ARG A CG   5  
ATOM   5451  C  CD   . ARG A 1 58 ? 10.115  3.281   -8.116  1.00 0.00 ? 58  ARG A CD   5  
ATOM   5452  N  NE   . ARG A 1 58 ? 10.857  2.830   -9.290  1.00 0.00 ? 58  ARG A NE   5  
ATOM   5453  C  CZ   . ARG A 1 58 ? 11.100  3.599   -10.346 1.00 0.00 ? 58  ARG A CZ   5  
ATOM   5454  N  NH1  . ARG A 1 58 ? 10.662  4.850   -10.374 1.00 0.00 ? 58  ARG A NH1  5  
ATOM   5455  N  NH2  . ARG A 1 58 ? 11.783  3.116   -11.376 1.00 0.00 ? 58  ARG A NH2  5  
ATOM   5456  H  H    . ARG A 1 58 ? 10.708  2.770   -4.653  1.00 0.00 ? 58  ARG A H    5  
ATOM   5457  H  HA   . ARG A 1 58 ? 10.076  0.090   -5.312  1.00 0.00 ? 58  ARG A HA   5  
ATOM   5458  H  HB2  . ARG A 1 58 ? 11.849  2.049   -6.783  1.00 0.00 ? 58  ARG A HB2  5  
ATOM   5459  H  HB3  . ARG A 1 58 ? 11.178  0.568   -7.453  1.00 0.00 ? 58  ARG A HB3  5  
ATOM   5460  H  HG2  . ARG A 1 58 ? 9.104   1.452   -7.701  1.00 0.00 ? 58  ARG A HG2  5  
ATOM   5461  H  HG3  . ARG A 1 58 ? 9.273   2.523   -6.309  1.00 0.00 ? 58  ARG A HG3  5  
ATOM   5462  H  HD2  . ARG A 1 58 ? 9.199   3.753   -8.440  1.00 0.00 ? 58  ARG A HD2  5  
ATOM   5463  H  HD3  . ARG A 1 58 ? 10.716  3.996   -7.574  1.00 0.00 ? 58  ARG A HD3  5  
ATOM   5464  H  HE   . ARG A 1 58 ? 11.190  1.909   -9.290  1.00 0.00 ? 58  ARG A HE   5  
ATOM   5465  H  HH11 . ARG A 1 58 ? 10.148  5.216   -9.599  1.00 0.00 ? 58  ARG A HH11 5  
ATOM   5466  H  HH12 . ARG A 1 58 ? 10.848  5.427   -11.170 1.00 0.00 ? 58  ARG A HH12 5  
ATOM   5467  H  HH21 . ARG A 1 58 ? 12.115  2.173   -11.358 1.00 0.00 ? 58  ARG A HH21 5  
ATOM   5468  H  HH22 . ARG A 1 58 ? 11.965  3.695   -12.170 1.00 0.00 ? 58  ARG A HH22 5  
ATOM   5469  N  N    . SER A 1 59 ? 13.048  0.653   -4.210  1.00 0.00 ? 59  SER A N    5  
ATOM   5470  C  CA   . SER A 1 59 ? 14.310  0.041   -3.813  1.00 0.00 ? 59  SER A CA   5  
ATOM   5471  C  C    . SER A 1 59 ? 14.161  -0.705  -2.490  1.00 0.00 ? 59  SER A C    5  
ATOM   5472  O  O    . SER A 1 59 ? 15.097  -1.350  -2.018  1.00 0.00 ? 59  SER A O    5  
ATOM   5473  C  CB   . SER A 1 59 ? 15.401  1.107   -3.689  1.00 0.00 ? 59  SER A CB   5  
ATOM   5474  O  OG   . SER A 1 59 ? 16.689  0.541   -3.862  1.00 0.00 ? 59  SER A OG   5  
ATOM   5475  H  H    . SER A 1 59 ? 12.829  1.552   -3.886  1.00 0.00 ? 59  SER A H    5  
ATOM   5476  H  HA   . SER A 1 59 ? 14.593  -0.664  -4.580  1.00 0.00 ? 59  SER A HA   5  
ATOM   5477  H  HB2  . SER A 1 59 ? 15.249  1.863   -4.444  1.00 0.00 ? 59  SER A HB2  5  
ATOM   5478  H  HB3  . SER A 1 59 ? 15.348  1.560   -2.710  1.00 0.00 ? 59  SER A HB3  5  
ATOM   5479  H  HG   . SER A 1 59 ? 17.281  0.880   -3.187  1.00 0.00 ? 59  SER A HG   5  
ATOM   5480  N  N    . LYS A 1 60 ? 12.975  -0.613  -1.898  1.00 0.00 ? 60  LYS A N    5  
ATOM   5481  C  CA   . LYS A 1 60 ? 12.699  -1.279  -0.630  1.00 0.00 ? 60  LYS A CA   5  
ATOM   5482  C  C    . LYS A 1 60 ? 11.582  -2.306  -0.788  1.00 0.00 ? 60  LYS A C    5  
ATOM   5483  O  O    . LYS A 1 60 ? 11.558  -3.322  -0.092  1.00 0.00 ? 60  LYS A O    5  
ATOM   5484  C  CB   . LYS A 1 60 ? 12.315  -0.252  0.437   1.00 0.00 ? 60  LYS A CB   5  
ATOM   5485  C  CG   . LYS A 1 60 ? 13.342  0.852   0.616   1.00 0.00 ? 60  LYS A CG   5  
ATOM   5486  C  CD   . LYS A 1 60 ? 14.680  0.299   1.079   1.00 0.00 ? 60  LYS A CD   5  
ATOM   5487  C  CE   . LYS A 1 60 ? 15.444  1.316   1.914   1.00 0.00 ? 60  LYS A CE   5  
ATOM   5488  N  NZ   . LYS A 1 60 ? 14.920  1.398   3.305   1.00 0.00 ? 60  LYS A NZ   5  
ATOM   5489  H  H    . LYS A 1 60 ? 12.268  -0.084  -2.324  1.00 0.00 ? 60  LYS A H    5  
ATOM   5490  H  HA   . LYS A 1 60 ? 13.599  -1.788  -0.320  1.00 0.00 ? 60  LYS A HA   5  
ATOM   5491  H  HB2  . LYS A 1 60 ? 11.374  0.202   0.160   1.00 0.00 ? 60  LYS A HB2  5  
ATOM   5492  H  HB3  . LYS A 1 60 ? 12.195  -0.760  1.382   1.00 0.00 ? 60  LYS A HB3  5  
ATOM   5493  H  HG2  . LYS A 1 60 ? 13.482  1.359   -0.327  1.00 0.00 ? 60  LYS A HG2  5  
ATOM   5494  H  HG3  . LYS A 1 60 ? 12.978  1.554   1.353   1.00 0.00 ? 60  LYS A HG3  5  
ATOM   5495  H  HD2  . LYS A 1 60 ? 14.507  -0.583  1.677   1.00 0.00 ? 60  LYS A HD2  5  
ATOM   5496  H  HD3  . LYS A 1 60 ? 15.272  0.039   0.213   1.00 0.00 ? 60  LYS A HD3  5  
ATOM   5497  H  HE2  . LYS A 1 60 ? 16.483  1.026   1.946   1.00 0.00 ? 60  LYS A HE2  5  
ATOM   5498  H  HE3  . LYS A 1 60 ? 15.355  2.285   1.446   1.00 0.00 ? 60  LYS A HE3  5  
ATOM   5499  H  HZ1  . LYS A 1 60 ? 15.678  1.688   3.956   1.00 0.00 ? 60  LYS A HZ1  5  
ATOM   5500  H  HZ2  . LYS A 1 60 ? 14.557  0.471   3.606   1.00 0.00 ? 60  LYS A HZ2  5  
ATOM   5501  H  HZ3  . LYS A 1 60 ? 14.148  2.093   3.356   1.00 0.00 ? 60  LYS A HZ3  5  
ATOM   5502  N  N    . SER A 1 61 ? 10.661  -2.036  -1.707  1.00 0.00 ? 61  SER A N    5  
ATOM   5503  C  CA   . SER A 1 61 ? 9.541   -2.936  -1.954  1.00 0.00 ? 61  SER A CA   5  
ATOM   5504  C  C    . SER A 1 61 ? 9.648   -3.571  -3.337  1.00 0.00 ? 61  SER A C    5  
ATOM   5505  O  O    . SER A 1 61 ? 9.177   -4.687  -3.559  1.00 0.00 ? 61  SER A O    5  
ATOM   5506  C  CB   . SER A 1 61 ? 8.216   -2.182  -1.828  1.00 0.00 ? 61  SER A CB   5  
ATOM   5507  O  OG   . SER A 1 61 ? 7.745   -2.197  -0.492  1.00 0.00 ? 61  SER A OG   5  
ATOM   5508  H  H    . SER A 1 61 ? 10.736  -1.210  -2.230  1.00 0.00 ? 61  SER A H    5  
ATOM   5509  H  HA   . SER A 1 61 ? 9.572   -3.717  -1.208  1.00 0.00 ? 61  SER A HA   5  
ATOM   5510  H  HB2  . SER A 1 61 ? 8.358   -1.157  -2.135  1.00 0.00 ? 61  SER A HB2  5  
ATOM   5511  H  HB3  . SER A 1 61 ? 7.477   -2.649  -2.463  1.00 0.00 ? 61  SER A HB3  5  
ATOM   5512  H  HG   . SER A 1 61 ? 8.053   -1.411  -0.034  1.00 0.00 ? 61  SER A HG   5  
ATOM   5513  N  N    . HIS A 1 62 ? 10.272  -2.852  -4.264  1.00 0.00 ? 62  HIS A N    5  
ATOM   5514  C  CA   . HIS A 1 62 ? 10.443  -3.344  -5.626  1.00 0.00 ? 62  HIS A CA   5  
ATOM   5515  C  C    . HIS A 1 62 ? 11.922  -3.491  -5.970  1.00 0.00 ? 62  HIS A C    5  
ATOM   5516  O  O    . HIS A 1 62 ? 12.335  -3.347  -7.121  1.00 0.00 ? 62  HIS A O    5  
ATOM   5517  C  CB   . HIS A 1 62 ? 9.768   -2.400  -6.621  1.00 0.00 ? 62  HIS A CB   5  
ATOM   5518  C  CG   . HIS A 1 62 ? 8.292   -2.260  -6.408  1.00 0.00 ? 62  HIS A CG   5  
ATOM   5519  N  ND1  . HIS A 1 62 ? 7.407   -3.307  -6.560  1.00 0.00 ? 62  HIS A ND1  5  
ATOM   5520  C  CD2  . HIS A 1 62 ? 7.546   -1.189  -6.050  1.00 0.00 ? 62  HIS A CD2  5  
ATOM   5521  C  CE1  . HIS A 1 62 ? 6.181   -2.886  -6.306  1.00 0.00 ? 62  HIS A CE1  5  
ATOM   5522  N  NE2  . HIS A 1 62 ? 6.238   -1.603  -5.994  1.00 0.00 ? 62  HIS A NE2  5  
ATOM   5523  H  H    . HIS A 1 62 ? 10.626  -1.970  -4.027  1.00 0.00 ? 62  HIS A H    5  
ATOM   5524  H  HA   . HIS A 1 62 ? 9.974   -4.314  -5.690  1.00 0.00 ? 62  HIS A HA   5  
ATOM   5525  H  HB2  . HIS A 1 62 ? 10.209  -1.418  -6.532  1.00 0.00 ? 62  HIS A HB2  5  
ATOM   5526  H  HB3  . HIS A 1 62 ? 9.925   -2.770  -7.624  1.00 0.00 ? 62  HIS A HB3  5  
ATOM   5527  H  HD1  . HIS A 1 62 ? 7.643   -4.223  -6.816  1.00 0.00 ? 62  HIS A HD1  5  
ATOM   5528  H  HD2  . HIS A 1 62 ? 7.911   -0.192  -5.846  1.00 0.00 ? 62  HIS A HD2  5  
ATOM   5529  H  HE1  . HIS A 1 62 ? 5.285   -3.486  -6.347  1.00 0.00 ? 62  HIS A HE1  5  
ATOM   5530  N  N    . PRO A 1 63 ? 12.741  -3.782  -4.948  1.00 0.00 ? 63  PRO A N    5  
ATOM   5531  C  CA   . PRO A 1 63 ? 14.187  -3.954  -5.118  1.00 0.00 ? 63  PRO A CA   5  
ATOM   5532  C  C    . PRO A 1 63 ? 14.534  -5.224  -5.887  1.00 0.00 ? 63  PRO A C    5  
ATOM   5533  O  O    . PRO A 1 63 ? 15.681  -5.426  -6.285  1.00 0.00 ? 63  PRO A O    5  
ATOM   5534  C  CB   . PRO A 1 63 ? 14.705  -4.042  -3.679  1.00 0.00 ? 63  PRO A CB   5  
ATOM   5535  C  CG   . PRO A 1 63 ? 13.543  -4.537  -2.889  1.00 0.00 ? 63  PRO A CG   5  
ATOM   5536  C  CD   . PRO A 1 63 ? 12.319  -3.968  -3.550  1.00 0.00 ? 63  PRO A CD   5  
ATOM   5537  H  HA   . PRO A 1 63 ? 14.633  -3.103  -5.611  1.00 0.00 ? 63  PRO A HA   5  
ATOM   5538  H  HB2  . PRO A 1 63 ? 15.537  -4.731  -3.635  1.00 0.00 ? 63  PRO A HB2  5  
ATOM   5539  H  HB3  . PRO A 1 63 ? 15.021  -3.065  -3.346  1.00 0.00 ? 63  PRO A HB3  5  
ATOM   5540  H  HG2  . PRO A 1 63 ? 13.516  -5.616  -2.914  1.00 0.00 ? 63  PRO A HG2  5  
ATOM   5541  H  HG3  . PRO A 1 63 ? 13.616  -4.186  -1.870  1.00 0.00 ? 63  PRO A HG3  5  
ATOM   5542  H  HD2  . PRO A 1 63 ? 11.496  -4.664  -3.485  1.00 0.00 ? 63  PRO A HD2  5  
ATOM   5543  H  HD3  . PRO A 1 63 ? 12.052  -3.023  -3.100  1.00 0.00 ? 63  PRO A HD3  5  
ATOM   5544  N  N    . ALA A 1 64 ? 13.536  -6.077  -6.093  1.00 0.00 ? 64  ALA A N    5  
ATOM   5545  C  CA   . ALA A 1 64 ? 13.736  -7.326  -6.817  1.00 0.00 ? 64  ALA A CA   5  
ATOM   5546  C  C    . ALA A 1 64 ? 13.378  -7.170  -8.291  1.00 0.00 ? 64  ALA A C    5  
ATOM   5547  O  O    . ALA A 1 64 ? 13.720  -8.017  -9.117  1.00 0.00 ? 64  ALA A O    5  
ATOM   5548  C  CB   . ALA A 1 64 ? 12.911  -8.439  -6.187  1.00 0.00 ? 64  ALA A CB   5  
ATOM   5549  H  H    . ALA A 1 64 ? 12.644  -5.860  -5.751  1.00 0.00 ? 64  ALA A H    5  
ATOM   5550  H  HA   . ALA A 1 64 ? 14.779  -7.595  -6.736  1.00 0.00 ? 64  ALA A HA   5  
ATOM   5551  H  HB1  . ALA A 1 64 ? 12.861  -9.277  -6.867  1.00 0.00 ? 64  ALA A HB1  5  
ATOM   5552  H  HB2  . ALA A 1 64 ? 13.374  -8.751  -5.263  1.00 0.00 ? 64  ALA A HB2  5  
ATOM   5553  H  HB3  . ALA A 1 64 ? 11.914  -8.078  -5.986  1.00 0.00 ? 64  ALA A HB3  5  
ATOM   5554  N  N    . LEU A 1 65 ? 12.688  -6.082  -8.615  1.00 0.00 ? 65  LEU A N    5  
ATOM   5555  C  CA   . LEU A 1 65 ? 12.283  -5.814  -9.991  1.00 0.00 ? 65  LEU A CA   5  
ATOM   5556  C  C    . LEU A 1 65 ? 13.311  -4.939  -10.700 1.00 0.00 ? 65  LEU A C    5  
ATOM   5557  O  O    . LEU A 1 65 ? 13.833  -5.306  -11.754 1.00 0.00 ? 65  LEU A O    5  
ATOM   5558  C  CB   . LEU A 1 65 ? 10.913  -5.135  -10.017 1.00 0.00 ? 65  LEU A CB   5  
ATOM   5559  C  CG   . LEU A 1 65 ? 9.757   -5.932  -9.413  1.00 0.00 ? 65  LEU A CG   5  
ATOM   5560  C  CD1  . LEU A 1 65 ? 8.530   -5.049  -9.244  1.00 0.00 ? 65  LEU A CD1  5  
ATOM   5561  C  CD2  . LEU A 1 65 ? 9.431   -7.140  -10.280 1.00 0.00 ? 65  LEU A CD2  5  
ATOM   5562  H  H    . LEU A 1 65 ? 12.445  -5.443  -7.913  1.00 0.00 ? 65  LEU A H    5  
ATOM   5563  H  HA   . LEU A 1 65 ? 12.217  -6.761  -10.506 1.00 0.00 ? 65  LEU A HA   5  
ATOM   5564  H  HB2  . LEU A 1 65 ? 10.994  -4.206  -9.472  1.00 0.00 ? 65  LEU A HB2  5  
ATOM   5565  H  HB3  . LEU A 1 65 ? 10.668  -4.925  -11.048 1.00 0.00 ? 65  LEU A HB3  5  
ATOM   5566  H  HG   . LEU A 1 65 ? 10.047  -6.290  -8.435  1.00 0.00 ? 65  LEU A HG   5  
ATOM   5567  H  HD11 . LEU A 1 65 ? 8.754   -4.250  -8.554  1.00 0.00 ? 65  LEU A HD11 5  
ATOM   5568  H  HD12 . LEU A 1 65 ? 7.712   -5.640  -8.858  1.00 0.00 ? 65  LEU A HD12 5  
ATOM   5569  H  HD13 . LEU A 1 65 ? 8.252   -4.632  -10.201 1.00 0.00 ? 65  LEU A HD13 5  
ATOM   5570  H  HD21 . LEU A 1 65 ? 10.251  -7.842  -10.241 1.00 0.00 ? 65  LEU A HD21 5  
ATOM   5571  H  HD22 . LEU A 1 65 ? 9.280   -6.820  -11.301 1.00 0.00 ? 65  LEU A HD22 5  
ATOM   5572  H  HD23 . LEU A 1 65 ? 8.533   -7.614  -9.914  1.00 0.00 ? 65  LEU A HD23 5  
ATOM   5573  N  N    . LEU A 1 66 ? 13.599  -3.781  -10.116 1.00 0.00 ? 66  LEU A N    5  
ATOM   5574  C  CA   . LEU A 1 66 ? 14.567  -2.854  -10.691 1.00 0.00 ? 66  LEU A CA   5  
ATOM   5575  C  C    . LEU A 1 66 ? 15.735  -3.606  -11.321 1.00 0.00 ? 66  LEU A C    5  
ATOM   5576  O  O    . LEU A 1 66 ? 16.196  -3.260  -12.409 1.00 0.00 ? 66  LEU A O    5  
ATOM   5577  C  CB   . LEU A 1 66 ? 15.083  -1.894  -9.617  1.00 0.00 ? 66  LEU A CB   5  
ATOM   5578  C  CG   . LEU A 1 66 ? 14.018  -1.119  -8.841  1.00 0.00 ? 66  LEU A CG   5  
ATOM   5579  C  CD1  . LEU A 1 66 ? 14.502  -0.813  -7.432  1.00 0.00 ? 66  LEU A CD1  5  
ATOM   5580  C  CD2  . LEU A 1 66 ? 13.653  0.164   -9.572  1.00 0.00 ? 66  LEU A CD2  5  
ATOM   5581  H  H    . LEU A 1 66 ? 13.151  -3.544  -9.278  1.00 0.00 ? 66  LEU A H    5  
ATOM   5582  H  HA   . LEU A 1 66 ? 14.065  -2.285  -11.459 1.00 0.00 ? 66  LEU A HA   5  
ATOM   5583  H  HB2  . LEU A 1 66 ? 15.656  -2.470  -8.907  1.00 0.00 ? 66  LEU A HB2  5  
ATOM   5584  H  HB3  . LEU A 1 66 ? 15.730  -1.175  -10.101 1.00 0.00 ? 66  LEU A HB3  5  
ATOM   5585  H  HG   . LEU A 1 66 ? 13.126  -1.726  -8.762  1.00 0.00 ? 66  LEU A HG   5  
ATOM   5586  H  HD11 . LEU A 1 66 ? 14.100  -1.544  -6.747  1.00 0.00 ? 66  LEU A HD11 5  
ATOM   5587  H  HD12 . LEU A 1 66 ? 14.168  0.173   -7.144  1.00 0.00 ? 66  LEU A HD12 5  
ATOM   5588  H  HD13 . LEU A 1 66 ? 15.581  -0.849  -7.406  1.00 0.00 ? 66  LEU A HD13 5  
ATOM   5589  H  HD21 . LEU A 1 66 ? 12.638  0.094   -9.936  1.00 0.00 ? 66  LEU A HD21 5  
ATOM   5590  H  HD22 . LEU A 1 66 ? 14.324  0.306   -10.407 1.00 0.00 ? 66  LEU A HD22 5  
ATOM   5591  H  HD23 . LEU A 1 66 ? 13.736  1.001   -8.895  1.00 0.00 ? 66  LEU A HD23 5  
ATOM   5592  N  N    . LEU A 1 67 ? 16.208  -4.638  -10.630 1.00 0.00 ? 67  LEU A N    5  
ATOM   5593  C  CA   . LEU A 1 67 ? 17.321  -5.442  -11.123 1.00 0.00 ? 67  LEU A CA   5  
ATOM   5594  C  C    . LEU A 1 67 ? 16.940  -6.170  -12.408 1.00 0.00 ? 67  LEU A C    5  
ATOM   5595  O  O    . LEU A 1 67 ? 15.773  -6.494  -12.628 1.00 0.00 ? 67  LEU A O    5  
ATOM   5596  C  CB   . LEU A 1 67 ? 17.755  -6.454  -10.060 1.00 0.00 ? 67  LEU A CB   5  
ATOM   5597  C  CG   . LEU A 1 67 ? 18.632  -7.606  -10.550 1.00 0.00 ? 67  LEU A CG   5  
ATOM   5598  C  CD1  . LEU A 1 67 ? 20.100  -7.211  -10.516 1.00 0.00 ? 67  LEU A CD1  5  
ATOM   5599  C  CD2  . LEU A 1 67 ? 18.394  -8.852  -9.708  1.00 0.00 ? 67  LEU A CD2  5  
ATOM   5600  H  H    . LEU A 1 67 ? 15.800  -4.865  -9.769  1.00 0.00 ? 67  LEU A H    5  
ATOM   5601  H  HA   . LEU A 1 67 ? 18.144  -4.776  -11.331 1.00 0.00 ? 67  LEU A HA   5  
ATOM   5602  H  HB2  . LEU A 1 67 ? 18.304  -5.920  -9.301  1.00 0.00 ? 67  LEU A HB2  5  
ATOM   5603  H  HB3  . LEU A 1 67 ? 16.861  -6.878  -9.625  1.00 0.00 ? 67  LEU A HB3  5  
ATOM   5604  H  HG   . LEU A 1 67 ? 18.372  -7.839  -11.573 1.00 0.00 ? 67  LEU A HG   5  
ATOM   5605  H  HD11 . LEU A 1 67 ? 20.694  -7.993  -10.965 1.00 0.00 ? 67  LEU A HD11 5  
ATOM   5606  H  HD12 . LEU A 1 67 ? 20.410  -7.066  -9.492  1.00 0.00 ? 67  LEU A HD12 5  
ATOM   5607  H  HD13 . LEU A 1 67 ? 20.238  -6.293  -11.067 1.00 0.00 ? 67  LEU A HD13 5  
ATOM   5608  H  HD21 . LEU A 1 67 ? 19.297  -9.102  -9.172  1.00 0.00 ? 67  LEU A HD21 5  
ATOM   5609  H  HD22 . LEU A 1 67 ? 18.118  -9.674  -10.353 1.00 0.00 ? 67  LEU A HD22 5  
ATOM   5610  H  HD23 . LEU A 1 67 ? 17.597  -8.664  -9.004  1.00 0.00 ? 67  LEU A HD23 5  
ATOM   5611  N  N    . ALA A 1 68 ? 17.933  -6.425  -13.254 1.00 0.00 ? 68  ALA A N    5  
ATOM   5612  C  CA   . ALA A 1 68 ? 17.703  -7.118  -14.516 1.00 0.00 ? 68  ALA A CA   5  
ATOM   5613  C  C    . ALA A 1 68 ? 17.052  -8.477  -14.284 1.00 0.00 ? 68  ALA A C    5  
ATOM   5614  O  O    . ALA A 1 68 ? 17.346  -9.176  -13.314 1.00 0.00 ? 68  ALA A O    5  
ATOM   5615  C  CB   . ALA A 1 68 ? 19.011  -7.279  -15.275 1.00 0.00 ? 68  ALA A CB   5  
ATOM   5616  H  H    . ALA A 1 68 ? 18.842  -6.141  -13.024 1.00 0.00 ? 68  ALA A H    5  
ATOM   5617  H  HA   . ALA A 1 68 ? 17.040  -6.510  -15.115 1.00 0.00 ? 68  ALA A HA   5  
ATOM   5618  H  HB1  . ALA A 1 68 ? 19.032  -8.248  -15.754 1.00 0.00 ? 68  ALA A HB1  5  
ATOM   5619  H  HB2  . ALA A 1 68 ? 19.090  -6.506  -16.024 1.00 0.00 ? 68  ALA A HB2  5  
ATOM   5620  H  HB3  . ALA A 1 68 ? 19.839  -7.200  -14.587 1.00 0.00 ? 68  ALA A HB3  5  
ATOM   5621  N  N    . PRO A 1 69 ? 16.146  -8.863  -15.195 1.00 0.00 ? 69  PRO A N    5  
ATOM   5622  C  CA   . PRO A 1 69 ? 15.434  -10.142 -15.111 1.00 0.00 ? 69  PRO A CA   5  
ATOM   5623  C  C    . PRO A 1 69 ? 16.350  -11.333 -15.374 1.00 0.00 ? 69  PRO A C    5  
ATOM   5624  O  O    . PRO A 1 69 ? 17.285  -11.244 -16.169 1.00 0.00 ? 69  PRO A O    5  
ATOM   5625  C  CB   . PRO A 1 69 ? 14.374  -10.030 -16.209 1.00 0.00 ? 69  PRO A CB   5  
ATOM   5626  C  CG   . PRO A 1 69 ? 14.940  -9.058  -17.186 1.00 0.00 ? 69  PRO A CG   5  
ATOM   5627  C  CD   . PRO A 1 69 ? 15.746  -8.080  -16.377 1.00 0.00 ? 69  PRO A CD   5  
ATOM   5628  H  HA   . PRO A 1 69 ? 14.951  -10.265 -14.153 1.00 0.00 ? 69  PRO A HA   5  
ATOM   5629  H  HB2  . PRO A 1 69 ? 14.216  -10.999 -16.661 1.00 0.00 ? 69  PRO A HB2  5  
ATOM   5630  H  HB3  . PRO A 1 69 ? 13.448  -9.670  -15.785 1.00 0.00 ? 69  PRO A HB3  5  
ATOM   5631  H  HG2  . PRO A 1 69 ? 15.574  -9.574  -17.891 1.00 0.00 ? 69  PRO A HG2  5  
ATOM   5632  H  HG3  . PRO A 1 69 ? 14.140  -8.548  -17.701 1.00 0.00 ? 69  PRO A HG3  5  
ATOM   5633  H  HD2  . PRO A 1 69 ? 16.612  -7.753  -16.933 1.00 0.00 ? 69  PRO A HD2  5  
ATOM   5634  H  HD3  . PRO A 1 69 ? 15.138  -7.235  -16.091 1.00 0.00 ? 69  PRO A HD3  5  
ATOM   5635  N  N    . GLN A 1 70 ? 16.074  -12.445 -14.701 1.00 0.00 ? 70  GLN A N    5  
ATOM   5636  C  CA   . GLN A 1 70 ? 16.874  -13.654 -14.863 1.00 0.00 ? 70  GLN A CA   5  
ATOM   5637  C  C    . GLN A 1 70 ? 16.087  -14.732 -15.601 1.00 0.00 ? 70  GLN A C    5  
ATOM   5638  O  O    . GLN A 1 70 ? 14.955  -15.047 -15.235 1.00 0.00 ? 70  GLN A O    5  
ATOM   5639  C  CB   . GLN A 1 70 ? 17.325  -14.178 -13.499 1.00 0.00 ? 70  GLN A CB   5  
ATOM   5640  C  CG   . GLN A 1 70 ? 18.442  -15.207 -13.582 1.00 0.00 ? 70  GLN A CG   5  
ATOM   5641  C  CD   . GLN A 1 70 ? 19.152  -15.406 -12.258 1.00 0.00 ? 70  GLN A CD   5  
ATOM   5642  O  OE1  . GLN A 1 70 ? 20.170  -14.770 -11.984 1.00 0.00 ? 70  GLN A OE1  5  
ATOM   5643  N  NE2  . GLN A 1 70 ? 18.616  -16.292 -11.426 1.00 0.00 ? 70  GLN A NE2  5  
ATOM   5644  H  H    . GLN A 1 70 ? 15.315  -12.454 -14.082 1.00 0.00 ? 70  GLN A H    5  
ATOM   5645  H  HA   . GLN A 1 70 ? 17.745  -13.398 -15.447 1.00 0.00 ? 70  GLN A HA   5  
ATOM   5646  H  HB2  . GLN A 1 70 ? 17.674  -13.347 -12.905 1.00 0.00 ? 70  GLN A HB2  5  
ATOM   5647  H  HB3  . GLN A 1 70 ? 16.481  -14.635 -13.005 1.00 0.00 ? 70  GLN A HB3  5  
ATOM   5648  H  HG2  . GLN A 1 70 ? 18.021  -16.151 -13.893 1.00 0.00 ? 70  GLN A HG2  5  
ATOM   5649  H  HG3  . GLN A 1 70 ? 19.164  -14.877 -14.315 1.00 0.00 ? 70  GLN A HG3  5  
ATOM   5650  H  HE21 . GLN A 1 70 ? 17.804  -16.762 -11.712 1.00 0.00 ? 70  GLN A HE21 5  
ATOM   5651  H  HE22 . GLN A 1 70 ? 19.055  -16.441 -10.564 1.00 0.00 ? 70  GLN A HE22 5  
ATOM   5652  N  N    . GLU A 1 71 ? 16.695  -15.294 -16.641 1.00 0.00 ? 71  GLU A N    5  
ATOM   5653  C  CA   . GLU A 1 71 ? 16.050  -16.337 -17.430 1.00 0.00 ? 71  GLU A CA   5  
ATOM   5654  C  C    . GLU A 1 71 ? 15.674  -17.528 -16.554 1.00 0.00 ? 71  GLU A C    5  
ATOM   5655  O  O    . GLU A 1 71 ? 16.542  -18.248 -16.059 1.00 0.00 ? 71  GLU A O    5  
ATOM   5656  C  CB   . GLU A 1 71 ? 16.971  -16.794 -18.563 1.00 0.00 ? 71  GLU A CB   5  
ATOM   5657  C  CG   . GLU A 1 71 ? 18.280  -17.394 -18.078 1.00 0.00 ? 71  GLU A CG   5  
ATOM   5658  C  CD   . GLU A 1 71 ? 19.409  -17.217 -19.075 1.00 0.00 ? 71  GLU A CD   5  
ATOM   5659  O  OE1  . GLU A 1 71 ? 19.126  -17.183 -20.291 1.00 0.00 ? 71  GLU A OE1  5  
ATOM   5660  O  OE2  . GLU A 1 71 ? 20.574  -17.113 -18.640 1.00 0.00 ? 71  GLU A OE2  5  
ATOM   5661  H  H    . GLU A 1 71 ? 17.598  -15.001 -16.883 1.00 0.00 ? 71  GLU A H    5  
ATOM   5662  H  HA   . GLU A 1 71 ? 15.150  -15.921 -17.857 1.00 0.00 ? 71  GLU A HA   5  
ATOM   5663  H  HB2  . GLU A 1 71 ? 16.455  -17.537 -19.153 1.00 0.00 ? 71  GLU A HB2  5  
ATOM   5664  H  HB3  . GLU A 1 71 ? 17.200  -15.945 -19.189 1.00 0.00 ? 71  GLU A HB3  5  
ATOM   5665  H  HG2  . GLU A 1 71 ? 18.561  -16.914 -17.152 1.00 0.00 ? 71  GLU A HG2  5  
ATOM   5666  H  HG3  . GLU A 1 71 ? 18.135  -18.451 -17.904 1.00 0.00 ? 71  GLU A HG3  5  
ATOM   5667  N  N    . SER A 1 72 ? 14.373  -17.730 -16.365 1.00 0.00 ? 72  SER A N    5  
ATOM   5668  C  CA   . SER A 1 72 ? 13.881  -18.830 -15.545 1.00 0.00 ? 72  SER A CA   5  
ATOM   5669  C  C    . SER A 1 72 ? 12.496  -19.275 -16.007 1.00 0.00 ? 72  SER A C    5  
ATOM   5670  O  O    . SER A 1 72 ? 11.794  -18.538 -16.699 1.00 0.00 ? 72  SER A O    5  
ATOM   5671  C  CB   . SER A 1 72 ? 13.831  -18.415 -14.073 1.00 0.00 ? 72  SER A CB   5  
ATOM   5672  O  OG   . SER A 1 72 ? 13.765  -19.549 -13.226 1.00 0.00 ? 72  SER A OG   5  
ATOM   5673  H  H    . SER A 1 72 ? 13.730  -17.121 -16.786 1.00 0.00 ? 72  SER A H    5  
ATOM   5674  H  HA   . SER A 1 72 ? 14.567  -19.657 -15.654 1.00 0.00 ? 72  SER A HA   5  
ATOM   5675  H  HB2  . SER A 1 72 ? 14.719  -17.851 -13.831 1.00 0.00 ? 72  SER A HB2  5  
ATOM   5676  H  HB3  . SER A 1 72 ? 12.957  -17.803 -13.905 1.00 0.00 ? 72  SER A HB3  5  
ATOM   5677  H  HG   . SER A 1 72 ? 14.378  -20.218 -13.538 1.00 0.00 ? 72  SER A HG   5  
ATOM   5678  N  N    . SER A 1 73 ? 12.111  -20.486 -15.618 1.00 0.00 ? 73  SER A N    5  
ATOM   5679  C  CA   . SER A 1 73 ? 10.812  -21.032 -15.995 1.00 0.00 ? 73  SER A CA   5  
ATOM   5680  C  C    . SER A 1 73 ? 9.825   -20.935 -14.836 1.00 0.00 ? 73  SER A C    5  
ATOM   5681  O  O    . SER A 1 73 ? 9.966   -21.624 -13.826 1.00 0.00 ? 73  SER A O    5  
ATOM   5682  C  CB   . SER A 1 73 ? 10.956  -22.490 -16.436 1.00 0.00 ? 73  SER A CB   5  
ATOM   5683  O  OG   . SER A 1 73 ? 11.224  -23.333 -15.330 1.00 0.00 ? 73  SER A OG   5  
ATOM   5684  H  H    . SER A 1 73 ? 12.715  -21.026 -15.067 1.00 0.00 ? 73  SER A H    5  
ATOM   5685  H  HA   . SER A 1 73 ? 10.435  -20.450 -16.823 1.00 0.00 ? 73  SER A HA   5  
ATOM   5686  H  HB2  . SER A 1 73 ? 10.040  -22.813 -16.907 1.00 0.00 ? 73  SER A HB2  5  
ATOM   5687  H  HB3  . SER A 1 73 ? 11.771  -22.570 -17.141 1.00 0.00 ? 73  SER A HB3  5  
ATOM   5688  H  HG   . SER A 1 73 ? 11.564  -22.808 -14.601 1.00 0.00 ? 73  SER A HG   5  
ATOM   5689  N  N    . GLY A 1 74 ? 8.824   -20.074 -14.989 1.00 0.00 ? 74  GLY A N    5  
ATOM   5690  C  CA   . GLY A 1 74 ? 7.827   -19.901 -13.948 1.00 0.00 ? 74  GLY A CA   5  
ATOM   5691  C  C    . GLY A 1 74 ? 6.413   -19.909 -14.492 1.00 0.00 ? 74  GLY A C    5  
ATOM   5692  O  O    . GLY A 1 74 ? 6.008   -19.021 -15.243 1.00 0.00 ? 74  GLY A O    5  
ATOM   5693  H  H    . GLY A 1 74 ? 8.761   -19.551 -15.816 1.00 0.00 ? 74  GLY A H    5  
ATOM   5694  H  HA2  . GLY A 1 74 ? 7.931   -20.701 -13.230 1.00 0.00 ? 74  GLY A HA2  5  
ATOM   5695  H  HA3  . GLY A 1 74 ? 8.003   -18.959 -13.450 1.00 0.00 ? 74  GLY A HA3  5  
ATOM   5696  N  N    . PRO A 1 75 ? 5.634   -20.934 -14.113 1.00 0.00 ? 75  PRO A N    5  
ATOM   5697  C  CA   . PRO A 1 75 ? 4.245   -21.079 -14.557 1.00 0.00 ? 75  PRO A CA   5  
ATOM   5698  C  C    . PRO A 1 75 ? 3.327   -20.027 -13.945 1.00 0.00 ? 75  PRO A C    5  
ATOM   5699  O  O    . PRO A 1 75 ? 3.117   -20.003 -12.732 1.00 0.00 ? 75  PRO A O    5  
ATOM   5700  C  CB   . PRO A 1 75 ? 3.860   -22.477 -14.065 1.00 0.00 ? 75  PRO A CB   5  
ATOM   5701  C  CG   . PRO A 1 75 ? 4.759   -22.731 -12.905 1.00 0.00 ? 75  PRO A CG   5  
ATOM   5702  C  CD   . PRO A 1 75 ? 6.051   -22.028 -13.220 1.00 0.00 ? 75  PRO A CD   5  
ATOM   5703  H  HA   . PRO A 1 75 ? 4.167   -21.041 -15.634 1.00 0.00 ? 75  PRO A HA   5  
ATOM   5704  H  HB2  . PRO A 1 75 ? 2.820   -22.483 -13.769 1.00 0.00 ? 75  PRO A HB2  5  
ATOM   5705  H  HB3  . PRO A 1 75 ? 4.020   -23.197 -14.853 1.00 0.00 ? 75  PRO A HB3  5  
ATOM   5706  H  HG2  . PRO A 1 75 ? 4.321   -22.325 -12.005 1.00 0.00 ? 75  PRO A HG2  5  
ATOM   5707  H  HG3  . PRO A 1 75 ? 4.927   -23.792 -12.797 1.00 0.00 ? 75  PRO A HG3  5  
ATOM   5708  H  HD2  . PRO A 1 75 ? 6.499   -21.640 -12.317 1.00 0.00 ? 75  PRO A HD2  5  
ATOM   5709  H  HD3  . PRO A 1 75 ? 6.731   -22.698 -13.724 1.00 0.00 ? 75  PRO A HD3  5  
ATOM   5710  N  N    . SER A 1 76 ? 2.782   -19.159 -14.791 1.00 0.00 ? 76  SER A N    5  
ATOM   5711  C  CA   . SER A 1 76 ? 1.889   -18.102 -14.332 1.00 0.00 ? 76  SER A CA   5  
ATOM   5712  C  C    . SER A 1 76 ? 0.438   -18.571 -14.350 1.00 0.00 ? 76  SER A C    5  
ATOM   5713  O  O    . SER A 1 76 ? 0.002   -19.241 -15.287 1.00 0.00 ? 76  SER A O    5  
ATOM   5714  C  CB   . SER A 1 76 ? 2.045   -16.857 -15.207 1.00 0.00 ? 76  SER A CB   5  
ATOM   5715  O  OG   . SER A 1 76 ? 1.536   -17.082 -16.510 1.00 0.00 ? 76  SER A OG   5  
ATOM   5716  H  H    . SER A 1 76 ? 2.988   -19.230 -15.747 1.00 0.00 ? 76  SER A H    5  
ATOM   5717  H  HA   . SER A 1 76 ? 2.162   -17.854 -13.317 1.00 0.00 ? 76  SER A HA   5  
ATOM   5718  H  HB2  . SER A 1 76 ? 1.506   -16.036 -14.760 1.00 0.00 ? 76  SER A HB2  5  
ATOM   5719  H  HB3  . SER A 1 76 ? 3.093   -16.602 -15.282 1.00 0.00 ? 76  SER A HB3  5  
ATOM   5720  H  HG   . SER A 1 76 ? 0.963   -17.852 -16.501 1.00 0.00 ? 76  SER A HG   5  
ATOM   5721  N  N    . SER A 1 77 ? -0.306  -18.215 -13.308 1.00 0.00 ? 77  SER A N    5  
ATOM   5722  C  CA   . SER A 1 77 ? -1.708  -18.602 -13.201 1.00 0.00 ? 77  SER A CA   5  
ATOM   5723  C  C    . SER A 1 77 ? -2.484  -18.184 -14.446 1.00 0.00 ? 77  SER A C    5  
ATOM   5724  O  O    . SER A 1 77 ? -3.073  -19.017 -15.133 1.00 0.00 ? 77  SER A O    5  
ATOM   5725  C  CB   . SER A 1 77 ? -2.339  -17.972 -11.958 1.00 0.00 ? 77  SER A CB   5  
ATOM   5726  O  OG   . SER A 1 77 ? -3.389  -18.780 -11.454 1.00 0.00 ? 77  SER A OG   5  
ATOM   5727  H  H    . SER A 1 77 ? 0.099   -17.681 -12.592 1.00 0.00 ? 77  SER A H    5  
ATOM   5728  H  HA   . SER A 1 77 ? -1.749  -19.677 -13.109 1.00 0.00 ? 77  SER A HA   5  
ATOM   5729  H  HB2  . SER A 1 77 ? -1.587  -17.862 -11.191 1.00 0.00 ? 77  SER A HB2  5  
ATOM   5730  H  HB3  . SER A 1 77 ? -2.739  -17.001 -12.213 1.00 0.00 ? 77  SER A HB3  5  
ATOM   5731  H  HG   . SER A 1 77 ? -4.206  -18.275 -11.445 1.00 0.00 ? 77  SER A HG   5  
ATOM   5732  N  N    . GLY A 1 78 ? -2.478  -16.885 -14.732 1.00 0.00 ? 78  GLY A N    5  
ATOM   5733  C  CA   . GLY A 1 78 ? -3.184  -16.378 -15.894 1.00 0.00 ? 78  GLY A CA   5  
ATOM   5734  C  C    . GLY A 1 78 ? -2.660  -15.030 -16.347 1.00 0.00 ? 78  GLY A C    5  
ATOM   5735  O  O    . GLY A 1 78 ? -1.496  -14.723 -16.093 1.00 0.00 ? 78  GLY A O    5  
ATOM   5736  H  H    . GLY A 1 78 ? -1.990  -16.267 -14.148 1.00 0.00 ? 78  GLY A H    5  
ATOM   5737  H  HA2  . GLY A 1 78 ? -3.077  -17.085 -16.703 1.00 0.00 ? 78  GLY A HA2  5  
ATOM   5738  H  HA3  . GLY A 1 78 ? -4.231  -16.280 -15.650 1.00 0.00 ? 78  GLY A HA3  5  
HETATM 5739  ZN ZN   . ZN  B 2 .  ? -8.315  0.585   3.814   1.00 0.00 ? 201 ZN  A ZN   5  
HETATM 5740  ZN ZN   . ZN  C 2 .  ? 5.353   0.110   -5.309  1.00 0.00 ? 401 ZN  A ZN   5  
ATOM   5741  N  N    . GLY A 1 1  ? -19.128 -29.014 12.655  1.00 0.00 ? 1   GLY A N    6  
ATOM   5742  C  CA   . GLY A 1 1  ? -18.590 -27.697 12.369  1.00 0.00 ? 1   GLY A CA   6  
ATOM   5743  C  C    . GLY A 1 1  ? -19.663 -26.627 12.338  1.00 0.00 ? 1   GLY A C    6  
ATOM   5744  O  O    . GLY A 1 1  ? -20.692 -26.789 11.682  1.00 0.00 ? 1   GLY A O    6  
ATOM   5745  H  H1   . GLY A 1 1  ? -19.511 -29.553 11.931  1.00 0.00 ? 1   GLY A H1   6  
ATOM   5746  H  HA2  . GLY A 1 1  ? -17.866 -27.444 13.129  1.00 0.00 ? 1   GLY A HA2  6  
ATOM   5747  H  HA3  . GLY A 1 1  ? -18.096 -27.723 11.409  1.00 0.00 ? 1   GLY A HA3  6  
ATOM   5748  N  N    . SER A 1 2  ? -19.425 -25.531 13.051  1.00 0.00 ? 2   SER A N    6  
ATOM   5749  C  CA   . SER A 1 2  ? -20.382 -24.432 13.107  1.00 0.00 ? 2   SER A CA   6  
ATOM   5750  C  C    . SER A 1 2  ? -19.977 -23.310 12.157  1.00 0.00 ? 2   SER A C    6  
ATOM   5751  O  O    . SER A 1 2  ? -18.866 -23.301 11.626  1.00 0.00 ? 2   SER A O    6  
ATOM   5752  C  CB   . SER A 1 2  ? -20.489 -23.893 14.535  1.00 0.00 ? 2   SER A CB   6  
ATOM   5753  O  OG   . SER A 1 2  ? -20.779 -24.934 15.452  1.00 0.00 ? 2   SER A OG   6  
ATOM   5754  H  H    . SER A 1 2  ? -18.586 -25.461 13.553  1.00 0.00 ? 2   SER A H    6  
ATOM   5755  H  HA   . SER A 1 2  ? -21.345 -24.815 12.803  1.00 0.00 ? 2   SER A HA   6  
ATOM   5756  H  HB2  . SER A 1 2  ? -19.553 -23.434 14.815  1.00 0.00 ? 2   SER A HB2  6  
ATOM   5757  H  HB3  . SER A 1 2  ? -21.279 -23.158 14.581  1.00 0.00 ? 2   SER A HB3  6  
ATOM   5758  H  HG   . SER A 1 2  ? -20.168 -25.661 15.316  1.00 0.00 ? 2   SER A HG   6  
ATOM   5759  N  N    . SER A 1 3  ? -20.886 -22.363 11.947  1.00 0.00 ? 3   SER A N    6  
ATOM   5760  C  CA   . SER A 1 3  ? -20.626 -21.237 11.058  1.00 0.00 ? 3   SER A CA   6  
ATOM   5761  C  C    . SER A 1 3  ? -21.480 -20.033 11.442  1.00 0.00 ? 3   SER A C    6  
ATOM   5762  O  O    . SER A 1 3  ? -22.695 -20.145 11.603  1.00 0.00 ? 3   SER A O    6  
ATOM   5763  C  CB   . SER A 1 3  ? -20.904 -21.631 9.606   1.00 0.00 ? 3   SER A CB   6  
ATOM   5764  O  OG   . SER A 1 3  ? -19.899 -22.499 9.112   1.00 0.00 ? 3   SER A OG   6  
ATOM   5765  H  H    . SER A 1 3  ? -21.753 -22.425 12.399  1.00 0.00 ? 3   SER A H    6  
ATOM   5766  H  HA   . SER A 1 3  ? -19.584 -20.971 11.156  1.00 0.00 ? 3   SER A HA   6  
ATOM   5767  H  HB2  . SER A 1 3  ? -21.858 -22.134 9.549   1.00 0.00 ? 3   SER A HB2  6  
ATOM   5768  H  HB3  . SER A 1 3  ? -20.929 -20.742 8.993   1.00 0.00 ? 3   SER A HB3  6  
ATOM   5769  H  HG   . SER A 1 3  ? -20.035 -23.381 9.467   1.00 0.00 ? 3   SER A HG   6  
ATOM   5770  N  N    . GLY A 1 4  ? -20.834 -18.879 11.589  1.00 0.00 ? 4   GLY A N    6  
ATOM   5771  C  CA   . GLY A 1 4  ? -21.549 -17.670 11.954  1.00 0.00 ? 4   GLY A CA   6  
ATOM   5772  C  C    . GLY A 1 4  ? -20.618 -16.504 12.218  1.00 0.00 ? 4   GLY A C    6  
ATOM   5773  O  O    . GLY A 1 4  ? -20.801 -15.762 13.183  1.00 0.00 ? 4   GLY A O    6  
ATOM   5774  H  H    . GLY A 1 4  ? -19.865 -18.850 11.448  1.00 0.00 ? 4   GLY A H    6  
ATOM   5775  H  HA2  . GLY A 1 4  ? -22.221 -17.406 11.151  1.00 0.00 ? 4   GLY A HA2  6  
ATOM   5776  H  HA3  . GLY A 1 4  ? -22.128 -17.863 12.845  1.00 0.00 ? 4   GLY A HA3  6  
ATOM   5777  N  N    . SER A 1 5  ? -19.615 -16.342 11.361  1.00 0.00 ? 5   SER A N    6  
ATOM   5778  C  CA   . SER A 1 5  ? -18.648 -15.261 11.510  1.00 0.00 ? 5   SER A CA   6  
ATOM   5779  C  C    . SER A 1 5  ? -18.016 -14.909 10.167  1.00 0.00 ? 5   SER A C    6  
ATOM   5780  O  O    . SER A 1 5  ? -17.664 -15.791 9.384   1.00 0.00 ? 5   SER A O    6  
ATOM   5781  C  CB   . SER A 1 5  ? -17.561 -15.656 12.511  1.00 0.00 ? 5   SER A CB   6  
ATOM   5782  O  OG   . SER A 1 5  ? -16.684 -16.622 11.957  1.00 0.00 ? 5   SER A OG   6  
ATOM   5783  H  H    . SER A 1 5  ? -19.523 -16.967 10.611  1.00 0.00 ? 5   SER A H    6  
ATOM   5784  H  HA   . SER A 1 5  ? -19.174 -14.396 11.885  1.00 0.00 ? 5   SER A HA   6  
ATOM   5785  H  HB2  . SER A 1 5  ? -16.989 -14.781 12.781  1.00 0.00 ? 5   SER A HB2  6  
ATOM   5786  H  HB3  . SER A 1 5  ? -18.023 -16.071 13.395  1.00 0.00 ? 5   SER A HB3  6  
ATOM   5787  H  HG   . SER A 1 5  ? -15.999 -16.835 12.595  1.00 0.00 ? 5   SER A HG   6  
ATOM   5788  N  N    . SER A 1 6  ? -17.874 -13.613 9.909   1.00 0.00 ? 6   SER A N    6  
ATOM   5789  C  CA   . SER A 1 6  ? -17.288 -13.142 8.659   1.00 0.00 ? 6   SER A CA   6  
ATOM   5790  C  C    . SER A 1 6  ? -16.717 -11.737 8.823   1.00 0.00 ? 6   SER A C    6  
ATOM   5791  O  O    . SER A 1 6  ? -17.413 -10.818 9.254   1.00 0.00 ? 6   SER A O    6  
ATOM   5792  C  CB   . SER A 1 6  ? -18.335 -13.153 7.544   1.00 0.00 ? 6   SER A CB   6  
ATOM   5793  O  OG   . SER A 1 6  ? -19.310 -12.146 7.750   1.00 0.00 ? 6   SER A OG   6  
ATOM   5794  H  H    . SER A 1 6  ? -18.174 -12.958 10.574  1.00 0.00 ? 6   SER A H    6  
ATOM   5795  H  HA   . SER A 1 6  ? -16.486 -13.815 8.395   1.00 0.00 ? 6   SER A HA   6  
ATOM   5796  H  HB2  . SER A 1 6  ? -17.849 -12.978 6.596   1.00 0.00 ? 6   SER A HB2  6  
ATOM   5797  H  HB3  . SER A 1 6  ? -18.826 -14.115 7.525   1.00 0.00 ? 6   SER A HB3  6  
ATOM   5798  H  HG   . SER A 1 6  ? -19.225 -11.795 8.640   1.00 0.00 ? 6   SER A HG   6  
ATOM   5799  N  N    . GLY A 1 7  ? -15.444 -11.577 8.475   1.00 0.00 ? 7   GLY A N    6  
ATOM   5800  C  CA   . GLY A 1 7  ? -14.799 -10.282 8.590   1.00 0.00 ? 7   GLY A CA   6  
ATOM   5801  C  C    . GLY A 1 7  ? -14.596 -9.614  7.244   1.00 0.00 ? 7   GLY A C    6  
ATOM   5802  O  O    . GLY A 1 7  ? -14.248 -10.272 6.263   1.00 0.00 ? 7   GLY A O    6  
ATOM   5803  H  H    . GLY A 1 7  ? -14.938 -12.346 8.137   1.00 0.00 ? 7   GLY A H    6  
ATOM   5804  H  HA2  . GLY A 1 7  ? -15.410 -9.642  9.209   1.00 0.00 ? 7   GLY A HA2  6  
ATOM   5805  H  HA3  . GLY A 1 7  ? -13.837 -10.412 9.063   1.00 0.00 ? 7   GLY A HA3  6  
ATOM   5806  N  N    . LEU A 1 8  ? -14.813 -8.305  7.196   1.00 0.00 ? 8   LEU A N    6  
ATOM   5807  C  CA   . LEU A 1 8  ? -14.653 -7.547  5.960   1.00 0.00 ? 8   LEU A CA   6  
ATOM   5808  C  C    . LEU A 1 8  ? -13.179 -7.274  5.676   1.00 0.00 ? 8   LEU A C    6  
ATOM   5809  O  O    . LEU A 1 8  ? -12.355 -7.256  6.590   1.00 0.00 ? 8   LEU A O    6  
ATOM   5810  C  CB   . LEU A 1 8  ? -15.422 -6.227  6.044   1.00 0.00 ? 8   LEU A CB   6  
ATOM   5811  C  CG   . LEU A 1 8  ? -16.886 -6.330  6.472   1.00 0.00 ? 8   LEU A CG   6  
ATOM   5812  C  CD1  . LEU A 1 8  ? -17.316 -5.072  7.211   1.00 0.00 ? 8   LEU A CD1  6  
ATOM   5813  C  CD2  . LEU A 1 8  ? -17.779 -6.571  5.263   1.00 0.00 ? 8   LEU A CD2  6  
ATOM   5814  H  H    . LEU A 1 8  ? -15.088 -7.835  8.011   1.00 0.00 ? 8   LEU A H    6  
ATOM   5815  H  HA   . LEU A 1 8  ? -15.058 -8.140  5.154   1.00 0.00 ? 8   LEU A HA   6  
ATOM   5816  H  HB2  . LEU A 1 8  ? -14.914 -5.594  6.755   1.00 0.00 ? 8   LEU A HB2  6  
ATOM   5817  H  HB3  . LEU A 1 8  ? -15.392 -5.766  5.068   1.00 0.00 ? 8   LEU A HB3  6  
ATOM   5818  H  HG   . LEU A 1 8  ? -17.000 -7.167  7.146   1.00 0.00 ? 8   LEU A HG   6  
ATOM   5819  H  HD11 . LEU A 1 8  ? -17.030 -4.203  6.638   1.00 0.00 ? 8   LEU A HD11 6  
ATOM   5820  H  HD12 . LEU A 1 8  ? -16.834 -5.040  8.177   1.00 0.00 ? 8   LEU A HD12 6  
ATOM   5821  H  HD13 . LEU A 1 8  ? -18.388 -5.081  7.343   1.00 0.00 ? 8   LEU A HD13 6  
ATOM   5822  H  HD21 . LEU A 1 8  ? -18.109 -7.599  5.260   1.00 0.00 ? 8   LEU A HD21 6  
ATOM   5823  H  HD22 . LEU A 1 8  ? -17.223 -6.369  4.359   1.00 0.00 ? 8   LEU A HD22 6  
ATOM   5824  H  HD23 . LEU A 1 8  ? -18.637 -5.917  5.313   1.00 0.00 ? 8   LEU A HD23 6  
ATOM   5825  N  N    . GLN A 1 9  ? -12.857 -7.059  4.405   1.00 0.00 ? 9   GLN A N    6  
ATOM   5826  C  CA   . GLN A 1 9  ? -11.483 -6.784  4.002   1.00 0.00 ? 9   GLN A CA   6  
ATOM   5827  C  C    . GLN A 1 9  ? -11.407 -5.521  3.151   1.00 0.00 ? 9   GLN A C    6  
ATOM   5828  O  O    . GLN A 1 9  ? -11.964 -5.464  2.054   1.00 0.00 ? 9   GLN A O    6  
ATOM   5829  C  CB   . GLN A 1 9  ? -10.910 -7.971  3.226   1.00 0.00 ? 9   GLN A CB   6  
ATOM   5830  C  CG   . GLN A 1 9  ? -9.420  -7.855  2.949   1.00 0.00 ? 9   GLN A CG   6  
ATOM   5831  C  CD   . GLN A 1 9  ? -8.572  -8.448  4.056   1.00 0.00 ? 9   GLN A CD   6  
ATOM   5832  O  OE1  . GLN A 1 9  ? -8.715  -9.621  4.402   1.00 0.00 ? 9   GLN A OE1  6  
ATOM   5833  N  NE2  . GLN A 1 9  ? -7.682  -7.639  4.619   1.00 0.00 ? 9   GLN A NE2  6  
ATOM   5834  H  H    . GLN A 1 9  ? -13.559 -7.086  3.723   1.00 0.00 ? 9   GLN A H    6  
ATOM   5835  H  HA   . GLN A 1 9  ? -10.898 -6.636  4.897   1.00 0.00 ? 9   GLN A HA   6  
ATOM   5836  H  HB2  . GLN A 1 9  ? -11.079 -8.873  3.794   1.00 0.00 ? 9   GLN A HB2  6  
ATOM   5837  H  HB3  . GLN A 1 9  ? -11.425 -8.049  2.280   1.00 0.00 ? 9   GLN A HB3  6  
ATOM   5838  H  HG2  . GLN A 1 9  ? -9.196  -8.373  2.028   1.00 0.00 ? 9   GLN A HG2  6  
ATOM   5839  H  HG3  . GLN A 1 9  ? -9.167  -6.810  2.842   1.00 0.00 ? 9   GLN A HG3  6  
ATOM   5840  H  HE21 . GLN A 1 9  ? -7.625  -6.716  4.293   1.00 0.00 ? 9   GLN A HE21 6  
ATOM   5841  H  HE22 . GLN A 1 9  ? -7.121  -7.996  5.338   1.00 0.00 ? 9   GLN A HE22 6  
ATOM   5842  N  N    . CYS A 1 10 ? -10.715 -4.509  3.664   1.00 0.00 ? 10  CYS A N    6  
ATOM   5843  C  CA   . CYS A 1 10 ? -10.567 -3.245  2.952   1.00 0.00 ? 10  CYS A CA   6  
ATOM   5844  C  C    . CYS A 1 10 ? -9.815  -3.445  1.640   1.00 0.00 ? 10  CYS A C    6  
ATOM   5845  O  O    . CYS A 1 10 ? -8.644  -3.825  1.636   1.00 0.00 ? 10  CYS A O    6  
ATOM   5846  C  CB   . CYS A 1 10 ? -9.830  -2.227  3.826   1.00 0.00 ? 10  CYS A CB   6  
ATOM   5847  S  SG   . CYS A 1 10 ? -9.698  -0.569  3.084   1.00 0.00 ? 10  CYS A SG   6  
ATOM   5848  H  H    . CYS A 1 10 ? -10.294 -4.614  4.543   1.00 0.00 ? 10  CYS A H    6  
ATOM   5849  H  HA   . CYS A 1 10 ? -11.555 -2.869  2.733   1.00 0.00 ? 10  CYS A HA   6  
ATOM   5850  H  HB2  . CYS A 1 10 ? -10.353 -2.125  4.765   1.00 0.00 ? 10  CYS A HB2  6  
ATOM   5851  H  HB3  . CYS A 1 10 ? -8.829  -2.585  4.014   1.00 0.00 ? 10  CYS A HB3  6  
ATOM   5852  N  N    . GLU A 1 11 ? -10.496 -3.185  0.528   1.00 0.00 ? 11  GLU A N    6  
ATOM   5853  C  CA   . GLU A 1 11 ? -9.891  -3.337  -0.790  1.00 0.00 ? 11  GLU A CA   6  
ATOM   5854  C  C    . GLU A 1 11 ? -9.059  -2.110  -1.152  1.00 0.00 ? 11  GLU A C    6  
ATOM   5855  O  O    . GLU A 1 11 ? -8.590  -1.977  -2.282  1.00 0.00 ? 11  GLU A O    6  
ATOM   5856  C  CB   . GLU A 1 11 ? -10.973 -3.563  -1.848  1.00 0.00 ? 11  GLU A CB   6  
ATOM   5857  C  CG   . GLU A 1 11 ? -11.715 -2.296  -2.241  1.00 0.00 ? 11  GLU A CG   6  
ATOM   5858  C  CD   . GLU A 1 11 ? -12.537 -2.469  -3.503  1.00 0.00 ? 11  GLU A CD   6  
ATOM   5859  O  OE1  . GLU A 1 11 ? -13.222 -3.505  -3.627  1.00 0.00 ? 11  GLU A OE1  6  
ATOM   5860  O  OE2  . GLU A 1 11 ? -12.495 -1.568  -4.367  1.00 0.00 ? 11  GLU A OE2  6  
ATOM   5861  H  H    . GLU A 1 11 ? -11.426 -2.885  0.596   1.00 0.00 ? 11  GLU A H    6  
ATOM   5862  H  HA   . GLU A 1 11 ? -9.244  -4.200  -0.761  1.00 0.00 ? 11  GLU A HA   6  
ATOM   5863  H  HB2  . GLU A 1 11 ? -10.513 -3.976  -2.734  1.00 0.00 ? 11  GLU A HB2  6  
ATOM   5864  H  HB3  . GLU A 1 11 ? -11.692 -4.271  -1.465  1.00 0.00 ? 11  GLU A HB3  6  
ATOM   5865  H  HG2  . GLU A 1 11 ? -12.376 -2.017  -1.435  1.00 0.00 ? 11  GLU A HG2  6  
ATOM   5866  H  HG3  . GLU A 1 11 ? -10.994 -1.508  -2.403  1.00 0.00 ? 11  GLU A HG3  6  
ATOM   5867  N  N    . ILE A 1 12 ? -8.881  -1.218  -0.184  1.00 0.00 ? 12  ILE A N    6  
ATOM   5868  C  CA   . ILE A 1 12 ? -8.105  -0.003  -0.400  1.00 0.00 ? 12  ILE A CA   6  
ATOM   5869  C  C    . ILE A 1 12 ? -6.661  -0.184  0.056   1.00 0.00 ? 12  ILE A C    6  
ATOM   5870  O  O    . ILE A 1 12 ? -5.723  0.060   -0.704  1.00 0.00 ? 12  ILE A O    6  
ATOM   5871  C  CB   . ILE A 1 12 ? -8.720  1.198   0.344   1.00 0.00 ? 12  ILE A CB   6  
ATOM   5872  C  CG1  . ILE A 1 12 ? -10.191 1.365   -0.040  1.00 0.00 ? 12  ILE A CG1  6  
ATOM   5873  C  CG2  . ILE A 1 12 ? -7.939  2.467   0.039   1.00 0.00 ? 12  ILE A CG2  6  
ATOM   5874  C  CD1  . ILE A 1 12 ? -10.399 1.713   -1.498  1.00 0.00 ? 12  ILE A CD1  6  
ATOM   5875  H  H    . ILE A 1 12 ? -9.280  -1.380  0.696   1.00 0.00 ? 12  ILE A H    6  
ATOM   5876  H  HA   . ILE A 1 12 ? -8.113  0.214   -1.459  1.00 0.00 ? 12  ILE A HA   6  
ATOM   5877  H  HB   . ILE A 1 12 ? -8.651  1.008   1.405   1.00 0.00 ? 12  ILE A HB   6  
ATOM   5878  H  HG12 . ILE A 1 12 ? -10.716 0.444   0.158   1.00 0.00 ? 12  ILE A HG12 6  
ATOM   5879  H  HG13 . ILE A 1 12 ? -10.623 2.156   0.555   1.00 0.00 ? 12  ILE A HG13 6  
ATOM   5880  H  HG21 . ILE A 1 12 ? -8.609  3.314   0.052   1.00 0.00 ? 12  ILE A HG21 6  
ATOM   5881  H  HG22 . ILE A 1 12 ? -7.171  2.605   0.785   1.00 0.00 ? 12  ILE A HG22 6  
ATOM   5882  H  HG23 . ILE A 1 12 ? -7.483  2.383   -0.936  1.00 0.00 ? 12  ILE A HG23 6  
ATOM   5883  H  HD11 . ILE A 1 12 ? -10.863 0.880   -2.004  1.00 0.00 ? 12  ILE A HD11 6  
ATOM   5884  H  HD12 . ILE A 1 12 ? -11.034 2.582   -1.574  1.00 0.00 ? 12  ILE A HD12 6  
ATOM   5885  H  HD13 . ILE A 1 12 ? -9.443  1.924   -1.957  1.00 0.00 ? 12  ILE A HD13 6  
ATOM   5886  N  N    . CYS A 1 13 ? -6.489  -0.615  1.301   1.00 0.00 ? 13  CYS A N    6  
ATOM   5887  C  CA   . CYS A 1 13 ? -5.160  -0.831  1.860   1.00 0.00 ? 13  CYS A CA   6  
ATOM   5888  C  C    . CYS A 1 13 ? -4.939  -2.306  2.184   1.00 0.00 ? 13  CYS A C    6  
ATOM   5889  O  O    . CYS A 1 13 ? -3.846  -2.837  1.994   1.00 0.00 ? 13  CYS A O    6  
ATOM   5890  C  CB   . CYS A 1 13 ? -4.970  0.013   3.121   1.00 0.00 ? 13  CYS A CB   6  
ATOM   5891  S  SG   . CYS A 1 13 ? -6.104  -0.416  4.481   1.00 0.00 ? 13  CYS A SG   6  
ATOM   5892  H  H    . CYS A 1 13 ? -7.276  -0.792  1.859   1.00 0.00 ? 13  CYS A H    6  
ATOM   5893  H  HA   . CYS A 1 13 ? -4.436  -0.526  1.120   1.00 0.00 ? 13  CYS A HA   6  
ATOM   5894  H  HB2  . CYS A 1 13 ? -3.961  -0.116  3.483   1.00 0.00 ? 13  CYS A HB2  6  
ATOM   5895  H  HB3  . CYS A 1 13 ? -5.129  1.053   2.876   1.00 0.00 ? 13  CYS A HB3  6  
ATOM   5896  N  N    . GLY A 1 14 ? -5.987  -2.962  2.674   1.00 0.00 ? 14  GLY A N    6  
ATOM   5897  C  CA   . GLY A 1 14 ? -5.888  -4.368  3.017   1.00 0.00 ? 14  GLY A CA   6  
ATOM   5898  C  C    . GLY A 1 14 ? -6.208  -4.634  4.474   1.00 0.00 ? 14  GLY A C    6  
ATOM   5899  O  O    . GLY A 1 14 ? -5.878  -5.694  5.006   1.00 0.00 ? 14  GLY A O    6  
ATOM   5900  H  H    . GLY A 1 14 ? -6.834  -2.486  2.804   1.00 0.00 ? 14  GLY A H    6  
ATOM   5901  H  HA2  . GLY A 1 14 ? -6.576  -4.927  2.400   1.00 0.00 ? 14  GLY A HA2  6  
ATOM   5902  H  HA3  . GLY A 1 14 ? -4.882  -4.706  2.814   1.00 0.00 ? 14  GLY A HA3  6  
ATOM   5903  N  N    . PHE A 1 15 ? -6.851  -3.669  5.123   1.00 0.00 ? 15  PHE A N    6  
ATOM   5904  C  CA   . PHE A 1 15 ? -7.213  -3.802  6.529   1.00 0.00 ? 15  PHE A CA   6  
ATOM   5905  C  C    . PHE A 1 15 ? -8.403  -4.743  6.697   1.00 0.00 ? 15  PHE A C    6  
ATOM   5906  O  O    . PHE A 1 15 ? -8.955  -5.246  5.718   1.00 0.00 ? 15  PHE A O    6  
ATOM   5907  C  CB   . PHE A 1 15 ? -7.543  -2.432  7.125   1.00 0.00 ? 15  PHE A CB   6  
ATOM   5908  C  CG   . PHE A 1 15 ? -7.376  -2.371  8.616   1.00 0.00 ? 15  PHE A CG   6  
ATOM   5909  C  CD1  . PHE A 1 15 ? -6.114  -2.413  9.188   1.00 0.00 ? 15  PHE A CD1  6  
ATOM   5910  C  CD2  . PHE A 1 15 ? -8.480  -2.273  9.447   1.00 0.00 ? 15  PHE A CD2  6  
ATOM   5911  C  CE1  . PHE A 1 15 ? -5.957  -2.356  10.560  1.00 0.00 ? 15  PHE A CE1  6  
ATOM   5912  C  CE2  . PHE A 1 15 ? -8.329  -2.216  10.820  1.00 0.00 ? 15  PHE A CE2  6  
ATOM   5913  C  CZ   . PHE A 1 15 ? -7.066  -2.259  11.377  1.00 0.00 ? 15  PHE A CZ   6  
ATOM   5914  H  H    . PHE A 1 15 ? -7.086  -2.846  4.644   1.00 0.00 ? 15  PHE A H    6  
ATOM   5915  H  HA   . PHE A 1 15 ? -6.365  -4.218  7.051   1.00 0.00 ? 15  PHE A HA   6  
ATOM   5916  H  HB2  . PHE A 1 15 ? -6.891  -1.691  6.688   1.00 0.00 ? 15  PHE A HB2  6  
ATOM   5917  H  HB3  . PHE A 1 15 ? -8.568  -2.185  6.894   1.00 0.00 ? 15  PHE A HB3  6  
ATOM   5918  H  HD1  . PHE A 1 15 ? -5.245  -2.489  8.549   1.00 0.00 ? 15  PHE A HD1  6  
ATOM   5919  H  HD2  . PHE A 1 15 ? -9.469  -2.241  9.013   1.00 0.00 ? 15  PHE A HD2  6  
ATOM   5920  H  HE1  . PHE A 1 15 ? -4.968  -2.390  10.992  1.00 0.00 ? 15  PHE A HE1  6  
ATOM   5921  H  HE2  . PHE A 1 15 ? -9.198  -2.140  11.456  1.00 0.00 ? 15  PHE A HE2  6  
ATOM   5922  H  HZ   . PHE A 1 15 ? -6.945  -2.214  12.449  1.00 0.00 ? 15  PHE A HZ   6  
ATOM   5923  N  N    . THR A 1 16 ? -8.794  -4.976  7.946   1.00 0.00 ? 16  THR A N    6  
ATOM   5924  C  CA   . THR A 1 16 ? -9.916  -5.856  8.244   1.00 0.00 ? 16  THR A CA   6  
ATOM   5925  C  C    . THR A 1 16 ? -10.730 -5.330  9.421   1.00 0.00 ? 16  THR A C    6  
ATOM   5926  O  O    . THR A 1 16 ? -10.172 -4.852  10.409  1.00 0.00 ? 16  THR A O    6  
ATOM   5927  C  CB   . THR A 1 16 ? -9.440  -7.286  8.562   1.00 0.00 ? 16  THR A CB   6  
ATOM   5928  O  OG1  . THR A 1 16 ? -8.194  -7.242  9.267   1.00 0.00 ? 16  THR A OG1  6  
ATOM   5929  C  CG2  . THR A 1 16 ? -9.278  -8.099  7.286   1.00 0.00 ? 16  THR A CG2  6  
ATOM   5930  H  H    . THR A 1 16 ? -8.314  -4.545  8.684   1.00 0.00 ? 16  THR A H    6  
ATOM   5931  H  HA   . THR A 1 16 ? -10.550 -5.896  7.370   1.00 0.00 ? 16  THR A HA   6  
ATOM   5932  H  HB   . THR A 1 16 ? -10.181 -7.766  9.185   1.00 0.00 ? 16  THR A HB   6  
ATOM   5933  H  HG1  . THR A 1 16 ? -7.564  -6.714  8.770   1.00 0.00 ? 16  THR A HG1  6  
ATOM   5934  H  HG21 . THR A 1 16 ? -9.117  -9.136  7.538   1.00 0.00 ? 16  THR A HG21 6  
ATOM   5935  H  HG22 . THR A 1 16 ? -8.431  -7.728  6.728   1.00 0.00 ? 16  THR A HG22 6  
ATOM   5936  H  HG23 . THR A 1 16 ? -10.172 -8.008  6.687   1.00 0.00 ? 16  THR A HG23 6  
ATOM   5937  N  N    . CYS A 1 17 ? -12.050 -5.423  9.310   1.00 0.00 ? 17  CYS A N    6  
ATOM   5938  C  CA   . CYS A 1 17 ? -12.941 -4.956  10.366  1.00 0.00 ? 17  CYS A CA   6  
ATOM   5939  C  C    . CYS A 1 17 ? -14.271 -5.702  10.325  1.00 0.00 ? 17  CYS A C    6  
ATOM   5940  O  O    . CYS A 1 17 ? -14.968 -5.693  9.310   1.00 0.00 ? 17  CYS A O    6  
ATOM   5941  C  CB   . CYS A 1 17 ? -13.182 -3.452  10.231  1.00 0.00 ? 17  CYS A CB   6  
ATOM   5942  S  SG   . CYS A 1 17 ? -13.510 -2.612  11.798  1.00 0.00 ? 17  CYS A SG   6  
ATOM   5943  H  H    . CYS A 1 17 ? -12.436 -5.813  8.498   1.00 0.00 ? 17  CYS A H    6  
ATOM   5944  H  HA   . CYS A 1 17 ? -12.462 -5.151  11.313  1.00 0.00 ? 17  CYS A HA   6  
ATOM   5945  H  HB2  . CYS A 1 17 ? -12.309 -2.993  9.790   1.00 0.00 ? 17  CYS A HB2  6  
ATOM   5946  H  HB3  . CYS A 1 17 ? -14.032 -3.288  9.584   1.00 0.00 ? 17  CYS A HB3  6  
ATOM   5947  H  HG   . CYS A 1 17 ? -13.091 -1.361  11.687  1.00 0.00 ? 17  CYS A HG   6  
ATOM   5948  N  N    . ARG A 1 18 ? -14.616 -6.348  11.434  1.00 0.00 ? 18  ARG A N    6  
ATOM   5949  C  CA   . ARG A 1 18 ? -15.860 -7.102  11.524  1.00 0.00 ? 18  ARG A CA   6  
ATOM   5950  C  C    . ARG A 1 18 ? -17.066 -6.185  11.338  1.00 0.00 ? 18  ARG A C    6  
ATOM   5951  O  O    . ARG A 1 18 ? -17.986 -6.499  10.584  1.00 0.00 ? 18  ARG A O    6  
ATOM   5952  C  CB   . ARG A 1 18 ? -15.952 -7.816  12.873  1.00 0.00 ? 18  ARG A CB   6  
ATOM   5953  C  CG   . ARG A 1 18 ? -14.823 -8.804  13.118  1.00 0.00 ? 18  ARG A CG   6  
ATOM   5954  C  CD   . ARG A 1 18 ? -15.232 -9.883  14.108  1.00 0.00 ? 18  ARG A CD   6  
ATOM   5955  N  NE   . ARG A 1 18 ? -14.091 -10.388 14.868  1.00 0.00 ? 18  ARG A NE   6  
ATOM   5956  C  CZ   . ARG A 1 18 ? -13.532 -11.573 14.653  1.00 0.00 ? 18  ARG A CZ   6  
ATOM   5957  N  NH1  . ARG A 1 18 ? -14.005 -12.371 13.706  1.00 0.00 ? 18  ARG A NH1  6  
ATOM   5958  N  NH2  . ARG A 1 18 ? -12.497 -11.963 15.386  1.00 0.00 ? 18  ARG A NH2  6  
ATOM   5959  H  H    . ARG A 1 18 ? -14.018 -6.317  12.210  1.00 0.00 ? 18  ARG A H    6  
ATOM   5960  H  HA   . ARG A 1 18 ? -15.859 -7.839  10.735  1.00 0.00 ? 18  ARG A HA   6  
ATOM   5961  H  HB2  . ARG A 1 18 ? -15.932 -7.077  13.661  1.00 0.00 ? 18  ARG A HB2  6  
ATOM   5962  H  HB3  . ARG A 1 18 ? -16.888 -8.353  12.919  1.00 0.00 ? 18  ARG A HB3  6  
ATOM   5963  H  HG2  . ARG A 1 18 ? -14.558 -9.272  12.182  1.00 0.00 ? 18  ARG A HG2  6  
ATOM   5964  H  HG3  . ARG A 1 18 ? -13.970 -8.270  13.511  1.00 0.00 ? 18  ARG A HG3  6  
ATOM   5965  H  HD2  . ARG A 1 18 ? -15.954 -9.467  14.795  1.00 0.00 ? 18  ARG A HD2  6  
ATOM   5966  H  HD3  . ARG A 1 18 ? -15.681 -10.700 13.565  1.00 0.00 ? 18  ARG A HD3  6  
ATOM   5967  H  HE   . ARG A 1 18 ? -13.726 -9.815  15.574  1.00 0.00 ? 18  ARG A HE   6  
ATOM   5968  H  HH11 . ARG A 1 18 ? -14.784 -12.080 13.151  1.00 0.00 ? 18  ARG A HH11 6  
ATOM   5969  H  HH12 . ARG A 1 18 ? -13.581 -13.263 13.545  1.00 0.00 ? 18  ARG A HH12 6  
ATOM   5970  H  HH21 . ARG A 1 18 ? -12.137 -11.364 16.102  1.00 0.00 ? 18  ARG A HH21 6  
ATOM   5971  H  HH22 . ARG A 1 18 ? -12.077 -12.855 15.224  1.00 0.00 ? 18  ARG A HH22 6  
ATOM   5972  N  N    . GLN A 1 19 ? -17.053 -5.051  12.031  1.00 0.00 ? 19  GLN A N    6  
ATOM   5973  C  CA   . GLN A 1 19 ? -18.146 -4.090  11.944  1.00 0.00 ? 19  GLN A CA   6  
ATOM   5974  C  C    . GLN A 1 19 ? -18.116 -3.353  10.609  1.00 0.00 ? 19  GLN A C    6  
ATOM   5975  O  O    . GLN A 1 19 ? -17.054 -2.952  10.131  1.00 0.00 ? 19  GLN A O    6  
ATOM   5976  C  CB   . GLN A 1 19 ? -18.064 -3.086  13.095  1.00 0.00 ? 19  GLN A CB   6  
ATOM   5977  C  CG   . GLN A 1 19 ? -18.681 -3.594  14.389  1.00 0.00 ? 19  GLN A CG   6  
ATOM   5978  C  CD   . GLN A 1 19 ? -20.196 -3.621  14.342  1.00 0.00 ? 19  GLN A CD   6  
ATOM   5979  O  OE1  . GLN A 1 19 ? -20.793 -4.481  13.693  1.00 0.00 ? 19  GLN A OE1  6  
ATOM   5980  N  NE2  . GLN A 1 19 ? -20.827 -2.677  15.030  1.00 0.00 ? 19  GLN A NE2  6  
ATOM   5981  H  H    . GLN A 1 19 ? -16.291 -4.857  12.616  1.00 0.00 ? 19  GLN A H    6  
ATOM   5982  H  HA   . GLN A 1 19 ? -19.074 -4.635  12.019  1.00 0.00 ? 19  GLN A HA   6  
ATOM   5983  H  HB2  . GLN A 1 19 ? -17.026 -2.855  13.283  1.00 0.00 ? 19  GLN A HB2  6  
ATOM   5984  H  HB3  . GLN A 1 19 ? -18.580 -2.182  12.807  1.00 0.00 ? 19  GLN A HB3  6  
ATOM   5985  H  HG2  . GLN A 1 19 ? -18.324 -4.596  14.574  1.00 0.00 ? 19  GLN A HG2  6  
ATOM   5986  H  HG3  . GLN A 1 19 ? -18.372 -2.947  15.197  1.00 0.00 ? 19  GLN A HG3  6  
ATOM   5987  H  HE21 . GLN A 1 19 ? -20.286 -2.024  15.522  1.00 0.00 ? 19  GLN A HE21 6  
ATOM   5988  H  HE22 . GLN A 1 19 ? -21.806 -2.671  15.016  1.00 0.00 ? 19  GLN A HE22 6  
ATOM   5989  N  N    . LYS A 1 20 ? -19.289 -3.178  10.009  1.00 0.00 ? 20  LYS A N    6  
ATOM   5990  C  CA   . LYS A 1 20 ? -19.400 -2.488  8.729   1.00 0.00 ? 20  LYS A CA   6  
ATOM   5991  C  C    . LYS A 1 20 ? -19.136 -0.995  8.891   1.00 0.00 ? 20  LYS A C    6  
ATOM   5992  O  O    . LYS A 1 20 ? -18.239 -0.441  8.256   1.00 0.00 ? 20  LYS A O    6  
ATOM   5993  C  CB   . LYS A 1 20 ? -20.789 -2.709  8.126   1.00 0.00 ? 20  LYS A CB   6  
ATOM   5994  C  CG   . LYS A 1 20 ? -20.923 -2.193  6.704   1.00 0.00 ? 20  LYS A CG   6  
ATOM   5995  C  CD   . LYS A 1 20 ? -20.469 -3.230  5.690   1.00 0.00 ? 20  LYS A CD   6  
ATOM   5996  C  CE   . LYS A 1 20 ? -20.026 -2.579  4.388   1.00 0.00 ? 20  LYS A CE   6  
ATOM   5997  N  NZ   . LYS A 1 20 ? -18.774 -1.792  4.559   1.00 0.00 ? 20  LYS A NZ   6  
ATOM   5998  H  H    . LYS A 1 20 ? -20.101 -3.520  10.440  1.00 0.00 ? 20  LYS A H    6  
ATOM   5999  H  HA   . LYS A 1 20 ? -18.658 -2.903  8.064   1.00 0.00 ? 20  LYS A HA   6  
ATOM   6000  H  HB2  . LYS A 1 20 ? -21.004 -3.767  8.125   1.00 0.00 ? 20  LYS A HB2  6  
ATOM   6001  H  HB3  . LYS A 1 20 ? -21.519 -2.203  8.741   1.00 0.00 ? 20  LYS A HB3  6  
ATOM   6002  H  HG2  . LYS A 1 20 ? -21.958 -1.950  6.515   1.00 0.00 ? 20  LYS A HG2  6  
ATOM   6003  H  HG3  . LYS A 1 20 ? -20.316 -1.305  6.594   1.00 0.00 ? 20  LYS A HG3  6  
ATOM   6004  H  HD2  . LYS A 1 20 ? -19.639 -3.785  6.102   1.00 0.00 ? 20  LYS A HD2  6  
ATOM   6005  H  HD3  . LYS A 1 20 ? -21.289 -3.903  5.485   1.00 0.00 ? 20  LYS A HD3  6  
ATOM   6006  H  HE2  . LYS A 1 20 ? -19.857 -3.352  3.654   1.00 0.00 ? 20  LYS A HE2  6  
ATOM   6007  H  HE3  . LYS A 1 20 ? -20.811 -1.922  4.044   1.00 0.00 ? 20  LYS A HE3  6  
ATOM   6008  H  HZ1  . LYS A 1 20 ? -18.770 -0.981  3.907   1.00 0.00 ? 20  LYS A HZ1  6  
ATOM   6009  H  HZ2  . LYS A 1 20 ? -17.946 -2.388  4.358   1.00 0.00 ? 20  LYS A HZ2  6  
ATOM   6010  H  HZ3  . LYS A 1 20 ? -18.705 -1.439  5.535   1.00 0.00 ? 20  LYS A HZ3  6  
ATOM   6011  N  N    . ALA A 1 21 ? -19.922 -0.349  9.746   1.00 0.00 ? 21  ALA A N    6  
ATOM   6012  C  CA   . ALA A 1 21 ? -19.770 1.080   9.994   1.00 0.00 ? 21  ALA A CA   6  
ATOM   6013  C  C    . ALA A 1 21 ? -18.303 1.452   10.178  1.00 0.00 ? 21  ALA A C    6  
ATOM   6014  O  O    . ALA A 1 21 ? -17.841 2.469   9.660   1.00 0.00 ? 21  ALA A O    6  
ATOM   6015  C  CB   . ALA A 1 21 ? -20.578 1.492   11.215  1.00 0.00 ? 21  ALA A CB   6  
ATOM   6016  H  H    . ALA A 1 21 ? -20.619 -0.845  10.223  1.00 0.00 ? 21  ALA A H    6  
ATOM   6017  H  HA   . ALA A 1 21 ? -20.161 1.610   9.138   1.00 0.00 ? 21  ALA A HA   6  
ATOM   6018  H  HB1  . ALA A 1 21 ? -21.608 1.195   11.081  1.00 0.00 ? 21  ALA A HB1  6  
ATOM   6019  H  HB2  . ALA A 1 21 ? -20.175 1.010   12.093  1.00 0.00 ? 21  ALA A HB2  6  
ATOM   6020  H  HB3  . ALA A 1 21 ? -20.525 2.564   11.336  1.00 0.00 ? 21  ALA A HB3  6  
ATOM   6021  N  N    . SER A 1 22 ? -17.575 0.623   10.919  1.00 0.00 ? 22  SER A N    6  
ATOM   6022  C  CA   . SER A 1 22 ? -16.160 0.868   11.175  1.00 0.00 ? 22  SER A CA   6  
ATOM   6023  C  C    . SER A 1 22 ? -15.380 0.965   9.867   1.00 0.00 ? 22  SER A C    6  
ATOM   6024  O  O    . SER A 1 22 ? -14.605 1.899   9.661   1.00 0.00 ? 22  SER A O    6  
ATOM   6025  C  CB   . SER A 1 22 ? -15.578 -0.245  12.048  1.00 0.00 ? 22  SER A CB   6  
ATOM   6026  O  OG   . SER A 1 22 ? -16.257 -0.327  13.289  1.00 0.00 ? 22  SER A OG   6  
ATOM   6027  H  H    . SER A 1 22 ? -18.000 -0.171  11.305  1.00 0.00 ? 22  SER A H    6  
ATOM   6028  H  HA   . SER A 1 22 ? -16.076 1.808   11.701  1.00 0.00 ? 22  SER A HA   6  
ATOM   6029  H  HB2  . SER A 1 22 ? -15.674 -1.189  11.535  1.00 0.00 ? 22  SER A HB2  6  
ATOM   6030  H  HB3  . SER A 1 22 ? -14.533 -0.042  12.236  1.00 0.00 ? 22  SER A HB3  6  
ATOM   6031  H  HG   . SER A 1 22 ? -17.160 -0.020  13.181  1.00 0.00 ? 22  SER A HG   6  
ATOM   6032  N  N    . LEU A 1 23 ? -15.592 -0.007  8.987   1.00 0.00 ? 23  LEU A N    6  
ATOM   6033  C  CA   . LEU A 1 23 ? -14.910 -0.033  7.697   1.00 0.00 ? 23  LEU A CA   6  
ATOM   6034  C  C    . LEU A 1 23 ? -15.183 1.245   6.911   1.00 0.00 ? 23  LEU A C    6  
ATOM   6035  O  O    . LEU A 1 23 ? -14.256 1.935   6.488   1.00 0.00 ? 23  LEU A O    6  
ATOM   6036  C  CB   . LEU A 1 23 ? -15.357 -1.250  6.886   1.00 0.00 ? 23  LEU A CB   6  
ATOM   6037  C  CG   . LEU A 1 23 ? -14.508 -1.588  5.660   1.00 0.00 ? 23  LEU A CG   6  
ATOM   6038  C  CD1  . LEU A 1 23 ? -13.163 -2.158  6.083   1.00 0.00 ? 23  LEU A CD1  6  
ATOM   6039  C  CD2  . LEU A 1 23 ? -15.243 -2.567  4.756   1.00 0.00 ? 23  LEU A CD2  6  
ATOM   6040  H  H    . LEU A 1 23 ? -16.222 -0.724  9.207   1.00 0.00 ? 23  LEU A H    6  
ATOM   6041  H  HA   . LEU A 1 23 ? -13.849 -0.106  7.886   1.00 0.00 ? 23  LEU A HA   6  
ATOM   6042  H  HB2  . LEU A 1 23 ? -15.345 -2.107  7.542   1.00 0.00 ? 23  LEU A HB2  6  
ATOM   6043  H  HB3  . LEU A 1 23 ? -16.368 -1.070  6.551   1.00 0.00 ? 23  LEU A HB3  6  
ATOM   6044  H  HG   . LEU A 1 23 ? -14.325 -0.684  5.097   1.00 0.00 ? 23  LEU A HG   6  
ATOM   6045  H  HD11 . LEU A 1 23 ? -13.074 -2.112  7.157   1.00 0.00 ? 23  LEU A HD11 6  
ATOM   6046  H  HD12 . LEU A 1 23 ? -12.370 -1.581  5.631   1.00 0.00 ? 23  LEU A HD12 6  
ATOM   6047  H  HD13 . LEU A 1 23 ? -13.089 -3.186  5.758   1.00 0.00 ? 23  LEU A HD13 6  
ATOM   6048  H  HD21 . LEU A 1 23 ? -14.525 -3.156  4.204   1.00 0.00 ? 23  LEU A HD21 6  
ATOM   6049  H  HD22 . LEU A 1 23 ? -15.867 -2.019  4.064   1.00 0.00 ? 23  LEU A HD22 6  
ATOM   6050  H  HD23 . LEU A 1 23 ? -15.859 -3.220  5.357   1.00 0.00 ? 23  LEU A HD23 6  
ATOM   6051  N  N    . ASN A 1 24 ? -16.461 1.555   6.720   1.00 0.00 ? 24  ASN A N    6  
ATOM   6052  C  CA   . ASN A 1 24 ? -16.857 2.751   5.986   1.00 0.00 ? 24  ASN A CA   6  
ATOM   6053  C  C    . ASN A 1 24 ? -16.143 3.984   6.531   1.00 0.00 ? 24  ASN A C    6  
ATOM   6054  O  O    . ASN A 1 24 ? -15.685 4.836   5.769   1.00 0.00 ? 24  ASN A O    6  
ATOM   6055  C  CB   . ASN A 1 24 ? -18.372 2.947   6.067   1.00 0.00 ? 24  ASN A CB   6  
ATOM   6056  C  CG   . ASN A 1 24 ? -19.135 1.872   5.318   1.00 0.00 ? 24  ASN A CG   6  
ATOM   6057  O  OD1  . ASN A 1 24 ? -18.939 1.678   4.118   1.00 0.00 ? 24  ASN A OD1  6  
ATOM   6058  N  ND2  . ASN A 1 24 ? -20.011 1.167   6.024   1.00 0.00 ? 24  ASN A ND2  6  
ATOM   6059  H  H    . ASN A 1 24 ? -17.155 0.965   7.082   1.00 0.00 ? 24  ASN A H    6  
ATOM   6060  H  HA   . ASN A 1 24 ? -16.575 2.613   4.953   1.00 0.00 ? 24  ASN A HA   6  
ATOM   6061  H  HB2  . ASN A 1 24 ? -18.677 2.922   7.103   1.00 0.00 ? 24  ASN A HB2  6  
ATOM   6062  H  HB3  . ASN A 1 24 ? -18.628 3.907   5.644   1.00 0.00 ? 24  ASN A HB3  6  
ATOM   6063  H  HD21 . ASN A 1 24 ? -20.115 1.377   6.976   1.00 0.00 ? 24  ASN A HD21 6  
ATOM   6064  H  HD22 . ASN A 1 24 ? -20.518 0.466   5.564   1.00 0.00 ? 24  ASN A HD22 6  
ATOM   6065  N  N    . TRP A 1 25 ? -16.052 4.072   7.853   1.00 0.00 ? 25  TRP A N    6  
ATOM   6066  C  CA   . TRP A 1 25 ? -15.393 5.202   8.499   1.00 0.00 ? 25  TRP A CA   6  
ATOM   6067  C  C    . TRP A 1 25 ? -13.892 5.183   8.231   1.00 0.00 ? 25  TRP A C    6  
ATOM   6068  O  O    . TRP A 1 25 ? -13.238 6.227   8.233   1.00 0.00 ? 25  TRP A O    6  
ATOM   6069  C  CB   . TRP A 1 25 ? -15.654 5.176   10.006  1.00 0.00 ? 25  TRP A CB   6  
ATOM   6070  C  CG   . TRP A 1 25 ? -14.770 6.108   10.778  1.00 0.00 ? 25  TRP A CG   6  
ATOM   6071  C  CD1  . TRP A 1 25 ? -13.431 5.966   11.008  1.00 0.00 ? 25  TRP A CD1  6  
ATOM   6072  C  CD2  . TRP A 1 25 ? -15.163 7.324   11.424  1.00 0.00 ? 25  TRP A CD2  6  
ATOM   6073  N  NE1  . TRP A 1 25 ? -12.968 7.020   11.757  1.00 0.00 ? 25  TRP A NE1  6  
ATOM   6074  C  CE2  . TRP A 1 25 ? -14.011 7.868   12.025  1.00 0.00 ? 25  TRP A CE2  6  
ATOM   6075  C  CE3  . TRP A 1 25 ? -16.375 8.007   11.551  1.00 0.00 ? 25  TRP A CE3  6  
ATOM   6076  C  CZ2  . TRP A 1 25 ? -14.038 9.061   12.742  1.00 0.00 ? 25  TRP A CZ2  6  
ATOM   6077  C  CZ3  . TRP A 1 25 ? -16.401 9.191   12.264  1.00 0.00 ? 25  TRP A CZ3  6  
ATOM   6078  C  CH2  . TRP A 1 25 ? -15.238 9.709   12.851  1.00 0.00 ? 25  TRP A CH2  6  
ATOM   6079  H  H    . TRP A 1 25 ? -16.436 3.361   8.407   1.00 0.00 ? 25  TRP A H    6  
ATOM   6080  H  HA   . TRP A 1 25 ? -15.810 6.108   8.086   1.00 0.00 ? 25  TRP A HA   6  
ATOM   6081  H  HB2  . TRP A 1 25 ? -16.680 5.458   10.193  1.00 0.00 ? 25  TRP A HB2  6  
ATOM   6082  H  HB3  . TRP A 1 25 ? -15.488 4.174   10.376  1.00 0.00 ? 25  TRP A HB3  6  
ATOM   6083  H  HD1  . TRP A 1 25 ? -12.837 5.139   10.649  1.00 0.00 ? 25  TRP A HD1  6  
ATOM   6084  H  HE1  . TRP A 1 25 ? -12.041 7.145   12.051  1.00 0.00 ? 25  TRP A HE1  6  
ATOM   6085  H  HE3  . TRP A 1 25 ? -17.282 7.625   11.106  1.00 0.00 ? 25  TRP A HE3  6  
ATOM   6086  H  HZ2  . TRP A 1 25 ? -13.151 9.473   13.200  1.00 0.00 ? 25  TRP A HZ2  6  
ATOM   6087  H  HZ3  . TRP A 1 25 ? -17.328 9.733   12.373  1.00 0.00 ? 25  TRP A HZ3  6  
ATOM   6088  H  HH2  . TRP A 1 25 ? -15.305 10.636  13.398  1.00 0.00 ? 25  TRP A HH2  6  
ATOM   6089  N  N    . HIS A 1 26 ? -13.351 3.991   8.000   1.00 0.00 ? 26  HIS A N    6  
ATOM   6090  C  CA   . HIS A 1 26 ? -11.926 3.838   7.729   1.00 0.00 ? 26  HIS A CA   6  
ATOM   6091  C  C    . HIS A 1 26 ? -11.643 3.944   6.233   1.00 0.00 ? 26  HIS A C    6  
ATOM   6092  O  O    . HIS A 1 26 ? -10.499 4.130   5.821   1.00 0.00 ? 26  HIS A O    6  
ATOM   6093  C  CB   . HIS A 1 26 ? -11.426 2.494   8.260   1.00 0.00 ? 26  HIS A CB   6  
ATOM   6094  C  CG   . HIS A 1 26 ? -10.250 1.953   7.507   1.00 0.00 ? 26  HIS A CG   6  
ATOM   6095  N  ND1  . HIS A 1 26 ? -8.951  2.337   7.763   1.00 0.00 ? 26  HIS A ND1  6  
ATOM   6096  C  CD2  . HIS A 1 26 ? -10.183 1.049   6.502   1.00 0.00 ? 26  HIS A CD2  6  
ATOM   6097  C  CE1  . HIS A 1 26 ? -8.135  1.695   6.946   1.00 0.00 ? 26  HIS A CE1  6  
ATOM   6098  N  NE2  . HIS A 1 26 ? -8.857  0.907   6.171   1.00 0.00 ? 26  HIS A NE2  6  
ATOM   6099  H  H    . HIS A 1 26 ? -13.924 3.196   8.012   1.00 0.00 ? 26  HIS A H    6  
ATOM   6100  H  HA   . HIS A 1 26 ? -11.404 4.633   8.239   1.00 0.00 ? 26  HIS A HA   6  
ATOM   6101  H  HB2  . HIS A 1 26 ? -11.133 2.610   9.293   1.00 0.00 ? 26  HIS A HB2  6  
ATOM   6102  H  HB3  . HIS A 1 26 ? -12.225 1.769   8.196   1.00 0.00 ? 26  HIS A HB3  6  
ATOM   6103  H  HD1  . HIS A 1 26 ? -8.669  2.985   8.441   1.00 0.00 ? 26  HIS A HD1  6  
ATOM   6104  H  HD2  . HIS A 1 26 ? -11.016 0.536   6.043   1.00 0.00 ? 26  HIS A HD2  6  
ATOM   6105  H  HE1  . HIS A 1 26 ? -7.060  1.796   6.917   1.00 0.00 ? 26  HIS A HE1  6  
ATOM   6106  N  N    . GLN A 1 27 ? -12.693 3.824   5.427   1.00 0.00 ? 27  GLN A N    6  
ATOM   6107  C  CA   . GLN A 1 27 ? -12.556 3.905   3.978   1.00 0.00 ? 27  GLN A CA   6  
ATOM   6108  C  C    . GLN A 1 27 ? -12.776 5.333   3.489   1.00 0.00 ? 27  GLN A C    6  
ATOM   6109  O  O    . GLN A 1 27 ? -12.124 5.784   2.547   1.00 0.00 ? 27  GLN A O    6  
ATOM   6110  C  CB   . GLN A 1 27 ? -13.550 2.962   3.297   1.00 0.00 ? 27  GLN A CB   6  
ATOM   6111  C  CG   . GLN A 1 27 ? -13.284 1.492   3.579   1.00 0.00 ? 27  GLN A CG   6  
ATOM   6112  C  CD   . GLN A 1 27 ? -13.707 0.592   2.434   1.00 0.00 ? 27  GLN A CD   6  
ATOM   6113  O  OE1  . GLN A 1 27 ? -14.375 1.033   1.497   1.00 0.00 ? 27  GLN A OE1  6  
ATOM   6114  N  NE2  . GLN A 1 27 ? -13.320 -0.676  2.503   1.00 0.00 ? 27  GLN A NE2  6  
ATOM   6115  H  H    . GLN A 1 27 ? -13.580 3.677   5.816   1.00 0.00 ? 27  GLN A H    6  
ATOM   6116  H  HA   . GLN A 1 27 ? -11.553 3.601   3.723   1.00 0.00 ? 27  GLN A HA   6  
ATOM   6117  H  HB2  . GLN A 1 27 ? -14.546 3.198   3.641   1.00 0.00 ? 27  GLN A HB2  6  
ATOM   6118  H  HB3  . GLN A 1 27 ? -13.500 3.116   2.229   1.00 0.00 ? 27  GLN A HB3  6  
ATOM   6119  H  HG2  . GLN A 1 27 ? -12.226 1.356   3.750   1.00 0.00 ? 27  GLN A HG2  6  
ATOM   6120  H  HG3  . GLN A 1 27 ? -13.831 1.204   4.465   1.00 0.00 ? 27  GLN A HG3  6  
ATOM   6121  H  HE21 . GLN A 1 27 ? -12.791 -0.956  3.279   1.00 0.00 ? 27  GLN A HE21 6  
ATOM   6122  H  HE22 . GLN A 1 27 ? -13.580 -1.279  1.777   1.00 0.00 ? 27  GLN A HE22 6  
ATOM   6123  N  N    . ARG A 1 28 ? -13.698 6.039   4.136   1.00 0.00 ? 28  ARG A N    6  
ATOM   6124  C  CA   . ARG A 1 28 ? -14.004 7.415   3.766   1.00 0.00 ? 28  ARG A CA   6  
ATOM   6125  C  C    . ARG A 1 28 ? -12.746 8.278   3.789   1.00 0.00 ? 28  ARG A C    6  
ATOM   6126  O  O    . ARG A 1 28 ? -12.601 9.206   2.994   1.00 0.00 ? 28  ARG A O    6  
ATOM   6127  C  CB   . ARG A 1 28 ? -15.053 7.999   4.714   1.00 0.00 ? 28  ARG A CB   6  
ATOM   6128  C  CG   . ARG A 1 28 ? -14.484 8.451   6.049   1.00 0.00 ? 28  ARG A CG   6  
ATOM   6129  C  CD   . ARG A 1 28 ? -15.557 9.069   6.932   1.00 0.00 ? 28  ARG A CD   6  
ATOM   6130  N  NE   . ARG A 1 28 ? -14.984 9.790   8.065   1.00 0.00 ? 28  ARG A NE   6  
ATOM   6131  C  CZ   . ARG A 1 28 ? -15.470 10.937  8.528   1.00 0.00 ? 28  ARG A CZ   6  
ATOM   6132  N  NH1  . ARG A 1 28 ? -16.531 11.489  7.957   1.00 0.00 ? 28  ARG A NH1  6  
ATOM   6133  N  NH2  . ARG A 1 28 ? -14.893 11.533  9.564   1.00 0.00 ? 28  ARG A NH2  6  
ATOM   6134  H  H    . ARG A 1 28 ? -14.184 5.624   4.879   1.00 0.00 ? 28  ARG A H    6  
ATOM   6135  H  HA   . ARG A 1 28 ? -14.403 7.408   2.762   1.00 0.00 ? 28  ARG A HA   6  
ATOM   6136  H  HB2  . ARG A 1 28 ? -15.517 8.851   4.239   1.00 0.00 ? 28  ARG A HB2  6  
ATOM   6137  H  HB3  . ARG A 1 28 ? -15.806 7.249   4.904   1.00 0.00 ? 28  ARG A HB3  6  
ATOM   6138  H  HG2  . ARG A 1 28 ? -14.062 7.597   6.558   1.00 0.00 ? 28  ARG A HG2  6  
ATOM   6139  H  HG3  . ARG A 1 28 ? -13.711 9.184   5.870   1.00 0.00 ? 28  ARG A HG3  6  
ATOM   6140  H  HD2  . ARG A 1 28 ? -16.141 9.756   6.338   1.00 0.00 ? 28  ARG A HD2  6  
ATOM   6141  H  HD3  . ARG A 1 28 ? -16.195 8.282   7.303   1.00 0.00 ? 28  ARG A HD3  6  
ATOM   6142  H  HE   . ARG A 1 28 ? -14.199 9.399   8.502   1.00 0.00 ? 28  ARG A HE   6  
ATOM   6143  H  HH11 . ARG A 1 28 ? -16.968 11.042  7.177   1.00 0.00 ? 28  ARG A HH11 6  
ATOM   6144  H  HH12 . ARG A 1 28 ? -16.896 12.352  8.308   1.00 0.00 ? 28  ARG A HH12 6  
ATOM   6145  H  HH21 . ARG A 1 28 ? -14.093 11.119  9.997   1.00 0.00 ? 28  ARG A HH21 6  
ATOM   6146  H  HH22 . ARG A 1 28 ? -15.259 12.395  9.911   1.00 0.00 ? 28  ARG A HH22 6  
ATOM   6147  N  N    . LYS A 1 29 ? -11.837 7.964   4.707   1.00 0.00 ? 29  LYS A N    6  
ATOM   6148  C  CA   . LYS A 1 29 ? -10.590 8.709   4.835   1.00 0.00 ? 29  LYS A CA   6  
ATOM   6149  C  C    . LYS A 1 29 ? -9.680  8.457   3.637   1.00 0.00 ? 29  LYS A C    6  
ATOM   6150  O  O    . LYS A 1 29 ? -8.966  9.353   3.187   1.00 0.00 ? 29  LYS A O    6  
ATOM   6151  C  CB   . LYS A 1 29 ? -9.869  8.318   6.127   1.00 0.00 ? 29  LYS A CB   6  
ATOM   6152  C  CG   . LYS A 1 29 ? -9.417  6.868   6.157   1.00 0.00 ? 29  LYS A CG   6  
ATOM   6153  C  CD   . LYS A 1 29 ? -8.327  6.645   7.192   1.00 0.00 ? 29  LYS A CD   6  
ATOM   6154  C  CE   . LYS A 1 29 ? -8.387  5.240   7.771   1.00 0.00 ? 29  LYS A CE   6  
ATOM   6155  N  NZ   . LYS A 1 29 ? -7.070  4.808   8.315   1.00 0.00 ? 29  LYS A NZ   6  
ATOM   6156  H  H    . LYS A 1 29 ? -12.010 7.213   5.313   1.00 0.00 ? 29  LYS A H    6  
ATOM   6157  H  HA   . LYS A 1 29 ? -10.833 9.760   4.872   1.00 0.00 ? 29  LYS A HA   6  
ATOM   6158  H  HB2  . LYS A 1 29 ? -8.999  8.947   6.244   1.00 0.00 ? 29  LYS A HB2  6  
ATOM   6159  H  HB3  . LYS A 1 29 ? -10.537 8.482   6.961   1.00 0.00 ? 29  LYS A HB3  6  
ATOM   6160  H  HG2  . LYS A 1 29 ? -10.262 6.242   6.400   1.00 0.00 ? 29  LYS A HG2  6  
ATOM   6161  H  HG3  . LYS A 1 29 ? -9.036  6.600   5.182   1.00 0.00 ? 29  LYS A HG3  6  
ATOM   6162  H  HD2  . LYS A 1 29 ? -7.364  6.789   6.725   1.00 0.00 ? 29  LYS A HD2  6  
ATOM   6163  H  HD3  . LYS A 1 29 ? -8.451  7.361   7.992   1.00 0.00 ? 29  LYS A HD3  6  
ATOM   6164  H  HE2  . LYS A 1 29 ? -9.118  5.223   8.564   1.00 0.00 ? 29  LYS A HE2  6  
ATOM   6165  H  HE3  . LYS A 1 29 ? -8.687  4.556   6.990   1.00 0.00 ? 29  LYS A HE3  6  
ATOM   6166  H  HZ1  . LYS A 1 29 ? -6.657  5.567   8.894   1.00 0.00 ? 29  LYS A HZ1  6  
ATOM   6167  H  HZ2  . LYS A 1 29 ? -6.417  4.586   7.537   1.00 0.00 ? 29  LYS A HZ2  6  
ATOM   6168  H  HZ3  . LYS A 1 29 ? -7.189  3.960   8.906   1.00 0.00 ? 29  LYS A HZ3  6  
ATOM   6169  N  N    . HIS A 1 30 ? -9.713  7.231   3.122   1.00 0.00 ? 30  HIS A N    6  
ATOM   6170  C  CA   . HIS A 1 30 ? -8.892  6.862   1.974   1.00 0.00 ? 30  HIS A CA   6  
ATOM   6171  C  C    . HIS A 1 30 ? -9.145  7.804   0.801   1.00 0.00 ? 30  HIS A C    6  
ATOM   6172  O  O    . HIS A 1 30 ? -8.216  8.194   0.095   1.00 0.00 ? 30  HIS A O    6  
ATOM   6173  C  CB   . HIS A 1 30 ? -9.180  5.420   1.557   1.00 0.00 ? 30  HIS A CB   6  
ATOM   6174  C  CG   . HIS A 1 30 ? -8.533  4.400   2.442   1.00 0.00 ? 30  HIS A CG   6  
ATOM   6175  N  ND1  . HIS A 1 30 ? -7.275  4.561   2.982   1.00 0.00 ? 30  HIS A ND1  6  
ATOM   6176  C  CD2  . HIS A 1 30 ? -8.979  3.200   2.883   1.00 0.00 ? 30  HIS A CD2  6  
ATOM   6177  C  CE1  . HIS A 1 30 ? -6.973  3.504   3.715   1.00 0.00 ? 30  HIS A CE1  6  
ATOM   6178  N  NE2  . HIS A 1 30 ? -7.991  2.663   3.671   1.00 0.00 ? 30  HIS A NE2  6  
ATOM   6179  H  H    . HIS A 1 30 ? -10.302 6.560   3.524   1.00 0.00 ? 30  HIS A H    6  
ATOM   6180  H  HA   . HIS A 1 30 ? -7.856  6.943   2.267   1.00 0.00 ? 30  HIS A HA   6  
ATOM   6181  H  HB2  . HIS A 1 30 ? -10.247 5.251   1.582   1.00 0.00 ? 30  HIS A HB2  6  
ATOM   6182  H  HB3  . HIS A 1 30 ? -8.820  5.264   0.551   1.00 0.00 ? 30  HIS A HB3  6  
ATOM   6183  H  HD1  . HIS A 1 30 ? -6.689  5.335   2.847   1.00 0.00 ? 30  HIS A HD1  6  
ATOM   6184  H  HD2  . HIS A 1 30 ? -9.934  2.747   2.656   1.00 0.00 ? 30  HIS A HD2  6  
ATOM   6185  H  HE1  . HIS A 1 30 ? -6.052  3.353   4.257   1.00 0.00 ? 30  HIS A HE1  6  
ATOM   6186  N  N    . ALA A 1 31 ? -10.408 8.164   0.599   1.00 0.00 ? 31  ALA A N    6  
ATOM   6187  C  CA   . ALA A 1 31 ? -10.783 9.060   -0.488  1.00 0.00 ? 31  ALA A CA   6  
ATOM   6188  C  C    . ALA A 1 31 ? -10.063 10.399  -0.368  1.00 0.00 ? 31  ALA A C    6  
ATOM   6189  O  O    . ALA A 1 31 ? -9.698  11.010  -1.372  1.00 0.00 ? 31  ALA A O    6  
ATOM   6190  C  CB   . ALA A 1 31 ? -12.290 9.269   -0.505  1.00 0.00 ? 31  ALA A CB   6  
ATOM   6191  H  H    . ALA A 1 31 ? -11.105 7.819   1.196   1.00 0.00 ? 31  ALA A H    6  
ATOM   6192  H  HA   . ALA A 1 31 ? -10.498 8.592   -1.420  1.00 0.00 ? 31  ALA A HA   6  
ATOM   6193  H  HB1  . ALA A 1 31 ? -12.507 10.294  -0.767  1.00 0.00 ? 31  ALA A HB1  6  
ATOM   6194  H  HB2  . ALA A 1 31 ? -12.736 8.608   -1.232  1.00 0.00 ? 31  ALA A HB2  6  
ATOM   6195  H  HB3  . ALA A 1 31 ? -12.693 9.054   0.473   1.00 0.00 ? 31  ALA A HB3  6  
ATOM   6196  N  N    . GLU A 1 32 ? -9.863  10.850  0.867   1.00 0.00 ? 32  GLU A N    6  
ATOM   6197  C  CA   . GLU A 1 32 ? -9.188  12.118  1.116   1.00 0.00 ? 32  GLU A CA   6  
ATOM   6198  C  C    . GLU A 1 32 ? -7.672  11.942  1.087   1.00 0.00 ? 32  GLU A C    6  
ATOM   6199  O  O    . GLU A 1 32 ? -6.942  12.819  0.622   1.00 0.00 ? 32  GLU A O    6  
ATOM   6200  C  CB   . GLU A 1 32 ? -9.620  12.694  2.466   1.00 0.00 ? 32  GLU A CB   6  
ATOM   6201  C  CG   . GLU A 1 32 ? -11.113 12.953  2.568   1.00 0.00 ? 32  GLU A CG   6  
ATOM   6202  C  CD   . GLU A 1 32 ? -11.553 14.160  1.761   1.00 0.00 ? 32  GLU A CD   6  
ATOM   6203  O  OE1  . GLU A 1 32 ? -11.684 14.031  0.526   1.00 0.00 ? 32  GLU A OE1  6  
ATOM   6204  O  OE2  . GLU A 1 32 ? -11.765 15.232  2.364   1.00 0.00 ? 32  GLU A OE2  6  
ATOM   6205  H  H    . GLU A 1 32 ? -10.177 10.318  1.627   1.00 0.00 ? 32  GLU A H    6  
ATOM   6206  H  HA   . GLU A 1 32 ? -9.473  12.805  0.334   1.00 0.00 ? 32  GLU A HA   6  
ATOM   6207  H  HB2  . GLU A 1 32 ? -9.341  12.000  3.246   1.00 0.00 ? 32  GLU A HB2  6  
ATOM   6208  H  HB3  . GLU A 1 32 ? -9.102  13.628  2.627   1.00 0.00 ? 32  GLU A HB3  6  
ATOM   6209  H  HG2  . GLU A 1 32 ? -11.642 12.085  2.204   1.00 0.00 ? 32  GLU A HG2  6  
ATOM   6210  H  HG3  . GLU A 1 32 ? -11.367 13.120  3.604   1.00 0.00 ? 32  GLU A HG3  6  
ATOM   6211  N  N    . THR A 1 33 ? -7.204  10.803  1.588   1.00 0.00 ? 33  THR A N    6  
ATOM   6212  C  CA   . THR A 1 33 ? -5.777  10.512  1.622   1.00 0.00 ? 33  THR A CA   6  
ATOM   6213  C  C    . THR A 1 33 ? -5.215  10.353  0.214   1.00 0.00 ? 33  THR A C    6  
ATOM   6214  O  O    . THR A 1 33 ? -4.210  10.971  -0.138  1.00 0.00 ? 33  THR A O    6  
ATOM   6215  C  CB   . THR A 1 33 ? -5.483  9.233   2.427   1.00 0.00 ? 33  THR A CB   6  
ATOM   6216  O  OG1  . THR A 1 33 ? -6.103  9.311   3.715   1.00 0.00 ? 33  THR A OG1  6  
ATOM   6217  C  CG2  . THR A 1 33 ? -3.985  9.028   2.592   1.00 0.00 ? 33  THR A CG2  6  
ATOM   6218  H  H    . THR A 1 33 ? -7.836  10.144  1.944   1.00 0.00 ? 33  THR A H    6  
ATOM   6219  H  HA   . THR A 1 33 ? -5.279  11.340  2.106   1.00 0.00 ? 33  THR A HA   6  
ATOM   6220  H  HB   . THR A 1 33 ? -5.890  8.387   1.891   1.00 0.00 ? 33  THR A HB   6  
ATOM   6221  H  HG1  . THR A 1 33 ? -5.451  9.575   4.369   1.00 0.00 ? 33  THR A HG1  6  
ATOM   6222  H  HG21 . THR A 1 33 ? -3.628  9.628   3.416   1.00 0.00 ? 33  THR A HG21 6  
ATOM   6223  H  HG22 . THR A 1 33 ? -3.479  9.325   1.685   1.00 0.00 ? 33  THR A HG22 6  
ATOM   6224  H  HG23 . THR A 1 33 ? -3.784  7.987   2.792   1.00 0.00 ? 33  THR A HG23 6  
ATOM   6225  N  N    . VAL A 1 34 ? -5.870  9.521   -0.589  1.00 0.00 ? 34  VAL A N    6  
ATOM   6226  C  CA   . VAL A 1 34 ? -5.436  9.282   -1.961  1.00 0.00 ? 34  VAL A CA   6  
ATOM   6227  C  C    . VAL A 1 34 ? -5.045  10.585  -2.648  1.00 0.00 ? 34  VAL A C    6  
ATOM   6228  O  O    . VAL A 1 34 ? -4.104  10.623  -3.441  1.00 0.00 ? 34  VAL A O    6  
ATOM   6229  C  CB   . VAL A 1 34 ? -6.538  8.591   -2.786  1.00 0.00 ? 34  VAL A CB   6  
ATOM   6230  C  CG1  . VAL A 1 34 ? -6.822  7.200   -2.238  1.00 0.00 ? 34  VAL A CG1  6  
ATOM   6231  C  CG2  . VAL A 1 34 ? -7.803  9.436   -2.799  1.00 0.00 ? 34  VAL A CG2  6  
ATOM   6232  H  H    . VAL A 1 34 ? -6.665  9.057   -0.252  1.00 0.00 ? 34  VAL A H    6  
ATOM   6233  H  HA   . VAL A 1 34 ? -4.576  8.630   -1.930  1.00 0.00 ? 34  VAL A HA   6  
ATOM   6234  H  HB   . VAL A 1 34 ? -6.188  8.488   -3.802  1.00 0.00 ? 34  VAL A HB   6  
ATOM   6235  H  HG11 . VAL A 1 34 ? -6.284  6.467   -2.821  1.00 0.00 ? 34  VAL A HG11 6  
ATOM   6236  H  HG12 . VAL A 1 34 ? -6.504  7.147   -1.207  1.00 0.00 ? 34  VAL A HG12 6  
ATOM   6237  H  HG13 . VAL A 1 34 ? -7.882  6.999   -2.299  1.00 0.00 ? 34  VAL A HG13 6  
ATOM   6238  H  HG21 . VAL A 1 34 ? -7.549  10.459  -3.032  1.00 0.00 ? 34  VAL A HG21 6  
ATOM   6239  H  HG22 . VAL A 1 34 ? -8.483  9.055   -3.547  1.00 0.00 ? 34  VAL A HG22 6  
ATOM   6240  H  HG23 . VAL A 1 34 ? -8.275  9.394   -1.829  1.00 0.00 ? 34  VAL A HG23 6  
ATOM   6241  N  N    . ALA A 1 35 ? -5.773  11.653  -2.339  1.00 0.00 ? 35  ALA A N    6  
ATOM   6242  C  CA   . ALA A 1 35 ? -5.500  12.960  -2.925  1.00 0.00 ? 35  ALA A CA   6  
ATOM   6243  C  C    . ALA A 1 35 ? -4.063  13.394  -2.654  1.00 0.00 ? 35  ALA A C    6  
ATOM   6244  O  O    . ALA A 1 35 ? -3.340  13.786  -3.569  1.00 0.00 ? 35  ALA A O    6  
ATOM   6245  C  CB   . ALA A 1 35 ? -6.477  13.994  -2.386  1.00 0.00 ? 35  ALA A CB   6  
ATOM   6246  H  H    . ALA A 1 35 ? -6.510  11.560  -1.701  1.00 0.00 ? 35  ALA A H    6  
ATOM   6247  H  HA   . ALA A 1 35 ? -5.647  12.884  -3.993  1.00 0.00 ? 35  ALA A HA   6  
ATOM   6248  H  HB1  . ALA A 1 35 ? -7.440  13.858  -2.856  1.00 0.00 ? 35  ALA A HB1  6  
ATOM   6249  H  HB2  . ALA A 1 35 ? -6.577  13.872  -1.318  1.00 0.00 ? 35  ALA A HB2  6  
ATOM   6250  H  HB3  . ALA A 1 35 ? -6.107  14.985  -2.602  1.00 0.00 ? 35  ALA A HB3  6  
ATOM   6251  N  N    . ALA A 1 36 ? -3.657  13.322  -1.391  1.00 0.00 ? 36  ALA A N    6  
ATOM   6252  C  CA   . ALA A 1 36 ? -2.306  13.706  -1.000  1.00 0.00 ? 36  ALA A CA   6  
ATOM   6253  C  C    . ALA A 1 36 ? -1.278  13.193  -2.002  1.00 0.00 ? 36  ALA A C    6  
ATOM   6254  O  O    . ALA A 1 36 ? -0.598  13.976  -2.666  1.00 0.00 ? 36  ALA A O    6  
ATOM   6255  C  CB   . ALA A 1 36 ? -1.992  13.185  0.395   1.00 0.00 ? 36  ALA A CB   6  
ATOM   6256  H  H    . ALA A 1 36 ? -4.279  13.001  -0.706  1.00 0.00 ? 36  ALA A H    6  
ATOM   6257  H  HA   . ALA A 1 36 ? -2.261  14.785  -0.974  1.00 0.00 ? 36  ALA A HA   6  
ATOM   6258  H  HB1  . ALA A 1 36 ? -1.108  13.679  0.771   1.00 0.00 ? 36  ALA A HB1  6  
ATOM   6259  H  HB2  . ALA A 1 36 ? -2.825  13.388  1.050   1.00 0.00 ? 36  ALA A HB2  6  
ATOM   6260  H  HB3  . ALA A 1 36 ? -1.818  12.121  0.351   1.00 0.00 ? 36  ALA A HB3  6  
ATOM   6261  N  N    . LEU A 1 37 ? -1.168  11.873  -2.107  1.00 0.00 ? 37  LEU A N    6  
ATOM   6262  C  CA   . LEU A 1 37 ? -0.221  11.255  -3.029  1.00 0.00 ? 37  LEU A CA   6  
ATOM   6263  C  C    . LEU A 1 37 ? -0.388  11.814  -4.438  1.00 0.00 ? 37  LEU A C    6  
ATOM   6264  O  O    . LEU A 1 37 ? -1.492  11.834  -4.982  1.00 0.00 ? 37  LEU A O    6  
ATOM   6265  C  CB   . LEU A 1 37 ? -0.412  9.737   -3.045  1.00 0.00 ? 37  LEU A CB   6  
ATOM   6266  C  CG   . LEU A 1 37 ? -0.672  9.079   -1.689  1.00 0.00 ? 37  LEU A CG   6  
ATOM   6267  C  CD1  . LEU A 1 37 ? 0.094   9.799   -0.590  1.00 0.00 ? 37  LEU A CD1  6  
ATOM   6268  C  CD2  . LEU A 1 37 ? -2.162  9.063   -1.381  1.00 0.00 ? 37  LEU A CD2  6  
ATOM   6269  H  H    . LEU A 1 37 ? -1.737  11.300  -1.552  1.00 0.00 ? 37  LEU A H    6  
ATOM   6270  H  HA   . LEU A 1 37 ? 0.776   11.480  -2.680  1.00 0.00 ? 37  LEU A HA   6  
ATOM   6271  H  HB2  . LEU A 1 37 ? -1.252  9.516   -3.686  1.00 0.00 ? 37  LEU A HB2  6  
ATOM   6272  H  HB3  . LEU A 1 37 ? 0.482   9.296   -3.462  1.00 0.00 ? 37  LEU A HB3  6  
ATOM   6273  H  HG   . LEU A 1 37 ? -0.325  8.055   -1.721  1.00 0.00 ? 37  LEU A HG   6  
ATOM   6274  H  HD11 . LEU A 1 37 ? 0.913   10.351  -1.025  1.00 0.00 ? 37  LEU A HD11 6  
ATOM   6275  H  HD12 . LEU A 1 37 ? 0.480   9.076   0.112   1.00 0.00 ? 37  LEU A HD12 6  
ATOM   6276  H  HD13 . LEU A 1 37 ? -0.569  10.481  -0.077  1.00 0.00 ? 37  LEU A HD13 6  
ATOM   6277  H  HD21 . LEU A 1 37 ? -2.459  8.065   -1.093  1.00 0.00 ? 37  LEU A HD21 6  
ATOM   6278  H  HD22 . LEU A 1 37 ? -2.715  9.364   -2.259  1.00 0.00 ? 37  LEU A HD22 6  
ATOM   6279  H  HD23 . LEU A 1 37 ? -2.370  9.748   -0.572  1.00 0.00 ? 37  LEU A HD23 6  
ATOM   6280  N  N    . ARG A 1 38 ? 0.716   12.266  -5.024  1.00 0.00 ? 38  ARG A N    6  
ATOM   6281  C  CA   . ARG A 1 38 ? 0.692   12.826  -6.370  1.00 0.00 ? 38  ARG A CA   6  
ATOM   6282  C  C    . ARG A 1 38 ? 1.546   11.991  -7.320  1.00 0.00 ? 38  ARG A C    6  
ATOM   6283  O  O    . ARG A 1 38 ? 1.251   11.891  -8.511  1.00 0.00 ? 38  ARG A O    6  
ATOM   6284  C  CB   . ARG A 1 38 ? 1.192   14.271  -6.354  1.00 0.00 ? 38  ARG A CB   6  
ATOM   6285  C  CG   . ARG A 1 38 ? 0.760   15.051  -5.123  1.00 0.00 ? 38  ARG A CG   6  
ATOM   6286  C  CD   . ARG A 1 38 ? 1.804   14.975  -4.020  1.00 0.00 ? 38  ARG A CD   6  
ATOM   6287  N  NE   . ARG A 1 38 ? 1.314   15.532  -2.762  1.00 0.00 ? 38  ARG A NE   6  
ATOM   6288  C  CZ   . ARG A 1 38 ? 1.364   16.825  -2.462  1.00 0.00 ? 38  ARG A CZ   6  
ATOM   6289  N  NH1  . ARG A 1 38 ? 1.880   17.690  -3.325  1.00 0.00 ? 38  ARG A NH1  6  
ATOM   6290  N  NH2  . ARG A 1 38 ? 0.897   17.256  -1.297  1.00 0.00 ? 38  ARG A NH2  6  
ATOM   6291  H  H    . ARG A 1 38 ? 1.567   12.224  -4.539  1.00 0.00 ? 38  ARG A H    6  
ATOM   6292  H  HA   . ARG A 1 38 ? -0.330  12.811  -6.717  1.00 0.00 ? 38  ARG A HA   6  
ATOM   6293  H  HB2  . ARG A 1 38 ? 2.271   14.267  -6.389  1.00 0.00 ? 38  ARG A HB2  6  
ATOM   6294  H  HB3  . ARG A 1 38 ? 0.812   14.780  -7.227  1.00 0.00 ? 38  ARG A HB3  6  
ATOM   6295  H  HG2  . ARG A 1 38 ? 0.616   16.086  -5.396  1.00 0.00 ? 38  ARG A HG2  6  
ATOM   6296  H  HG3  . ARG A 1 38 ? -0.170  14.641  -4.756  1.00 0.00 ? 38  ARG A HG3  6  
ATOM   6297  H  HD2  . ARG A 1 38 ? 2.069   13.940  -3.865  1.00 0.00 ? 38  ARG A HD2  6  
ATOM   6298  H  HD3  . ARG A 1 38 ? 2.678   15.527  -4.332  1.00 0.00 ? 38  ARG A HD3  6  
ATOM   6299  H  HE   . ARG A 1 38 ? 0.928   14.911  -2.110  1.00 0.00 ? 38  ARG A HE   6  
ATOM   6300  H  HH11 . ARG A 1 38 ? 2.231   17.368  -4.204  1.00 0.00 ? 38  ARG A HH11 6  
ATOM   6301  H  HH12 . ARG A 1 38 ? 1.916   18.663  -3.097  1.00 0.00 ? 38  ARG A HH12 6  
ATOM   6302  H  HH21 . ARG A 1 38 ? 0.508   16.607  -0.644  1.00 0.00 ? 38  ARG A HH21 6  
ATOM   6303  H  HH22 . ARG A 1 38 ? 0.936   18.229  -1.072  1.00 0.00 ? 38  ARG A HH22 6  
ATOM   6304  N  N    . PHE A 1 39 ? 2.607   11.395  -6.786  1.00 0.00 ? 39  PHE A N    6  
ATOM   6305  C  CA   . PHE A 1 39 ? 3.505   10.571  -7.586  1.00 0.00 ? 39  PHE A CA   6  
ATOM   6306  C  C    . PHE A 1 39 ? 3.189   9.089   -7.405  1.00 0.00 ? 39  PHE A C    6  
ATOM   6307  O  O    . PHE A 1 39 ? 3.551   8.469   -6.405  1.00 0.00 ? 39  PHE A O    6  
ATOM   6308  C  CB   . PHE A 1 39 ? 4.960   10.845  -7.202  1.00 0.00 ? 39  PHE A CB   6  
ATOM   6309  C  CG   . PHE A 1 39 ? 5.292   12.307  -7.113  1.00 0.00 ? 39  PHE A CG   6  
ATOM   6310  C  CD1  . PHE A 1 39 ? 4.885   13.059  -6.022  1.00 0.00 ? 39  PHE A CD1  6  
ATOM   6311  C  CD2  . PHE A 1 39 ? 6.012   12.930  -8.120  1.00 0.00 ? 39  PHE A CD2  6  
ATOM   6312  C  CE1  . PHE A 1 39 ? 5.189   14.404  -5.939  1.00 0.00 ? 39  PHE A CE1  6  
ATOM   6313  C  CE2  . PHE A 1 39 ? 6.319   14.275  -8.042  1.00 0.00 ? 39  PHE A CE2  6  
ATOM   6314  C  CZ   . PHE A 1 39 ? 5.907   15.013  -6.949  1.00 0.00 ? 39  PHE A CZ   6  
ATOM   6315  H  H    . PHE A 1 39 ? 2.790   11.513  -5.830  1.00 0.00 ? 39  PHE A H    6  
ATOM   6316  H  HA   . PHE A 1 39 ? 3.359   10.834  -8.622  1.00 0.00 ? 39  PHE A HA   6  
ATOM   6317  H  HB2  . PHE A 1 39 ? 5.160   10.401  -6.238  1.00 0.00 ? 39  PHE A HB2  6  
ATOM   6318  H  HB3  . PHE A 1 39 ? 5.610   10.400  -7.940  1.00 0.00 ? 39  PHE A HB3  6  
ATOM   6319  H  HD1  . PHE A 1 39 ? 4.324   12.584  -5.231  1.00 0.00 ? 39  PHE A HD1  6  
ATOM   6320  H  HD2  . PHE A 1 39 ? 6.334   12.353  -8.976  1.00 0.00 ? 39  PHE A HD2  6  
ATOM   6321  H  HE1  . PHE A 1 39 ? 4.866   14.979  -5.084  1.00 0.00 ? 39  PHE A HE1  6  
ATOM   6322  H  HE2  . PHE A 1 39 ? 6.881   14.748  -8.834  1.00 0.00 ? 39  PHE A HE2  6  
ATOM   6323  H  HZ   . PHE A 1 39 ? 6.145   16.064  -6.887  1.00 0.00 ? 39  PHE A HZ   6  
ATOM   6324  N  N    . PRO A 1 40 ? 2.497   8.507   -8.396  1.00 0.00 ? 40  PRO A N    6  
ATOM   6325  C  CA   . PRO A 1 40 ? 2.117   7.092   -8.370  1.00 0.00 ? 40  PRO A CA   6  
ATOM   6326  C  C    . PRO A 1 40 ? 3.317   6.166   -8.533  1.00 0.00 ? 40  PRO A C    6  
ATOM   6327  O  O    . PRO A 1 40 ? 4.427   6.616   -8.820  1.00 0.00 ? 40  PRO A O    6  
ATOM   6328  C  CB   . PRO A 1 40 ? 1.171   6.957   -9.566  1.00 0.00 ? 40  PRO A CB   6  
ATOM   6329  C  CG   . PRO A 1 40 ? 1.573   8.053   -10.492 1.00 0.00 ? 40  PRO A CG   6  
ATOM   6330  C  CD   . PRO A 1 40 ? 2.033   9.186   -9.617  1.00 0.00 ? 40  PRO A CD   6  
ATOM   6331  H  HA   . PRO A 1 40 ? 1.589   6.839   -7.462  1.00 0.00 ? 40  PRO A HA   6  
ATOM   6332  H  HB2  . PRO A 1 40 ? 1.301   5.985   -10.023 1.00 0.00 ? 40  PRO A HB2  6  
ATOM   6333  H  HB3  . PRO A 1 40 ? 0.150   7.073   -9.237  1.00 0.00 ? 40  PRO A HB3  6  
ATOM   6334  H  HG2  . PRO A 1 40 ? 2.378   7.719   -11.128 1.00 0.00 ? 40  PRO A HG2  6  
ATOM   6335  H  HG3  . PRO A 1 40 ? 0.725   8.359   -11.087 1.00 0.00 ? 40  PRO A HG3  6  
ATOM   6336  H  HD2  . PRO A 1 40 ? 2.841   9.724   -10.090 1.00 0.00 ? 40  PRO A HD2  6  
ATOM   6337  H  HD3  . PRO A 1 40 ? 1.211   9.852   -9.399  1.00 0.00 ? 40  PRO A HD3  6  
ATOM   6338  N  N    . CYS A 1 41 ? 3.089   4.870   -8.348  1.00 0.00 ? 41  CYS A N    6  
ATOM   6339  C  CA   . CYS A 1 41 ? 4.151   3.880   -8.474  1.00 0.00 ? 41  CYS A CA   6  
ATOM   6340  C  C    . CYS A 1 41 ? 4.004   3.086   -9.769  1.00 0.00 ? 41  CYS A C    6  
ATOM   6341  O  O    . CYS A 1 41 ? 3.131   2.226   -9.885  1.00 0.00 ? 41  CYS A O    6  
ATOM   6342  C  CB   . CYS A 1 41 ? 4.136   2.929   -7.276  1.00 0.00 ? 41  CYS A CB   6  
ATOM   6343  S  SG   . CYS A 1 41 ? 5.632   1.900   -7.124  1.00 0.00 ? 41  CYS A SG   6  
ATOM   6344  H  H    . CYS A 1 41 ? 2.182   4.572   -8.120  1.00 0.00 ? 41  CYS A H    6  
ATOM   6345  H  HA   . CYS A 1 41 ? 5.094   4.405   -8.494  1.00 0.00 ? 41  CYS A HA   6  
ATOM   6346  H  HB2  . CYS A 1 41 ? 4.044   3.508   -6.368  1.00 0.00 ? 41  CYS A HB2  6  
ATOM   6347  H  HB3  . CYS A 1 41 ? 3.288   2.267   -7.362  1.00 0.00 ? 41  CYS A HB3  6  
ATOM   6348  N  N    . GLU A 1 42 ? 4.864   3.381   -10.739 1.00 0.00 ? 42  GLU A N    6  
ATOM   6349  C  CA   . GLU A 1 42 ? 4.828   2.695   -12.025 1.00 0.00 ? 42  GLU A CA   6  
ATOM   6350  C  C    . GLU A 1 42 ? 5.199   1.223   -11.867 1.00 0.00 ? 42  GLU A C    6  
ATOM   6351  O  O    . GLU A 1 42 ? 5.193   0.462   -12.835 1.00 0.00 ? 42  GLU A O    6  
ATOM   6352  C  CB   . GLU A 1 42 ? 5.781   3.369   -13.014 1.00 0.00 ? 42  GLU A CB   6  
ATOM   6353  C  CG   . GLU A 1 42 ? 7.249   3.129   -12.704 1.00 0.00 ? 42  GLU A CG   6  
ATOM   6354  C  CD   . GLU A 1 42 ? 8.165   3.599   -13.818 1.00 0.00 ? 42  GLU A CD   6  
ATOM   6355  O  OE1  . GLU A 1 42 ? 7.938   4.708   -14.345 1.00 0.00 ? 42  GLU A OE1  6  
ATOM   6356  O  OE2  . GLU A 1 42 ? 9.109   2.858   -14.162 1.00 0.00 ? 42  GLU A OE2  6  
ATOM   6357  H  H    . GLU A 1 42 ? 5.537   4.076   -10.586 1.00 0.00 ? 42  GLU A H    6  
ATOM   6358  H  HA   . GLU A 1 42 ? 3.821   2.761   -12.408 1.00 0.00 ? 42  GLU A HA   6  
ATOM   6359  H  HB2  . GLU A 1 42 ? 5.577   2.992   -14.006 1.00 0.00 ? 42  GLU A HB2  6  
ATOM   6360  H  HB3  . GLU A 1 42 ? 5.601   4.434   -13.000 1.00 0.00 ? 42  GLU A HB3  6  
ATOM   6361  H  HG2  . GLU A 1 42 ? 7.505   3.661   -11.800 1.00 0.00 ? 42  GLU A HG2  6  
ATOM   6362  H  HG3  . GLU A 1 42 ? 7.404   2.071   -12.554 1.00 0.00 ? 42  GLU A HG3  6  
ATOM   6363  N  N    . PHE A 1 43 ? 5.522   0.829   -10.640 1.00 0.00 ? 43  PHE A N    6  
ATOM   6364  C  CA   . PHE A 1 43 ? 5.897   -0.551  -10.354 1.00 0.00 ? 43  PHE A CA   6  
ATOM   6365  C  C    . PHE A 1 43 ? 4.674   -1.380  -9.973  1.00 0.00 ? 43  PHE A C    6  
ATOM   6366  O  O    . PHE A 1 43 ? 4.429   -2.444  -10.542 1.00 0.00 ? 43  PHE A O    6  
ATOM   6367  C  CB   . PHE A 1 43 ? 6.930   -0.598  -9.226  1.00 0.00 ? 43  PHE A CB   6  
ATOM   6368  C  CG   . PHE A 1 43 ? 8.351   -0.593  -9.713  1.00 0.00 ? 43  PHE A CG   6  
ATOM   6369  C  CD1  . PHE A 1 43 ? 8.933   -1.751  -10.203 1.00 0.00 ? 43  PHE A CD1  6  
ATOM   6370  C  CD2  . PHE A 1 43 ? 9.105   0.569   -9.681  1.00 0.00 ? 43  PHE A CD2  6  
ATOM   6371  C  CE1  . PHE A 1 43 ? 10.240  -1.751  -10.653 1.00 0.00 ? 43  PHE A CE1  6  
ATOM   6372  C  CE2  . PHE A 1 43 ? 10.412  0.575   -10.130 1.00 0.00 ? 43  PHE A CE2  6  
ATOM   6373  C  CZ   . PHE A 1 43 ? 10.981  -0.586  -10.615 1.00 0.00 ? 43  PHE A CZ   6  
ATOM   6374  H  H    . PHE A 1 43 ? 5.508   1.482   -9.909  1.00 0.00 ? 43  PHE A H    6  
ATOM   6375  H  HA   . PHE A 1 43 ? 6.335   -0.967  -11.248 1.00 0.00 ? 43  PHE A HA   6  
ATOM   6376  H  HB2  . PHE A 1 43 ? 6.796   0.264   -8.589  1.00 0.00 ? 43  PHE A HB2  6  
ATOM   6377  H  HB3  . PHE A 1 43 ? 6.779   -1.496  -8.646  1.00 0.00 ? 43  PHE A HB3  6  
ATOM   6378  H  HD1  . PHE A 1 43 ? 8.353   -2.664  -10.233 1.00 0.00 ? 43  PHE A HD1  6  
ATOM   6379  H  HD2  . PHE A 1 43 ? 8.662   1.477   -9.300  1.00 0.00 ? 43  PHE A HD2  6  
ATOM   6380  H  HE1  . PHE A 1 43 ? 10.681  -2.661  -11.032 1.00 0.00 ? 43  PHE A HE1  6  
ATOM   6381  H  HE2  . PHE A 1 43 ? 10.989  1.487   -10.099 1.00 0.00 ? 43  PHE A HE2  6  
ATOM   6382  H  HZ   . PHE A 1 43 ? 12.001  -0.583  -10.967 1.00 0.00 ? 43  PHE A HZ   6  
ATOM   6383  N  N    . CYS A 1 44 ? 3.909   -0.884  -9.006  1.00 0.00 ? 44  CYS A N    6  
ATOM   6384  C  CA   . CYS A 1 44 ? 2.712   -1.577  -8.547  1.00 0.00 ? 44  CYS A CA   6  
ATOM   6385  C  C    . CYS A 1 44 ? 1.466   -0.731  -8.791  1.00 0.00 ? 44  CYS A C    6  
ATOM   6386  O  O    . CYS A 1 44 ? 0.400   -1.254  -9.114  1.00 0.00 ? 44  CYS A O    6  
ATOM   6387  C  CB   . CYS A 1 44 ? 2.830   -1.913  -7.059  1.00 0.00 ? 44  CYS A CB   6  
ATOM   6388  S  SG   . CYS A 1 44 ? 3.048   -0.458  -5.983  1.00 0.00 ? 44  CYS A SG   6  
ATOM   6389  H  H    . CYS A 1 44 ? 4.156   -0.031  -8.590  1.00 0.00 ? 44  CYS A H    6  
ATOM   6390  H  HA   . CYS A 1 44 ? 2.623   -2.495  -9.108  1.00 0.00 ? 44  CYS A HA   6  
ATOM   6391  H  HB2  . CYS A 1 44 ? 1.933   -2.424  -6.740  1.00 0.00 ? 44  CYS A HB2  6  
ATOM   6392  H  HB3  . CYS A 1 44 ? 3.680   -2.562  -6.910  1.00 0.00 ? 44  CYS A HB3  6  
ATOM   6393  N  N    . GLY A 1 45 ? 1.609   0.582   -8.633  1.00 0.00 ? 45  GLY A N    6  
ATOM   6394  C  CA   . GLY A 1 45 ? 0.488   1.480   -8.840  1.00 0.00 ? 45  GLY A CA   6  
ATOM   6395  C  C    . GLY A 1 45 ? 0.232   2.373   -7.642  1.00 0.00 ? 45  GLY A C    6  
ATOM   6396  O  O    . GLY A 1 45 ? -0.569  3.306   -7.714  1.00 0.00 ? 45  GLY A O    6  
ATOM   6397  H  H    . GLY A 1 45 ? 2.482   0.943   -8.374  1.00 0.00 ? 45  GLY A H    6  
ATOM   6398  H  HA2  . GLY A 1 45 ? 0.691   2.100   -9.701  1.00 0.00 ? 45  GLY A HA2  6  
ATOM   6399  H  HA3  . GLY A 1 45 ? -0.398  0.893   -9.033  1.00 0.00 ? 45  GLY A HA3  6  
ATOM   6400  N  N    . LYS A 1 46 ? 0.911   2.087   -6.537  1.00 0.00 ? 46  LYS A N    6  
ATOM   6401  C  CA   . LYS A 1 46 ? 0.753   2.870   -5.317  1.00 0.00 ? 46  LYS A CA   6  
ATOM   6402  C  C    . LYS A 1 46 ? 0.938   4.358   -5.598  1.00 0.00 ? 46  LYS A C    6  
ATOM   6403  O  O    . LYS A 1 46 ? 1.173   4.759   -6.738  1.00 0.00 ? 46  LYS A O    6  
ATOM   6404  C  CB   . LYS A 1 46 ? 1.759   2.411   -4.258  1.00 0.00 ? 46  LYS A CB   6  
ATOM   6405  C  CG   . LYS A 1 46 ? 1.257   1.263   -3.400  1.00 0.00 ? 46  LYS A CG   6  
ATOM   6406  C  CD   . LYS A 1 46 ? 2.265   0.887   -2.327  1.00 0.00 ? 46  LYS A CD   6  
ATOM   6407  C  CE   . LYS A 1 46 ? 2.078   1.723   -1.070  1.00 0.00 ? 46  LYS A CE   6  
ATOM   6408  N  NZ   . LYS A 1 46 ? 0.916   1.258   -0.262  1.00 0.00 ? 46  LYS A NZ   6  
ATOM   6409  H  H    . LYS A 1 46 ? 1.534   1.330   -6.542  1.00 0.00 ? 46  LYS A H    6  
ATOM   6410  H  HA   . LYS A 1 46 ? -0.247  2.707   -4.945  1.00 0.00 ? 46  LYS A HA   6  
ATOM   6411  H  HB2  . LYS A 1 46 ? 2.665   2.094   -4.753  1.00 0.00 ? 46  LYS A HB2  6  
ATOM   6412  H  HB3  . LYS A 1 46 ? 1.986   3.245   -3.610  1.00 0.00 ? 46  LYS A HB3  6  
ATOM   6413  H  HG2  . LYS A 1 46 ? 0.334   1.557   -2.924  1.00 0.00 ? 46  LYS A HG2  6  
ATOM   6414  H  HG3  . LYS A 1 46 ? 1.081   0.404   -4.032  1.00 0.00 ? 46  LYS A HG3  6  
ATOM   6415  H  HD2  . LYS A 1 46 ? 2.138   -0.155  -2.075  1.00 0.00 ? 46  LYS A HD2  6  
ATOM   6416  H  HD3  . LYS A 1 46 ? 3.263   1.048   -2.710  1.00 0.00 ? 46  LYS A HD3  6  
ATOM   6417  H  HE2  . LYS A 1 46 ? 2.972   1.653   -0.470  1.00 0.00 ? 46  LYS A HE2  6  
ATOM   6418  H  HE3  . LYS A 1 46 ? 1.916   2.751   -1.358  1.00 0.00 ? 46  LYS A HE3  6  
ATOM   6419  H  HZ1  . LYS A 1 46 ? 0.839   0.221   -0.311  1.00 0.00 ? 46  LYS A HZ1  6  
ATOM   6420  H  HZ2  . LYS A 1 46 ? 0.037   1.676   -0.627  1.00 0.00 ? 46  LYS A HZ2  6  
ATOM   6421  H  HZ3  . LYS A 1 46 ? 1.036   1.539   0.732   1.00 0.00 ? 46  LYS A HZ3  6  
ATOM   6422  N  N    . ARG A 1 47 ? 0.831   5.170   -4.552  1.00 0.00 ? 47  ARG A N    6  
ATOM   6423  C  CA   . ARG A 1 47 ? 0.986   6.614   -4.687  1.00 0.00 ? 47  ARG A CA   6  
ATOM   6424  C  C    . ARG A 1 47 ? 1.600   7.215   -3.425  1.00 0.00 ? 47  ARG A C    6  
ATOM   6425  O  O    . ARG A 1 47 ? 1.329   6.761   -2.313  1.00 0.00 ? 47  ARG A O    6  
ATOM   6426  C  CB   . ARG A 1 47 ? -0.367  7.270   -4.970  1.00 0.00 ? 47  ARG A CB   6  
ATOM   6427  C  CG   . ARG A 1 47 ? -0.996  6.825   -6.280  1.00 0.00 ? 47  ARG A CG   6  
ATOM   6428  C  CD   . ARG A 1 47 ? -2.386  7.415   -6.459  1.00 0.00 ? 47  ARG A CD   6  
ATOM   6429  N  NE   . ARG A 1 47 ? -2.910  7.186   -7.803  1.00 0.00 ? 47  ARG A NE   6  
ATOM   6430  C  CZ   . ARG A 1 47 ? -3.426  6.029   -8.203  1.00 0.00 ? 47  ARG A CZ   6  
ATOM   6431  N  NH1  . ARG A 1 47 ? -3.489  5.002   -7.366  1.00 0.00 ? 47  ARG A NH1  6  
ATOM   6432  N  NH2  . ARG A 1 47 ? -3.882  5.898   -9.442  1.00 0.00 ? 47  ARG A NH2  6  
ATOM   6433  H  H    . ARG A 1 47 ? 0.642   4.791   -3.668  1.00 0.00 ? 47  ARG A H    6  
ATOM   6434  H  HA   . ARG A 1 47 ? 1.648   6.800   -5.519  1.00 0.00 ? 47  ARG A HA   6  
ATOM   6435  H  HB2  . ARG A 1 47 ? -1.048  7.025   -4.168  1.00 0.00 ? 47  ARG A HB2  6  
ATOM   6436  H  HB3  . ARG A 1 47 ? -0.233  8.340   -5.005  1.00 0.00 ? 47  ARG A HB3  6  
ATOM   6437  H  HG2  . ARG A 1 47 ? -0.371  7.151   -7.098  1.00 0.00 ? 47  ARG A HG2  6  
ATOM   6438  H  HG3  . ARG A 1 47 ? -1.068  5.747   -6.287  1.00 0.00 ? 47  ARG A HG3  6  
ATOM   6439  H  HD2  . ARG A 1 47 ? -3.052  6.959   -5.741  1.00 0.00 ? 47  ARG A HD2  6  
ATOM   6440  H  HD3  . ARG A 1 47 ? -2.337  8.478   -6.278  1.00 0.00 ? 47  ARG A HD3  6  
ATOM   6441  H  HE   . ARG A 1 47 ? -2.874  7.931   -8.437  1.00 0.00 ? 47  ARG A HE   6  
ATOM   6442  H  HH11 . ARG A 1 47 ? -3.147  5.099   -6.432  1.00 0.00 ? 47  ARG A HH11 6  
ATOM   6443  H  HH12 . ARG A 1 47 ? -3.879  4.133   -7.670  1.00 0.00 ? 47  ARG A HH12 6  
ATOM   6444  H  HH21 . ARG A 1 47 ? -3.837  6.670   -10.075 1.00 0.00 ? 47  ARG A HH21 6  
ATOM   6445  H  HH22 . ARG A 1 47 ? -4.271  5.027   -9.742  1.00 0.00 ? 47  ARG A HH22 6  
ATOM   6446  N  N    . PHE A 1 48 ? 2.430   8.237   -3.607  1.00 0.00 ? 48  PHE A N    6  
ATOM   6447  C  CA   . PHE A 1 48 ? 3.084   8.899   -2.484  1.00 0.00 ? 48  PHE A CA   6  
ATOM   6448  C  C    . PHE A 1 48 ? 2.965   10.415  -2.603  1.00 0.00 ? 48  PHE A C    6  
ATOM   6449  O  O    . PHE A 1 48 ? 2.850   10.955  -3.703  1.00 0.00 ? 48  PHE A O    6  
ATOM   6450  C  CB   . PHE A 1 48 ? 4.558   8.496   -2.415  1.00 0.00 ? 48  PHE A CB   6  
ATOM   6451  C  CG   . PHE A 1 48 ? 4.768   7.017   -2.257  1.00 0.00 ? 48  PHE A CG   6  
ATOM   6452  C  CD1  . PHE A 1 48 ? 4.297   6.131   -3.213  1.00 0.00 ? 48  PHE A CD1  6  
ATOM   6453  C  CD2  . PHE A 1 48 ? 5.438   6.513   -1.154  1.00 0.00 ? 48  PHE A CD2  6  
ATOM   6454  C  CE1  . PHE A 1 48 ? 4.489   4.770   -3.069  1.00 0.00 ? 48  PHE A CE1  6  
ATOM   6455  C  CE2  . PHE A 1 48 ? 5.633   5.153   -1.005  1.00 0.00 ? 48  PHE A CE2  6  
ATOM   6456  C  CZ   . PHE A 1 48 ? 5.158   4.280   -1.964  1.00 0.00 ? 48  PHE A CZ   6  
ATOM   6457  H  H    . PHE A 1 48 ? 2.607   8.553   -4.518  1.00 0.00 ? 48  PHE A H    6  
ATOM   6458  H  HA   . PHE A 1 48 ? 2.590   8.581   -1.579  1.00 0.00 ? 48  PHE A HA   6  
ATOM   6459  H  HB2  . PHE A 1 48 ? 5.051   8.805   -3.325  1.00 0.00 ? 48  PHE A HB2  6  
ATOM   6460  H  HB3  . PHE A 1 48 ? 5.020   8.990   -1.574  1.00 0.00 ? 48  PHE A HB3  6  
ATOM   6461  H  HD1  . PHE A 1 48 ? 3.774   6.512   -4.077  1.00 0.00 ? 48  PHE A HD1  6  
ATOM   6462  H  HD2  . PHE A 1 48 ? 5.810   7.195   -0.402  1.00 0.00 ? 48  PHE A HD2  6  
ATOM   6463  H  HE1  . PHE A 1 48 ? 4.117   4.089   -3.821  1.00 0.00 ? 48  PHE A HE1  6  
ATOM   6464  H  HE2  . PHE A 1 48 ? 6.157   4.774   -0.140  1.00 0.00 ? 48  PHE A HE2  6  
ATOM   6465  H  HZ   . PHE A 1 48 ? 5.309   3.217   -1.850  1.00 0.00 ? 48  PHE A HZ   6  
ATOM   6466  N  N    . GLU A 1 49 ? 2.993   11.096  -1.461  1.00 0.00 ? 49  GLU A N    6  
ATOM   6467  C  CA   . GLU A 1 49 ? 2.886   12.551  -1.437  1.00 0.00 ? 49  GLU A CA   6  
ATOM   6468  C  C    . GLU A 1 49 ? 4.070   13.194  -2.154  1.00 0.00 ? 49  GLU A C    6  
ATOM   6469  O  O    . GLU A 1 49 ? 4.021   14.367  -2.527  1.00 0.00 ? 49  GLU A O    6  
ATOM   6470  C  CB   . GLU A 1 49 ? 2.814   13.055  0.005   1.00 0.00 ? 49  GLU A CB   6  
ATOM   6471  C  CG   . GLU A 1 49 ? 3.822   12.397  0.932   1.00 0.00 ? 49  GLU A CG   6  
ATOM   6472  C  CD   . GLU A 1 49 ? 4.244   13.302  2.072   1.00 0.00 ? 49  GLU A CD   6  
ATOM   6473  O  OE1  . GLU A 1 49 ? 4.087   14.534  1.941   1.00 0.00 ? 49  GLU A OE1  6  
ATOM   6474  O  OE2  . GLU A 1 49 ? 4.732   12.780  3.096   1.00 0.00 ? 49  GLU A OE2  6  
ATOM   6475  H  H    . GLU A 1 49 ? 3.086   10.610  -0.616  1.00 0.00 ? 49  GLU A H    6  
ATOM   6476  H  HA   . GLU A 1 49 ? 1.977   12.825  -1.951  1.00 0.00 ? 49  GLU A HA   6  
ATOM   6477  H  HB2  . GLU A 1 49 ? 2.992   14.120  0.011   1.00 0.00 ? 49  GLU A HB2  6  
ATOM   6478  H  HB3  . GLU A 1 49 ? 1.824   12.863  0.391   1.00 0.00 ? 49  GLU A HB3  6  
ATOM   6479  H  HG2  . GLU A 1 49 ? 3.381   11.503  1.346   1.00 0.00 ? 49  GLU A HG2  6  
ATOM   6480  H  HG3  . GLU A 1 49 ? 4.699   12.132  0.359   1.00 0.00 ? 49  GLU A HG3  6  
ATOM   6481  N  N    . LYS A 1 50 ? 5.132   12.419  -2.343  1.00 0.00 ? 50  LYS A N    6  
ATOM   6482  C  CA   . LYS A 1 50 ? 6.329   12.912  -3.015  1.00 0.00 ? 50  LYS A CA   6  
ATOM   6483  C  C    . LYS A 1 50 ? 7.092   11.767  -3.674  1.00 0.00 ? 50  LYS A C    6  
ATOM   6484  O  O    . LYS A 1 50 ? 6.890   10.593  -3.362  1.00 0.00 ? 50  LYS A O    6  
ATOM   6485  C  CB   . LYS A 1 50 ? 7.237   13.637  -2.019  1.00 0.00 ? 50  LYS A CB   6  
ATOM   6486  C  CG   . LYS A 1 50 ? 7.081   13.150  -0.589  1.00 0.00 ? 50  LYS A CG   6  
ATOM   6487  C  CD   . LYS A 1 50 ? 8.162   13.720  0.315   1.00 0.00 ? 50  LYS A CD   6  
ATOM   6488  C  CE   . LYS A 1 50 ? 7.833   15.141  0.749   1.00 0.00 ? 50  LYS A CE   6  
ATOM   6489  N  NZ   . LYS A 1 50 ? 6.999   15.165  1.983   1.00 0.00 ? 50  LYS A NZ   6  
ATOM   6490  H  H    . LYS A 1 50 ? 5.111   11.493  -2.023  1.00 0.00 ? 50  LYS A H    6  
ATOM   6491  H  HA   . LYS A 1 50 ? 6.018   13.608  -3.779  1.00 0.00 ? 50  LYS A HA   6  
ATOM   6492  H  HB2  . LYS A 1 50 ? 8.265   13.494  -2.317  1.00 0.00 ? 50  LYS A HB2  6  
ATOM   6493  H  HB3  . LYS A 1 50 ? 7.007   14.693  -2.044  1.00 0.00 ? 50  LYS A HB3  6  
ATOM   6494  H  HG2  . LYS A 1 50 ? 6.116   13.458  -0.216  1.00 0.00 ? 50  LYS A HG2  6  
ATOM   6495  H  HG3  . LYS A 1 50 ? 7.147   12.071  -0.576  1.00 0.00 ? 50  LYS A HG3  6  
ATOM   6496  H  HD2  . LYS A 1 50 ? 8.250   13.099  1.193   1.00 0.00 ? 50  LYS A HD2  6  
ATOM   6497  H  HD3  . LYS A 1 50 ? 9.101   13.725  -0.220  1.00 0.00 ? 50  LYS A HD3  6  
ATOM   6498  H  HE2  . LYS A 1 50 ? 8.755   15.668  0.938   1.00 0.00 ? 50  LYS A HE2  6  
ATOM   6499  H  HE3  . LYS A 1 50 ? 7.295   15.631  -0.049  1.00 0.00 ? 50  LYS A HE3  6  
ATOM   6500  H  HZ1  . LYS A 1 50 ? 6.321   14.376  1.970   1.00 0.00 ? 50  LYS A HZ1  6  
ATOM   6501  H  HZ2  . LYS A 1 50 ? 6.472   16.059  2.040   1.00 0.00 ? 50  LYS A HZ2  6  
ATOM   6502  H  HZ3  . LYS A 1 50 ? 7.603   15.075  2.824   1.00 0.00 ? 50  LYS A HZ3  6  
ATOM   6503  N  N    . PRO A 1 51 ? 7.992   12.114  -4.607  1.00 0.00 ? 51  PRO A N    6  
ATOM   6504  C  CA   . PRO A 1 51 ? 8.805   11.130  -5.328  1.00 0.00 ? 51  PRO A CA   6  
ATOM   6505  C  C    . PRO A 1 51 ? 9.845   10.469  -4.430  1.00 0.00 ? 51  PRO A C    6  
ATOM   6506  O  O    . PRO A 1 51 ? 10.067  9.260   -4.508  1.00 0.00 ? 51  PRO A O    6  
ATOM   6507  C  CB   . PRO A 1 51 ? 9.488   11.963  -6.415  1.00 0.00 ? 51  PRO A CB   6  
ATOM   6508  C  CG   . PRO A 1 51 ? 9.526   13.347  -5.864  1.00 0.00 ? 51  PRO A CG   6  
ATOM   6509  C  CD   . PRO A 1 51 ? 8.285   13.494  -5.029  1.00 0.00 ? 51  PRO A CD   6  
ATOM   6510  H  HA   . PRO A 1 51 ? 8.191   10.369  -5.787  1.00 0.00 ? 51  PRO A HA   6  
ATOM   6511  H  HB2  . PRO A 1 51 ? 10.484  11.580  -6.593  1.00 0.00 ? 51  PRO A HB2  6  
ATOM   6512  H  HB3  . PRO A 1 51 ? 8.911   11.916  -7.326  1.00 0.00 ? 51  PRO A HB3  6  
ATOM   6513  H  HG2  . PRO A 1 51 ? 10.407  13.475  -5.253  1.00 0.00 ? 51  PRO A HG2  6  
ATOM   6514  H  HG3  . PRO A 1 51 ? 9.521   14.063  -6.673  1.00 0.00 ? 51  PRO A HG3  6  
ATOM   6515  H  HD2  . PRO A 1 51 ? 8.477   14.126  -4.175  1.00 0.00 ? 51  PRO A HD2  6  
ATOM   6516  H  HD3  . PRO A 1 51 ? 7.476   13.895  -5.622  1.00 0.00 ? 51  PRO A HD3  6  
ATOM   6517  N  N    . ASP A 1 52 ? 10.479  11.268  -3.579  1.00 0.00 ? 52  ASP A N    6  
ATOM   6518  C  CA   . ASP A 1 52 ? 11.495  10.759  -2.665  1.00 0.00 ? 52  ASP A CA   6  
ATOM   6519  C  C    . ASP A 1 52 ? 11.031  9.467   -2.001  1.00 0.00 ? 52  ASP A C    6  
ATOM   6520  O  O    . ASP A 1 52 ? 11.815  8.537   -1.812  1.00 0.00 ? 52  ASP A O    6  
ATOM   6521  C  CB   . ASP A 1 52 ? 11.823  11.806  -1.599  1.00 0.00 ? 52  ASP A CB   6  
ATOM   6522  C  CG   . ASP A 1 52 ? 12.717  11.257  -0.505  1.00 0.00 ? 52  ASP A CG   6  
ATOM   6523  O  OD1  . ASP A 1 52 ? 12.326  10.259  0.136   1.00 0.00 ? 52  ASP A OD1  6  
ATOM   6524  O  OD2  . ASP A 1 52 ? 13.808  11.826  -0.288  1.00 0.00 ? 52  ASP A OD2  6  
ATOM   6525  H  H    . ASP A 1 52 ? 10.258  12.223  -3.565  1.00 0.00 ? 52  ASP A H    6  
ATOM   6526  H  HA   . ASP A 1 52 ? 12.385  10.553  -3.240  1.00 0.00 ? 52  ASP A HA   6  
ATOM   6527  H  HB2  . ASP A 1 52 ? 12.327  12.639  -2.066  1.00 0.00 ? 52  ASP A HB2  6  
ATOM   6528  H  HB3  . ASP A 1 52 ? 10.904  12.152  -1.150  1.00 0.00 ? 52  ASP A HB3  6  
ATOM   6529  N  N    . SER A 1 53 ? 9.750   9.416   -1.648  1.00 0.00 ? 53  SER A N    6  
ATOM   6530  C  CA   . SER A 1 53 ? 9.182   8.240   -1.000  1.00 0.00 ? 53  SER A CA   6  
ATOM   6531  C  C    . SER A 1 53 ? 8.881   7.148   -2.022  1.00 0.00 ? 53  SER A C    6  
ATOM   6532  O  O    . SER A 1 53 ? 8.897   5.959   -1.702  1.00 0.00 ? 53  SER A O    6  
ATOM   6533  C  CB   . SER A 1 53 ? 7.905   8.614   -0.246  1.00 0.00 ? 53  SER A CB   6  
ATOM   6534  O  OG   . SER A 1 53 ? 7.639   7.691   0.797   1.00 0.00 ? 53  SER A OG   6  
ATOM   6535  H  H    . SER A 1 53 ? 9.175   10.189  -1.825  1.00 0.00 ? 53  SER A H    6  
ATOM   6536  H  HA   . SER A 1 53 ? 9.910   7.865   -0.295  1.00 0.00 ? 53  SER A HA   6  
ATOM   6537  H  HB2  . SER A 1 53 ? 8.018   9.598   0.182   1.00 0.00 ? 53  SER A HB2  6  
ATOM   6538  H  HB3  . SER A 1 53 ? 7.071   8.613   -0.933  1.00 0.00 ? 53  SER A HB3  6  
ATOM   6539  H  HG   . SER A 1 53 ? 8.468   7.380   1.168   1.00 0.00 ? 53  SER A HG   6  
ATOM   6540  N  N    . VAL A 1 54 ? 8.607   7.561   -3.256  1.00 0.00 ? 54  VAL A N    6  
ATOM   6541  C  CA   . VAL A 1 54 ? 8.304   6.620   -4.327  1.00 0.00 ? 54  VAL A CA   6  
ATOM   6542  C  C    . VAL A 1 54 ? 9.558   5.883   -4.784  1.00 0.00 ? 54  VAL A C    6  
ATOM   6543  O  O    . VAL A 1 54 ? 9.504   4.708   -5.143  1.00 0.00 ? 54  VAL A O    6  
ATOM   6544  C  CB   . VAL A 1 54 ? 7.671   7.332   -5.537  1.00 0.00 ? 54  VAL A CB   6  
ATOM   6545  C  CG1  . VAL A 1 54 ? 8.080   6.648   -6.833  1.00 0.00 ? 54  VAL A CG1  6  
ATOM   6546  C  CG2  . VAL A 1 54 ? 6.157   7.371   -5.400  1.00 0.00 ? 54  VAL A CG2  6  
ATOM   6547  H  H    . VAL A 1 54 ? 8.610   8.521   -3.450  1.00 0.00 ? 54  VAL A H    6  
ATOM   6548  H  HA   . VAL A 1 54 ? 7.593   5.900   -3.948  1.00 0.00 ? 54  VAL A HA   6  
ATOM   6549  H  HB   . VAL A 1 54 ? 8.036   8.348   -5.562  1.00 0.00 ? 54  VAL A HB   6  
ATOM   6550  H  HG11 . VAL A 1 54 ? 7.723   7.227   -7.673  1.00 0.00 ? 54  VAL A HG11 6  
ATOM   6551  H  HG12 . VAL A 1 54 ? 9.156   6.573   -6.878  1.00 0.00 ? 54  VAL A HG12 6  
ATOM   6552  H  HG13 . VAL A 1 54 ? 7.648   5.659   -6.869  1.00 0.00 ? 54  VAL A HG13 6  
ATOM   6553  H  HG21 . VAL A 1 54 ? 5.726   6.540   -5.937  1.00 0.00 ? 54  VAL A HG21 6  
ATOM   6554  H  HG22 . VAL A 1 54 ? 5.888   7.304   -4.356  1.00 0.00 ? 54  VAL A HG22 6  
ATOM   6555  H  HG23 . VAL A 1 54 ? 5.782   8.298   -5.808  1.00 0.00 ? 54  VAL A HG23 6  
ATOM   6556  N  N    . ALA A 1 55 ? 10.688  6.583   -4.766  1.00 0.00 ? 55  ALA A N    6  
ATOM   6557  C  CA   . ALA A 1 55 ? 11.957  5.995   -5.176  1.00 0.00 ? 55  ALA A CA   6  
ATOM   6558  C  C    . ALA A 1 55 ? 12.451  4.984   -4.147  1.00 0.00 ? 55  ALA A C    6  
ATOM   6559  O  O    . ALA A 1 55 ? 13.005  3.944   -4.502  1.00 0.00 ? 55  ALA A O    6  
ATOM   6560  C  CB   . ALA A 1 55 ? 12.998  7.084   -5.390  1.00 0.00 ? 55  ALA A CB   6  
ATOM   6561  H  H    . ALA A 1 55 ? 10.667  7.517   -4.470  1.00 0.00 ? 55  ALA A H    6  
ATOM   6562  H  HA   . ALA A 1 55 ? 11.802  5.489   -6.118  1.00 0.00 ? 55  ALA A HA   6  
ATOM   6563  H  HB1  . ALA A 1 55 ? 12.774  7.621   -6.301  1.00 0.00 ? 55  ALA A HB1  6  
ATOM   6564  H  HB2  . ALA A 1 55 ? 12.981  7.768   -4.555  1.00 0.00 ? 55  ALA A HB2  6  
ATOM   6565  H  HB3  . ALA A 1 55 ? 13.977  6.635   -5.469  1.00 0.00 ? 55  ALA A HB3  6  
ATOM   6566  N  N    . ALA A 1 56 ? 12.247  5.296   -2.872  1.00 0.00 ? 56  ALA A N    6  
ATOM   6567  C  CA   . ALA A 1 56 ? 12.670  4.413   -1.792  1.00 0.00 ? 56  ALA A CA   6  
ATOM   6568  C  C    . ALA A 1 56 ? 11.763  3.191   -1.695  1.00 0.00 ? 56  ALA A C    6  
ATOM   6569  O  O    . ALA A 1 56 ? 12.230  2.077   -1.455  1.00 0.00 ? 56  ALA A O    6  
ATOM   6570  C  CB   . ALA A 1 56 ? 12.687  5.167   -0.470  1.00 0.00 ? 56  ALA A CB   6  
ATOM   6571  H  H    . ALA A 1 56 ? 11.799  6.139   -2.652  1.00 0.00 ? 56  ALA A H    6  
ATOM   6572  H  HA   . ALA A 1 56 ? 13.678  4.085   -2.005  1.00 0.00 ? 56  ALA A HA   6  
ATOM   6573  H  HB1  . ALA A 1 56 ? 13.542  5.827   -0.445  1.00 0.00 ? 56  ALA A HB1  6  
ATOM   6574  H  HB2  . ALA A 1 56 ? 11.781  5.746   -0.375  1.00 0.00 ? 56  ALA A HB2  6  
ATOM   6575  H  HB3  . ALA A 1 56 ? 12.753  4.462   0.345   1.00 0.00 ? 56  ALA A HB3  6  
ATOM   6576  N  N    . HIS A 1 57 ? 10.465  3.407   -1.881  1.00 0.00 ? 57  HIS A N    6  
ATOM   6577  C  CA   . HIS A 1 57 ? 9.492   2.322   -1.813  1.00 0.00 ? 57  HIS A CA   6  
ATOM   6578  C  C    . HIS A 1 57 ? 9.861   1.201   -2.780  1.00 0.00 ? 57  HIS A C    6  
ATOM   6579  O  O    . HIS A 1 57 ? 9.634   0.024   -2.497  1.00 0.00 ? 57  HIS A O    6  
ATOM   6580  C  CB   . HIS A 1 57 ? 8.091   2.845   -2.130  1.00 0.00 ? 57  HIS A CB   6  
ATOM   6581  C  CG   . HIS A 1 57 ? 7.177   1.803   -2.698  1.00 0.00 ? 57  HIS A CG   6  
ATOM   6582  N  ND1  . HIS A 1 57 ? 6.728   0.720   -1.972  1.00 0.00 ? 57  HIS A ND1  6  
ATOM   6583  C  CD2  . HIS A 1 57 ? 6.626   1.683   -3.929  1.00 0.00 ? 57  HIS A CD2  6  
ATOM   6584  C  CE1  . HIS A 1 57 ? 5.942   -0.022  -2.732  1.00 0.00 ? 57  HIS A CE1  6  
ATOM   6585  N  NE2  . HIS A 1 57 ? 5.863   0.541   -3.924  1.00 0.00 ? 57  HIS A NE2  6  
ATOM   6586  H  H    . HIS A 1 57 ? 10.154  4.317   -2.068  1.00 0.00 ? 57  HIS A H    6  
ATOM   6587  H  HA   . HIS A 1 57 ? 9.501   1.930   -0.808  1.00 0.00 ? 57  HIS A HA   6  
ATOM   6588  H  HB2  . HIS A 1 57 ? 7.641   3.222   -1.224  1.00 0.00 ? 57  HIS A HB2  6  
ATOM   6589  H  HB3  . HIS A 1 57 ? 8.167   3.648   -2.850  1.00 0.00 ? 57  HIS A HB3  6  
ATOM   6590  H  HD1  . HIS A 1 57 ? 6.953   0.523   -1.039  1.00 0.00 ? 57  HIS A HD1  6  
ATOM   6591  H  HD2  . HIS A 1 57 ? 6.762   2.360   -4.761  1.00 0.00 ? 57  HIS A HD2  6  
ATOM   6592  H  HE1  . HIS A 1 57 ? 5.447   -0.933  -2.431  1.00 0.00 ? 57  HIS A HE1  6  
ATOM   6593  N  N    . ARG A 1 58 ? 10.429  1.574   -3.922  1.00 0.00 ? 58  ARG A N    6  
ATOM   6594  C  CA   . ARG A 1 58 ? 10.827  0.600   -4.932  1.00 0.00 ? 58  ARG A CA   6  
ATOM   6595  C  C    . ARG A 1 58 ? 12.053  -0.185  -4.476  1.00 0.00 ? 58  ARG A C    6  
ATOM   6596  O  O    . ARG A 1 58 ? 12.322  -1.278  -4.974  1.00 0.00 ? 58  ARG A O    6  
ATOM   6597  C  CB   . ARG A 1 58 ? 11.121  1.302   -6.259  1.00 0.00 ? 58  ARG A CB   6  
ATOM   6598  C  CG   . ARG A 1 58 ? 9.983   2.182   -6.749  1.00 0.00 ? 58  ARG A CG   6  
ATOM   6599  C  CD   . ARG A 1 58 ? 10.491  3.307   -7.637  1.00 0.00 ? 58  ARG A CD   6  
ATOM   6600  N  NE   . ARG A 1 58 ? 9.408   4.174   -8.095  1.00 0.00 ? 58  ARG A NE   6  
ATOM   6601  C  CZ   . ARG A 1 58 ? 9.474   4.911   -9.198  1.00 0.00 ? 58  ARG A CZ   6  
ATOM   6602  N  NH1  . ARG A 1 58 ? 10.564  4.886   -9.952  1.00 0.00 ? 58  ARG A NH1  6  
ATOM   6603  N  NH2  . ARG A 1 58 ? 8.447   5.675   -9.549  1.00 0.00 ? 58  ARG A NH2  6  
ATOM   6604  H  H    . ARG A 1 58 ? 10.584  2.527   -4.091  1.00 0.00 ? 58  ARG A H    6  
ATOM   6605  H  HA   . ARG A 1 58 ? 10.006  -0.086  -5.072  1.00 0.00 ? 58  ARG A HA   6  
ATOM   6606  H  HB2  . ARG A 1 58 ? 11.999  1.920   -6.140  1.00 0.00 ? 58  ARG A HB2  6  
ATOM   6607  H  HB3  . ARG A 1 58 ? 11.318  0.553   -7.012  1.00 0.00 ? 58  ARG A HB3  6  
ATOM   6608  H  HG2  . ARG A 1 58 ? 9.289   1.577   -7.314  1.00 0.00 ? 58  ARG A HG2  6  
ATOM   6609  H  HG3  . ARG A 1 58 ? 9.478   2.609   -5.895  1.00 0.00 ? 58  ARG A HG3  6  
ATOM   6610  H  HD2  . ARG A 1 58 ? 11.200  3.898   -7.077  1.00 0.00 ? 58  ARG A HD2  6  
ATOM   6611  H  HD3  . ARG A 1 58 ? 10.982  2.875   -8.496  1.00 0.00 ? 58  ARG A HD3  6  
ATOM   6612  H  HE   . ARG A 1 58 ? 8.593   4.207   -7.553  1.00 0.00 ? 58  ARG A HE   6  
ATOM   6613  H  HH11 . ARG A 1 58 ? 11.339  4.310   -9.691  1.00 0.00 ? 58  ARG A HH11 6  
ATOM   6614  H  HH12 . ARG A 1 58 ? 10.611  5.441   -10.783 1.00 0.00 ? 58  ARG A HH12 6  
ATOM   6615  H  HH21 . ARG A 1 58 ? 7.624   5.696   -8.983  1.00 0.00 ? 58  ARG A HH21 6  
ATOM   6616  H  HH22 . ARG A 1 58 ? 8.498   6.229   -10.379 1.00 0.00 ? 58  ARG A HH22 6  
ATOM   6617  N  N    . SER A 1 59 ? 12.793  0.381   -3.528  1.00 0.00 ? 59  SER A N    6  
ATOM   6618  C  CA   . SER A 1 59 ? 13.993  -0.264  -3.008  1.00 0.00 ? 59  SER A CA   6  
ATOM   6619  C  C    . SER A 1 59 ? 13.667  -1.112  -1.783  1.00 0.00 ? 59  SER A C    6  
ATOM   6620  O  O    . SER A 1 59 ? 14.520  -1.836  -1.268  1.00 0.00 ? 59  SER A O    6  
ATOM   6621  C  CB   . SER A 1 59 ? 15.047  0.785   -2.650  1.00 0.00 ? 59  SER A CB   6  
ATOM   6622  O  OG   . SER A 1 59 ? 16.299  0.179   -2.381  1.00 0.00 ? 59  SER A OG   6  
ATOM   6623  H  H    . SER A 1 59 ? 12.526  1.254   -3.171  1.00 0.00 ? 59  SER A H    6  
ATOM   6624  H  HA   . SER A 1 59 ? 14.386  -0.907  -3.782  1.00 0.00 ? 59  SER A HA   6  
ATOM   6625  H  HB2  . SER A 1 59 ? 15.163  1.472   -3.475  1.00 0.00 ? 59  SER A HB2  6  
ATOM   6626  H  HB3  . SER A 1 59 ? 14.727  1.328   -1.772  1.00 0.00 ? 59  SER A HB3  6  
ATOM   6627  H  HG   . SER A 1 59 ? 16.164  -0.735  -2.121  1.00 0.00 ? 59  SER A HG   6  
ATOM   6628  N  N    . LYS A 1 60 ? 12.425  -1.018  -1.319  1.00 0.00 ? 60  LYS A N    6  
ATOM   6629  C  CA   . LYS A 1 60 ? 11.982  -1.776  -0.155  1.00 0.00 ? 60  LYS A CA   6  
ATOM   6630  C  C    . LYS A 1 60 ? 10.856  -2.736  -0.527  1.00 0.00 ? 60  LYS A C    6  
ATOM   6631  O  O    . LYS A 1 60 ? 10.654  -3.755  0.133   1.00 0.00 ? 60  LYS A O    6  
ATOM   6632  C  CB   . LYS A 1 60 ? 11.513  -0.826  0.949   1.00 0.00 ? 60  LYS A CB   6  
ATOM   6633  C  CG   . LYS A 1 60 ? 12.651  -0.201  1.738   1.00 0.00 ? 60  LYS A CG   6  
ATOM   6634  C  CD   . LYS A 1 60 ? 12.231  0.123   3.162   1.00 0.00 ? 60  LYS A CD   6  
ATOM   6635  C  CE   . LYS A 1 60 ? 12.246  -1.116  4.043   1.00 0.00 ? 60  LYS A CE   6  
ATOM   6636  N  NZ   . LYS A 1 60 ? 11.347  -0.970  5.221   1.00 0.00 ? 60  LYS A NZ   6  
ATOM   6637  H  H    . LYS A 1 60 ? 11.790  -0.424  -1.772  1.00 0.00 ? 60  LYS A H    6  
ATOM   6638  H  HA   . LYS A 1 60 ? 12.822  -2.349  0.207   1.00 0.00 ? 60  LYS A HA   6  
ATOM   6639  H  HB2  . LYS A 1 60 ? 10.933  -0.032  0.503   1.00 0.00 ? 60  LYS A HB2  6  
ATOM   6640  H  HB3  . LYS A 1 60 ? 10.886  -1.375  1.637   1.00 0.00 ? 60  LYS A HB3  6  
ATOM   6641  H  HG2  . LYS A 1 60 ? 13.479  -0.893  1.767   1.00 0.00 ? 60  LYS A HG2  6  
ATOM   6642  H  HG3  . LYS A 1 60 ? 12.959  0.711   1.246   1.00 0.00 ? 60  LYS A HG3  6  
ATOM   6643  H  HD2  . LYS A 1 60 ? 12.914  0.851   3.573   1.00 0.00 ? 60  LYS A HD2  6  
ATOM   6644  H  HD3  . LYS A 1 60 ? 11.230  0.533   3.148   1.00 0.00 ? 60  LYS A HD3  6  
ATOM   6645  H  HE2  . LYS A 1 60 ? 11.922  -1.963  3.457   1.00 0.00 ? 60  LYS A HE2  6  
ATOM   6646  H  HE3  . LYS A 1 60 ? 13.255  -1.283  4.390   1.00 0.00 ? 60  LYS A HE3  6  
ATOM   6647  H  HZ1  . LYS A 1 60 ? 10.465  -0.494  4.941   1.00 0.00 ? 60  LYS A HZ1  6  
ATOM   6648  H  HZ2  . LYS A 1 60 ? 11.813  -0.405  5.959   1.00 0.00 ? 60  LYS A HZ2  6  
ATOM   6649  H  HZ3  . LYS A 1 60 ? 11.114  -1.905  5.612   1.00 0.00 ? 60  LYS A HZ3  6  
ATOM   6650  N  N    . SER A 1 61 ? 10.128  -2.404  -1.588  1.00 0.00 ? 61  SER A N    6  
ATOM   6651  C  CA   . SER A 1 61 ? 9.021   -3.235  -2.045  1.00 0.00 ? 61  SER A CA   6  
ATOM   6652  C  C    . SER A 1 61 ? 9.304   -3.801  -3.434  1.00 0.00 ? 61  SER A C    6  
ATOM   6653  O  O    . SER A 1 61 ? 8.860   -4.898  -3.773  1.00 0.00 ? 61  SER A O    6  
ATOM   6654  C  CB   . SER A 1 61 ? 7.722   -2.427  -2.067  1.00 0.00 ? 61  SER A CB   6  
ATOM   6655  O  OG   . SER A 1 61 ? 7.119   -2.396  -0.786  1.00 0.00 ? 61  SER A OG   6  
ATOM   6656  H  H    . SER A 1 61 ? 10.338  -1.578  -2.072  1.00 0.00 ? 61  SER A H    6  
ATOM   6657  H  HA   . SER A 1 61 ? 8.913   -4.055  -1.351  1.00 0.00 ? 61  SER A HA   6  
ATOM   6658  H  HB2  . SER A 1 61 ? 7.937   -1.415  -2.375  1.00 0.00 ? 61  SER A HB2  6  
ATOM   6659  H  HB3  . SER A 1 61 ? 7.033   -2.877  -2.766  1.00 0.00 ? 61  SER A HB3  6  
ATOM   6660  H  HG   . SER A 1 61 ? 6.881   -1.493  -0.565  1.00 0.00 ? 61  SER A HG   6  
ATOM   6661  N  N    . HIS A 1 62 ? 10.048  -3.043  -4.234  1.00 0.00 ? 62  HIS A N    6  
ATOM   6662  C  CA   . HIS A 1 62 ? 10.392  -3.468  -5.586  1.00 0.00 ? 62  HIS A CA   6  
ATOM   6663  C  C    . HIS A 1 62 ? 11.903  -3.617  -5.741  1.00 0.00 ? 62  HIS A C    6  
ATOM   6664  O  O    . HIS A 1 62 ? 12.468  -3.385  -6.810  1.00 0.00 ? 62  HIS A O    6  
ATOM   6665  C  CB   . HIS A 1 62 ? 9.859   -2.466  -6.610  1.00 0.00 ? 62  HIS A CB   6  
ATOM   6666  C  CG   . HIS A 1 62 ? 8.367   -2.334  -6.599  1.00 0.00 ? 62  HIS A CG   6  
ATOM   6667  N  ND1  . HIS A 1 62 ? 7.519   -3.356  -6.971  1.00 0.00 ? 62  HIS A ND1  6  
ATOM   6668  C  CD2  . HIS A 1 62 ? 7.573   -1.294  -6.257  1.00 0.00 ? 62  HIS A CD2  6  
ATOM   6669  C  CE1  . HIS A 1 62 ? 6.267   -2.949  -6.859  1.00 0.00 ? 62  HIS A CE1  6  
ATOM   6670  N  NE2  . HIS A 1 62 ? 6.272   -1.701  -6.427  1.00 0.00 ? 62  HIS A NE2  6  
ATOM   6671  H  H    . HIS A 1 62 ? 10.373  -2.179  -3.907  1.00 0.00 ? 62  HIS A H    6  
ATOM   6672  H  HA   . HIS A 1 62 ? 9.930   -4.428  -5.760  1.00 0.00 ? 62  HIS A HA   6  
ATOM   6673  H  HB2  . HIS A 1 62 ? 10.279  -1.492  -6.402  1.00 0.00 ? 62  HIS A HB2  6  
ATOM   6674  H  HB3  . HIS A 1 62 ? 10.159  -2.778  -7.600  1.00 0.00 ? 62  HIS A HB3  6  
ATOM   6675  H  HD1  . HIS A 1 62 ? 7.794   -4.247  -7.273  1.00 0.00 ? 62  HIS A HD1  6  
ATOM   6676  H  HD2  . HIS A 1 62 ? 7.900   -0.322  -5.913  1.00 0.00 ? 62  HIS A HD2  6  
ATOM   6677  H  HE1  . HIS A 1 62 ? 5.389   -3.536  -7.082  1.00 0.00 ? 62  HIS A HE1  6  
ATOM   6678  N  N    . PRO A 1 63 ? 12.575  -4.011  -4.649  1.00 0.00 ? 63  PRO A N    6  
ATOM   6679  C  CA   . PRO A 1 63 ? 14.028  -4.198  -4.638  1.00 0.00 ? 63  PRO A CA   6  
ATOM   6680  C  C    . PRO A 1 63 ? 14.463  -5.406  -5.461  1.00 0.00 ? 63  PRO A C    6  
ATOM   6681  O  O    . PRO A 1 63 ? 15.638  -5.550  -5.796  1.00 0.00 ? 63  PRO A O    6  
ATOM   6682  C  CB   . PRO A 1 63 ? 14.347  -4.418  -3.157  1.00 0.00 ? 63  PRO A CB   6  
ATOM   6683  C  CG   . PRO A 1 63 ? 13.085  -4.953  -2.573  1.00 0.00 ? 63  PRO A CG   6  
ATOM   6684  C  CD   . PRO A 1 63 ? 11.966  -4.304  -3.340  1.00 0.00 ? 63  PRO A CD   6  
ATOM   6685  H  HA   . PRO A 1 63 ? 14.545  -3.318  -4.992  1.00 0.00 ? 63  PRO A HA   6  
ATOM   6686  H  HB2  . PRO A 1 63 ? 15.159  -5.125  -3.062  1.00 0.00 ? 63  PRO A HB2  6  
ATOM   6687  H  HB3  . PRO A 1 63 ? 14.625  -3.479  -2.702  1.00 0.00 ? 63  PRO A HB3  6  
ATOM   6688  H  HG2  . PRO A 1 63 ? 13.050  -6.025  -2.694  1.00 0.00 ? 63  PRO A HG2  6  
ATOM   6689  H  HG3  . PRO A 1 63 ? 13.024  -4.690  -1.528  1.00 0.00 ? 63  PRO A HG3  6  
ATOM   6690  H  HD2  . PRO A 1 63 ? 11.135  -4.986  -3.445  1.00 0.00 ? 63  PRO A HD2  6  
ATOM   6691  H  HD3  . PRO A 1 63 ? 11.651  -3.395  -2.850  1.00 0.00 ? 63  PRO A HD3  6  
ATOM   6692  N  N    . ALA A 1 64 ? 13.507  -6.272  -5.783  1.00 0.00 ? 64  ALA A N    6  
ATOM   6693  C  CA   . ALA A 1 64 ? 13.792  -7.466  -6.569  1.00 0.00 ? 64  ALA A CA   6  
ATOM   6694  C  C    . ALA A 1 64 ? 13.566  -7.211  -8.055  1.00 0.00 ? 64  ALA A C    6  
ATOM   6695  O  O    . ALA A 1 64 ? 14.000  -7.993  -8.903  1.00 0.00 ? 64  ALA A O    6  
ATOM   6696  C  CB   . ALA A 1 64 ? 12.932  -8.628  -6.094  1.00 0.00 ? 64  ALA A CB   6  
ATOM   6697  H  H    . ALA A 1 64 ? 12.589  -6.102  -5.486  1.00 0.00 ? 64  ALA A H    6  
ATOM   6698  H  HA   . ALA A 1 64 ? 14.828  -7.730  -6.412  1.00 0.00 ? 64  ALA A HA   6  
ATOM   6699  H  HB1  . ALA A 1 64 ? 13.551  -9.343  -5.572  1.00 0.00 ? 64  ALA A HB1  6  
ATOM   6700  H  HB2  . ALA A 1 64 ? 12.166  -8.259  -5.427  1.00 0.00 ? 64  ALA A HB2  6  
ATOM   6701  H  HB3  . ALA A 1 64 ? 12.469  -9.104  -6.945  1.00 0.00 ? 64  ALA A HB3  6  
ATOM   6702  N  N    . LEU A 1 65 ? 12.884  -6.115  -8.366  1.00 0.00 ? 65  LEU A N    6  
ATOM   6703  C  CA   . LEU A 1 65 ? 12.600  -5.757  -9.752  1.00 0.00 ? 65  LEU A CA   6  
ATOM   6704  C  C    . LEU A 1 65 ? 13.693  -4.856  -10.317 1.00 0.00 ? 65  LEU A C    6  
ATOM   6705  O  O    . LEU A 1 65 ? 14.212  -5.100  -11.407 1.00 0.00 ? 65  LEU A O    6  
ATOM   6706  C  CB   . LEU A 1 65 ? 11.244  -5.057  -9.850  1.00 0.00 ? 65  LEU A CB   6  
ATOM   6707  C  CG   . LEU A 1 65 ? 10.019  -5.918  -9.540  1.00 0.00 ? 65  LEU A CG   6  
ATOM   6708  C  CD1  . LEU A 1 65 ? 8.752   -5.079  -9.580  1.00 0.00 ? 65  LEU A CD1  6  
ATOM   6709  C  CD2  . LEU A 1 65 ? 9.922   -7.079  -10.519 1.00 0.00 ? 65  LEU A CD2  6  
ATOM   6710  H  H    . LEU A 1 65 ? 12.564  -5.531  -7.648  1.00 0.00 ? 65  LEU A H    6  
ATOM   6711  H  HA   . LEU A 1 65 ? 12.568  -6.669  -10.329 1.00 0.00 ? 65  LEU A HA   6  
ATOM   6712  H  HB2  . LEU A 1 65 ? 11.248  -4.228  -9.159  1.00 0.00 ? 65  LEU A HB2  6  
ATOM   6713  H  HB3  . LEU A 1 65 ? 11.139  -4.681  -10.858 1.00 0.00 ? 65  LEU A HB3  6  
ATOM   6714  H  HG   . LEU A 1 65 ? 10.117  -6.327  -8.544  1.00 0.00 ? 65  LEU A HG   6  
ATOM   6715  H  HD11 . LEU A 1 65 ? 8.823   -4.285  -8.851  1.00 0.00 ? 65  LEU A HD11 6  
ATOM   6716  H  HD12 . LEU A 1 65 ? 7.900   -5.702  -9.351  1.00 0.00 ? 65  LEU A HD12 6  
ATOM   6717  H  HD13 . LEU A 1 65 ? 8.632   -4.654  -10.566 1.00 0.00 ? 65  LEU A HD13 6  
ATOM   6718  H  HD21 . LEU A 1 65 ? 9.118   -7.735  -10.221 1.00 0.00 ? 65  LEU A HD21 6  
ATOM   6719  H  HD22 . LEU A 1 65 ? 10.853  -7.628  -10.520 1.00 0.00 ? 65  LEU A HD22 6  
ATOM   6720  H  HD23 . LEU A 1 65 ? 9.727   -6.699  -11.511 1.00 0.00 ? 65  LEU A HD23 6  
ATOM   6721  N  N    . LEU A 1 66 ? 14.040  -3.815  -9.568  1.00 0.00 ? 66  LEU A N    6  
ATOM   6722  C  CA   . LEU A 1 66 ? 15.074  -2.878  -9.993  1.00 0.00 ? 66  LEU A CA   6  
ATOM   6723  C  C    . LEU A 1 66 ? 16.187  -3.599  -10.745 1.00 0.00 ? 66  LEU A C    6  
ATOM   6724  O  O    . LEU A 1 66 ? 16.688  -3.107  -11.757 1.00 0.00 ? 66  LEU A O    6  
ATOM   6725  C  CB   . LEU A 1 66 ? 15.653  -2.144  -8.782  1.00 0.00 ? 66  LEU A CB   6  
ATOM   6726  C  CG   . LEU A 1 66 ? 14.659  -1.333  -7.950  1.00 0.00 ? 66  LEU A CG   6  
ATOM   6727  C  CD1  . LEU A 1 66 ? 15.132  -1.225  -6.508  1.00 0.00 ? 66  LEU A CD1  6  
ATOM   6728  C  CD2  . LEU A 1 66 ? 14.461  0.050   -8.553  1.00 0.00 ? 66  LEU A CD2  6  
ATOM   6729  H  H    . LEU A 1 66 ? 13.591  -3.673  -8.709  1.00 0.00 ? 66  LEU A H    6  
ATOM   6730  H  HA   . LEU A 1 66 ? 14.616  -2.158  -10.655 1.00 0.00 ? 66  LEU A HA   6  
ATOM   6731  H  HB2  . LEU A 1 66 ? 16.104  -2.880  -8.134  1.00 0.00 ? 66  LEU A HB2  6  
ATOM   6732  H  HB3  . LEU A 1 66 ? 16.416  -1.467  -9.140  1.00 0.00 ? 66  LEU A HB3  6  
ATOM   6733  H  HG   . LEU A 1 66 ? 13.703  -1.839  -7.949  1.00 0.00 ? 66  LEU A HG   6  
ATOM   6734  H  HD11 . LEU A 1 66 ? 15.451  -0.214  -6.309  1.00 0.00 ? 66  LEU A HD11 6  
ATOM   6735  H  HD12 . LEU A 1 66 ? 15.960  -1.901  -6.350  1.00 0.00 ? 66  LEU A HD12 6  
ATOM   6736  H  HD13 . LEU A 1 66 ? 14.322  -1.487  -5.843  1.00 0.00 ? 66  LEU A HD13 6  
ATOM   6737  H  HD21 . LEU A 1 66 ? 15.387  0.383   -8.998  1.00 0.00 ? 66  LEU A HD21 6  
ATOM   6738  H  HD22 . LEU A 1 66 ? 14.165  0.742   -7.777  1.00 0.00 ? 66  LEU A HD22 6  
ATOM   6739  H  HD23 . LEU A 1 66 ? 13.693  0.006   -9.310  1.00 0.00 ? 66  LEU A HD23 6  
ATOM   6740  N  N    . LEU A 1 67 ? 16.569  -4.770  -10.246 1.00 0.00 ? 67  LEU A N    6  
ATOM   6741  C  CA   . LEU A 1 67 ? 17.622  -5.561  -10.872 1.00 0.00 ? 67  LEU A CA   6  
ATOM   6742  C  C    . LEU A 1 67 ? 17.292  -5.849  -12.333 1.00 0.00 ? 67  LEU A C    6  
ATOM   6743  O  O    . LEU A 1 67 ? 16.231  -5.467  -12.827 1.00 0.00 ? 67  LEU A O    6  
ATOM   6744  C  CB   . LEU A 1 67 ? 17.819  -6.875  -10.113 1.00 0.00 ? 67  LEU A CB   6  
ATOM   6745  C  CG   . LEU A 1 67 ? 18.842  -6.847  -8.977  1.00 0.00 ? 67  LEU A CG   6  
ATOM   6746  C  CD1  . LEU A 1 67 ? 18.355  -5.959  -7.843  1.00 0.00 ? 67  LEU A CD1  6  
ATOM   6747  C  CD2  . LEU A 1 67 ? 19.117  -8.256  -8.473  1.00 0.00 ? 67  LEU A CD2  6  
ATOM   6748  H  H    . LEU A 1 67 ? 16.133  -5.110  -9.437  1.00 0.00 ? 67  LEU A H    6  
ATOM   6749  H  HA   . LEU A 1 67 ? 18.537  -4.989  -10.828 1.00 0.00 ? 67  LEU A HA   6  
ATOM   6750  H  HB2  . LEU A 1 67 ? 16.867  -7.160  -9.694  1.00 0.00 ? 67  LEU A HB2  6  
ATOM   6751  H  HB3  . LEU A 1 67 ? 18.136  -7.623  -10.826 1.00 0.00 ? 67  LEU A HB3  6  
ATOM   6752  H  HG   . LEU A 1 67 ? 19.771  -6.436  -9.347  1.00 0.00 ? 67  LEU A HG   6  
ATOM   6753  H  HD11 . LEU A 1 67 ? 17.818  -5.116  -8.251  1.00 0.00 ? 67  LEU A HD11 6  
ATOM   6754  H  HD12 . LEU A 1 67 ? 19.202  -5.604  -7.274  1.00 0.00 ? 67  LEU A HD12 6  
ATOM   6755  H  HD13 . LEU A 1 67 ? 17.701  -6.526  -7.197  1.00 0.00 ? 67  LEU A HD13 6  
ATOM   6756  H  HD21 . LEU A 1 67 ? 19.891  -8.709  -9.075  1.00 0.00 ? 67  LEU A HD21 6  
ATOM   6757  H  HD22 . LEU A 1 67 ? 18.215  -8.847  -8.544  1.00 0.00 ? 67  LEU A HD22 6  
ATOM   6758  H  HD23 . LEU A 1 67 ? 19.440  -8.214  -7.443  1.00 0.00 ? 67  LEU A HD23 6  
ATOM   6759  N  N    . ALA A 1 68 ? 18.206  -6.527  -13.019 1.00 0.00 ? 68  ALA A N    6  
ATOM   6760  C  CA   . ALA A 1 68 ? 18.010  -6.870  -14.422 1.00 0.00 ? 68  ALA A CA   6  
ATOM   6761  C  C    . ALA A 1 68 ? 16.893  -7.895  -14.585 1.00 0.00 ? 68  ALA A C    6  
ATOM   6762  O  O    . ALA A 1 68 ? 16.737  -8.813  -13.779 1.00 0.00 ? 68  ALA A O    6  
ATOM   6763  C  CB   . ALA A 1 68 ? 19.305  -7.397  -15.022 1.00 0.00 ? 68  ALA A CB   6  
ATOM   6764  H  H    . ALA A 1 68 ? 19.032  -6.805  -12.570 1.00 0.00 ? 68  ALA A H    6  
ATOM   6765  H  HA   . ALA A 1 68 ? 17.737  -5.968  -14.951 1.00 0.00 ? 68  ALA A HA   6  
ATOM   6766  H  HB1  . ALA A 1 68 ? 19.154  -7.608  -16.071 1.00 0.00 ? 68  ALA A HB1  6  
ATOM   6767  H  HB2  . ALA A 1 68 ? 20.081  -6.654  -14.912 1.00 0.00 ? 68  ALA A HB2  6  
ATOM   6768  H  HB3  . ALA A 1 68 ? 19.597  -8.301  -14.511 1.00 0.00 ? 68  ALA A HB3  6  
ATOM   6769  N  N    . PRO A 1 69 ? 16.096  -7.738  -15.652 1.00 0.00 ? 69  PRO A N    6  
ATOM   6770  C  CA   . PRO A 1 69 ? 14.979  -8.641  -15.946 1.00 0.00 ? 69  PRO A CA   6  
ATOM   6771  C  C    . PRO A 1 69 ? 15.452  -10.025 -16.380 1.00 0.00 ? 69  PRO A C    6  
ATOM   6772  O  O    . PRO A 1 69 ? 14.656  -10.848 -16.833 1.00 0.00 ? 69  PRO A O    6  
ATOM   6773  C  CB   . PRO A 1 69 ? 14.250  -7.941  -17.095 1.00 0.00 ? 69  PRO A CB   6  
ATOM   6774  C  CG   . PRO A 1 69 ? 15.292  -7.103  -17.752 1.00 0.00 ? 69  PRO A CG   6  
ATOM   6775  C  CD   . PRO A 1 69 ? 16.224  -6.667  -16.655 1.00 0.00 ? 69  PRO A CD   6  
ATOM   6776  H  HA   . PRO A 1 69 ? 14.314  -8.738  -15.101 1.00 0.00 ? 69  PRO A HA   6  
ATOM   6777  H  HB2  . PRO A 1 69 ? 13.850  -8.680  -17.775 1.00 0.00 ? 69  PRO A HB2  6  
ATOM   6778  H  HB3  . PRO A 1 69 ? 13.448  -7.335  -16.701 1.00 0.00 ? 69  PRO A HB3  6  
ATOM   6779  H  HG2  . PRO A 1 69 ? 15.825  -7.688  -18.486 1.00 0.00 ? 69  PRO A HG2  6  
ATOM   6780  H  HG3  . PRO A 1 69 ? 14.833  -6.244  -18.216 1.00 0.00 ? 69  PRO A HG3  6  
ATOM   6781  H  HD2  . PRO A 1 69 ? 17.237  -6.603  -17.024 1.00 0.00 ? 69  PRO A HD2  6  
ATOM   6782  H  HD3  . PRO A 1 69 ? 15.908  -5.718  -16.246 1.00 0.00 ? 69  PRO A HD3  6  
ATOM   6783  N  N    . GLN A 1 70 ? 16.749  -10.274 -16.237 1.00 0.00 ? 70  GLN A N    6  
ATOM   6784  C  CA   . GLN A 1 70 ? 17.326  -11.559 -16.615 1.00 0.00 ? 70  GLN A CA   6  
ATOM   6785  C  C    . GLN A 1 70 ? 16.474  -12.712 -16.096 1.00 0.00 ? 70  GLN A C    6  
ATOM   6786  O  O    . GLN A 1 70 ? 16.126  -13.625 -16.844 1.00 0.00 ? 70  GLN A O    6  
ATOM   6787  C  CB   . GLN A 1 70 ? 18.752  -11.680 -16.076 1.00 0.00 ? 70  GLN A CB   6  
ATOM   6788  C  CG   . GLN A 1 70 ? 19.463  -12.950 -16.514 1.00 0.00 ? 70  GLN A CG   6  
ATOM   6789  C  CD   . GLN A 1 70 ? 20.966  -12.775 -16.608 1.00 0.00 ? 70  GLN A CD   6  
ATOM   6790  O  OE1  . GLN A 1 70 ? 21.458  -11.693 -16.931 1.00 0.00 ? 70  GLN A OE1  6  
ATOM   6791  N  NE2  . GLN A 1 70 ? 21.705  -13.842 -16.326 1.00 0.00 ? 70  GLN A NE2  6  
ATOM   6792  H  H    . GLN A 1 70 ? 17.332  -9.578  -15.870 1.00 0.00 ? 70  GLN A H    6  
ATOM   6793  H  HA   . GLN A 1 70 ? 17.354  -11.605 -17.693 1.00 0.00 ? 70  GLN A HA   6  
ATOM   6794  H  HB2  . GLN A 1 70 ? 19.328  -10.833 -16.420 1.00 0.00 ? 70  GLN A HB2  6  
ATOM   6795  H  HB3  . GLN A 1 70 ? 18.718  -11.667 -14.996 1.00 0.00 ? 70  GLN A HB3  6  
ATOM   6796  H  HG2  . GLN A 1 70 ? 19.251  -13.731 -15.799 1.00 0.00 ? 70  GLN A HG2  6  
ATOM   6797  H  HG3  . GLN A 1 70 ? 19.088  -13.240 -17.485 1.00 0.00 ? 70  GLN A HG3  6  
ATOM   6798  H  HE21 . GLN A 1 70 ? 21.244  -14.671 -16.077 1.00 0.00 ? 70  GLN A HE21 6  
ATOM   6799  H  HE22 . GLN A 1 70 ? 22.679  -13.757 -16.379 1.00 0.00 ? 70  GLN A HE22 6  
ATOM   6800  N  N    . GLU A 1 71 ? 16.142  -12.664 -14.810 1.00 0.00 ? 71  GLU A N    6  
ATOM   6801  C  CA   . GLU A 1 71 ? 15.331  -13.706 -14.191 1.00 0.00 ? 71  GLU A CA   6  
ATOM   6802  C  C    . GLU A 1 71 ? 14.283  -13.100 -13.262 1.00 0.00 ? 71  GLU A C    6  
ATOM   6803  O  O    . GLU A 1 71 ? 14.614  -12.535 -12.220 1.00 0.00 ? 71  GLU A O    6  
ATOM   6804  C  CB   . GLU A 1 71 ? 16.219  -14.678 -13.411 1.00 0.00 ? 71  GLU A CB   6  
ATOM   6805  C  CG   . GLU A 1 71 ? 17.023  -15.613 -14.299 1.00 0.00 ? 71  GLU A CG   6  
ATOM   6806  C  CD   . GLU A 1 71 ? 17.537  -16.829 -13.551 1.00 0.00 ? 71  GLU A CD   6  
ATOM   6807  O  OE1  . GLU A 1 71 ? 16.731  -17.745 -13.285 1.00 0.00 ? 71  GLU A OE1  6  
ATOM   6808  O  OE2  . GLU A 1 71 ? 18.744  -16.863 -13.232 1.00 0.00 ? 71  GLU A OE2  6  
ATOM   6809  H  H    . GLU A 1 71 ? 16.450  -11.910 -14.264 1.00 0.00 ? 71  GLU A H    6  
ATOM   6810  H  HA   . GLU A 1 71 ? 14.828  -14.246 -14.978 1.00 0.00 ? 71  GLU A HA   6  
ATOM   6811  H  HB2  . GLU A 1 71 ? 16.908  -14.110 -12.804 1.00 0.00 ? 71  GLU A HB2  6  
ATOM   6812  H  HB3  . GLU A 1 71 ? 15.594  -15.277 -12.765 1.00 0.00 ? 71  GLU A HB3  6  
ATOM   6813  H  HG2  . GLU A 1 71 ? 16.394  -15.948 -15.110 1.00 0.00 ? 71  GLU A HG2  6  
ATOM   6814  H  HG3  . GLU A 1 71 ? 17.867  -15.072 -14.699 1.00 0.00 ? 71  GLU A HG3  6  
ATOM   6815  N  N    . SER A 1 72 ? 13.017  -13.223 -13.648 1.00 0.00 ? 72  SER A N    6  
ATOM   6816  C  CA   . SER A 1 72 ? 11.920  -12.684 -12.852 1.00 0.00 ? 72  SER A CA   6  
ATOM   6817  C  C    . SER A 1 72 ? 10.801  -13.711 -12.704 1.00 0.00 ? 72  SER A C    6  
ATOM   6818  O  O    . SER A 1 72 ? 10.851  -14.789 -13.296 1.00 0.00 ? 72  SER A O    6  
ATOM   6819  C  CB   . SER A 1 72 ? 11.374  -11.408 -13.496 1.00 0.00 ? 72  SER A CB   6  
ATOM   6820  O  OG   . SER A 1 72 ? 12.054  -10.262 -13.014 1.00 0.00 ? 72  SER A OG   6  
ATOM   6821  H  H    . SER A 1 72 ? 12.817  -13.684 -14.489 1.00 0.00 ? 72  SER A H    6  
ATOM   6822  H  HA   . SER A 1 72 ? 12.307  -12.446 -11.873 1.00 0.00 ? 72  SER A HA   6  
ATOM   6823  H  HB2  . SER A 1 72 ? 11.503  -11.464 -14.566 1.00 0.00 ? 72  SER A HB2  6  
ATOM   6824  H  HB3  . SER A 1 72 ? 10.323  -11.312 -13.264 1.00 0.00 ? 72  SER A HB3  6  
ATOM   6825  H  HG   . SER A 1 72 ? 11.996  -9.558  -13.663 1.00 0.00 ? 72  SER A HG   6  
ATOM   6826  N  N    . SER A 1 73 ? 9.794   -13.367 -11.908 1.00 0.00 ? 73  SER A N    6  
ATOM   6827  C  CA   . SER A 1 73 ? 8.664   -14.260 -11.677 1.00 0.00 ? 73  SER A CA   6  
ATOM   6828  C  C    . SER A 1 73 ? 7.383   -13.465 -11.444 1.00 0.00 ? 73  SER A C    6  
ATOM   6829  O  O    . SER A 1 73 ? 7.286   -12.687 -10.496 1.00 0.00 ? 73  SER A O    6  
ATOM   6830  C  CB   . SER A 1 73 ? 8.940   -15.168 -10.477 1.00 0.00 ? 73  SER A CB   6  
ATOM   6831  O  OG   . SER A 1 73 ? 10.129  -15.915 -10.667 1.00 0.00 ? 73  SER A OG   6  
ATOM   6832  H  H    . SER A 1 73 ? 9.812   -12.494 -11.464 1.00 0.00 ? 73  SER A H    6  
ATOM   6833  H  HA   . SER A 1 73 ? 8.539   -14.871 -12.559 1.00 0.00 ? 73  SER A HA   6  
ATOM   6834  H  HB2  . SER A 1 73 ? 9.047   -14.564 -9.589  1.00 0.00 ? 73  SER A HB2  6  
ATOM   6835  H  HB3  . SER A 1 73 ? 8.115   -15.853 -10.350 1.00 0.00 ? 73  SER A HB3  6  
ATOM   6836  H  HG   . SER A 1 73 ? 10.888  -15.330 -10.612 1.00 0.00 ? 73  SER A HG   6  
ATOM   6837  N  N    . GLY A 1 74 ? 6.400   -13.668 -12.316 1.00 0.00 ? 74  GLY A N    6  
ATOM   6838  C  CA   . GLY A 1 74 ? 5.137   -12.964 -12.189 1.00 0.00 ? 74  GLY A CA   6  
ATOM   6839  C  C    . GLY A 1 74 ? 4.039   -13.586 -13.028 1.00 0.00 ? 74  GLY A C    6  
ATOM   6840  O  O    . GLY A 1 74 ? 4.297   -14.350 -13.958 1.00 0.00 ? 74  GLY A O    6  
ATOM   6841  H  H    . GLY A 1 74 ? 6.534   -14.301 -13.053 1.00 0.00 ? 74  GLY A H    6  
ATOM   6842  H  HA2  . GLY A 1 74 ? 4.835   -12.975 -11.152 1.00 0.00 ? 74  GLY A HA2  6  
ATOM   6843  H  HA3  . GLY A 1 74 ? 5.277   -11.940 -12.502 1.00 0.00 ? 74  GLY A HA3  6  
ATOM   6844  N  N    . PRO A 1 75 ? 2.781   -13.260 -12.699 1.00 0.00 ? 75  PRO A N    6  
ATOM   6845  C  CA   . PRO A 1 75 ? 1.614   -13.782 -13.417 1.00 0.00 ? 75  PRO A CA   6  
ATOM   6846  C  C    . PRO A 1 75 ? 1.497   -13.212 -14.826 1.00 0.00 ? 75  PRO A C    6  
ATOM   6847  O  O    . PRO A 1 75 ? 2.038   -12.147 -15.122 1.00 0.00 ? 75  PRO A O    6  
ATOM   6848  C  CB   . PRO A 1 75 ? 0.434   -13.324 -12.556 1.00 0.00 ? 75  PRO A CB   6  
ATOM   6849  C  CG   . PRO A 1 75 ? 0.934   -12.118 -11.838 1.00 0.00 ? 75  PRO A CG   6  
ATOM   6850  C  CD   . PRO A 1 75 ? 2.400   -12.355 -11.602 1.00 0.00 ? 75  PRO A CD   6  
ATOM   6851  H  HA   . PRO A 1 75 ? 1.629   -14.861 -13.466 1.00 0.00 ? 75  PRO A HA   6  
ATOM   6852  H  HB2  . PRO A 1 75 ? -0.408  -13.087 -13.191 1.00 0.00 ? 75  PRO A HB2  6  
ATOM   6853  H  HB3  . PRO A 1 75 ? 0.161   -14.109 -11.866 1.00 0.00 ? 75  PRO A HB3  6  
ATOM   6854  H  HG2  . PRO A 1 75 ? 0.789   -11.241 -12.450 1.00 0.00 ? 75  PRO A HG2  6  
ATOM   6855  H  HG3  . PRO A 1 75 ? 0.415   -12.010 -10.897 1.00 0.00 ? 75  PRO A HG3  6  
ATOM   6856  H  HD2  . PRO A 1 75 ? 2.946   -11.425 -11.661 1.00 0.00 ? 75  PRO A HD2  6  
ATOM   6857  H  HD3  . PRO A 1 75 ? 2.556   -12.826 -10.642 1.00 0.00 ? 75  PRO A HD3  6  
ATOM   6858  N  N    . SER A 1 76 ? 0.788   -13.929 -15.692 1.00 0.00 ? 76  SER A N    6  
ATOM   6859  C  CA   . SER A 1 76 ? 0.603   -13.496 -17.072 1.00 0.00 ? 76  SER A CA   6  
ATOM   6860  C  C    . SER A 1 76 ? -0.523  -12.471 -17.174 1.00 0.00 ? 76  SER A C    6  
ATOM   6861  O  O    . SER A 1 76 ? -1.492  -12.521 -16.418 1.00 0.00 ? 76  SER A O    6  
ATOM   6862  C  CB   . SER A 1 76 ? 0.299   -14.697 -17.970 1.00 0.00 ? 76  SER A CB   6  
ATOM   6863  O  OG   . SER A 1 76 ? 1.454   -15.494 -18.165 1.00 0.00 ? 76  SER A OG   6  
ATOM   6864  H  H    . SER A 1 76 ? 0.381   -14.770 -15.396 1.00 0.00 ? 76  SER A H    6  
ATOM   6865  H  HA   . SER A 1 76 ? 1.523   -13.036 -17.401 1.00 0.00 ? 76  SER A HA   6  
ATOM   6866  H  HB2  . SER A 1 76 ? -0.468  -15.301 -17.509 1.00 0.00 ? 76  SER A HB2  6  
ATOM   6867  H  HB3  . SER A 1 76 ? -0.048  -14.345 -18.931 1.00 0.00 ? 76  SER A HB3  6  
ATOM   6868  H  HG   . SER A 1 76 ? 1.221   -16.278 -18.668 1.00 0.00 ? 76  SER A HG   6  
ATOM   6869  N  N    . SER A 1 77 ? -0.387  -11.543 -18.116 1.00 0.00 ? 77  SER A N    6  
ATOM   6870  C  CA   . SER A 1 77 ? -1.390  -10.504 -18.316 1.00 0.00 ? 77  SER A CA   6  
ATOM   6871  C  C    . SER A 1 77 ? -1.505  -9.615  -17.081 1.00 0.00 ? 77  SER A C    6  
ATOM   6872  O  O    . SER A 1 77 ? -2.603  -9.246  -16.668 1.00 0.00 ? 77  SER A O    6  
ATOM   6873  C  CB   . SER A 1 77 ? -2.748  -11.131 -18.635 1.00 0.00 ? 77  SER A CB   6  
ATOM   6874  O  OG   . SER A 1 77 ? -3.731  -10.135 -18.857 1.00 0.00 ? 77  SER A OG   6  
ATOM   6875  H  H    . SER A 1 77 ? 0.409   -11.556 -18.688 1.00 0.00 ? 77  SER A H    6  
ATOM   6876  H  HA   . SER A 1 77 ? -1.077  -9.898  -19.153 1.00 0.00 ? 77  SER A HA   6  
ATOM   6877  H  HB2  . SER A 1 77 ? -2.661  -11.739 -19.523 1.00 0.00 ? 77  SER A HB2  6  
ATOM   6878  H  HB3  . SER A 1 77 ? -3.060  -11.749 -17.805 1.00 0.00 ? 77  SER A HB3  6  
ATOM   6879  H  HG   . SER A 1 77 ? -3.648  -9.449  -18.191 1.00 0.00 ? 77  SER A HG   6  
ATOM   6880  N  N    . GLY A 1 78 ? -0.361  -9.276  -16.495 1.00 0.00 ? 78  GLY A N    6  
ATOM   6881  C  CA   . GLY A 1 78 ? -0.354  -8.434  -15.313 1.00 0.00 ? 78  GLY A CA   6  
ATOM   6882  C  C    . GLY A 1 78 ? -1.494  -8.753  -14.367 1.00 0.00 ? 78  GLY A C    6  
ATOM   6883  O  O    . GLY A 1 78 ? -1.260  -8.870  -13.165 1.00 0.00 ? 78  GLY A O    6  
ATOM   6884  H  H    . GLY A 1 78 ? 0.486   -9.600  -16.868 1.00 0.00 ? 78  GLY A H    6  
ATOM   6885  H  HA2  . GLY A 1 78 ? 0.582   -8.571  -14.792 1.00 0.00 ? 78  GLY A HA2  6  
ATOM   6886  H  HA3  . GLY A 1 78 ? -0.435  -7.401  -15.620 1.00 0.00 ? 78  GLY A HA3  6  
HETATM 6887  ZN ZN   . ZN  B 2 .  ? -8.112  0.697   4.265   1.00 0.00 ? 201 ZN  A ZN   6  
HETATM 6888  ZN ZN   . ZN  C 2 .  ? 5.311   -0.006  -5.791  1.00 0.00 ? 401 ZN  A ZN   6  
ATOM   6889  N  N    . GLY A 1 1  ? -2.203  -22.474 17.045  1.00 0.00 ? 1   GLY A N    7  
ATOM   6890  C  CA   . GLY A 1 1  ? -2.534  -21.074 17.238  1.00 0.00 ? 1   GLY A CA   7  
ATOM   6891  C  C    . GLY A 1 1  ? -4.029  -20.827 17.240  1.00 0.00 ? 1   GLY A C    7  
ATOM   6892  O  O    . GLY A 1 1  ? -4.785  -21.541 16.581  1.00 0.00 ? 1   GLY A O    7  
ATOM   6893  H  H1   . GLY A 1 1  ? -2.505  -23.141 17.696  1.00 0.00 ? 1   GLY A H1   7  
ATOM   6894  H  HA2  . GLY A 1 1  ? -2.124  -20.746 18.181  1.00 0.00 ? 1   GLY A HA2  7  
ATOM   6895  H  HA3  . GLY A 1 1  ? -2.087  -20.497 16.442  1.00 0.00 ? 1   GLY A HA3  7  
ATOM   6896  N  N    . SER A 1 2  ? -4.459  -19.813 17.985  1.00 0.00 ? 2   SER A N    7  
ATOM   6897  C  CA   . SER A 1 2  ? -5.875  -19.477 18.075  1.00 0.00 ? 2   SER A CA   7  
ATOM   6898  C  C    . SER A 1 2  ? -6.220  -18.325 17.136  1.00 0.00 ? 2   SER A C    7  
ATOM   6899  O  O    . SER A 1 2  ? -5.845  -17.178 17.379  1.00 0.00 ? 2   SER A O    7  
ATOM   6900  C  CB   . SER A 1 2  ? -6.242  -19.105 19.513  1.00 0.00 ? 2   SER A CB   7  
ATOM   6901  O  OG   . SER A 1 2  ? -5.439  -18.037 19.985  1.00 0.00 ? 2   SER A OG   7  
ATOM   6902  H  H    . SER A 1 2  ? -3.808  -19.281 18.489  1.00 0.00 ? 2   SER A H    7  
ATOM   6903  H  HA   . SER A 1 2  ? -6.442  -20.348 17.782  1.00 0.00 ? 2   SER A HA   7  
ATOM   6904  H  HB2  . SER A 1 2  ? -7.278  -18.805 19.551  1.00 0.00 ? 2   SER A HB2  7  
ATOM   6905  H  HB3  . SER A 1 2  ? -6.092  -19.963 20.153  1.00 0.00 ? 2   SER A HB3  7  
ATOM   6906  H  HG   . SER A 1 2  ? -4.514  -18.293 19.952  1.00 0.00 ? 2   SER A HG   7  
ATOM   6907  N  N    . SER A 1 3  ? -6.938  -18.640 16.063  1.00 0.00 ? 3   SER A N    7  
ATOM   6908  C  CA   . SER A 1 3  ? -7.332  -17.633 15.084  1.00 0.00 ? 3   SER A CA   7  
ATOM   6909  C  C    . SER A 1 3  ? -8.753  -17.145 15.349  1.00 0.00 ? 3   SER A C    7  
ATOM   6910  O  O    . SER A 1 3  ? -9.671  -17.943 15.533  1.00 0.00 ? 3   SER A O    7  
ATOM   6911  C  CB   . SER A 1 3  ? -7.231  -18.201 13.668  1.00 0.00 ? 3   SER A CB   7  
ATOM   6912  O  OG   . SER A 1 3  ? -7.009  -17.172 12.720  1.00 0.00 ? 3   SER A OG   7  
ATOM   6913  H  H    . SER A 1 3  ? -7.207  -19.572 15.925  1.00 0.00 ? 3   SER A H    7  
ATOM   6914  H  HA   . SER A 1 3  ? -6.654  -16.798 15.177  1.00 0.00 ? 3   SER A HA   7  
ATOM   6915  H  HB2  . SER A 1 3  ? -6.410  -18.900 13.621  1.00 0.00 ? 3   SER A HB2  7  
ATOM   6916  H  HB3  . SER A 1 3  ? -8.151  -18.710 13.420  1.00 0.00 ? 3   SER A HB3  7  
ATOM   6917  H  HG   . SER A 1 3  ? -7.217  -16.322 13.115  1.00 0.00 ? 3   SER A HG   7  
ATOM   6918  N  N    . GLY A 1 4  ? -8.926  -15.827 15.365  1.00 0.00 ? 4   GLY A N    7  
ATOM   6919  C  CA   . GLY A 1 4  ? -10.237 -15.254 15.607  1.00 0.00 ? 4   GLY A CA   7  
ATOM   6920  C  C    . GLY A 1 4  ? -11.160 -15.390 14.412  1.00 0.00 ? 4   GLY A C    7  
ATOM   6921  O  O    . GLY A 1 4  ? -11.099 -16.379 13.682  1.00 0.00 ? 4   GLY A O    7  
ATOM   6922  H  H    . GLY A 1 4  ? -8.157  -15.239 15.212  1.00 0.00 ? 4   GLY A H    7  
ATOM   6923  H  HA2  . GLY A 1 4  ? -10.685 -15.753 16.454  1.00 0.00 ? 4   GLY A HA2  7  
ATOM   6924  H  HA3  . GLY A 1 4  ? -10.122 -14.205 15.840  1.00 0.00 ? 4   GLY A HA3  7  
ATOM   6925  N  N    . SER A 1 5  ? -12.018 -14.395 14.213  1.00 0.00 ? 5   SER A N    7  
ATOM   6926  C  CA   . SER A 1 5  ? -12.961 -14.410 13.101  1.00 0.00 ? 5   SER A CA   7  
ATOM   6927  C  C    . SER A 1 5  ? -12.264 -14.053 11.792  1.00 0.00 ? 5   SER A C    7  
ATOM   6928  O  O    . SER A 1 5  ? -11.137 -13.558 11.791  1.00 0.00 ? 5   SER A O    7  
ATOM   6929  C  CB   . SER A 1 5  ? -14.108 -13.434 13.364  1.00 0.00 ? 5   SER A CB   7  
ATOM   6930  O  OG   . SER A 1 5  ? -13.627 -12.109 13.514  1.00 0.00 ? 5   SER A OG   7  
ATOM   6931  H  H    . SER A 1 5  ? -12.018 -13.633 14.830  1.00 0.00 ? 5   SER A H    7  
ATOM   6932  H  HA   . SER A 1 5  ? -13.362 -15.410 13.020  1.00 0.00 ? 5   SER A HA   7  
ATOM   6933  H  HB2  . SER A 1 5  ? -14.798 -13.460 12.534  1.00 0.00 ? 5   SER A HB2  7  
ATOM   6934  H  HB3  . SER A 1 5  ? -14.623 -13.722 14.269  1.00 0.00 ? 5   SER A HB3  7  
ATOM   6935  H  HG   . SER A 1 5  ? -12.935 -12.094 14.180  1.00 0.00 ? 5   SER A HG   7  
ATOM   6936  N  N    . SER A 1 6  ? -12.943 -14.307 10.678  1.00 0.00 ? 6   SER A N    7  
ATOM   6937  C  CA   . SER A 1 6  ? -12.388 -14.016 9.361   1.00 0.00 ? 6   SER A CA   7  
ATOM   6938  C  C    . SER A 1 6  ? -11.846 -12.591 9.302   1.00 0.00 ? 6   SER A C    7  
ATOM   6939  O  O    . SER A 1 6  ? -10.705 -12.365 8.903   1.00 0.00 ? 6   SER A O    7  
ATOM   6940  C  CB   . SER A 1 6  ? -13.453 -14.214 8.281   1.00 0.00 ? 6   SER A CB   7  
ATOM   6941  O  OG   . SER A 1 6  ? -12.859 -14.472 7.020   1.00 0.00 ? 6   SER A OG   7  
ATOM   6942  H  H    . SER A 1 6  ? -13.837 -14.703 10.744  1.00 0.00 ? 6   SER A H    7  
ATOM   6943  H  HA   . SER A 1 6  ? -11.576 -14.705 9.184   1.00 0.00 ? 6   SER A HA   7  
ATOM   6944  H  HB2  . SER A 1 6  ? -14.081 -15.050 8.547   1.00 0.00 ? 6   SER A HB2  7  
ATOM   6945  H  HB3  . SER A 1 6  ? -14.056 -13.320 8.205   1.00 0.00 ? 6   SER A HB3  7  
ATOM   6946  H  HG   . SER A 1 6  ? -13.459 -14.996 6.485   1.00 0.00 ? 6   SER A HG   7  
ATOM   6947  N  N    . GLY A 1 7  ? -12.676 -11.633 9.704   1.00 0.00 ? 7   GLY A N    7  
ATOM   6948  C  CA   . GLY A 1 7  ? -12.264 -10.241 9.690   1.00 0.00 ? 7   GLY A CA   7  
ATOM   6949  C  C    . GLY A 1 7  ? -12.309 -9.637  8.300   1.00 0.00 ? 7   GLY A C    7  
ATOM   6950  O  O    . GLY A 1 7  ? -11.939 -10.286 7.321   1.00 0.00 ? 7   GLY A O    7  
ATOM   6951  H  H    . GLY A 1 7  ? -13.575 -11.872 10.013  1.00 0.00 ? 7   GLY A H    7  
ATOM   6952  H  HA2  . GLY A 1 7  ? -12.917 -9.677  10.338  1.00 0.00 ? 7   GLY A HA2  7  
ATOM   6953  H  HA3  . GLY A 1 7  ? -11.254 -10.173 10.067  1.00 0.00 ? 7   GLY A HA3  7  
ATOM   6954  N  N    . LEU A 1 8  ? -12.764 -8.393  8.213   1.00 0.00 ? 8   LEU A N    7  
ATOM   6955  C  CA   . LEU A 1 8  ? -12.858 -7.701  6.932   1.00 0.00 ? 8   LEU A CA   7  
ATOM   6956  C  C    . LEU A 1 8  ? -11.478 -7.277  6.439   1.00 0.00 ? 8   LEU A C    7  
ATOM   6957  O  O    . LEU A 1 8  ? -10.571 -7.040  7.236   1.00 0.00 ? 8   LEU A O    7  
ATOM   6958  C  CB   . LEU A 1 8  ? -13.766 -6.476  7.057   1.00 0.00 ? 8   LEU A CB   7  
ATOM   6959  C  CG   . LEU A 1 8  ? -15.163 -6.731  7.625   1.00 0.00 ? 8   LEU A CG   7  
ATOM   6960  C  CD1  . LEU A 1 8  ? -15.762 -5.443  8.167   1.00 0.00 ? 8   LEU A CD1  7  
ATOM   6961  C  CD2  . LEU A 1 8  ? -16.068 -7.337  6.562   1.00 0.00 ? 8   LEU A CD2  7  
ATOM   6962  H  H    . LEU A 1 8  ? -13.044 -7.927  9.028   1.00 0.00 ? 8   LEU A H    7  
ATOM   6963  H  HA   . LEU A 1 8  ? -13.288 -8.386  6.216   1.00 0.00 ? 8   LEU A HA   7  
ATOM   6964  H  HB2  . LEU A 1 8  ? -13.273 -5.763  7.700   1.00 0.00 ? 8   LEU A HB2  7  
ATOM   6965  H  HB3  . LEU A 1 8  ? -13.882 -6.049  6.071   1.00 0.00 ? 8   LEU A HB3  7  
ATOM   6966  H  HG   . LEU A 1 8  ? -15.089 -7.434  8.443   1.00 0.00 ? 8   LEU A HG   7  
ATOM   6967  H  HD11 . LEU A 1 8  ? -15.256 -5.166  9.079   1.00 0.00 ? 8   LEU A HD11 7  
ATOM   6968  H  HD12 . LEU A 1 8  ? -16.813 -5.591  8.368   1.00 0.00 ? 8   LEU A HD12 7  
ATOM   6969  H  HD13 . LEU A 1 8  ? -15.644 -4.656  7.436   1.00 0.00 ? 8   LEU A HD13 7  
ATOM   6970  H  HD21 . LEU A 1 8  ? -16.937 -6.709  6.429   1.00 0.00 ? 8   LEU A HD21 7  
ATOM   6971  H  HD22 . LEU A 1 8  ? -16.381 -8.322  6.876   1.00 0.00 ? 8   LEU A HD22 7  
ATOM   6972  H  HD23 . LEU A 1 8  ? -15.530 -7.409  5.629   1.00 0.00 ? 8   LEU A HD23 7  
ATOM   6973  N  N    . GLN A 1 9  ? -11.330 -7.182  5.122   1.00 0.00 ? 9   GLN A N    7  
ATOM   6974  C  CA   . GLN A 1 9  ? -10.060 -6.785  4.524   1.00 0.00 ? 9   GLN A CA   7  
ATOM   6975  C  C    . GLN A 1 9  ? -10.274 -5.726  3.447   1.00 0.00 ? 9   GLN A C    7  
ATOM   6976  O  O    . GLN A 1 9  ? -10.925 -5.979  2.433   1.00 0.00 ? 9   GLN A O    7  
ATOM   6977  C  CB   . GLN A 1 9  ? -9.351  -8.001  3.926   1.00 0.00 ? 9   GLN A CB   7  
ATOM   6978  C  CG   . GLN A 1 9  ? -7.930  -7.714  3.470   1.00 0.00 ? 9   GLN A CG   7  
ATOM   6979  C  CD   . GLN A 1 9  ? -6.904  -7.981  4.554   1.00 0.00 ? 9   GLN A CD   7  
ATOM   6980  O  OE1  . GLN A 1 9  ? -6.972  -8.992  5.253   1.00 0.00 ? 9   GLN A OE1  7  
ATOM   6981  N  NE2  . GLN A 1 9  ? -5.946  -7.073  4.699   1.00 0.00 ? 9   GLN A NE2  7  
ATOM   6982  H  H    . GLN A 1 9  ? -12.090 -7.384  4.539   1.00 0.00 ? 9   GLN A H    7  
ATOM   6983  H  HA   . GLN A 1 9  ? -9.443  -6.367  5.304   1.00 0.00 ? 9   GLN A HA   7  
ATOM   6984  H  HB2  . GLN A 1 9  ? -9.317  -8.784  4.669   1.00 0.00 ? 9   GLN A HB2  7  
ATOM   6985  H  HB3  . GLN A 1 9  ? -9.916  -8.350  3.074   1.00 0.00 ? 9   GLN A HB3  7  
ATOM   6986  H  HG2  . GLN A 1 9  ? -7.704  -8.341  2.621   1.00 0.00 ? 9   GLN A HG2  7  
ATOM   6987  H  HG3  . GLN A 1 9  ? -7.863  -6.676  3.178   1.00 0.00 ? 9   GLN A HG3  7  
ATOM   6988  H  HE21 . GLN A 1 9  ? -5.956  -6.291  4.106   1.00 0.00 ? 9   GLN A HE21 7  
ATOM   6989  H  HE22 . GLN A 1 9  ? -5.270  -7.220  5.392   1.00 0.00 ? 9   GLN A HE22 7  
ATOM   6990  N  N    . CYS A 1 10 ? -9.721  -4.539  3.673   1.00 0.00 ? 10  CYS A N    7  
ATOM   6991  C  CA   . CYS A 1 10 ? -9.851  -3.441  2.723   1.00 0.00 ? 10  CYS A CA   7  
ATOM   6992  C  C    . CYS A 1 10 ? -9.010  -3.698  1.476   1.00 0.00 ? 10  CYS A C    7  
ATOM   6993  O  O    . CYS A 1 10 ? -7.969  -4.350  1.541   1.00 0.00 ? 10  CYS A O    7  
ATOM   6994  C  CB   . CYS A 1 10 ? -9.427  -2.123  3.375   1.00 0.00 ? 10  CYS A CB   7  
ATOM   6995  S  SG   . CYS A 1 10 ? -9.036  -0.799  2.186   1.00 0.00 ? 10  CYS A SG   7  
ATOM   6996  H  H    . CYS A 1 10 ? -9.213  -4.398  4.500   1.00 0.00 ? 10  CYS A H    7  
ATOM   6997  H  HA   . CYS A 1 10 ? -10.889 -3.372  2.435   1.00 0.00 ? 10  CYS A HA   7  
ATOM   6998  H  HB2  . CYS A 1 10 ? -10.227 -1.769  4.008   1.00 0.00 ? 10  CYS A HB2  7  
ATOM   6999  H  HB3  . CYS A 1 10 ? -8.547  -2.295  3.977   1.00 0.00 ? 10  CYS A HB3  7  
ATOM   7000  N  N    . GLU A 1 11 ? -9.471  -3.181  0.341   1.00 0.00 ? 11  GLU A N    7  
ATOM   7001  C  CA   . GLU A 1 11 ? -8.762  -3.356  -0.921  1.00 0.00 ? 11  GLU A CA   7  
ATOM   7002  C  C    . GLU A 1 11 ? -7.957  -2.107  -1.269  1.00 0.00 ? 11  GLU A C    7  
ATOM   7003  O  O    . GLU A 1 11 ? -6.897  -2.193  -1.891  1.00 0.00 ? 11  GLU A O    7  
ATOM   7004  C  CB   . GLU A 1 11 ? -9.749  -3.670  -2.047  1.00 0.00 ? 11  GLU A CB   7  
ATOM   7005  C  CG   . GLU A 1 11 ? -10.706 -2.530  -2.354  1.00 0.00 ? 11  GLU A CG   7  
ATOM   7006  C  CD   . GLU A 1 11 ? -11.996 -3.007  -2.992  1.00 0.00 ? 11  GLU A CD   7  
ATOM   7007  O  OE1  . GLU A 1 11 ? -12.757 -3.734  -2.319  1.00 0.00 ? 11  GLU A OE1  7  
ATOM   7008  O  OE2  . GLU A 1 11 ? -12.245 -2.654  -4.163  1.00 0.00 ? 11  GLU A OE2  7  
ATOM   7009  H  H    . GLU A 1 11 ? -10.308 -2.671  0.353   1.00 0.00 ? 11  GLU A H    7  
ATOM   7010  H  HA   . GLU A 1 11 ? -8.083  -4.187  -0.807  1.00 0.00 ? 11  GLU A HA   7  
ATOM   7011  H  HB2  . GLU A 1 11 ? -9.193  -3.898  -2.944  1.00 0.00 ? 11  GLU A HB2  7  
ATOM   7012  H  HB3  . GLU A 1 11 ? -10.332 -4.535  -1.766  1.00 0.00 ? 11  GLU A HB3  7  
ATOM   7013  H  HG2  . GLU A 1 11 ? -10.945 -2.020  -1.433  1.00 0.00 ? 11  GLU A HG2  7  
ATOM   7014  H  HG3  . GLU A 1 11 ? -10.220 -1.842  -3.030  1.00 0.00 ? 11  GLU A HG3  7  
ATOM   7015  N  N    . ILE A 1 12 ? -8.467  -0.949  -0.865  1.00 0.00 ? 12  ILE A N    7  
ATOM   7016  C  CA   . ILE A 1 12 ? -7.796  0.316   -1.134  1.00 0.00 ? 12  ILE A CA   7  
ATOM   7017  C  C    . ILE A 1 12 ? -6.338  0.271   -0.687  1.00 0.00 ? 12  ILE A C    7  
ATOM   7018  O  O    . ILE A 1 12 ? -5.424  0.406   -1.501  1.00 0.00 ? 12  ILE A O    7  
ATOM   7019  C  CB   . ILE A 1 12 ? -8.501  1.489   -0.427  1.00 0.00 ? 12  ILE A CB   7  
ATOM   7020  C  CG1  . ILE A 1 12 ? -9.905  1.689   -1.002  1.00 0.00 ? 12  ILE A CG1  7  
ATOM   7021  C  CG2  . ILE A 1 12 ? -7.680  2.762   -0.566  1.00 0.00 ? 12  ILE A CG2  7  
ATOM   7022  C  CD1  . ILE A 1 12 ? -10.995 1.050   -0.170  1.00 0.00 ? 12  ILE A CD1  7  
ATOM   7023  H  H    . ILE A 1 12 ? -9.315  -0.946  -0.373  1.00 0.00 ? 12  ILE A H    7  
ATOM   7024  H  HA   . ILE A 1 12 ? -7.830  0.491   -2.199  1.00 0.00 ? 12  ILE A HA   7  
ATOM   7025  H  HB   . ILE A 1 12 ? -8.580  1.253   0.623   1.00 0.00 ? 12  ILE A HB   7  
ATOM   7026  H  HG12 . ILE A 1 12 ? -10.114 2.746   -1.066  1.00 0.00 ? 12  ILE A HG12 7  
ATOM   7027  H  HG13 . ILE A 1 12 ? -9.945  1.258   -1.992  1.00 0.00 ? 12  ILE A HG13 7  
ATOM   7028  H  HG21 . ILE A 1 12 ? -7.182  2.973   0.370   1.00 0.00 ? 12  ILE A HG21 7  
ATOM   7029  H  HG22 . ILE A 1 12 ? -6.942  2.631   -1.343  1.00 0.00 ? 12  ILE A HG22 7  
ATOM   7030  H  HG23 . ILE A 1 12 ? -8.330  3.585   -0.821  1.00 0.00 ? 12  ILE A HG23 7  
ATOM   7031  H  HD11 . ILE A 1 12 ? -11.800 0.731   -0.816  1.00 0.00 ? 12  ILE A HD11 7  
ATOM   7032  H  HD12 . ILE A 1 12 ? -10.594 0.197   0.356   1.00 0.00 ? 12  ILE A HD12 7  
ATOM   7033  H  HD13 . ILE A 1 12 ? -11.371 1.769   0.543   1.00 0.00 ? 12  ILE A HD13 7  
ATOM   7034  N  N    . CYS A 1 13 ? -6.128  0.079   0.610   1.00 0.00 ? 13  CYS A N    7  
ATOM   7035  C  CA   . CYS A 1 13 ? -4.782  0.014   1.167   1.00 0.00 ? 13  CYS A CA   7  
ATOM   7036  C  C    . CYS A 1 13 ? -4.424  -1.416  1.559   1.00 0.00 ? 13  CYS A C    7  
ATOM   7037  O  O    . CYS A 1 13 ? -3.287  -1.853  1.384   1.00 0.00 ? 13  CYS A O    7  
ATOM   7038  C  CB   . CYS A 1 13 ? -4.666  0.933   2.385   1.00 0.00 ? 13  CYS A CB   7  
ATOM   7039  S  SG   . CYS A 1 13 ? -5.750  0.467   3.773   1.00 0.00 ? 13  CYS A SG   7  
ATOM   7040  H  H    . CYS A 1 13 ? -6.898  -0.021  1.210   1.00 0.00 ? 13  CYS A H    7  
ATOM   7041  H  HA   . CYS A 1 13 ? -4.093  0.349   0.407   1.00 0.00 ? 13  CYS A HA   7  
ATOM   7042  H  HB2  . CYS A 1 13 ? -3.647  0.915   2.744   1.00 0.00 ? 13  CYS A HB2  7  
ATOM   7043  H  HB3  . CYS A 1 13 ? -4.921  1.941   2.091   1.00 0.00 ? 13  CYS A HB3  7  
ATOM   7044  N  N    . GLY A 1 14 ? -5.404  -2.141  2.090   1.00 0.00 ? 14  GLY A N    7  
ATOM   7045  C  CA   . GLY A 1 14 ? -5.173  -3.515  2.499   1.00 0.00 ? 14  GLY A CA   7  
ATOM   7046  C  C    . GLY A 1 14 ? -5.238  -3.691  4.003   1.00 0.00 ? 14  GLY A C    7  
ATOM   7047  O  O    . GLY A 1 14 ? -4.559  -4.551  4.565   1.00 0.00 ? 14  GLY A O    7  
ATOM   7048  H  H    . GLY A 1 14 ? -6.291  -1.740  2.206   1.00 0.00 ? 14  GLY A H    7  
ATOM   7049  H  HA2  . GLY A 1 14 ? -5.919  -4.146  2.040   1.00 0.00 ? 14  GLY A HA2  7  
ATOM   7050  H  HA3  . GLY A 1 14 ? -4.196  -3.821  2.154   1.00 0.00 ? 14  GLY A HA3  7  
ATOM   7051  N  N    . PHE A 1 15 ? -6.056  -2.874  4.658   1.00 0.00 ? 15  PHE A N    7  
ATOM   7052  C  CA   . PHE A 1 15 ? -6.205  -2.941  6.107   1.00 0.00 ? 15  PHE A CA   7  
ATOM   7053  C  C    . PHE A 1 15 ? -7.210  -4.021  6.500   1.00 0.00 ? 15  PHE A C    7  
ATOM   7054  O  O    . PHE A 1 15 ? -7.850  -4.632  5.644   1.00 0.00 ? 15  PHE A O    7  
ATOM   7055  C  CB   . PHE A 1 15 ? -6.654  -1.586  6.658   1.00 0.00 ? 15  PHE A CB   7  
ATOM   7056  C  CG   . PHE A 1 15 ? -6.536  -1.478  8.152   1.00 0.00 ? 15  PHE A CG   7  
ATOM   7057  C  CD1  . PHE A 1 15 ? -5.297  -1.334  8.754   1.00 0.00 ? 15  PHE A CD1  7  
ATOM   7058  C  CD2  . PHE A 1 15 ? -7.665  -1.522  8.954   1.00 0.00 ? 15  PHE A CD2  7  
ATOM   7059  C  CE1  . PHE A 1 15 ? -5.185  -1.234  10.128  1.00 0.00 ? 15  PHE A CE1  7  
ATOM   7060  C  CE2  . PHE A 1 15 ? -7.560  -1.422  10.328  1.00 0.00 ? 15  PHE A CE2  7  
ATOM   7061  C  CZ   . PHE A 1 15 ? -6.318  -1.279  10.916  1.00 0.00 ? 15  PHE A CZ   7  
ATOM   7062  H  H    . PHE A 1 15 ? -6.571  -2.209  4.154   1.00 0.00 ? 15  PHE A H    7  
ATOM   7063  H  HA   . PHE A 1 15 ? -5.244  -3.191  6.527   1.00 0.00 ? 15  PHE A HA   7  
ATOM   7064  H  HB2  . PHE A 1 15 ? -6.046  -0.809  6.221   1.00 0.00 ? 15  PHE A HB2  7  
ATOM   7065  H  HB3  . PHE A 1 15 ? -7.687  -1.422  6.393   1.00 0.00 ? 15  PHE A HB3  7  
ATOM   7066  H  HD1  . PHE A 1 15 ? -4.409  -1.299  8.138   1.00 0.00 ? 15  PHE A HD1  7  
ATOM   7067  H  HD2  . PHE A 1 15 ? -8.637  -1.634  8.496   1.00 0.00 ? 15  PHE A HD2  7  
ATOM   7068  H  HE1  . PHE A 1 15 ? -4.212  -1.123  10.584  1.00 0.00 ? 15  PHE A HE1  7  
ATOM   7069  H  HE2  . PHE A 1 15 ? -8.447  -1.457  10.942  1.00 0.00 ? 15  PHE A HE2  7  
ATOM   7070  H  HZ   . PHE A 1 15 ? -6.233  -1.201  11.990  1.00 0.00 ? 15  PHE A HZ   7  
ATOM   7071  N  N    . THR A 1 16 ? -7.343  -4.250  7.803   1.00 0.00 ? 16  THR A N    7  
ATOM   7072  C  CA   . THR A 1 16 ? -8.267  -5.256  8.311   1.00 0.00 ? 16  THR A CA   7  
ATOM   7073  C  C    . THR A 1 16 ? -9.043  -4.732  9.514   1.00 0.00 ? 16  THR A C    7  
ATOM   7074  O  O    . THR A 1 16 ? -8.459  -4.194  10.455  1.00 0.00 ? 16  THR A O    7  
ATOM   7075  C  CB   . THR A 1 16 ? -7.527  -6.546  8.714   1.00 0.00 ? 16  THR A CB   7  
ATOM   7076  O  OG1  . THR A 1 16 ? -6.259  -6.223  9.294   1.00 0.00 ? 16  THR A OG1  7  
ATOM   7077  C  CG2  . THR A 1 16 ? -7.323  -7.452  7.509   1.00 0.00 ? 16  THR A CG2  7  
ATOM   7078  H  H    . THR A 1 16 ? -6.805  -3.731  8.436   1.00 0.00 ? 16  THR A H    7  
ATOM   7079  H  HA   . THR A 1 16 ? -8.964  -5.498  7.522   1.00 0.00 ? 16  THR A HA   7  
ATOM   7080  H  HB   . THR A 1 16 ? -8.125  -7.072  9.445   1.00 0.00 ? 16  THR A HB   7  
ATOM   7081  H  HG1  . THR A 1 16 ? -5.638  -5.993  8.599   1.00 0.00 ? 16  THR A HG1  7  
ATOM   7082  H  HG21 . THR A 1 16 ? -6.545  -7.045  6.880   1.00 0.00 ? 16  THR A HG21 7  
ATOM   7083  H  HG22 . THR A 1 16 ? -8.243  -7.516  6.948   1.00 0.00 ? 16  THR A HG22 7  
ATOM   7084  H  HG23 . THR A 1 16 ? -7.036  -8.437  7.844   1.00 0.00 ? 16  THR A HG23 7  
ATOM   7085  N  N    . CYS A 1 17 ? -10.361 -4.894  9.478   1.00 0.00 ? 17  CYS A N    7  
ATOM   7086  C  CA   . CYS A 1 17 ? -11.218 -4.436  10.566  1.00 0.00 ? 17  CYS A CA   7  
ATOM   7087  C  C    . CYS A 1 17 ? -12.324 -5.447  10.848  1.00 0.00 ? 17  CYS A C    7  
ATOM   7088  O  O    . CYS A 1 17 ? -12.956 -5.964  9.927   1.00 0.00 ? 17  CYS A O    7  
ATOM   7089  C  CB   . CYS A 1 17 ? -11.827 -3.075  10.225  1.00 0.00 ? 17  CYS A CB   7  
ATOM   7090  S  SG   . CYS A 1 17 ? -12.352 -2.120  11.668  1.00 0.00 ? 17  CYS A SG   7  
ATOM   7091  H  H    . CYS A 1 17 ? -10.768 -5.330  8.701   1.00 0.00 ? 17  CYS A H    7  
ATOM   7092  H  HA   . CYS A 1 17 ? -10.605 -4.336  11.449  1.00 0.00 ? 17  CYS A HA   7  
ATOM   7093  H  HB2  . CYS A 1 17 ? -11.097 -2.486  9.690   1.00 0.00 ? 17  CYS A HB2  7  
ATOM   7094  H  HB3  . CYS A 1 17 ? -12.692 -3.224  9.596   1.00 0.00 ? 17  CYS A HB3  7  
ATOM   7095  H  HG   . CYS A 1 17 ? -12.145 -2.861  12.746  1.00 0.00 ? 17  CYS A HG   7  
ATOM   7096  N  N    . ARG A 1 18 ? -12.553 -5.724  12.128  1.00 0.00 ? 18  ARG A N    7  
ATOM   7097  C  CA   . ARG A 1 18 ? -13.582 -6.675  12.531  1.00 0.00 ? 18  ARG A CA   7  
ATOM   7098  C  C    . ARG A 1 18 ? -14.975 -6.079  12.348  1.00 0.00 ? 18  ARG A C    7  
ATOM   7099  O  O    . ARG A 1 18 ? -15.875 -6.733  11.821  1.00 0.00 ? 18  ARG A O    7  
ATOM   7100  C  CB   . ARG A 1 18 ? -13.380 -7.088  13.990  1.00 0.00 ? 18  ARG A CB   7  
ATOM   7101  C  CG   . ARG A 1 18 ? -12.189 -8.008  14.203  1.00 0.00 ? 18  ARG A CG   7  
ATOM   7102  C  CD   . ARG A 1 18 ? -10.934 -7.221  14.548  1.00 0.00 ? 18  ARG A CD   7  
ATOM   7103  N  NE   . ARG A 1 18 ? -10.857 -6.909  15.972  1.00 0.00 ? 18  ARG A NE   7  
ATOM   7104  C  CZ   . ARG A 1 18 ? -9.786  -6.377  16.551  1.00 0.00 ? 18  ARG A CZ   7  
ATOM   7105  N  NH1  . ARG A 1 18 ? -8.708  -6.101  15.831  1.00 0.00 ? 18  ARG A NH1  7  
ATOM   7106  N  NH2  . ARG A 1 18 ? -9.793  -6.122  17.853  1.00 0.00 ? 18  ARG A NH2  7  
ATOM   7107  H  H    . ARG A 1 18 ? -12.017 -5.279  12.817  1.00 0.00 ? 18  ARG A H    7  
ATOM   7108  H  HA   . ARG A 1 18 ? -13.491 -7.548  11.903  1.00 0.00 ? 18  ARG A HA   7  
ATOM   7109  H  HB2  . ARG A 1 18 ? -13.233 -6.200  14.587  1.00 0.00 ? 18  ARG A HB2  7  
ATOM   7110  H  HB3  . ARG A 1 18 ? -14.267 -7.600  14.333  1.00 0.00 ? 18  ARG A HB3  7  
ATOM   7111  H  HG2  . ARG A 1 18 ? -12.409 -8.685  15.015  1.00 0.00 ? 18  ARG A HG2  7  
ATOM   7112  H  HG3  . ARG A 1 18 ? -12.014 -8.571  13.299  1.00 0.00 ? 18  ARG A HG3  7  
ATOM   7113  H  HD2  . ARG A 1 18 ? -10.070 -7.808  14.271  1.00 0.00 ? 18  ARG A HD2  7  
ATOM   7114  H  HD3  . ARG A 1 18 ? -10.937 -6.299  13.986  1.00 0.00 ? 18  ARG A HD3  7  
ATOM   7115  H  HE   . ARG A 1 18 ? -11.643 -7.105  16.523  1.00 0.00 ? 18  ARG A HE   7  
ATOM   7116  H  HH11 . ARG A 1 18 ? -8.700  -6.291  14.850  1.00 0.00 ? 18  ARG A HH11 7  
ATOM   7117  H  HH12 . ARG A 1 18 ? -7.903  -5.699  16.270  1.00 0.00 ? 18  ARG A HH12 7  
ATOM   7118  H  HH21 . ARG A 1 18 ? -10.604 -6.329  18.399  1.00 0.00 ? 18  ARG A HH21 7  
ATOM   7119  H  HH22 . ARG A 1 18 ? -8.986  -5.722  18.288  1.00 0.00 ? 18  ARG A HH22 7  
ATOM   7120  N  N    . GLN A 1 19 ? -15.144 -4.836  12.788  1.00 0.00 ? 19  GLN A N    7  
ATOM   7121  C  CA   . GLN A 1 19 ? -16.428 -4.154  12.673  1.00 0.00 ? 19  GLN A CA   7  
ATOM   7122  C  C    . GLN A 1 19 ? -16.611 -3.571  11.276  1.00 0.00 ? 19  GLN A C    7  
ATOM   7123  O  O    . GLN A 1 19 ? -15.666 -3.059  10.676  1.00 0.00 ? 19  GLN A O    7  
ATOM   7124  C  CB   . GLN A 1 19 ? -16.534 -3.044  13.720  1.00 0.00 ? 19  GLN A CB   7  
ATOM   7125  C  CG   . GLN A 1 19 ? -16.438 -3.546  15.152  1.00 0.00 ? 19  GLN A CG   7  
ATOM   7126  C  CD   . GLN A 1 19 ? -16.974 -2.547  16.158  1.00 0.00 ? 19  GLN A CD   7  
ATOM   7127  O  OE1  . GLN A 1 19 ? -18.180 -2.309  16.231  1.00 0.00 ? 19  GLN A OE1  7  
ATOM   7128  N  NE2  . GLN A 1 19 ? -16.079 -1.956  16.941  1.00 0.00 ? 19  GLN A NE2  7  
ATOM   7129  H  H    . GLN A 1 19 ? -14.389 -4.368  13.199  1.00 0.00 ? 19  GLN A H    7  
ATOM   7130  H  HA   . GLN A 1 19 ? -17.206 -4.880  12.852  1.00 0.00 ? 19  GLN A HA   7  
ATOM   7131  H  HB2  . GLN A 1 19 ? -15.738 -2.333  13.556  1.00 0.00 ? 19  GLN A HB2  7  
ATOM   7132  H  HB3  . GLN A 1 19 ? -17.483 -2.543  13.601  1.00 0.00 ? 19  GLN A HB3  7  
ATOM   7133  H  HG2  . GLN A 1 19 ? -17.006 -4.460  15.238  1.00 0.00 ? 19  GLN A HG2  7  
ATOM   7134  H  HG3  . GLN A 1 19 ? -15.401 -3.745  15.381  1.00 0.00 ? 19  GLN A HG3  7  
ATOM   7135  H  HE21 . GLN A 1 19 ? -15.135 -2.195  16.825  1.00 0.00 ? 19  GLN A HE21 7  
ATOM   7136  H  HE22 . GLN A 1 19 ? -16.397 -1.306  17.600  1.00 0.00 ? 19  GLN A HE22 7  
ATOM   7137  N  N    . LYS A 1 20 ? -17.834 -3.653  10.762  1.00 0.00 ? 20  LYS A N    7  
ATOM   7138  C  CA   . LYS A 1 20 ? -18.144 -3.133  9.436   1.00 0.00 ? 20  LYS A CA   7  
ATOM   7139  C  C    . LYS A 1 20 ? -18.169 -1.608  9.441   1.00 0.00 ? 20  LYS A C    7  
ATOM   7140  O  O    . LYS A 1 20 ? -17.506 -0.964  8.629   1.00 0.00 ? 20  LYS A O    7  
ATOM   7141  C  CB   . LYS A 1 20 ? -19.492 -3.674  8.955   1.00 0.00 ? 20  LYS A CB   7  
ATOM   7142  C  CG   . LYS A 1 20 ? -19.758 -3.422  7.481   1.00 0.00 ? 20  LYS A CG   7  
ATOM   7143  C  CD   . LYS A 1 20 ? -19.153 -4.511  6.611   1.00 0.00 ? 20  LYS A CD   7  
ATOM   7144  C  CE   . LYS A 1 20 ? -18.827 -3.994  5.218   1.00 0.00 ? 20  LYS A CE   7  
ATOM   7145  N  NZ   . LYS A 1 20 ? -20.054 -3.792  4.400   1.00 0.00 ? 20  LYS A NZ   7  
ATOM   7146  H  H    . LYS A 1 20 ? -18.547 -4.073  11.289  1.00 0.00 ? 20  LYS A H    7  
ATOM   7147  H  HA   . LYS A 1 20 ? -17.370 -3.466  8.760   1.00 0.00 ? 20  LYS A HA   7  
ATOM   7148  H  HB2  . LYS A 1 20 ? -19.521 -4.740  9.128   1.00 0.00 ? 20  LYS A HB2  7  
ATOM   7149  H  HB3  . LYS A 1 20 ? -20.279 -3.205  9.527   1.00 0.00 ? 20  LYS A HB3  7  
ATOM   7150  H  HG2  . LYS A 1 20 ? -20.825 -3.397  7.316   1.00 0.00 ? 20  LYS A HG2  7  
ATOM   7151  H  HG3  . LYS A 1 20 ? -19.326 -2.471  7.205   1.00 0.00 ? 20  LYS A HG3  7  
ATOM   7152  H  HD2  . LYS A 1 20 ? -18.243 -4.865  7.073   1.00 0.00 ? 20  LYS A HD2  7  
ATOM   7153  H  HD3  . LYS A 1 20 ? -19.857 -5.326  6.527   1.00 0.00 ? 20  LYS A HD3  7  
ATOM   7154  H  HE2  . LYS A 1 20 ? -18.306 -3.053  5.310   1.00 0.00 ? 20  LYS A HE2  7  
ATOM   7155  H  HE3  . LYS A 1 20 ? -18.188 -4.711  4.723   1.00 0.00 ? 20  LYS A HE3  7  
ATOM   7156  H  HZ1  . LYS A 1 20 ? -20.356 -4.694  3.980   1.00 0.00 ? 20  LYS A HZ1  7  
ATOM   7157  H  HZ2  . LYS A 1 20 ? -19.866 -3.113  3.635   1.00 0.00 ? 20  LYS A HZ2  7  
ATOM   7158  H  HZ3  . LYS A 1 20 ? -20.824 -3.424  4.995   1.00 0.00 ? 20  LYS A HZ3  7  
ATOM   7159  N  N    . ALA A 1 21 ? -18.937 -1.037  10.364  1.00 0.00 ? 21  ALA A N    7  
ATOM   7160  C  CA   . ALA A 1 21 ? -19.045 0.412   10.477  1.00 0.00 ? 21  ALA A CA   7  
ATOM   7161  C  C    . ALA A 1 21 ? -17.678 1.076   10.352  1.00 0.00 ? 21  ALA A C    7  
ATOM   7162  O  O    . ALA A 1 21 ? -17.533 2.098   9.681   1.00 0.00 ? 21  ALA A O    7  
ATOM   7163  C  CB   . ALA A 1 21 ? -19.699 0.791   11.797  1.00 0.00 ? 21  ALA A CB   7  
ATOM   7164  H  H    . ALA A 1 21 ? -19.441 -1.604  10.984  1.00 0.00 ? 21  ALA A H    7  
ATOM   7165  H  HA   . ALA A 1 21 ? -19.679 0.763   9.675   1.00 0.00 ? 21  ALA A HA   7  
ATOM   7166  H  HB1  . ALA A 1 21 ? -18.943 1.135   12.487  1.00 0.00 ? 21  ALA A HB1  7  
ATOM   7167  H  HB2  . ALA A 1 21 ? -20.419 1.578   11.629  1.00 0.00 ? 21  ALA A HB2  7  
ATOM   7168  H  HB3  . ALA A 1 21 ? -20.199 -0.072  12.212  1.00 0.00 ? 21  ALA A HB3  7  
ATOM   7169  N  N    . SER A 1 22 ? -16.679 0.490   11.003  1.00 0.00 ? 22  SER A N    7  
ATOM   7170  C  CA   . SER A 1 22 ? -15.324 1.028   10.968  1.00 0.00 ? 22  SER A CA   7  
ATOM   7171  C  C    . SER A 1 22 ? -14.781 1.042   9.542   1.00 0.00 ? 22  SER A C    7  
ATOM   7172  O  O    . SER A 1 22 ? -14.344 2.080   9.042   1.00 0.00 ? 22  SER A O    7  
ATOM   7173  C  CB   . SER A 1 22 ? -14.401 0.203   11.868  1.00 0.00 ? 22  SER A CB   7  
ATOM   7174  O  OG   . SER A 1 22 ? -14.445 0.668   13.206  1.00 0.00 ? 22  SER A OG   7  
ATOM   7175  H  H    . SER A 1 22 ? -16.858 -0.323  11.521  1.00 0.00 ? 22  SER A H    7  
ATOM   7176  H  HA   . SER A 1 22 ? -15.360 2.042   11.338  1.00 0.00 ? 22  SER A HA   7  
ATOM   7177  H  HB2  . SER A 1 22 ? -14.713 -0.830  11.849  1.00 0.00 ? 22  SER A HB2  7  
ATOM   7178  H  HB3  . SER A 1 22 ? -13.387 0.279   11.506  1.00 0.00 ? 22  SER A HB3  7  
ATOM   7179  H  HG   . SER A 1 22 ? -14.665 1.602   13.213  1.00 0.00 ? 22  SER A HG   7  
ATOM   7180  N  N    . LEU A 1 23 ? -14.813 -0.116  8.892   1.00 0.00 ? 23  LEU A N    7  
ATOM   7181  C  CA   . LEU A 1 23 ? -14.325 -0.238  7.523   1.00 0.00 ? 23  LEU A CA   7  
ATOM   7182  C  C    . LEU A 1 23 ? -14.843 0.905   6.656   1.00 0.00 ? 23  LEU A C    7  
ATOM   7183  O  O    . LEU A 1 23 ? -14.073 1.574   5.969   1.00 0.00 ? 23  LEU A O    7  
ATOM   7184  C  CB   . LEU A 1 23 ? -14.753 -1.580  6.926   1.00 0.00 ? 23  LEU A CB   7  
ATOM   7185  C  CG   . LEU A 1 23 ? -14.035 -2.004  5.644   1.00 0.00 ? 23  LEU A CG   7  
ATOM   7186  C  CD1  . LEU A 1 23 ? -12.566 -2.284  5.922   1.00 0.00 ? 23  LEU A CD1  7  
ATOM   7187  C  CD2  . LEU A 1 23 ? -14.707 -3.226  5.036   1.00 0.00 ? 23  LEU A CD2  7  
ATOM   7188  H  H    . LEU A 1 23 ? -15.173 -0.908  9.343   1.00 0.00 ? 23  LEU A H    7  
ATOM   7189  H  HA   . LEU A 1 23 ? -13.247 -0.193  7.550   1.00 0.00 ? 23  LEU A HA   7  
ATOM   7190  H  HB2  . LEU A 1 23 ? -14.579 -2.343  7.670   1.00 0.00 ? 23  LEU A HB2  7  
ATOM   7191  H  HB3  . LEU A 1 23 ? -15.810 -1.524  6.711   1.00 0.00 ? 23  LEU A HB3  7  
ATOM   7192  H  HG   . LEU A 1 23 ? -14.090 -1.198  4.925   1.00 0.00 ? 23  LEU A HG   7  
ATOM   7193  H  HD11 . LEU A 1 23 ? -12.152 -2.868  5.115   1.00 0.00 ? 23  LEU A HD11 7  
ATOM   7194  H  HD12 . LEU A 1 23 ? -12.473 -2.832  6.848   1.00 0.00 ? 23  LEU A HD12 7  
ATOM   7195  H  HD13 . LEU A 1 23 ? -12.031 -1.349  6.003   1.00 0.00 ? 23  LEU A HD13 7  
ATOM   7196  H  HD21 . LEU A 1 23 ? -13.971 -4.002  4.883   1.00 0.00 ? 23  LEU A HD21 7  
ATOM   7197  H  HD22 . LEU A 1 23 ? -15.150 -2.959  4.087   1.00 0.00 ? 23  LEU A HD22 7  
ATOM   7198  H  HD23 . LEU A 1 23 ? -15.475 -3.585  5.705   1.00 0.00 ? 23  LEU A HD23 7  
ATOM   7199  N  N    . ASN A 1 24 ? -16.154 1.124   6.695   1.00 0.00 ? 24  ASN A N    7  
ATOM   7200  C  CA   . ASN A 1 24 ? -16.775 2.187   5.914   1.00 0.00 ? 24  ASN A CA   7  
ATOM   7201  C  C    . ASN A 1 24 ? -16.077 3.521   6.161   1.00 0.00 ? 24  ASN A C    7  
ATOM   7202  O  O    . ASN A 1 24 ? -15.639 4.187   5.222   1.00 0.00 ? 24  ASN A O    7  
ATOM   7203  C  CB   . ASN A 1 24 ? -18.260 2.304   6.263   1.00 0.00 ? 24  ASN A CB   7  
ATOM   7204  C  CG   . ASN A 1 24 ? -19.117 1.329   5.479   1.00 0.00 ? 24  ASN A CG   7  
ATOM   7205  O  OD1  . ASN A 1 24 ? -19.241 1.437   4.259   1.00 0.00 ? 24  ASN A OD1  7  
ATOM   7206  N  ND2  . ASN A 1 24 ? -19.712 0.370   6.178   1.00 0.00 ? 24  ASN A ND2  7  
ATOM   7207  H  H    . ASN A 1 24 ? -16.717 0.556   7.262   1.00 0.00 ? 24  ASN A H    7  
ATOM   7208  H  HA   . ASN A 1 24 ? -16.679 1.931   4.870   1.00 0.00 ? 24  ASN A HA   7  
ATOM   7209  H  HB2  . ASN A 1 24 ? -18.393 2.103   7.317   1.00 0.00 ? 24  ASN A HB2  7  
ATOM   7210  H  HB3  . ASN A 1 24 ? -18.597 3.306   6.047   1.00 0.00 ? 24  ASN A HB3  7  
ATOM   7211  H  HD21 . ASN A 1 24 ? -19.568 0.345   7.147   1.00 0.00 ? 24  ASN A HD21 7  
ATOM   7212  H  HD22 . ASN A 1 24 ? -20.271 -0.275  5.696   1.00 0.00 ? 24  ASN A HD22 7  
ATOM   7213  N  N    . TRP A 1 25 ? -15.977 3.905   7.428   1.00 0.00 ? 25  TRP A N    7  
ATOM   7214  C  CA   . TRP A 1 25 ? -15.331 5.160   7.798   1.00 0.00 ? 25  TRP A CA   7  
ATOM   7215  C  C    . TRP A 1 25 ? -13.854 5.144   7.421   1.00 0.00 ? 25  TRP A C    7  
ATOM   7216  O  O    . TRP A 1 25 ? -13.249 6.192   7.195   1.00 0.00 ? 25  TRP A O    7  
ATOM   7217  C  CB   . TRP A 1 25 ? -15.485 5.413   9.298   1.00 0.00 ? 25  TRP A CB   7  
ATOM   7218  C  CG   . TRP A 1 25 ? -14.747 6.628   9.774   1.00 0.00 ? 25  TRP A CG   7  
ATOM   7219  C  CD1  . TRP A 1 25 ? -13.398 6.835   9.732   1.00 0.00 ? 25  TRP A CD1  7  
ATOM   7220  C  CD2  . TRP A 1 25 ? -15.317 7.800   10.366  1.00 0.00 ? 25  TRP A CD2  7  
ATOM   7221  N  NE1  . TRP A 1 25 ? -13.095 8.066   10.262  1.00 0.00 ? 25  TRP A NE1  7  
ATOM   7222  C  CE2  . TRP A 1 25 ? -14.255 8.678   10.657  1.00 0.00 ? 25  TRP A CE2  7  
ATOM   7223  C  CE3  . TRP A 1 25 ? -16.621 8.195   10.676  1.00 0.00 ? 25  TRP A CE3  7  
ATOM   7224  C  CZ2  . TRP A 1 25 ? -14.459 9.924   11.244  1.00 0.00 ? 25  TRP A CZ2  7  
ATOM   7225  C  CZ3  . TRP A 1 25 ? -16.822 9.432   11.258  1.00 0.00 ? 25  TRP A CZ3  7  
ATOM   7226  C  CH2  . TRP A 1 25 ? -15.747 10.285  11.537  1.00 0.00 ? 25  TRP A CH2  7  
ATOM   7227  H  H    . TRP A 1 25 ? -16.345 3.331   8.132   1.00 0.00 ? 25  TRP A H    7  
ATOM   7228  H  HA   . TRP A 1 25 ? -15.821 5.955   7.255   1.00 0.00 ? 25  TRP A HA   7  
ATOM   7229  H  HB2  . TRP A 1 25 ? -16.531 5.548   9.529   1.00 0.00 ? 25  TRP A HB2  7  
ATOM   7230  H  HB3  . TRP A 1 25 ? -15.108 4.559   9.841   1.00 0.00 ? 25  TRP A HB3  7  
ATOM   7231  H  HD1  . TRP A 1 25 ? -12.685 6.126   9.339   1.00 0.00 ? 25  TRP A HD1  7  
ATOM   7232  H  HE1  . TRP A 1 25 ? -12.194 8.445   10.342  1.00 0.00 ? 25  TRP A HE1  7  
ATOM   7233  H  HE3  . TRP A 1 25 ? -17.464 7.551   10.469  1.00 0.00 ? 25  TRP A HE3  7  
ATOM   7234  H  HZ2  . TRP A 1 25 ? -13.641 10.594  11.464  1.00 0.00 ? 25  TRP A HZ2  7  
ATOM   7235  H  HZ3  . TRP A 1 25 ? -17.824 9.753   11.505  1.00 0.00 ? 25  TRP A HZ3  7  
ATOM   7236  H  HH2  . TRP A 1 25 ? -15.950 11.241  11.992  1.00 0.00 ? 25  TRP A HH2  7  
ATOM   7237  N  N    . HIS A 1 26 ? -13.278 3.948   7.355   1.00 0.00 ? 26  HIS A N    7  
ATOM   7238  C  CA   . HIS A 1 26 ? -11.870 3.796   7.004   1.00 0.00 ? 26  HIS A CA   7  
ATOM   7239  C  C    . HIS A 1 26 ? -11.680 3.827   5.491   1.00 0.00 ? 26  HIS A C    7  
ATOM   7240  O  O    . HIS A 1 26 ? -10.581 4.079   4.999   1.00 0.00 ? 26  HIS A O    7  
ATOM   7241  C  CB   . HIS A 1 26 ? -11.319 2.487   7.572   1.00 0.00 ? 26  HIS A CB   7  
ATOM   7242  C  CG   . HIS A 1 26 ? -10.169 1.932   6.790   1.00 0.00 ? 26  HIS A CG   7  
ATOM   7243  N  ND1  . HIS A 1 26 ? -8.851  2.178   7.111   1.00 0.00 ? 26  HIS A ND1  7  
ATOM   7244  C  CD2  . HIS A 1 26 ? -10.146 1.136   5.695   1.00 0.00 ? 26  HIS A CD2  7  
ATOM   7245  C  CE1  . HIS A 1 26 ? -8.067  1.560   6.247   1.00 0.00 ? 26  HIS A CE1  7  
ATOM   7246  N  NE2  . HIS A 1 26 ? -8.827  0.920   5.377   1.00 0.00 ? 26  HIS A NE2  7  
ATOM   7247  H  H    . HIS A 1 26 ? -13.812 3.149   7.546   1.00 0.00 ? 26  HIS A H    7  
ATOM   7248  H  HA   . HIS A 1 26 ? -11.329 4.623   7.439   1.00 0.00 ? 26  HIS A HA   7  
ATOM   7249  H  HB2  . HIS A 1 26 ? -10.981 2.656   8.584   1.00 0.00 ? 26  HIS A HB2  7  
ATOM   7250  H  HB3  . HIS A 1 26 ? -12.106 1.746   7.579   1.00 0.00 ? 26  HIS A HB3  7  
ATOM   7251  H  HD1  . HIS A 1 26 ? -8.538  2.726   7.860   1.00 0.00 ? 26  HIS A HD1  7  
ATOM   7252  H  HD2  . HIS A 1 26 ? -11.004 0.745   5.167   1.00 0.00 ? 26  HIS A HD2  7  
ATOM   7253  H  HE1  . HIS A 1 26 ? -6.987  1.574   6.251   1.00 0.00 ? 26  HIS A HE1  7  
ATOM   7254  N  N    . GLN A 1 27 ? -12.759 3.569   4.759   1.00 0.00 ? 27  GLN A N    7  
ATOM   7255  C  CA   . GLN A 1 27 ? -12.710 3.566   3.301   1.00 0.00 ? 27  GLN A CA   7  
ATOM   7256  C  C    . GLN A 1 27 ? -13.014 4.953   2.744   1.00 0.00 ? 27  GLN A C    7  
ATOM   7257  O  O    . GLN A 1 27 ? -12.414 5.381   1.758   1.00 0.00 ? 27  GLN A O    7  
ATOM   7258  C  CB   . GLN A 1 27 ? -13.704 2.549   2.739   1.00 0.00 ? 27  GLN A CB   7  
ATOM   7259  C  CG   . GLN A 1 27 ? -13.274 1.104   2.937   1.00 0.00 ? 27  GLN A CG   7  
ATOM   7260  C  CD   . GLN A 1 27 ? -13.928 0.160   1.948   1.00 0.00 ? 27  GLN A CD   7  
ATOM   7261  O  OE1  . GLN A 1 27 ? -14.899 0.517   1.279   1.00 0.00 ? 27  GLN A OE1  7  
ATOM   7262  N  NE2  . GLN A 1 27 ? -13.398 -1.054  1.849   1.00 0.00 ? 27  GLN A NE2  7  
ATOM   7263  H  H    . GLN A 1 27 ? -13.607 3.376   5.209   1.00 0.00 ? 27  GLN A H    7  
ATOM   7264  H  HA   . GLN A 1 27 ? -11.712 3.283   3.004   1.00 0.00 ? 27  GLN A HA   7  
ATOM   7265  H  HB2  . GLN A 1 27 ? -14.658 2.688   3.225   1.00 0.00 ? 27  GLN A HB2  7  
ATOM   7266  H  HB3  . GLN A 1 27 ? -13.820 2.725   1.679   1.00 0.00 ? 27  GLN A HB3  7  
ATOM   7267  H  HG2  . GLN A 1 27 ? -12.203 1.041   2.817   1.00 0.00 ? 27  GLN A HG2  7  
ATOM   7268  H  HG3  . GLN A 1 27 ? -13.542 0.797   3.937   1.00 0.00 ? 27  GLN A HG3  7  
ATOM   7269  H  HE21 . GLN A 1 27 ? -12.625 -1.268  2.414   1.00 0.00 ? 27  GLN A HE21 7  
ATOM   7270  H  HE22 . GLN A 1 27 ? -13.801 -1.685  1.218   1.00 0.00 ? 27  GLN A HE22 7  
ATOM   7271  N  N    . ARG A 1 28 ? -13.949 5.650   3.382   1.00 0.00 ? 28  ARG A N    7  
ATOM   7272  C  CA   . ARG A 1 28 ? -14.333 6.988   2.948   1.00 0.00 ? 28  ARG A CA   7  
ATOM   7273  C  C    . ARG A 1 28 ? -13.138 7.936   2.986   1.00 0.00 ? 28  ARG A C    7  
ATOM   7274  O  O    . ARG A 1 28 ? -13.028 8.849   2.167   1.00 0.00 ? 28  ARG A O    7  
ATOM   7275  C  CB   . ARG A 1 28 ? -15.456 7.531   3.833   1.00 0.00 ? 28  ARG A CB   7  
ATOM   7276  C  CG   . ARG A 1 28 ? -14.974 8.063   5.173   1.00 0.00 ? 28  ARG A CG   7  
ATOM   7277  C  CD   . ARG A 1 28 ? -16.127 8.598   6.007   1.00 0.00 ? 28  ARG A CD   7  
ATOM   7278  N  NE   . ARG A 1 28 ? -16.390 10.009  5.736   1.00 0.00 ? 28  ARG A NE   7  
ATOM   7279  C  CZ   . ARG A 1 28 ? -15.744 11.005  6.331   1.00 0.00 ? 28  ARG A CZ   7  
ATOM   7280  N  NH1  . ARG A 1 28 ? -14.801 10.747  7.227   1.00 0.00 ? 28  ARG A NH1  7  
ATOM   7281  N  NH2  . ARG A 1 28 ? -16.040 12.263  6.031   1.00 0.00 ? 28  ARG A NH2  7  
ATOM   7282  H  H    . ARG A 1 28 ? -14.392 5.255   4.161   1.00 0.00 ? 28  ARG A H    7  
ATOM   7283  H  HA   . ARG A 1 28 ? -14.689 6.918   1.931   1.00 0.00 ? 28  ARG A HA   7  
ATOM   7284  H  HB2  . ARG A 1 28 ? -15.954 8.335   3.310   1.00 0.00 ? 28  ARG A HB2  7  
ATOM   7285  H  HB3  . ARG A 1 28 ? -16.166 6.739   4.019   1.00 0.00 ? 28  ARG A HB3  7  
ATOM   7286  H  HG2  . ARG A 1 28 ? -14.493 7.262   5.715   1.00 0.00 ? 28  ARG A HG2  7  
ATOM   7287  H  HG3  . ARG A 1 28 ? -14.266 8.859   4.999   1.00 0.00 ? 28  ARG A HG3  7  
ATOM   7288  H  HD2  . ARG A 1 28 ? -17.014 8.026   5.780   1.00 0.00 ? 28  ARG A HD2  7  
ATOM   7289  H  HD3  . ARG A 1 28 ? -15.881 8.482   7.052   1.00 0.00 ? 28  ARG A HD3  7  
ATOM   7290  H  HE   . ARG A 1 28 ? -17.083 10.223  5.077   1.00 0.00 ? 28  ARG A HE   7  
ATOM   7291  H  HH11 . ARG A 1 28 ? -14.575 9.800   7.455   1.00 0.00 ? 28  ARG A HH11 7  
ATOM   7292  H  HH12 . ARG A 1 28 ? -14.316 11.499  7.673   1.00 0.00 ? 28  ARG A HH12 7  
ATOM   7293  H  HH21 . ARG A 1 28 ? -16.750 12.462  5.356   1.00 0.00 ? 28  ARG A HH21 7  
ATOM   7294  H  HH22 . ARG A 1 28 ? -15.554 13.012  6.480   1.00 0.00 ? 28  ARG A HH22 7  
ATOM   7295  N  N    . LYS A 1 29 ? -12.243 7.714   3.944   1.00 0.00 ? 29  LYS A N    7  
ATOM   7296  C  CA   . LYS A 1 29 ? -11.055 8.547   4.090   1.00 0.00 ? 29  LYS A CA   7  
ATOM   7297  C  C    . LYS A 1 29 ? -10.151 8.423   2.868   1.00 0.00 ? 29  LYS A C    7  
ATOM   7298  O  O    . LYS A 1 29 ? -9.559  9.406   2.419   1.00 0.00 ? 29  LYS A O    7  
ATOM   7299  C  CB   . LYS A 1 29 ? -10.283 8.153   5.351   1.00 0.00 ? 29  LYS A CB   7  
ATOM   7300  C  CG   . LYS A 1 29 ? -9.264  7.051   5.121   1.00 0.00 ? 29  LYS A CG   7  
ATOM   7301  C  CD   . LYS A 1 29 ? -8.367  6.858   6.333   1.00 0.00 ? 29  LYS A CD   7  
ATOM   7302  C  CE   . LYS A 1 29 ? -8.935  5.819   7.287   1.00 0.00 ? 29  LYS A CE   7  
ATOM   7303  N  NZ   . LYS A 1 29 ? -7.910  5.333   8.252   1.00 0.00 ? 29  LYS A NZ   7  
ATOM   7304  H  H    . LYS A 1 29 ? -12.386 6.970   4.567   1.00 0.00 ? 29  LYS A H    7  
ATOM   7305  H  HA   . LYS A 1 29 ? -11.378 9.572   4.182   1.00 0.00 ? 29  LYS A HA   7  
ATOM   7306  H  HB2  . LYS A 1 29 ? -9.765  9.022   5.728   1.00 0.00 ? 29  LYS A HB2  7  
ATOM   7307  H  HB3  . LYS A 1 29 ? -10.987 7.813   6.098   1.00 0.00 ? 29  LYS A HB3  7  
ATOM   7308  H  HG2  . LYS A 1 29 ? -9.784  6.126   4.922   1.00 0.00 ? 29  LYS A HG2  7  
ATOM   7309  H  HG3  . LYS A 1 29 ? -8.651  7.312   4.269   1.00 0.00 ? 29  LYS A HG3  7  
ATOM   7310  H  HD2  . LYS A 1 29 ? -7.393  6.531   6.001   1.00 0.00 ? 29  LYS A HD2  7  
ATOM   7311  H  HD3  . LYS A 1 29 ? -8.274  7.801   6.854   1.00 0.00 ? 29  LYS A HD3  7  
ATOM   7312  H  HE2  . LYS A 1 29 ? -9.752  6.262   7.835   1.00 0.00 ? 29  LYS A HE2  7  
ATOM   7313  H  HE3  . LYS A 1 29 ? -9.300  4.982   6.710   1.00 0.00 ? 29  LYS A HE3  7  
ATOM   7314  H  HZ1  . LYS A 1 29 ? -7.751  4.314   8.121   1.00 0.00 ? 29  LYS A HZ1  7  
ATOM   7315  H  HZ2  . LYS A 1 29 ? -8.231  5.500   9.227   1.00 0.00 ? 29  LYS A HZ2  7  
ATOM   7316  H  HZ3  . LYS A 1 29 ? -7.012  5.836   8.103   1.00 0.00 ? 29  LYS A HZ3  7  
ATOM   7317  N  N    . HIS A 1 30 ? -10.048 7.210   2.333   1.00 0.00 ? 30  HIS A N    7  
ATOM   7318  C  CA   . HIS A 1 30 ? -9.217  6.959   1.161   1.00 0.00 ? 30  HIS A CA   7  
ATOM   7319  C  C    . HIS A 1 30 ? -9.556  7.933   0.036   1.00 0.00 ? 30  HIS A C    7  
ATOM   7320  O  O    . HIS A 1 30 ? -8.669  8.416   -0.667  1.00 0.00 ? 30  HIS A O    7  
ATOM   7321  C  CB   . HIS A 1 30 ? -9.400  5.520   0.679   1.00 0.00 ? 30  HIS A CB   7  
ATOM   7322  C  CG   . HIS A 1 30 ? -8.787  4.501   1.589   1.00 0.00 ? 30  HIS A CG   7  
ATOM   7323  N  ND1  . HIS A 1 30 ? -7.549  4.663   2.175   1.00 0.00 ? 30  HIS A ND1  7  
ATOM   7324  C  CD2  . HIS A 1 30 ? -9.249  3.302   2.014   1.00 0.00 ? 30  HIS A CD2  7  
ATOM   7325  C  CE1  . HIS A 1 30 ? -7.276  3.606   2.920   1.00 0.00 ? 30  HIS A CE1  7  
ATOM   7326  N  NE2  . HIS A 1 30 ? -8.291  2.766   2.840   1.00 0.00 ? 30  HIS A NE2  7  
ATOM   7327  H  H    . HIS A 1 30 ? -10.544 6.467   2.736   1.00 0.00 ? 30  HIS A H    7  
ATOM   7328  H  HA   . HIS A 1 30 ? -8.186  7.105   1.448   1.00 0.00 ? 30  HIS A HA   7  
ATOM   7329  H  HB2  . HIS A 1 30 ? -10.455 5.304   0.603   1.00 0.00 ? 30  HIS A HB2  7  
ATOM   7330  H  HB3  . HIS A 1 30 ? -8.945  5.413   -0.295  1.00 0.00 ? 30  HIS A HB3  7  
ATOM   7331  H  HD1  . HIS A 1 30 ? -6.958  5.436   2.060   1.00 0.00 ? 30  HIS A HD1  7  
ATOM   7332  H  HD2  . HIS A 1 30 ? -10.195 2.849   1.753   1.00 0.00 ? 30  HIS A HD2  7  
ATOM   7333  H  HE1  . HIS A 1 30 ? -6.375  3.455   3.497   1.00 0.00 ? 30  HIS A HE1  7  
ATOM   7334  N  N    . ALA A 1 31 ? -10.844 8.215   -0.127  1.00 0.00 ? 31  ALA A N    7  
ATOM   7335  C  CA   . ALA A 1 31 ? -11.299 9.131   -1.166  1.00 0.00 ? 31  ALA A CA   7  
ATOM   7336  C  C    . ALA A 1 31 ? -10.546 10.455  -1.099  1.00 0.00 ? 31  ALA A C    7  
ATOM   7337  O  O    . ALA A 1 31 ? -10.098 10.976  -2.119  1.00 0.00 ? 31  ALA A O    7  
ATOM   7338  C  CB   . ALA A 1 31 ? -12.798 9.366   -1.042  1.00 0.00 ? 31  ALA A CB   7  
ATOM   7339  H  H    . ALA A 1 31 ? -11.504 7.798   0.465   1.00 0.00 ? 31  ALA A H    7  
ATOM   7340  H  HA   . ALA A 1 31 ? -11.111 8.669   -2.124  1.00 0.00 ? 31  ALA A HA   7  
ATOM   7341  H  HB1  . ALA A 1 31 ? -13.307 8.415   -0.985  1.00 0.00 ? 31  ALA A HB1  7  
ATOM   7342  H  HB2  . ALA A 1 31 ? -12.999 9.937   -0.147  1.00 0.00 ? 31  ALA A HB2  7  
ATOM   7343  H  HB3  . ALA A 1 31 ? -13.148 9.913   -1.904  1.00 0.00 ? 31  ALA A HB3  7  
ATOM   7344  N  N    . GLU A 1 32 ? -10.413 10.994  0.109   1.00 0.00 ? 32  GLU A N    7  
ATOM   7345  C  CA   . GLU A 1 32 ? -9.715  12.259  0.308   1.00 0.00 ? 32  GLU A CA   7  
ATOM   7346  C  C    . GLU A 1 32 ? -8.204  12.046  0.347   1.00 0.00 ? 32  GLU A C    7  
ATOM   7347  O  O    . GLU A 1 32 ? -7.438  12.842  -0.199  1.00 0.00 ? 32  GLU A O    7  
ATOM   7348  C  CB   . GLU A 1 32 ? -10.181 12.926  1.603   1.00 0.00 ? 32  GLU A CB   7  
ATOM   7349  C  CG   . GLU A 1 32 ? -9.913  12.095  2.847   1.00 0.00 ? 32  GLU A CG   7  
ATOM   7350  C  CD   . GLU A 1 32 ? -10.063 12.895  4.126   1.00 0.00 ? 32  GLU A CD   7  
ATOM   7351  O  OE1  . GLU A 1 32 ? -11.119 13.537  4.303   1.00 0.00 ? 32  GLU A OE1  7  
ATOM   7352  O  OE2  . GLU A 1 32 ? -9.125  12.878  4.950   1.00 0.00 ? 32  GLU A OE2  7  
ATOM   7353  H  H    . GLU A 1 32 ? -10.792 10.530  0.885   1.00 0.00 ? 32  GLU A H    7  
ATOM   7354  H  HA   . GLU A 1 32 ? -9.954  12.903  -0.524  1.00 0.00 ? 32  GLU A HA   7  
ATOM   7355  H  HB2  . GLU A 1 32 ? -9.671  13.872  1.710   1.00 0.00 ? 32  GLU A HB2  7  
ATOM   7356  H  HB3  . GLU A 1 32 ? -11.244 13.106  1.539   1.00 0.00 ? 32  GLU A HB3  7  
ATOM   7357  H  HG2  . GLU A 1 32 ? -10.611 11.272  2.871   1.00 0.00 ? 32  GLU A HG2  7  
ATOM   7358  H  HG3  . GLU A 1 32 ? -8.905  11.710  2.796   1.00 0.00 ? 32  GLU A HG3  7  
ATOM   7359  N  N    . THR A 1 33 ? -7.781  10.967  0.998   1.00 0.00 ? 33  THR A N    7  
ATOM   7360  C  CA   . THR A 1 33 ? -6.363  10.650  1.111   1.00 0.00 ? 33  THR A CA   7  
ATOM   7361  C  C    . THR A 1 33 ? -5.653  10.822  -0.227  1.00 0.00 ? 33  THR A C    7  
ATOM   7362  O  O    . THR A 1 33 ? -4.624  11.492  -0.313  1.00 0.00 ? 33  THR A O    7  
ATOM   7363  C  CB   . THR A 1 33 ? -6.148  9.209   1.612   1.00 0.00 ? 33  THR A CB   7  
ATOM   7364  O  OG1  . THR A 1 33 ? -6.758  9.041   2.897   1.00 0.00 ? 33  THR A OG1  7  
ATOM   7365  C  CG2  . THR A 1 33 ? -4.665  8.884   1.704   1.00 0.00 ? 33  THR A CG2  7  
ATOM   7366  H  H    . THR A 1 33 ? -8.439  10.371  1.412   1.00 0.00 ? 33  THR A H    7  
ATOM   7367  H  HA   . THR A 1 33 ? -5.926  11.328  1.830   1.00 0.00 ? 33  THR A HA   7  
ATOM   7368  H  HB   . THR A 1 33 ? -6.608  8.528   0.911   1.00 0.00 ? 33  THR A HB   7  
ATOM   7369  H  HG1  . THR A 1 33 ? -6.931  9.902   3.284   1.00 0.00 ? 33  THR A HG1  7  
ATOM   7370  H  HG21 . THR A 1 33 ? -4.504  7.854   1.422   1.00 0.00 ? 33  THR A HG21 7  
ATOM   7371  H  HG22 . THR A 1 33 ? -4.324  9.037   2.717   1.00 0.00 ? 33  THR A HG22 7  
ATOM   7372  H  HG23 . THR A 1 33 ? -4.113  9.530   1.038   1.00 0.00 ? 33  THR A HG23 7  
ATOM   7373  N  N    . VAL A 1 34 ? -6.208  10.212  -1.269  1.00 0.00 ? 34  VAL A N    7  
ATOM   7374  C  CA   . VAL A 1 34 ? -5.628  10.299  -2.604  1.00 0.00 ? 34  VAL A CA   7  
ATOM   7375  C  C    . VAL A 1 34 ? -5.031  11.680  -2.855  1.00 0.00 ? 34  VAL A C    7  
ATOM   7376  O  O    . VAL A 1 34 ? -3.849  11.808  -3.170  1.00 0.00 ? 34  VAL A O    7  
ATOM   7377  C  CB   . VAL A 1 34 ? -6.677  10.001  -3.692  1.00 0.00 ? 34  VAL A CB   7  
ATOM   7378  C  CG1  . VAL A 1 34 ? -6.087  10.219  -5.077  1.00 0.00 ? 34  VAL A CG1  7  
ATOM   7379  C  CG2  . VAL A 1 34 ? -7.206  8.582   -3.546  1.00 0.00 ? 34  VAL A CG2  7  
ATOM   7380  H  H    . VAL A 1 34 ? -7.028  9.692   -1.137  1.00 0.00 ? 34  VAL A H    7  
ATOM   7381  H  HA   . VAL A 1 34 ? -4.844  9.560   -2.677  1.00 0.00 ? 34  VAL A HA   7  
ATOM   7382  H  HB   . VAL A 1 34 ? -7.503  10.685  -3.565  1.00 0.00 ? 34  VAL A HB   7  
ATOM   7383  H  HG11 . VAL A 1 34 ? -5.010  10.268  -5.005  1.00 0.00 ? 34  VAL A HG11 7  
ATOM   7384  H  HG12 . VAL A 1 34 ? -6.369  9.399   -5.722  1.00 0.00 ? 34  VAL A HG12 7  
ATOM   7385  H  HG13 . VAL A 1 34 ? -6.462  11.145  -5.486  1.00 0.00 ? 34  VAL A HG13 7  
ATOM   7386  H  HG21 . VAL A 1 34 ? -6.597  7.909   -4.132  1.00 0.00 ? 34  VAL A HG21 7  
ATOM   7387  H  HG22 . VAL A 1 34 ? -7.169  8.288   -2.507  1.00 0.00 ? 34  VAL A HG22 7  
ATOM   7388  H  HG23 . VAL A 1 34 ? -8.227  8.540   -3.895  1.00 0.00 ? 34  VAL A HG23 7  
ATOM   7389  N  N    . ALA A 1 35 ? -5.858  12.711  -2.711  1.00 0.00 ? 35  ALA A N    7  
ATOM   7390  C  CA   . ALA A 1 35 ? -5.411  14.082  -2.919  1.00 0.00 ? 35  ALA A CA   7  
ATOM   7391  C  C    . ALA A 1 35 ? -3.965  14.263  -2.470  1.00 0.00 ? 35  ALA A C    7  
ATOM   7392  O  O    . ALA A 1 35 ? -3.153  14.854  -3.181  1.00 0.00 ? 35  ALA A O    7  
ATOM   7393  C  CB   . ALA A 1 35 ? -6.320  15.052  -2.179  1.00 0.00 ? 35  ALA A CB   7  
ATOM   7394  H  H    . ALA A 1 35 ? -6.789  12.545  -2.458  1.00 0.00 ? 35  ALA A H    7  
ATOM   7395  H  HA   . ALA A 1 35 ? -5.478  14.299  -3.976  1.00 0.00 ? 35  ALA A HA   7  
ATOM   7396  H  HB1  . ALA A 1 35 ? -7.351  14.765  -2.331  1.00 0.00 ? 35  ALA A HB1  7  
ATOM   7397  H  HB2  . ALA A 1 35 ? -6.091  15.027  -1.125  1.00 0.00 ? 35  ALA A HB2  7  
ATOM   7398  H  HB3  . ALA A 1 35 ? -6.165  16.051  -2.558  1.00 0.00 ? 35  ALA A HB3  7  
ATOM   7399  N  N    . ALA A 1 36 ? -3.650  13.750  -1.285  1.00 0.00 ? 36  ALA A N    7  
ATOM   7400  C  CA   . ALA A 1 36 ? -2.301  13.854  -0.741  1.00 0.00 ? 36  ALA A CA   7  
ATOM   7401  C  C    . ALA A 1 36 ? -1.269  13.319  -1.728  1.00 0.00 ? 36  ALA A C    7  
ATOM   7402  O  O    . ALA A 1 36 ? -0.469  14.078  -2.278  1.00 0.00 ? 36  ALA A O    7  
ATOM   7403  C  CB   . ALA A 1 36 ? -2.206  13.108  0.581   1.00 0.00 ? 36  ALA A CB   7  
ATOM   7404  H  H    . ALA A 1 36 ? -4.341  13.290  -0.764  1.00 0.00 ? 36  ALA A H    7  
ATOM   7405  H  HA   . ALA A 1 36 ? -2.097  14.898  -0.553  1.00 0.00 ? 36  ALA A HA   7  
ATOM   7406  H  HB1  . ALA A 1 36 ? -1.895  12.090  0.397   1.00 0.00 ? 36  ALA A HB1  7  
ATOM   7407  H  HB2  . ALA A 1 36 ? -1.485  13.596  1.219   1.00 0.00 ? 36  ALA A HB2  7  
ATOM   7408  H  HB3  . ALA A 1 36 ? -3.172  13.107  1.064   1.00 0.00 ? 36  ALA A HB3  7  
ATOM   7409  N  N    . LEU A 1 37 ? -1.291  12.010  -1.948  1.00 0.00 ? 37  LEU A N    7  
ATOM   7410  C  CA   . LEU A 1 37 ? -0.356  11.373  -2.869  1.00 0.00 ? 37  LEU A CA   7  
ATOM   7411  C  C    . LEU A 1 37 ? -0.372  12.067  -4.228  1.00 0.00 ? 37  LEU A C    7  
ATOM   7412  O  O    . LEU A 1 37 ? -1.419  12.186  -4.863  1.00 0.00 ? 37  LEU A O    7  
ATOM   7413  C  CB   . LEU A 1 37 ? -0.703  9.892   -3.037  1.00 0.00 ? 37  LEU A CB   7  
ATOM   7414  C  CG   . LEU A 1 37 ? -1.120  9.153   -1.765  1.00 0.00 ? 37  LEU A CG   7  
ATOM   7415  C  CD1  . LEU A 1 37 ? -0.415  9.738   -0.552  1.00 0.00 ? 37  LEU A CD1  7  
ATOM   7416  C  CD2  . LEU A 1 37 ? -2.630  9.210   -1.586  1.00 0.00 ? 37  LEU A CD2  7  
ATOM   7417  H  H    . LEU A 1 37 ? -1.951  11.457  -1.481  1.00 0.00 ? 37  LEU A H    7  
ATOM   7418  H  HA   . LEU A 1 37 ? 0.634   11.457  -2.447  1.00 0.00 ? 37  LEU A HA   7  
ATOM   7419  H  HB2  . LEU A 1 37 ? -1.517  9.821   -3.742  1.00 0.00 ? 37  LEU A HB2  7  
ATOM   7420  H  HB3  . LEU A 1 37 ? 0.166   9.393   -3.441  1.00 0.00 ? 37  LEU A HB3  7  
ATOM   7421  H  HG   . LEU A 1 37 ? -0.832  8.114   -1.849  1.00 0.00 ? 37  LEU A HG   7  
ATOM   7422  H  HD11 . LEU A 1 37 ? -1.104  10.357  0.002   1.00 0.00 ? 37  LEU A HD11 7  
ATOM   7423  H  HD12 . LEU A 1 37 ? 0.425   10.335  -0.876  1.00 0.00 ? 37  LEU A HD12 7  
ATOM   7424  H  HD13 . LEU A 1 37 ? -0.062  8.936   0.081   1.00 0.00 ? 37  LEU A HD13 7  
ATOM   7425  H  HD21 . LEU A 1 37 ? -2.865  9.270   -0.533  1.00 0.00 ? 37  LEU A HD21 7  
ATOM   7426  H  HD22 . LEU A 1 37 ? -3.076  8.319   -2.004  1.00 0.00 ? 37  LEU A HD22 7  
ATOM   7427  H  HD23 . LEU A 1 37 ? -3.020  10.080  -2.092  1.00 0.00 ? 37  LEU A HD23 7  
ATOM   7428  N  N    . ARG A 1 38 ? 0.797   12.522  -4.667  1.00 0.00 ? 38  ARG A N    7  
ATOM   7429  C  CA   . ARG A 1 38 ? 0.919   13.203  -5.950  1.00 0.00 ? 38  ARG A CA   7  
ATOM   7430  C  C    . ARG A 1 38 ? 1.837   12.429  -6.892  1.00 0.00 ? 38  ARG A C    7  
ATOM   7431  O  O    . ARG A 1 38 ? 1.672   12.474  -8.111  1.00 0.00 ? 38  ARG A O    7  
ATOM   7432  C  CB   . ARG A 1 38 ? 1.454   14.622  -5.750  1.00 0.00 ? 38  ARG A CB   7  
ATOM   7433  C  CG   . ARG A 1 38 ? 0.934   15.297  -4.492  1.00 0.00 ? 38  ARG A CG   7  
ATOM   7434  C  CD   . ARG A 1 38 ? 1.868   15.073  -3.312  1.00 0.00 ? 38  ARG A CD   7  
ATOM   7435  N  NE   . ARG A 1 38 ? 1.415   15.775  -2.114  1.00 0.00 ? 38  ARG A NE   7  
ATOM   7436  C  CZ   . ARG A 1 38 ? 1.728   17.036  -1.839  1.00 0.00 ? 38  ARG A CZ   7  
ATOM   7437  N  NH1  . ARG A 1 38 ? 2.491   17.731  -2.672  1.00 0.00 ? 38  ARG A NH1  7  
ATOM   7438  N  NH2  . ARG A 1 38 ? 1.278   17.606  -0.729  1.00 0.00 ? 38  ARG A NH2  7  
ATOM   7439  H  H    . ARG A 1 38 ? 1.598   12.397  -4.115  1.00 0.00 ? 38  ARG A H    7  
ATOM   7440  H  HA   . ARG A 1 38 ? -0.066  13.258  -6.391  1.00 0.00 ? 38  ARG A HA   7  
ATOM   7441  H  HB2  . ARG A 1 38 ? 2.532   14.582  -5.691  1.00 0.00 ? 38  ARG A HB2  7  
ATOM   7442  H  HB3  . ARG A 1 38 ? 1.170   15.224  -6.599  1.00 0.00 ? 38  ARG A HB3  7  
ATOM   7443  H  HG2  . ARG A 1 38 ? 0.849   16.358  -4.672  1.00 0.00 ? 38  ARG A HG2  7  
ATOM   7444  H  HG3  . ARG A 1 38 ? -0.038  14.892  -4.252  1.00 0.00 ? 38  ARG A HG3  7  
ATOM   7445  H  HD2  . ARG A 1 38 ? 1.914   14.015  -3.102  1.00 0.00 ? 38  ARG A HD2  7  
ATOM   7446  H  HD3  . ARG A 1 38 ? 2.852   15.430  -3.577  1.00 0.00 ? 38  ARG A HD3  7  
ATOM   7447  H  HE   . ARG A 1 38 ? 0.851   15.280  -1.485  1.00 0.00 ? 38  ARG A HE   7  
ATOM   7448  H  HH11 . ARG A 1 38 ? 2.831   17.304  -3.510  1.00 0.00 ? 38  ARG A HH11 7  
ATOM   7449  H  HH12 . ARG A 1 38 ? 2.724   18.681  -2.463  1.00 0.00 ? 38  ARG A HH12 7  
ATOM   7450  H  HH21 . ARG A 1 38 ? 0.702   17.085  -0.098  1.00 0.00 ? 38  ARG A HH21 7  
ATOM   7451  H  HH22 . ARG A 1 38 ? 1.514   18.555  -0.522  1.00 0.00 ? 38  ARG A HH22 7  
ATOM   7452  N  N    . PHE A 1 39 ? 2.803   11.721  -6.318  1.00 0.00 ? 39  PHE A N    7  
ATOM   7453  C  CA   . PHE A 1 39 ? 3.749   10.939  -7.106  1.00 0.00 ? 39  PHE A CA   7  
ATOM   7454  C  C    . PHE A 1 39 ? 3.350   9.466   -7.129  1.00 0.00 ? 39  PHE A C    7  
ATOM   7455  O  O    . PHE A 1 39 ? 3.570   8.722   -6.174  1.00 0.00 ? 39  PHE A O    7  
ATOM   7456  C  CB   . PHE A 1 39 ? 5.162   11.086  -6.539  1.00 0.00 ? 39  PHE A CB   7  
ATOM   7457  C  CG   . PHE A 1 39 ? 5.532   12.505  -6.212  1.00 0.00 ? 39  PHE A CG   7  
ATOM   7458  C  CD1  . PHE A 1 39 ? 5.007   13.131  -5.093  1.00 0.00 ? 39  PHE A CD1  7  
ATOM   7459  C  CD2  . PHE A 1 39 ? 6.405   13.212  -7.023  1.00 0.00 ? 39  PHE A CD2  7  
ATOM   7460  C  CE1  . PHE A 1 39 ? 5.344   14.436  -4.790  1.00 0.00 ? 39  PHE A CE1  7  
ATOM   7461  C  CE2  . PHE A 1 39 ? 6.746   14.518  -6.725  1.00 0.00 ? 39  PHE A CE2  7  
ATOM   7462  C  CZ   . PHE A 1 39 ? 6.216   15.130  -5.606  1.00 0.00 ? 39  PHE A CZ   7  
ATOM   7463  H  H    . PHE A 1 39 ? 2.883   11.725  -5.341  1.00 0.00 ? 39  PHE A H    7  
ATOM   7464  H  HA   . PHE A 1 39 ? 3.733   11.320  -8.115  1.00 0.00 ? 39  PHE A HA   7  
ATOM   7465  H  HB2  . PHE A 1 39 ? 5.242   10.506  -5.633  1.00 0.00 ? 39  PHE A HB2  7  
ATOM   7466  H  HB3  . PHE A 1 39 ? 5.873   10.716  -7.263  1.00 0.00 ? 39  PHE A HB3  7  
ATOM   7467  H  HD1  . PHE A 1 39 ? 4.325   12.589  -4.453  1.00 0.00 ? 39  PHE A HD1  7  
ATOM   7468  H  HD2  . PHE A 1 39 ? 6.820   12.734  -7.899  1.00 0.00 ? 39  PHE A HD2  7  
ATOM   7469  H  HE1  . PHE A 1 39 ? 4.928   14.913  -3.915  1.00 0.00 ? 39  PHE A HE1  7  
ATOM   7470  H  HE2  . PHE A 1 39 ? 7.428   15.058  -7.365  1.00 0.00 ? 39  PHE A HE2  7  
ATOM   7471  H  HZ   . PHE A 1 39 ? 6.481   16.151  -5.372  1.00 0.00 ? 39  PHE A HZ   7  
ATOM   7472  N  N    . PRO A 1 40 ? 2.747   9.035   -8.247  1.00 0.00 ? 40  PRO A N    7  
ATOM   7473  C  CA   . PRO A 1 40 ? 2.304   7.649   -8.424  1.00 0.00 ? 40  PRO A CA   7  
ATOM   7474  C  C    . PRO A 1 40 ? 3.473   6.680   -8.563  1.00 0.00 ? 40  PRO A C    7  
ATOM   7475  O  O    . PRO A 1 40 ? 4.625   7.095   -8.686  1.00 0.00 ? 40  PRO A O    7  
ATOM   7476  C  CB   . PRO A 1 40 ? 1.492   7.698   -9.721  1.00 0.00 ? 40  PRO A CB   7  
ATOM   7477  C  CG   . PRO A 1 40 ? 2.043   8.863   -10.468 1.00 0.00 ? 40  PRO A CG   7  
ATOM   7478  C  CD   . PRO A 1 40 ? 2.452   9.867   -9.426  1.00 0.00 ? 40  PRO A CD   7  
ATOM   7479  H  HA   . PRO A 1 40 ? 1.668   7.329   -7.611  1.00 0.00 ? 40  PRO A HA   7  
ATOM   7480  H  HB2  . PRO A 1 40 ? 1.629   6.776   -10.268 1.00 0.00 ? 40  PRO A HB2  7  
ATOM   7481  H  HB3  . PRO A 1 40 ? 0.447   7.835   -9.490  1.00 0.00 ? 40  PRO A HB3  7  
ATOM   7482  H  HG2  . PRO A 1 40 ? 2.898   8.556   -11.049 1.00 0.00 ? 40  PRO A HG2  7  
ATOM   7483  H  HG3  . PRO A 1 40 ? 1.281   9.280   -11.110 1.00 0.00 ? 40  PRO A HG3  7  
ATOM   7484  H  HD2  . PRO A 1 40 ? 3.331   10.407  -9.747  1.00 0.00 ? 40  PRO A HD2  7  
ATOM   7485  H  HD3  . PRO A 1 40 ? 1.641   10.551  -9.221  1.00 0.00 ? 40  PRO A HD3  7  
ATOM   7486  N  N    . CYS A 1 41 ? 3.169   5.386   -8.543  1.00 0.00 ? 41  CYS A N    7  
ATOM   7487  C  CA   . CYS A 1 41 ? 4.194   4.357   -8.667  1.00 0.00 ? 41  CYS A CA   7  
ATOM   7488  C  C    . CYS A 1 41 ? 4.167   3.727   -10.056 1.00 0.00 ? 41  CYS A C    7  
ATOM   7489  O  O    . CYS A 1 41 ? 3.256   2.968   -10.387 1.00 0.00 ? 41  CYS A O    7  
ATOM   7490  C  CB   . CYS A 1 41 ? 3.994   3.277   -7.601  1.00 0.00 ? 41  CYS A CB   7  
ATOM   7491  S  SG   . CYS A 1 41 ? 5.405   2.139   -7.422  1.00 0.00 ? 41  CYS A SG   7  
ATOM   7492  H  H    . CYS A 1 41 ? 2.231   5.117   -8.441  1.00 0.00 ? 41  CYS A H    7  
ATOM   7493  H  HA   . CYS A 1 41 ? 5.154   4.825   -8.516  1.00 0.00 ? 41  CYS A HA   7  
ATOM   7494  H  HB2  . CYS A 1 41 ? 3.832   3.752   -6.644  1.00 0.00 ? 41  CYS A HB2  7  
ATOM   7495  H  HB3  . CYS A 1 41 ? 3.125   2.688   -7.856  1.00 0.00 ? 41  CYS A HB3  7  
ATOM   7496  N  N    . GLU A 1 42 ? 5.172   4.048   -10.865 1.00 0.00 ? 42  GLU A N    7  
ATOM   7497  C  CA   . GLU A 1 42 ? 5.263   3.514   -12.219 1.00 0.00 ? 42  GLU A CA   7  
ATOM   7498  C  C    . GLU A 1 42 ? 5.513   2.008   -12.194 1.00 0.00 ? 42  GLU A C    7  
ATOM   7499  O  O    . GLU A 1 42 ? 5.606   1.366   -13.240 1.00 0.00 ? 42  GLU A O    7  
ATOM   7500  C  CB   . GLU A 1 42 ? 6.380   4.215   -12.994 1.00 0.00 ? 42  GLU A CB   7  
ATOM   7501  C  CG   . GLU A 1 42 ? 7.775   3.863   -12.503 1.00 0.00 ? 42  GLU A CG   7  
ATOM   7502  C  CD   . GLU A 1 42 ? 8.841   4.103   -13.554 1.00 0.00 ? 42  GLU A CD   7  
ATOM   7503  O  OE1  . GLU A 1 42 ? 8.973   5.256   -14.014 1.00 0.00 ? 42  GLU A OE1  7  
ATOM   7504  O  OE2  . GLU A 1 42 ? 9.544   3.136   -13.916 1.00 0.00 ? 42  GLU A OE2  7  
ATOM   7505  H  H    . GLU A 1 42 ? 5.868   4.658   -10.544 1.00 0.00 ? 42  GLU A H    7  
ATOM   7506  H  HA   . GLU A 1 42 ? 4.322   3.702   -12.713 1.00 0.00 ? 42  GLU A HA   7  
ATOM   7507  H  HB2  . GLU A 1 42 ? 6.307   3.939   -14.035 1.00 0.00 ? 42  GLU A HB2  7  
ATOM   7508  H  HB3  . GLU A 1 42 ? 6.249   5.283   -12.903 1.00 0.00 ? 42  GLU A HB3  7  
ATOM   7509  H  HG2  . GLU A 1 42 ? 8.001   4.468   -11.638 1.00 0.00 ? 42  GLU A HG2  7  
ATOM   7510  H  HG3  . GLU A 1 42 ? 7.792   2.819   -12.225 1.00 0.00 ? 42  GLU A HG3  7  
ATOM   7511  N  N    . PHE A 1 43 ? 5.621   1.452   -10.992 1.00 0.00 ? 43  PHE A N    7  
ATOM   7512  C  CA   . PHE A 1 43 ? 5.862   0.023   -10.830 1.00 0.00 ? 43  PHE A CA   7  
ATOM   7513  C  C    . PHE A 1 43 ? 4.547   -0.737  -10.681 1.00 0.00 ? 43  PHE A C    7  
ATOM   7514  O  O    . PHE A 1 43 ? 4.298   -1.713  -11.387 1.00 0.00 ? 43  PHE A O    7  
ATOM   7515  C  CB   . PHE A 1 43 ? 6.752   -0.230  -9.611  1.00 0.00 ? 43  PHE A CB   7  
ATOM   7516  C  CG   . PHE A 1 43 ? 8.210   -0.354  -9.948  1.00 0.00 ? 43  PHE A CG   7  
ATOM   7517  C  CD1  . PHE A 1 43 ? 9.025   0.767   -9.977  1.00 0.00 ? 43  PHE A CD1  7  
ATOM   7518  C  CD2  . PHE A 1 43 ? 8.766   -1.589  -10.237 1.00 0.00 ? 43  PHE A CD2  7  
ATOM   7519  C  CE1  . PHE A 1 43 ? 10.367  0.656   -10.288 1.00 0.00 ? 43  PHE A CE1  7  
ATOM   7520  C  CE2  . PHE A 1 43 ? 10.108  -1.706  -10.548 1.00 0.00 ? 43  PHE A CE2  7  
ATOM   7521  C  CZ   . PHE A 1 43 ? 10.909  -0.582  -10.572 1.00 0.00 ? 43  PHE A CZ   7  
ATOM   7522  H  H    . PHE A 1 43 ? 5.538   2.017   -10.195 1.00 0.00 ? 43  PHE A H    7  
ATOM   7523  H  HA   . PHE A 1 43 ? 6.369   -0.329  -11.714 1.00 0.00 ? 43  PHE A HA   7  
ATOM   7524  H  HB2  . PHE A 1 43 ? 6.640   0.588   -8.916  1.00 0.00 ? 43  PHE A HB2  7  
ATOM   7525  H  HB3  . PHE A 1 43 ? 6.442   -1.147  -9.133  1.00 0.00 ? 43  PHE A HB3  7  
ATOM   7526  H  HD1  . PHE A 1 43 ? 8.603   1.735   -9.753  1.00 0.00 ? 43  PHE A HD1  7  
ATOM   7527  H  HD2  . PHE A 1 43 ? 8.140   -2.470  -10.217 1.00 0.00 ? 43  PHE A HD2  7  
ATOM   7528  H  HE1  . PHE A 1 43 ? 10.992  1.537   -10.306 1.00 0.00 ? 43  PHE A HE1  7  
ATOM   7529  H  HE2  . PHE A 1 43 ? 10.528  -2.676  -10.770 1.00 0.00 ? 43  PHE A HE2  7  
ATOM   7530  H  HZ   . PHE A 1 43 ? 11.958  -0.671  -10.816 1.00 0.00 ? 43  PHE A HZ   7  
ATOM   7531  N  N    . CYS A 1 44 ? 3.709   -0.281  -9.755  1.00 0.00 ? 44  CYS A N    7  
ATOM   7532  C  CA   . CYS A 1 44 ? 2.420   -0.916  -9.511  1.00 0.00 ? 44  CYS A CA   7  
ATOM   7533  C  C    . CYS A 1 44 ? 1.274   0.050   -9.798  1.00 0.00 ? 44  CYS A C    7  
ATOM   7534  O  O    . CYS A 1 44 ? 0.217   -0.351  -10.283 1.00 0.00 ? 44  CYS A O    7  
ATOM   7535  C  CB   . CYS A 1 44 ? 2.336   -1.409  -8.065  1.00 0.00 ? 44  CYS A CB   7  
ATOM   7536  S  SG   . CYS A 1 44 ? 2.548   -0.096  -6.819  1.00 0.00 ? 44  CYS A SG   7  
ATOM   7537  H  H    . CYS A 1 44 ? 3.964   0.503   -9.223  1.00 0.00 ? 44  CYS A H    7  
ATOM   7538  H  HA   . CYS A 1 44 ? 2.336   -1.763  -10.176 1.00 0.00 ? 44  CYS A HA   7  
ATOM   7539  H  HB2  . CYS A 1 44 ? 1.369   -1.862  -7.902  1.00 0.00 ? 44  CYS A HB2  7  
ATOM   7540  H  HB3  . CYS A 1 44 ? 3.107   -2.147  -7.899  1.00 0.00 ? 44  CYS A HB3  7  
ATOM   7541  N  N    . GLY A 1 45 ? 1.493   1.326   -9.495  1.00 0.00 ? 45  GLY A N    7  
ATOM   7542  C  CA   . GLY A 1 45 ? 0.471   2.330   -9.727  1.00 0.00 ? 45  GLY A CA   7  
ATOM   7543  C  C    . GLY A 1 45 ? 0.111   3.093   -8.467  1.00 0.00 ? 45  GLY A C    7  
ATOM   7544  O  O    . GLY A 1 45 ? -0.625  4.078   -8.518  1.00 0.00 ? 45  GLY A O    7  
ATOM   7545  H  H    . GLY A 1 45 ? 2.356   1.588   -9.110  1.00 0.00 ? 45  GLY A H    7  
ATOM   7546  H  HA2  . GLY A 1 45 ? 0.829   3.028   -10.468 1.00 0.00 ? 45  GLY A HA2  7  
ATOM   7547  H  HA3  . GLY A 1 45 ? -0.416  1.843   -10.104 1.00 0.00 ? 45  GLY A HA3  7  
ATOM   7548  N  N    . LYS A 1 46 ? 0.630   2.636   -7.332  1.00 0.00 ? 46  LYS A N    7  
ATOM   7549  C  CA   . LYS A 1 46 ? 0.360   3.282   -6.053  1.00 0.00 ? 46  LYS A CA   7  
ATOM   7550  C  C    . LYS A 1 46 ? 0.653   4.777   -6.125  1.00 0.00 ? 46  LYS A C    7  
ATOM   7551  O  O    . LYS A 1 46 ? 1.045   5.292   -7.173  1.00 0.00 ? 46  LYS A O    7  
ATOM   7552  C  CB   . LYS A 1 46 ? 1.200   2.639   -4.947  1.00 0.00 ? 46  LYS A CB   7  
ATOM   7553  C  CG   . LYS A 1 46 ? 0.523   1.454   -4.280  1.00 0.00 ? 46  LYS A CG   7  
ATOM   7554  C  CD   . LYS A 1 46 ? 1.358   0.909   -3.133  1.00 0.00 ? 46  LYS A CD   7  
ATOM   7555  C  CE   . LYS A 1 46 ? 1.006   1.584   -1.816  1.00 0.00 ? 46  LYS A CE   7  
ATOM   7556  N  NZ   . LYS A 1 46 ? -0.311  1.126   -1.293  1.00 0.00 ? 46  LYS A NZ   7  
ATOM   7557  H  H    . LYS A 1 46 ? 1.210   1.846   -7.356  1.00 0.00 ? 46  LYS A H    7  
ATOM   7558  H  HA   . LYS A 1 46 ? -0.686  3.143   -5.826  1.00 0.00 ? 46  LYS A HA   7  
ATOM   7559  H  HB2  . LYS A 1 46 ? 2.134   2.302   -5.371  1.00 0.00 ? 46  LYS A HB2  7  
ATOM   7560  H  HB3  . LYS A 1 46 ? 1.406   3.383   -4.190  1.00 0.00 ? 46  LYS A HB3  7  
ATOM   7561  H  HG2  . LYS A 1 46 ? -0.435  1.769   -3.895  1.00 0.00 ? 46  LYS A HG2  7  
ATOM   7562  H  HG3  . LYS A 1 46 ? 0.381   0.673   -5.013  1.00 0.00 ? 46  LYS A HG3  7  
ATOM   7563  H  HD2  . LYS A 1 46 ? 1.177   -0.152  -3.040  1.00 0.00 ? 46  LYS A HD2  7  
ATOM   7564  H  HD3  . LYS A 1 46 ? 2.404   1.080   -3.347  1.00 0.00 ? 46  LYS A HD3  7  
ATOM   7565  H  HE2  . LYS A 1 46 ? 1.771   1.353   -1.092  1.00 0.00 ? 46  LYS A HE2  7  
ATOM   7566  H  HE3  . LYS A 1 46 ? 0.970   2.652   -1.973  1.00 0.00 ? 46  LYS A HE3  7  
ATOM   7567  H  HZ1  . LYS A 1 46 ? -0.357  1.271   -0.264  1.00 0.00 ? 46  LYS A HZ1  7  
ATOM   7568  H  HZ2  . LYS A 1 46 ? -0.444  0.115   -1.495  1.00 0.00 ? 46  LYS A HZ2  7  
ATOM   7569  H  HZ3  . LYS A 1 46 ? -1.081  1.662   -1.743  1.00 0.00 ? 46  LYS A HZ3  7  
ATOM   7570  N  N    . ARG A 1 47 ? 0.462   5.467   -5.006  1.00 0.00 ? 47  ARG A N    7  
ATOM   7571  C  CA   . ARG A 1 47 ? 0.706   6.903   -4.943  1.00 0.00 ? 47  ARG A CA   7  
ATOM   7572  C  C    . ARG A 1 47 ? 1.199   7.311   -3.558  1.00 0.00 ? 47  ARG A C    7  
ATOM   7573  O  O    . ARG A 1 47 ? 0.761   6.763   -2.545  1.00 0.00 ? 47  ARG A O    7  
ATOM   7574  C  CB   . ARG A 1 47 ? -0.568  7.675   -5.290  1.00 0.00 ? 47  ARG A CB   7  
ATOM   7575  C  CG   . ARG A 1 47 ? -1.102  7.375   -6.681  1.00 0.00 ? 47  ARG A CG   7  
ATOM   7576  C  CD   . ARG A 1 47 ? -2.522  7.891   -6.856  1.00 0.00 ? 47  ARG A CD   7  
ATOM   7577  N  NE   . ARG A 1 47 ? -2.867  8.076   -8.263  1.00 0.00 ? 47  ARG A NE   7  
ATOM   7578  C  CZ   . ARG A 1 47 ? -2.698  9.220   -8.916  1.00 0.00 ? 47  ARG A CZ   7  
ATOM   7579  N  NH1  . ARG A 1 47 ? -2.191  10.275  -8.293  1.00 0.00 ? 47  ARG A NH1  7  
ATOM   7580  N  NH2  . ARG A 1 47 ? -3.036  9.311   -10.196 1.00 0.00 ? 47  ARG A NH2  7  
ATOM   7581  H  H    . ARG A 1 47 ? 0.149   5.000   -4.203  1.00 0.00 ? 47  ARG A H    7  
ATOM   7582  H  HA   . ARG A 1 47 ? 1.470   7.142   -5.668  1.00 0.00 ? 47  ARG A HA   7  
ATOM   7583  H  HB2  . ARG A 1 47 ? -1.335  7.422   -4.572  1.00 0.00 ? 47  ARG A HB2  7  
ATOM   7584  H  HB3  . ARG A 1 47 ? -0.362  8.733   -5.228  1.00 0.00 ? 47  ARG A HB3  7  
ATOM   7585  H  HG2  . ARG A 1 47 ? -0.466  7.851   -7.412  1.00 0.00 ? 47  ARG A HG2  7  
ATOM   7586  H  HG3  . ARG A 1 47 ? -1.095  6.306   -6.836  1.00 0.00 ? 47  ARG A HG3  7  
ATOM   7587  H  HD2  . ARG A 1 47 ? -3.206  7.179   -6.418  1.00 0.00 ? 47  ARG A HD2  7  
ATOM   7588  H  HD3  . ARG A 1 47 ? -2.612  8.837   -6.345  1.00 0.00 ? 47  ARG A HD3  7  
ATOM   7589  H  HE   . ARG A 1 47 ? -3.244  7.310   -8.743  1.00 0.00 ? 47  ARG A HE   7  
ATOM   7590  H  HH11 . ARG A 1 47 ? -1.934  10.209  -7.329  1.00 0.00 ? 47  ARG A HH11 7  
ATOM   7591  H  HH12 . ARG A 1 47 ? -2.063  11.135  -8.788  1.00 0.00 ? 47  ARG A HH12 7  
ATOM   7592  H  HH21 . ARG A 1 47 ? -3.419  8.518   -10.669 1.00 0.00 ? 47  ARG A HH21 7  
ATOM   7593  H  HH22 . ARG A 1 47 ? -2.909  10.173  -10.687 1.00 0.00 ? 47  ARG A HH22 7  
ATOM   7594  N  N    . PHE A 1 48 ? 2.113   8.274   -3.520  1.00 0.00 ? 48  PHE A N    7  
ATOM   7595  C  CA   . PHE A 1 48 ? 2.667   8.754   -2.259  1.00 0.00 ? 48  PHE A CA   7  
ATOM   7596  C  C    . PHE A 1 48 ? 2.647   10.279  -2.202  1.00 0.00 ? 48  PHE A C    7  
ATOM   7597  O  O    . PHE A 1 48 ? 2.667   10.949  -3.234  1.00 0.00 ? 48  PHE A O    7  
ATOM   7598  C  CB   . PHE A 1 48 ? 4.099   8.244   -2.080  1.00 0.00 ? 48  PHE A CB   7  
ATOM   7599  C  CG   . PHE A 1 48 ? 4.205   6.746   -2.075  1.00 0.00 ? 48  PHE A CG   7  
ATOM   7600  C  CD1  . PHE A 1 48 ? 3.844   6.009   -3.192  1.00 0.00 ? 48  PHE A CD1  7  
ATOM   7601  C  CD2  . PHE A 1 48 ? 4.667   6.074   -0.955  1.00 0.00 ? 48  PHE A CD2  7  
ATOM   7602  C  CE1  . PHE A 1 48 ? 3.940   4.631   -3.190  1.00 0.00 ? 48  PHE A CE1  7  
ATOM   7603  C  CE2  . PHE A 1 48 ? 4.766   4.696   -0.947  1.00 0.00 ? 48  PHE A CE2  7  
ATOM   7604  C  CZ   . PHE A 1 48 ? 4.403   3.973   -2.067  1.00 0.00 ? 48  PHE A CZ   7  
ATOM   7605  H  H    . PHE A 1 48 ? 2.424   8.672   -4.361  1.00 0.00 ? 48  PHE A H    7  
ATOM   7606  H  HA   . PHE A 1 48 ? 2.053   8.368   -1.460  1.00 0.00 ? 48  PHE A HA   7  
ATOM   7607  H  HB2  . PHE A 1 48 ? 4.710   8.617   -2.887  1.00 0.00 ? 48  PHE A HB2  7  
ATOM   7608  H  HB3  . PHE A 1 48 ? 4.487   8.609   -1.141  1.00 0.00 ? 48  PHE A HB3  7  
ATOM   7609  H  HD1  . PHE A 1 48 ? 3.483   6.522   -4.071  1.00 0.00 ? 48  PHE A HD1  7  
ATOM   7610  H  HD2  . PHE A 1 48 ? 4.951   6.639   -0.078  1.00 0.00 ? 48  PHE A HD2  7  
ATOM   7611  H  HE1  . PHE A 1 48 ? 3.656   4.068   -4.066  1.00 0.00 ? 48  PHE A HE1  7  
ATOM   7612  H  HE2  . PHE A 1 48 ? 5.128   4.185   -0.067  1.00 0.00 ? 48  PHE A HE2  7  
ATOM   7613  H  HZ   . PHE A 1 48 ? 4.479   2.896   -2.063  1.00 0.00 ? 48  PHE A HZ   7  
ATOM   7614  N  N    . GLU A 1 49 ? 2.608   10.819  -0.988  1.00 0.00 ? 49  GLU A N    7  
ATOM   7615  C  CA   . GLU A 1 49 ? 2.584   12.264  -0.796  1.00 0.00 ? 49  GLU A CA   7  
ATOM   7616  C  C    . GLU A 1 49 ? 3.853   12.907  -1.347  1.00 0.00 ? 49  GLU A C    7  
ATOM   7617  O  O    . GLU A 1 49 ? 3.893   14.111  -1.602  1.00 0.00 ? 49  GLU A O    7  
ATOM   7618  C  CB   . GLU A 1 49 ? 2.431   12.602  0.689   1.00 0.00 ? 49  GLU A CB   7  
ATOM   7619  C  CG   . GLU A 1 49 ? 3.362   11.809  1.592   1.00 0.00 ? 49  GLU A CG   7  
ATOM   7620  C  CD   . GLU A 1 49 ? 3.770   12.582  2.830   1.00 0.00 ? 49  GLU A CD   7  
ATOM   7621  O  OE1  . GLU A 1 49 ? 4.479   13.601  2.686   1.00 0.00 ? 49  GLU A OE1  7  
ATOM   7622  O  OE2  . GLU A 1 49 ? 3.383   12.169  3.943   1.00 0.00 ? 49  GLU A OE2  7  
ATOM   7623  H  H    . GLU A 1 49 ? 2.594   10.232  -0.203  1.00 0.00 ? 49  GLU A H    7  
ATOM   7624  H  HA   . GLU A 1 49 ? 1.734   12.656  -1.334  1.00 0.00 ? 49  GLU A HA   7  
ATOM   7625  H  HB2  . GLU A 1 49 ? 2.635   13.653  0.830   1.00 0.00 ? 49  GLU A HB2  7  
ATOM   7626  H  HB3  . GLU A 1 49 ? 1.414   12.398  0.988   1.00 0.00 ? 49  GLU A HB3  7  
ATOM   7627  H  HG2  . GLU A 1 49 ? 2.859   10.905  1.900   1.00 0.00 ? 49  GLU A HG2  7  
ATOM   7628  H  HG3  . GLU A 1 49 ? 4.251   11.553  1.035   1.00 0.00 ? 49  GLU A HG3  7  
ATOM   7629  N  N    . LYS A 1 50 ? 4.890   12.096  -1.528  1.00 0.00 ? 50  LYS A N    7  
ATOM   7630  C  CA   . LYS A 1 50 ? 6.162   12.583  -2.049  1.00 0.00 ? 50  LYS A CA   7  
ATOM   7631  C  C    . LYS A 1 50 ? 6.943   11.457  -2.717  1.00 0.00 ? 50  LYS A C    7  
ATOM   7632  O  O    . LYS A 1 50 ? 6.657   10.274  -2.529  1.00 0.00 ? 50  LYS A O    7  
ATOM   7633  C  CB   . LYS A 1 50 ? 6.996   13.198  -0.923  1.00 0.00 ? 50  LYS A CB   7  
ATOM   7634  C  CG   . LYS A 1 50 ? 6.679   12.629  0.450   1.00 0.00 ? 50  LYS A CG   7  
ATOM   7635  C  CD   . LYS A 1 50 ? 7.786   12.928  1.446   1.00 0.00 ? 50  LYS A CD   7  
ATOM   7636  C  CE   . LYS A 1 50 ? 7.818   14.403  1.819   1.00 0.00 ? 50  LYS A CE   7  
ATOM   7637  N  NZ   . LYS A 1 50 ? 8.378   14.619  3.181   1.00 0.00 ? 50  LYS A NZ   7  
ATOM   7638  H  H    . LYS A 1 50 ? 4.797   11.146  -1.305  1.00 0.00 ? 50  LYS A H    7  
ATOM   7639  H  HA   . LYS A 1 50 ? 5.949   13.344  -2.785  1.00 0.00 ? 50  LYS A HA   7  
ATOM   7640  H  HB2  . LYS A 1 50 ? 8.041   13.024  -1.129  1.00 0.00 ? 50  LYS A HB2  7  
ATOM   7641  H  HB3  . LYS A 1 50 ? 6.815   14.263  -0.898  1.00 0.00 ? 50  LYS A HB3  7  
ATOM   7642  H  HG2  . LYS A 1 50 ? 5.759   13.067  0.808   1.00 0.00 ? 50  LYS A HG2  7  
ATOM   7643  H  HG3  . LYS A 1 50 ? 6.561   11.558  0.366   1.00 0.00 ? 50  LYS A HG3  7  
ATOM   7644  H  HD2  . LYS A 1 50 ? 7.620   12.347  2.341   1.00 0.00 ? 50  LYS A HD2  7  
ATOM   7645  H  HD3  . LYS A 1 50 ? 8.736   12.656  1.009   1.00 0.00 ? 50  LYS A HD3  7  
ATOM   7646  H  HE2  . LYS A 1 50 ? 8.427   14.929  1.100   1.00 0.00 ? 50  LYS A HE2  7  
ATOM   7647  H  HE3  . LYS A 1 50 ? 6.810   14.790  1.787   1.00 0.00 ? 50  LYS A HE3  7  
ATOM   7648  H  HZ1  . LYS A 1 50 ? 8.339   15.629  3.427   1.00 0.00 ? 50  LYS A HZ1  7  
ATOM   7649  H  HZ2  . LYS A 1 50 ? 9.369   14.304  3.214   1.00 0.00 ? 50  LYS A HZ2  7  
ATOM   7650  H  HZ3  . LYS A 1 50 ? 7.831   14.081  3.883   1.00 0.00 ? 50  LYS A HZ3  7  
ATOM   7651  N  N    . PRO A 1 51 ? 7.954   11.830  -3.516  1.00 0.00 ? 51  PRO A N    7  
ATOM   7652  C  CA   . PRO A 1 51 ? 8.798   10.865  -4.227  1.00 0.00 ? 51  PRO A CA   7  
ATOM   7653  C  C    . PRO A 1 51 ? 9.704   10.081  -3.283  1.00 0.00 ? 51  PRO A C    7  
ATOM   7654  O  O    . PRO A 1 51 ? 9.853   8.866   -3.416  1.00 0.00 ? 51  PRO A O    7  
ATOM   7655  C  CB   . PRO A 1 51 ? 9.633   11.745  -5.160  1.00 0.00 ? 51  PRO A CB   7  
ATOM   7656  C  CG   . PRO A 1 51 ? 9.670   13.077  -4.494  1.00 0.00 ? 51  PRO A CG   7  
ATOM   7657  C  CD   . PRO A 1 51 ? 8.351   13.222  -3.786  1.00 0.00 ? 51  PRO A CD   7  
ATOM   7658  H  HA   . PRO A 1 51 ? 8.207   10.176  -4.812  1.00 0.00 ? 51  PRO A HA   7  
ATOM   7659  H  HB2  . PRO A 1 51 ? 10.625  11.326  -5.263  1.00 0.00 ? 51  PRO A HB2  7  
ATOM   7660  H  HB3  . PRO A 1 51 ? 9.158   11.801  -6.128  1.00 0.00 ? 51  PRO A HB3  7  
ATOM   7661  H  HG2  . PRO A 1 51 ? 10.482  13.110  -3.784  1.00 0.00 ? 51  PRO A HG2  7  
ATOM   7662  H  HG3  . PRO A 1 51 ? 9.784   13.854  -5.235  1.00 0.00 ? 51  PRO A HG3  7  
ATOM   7663  H  HD2  . PRO A 1 51 ? 8.475   13.773  -2.866  1.00 0.00 ? 51  PRO A HD2  7  
ATOM   7664  H  HD3  . PRO A 1 51 ? 7.631   13.710  -4.426  1.00 0.00 ? 51  PRO A HD3  7  
ATOM   7665  N  N    . ASP A 1 52 ? 10.305  10.783  -2.328  1.00 0.00 ? 52  ASP A N    7  
ATOM   7666  C  CA   . ASP A 1 52 ? 11.195  10.152  -1.361  1.00 0.00 ? 52  ASP A CA   7  
ATOM   7667  C  C    . ASP A 1 52 ? 10.619  8.825   -0.878  1.00 0.00 ? 52  ASP A C    7  
ATOM   7668  O  O    . ASP A 1 52 ? 11.353  7.860   -0.663  1.00 0.00 ? 52  ASP A O    7  
ATOM   7669  C  CB   . ASP A 1 52 ? 11.431  11.083  -0.170  1.00 0.00 ? 52  ASP A CB   7  
ATOM   7670  C  CG   . ASP A 1 52 ? 12.789  10.873  0.469   1.00 0.00 ? 52  ASP A CG   7  
ATOM   7671  O  OD1  . ASP A 1 52 ? 13.770  11.482  -0.008  1.00 0.00 ? 52  ASP A OD1  7  
ATOM   7672  O  OD2  . ASP A 1 52 ? 12.872  10.101  1.446   1.00 0.00 ? 52  ASP A OD2  7  
ATOM   7673  H  H    . ASP A 1 52 ? 10.146  11.749  -2.273  1.00 0.00 ? 52  ASP A H    7  
ATOM   7674  H  HA   . ASP A 1 52 ? 12.138  9.964   -1.851  1.00 0.00 ? 52  ASP A HA   7  
ATOM   7675  H  HB2  . ASP A 1 52 ? 11.366  12.108  -0.504  1.00 0.00 ? 52  ASP A HB2  7  
ATOM   7676  H  HB3  . ASP A 1 52 ? 10.670  10.903  0.575   1.00 0.00 ? 52  ASP A HB3  7  
ATOM   7677  N  N    . SER A 1 53 ? 9.302   8.783   -0.709  1.00 0.00 ? 53  SER A N    7  
ATOM   7678  C  CA   . SER A 1 53 ? 8.628   7.576   -0.246  1.00 0.00 ? 53  SER A CA   7  
ATOM   7679  C  C    . SER A 1 53 ? 8.390   6.609   -1.403  1.00 0.00 ? 53  SER A C    7  
ATOM   7680  O  O    . SER A 1 53 ? 8.365   5.393   -1.216  1.00 0.00 ? 53  SER A O    7  
ATOM   7681  C  CB   . SER A 1 53 ? 7.296   7.931   0.418   1.00 0.00 ? 53  SER A CB   7  
ATOM   7682  O  OG   . SER A 1 53 ? 7.503   8.603   1.648   1.00 0.00 ? 53  SER A OG   7  
ATOM   7683  H  H    . SER A 1 53 ? 8.771   9.585   -0.896  1.00 0.00 ? 53  SER A H    7  
ATOM   7684  H  HA   . SER A 1 53 ? 9.267   7.097   0.481   1.00 0.00 ? 53  SER A HA   7  
ATOM   7685  H  HB2  . SER A 1 53 ? 6.730   8.574   -0.239  1.00 0.00 ? 53  SER A HB2  7  
ATOM   7686  H  HB3  . SER A 1 53 ? 6.737   7.026   0.605   1.00 0.00 ? 53  SER A HB3  7  
ATOM   7687  H  HG   . SER A 1 53 ? 8.427   8.534   1.899   1.00 0.00 ? 53  SER A HG   7  
ATOM   7688  N  N    . VAL A 1 54 ? 8.216   7.161   -2.600  1.00 0.00 ? 54  VAL A N    7  
ATOM   7689  C  CA   . VAL A 1 54 ? 7.981   6.350   -3.789  1.00 0.00 ? 54  VAL A CA   7  
ATOM   7690  C  C    . VAL A 1 54 ? 9.243   5.598   -4.199  1.00 0.00 ? 54  VAL A C    7  
ATOM   7691  O  O    . VAL A 1 54 ? 9.172   4.541   -4.824  1.00 0.00 ? 54  VAL A O    7  
ATOM   7692  C  CB   . VAL A 1 54 ? 7.503   7.212   -4.971  1.00 0.00 ? 54  VAL A CB   7  
ATOM   7693  C  CG1  . VAL A 1 54 ? 8.000   6.636   -6.288  1.00 0.00 ? 54  VAL A CG1  7  
ATOM   7694  C  CG2  . VAL A 1 54 ? 5.986   7.326   -4.969  1.00 0.00 ? 54  VAL A CG2  7  
ATOM   7695  H  H    . VAL A 1 54 ? 8.246   8.137   -2.686  1.00 0.00 ? 54  VAL A H    7  
ATOM   7696  H  HA   . VAL A 1 54 ? 7.207   5.633   -3.556  1.00 0.00 ? 54  VAL A HA   7  
ATOM   7697  H  HB   . VAL A 1 54 ? 7.917   8.204   -4.859  1.00 0.00 ? 54  VAL A HB   7  
ATOM   7698  H  HG11 . VAL A 1 54 ? 7.625   7.233   -7.107  1.00 0.00 ? 54  VAL A HG11 7  
ATOM   7699  H  HG12 . VAL A 1 54 ? 9.080   6.645   -6.300  1.00 0.00 ? 54  VAL A HG12 7  
ATOM   7700  H  HG13 . VAL A 1 54 ? 7.647   5.621   -6.393  1.00 0.00 ? 54  VAL A HG13 7  
ATOM   7701  H  HG21 . VAL A 1 54 ? 5.619   7.216   -3.959  1.00 0.00 ? 54  VAL A HG21 7  
ATOM   7702  H  HG22 . VAL A 1 54 ? 5.696   8.293   -5.353  1.00 0.00 ? 54  VAL A HG22 7  
ATOM   7703  H  HG23 . VAL A 1 54 ? 5.565   6.551   -5.591  1.00 0.00 ? 54  VAL A HG23 7  
ATOM   7704  N  N    . ALA A 1 55 ? 10.397  6.152   -3.843  1.00 0.00 ? 55  ALA A N    7  
ATOM   7705  C  CA   . ALA A 1 55 ? 11.675  5.533   -4.171  1.00 0.00 ? 55  ALA A CA   7  
ATOM   7706  C  C    . ALA A 1 55 ? 11.976  4.366   -3.238  1.00 0.00 ? 55  ALA A C    7  
ATOM   7707  O  O    . ALA A 1 55 ? 12.512  3.342   -3.662  1.00 0.00 ? 55  ALA A O    7  
ATOM   7708  C  CB   . ALA A 1 55 ? 12.792  6.564   -4.108  1.00 0.00 ? 55  ALA A CB   7  
ATOM   7709  H  H    . ALA A 1 55 ? 10.389  6.997   -3.345  1.00 0.00 ? 55  ALA A H    7  
ATOM   7710  H  HA   . ALA A 1 55 ? 11.616  5.165   -5.185  1.00 0.00 ? 55  ALA A HA   7  
ATOM   7711  H  HB1  . ALA A 1 55 ? 12.524  7.342   -3.408  1.00 0.00 ? 55  ALA A HB1  7  
ATOM   7712  H  HB2  . ALA A 1 55 ? 13.705  6.086   -3.783  1.00 0.00 ? 55  ALA A HB2  7  
ATOM   7713  H  HB3  . ALA A 1 55 ? 12.940  6.995   -5.086  1.00 0.00 ? 55  ALA A HB3  7  
ATOM   7714  N  N    . ALA A 1 56 ? 11.628  4.527   -1.965  1.00 0.00 ? 56  ALA A N    7  
ATOM   7715  C  CA   . ALA A 1 56 ? 11.860  3.485   -0.972  1.00 0.00 ? 56  ALA A CA   7  
ATOM   7716  C  C    . ALA A 1 56 ? 10.869  2.338   -1.139  1.00 0.00 ? 56  ALA A C    7  
ATOM   7717  O  O    . ALA A 1 56 ? 11.230  1.168   -1.004  1.00 0.00 ? 56  ALA A O    7  
ATOM   7718  C  CB   . ALA A 1 56 ? 11.769  4.064   0.431   1.00 0.00 ? 56  ALA A CB   7  
ATOM   7719  H  H    . ALA A 1 56 ? 11.204  5.365   -1.688  1.00 0.00 ? 56  ALA A H    7  
ATOM   7720  H  HA   . ALA A 1 56 ? 12.861  3.105   -1.114  1.00 0.00 ? 56  ALA A HA   7  
ATOM   7721  H  HB1  . ALA A 1 56 ? 11.728  5.143   0.373   1.00 0.00 ? 56  ALA A HB1  7  
ATOM   7722  H  HB2  . ALA A 1 56 ? 10.877  3.696   0.916   1.00 0.00 ? 56  ALA A HB2  7  
ATOM   7723  H  HB3  . ALA A 1 56 ? 12.637  3.767   1.000   1.00 0.00 ? 56  ALA A HB3  7  
ATOM   7724  N  N    . HIS A 1 57 ? 9.618   2.680   -1.431  1.00 0.00 ? 57  HIS A N    7  
ATOM   7725  C  CA   . HIS A 1 57 ? 8.575   1.678   -1.616  1.00 0.00 ? 57  HIS A CA   7  
ATOM   7726  C  C    . HIS A 1 57 ? 8.990   0.647   -2.661  1.00 0.00 ? 57  HIS A C    7  
ATOM   7727  O  O    . HIS A 1 57 ? 8.678   -0.538  -2.537  1.00 0.00 ? 57  HIS A O    7  
ATOM   7728  C  CB   . HIS A 1 57 ? 7.264   2.346   -2.033  1.00 0.00 ? 57  HIS A CB   7  
ATOM   7729  C  CG   . HIS A 1 57 ? 6.369   1.456   -2.839  1.00 0.00 ? 57  HIS A CG   7  
ATOM   7730  N  ND1  . HIS A 1 57 ? 5.769   0.326   -2.324  1.00 0.00 ? 57  HIS A ND1  7  
ATOM   7731  C  CD2  . HIS A 1 57 ? 5.970   1.536   -4.130  1.00 0.00 ? 57  HIS A CD2  7  
ATOM   7732  C  CE1  . HIS A 1 57 ? 5.042   -0.251  -3.264  1.00 0.00 ? 57  HIS A CE1  7  
ATOM   7733  N  NE2  . HIS A 1 57 ? 5.147   0.464   -4.370  1.00 0.00 ? 57  HIS A NE2  7  
ATOM   7734  H  H    . HIS A 1 57 ? 9.392   3.628   -1.525  1.00 0.00 ? 57  HIS A H    7  
ATOM   7735  H  HA   . HIS A 1 57 ? 8.427   1.175   -0.672  1.00 0.00 ? 57  HIS A HA   7  
ATOM   7736  H  HB2  . HIS A 1 57 ? 6.723   2.647   -1.148  1.00 0.00 ? 57  HIS A HB2  7  
ATOM   7737  H  HB3  . HIS A 1 57 ? 7.487   3.220   -2.628  1.00 0.00 ? 57  HIS A HB3  7  
ATOM   7738  H  HD1  . HIS A 1 57 ? 5.863   -0.004  -1.407  1.00 0.00 ? 57  HIS A HD1  7  
ATOM   7739  H  HD2  . HIS A 1 57 ? 6.249   2.301   -4.842  1.00 0.00 ? 57  HIS A HD2  7  
ATOM   7740  H  HE1  . HIS A 1 57 ? 4.460   -1.153  -3.148  1.00 0.00 ? 57  HIS A HE1  7  
ATOM   7741  N  N    . ARG A 1 58 ? 9.693   1.106   -3.691  1.00 0.00 ? 58  ARG A N    7  
ATOM   7742  C  CA   . ARG A 1 58 ? 10.149  0.225   -4.759  1.00 0.00 ? 58  ARG A CA   7  
ATOM   7743  C  C    . ARG A 1 58 ? 11.256  -0.701  -4.264  1.00 0.00 ? 58  ARG A C    7  
ATOM   7744  O  O    . ARG A 1 58 ? 11.521  -1.744  -4.862  1.00 0.00 ? 58  ARG A O    7  
ATOM   7745  C  CB   . ARG A 1 58 ? 10.650  1.046   -5.948  1.00 0.00 ? 58  ARG A CB   7  
ATOM   7746  C  CG   . ARG A 1 58 ? 9.618   2.019   -6.494  1.00 0.00 ? 58  ARG A CG   7  
ATOM   7747  C  CD   . ARG A 1 58 ? 10.276  3.261   -7.075  1.00 0.00 ? 58  ARG A CD   7  
ATOM   7748  N  NE   . ARG A 1 58 ? 11.121  2.946   -8.223  1.00 0.00 ? 58  ARG A NE   7  
ATOM   7749  C  CZ   . ARG A 1 58 ? 12.435  2.766   -8.142  1.00 0.00 ? 58  ARG A CZ   7  
ATOM   7750  N  NH1  . ARG A 1 58 ? 13.050  2.868   -6.972  1.00 0.00 ? 58  ARG A NH1  7  
ATOM   7751  N  NH2  . ARG A 1 58 ? 13.136  2.482   -9.233  1.00 0.00 ? 58  ARG A NH2  7  
ATOM   7752  H  H    . ARG A 1 58 ? 9.911   2.061   -3.734  1.00 0.00 ? 58  ARG A H    7  
ATOM   7753  H  HA   . ARG A 1 58 ? 9.309   -0.375  -5.075  1.00 0.00 ? 58  ARG A HA   7  
ATOM   7754  H  HB2  . ARG A 1 58 ? 11.518  1.611   -5.641  1.00 0.00 ? 58  ARG A HB2  7  
ATOM   7755  H  HB3  . ARG A 1 58 ? 10.932  0.371   -6.742  1.00 0.00 ? 58  ARG A HB3  7  
ATOM   7756  H  HG2  . ARG A 1 58 ? 9.051   1.529   -7.271  1.00 0.00 ? 58  ARG A HG2  7  
ATOM   7757  H  HG3  . ARG A 1 58 ? 8.956   2.314   -5.693  1.00 0.00 ? 58  ARG A HG3  7  
ATOM   7758  H  HD2  . ARG A 1 58 ? 9.505   3.949   -7.385  1.00 0.00 ? 58  ARG A HD2  7  
ATOM   7759  H  HD3  . ARG A 1 58 ? 10.882  3.722   -6.309  1.00 0.00 ? 58  ARG A HD3  7  
ATOM   7760  H  HE   . ARG A 1 58 ? 10.687  2.867   -9.098  1.00 0.00 ? 58  ARG A HE   7  
ATOM   7761  H  HH11 . ARG A 1 58 ? 12.525  3.081   -6.149  1.00 0.00 ? 58  ARG A HH11 7  
ATOM   7762  H  HH12 . ARG A 1 58 ? 14.039  2.730   -6.913  1.00 0.00 ? 58  ARG A HH12 7  
ATOM   7763  H  HH21 . ARG A 1 58 ? 12.675  2.404   -10.116 1.00 0.00 ? 58  ARG A HH21 7  
ATOM   7764  H  HH22 . ARG A 1 58 ? 14.124  2.347   -9.171  1.00 0.00 ? 58  ARG A HH22 7  
ATOM   7765  N  N    . SER A 1 59 ? 11.901  -0.312  -3.168  1.00 0.00 ? 59  SER A N    7  
ATOM   7766  C  CA   . SER A 1 59 ? 12.982  -1.105  -2.595  1.00 0.00 ? 59  SER A CA   7  
ATOM   7767  C  C    . SER A 1 59 ? 12.454  -2.044  -1.515  1.00 0.00 ? 59  SER A C    7  
ATOM   7768  O  O    . SER A 1 59 ? 13.196  -2.860  -0.968  1.00 0.00 ? 59  SER A O    7  
ATOM   7769  C  CB   . SER A 1 59 ? 14.059  -0.189  -2.009  1.00 0.00 ? 59  SER A CB   7  
ATOM   7770  O  OG   . SER A 1 59 ? 14.936  0.278   -3.019  1.00 0.00 ? 59  SER A OG   7  
ATOM   7771  H  H    . SER A 1 59 ? 11.644  0.530   -2.737  1.00 0.00 ? 59  SER A H    7  
ATOM   7772  H  HA   . SER A 1 59 ? 13.417  -1.695  -3.388  1.00 0.00 ? 59  SER A HA   7  
ATOM   7773  H  HB2  . SER A 1 59 ? 13.588  0.660   -1.538  1.00 0.00 ? 59  SER A HB2  7  
ATOM   7774  H  HB3  . SER A 1 59 ? 14.633  -0.736  -1.275  1.00 0.00 ? 59  SER A HB3  7  
ATOM   7775  H  HG   . SER A 1 59 ? 15.481  0.986   -2.668  1.00 0.00 ? 59  SER A HG   7  
ATOM   7776  N  N    . LYS A 1 60 ? 11.167  -1.922  -1.212  1.00 0.00 ? 60  LYS A N    7  
ATOM   7777  C  CA   . LYS A 1 60 ? 10.536  -2.759  -0.198  1.00 0.00 ? 60  LYS A CA   7  
ATOM   7778  C  C    . LYS A 1 60 ? 9.431   -3.615  -0.810  1.00 0.00 ? 60  LYS A C    7  
ATOM   7779  O  O    . LYS A 1 60 ? 9.196   -4.743  -0.378  1.00 0.00 ? 60  LYS A O    7  
ATOM   7780  C  CB   . LYS A 1 60 ? 9.962   -1.892  0.924   1.00 0.00 ? 60  LYS A CB   7  
ATOM   7781  C  CG   . LYS A 1 60 ? 10.960  -0.903  1.500   1.00 0.00 ? 60  LYS A CG   7  
ATOM   7782  C  CD   . LYS A 1 60 ? 12.116  -1.613  2.186   1.00 0.00 ? 60  LYS A CD   7  
ATOM   7783  C  CE   . LYS A 1 60 ? 11.742  -2.058  3.591   1.00 0.00 ? 60  LYS A CE   7  
ATOM   7784  N  NZ   . LYS A 1 60 ? 11.057  -3.380  3.590   1.00 0.00 ? 60  LYS A NZ   7  
ATOM   7785  H  H    . LYS A 1 60 ? 10.626  -1.252  -1.682  1.00 0.00 ? 60  LYS A H    7  
ATOM   7786  H  HA   . LYS A 1 60 ? 11.293  -3.410  0.213   1.00 0.00 ? 60  LYS A HA   7  
ATOM   7787  H  HB2  . LYS A 1 60 ? 9.119   -1.337  0.539   1.00 0.00 ? 60  LYS A HB2  7  
ATOM   7788  H  HB3  . LYS A 1 60 ? 9.623   -2.536  1.723   1.00 0.00 ? 60  LYS A HB3  7  
ATOM   7789  H  HG2  . LYS A 1 60 ? 11.351  -0.292  0.700   1.00 0.00 ? 60  LYS A HG2  7  
ATOM   7790  H  HG3  . LYS A 1 60 ? 10.457  -0.275  2.222   1.00 0.00 ? 60  LYS A HG3  7  
ATOM   7791  H  HD2  . LYS A 1 60 ? 12.388  -2.482  1.605   1.00 0.00 ? 60  LYS A HD2  7  
ATOM   7792  H  HD3  . LYS A 1 60 ? 12.958  -0.938  2.243   1.00 0.00 ? 60  LYS A HD3  7  
ATOM   7793  H  HE2  . LYS A 1 60 ? 12.641  -2.129  4.184   1.00 0.00 ? 60  LYS A HE2  7  
ATOM   7794  H  HE3  . LYS A 1 60 ? 11.082  -1.321  4.024   1.00 0.00 ? 60  LYS A HE3  7  
ATOM   7795  H  HZ1  . LYS A 1 60 ? 10.070  -3.271  3.900   1.00 0.00 ? 60  LYS A HZ1  7  
ATOM   7796  H  HZ2  . LYS A 1 60 ? 11.541  -4.034  4.237   1.00 0.00 ? 60  LYS A HZ2  7  
ATOM   7797  H  HZ3  . LYS A 1 60 ? 11.066  -3.787  2.633   1.00 0.00 ? 60  LYS A HZ3  7  
ATOM   7798  N  N    . SER A 1 61 ? 8.757   -3.071  -1.818  1.00 0.00 ? 61  SER A N    7  
ATOM   7799  C  CA   . SER A 1 61 ? 7.675   -3.784  -2.487  1.00 0.00 ? 61  SER A CA   7  
ATOM   7800  C  C    . SER A 1 61 ? 8.102   -4.233  -3.881  1.00 0.00 ? 61  SER A C    7  
ATOM   7801  O  O    . SER A 1 61 ? 7.622   -5.245  -4.394  1.00 0.00 ? 61  SER A O    7  
ATOM   7802  C  CB   . SER A 1 61 ? 6.434   -2.895  -2.584  1.00 0.00 ? 61  SER A CB   7  
ATOM   7803  O  OG   . SER A 1 61 ? 5.670   -2.956  -1.392  1.00 0.00 ? 61  SER A OG   7  
ATOM   7804  H  H    . SER A 1 61 ? 8.992   -2.167  -2.117  1.00 0.00 ? 61  SER A H    7  
ATOM   7805  H  HA   . SER A 1 61 ? 7.439   -4.656  -1.897  1.00 0.00 ? 61  SER A HA   7  
ATOM   7806  H  HB2  . SER A 1 61 ? 6.737   -1.873  -2.751  1.00 0.00 ? 61  SER A HB2  7  
ATOM   7807  H  HB3  . SER A 1 61 ? 5.820   -3.228  -3.408  1.00 0.00 ? 61  SER A HB3  7  
ATOM   7808  H  HG   . SER A 1 61 ? 5.958   -3.704  -0.864  1.00 0.00 ? 61  SER A HG   7  
ATOM   7809  N  N    . HIS A 1 62 ? 9.008   -3.474  -4.490  1.00 0.00 ? 62  HIS A N    7  
ATOM   7810  C  CA   . HIS A 1 62 ? 9.501   -3.794  -5.825  1.00 0.00 ? 62  HIS A CA   7  
ATOM   7811  C  C    . HIS A 1 62 ? 11.002  -4.067  -5.799  1.00 0.00 ? 62  HIS A C    7  
ATOM   7812  O  O    . HIS A 1 62 ? 11.724  -3.794  -6.758  1.00 0.00 ? 62  HIS A O    7  
ATOM   7813  C  CB   . HIS A 1 62 ? 9.196   -2.649  -6.792  1.00 0.00 ? 62  HIS A CB   7  
ATOM   7814  C  CG   . HIS A 1 62 ? 7.732   -2.379  -6.957  1.00 0.00 ? 62  HIS A CG   7  
ATOM   7815  N  ND1  . HIS A 1 62 ? 6.852   -3.300  -7.486  1.00 0.00 ? 62  HIS A ND1  7  
ATOM   7816  C  CD2  . HIS A 1 62 ? 6.995   -1.284  -6.659  1.00 0.00 ? 62  HIS A CD2  7  
ATOM   7817  C  CE1  . HIS A 1 62 ? 5.637   -2.782  -7.507  1.00 0.00 ? 62  HIS A CE1  7  
ATOM   7818  N  NE2  . HIS A 1 62 ? 5.696   -1.559  -7.010  1.00 0.00 ? 62  HIS A NE2  7  
ATOM   7819  H  H    . HIS A 1 62 ? 9.353   -2.681  -4.030  1.00 0.00 ? 62  HIS A H    7  
ATOM   7820  H  HA   . HIS A 1 62 ? 8.992   -4.684  -6.162  1.00 0.00 ? 62  HIS A HA   7  
ATOM   7821  H  HB2  . HIS A 1 62 ? 9.661   -1.745  -6.427  1.00 0.00 ? 62  HIS A HB2  7  
ATOM   7822  H  HB3  . HIS A 1 62 ? 9.602   -2.890  -7.764  1.00 0.00 ? 62  HIS A HB3  7  
ATOM   7823  H  HD1  . HIS A 1 62 ? 7.084   -4.198  -7.800  1.00 0.00 ? 62  HIS A HD1  7  
ATOM   7824  H  HD2  . HIS A 1 62 ? 7.360   -0.363  -6.225  1.00 0.00 ? 62  HIS A HD2  7  
ATOM   7825  H  HE1  . HIS A 1 62 ? 4.746   -3.273  -7.868  1.00 0.00 ? 62  HIS A HE1  7  
ATOM   7826  N  N    . PRO A 1 63 ? 11.484  -4.619  -4.675  1.00 0.00 ? 63  PRO A N    7  
ATOM   7827  C  CA   . PRO A 1 63 ? 12.903  -4.941  -4.497  1.00 0.00 ? 63  PRO A CA   7  
ATOM   7828  C  C    . PRO A 1 63 ? 13.348  -6.104  -5.376  1.00 0.00 ? 63  PRO A C    7  
ATOM   7829  O  O    . PRO A 1 63 ? 14.537  -6.412  -5.460  1.00 0.00 ? 63  PRO A O    7  
ATOM   7830  C  CB   . PRO A 1 63 ? 12.998  -5.321  -3.018  1.00 0.00 ? 63  PRO A CB   7  
ATOM   7831  C  CG   . PRO A 1 63 ? 11.629  -5.787  -2.658  1.00 0.00 ? 63  PRO A CG   7  
ATOM   7832  C  CD   . PRO A 1 63 ? 10.681  -4.971  -3.492  1.00 0.00 ? 63  PRO A CD   7  
ATOM   7833  H  HA   . PRO A 1 63 ? 13.532  -4.084  -4.691  1.00 0.00 ? 63  PRO A HA   7  
ATOM   7834  H  HB2  . PRO A 1 63 ? 13.730  -6.107  -2.891  1.00 0.00 ? 63  PRO A HB2  7  
ATOM   7835  H  HB3  . PRO A 1 63 ? 13.285  -4.457  -2.438  1.00 0.00 ? 63  PRO A HB3  7  
ATOM   7836  H  HG2  . PRO A 1 63 ? 11.526  -6.836  -2.891  1.00 0.00 ? 63  PRO A HG2  7  
ATOM   7837  H  HG3  . PRO A 1 63 ? 11.447  -5.615  -1.608  1.00 0.00 ? 63  PRO A HG3  7  
ATOM   7838  H  HD2  . PRO A 1 63 ? 9.821   -5.561  -3.772  1.00 0.00 ? 63  PRO A HD2  7  
ATOM   7839  H  HD3  . PRO A 1 63 ? 10.375  -4.084  -2.957  1.00 0.00 ? 63  PRO A HD3  7  
ATOM   7840  N  N    . ALA A 1 64 ? 12.387  -6.748  -6.030  1.00 0.00 ? 64  ALA A N    7  
ATOM   7841  C  CA   . ALA A 1 64 ? 12.680  -7.876  -6.905  1.00 0.00 ? 64  ALA A CA   7  
ATOM   7842  C  C    . ALA A 1 64 ? 12.630  -7.461  -8.371  1.00 0.00 ? 64  ALA A C    7  
ATOM   7843  O  O    . ALA A 1 64 ? 13.052  -8.210  -9.254  1.00 0.00 ? 64  ALA A O    7  
ATOM   7844  C  CB   . ALA A 1 64 ? 11.706  -9.015  -6.643  1.00 0.00 ? 64  ALA A CB   7  
ATOM   7845  H  H    . ALA A 1 64 ? 11.458  -6.455  -5.923  1.00 0.00 ? 64  ALA A H    7  
ATOM   7846  H  HA   . ALA A 1 64 ? 13.676  -8.227  -6.674  1.00 0.00 ? 64  ALA A HA   7  
ATOM   7847  H  HB1  . ALA A 1 64 ? 11.504  -9.078  -5.583  1.00 0.00 ? 64  ALA A HB1  7  
ATOM   7848  H  HB2  . ALA A 1 64 ? 10.785  -8.830  -7.175  1.00 0.00 ? 64  ALA A HB2  7  
ATOM   7849  H  HB3  . ALA A 1 64 ? 12.138  -9.944  -6.983  1.00 0.00 ? 64  ALA A HB3  7  
ATOM   7850  N  N    . LEU A 1 65 ? 12.111  -6.265  -8.626  1.00 0.00 ? 65  LEU A N    7  
ATOM   7851  C  CA   . LEU A 1 65 ? 12.005  -5.751  -9.987  1.00 0.00 ? 65  LEU A CA   7  
ATOM   7852  C  C    . LEU A 1 65 ? 13.173  -4.824  -10.311 1.00 0.00 ? 65  LEU A C    7  
ATOM   7853  O  O    . LEU A 1 65 ? 13.871  -5.013  -11.308 1.00 0.00 ? 65  LEU A O    7  
ATOM   7854  C  CB   . LEU A 1 65 ? 10.682  -5.006  -10.170 1.00 0.00 ? 65  LEU A CB   7  
ATOM   7855  C  CG   . LEU A 1 65 ? 9.413   -5.827  -9.937  1.00 0.00 ? 65  LEU A CG   7  
ATOM   7856  C  CD1  . LEU A 1 65 ? 8.218   -4.912  -9.718  1.00 0.00 ? 65  LEU A CD1  7  
ATOM   7857  C  CD2  . LEU A 1 65 ? 9.161   -6.764  -11.110 1.00 0.00 ? 65  LEU A CD2  7  
ATOM   7858  H  H    . LEU A 1 65 ? 11.792  -5.714  -7.882  1.00 0.00 ? 65  LEU A H    7  
ATOM   7859  H  HA   . LEU A 1 65 ? 12.032  -6.593  -10.662 1.00 0.00 ? 65  LEU A HA   7  
ATOM   7860  H  HB2  . LEU A 1 65 ? 10.670  -4.177  -9.479  1.00 0.00 ? 65  LEU A HB2  7  
ATOM   7861  H  HB3  . LEU A 1 65 ? 10.653  -4.630  -11.183 1.00 0.00 ? 65  LEU A HB3  7  
ATOM   7862  H  HG   . LEU A 1 65 ? 9.538   -6.429  -9.048  1.00 0.00 ? 65  LEU A HG   7  
ATOM   7863  H  HD11 . LEU A 1 65 ? 7.408   -5.475  -9.281  1.00 0.00 ? 65  LEU A HD11 7  
ATOM   7864  H  HD12 . LEU A 1 65 ? 7.900   -4.501  -10.666 1.00 0.00 ? 65  LEU A HD12 7  
ATOM   7865  H  HD13 . LEU A 1 65 ? 8.498   -4.107  -9.054  1.00 0.00 ? 65  LEU A HD13 7  
ATOM   7866  H  HD21 . LEU A 1 65 ? 9.266   -6.218  -12.036 1.00 0.00 ? 65  LEU A HD21 7  
ATOM   7867  H  HD22 . LEU A 1 65 ? 8.160   -7.165  -11.041 1.00 0.00 ? 65  LEU A HD22 7  
ATOM   7868  H  HD23 . LEU A 1 65 ? 9.876   -7.572  -11.085 1.00 0.00 ? 65  LEU A HD23 7  
ATOM   7869  N  N    . LEU A 1 66 ? 13.380  -3.823  -9.462  1.00 0.00 ? 66  LEU A N    7  
ATOM   7870  C  CA   . LEU A 1 66 ? 14.464  -2.867  -9.657  1.00 0.00 ? 66  LEU A CA   7  
ATOM   7871  C  C    . LEU A 1 66 ? 15.702  -3.556  -10.223 1.00 0.00 ? 66  LEU A C    7  
ATOM   7872  O  O    . LEU A 1 66 ? 16.345  -3.045  -11.141 1.00 0.00 ? 66  LEU A O    7  
ATOM   7873  C  CB   . LEU A 1 66 ? 14.809  -2.181  -8.334  1.00 0.00 ? 66  LEU A CB   7  
ATOM   7874  C  CG   . LEU A 1 66 ? 13.654  -1.471  -7.626  1.00 0.00 ? 66  LEU A CG   7  
ATOM   7875  C  CD1  . LEU A 1 66 ? 13.905  -1.408  -6.127  1.00 0.00 ? 66  LEU A CD1  7  
ATOM   7876  C  CD2  . LEU A 1 66 ? 13.459  -0.073  -8.194  1.00 0.00 ? 66  LEU A CD2  7  
ATOM   7877  H  H    . LEU A 1 66 ? 12.790  -3.724  -8.686  1.00 0.00 ? 66  LEU A H    7  
ATOM   7878  H  HA   . LEU A 1 66 ? 14.127  -2.123  -10.362 1.00 0.00 ? 66  LEU A HA   7  
ATOM   7879  H  HB2  . LEU A 1 66 ? 15.196  -2.932  -7.663  1.00 0.00 ? 66  LEU A HB2  7  
ATOM   7880  H  HB3  . LEU A 1 66 ? 15.577  -1.447  -8.533  1.00 0.00 ? 66  LEU A HB3  7  
ATOM   7881  H  HG   . LEU A 1 66 ? 12.743  -2.029  -7.788  1.00 0.00 ? 66  LEU A HG   7  
ATOM   7882  H  HD11 . LEU A 1 66 ? 13.683  -2.367  -5.684  1.00 0.00 ? 66  LEU A HD11 7  
ATOM   7883  H  HD12 . LEU A 1 66 ? 13.271  -0.652  -5.687  1.00 0.00 ? 66  LEU A HD12 7  
ATOM   7884  H  HD13 . LEU A 1 66 ? 14.941  -1.159  -5.946  1.00 0.00 ? 66  LEU A HD13 7  
ATOM   7885  H  HD21 . LEU A 1 66 ? 13.314  0.627   -7.385  1.00 0.00 ? 66  LEU A HD21 7  
ATOM   7886  H  HD22 . LEU A 1 66 ? 12.591  -0.064  -8.838  1.00 0.00 ? 66  LEU A HD22 7  
ATOM   7887  H  HD23 . LEU A 1 66 ? 14.332  0.210   -8.763  1.00 0.00 ? 66  LEU A HD23 7  
ATOM   7888  N  N    . LEU A 1 67 ? 16.030  -4.719  -9.671  1.00 0.00 ? 67  LEU A N    7  
ATOM   7889  C  CA   . LEU A 1 67 ? 17.190  -5.480  -10.122 1.00 0.00 ? 67  LEU A CA   7  
ATOM   7890  C  C    . LEU A 1 67 ? 17.085  -5.801  -11.609 1.00 0.00 ? 67  LEU A C    7  
ATOM   7891  O  O    . LEU A 1 67 ? 16.030  -5.629  -12.219 1.00 0.00 ? 67  LEU A O    7  
ATOM   7892  C  CB   . LEU A 1 67 ? 17.321  -6.773  -9.317  1.00 0.00 ? 67  LEU A CB   7  
ATOM   7893  C  CG   . LEU A 1 67 ? 18.073  -6.665  -7.990  1.00 0.00 ? 67  LEU A CG   7  
ATOM   7894  C  CD1  . LEU A 1 67 ? 19.500  -6.193  -8.223  1.00 0.00 ? 67  LEU A CD1  7  
ATOM   7895  C  CD2  . LEU A 1 67 ? 17.347  -5.724  -7.040  1.00 0.00 ? 67  LEU A CD2  7  
ATOM   7896  H  H    . LEU A 1 67 ? 15.480  -5.075  -8.943  1.00 0.00 ? 67  LEU A H    7  
ATOM   7897  H  HA   . LEU A 1 67 ? 18.068  -4.873  -9.959  1.00 0.00 ? 67  LEU A HA   7  
ATOM   7898  H  HB2  . LEU A 1 67 ? 16.326  -7.132  -9.104  1.00 0.00 ? 67  LEU A HB2  7  
ATOM   7899  H  HB3  . LEU A 1 67 ? 17.838  -7.495  -9.933  1.00 0.00 ? 67  LEU A HB3  7  
ATOM   7900  H  HG   . LEU A 1 67 ? 18.117  -7.641  -7.527  1.00 0.00 ? 67  LEU A HG   7  
ATOM   7901  H  HD11 . LEU A 1 67 ? 20.188  -6.978  -7.946  1.00 0.00 ? 67  LEU A HD11 7  
ATOM   7902  H  HD12 . LEU A 1 67 ? 19.692  -5.317  -7.621  1.00 0.00 ? 67  LEU A HD12 7  
ATOM   7903  H  HD13 . LEU A 1 67 ? 19.633  -5.949  -9.267  1.00 0.00 ? 67  LEU A HD13 7  
ATOM   7904  H  HD21 . LEU A 1 67 ? 18.034  -5.378  -6.282  1.00 0.00 ? 67  LEU A HD21 7  
ATOM   7905  H  HD22 . LEU A 1 67 ? 16.527  -6.248  -6.571  1.00 0.00 ? 67  LEU A HD22 7  
ATOM   7906  H  HD23 . LEU A 1 67 ? 16.965  -4.878  -7.593  1.00 0.00 ? 67  LEU A HD23 7  
ATOM   7907  N  N    . ALA A 1 68 ? 18.186  -6.271  -12.187 1.00 0.00 ? 68  ALA A N    7  
ATOM   7908  C  CA   . ALA A 1 68 ? 18.217  -6.622  -13.602 1.00 0.00 ? 68  ALA A CA   7  
ATOM   7909  C  C    . ALA A 1 68 ? 17.230  -7.743  -13.911 1.00 0.00 ? 68  ALA A C    7  
ATOM   7910  O  O    . ALA A 1 68 ? 16.776  -8.465  -13.024 1.00 0.00 ? 68  ALA A O    7  
ATOM   7911  C  CB   . ALA A 1 68 ? 19.624  -7.026  -14.015 1.00 0.00 ? 68  ALA A CB   7  
ATOM   7912  H  H    . ALA A 1 68 ? 18.996  -6.387  -11.648 1.00 0.00 ? 68  ALA A H    7  
ATOM   7913  H  HA   . ALA A 1 68 ? 17.939  -5.745  -14.169 1.00 0.00 ? 68  ALA A HA   7  
ATOM   7914  H  HB1  . ALA A 1 68 ? 20.243  -7.120  -13.135 1.00 0.00 ? 68  ALA A HB1  7  
ATOM   7915  H  HB2  . ALA A 1 68 ? 19.589  -7.972  -14.534 1.00 0.00 ? 68  ALA A HB2  7  
ATOM   7916  H  HB3  . ALA A 1 68 ? 20.038  -6.271  -14.667 1.00 0.00 ? 68  ALA A HB3  7  
ATOM   7917  N  N    . PRO A 1 69 ? 16.889  -7.892  -15.200 1.00 0.00 ? 69  PRO A N    7  
ATOM   7918  C  CA   . PRO A 1 69 ? 15.952  -8.924  -15.655 1.00 0.00 ? 69  PRO A CA   7  
ATOM   7919  C  C    . PRO A 1 69 ? 16.537  -10.328 -15.545 1.00 0.00 ? 69  PRO A C    7  
ATOM   7920  O  O    . PRO A 1 69 ? 17.581  -10.527 -14.925 1.00 0.00 ? 69  PRO A O    7  
ATOM   7921  C  CB   . PRO A 1 69 ? 15.709  -8.559  -17.122 1.00 0.00 ? 69  PRO A CB   7  
ATOM   7922  C  CG   . PRO A 1 69 ? 16.930  -7.811  -17.533 1.00 0.00 ? 69  PRO A CG   7  
ATOM   7923  C  CD   . PRO A 1 69 ? 17.392  -7.067  -16.311 1.00 0.00 ? 69  PRO A CD   7  
ATOM   7924  H  HA   . PRO A 1 69 ? 15.019  -8.880  -15.113 1.00 0.00 ? 69  PRO A HA   7  
ATOM   7925  H  HB2  . PRO A 1 69 ? 15.583  -9.462  -17.704 1.00 0.00 ? 69  PRO A HB2  7  
ATOM   7926  H  HB3  . PRO A 1 69 ? 14.825  -7.946  -17.203 1.00 0.00 ? 69  PRO A HB3  7  
ATOM   7927  H  HG2  . PRO A 1 69 ? 17.691  -8.502  -17.862 1.00 0.00 ? 69  PRO A HG2  7  
ATOM   7928  H  HG3  . PRO A 1 69 ? 16.686  -7.117  -18.324 1.00 0.00 ? 69  PRO A HG3  7  
ATOM   7929  H  HD2  . PRO A 1 69 ? 18.470  -7.008  -16.290 1.00 0.00 ? 69  PRO A HD2  7  
ATOM   7930  H  HD3  . PRO A 1 69 ? 16.957  -6.079  -16.283 1.00 0.00 ? 69  PRO A HD3  7  
ATOM   7931  N  N    . GLN A 1 70 ? 15.857  -11.296 -16.151 1.00 0.00 ? 70  GLN A N    7  
ATOM   7932  C  CA   . GLN A 1 70 ? 16.311  -12.682 -16.120 1.00 0.00 ? 70  GLN A CA   7  
ATOM   7933  C  C    . GLN A 1 70 ? 17.826  -12.762 -16.273 1.00 0.00 ? 70  GLN A C    7  
ATOM   7934  O  O    . GLN A 1 70 ? 18.492  -13.510 -15.558 1.00 0.00 ? 70  GLN A O    7  
ATOM   7935  C  CB   . GLN A 1 70 ? 15.631  -13.488 -17.228 1.00 0.00 ? 70  GLN A CB   7  
ATOM   7936  C  CG   . GLN A 1 70 ? 15.909  -12.956 -18.625 1.00 0.00 ? 70  GLN A CG   7  
ATOM   7937  C  CD   . GLN A 1 70 ? 14.993  -13.560 -19.672 1.00 0.00 ? 70  GLN A CD   7  
ATOM   7938  O  OE1  . GLN A 1 70 ? 14.167  -14.421 -19.368 1.00 0.00 ? 70  GLN A OE1  7  
ATOM   7939  N  NE2  . GLN A 1 70 ? 15.135  -13.110 -20.913 1.00 0.00 ? 70  GLN A NE2  7  
ATOM   7940  H  H    . GLN A 1 70 ? 15.032  -11.074 -16.630 1.00 0.00 ? 70  GLN A H    7  
ATOM   7941  H  HA   . GLN A 1 70 ? 16.036  -13.099 -15.163 1.00 0.00 ? 70  GLN A HA   7  
ATOM   7942  H  HB2  . GLN A 1 70 ? 15.978  -14.509 -17.179 1.00 0.00 ? 70  GLN A HB2  7  
ATOM   7943  H  HB3  . GLN A 1 70 ? 14.563  -13.471 -17.066 1.00 0.00 ? 70  GLN A HB3  7  
ATOM   7944  H  HG2  . GLN A 1 70 ? 15.770  -11.885 -18.623 1.00 0.00 ? 70  GLN A HG2  7  
ATOM   7945  H  HG3  . GLN A 1 70 ? 16.931  -13.186 -18.887 1.00 0.00 ? 70  GLN A HG3  7  
ATOM   7946  H  HE21 . GLN A 1 70 ? 15.815  -12.424 -21.081 1.00 0.00 ? 70  GLN A HE21 7  
ATOM   7947  H  HE22 . GLN A 1 70 ? 14.557  -13.484 -21.609 1.00 0.00 ? 70  GLN A HE22 7  
ATOM   7948  N  N    . GLU A 1 71 ? 18.363  -11.987 -17.210 1.00 0.00 ? 71  GLU A N    7  
ATOM   7949  C  CA   . GLU A 1 71 ? 19.800  -11.972 -17.457 1.00 0.00 ? 71  GLU A CA   7  
ATOM   7950  C  C    . GLU A 1 71 ? 20.530  -11.180 -16.376 1.00 0.00 ? 71  GLU A C    7  
ATOM   7951  O  O    . GLU A 1 71 ? 20.307  -9.980  -16.214 1.00 0.00 ? 71  GLU A O    7  
ATOM   7952  C  CB   . GLU A 1 71 ? 20.098  -11.373 -18.833 1.00 0.00 ? 71  GLU A CB   7  
ATOM   7953  C  CG   . GLU A 1 71 ? 19.496  -9.994  -19.039 1.00 0.00 ? 71  GLU A CG   7  
ATOM   7954  C  CD   . GLU A 1 71 ? 18.151  -10.043 -19.738 1.00 0.00 ? 71  GLU A CD   7  
ATOM   7955  O  OE1  . GLU A 1 71 ? 17.131  -10.250 -19.048 1.00 0.00 ? 71  GLU A OE1  7  
ATOM   7956  O  OE2  . GLU A 1 71 ? 18.118  -9.874  -20.975 1.00 0.00 ? 71  GLU A OE2  7  
ATOM   7957  H  H    . GLU A 1 71 ? 17.780  -11.412 -17.748 1.00 0.00 ? 71  GLU A H    7  
ATOM   7958  H  HA   . GLU A 1 71 ? 20.151  -12.993 -17.436 1.00 0.00 ? 71  GLU A HA   7  
ATOM   7959  H  HB2  . GLU A 1 71 ? 21.168  -11.299 -18.956 1.00 0.00 ? 71  GLU A HB2  7  
ATOM   7960  H  HB3  . GLU A 1 71 ? 19.703  -12.033 -19.592 1.00 0.00 ? 71  GLU A HB3  7  
ATOM   7961  H  HG2  . GLU A 1 71 ? 19.366  -9.524  -18.076 1.00 0.00 ? 71  GLU A HG2  7  
ATOM   7962  H  HG3  . GLU A 1 71 ? 20.175  -9.404  -19.638 1.00 0.00 ? 71  GLU A HG3  7  
ATOM   7963  N  N    . SER A 1 72 ? 21.403  -11.859 -15.639 1.00 0.00 ? 72  SER A N    7  
ATOM   7964  C  CA   . SER A 1 72 ? 22.162  -11.221 -14.571 1.00 0.00 ? 72  SER A CA   7  
ATOM   7965  C  C    . SER A 1 72 ? 23.283  -10.357 -15.143 1.00 0.00 ? 72  SER A C    7  
ATOM   7966  O  O    . SER A 1 72 ? 23.755  -10.590 -16.255 1.00 0.00 ? 72  SER A O    7  
ATOM   7967  C  CB   . SER A 1 72 ? 22.746  -12.276 -13.630 1.00 0.00 ? 72  SER A CB   7  
ATOM   7968  O  OG   . SER A 1 72 ? 23.744  -11.717 -12.793 1.00 0.00 ? 72  SER A OG   7  
ATOM   7969  H  H    . SER A 1 72 ? 21.537  -12.814 -15.817 1.00 0.00 ? 72  SER A H    7  
ATOM   7970  H  HA   . SER A 1 72 ? 21.485  -10.590 -14.015 1.00 0.00 ? 72  SER A HA   7  
ATOM   7971  H  HB2  . SER A 1 72 ? 21.959  -12.679 -13.012 1.00 0.00 ? 72  SER A HB2  7  
ATOM   7972  H  HB3  . SER A 1 72 ? 23.188  -13.071 -14.215 1.00 0.00 ? 72  SER A HB3  7  
ATOM   7973  H  HG   . SER A 1 72 ? 23.326  -11.261 -12.059 1.00 0.00 ? 72  SER A HG   7  
ATOM   7974  N  N    . SER A 1 73 ? 23.702  -9.358  -14.373 1.00 0.00 ? 73  SER A N    7  
ATOM   7975  C  CA   . SER A 1 73 ? 24.764  -8.456  -14.803 1.00 0.00 ? 73  SER A CA   7  
ATOM   7976  C  C    . SER A 1 73 ? 26.100  -9.189  -14.887 1.00 0.00 ? 73  SER A C    7  
ATOM   7977  O  O    . SER A 1 73 ? 26.220  -10.334 -14.453 1.00 0.00 ? 73  SER A O    7  
ATOM   7978  C  CB   . SER A 1 73 ? 24.879  -7.273  -13.839 1.00 0.00 ? 73  SER A CB   7  
ATOM   7979  O  OG   . SER A 1 73 ? 24.986  -7.717  -12.498 1.00 0.00 ? 73  SER A OG   7  
ATOM   7980  H  H    . SER A 1 73 ? 23.286  -9.223  -13.496 1.00 0.00 ? 73  SER A H    7  
ATOM   7981  H  HA   . SER A 1 73 ? 24.508  -8.086  -15.784 1.00 0.00 ? 73  SER A HA   7  
ATOM   7982  H  HB2  . SER A 1 73 ? 25.757  -6.695  -14.086 1.00 0.00 ? 73  SER A HB2  7  
ATOM   7983  H  HB3  . SER A 1 73 ? 24.000  -6.651  -13.931 1.00 0.00 ? 73  SER A HB3  7  
ATOM   7984  H  HG   . SER A 1 73 ? 25.733  -8.315  -12.417 1.00 0.00 ? 73  SER A HG   7  
ATOM   7985  N  N    . GLY A 1 74 ? 27.102  -8.519  -15.448 1.00 0.00 ? 74  GLY A N    7  
ATOM   7986  C  CA   . GLY A 1 74 ? 28.415  -9.122  -15.579 1.00 0.00 ? 74  GLY A CA   7  
ATOM   7987  C  C    . GLY A 1 74 ? 29.061  -9.404  -14.237 1.00 0.00 ? 74  GLY A C    7  
ATOM   7988  O  O    . GLY A 1 74 ? 28.565  -10.201 -13.441 1.00 0.00 ? 74  GLY A O    7  
ATOM   7989  H  H    . GLY A 1 74 ? 26.947  -7.609  -15.776 1.00 0.00 ? 74  GLY A H    7  
ATOM   7990  H  HA2  . GLY A 1 74 ? 28.321  -10.050 -16.124 1.00 0.00 ? 74  GLY A HA2  7  
ATOM   7991  H  HA3  . GLY A 1 74 ? 29.052  -8.452  -16.138 1.00 0.00 ? 74  GLY A HA3  7  
ATOM   7992  N  N    . PRO A 1 75 ? 30.195  -8.740  -13.971 1.00 0.00 ? 75  PRO A N    7  
ATOM   7993  C  CA   . PRO A 1 75 ? 30.935  -8.908  -12.716 1.00 0.00 ? 75  PRO A CA   7  
ATOM   7994  C  C    . PRO A 1 75 ? 30.193  -8.316  -11.523 1.00 0.00 ? 75  PRO A C    7  
ATOM   7995  O  O    . PRO A 1 75 ? 30.228  -8.867  -10.423 1.00 0.00 ? 75  PRO A O    7  
ATOM   7996  C  CB   . PRO A 1 75 ? 32.238  -8.145  -12.968 1.00 0.00 ? 75  PRO A CB   7  
ATOM   7997  C  CG   . PRO A 1 75 ? 31.891  -7.134  -14.006 1.00 0.00 ? 75  PRO A CG   7  
ATOM   7998  C  CD   . PRO A 1 75 ? 30.844  -7.774  -14.874 1.00 0.00 ? 75  PRO A CD   7  
ATOM   7999  H  HA   . PRO A 1 75 ? 31.156  -9.947  -12.522 1.00 0.00 ? 75  PRO A HA   7  
ATOM   8000  H  HB2  . PRO A 1 75 ? 32.566  -7.676  -12.051 1.00 0.00 ? 75  PRO A HB2  7  
ATOM   8001  H  HB3  . PRO A 1 75 ? 32.997  -8.828  -13.321 1.00 0.00 ? 75  PRO A HB3  7  
ATOM   8002  H  HG2  . PRO A 1 75 ? 31.496  -6.246  -13.535 1.00 0.00 ? 75  PRO A HG2  7  
ATOM   8003  H  HG3  . PRO A 1 75 ? 32.766  -6.893  -14.590 1.00 0.00 ? 75  PRO A HG3  7  
ATOM   8004  H  HD2  . PRO A 1 75 ? 30.137  -7.035  -15.220 1.00 0.00 ? 75  PRO A HD2  7  
ATOM   8005  H  HD3  . PRO A 1 75 ? 31.305  -8.279  -15.711 1.00 0.00 ? 75  PRO A HD3  7  
ATOM   8006  N  N    . SER A 1 76 ? 29.523  -7.190  -11.748 1.00 0.00 ? 76  SER A N    7  
ATOM   8007  C  CA   . SER A 1 76 ? 28.775  -6.522  -10.689 1.00 0.00 ? 76  SER A CA   7  
ATOM   8008  C  C    . SER A 1 76 ? 27.762  -7.471  -10.057 1.00 0.00 ? 76  SER A C    7  
ATOM   8009  O  O    . SER A 1 76 ? 26.897  -8.018  -10.741 1.00 0.00 ? 76  SER A O    7  
ATOM   8010  C  CB   . SER A 1 76 ? 28.059  -5.288  -11.243 1.00 0.00 ? 76  SER A CB   7  
ATOM   8011  O  OG   . SER A 1 76 ? 27.193  -5.636  -12.309 1.00 0.00 ? 76  SER A OG   7  
ATOM   8012  H  H    . SER A 1 76 ? 29.533  -6.799  -12.646 1.00 0.00 ? 76  SER A H    7  
ATOM   8013  H  HA   . SER A 1 76 ? 29.479  -6.209  -9.932  1.00 0.00 ? 76  SER A HA   7  
ATOM   8014  H  HB2  . SER A 1 76 ? 27.477  -4.830  -10.457 1.00 0.00 ? 76  SER A HB2  7  
ATOM   8015  H  HB3  . SER A 1 76 ? 28.792  -4.582  -11.606 1.00 0.00 ? 76  SER A HB3  7  
ATOM   8016  H  HG   . SER A 1 76 ? 26.913  -6.549  -12.209 1.00 0.00 ? 76  SER A HG   7  
ATOM   8017  N  N    . SER A 1 77 ? 27.876  -7.661  -8.746  1.00 0.00 ? 77  SER A N    7  
ATOM   8018  C  CA   . SER A 1 77 ? 26.973  -8.546  -8.021  1.00 0.00 ? 77  SER A CA   7  
ATOM   8019  C  C    . SER A 1 77 ? 25.907  -7.746  -7.279  1.00 0.00 ? 77  SER A C    7  
ATOM   8020  O  O    . SER A 1 77 ? 26.166  -6.646  -6.793  1.00 0.00 ? 77  SER A O    7  
ATOM   8021  C  CB   . SER A 1 77 ? 27.758  -9.411  -7.032  1.00 0.00 ? 77  SER A CB   7  
ATOM   8022  O  OG   . SER A 1 77 ? 28.787  -10.130 -7.689  1.00 0.00 ? 77  SER A OG   7  
ATOM   8023  H  H    . SER A 1 77 ? 28.586  -7.196  -8.256  1.00 0.00 ? 77  SER A H    7  
ATOM   8024  H  HA   . SER A 1 77 ? 26.488  -9.188  -8.741  1.00 0.00 ? 77  SER A HA   7  
ATOM   8025  H  HB2  . SER A 1 77 ? 28.202  -8.779  -6.279  1.00 0.00 ? 77  SER A HB2  7  
ATOM   8026  H  HB3  . SER A 1 77 ? 27.086  -10.115 -6.562  1.00 0.00 ? 77  SER A HB3  7  
ATOM   8027  H  HG   . SER A 1 77 ? 29.641  -9.833  -7.368  1.00 0.00 ? 77  SER A HG   7  
ATOM   8028  N  N    . GLY A 1 78 ? 24.705  -8.308  -7.195  1.00 0.00 ? 78  GLY A N    7  
ATOM   8029  C  CA   . GLY A 1 78 ? 23.616  -7.634  -6.511  1.00 0.00 ? 78  GLY A CA   7  
ATOM   8030  C  C    . GLY A 1 78 ? 23.483  -6.182  -6.925  1.00 0.00 ? 78  GLY A C    7  
ATOM   8031  O  O    . GLY A 1 78 ? 23.087  -5.917  -8.059  1.00 0.00 ? 78  GLY A O    7  
ATOM   8032  H  H    . GLY A 1 78 ? 24.556  -9.188  -7.601  1.00 0.00 ? 78  GLY A H    7  
ATOM   8033  H  HA2  . GLY A 1 78 ? 22.693  -8.148  -6.734  1.00 0.00 ? 78  GLY A HA2  7  
ATOM   8034  H  HA3  . GLY A 1 78 ? 23.794  -7.678  -5.447  1.00 0.00 ? 78  GLY A HA3  7  
HETATM 8035  ZN ZN   . ZN  B 2 .  ? -8.004  0.849   3.508   1.00 0.00 ? 201 ZN  A ZN   7  
HETATM 8036  ZN ZN   . ZN  C 2 .  ? 4.789   0.145   -6.341  1.00 0.00 ? 401 ZN  A ZN   7  
ATOM   8037  N  N    . GLY A 1 1  ? -1.975  -12.590 1.151   1.00 0.00 ? 1   GLY A N    8  
ATOM   8038  C  CA   . GLY A 1 1  ? -2.129  -12.977 -0.239  1.00 0.00 ? 1   GLY A CA   8  
ATOM   8039  C  C    . GLY A 1 1  ? -3.467  -13.635 -0.513  1.00 0.00 ? 1   GLY A C    8  
ATOM   8040  O  O    . GLY A 1 1  ? -4.303  -13.083 -1.228  1.00 0.00 ? 1   GLY A O    8  
ATOM   8041  H  H1   . GLY A 1 1  ? -1.292  -11.934 1.402   1.00 0.00 ? 1   GLY A H1   8  
ATOM   8042  H  HA2  . GLY A 1 1  ? -2.039  -12.097 -0.858  1.00 0.00 ? 1   GLY A HA2  8  
ATOM   8043  H  HA3  . GLY A 1 1  ? -1.342  -13.669 -0.498  1.00 0.00 ? 1   GLY A HA3  8  
ATOM   8044  N  N    . SER A 1 2  ? -3.670  -14.818 0.057   1.00 0.00 ? 2   SER A N    8  
ATOM   8045  C  CA   . SER A 1 2  ? -4.914  -15.555 -0.134  1.00 0.00 ? 2   SER A CA   8  
ATOM   8046  C  C    . SER A 1 2  ? -5.683  -15.672 1.178   1.00 0.00 ? 2   SER A C    8  
ATOM   8047  O  O    . SER A 1 2  ? -5.189  -16.240 2.152   1.00 0.00 ? 2   SER A O    8  
ATOM   8048  C  CB   . SER A 1 2  ? -4.625  -16.949 -0.695  1.00 0.00 ? 2   SER A CB   8  
ATOM   8049  O  OG   . SER A 1 2  ? -3.826  -17.703 0.200   1.00 0.00 ? 2   SER A OG   8  
ATOM   8050  H  H    . SER A 1 2  ? -2.965  -15.207 0.616   1.00 0.00 ? 2   SER A H    8  
ATOM   8051  H  HA   . SER A 1 2  ? -5.517  -15.009 -0.844  1.00 0.00 ? 2   SER A HA   8  
ATOM   8052  H  HB2  . SER A 1 2  ? -5.556  -17.471 -0.854  1.00 0.00 ? 2   SER A HB2  8  
ATOM   8053  H  HB3  . SER A 1 2  ? -4.100  -16.854 -1.635  1.00 0.00 ? 2   SER A HB3  8  
ATOM   8054  H  HG   . SER A 1 2  ? -3.756  -17.238 1.037   1.00 0.00 ? 2   SER A HG   8  
ATOM   8055  N  N    . SER A 1 3  ? -6.897  -15.130 1.196   1.00 0.00 ? 3   SER A N    8  
ATOM   8056  C  CA   . SER A 1 3  ? -7.734  -15.169 2.389   1.00 0.00 ? 3   SER A CA   8  
ATOM   8057  C  C    . SER A 1 3  ? -9.113  -15.737 2.066   1.00 0.00 ? 3   SER A C    8  
ATOM   8058  O  O    . SER A 1 3  ? -9.655  -15.505 0.987   1.00 0.00 ? 3   SER A O    8  
ATOM   8059  C  CB   . SER A 1 3  ? -7.874  -13.768 2.986   1.00 0.00 ? 3   SER A CB   8  
ATOM   8060  O  OG   . SER A 1 3  ? -6.703  -13.395 3.693   1.00 0.00 ? 3   SER A OG   8  
ATOM   8061  H  H    . SER A 1 3  ? -7.235  -14.691 0.388   1.00 0.00 ? 3   SER A H    8  
ATOM   8062  H  HA   . SER A 1 3  ? -7.253  -15.812 3.111   1.00 0.00 ? 3   SER A HA   8  
ATOM   8063  H  HB2  . SER A 1 3  ? -8.042  -13.056 2.192   1.00 0.00 ? 3   SER A HB2  8  
ATOM   8064  H  HB3  . SER A 1 3  ? -8.712  -13.752 3.668   1.00 0.00 ? 3   SER A HB3  8  
ATOM   8065  H  HG   . SER A 1 3  ? -6.409  -14.130 4.235   1.00 0.00 ? 3   SER A HG   8  
ATOM   8066  N  N    . GLY A 1 4  ? -9.675  -16.484 3.012   1.00 0.00 ? 4   GLY A N    8  
ATOM   8067  C  CA   . GLY A 1 4  ? -10.985 -17.074 2.811   1.00 0.00 ? 4   GLY A CA   8  
ATOM   8068  C  C    . GLY A 1 4  ? -11.756 -17.229 4.107   1.00 0.00 ? 4   GLY A C    8  
ATOM   8069  O  O    . GLY A 1 4  ? -12.255 -18.312 4.414   1.00 0.00 ? 4   GLY A O    8  
ATOM   8070  H  H    . GLY A 1 4  ? -9.196  -16.635 3.854   1.00 0.00 ? 4   GLY A H    8  
ATOM   8071  H  HA2  . GLY A 1 4  ? -11.552 -16.445 2.140   1.00 0.00 ? 4   GLY A HA2  8  
ATOM   8072  H  HA3  . GLY A 1 4  ? -10.863 -18.047 2.359   1.00 0.00 ? 4   GLY A HA3  8  
ATOM   8073  N  N    . SER A 1 5  ? -11.853 -16.145 4.870   1.00 0.00 ? 5   SER A N    8  
ATOM   8074  C  CA   . SER A 1 5  ? -12.565 -16.167 6.142   1.00 0.00 ? 5   SER A CA   8  
ATOM   8075  C  C    . SER A 1 5  ? -13.547 -15.004 6.236   1.00 0.00 ? 5   SER A C    8  
ATOM   8076  O  O    . SER A 1 5  ? -13.630 -14.172 5.332   1.00 0.00 ? 5   SER A O    8  
ATOM   8077  C  CB   . SER A 1 5  ? -11.573 -16.106 7.306   1.00 0.00 ? 5   SER A CB   8  
ATOM   8078  O  OG   . SER A 1 5  ? -10.837 -14.895 7.286   1.00 0.00 ? 5   SER A OG   8  
ATOM   8079  H  H    . SER A 1 5  ? -11.434 -15.311 4.570   1.00 0.00 ? 5   SER A H    8  
ATOM   8080  H  HA   . SER A 1 5  ? -13.116 -17.094 6.198   1.00 0.00 ? 5   SER A HA   8  
ATOM   8081  H  HB2  . SER A 1 5  ? -12.112 -16.171 8.239   1.00 0.00 ? 5   SER A HB2  8  
ATOM   8082  H  HB3  . SER A 1 5  ? -10.883 -16.934 7.231   1.00 0.00 ? 5   SER A HB3  8  
ATOM   8083  H  HG   . SER A 1 5  ? -10.558 -14.705 6.388   1.00 0.00 ? 5   SER A HG   8  
ATOM   8084  N  N    . SER A 1 6  ? -14.292 -14.953 7.336   1.00 0.00 ? 6   SER A N    8  
ATOM   8085  C  CA   . SER A 1 6  ? -15.272 -13.895 7.547   1.00 0.00 ? 6   SER A CA   8  
ATOM   8086  C  C    . SER A 1 6  ? -14.595 -12.613 8.023   1.00 0.00 ? 6   SER A C    8  
ATOM   8087  O  O    . SER A 1 6  ? -14.047 -12.559 9.123   1.00 0.00 ? 6   SER A O    8  
ATOM   8088  C  CB   . SER A 1 6  ? -16.322 -14.339 8.567   1.00 0.00 ? 6   SER A CB   8  
ATOM   8089  O  OG   . SER A 1 6  ? -17.175 -15.331 8.022   1.00 0.00 ? 6   SER A OG   8  
ATOM   8090  H  H    . SER A 1 6  ? -14.180 -15.645 8.021   1.00 0.00 ? 6   SER A H    8  
ATOM   8091  H  HA   . SER A 1 6  ? -15.760 -13.701 6.603   1.00 0.00 ? 6   SER A HA   8  
ATOM   8092  H  HB2  . SER A 1 6  ? -15.827 -14.746 9.436   1.00 0.00 ? 6   SER A HB2  8  
ATOM   8093  H  HB3  . SER A 1 6  ? -16.919 -13.488 8.859   1.00 0.00 ? 6   SER A HB3  8  
ATOM   8094  H  HG   . SER A 1 6  ? -18.045 -15.261 8.424   1.00 0.00 ? 6   SER A HG   8  
ATOM   8095  N  N    . GLY A 1 7  ? -14.637 -11.582 7.184   1.00 0.00 ? 7   GLY A N    8  
ATOM   8096  C  CA   . GLY A 1 7  ? -14.023 -10.315 7.536   1.00 0.00 ? 7   GLY A CA   8  
ATOM   8097  C  C    . GLY A 1 7  ? -13.943 -9.363  6.359   1.00 0.00 ? 7   GLY A C    8  
ATOM   8098  O  O    . GLY A 1 7  ? -13.649 -9.776  5.236   1.00 0.00 ? 7   GLY A O    8  
ATOM   8099  H  H    . GLY A 1 7  ? -15.087 -11.683 6.320   1.00 0.00 ? 7   GLY A H    8  
ATOM   8100  H  HA2  . GLY A 1 7  ? -14.603 -9.852  8.321   1.00 0.00 ? 7   GLY A HA2  8  
ATOM   8101  H  HA3  . GLY A 1 7  ? -13.024 -10.501 7.902   1.00 0.00 ? 7   GLY A HA3  8  
ATOM   8102  N  N    . LEU A 1 8  ? -14.208 -8.086  6.613   1.00 0.00 ? 8   LEU A N    8  
ATOM   8103  C  CA   . LEU A 1 8  ? -14.166 -7.073  5.565   1.00 0.00 ? 8   LEU A CA   8  
ATOM   8104  C  C    . LEU A 1 8  ? -12.727 -6.769  5.159   1.00 0.00 ? 8   LEU A C    8  
ATOM   8105  O  O    . LEU A 1 8  ? -11.829 -6.736  5.999   1.00 0.00 ? 8   LEU A O    8  
ATOM   8106  C  CB   . LEU A 1 8  ? -14.856 -5.792  6.038   1.00 0.00 ? 8   LEU A CB   8  
ATOM   8107  C  CG   . LEU A 1 8  ? -16.308 -5.942  6.495   1.00 0.00 ? 8   LEU A CG   8  
ATOM   8108  C  CD1  . LEU A 1 8  ? -16.661 -4.866  7.510   1.00 0.00 ? 8   LEU A CD1  8  
ATOM   8109  C  CD2  . LEU A 1 8  ? -17.251 -5.882  5.302   1.00 0.00 ? 8   LEU A CD2  8  
ATOM   8110  H  H    . LEU A 1 8  ? -14.436 -7.818  7.527   1.00 0.00 ? 8   LEU A H    8  
ATOM   8111  H  HA   . LEU A 1 8  ? -14.695 -7.461  4.707   1.00 0.00 ? 8   LEU A HA   8  
ATOM   8112  H  HB2  . LEU A 1 8  ? -14.288 -5.398  6.867   1.00 0.00 ? 8   LEU A HB2  8  
ATOM   8113  H  HB3  . LEU A 1 8  ? -14.836 -5.085  5.221   1.00 0.00 ? 8   LEU A HB3  8  
ATOM   8114  H  HG   . LEU A 1 8  ? -16.431 -6.904  6.972   1.00 0.00 ? 8   LEU A HG   8  
ATOM   8115  H  HD11 . LEU A 1 8  ? -16.816 -3.927  7.001   1.00 0.00 ? 8   LEU A HD11 8  
ATOM   8116  H  HD12 . LEU A 1 8  ? -15.854 -4.763  8.220   1.00 0.00 ? 8   LEU A HD12 8  
ATOM   8117  H  HD13 . LEU A 1 8  ? -17.565 -5.147  8.032   1.00 0.00 ? 8   LEU A HD13 8  
ATOM   8118  H  HD21 . LEU A 1 8  ? -17.977 -5.098  5.457   1.00 0.00 ? 8   LEU A HD21 8  
ATOM   8119  H  HD22 . LEU A 1 8  ? -17.761 -6.829  5.199   1.00 0.00 ? 8   LEU A HD22 8  
ATOM   8120  H  HD23 . LEU A 1 8  ? -16.685 -5.678  4.406   1.00 0.00 ? 8   LEU A HD23 8  
ATOM   8121  N  N    . GLN A 1 9  ? -12.518 -6.544  3.865   1.00 0.00 ? 9   GLN A N    8  
ATOM   8122  C  CA   . GLN A 1 9  ? -11.189 -6.241  3.349   1.00 0.00 ? 9   GLN A CA   8  
ATOM   8123  C  C    . GLN A 1 9  ? -11.233 -5.050  2.397   1.00 0.00 ? 9   GLN A C    8  
ATOM   8124  O  O    . GLN A 1 9  ? -12.022 -5.027  1.451   1.00 0.00 ? 9   GLN A O    8  
ATOM   8125  C  CB   . GLN A 1 9  ? -10.606 -7.460  2.633   1.00 0.00 ? 9   GLN A CB   8  
ATOM   8126  C  CG   . GLN A 1 9  ? -9.306  -7.172  1.899   1.00 0.00 ? 9   GLN A CG   8  
ATOM   8127  C  CD   . GLN A 1 9  ? -8.363  -8.359  1.893   1.00 0.00 ? 9   GLN A CD   8  
ATOM   8128  O  OE1  . GLN A 1 9  ? -8.615  -9.363  1.227   1.00 0.00 ? 9   GLN A OE1  8  
ATOM   8129  N  NE2  . GLN A 1 9  ? -7.269  -8.249  2.637   1.00 0.00 ? 9   GLN A NE2  8  
ATOM   8130  H  H    . GLN A 1 9  ? -13.274 -6.584  3.245   1.00 0.00 ? 9   GLN A H    8  
ATOM   8131  H  HA   . GLN A 1 9  ? -10.556 -5.991  4.187   1.00 0.00 ? 9   GLN A HA   8  
ATOM   8132  H  HB2  . GLN A 1 9  ? -10.419 -8.235  3.361   1.00 0.00 ? 9   GLN A HB2  8  
ATOM   8133  H  HB3  . GLN A 1 9  ? -11.328 -7.819  1.914   1.00 0.00 ? 9   GLN A HB3  8  
ATOM   8134  H  HG2  . GLN A 1 9  ? -9.535  -6.909  0.877   1.00 0.00 ? 9   GLN A HG2  8  
ATOM   8135  H  HG3  . GLN A 1 9  ? -8.813  -6.340  2.381   1.00 0.00 ? 9   GLN A HG3  8  
ATOM   8136  H  HE21 . GLN A 1 9  ? -7.135  -7.419  3.143   1.00 0.00 ? 9   GLN A HE21 8  
ATOM   8137  H  HE22 . GLN A 1 9  ? -6.643  -9.001  2.653   1.00 0.00 ? 9   GLN A HE22 8  
ATOM   8138  N  N    . CYS A 1 10 ? -10.382 -4.062  2.652   1.00 0.00 ? 10  CYS A N    8  
ATOM   8139  C  CA   . CYS A 1 10 ? -10.324 -2.867  1.819   1.00 0.00 ? 10  CYS A CA   8  
ATOM   8140  C  C    . CYS A 1 10 ? -9.583  -3.149  0.515   1.00 0.00 ? 10  CYS A C    8  
ATOM   8141  O  O    . CYS A 1 10 ? -8.692  -3.997  0.467   1.00 0.00 ? 10  CYS A O    8  
ATOM   8142  C  CB   . CYS A 1 10 ? -9.638  -1.727  2.573   1.00 0.00 ? 10  CYS A CB   8  
ATOM   8143  S  SG   . CYS A 1 10 ? -8.952  -0.429  1.494   1.00 0.00 ? 10  CYS A SG   8  
ATOM   8144  H  H    . CYS A 1 10 ? -9.778  -4.138  3.421   1.00 0.00 ? 10  CYS A H    8  
ATOM   8145  H  HA   . CYS A 1 10 ? -11.337 -2.575  1.586   1.00 0.00 ? 10  CYS A HA   8  
ATOM   8146  H  HB2  . CYS A 1 10 ? -10.355 -1.259  3.233   1.00 0.00 ? 10  CYS A HB2  8  
ATOM   8147  H  HB3  . CYS A 1 10 ? -8.827  -2.131  3.160   1.00 0.00 ? 10  CYS A HB3  8  
ATOM   8148  N  N    . GLU A 1 11 ? -9.956  -2.430  -0.539  1.00 0.00 ? 11  GLU A N    8  
ATOM   8149  C  CA   . GLU A 1 11 ? -9.326  -2.603  -1.843  1.00 0.00 ? 11  GLU A CA   8  
ATOM   8150  C  C    . GLU A 1 11 ? -8.293  -1.509  -2.097  1.00 0.00 ? 11  GLU A C    8  
ATOM   8151  O  O    . GLU A 1 11 ? -7.282  -1.739  -2.762  1.00 0.00 ? 11  GLU A O    8  
ATOM   8152  C  CB   . GLU A 1 11 ? -10.383 -2.590  -2.950  1.00 0.00 ? 11  GLU A CB   8  
ATOM   8153  C  CG   . GLU A 1 11 ? -11.091 -1.254  -3.099  1.00 0.00 ? 11  GLU A CG   8  
ATOM   8154  C  CD   . GLU A 1 11 ? -12.094 -1.250  -4.236  1.00 0.00 ? 11  GLU A CD   8  
ATOM   8155  O  OE1  . GLU A 1 11 ? -11.695 -1.548  -5.381  1.00 0.00 ? 11  GLU A OE1  8  
ATOM   8156  O  OE2  . GLU A 1 11 ? -13.279 -0.948  -3.981  1.00 0.00 ? 11  GLU A OE2  8  
ATOM   8157  H  H    . GLU A 1 11 ? -10.672 -1.769  -0.438  1.00 0.00 ? 11  GLU A H    8  
ATOM   8158  H  HA   . GLU A 1 11 ? -8.828  -3.560  -1.845  1.00 0.00 ? 11  GLU A HA   8  
ATOM   8159  H  HB2  . GLU A 1 11 ? -9.905  -2.829  -3.889  1.00 0.00 ? 11  GLU A HB2  8  
ATOM   8160  H  HB3  . GLU A 1 11 ? -11.124 -3.344  -2.732  1.00 0.00 ? 11  GLU A HB3  8  
ATOM   8161  H  HG2  . GLU A 1 11 ? -11.612 -1.032  -2.180  1.00 0.00 ? 11  GLU A HG2  8  
ATOM   8162  H  HG3  . GLU A 1 11 ? -10.352 -0.489  -3.287  1.00 0.00 ? 11  GLU A HG3  8  
ATOM   8163  N  N    . ILE A 1 12 ? -8.555  -0.321  -1.565  1.00 0.00 ? 12  ILE A N    8  
ATOM   8164  C  CA   . ILE A 1 12 ? -7.649  0.808   -1.734  1.00 0.00 ? 12  ILE A CA   8  
ATOM   8165  C  C    . ILE A 1 12 ? -6.211  0.410   -1.418  1.00 0.00 ? 12  ILE A C    8  
ATOM   8166  O  O    . ILE A 1 12 ? -5.327  0.509   -2.269  1.00 0.00 ? 12  ILE A O    8  
ATOM   8167  C  CB   . ILE A 1 12 ? -8.051  1.992   -0.835  1.00 0.00 ? 12  ILE A CB   8  
ATOM   8168  C  CG1  . ILE A 1 12 ? -9.407  2.552   -1.268  1.00 0.00 ? 12  ILE A CG1  8  
ATOM   8169  C  CG2  . ILE A 1 12 ? -6.985  3.077   -0.880  1.00 0.00 ? 12  ILE A CG2  8  
ATOM   8170  C  CD1  . ILE A 1 12 ? -10.562 2.057   -0.426  1.00 0.00 ? 12  ILE A CD1  8  
ATOM   8171  H  H    . ILE A 1 12 ? -9.377  -0.200  -1.046  1.00 0.00 ? 12  ILE A H    8  
ATOM   8172  H  HA   . ILE A 1 12 ? -7.705  1.129   -2.764  1.00 0.00 ? 12  ILE A HA   8  
ATOM   8173  H  HB   . ILE A 1 12 ? -8.124  1.636   0.181   1.00 0.00 ? 12  ILE A HB   8  
ATOM   8174  H  HG12 . ILE A 1 12 ? -9.385  3.628   -1.198  1.00 0.00 ? 12  ILE A HG12 8  
ATOM   8175  H  HG13 . ILE A 1 12 ? -9.596  2.266   -2.293  1.00 0.00 ? 12  ILE A HG13 8  
ATOM   8176  H  HG21 . ILE A 1 12 ? -7.378  3.986   -0.448  1.00 0.00 ? 12  ILE A HG21 8  
ATOM   8177  H  HG22 . ILE A 1 12 ? -6.122  2.757   -0.317  1.00 0.00 ? 12  ILE A HG22 8  
ATOM   8178  H  HG23 . ILE A 1 12 ? -6.700  3.260   -1.905  1.00 0.00 ? 12  ILE A HG23 8  
ATOM   8179  H  HD11 . ILE A 1 12 ? -10.666 2.683   0.448   1.00 0.00 ? 12  ILE A HD11 8  
ATOM   8180  H  HD12 . ILE A 1 12 ? -11.472 2.091   -1.006  1.00 0.00 ? 12  ILE A HD12 8  
ATOM   8181  H  HD13 . ILE A 1 12 ? -10.371 1.039   -0.117  1.00 0.00 ? 12  ILE A HD13 8  
ATOM   8182  N  N    . CYS A 1 13 ? -5.984  -0.042  -0.189  1.00 0.00 ? 13  CYS A N    8  
ATOM   8183  C  CA   . CYS A 1 13 ? -4.654  -0.457  0.240   1.00 0.00 ? 13  CYS A CA   8  
ATOM   8184  C  C    . CYS A 1 13 ? -4.595  -1.968  0.443   1.00 0.00 ? 13  CYS A C    8  
ATOM   8185  O  O    . CYS A 1 13 ? -3.594  -2.609  0.127   1.00 0.00 ? 13  CYS A O    8  
ATOM   8186  C  CB   . CYS A 1 13 ? -4.267  0.259   1.535   1.00 0.00 ? 13  CYS A CB   8  
ATOM   8187  S  SG   . CYS A 1 13 ? -5.396  -0.062  2.928   1.00 0.00 ? 13  CYS A SG   8  
ATOM   8188  H  H    . CYS A 1 13 ? -6.730  -0.098  0.445   1.00 0.00 ? 13  CYS A H    8  
ATOM   8189  H  HA   . CYS A 1 13 ? -3.954  -0.183  -0.535  1.00 0.00 ? 13  CYS A HA   8  
ATOM   8190  H  HB2  . CYS A 1 13 ? -3.279  -0.062  1.834   1.00 0.00 ? 13  CYS A HB2  8  
ATOM   8191  H  HB3  . CYS A 1 13 ? -4.255  1.324   1.359   1.00 0.00 ? 13  CYS A HB3  8  
ATOM   8192  N  N    . GLY A 1 14 ? -5.676  -2.531  0.975   1.00 0.00 ? 14  GLY A N    8  
ATOM   8193  C  CA   . GLY A 1 14 ? -5.727  -3.962  1.212   1.00 0.00 ? 14  GLY A CA   8  
ATOM   8194  C  C    . GLY A 1 14 ? -5.755  -4.304  2.688   1.00 0.00 ? 14  GLY A C    8  
ATOM   8195  O  O    . GLY A 1 14 ? -5.092  -5.244  3.127   1.00 0.00 ? 14  GLY A O    8  
ATOM   8196  H  H    . GLY A 1 14 ? -6.445  -1.970  1.208   1.00 0.00 ? 14  GLY A H    8  
ATOM   8197  H  HA2  . GLY A 1 14 ? -6.614  -4.362  0.743   1.00 0.00 ? 14  GLY A HA2  8  
ATOM   8198  H  HA3  . GLY A 1 14 ? -4.858  -4.421  0.764   1.00 0.00 ? 14  GLY A HA3  8  
ATOM   8199  N  N    . PHE A 1 15 ? -6.525  -3.540  3.456   1.00 0.00 ? 15  PHE A N    8  
ATOM   8200  C  CA   . PHE A 1 15 ? -6.634  -3.766  4.893   1.00 0.00 ? 15  PHE A CA   8  
ATOM   8201  C  C    . PHE A 1 15 ? -7.781  -4.722  5.207   1.00 0.00 ? 15  PHE A C    8  
ATOM   8202  O  O    . PHE A 1 15 ? -8.532  -5.124  4.317   1.00 0.00 ? 15  PHE A O    8  
ATOM   8203  C  CB   . PHE A 1 15 ? -6.847  -2.439  5.624   1.00 0.00 ? 15  PHE A CB   8  
ATOM   8204  C  CG   . PHE A 1 15 ? -6.623  -2.529  7.107   1.00 0.00 ? 15  PHE A CG   8  
ATOM   8205  C  CD1  . PHE A 1 15 ? -5.403  -2.947  7.613   1.00 0.00 ? 15  PHE A CD1  8  
ATOM   8206  C  CD2  . PHE A 1 15 ? -7.634  -2.197  7.995   1.00 0.00 ? 15  PHE A CD2  8  
ATOM   8207  C  CE1  . PHE A 1 15 ? -5.194  -3.030  8.976   1.00 0.00 ? 15  PHE A CE1  8  
ATOM   8208  C  CE2  . PHE A 1 15 ? -7.431  -2.279  9.359   1.00 0.00 ? 15  PHE A CE2  8  
ATOM   8209  C  CZ   . PHE A 1 15 ? -6.209  -2.697  9.851   1.00 0.00 ? 15  PHE A CZ   8  
ATOM   8210  H  H    . PHE A 1 15 ? -7.030  -2.806  3.048   1.00 0.00 ? 15  PHE A H    8  
ATOM   8211  H  HA   . PHE A 1 15 ? -5.710  -4.209  5.230   1.00 0.00 ? 15  PHE A HA   8  
ATOM   8212  H  HB2  . PHE A 1 15 ? -6.161  -1.705  5.230   1.00 0.00 ? 15  PHE A HB2  8  
ATOM   8213  H  HB3  . PHE A 1 15 ? -7.860  -2.104  5.460   1.00 0.00 ? 15  PHE A HB3  8  
ATOM   8214  H  HD1  . PHE A 1 15 ? -4.607  -3.208  6.929   1.00 0.00 ? 15  PHE A HD1  8  
ATOM   8215  H  HD2  . PHE A 1 15 ? -8.590  -1.871  7.612   1.00 0.00 ? 15  PHE A HD2  8  
ATOM   8216  H  HE1  . PHE A 1 15 ? -4.238  -3.358  9.357   1.00 0.00 ? 15  PHE A HE1  8  
ATOM   8217  H  HE2  . PHE A 1 15 ? -8.226  -2.018  10.041  1.00 0.00 ? 15  PHE A HE2  8  
ATOM   8218  H  HZ   . PHE A 1 15 ? -6.048  -2.761  10.916  1.00 0.00 ? 15  PHE A HZ   8  
ATOM   8219  N  N    . THR A 1 16 ? -7.911  -5.084  6.480   1.00 0.00 ? 16  THR A N    8  
ATOM   8220  C  CA   . THR A 1 16 ? -8.964  -5.994  6.912   1.00 0.00 ? 16  THR A CA   8  
ATOM   8221  C  C    . THR A 1 16 ? -9.422  -5.670  8.330   1.00 0.00 ? 16  THR A C    8  
ATOM   8222  O  O    . THR A 1 16 ? -8.603  -5.499  9.233   1.00 0.00 ? 16  THR A O    8  
ATOM   8223  C  CB   . THR A 1 16 ? -8.496  -7.461  6.859   1.00 0.00 ? 16  THR A CB   8  
ATOM   8224  O  OG1  . THR A 1 16 ? -7.095  -7.539  7.144   1.00 0.00 ? 16  THR A OG1  8  
ATOM   8225  C  CG2  . THR A 1 16 ? -8.775  -8.068  5.492   1.00 0.00 ? 16  THR A CG2  8  
ATOM   8226  H  H    . THR A 1 16 ? -7.282  -4.730  7.142   1.00 0.00 ? 16  THR A H    8  
ATOM   8227  H  HA   . THR A 1 16 ? -9.801  -5.880  6.239   1.00 0.00 ? 16  THR A HA   8  
ATOM   8228  H  HB   . THR A 1 16 ? -9.039  -8.023  7.605   1.00 0.00 ? 16  THR A HB   8  
ATOM   8229  H  HG1  . THR A 1 16 ? -6.873  -6.910  7.835   1.00 0.00 ? 16  THR A HG1  8  
ATOM   8230  H  HG21 . THR A 1 16 ? -8.675  -9.142  5.548   1.00 0.00 ? 16  THR A HG21 8  
ATOM   8231  H  HG22 . THR A 1 16 ? -8.070  -7.677  4.774   1.00 0.00 ? 16  THR A HG22 8  
ATOM   8232  H  HG23 . THR A 1 16 ? -9.779  -7.816  5.186   1.00 0.00 ? 16  THR A HG23 8  
ATOM   8233  N  N    . CYS A 1 17 ? -10.735 -5.588  8.517   1.00 0.00 ? 17  CYS A N    8  
ATOM   8234  C  CA   . CYS A 1 17 ? -11.302 -5.284  9.826   1.00 0.00 ? 17  CYS A CA   8  
ATOM   8235  C  C    . CYS A 1 17 ? -12.690 -5.900  9.974   1.00 0.00 ? 17  CYS A C    8  
ATOM   8236  O  O    . CYS A 1 17 ? -13.581 -5.647  9.163   1.00 0.00 ? 17  CYS A O    8  
ATOM   8237  C  CB   . CYS A 1 17 ? -11.378 -3.770  10.034  1.00 0.00 ? 17  CYS A CB   8  
ATOM   8238  S  SG   . CYS A 1 17 ? -12.451 -2.917  8.855   1.00 0.00 ? 17  CYS A SG   8  
ATOM   8239  H  H    . CYS A 1 17 ? -11.337 -5.734  7.758   1.00 0.00 ? 17  CYS A H    8  
ATOM   8240  H  HA   . CYS A 1 17 ? -10.652 -5.709  10.575  1.00 0.00 ? 17  CYS A HA   8  
ATOM   8241  H  HB2  . CYS A 1 17 ? -11.756 -3.569  11.026  1.00 0.00 ? 17  CYS A HB2  8  
ATOM   8242  H  HB3  . CYS A 1 17 ? -10.387 -3.352  9.941   1.00 0.00 ? 17  CYS A HB3  8  
ATOM   8243  H  HG   . CYS A 1 17 ? -11.741 -1.962  8.273   1.00 0.00 ? 17  CYS A HG   8  
ATOM   8244  N  N    . ARG A 1 18 ? -12.864 -6.711  11.012  1.00 0.00 ? 18  ARG A N    8  
ATOM   8245  C  CA   . ARG A 1 18 ? -14.142 -7.366  11.264  1.00 0.00 ? 18  ARG A CA   8  
ATOM   8246  C  C    . ARG A 1 18 ? -15.242 -6.336  11.506  1.00 0.00 ? 18  ARG A C    8  
ATOM   8247  O  O    . ARG A 1 18 ? -16.348 -6.461  10.981  1.00 0.00 ? 18  ARG A O    8  
ATOM   8248  C  CB   . ARG A 1 18 ? -14.031 -8.302  12.469  1.00 0.00 ? 18  ARG A CB   8  
ATOM   8249  C  CG   . ARG A 1 18 ? -13.034 -9.432  12.272  1.00 0.00 ? 18  ARG A CG   8  
ATOM   8250  C  CD   . ARG A 1 18 ? -11.625 -9.005  12.654  1.00 0.00 ? 18  ARG A CD   8  
ATOM   8251  N  NE   . ARG A 1 18 ? -10.829 -10.125 13.149  1.00 0.00 ? 18  ARG A NE   8  
ATOM   8252  C  CZ   . ARG A 1 18 ? -9.601  -9.994  13.638  1.00 0.00 ? 18  ARG A CZ   8  
ATOM   8253  N  NH1  . ARG A 1 18 ? -9.031  -8.798  13.697  1.00 0.00 ? 18  ARG A NH1  8  
ATOM   8254  N  NH2  . ARG A 1 18 ? -8.940  -11.060 14.070  1.00 0.00 ? 18  ARG A NH2  8  
ATOM   8255  H  H    . ARG A 1 18 ? -12.115 -6.873  11.623  1.00 0.00 ? 18  ARG A H    8  
ATOM   8256  H  HA   . ARG A 1 18 ? -14.395 -7.947  10.390  1.00 0.00 ? 18  ARG A HA   8  
ATOM   8257  H  HB2  . ARG A 1 18 ? -13.724 -7.727  13.330  1.00 0.00 ? 18  ARG A HB2  8  
ATOM   8258  H  HB3  . ARG A 1 18 ? -15.000 -8.736  12.663  1.00 0.00 ? 18  ARG A HB3  8  
ATOM   8259  H  HG2  . ARG A 1 18 ? -13.325 -10.268 12.891  1.00 0.00 ? 18  ARG A HG2  8  
ATOM   8260  H  HG3  . ARG A 1 18 ? -13.042 -9.729  11.234  1.00 0.00 ? 18  ARG A HG3  8  
ATOM   8261  H  HD2  . ARG A 1 18 ? -11.141 -8.589  11.783  1.00 0.00 ? 18  ARG A HD2  8  
ATOM   8262  H  HD3  . ARG A 1 18 ? -11.689 -8.251  13.425  1.00 0.00 ? 18  ARG A HD3  8  
ATOM   8263  H  HE   . ARG A 1 18 ? -11.231 -11.017 13.115  1.00 0.00 ? 18  ARG A HE   8  
ATOM   8264  H  HH11 . ARG A 1 18 ? -9.527  -7.992  13.373  1.00 0.00 ? 18  ARG A HH11 8  
ATOM   8265  H  HH12 . ARG A 1 18 ? -8.106  -8.702  14.066  1.00 0.00 ? 18  ARG A HH12 8  
ATOM   8266  H  HH21 . ARG A 1 18 ? -9.367  -11.963 14.027  1.00 0.00 ? 18  ARG A HH21 8  
ATOM   8267  H  HH22 . ARG A 1 18 ? -8.016  -10.961 14.437  1.00 0.00 ? 18  ARG A HH22 8  
ATOM   8268  N  N    . GLN A 1 19 ? -14.930 -5.320  12.304  1.00 0.00 ? 19  GLN A N    8  
ATOM   8269  C  CA   . GLN A 1 19 ? -15.892 -4.271  12.617  1.00 0.00 ? 19  GLN A CA   8  
ATOM   8270  C  C    . GLN A 1 19 ? -16.126 -3.369  11.409  1.00 0.00 ? 19  GLN A C    8  
ATOM   8271  O  O    . GLN A 1 19 ? -15.198 -2.735  10.905  1.00 0.00 ? 19  GLN A O    8  
ATOM   8272  C  CB   . GLN A 1 19 ? -15.403 -3.437  13.803  1.00 0.00 ? 19  GLN A CB   8  
ATOM   8273  C  CG   . GLN A 1 19 ? -15.180 -4.251  15.067  1.00 0.00 ? 19  GLN A CG   8  
ATOM   8274  C  CD   . GLN A 1 19 ? -14.667 -3.411  16.219  1.00 0.00 ? 19  GLN A CD   8  
ATOM   8275  O  OE1  . GLN A 1 19 ? -15.423 -2.669  16.847  1.00 0.00 ? 19  GLN A OE1  8  
ATOM   8276  N  NE2  . GLN A 1 19 ? -13.374 -3.522  16.504  1.00 0.00 ? 19  GLN A NE2  8  
ATOM   8277  H  H    . GLN A 1 19 ? -14.032 -5.276  12.693  1.00 0.00 ? 19  GLN A H    8  
ATOM   8278  H  HA   . GLN A 1 19 ? -16.825 -4.745  12.882  1.00 0.00 ? 19  GLN A HA   8  
ATOM   8279  H  HB2  . GLN A 1 19 ? -14.471 -2.964  13.535  1.00 0.00 ? 19  GLN A HB2  8  
ATOM   8280  H  HB3  . GLN A 1 19 ? -16.137 -2.674  14.017  1.00 0.00 ? 19  GLN A HB3  8  
ATOM   8281  H  HG2  . GLN A 1 19 ? -16.116 -4.702  15.360  1.00 0.00 ? 19  GLN A HG2  8  
ATOM   8282  H  HG3  . GLN A 1 19 ? -14.458 -5.027  14.857  1.00 0.00 ? 19  GLN A HG3  8  
ATOM   8283  H  HE21 . GLN A 1 19 ? -12.832 -4.132  15.961  1.00 0.00 ? 19  GLN A HE21 8  
ATOM   8284  H  HE22 . GLN A 1 19 ? -13.016 -2.989  17.243  1.00 0.00 ? 19  GLN A HE22 8  
ATOM   8285  N  N    . LYS A 1 20 ? -17.371 -3.317  10.947  1.00 0.00 ? 20  LYS A N    8  
ATOM   8286  C  CA   . LYS A 1 20 ? -17.728 -2.493  9.799   1.00 0.00 ? 20  LYS A CA   8  
ATOM   8287  C  C    . LYS A 1 20 ? -17.357 -1.033  10.040  1.00 0.00 ? 20  LYS A C    8  
ATOM   8288  O  O    . LYS A 1 20 ? -16.696 -0.406  9.214   1.00 0.00 ? 20  LYS A O    8  
ATOM   8289  C  CB   . LYS A 1 20 ? -19.226 -2.609  9.508   1.00 0.00 ? 20  LYS A CB   8  
ATOM   8290  C  CG   . LYS A 1 20 ? -19.698 -1.706  8.382   1.00 0.00 ? 20  LYS A CG   8  
ATOM   8291  C  CD   . LYS A 1 20 ? -19.453 -2.336  7.021   1.00 0.00 ? 20  LYS A CD   8  
ATOM   8292  C  CE   . LYS A 1 20 ? -19.243 -1.279  5.947   1.00 0.00 ? 20  LYS A CE   8  
ATOM   8293  N  NZ   . LYS A 1 20 ? -20.449 -0.424  5.767   1.00 0.00 ? 20  LYS A NZ   8  
ATOM   8294  H  H    . LYS A 1 20 ? -18.067 -3.846  11.392  1.00 0.00 ? 20  LYS A H    8  
ATOM   8295  H  HA   . LYS A 1 20 ? -17.175 -2.856  8.946   1.00 0.00 ? 20  LYS A HA   8  
ATOM   8296  H  HB2  . LYS A 1 20 ? -19.450 -3.631  9.240   1.00 0.00 ? 20  LYS A HB2  8  
ATOM   8297  H  HB3  . LYS A 1 20 ? -19.775 -2.351  10.402  1.00 0.00 ? 20  LYS A HB3  8  
ATOM   8298  H  HG2  . LYS A 1 20 ? -20.757 -1.525  8.498   1.00 0.00 ? 20  LYS A HG2  8  
ATOM   8299  H  HG3  . LYS A 1 20 ? -19.163 -0.768  8.436   1.00 0.00 ? 20  LYS A HG3  8  
ATOM   8300  H  HD2  . LYS A 1 20 ? -18.573 -2.958  7.075   1.00 0.00 ? 20  LYS A HD2  8  
ATOM   8301  H  HD3  . LYS A 1 20 ? -20.308 -2.941  6.756   1.00 0.00 ? 20  LYS A HD3  8  
ATOM   8302  H  HE2  . LYS A 1 20 ? -18.409 -0.656  6.232   1.00 0.00 ? 20  LYS A HE2  8  
ATOM   8303  H  HE3  . LYS A 1 20 ? -19.020 -1.774  5.013   1.00 0.00 ? 20  LYS A HE3  8  
ATOM   8304  H  HZ1  . LYS A 1 20 ? -21.237 -0.992  5.397   1.00 0.00 ? 20  LYS A HZ1  8  
ATOM   8305  H  HZ2  . LYS A 1 20 ? -20.245 0.344   5.097   1.00 0.00 ? 20  LYS A HZ2  8  
ATOM   8306  H  HZ3  . LYS A 1 20 ? -20.732 -0.009  6.678   1.00 0.00 ? 20  LYS A HZ3  8  
ATOM   8307  N  N    . ALA A 1 21 ? -17.787 -0.499  11.179  1.00 0.00 ? 21  ALA A N    8  
ATOM   8308  C  CA   . ALA A 1 21 ? -17.497 0.886   11.530  1.00 0.00 ? 21  ALA A CA   8  
ATOM   8309  C  C    . ALA A 1 21 ? -16.044 1.235   11.231  1.00 0.00 ? 21  ALA A C    8  
ATOM   8310  O  O    . ALA A 1 21 ? -15.758 2.248   10.592  1.00 0.00 ? 21  ALA A O    8  
ATOM   8311  C  CB   . ALA A 1 21 ? -17.810 1.134   12.999  1.00 0.00 ? 21  ALA A CB   8  
ATOM   8312  H  H    . ALA A 1 21 ? -18.310 -1.050  11.798  1.00 0.00 ? 21  ALA A H    8  
ATOM   8313  H  HA   . ALA A 1 21 ? -18.139 1.522   10.938  1.00 0.00 ? 21  ALA A HA   8  
ATOM   8314  H  HB1  . ALA A 1 21 ? -18.351 0.288   13.398  1.00 0.00 ? 21  ALA A HB1  8  
ATOM   8315  H  HB2  . ALA A 1 21 ? -16.889 1.264   13.546  1.00 0.00 ? 21  ALA A HB2  8  
ATOM   8316  H  HB3  . ALA A 1 21 ? -18.414 2.024   13.092  1.00 0.00 ? 21  ALA A HB3  8  
ATOM   8317  N  N    . SER A 1 22 ? -15.128 0.391   11.697  1.00 0.00 ? 22  SER A N    8  
ATOM   8318  C  CA   . SER A 1 22 ? -13.703 0.614   11.482  1.00 0.00 ? 22  SER A CA   8  
ATOM   8319  C  C    . SER A 1 22 ? -13.405 0.837   10.003  1.00 0.00 ? 22  SER A C    8  
ATOM   8320  O  O    . SER A 1 22 ? -12.658 1.747   9.639   1.00 0.00 ? 22  SER A O    8  
ATOM   8321  C  CB   . SER A 1 22 ? -12.896 -0.576  12.003  1.00 0.00 ? 22  SER A CB   8  
ATOM   8322  O  OG   . SER A 1 22 ? -12.872 -0.596  13.420  1.00 0.00 ? 22  SER A OG   8  
ATOM   8323  H  H    . SER A 1 22 ? -15.419 -0.399  12.199  1.00 0.00 ? 22  SER A H    8  
ATOM   8324  H  HA   . SER A 1 22 ? -13.420 1.499   12.033  1.00 0.00 ? 22  SER A HA   8  
ATOM   8325  H  HB2  . SER A 1 22 ? -13.342 -1.493  11.650  1.00 0.00 ? 22  SER A HB2  8  
ATOM   8326  H  HB3  . SER A 1 22 ? -11.881 -0.506  11.638  1.00 0.00 ? 22  SER A HB3  8  
ATOM   8327  H  HG   . SER A 1 22 ? -13.552 -1.191  13.744  1.00 0.00 ? 22  SER A HG   8  
ATOM   8328  N  N    . LEU A 1 23 ? -13.993 0.001   9.155   1.00 0.00 ? 23  LEU A N    8  
ATOM   8329  C  CA   . LEU A 1 23 ? -13.792 0.106   7.714   1.00 0.00 ? 23  LEU A CA   8  
ATOM   8330  C  C    . LEU A 1 23 ? -14.115 1.513   7.219   1.00 0.00 ? 23  LEU A C    8  
ATOM   8331  O  O    . LEU A 1 23 ? -13.258 2.198   6.663   1.00 0.00 ? 23  LEU A O    8  
ATOM   8332  C  CB   . LEU A 1 23 ? -14.662 -0.916  6.981   1.00 0.00 ? 23  LEU A CB   8  
ATOM   8333  C  CG   . LEU A 1 23 ? -14.279 -1.208  5.530   1.00 0.00 ? 23  LEU A CG   8  
ATOM   8334  C  CD1  . LEU A 1 23 ? -12.917 -1.882  5.463   1.00 0.00 ? 23  LEU A CD1  8  
ATOM   8335  C  CD2  . LEU A 1 23 ? -15.338 -2.072  4.862   1.00 0.00 ? 23  LEU A CD2  8  
ATOM   8336  H  H    . LEU A 1 23 ? -14.577 -0.703  9.504   1.00 0.00 ? 23  LEU A H    8  
ATOM   8337  H  HA   . LEU A 1 23 ? -12.753 -0.105  7.508   1.00 0.00 ? 23  LEU A HA   8  
ATOM   8338  H  HB2  . LEU A 1 23 ? -14.613 -1.845  7.529   1.00 0.00 ? 23  LEU A HB2  8  
ATOM   8339  H  HB3  . LEU A 1 23 ? -15.679 -0.550  6.989   1.00 0.00 ? 23  LEU A HB3  8  
ATOM   8340  H  HG   . LEU A 1 23 ? -14.215 -0.275  4.987   1.00 0.00 ? 23  LEU A HG   8  
ATOM   8341  H  HD11 . LEU A 1 23 ? -13.048 -2.942  5.305   1.00 0.00 ? 23  LEU A HD11 8  
ATOM   8342  H  HD12 . LEU A 1 23 ? -12.389 -1.719  6.390   1.00 0.00 ? 23  LEU A HD12 8  
ATOM   8343  H  HD13 . LEU A 1 23 ? -12.348 -1.464  4.646   1.00 0.00 ? 23  LEU A HD13 8  
ATOM   8344  H  HD21 . LEU A 1 23 ? -16.285 -1.931  5.361   1.00 0.00 ? 23  LEU A HD21 8  
ATOM   8345  H  HD22 . LEU A 1 23 ? -15.048 -3.111  4.926   1.00 0.00 ? 23  LEU A HD22 8  
ATOM   8346  H  HD23 . LEU A 1 23 ? -15.432 -1.788  3.824   1.00 0.00 ? 23  LEU A HD23 8  
ATOM   8347  N  N    . ASN A 1 24 ? -15.356 1.937   7.429   1.00 0.00 ? 24  ASN A N    8  
ATOM   8348  C  CA   . ASN A 1 24 ? -15.792 3.263   7.006   1.00 0.00 ? 24  ASN A CA   8  
ATOM   8349  C  C    . ASN A 1 24 ? -14.780 4.327   7.422   1.00 0.00 ? 24  ASN A C    8  
ATOM   8350  O  O    . ASN A 1 24 ? -14.284 5.085   6.589   1.00 0.00 ? 24  ASN A O    8  
ATOM   8351  C  CB   . ASN A 1 24 ? -17.163 3.587   7.603   1.00 0.00 ? 24  ASN A CB   8  
ATOM   8352  C  CG   . ASN A 1 24 ? -18.301 3.002   6.789   1.00 0.00 ? 24  ASN A CG   8  
ATOM   8353  O  OD1  . ASN A 1 24 ? -18.298 3.069   5.560   1.00 0.00 ? 24  ASN A OD1  8  
ATOM   8354  N  ND2  . ASN A 1 24 ? -19.283 2.425   7.473   1.00 0.00 ? 24  ASN A ND2  8  
ATOM   8355  H  H    . ASN A 1 24 ? -15.995 1.345   7.878   1.00 0.00 ? 24  ASN A H    8  
ATOM   8356  H  HA   . ASN A 1 24 ? -15.871 3.259   5.930   1.00 0.00 ? 24  ASN A HA   8  
ATOM   8357  H  HB2  . ASN A 1 24 ? -17.218 3.182   8.604   1.00 0.00 ? 24  ASN A HB2  8  
ATOM   8358  H  HB3  . ASN A 1 24 ? -17.288 4.658   7.645   1.00 0.00 ? 24  ASN A HB3  8  
ATOM   8359  H  HD21 . ASN A 1 24 ? -19.219 2.409   8.451   1.00 0.00 ? 24  ASN A HD21 8  
ATOM   8360  H  HD22 . ASN A 1 24 ? -20.030 2.039   6.971   1.00 0.00 ? 24  ASN A HD22 8  
ATOM   8361  N  N    . TRP A 1 25 ? -14.479 4.375   8.714   1.00 0.00 ? 25  TRP A N    8  
ATOM   8362  C  CA   . TRP A 1 25 ? -13.526 5.346   9.241   1.00 0.00 ? 25  TRP A CA   8  
ATOM   8363  C  C    . TRP A 1 25 ? -12.166 5.192   8.569   1.00 0.00 ? 25  TRP A C    8  
ATOM   8364  O  O    . TRP A 1 25 ? -11.386 6.142   8.499   1.00 0.00 ? 25  TRP A O    8  
ATOM   8365  C  CB   . TRP A 1 25 ? -13.382 5.181   10.755  1.00 0.00 ? 25  TRP A CB   8  
ATOM   8366  C  CG   . TRP A 1 25 ? -12.228 5.945   11.329  1.00 0.00 ? 25  TRP A CG   8  
ATOM   8367  C  CD1  . TRP A 1 25 ? -10.903 5.636   11.215  1.00 0.00 ? 25  TRP A CD1  8  
ATOM   8368  C  CD2  . TRP A 1 25 ? -12.297 7.145   12.107  1.00 0.00 ? 25  TRP A CD2  8  
ATOM   8369  N  NE1  . TRP A 1 25 ? -10.143 6.571   11.876  1.00 0.00 ? 25  TRP A NE1  8  
ATOM   8370  C  CE2  . TRP A 1 25 ? -10.975 7.507   12.431  1.00 0.00 ? 25  TRP A CE2  8  
ATOM   8371  C  CE3  . TRP A 1 25 ? -13.346 7.949   12.560  1.00 0.00 ? 25  TRP A CE3  8  
ATOM   8372  C  CZ2  . TRP A 1 25 ? -10.677 8.638   13.188  1.00 0.00 ? 25  TRP A CZ2  8  
ATOM   8373  C  CZ3  . TRP A 1 25 ? -13.049 9.070   13.312  1.00 0.00 ? 25  TRP A CZ3  8  
ATOM   8374  C  CH2  . TRP A 1 25 ? -11.724 9.407   13.619  1.00 0.00 ? 25  TRP A CH2  8  
ATOM   8375  H  H    . TRP A 1 25 ? -14.908 3.744   9.330   1.00 0.00 ? 25  TRP A H    8  
ATOM   8376  H  HA   . TRP A 1 25 ? -13.909 6.333   9.030   1.00 0.00 ? 25  TRP A HA   8  
ATOM   8377  H  HB2  . TRP A 1 25 ? -14.284 5.529   11.235  1.00 0.00 ? 25  TRP A HB2  8  
ATOM   8378  H  HB3  . TRP A 1 25 ? -13.237 4.135   10.983  1.00 0.00 ? 25  TRP A HB3  8  
ATOM   8379  H  HD1  . TRP A 1 25 ? -10.522 4.778   10.683  1.00 0.00 ? 25  TRP A HD1  8  
ATOM   8380  H  HE1  . TRP A 1 25 ? -9.165  6.568   11.939  1.00 0.00 ? 25  TRP A HE1  8  
ATOM   8381  H  HE3  . TRP A 1 25 ? -14.374 7.706   12.334  1.00 0.00 ? 25  TRP A HE3  8  
ATOM   8382  H  HZ2  . TRP A 1 25 ? -9.661  8.911   13.433  1.00 0.00 ? 25  TRP A HZ2  8  
ATOM   8383  H  HZ3  . TRP A 1 25 ? -13.847 9.703   13.671  1.00 0.00 ? 25  TRP A HZ3  8  
ATOM   8384  H  HH2  . TRP A 1 25 ? -11.539 10.291  14.208  1.00 0.00 ? 25  TRP A HH2  8  
ATOM   8385  N  N    . HIS A 1 26 ? -11.886 3.989   8.077   1.00 0.00 ? 26  HIS A N    8  
ATOM   8386  C  CA   . HIS A 1 26 ? -10.619 3.712   7.410   1.00 0.00 ? 26  HIS A CA   8  
ATOM   8387  C  C    . HIS A 1 26 ? -10.687 4.092   5.934   1.00 0.00 ? 26  HIS A C    8  
ATOM   8388  O  O    . HIS A 1 26 ? -9.661  4.324   5.296   1.00 0.00 ? 26  HIS A O    8  
ATOM   8389  C  CB   . HIS A 1 26 ? -10.257 2.233   7.551   1.00 0.00 ? 26  HIS A CB   8  
ATOM   8390  C  CG   . HIS A 1 26 ? -9.341  1.735   6.475   1.00 0.00 ? 26  HIS A CG   8  
ATOM   8391  N  ND1  . HIS A 1 26 ? -7.983  1.977   6.472   1.00 0.00 ? 26  HIS A ND1  8  
ATOM   8392  C  CD2  . HIS A 1 26 ? -9.594  1.004   5.365   1.00 0.00 ? 26  HIS A CD2  8  
ATOM   8393  C  CE1  . HIS A 1 26 ? -7.441  1.418   5.405   1.00 0.00 ? 26  HIS A CE1  8  
ATOM   8394  N  NE2  . HIS A 1 26 ? -8.397  0.820   4.717   1.00 0.00 ? 26  HIS A NE2  8  
ATOM   8395  H  H    . HIS A 1 26 ? -12.548 3.272   8.164   1.00 0.00 ? 26  HIS A H    8  
ATOM   8396  H  HA   . HIS A 1 26 ? -9.856  4.307   7.887   1.00 0.00 ? 26  HIS A HA   8  
ATOM   8397  H  HB2  . HIS A 1 26 ? -9.768  2.078   8.501   1.00 0.00 ? 26  HIS A HB2  8  
ATOM   8398  H  HB3  . HIS A 1 26 ? -11.162 1.643   7.516   1.00 0.00 ? 26  HIS A HB3  8  
ATOM   8399  H  HD1  . HIS A 1 26 ? -7.491  2.485   7.150   1.00 0.00 ? 26  HIS A HD1  8  
ATOM   8400  H  HD2  . HIS A 1 26 ? -10.558 0.633   5.047   1.00 0.00 ? 26  HIS A HD2  8  
ATOM   8401  H  HE1  . HIS A 1 26 ? -6.395  1.443   5.140   1.00 0.00 ? 26  HIS A HE1  8  
ATOM   8402  N  N    . GLN A 1 27 ? -11.903 4.154   5.399   1.00 0.00 ? 27  GLN A N    8  
ATOM   8403  C  CA   . GLN A 1 27 ? -12.104 4.505   3.998   1.00 0.00 ? 27  GLN A CA   8  
ATOM   8404  C  C    . GLN A 1 27 ? -12.219 6.016   3.827   1.00 0.00 ? 27  GLN A C    8  
ATOM   8405  O  O    . GLN A 1 27 ? -11.671 6.587   2.884   1.00 0.00 ? 27  GLN A O    8  
ATOM   8406  C  CB   . GLN A 1 27 ? -13.358 3.820   3.454   1.00 0.00 ? 27  GLN A CB   8  
ATOM   8407  C  CG   . GLN A 1 27 ? -13.278 2.302   3.467   1.00 0.00 ? 27  GLN A CG   8  
ATOM   8408  C  CD   . GLN A 1 27 ? -14.538 1.646   2.939   1.00 0.00 ? 27  GLN A CD   8  
ATOM   8409  O  OE1  . GLN A 1 27 ? -15.557 2.307   2.733   1.00 0.00 ? 27  GLN A OE1  8  
ATOM   8410  N  NE2  . GLN A 1 27 ? -14.477 0.339   2.716   1.00 0.00 ? 27  GLN A NE2  8  
ATOM   8411  H  H    . GLN A 1 27 ? -12.682 3.958   5.959   1.00 0.00 ? 27  GLN A H    8  
ATOM   8412  H  HA   . GLN A 1 27 ? -11.246 4.157   3.443   1.00 0.00 ? 27  GLN A HA   8  
ATOM   8413  H  HB2  . GLN A 1 27 ? -14.206 4.120   4.052   1.00 0.00 ? 27  GLN A HB2  8  
ATOM   8414  H  HB3  . GLN A 1 27 ? -13.516 4.141   2.435   1.00 0.00 ? 27  GLN A HB3  8  
ATOM   8415  H  HG2  . GLN A 1 27 ? -12.445 1.993   2.853   1.00 0.00 ? 27  GLN A HG2  8  
ATOM   8416  H  HG3  . GLN A 1 27 ? -13.116 1.973   4.483   1.00 0.00 ? 27  GLN A HG3  8  
ATOM   8417  H  HE21 . GLN A 1 27 ? -13.632 -0.123  2.904   1.00 0.00 ? 27  GLN A HE21 8  
ATOM   8418  H  HE22 . GLN A 1 27 ? -15.277 -0.111  2.375   1.00 0.00 ? 27  GLN A HE22 8  
ATOM   8419  N  N    . ARG A 1 28 ? -12.936 6.657   4.744   1.00 0.00 ? 28  ARG A N    8  
ATOM   8420  C  CA   . ARG A 1 28 ? -13.125 8.102   4.693   1.00 0.00 ? 28  ARG A CA   8  
ATOM   8421  C  C    . ARG A 1 28 ? -11.801 8.814   4.431   1.00 0.00 ? 28  ARG A C    8  
ATOM   8422  O  O    . ARG A 1 28 ? -11.748 9.797   3.691   1.00 0.00 ? 28  ARG A O    8  
ATOM   8423  C  CB   . ARG A 1 28 ? -13.736 8.604   6.003   1.00 0.00 ? 28  ARG A CB   8  
ATOM   8424  C  CG   . ARG A 1 28 ? -12.733 8.714   7.140   1.00 0.00 ? 28  ARG A CG   8  
ATOM   8425  C  CD   . ARG A 1 28 ? -13.423 9.003   8.464   1.00 0.00 ? 28  ARG A CD   8  
ATOM   8426  N  NE   . ARG A 1 28 ? -13.534 10.436  8.722   1.00 0.00 ? 28  ARG A NE   8  
ATOM   8427  C  CZ   . ARG A 1 28 ? -12.677 11.117  9.474   1.00 0.00 ? 28  ARG A CZ   8  
ATOM   8428  N  NH1  . ARG A 1 28 ? -11.650 10.498  10.040  1.00 0.00 ? 28  ARG A NH1  8  
ATOM   8429  N  NH2  . ARG A 1 28 ? -12.845 12.420  9.661   1.00 0.00 ? 28  ARG A NH2  8  
ATOM   8430  H  H    . ARG A 1 28 ? -13.348 6.147   5.472   1.00 0.00 ? 28  ARG A H    8  
ATOM   8431  H  HA   . ARG A 1 28 ? -13.804 8.320   3.883   1.00 0.00 ? 28  ARG A HA   8  
ATOM   8432  H  HB2  . ARG A 1 28 ? -14.165 9.581   5.835   1.00 0.00 ? 28  ARG A HB2  8  
ATOM   8433  H  HB3  . ARG A 1 28 ? -14.518 7.924   6.305   1.00 0.00 ? 28  ARG A HB3  8  
ATOM   8434  H  HG2  . ARG A 1 28 ? -12.195 7.781   7.224   1.00 0.00 ? 28  ARG A HG2  8  
ATOM   8435  H  HG3  . ARG A 1 28 ? -12.042 9.514   6.922   1.00 0.00 ? 28  ARG A HG3  8  
ATOM   8436  H  HD2  . ARG A 1 28 ? -14.413 8.574   8.441   1.00 0.00 ? 28  ARG A HD2  8  
ATOM   8437  H  HD3  . ARG A 1 28 ? -12.852 8.547   9.259   1.00 0.00 ? 28  ARG A HD3  8  
ATOM   8438  H  HE   . ARG A 1 28 ? -14.286 10.914  8.313   1.00 0.00 ? 28  ARG A HE   8  
ATOM   8439  H  HH11 . ARG A 1 28 ? -11.520 9.516   9.900   1.00 0.00 ? 28  ARG A HH11 8  
ATOM   8440  H  HH12 . ARG A 1 28 ? -11.005 11.013  10.606  1.00 0.00 ? 28  ARG A HH12 8  
ATOM   8441  H  HH21 . ARG A 1 28 ? -13.618 12.890  9.236   1.00 0.00 ? 28  ARG A HH21 8  
ATOM   8442  H  HH22 . ARG A 1 28 ? -12.200 12.931  10.228  1.00 0.00 ? 28  ARG A HH22 8  
ATOM   8443  N  N    . LYS A 1 29 ? -10.734 8.313   5.043   1.00 0.00 ? 29  LYS A N    8  
ATOM   8444  C  CA   . LYS A 1 29 ? -9.409  8.899   4.876   1.00 0.00 ? 29  LYS A CA   8  
ATOM   8445  C  C    . LYS A 1 29 ? -8.883  8.661   3.464   1.00 0.00 ? 29  LYS A C    8  
ATOM   8446  O  O    . LYS A 1 29 ? -8.241  9.531   2.875   1.00 0.00 ? 29  LYS A O    8  
ATOM   8447  C  CB   . LYS A 1 29 ? -8.436  8.312   5.901   1.00 0.00 ? 29  LYS A CB   8  
ATOM   8448  C  CG   . LYS A 1 29 ? -8.189  6.824   5.721   1.00 0.00 ? 29  LYS A CG   8  
ATOM   8449  C  CD   . LYS A 1 29 ? -6.958  6.367   6.486   1.00 0.00 ? 29  LYS A CD   8  
ATOM   8450  C  CE   . LYS A 1 29 ? -7.088  4.921   6.940   1.00 0.00 ? 29  LYS A CE   8  
ATOM   8451  N  NZ   . LYS A 1 29 ? -5.759  4.276   7.125   1.00 0.00 ? 29  LYS A NZ   8  
ATOM   8452  H  H    . LYS A 1 29 ? -10.839 7.527   5.620   1.00 0.00 ? 29  LYS A H    8  
ATOM   8453  H  HA   . LYS A 1 29 ? -9.494  9.963   5.041   1.00 0.00 ? 29  LYS A HA   8  
ATOM   8454  H  HB2  . LYS A 1 29 ? -7.490  8.826   5.816   1.00 0.00 ? 29  LYS A HB2  8  
ATOM   8455  H  HB3  . LYS A 1 29 ? -8.836  8.472   6.892   1.00 0.00 ? 29  LYS A HB3  8  
ATOM   8456  H  HG2  . LYS A 1 29 ? -9.047  6.279   6.084   1.00 0.00 ? 29  LYS A HG2  8  
ATOM   8457  H  HG3  . LYS A 1 29 ? -8.046  6.616   4.670   1.00 0.00 ? 29  LYS A HG3  8  
ATOM   8458  H  HD2  . LYS A 1 29 ? -6.093  6.455   5.845   1.00 0.00 ? 29  LYS A HD2  8  
ATOM   8459  H  HD3  . LYS A 1 29 ? -6.830  6.998   7.355   1.00 0.00 ? 29  LYS A HD3  8  
ATOM   8460  H  HE2  . LYS A 1 29 ? -7.624  4.899   7.877   1.00 0.00 ? 29  LYS A HE2  8  
ATOM   8461  H  HE3  . LYS A 1 29 ? -7.645  4.373   6.194   1.00 0.00 ? 29  LYS A HE3  8  
ATOM   8462  H  HZ1  . LYS A 1 29 ? -5.868  3.243   7.178   1.00 0.00 ? 29  LYS A HZ1  8  
ATOM   8463  H  HZ2  . LYS A 1 29 ? -5.318  4.612   8.005   1.00 0.00 ? 29  LYS A HZ2  8  
ATOM   8464  H  HZ3  . LYS A 1 29 ? -5.135  4.508   6.327   1.00 0.00 ? 29  LYS A HZ3  8  
ATOM   8465  N  N    . HIS A 1 30 ? -9.159  7.478   2.926   1.00 0.00 ? 30  HIS A N    8  
ATOM   8466  C  CA   . HIS A 1 30 ? -8.715  7.126   1.582   1.00 0.00 ? 30  HIS A CA   8  
ATOM   8467  C  C    . HIS A 1 30 ? -9.213  8.145   0.561   1.00 0.00 ? 30  HIS A C    8  
ATOM   8468  O  O    . HIS A 1 30 ? -8.491  8.514   -0.365  1.00 0.00 ? 30  HIS A O    8  
ATOM   8469  C  CB   . HIS A 1 30 ? -9.209  5.729   1.207   1.00 0.00 ? 30  HIS A CB   8  
ATOM   8470  C  CG   . HIS A 1 30 ? -8.306  4.629   1.673   1.00 0.00 ? 30  HIS A CG   8  
ATOM   8471  N  ND1  . HIS A 1 30 ? -6.931  4.735   1.675   1.00 0.00 ? 30  HIS A ND1  8  
ATOM   8472  C  CD2  . HIS A 1 30 ? -8.587  3.396   2.155   1.00 0.00 ? 30  HIS A CD2  8  
ATOM   8473  C  CE1  . HIS A 1 30 ? -6.406  3.614   2.137   1.00 0.00 ? 30  HIS A CE1  8  
ATOM   8474  N  NE2  . HIS A 1 30 ? -7.390  2.785   2.436   1.00 0.00 ? 30  HIS A NE2  8  
ATOM   8475  H  H    . HIS A 1 30 ? -9.675  6.826   3.445   1.00 0.00 ? 30  HIS A H    8  
ATOM   8476  H  HA   . HIS A 1 30 ? -7.635  7.130   1.578   1.00 0.00 ? 30  HIS A HA   8  
ATOM   8477  H  HB2  . HIS A 1 30 ? -10.182 5.568   1.649   1.00 0.00 ? 30  HIS A HB2  8  
ATOM   8478  H  HB3  . HIS A 1 30 ? -9.292  5.659   0.132   1.00 0.00 ? 30  HIS A HB3  8  
ATOM   8479  H  HD1  . HIS A 1 30 ? -6.416  5.514   1.380   1.00 0.00 ? 30  HIS A HD1  8  
ATOM   8480  H  HD2  . HIS A 1 30 ? -9.571  2.970   2.294   1.00 0.00 ? 30  HIS A HD2  8  
ATOM   8481  H  HE1  . HIS A 1 30 ? -5.352  3.409   2.251   1.00 0.00 ? 30  HIS A HE1  8  
ATOM   8482  N  N    . ALA A 1 31 ? -10.451 8.596   0.738   1.00 0.00 ? 31  ALA A N    8  
ATOM   8483  C  CA   . ALA A 1 31 ? -11.044 9.573   -0.167  1.00 0.00 ? 31  ALA A CA   8  
ATOM   8484  C  C    . ALA A 1 31 ? -10.161 10.809  -0.295  1.00 0.00 ? 31  ALA A C    8  
ATOM   8485  O  O    . ALA A 1 31 ? -9.917  11.297  -1.398  1.00 0.00 ? 31  ALA A O    8  
ATOM   8486  C  CB   . ALA A 1 31 ? -12.434 9.962   0.315   1.00 0.00 ? 31  ALA A CB   8  
ATOM   8487  H  H    . ALA A 1 31 ? -10.977 8.264   1.495   1.00 0.00 ? 31  ALA A H    8  
ATOM   8488  H  HA   . ALA A 1 31 ? -11.143 9.111   -1.139  1.00 0.00 ? 31  ALA A HA   8  
ATOM   8489  H  HB1  . ALA A 1 31 ? -13.014 9.069   0.495   1.00 0.00 ? 31  ALA A HB1  8  
ATOM   8490  H  HB2  . ALA A 1 31 ? -12.352 10.529  1.230   1.00 0.00 ? 31  ALA A HB2  8  
ATOM   8491  H  HB3  . ALA A 1 31 ? -12.921 10.562  -0.439  1.00 0.00 ? 31  ALA A HB3  8  
ATOM   8492  N  N    . GLU A 1 32 ? -9.686  11.312  0.840   1.00 0.00 ? 32  GLU A N    8  
ATOM   8493  C  CA   . GLU A 1 32 ? -8.831  12.493  0.853   1.00 0.00 ? 32  GLU A CA   8  
ATOM   8494  C  C    . GLU A 1 32 ? -7.399  12.133  0.467   1.00 0.00 ? 32  GLU A C    8  
ATOM   8495  O  O    . GLU A 1 32 ? -6.717  12.896  -0.219  1.00 0.00 ? 32  GLU A O    8  
ATOM   8496  C  CB   . GLU A 1 32 ? -8.849  13.148  2.236   1.00 0.00 ? 32  GLU A CB   8  
ATOM   8497  C  CG   . GLU A 1 32 ? -8.203  12.300  3.319   1.00 0.00 ? 32  GLU A CG   8  
ATOM   8498  C  CD   . GLU A 1 32 ? -7.873  13.098  4.566   1.00 0.00 ? 32  GLU A CD   8  
ATOM   8499  O  OE1  . GLU A 1 32 ? -8.705  13.938  4.969   1.00 0.00 ? 32  GLU A OE1  8  
ATOM   8500  O  OE2  . GLU A 1 32 ? -6.784  12.884  5.138   1.00 0.00 ? 32  GLU A OE2  8  
ATOM   8501  H  H    . GLU A 1 32 ? -9.915  10.878  1.688   1.00 0.00 ? 32  GLU A H    8  
ATOM   8502  H  HA   . GLU A 1 32 ? -9.221  13.192  0.129   1.00 0.00 ? 32  GLU A HA   8  
ATOM   8503  H  HB2  . GLU A 1 32 ? -8.323  14.089  2.182   1.00 0.00 ? 32  GLU A HB2  8  
ATOM   8504  H  HB3  . GLU A 1 32 ? -9.874  13.335  2.519   1.00 0.00 ? 32  GLU A HB3  8  
ATOM   8505  H  HG2  . GLU A 1 32 ? -8.881  11.505  3.589   1.00 0.00 ? 32  GLU A HG2  8  
ATOM   8506  H  HG3  . GLU A 1 32 ? -7.289  11.876  2.929   1.00 0.00 ? 32  GLU A HG3  8  
ATOM   8507  N  N    . THR A 1 33 ? -6.948  10.965  0.914   1.00 0.00 ? 33  THR A N    8  
ATOM   8508  C  CA   . THR A 1 33 ? -5.598  10.503  0.618   1.00 0.00 ? 33  THR A CA   8  
ATOM   8509  C  C    . THR A 1 33 ? -5.400  10.306  -0.881  1.00 0.00 ? 33  THR A C    8  
ATOM   8510  O  O    . THR A 1 33 ? -4.555  10.956  -1.497  1.00 0.00 ? 33  THR A O    8  
ATOM   8511  C  CB   . THR A 1 33 ? -5.284  9.181   1.344   1.00 0.00 ? 33  THR A CB   8  
ATOM   8512  O  OG1  . THR A 1 33 ? -5.427  9.353   2.758   1.00 0.00 ? 33  THR A OG1  8  
ATOM   8513  C  CG2  . THR A 1 33 ? -3.874  8.710   1.024   1.00 0.00 ? 33  THR A CG2  8  
ATOM   8514  H  H    . THR A 1 33 ? -7.539  10.401  1.456   1.00 0.00 ? 33  THR A H    8  
ATOM   8515  H  HA   . THR A 1 33 ? -4.904  11.254  0.967   1.00 0.00 ? 33  THR A HA   8  
ATOM   8516  H  HB   . THR A 1 33 ? -5.984  8.429   1.008   1.00 0.00 ? 33  THR A HB   8  
ATOM   8517  H  HG1  . THR A 1 33 ? -6.239  9.831   2.942   1.00 0.00 ? 33  THR A HG1  8  
ATOM   8518  H  HG21 . THR A 1 33 ? -3.850  8.293   0.029   1.00 0.00 ? 33  THR A HG21 8  
ATOM   8519  H  HG22 . THR A 1 33 ? -3.576  7.956   1.738   1.00 0.00 ? 33  THR A HG22 8  
ATOM   8520  H  HG23 . THR A 1 33 ? -3.194  9.547   1.080   1.00 0.00 ? 33  THR A HG23 8  
ATOM   8521  N  N    . VAL A 1 34 ? -6.186  9.405   -1.463  1.00 0.00 ? 34  VAL A N    8  
ATOM   8522  C  CA   . VAL A 1 34 ? -6.098  9.124   -2.891  1.00 0.00 ? 34  VAL A CA   8  
ATOM   8523  C  C    . VAL A 1 34 ? -5.700  10.370  -3.674  1.00 0.00 ? 34  VAL A C    8  
ATOM   8524  O  O    . VAL A 1 34 ? -4.942  10.293  -4.640  1.00 0.00 ? 34  VAL A O    8  
ATOM   8525  C  CB   . VAL A 1 34 ? -7.435  8.591   -3.441  1.00 0.00 ? 34  VAL A CB   8  
ATOM   8526  C  CG1  . VAL A 1 34 ? -7.784  7.258   -2.797  1.00 0.00 ? 34  VAL A CG1  8  
ATOM   8527  C  CG2  . VAL A 1 34 ? -8.545  9.607   -3.219  1.00 0.00 ? 34  VAL A CG2  8  
ATOM   8528  H  H    . VAL A 1 34 ? -6.840  8.919   -0.920  1.00 0.00 ? 34  VAL A H    8  
ATOM   8529  H  HA   . VAL A 1 34 ? -5.345  8.364   -3.036  1.00 0.00 ? 34  VAL A HA   8  
ATOM   8530  H  HB   . VAL A 1 34 ? -7.326  8.434   -4.504  1.00 0.00 ? 34  VAL A HB   8  
ATOM   8531  H  HG11 . VAL A 1 34 ? -6.982  6.955   -2.140  1.00 0.00 ? 34  VAL A HG11 8  
ATOM   8532  H  HG12 . VAL A 1 34 ? -8.697  7.361   -2.229  1.00 0.00 ? 34  VAL A HG12 8  
ATOM   8533  H  HG13 . VAL A 1 34 ? -7.919  6.511   -3.566  1.00 0.00 ? 34  VAL A HG13 8  
ATOM   8534  H  HG21 . VAL A 1 34 ? -8.267  10.272  -2.415  1.00 0.00 ? 34  VAL A HG21 8  
ATOM   8535  H  HG22 . VAL A 1 34 ? -8.696  10.179  -4.123  1.00 0.00 ? 34  VAL A HG22 8  
ATOM   8536  H  HG23 . VAL A 1 34 ? -9.459  9.092   -2.962  1.00 0.00 ? 34  VAL A HG23 8  
ATOM   8537  N  N    . ALA A 1 35 ? -6.217  11.519  -3.249  1.00 0.00 ? 35  ALA A N    8  
ATOM   8538  C  CA   . ALA A 1 35 ? -5.913  12.783  -3.908  1.00 0.00 ? 35  ALA A CA   8  
ATOM   8539  C  C    . ALA A 1 35 ? -4.510  13.263  -3.555  1.00 0.00 ? 35  ALA A C    8  
ATOM   8540  O  O    . ALA A 1 35 ? -3.661  13.429  -4.431  1.00 0.00 ? 35  ALA A O    8  
ATOM   8541  C  CB   . ALA A 1 35 ? -6.944  13.836  -3.530  1.00 0.00 ? 35  ALA A CB   8  
ATOM   8542  H  H    . ALA A 1 35 ? -6.815  11.516  -2.473  1.00 0.00 ? 35  ALA A H    8  
ATOM   8543  H  HA   . ALA A 1 35 ? -5.971  12.625  -4.975  1.00 0.00 ? 35  ALA A HA   8  
ATOM   8544  H  HB1  . ALA A 1 35 ? -6.731  14.754  -4.060  1.00 0.00 ? 35  ALA A HB1  8  
ATOM   8545  H  HB2  . ALA A 1 35 ? -7.930  13.486  -3.797  1.00 0.00 ? 35  ALA A HB2  8  
ATOM   8546  H  HB3  . ALA A 1 35 ? -6.901  14.016  -2.466  1.00 0.00 ? 35  ALA A HB3  8  
ATOM   8547  N  N    . ALA A 1 36 ? -4.272  13.486  -2.266  1.00 0.00 ? 36  ALA A N    8  
ATOM   8548  C  CA   . ALA A 1 36 ? -2.971  13.946  -1.797  1.00 0.00 ? 36  ALA A CA   8  
ATOM   8549  C  C    . ALA A 1 36 ? -1.844  13.352  -2.635  1.00 0.00 ? 36  ALA A C    8  
ATOM   8550  O  O    . ALA A 1 36 ? -0.863  14.029  -2.944  1.00 0.00 ? 36  ALA A O    8  
ATOM   8551  C  CB   . ALA A 1 36 ? -2.783  13.591  -0.330  1.00 0.00 ? 36  ALA A CB   8  
ATOM   8552  H  H    . ALA A 1 36 ? -4.989  13.335  -1.615  1.00 0.00 ? 36  ALA A H    8  
ATOM   8553  H  HA   . ALA A 1 36 ? -2.945  15.022  -1.889  1.00 0.00 ? 36  ALA A HA   8  
ATOM   8554  H  HB1  . ALA A 1 36 ? -3.343  14.284  0.282   1.00 0.00 ? 36  ALA A HB1  8  
ATOM   8555  H  HB2  . ALA A 1 36 ? -3.138  12.587  -0.154  1.00 0.00 ? 36  ALA A HB2  8  
ATOM   8556  H  HB3  . ALA A 1 36 ? -1.736  13.653  -0.076  1.00 0.00 ? 36  ALA A HB3  8  
ATOM   8557  N  N    . LEU A 1 37 ? -1.990  12.083  -3.000  1.00 0.00 ? 37  LEU A N    8  
ATOM   8558  C  CA   . LEU A 1 37 ? -0.984  11.396  -3.803  1.00 0.00 ? 37  LEU A CA   8  
ATOM   8559  C  C    . LEU A 1 37 ? -0.774  12.107  -5.136  1.00 0.00 ? 37  LEU A C    8  
ATOM   8560  O  O    . LEU A 1 37 ? -1.707  12.255  -5.925  1.00 0.00 ? 37  LEU A O    8  
ATOM   8561  C  CB   . LEU A 1 37 ? -1.399  9.944   -4.045  1.00 0.00 ? 37  LEU A CB   8  
ATOM   8562  C  CG   . LEU A 1 37 ? -2.059  9.229   -2.866  1.00 0.00 ? 37  LEU A CG   8  
ATOM   8563  C  CD1  . LEU A 1 37 ? -2.701  7.928   -3.321  1.00 0.00 ? 37  LEU A CD1  8  
ATOM   8564  C  CD2  . LEU A 1 37 ? -1.043  8.968   -1.764  1.00 0.00 ? 37  LEU A CD2  8  
ATOM   8565  H  H    . LEU A 1 37 ? -2.793  11.595  -2.724  1.00 0.00 ? 37  LEU A H    8  
ATOM   8566  H  HA   . LEU A 1 37 ? -0.055  11.409  -3.251  1.00 0.00 ? 37  LEU A HA   8  
ATOM   8567  H  HB2  . LEU A 1 37 ? -2.095  9.933   -4.870  1.00 0.00 ? 37  LEU A HB2  8  
ATOM   8568  H  HB3  . LEU A 1 37 ? -0.513  9.389   -4.316  1.00 0.00 ? 37  LEU A HB3  8  
ATOM   8569  H  HG   . LEU A 1 37 ? -2.838  9.861   -2.460  1.00 0.00 ? 37  LEU A HG   8  
ATOM   8570  H  HD11 . LEU A 1 37 ? -3.166  7.441   -2.478  1.00 0.00 ? 37  LEU A HD11 8  
ATOM   8571  H  HD12 . LEU A 1 37 ? -1.944  7.281   -3.739  1.00 0.00 ? 37  LEU A HD12 8  
ATOM   8572  H  HD13 . LEU A 1 37 ? -3.447  8.139   -4.073  1.00 0.00 ? 37  LEU A HD13 8  
ATOM   8573  H  HD21 . LEU A 1 37 ? -1.486  9.195   -0.805  1.00 0.00 ? 37  LEU A HD21 8  
ATOM   8574  H  HD22 . LEU A 1 37 ? -0.176  9.595   -1.917  1.00 0.00 ? 37  LEU A HD22 8  
ATOM   8575  H  HD23 . LEU A 1 37 ? -0.746  7.930   -1.786  1.00 0.00 ? 37  LEU A HD23 8  
ATOM   8576  N  N    . ARG A 1 38 ? 0.458   12.542  -5.381  1.00 0.00 ? 38  ARG A N    8  
ATOM   8577  C  CA   . ARG A 1 38 ? 0.791   13.235  -6.620  1.00 0.00 ? 38  ARG A CA   8  
ATOM   8578  C  C    . ARG A 1 38 ? 1.831   12.454  -7.418  1.00 0.00 ? 38  ARG A C    8  
ATOM   8579  O  O    . ARG A 1 38 ? 1.853   12.507  -8.648  1.00 0.00 ? 38  ARG A O    8  
ATOM   8580  C  CB   . ARG A 1 38 ? 1.315   14.640  -6.317  1.00 0.00 ? 38  ARG A CB   8  
ATOM   8581  C  CG   . ARG A 1 38 ? 0.612   15.314  -5.151  1.00 0.00 ? 38  ARG A CG   8  
ATOM   8582  C  CD   . ARG A 1 38 ? 1.370   15.108  -3.849  1.00 0.00 ? 38  ARG A CD   8  
ATOM   8583  N  NE   . ARG A 1 38 ? 0.755   15.827  -2.737  1.00 0.00 ? 38  ARG A NE   8  
ATOM   8584  C  CZ   . ARG A 1 38 ? 1.448   16.455  -1.794  1.00 0.00 ? 38  ARG A CZ   8  
ATOM   8585  N  NH1  . ARG A 1 38 ? 2.774   16.453  -1.829  1.00 0.00 ? 38  ARG A NH1  8  
ATOM   8586  N  NH2  . ARG A 1 38 ? 0.816   17.088  -0.814  1.00 0.00 ? 38  ARG A NH2  8  
ATOM   8587  H  H    . ARG A 1 38 ? 1.160   12.393  -4.713  1.00 0.00 ? 38  ARG A H    8  
ATOM   8588  H  HA   . ARG A 1 38 ? -0.111  13.316  -7.208  1.00 0.00 ? 38  ARG A HA   8  
ATOM   8589  H  HB2  . ARG A 1 38 ? 2.368   14.577  -6.087  1.00 0.00 ? 38  ARG A HB2  8  
ATOM   8590  H  HB3  . ARG A 1 38 ? 1.183   15.257  -7.194  1.00 0.00 ? 38  ARG A HB3  8  
ATOM   8591  H  HG2  . ARG A 1 38 ? 0.541   16.374  -5.349  1.00 0.00 ? 38  ARG A HG2  8  
ATOM   8592  H  HG3  . ARG A 1 38 ? -0.379  14.897  -5.050  1.00 0.00 ? 38  ARG A HG3  8  
ATOM   8593  H  HD2  . ARG A 1 38 ? 1.384   14.053  -3.619  1.00 0.00 ? 38  ARG A HD2  8  
ATOM   8594  H  HD3  . ARG A 1 38 ? 2.383   15.461  -3.978  1.00 0.00 ? 38  ARG A HD3  8  
ATOM   8595  H  HE   . ARG A 1 38 ? -0.224  15.842  -2.692  1.00 0.00 ? 38  ARG A HE   8  
ATOM   8596  H  HH11 . ARG A 1 38 ? 3.253   15.978  -2.567  1.00 0.00 ? 38  ARG A HH11 8  
ATOM   8597  H  HH12 . ARG A 1 38 ? 3.294   16.928  -1.118  1.00 0.00 ? 38  ARG A HH12 8  
ATOM   8598  H  HH21 . ARG A 1 38 ? -0.183  17.092  -0.785  1.00 0.00 ? 38  ARG A HH21 8  
ATOM   8599  H  HH22 . ARG A 1 38 ? 1.339   17.560  -0.105  1.00 0.00 ? 38  ARG A HH22 8  
ATOM   8600  N  N    . PHE A 1 39 ? 2.691   11.729  -6.710  1.00 0.00 ? 39  PHE A N    8  
ATOM   8601  C  CA   . PHE A 1 39 ? 3.734   10.938  -7.351  1.00 0.00 ? 39  PHE A CA   8  
ATOM   8602  C  C    . PHE A 1 39 ? 3.311   9.477   -7.473  1.00 0.00 ? 39  PHE A C    8  
ATOM   8603  O  O    . PHE A 1 39 ? 3.357   8.709   -6.512  1.00 0.00 ? 39  PHE A O    8  
ATOM   8604  C  CB   . PHE A 1 39 ? 5.040   11.039  -6.560  1.00 0.00 ? 39  PHE A CB   8  
ATOM   8605  C  CG   . PHE A 1 39 ? 5.390   12.443  -6.158  1.00 0.00 ? 39  PHE A CG   8  
ATOM   8606  C  CD1  . PHE A 1 39 ? 4.726   13.065  -5.113  1.00 0.00 ? 39  PHE A CD1  8  
ATOM   8607  C  CD2  . PHE A 1 39 ? 6.385   13.140  -6.824  1.00 0.00 ? 39  PHE A CD2  8  
ATOM   8608  C  CE1  . PHE A 1 39 ? 5.046   14.357  -4.742  1.00 0.00 ? 39  PHE A CE1  8  
ATOM   8609  C  CE2  . PHE A 1 39 ? 6.710   14.433  -6.457  1.00 0.00 ? 39  PHE A CE2  8  
ATOM   8610  C  CZ   . PHE A 1 39 ? 6.040   15.041  -5.414  1.00 0.00 ? 39  PHE A CZ   8  
ATOM   8611  H  H    . PHE A 1 39 ? 2.623   11.728  -5.732  1.00 0.00 ? 39  PHE A H    8  
ATOM   8612  H  HA   . PHE A 1 39 ? 3.891   11.339  -8.341  1.00 0.00 ? 39  PHE A HA   8  
ATOM   8613  H  HB2  . PHE A 1 39 ? 4.953   10.448  -5.660  1.00 0.00 ? 39  PHE A HB2  8  
ATOM   8614  H  HB3  . PHE A 1 39 ? 5.848   10.653  -7.162  1.00 0.00 ? 39  PHE A HB3  8  
ATOM   8615  H  HD1  . PHE A 1 39 ? 3.949   12.531  -4.586  1.00 0.00 ? 39  PHE A HD1  8  
ATOM   8616  H  HD2  . PHE A 1 39 ? 6.910   12.664  -7.641  1.00 0.00 ? 39  PHE A HD2  8  
ATOM   8617  H  HE1  . PHE A 1 39 ? 4.522   14.831  -3.926  1.00 0.00 ? 39  PHE A HE1  8  
ATOM   8618  H  HE2  . PHE A 1 39 ? 7.488   14.964  -6.985  1.00 0.00 ? 39  PHE A HE2  8  
ATOM   8619  H  HZ   . PHE A 1 39 ? 6.292   16.051  -5.126  1.00 0.00 ? 39  PHE A HZ   8  
ATOM   8620  N  N    . PRO A 1 40 ? 2.889   9.083   -8.684  1.00 0.00 ? 40  PRO A N    8  
ATOM   8621  C  CA   . PRO A 1 40 ? 2.450   7.712   -8.962  1.00 0.00 ? 40  PRO A CA   8  
ATOM   8622  C  C    . PRO A 1 40 ? 3.604   6.716   -8.932  1.00 0.00 ? 40  PRO A C    8  
ATOM   8623  O  O    . PRO A 1 40 ? 4.769   7.103   -8.830  1.00 0.00 ? 40  PRO A O    8  
ATOM   8624  C  CB   . PRO A 1 40 ? 1.862   7.807   -10.372 1.00 0.00 ? 40  PRO A CB   8  
ATOM   8625  C  CG   . PRO A 1 40 ? 2.552   8.972   -10.993 1.00 0.00 ? 40  PRO A CG   8  
ATOM   8626  C  CD   . PRO A 1 40 ? 2.809   9.945   -9.875  1.00 0.00 ? 40  PRO A CD   8  
ATOM   8627  H  HA   . PRO A 1 40 ? 1.683   7.394   -8.271  1.00 0.00 ? 40  PRO A HA   8  
ATOM   8628  H  HB2  . PRO A 1 40 ? 2.065   6.893   -10.911 1.00 0.00 ? 40  PRO A HB2  8  
ATOM   8629  H  HB3  . PRO A 1 40 ? 0.795   7.967   -10.311 1.00 0.00 ? 40  PRO A HB3  8  
ATOM   8630  H  HG2  . PRO A 1 40 ? 3.484   8.654   -11.434 1.00 0.00 ? 40  PRO A HG2  8  
ATOM   8631  H  HG3  . PRO A 1 40 ? 1.914   9.421   -11.740 1.00 0.00 ? 40  PRO A HG3  8  
ATOM   8632  H  HD2  . PRO A 1 40 ? 3.740   10.468  -10.036 1.00 0.00 ? 40  PRO A HD2  8  
ATOM   8633  H  HD3  . PRO A 1 40 ? 1.991   10.645  -9.789  1.00 0.00 ? 40  PRO A HD3  8  
ATOM   8634  N  N    . CYS A 1 41 ? 3.274   5.432   -9.021  1.00 0.00 ? 41  CYS A N    8  
ATOM   8635  C  CA   . CYS A 1 41 ? 4.282   4.380   -9.005  1.00 0.00 ? 41  CYS A CA   8  
ATOM   8636  C  C    . CYS A 1 41 ? 4.449   3.765   -10.391 1.00 0.00 ? 41  CYS A C    8  
ATOM   8637  O  O    . CYS A 1 41 ? 3.599   3.002   -10.848 1.00 0.00 ? 41  CYS A O    8  
ATOM   8638  C  CB   . CYS A 1 41 ? 3.901   3.295   -7.996  1.00 0.00 ? 41  CYS A CB   8  
ATOM   8639  S  SG   . CYS A 1 41 ? 5.238   2.111   -7.635  1.00 0.00 ? 41  CYS A SG   8  
ATOM   8640  H  H    . CYS A 1 41 ? 2.327   5.186   -9.100  1.00 0.00 ? 41  CYS A H    8  
ATOM   8641  H  HA   . CYS A 1 41 ? 5.220   4.823   -8.706  1.00 0.00 ? 41  CYS A HA   8  
ATOM   8642  H  HB2  . CYS A 1 41 ? 3.618   3.764   -7.064  1.00 0.00 ? 41  CYS A HB2  8  
ATOM   8643  H  HB3  . CYS A 1 41 ? 3.060   2.736   -8.380  1.00 0.00 ? 41  CYS A HB3  8  
ATOM   8644  N  N    . GLU A 1 42 ? 5.551   4.102   -11.053 1.00 0.00 ? 42  GLU A N    8  
ATOM   8645  C  CA   . GLU A 1 42 ? 5.829   3.584   -12.387 1.00 0.00 ? 42  GLU A CA   8  
ATOM   8646  C  C    . GLU A 1 42 ? 6.059   2.075   -12.348 1.00 0.00 ? 42  GLU A C    8  
ATOM   8647  O  O    . GLU A 1 42 ? 6.269   1.441   -13.381 1.00 0.00 ? 42  GLU A O    8  
ATOM   8648  C  CB   . GLU A 1 42 ? 7.053   4.281   -12.985 1.00 0.00 ? 42  GLU A CB   8  
ATOM   8649  C  CG   . GLU A 1 42 ? 8.362   3.890   -12.320 1.00 0.00 ? 42  GLU A CG   8  
ATOM   8650  C  CD   . GLU A 1 42 ? 9.561   4.098   -13.225 1.00 0.00 ? 42  GLU A CD   8  
ATOM   8651  O  OE1  . GLU A 1 42 ? 9.687   5.199   -13.801 1.00 0.00 ? 42  GLU A OE1  8  
ATOM   8652  O  OE2  . GLU A 1 42 ? 10.374  3.159   -13.357 1.00 0.00 ? 42  GLU A OE2  8  
ATOM   8653  H  H    . GLU A 1 42 ? 6.192   4.715   -10.635 1.00 0.00 ? 42  GLU A H    8  
ATOM   8654  H  HA   . GLU A 1 42 ? 4.971   3.789   -13.008 1.00 0.00 ? 42  GLU A HA   8  
ATOM   8655  H  HB2  . GLU A 1 42 ? 7.117   4.033   -14.035 1.00 0.00 ? 42  GLU A HB2  8  
ATOM   8656  H  HB3  . GLU A 1 42 ? 6.928   5.349   -12.885 1.00 0.00 ? 42  GLU A HB3  8  
ATOM   8657  H  HG2  . GLU A 1 42 ? 8.493   4.489   -11.432 1.00 0.00 ? 42  GLU A HG2  8  
ATOM   8658  H  HG3  . GLU A 1 42 ? 8.314   2.846   -12.046 1.00 0.00 ? 42  GLU A HG3  8  
ATOM   8659  N  N    . PHE A 1 43 ? 6.017   1.508   -11.147 1.00 0.00 ? 43  PHE A N    8  
ATOM   8660  C  CA   . PHE A 1 43 ? 6.221   0.075   -10.971 1.00 0.00 ? 43  PHE A CA   8  
ATOM   8661  C  C    . PHE A 1 43 ? 4.894   -0.675  -11.030 1.00 0.00 ? 43  PHE A C    8  
ATOM   8662  O  O    . PHE A 1 43 ? 4.745   -1.639  -11.782 1.00 0.00 ? 43  PHE A O    8  
ATOM   8663  C  CB   . PHE A 1 43 ? 6.918   -0.202  -9.637  1.00 0.00 ? 43  PHE A CB   8  
ATOM   8664  C  CG   . PHE A 1 43 ? 8.415   -0.257  -9.742  1.00 0.00 ? 43  PHE A CG   8  
ATOM   8665  C  CD1  . PHE A 1 43 ? 9.047   -1.387  -10.235 1.00 0.00 ? 43  PHE A CD1  8  
ATOM   8666  C  CD2  . PHE A 1 43 ? 9.190   0.822   -9.348  1.00 0.00 ? 43  PHE A CD2  8  
ATOM   8667  C  CE1  . PHE A 1 43 ? 10.425  -1.441  -10.333 1.00 0.00 ? 43  PHE A CE1  8  
ATOM   8668  C  CE2  . PHE A 1 43 ? 10.568  0.774   -9.445  1.00 0.00 ? 43  PHE A CE2  8  
ATOM   8669  C  CZ   . PHE A 1 43 ? 11.186  -0.359  -9.937  1.00 0.00 ? 43  PHE A CZ   8  
ATOM   8670  H  H    . PHE A 1 43 ? 5.845   2.067   -10.360 1.00 0.00 ? 43  PHE A H    8  
ATOM   8671  H  HA   . PHE A 1 43 ? 6.852   -0.270  -11.775 1.00 0.00 ? 43  PHE A HA   8  
ATOM   8672  H  HB2  . PHE A 1 43 ? 6.663   0.579   -8.937  1.00 0.00 ? 43  PHE A HB2  8  
ATOM   8673  H  HB3  . PHE A 1 43 ? 6.576   -1.151  -9.251  1.00 0.00 ? 43  PHE A HB3  8  
ATOM   8674  H  HD1  . PHE A 1 43 ? 8.452   -2.235  -10.545 1.00 0.00 ? 43  PHE A HD1  8  
ATOM   8675  H  HD2  . PHE A 1 43 ? 8.709   1.708   -8.962  1.00 0.00 ? 43  PHE A HD2  8  
ATOM   8676  H  HE1  . PHE A 1 43 ? 10.905  -2.328  -10.718 1.00 0.00 ? 43  PHE A HE1  8  
ATOM   8677  H  HE2  . PHE A 1 43 ? 11.161  1.621   -9.134  1.00 0.00 ? 43  PHE A HE2  8  
ATOM   8678  H  HZ   . PHE A 1 43 ? 12.263  -0.398  -10.014 1.00 0.00 ? 43  PHE A HZ   8  
ATOM   8679  N  N    . CYS A 1 44 ? 3.932   -0.227  -10.230 1.00 0.00 ? 44  CYS A N    8  
ATOM   8680  C  CA   . CYS A 1 44 ? 2.617   -0.855  -10.189 1.00 0.00 ? 44  CYS A CA   8  
ATOM   8681  C  C    . CYS A 1 44 ? 1.532   0.126   -10.626 1.00 0.00 ? 44  CYS A C    8  
ATOM   8682  O  O    . CYS A 1 44 ? 0.560   -0.256  -11.276 1.00 0.00 ? 44  CYS A O    8  
ATOM   8683  C  CB   . CYS A 1 44 ? 2.318   -1.369  -8.780  1.00 0.00 ? 44  CYS A CB   8  
ATOM   8684  S  SG   . CYS A 1 44 ? 2.332   -0.076  -7.498  1.00 0.00 ? 44  CYS A SG   8  
ATOM   8685  H  H    . CYS A 1 44 ? 4.111   0.545   -9.653  1.00 0.00 ? 44  CYS A H    8  
ATOM   8686  H  HA   . CYS A 1 44 ? 2.626   -1.690  -10.873 1.00 0.00 ? 44  CYS A HA   8  
ATOM   8687  H  HB2  . CYS A 1 44 ? 1.339   -1.827  -8.772  1.00 0.00 ? 44  CYS A HB2  8  
ATOM   8688  H  HB3  . CYS A 1 44 ? 3.057   -2.109  -8.510  1.00 0.00 ? 44  CYS A HB3  8  
ATOM   8689  N  N    . GLY A 1 45 ? 1.707   1.393   -10.262 1.00 0.00 ? 45  GLY A N    8  
ATOM   8690  C  CA   . GLY A 1 45 ? 0.736   2.409   -10.624 1.00 0.00 ? 45  GLY A CA   8  
ATOM   8691  C  C    . GLY A 1 45 ? 0.218   3.172   -9.421  1.00 0.00 ? 45  GLY A C    8  
ATOM   8692  O  O    . GLY A 1 45 ? -0.474  4.180   -9.565  1.00 0.00 ? 45  GLY A O    8  
ATOM   8693  H  H    . GLY A 1 45 ? 2.501   1.640   -9.744  1.00 0.00 ? 45  GLY A H    8  
ATOM   8694  H  HA2  . GLY A 1 45 ? 1.198   3.106   -11.308 1.00 0.00 ? 45  GLY A HA2  8  
ATOM   8695  H  HA3  . GLY A 1 45 ? -0.098  1.934   -11.120 1.00 0.00 ? 45  GLY A HA3  8  
ATOM   8696  N  N    . LYS A 1 46 ? 0.552   2.689   -8.229  1.00 0.00 ? 46  LYS A N    8  
ATOM   8697  C  CA   . LYS A 1 46 ? 0.117   3.331   -6.994  1.00 0.00 ? 46  LYS A CA   8  
ATOM   8698  C  C    . LYS A 1 46 ? 0.477   4.814   -6.995  1.00 0.00 ? 46  LYS A C    8  
ATOM   8699  O  O    . LYS A 1 46 ? 1.048   5.322   -7.959  1.00 0.00 ? 46  LYS A O    8  
ATOM   8700  C  CB   . LYS A 1 46 ? 0.753   2.642   -5.785  1.00 0.00 ? 46  LYS A CB   8  
ATOM   8701  C  CG   . LYS A 1 46 ? -0.045  1.456   -5.271  1.00 0.00 ? 46  LYS A CG   8  
ATOM   8702  C  CD   . LYS A 1 46 ? 0.611   0.828   -4.053  1.00 0.00 ? 46  LYS A CD   8  
ATOM   8703  C  CE   . LYS A 1 46 ? 0.146   1.492   -2.766  1.00 0.00 ? 46  LYS A CE   8  
ATOM   8704  N  NZ   . LYS A 1 46 ? -1.233  1.071   -2.392  1.00 0.00 ? 46  LYS A NZ   8  
ATOM   8705  H  H    . LYS A 1 46 ? 1.106   1.882   -8.178  1.00 0.00 ? 46  LYS A H    8  
ATOM   8706  H  HA   . LYS A 1 46 ? -0.956  3.234   -6.930  1.00 0.00 ? 46  LYS A HA   8  
ATOM   8707  H  HB2  . LYS A 1 46 ? 1.738   2.295   -6.060  1.00 0.00 ? 46  LYS A HB2  8  
ATOM   8708  H  HB3  . LYS A 1 46 ? 0.846   3.361   -4.983  1.00 0.00 ? 46  LYS A HB3  8  
ATOM   8709  H  HG2  . LYS A 1 46 ? -1.036  1.790   -5.001  1.00 0.00 ? 46  LYS A HG2  8  
ATOM   8710  H  HG3  . LYS A 1 46 ? -0.114  0.714   -6.054  1.00 0.00 ? 46  LYS A HG3  8  
ATOM   8711  H  HD2  . LYS A 1 46 ? 0.355   -0.220  -4.017  1.00 0.00 ? 46  LYS A HD2  8  
ATOM   8712  H  HD3  . LYS A 1 46 ? 1.683   0.936   -4.136  1.00 0.00 ? 46  LYS A HD3  8  
ATOM   8713  H  HE2  . LYS A 1 46 ? 0.824   1.220   -1.971  1.00 0.00 ? 46  LYS A HE2  8  
ATOM   8714  H  HE3  . LYS A 1 46 ? 0.162   2.563   -2.902  1.00 0.00 ? 46  LYS A HE3  8  
ATOM   8715  H  HZ1  . LYS A 1 46 ? -1.684  1.804   -1.808  1.00 0.00 ? 46  LYS A HZ1  8  
ATOM   8716  H  HZ2  . LYS A 1 46 ? -1.201  0.184   -1.850  1.00 0.00 ? 46  LYS A HZ2  8  
ATOM   8717  H  HZ3  . LYS A 1 46 ? -1.806  0.922   -3.247  1.00 0.00 ? 46  LYS A HZ3  8  
ATOM   8718  N  N    . ARG A 1 47 ? 0.141   5.500   -5.908  1.00 0.00 ? 47  ARG A N    8  
ATOM   8719  C  CA   . ARG A 1 47 ? 0.429   6.924   -5.784  1.00 0.00 ? 47  ARG A CA   8  
ATOM   8720  C  C    . ARG A 1 47 ? 0.735   7.293   -4.335  1.00 0.00 ? 47  ARG A C    8  
ATOM   8721  O  O    . ARG A 1 47 ? 0.140   6.746   -3.406  1.00 0.00 ? 47  ARG A O    8  
ATOM   8722  C  CB   . ARG A 1 47 ? -0.752  7.752   -6.294  1.00 0.00 ? 47  ARG A CB   8  
ATOM   8723  C  CG   . ARG A 1 47 ? -1.090  7.495   -7.754  1.00 0.00 ? 47  ARG A CG   8  
ATOM   8724  C  CD   . ARG A 1 47 ? -2.345  8.243   -8.174  1.00 0.00 ? 47  ARG A CD   8  
ATOM   8725  N  NE   . ARG A 1 47 ? -2.325  8.592   -9.593  1.00 0.00 ? 47  ARG A NE   8  
ATOM   8726  C  CZ   . ARG A 1 47 ? -1.619  9.599   -10.092 1.00 0.00 ? 47  ARG A CZ   8  
ATOM   8727  N  NH1  . ARG A 1 47 ? -0.878  10.354  -9.293  1.00 0.00 ? 47  ARG A NH1  8  
ATOM   8728  N  NH2  . ARG A 1 47 ? -1.652  9.853   -11.394 1.00 0.00 ? 47  ARG A NH2  8  
ATOM   8729  H  H    . ARG A 1 47 ? -0.313  5.039   -5.172  1.00 0.00 ? 47  ARG A H    8  
ATOM   8730  H  HA   . ARG A 1 47 ? 1.297   7.141   -6.389  1.00 0.00 ? 47  ARG A HA   8  
ATOM   8731  H  HB2  . ARG A 1 47 ? -1.623  7.519   -5.699  1.00 0.00 ? 47  ARG A HB2  8  
ATOM   8732  H  HB3  . ARG A 1 47 ? -0.517  8.799   -6.181  1.00 0.00 ? 47  ARG A HB3  8  
ATOM   8733  H  HG2  . ARG A 1 47 ? -0.266  7.824   -8.368  1.00 0.00 ? 47  ARG A HG2  8  
ATOM   8734  H  HG3  . ARG A 1 47 ? -1.248  6.436   -7.896  1.00 0.00 ? 47  ARG A HG3  8  
ATOM   8735  H  HD2  . ARG A 1 47 ? -3.204  7.618   -7.979  1.00 0.00 ? 47  ARG A HD2  8  
ATOM   8736  H  HD3  . ARG A 1 47 ? -2.420  9.149   -7.592  1.00 0.00 ? 47  ARG A HD3  8  
ATOM   8737  H  HE   . ARG A 1 47 ? -2.866  8.047   -10.201 1.00 0.00 ? 47  ARG A HE   8  
ATOM   8738  H  HH11 . ARG A 1 47 ? -0.850  10.165  -8.311  1.00 0.00 ? 47  ARG A HH11 8  
ATOM   8739  H  HH12 . ARG A 1 47 ? -0.346  11.112  -9.672  1.00 0.00 ? 47  ARG A HH12 8  
ATOM   8740  H  HH21 . ARG A 1 47 ? -2.209  9.286   -12.000 1.00 0.00 ? 47  ARG A HH21 8  
ATOM   8741  H  HH22 . ARG A 1 47 ? -1.120  10.612  -11.769 1.00 0.00 ? 47  ARG A HH22 8  
ATOM   8742  N  N    . PHE A 1 48 ? 1.665   8.223   -4.151  1.00 0.00 ? 48  PHE A N    8  
ATOM   8743  C  CA   . PHE A 1 48 ? 2.051   8.664   -2.815  1.00 0.00 ? 48  PHE A CA   8  
ATOM   8744  C  C    . PHE A 1 48 ? 2.081   10.188  -2.733  1.00 0.00 ? 48  PHE A C    8  
ATOM   8745  O  O    . PHE A 1 48 ? 2.416   10.865  -3.705  1.00 0.00 ? 48  PHE A O    8  
ATOM   8746  C  CB   . PHE A 1 48 ? 3.422   8.095   -2.443  1.00 0.00 ? 48  PHE A CB   8  
ATOM   8747  C  CG   . PHE A 1 48 ? 3.473   6.594   -2.464  1.00 0.00 ? 48  PHE A CG   8  
ATOM   8748  C  CD1  . PHE A 1 48 ? 3.301   5.898   -3.650  1.00 0.00 ? 48  PHE A CD1  8  
ATOM   8749  C  CD2  . PHE A 1 48 ? 3.694   5.879   -1.298  1.00 0.00 ? 48  PHE A CD2  8  
ATOM   8750  C  CE1  . PHE A 1 48 ? 3.348   4.517   -3.672  1.00 0.00 ? 48  PHE A CE1  8  
ATOM   8751  C  CE2  . PHE A 1 48 ? 3.741   4.497   -1.314  1.00 0.00 ? 48  PHE A CE2  8  
ATOM   8752  C  CZ   . PHE A 1 48 ? 3.569   3.816   -2.503  1.00 0.00 ? 48  PHE A CZ   8  
ATOM   8753  H  H    . PHE A 1 48 ? 2.104   8.622   -4.931  1.00 0.00 ? 48  PHE A H    8  
ATOM   8754  H  HA   . PHE A 1 48 ? 1.315   8.293   -2.119  1.00 0.00 ? 48  PHE A HA   8  
ATOM   8755  H  HB2  . PHE A 1 48 ? 4.158   8.461   -3.142  1.00 0.00 ? 48  PHE A HB2  8  
ATOM   8756  H  HB3  . PHE A 1 48 ? 3.681   8.423   -1.448  1.00 0.00 ? 48  PHE A HB3  8  
ATOM   8757  H  HD1  . PHE A 1 48 ? 3.129   6.445   -4.566  1.00 0.00 ? 48  PHE A HD1  8  
ATOM   8758  H  HD2  . PHE A 1 48 ? 3.829   6.411   -0.367  1.00 0.00 ? 48  PHE A HD2  8  
ATOM   8759  H  HE1  . PHE A 1 48 ? 3.213   3.987   -4.603  1.00 0.00 ? 48  PHE A HE1  8  
ATOM   8760  H  HE2  . PHE A 1 48 ? 3.915   3.952   -0.398  1.00 0.00 ? 48  PHE A HE2  8  
ATOM   8761  H  HZ   . PHE A 1 48 ? 3.605   2.737   -2.518  1.00 0.00 ? 48  PHE A HZ   8  
ATOM   8762  N  N    . GLU A 1 49 ? 1.729   10.719  -1.567  1.00 0.00 ? 49  GLU A N    8  
ATOM   8763  C  CA   . GLU A 1 49 ? 1.714   12.162  -1.358  1.00 0.00 ? 49  GLU A CA   8  
ATOM   8764  C  C    . GLU A 1 49 ? 3.069   12.775  -1.700  1.00 0.00 ? 49  GLU A C    8  
ATOM   8765  O  O    . GLU A 1 49 ? 3.173   13.972  -1.967  1.00 0.00 ? 49  GLU A O    8  
ATOM   8766  C  CB   . GLU A 1 49 ? 1.347   12.486  0.091   1.00 0.00 ? 49  GLU A CB   8  
ATOM   8767  C  CG   . GLU A 1 49 ? 2.038   11.594  1.109   1.00 0.00 ? 49  GLU A CG   8  
ATOM   8768  C  CD   . GLU A 1 49 ? 2.289   12.299  2.427   1.00 0.00 ? 49  GLU A CD   8  
ATOM   8769  O  OE1  . GLU A 1 49 ? 1.401   13.053  2.877   1.00 0.00 ? 49  GLU A OE1  8  
ATOM   8770  O  OE2  . GLU A 1 49 ? 3.376   12.097  3.010   1.00 0.00 ? 49  GLU A OE2  8  
ATOM   8771  H  H    . GLU A 1 49 ? 1.472   10.126  -0.829  1.00 0.00 ? 49  GLU A H    8  
ATOM   8772  H  HA   . GLU A 1 49 ? 0.967   12.584  -2.012  1.00 0.00 ? 49  GLU A HA   8  
ATOM   8773  H  HB2  . GLU A 1 49 ? 1.618   13.511  0.298   1.00 0.00 ? 49  GLU A HB2  8  
ATOM   8774  H  HB3  . GLU A 1 49 ? 0.279   12.375  0.213   1.00 0.00 ? 49  GLU A HB3  8  
ATOM   8775  H  HG2  . GLU A 1 49 ? 1.416   10.731  1.293   1.00 0.00 ? 49  GLU A HG2  8  
ATOM   8776  H  HG3  . GLU A 1 49 ? 2.985   11.273  0.702   1.00 0.00 ? 49  GLU A HG3  8  
ATOM   8777  N  N    . LYS A 1 50 ? 4.107   11.945  -1.690  1.00 0.00 ? 50  LYS A N    8  
ATOM   8778  C  CA   . LYS A 1 50 ? 5.456   12.402  -2.000  1.00 0.00 ? 50  LYS A CA   8  
ATOM   8779  C  C    . LYS A 1 50 ? 6.295   11.269  -2.582  1.00 0.00 ? 50  LYS A C    8  
ATOM   8780  O  O    . LYS A 1 50 ? 5.957   10.091  -2.464  1.00 0.00 ? 50  LYS A O    8  
ATOM   8781  C  CB   . LYS A 1 50 ? 6.130   12.956  -0.742  1.00 0.00 ? 50  LYS A CB   8  
ATOM   8782  C  CG   . LYS A 1 50 ? 5.606   12.347  0.547   1.00 0.00 ? 50  LYS A CG   8  
ATOM   8783  C  CD   . LYS A 1 50 ? 6.376   12.853  1.755   1.00 0.00 ? 50  LYS A CD   8  
ATOM   8784  C  CE   . LYS A 1 50 ? 6.403   11.819  2.871   1.00 0.00 ? 50  LYS A CE   8  
ATOM   8785  N  NZ   . LYS A 1 50 ? 7.598   11.979  3.745   1.00 0.00 ? 50  LYS A NZ   8  
ATOM   8786  H  H    . LYS A 1 50 ? 3.961   11.000  -1.470  1.00 0.00 ? 50  LYS A H    8  
ATOM   8787  H  HA   . LYS A 1 50 ? 5.379   13.190  -2.733  1.00 0.00 ? 50  LYS A HA   8  
ATOM   8788  H  HB2  . LYS A 1 50 ? 7.191   12.762  -0.802  1.00 0.00 ? 50  LYS A HB2  8  
ATOM   8789  H  HB3  . LYS A 1 50 ? 5.969   14.024  -0.703  1.00 0.00 ? 50  LYS A HB3  8  
ATOM   8790  H  HG2  . LYS A 1 50 ? 4.565   12.610  0.661   1.00 0.00 ? 50  LYS A HG2  8  
ATOM   8791  H  HG3  . LYS A 1 50 ? 5.704   11.272  0.493   1.00 0.00 ? 50  LYS A HG3  8  
ATOM   8792  H  HD2  . LYS A 1 50 ? 7.390   13.073  1.459   1.00 0.00 ? 50  LYS A HD2  8  
ATOM   8793  H  HD3  . LYS A 1 50 ? 5.902   13.753  2.122   1.00 0.00 ? 50  LYS A HD3  8  
ATOM   8794  H  HE2  . LYS A 1 50 ? 5.512   11.930  3.469   1.00 0.00 ? 50  LYS A HE2  8  
ATOM   8795  H  HE3  . LYS A 1 50 ? 6.420   10.833  2.430   1.00 0.00 ? 50  LYS A HE3  8  
ATOM   8796  H  HZ1  . LYS A 1 50 ? 8.468   11.884  3.183   1.00 0.00 ? 50  LYS A HZ1  8  
ATOM   8797  H  HZ2  . LYS A 1 50 ? 7.598   11.250  4.487   1.00 0.00 ? 50  LYS A HZ2  8  
ATOM   8798  H  HZ3  . LYS A 1 50 ? 7.589   12.916  4.195   1.00 0.00 ? 50  LYS A HZ3  8  
ATOM   8799  N  N    . PRO A 1 51 ? 7.416   11.630  -3.223  1.00 0.00 ? 51  PRO A N    8  
ATOM   8800  C  CA   . PRO A 1 51 ? 8.327   10.658  -3.834  1.00 0.00 ? 51  PRO A CA   8  
ATOM   8801  C  C    . PRO A 1 51 ? 9.073   9.829   -2.794  1.00 0.00 ? 51  PRO A C    8  
ATOM   8802  O  O    . PRO A 1 51 ? 9.206   8.613   -2.934  1.00 0.00 ? 51  PRO A O    8  
ATOM   8803  C  CB   . PRO A 1 51 ? 9.305   11.533  -4.621  1.00 0.00 ? 51  PRO A CB   8  
ATOM   8804  C  CG   . PRO A 1 51 ? 9.281   12.849  -3.923  1.00 0.00 ? 51  PRO A CG   8  
ATOM   8805  C  CD   . PRO A 1 51 ? 7.881   13.016  -3.401  1.00 0.00 ? 51  PRO A CD   8  
ATOM   8806  H  HA   . PRO A 1 51 ? 7.806   9.998   -4.512  1.00 0.00 ? 51  PRO A HA   8  
ATOM   8807  H  HB2  . PRO A 1 51 ? 10.290  11.089  -4.596  1.00 0.00 ? 51  PRO A HB2  8  
ATOM   8808  H  HB3  . PRO A 1 51 ? 8.971   11.623  -5.644  1.00 0.00 ? 51  PRO A HB3  8  
ATOM   8809  H  HG2  . PRO A 1 51 ? 9.988   12.845  -3.107  1.00 0.00 ? 51  PRO A HG2  8  
ATOM   8810  H  HG3  . PRO A 1 51 ? 9.517   13.639  -4.621  1.00 0.00 ? 51  PRO A HG3  8  
ATOM   8811  H  HD2  . PRO A 1 51 ? 7.890   13.544  -2.459  1.00 0.00 ? 51  PRO A HD2  8  
ATOM   8812  H  HD3  . PRO A 1 51 ? 7.269   13.537  -4.122  1.00 0.00 ? 51  PRO A HD3  8  
ATOM   8813  N  N    . ASP A 1 52 ? 9.557   10.494  -1.751  1.00 0.00 ? 52  ASP A N    8  
ATOM   8814  C  CA   . ASP A 1 52 ? 10.288  9.818   -0.685  1.00 0.00 ? 52  ASP A CA   8  
ATOM   8815  C  C    . ASP A 1 52 ? 9.621   8.495   -0.322  1.00 0.00 ? 52  ASP A C    8  
ATOM   8816  O  O    . ASP A 1 52 ? 10.296  7.497   -0.069  1.00 0.00 ? 52  ASP A O    8  
ATOM   8817  C  CB   . ASP A 1 52 ? 10.376  10.715  0.551   1.00 0.00 ? 52  ASP A CB   8  
ATOM   8818  C  CG   . ASP A 1 52 ? 11.406  10.226  1.549   1.00 0.00 ? 52  ASP A CG   8  
ATOM   8819  O  OD1  . ASP A 1 52 ? 11.269  9.081   2.029   1.00 0.00 ? 52  ASP A OD1  8  
ATOM   8820  O  OD2  . ASP A 1 52 ? 12.349  10.987  1.852   1.00 0.00 ? 52  ASP A OD2  8  
ATOM   8821  H  H    . ASP A 1 52 ? 9.418   11.463  -1.695  1.00 0.00 ? 52  ASP A H    8  
ATOM   8822  H  HA   . ASP A 1 52 ? 11.286  9.617   -1.044  1.00 0.00 ? 52  ASP A HA   8  
ATOM   8823  H  HB2  . ASP A 1 52 ? 10.647  11.715  0.244   1.00 0.00 ? 52  ASP A HB2  8  
ATOM   8824  H  HB3  . ASP A 1 52 ? 9.412   10.741  1.038   1.00 0.00 ? 52  ASP A HB3  8  
ATOM   8825  N  N    . SER A 1 53 ? 8.292   8.495   -0.299  1.00 0.00 ? 53  SER A N    8  
ATOM   8826  C  CA   . SER A 1 53 ? 7.533   7.297   0.037   1.00 0.00 ? 53  SER A CA   8  
ATOM   8827  C  C    . SER A 1 53 ? 7.438   6.359   -1.162  1.00 0.00 ? 53  SER A C    8  
ATOM   8828  O  O    . SER A 1 53 ? 7.308   5.145   -1.007  1.00 0.00 ? 53  SER A O    8  
ATOM   8829  C  CB   . SER A 1 53 ? 6.130   7.673   0.517   1.00 0.00 ? 53  SER A CB   8  
ATOM   8830  O  OG   . SER A 1 53 ? 6.172   8.255   1.808   1.00 0.00 ? 53  SER A OG   8  
ATOM   8831  H  H    . SER A 1 53 ? 7.810   9.323   -0.511  1.00 0.00 ? 53  SER A H    8  
ATOM   8832  H  HA   . SER A 1 53 ? 8.053   6.789   0.836   1.00 0.00 ? 53  SER A HA   8  
ATOM   8833  H  HB2  . SER A 1 53 ? 5.696   8.383   -0.171  1.00 0.00 ? 53  SER A HB2  8  
ATOM   8834  H  HB3  . SER A 1 53 ? 5.515   6.786   0.555   1.00 0.00 ? 53  SER A HB3  8  
ATOM   8835  H  HG   . SER A 1 53 ? 7.003   8.032   2.234   1.00 0.00 ? 53  SER A HG   8  
ATOM   8836  N  N    . VAL A 1 54 ? 7.504   6.932   -2.360  1.00 0.00 ? 54  VAL A N    8  
ATOM   8837  C  CA   . VAL A 1 54 ? 7.427   6.150   -3.588  1.00 0.00 ? 54  VAL A CA   8  
ATOM   8838  C  C    . VAL A 1 54 ? 8.698   5.337   -3.802  1.00 0.00 ? 54  VAL A C    8  
ATOM   8839  O  O    . VAL A 1 54 ? 8.660   4.240   -4.358  1.00 0.00 ? 54  VAL A O    8  
ATOM   8840  C  CB   . VAL A 1 54 ? 7.193   7.051   -4.814  1.00 0.00 ? 54  VAL A CB   8  
ATOM   8841  C  CG1  . VAL A 1 54 ? 7.911   6.491   -6.033  1.00 0.00 ? 54  VAL A CG1  8  
ATOM   8842  C  CG2  . VAL A 1 54 ? 5.704   7.205   -5.086  1.00 0.00 ? 54  VAL A CG2  8  
ATOM   8843  H  H    . VAL A 1 54 ? 7.608   7.905   -2.419  1.00 0.00 ? 54  VAL A H    8  
ATOM   8844  H  HA   . VAL A 1 54 ? 6.589   5.473   -3.500  1.00 0.00 ? 54  VAL A HA   8  
ATOM   8845  H  HB   . VAL A 1 54 ? 7.602   8.028   -4.601  1.00 0.00 ? 54  VAL A HB   8  
ATOM   8846  H  HG11 . VAL A 1 54 ? 7.535   5.502   -6.249  1.00 0.00 ? 54  VAL A HG11 8  
ATOM   8847  H  HG12 . VAL A 1 54 ? 7.738   7.137   -6.882  1.00 0.00 ? 54  VAL A HG12 8  
ATOM   8848  H  HG13 . VAL A 1 54 ? 8.971   6.437   -5.832  1.00 0.00 ? 54  VAL A HG13 8  
ATOM   8849  H  HG21 . VAL A 1 54 ? 5.156   7.084   -4.164  1.00 0.00 ? 54  VAL A HG21 8  
ATOM   8850  H  HG22 . VAL A 1 54 ? 5.512   8.187   -5.493  1.00 0.00 ? 54  VAL A HG22 8  
ATOM   8851  H  HG23 . VAL A 1 54 ? 5.388   6.454   -5.795  1.00 0.00 ? 54  VAL A HG23 8  
ATOM   8852  N  N    . ALA A 1 55 ? 9.825   5.883   -3.357  1.00 0.00 ? 55  ALA A N    8  
ATOM   8853  C  CA   . ALA A 1 55 ? 11.109  5.208   -3.498  1.00 0.00 ? 55  ALA A CA   8  
ATOM   8854  C  C    . ALA A 1 55 ? 11.222  4.035   -2.531  1.00 0.00 ? 55  ALA A C    8  
ATOM   8855  O  O    . ALA A 1 55 ? 11.778  2.990   -2.870  1.00 0.00 ? 55  ALA A O    8  
ATOM   8856  C  CB   . ALA A 1 55 ? 12.250  6.191   -3.274  1.00 0.00 ? 55  ALA A CB   8  
ATOM   8857  H  H    . ALA A 1 55 ? 9.792   6.761   -2.923  1.00 0.00 ? 55  ALA A H    8  
ATOM   8858  H  HA   . ALA A 1 55 ? 11.181  4.836   -4.510  1.00 0.00 ? 55  ALA A HA   8  
ATOM   8859  H  HB1  . ALA A 1 55 ? 13.068  5.684   -2.783  1.00 0.00 ? 55  ALA A HB1  8  
ATOM   8860  H  HB2  . ALA A 1 55 ? 12.583  6.578   -4.225  1.00 0.00 ? 55  ALA A HB2  8  
ATOM   8861  H  HB3  . ALA A 1 55 ? 11.906  7.005   -2.654  1.00 0.00 ? 55  ALA A HB3  8  
ATOM   8862  N  N    . ALA A 1 56 ? 10.691  4.214   -1.326  1.00 0.00 ? 56  ALA A N    8  
ATOM   8863  C  CA   . ALA A 1 56 ? 10.731  3.170   -0.310  1.00 0.00 ? 56  ALA A CA   8  
ATOM   8864  C  C    . ALA A 1 56 ? 9.751   2.048   -0.638  1.00 0.00 ? 56  ALA A C    8  
ATOM   8865  O  O    . ALA A 1 56 ? 10.051  0.870   -0.439  1.00 0.00 ? 56  ALA A O    8  
ATOM   8866  C  CB   . ALA A 1 56 ? 10.426  3.754   1.061   1.00 0.00 ? 56  ALA A CB   8  
ATOM   8867  H  H    . ALA A 1 56 ? 10.261  5.069   -1.116  1.00 0.00 ? 56  ALA A H    8  
ATOM   8868  H  HA   . ALA A 1 56 ? 11.732  2.764   -0.288  1.00 0.00 ? 56  ALA A HA   8  
ATOM   8869  H  HB1  . ALA A 1 56 ? 10.191  2.955   1.748   1.00 0.00 ? 56  ALA A HB1  8  
ATOM   8870  H  HB2  . ALA A 1 56 ? 11.288  4.297   1.420   1.00 0.00 ? 56  ALA A HB2  8  
ATOM   8871  H  HB3  . ALA A 1 56 ? 9.584   4.425   0.987   1.00 0.00 ? 56  ALA A HB3  8  
ATOM   8872  N  N    . HIS A 1 57 ? 8.579   2.420   -1.141  1.00 0.00 ? 57  HIS A N    8  
ATOM   8873  C  CA   . HIS A 1 57 ? 7.554   1.444   -1.496  1.00 0.00 ? 57  HIS A CA   8  
ATOM   8874  C  C    . HIS A 1 57 ? 8.097   0.426   -2.495  1.00 0.00 ? 57  HIS A C    8  
ATOM   8875  O  O    . HIS A 1 57 ? 7.722   -0.746  -2.466  1.00 0.00 ? 57  HIS A O    8  
ATOM   8876  C  CB   . HIS A 1 57 ? 6.331   2.149   -2.083  1.00 0.00 ? 57  HIS A CB   8  
ATOM   8877  C  CG   . HIS A 1 57 ? 5.536   1.290   -3.018  1.00 0.00 ? 57  HIS A CG   8  
ATOM   8878  N  ND1  . HIS A 1 57 ? 4.808   0.196   -2.600  1.00 0.00 ? 57  HIS A ND1  8  
ATOM   8879  C  CD2  . HIS A 1 57 ? 5.357   1.370   -4.357  1.00 0.00 ? 57  HIS A CD2  8  
ATOM   8880  C  CE1  . HIS A 1 57 ? 4.216   -0.360  -3.642  1.00 0.00 ? 57  HIS A CE1  8  
ATOM   8881  N  NE2  . HIS A 1 57 ? 4.533   0.333   -4.721  1.00 0.00 ? 57  HIS A NE2  8  
ATOM   8882  H  H    . HIS A 1 57 ? 8.398   3.374   -1.277  1.00 0.00 ? 57  HIS A H    8  
ATOM   8883  H  HA   . HIS A 1 57 ? 7.263   0.926   -0.595  1.00 0.00 ? 57  HIS A HA   8  
ATOM   8884  H  HB2  . HIS A 1 57 ? 5.678   2.453   -1.278  1.00 0.00 ? 57  HIS A HB2  8  
ATOM   8885  H  HB3  . HIS A 1 57 ? 6.654   3.024   -2.628  1.00 0.00 ? 57  HIS A HB3  8  
ATOM   8886  H  HD1  . HIS A 1 57 ? 4.736   -0.125  -1.678  1.00 0.00 ? 57  HIS A HD1  8  
ATOM   8887  H  HD2  . HIS A 1 57 ? 5.784   2.111   -5.019  1.00 0.00 ? 57  HIS A HD2  8  
ATOM   8888  H  HE1  . HIS A 1 57 ? 3.581   -1.233  -3.617  1.00 0.00 ? 57  HIS A HE1  8  
ATOM   8889  N  N    . ARG A 1 58 ? 8.980   0.882   -3.377  1.00 0.00 ? 58  ARG A N    8  
ATOM   8890  C  CA   . ARG A 1 58 ? 9.573   0.012   -4.385  1.00 0.00 ? 58  ARG A CA   8  
ATOM   8891  C  C    . ARG A 1 58 ? 10.594  -0.932  -3.756  1.00 0.00 ? 58  ARG A C    8  
ATOM   8892  O  O    . ARG A 1 58 ? 10.946  -1.958  -4.338  1.00 0.00 ? 58  ARG A O    8  
ATOM   8893  C  CB   . ARG A 1 58 ? 10.240  0.845   -5.481  1.00 0.00 ? 58  ARG A CB   8  
ATOM   8894  C  CG   . ARG A 1 58 ? 9.294   1.817   -6.167  1.00 0.00 ? 58  ARG A CG   8  
ATOM   8895  C  CD   . ARG A 1 58 ? 10.031  3.047   -6.674  1.00 0.00 ? 58  ARG A CD   8  
ATOM   8896  N  NE   . ARG A 1 58 ? 9.131   3.995   -7.324  1.00 0.00 ? 58  ARG A NE   8  
ATOM   8897  C  CZ   . ARG A 1 58 ? 9.537   4.924   -8.183  1.00 0.00 ? 58  ARG A CZ   8  
ATOM   8898  N  NH1  . ARG A 1 58 ? 10.822  5.027   -8.494  1.00 0.00 ? 58  ARG A NH1  8  
ATOM   8899  N  NH2  . ARG A 1 58 ? 8.657   5.750   -8.734  1.00 0.00 ? 58  ARG A NH2  8  
ATOM   8900  H  H    . ARG A 1 58 ? 9.240   1.827   -3.349  1.00 0.00 ? 58  ARG A H    8  
ATOM   8901  H  HA   . ARG A 1 58 ? 8.780   -0.576  -4.824  1.00 0.00 ? 58  ARG A HA   8  
ATOM   8902  H  HB2  . ARG A 1 58 ? 11.049  1.412   -5.044  1.00 0.00 ? 58  ARG A HB2  8  
ATOM   8903  H  HB3  . ARG A 1 58 ? 10.641  0.178   -6.229  1.00 0.00 ? 58  ARG A HB3  8  
ATOM   8904  H  HG2  . ARG A 1 58 ? 8.827   1.321   -7.005  1.00 0.00 ? 58  ARG A HG2  8  
ATOM   8905  H  HG3  . ARG A 1 58 ? 8.537   2.127   -5.462  1.00 0.00 ? 58  ARG A HG3  8  
ATOM   8906  H  HD2  . ARG A 1 58 ? 10.508  3.535   -5.837  1.00 0.00 ? 58  ARG A HD2  8  
ATOM   8907  H  HD3  . ARG A 1 58 ? 10.782  2.733   -7.383  1.00 0.00 ? 58  ARG A HD3  8  
ATOM   8908  H  HE   . ARG A 1 58 ? 8.177   3.937   -7.109  1.00 0.00 ? 58  ARG A HE   8  
ATOM   8909  H  HH11 . ARG A 1 58 ? 11.487  4.405   -8.082  1.00 0.00 ? 58  ARG A HH11 8  
ATOM   8910  H  HH12 . ARG A 1 58 ? 11.125  5.726   -9.143  1.00 0.00 ? 58  ARG A HH12 8  
ATOM   8911  H  HH21 . ARG A 1 58 ? 7.688   5.675   -8.502  1.00 0.00 ? 58  ARG A HH21 8  
ATOM   8912  H  HH22 . ARG A 1 58 ? 8.964   6.448   -9.380  1.00 0.00 ? 58  ARG A HH22 8  
ATOM   8913  N  N    . SER A 1 59 ? 11.065  -0.577  -2.565  1.00 0.00 ? 59  SER A N    8  
ATOM   8914  C  CA   . SER A 1 59 ? 12.049  -1.390  -1.859  1.00 0.00 ? 59  SER A CA   8  
ATOM   8915  C  C    . SER A 1 59 ? 11.365  -2.374  -0.916  1.00 0.00 ? 59  SER A C    8  
ATOM   8916  O  O    . SER A 1 59 ? 12.011  -3.244  -0.332  1.00 0.00 ? 59  SER A O    8  
ATOM   8917  C  CB   . SER A 1 59 ? 13.010  -0.496  -1.072  1.00 0.00 ? 59  SER A CB   8  
ATOM   8918  O  OG   . SER A 1 59 ? 13.796  0.299   -1.943  1.00 0.00 ? 59  SER A OG   8  
ATOM   8919  H  H    . SER A 1 59 ? 10.746  0.253   -2.153  1.00 0.00 ? 59  SER A H    8  
ATOM   8920  H  HA   . SER A 1 59 ? 12.610  -1.945  -2.596  1.00 0.00 ? 59  SER A HA   8  
ATOM   8921  H  HB2  . SER A 1 59 ? 12.443  0.155   -0.425  1.00 0.00 ? 59  SER A HB2  8  
ATOM   8922  H  HB3  . SER A 1 59 ? 13.666  -1.114  -0.477  1.00 0.00 ? 59  SER A HB3  8  
ATOM   8923  H  HG   . SER A 1 59 ? 14.609  0.552   -1.500  1.00 0.00 ? 59  SER A HG   8  
ATOM   8924  N  N    . LYS A 1 60 ? 10.052  -2.231  -0.773  1.00 0.00 ? 60  LYS A N    8  
ATOM   8925  C  CA   . LYS A 1 60 ? 9.276   -3.106  0.098   1.00 0.00 ? 60  LYS A CA   8  
ATOM   8926  C  C    . LYS A 1 60 ? 8.238   -3.888  -0.702  1.00 0.00 ? 60  LYS A C    8  
ATOM   8927  O  O    . LYS A 1 60 ? 7.864   -5.000  -0.331  1.00 0.00 ? 60  LYS A O    8  
ATOM   8928  C  CB   . LYS A 1 60 ? 8.584   -2.290  1.191   1.00 0.00 ? 60  LYS A CB   8  
ATOM   8929  C  CG   . LYS A 1 60 ? 9.543   -1.710  2.217   1.00 0.00 ? 60  LYS A CG   8  
ATOM   8930  C  CD   . LYS A 1 60 ? 8.830   -0.781  3.185   1.00 0.00 ? 60  LYS A CD   8  
ATOM   8931  C  CE   . LYS A 1 60 ? 9.792   -0.200  4.210   1.00 0.00 ? 60  LYS A CE   8  
ATOM   8932  N  NZ   . LYS A 1 60 ? 10.235  -1.223  5.197   1.00 0.00 ? 60  LYS A NZ   8  
ATOM   8933  H  H    . LYS A 1 60 ? 9.592   -1.518  -1.266  1.00 0.00 ? 60  LYS A H    8  
ATOM   8934  H  HA   . LYS A 1 60 ? 9.958   -3.805  0.558   1.00 0.00 ? 60  LYS A HA   8  
ATOM   8935  H  HB2  . LYS A 1 60 ? 8.047   -1.474  0.730   1.00 0.00 ? 60  LYS A HB2  8  
ATOM   8936  H  HB3  . LYS A 1 60 ? 7.880   -2.926  1.708   1.00 0.00 ? 60  LYS A HB3  8  
ATOM   8937  H  HG2  . LYS A 1 60 ? 9.992   -2.519  2.775   1.00 0.00 ? 60  LYS A HG2  8  
ATOM   8938  H  HG3  . LYS A 1 60 ? 10.315  -1.155  1.701   1.00 0.00 ? 60  LYS A HG3  8  
ATOM   8939  H  HD2  . LYS A 1 60 ? 8.382   0.029   2.629   1.00 0.00 ? 60  LYS A HD2  8  
ATOM   8940  H  HD3  . LYS A 1 60 ? 8.060   -1.336  3.701   1.00 0.00 ? 60  LYS A HD3  8  
ATOM   8941  H  HE2  . LYS A 1 60 ? 10.657  0.188   3.694   1.00 0.00 ? 60  LYS A HE2  8  
ATOM   8942  H  HE3  . LYS A 1 60 ? 9.296   0.603   4.735   1.00 0.00 ? 60  LYS A HE3  8  
ATOM   8943  H  HZ1  . LYS A 1 60 ? 10.615  -2.056  4.702   1.00 0.00 ? 60  LYS A HZ1  8  
ATOM   8944  H  HZ2  . LYS A 1 60 ? 9.433   -1.522  5.787   1.00 0.00 ? 60  LYS A HZ2  8  
ATOM   8945  H  HZ3  . LYS A 1 60 ? 10.976  -0.830  5.811   1.00 0.00 ? 60  LYS A HZ3  8  
ATOM   8946  N  N    . SER A 1 61 ? 7.778   -3.298  -1.800  1.00 0.00 ? 61  SER A N    8  
ATOM   8947  C  CA   . SER A 1 61 ? 6.781   -3.938  -2.651  1.00 0.00 ? 61  SER A CA   8  
ATOM   8948  C  C    . SER A 1 61 ? 7.393   -4.356  -3.985  1.00 0.00 ? 61  SER A C    8  
ATOM   8949  O  O    . SER A 1 61 ? 6.980   -5.347  -4.587  1.00 0.00 ? 61  SER A O    8  
ATOM   8950  C  CB   . SER A 1 61 ? 5.602   -2.994  -2.891  1.00 0.00 ? 61  SER A CB   8  
ATOM   8951  O  OG   . SER A 1 61 ? 4.645   -3.098  -1.851  1.00 0.00 ? 61  SER A OG   8  
ATOM   8952  H  H    . SER A 1 61 ? 8.114   -2.410  -2.043  1.00 0.00 ? 61  SER A H    8  
ATOM   8953  H  HA   . SER A 1 61 ? 6.426   -4.821  -2.139  1.00 0.00 ? 61  SER A HA   8  
ATOM   8954  H  HB2  . SER A 1 61 ? 5.961   -1.977  -2.932  1.00 0.00 ? 61  SER A HB2  8  
ATOM   8955  H  HB3  . SER A 1 61 ? 5.127   -3.246  -3.828  1.00 0.00 ? 61  SER A HB3  8  
ATOM   8956  H  HG   . SER A 1 61 ? 4.424   -4.022  -1.711  1.00 0.00 ? 61  SER A HG   8  
ATOM   8957  N  N    . HIS A 1 62 ? 8.380   -3.592  -4.441  1.00 0.00 ? 62  HIS A N    8  
ATOM   8958  C  CA   . HIS A 1 62 ? 9.050   -3.881  -5.704  1.00 0.00 ? 62  HIS A CA   8  
ATOM   8959  C  C    . HIS A 1 62 ? 10.531  -4.173  -5.478  1.00 0.00 ? 62  HIS A C    8  
ATOM   8960  O  O    . HIS A 1 62 ? 11.383  -3.864  -6.311  1.00 0.00 ? 62  HIS A O    8  
ATOM   8961  C  CB   . HIS A 1 62 ? 8.891   -2.708  -6.671  1.00 0.00 ? 62  HIS A CB   8  
ATOM   8962  C  CG   . HIS A 1 62 ? 7.468   -2.425  -7.041  1.00 0.00 ? 62  HIS A CG   8  
ATOM   8963  N  ND1  . HIS A 1 62 ? 6.702   -3.287  -7.797  1.00 0.00 ? 62  HIS A ND1  8  
ATOM   8964  C  CD2  . HIS A 1 62 ? 6.671   -1.370  -6.753  1.00 0.00 ? 62  HIS A CD2  8  
ATOM   8965  C  CE1  . HIS A 1 62 ? 5.496   -2.773  -7.960  1.00 0.00 ? 62  HIS A CE1  8  
ATOM   8966  N  NE2  . HIS A 1 62 ? 5.451   -1.610  -7.336  1.00 0.00 ? 62  HIS A NE2  8  
ATOM   8967  H  H    . HIS A 1 62 ? 8.665   -2.815  -3.916  1.00 0.00 ? 62  HIS A H    8  
ATOM   8968  H  HA   . HIS A 1 62 ? 8.585   -4.756  -6.133  1.00 0.00 ? 62  HIS A HA   8  
ATOM   8969  H  HB2  . HIS A 1 62 ? 9.298   -1.817  -6.215  1.00 0.00 ? 62  HIS A HB2  8  
ATOM   8970  H  HB3  . HIS A 1 62 ? 9.435   -2.922  -7.579  1.00 0.00 ? 62  HIS A HB3  8  
ATOM   8971  H  HD1  . HIS A 1 62 ? 6.998   -4.146  -8.162  1.00 0.00 ? 62  HIS A HD1  8  
ATOM   8972  H  HD2  . HIS A 1 62 ? 6.944   -0.499  -6.173  1.00 0.00 ? 62  HIS A HD2  8  
ATOM   8973  H  HE1  . HIS A 1 62 ? 4.684   -3.226  -8.509  1.00 0.00 ? 62  HIS A HE1  8  
ATOM   8974  N  N    . PRO A 1 63 ? 10.846  -4.783  -4.326  1.00 0.00 ? 63  PRO A N    8  
ATOM   8975  C  CA   . PRO A 1 63 ? 12.223  -5.130  -3.964  1.00 0.00 ? 63  PRO A CA   8  
ATOM   8976  C  C    . PRO A 1 63 ? 12.783  -6.256  -4.826  1.00 0.00 ? 63  PRO A C    8  
ATOM   8977  O  O    . PRO A 1 63 ? 13.975  -6.555  -4.776  1.00 0.00 ? 63  PRO A O    8  
ATOM   8978  C  CB   . PRO A 1 63 ? 12.105  -5.580  -2.506  1.00 0.00 ? 63  PRO A CB   8  
ATOM   8979  C  CG   . PRO A 1 63 ? 10.697  -6.047  -2.367  1.00 0.00 ? 63  PRO A CG   8  
ATOM   8980  C  CD   . PRO A 1 63 ? 9.881   -5.181  -3.287  1.00 0.00 ? 63  PRO A CD   8  
ATOM   8981  H  HA   . PRO A 1 63 ? 12.877  -4.272  -4.026  1.00 0.00 ? 63  PRO A HA   8  
ATOM   8982  H  HB2  . PRO A 1 63 ? 12.807  -6.379  -2.315  1.00 0.00 ? 63  PRO A HB2  8  
ATOM   8983  H  HB3  . PRO A 1 63 ? 12.311  -4.748  -1.850  1.00 0.00 ? 63  PRO A HB3  8  
ATOM   8984  H  HG2  . PRO A 1 63 ? 10.622  -7.082  -2.662  1.00 0.00 ? 63  PRO A HG2  8  
ATOM   8985  H  HG3  . PRO A 1 63 ? 10.368  -5.922  -1.346  1.00 0.00 ? 63  PRO A HG3  8  
ATOM   8986  H  HD2  . PRO A 1 63 ? 9.066   -5.746  -3.714  1.00 0.00 ? 63  PRO A HD2  8  
ATOM   8987  H  HD3  . PRO A 1 63 ? 9.507   -4.316  -2.758  1.00 0.00 ? 63  PRO A HD3  8  
ATOM   8988  N  N    . ALA A 1 64 ? 11.913  -6.878  -5.616  1.00 0.00 ? 64  ALA A N    8  
ATOM   8989  C  CA   . ALA A 1 64 ? 12.322  -7.970  -6.491  1.00 0.00 ? 64  ALA A CA   8  
ATOM   8990  C  C    . ALA A 1 64 ? 12.485  -7.490  -7.929  1.00 0.00 ? 64  ALA A C    8  
ATOM   8991  O  O    . ALA A 1 64 ? 13.002  -8.214  -8.781  1.00 0.00 ? 64  ALA A O    8  
ATOM   8992  C  CB   . ALA A 1 64 ? 11.312  -9.106  -6.423  1.00 0.00 ? 64  ALA A CB   8  
ATOM   8993  H  H    . ALA A 1 64 ? 10.976  -6.594  -5.611  1.00 0.00 ? 64  ALA A H    8  
ATOM   8994  H  HA   . ALA A 1 64 ? 13.272  -8.344  -6.137  1.00 0.00 ? 64  ALA A HA   8  
ATOM   8995  H  HB1  . ALA A 1 64 ? 11.417  -9.733  -7.297  1.00 0.00 ? 64  ALA A HB1  8  
ATOM   8996  H  HB2  . ALA A 1 64 ? 11.490  -9.694  -5.535  1.00 0.00 ? 64  ALA A HB2  8  
ATOM   8997  H  HB3  . ALA A 1 64 ? 10.313  -8.698  -6.391  1.00 0.00 ? 64  ALA A HB3  8  
ATOM   8998  N  N    . LEU A 1 65 ? 12.041  -6.266  -8.193  1.00 0.00 ? 65  LEU A N    8  
ATOM   8999  C  CA   . LEU A 1 65 ? 12.137  -5.689  -9.529  1.00 0.00 ? 65  LEU A CA   8  
ATOM   9000  C  C    . LEU A 1 65 ? 13.390  -4.828  -9.662  1.00 0.00 ? 65  LEU A C    8  
ATOM   9001  O  O    . LEU A 1 65 ? 14.168  -4.986  -10.604 1.00 0.00 ? 65  LEU A O    8  
ATOM   9002  C  CB   . LEU A 1 65 ? 10.894  -4.852  -9.835  1.00 0.00 ? 65  LEU A CB   8  
ATOM   9003  C  CG   . LEU A 1 65 ? 9.590   -5.628  -10.020 1.00 0.00 ? 65  LEU A CG   8  
ATOM   9004  C  CD1  . LEU A 1 65 ? 8.423   -4.673  -10.218 1.00 0.00 ? 65  LEU A CD1  8  
ATOM   9005  C  CD2  . LEU A 1 65 ? 9.703   -6.587  -11.197 1.00 0.00 ? 65  LEU A CD2  8  
ATOM   9006  H  H    . LEU A 1 65 ? 11.639  -5.737  -7.473  1.00 0.00 ? 65  LEU A H    8  
ATOM   9007  H  HA   . LEU A 1 65 ? 12.197  -6.502  -10.238 1.00 0.00 ? 65  LEU A HA   8  
ATOM   9008  H  HB2  . LEU A 1 65 ? 10.753  -4.159  -9.020  1.00 0.00 ? 65  LEU A HB2  8  
ATOM   9009  H  HB3  . LEU A 1 65 ? 11.084  -4.300  -10.745 1.00 0.00 ? 65  LEU A HB3  8  
ATOM   9010  H  HG   . LEU A 1 65 ? 9.397   -6.211  -9.130  1.00 0.00 ? 65  LEU A HG   8  
ATOM   9011  H  HD11 . LEU A 1 65 ? 8.414   -3.947  -9.420  1.00 0.00 ? 65  LEU A HD11 8  
ATOM   9012  H  HD12 . LEU A 1 65 ? 7.498   -5.230  -10.210 1.00 0.00 ? 65  LEU A HD12 8  
ATOM   9013  H  HD13 . LEU A 1 65 ? 8.530   -4.167  -11.166 1.00 0.00 ? 65  LEU A HD13 8  
ATOM   9014  H  HD21 . LEU A 1 65 ? 10.518  -7.274  -11.024 1.00 0.00 ? 65  LEU A HD21 8  
ATOM   9015  H  HD22 . LEU A 1 65 ? 9.891   -6.026  -12.101 1.00 0.00 ? 65  LEU A HD22 8  
ATOM   9016  H  HD23 . LEU A 1 65 ? 8.781   -7.139  -11.300 1.00 0.00 ? 65  LEU A HD23 8  
ATOM   9017  N  N    . LEU A 1 66 ? 13.580  -3.919  -8.712  1.00 0.00 ? 66  LEU A N    8  
ATOM   9018  C  CA   . LEU A 1 66 ? 14.739  -3.034  -8.720  1.00 0.00 ? 66  LEU A CA   8  
ATOM   9019  C  C    . LEU A 1 66 ? 15.976  -3.762  -9.238  1.00 0.00 ? 66  LEU A C    8  
ATOM   9020  O  O    . LEU A 1 66 ? 16.755  -3.209  -10.016 1.00 0.00 ? 66  LEU A O    8  
ATOM   9021  C  CB   . LEU A 1 66 ? 15.003  -2.494  -7.314  1.00 0.00 ? 66  LEU A CB   8  
ATOM   9022  C  CG   . LEU A 1 66 ? 13.833  -1.777  -6.640  1.00 0.00 ? 66  LEU A CG   8  
ATOM   9023  C  CD1  . LEU A 1 66 ? 13.971  -1.837  -5.126  1.00 0.00 ? 66  LEU A CD1  8  
ATOM   9024  C  CD2  . LEU A 1 66 ? 13.747  -0.334  -7.113  1.00 0.00 ? 66  LEU A CD2  8  
ATOM   9025  H  H    . LEU A 1 66 ? 12.925  -3.841  -7.987  1.00 0.00 ? 66  LEU A H    8  
ATOM   9026  H  HA   . LEU A 1 66 ? 14.520  -2.208  -9.380  1.00 0.00 ? 66  LEU A HA   8  
ATOM   9027  H  HB2  . LEU A 1 66 ? 15.287  -3.325  -6.688  1.00 0.00 ? 66  LEU A HB2  8  
ATOM   9028  H  HB3  . LEU A 1 66 ? 15.827  -1.796  -7.378  1.00 0.00 ? 66  LEU A HB3  8  
ATOM   9029  H  HG   . LEU A 1 66 ? 12.911  -2.274  -6.910  1.00 0.00 ? 66  LEU A HG   8  
ATOM   9030  H  HD11 . LEU A 1 66 ? 14.164  -2.855  -4.823  1.00 0.00 ? 66  LEU A HD11 8  
ATOM   9031  H  HD12 . LEU A 1 66 ? 13.056  -1.492  -4.668  1.00 0.00 ? 66  LEU A HD12 8  
ATOM   9032  H  HD13 . LEU A 1 66 ? 14.790  -1.206  -4.815  1.00 0.00 ? 66  LEU A HD13 8  
ATOM   9033  H  HD21 . LEU A 1 66 ? 13.297  -0.303  -8.094  1.00 0.00 ? 66  LEU A HD21 8  
ATOM   9034  H  HD22 . LEU A 1 66 ? 14.740  0.090   -7.159  1.00 0.00 ? 66  LEU A HD22 8  
ATOM   9035  H  HD23 . LEU A 1 66 ? 13.144  0.236   -6.422  1.00 0.00 ? 66  LEU A HD23 8  
ATOM   9036  N  N    . LEU A 1 67 ? 16.149  -5.006  -8.804  1.00 0.00 ? 67  LEU A N    8  
ATOM   9037  C  CA   . LEU A 1 67 ? 17.290  -5.811  -9.225  1.00 0.00 ? 67  LEU A CA   8  
ATOM   9038  C  C    . LEU A 1 67 ? 17.406  -5.838  -10.746 1.00 0.00 ? 67  LEU A C    8  
ATOM   9039  O  O    . LEU A 1 67 ? 16.409  -5.710  -11.456 1.00 0.00 ? 67  LEU A O    8  
ATOM   9040  C  CB   . LEU A 1 67 ? 17.159  -7.237  -8.687  1.00 0.00 ? 67  LEU A CB   8  
ATOM   9041  C  CG   . LEU A 1 67 ? 18.468  -7.943  -8.330  1.00 0.00 ? 67  LEU A CG   8  
ATOM   9042  C  CD1  . LEU A 1 67 ? 19.166  -7.225  -7.185  1.00 0.00 ? 67  LEU A CD1  8  
ATOM   9043  C  CD2  . LEU A 1 67 ? 18.208  -9.398  -7.970  1.00 0.00 ? 67  LEU A CD2  8  
ATOM   9044  H  H    . LEU A 1 67 ? 15.495  -5.392  -8.185  1.00 0.00 ? 67  LEU A H    8  
ATOM   9045  H  HA   . LEU A 1 67 ? 18.182  -5.361  -8.816  1.00 0.00 ? 67  LEU A HA   8  
ATOM   9046  H  HB2  . LEU A 1 67 ? 16.550  -7.200  -7.797  1.00 0.00 ? 67  LEU A HB2  8  
ATOM   9047  H  HB3  . LEU A 1 67 ? 16.658  -7.829  -9.439  1.00 0.00 ? 67  LEU A HB3  8  
ATOM   9048  H  HG   . LEU A 1 67 ? 19.126  -7.921  -9.187  1.00 0.00 ? 67  LEU A HG   8  
ATOM   9049  H  HD11 . LEU A 1 67 ? 18.930  -7.718  -6.254  1.00 0.00 ? 67  LEU A HD11 8  
ATOM   9050  H  HD12 . LEU A 1 67 ? 18.829  -6.199  -7.144  1.00 0.00 ? 67  LEU A HD12 8  
ATOM   9051  H  HD13 . LEU A 1 67 ? 20.234  -7.247  -7.344  1.00 0.00 ? 67  LEU A HD13 8  
ATOM   9052  H  HD21 . LEU A 1 67 ? 17.189  -9.508  -7.631  1.00 0.00 ? 67  LEU A HD21 8  
ATOM   9053  H  HD22 . LEU A 1 67 ? 18.884  -9.700  -7.182  1.00 0.00 ? 67  LEU A HD22 8  
ATOM   9054  H  HD23 . LEU A 1 67 ? 18.368  -10.018 -8.839  1.00 0.00 ? 67  LEU A HD23 8  
ATOM   9055  N  N    . ALA A 1 68 ? 18.629  -6.007  -11.238 1.00 0.00 ? 68  ALA A N    8  
ATOM   9056  C  CA   . ALA A 1 68 ? 18.874  -6.056  -12.674 1.00 0.00 ? 68  ALA A CA   8  
ATOM   9057  C  C    . ALA A 1 68 ? 17.962  -7.072  -13.353 1.00 0.00 ? 68  ALA A C    8  
ATOM   9058  O  O    . ALA A 1 68 ? 17.563  -8.076  -12.762 1.00 0.00 ? 68  ALA A O    8  
ATOM   9059  C  CB   . ALA A 1 68 ? 20.334  -6.386  -12.949 1.00 0.00 ? 68  ALA A CB   8  
ATOM   9060  H  H    . ALA A 1 68 ? 19.383  -6.104  -10.620 1.00 0.00 ? 68  ALA A H    8  
ATOM   9061  H  HA   . ALA A 1 68 ? 18.670  -5.075  -13.081 1.00 0.00 ? 68  ALA A HA   8  
ATOM   9062  H  HB1  . ALA A 1 68 ? 20.966  -5.715  -12.387 1.00 0.00 ? 68  ALA A HB1  8  
ATOM   9063  H  HB2  . ALA A 1 68 ? 20.534  -7.405  -12.651 1.00 0.00 ? 68  ALA A HB2  8  
ATOM   9064  H  HB3  . ALA A 1 68 ? 20.535  -6.273  -14.004 1.00 0.00 ? 68  ALA A HB3  8  
ATOM   9065  N  N    . PRO A 1 69 ? 17.623  -6.808  -14.623 1.00 0.00 ? 69  PRO A N    8  
ATOM   9066  C  CA   . PRO A 1 69 ? 16.754  -7.688  -15.410 1.00 0.00 ? 69  PRO A CA   8  
ATOM   9067  C  C    . PRO A 1 69 ? 17.432  -9.008  -15.762 1.00 0.00 ? 69  PRO A C    8  
ATOM   9068  O  O    . PRO A 1 69 ? 17.929  -9.182  -16.874 1.00 0.00 ? 69  PRO A O    8  
ATOM   9069  C  CB   . PRO A 1 69 ? 16.478  -6.874  -16.677 1.00 0.00 ? 69  PRO A CB   8  
ATOM   9070  C  CG   . PRO A 1 69 ? 17.643  -5.954  -16.797 1.00 0.00 ? 69  PRO A CG   8  
ATOM   9071  C  CD   . PRO A 1 69 ? 18.063  -5.630  -15.390 1.00 0.00 ? 69  PRO A CD   8  
ATOM   9072  H  HA   . PRO A 1 69 ? 15.824  -7.888  -14.899 1.00 0.00 ? 69  PRO A HA   8  
ATOM   9073  H  HB2  . PRO A 1 69 ? 16.408  -7.539  -17.527 1.00 0.00 ? 69  PRO A HB2  8  
ATOM   9074  H  HB3  . PRO A 1 69 ? 15.554  -6.328  -16.563 1.00 0.00 ? 69  PRO A HB3  8  
ATOM   9075  H  HG2  . PRO A 1 69 ? 18.447  -6.446  -17.324 1.00 0.00 ? 69  PRO A HG2  8  
ATOM   9076  H  HG3  . PRO A 1 69 ? 17.348  -5.054  -17.317 1.00 0.00 ? 69  PRO A HG3  8  
ATOM   9077  H  HD2  . PRO A 1 69 ? 19.134  -5.511  -15.334 1.00 0.00 ? 69  PRO A HD2  8  
ATOM   9078  H  HD3  . PRO A 1 69 ? 17.563  -4.737  -15.044 1.00 0.00 ? 69  PRO A HD3  8  
ATOM   9079  N  N    . GLN A 1 70 ? 17.447  -9.933  -14.808 1.00 0.00 ? 70  GLN A N    8  
ATOM   9080  C  CA   . GLN A 1 70 ? 18.064  -11.237 -15.019 1.00 0.00 ? 70  GLN A CA   8  
ATOM   9081  C  C    . GLN A 1 70 ? 17.438  -11.949 -16.214 1.00 0.00 ? 70  GLN A C    8  
ATOM   9082  O  O    . GLN A 1 70 ? 18.130  -12.615 -16.983 1.00 0.00 ? 70  GLN A O    8  
ATOM   9083  C  CB   . GLN A 1 70 ? 17.923  -12.101 -13.765 1.00 0.00 ? 70  GLN A CB   8  
ATOM   9084  C  CG   . GLN A 1 70 ? 19.032  -11.883 -12.748 1.00 0.00 ? 70  GLN A CG   8  
ATOM   9085  C  CD   . GLN A 1 70 ? 19.179  -10.428 -12.348 1.00 0.00 ? 70  GLN A CD   8  
ATOM   9086  O  OE1  . GLN A 1 70 ? 19.726  -9.619  -13.097 1.00 0.00 ? 70  GLN A OE1  8  
ATOM   9087  N  NE2  . GLN A 1 70 ? 18.691  -10.089 -11.160 1.00 0.00 ? 70  GLN A NE2  8  
ATOM   9088  H  H    . GLN A 1 70 ? 17.034  -9.734  -13.943 1.00 0.00 ? 70  GLN A H    8  
ATOM   9089  H  HA   . GLN A 1 70 ? 19.113  -11.079 -15.219 1.00 0.00 ? 70  GLN A HA   8  
ATOM   9090  H  HB2  . GLN A 1 70 ? 16.979  -11.875 -13.291 1.00 0.00 ? 70  GLN A HB2  8  
ATOM   9091  H  HB3  . GLN A 1 70 ? 17.930  -13.141 -14.055 1.00 0.00 ? 70  GLN A HB3  8  
ATOM   9092  H  HG2  . GLN A 1 70 ? 18.811  -12.463 -11.864 1.00 0.00 ? 70  GLN A HG2  8  
ATOM   9093  H  HG3  . GLN A 1 70 ? 19.965  -12.220 -13.175 1.00 0.00 ? 70  GLN A HG3  8  
ATOM   9094  H  HE21 . GLN A 1 70 ? 18.270  -10.787 -10.616 1.00 0.00 ? 70  GLN A HE21 8  
ATOM   9095  H  HE22 . GLN A 1 70 ? 18.773  -9.155  -10.876 1.00 0.00 ? 70  GLN A HE22 8  
ATOM   9096  N  N    . GLU A 1 71 ? 16.125  -11.804 -16.362 1.00 0.00 ? 71  GLU A N    8  
ATOM   9097  C  CA   . GLU A 1 71 ? 15.407  -12.434 -17.463 1.00 0.00 ? 71  GLU A CA   8  
ATOM   9098  C  C    . GLU A 1 71 ? 15.525  -13.954 -17.390 1.00 0.00 ? 71  GLU A C    8  
ATOM   9099  O  O    . GLU A 1 71 ? 15.626  -14.629 -18.414 1.00 0.00 ? 71  GLU A O    8  
ATOM   9100  C  CB   . GLU A 1 71 ? 15.945  -11.934 -18.805 1.00 0.00 ? 71  GLU A CB   8  
ATOM   9101  C  CG   . GLU A 1 71 ? 15.533  -10.508 -19.133 1.00 0.00 ? 71  GLU A CG   8  
ATOM   9102  C  CD   . GLU A 1 71 ? 16.265  -9.952  -20.338 1.00 0.00 ? 71  GLU A CD   8  
ATOM   9103  O  OE1  . GLU A 1 71 ? 16.262  -10.619 -21.394 1.00 0.00 ? 71  GLU A OE1  8  
ATOM   9104  O  OE2  . GLU A 1 71 ? 16.842  -8.850  -20.226 1.00 0.00 ? 71  GLU A OE2  8  
ATOM   9105  H  H    . GLU A 1 71 ? 15.628  -11.260 -15.715 1.00 0.00 ? 71  GLU A H    8  
ATOM   9106  H  HA   . GLU A 1 71 ? 14.366  -12.162 -17.379 1.00 0.00 ? 71  GLU A HA   8  
ATOM   9107  H  HB2  . GLU A 1 71 ? 17.024  -11.980 -18.787 1.00 0.00 ? 71  GLU A HB2  8  
ATOM   9108  H  HB3  . GLU A 1 71 ? 15.579  -12.581 -19.589 1.00 0.00 ? 71  GLU A HB3  8  
ATOM   9109  H  HG2  . GLU A 1 71 ? 14.472  -10.491 -19.336 1.00 0.00 ? 71  GLU A HG2  8  
ATOM   9110  H  HG3  . GLU A 1 71 ? 15.745  -9.881  -18.279 1.00 0.00 ? 71  GLU A HG3  8  
ATOM   9111  N  N    . SER A 1 72 ? 15.513  -14.485 -16.172 1.00 0.00 ? 72  SER A N    8  
ATOM   9112  C  CA   . SER A 1 72 ? 15.623  -15.924 -15.964 1.00 0.00 ? 72  SER A CA   8  
ATOM   9113  C  C    . SER A 1 72 ? 14.402  -16.649 -16.522 1.00 0.00 ? 72  SER A C    8  
ATOM   9114  O  O    . SER A 1 72 ? 14.529  -17.647 -17.231 1.00 0.00 ? 72  SER A O    8  
ATOM   9115  C  CB   . SER A 1 72 ? 15.778  -16.235 -14.474 1.00 0.00 ? 72  SER A CB   8  
ATOM   9116  O  OG   . SER A 1 72 ? 17.097  -15.969 -14.032 1.00 0.00 ? 72  SER A OG   8  
ATOM   9117  H  H    . SER A 1 72 ? 15.430  -13.894 -15.394 1.00 0.00 ? 72  SER A H    8  
ATOM   9118  H  HA   . SER A 1 72 ? 16.502  -16.268 -16.488 1.00 0.00 ? 72  SER A HA   8  
ATOM   9119  H  HB2  . SER A 1 72 ? 15.091  -15.624 -13.908 1.00 0.00 ? 72  SER A HB2  8  
ATOM   9120  H  HB3  . SER A 1 72 ? 15.557  -17.279 -14.302 1.00 0.00 ? 72  SER A HB3  8  
ATOM   9121  H  HG   . SER A 1 72 ? 17.688  -16.652 -14.357 1.00 0.00 ? 72  SER A HG   8  
ATOM   9122  N  N    . SER A 1 73 ? 13.218  -16.138 -16.196 1.00 0.00 ? 73  SER A N    8  
ATOM   9123  C  CA   . SER A 1 73 ? 11.973  -16.738 -16.661 1.00 0.00 ? 73  SER A CA   8  
ATOM   9124  C  C    . SER A 1 73 ? 11.377  -15.930 -17.810 1.00 0.00 ? 73  SER A C    8  
ATOM   9125  O  O    . SER A 1 73 ? 11.670  -14.746 -17.969 1.00 0.00 ? 73  SER A O    8  
ATOM   9126  C  CB   . SER A 1 73 ? 10.967  -16.831 -15.512 1.00 0.00 ? 73  SER A CB   8  
ATOM   9127  O  OG   . SER A 1 73 ? 10.589  -15.542 -15.059 1.00 0.00 ? 73  SER A OG   8  
ATOM   9128  H  H    . SER A 1 73 ? 13.182  -15.340 -15.628 1.00 0.00 ? 73  SER A H    8  
ATOM   9129  H  HA   . SER A 1 73 ? 12.196  -17.733 -17.014 1.00 0.00 ? 73  SER A HA   8  
ATOM   9130  H  HB2  . SER A 1 73 ? 10.085  -17.353 -15.850 1.00 0.00 ? 73  SER A HB2  8  
ATOM   9131  H  HB3  . SER A 1 73 ? 11.413  -17.372 -14.690 1.00 0.00 ? 73  SER A HB3  8  
ATOM   9132  H  HG   . SER A 1 73 ? 10.206  -15.047 -15.787 1.00 0.00 ? 73  SER A HG   8  
ATOM   9133  N  N    . GLY A 1 74 ? 10.537  -16.581 -18.609 1.00 0.00 ? 74  GLY A N    8  
ATOM   9134  C  CA   . GLY A 1 74 ? 9.912   -15.908 -19.733 1.00 0.00 ? 74  GLY A CA   8  
ATOM   9135  C  C    . GLY A 1 74 ? 8.450   -15.596 -19.482 1.00 0.00 ? 74  GLY A C    8  
ATOM   9136  O  O    . GLY A 1 74 ? 7.561   -16.391 -19.791 1.00 0.00 ? 74  GLY A O    8  
ATOM   9137  H  H    . GLY A 1 74 ? 10.340  -17.525 -18.434 1.00 0.00 ? 74  GLY A H    8  
ATOM   9138  H  HA2  . GLY A 1 74 ? 10.439  -14.986 -19.925 1.00 0.00 ? 74  GLY A HA2  8  
ATOM   9139  H  HA3  . GLY A 1 74 ? 9.988   -16.543 -20.604 1.00 0.00 ? 74  GLY A HA3  8  
ATOM   9140  N  N    . PRO A 1 75 ? 8.184   -14.414 -18.908 1.00 0.00 ? 75  PRO A N    8  
ATOM   9141  C  CA   . PRO A 1 75 ? 6.820   -13.972 -18.602 1.00 0.00 ? 75  PRO A CA   8  
ATOM   9142  C  C    . PRO A 1 75 ? 6.018   -13.652 -19.859 1.00 0.00 ? 75  PRO A C    8  
ATOM   9143  O  O    . PRO A 1 75 ? 4.800   -13.483 -19.803 1.00 0.00 ? 75  PRO A O    8  
ATOM   9144  C  CB   . PRO A 1 75 ? 7.036   -12.706 -17.769 1.00 0.00 ? 75  PRO A CB   8  
ATOM   9145  C  CG   . PRO A 1 75 ? 8.373   -12.200 -18.189 1.00 0.00 ? 75  PRO A CG   8  
ATOM   9146  C  CD   . PRO A 1 75 ? 9.193   -13.417 -18.513 1.00 0.00 ? 75  PRO A CD   8  
ATOM   9147  H  HA   . PRO A 1 75 ? 6.288   -14.705 -18.013 1.00 0.00 ? 75  PRO A HA   8  
ATOM   9148  H  HB2  . PRO A 1 75 ? 6.255   -11.991 -17.987 1.00 0.00 ? 75  PRO A HB2  8  
ATOM   9149  H  HB3  . PRO A 1 75 ? 7.020   -12.954 -16.718 1.00 0.00 ? 75  PRO A HB3  8  
ATOM   9150  H  HG2  . PRO A 1 75 ? 8.270   -11.573 -19.061 1.00 0.00 ? 75  PRO A HG2  8  
ATOM   9151  H  HG3  . PRO A 1 75 ? 8.826   -11.647 -17.379 1.00 0.00 ? 75  PRO A HG3  8  
ATOM   9152  H  HD2  . PRO A 1 75 ? 9.870   -13.210 -19.329 1.00 0.00 ? 75  PRO A HD2  8  
ATOM   9153  H  HD3  . PRO A 1 75 ? 9.740   -13.747 -17.642 1.00 0.00 ? 75  PRO A HD3  8  
ATOM   9154  N  N    . SER A 1 76 ? 6.709   -13.571 -20.991 1.00 0.00 ? 76  SER A N    8  
ATOM   9155  C  CA   . SER A 1 76 ? 6.061   -13.268 -22.262 1.00 0.00 ? 76  SER A CA   8  
ATOM   9156  C  C    . SER A 1 76 ? 4.762   -14.054 -22.410 1.00 0.00 ? 76  SER A C    8  
ATOM   9157  O  O    . SER A 1 76 ? 3.747   -13.518 -22.856 1.00 0.00 ? 76  SER A O    8  
ATOM   9158  C  CB   . SER A 1 76 ? 7.000   -13.590 -23.426 1.00 0.00 ? 76  SER A CB   8  
ATOM   9159  O  OG   . SER A 1 76 ? 6.322   -13.502 -24.667 1.00 0.00 ? 76  SER A OG   8  
ATOM   9160  H  H    . SER A 1 76 ? 7.679   -13.716 -20.971 1.00 0.00 ? 76  SER A H    8  
ATOM   9161  H  HA   . SER A 1 76 ? 5.834   -12.213 -22.275 1.00 0.00 ? 76  SER A HA   8  
ATOM   9162  H  HB2  . SER A 1 76 ? 7.820   -12.888 -23.428 1.00 0.00 ? 76  SER A HB2  8  
ATOM   9163  H  HB3  . SER A 1 76 ? 7.384   -14.593 -23.309 1.00 0.00 ? 76  SER A HB3  8  
ATOM   9164  H  HG   . SER A 1 76 ? 6.960   -13.375 -25.373 1.00 0.00 ? 76  SER A HG   8  
ATOM   9165  N  N    . SER A 1 77 ? 4.801   -15.327 -22.032 1.00 0.00 ? 77  SER A N    8  
ATOM   9166  C  CA   . SER A 1 77 ? 3.629   -16.189 -22.126 1.00 0.00 ? 77  SER A CA   8  
ATOM   9167  C  C    . SER A 1 77 ? 2.471   -15.622 -21.309 1.00 0.00 ? 77  SER A C    8  
ATOM   9168  O  O    . SER A 1 77 ? 2.647   -15.216 -20.161 1.00 0.00 ? 77  SER A O    8  
ATOM   9169  C  CB   . SER A 1 77 ? 3.967   -17.600 -21.641 1.00 0.00 ? 77  SER A CB   8  
ATOM   9170  O  OG   . SER A 1 77 ? 2.908   -18.501 -21.916 1.00 0.00 ? 77  SER A OG   8  
ATOM   9171  H  H    . SER A 1 77 ? 5.640   -15.697 -21.684 1.00 0.00 ? 77  SER A H    8  
ATOM   9172  H  HA   . SER A 1 77 ? 3.333   -16.235 -23.163 1.00 0.00 ? 77  SER A HA   8  
ATOM   9173  H  HB2  . SER A 1 77 ? 4.858   -17.947 -22.142 1.00 0.00 ? 77  SER A HB2  8  
ATOM   9174  H  HB3  . SER A 1 77 ? 4.138   -17.580 -20.574 1.00 0.00 ? 77  SER A HB3  8  
ATOM   9175  H  HG   . SER A 1 77 ? 2.238   -18.058 -22.442 1.00 0.00 ? 77  SER A HG   8  
ATOM   9176  N  N    . GLY A 1 78 ? 1.286   -15.599 -21.911 1.00 0.00 ? 78  GLY A N    8  
ATOM   9177  C  CA   . GLY A 1 78 ? 0.116   -15.080 -21.227 1.00 0.00 ? 78  GLY A CA   8  
ATOM   9178  C  C    . GLY A 1 78 ? -0.157  -13.628 -21.565 1.00 0.00 ? 78  GLY A C    8  
ATOM   9179  O  O    . GLY A 1 78 ? -0.072  -13.259 -22.735 1.00 0.00 ? 78  GLY A O    8  
ATOM   9180  H  H    . GLY A 1 78 ? 1.205   -15.936 -22.828 1.00 0.00 ? 78  GLY A H    8  
ATOM   9181  H  HA2  . GLY A 1 78 ? -0.743  -15.671 -21.506 1.00 0.00 ? 78  GLY A HA2  8  
ATOM   9182  H  HA3  . GLY A 1 78 ? 0.269   -15.166 -20.161 1.00 0.00 ? 78  GLY A HA3  8  
HETATM 9183  ZN ZN   . ZN  B 2 .  ? -7.484  0.787   2.873   1.00 0.00 ? 201 ZN  A ZN   8  
HETATM 9184  ZN ZN   . ZN  C 2 .  ? 4.471   0.083   -6.742  1.00 0.00 ? 401 ZN  A ZN   8  
ATOM   9185  N  N    . GLY A 1 1  ? -12.445 -22.794 -2.839  1.00 0.00 ? 1   GLY A N    9  
ATOM   9186  C  CA   . GLY A 1 1  ? -13.211 -21.887 -2.005  1.00 0.00 ? 1   GLY A CA   9  
ATOM   9187  C  C    . GLY A 1 1  ? -13.035 -20.437 -2.411  1.00 0.00 ? 1   GLY A C    9  
ATOM   9188  O  O    . GLY A 1 1  ? -13.388 -20.050 -3.524  1.00 0.00 ? 1   GLY A O    9  
ATOM   9189  H  H1   . GLY A 1 1  ? -11.476 -22.675 -2.927  1.00 0.00 ? 1   GLY A H1   9  
ATOM   9190  H  HA2  . GLY A 1 1  ? -14.257 -22.146 -2.077  1.00 0.00 ? 1   GLY A HA2  9  
ATOM   9191  H  HA3  . GLY A 1 1  ? -12.892 -22.003 -0.979  1.00 0.00 ? 1   GLY A HA3  9  
ATOM   9192  N  N    . SER A 1 2  ? -12.489 -19.633 -1.504  1.00 0.00 ? 2   SER A N    9  
ATOM   9193  C  CA   . SER A 1 2  ? -12.272 -18.216 -1.772  1.00 0.00 ? 2   SER A CA   9  
ATOM   9194  C  C    . SER A 1 2  ? -10.997 -17.724 -1.095  1.00 0.00 ? 2   SER A C    9  
ATOM   9195  O  O    . SER A 1 2  ? -10.462 -18.382 -0.202  1.00 0.00 ? 2   SER A O    9  
ATOM   9196  C  CB   . SER A 1 2  ? -13.469 -17.394 -1.288  1.00 0.00 ? 2   SER A CB   9  
ATOM   9197  O  OG   . SER A 1 2  ? -13.693 -16.276 -2.128  1.00 0.00 ? 2   SER A OG   9  
ATOM   9198  H  H    . SER A 1 2  ? -12.229 -20.001 -0.634  1.00 0.00 ? 2   SER A H    9  
ATOM   9199  H  HA   . SER A 1 2  ? -12.170 -18.092 -2.840  1.00 0.00 ? 2   SER A HA   9  
ATOM   9200  H  HB2  . SER A 1 2  ? -14.353 -18.014 -1.291  1.00 0.00 ? 2   SER A HB2  9  
ATOM   9201  H  HB3  . SER A 1 2  ? -13.279 -17.043 -0.284  1.00 0.00 ? 2   SER A HB3  9  
ATOM   9202  H  HG   . SER A 1 2  ? -12.852 -15.947 -2.455  1.00 0.00 ? 2   SER A HG   9  
ATOM   9203  N  N    . SER A 1 3  ? -10.515 -16.563 -1.526  1.00 0.00 ? 3   SER A N    9  
ATOM   9204  C  CA   . SER A 1 3  ? -9.300  -15.984 -0.965  1.00 0.00 ? 3   SER A CA   9  
ATOM   9205  C  C    . SER A 1 3  ? -9.525  -15.541 0.477   1.00 0.00 ? 3   SER A C    9  
ATOM   9206  O  O    . SER A 1 3  ? -8.887  -16.046 1.400   1.00 0.00 ? 3   SER A O    9  
ATOM   9207  C  CB   . SER A 1 3  ? -8.840  -14.794 -1.810  1.00 0.00 ? 3   SER A CB   9  
ATOM   9208  O  OG   . SER A 1 3  ? -7.963  -15.210 -2.843  1.00 0.00 ? 3   SER A OG   9  
ATOM   9209  H  H    . SER A 1 3  ? -10.986 -16.086 -2.241  1.00 0.00 ? 3   SER A H    9  
ATOM   9210  H  HA   . SER A 1 3  ? -8.532  -16.743 -0.981  1.00 0.00 ? 3   SER A HA   9  
ATOM   9211  H  HB2  . SER A 1 3  ? -9.700  -14.317 -2.254  1.00 0.00 ? 3   SER A HB2  9  
ATOM   9212  H  HB3  . SER A 1 3  ? -8.322  -14.086 -1.178  1.00 0.00 ? 3   SER A HB3  9  
ATOM   9213  H  HG   . SER A 1 3  ? -7.470  -15.981 -2.553  1.00 0.00 ? 3   SER A HG   9  
ATOM   9214  N  N    . GLY A 1 4  ? -10.438 -14.593 0.663   1.00 0.00 ? 4   GLY A N    9  
ATOM   9215  C  CA   . GLY A 1 4  ? -10.732 -14.097 1.995   1.00 0.00 ? 4   GLY A CA   9  
ATOM   9216  C  C    . GLY A 1 4  ? -11.508 -15.097 2.828   1.00 0.00 ? 4   GLY A C    9  
ATOM   9217  O  O    . GLY A 1 4  ? -12.631 -15.465 2.483   1.00 0.00 ? 4   GLY A O    9  
ATOM   9218  H  H    . GLY A 1 4  ? -10.916 -14.227 -0.110  1.00 0.00 ? 4   GLY A H    9  
ATOM   9219  H  HA2  . GLY A 1 4  ? -9.803  -13.870 2.496   1.00 0.00 ? 4   GLY A HA2  9  
ATOM   9220  H  HA3  . GLY A 1 4  ? -11.313 -13.190 1.909   1.00 0.00 ? 4   GLY A HA3  9  
ATOM   9221  N  N    . SER A 1 5  ? -10.908 -15.541 3.928   1.00 0.00 ? 5   SER A N    9  
ATOM   9222  C  CA   . SER A 1 5  ? -11.548 -16.510 4.810   1.00 0.00 ? 5   SER A CA   9  
ATOM   9223  C  C    . SER A 1 5  ? -12.421 -15.808 5.846   1.00 0.00 ? 5   SER A C    9  
ATOM   9224  O  O    . SER A 1 5  ? -13.575 -16.180 6.056   1.00 0.00 ? 5   SER A O    9  
ATOM   9225  C  CB   . SER A 1 5  ? -10.493 -17.367 5.512   1.00 0.00 ? 5   SER A CB   9  
ATOM   9226  O  OG   . SER A 1 5  ? -9.908  -18.293 4.613   1.00 0.00 ? 5   SER A OG   9  
ATOM   9227  H  H    . SER A 1 5  ? -10.012 -15.211 4.150   1.00 0.00 ? 5   SER A H    9  
ATOM   9228  H  HA   . SER A 1 5  ? -12.173 -17.148 4.203   1.00 0.00 ? 5   SER A HA   9  
ATOM   9229  H  HB2  . SER A 1 5  ? -9.718  -16.728 5.907   1.00 0.00 ? 5   SER A HB2  9  
ATOM   9230  H  HB3  . SER A 1 5  ? -10.957 -17.913 6.321   1.00 0.00 ? 5   SER A HB3  9  
ATOM   9231  H  HG   . SER A 1 5  ? -10.553 -18.963 4.377   1.00 0.00 ? 5   SER A HG   9  
ATOM   9232  N  N    . SER A 1 6  ? -11.860 -14.790 6.491   1.00 0.00 ? 6   SER A N    9  
ATOM   9233  C  CA   . SER A 1 6  ? -12.584 -14.037 7.509   1.00 0.00 ? 6   SER A CA   9  
ATOM   9234  C  C    . SER A 1 6  ? -12.057 -12.609 7.605   1.00 0.00 ? 6   SER A C    9  
ATOM   9235  O  O    . SER A 1 6  ? -10.850 -12.384 7.684   1.00 0.00 ? 6   SER A O    9  
ATOM   9236  C  CB   . SER A 1 6  ? -12.464 -14.730 8.867   1.00 0.00 ? 6   SER A CB   9  
ATOM   9237  O  OG   . SER A 1 6  ? -13.504 -14.323 9.740   1.00 0.00 ? 6   SER A OG   9  
ATOM   9238  H  H    . SER A 1 6  ? -10.935 -14.541 6.279   1.00 0.00 ? 6   SER A H    9  
ATOM   9239  H  HA   . SER A 1 6  ? -13.624 -14.006 7.220   1.00 0.00 ? 6   SER A HA   9  
ATOM   9240  H  HB2  . SER A 1 6  ? -12.523 -15.799 8.730   1.00 0.00 ? 6   SER A HB2  9  
ATOM   9241  H  HB3  . SER A 1 6  ? -11.514 -14.476 9.315   1.00 0.00 ? 6   SER A HB3  9  
ATOM   9242  H  HG   . SER A 1 6  ? -13.261 -14.531 10.646  1.00 0.00 ? 6   SER A HG   9  
ATOM   9243  N  N    . GLY A 1 7  ? -12.974 -11.645 7.597   1.00 0.00 ? 7   GLY A N    9  
ATOM   9244  C  CA   . GLY A 1 7  ? -12.583 -10.250 7.684   1.00 0.00 ? 7   GLY A CA   9  
ATOM   9245  C  C    . GLY A 1 7  ? -12.932 -9.471  6.431   1.00 0.00 ? 7   GLY A C    9  
ATOM   9246  O  O    . GLY A 1 7  ? -13.010 -10.038 5.341   1.00 0.00 ? 7   GLY A O    9  
ATOM   9247  H  H    . GLY A 1 7  ? -13.922 -11.883 7.533   1.00 0.00 ? 7   GLY A H    9  
ATOM   9248  H  HA2  . GLY A 1 7  ? -13.086 -9.799  8.527   1.00 0.00 ? 7   GLY A HA2  9  
ATOM   9249  H  HA3  . GLY A 1 7  ? -11.516 -10.196 7.843   1.00 0.00 ? 7   GLY A HA3  9  
ATOM   9250  N  N    . LEU A 1 8  ? -13.144 -8.169  6.586   1.00 0.00 ? 8   LEU A N    9  
ATOM   9251  C  CA   . LEU A 1 8  ? -13.487 -7.311  5.457   1.00 0.00 ? 8   LEU A CA   9  
ATOM   9252  C  C    . LEU A 1 8  ? -12.241 -6.924  4.668   1.00 0.00 ? 8   LEU A C    9  
ATOM   9253  O  O    . LEU A 1 8  ? -11.153 -6.799  5.230   1.00 0.00 ? 8   LEU A O    9  
ATOM   9254  C  CB   . LEU A 1 8  ? -14.205 -6.052  5.948   1.00 0.00 ? 8   LEU A CB   9  
ATOM   9255  C  CG   . LEU A 1 8  ? -15.427 -6.281  6.839   1.00 0.00 ? 8   LEU A CG   9  
ATOM   9256  C  CD1  . LEU A 1 8  ? -15.667 -5.076  7.735   1.00 0.00 ? 8   LEU A CD1  9  
ATOM   9257  C  CD2  . LEU A 1 8  ? -16.657 -6.571  5.992   1.00 0.00 ? 8   LEU A CD2  9  
ATOM   9258  H  H    . LEU A 1 8  ? -13.067 -7.774  7.479   1.00 0.00 ? 8   LEU A H    9  
ATOM   9259  H  HA   . LEU A 1 8  ? -14.151 -7.865  4.810   1.00 0.00 ? 8   LEU A HA   9  
ATOM   9260  H  HB2  . LEU A 1 8  ? -13.494 -5.464  6.508   1.00 0.00 ? 8   LEU A HB2  9  
ATOM   9261  H  HB3  . LEU A 1 8  ? -14.527 -5.496  5.080   1.00 0.00 ? 8   LEU A HB3  9  
ATOM   9262  H  HG   . LEU A 1 8  ? -15.247 -7.138  7.473   1.00 0.00 ? 8   LEU A HG   9  
ATOM   9263  H  HD11 . LEU A 1 8  ? -15.848 -5.410  8.746   1.00 0.00 ? 8   LEU A HD11 9  
ATOM   9264  H  HD12 . LEU A 1 8  ? -16.526 -4.527  7.378   1.00 0.00 ? 8   LEU A HD12 9  
ATOM   9265  H  HD13 . LEU A 1 8  ? -14.798 -4.435  7.717   1.00 0.00 ? 8   LEU A HD13 9  
ATOM   9266  H  HD21 . LEU A 1 8  ? -16.494 -7.470  5.416   1.00 0.00 ? 8   LEU A HD21 9  
ATOM   9267  H  HD22 . LEU A 1 8  ? -16.836 -5.743  5.321   1.00 0.00 ? 8   LEU A HD22 9  
ATOM   9268  H  HD23 . LEU A 1 8  ? -17.514 -6.706  6.635   1.00 0.00 ? 8   LEU A HD23 9  
ATOM   9269  N  N    . GLN A 1 9  ? -12.409 -6.733  3.363   1.00 0.00 ? 9   GLN A N    9  
ATOM   9270  C  CA   . GLN A 1 9  ? -11.297 -6.359  2.497   1.00 0.00 ? 9   GLN A CA   9  
ATOM   9271  C  C    . GLN A 1 9  ? -11.590 -5.050  1.771   1.00 0.00 ? 9   GLN A C    9  
ATOM   9272  O  O    . GLN A 1 9  ? -12.569 -4.944  1.031   1.00 0.00 ? 9   GLN A O    9  
ATOM   9273  C  CB   . GLN A 1 9  ? -11.017 -7.468  1.482   1.00 0.00 ? 9   GLN A CB   9  
ATOM   9274  C  CG   . GLN A 1 9  ? -9.739  -7.258  0.687   1.00 0.00 ? 9   GLN A CG   9  
ATOM   9275  C  CD   . GLN A 1 9  ? -8.533  -7.905  1.340   1.00 0.00 ? 9   GLN A CD   9  
ATOM   9276  O  OE1  . GLN A 1 9  ? -8.517  -9.112  1.582   1.00 0.00 ? 9   GLN A OE1  9  
ATOM   9277  N  NE2  . GLN A 1 9  ? -7.515  -7.103  1.629   1.00 0.00 ? 9   GLN A NE2  9  
ATOM   9278  H  H    . GLN A 1 9  ? -13.300 -6.848  2.974   1.00 0.00 ? 9   GLN A H    9  
ATOM   9279  H  HA   . GLN A 1 9  ? -10.424 -6.224  3.118   1.00 0.00 ? 9   GLN A HA   9  
ATOM   9280  H  HB2  . GLN A 1 9  ? -10.940 -8.409  2.006   1.00 0.00 ? 9   GLN A HB2  9  
ATOM   9281  H  HB3  . GLN A 1 9  ? -11.843 -7.520  0.787   1.00 0.00 ? 9   GLN A HB3  9  
ATOM   9282  H  HG2  . GLN A 1 9  ? -9.867  -7.684  -0.297  1.00 0.00 ? 9   GLN A HG2  9  
ATOM   9283  H  HG3  . GLN A 1 9  ? -9.556  -6.197  0.599   1.00 0.00 ? 9   GLN A HG3  9  
ATOM   9284  H  HE21 . GLN A 1 9  ? -7.598  -6.152  1.409   1.00 0.00 ? 9   GLN A HE21 9  
ATOM   9285  H  HE22 . GLN A 1 9  ? -6.723  -7.495  2.052   1.00 0.00 ? 9   GLN A HE22 9  
ATOM   9286  N  N    . CYS A 1 10 ? -10.735 -4.056  1.985   1.00 0.00 ? 10  CYS A N    9  
ATOM   9287  C  CA   . CYS A 1 10 ? -10.902 -2.753  1.352   1.00 0.00 ? 10  CYS A CA   9  
ATOM   9288  C  C    . CYS A 1 10 ? -10.597 -2.832  -0.141  1.00 0.00 ? 10  CYS A C    9  
ATOM   9289  O  O    . CYS A 1 10 ? -9.816  -3.673  -0.581  1.00 0.00 ? 10  CYS A O    9  
ATOM   9290  C  CB   . CYS A 1 10 ? -9.990  -1.720  2.016   1.00 0.00 ? 10  CYS A CB   9  
ATOM   9291  S  SG   . CYS A 1 10 ? -9.690  -0.234  1.005   1.00 0.00 ? 10  CYS A SG   9  
ATOM   9292  H  H    . CYS A 1 10 ? -9.973  -4.201  2.586   1.00 0.00 ? 10  CYS A H    9  
ATOM   9293  H  HA   . CYS A 1 10 ? -11.929 -2.450  1.482   1.00 0.00 ? 10  CYS A HA   9  
ATOM   9294  H  HB2  . CYS A 1 10 ? -10.439 -1.399  2.945   1.00 0.00 ? 10  CYS A HB2  9  
ATOM   9295  H  HB3  . CYS A 1 10 ? -9.033  -2.176  2.223   1.00 0.00 ? 10  CYS A HB3  9  
ATOM   9296  N  N    . GLU A 1 11 ? -11.221 -1.948  -0.914  1.00 0.00 ? 11  GLU A N    9  
ATOM   9297  C  CA   . GLU A 1 11 ? -11.017 -1.918  -2.357  1.00 0.00 ? 11  GLU A CA   9  
ATOM   9298  C  C    . GLU A 1 11 ? -10.020 -0.829  -2.743  1.00 0.00 ? 11  GLU A C    9  
ATOM   9299  O  O    . GLU A 1 11 ? -9.266  -0.976  -3.705  1.00 0.00 ? 11  GLU A O    9  
ATOM   9300  C  CB   . GLU A 1 11 ? -12.347 -1.685  -3.078  1.00 0.00 ? 11  GLU A CB   9  
ATOM   9301  C  CG   . GLU A 1 11 ? -12.919 -0.293  -2.866  1.00 0.00 ? 11  GLU A CG   9  
ATOM   9302  C  CD   . GLU A 1 11 ? -14.221 -0.078  -3.613  1.00 0.00 ? 11  GLU A CD   9  
ATOM   9303  O  OE1  . GLU A 1 11 ? -14.168 0.245   -4.818  1.00 0.00 ? 11  GLU A OE1  9  
ATOM   9304  O  OE2  . GLU A 1 11 ? -15.293 -0.233  -2.991  1.00 0.00 ? 11  GLU A OE2  9  
ATOM   9305  H  H    . GLU A 1 11 ? -11.833 -1.301  -0.503  1.00 0.00 ? 11  GLU A H    9  
ATOM   9306  H  HA   . GLU A 1 11 ? -10.620 -2.876  -2.656  1.00 0.00 ? 11  GLU A HA   9  
ATOM   9307  H  HB2  . GLU A 1 11 ? -12.200 -1.835  -4.137  1.00 0.00 ? 11  GLU A HB2  9  
ATOM   9308  H  HB3  . GLU A 1 11 ? -13.067 -2.405  -2.719  1.00 0.00 ? 11  GLU A HB3  9  
ATOM   9309  H  HG2  . GLU A 1 11 ? -13.098 -0.148  -1.812  1.00 0.00 ? 11  GLU A HG2  9  
ATOM   9310  H  HG3  . GLU A 1 11 ? -12.198 0.434   -3.211  1.00 0.00 ? 11  GLU A HG3  9  
ATOM   9311  N  N    . ILE A 1 12 ? -10.023 0.263   -1.986  1.00 0.00 ? 12  ILE A N    9  
ATOM   9312  C  CA   . ILE A 1 12 ? -9.119  1.376   -2.248  1.00 0.00 ? 12  ILE A CA   9  
ATOM   9313  C  C    . ILE A 1 12 ? -7.667  0.912   -2.268  1.00 0.00 ? 12  ILE A C    9  
ATOM   9314  O  O    . ILE A 1 12 ? -7.021  0.901   -3.317  1.00 0.00 ? 12  ILE A O    9  
ATOM   9315  C  CB   . ILE A 1 12 ? -9.276  2.489   -1.195  1.00 0.00 ? 12  ILE A CB   9  
ATOM   9316  C  CG1  . ILE A 1 12 ? -10.745 2.896   -1.067  1.00 0.00 ? 12  ILE A CG1  9  
ATOM   9317  C  CG2  . ILE A 1 12 ? -8.418  3.691   -1.563  1.00 0.00 ? 12  ILE A CG2  9  
ATOM   9318  C  CD1  . ILE A 1 12 ? -11.361 3.357   -2.369  1.00 0.00 ? 12  ILE A CD1  9  
ATOM   9319  H  H    . ILE A 1 12 ? -10.647 0.322   -1.234  1.00 0.00 ? 12  ILE A H    9  
ATOM   9320  H  HA   . ILE A 1 12 ? -9.368  1.786   -3.217  1.00 0.00 ? 12  ILE A HA   9  
ATOM   9321  H  HB   . ILE A 1 12 ? -8.931  2.107   -0.247  1.00 0.00 ? 12  ILE A HB   9  
ATOM   9322  H  HG12 . ILE A 1 12 ? -11.316 2.053   -0.712  1.00 0.00 ? 12  ILE A HG12 9  
ATOM   9323  H  HG13 . ILE A 1 12 ? -10.826 3.705   -0.356  1.00 0.00 ? 12  ILE A HG13 9  
ATOM   9324  H  HG21 . ILE A 1 12 ? -8.485  3.869   -2.626  1.00 0.00 ? 12  ILE A HG21 9  
ATOM   9325  H  HG22 . ILE A 1 12 ? -8.771  4.561   -1.030  1.00 0.00 ? 12  ILE A HG22 9  
ATOM   9326  H  HG23 . ILE A 1 12 ? -7.391  3.496   -1.294  1.00 0.00 ? 12  ILE A HG23 9  
ATOM   9327  H  HD11 . ILE A 1 12 ? -12.303 3.846   -2.170  1.00 0.00 ? 12  ILE A HD11 9  
ATOM   9328  H  HD12 . ILE A 1 12 ? -10.692 4.049   -2.859  1.00 0.00 ? 12  ILE A HD12 9  
ATOM   9329  H  HD13 . ILE A 1 12 ? -11.527 2.504   -3.011  1.00 0.00 ? 12  ILE A HD13 9  
ATOM   9330  N  N    . CYS A 1 13 ? -7.159  0.526   -1.102  1.00 0.00 ? 13  CYS A N    9  
ATOM   9331  C  CA   . CYS A 1 13 ? -5.783  0.059   -0.984  1.00 0.00 ? 13  CYS A CA   9  
ATOM   9332  C  C    . CYS A 1 13 ? -5.729  -1.465  -0.930  1.00 0.00 ? 13  CYS A C    9  
ATOM   9333  O  O    . CYS A 1 13 ? -4.879  -2.090  -1.564  1.00 0.00 ? 13  CYS A O    9  
ATOM   9334  C  CB   . CYS A 1 13 ? -5.127  0.648   0.267   1.00 0.00 ? 13  CYS A CB   9  
ATOM   9335  S  SG   . CYS A 1 13 ? -5.947  0.181   1.825   1.00 0.00 ? 13  CYS A SG   9  
ATOM   9336  H  H    . CYS A 1 13 ? -7.723  0.558   -0.301  1.00 0.00 ? 13  CYS A H    9  
ATOM   9337  H  HA   . CYS A 1 13 ? -5.242  0.395   -1.856  1.00 0.00 ? 13  CYS A HA   9  
ATOM   9338  H  HB2  . CYS A 1 13 ? -4.103  0.309   0.321   1.00 0.00 ? 13  CYS A HB2  9  
ATOM   9339  H  HB3  . CYS A 1 13 ? -5.141  1.726   0.197   1.00 0.00 ? 13  CYS A HB3  9  
ATOM   9340  N  N    . GLY A 1 14 ? -6.643  -2.058  -0.168  1.00 0.00 ? 14  GLY A N    9  
ATOM   9341  C  CA   . GLY A 1 14 ? -6.683  -3.503  -0.045  1.00 0.00 ? 14  GLY A CA   9  
ATOM   9342  C  C    . GLY A 1 14 ? -6.404  -3.973  1.369   1.00 0.00 ? 14  GLY A C    9  
ATOM   9343  O  O    . GLY A 1 14 ? -5.893  -5.074  1.576   1.00 0.00 ? 14  GLY A O    9  
ATOM   9344  H  H    . GLY A 1 14 ? -7.296  -1.509  0.315   1.00 0.00 ? 14  GLY A H    9  
ATOM   9345  H  HA2  . GLY A 1 14 ? -7.660  -3.852  -0.343  1.00 0.00 ? 14  GLY A HA2  9  
ATOM   9346  H  HA3  . GLY A 1 14 ? -5.943  -3.929  -0.706  1.00 0.00 ? 14  GLY A HA3  9  
ATOM   9347  N  N    . PHE A 1 15 ? -6.738  -3.136  2.345   1.00 0.00 ? 15  PHE A N    9  
ATOM   9348  C  CA   . PHE A 1 15 ? -6.517  -3.470  3.748   1.00 0.00 ? 15  PHE A CA   9  
ATOM   9349  C  C    . PHE A 1 15 ? -7.517  -4.521  4.220   1.00 0.00 ? 15  PHE A C    9  
ATOM   9350  O  O    . PHE A 1 15 ? -8.451  -4.875  3.500   1.00 0.00 ? 15  PHE A O    9  
ATOM   9351  C  CB   . PHE A 1 15 ? -6.630  -2.216  4.617   1.00 0.00 ? 15  PHE A CB   9  
ATOM   9352  C  CG   . PHE A 1 15 ? -6.171  -2.423  6.032   1.00 0.00 ? 15  PHE A CG   9  
ATOM   9353  C  CD1  . PHE A 1 15 ? -4.875  -2.834  6.300   1.00 0.00 ? 15  PHE A CD1  9  
ATOM   9354  C  CD2  . PHE A 1 15 ? -7.035  -2.209  7.093   1.00 0.00 ? 15  PHE A CD2  9  
ATOM   9355  C  CE1  . PHE A 1 15 ? -4.449  -3.026  7.601   1.00 0.00 ? 15  PHE A CE1  9  
ATOM   9356  C  CE2  . PHE A 1 15 ? -6.615  -2.399  8.396   1.00 0.00 ? 15  PHE A CE2  9  
ATOM   9357  C  CZ   . PHE A 1 15 ? -5.320  -2.809  8.650   1.00 0.00 ? 15  PHE A CZ   9  
ATOM   9358  H  H    . PHE A 1 15 ? -7.141  -2.272  2.117   1.00 0.00 ? 15  PHE A H    9  
ATOM   9359  H  HA   . PHE A 1 15 ? -5.520  -3.872  3.839   1.00 0.00 ? 15  PHE A HA   9  
ATOM   9360  H  HB2  . PHE A 1 15 ? -6.027  -1.431  4.185   1.00 0.00 ? 15  PHE A HB2  9  
ATOM   9361  H  HB3  . PHE A 1 15 ? -7.661  -1.898  4.644   1.00 0.00 ? 15  PHE A HB3  9  
ATOM   9362  H  HD1  . PHE A 1 15 ? -4.192  -3.004  5.479   1.00 0.00 ? 15  PHE A HD1  9  
ATOM   9363  H  HD2  . PHE A 1 15 ? -8.048  -1.889  6.896   1.00 0.00 ? 15  PHE A HD2  9  
ATOM   9364  H  HE1  . PHE A 1 15 ? -3.436  -3.346  7.796   1.00 0.00 ? 15  PHE A HE1  9  
ATOM   9365  H  HE2  . PHE A 1 15 ? -7.298  -2.229  9.214   1.00 0.00 ? 15  PHE A HE2  9  
ATOM   9366  H  HZ   . PHE A 1 15 ? -4.989  -2.957  9.667   1.00 0.00 ? 15  PHE A HZ   9  
ATOM   9367  N  N    . THR A 1 16 ? -7.313  -5.019  5.436   1.00 0.00 ? 16  THR A N    9  
ATOM   9368  C  CA   . THR A 1 16 ? -8.194  -6.031  6.005   1.00 0.00 ? 16  THR A CA   9  
ATOM   9369  C  C    . THR A 1 16 ? -8.559  -5.695  7.446   1.00 0.00 ? 16  THR A C    9  
ATOM   9370  O  O    . THR A 1 16 ? -7.688  -5.397  8.264   1.00 0.00 ? 16  THR A O    9  
ATOM   9371  C  CB   . THR A 1 16 ? -7.546  -7.428  5.964   1.00 0.00 ? 16  THR A CB   9  
ATOM   9372  O  OG1  . THR A 1 16 ? -6.126  -7.313  6.114   1.00 0.00 ? 16  THR A OG1  9  
ATOM   9373  C  CG2  . THR A 1 16 ? -7.867  -8.135  4.656   1.00 0.00 ? 16  THR A CG2  9  
ATOM   9374  H  H    . THR A 1 16 ? -6.551  -4.697  5.961   1.00 0.00 ? 16  THR A H    9  
ATOM   9375  H  HA   . THR A 1 16 ? -9.097  -6.059  5.412   1.00 0.00 ? 16  THR A HA   9  
ATOM   9376  H  HB   . THR A 1 16 ? -7.941  -8.015  6.780   1.00 0.00 ? 16  THR A HB   9  
ATOM   9377  H  HG1  . THR A 1 16 ? -5.690  -7.759  5.383   1.00 0.00 ? 16  THR A HG1  9  
ATOM   9378  H  HG21 . THR A 1 16 ? -8.918  -8.020  4.433   1.00 0.00 ? 16  THR A HG21 9  
ATOM   9379  H  HG22 . THR A 1 16 ? -7.631  -9.185  4.747   1.00 0.00 ? 16  THR A HG22 9  
ATOM   9380  H  HG23 . THR A 1 16 ? -7.281  -7.703  3.860   1.00 0.00 ? 16  THR A HG23 9  
ATOM   9381  N  N    . CYS A 1 17 ? -9.851  -5.746  7.751   1.00 0.00 ? 17  CYS A N    9  
ATOM   9382  C  CA   . CYS A 1 17 ? -10.332 -5.446  9.096   1.00 0.00 ? 17  CYS A CA   9  
ATOM   9383  C  C    . CYS A 1 17 ? -11.500 -6.352  9.470   1.00 0.00 ? 17  CYS A C    9  
ATOM   9384  O  O    . CYS A 1 17 ? -12.434 -6.532  8.689   1.00 0.00 ? 17  CYS A O    9  
ATOM   9385  C  CB   . CYS A 1 17 ? -10.756 -3.980  9.193   1.00 0.00 ? 17  CYS A CB   9  
ATOM   9386  S  SG   . CYS A 1 17 ? -12.134 -3.536  8.110   1.00 0.00 ? 17  CYS A SG   9  
ATOM   9387  H  H    . CYS A 1 17 ? -10.498 -5.990  7.057   1.00 0.00 ? 17  CYS A H    9  
ATOM   9388  H  HA   . CYS A 1 17 ? -9.519  -5.624  9.784   1.00 0.00 ? 17  CYS A HA   9  
ATOM   9389  H  HB2  . CYS A 1 17 ? -11.055 -3.766  10.209  1.00 0.00 ? 17  CYS A HB2  9  
ATOM   9390  H  HB3  . CYS A 1 17 ? -9.916  -3.352  8.933   1.00 0.00 ? 17  CYS A HB3  9  
ATOM   9391  H  HG   . CYS A 1 17 ? -11.934 -2.300  7.680   1.00 0.00 ? 17  CYS A HG   9  
ATOM   9392  N  N    . ARG A 1 18 ? -11.439 -6.921  10.669  1.00 0.00 ? 18  ARG A N    9  
ATOM   9393  C  CA   . ARG A 1 18 ? -12.491 -7.811  11.146  1.00 0.00 ? 18  ARG A CA   9  
ATOM   9394  C  C    . ARG A 1 18 ? -13.781 -7.039  11.405  1.00 0.00 ? 18  ARG A C    9  
ATOM   9395  O  O    . ARG A 1 18 ? -14.862 -7.464  10.999  1.00 0.00 ? 18  ARG A O    9  
ATOM   9396  C  CB   . ARG A 1 18 ? -12.045 -8.523  12.425  1.00 0.00 ? 18  ARG A CB   9  
ATOM   9397  C  CG   . ARG A 1 18 ? -10.872 -9.468  12.218  1.00 0.00 ? 18  ARG A CG   9  
ATOM   9398  C  CD   . ARG A 1 18 ? -9.555  -8.812  12.600  1.00 0.00 ? 18  ARG A CD   9  
ATOM   9399  N  NE   . ARG A 1 18 ? -9.220  -9.034  14.004  1.00 0.00 ? 18  ARG A NE   9  
ATOM   9400  C  CZ   . ARG A 1 18 ? -8.357  -9.955  14.417  1.00 0.00 ? 18  ARG A CZ   9  
ATOM   9401  N  NH1  . ARG A 1 18 ? -7.745  -10.736 13.538  1.00 0.00 ? 18  ARG A NH1  9  
ATOM   9402  N  NH2  . ARG A 1 18 ? -8.104  -10.097 15.712  1.00 0.00 ? 18  ARG A NH2  9  
ATOM   9403  H  H    . ARG A 1 18 ? -10.669 -6.739  11.247  1.00 0.00 ? 18  ARG A H    9  
ATOM   9404  H  HA   . ARG A 1 18 ? -12.675 -8.549  10.379  1.00 0.00 ? 18  ARG A HA   9  
ATOM   9405  H  HB2  . ARG A 1 18 ? -11.757 -7.781  13.155  1.00 0.00 ? 18  ARG A HB2  9  
ATOM   9406  H  HB3  . ARG A 1 18 ? -12.875 -9.094  12.812  1.00 0.00 ? 18  ARG A HB3  9  
ATOM   9407  H  HG2  . ARG A 1 18 ? -11.016 -10.345 12.832  1.00 0.00 ? 18  ARG A HG2  9  
ATOM   9408  H  HG3  . ARG A 1 18 ? -10.833 -9.756  11.178  1.00 0.00 ? 18  ARG A HG3  9  
ATOM   9409  H  HD2  . ARG A 1 18 ? -8.770  -9.224  11.984  1.00 0.00 ? 18  ARG A HD2  9  
ATOM   9410  H  HD3  . ARG A 1 18 ? -9.632  -7.750  12.422  1.00 0.00 ? 18  ARG A HD3  9  
ATOM   9411  H  HE   . ARG A 1 18 ? -9.661  -8.467  14.671  1.00 0.00 ? 18  ARG A HE   9  
ATOM   9412  H  HH11 . ARG A 1 18 ? -7.932  -10.631 12.562  1.00 0.00 ? 18  ARG A HH11 9  
ATOM   9413  H  HH12 . ARG A 1 18 ? -7.094  -11.429 13.851  1.00 0.00 ? 18  ARG A HH12 9  
ATOM   9414  H  HH21 . ARG A 1 18 ? -8.563  -9.509  16.378  1.00 0.00 ? 18  ARG A HH21 9  
ATOM   9415  H  HH22 . ARG A 1 18 ? -7.455  -10.790 16.022  1.00 0.00 ? 18  ARG A HH22 9  
ATOM   9416  N  N    . GLN A 1 19 ? -13.659 -5.903  12.084  1.00 0.00 ? 19  GLN A N    9  
ATOM   9417  C  CA   . GLN A 1 19 ? -14.815 -5.072  12.397  1.00 0.00 ? 19  GLN A CA   9  
ATOM   9418  C  C    . GLN A 1 19 ? -15.218 -4.224  11.196  1.00 0.00 ? 19  GLN A C    9  
ATOM   9419  O  O    . GLN A 1 19 ? -14.403 -3.948  10.316  1.00 0.00 ? 19  GLN A O    9  
ATOM   9420  C  CB   . GLN A 1 19 ? -14.512 -4.170  13.595  1.00 0.00 ? 19  GLN A CB   9  
ATOM   9421  C  CG   . GLN A 1 19 ? -14.019 -4.928  14.817  1.00 0.00 ? 19  GLN A CG   9  
ATOM   9422  C  CD   . GLN A 1 19 ? -12.507 -5.031  14.869  1.00 0.00 ? 19  GLN A CD   9  
ATOM   9423  O  OE1  . GLN A 1 19 ? -11.934 -6.076  14.559  1.00 0.00 ? 19  GLN A OE1  9  
ATOM   9424  N  NE2  . GLN A 1 19 ? -11.852 -3.945  15.262  1.00 0.00 ? 19  GLN A NE2  9  
ATOM   9425  H  H    . GLN A 1 19 ? -12.770 -5.617  12.380  1.00 0.00 ? 19  GLN A H    9  
ATOM   9426  H  HA   . GLN A 1 19 ? -15.635 -5.728  12.650  1.00 0.00 ? 19  GLN A HA   9  
ATOM   9427  H  HB2  . GLN A 1 19 ? -13.754 -3.456  13.310  1.00 0.00 ? 19  GLN A HB2  9  
ATOM   9428  H  HB3  . GLN A 1 19 ? -15.412 -3.639  13.867  1.00 0.00 ? 19  GLN A HB3  9  
ATOM   9429  H  HG2  . GLN A 1 19 ? -14.359 -4.415  15.705  1.00 0.00 ? 19  GLN A HG2  9  
ATOM   9430  H  HG3  . GLN A 1 19 ? -14.433 -5.925  14.798  1.00 0.00 ? 19  GLN A HG3  9  
ATOM   9431  H  HE21 . GLN A 1 19 ? -12.375 -3.149  15.494  1.00 0.00 ? 19  GLN A HE21 9  
ATOM   9432  H  HE22 . GLN A 1 19 ? -10.875 -3.984  15.305  1.00 0.00 ? 19  GLN A HE22 9  
ATOM   9433  N  N    . LYS A 1 20 ? -16.481 -3.812  11.165  1.00 0.00 ? 20  LYS A N    9  
ATOM   9434  C  CA   . LYS A 1 20 ? -16.993 -2.994  10.072  1.00 0.00 ? 20  LYS A CA   9  
ATOM   9435  C  C    . LYS A 1 20 ? -16.593 -1.533  10.253  1.00 0.00 ? 20  LYS A C    9  
ATOM   9436  O  O    . LYS A 1 20 ? -16.036 -0.916  9.345   1.00 0.00 ? 20  LYS A O    9  
ATOM   9437  C  CB   . LYS A 1 20 ? -18.517 -3.110  9.992   1.00 0.00 ? 20  LYS A CB   9  
ATOM   9438  C  CG   . LYS A 1 20 ? -18.995 -4.298  9.176   1.00 0.00 ? 20  LYS A CG   9  
ATOM   9439  C  CD   . LYS A 1 20 ? -18.708 -5.612  9.883   1.00 0.00 ? 20  LYS A CD   9  
ATOM   9440  C  CE   . LYS A 1 20 ? -19.550 -6.745  9.316   1.00 0.00 ? 20  LYS A CE   9  
ATOM   9441  N  NZ   . LYS A 1 20 ? -20.887 -6.822  9.968   1.00 0.00 ? 20  LYS A NZ   9  
ATOM   9442  H  H    . LYS A 1 20 ? -17.084 -4.065  11.896  1.00 0.00 ? 20  LYS A H    9  
ATOM   9443  H  HA   . LYS A 1 20 ? -16.564 -3.362  9.153   1.00 0.00 ? 20  LYS A HA   9  
ATOM   9444  H  HB2  . LYS A 1 20 ? -18.912 -3.205  10.993  1.00 0.00 ? 20  LYS A HB2  9  
ATOM   9445  H  HB3  . LYS A 1 20 ? -18.911 -2.209  9.543   1.00 0.00 ? 20  LYS A HB3  9  
ATOM   9446  H  HG2  . LYS A 1 20 ? -20.060 -4.211  9.019   1.00 0.00 ? 20  LYS A HG2  9  
ATOM   9447  H  HG3  . LYS A 1 20 ? -18.487 -4.295  8.222   1.00 0.00 ? 20  LYS A HG3  9  
ATOM   9448  H  HD2  . LYS A 1 20 ? -17.664 -5.858  9.759   1.00 0.00 ? 20  LYS A HD2  9  
ATOM   9449  H  HD3  . LYS A 1 20 ? -18.931 -5.500  10.935  1.00 0.00 ? 20  LYS A HD3  9  
ATOM   9450  H  HE2  . LYS A 1 20 ? -19.684 -6.582  8.258   1.00 0.00 ? 20  LYS A HE2  9  
ATOM   9451  H  HE3  . LYS A 1 20 ? -19.028 -7.677  9.474   1.00 0.00 ? 20  LYS A HE3  9  
ATOM   9452  H  HZ1  . LYS A 1 20 ? -20.984 -6.064  10.673  1.00 0.00 ? 20  LYS A HZ1  9  
ATOM   9453  H  HZ2  . LYS A 1 20 ? -21.000 -7.740  10.444  1.00 0.00 ? 20  LYS A HZ2  9  
ATOM   9454  H  HZ3  . LYS A 1 20 ? -21.638 -6.718  9.256   1.00 0.00 ? 20  LYS A HZ3  9  
ATOM   9455  N  N    . ALA A 1 21 ? -16.879 -0.987  11.430  1.00 0.00 ? 21  ALA A N    9  
ATOM   9456  C  CA   . ALA A 1 21 ? -16.545 0.400   11.729  1.00 0.00 ? 21  ALA A CA   9  
ATOM   9457  C  C    . ALA A 1 21 ? -15.153 0.753   11.215  1.00 0.00 ? 21  ALA A C    9  
ATOM   9458  O  O    . ALA A 1 21 ? -14.983 1.718   10.470  1.00 0.00 ? 21  ALA A O    9  
ATOM   9459  C  CB   . ALA A 1 21 ? -16.635 0.653   13.227  1.00 0.00 ? 21  ALA A CB   9  
ATOM   9460  H  H    . ALA A 1 21 ? -17.323 -1.530  12.113  1.00 0.00 ? 21  ALA A H    9  
ATOM   9461  H  HA   . ALA A 1 21 ? -17.270 1.032   11.238  1.00 0.00 ? 21  ALA A HA   9  
ATOM   9462  H  HB1  . ALA A 1 21 ? -16.117 1.570   13.468  1.00 0.00 ? 21  ALA A HB1  9  
ATOM   9463  H  HB2  . ALA A 1 21 ? -17.672 0.739   13.515  1.00 0.00 ? 21  ALA A HB2  9  
ATOM   9464  H  HB3  . ALA A 1 21 ? -16.180 -0.169  13.759  1.00 0.00 ? 21  ALA A HB3  9  
ATOM   9465  N  N    . SER A 1 22 ? -14.161 -0.034  11.617  1.00 0.00 ? 22  SER A N    9  
ATOM   9466  C  CA   . SER A 1 22 ? -12.783 0.199   11.200  1.00 0.00 ? 22  SER A CA   9  
ATOM   9467  C  C    . SER A 1 22 ? -12.715 0.530   9.712   1.00 0.00 ? 22  SER A C    9  
ATOM   9468  O  O    . SER A 1 22 ? -12.074 1.502   9.309   1.00 0.00 ? 22  SER A O    9  
ATOM   9469  C  CB   . SER A 1 22 ? -11.922 -1.030  11.500  1.00 0.00 ? 22  SER A CB   9  
ATOM   9470  O  OG   . SER A 1 22 ? -12.501 -2.203  10.956  1.00 0.00 ? 22  SER A OG   9  
ATOM   9471  H  H    . SER A 1 22 ? -14.360 -0.788  12.211  1.00 0.00 ? 22  SER A H    9  
ATOM   9472  H  HA   . SER A 1 22 ? -12.404 1.040   11.762  1.00 0.00 ? 22  SER A HA   9  
ATOM   9473  H  HB2  . SER A 1 22 ? -10.942 -0.893  11.070  1.00 0.00 ? 22  SER A HB2  9  
ATOM   9474  H  HB3  . SER A 1 22 ? -11.833 -1.150  12.570  1.00 0.00 ? 22  SER A HB3  9  
ATOM   9475  H  HG   . SER A 1 22 ? -12.888 -2.726  11.661  1.00 0.00 ? 22  SER A HG   9  
ATOM   9476  N  N    . LEU A 1 23 ? -13.380 -0.284  8.900   1.00 0.00 ? 23  LEU A N    9  
ATOM   9477  C  CA   . LEU A 1 23 ? -13.395 -0.079  7.456   1.00 0.00 ? 23  LEU A CA   9  
ATOM   9478  C  C    . LEU A 1 23 ? -13.927 1.308   7.109   1.00 0.00 ? 23  LEU A C    9  
ATOM   9479  O  O    . LEU A 1 23 ? -13.285 2.065   6.381   1.00 0.00 ? 23  LEU A O    9  
ATOM   9480  C  CB   . LEU A 1 23 ? -14.252 -1.150  6.778   1.00 0.00 ? 23  LEU A CB   9  
ATOM   9481  C  CG   . LEU A 1 23 ? -13.933 -1.435  5.310   1.00 0.00 ? 23  LEU A CG   9  
ATOM   9482  C  CD1  . LEU A 1 23 ? -12.560 -2.076  5.177   1.00 0.00 ? 23  LEU A CD1  9  
ATOM   9483  C  CD2  . LEU A 1 23 ? -15.002 -2.327  4.696   1.00 0.00 ? 23  LEU A CD2  9  
ATOM   9484  H  H    . LEU A 1 23 ? -13.872 -1.041  9.280   1.00 0.00 ? 23  LEU A H    9  
ATOM   9485  H  HA   . LEU A 1 23 ? -12.380 -0.162  7.098   1.00 0.00 ? 23  LEU A HA   9  
ATOM   9486  H  HB2  . LEU A 1 23 ? -14.127 -2.070  7.328   1.00 0.00 ? 23  LEU A HB2  9  
ATOM   9487  H  HB3  . LEU A 1 23 ? -15.284 -0.834  6.838   1.00 0.00 ? 23  LEU A HB3  9  
ATOM   9488  H  HG   . LEU A 1 23 ? -13.920 -0.502  4.764   1.00 0.00 ? 23  LEU A HG   9  
ATOM   9489  H  HD11 . LEU A 1 23 ? -12.286 -2.126  4.134   1.00 0.00 ? 23  LEU A HD11 9  
ATOM   9490  H  HD12 . LEU A 1 23 ? -12.586 -3.073  5.592   1.00 0.00 ? 23  LEU A HD12 9  
ATOM   9491  H  HD13 . LEU A 1 23 ? -11.833 -1.483  5.713   1.00 0.00 ? 23  LEU A HD13 9  
ATOM   9492  H  HD21 . LEU A 1 23 ? -14.883 -2.343  3.623   1.00 0.00 ? 23  LEU A HD21 9  
ATOM   9493  H  HD22 . LEU A 1 23 ? -15.980 -1.941  4.944   1.00 0.00 ? 23  LEU A HD22 9  
ATOM   9494  H  HD23 . LEU A 1 23 ? -14.901 -3.330  5.084   1.00 0.00 ? 23  LEU A HD23 9  
ATOM   9495  N  N    . ASN A 1 24 ? -15.102 1.635   7.637   1.00 0.00 ? 24  ASN A N    9  
ATOM   9496  C  CA   . ASN A 1 24 ? -15.718 2.932   7.384   1.00 0.00 ? 24  ASN A CA   9  
ATOM   9497  C  C    . ASN A 1 24 ? -14.772 4.068   7.763   1.00 0.00 ? 24  ASN A C    9  
ATOM   9498  O  O    . ASN A 1 24 ? -14.589 5.017   7.001   1.00 0.00 ? 24  ASN A O    9  
ATOM   9499  C  CB   . ASN A 1 24 ? -17.026 3.060   8.168   1.00 0.00 ? 24  ASN A CB   9  
ATOM   9500  C  CG   . ASN A 1 24 ? -18.168 2.305   7.514   1.00 0.00 ? 24  ASN A CG   9  
ATOM   9501  O  OD1  . ASN A 1 24 ? -19.109 2.906   6.997   1.00 0.00 ? 24  ASN A OD1  9  
ATOM   9502  N  ND2  . ASN A 1 24 ? -18.088 0.979   7.536   1.00 0.00 ? 24  ASN A ND2  9  
ATOM   9503  H  H    . ASN A 1 24 ? -15.565 0.989   8.209   1.00 0.00 ? 24  ASN A H    9  
ATOM   9504  H  HA   . ASN A 1 24 ? -15.934 2.997   6.328   1.00 0.00 ? 24  ASN A HA   9  
ATOM   9505  H  HB2  . ASN A 1 24 ? -16.882 2.666   9.163   1.00 0.00 ? 24  ASN A HB2  9  
ATOM   9506  H  HB3  . ASN A 1 24 ? -17.299 4.102   8.234   1.00 0.00 ? 24  ASN A HB3  9  
ATOM   9507  H  HD21 . ASN A 1 24 ? -17.309 0.568   7.965   1.00 0.00 ? 24  ASN A HD21 9  
ATOM   9508  H  HD22 . ASN A 1 24 ? -18.812 0.466   7.120   1.00 0.00 ? 24  ASN A HD22 9  
ATOM   9509  N  N    . TRP A 1 25 ? -14.175 3.962   8.944   1.00 0.00 ? 25  TRP A N    9  
ATOM   9510  C  CA   . TRP A 1 25 ? -13.247 4.980   9.425   1.00 0.00 ? 25  TRP A CA   9  
ATOM   9511  C  C    . TRP A 1 25 ? -11.972 4.993   8.588   1.00 0.00 ? 25  TRP A C    9  
ATOM   9512  O  O    . TRP A 1 25 ? -11.355 6.041   8.395   1.00 0.00 ? 25  TRP A O    9  
ATOM   9513  C  CB   . TRP A 1 25 ? -12.904 4.734   10.895  1.00 0.00 ? 25  TRP A CB   9  
ATOM   9514  C  CG   . TRP A 1 25 ? -11.605 5.354   11.314  1.00 0.00 ? 25  TRP A CG   9  
ATOM   9515  C  CD1  . TRP A 1 25 ? -10.350 4.940   10.968  1.00 0.00 ? 25  TRP A CD1  9  
ATOM   9516  C  CD2  . TRP A 1 25 ? -11.435 6.497   12.158  1.00 0.00 ? 25  TRP A CD2  9  
ATOM   9517  N  NE1  . TRP A 1 25 ? -9.410  5.758   11.547  1.00 0.00 ? 25  TRP A NE1  9  
ATOM   9518  C  CE2  . TRP A 1 25 ? -10.050 6.722   12.282  1.00 0.00 ? 25  TRP A CE2  9  
ATOM   9519  C  CE3  . TRP A 1 25 ? -12.318 7.355   12.821  1.00 0.00 ? 25  TRP A CE3  9  
ATOM   9520  C  CZ2  . TRP A 1 25 ? -9.530  7.766   13.041  1.00 0.00 ? 25  TRP A CZ2  9  
ATOM   9521  C  CZ3  . TRP A 1 25 ? -11.800 8.391   13.574  1.00 0.00 ? 25  TRP A CZ3  9  
ATOM   9522  C  CH2  . TRP A 1 25 ? -10.417 8.591   13.679  1.00 0.00 ? 25  TRP A CH2  9  
ATOM   9523  H  H    . TRP A 1 25 ? -14.361 3.181   9.507   1.00 0.00 ? 25  TRP A H    9  
ATOM   9524  H  HA   . TRP A 1 25 ? -13.733 5.940   9.334   1.00 0.00 ? 25  TRP A HA   9  
ATOM   9525  H  HB2  . TRP A 1 25 ? -13.686 5.146   11.514  1.00 0.00 ? 25  TRP A HB2  9  
ATOM   9526  H  HB3  . TRP A 1 25 ? -12.837 3.669   11.067  1.00 0.00 ? 25  TRP A HB3  9  
ATOM   9527  H  HD1  . TRP A 1 25 ? -10.143 4.092   10.334  1.00 0.00 ? 25  TRP A HD1  9  
ATOM   9528  H  HE1  . TRP A 1 25 ? -8.439  5.667   11.449  1.00 0.00 ? 25  TRP A HE1  9  
ATOM   9529  H  HE3  . TRP A 1 25 ? -13.387 7.218   12.752  1.00 0.00 ? 25  TRP A HE3  9  
ATOM   9530  H  HZ2  . TRP A 1 25 ? -8.466  7.934   13.131  1.00 0.00 ? 25  TRP A HZ2  9  
ATOM   9531  H  HZ3  . TRP A 1 25 ? -12.467 9.064   14.093  1.00 0.00 ? 25  TRP A HZ3  9  
ATOM   9532  H  HH2  . TRP A 1 25 ? -10.057 9.413   14.278  1.00 0.00 ? 25  TRP A HH2  9  
ATOM   9533  N  N    . HIS A 1 26 ? -11.583 3.823   8.092   1.00 0.00 ? 26  HIS A N    9  
ATOM   9534  C  CA   . HIS A 1 26 ? -10.381 3.701   7.274   1.00 0.00 ? 26  HIS A CA   9  
ATOM   9535  C  C    . HIS A 1 26 ? -10.666 4.094   5.828   1.00 0.00 ? 26  HIS A C    9  
ATOM   9536  O  O    . HIS A 1 26 ? -9.746  4.375   5.060   1.00 0.00 ? 26  HIS A O    9  
ATOM   9537  C  CB   . HIS A 1 26 ? -9.844  2.270   7.330   1.00 0.00 ? 26  HIS A CB   9  
ATOM   9538  C  CG   . HIS A 1 26 ? -9.121  1.853   6.087   1.00 0.00 ? 26  HIS A CG   9  
ATOM   9539  N  ND1  . HIS A 1 26 ? -7.801  2.169   5.842   1.00 0.00 ? 26  HIS A ND1  9  
ATOM   9540  C  CD2  . HIS A 1 26 ? -9.540  1.139   5.016   1.00 0.00 ? 26  HIS A CD2  9  
ATOM   9541  C  CE1  . HIS A 1 26 ? -7.441  1.669   4.673   1.00 0.00 ? 26  HIS A CE1  9  
ATOM   9542  N  NE2  . HIS A 1 26 ? -8.478  1.039   4.152   1.00 0.00 ? 26  HIS A NE2  9  
ATOM   9543  H  H    . HIS A 1 26 ? -12.116 3.023   8.280   1.00 0.00 ? 26  HIS A H    9  
ATOM   9544  H  HA   . HIS A 1 26 ? -9.637  4.371   7.677   1.00 0.00 ? 26  HIS A HA   9  
ATOM   9545  H  HB2  . HIS A 1 26 ? -9.156  2.183   8.158   1.00 0.00 ? 26  HIS A HB2  9  
ATOM   9546  H  HB3  . HIS A 1 26 ? -10.668 1.588   7.480   1.00 0.00 ? 26  HIS A HB3  9  
ATOM   9547  H  HD1  . HIS A 1 26 ? -7.216  2.684   6.435   1.00 0.00 ? 26  HIS A HD1  9  
ATOM   9548  H  HD2  . HIS A 1 26 ? -10.528 0.725   4.868   1.00 0.00 ? 26  HIS A HD2  9  
ATOM   9549  H  HE1  . HIS A 1 26 ? -6.465  1.759   4.221   1.00 0.00 ? 26  HIS A HE1  9  
ATOM   9550  N  N    . GLN A 1 27 ? -11.944 4.109   5.465   1.00 0.00 ? 27  GLN A N    9  
ATOM   9551  C  CA   . GLN A 1 27 ? -12.349 4.466   4.110   1.00 0.00 ? 27  GLN A CA   9  
ATOM   9552  C  C    . GLN A 1 27 ? -12.562 5.971   3.984   1.00 0.00 ? 27  GLN A C    9  
ATOM   9553  O  O    . GLN A 1 27 ? -12.255 6.567   2.952   1.00 0.00 ? 27  GLN A O    9  
ATOM   9554  C  CB   . GLN A 1 27 ? -13.629 3.724   3.725   1.00 0.00 ? 27  GLN A CB   9  
ATOM   9555  C  CG   . GLN A 1 27 ? -13.387 2.305   3.237   1.00 0.00 ? 27  GLN A CG   9  
ATOM   9556  C  CD   . GLN A 1 27 ? -14.668 1.505   3.108   1.00 0.00 ? 27  GLN A CD   9  
ATOM   9557  O  OE1  . GLN A 1 27 ? -15.744 1.970   3.485   1.00 0.00 ? 27  GLN A OE1  9  
ATOM   9558  N  NE2  . GLN A 1 27 ? -14.559 0.294   2.574   1.00 0.00 ? 27  GLN A NE2  9  
ATOM   9559  H  H    . GLN A 1 27 ? -12.631 3.875   6.123   1.00 0.00 ? 27  GLN A H    9  
ATOM   9560  H  HA   . GLN A 1 27 ? -11.557 4.170   3.439   1.00 0.00 ? 27  GLN A HA   9  
ATOM   9561  H  HB2  . GLN A 1 27 ? -14.278 3.679   4.587   1.00 0.00 ? 27  GLN A HB2  9  
ATOM   9562  H  HB3  . GLN A 1 27 ? -14.126 4.272   2.939   1.00 0.00 ? 27  GLN A HB3  9  
ATOM   9563  H  HG2  . GLN A 1 27 ? -12.909 2.348   2.269   1.00 0.00 ? 27  GLN A HG2  9  
ATOM   9564  H  HG3  . GLN A 1 27 ? -12.735 1.804   3.937   1.00 0.00 ? 27  GLN A HG3  9  
ATOM   9565  H  HE21 . GLN A 1 27 ? -13.669 -0.011  2.298   1.00 0.00 ? 27  GLN A HE21 9  
ATOM   9566  H  HE22 . GLN A 1 27 ? -15.371 -0.245  2.480   1.00 0.00 ? 27  GLN A HE22 9  
ATOM   9567  N  N    . ARG A 1 28 ? -13.090 6.579   5.041   1.00 0.00 ? 28  ARG A N    9  
ATOM   9568  C  CA   . ARG A 1 28 ? -13.346 8.015   5.048   1.00 0.00 ? 28  ARG A CA   9  
ATOM   9569  C  C    . ARG A 1 28 ? -12.055 8.798   4.829   1.00 0.00 ? 28  ARG A C    9  
ATOM   9570  O  O    . ARG A 1 28 ? -12.067 9.888   4.256   1.00 0.00 ? 28  ARG A O    9  
ATOM   9571  C  CB   . ARG A 1 28 ? -13.990 8.433   6.371   1.00 0.00 ? 28  ARG A CB   9  
ATOM   9572  C  CG   . ARG A 1 28 ? -12.991 8.634   7.499   1.00 0.00 ? 28  ARG A CG   9  
ATOM   9573  C  CD   . ARG A 1 28 ? -13.666 8.570   8.860   1.00 0.00 ? 28  ARG A CD   9  
ATOM   9574  N  NE   . ARG A 1 28 ? -14.239 9.856   9.247   1.00 0.00 ? 28  ARG A NE   9  
ATOM   9575  C  CZ   . ARG A 1 28 ? -15.538 10.131  9.185   1.00 0.00 ? 28  ARG A CZ   9  
ATOM   9576  N  NH1  . ARG A 1 28 ? -16.393 9.213   8.755   1.00 0.00 ? 28  ARG A NH1  9  
ATOM   9577  N  NH2  . ARG A 1 28 ? -15.983 11.325  9.555   1.00 0.00 ? 28  ARG A NH2  9  
ATOM   9578  H  H    . ARG A 1 28 ? -13.314 6.050   5.836   1.00 0.00 ? 28  ARG A H    9  
ATOM   9579  H  HA   . ARG A 1 28 ? -14.028 8.234   4.241   1.00 0.00 ? 28  ARG A HA   9  
ATOM   9580  H  HB2  . ARG A 1 28 ? -14.522 9.362   6.222   1.00 0.00 ? 28  ARG A HB2  9  
ATOM   9581  H  HB3  . ARG A 1 28 ? -14.692 7.670   6.673   1.00 0.00 ? 28  ARG A HB3  9  
ATOM   9582  H  HG2  . ARG A 1 28 ? -12.241 7.858   7.445   1.00 0.00 ? 28  ARG A HG2  9  
ATOM   9583  H  HG3  . ARG A 1 28 ? -12.522 9.600   7.384   1.00 0.00 ? 28  ARG A HG3  9  
ATOM   9584  H  HD2  . ARG A 1 28 ? -14.454 7.833   8.822   1.00 0.00 ? 28  ARG A HD2  9  
ATOM   9585  H  HD3  . ARG A 1 28 ? -12.933 8.276   9.597   1.00 0.00 ? 28  ARG A HD3  9  
ATOM   9586  H  HE   . ARG A 1 28 ? -13.625 10.549  9.568   1.00 0.00 ? 28  ARG A HE   9  
ATOM   9587  H  HH11 . ARG A 1 28 ? -16.060 8.313   8.476   1.00 0.00 ? 28  ARG A HH11 9  
ATOM   9588  H  HH12 . ARG A 1 28 ? -17.370 9.422   8.710   1.00 0.00 ? 28  ARG A HH12 9  
ATOM   9589  H  HH21 . ARG A 1 28 ? -15.341 12.018  9.881   1.00 0.00 ? 28  ARG A HH21 9  
ATOM   9590  H  HH22 . ARG A 1 28 ? -16.960 11.530  9.508   1.00 0.00 ? 28  ARG A HH22 9  
ATOM   9591  N  N    . LYS A 1 29 ? -10.942 8.236   5.289   1.00 0.00 ? 29  LYS A N    9  
ATOM   9592  C  CA   . LYS A 1 29 ? -9.642  8.880   5.143   1.00 0.00 ? 29  LYS A CA   9  
ATOM   9593  C  C    . LYS A 1 29 ? -9.156  8.803   3.699   1.00 0.00 ? 29  LYS A C    9  
ATOM   9594  O  O    . LYS A 1 29 ? -8.515  9.728   3.199   1.00 0.00 ? 29  LYS A O    9  
ATOM   9595  C  CB   . LYS A 1 29 ? -8.618  8.225   6.072   1.00 0.00 ? 29  LYS A CB   9  
ATOM   9596  C  CG   . LYS A 1 29 ? -8.034  6.935   5.522   1.00 0.00 ? 29  LYS A CG   9  
ATOM   9597  C  CD   . LYS A 1 29 ? -7.415  6.089   6.622   1.00 0.00 ? 29  LYS A CD   9  
ATOM   9598  C  CE   . LYS A 1 29 ? -6.608  4.934   6.049   1.00 0.00 ? 29  LYS A CE   9  
ATOM   9599  N  NZ   . LYS A 1 29 ? -5.468  5.412   5.218   1.00 0.00 ? 29  LYS A NZ   9  
ATOM   9600  H  H    . LYS A 1 29 ? -10.997 7.365   5.737   1.00 0.00 ? 29  LYS A H    9  
ATOM   9601  H  HA   . LYS A 1 29 ? -9.753  9.918   5.418   1.00 0.00 ? 29  LYS A HA   9  
ATOM   9602  H  HB2  . LYS A 1 29 ? -7.808  8.919   6.243   1.00 0.00 ? 29  LYS A HB2  9  
ATOM   9603  H  HB3  . LYS A 1 29 ? -9.096  8.004   7.016   1.00 0.00 ? 29  LYS A HB3  9  
ATOM   9604  H  HG2  . LYS A 1 29 ? -8.821  6.368   5.046   1.00 0.00 ? 29  LYS A HG2  9  
ATOM   9605  H  HG3  . LYS A 1 29 ? -7.272  7.178   4.794   1.00 0.00 ? 29  LYS A HG3  9  
ATOM   9606  H  HD2  . LYS A 1 29 ? -6.762  6.710   7.217   1.00 0.00 ? 29  LYS A HD2  9  
ATOM   9607  H  HD3  . LYS A 1 29 ? -8.204  5.692   7.245   1.00 0.00 ? 29  LYS A HD3  9  
ATOM   9608  H  HE2  . LYS A 1 29 ? -6.224  4.341   6.864   1.00 0.00 ? 29  LYS A HE2  9  
ATOM   9609  H  HE3  . LYS A 1 29 ? -7.258  4.326   5.437   1.00 0.00 ? 29  LYS A HE3  9  
ATOM   9610  H  HZ1  . LYS A 1 29 ? -4.739  4.674   5.154   1.00 0.00 ? 29  LYS A HZ1  9  
ATOM   9611  H  HZ2  . LYS A 1 29 ? -5.048  6.263   5.644   1.00 0.00 ? 29  LYS A HZ2  9  
ATOM   9612  H  HZ3  . LYS A 1 29 ? -5.797  5.644   4.259   1.00 0.00 ? 29  LYS A HZ3  9  
ATOM   9613  N  N    . HIS A 1 30 ? -9.466  7.695   3.033   1.00 0.00 ? 30  HIS A N    9  
ATOM   9614  C  CA   . HIS A 1 30 ? -9.062  7.499   1.645   1.00 0.00 ? 30  HIS A CA   9  
ATOM   9615  C  C    . HIS A 1 30 ? -9.471  8.691   0.787   1.00 0.00 ? 30  HIS A C    9  
ATOM   9616  O  O    . HIS A 1 30 ? -8.718  9.131   -0.082  1.00 0.00 ? 30  HIS A O    9  
ATOM   9617  C  CB   . HIS A 1 30 ? -9.681  6.217   1.088   1.00 0.00 ? 30  HIS A CB   9  
ATOM   9618  C  CG   . HIS A 1 30 ? -8.843  4.997   1.318   1.00 0.00 ? 30  HIS A CG   9  
ATOM   9619  N  ND1  . HIS A 1 30 ? -7.465  5.017   1.303   1.00 0.00 ? 30  HIS A ND1  9  
ATOM   9620  C  CD2  . HIS A 1 30 ? -9.197  3.715   1.572   1.00 0.00 ? 30  HIS A CD2  9  
ATOM   9621  C  CE1  . HIS A 1 30 ? -7.006  3.801   1.535   1.00 0.00 ? 30  HIS A CE1  9  
ATOM   9622  N  NE2  . HIS A 1 30 ? -8.037  2.992   1.703   1.00 0.00 ? 30  HIS A NE2  9  
ATOM   9623  H  H    . HIS A 1 30 ? -9.978  6.993   3.486   1.00 0.00 ? 30  HIS A H    9  
ATOM   9624  H  HA   . HIS A 1 30 ? -7.986  7.407   1.623   1.00 0.00 ? 30  HIS A HA   9  
ATOM   9625  H  HB2  . HIS A 1 30 ? -10.640 6.054   1.559   1.00 0.00 ? 30  HIS A HB2  9  
ATOM   9626  H  HB3  . HIS A 1 30 ? -9.823  6.327   0.023   1.00 0.00 ? 30  HIS A HB3  9  
ATOM   9627  H  HD1  . HIS A 1 30 ? -6.906  5.806   1.144   1.00 0.00 ? 30  HIS A HD1  9  
ATOM   9628  H  HD2  . HIS A 1 30 ? -10.204 3.332   1.655   1.00 0.00 ? 30  HIS A HD2  9  
ATOM   9629  H  HE1  . HIS A 1 30 ? -5.966  3.515   1.582   1.00 0.00 ? 30  HIS A HE1  9  
ATOM   9630  N  N    . ALA A 1 31 ? -10.670 9.209   1.035   1.00 0.00 ? 31  ALA A N    9  
ATOM   9631  C  CA   . ALA A 1 31 ? -11.179 10.351  0.285   1.00 0.00 ? 31  ALA A CA   9  
ATOM   9632  C  C    . ALA A 1 31 ? -10.183 11.505  0.300   1.00 0.00 ? 31  ALA A C    9  
ATOM   9633  O  O    . ALA A 1 31 ? -9.977  12.172  -0.714  1.00 0.00 ? 31  ALA A O    9  
ATOM   9634  C  CB   . ALA A 1 31 ? -12.518 10.800  0.852   1.00 0.00 ? 31  ALA A CB   9  
ATOM   9635  H  H    . ALA A 1 31 ? -11.224 8.815   1.740   1.00 0.00 ? 31  ALA A H    9  
ATOM   9636  H  HA   . ALA A 1 31 ? -11.335 10.037  -0.737  1.00 0.00 ? 31  ALA A HA   9  
ATOM   9637  H  HB1  . ALA A 1 31 ? -12.507 11.871  0.992   1.00 0.00 ? 31  ALA A HB1  9  
ATOM   9638  H  HB2  . ALA A 1 31 ? -13.307 10.534  0.164   1.00 0.00 ? 31  ALA A HB2  9  
ATOM   9639  H  HB3  . ALA A 1 31 ? -12.688 10.313  1.801   1.00 0.00 ? 31  ALA A HB3  9  
ATOM   9640  N  N    . GLU A 1 32 ? -9.568  11.736  1.456   1.00 0.00 ? 32  GLU A N    9  
ATOM   9641  C  CA   . GLU A 1 32 ? -8.595  12.812  1.602   1.00 0.00 ? 32  GLU A CA   9  
ATOM   9642  C  C    . GLU A 1 32 ? -7.218  12.370  1.114   1.00 0.00 ? 32  GLU A C    9  
ATOM   9643  O  O    . GLU A 1 32 ? -6.525  13.111  0.417   1.00 0.00 ? 32  GLU A O    9  
ATOM   9644  C  CB   . GLU A 1 32 ? -8.511  13.260  3.062   1.00 0.00 ? 32  GLU A CB   9  
ATOM   9645  C  CG   . GLU A 1 32 ? -9.827  13.778  3.617   1.00 0.00 ? 32  GLU A CG   9  
ATOM   9646  C  CD   . GLU A 1 32 ? -10.722 12.666  4.130   1.00 0.00 ? 32  GLU A CD   9  
ATOM   9647  O  OE1  . GLU A 1 32 ? -10.375 12.056  5.163   1.00 0.00 ? 32  GLU A OE1  9  
ATOM   9648  O  OE2  . GLU A 1 32 ? -11.768 12.407  3.500   1.00 0.00 ? 32  GLU A OE2  9  
ATOM   9649  H  H    . GLU A 1 32 ? -9.775  11.170  2.229   1.00 0.00 ? 32  GLU A H    9  
ATOM   9650  H  HA   . GLU A 1 32 ? -8.927  13.643  0.999   1.00 0.00 ? 32  GLU A HA   9  
ATOM   9651  H  HB2  . GLU A 1 32 ? -8.194  12.422  3.666   1.00 0.00 ? 32  GLU A HB2  9  
ATOM   9652  H  HB3  . GLU A 1 32 ? -7.776  14.047  3.143   1.00 0.00 ? 32  GLU A HB3  9  
ATOM   9653  H  HG2  . GLU A 1 32 ? -9.619  14.456  4.431   1.00 0.00 ? 32  GLU A HG2  9  
ATOM   9654  H  HG3  . GLU A 1 32 ? -10.349 14.308  2.833   1.00 0.00 ? 32  GLU A HG3  9  
ATOM   9655  N  N    . THR A 1 33 ? -6.827  11.155  1.486   1.00 0.00 ? 33  THR A N    9  
ATOM   9656  C  CA   . THR A 1 33 ? -5.533  10.613  1.090   1.00 0.00 ? 33  THR A CA   9  
ATOM   9657  C  C    . THR A 1 33 ? -5.389  10.590  -0.428  1.00 0.00 ? 33  THR A C    9  
ATOM   9658  O  O    . THR A 1 33 ? -4.472  11.194  -0.984  1.00 0.00 ? 33  THR A O    9  
ATOM   9659  C  CB   . THR A 1 33 ? -5.330  9.187   1.635   1.00 0.00 ? 33  THR A CB   9  
ATOM   9660  O  OG1  . THR A 1 33 ? -5.565  9.165   3.048   1.00 0.00 ? 33  THR A OG1  9  
ATOM   9661  C  CG2  . THR A 1 33 ? -3.923  8.691   1.342   1.00 0.00 ? 33  THR A CG2  9  
ATOM   9662  H  H    . THR A 1 33 ? -7.424  10.611  2.042   1.00 0.00 ? 33  THR A H    9  
ATOM   9663  H  HA   . THR A 1 33 ? -4.764  11.248  1.505   1.00 0.00 ? 33  THR A HA   9  
ATOM   9664  H  HB   . THR A 1 33 ? -6.037  8.528   1.150   1.00 0.00 ? 33  THR A HB   9  
ATOM   9665  H  HG1  . THR A 1 33 ? -6.199  9.848   3.278   1.00 0.00 ? 33  THR A HG1  9  
ATOM   9666  H  HG21 . THR A 1 33 ? -3.771  7.735   1.821   1.00 0.00 ? 33  THR A HG21 9  
ATOM   9667  H  HG22 . THR A 1 33 ? -3.204  9.402   1.721   1.00 0.00 ? 33  THR A HG22 9  
ATOM   9668  H  HG23 . THR A 1 33 ? -3.795  8.583   0.275   1.00 0.00 ? 33  THR A HG23 9  
ATOM   9669  N  N    . VAL A 1 34 ? -6.302  9.889   -1.094  1.00 0.00 ? 34  VAL A N    9  
ATOM   9670  C  CA   . VAL A 1 34 ? -6.277  9.789   -2.548  1.00 0.00 ? 34  VAL A CA   9  
ATOM   9671  C  C    . VAL A 1 34 ? -5.755  11.075  -3.179  1.00 0.00 ? 34  VAL A C    9  
ATOM   9672  O  O    . VAL A 1 34 ? -4.962  11.040  -4.119  1.00 0.00 ? 34  VAL A O    9  
ATOM   9673  C  CB   . VAL A 1 34 ? -7.677  9.484   -3.113  1.00 0.00 ? 34  VAL A CB   9  
ATOM   9674  C  CG1  . VAL A 1 34 ? -8.661  10.576  -2.721  1.00 0.00 ? 34  VAL A CG1  9  
ATOM   9675  C  CG2  . VAL A 1 34 ? -7.618  9.327   -4.625  1.00 0.00 ? 34  VAL A CG2  9  
ATOM   9676  H  H    . VAL A 1 34 ? -7.009  9.430   -0.595  1.00 0.00 ? 34  VAL A H    9  
ATOM   9677  H  HA   . VAL A 1 34 ? -5.619  8.975   -2.816  1.00 0.00 ? 34  VAL A HA   9  
ATOM   9678  H  HB   . VAL A 1 34 ? -8.020  8.552   -2.689  1.00 0.00 ? 34  VAL A HB   9  
ATOM   9679  H  HG11 . VAL A 1 34 ? -8.468  11.462  -3.308  1.00 0.00 ? 34  VAL A HG11 9  
ATOM   9680  H  HG12 . VAL A 1 34 ? -9.669  10.234  -2.902  1.00 0.00 ? 34  VAL A HG12 9  
ATOM   9681  H  HG13 . VAL A 1 34 ? -8.542  10.807  -1.672  1.00 0.00 ? 34  VAL A HG13 9  
ATOM   9682  H  HG21 . VAL A 1 34 ? -8.425  8.689   -4.952  1.00 0.00 ? 34  VAL A HG21 9  
ATOM   9683  H  HG22 . VAL A 1 34 ? -7.714  10.297  -5.093  1.00 0.00 ? 34  VAL A HG22 9  
ATOM   9684  H  HG23 . VAL A 1 34 ? -6.673  8.886   -4.905  1.00 0.00 ? 34  VAL A HG23 9  
ATOM   9685  N  N    . ALA A 1 35 ? -6.205  12.210  -2.654  1.00 0.00 ? 35  ALA A N    9  
ATOM   9686  C  CA   . ALA A 1 35 ? -5.782  13.508  -3.164  1.00 0.00 ? 35  ALA A CA   9  
ATOM   9687  C  C    . ALA A 1 35 ? -4.363  13.839  -2.713  1.00 0.00 ? 35  ALA A C    9  
ATOM   9688  O  O    . ALA A 1 35 ? -3.523  14.239  -3.519  1.00 0.00 ? 35  ALA A O    9  
ATOM   9689  C  CB   . ALA A 1 35 ? -6.747  14.594  -2.712  1.00 0.00 ? 35  ALA A CB   9  
ATOM   9690  H  H    . ALA A 1 35 ? -6.836  12.173  -1.905  1.00 0.00 ? 35  ALA A H    9  
ATOM   9691  H  HA   . ALA A 1 35 ? -5.805  13.467  -4.244  1.00 0.00 ? 35  ALA A HA   9  
ATOM   9692  H  HB1  . ALA A 1 35 ? -7.739  14.367  -3.076  1.00 0.00 ? 35  ALA A HB1  9  
ATOM   9693  H  HB2  . ALA A 1 35 ? -6.761  14.637  -1.633  1.00 0.00 ? 35  ALA A HB2  9  
ATOM   9694  H  HB3  . ALA A 1 35 ? -6.428  15.546  -3.107  1.00 0.00 ? 35  ALA A HB3  9  
ATOM   9695  N  N    . ALA A 1 36 ? -4.103  13.669  -1.421  1.00 0.00 ? 36  ALA A N    9  
ATOM   9696  C  CA   . ALA A 1 36 ? -2.785  13.948  -0.864  1.00 0.00 ? 36  ALA A CA   9  
ATOM   9697  C  C    . ALA A 1 36 ? -1.682  13.380  -1.751  1.00 0.00 ? 36  ALA A C    9  
ATOM   9698  O  O    . ALA A 1 36 ? -0.601  13.959  -1.864  1.00 0.00 ? 36  ALA A O    9  
ATOM   9699  C  CB   . ALA A 1 36 ? -2.676  13.382  0.544   1.00 0.00 ? 36  ALA A CB   9  
ATOM   9700  H  H    . ALA A 1 36 ? -4.814  13.347  -0.829  1.00 0.00 ? 36  ALA A H    9  
ATOM   9701  H  HA   . ALA A 1 36 ? -2.668  15.021  -0.805  1.00 0.00 ? 36  ALA A HA   9  
ATOM   9702  H  HB1  . ALA A 1 36 ? -2.259  14.131  1.201   1.00 0.00 ? 36  ALA A HB1  9  
ATOM   9703  H  HB2  . ALA A 1 36 ? -3.658  13.101  0.895   1.00 0.00 ? 36  ALA A HB2  9  
ATOM   9704  H  HB3  . ALA A 1 36 ? -2.035  12.513  0.534   1.00 0.00 ? 36  ALA A HB3  9  
ATOM   9705  N  N    . LEU A 1 37 ? -1.961  12.243  -2.379  1.00 0.00 ? 37  LEU A N    9  
ATOM   9706  C  CA   . LEU A 1 37 ? -0.992  11.595  -3.256  1.00 0.00 ? 37  LEU A CA   9  
ATOM   9707  C  C    . LEU A 1 37 ? -0.875  12.340  -4.582  1.00 0.00 ? 37  LEU A C    9  
ATOM   9708  O  O    . LEU A 1 37 ? -1.855  12.484  -5.313  1.00 0.00 ? 37  LEU A O    9  
ATOM   9709  C  CB   . LEU A 1 37 ? -1.396  10.141  -3.509  1.00 0.00 ? 37  LEU A CB   9  
ATOM   9710  C  CG   . LEU A 1 37 ? -2.035  9.407   -2.330  1.00 0.00 ? 37  LEU A CG   9  
ATOM   9711  C  CD1  . LEU A 1 37 ? -2.792  8.180   -2.812  1.00 0.00 ? 37  LEU A CD1  9  
ATOM   9712  C  CD2  . LEU A 1 37 ? -0.978  9.016   -1.307  1.00 0.00 ? 37  LEU A CD2  9  
ATOM   9713  H  H    . LEU A 1 37 ? -2.839  11.828  -2.250  1.00 0.00 ? 37  LEU A H    9  
ATOM   9714  H  HA   . LEU A 1 37 ? -0.033  11.613  -2.761  1.00 0.00 ? 37  LEU A HA   9  
ATOM   9715  H  HB2  . LEU A 1 37 ? -2.100  10.131  -4.326  1.00 0.00 ? 37  LEU A HB2  9  
ATOM   9716  H  HB3  . LEU A 1 37 ? -0.507  9.597   -3.795  1.00 0.00 ? 37  LEU A HB3  9  
ATOM   9717  H  HG   . LEU A 1 37 ? -2.743  10.066  -1.845  1.00 0.00 ? 37  LEU A HG   9  
ATOM   9718  H  HD11 . LEU A 1 37 ? -3.708  8.077   -2.250  1.00 0.00 ? 37  LEU A HD11 9  
ATOM   9719  H  HD12 . LEU A 1 37 ? -2.181  7.301   -2.669  1.00 0.00 ? 37  LEU A HD12 9  
ATOM   9720  H  HD13 . LEU A 1 37 ? -3.024  8.289   -3.861  1.00 0.00 ? 37  LEU A HD13 9  
ATOM   9721  H  HD21 . LEU A 1 37 ? -0.739  7.969   -1.420  1.00 0.00 ? 37  LEU A HD21 9  
ATOM   9722  H  HD22 . LEU A 1 37 ? -1.357  9.194   -0.311  1.00 0.00 ? 37  LEU A HD22 9  
ATOM   9723  H  HD23 . LEU A 1 37 ? -0.089  9.608   -1.465  1.00 0.00 ? 37  LEU A HD23 9  
ATOM   9724  N  N    . ARG A 1 38 ? 0.330   12.809  -4.886  1.00 0.00 ? 38  ARG A N    9  
ATOM   9725  C  CA   . ARG A 1 38 ? 0.576   13.538  -6.125  1.00 0.00 ? 38  ARG A CA   9  
ATOM   9726  C  C    . ARG A 1 38 ? 1.585   12.800  -7.000  1.00 0.00 ? 38  ARG A C    9  
ATOM   9727  O  O    . ARG A 1 38 ? 1.556   12.908  -8.226  1.00 0.00 ? 38  ARG A O    9  
ATOM   9728  C  CB   . ARG A 1 38 ? 1.085   14.948  -5.819  1.00 0.00 ? 38  ARG A CB   9  
ATOM   9729  C  CG   . ARG A 1 38 ? 0.439   15.577  -4.596  1.00 0.00 ? 38  ARG A CG   9  
ATOM   9730  C  CD   . ARG A 1 38 ? 1.265   15.333  -3.342  1.00 0.00 ? 38  ARG A CD   9  
ATOM   9731  N  NE   . ARG A 1 38 ? 0.740   16.063  -2.191  1.00 0.00 ? 38  ARG A NE   9  
ATOM   9732  C  CZ   . ARG A 1 38 ? 0.991   17.347  -1.958  1.00 0.00 ? 38  ARG A CZ   9  
ATOM   9733  N  NH1  . ARG A 1 38 ? 1.754   18.038  -2.793  1.00 0.00 ? 38  ARG A NH1  9  
ATOM   9734  N  NH2  . ARG A 1 38 ? 0.478   17.941  -0.889  1.00 0.00 ? 38  ARG A NH2  9  
ATOM   9735  H  H    . ARG A 1 38 ? 1.072   12.662  -4.263  1.00 0.00 ? 38  ARG A H    9  
ATOM   9736  H  HA   . ARG A 1 38 ? -0.360  13.611  -6.658  1.00 0.00 ? 38  ARG A HA   9  
ATOM   9737  H  HB2  . ARG A 1 38 ? 2.152   14.905  -5.653  1.00 0.00 ? 38  ARG A HB2  9  
ATOM   9738  H  HB3  . ARG A 1 38 ? 0.887   15.581  -6.670  1.00 0.00 ? 38  ARG A HB3  9  
ATOM   9739  H  HG2  . ARG A 1 38 ? 0.352   16.642  -4.754  1.00 0.00 ? 38  ARG A HG2  9  
ATOM   9740  H  HG3  . ARG A 1 38 ? -0.543  15.150  -4.459  1.00 0.00 ? 38  ARG A HG3  9  
ATOM   9741  H  HD2  . ARG A 1 38 ? 1.255   14.276  -3.121  1.00 0.00 ? 38  ARG A HD2  9  
ATOM   9742  H  HD3  . ARG A 1 38 ? 2.279   15.652  -3.528  1.00 0.00 ? 38  ARG A HD3  9  
ATOM   9743  H  HE   . ARG A 1 38 ? 0.174   15.571  -1.561  1.00 0.00 ? 38  ARG A HE   9  
ATOM   9744  H  HH11 . ARG A 1 38 ? 2.142   17.593  -3.600  1.00 0.00 ? 38  ARG A HH11 9  
ATOM   9745  H  HH12 . ARG A 1 38 ? 1.941   19.005  -2.616  1.00 0.00 ? 38  ARG A HH12 9  
ATOM   9746  H  HH21 . ARG A 1 38 ? -0.098  17.423  -0.257  1.00 0.00 ? 38  ARG A HH21 9  
ATOM   9747  H  HH22 . ARG A 1 38 ? 0.667   18.907  -0.714  1.00 0.00 ? 38  ARG A HH22 9  
ATOM   9748  N  N    . PHE A 1 39 ? 2.476   12.049  -6.361  1.00 0.00 ? 39  PHE A N    9  
ATOM   9749  C  CA   . PHE A 1 39 ? 3.495   11.294  -7.080  1.00 0.00 ? 39  PHE A CA   9  
ATOM   9750  C  C    . PHE A 1 39 ? 3.069   9.840   -7.260  1.00 0.00 ? 39  PHE A C    9  
ATOM   9751  O  O    . PHE A 1 39 ? 3.151   9.025   -6.340  1.00 0.00 ? 39  PHE A O    9  
ATOM   9752  C  CB   . PHE A 1 39 ? 4.830   11.358  -6.334  1.00 0.00 ? 39  PHE A CB   9  
ATOM   9753  C  CG   . PHE A 1 39 ? 5.197   12.742  -5.880  1.00 0.00 ? 39  PHE A CG   9  
ATOM   9754  C  CD1  . PHE A 1 39 ? 4.580   13.309  -4.776  1.00 0.00 ? 39  PHE A CD1  9  
ATOM   9755  C  CD2  . PHE A 1 39 ? 6.158   13.475  -6.556  1.00 0.00 ? 39  PHE A CD2  9  
ATOM   9756  C  CE1  . PHE A 1 39 ? 4.915   14.582  -4.356  1.00 0.00 ? 39  PHE A CE1  9  
ATOM   9757  C  CE2  . PHE A 1 39 ? 6.498   14.749  -6.140  1.00 0.00 ? 39  PHE A CE2  9  
ATOM   9758  C  CZ   . PHE A 1 39 ? 5.876   15.303  -5.038  1.00 0.00 ? 39  PHE A CZ   9  
ATOM   9759  H  H    . PHE A 1 39 ? 2.449   12.003  -5.382  1.00 0.00 ? 39  PHE A H    9  
ATOM   9760  H  HA   . PHE A 1 39 ? 3.615   11.744  -8.054  1.00 0.00 ? 39  PHE A HA   9  
ATOM   9761  H  HB2  . PHE A 1 39 ? 4.776   10.726  -5.461  1.00 0.00 ? 39  PHE A HB2  9  
ATOM   9762  H  HB3  . PHE A 1 39 ? 5.615   11.002  -6.984  1.00 0.00 ? 39  PHE A HB3  9  
ATOM   9763  H  HD1  . PHE A 1 39 ? 3.829   12.746  -4.241  1.00 0.00 ? 39  PHE A HD1  9  
ATOM   9764  H  HD2  . PHE A 1 39 ? 6.646   13.043  -7.418  1.00 0.00 ? 39  PHE A HD2  9  
ATOM   9765  H  HE1  . PHE A 1 39 ? 4.428   15.013  -3.494  1.00 0.00 ? 39  PHE A HE1  9  
ATOM   9766  H  HE2  . PHE A 1 39 ? 7.250   15.309  -6.676  1.00 0.00 ? 39  PHE A HE2  9  
ATOM   9767  H  HZ   . PHE A 1 39 ? 6.139   16.298  -4.713  1.00 0.00 ? 39  PHE A HZ   9  
ATOM   9768  N  N    . PRO A 1 40 ? 2.602   9.506   -8.472  1.00 0.00 ? 40  PRO A N    9  
ATOM   9769  C  CA   . PRO A 1 40 ? 2.153   8.150   -8.801  1.00 0.00 ? 40  PRO A CA   9  
ATOM   9770  C  C    . PRO A 1 40 ? 3.309   7.156   -8.864  1.00 0.00 ? 40  PRO A C    9  
ATOM   9771  O  O    . PRO A 1 40 ? 4.476   7.541   -8.795  1.00 0.00 ? 40  PRO A O    9  
ATOM   9772  C  CB   . PRO A 1 40 ? 1.512   8.313   -10.181 1.00 0.00 ? 40  PRO A CB   9  
ATOM   9773  C  CG   . PRO A 1 40 ? 2.178   9.510   -10.768 1.00 0.00 ? 40  PRO A CG   9  
ATOM   9774  C  CD   . PRO A 1 40 ? 2.476   10.426  -9.614  1.00 0.00 ? 40  PRO A CD   9  
ATOM   9775  H  HA   . PRO A 1 40 ? 1.413   7.795   -8.098  1.00 0.00 ? 40  PRO A HA   9  
ATOM   9776  H  HB2  . PRO A 1 40 ? 1.696   7.428   -10.773 1.00 0.00 ? 40  PRO A HB2  9  
ATOM   9777  H  HB3  . PRO A 1 40 ? 0.449   8.467   -10.072 1.00 0.00 ? 40  PRO A HB3  9  
ATOM   9778  H  HG2  . PRO A 1 40 ? 3.093   9.216   -11.260 1.00 0.00 ? 40  PRO A HG2  9  
ATOM   9779  H  HG3  . PRO A 1 40 ? 1.513   9.993   -11.468 1.00 0.00 ? 40  PRO A HG3  9  
ATOM   9780  H  HD2  . PRO A 1 40 ? 3.400   10.959  -9.784  1.00 0.00 ? 40  PRO A HD2  9  
ATOM   9781  H  HD3  . PRO A 1 40 ? 1.662   11.119  -9.462  1.00 0.00 ? 40  PRO A HD3  9  
ATOM   9782  N  N    . CYS A 1 41 ? 2.976   5.877   -8.997  1.00 0.00 ? 41  CYS A N    9  
ATOM   9783  C  CA   . CYS A 1 41 ? 3.985   4.827   -9.071  1.00 0.00 ? 41  CYS A CA   9  
ATOM   9784  C  C    . CYS A 1 41 ? 4.118   4.299   -10.496 1.00 0.00 ? 41  CYS A C    9  
ATOM   9785  O  O    . CYS A 1 41 ? 3.247   3.581   -10.986 1.00 0.00 ? 41  CYS A O    9  
ATOM   9786  C  CB   . CYS A 1 41 ? 3.629   3.681   -8.121  1.00 0.00 ? 41  CYS A CB   9  
ATOM   9787  S  SG   . CYS A 1 41 ? 4.985   2.497   -7.844  1.00 0.00 ? 41  CYS A SG   9  
ATOM   9788  H  H    . CYS A 1 41 ? 2.027   5.632   -9.048  1.00 0.00 ? 41  CYS A H    9  
ATOM   9789  H  HA   . CYS A 1 41 ? 4.930   5.253   -8.768  1.00 0.00 ? 41  CYS A HA   9  
ATOM   9790  H  HB2  . CYS A 1 41 ? 3.351   4.092   -7.162  1.00 0.00 ? 41  CYS A HB2  9  
ATOM   9791  H  HB3  . CYS A 1 41 ? 2.792   3.134   -8.528  1.00 0.00 ? 41  CYS A HB3  9  
ATOM   9792  N  N    . GLU A 1 42 ? 5.215   4.660   -11.155 1.00 0.00 ? 42  GLU A N    9  
ATOM   9793  C  CA   . GLU A 1 42 ? 5.461   4.223   -12.524 1.00 0.00 ? 42  GLU A CA   9  
ATOM   9794  C  C    . GLU A 1 42 ? 5.666   2.712   -12.584 1.00 0.00 ? 42  GLU A C    9  
ATOM   9795  O  O    . GLU A 1 42 ? 5.850   2.141   -13.659 1.00 0.00 ? 42  GLU A O    9  
ATOM   9796  C  CB   . GLU A 1 42 ? 6.686   4.937   -13.099 1.00 0.00 ? 42  GLU A CB   9  
ATOM   9797  C  CG   . GLU A 1 42 ? 7.967   4.667   -12.327 1.00 0.00 ? 42  GLU A CG   9  
ATOM   9798  C  CD   . GLU A 1 42 ? 9.211   4.981   -13.134 1.00 0.00 ? 42  GLU A CD   9  
ATOM   9799  O  OE1  . GLU A 1 42 ? 9.138   5.854   -14.024 1.00 0.00 ? 42  GLU A OE1  9  
ATOM   9800  O  OE2  . GLU A 1 42 ? 10.260  4.354   -12.875 1.00 0.00 ? 42  GLU A OE2  9  
ATOM   9801  H  H    . GLU A 1 42 ? 5.873   5.234   -10.711 1.00 0.00 ? 42  GLU A H    9  
ATOM   9802  H  HA   . GLU A 1 42 ? 4.596   4.480   -13.115 1.00 0.00 ? 42  GLU A HA   9  
ATOM   9803  H  HB2  . GLU A 1 42 ? 6.830   4.615   -14.120 1.00 0.00 ? 42  GLU A HB2  9  
ATOM   9804  H  HB3  . GLU A 1 42 ? 6.503   6.002   -13.089 1.00 0.00 ? 42  GLU A HB3  9  
ATOM   9805  H  HG2  . GLU A 1 42 ? 7.971   5.276   -11.436 1.00 0.00 ? 42  GLU A HG2  9  
ATOM   9806  H  HG3  . GLU A 1 42 ? 7.990   3.623   -12.049 1.00 0.00 ? 42  GLU A HG3  9  
ATOM   9807  N  N    . PHE A 1 43 ? 5.633   2.069   -11.421 1.00 0.00 ? 43  PHE A N    9  
ATOM   9808  C  CA   . PHE A 1 43 ? 5.816   0.625   -11.340 1.00 0.00 ? 43  PHE A CA   9  
ATOM   9809  C  C    . PHE A 1 43 ? 4.475   -0.098  -11.408 1.00 0.00 ? 43  PHE A C    9  
ATOM   9810  O  O    . PHE A 1 43 ? 4.281   -0.995  -12.229 1.00 0.00 ? 43  PHE A O    9  
ATOM   9811  C  CB   . PHE A 1 43 ? 6.543   0.254   -10.046 1.00 0.00 ? 43  PHE A CB   9  
ATOM   9812  C  CG   . PHE A 1 43 ? 8.038   0.210   -10.189 1.00 0.00 ? 43  PHE A CG   9  
ATOM   9813  C  CD1  . PHE A 1 43 ? 8.798   1.354   -10.010 1.00 0.00 ? 43  PHE A CD1  9  
ATOM   9814  C  CD2  . PHE A 1 43 ? 8.682   -0.976  -10.503 1.00 0.00 ? 43  PHE A CD2  9  
ATOM   9815  C  CE1  . PHE A 1 43 ? 10.174  1.316   -10.142 1.00 0.00 ? 43  PHE A CE1  9  
ATOM   9816  C  CE2  . PHE A 1 43 ? 10.057  -1.020  -10.636 1.00 0.00 ? 43  PHE A CE2  9  
ATOM   9817  C  CZ   . PHE A 1 43 ? 10.804  0.128   -10.454 1.00 0.00 ? 43  PHE A CZ   9  
ATOM   9818  H  H    . PHE A 1 43 ? 5.482   2.580   -10.598 1.00 0.00 ? 43  PHE A H    9  
ATOM   9819  H  HA   . PHE A 1 43 ? 6.419   0.320   -12.181 1.00 0.00 ? 43  PHE A HA   9  
ATOM   9820  H  HB2  . PHE A 1 43 ? 6.305   0.983   -9.286  1.00 0.00 ? 43  PHE A HB2  9  
ATOM   9821  H  HB3  . PHE A 1 43 ? 6.211   -0.721  -9.721  1.00 0.00 ? 43  PHE A HB3  9  
ATOM   9822  H  HD1  . PHE A 1 43 ? 8.307   2.284   -9.765  1.00 0.00 ? 43  PHE A HD1  9  
ATOM   9823  H  HD2  . PHE A 1 43 ? 8.099   -1.875  -10.645 1.00 0.00 ? 43  PHE A HD2  9  
ATOM   9824  H  HE1  . PHE A 1 43 ? 10.755  2.215   -9.999  1.00 0.00 ? 43  PHE A HE1  9  
ATOM   9825  H  HE2  . PHE A 1 43 ? 10.547  -1.951  -10.880 1.00 0.00 ? 43  PHE A HE2  9  
ATOM   9826  H  HZ   . PHE A 1 43 ? 11.878  0.096   -10.558 1.00 0.00 ? 43  PHE A HZ   9  
ATOM   9827  N  N    . CYS A 1 44 ? 3.551   0.298   -10.539 1.00 0.00 ? 44  CYS A N    9  
ATOM   9828  C  CA   . CYS A 1 44 ? 2.227   -0.312  -10.498 1.00 0.00 ? 44  CYS A CA   9  
ATOM   9829  C  C    . CYS A 1 44 ? 1.145   0.717   -10.810 1.00 0.00 ? 44  CYS A C    9  
ATOM   9830  O  O    . CYS A 1 44 ? 0.108   0.388   -11.385 1.00 0.00 ? 44  CYS A O    9  
ATOM   9831  C  CB   . CYS A 1 44 ? 1.973   -0.936  -9.124  1.00 0.00 ? 44  CYS A CB   9  
ATOM   9832  S  SG   . CYS A 1 44 ? 2.078   0.244   -7.740  1.00 0.00 ? 44  CYS A SG   9  
ATOM   9833  H  H    . CYS A 1 44 ? 3.765   1.018   -9.908  1.00 0.00 ? 44  CYS A H    9  
ATOM   9834  H  HA   . CYS A 1 44 ? 2.196   -1.088  -11.247 1.00 0.00 ? 44  CYS A HA   9  
ATOM   9835  H  HB2  . CYS A 1 44 ? 0.983   -1.368  -9.112  1.00 0.00 ? 44  CYS A HB2  9  
ATOM   9836  H  HB3  . CYS A 1 44 ? 2.701   -1.714  -8.950  1.00 0.00 ? 44  CYS A HB3  9  
ATOM   9837  N  N    . GLY A 1 45 ? 1.394   1.965   -10.426 1.00 0.00 ? 45  GLY A N    9  
ATOM   9838  C  CA   . GLY A 1 45 ? 0.432   3.024   -10.673 1.00 0.00 ? 45  GLY A CA   9  
ATOM   9839  C  C    . GLY A 1 45 ? -0.043  3.685   -9.394  1.00 0.00 ? 45  GLY A C    9  
ATOM   9840  O  O    . GLY A 1 45 ? -0.776  4.673   -9.433  1.00 0.00 ? 45  GLY A O    9  
ATOM   9841  H  H    . GLY A 1 45 ? 2.238   2.169   -9.971  1.00 0.00 ? 45  GLY A H    9  
ATOM   9842  H  HA2  . GLY A 1 45 ? 0.890   3.771   -11.304 1.00 0.00 ? 45  GLY A HA2  9  
ATOM   9843  H  HA3  . GLY A 1 45 ? -0.421  2.606   -11.187 1.00 0.00 ? 45  GLY A HA3  9  
ATOM   9844  N  N    . LYS A 1 46 ? 0.373   3.138   -8.257  1.00 0.00 ? 46  LYS A N    9  
ATOM   9845  C  CA   . LYS A 1 46 ? -0.015  3.680   -6.960  1.00 0.00 ? 46  LYS A CA   9  
ATOM   9846  C  C    . LYS A 1 46 ? 0.279   5.175   -6.885  1.00 0.00 ? 46  LYS A C    9  
ATOM   9847  O  O    . LYS A 1 46 ? 0.771   5.769   -7.845  1.00 0.00 ? 46  LYS A O    9  
ATOM   9848  C  CB   . LYS A 1 46 ? 0.723   2.948   -5.837  1.00 0.00 ? 46  LYS A CB   9  
ATOM   9849  C  CG   . LYS A 1 46 ? -0.013  1.722   -5.324  1.00 0.00 ? 46  LYS A CG   9  
ATOM   9850  C  CD   . LYS A 1 46 ? 0.757   1.036   -4.208  1.00 0.00 ? 46  LYS A CD   9  
ATOM   9851  C  CE   . LYS A 1 46 ? 0.287   1.502   -2.838  1.00 0.00 ? 46  LYS A CE   9  
ATOM   9852  N  NZ   . LYS A 1 46 ? 0.556   2.951   -2.624  1.00 0.00 ? 46  LYS A NZ   9  
ATOM   9853  H  H    . LYS A 1 46 ? 0.956   2.351   -8.291  1.00 0.00 ? 46  LYS A H    9  
ATOM   9854  H  HA   . LYS A 1 46 ? -1.077  3.528   -6.841  1.00 0.00 ? 46  LYS A HA   9  
ATOM   9855  H  HB2  . LYS A 1 46 ? 1.690   2.635   -6.202  1.00 0.00 ? 46  LYS A HB2  9  
ATOM   9856  H  HB3  . LYS A 1 46 ? 0.863   3.630   -5.011  1.00 0.00 ? 46  LYS A HB3  9  
ATOM   9857  H  HG2  . LYS A 1 46 ? -0.979  2.025   -4.947  1.00 0.00 ? 46  LYS A HG2  9  
ATOM   9858  H  HG3  . LYS A 1 46 ? -0.145  1.025   -6.139  1.00 0.00 ? 46  LYS A HG3  9  
ATOM   9859  H  HD2  . LYS A 1 46 ? 0.608   -0.031  -4.283  1.00 0.00 ? 46  LYS A HD2  9  
ATOM   9860  H  HD3  . LYS A 1 46 ? 1.808   1.263   -4.315  1.00 0.00 ? 46  LYS A HD3  9  
ATOM   9861  H  HE2  . LYS A 1 46 ? -0.774  1.325   -2.757  1.00 0.00 ? 46  LYS A HE2  9  
ATOM   9862  H  HE3  . LYS A 1 46 ? 0.806   0.933   -2.082  1.00 0.00 ? 46  LYS A HE3  9  
ATOM   9863  H  HZ1  . LYS A 1 46 ? 0.259   3.231   -1.667  1.00 0.00 ? 46  LYS A HZ1  9  
ATOM   9864  H  HZ2  . LYS A 1 46 ? 0.028   3.519   -3.318  1.00 0.00 ? 46  LYS A HZ2  9  
ATOM   9865  H  HZ3  . LYS A 1 46 ? 1.571   3.147   -2.732  1.00 0.00 ? 46  LYS A HZ3  9  
ATOM   9866  N  N    . ARG A 1 47 ? -0.024  5.776   -5.740  1.00 0.00 ? 47  ARG A N    9  
ATOM   9867  C  CA   . ARG A 1 47 ? 0.208   7.202   -5.540  1.00 0.00 ? 47  ARG A CA   9  
ATOM   9868  C  C    . ARG A 1 47 ? 0.609   7.491   -4.096  1.00 0.00 ? 47  ARG A C    9  
ATOM   9869  O  O    . ARG A 1 47 ? 0.054   6.916   -3.160  1.00 0.00 ? 47  ARG A O    9  
ATOM   9870  C  CB   . ARG A 1 47 ? -1.046  8.000   -5.902  1.00 0.00 ? 47  ARG A CB   9  
ATOM   9871  C  CG   . ARG A 1 47 ? -1.409  7.929   -7.376  1.00 0.00 ? 47  ARG A CG   9  
ATOM   9872  C  CD   . ARG A 1 47 ? -2.525  8.903   -7.722  1.00 0.00 ? 47  ARG A CD   9  
ATOM   9873  N  NE   . ARG A 1 47 ? -2.452  9.347   -9.112  1.00 0.00 ? 47  ARG A NE   9  
ATOM   9874  C  CZ   . ARG A 1 47 ? -2.959  10.497  -9.543  1.00 0.00 ? 47  ARG A CZ   9  
ATOM   9875  N  NH1  . ARG A 1 47 ? -3.572  11.314  -8.698  1.00 0.00 ? 47  ARG A NH1  9  
ATOM   9876  N  NH2  . ARG A 1 47 ? -2.852  10.831  -10.823 1.00 0.00 ? 47  ARG A NH2  9  
ATOM   9877  H  H    . ARG A 1 47 ? -0.414  5.249   -5.011  1.00 0.00 ? 47  ARG A H    9  
ATOM   9878  H  HA   . ARG A 1 47 ? 1.015   7.501   -6.192  1.00 0.00 ? 47  ARG A HA   9  
ATOM   9879  H  HB2  . ARG A 1 47 ? -1.879  7.618   -5.330  1.00 0.00 ? 47  ARG A HB2  9  
ATOM   9880  H  HB3  . ARG A 1 47 ? -0.886  9.036   -5.642  1.00 0.00 ? 47  ARG A HB3  9  
ATOM   9881  H  HG2  . ARG A 1 47 ? -0.537  8.174   -7.964  1.00 0.00 ? 47  ARG A HG2  9  
ATOM   9882  H  HG3  . ARG A 1 47 ? -1.733  6.926   -7.609  1.00 0.00 ? 47  ARG A HG3  9  
ATOM   9883  H  HD2  . ARG A 1 47 ? -3.474  8.415   -7.560  1.00 0.00 ? 47  ARG A HD2  9  
ATOM   9884  H  HD3  . ARG A 1 47 ? -2.447  9.763   -7.074  1.00 0.00 ? 47  ARG A HD3  9  
ATOM   9885  H  HE   . ARG A 1 47 ? -2.003  8.759   -9.753  1.00 0.00 ? 47  ARG A HE   9  
ATOM   9886  H  HH11 . ARG A 1 47 ? -3.653  11.065  -7.733  1.00 0.00 ? 47  ARG A HH11 9  
ATOM   9887  H  HH12 . ARG A 1 47 ? -3.952  12.179  -9.026  1.00 0.00 ? 47  ARG A HH12 9  
ATOM   9888  H  HH21 . ARG A 1 47 ? -2.391  10.218  -11.463 1.00 0.00 ? 47  ARG A HH21 9  
ATOM   9889  H  HH22 . ARG A 1 47 ? -3.234  11.696  -11.147 1.00 0.00 ? 47  ARG A HH22 9  
ATOM   9890  N  N    . PHE A 1 48 ? 1.577   8.384   -3.924  1.00 0.00 ? 48  PHE A N    9  
ATOM   9891  C  CA   . PHE A 1 48 ? 2.054   8.748   -2.595  1.00 0.00 ? 48  PHE A CA   9  
ATOM   9892  C  C    . PHE A 1 48 ? 2.072   10.264  -2.420  1.00 0.00 ? 48  PHE A C    9  
ATOM   9893  O  O    . PHE A 1 48 ? 2.294   11.007  -3.376  1.00 0.00 ? 48  PHE A O    9  
ATOM   9894  C  CB   . PHE A 1 48 ? 3.455   8.180   -2.360  1.00 0.00 ? 48  PHE A CB   9  
ATOM   9895  C  CG   . PHE A 1 48 ? 3.517   6.682   -2.445  1.00 0.00 ? 48  PHE A CG   9  
ATOM   9896  C  CD1  . PHE A 1 48 ? 3.187   6.027   -3.621  1.00 0.00 ? 48  PHE A CD1  9  
ATOM   9897  C  CD2  . PHE A 1 48 ? 3.905   5.928   -1.349  1.00 0.00 ? 48  PHE A CD2  9  
ATOM   9898  C  CE1  . PHE A 1 48 ? 3.242   4.649   -3.701  1.00 0.00 ? 48  PHE A CE1  9  
ATOM   9899  C  CE2  . PHE A 1 48 ? 3.962   4.549   -1.424  1.00 0.00 ? 48  PHE A CE2  9  
ATOM   9900  C  CZ   . PHE A 1 48 ? 3.631   3.909   -2.602  1.00 0.00 ? 48  PHE A CZ   9  
ATOM   9901  H  H    . PHE A 1 48 ? 1.981   8.809   -4.711  1.00 0.00 ? 48  PHE A H    9  
ATOM   9902  H  HA   . PHE A 1 48 ? 1.376   8.322   -1.873  1.00 0.00 ? 48  PHE A HA   9  
ATOM   9903  H  HB2  . PHE A 1 48 ? 4.129   8.582   -3.102  1.00 0.00 ? 48  PHE A HB2  9  
ATOM   9904  H  HB3  . PHE A 1 48 ? 3.794   8.472   -1.377  1.00 0.00 ? 48  PHE A HB3  9  
ATOM   9905  H  HD1  . PHE A 1 48 ? 2.883   6.605   -4.482  1.00 0.00 ? 48  PHE A HD1  9  
ATOM   9906  H  HD2  . PHE A 1 48 ? 4.165   6.428   -0.427  1.00 0.00 ? 48  PHE A HD2  9  
ATOM   9907  H  HE1  . PHE A 1 48 ? 2.982   4.151   -4.623  1.00 0.00 ? 48  PHE A HE1  9  
ATOM   9908  H  HE2  . PHE A 1 48 ? 4.267   3.974   -0.562  1.00 0.00 ? 48  PHE A HE2  9  
ATOM   9909  H  HZ   . PHE A 1 48 ? 3.674   2.832   -2.662  1.00 0.00 ? 48  PHE A HZ   9  
ATOM   9910  N  N    . GLU A 1 49 ? 1.835   10.715  -1.192  1.00 0.00 ? 49  GLU A N    9  
ATOM   9911  C  CA   . GLU A 1 49 ? 1.822   12.142  -0.892  1.00 0.00 ? 49  GLU A CA   9  
ATOM   9912  C  C    . GLU A 1 49 ? 3.150   12.790  -1.272  1.00 0.00 ? 49  GLU A C    9  
ATOM   9913  O  O    . GLU A 1 49 ? 3.238   14.008  -1.427  1.00 0.00 ? 49  GLU A O    9  
ATOM   9914  C  CB   . GLU A 1 49 ? 1.537   12.370  0.594   1.00 0.00 ? 49  GLU A CB   9  
ATOM   9915  C  CG   . GLU A 1 49 ? 2.313   11.441  1.512   1.00 0.00 ? 49  GLU A CG   9  
ATOM   9916  C  CD   . GLU A 1 49 ? 2.644   12.082  2.846   1.00 0.00 ? 49  GLU A CD   9  
ATOM   9917  O  OE1  . GLU A 1 49 ? 2.595   13.327  2.934   1.00 0.00 ? 49  GLU A OE1  9  
ATOM   9918  O  OE2  . GLU A 1 49 ? 2.952   11.340  3.802   1.00 0.00 ? 49  GLU A OE2  9  
ATOM   9919  H  H    . GLU A 1 49 ? 1.664   10.073  -0.472  1.00 0.00 ? 49  GLU A H    9  
ATOM   9920  H  HA   . GLU A 1 49 ? 1.034   12.596  -1.474  1.00 0.00 ? 49  GLU A HA   9  
ATOM   9921  H  HB2  . GLU A 1 49 ? 1.794   13.389  0.845   1.00 0.00 ? 49  GLU A HB2  9  
ATOM   9922  H  HB3  . GLU A 1 49 ? 0.482   12.220  0.773   1.00 0.00 ? 49  GLU A HB3  9  
ATOM   9923  H  HG2  . GLU A 1 49 ? 1.720   10.557  1.693   1.00 0.00 ? 49  GLU A HG2  9  
ATOM   9924  H  HG3  . GLU A 1 49 ? 3.235   11.161  1.025   1.00 0.00 ? 49  GLU A HG3  9  
ATOM   9925  N  N    . LYS A 1 50 ? 4.182   11.966  -1.420  1.00 0.00 ? 50  LYS A N    9  
ATOM   9926  C  CA   . LYS A 1 50 ? 5.507   12.456  -1.783  1.00 0.00 ? 50  LYS A CA   9  
ATOM   9927  C  C    . LYS A 1 50 ? 6.322   11.364  -2.468  1.00 0.00 ? 50  LYS A C    9  
ATOM   9928  O  O    . LYS A 1 50 ? 6.000   10.178  -2.397  1.00 0.00 ? 50  LYS A O    9  
ATOM   9929  C  CB   . LYS A 1 50 ? 6.246   12.956  -0.539  1.00 0.00 ? 50  LYS A CB   9  
ATOM   9930  C  CG   . LYS A 1 50 ? 5.797   12.283  0.746   1.00 0.00 ? 50  LYS A CG   9  
ATOM   9931  C  CD   . LYS A 1 50 ? 6.725   12.615  1.903   1.00 0.00 ? 50  LYS A CD   9  
ATOM   9932  C  CE   . LYS A 1 50 ? 6.542   14.050  2.371   1.00 0.00 ? 50  LYS A CE   9  
ATOM   9933  N  NZ   . LYS A 1 50 ? 6.832   14.201  3.824   1.00 0.00 ? 50  LYS A NZ   9  
ATOM   9934  H  H    . LYS A 1 50 ? 4.050   11.004  -1.284  1.00 0.00 ? 50  LYS A H    9  
ATOM   9935  H  HA   . LYS A 1 50 ? 5.380   13.279  -2.470  1.00 0.00 ? 50  LYS A HA   9  
ATOM   9936  H  HB2  . LYS A 1 50 ? 7.303   12.773  -0.666  1.00 0.00 ? 50  LYS A HB2  9  
ATOM   9937  H  HB3  . LYS A 1 50 ? 6.082   14.019  -0.441  1.00 0.00 ? 50  LYS A HB3  9  
ATOM   9938  H  HG2  . LYS A 1 50 ? 4.801   12.622  0.990   1.00 0.00 ? 50  LYS A HG2  9  
ATOM   9939  H  HG3  . LYS A 1 50 ? 5.789   11.213  0.598   1.00 0.00 ? 50  LYS A HG3  9  
ATOM   9940  H  HD2  . LYS A 1 50 ? 6.513   11.949  2.726   1.00 0.00 ? 50  LYS A HD2  9  
ATOM   9941  H  HD3  . LYS A 1 50 ? 7.748   12.478  1.582   1.00 0.00 ? 50  LYS A HD3  9  
ATOM   9942  H  HE2  . LYS A 1 50 ? 7.210   14.686  1.812   1.00 0.00 ? 50  LYS A HE2  9  
ATOM   9943  H  HE3  . LYS A 1 50 ? 5.520   14.348  2.184   1.00 0.00 ? 50  LYS A HE3  9  
ATOM   9944  H  HZ1  . LYS A 1 50 ? 5.951   14.380  4.347   1.00 0.00 ? 50  LYS A HZ1  9  
ATOM   9945  H  HZ2  . LYS A 1 50 ? 7.481   14.998  3.978   1.00 0.00 ? 50  LYS A HZ2  9  
ATOM   9946  H  HZ3  . LYS A 1 50 ? 7.271   13.333  4.193   1.00 0.00 ? 50  LYS A HZ3  9  
ATOM   9947  N  N    . PRO A 1 51 ? 7.406   11.771  -3.146  1.00 0.00 ? 51  PRO A N    9  
ATOM   9948  C  CA   . PRO A 1 51 ? 8.291   10.842  -3.855  1.00 0.00 ? 51  PRO A CA   9  
ATOM   9949  C  C    . PRO A 1 51 ? 9.096   9.966   -2.901  1.00 0.00 ? 51  PRO A C    9  
ATOM   9950  O  O    . PRO A 1 51 ? 9.242   8.764   -3.120  1.00 0.00 ? 51  PRO A O    9  
ATOM   9951  C  CB   . PRO A 1 51 ? 9.220   11.769  -4.643  1.00 0.00 ? 51  PRO A CB   9  
ATOM   9952  C  CG   . PRO A 1 51 ? 9.223   13.045  -3.875  1.00 0.00 ? 51  PRO A CG   9  
ATOM   9953  C  CD   . PRO A 1 51 ? 7.850   13.169  -3.273  1.00 0.00 ? 51  PRO A CD   9  
ATOM   9954  H  HA   . PRO A 1 51 ? 7.740   10.214  -4.540  1.00 0.00 ? 51  PRO A HA   9  
ATOM   9955  H  HB2  . PRO A 1 51 ? 10.208  11.334  -4.693  1.00 0.00 ? 51  PRO A HB2  9  
ATOM   9956  H  HB3  . PRO A 1 51 ? 8.832   11.910  -5.641  1.00 0.00 ? 51  PRO A HB3  9  
ATOM   9957  H  HG2  . PRO A 1 51 ? 9.971   13.004  -3.098  1.00 0.00 ? 51  PRO A HG2  9  
ATOM   9958  H  HG3  . PRO A 1 51 ? 9.416   13.873  -4.540  1.00 0.00 ? 51  PRO A HG3  9  
ATOM   9959  H  HD2  . PRO A 1 51 ? 7.904   13.646  -2.305  1.00 0.00 ? 51  PRO A HD2  9  
ATOM   9960  H  HD3  . PRO A 1 51 ? 7.198   13.722  -3.932  1.00 0.00 ? 51  PRO A HD3  9  
ATOM   9961  N  N    . ASP A 1 52 ? 9.616   10.577  -1.841  1.00 0.00 ? 52  ASP A N    9  
ATOM   9962  C  CA   . ASP A 1 52 ? 10.405  9.852   -0.853  1.00 0.00 ? 52  ASP A CA   9  
ATOM   9963  C  C    . ASP A 1 52 ? 9.753   8.516   -0.509  1.00 0.00 ? 52  ASP A C    9  
ATOM   9964  O  O    . ASP A 1 52 ? 10.437  7.513   -0.308  1.00 0.00 ? 52  ASP A O    9  
ATOM   9965  C  CB   . ASP A 1 52 ? 10.572  10.693  0.414   1.00 0.00 ? 52  ASP A CB   9  
ATOM   9966  C  CG   . ASP A 1 52 ? 11.790  11.593  0.355   1.00 0.00 ? 52  ASP A CG   9  
ATOM   9967  O  OD1  . ASP A 1 52 ? 12.840  11.138  -0.146  1.00 0.00 ? 52  ASP A OD1  9  
ATOM   9968  O  OD2  . ASP A 1 52 ? 11.694  12.753  0.809   1.00 0.00 ? 52  ASP A OD2  9  
ATOM   9969  H  H    . ASP A 1 52 ? 9.464   11.538  -1.721  1.00 0.00 ? 52  ASP A H    9  
ATOM   9970  H  HA   . ASP A 1 52 ? 11.379  9.663   -1.279  1.00 0.00 ? 52  ASP A HA   9  
ATOM   9971  H  HB2  . ASP A 1 52 ? 9.696   11.312  0.545   1.00 0.00 ? 52  ASP A HB2  9  
ATOM   9972  H  HB3  . ASP A 1 52 ? 10.674  10.035  1.264   1.00 0.00 ? 52  ASP A HB3  9  
ATOM   9973  N  N    . SER A 1 53 ? 8.425   8.512   -0.443  1.00 0.00 ? 53  SER A N    9  
ATOM   9974  C  CA   . SER A 1 53 ? 7.680   7.301   -0.119  1.00 0.00 ? 53  SER A CA   9  
ATOM   9975  C  C    . SER A 1 53 ? 7.526   6.412   -1.349  1.00 0.00 ? 53  SER A C    9  
ATOM   9976  O  O    . SER A 1 53 ? 7.400   5.193   -1.237  1.00 0.00 ? 53  SER A O    9  
ATOM   9977  C  CB   . SER A 1 53 ? 6.302   7.659   0.441   1.00 0.00 ? 53  SER A CB   9  
ATOM   9978  O  OG   . SER A 1 53 ? 5.824   6.644   1.307   1.00 0.00 ? 53  SER A OG   9  
ATOM   9979  H  H    . SER A 1 53 ? 7.936   9.344   -0.614  1.00 0.00 ? 53  SER A H    9  
ATOM   9980  H  HA   . SER A 1 53 ? 8.236   6.761   0.634   1.00 0.00 ? 53  SER A HA   9  
ATOM   9981  H  HB2  . SER A 1 53 ? 6.370   8.584   0.993   1.00 0.00 ? 53  SER A HB2  9  
ATOM   9982  H  HB3  . SER A 1 53 ? 5.605   7.778   -0.375  1.00 0.00 ? 53  SER A HB3  9  
ATOM   9983  H  HG   . SER A 1 53 ? 5.627   5.855   0.797   1.00 0.00 ? 53  SER A HG   9  
ATOM   9984  N  N    . VAL A 1 54 ? 7.537   7.033   -2.525  1.00 0.00 ? 54  VAL A N    9  
ATOM   9985  C  CA   . VAL A 1 54 ? 7.400   6.299   -3.777  1.00 0.00 ? 54  VAL A CA   9  
ATOM   9986  C  C    . VAL A 1 54 ? 8.671   5.522   -4.101  1.00 0.00 ? 54  VAL A C    9  
ATOM   9987  O  O    . VAL A 1 54 ? 8.625   4.483   -4.760  1.00 0.00 ? 54  VAL A O    9  
ATOM   9988  C  CB   . VAL A 1 54 ? 7.078   7.245   -4.949  1.00 0.00 ? 54  VAL A CB   9  
ATOM   9989  C  CG1  . VAL A 1 54 ? 7.709   6.736   -6.236  1.00 0.00 ? 54  VAL A CG1  9  
ATOM   9990  C  CG2  . VAL A 1 54 ? 5.573   7.401   -5.109  1.00 0.00 ? 54  VAL A CG2  9  
ATOM   9991  H  H    . VAL A 1 54 ? 7.641   8.007   -2.550  1.00 0.00 ? 54  VAL A H    9  
ATOM   9992  H  HA   . VAL A 1 54 ? 6.581   5.603   -3.669  1.00 0.00 ? 54  VAL A HA   9  
ATOM   9993  H  HB   . VAL A 1 54 ? 7.498   8.216   -4.728  1.00 0.00 ? 54  VAL A HB   9  
ATOM   9994  H  HG11 . VAL A 1 54 ? 8.785   6.751   -6.139  1.00 0.00 ? 54  VAL A HG11 9  
ATOM   9995  H  HG12 . VAL A 1 54 ? 7.378   5.726   -6.425  1.00 0.00 ? 54  VAL A HG12 9  
ATOM   9996  H  HG13 . VAL A 1 54 ? 7.414   7.372   -7.058  1.00 0.00 ? 54  VAL A HG13 9  
ATOM   9997  H  HG21 . VAL A 1 54 ? 5.222   6.726   -5.875  1.00 0.00 ? 54  VAL A HG21 9  
ATOM   9998  H  HG22 . VAL A 1 54 ? 5.085   7.170   -4.174  1.00 0.00 ? 54  VAL A HG22 9  
ATOM   9999  H  HG23 . VAL A 1 54 ? 5.344   8.418   -5.392  1.00 0.00 ? 54  VAL A HG23 9  
ATOM   10000 N  N    . ALA A 1 55 ? 9.805   6.031   -3.633  1.00 0.00 ? 55  ALA A N    9  
ATOM   10001 C  CA   . ALA A 1 55 ? 11.089  5.384   -3.870  1.00 0.00 ? 55  ALA A CA   9  
ATOM   10002 C  C    . ALA A 1 55 ? 11.262  4.162   -2.974  1.00 0.00 ? 55  ALA A C    9  
ATOM   10003 O  O    . ALA A 1 55 ? 11.815  3.146   -3.394  1.00 0.00 ? 55  ALA A O    9  
ATOM   10004 C  CB   . ALA A 1 55 ? 12.227  6.369   -3.646  1.00 0.00 ? 55  ALA A CB   9  
ATOM   10005 H  H    . ALA A 1 55 ? 9.778   6.862   -3.114  1.00 0.00 ? 55  ALA A H    9  
ATOM   10006 H  HA   . ALA A 1 55 ? 11.118  5.067   -4.903  1.00 0.00 ? 55  ALA A HA   9  
ATOM   10007 H  HB1  . ALA A 1 55 ? 13.046  5.866   -3.152  1.00 0.00 ? 55  ALA A HB1  9  
ATOM   10008 H  HB2  . ALA A 1 55 ? 12.562  6.754   -4.598  1.00 0.00 ? 55  ALA A HB2  9  
ATOM   10009 H  HB3  . ALA A 1 55 ? 11.880  7.185   -3.029  1.00 0.00 ? 55  ALA A HB3  9  
ATOM   10010 N  N    . ALA A 1 56 ? 10.784  4.268   -1.738  1.00 0.00 ? 56  ALA A N    9  
ATOM   10011 C  CA   . ALA A 1 56 ? 10.884  3.171   -0.784  1.00 0.00 ? 56  ALA A CA   9  
ATOM   10012 C  C    . ALA A 1 56 ? 9.863   2.081   -1.091  1.00 0.00 ? 56  ALA A C    9  
ATOM   10013 O  O    . ALA A 1 56 ? 10.147  0.891   -0.948  1.00 0.00 ? 56  ALA A O    9  
ATOM   10014 C  CB   . ALA A 1 56 ? 10.698  3.687   0.635   1.00 0.00 ? 56  ALA A CB   9  
ATOM   10015 H  H    . ALA A 1 56 ? 10.353  5.103   -1.463  1.00 0.00 ? 56  ALA A H    9  
ATOM   10016 H  HA   . ALA A 1 56 ? 11.877  2.751   -0.861  1.00 0.00 ? 56  ALA A HA   9  
ATOM   10017 H  HB1  . ALA A 1 56 ? 9.948   4.464   0.639   1.00 0.00 ? 56  ALA A HB1  9  
ATOM   10018 H  HB2  . ALA A 1 56 ? 10.381  2.877   1.274   1.00 0.00 ? 56  ALA A HB2  9  
ATOM   10019 H  HB3  . ALA A 1 56 ? 11.634  4.087   0.998   1.00 0.00 ? 56  ALA A HB3  9  
ATOM   10020 N  N    . HIS A 1 57 ? 8.672   2.495   -1.513  1.00 0.00 ? 57  HIS A N    9  
ATOM   10021 C  CA   . HIS A 1 57 ? 7.607   1.553   -1.839  1.00 0.00 ? 57  HIS A CA   9  
ATOM   10022 C  C    . HIS A 1 57 ? 8.084   0.528   -2.864  1.00 0.00 ? 57  HIS A C    9  
ATOM   10023 O  O    . HIS A 1 57 ? 7.682   -0.635  -2.825  1.00 0.00 ? 57  HIS A O    9  
ATOM   10024 C  CB   . HIS A 1 57 ? 6.385   2.299   -2.377  1.00 0.00 ? 57  HIS A CB   9  
ATOM   10025 C  CG   . HIS A 1 57 ? 5.539   1.475   -3.299  1.00 0.00 ? 57  HIS A CG   9  
ATOM   10026 N  ND1  . HIS A 1 57 ? 4.837   0.364   -2.884  1.00 0.00 ? 57  HIS A ND1  9  
ATOM   10027 C  CD2  . HIS A 1 57 ? 5.284   1.608   -4.622  1.00 0.00 ? 57  HIS A CD2  9  
ATOM   10028 C  CE1  . HIS A 1 57 ? 4.187   -0.152  -3.912  1.00 0.00 ? 57  HIS A CE1  9  
ATOM   10029 N  NE2  . HIS A 1 57 ? 4.441   0.584   -4.979  1.00 0.00 ? 57  HIS A NE2  9  
ATOM   10030 H  H    . HIS A 1 57 ? 8.506   3.456   -1.607  1.00 0.00 ? 57  HIS A H    9  
ATOM   10031 H  HA   . HIS A 1 57 ? 7.332   1.036   -0.933  1.00 0.00 ? 57  HIS A HA   9  
ATOM   10032 H  HB2  . HIS A 1 57 ? 5.767   2.608   -1.548  1.00 0.00 ? 57  HIS A HB2  9  
ATOM   10033 H  HB3  . HIS A 1 57 ? 6.715   3.173   -2.920  1.00 0.00 ? 57  HIS A HB3  9  
ATOM   10034 H  HD1  . HIS A 1 57 ? 4.818   0.006   -1.973  1.00 0.00 ? 57  HIS A HD1  9  
ATOM   10035 H  HD2  . HIS A 1 57 ? 5.671   2.377   -5.276  1.00 0.00 ? 57  HIS A HD2  9  
ATOM   10036 H  HE1  . HIS A 1 57 ? 3.555   -1.027  -3.886  1.00 0.00 ? 57  HIS A HE1  9  
ATOM   10037 N  N    . ARG A 1 58 ? 8.942   0.968   -3.779  1.00 0.00 ? 58  ARG A N    9  
ATOM   10038 C  CA   . ARG A 1 58 ? 9.471   0.089   -4.814  1.00 0.00 ? 58  ARG A CA   9  
ATOM   10039 C  C    . ARG A 1 58 ? 10.438  -0.931  -4.220  1.00 0.00 ? 58  ARG A C    9  
ATOM   10040 O  O    . ARG A 1 58 ? 10.712  -1.968  -4.824  1.00 0.00 ? 58  ARG A O    9  
ATOM   10041 C  CB   . ARG A 1 58 ? 10.178  0.908   -5.896  1.00 0.00 ? 58  ARG A CB   9  
ATOM   10042 C  CG   . ARG A 1 58 ? 9.279   1.932   -6.570  1.00 0.00 ? 58  ARG A CG   9  
ATOM   10043 C  CD   . ARG A 1 58 ? 10.061  3.165   -6.996  1.00 0.00 ? 58  ARG A CD   9  
ATOM   10044 N  NE   . ARG A 1 58 ? 11.210  2.823   -7.829  1.00 0.00 ? 58  ARG A NE   9  
ATOM   10045 C  CZ   . ARG A 1 58 ? 12.190  3.674   -8.115  1.00 0.00 ? 58  ARG A CZ   9  
ATOM   10046 N  NH1  . ARG A 1 58 ? 12.160  4.909   -7.635  1.00 0.00 ? 58  ARG A NH1  9  
ATOM   10047 N  NH2  . ARG A 1 58 ? 13.203  3.288   -8.880  1.00 0.00 ? 58  ARG A NH2  9  
ATOM   10048 H  H    . ARG A 1 58 ? 9.224   1.906   -3.758  1.00 0.00 ? 58  ARG A H    9  
ATOM   10049 H  HA   . ARG A 1 58 ? 8.640   -0.438  -5.260  1.00 0.00 ? 58  ARG A HA   9  
ATOM   10050 H  HB2  . ARG A 1 58 ? 11.010  1.432   -5.448  1.00 0.00 ? 58  ARG A HB2  9  
ATOM   10051 H  HB3  . ARG A 1 58 ? 10.552  0.235   -6.653  1.00 0.00 ? 58  ARG A HB3  9  
ATOM   10052 H  HG2  . ARG A 1 58 ? 8.831   1.483   -7.444  1.00 0.00 ? 58  ARG A HG2  9  
ATOM   10053 H  HG3  . ARG A 1 58 ? 8.505   2.228   -5.878  1.00 0.00 ? 58  ARG A HG3  9  
ATOM   10054 H  HD2  . ARG A 1 58 ? 9.405   3.816   -7.554  1.00 0.00 ? 58  ARG A HD2  9  
ATOM   10055 H  HD3  . ARG A 1 58 ? 10.409  3.677   -6.111  1.00 0.00 ? 58  ARG A HD3  9  
ATOM   10056 H  HE   . ARG A 1 58 ? 11.253  1.915   -8.194  1.00 0.00 ? 58  ARG A HE   9  
ATOM   10057 H  HH11 . ARG A 1 58 ? 11.399  5.202   -7.057  1.00 0.00 ? 58  ARG A HH11 9  
ATOM   10058 H  HH12 . ARG A 1 58 ? 12.900  5.547   -7.850  1.00 0.00 ? 58  ARG A HH12 9  
ATOM   10059 H  HH21 . ARG A 1 58 ? 13.229  2.358   -9.244  1.00 0.00 ? 58  ARG A HH21 9  
ATOM   10060 H  HH22 . ARG A 1 58 ? 13.940  3.929   -9.094  1.00 0.00 ? 58  ARG A HH22 9  
ATOM   10061 N  N    . SER A 1 59 ? 10.953  -0.628  -3.032  1.00 0.00 ? 59  SER A N    9  
ATOM   10062 C  CA   . SER A 1 59 ? 11.893  -1.516  -2.358  1.00 0.00 ? 59  SER A CA   9  
ATOM   10063 C  C    . SER A 1 59 ? 11.161  -2.465  -1.413  1.00 0.00 ? 59  SER A C    9  
ATOM   10064 O  O    . SER A 1 59 ? 11.764  -3.367  -0.831  1.00 0.00 ? 59  SER A O    9  
ATOM   10065 C  CB   . SER A 1 59 ? 12.928  -0.701  -1.580  1.00 0.00 ? 59  SER A CB   9  
ATOM   10066 O  OG   . SER A 1 59 ? 13.966  -1.532  -1.088  1.00 0.00 ? 59  SER A OG   9  
ATOM   10067 H  H    . SER A 1 59 ? 10.696  0.214   -2.601  1.00 0.00 ? 59  SER A H    9  
ATOM   10068 H  HA   . SER A 1 59 ? 12.399  -2.098  -3.113  1.00 0.00 ? 59  SER A HA   9  
ATOM   10069 H  HB2  . SER A 1 59 ? 13.358  0.045   -2.230  1.00 0.00 ? 59  SER A HB2  9  
ATOM   10070 H  HB3  . SER A 1 59 ? 12.445  -0.216  -0.744  1.00 0.00 ? 59  SER A HB3  9  
ATOM   10071 H  HG   . SER A 1 59 ? 14.326  -1.152  -0.283  1.00 0.00 ? 59  SER A HG   9  
ATOM   10072 N  N    . LYS A 1 60 ? 9.858   -2.255  -1.267  1.00 0.00 ? 60  LYS A N    9  
ATOM   10073 C  CA   . LYS A 1 60 ? 9.041   -3.091  -0.395  1.00 0.00 ? 60  LYS A CA   9  
ATOM   10074 C  C    . LYS A 1 60 ? 7.963   -3.817  -1.191  1.00 0.00 ? 60  LYS A C    9  
ATOM   10075 O  O    . LYS A 1 60 ? 7.527   -4.906  -0.816  1.00 0.00 ? 60  LYS A O    9  
ATOM   10076 C  CB   . LYS A 1 60 ? 8.395   -2.241  0.702   1.00 0.00 ? 60  LYS A CB   9  
ATOM   10077 C  CG   . LYS A 1 60 ? 9.393   -1.437  1.517   1.00 0.00 ? 60  LYS A CG   9  
ATOM   10078 C  CD   . LYS A 1 60 ? 9.772   -2.157  2.800   1.00 0.00 ? 60  LYS A CD   9  
ATOM   10079 C  CE   . LYS A 1 60 ? 10.946  -3.100  2.585   1.00 0.00 ? 60  LYS A CE   9  
ATOM   10080 N  NZ   . LYS A 1 60 ? 11.205  -3.947  3.782   1.00 0.00 ? 60  LYS A NZ   9  
ATOM   10081 H  H    . LYS A 1 60 ? 9.434   -1.520  -1.758  1.00 0.00 ? 60  LYS A H    9  
ATOM   10082 H  HA   . LYS A 1 60 ? 9.688   -3.823  0.064   1.00 0.00 ? 60  LYS A HA   9  
ATOM   10083 H  HB2  . LYS A 1 60 ? 7.699   -1.553  0.244   1.00 0.00 ? 60  LYS A HB2  9  
ATOM   10084 H  HB3  . LYS A 1 60 ? 7.854   -2.892  1.374   1.00 0.00 ? 60  LYS A HB3  9  
ATOM   10085 H  HG2  . LYS A 1 60 ? 10.284  -1.283  0.927   1.00 0.00 ? 60  LYS A HG2  9  
ATOM   10086 H  HG3  . LYS A 1 60 ? 8.954   -0.482  1.767   1.00 0.00 ? 60  LYS A HG3  9  
ATOM   10087 H  HD2  . LYS A 1 60 ? 10.046  -1.425  3.546   1.00 0.00 ? 60  LYS A HD2  9  
ATOM   10088 H  HD3  . LYS A 1 60 ? 8.923   -2.728  3.147   1.00 0.00 ? 60  LYS A HD3  9  
ATOM   10089 H  HE2  . LYS A 1 60 ? 10.728  -3.739  1.743   1.00 0.00 ? 60  LYS A HE2  9  
ATOM   10090 H  HE3  . LYS A 1 60 ? 11.828  -2.513  2.372   1.00 0.00 ? 60  LYS A HE3  9  
ATOM   10091 H  HZ1  . LYS A 1 60 ? 12.123  -3.700  4.203   1.00 0.00 ? 60  LYS A HZ1  9  
ATOM   10092 H  HZ2  . LYS A 1 60 ? 11.219  -4.951  3.513   1.00 0.00 ? 60  LYS A HZ2  9  
ATOM   10093 H  HZ3  . LYS A 1 60 ? 10.459  -3.800  4.492   1.00 0.00 ? 60  LYS A HZ3  9  
ATOM   10094 N  N    . SER A 1 61 ? 7.537   -3.209  -2.294  1.00 0.00 ? 61  SER A N    9  
ATOM   10095 C  CA   . SER A 1 61 ? 6.507   -3.798  -3.143  1.00 0.00 ? 61  SER A CA   9  
ATOM   10096 C  C    . SER A 1 61 ? 7.084   -4.200  -4.497  1.00 0.00 ? 61  SER A C    9  
ATOM   10097 O  O    . SER A 1 61 ? 6.619   -5.152  -5.124  1.00 0.00 ? 61  SER A O    9  
ATOM   10098 C  CB   . SER A 1 61 ? 5.354   -2.812  -3.340  1.00 0.00 ? 61  SER A CB   9  
ATOM   10099 O  OG   . SER A 1 61 ? 4.438   -2.877  -2.260  1.00 0.00 ? 61  SER A OG   9  
ATOM   10100 H  H    . SER A 1 61 ? 7.923   -2.343  -2.541  1.00 0.00 ? 61  SER A H    9  
ATOM   10101 H  HA   . SER A 1 61 ? 6.134   -4.681  -2.647  1.00 0.00 ? 61  SER A HA   9  
ATOM   10102 H  HB2  . SER A 1 61 ? 5.747   -1.809  -3.403  1.00 0.00 ? 61  SER A HB2  9  
ATOM   10103 H  HB3  . SER A 1 61 ? 4.831   -3.052  -4.254  1.00 0.00 ? 61  SER A HB3  9  
ATOM   10104 H  HG   . SER A 1 61 ? 4.658   -3.623  -1.698  1.00 0.00 ? 61  SER A HG   9  
ATOM   10105 N  N    . HIS A 1 62 ? 8.101   -3.468  -4.941  1.00 0.00 ? 62  HIS A N    9  
ATOM   10106 C  CA   . HIS A 1 62 ? 8.743   -3.748  -6.220  1.00 0.00 ? 62  HIS A CA   9  
ATOM   10107 C  C    . HIS A 1 62 ? 10.211  -4.113  -6.023  1.00 0.00 ? 62  HIS A C    9  
ATOM   10108 O  O    . HIS A 1 62 ? 11.063  -3.838  -6.868  1.00 0.00 ? 62  HIS A O    9  
ATOM   10109 C  CB   . HIS A 1 62 ? 8.627   -2.538  -7.149  1.00 0.00 ? 62  HIS A CB   9  
ATOM   10110 C  CG   . HIS A 1 62 ? 7.213   -2.168  -7.476  1.00 0.00 ? 62  HIS A CG   9  
ATOM   10111 N  ND1  . HIS A 1 62 ? 6.366   -2.989  -8.191  1.00 0.00 ? 62  HIS A ND1  9  
ATOM   10112 C  CD2  . HIS A 1 62 ? 6.497   -1.058  -7.180  1.00 0.00 ? 62  HIS A CD2  9  
ATOM   10113 C  CE1  . HIS A 1 62 ? 5.191   -2.399  -8.322  1.00 0.00 ? 62  HIS A CE1  9  
ATOM   10114 N  NE2  . HIS A 1 62 ? 5.244   -1.226  -7.717  1.00 0.00 ? 62  HIS A NE2  9  
ATOM   10115 H  H    . HIS A 1 62 ? 8.427   -2.722  -4.395  1.00 0.00 ? 62  HIS A H    9  
ATOM   10116 H  HA   . HIS A 1 62 ? 8.233   -4.586  -6.671  1.00 0.00 ? 62  HIS A HA   9  
ATOM   10117 H  HB2  . HIS A 1 62 ? 9.092   -1.685  -6.677  1.00 0.00 ? 62  HIS A HB2  9  
ATOM   10118 H  HB3  . HIS A 1 62 ? 9.137   -2.754  -8.076  1.00 0.00 ? 62  HIS A HB3  9  
ATOM   10119 H  HD1  . HIS A 1 62 ? 6.593   -3.872  -8.550  1.00 0.00 ? 62  HIS A HD1  9  
ATOM   10120 H  HD2  . HIS A 1 62 ? 6.846   -0.199  -6.625  1.00 0.00 ? 62  HIS A HD2  9  
ATOM   10121 H  HE1  . HIS A 1 62 ? 4.333   -2.806  -8.836  1.00 0.00 ? 62  HIS A HE1  9  
ATOM   10122 N  N    . PRO A 1 63 ? 10.515  -4.748  -4.881  1.00 0.00 ? 63  PRO A N    9  
ATOM   10123 C  CA   . PRO A 1 63 ? 11.880  -5.164  -4.546  1.00 0.00 ? 63  PRO A CA   9  
ATOM   10124 C  C    . PRO A 1 63 ? 12.369  -6.309  -5.427  1.00 0.00 ? 63  PRO A C    9  
ATOM   10125 O  O    . PRO A 1 63 ? 13.558  -6.628  -5.443  1.00 0.00 ? 63  PRO A O    9  
ATOM   10126 C  CB   . PRO A 1 63 ? 11.764  -5.622  -3.090  1.00 0.00 ? 63  PRO A CB   9  
ATOM   10127 C  CG   . PRO A 1 63 ? 10.338  -6.020  -2.931  1.00 0.00 ? 63  PRO A CG   9  
ATOM   10128 C  CD   . PRO A 1 63 ? 9.550   -5.108  -3.829  1.00 0.00 ? 63  PRO A CD   9  
ATOM   10129 H  HA   . PRO A 1 63 ? 12.574  -4.339  -4.612  1.00 0.00 ? 63  PRO A HA   9  
ATOM   10130 H  HB2  . PRO A 1 63 ? 12.430  -6.455  -2.918  1.00 0.00 ? 63  PRO A HB2  9  
ATOM   10131 H  HB3  . PRO A 1 63 ? 12.022  -4.806  -2.431  1.00 0.00 ? 63  PRO A HB3  9  
ATOM   10132 H  HG2  . PRO A 1 63 ? 10.208  -7.048  -3.233  1.00 0.00 ? 63  PRO A HG2  9  
ATOM   10133 H  HG3  . PRO A 1 63 ? 10.033  -5.889  -1.903  1.00 0.00 ? 63  PRO A HG3  9  
ATOM   10134 H  HD2  . PRO A 1 63 ? 8.701   -5.629  -4.246  1.00 0.00 ? 63  PRO A HD2  9  
ATOM   10135 H  HD3  . PRO A 1 63 ? 9.227   -4.231  -3.287  1.00 0.00 ? 63  PRO A HD3  9  
ATOM   10136 N  N    . ALA A 1 64 ? 11.446  -6.923  -6.159  1.00 0.00 ? 64  ALA A N    9  
ATOM   10137 C  CA   . ALA A 1 64 ? 11.784  -8.030  -7.044  1.00 0.00 ? 64  ALA A CA   9  
ATOM   10138 C  C    . ALA A 1 64 ? 11.950  -7.552  -8.482  1.00 0.00 ? 64  ALA A C    9  
ATOM   10139 O  O    . ALA A 1 64 ? 12.487  -8.270  -9.328  1.00 0.00 ? 64  ALA A O    9  
ATOM   10140 C  CB   . ALA A 1 64 ? 10.719  -9.113  -6.965  1.00 0.00 ? 64  ALA A CB   9  
ATOM   10141 H  H    . ALA A 1 64 ? 10.515  -6.623  -6.103  1.00 0.00 ? 64  ALA A H    9  
ATOM   10142 H  HA   . ALA A 1 64 ? 12.719  -8.454  -6.706  1.00 0.00 ? 64  ALA A HA   9  
ATOM   10143 H  HB1  . ALA A 1 64 ? 11.076  -10.005 -7.460  1.00 0.00 ? 64  ALA A HB1  9  
ATOM   10144 H  HB2  . ALA A 1 64 ? 10.507  -9.335  -5.930  1.00 0.00 ? 64  ALA A HB2  9  
ATOM   10145 H  HB3  . ALA A 1 64 ? 9.818   -8.768  -7.451  1.00 0.00 ? 64  ALA A HB3  9  
ATOM   10146 N  N    . LEU A 1 65 ? 11.486  -6.338  -8.755  1.00 0.00 ? 65  LEU A N    9  
ATOM   10147 C  CA   . LEU A 1 65 ? 11.583  -5.764  -10.092 1.00 0.00 ? 65  LEU A CA   9  
ATOM   10148 C  C    . LEU A 1 65 ? 12.824  -4.887  -10.220 1.00 0.00 ? 65  LEU A C    9  
ATOM   10149 O  O    . LEU A 1 65 ? 13.642  -5.078  -11.121 1.00 0.00 ? 65  LEU A O    9  
ATOM   10150 C  CB   . LEU A 1 65 ? 10.330  -4.944  -10.409 1.00 0.00 ? 65  LEU A CB   9  
ATOM   10151 C  CG   . LEU A 1 65 ? 9.020   -5.728  -10.499 1.00 0.00 ? 65  LEU A CG   9  
ATOM   10152 C  CD1  . LEU A 1 65 ? 7.831   -4.780  -10.510 1.00 0.00 ? 65  LEU A CD1  9  
ATOM   10153 C  CD2  . LEU A 1 65 ? 9.012   -6.612  -11.737 1.00 0.00 ? 65  LEU A CD2  9  
ATOM   10154 H  H    . LEU A 1 65 ? 11.069  -5.814  -8.040  1.00 0.00 ? 65  LEU A H    9  
ATOM   10155 H  HA   . LEU A 1 65 ? 11.657  -6.578  -10.797 1.00 0.00 ? 65  LEU A HA   9  
ATOM   10156 H  HB2  . LEU A 1 65 ? 10.218  -4.200  -9.635  1.00 0.00 ? 65  LEU A HB2  9  
ATOM   10157 H  HB3  . LEU A 1 65 ? 10.489  -4.452  -11.358 1.00 0.00 ? 65  LEU A HB3  9  
ATOM   10158 H  HG   . LEU A 1 65 ? 8.929   -6.366  -9.631  1.00 0.00 ? 65  LEU A HG   9  
ATOM   10159 H  HD11 . LEU A 1 65 ? 7.065   -5.156  -9.849  1.00 0.00 ? 65  LEU A HD11 9  
ATOM   10160 H  HD12 . LEU A 1 65 ? 7.438   -4.708  -11.513 1.00 0.00 ? 65  LEU A HD12 9  
ATOM   10161 H  HD13 . LEU A 1 65 ? 8.147   -3.802  -10.176 1.00 0.00 ? 65  LEU A HD13 9  
ATOM   10162 H  HD21 . LEU A 1 65 ? 9.457   -6.077  -12.563 1.00 0.00 ? 65  LEU A HD21 9  
ATOM   10163 H  HD22 . LEU A 1 65 ? 7.993   -6.874  -11.985 1.00 0.00 ? 65  LEU A HD22 9  
ATOM   10164 H  HD23 . LEU A 1 65 ? 9.578   -7.510  -11.542 1.00 0.00 ? 65  LEU A HD23 9  
ATOM   10165 N  N    . LEU A 1 66 ? 12.959  -3.926  -9.313  1.00 0.00 ? 66  LEU A N    9  
ATOM   10166 C  CA   . LEU A 1 66 ? 14.102  -3.020  -9.323  1.00 0.00 ? 66  LEU A CA   9  
ATOM   10167 C  C    . LEU A 1 66 ? 15.394  -3.776  -9.616  1.00 0.00 ? 66  LEU A C    9  
ATOM   10168 O  O    . LEU A 1 66 ? 16.161  -3.396  -10.502 1.00 0.00 ? 66  LEU A O    9  
ATOM   10169 C  CB   . LEU A 1 66 ? 14.216  -2.296  -7.980  1.00 0.00 ? 66  LEU A CB   9  
ATOM   10170 C  CG   . LEU A 1 66 ? 12.969  -1.542  -7.516  1.00 0.00 ? 66  LEU A CG   9  
ATOM   10171 C  CD1  . LEU A 1 66 ? 12.979  -1.372  -6.005  1.00 0.00 ? 66  LEU A CD1  9  
ATOM   10172 C  CD2  . LEU A 1 66 ? 12.877  -0.189  -8.206  1.00 0.00 ? 66  LEU A CD2  9  
ATOM   10173 H  H    . LEU A 1 66 ? 12.274  -3.822  -8.620  1.00 0.00 ? 66  LEU A H    9  
ATOM   10174 H  HA   . LEU A 1 66 ? 13.941  -2.291  -10.103 1.00 0.00 ? 66  LEU A HA   9  
ATOM   10175 H  HB2  . LEU A 1 66 ? 14.456  -3.031  -7.227  1.00 0.00 ? 66  LEU A HB2  9  
ATOM   10176 H  HB3  . LEU A 1 66 ? 15.025  -1.584  -8.056  1.00 0.00 ? 66  LEU A HB3  9  
ATOM   10177 H  HG   . LEU A 1 66 ? 12.091  -2.114  -7.782  1.00 0.00 ? 66  LEU A HG   9  
ATOM   10178 H  HD11 . LEU A 1 66 ? 12.772  -2.322  -5.535  1.00 0.00 ? 66  LEU A HD11 9  
ATOM   10179 H  HD12 . LEU A 1 66 ? 12.223  -0.656  -5.719  1.00 0.00 ? 66  LEU A HD12 9  
ATOM   10180 H  HD13 . LEU A 1 66 ? 13.949  -1.017  -5.689  1.00 0.00 ? 66  LEU A HD13 9  
ATOM   10181 H  HD21 . LEU A 1 66 ? 13.298  -0.262  -9.198  1.00 0.00 ? 66  LEU A HD21 9  
ATOM   10182 H  HD22 . LEU A 1 66 ? 13.428  0.545   -7.635  1.00 0.00 ? 66  LEU A HD22 9  
ATOM   10183 H  HD23 . LEU A 1 66 ? 11.842  0.111   -8.275  1.00 0.00 ? 66  LEU A HD23 9  
ATOM   10184 N  N    . LEU A 1 67 ? 15.627  -4.850  -8.870  1.00 0.00 ? 67  LEU A N    9  
ATOM   10185 C  CA   . LEU A 1 67 ? 16.825  -5.662  -9.051  1.00 0.00 ? 67  LEU A CA   9  
ATOM   10186 C  C    . LEU A 1 67 ? 16.808  -6.364  -10.406 1.00 0.00 ? 67  LEU A C    9  
ATOM   10187 O  O    . LEU A 1 67 ? 15.834  -6.268  -11.152 1.00 0.00 ? 67  LEU A O    9  
ATOM   10188 C  CB   . LEU A 1 67 ? 16.939  -6.697  -7.930  1.00 0.00 ? 67  LEU A CB   9  
ATOM   10189 C  CG   . LEU A 1 67 ? 16.830  -6.156  -6.504  1.00 0.00 ? 67  LEU A CG   9  
ATOM   10190 C  CD1  . LEU A 1 67 ? 16.434  -7.264  -5.541  1.00 0.00 ? 67  LEU A CD1  9  
ATOM   10191 C  CD2  . LEU A 1 67 ? 18.143  -5.518  -6.074  1.00 0.00 ? 67  LEU A CD2  9  
ATOM   10192 H  H    . LEU A 1 67 ? 14.979  -5.103  -8.180  1.00 0.00 ? 67  LEU A H    9  
ATOM   10193 H  HA   . LEU A 1 67 ? 17.681  -5.005  -9.011  1.00 0.00 ? 67  LEU A HA   9  
ATOM   10194 H  HB2  . LEU A 1 67 ? 16.152  -7.422  -8.069  1.00 0.00 ? 67  LEU A HB2  9  
ATOM   10195 H  HB3  . LEU A 1 67 ? 17.898  -7.185  -8.028  1.00 0.00 ? 67  LEU A HB3  9  
ATOM   10196 H  HG   . LEU A 1 67 ? 16.062  -5.395  -6.472  1.00 0.00 ? 67  LEU A HG   9  
ATOM   10197 H  HD11 . LEU A 1 67 ? 16.292  -6.850  -4.554  1.00 0.00 ? 67  LEU A HD11 9  
ATOM   10198 H  HD12 . LEU A 1 67 ? 17.214  -8.010  -5.510  1.00 0.00 ? 67  LEU A HD12 9  
ATOM   10199 H  HD13 . LEU A 1 67 ? 15.513  -7.720  -5.876  1.00 0.00 ? 67  LEU A HD13 9  
ATOM   10200 H  HD21 . LEU A 1 67 ? 18.261  -5.622  -5.006  1.00 0.00 ? 67  LEU A HD21 9  
ATOM   10201 H  HD22 . LEU A 1 67 ? 18.137  -4.470  -6.335  1.00 0.00 ? 67  LEU A HD22 9  
ATOM   10202 H  HD23 . LEU A 1 67 ? 18.963  -6.010  -6.576  1.00 0.00 ? 67  LEU A HD23 9  
ATOM   10203 N  N    . ALA A 1 68 ? 17.890  -7.070  -10.715 1.00 0.00 ? 68  ALA A N    9  
ATOM   10204 C  CA   . ALA A 1 68 ? 17.998  -7.791  -11.977 1.00 0.00 ? 68  ALA A CA   9  
ATOM   10205 C  C    . ALA A 1 68 ? 18.285  -9.270  -11.742 1.00 0.00 ? 68  ALA A C    9  
ATOM   10206 O  O    . ALA A 1 68 ? 18.781  -9.671  -10.688 1.00 0.00 ? 68  ALA A O    9  
ATOM   10207 C  CB   . ALA A 1 68 ? 19.081  -7.172  -12.848 1.00 0.00 ? 68  ALA A CB   9  
ATOM   10208 H  H    . ALA A 1 68 ? 18.634  -7.108  -10.078 1.00 0.00 ? 68  ALA A H    9  
ATOM   10209 H  HA   . ALA A 1 68 ? 17.055  -7.696  -12.497 1.00 0.00 ? 68  ALA A HA   9  
ATOM   10210 H  HB1  . ALA A 1 68 ? 19.270  -6.160  -12.521 1.00 0.00 ? 68  ALA A HB1  9  
ATOM   10211 H  HB2  . ALA A 1 68 ? 19.987  -7.754  -12.762 1.00 0.00 ? 68  ALA A HB2  9  
ATOM   10212 H  HB3  . ALA A 1 68 ? 18.755  -7.163  -13.877 1.00 0.00 ? 68  ALA A HB3  9  
ATOM   10213 N  N    . PRO A 1 69 ? 17.967  -10.102 -12.744 1.00 0.00 ? 69  PRO A N    9  
ATOM   10214 C  CA   . PRO A 1 69 ? 18.183  -11.550 -12.670 1.00 0.00 ? 69  PRO A CA   9  
ATOM   10215 C  C    . PRO A 1 69 ? 19.662  -11.918 -12.703 1.00 0.00 ? 69  PRO A C    9  
ATOM   10216 O  O    . PRO A 1 69 ? 20.370  -11.595 -13.656 1.00 0.00 ? 69  PRO A O    9  
ATOM   10217 C  CB   . PRO A 1 69 ? 17.472  -12.079 -13.918 1.00 0.00 ? 69  PRO A CB   9  
ATOM   10218 C  CG   . PRO A 1 69 ? 17.478  -10.934 -14.871 1.00 0.00 ? 69  PRO A CG   9  
ATOM   10219 C  CD   . PRO A 1 69 ? 17.373  -9.693  -14.028 1.00 0.00 ? 69  PRO A CD   9  
ATOM   10220 H  HA   . PRO A 1 69 ? 17.727  -11.974 -11.787 1.00 0.00 ? 69  PRO A HA   9  
ATOM   10221 H  HB2  . PRO A 1 69 ? 18.016  -12.926 -14.313 1.00 0.00 ? 69  PRO A HB2  9  
ATOM   10222 H  HB3  . PRO A 1 69 ? 16.466  -12.377 -13.664 1.00 0.00 ? 69  PRO A HB3  9  
ATOM   10223 H  HG2  . PRO A 1 69 ? 18.399  -10.929 -15.433 1.00 0.00 ? 69  PRO A HG2  9  
ATOM   10224 H  HG3  . PRO A 1 69 ? 16.630  -11.007 -15.537 1.00 0.00 ? 69  PRO A HG3  9  
ATOM   10225 H  HD2  . PRO A 1 69 ? 17.935  -8.886  -14.474 1.00 0.00 ? 69  PRO A HD2  9  
ATOM   10226 H  HD3  . PRO A 1 69 ? 16.339  -9.410  -13.901 1.00 0.00 ? 69  PRO A HD3  9  
ATOM   10227 N  N    . GLN A 1 70 ? 20.122  -12.597 -11.656 1.00 0.00 ? 70  GLN A N    9  
ATOM   10228 C  CA   . GLN A 1 70 ? 21.518  -13.008 -11.567 1.00 0.00 ? 70  GLN A CA   9  
ATOM   10229 C  C    . GLN A 1 70 ? 21.855  -14.028 -12.649 1.00 0.00 ? 70  GLN A C    9  
ATOM   10230 O  O    . GLN A 1 70 ? 20.963  -14.621 -13.256 1.00 0.00 ? 70  GLN A O    9  
ATOM   10231 C  CB   . GLN A 1 70 ? 21.810  -13.597 -10.186 1.00 0.00 ? 70  GLN A CB   9  
ATOM   10232 C  CG   . GLN A 1 70 ? 23.269  -13.486 -9.774  1.00 0.00 ? 70  GLN A CG   9  
ATOM   10233 C  CD   . GLN A 1 70 ? 23.533  -14.067 -8.398  1.00 0.00 ? 70  GLN A CD   9  
ATOM   10234 O  OE1  . GLN A 1 70 ? 22.735  -13.898 -7.476  1.00 0.00 ? 70  GLN A OE1  9  
ATOM   10235 N  NE2  . GLN A 1 70 ? 24.658  -14.758 -8.253  1.00 0.00 ? 70  GLN A NE2  9  
ATOM   10236 H  H    . GLN A 1 70 ? 19.508  -12.825 -10.928 1.00 0.00 ? 70  GLN A H    9  
ATOM   10237 H  HA   . GLN A 1 70 ? 22.132  -12.132 -11.712 1.00 0.00 ? 70  GLN A HA   9  
ATOM   10238 H  HB2  . GLN A 1 70 ? 21.211  -13.079 -9.452  1.00 0.00 ? 70  GLN A HB2  9  
ATOM   10239 H  HB3  . GLN A 1 70 ? 21.538  -14.642 -10.188 1.00 0.00 ? 70  GLN A HB3  9  
ATOM   10240 H  HG2  . GLN A 1 70 ? 23.875  -14.016 -10.493 1.00 0.00 ? 70  GLN A HG2  9  
ATOM   10241 H  HG3  . GLN A 1 70 ? 23.550  -12.443 -9.768  1.00 0.00 ? 70  GLN A HG3  9  
ATOM   10242 H  HE21 . GLN A 1 70 ? 25.247  -14.851 -9.032  1.00 0.00 ? 70  GLN A HE21 9  
ATOM   10243 H  HE22 . GLN A 1 70 ? 24.854  -15.144 -7.375  1.00 0.00 ? 70  GLN A HE22 9  
ATOM   10244 N  N    . GLU A 1 71 ? 23.148  -14.228 -12.886 1.00 0.00 ? 71  GLU A N    9  
ATOM   10245 C  CA   . GLU A 1 71 ? 23.602  -15.176 -13.896 1.00 0.00 ? 71  GLU A CA   9  
ATOM   10246 C  C    . GLU A 1 71 ? 23.231  -14.697 -15.297 1.00 0.00 ? 71  GLU A C    9  
ATOM   10247 O  O    . GLU A 1 71 ? 22.767  -15.477 -16.129 1.00 0.00 ? 71  GLU A O    9  
ATOM   10248 C  CB   . GLU A 1 71 ? 22.995  -16.557 -13.640 1.00 0.00 ? 71  GLU A CB   9  
ATOM   10249 C  CG   . GLU A 1 71 ? 23.809  -17.698 -14.229 1.00 0.00 ? 71  GLU A CG   9  
ATOM   10250 C  CD   . GLU A 1 71 ? 25.188  -17.811 -13.609 1.00 0.00 ? 71  GLU A CD   9  
ATOM   10251 O  OE1  . GLU A 1 71 ? 25.271  -17.958 -12.371 1.00 0.00 ? 71  GLU A OE1  9  
ATOM   10252 O  OE2  . GLU A 1 71 ? 26.184  -17.753 -14.360 1.00 0.00 ? 71  GLU A OE2  9  
ATOM   10253 H  H    . GLU A 1 71 ? 23.812  -13.725 -12.369 1.00 0.00 ? 71  GLU A H    9  
ATOM   10254 H  HA   . GLU A 1 71 ? 24.677  -15.246 -13.826 1.00 0.00 ? 71  GLU A HA   9  
ATOM   10255 H  HB2  . GLU A 1 71 ? 22.917  -16.711 -12.574 1.00 0.00 ? 71  GLU A HB2  9  
ATOM   10256 H  HB3  . GLU A 1 71 ? 22.006  -16.588 -14.073 1.00 0.00 ? 71  GLU A HB3  9  
ATOM   10257 H  HG2  . GLU A 1 71 ? 23.280  -18.624 -14.063 1.00 0.00 ? 71  GLU A HG2  9  
ATOM   10258 H  HG3  . GLU A 1 71 ? 23.920  -17.533 -15.291 1.00 0.00 ? 71  GLU A HG3  9  
ATOM   10259 N  N    . SER A 1 72 ? 23.438  -13.409 -15.550 1.00 0.00 ? 72  SER A N    9  
ATOM   10260 C  CA   . SER A 1 72 ? 23.122  -12.824 -16.848 1.00 0.00 ? 72  SER A CA   9  
ATOM   10261 C  C    . SER A 1 72 ? 24.295  -12.973 -17.811 1.00 0.00 ? 72  SER A C    9  
ATOM   10262 O  O    . SER A 1 72 ? 25.455  -12.977 -17.399 1.00 0.00 ? 72  SER A O    9  
ATOM   10263 C  CB   . SER A 1 72 ? 22.761  -11.346 -16.690 1.00 0.00 ? 72  SER A CB   9  
ATOM   10264 O  OG   . SER A 1 72 ? 21.918  -10.912 -17.743 1.00 0.00 ? 72  SER A OG   9  
ATOM   10265 H  H    . SER A 1 72 ? 23.811  -12.838 -14.846 1.00 0.00 ? 72  SER A H    9  
ATOM   10266 H  HA   . SER A 1 72 ? 22.271  -13.352 -17.251 1.00 0.00 ? 72  SER A HA   9  
ATOM   10267 H  HB2  . SER A 1 72 ? 22.248  -11.201 -15.752 1.00 0.00 ? 72  SER A HB2  9  
ATOM   10268 H  HB3  . SER A 1 72 ? 23.665  -10.754 -16.702 1.00 0.00 ? 72  SER A HB3  9  
ATOM   10269 H  HG   . SER A 1 72 ? 22.040  -9.970  -17.884 1.00 0.00 ? 72  SER A HG   9  
ATOM   10270 N  N    . SER A 1 73 ? 23.984  -13.095 -19.098 1.00 0.00 ? 73  SER A N    9  
ATOM   10271 C  CA   . SER A 1 73 ? 25.012  -13.249 -20.121 1.00 0.00 ? 73  SER A CA   9  
ATOM   10272 C  C    . SER A 1 73 ? 26.025  -12.111 -20.048 1.00 0.00 ? 73  SER A C    9  
ATOM   10273 O  O    . SER A 1 73 ? 25.657  -10.941 -19.948 1.00 0.00 ? 73  SER A O    9  
ATOM   10274 C  CB   . SER A 1 73 ? 24.374  -13.291 -21.512 1.00 0.00 ? 73  SER A CB   9  
ATOM   10275 O  OG   . SER A 1 73 ? 23.882  -12.016 -21.885 1.00 0.00 ? 73  SER A OG   9  
ATOM   10276 H  H    . SER A 1 73 ? 23.041  -13.085 -19.365 1.00 0.00 ? 73  SER A H    9  
ATOM   10277 H  HA   . SER A 1 73 ? 25.523  -14.183 -19.941 1.00 0.00 ? 73  SER A HA   9  
ATOM   10278 H  HB2  . SER A 1 73 ? 25.113  -13.604 -22.234 1.00 0.00 ? 73  SER A HB2  9  
ATOM   10279 H  HB3  . SER A 1 73 ? 23.554  -13.994 -21.507 1.00 0.00 ? 73  SER A HB3  9  
ATOM   10280 H  HG   . SER A 1 73 ? 24.501  -11.597 -22.488 1.00 0.00 ? 73  SER A HG   9  
ATOM   10281 N  N    . GLY A 1 74 ? 27.306  -12.464 -20.099 1.00 0.00 ? 74  GLY A N    9  
ATOM   10282 C  CA   . GLY A 1 74 ? 28.355  -11.462 -20.037 1.00 0.00 ? 74  GLY A CA   9  
ATOM   10283 C  C    . GLY A 1 74 ? 29.737  -12.057 -20.217 1.00 0.00 ? 74  GLY A C    9  
ATOM   10284 O  O    . GLY A 1 74 ? 29.935  -12.999 -20.985 1.00 0.00 ? 74  GLY A O    9  
ATOM   10285 H  H    . GLY A 1 74 ? 27.542  -13.412 -20.179 1.00 0.00 ? 74  GLY A H    9  
ATOM   10286 H  HA2  . GLY A 1 74 ? 28.185  -10.731 -20.813 1.00 0.00 ? 74  GLY A HA2  9  
ATOM   10287 H  HA3  . GLY A 1 74 ? 28.310  -10.970 -19.077 1.00 0.00 ? 74  GLY A HA3  9  
ATOM   10288 N  N    . PRO A 1 75 ? 30.723  -11.502 -19.498 1.00 0.00 ? 75  PRO A N    9  
ATOM   10289 C  CA   . PRO A 1 75 ? 32.112  -11.967 -19.566 1.00 0.00 ? 75  PRO A CA   9  
ATOM   10290 C  C    . PRO A 1 75 ? 32.293  -13.343 -18.934 1.00 0.00 ? 75  PRO A C    9  
ATOM   10291 O  O    . PRO A 1 75 ? 31.805  -13.601 -17.833 1.00 0.00 ? 75  PRO A O    9  
ATOM   10292 C  CB   . PRO A 1 75 ? 32.880  -10.908 -18.771 1.00 0.00 ? 75  PRO A CB   9  
ATOM   10293 C  CG   . PRO A 1 75 ? 31.874  -10.333 -17.835 1.00 0.00 ? 75  PRO A CG   9  
ATOM   10294 C  CD   . PRO A 1 75 ? 30.559  -10.376 -18.562 1.00 0.00 ? 75  PRO A CD   9  
ATOM   10295 H  HA   . PRO A 1 75 ? 32.473  -11.989 -20.583 1.00 0.00 ? 75  PRO A HA   9  
ATOM   10296 H  HB2  . PRO A 1 75 ? 33.696  -11.376 -18.238 1.00 0.00 ? 75  PRO A HB2  9  
ATOM   10297 H  HB3  . PRO A 1 75 ? 33.266  -10.158 -19.444 1.00 0.00 ? 75  PRO A HB3  9  
ATOM   10298 H  HG2  . PRO A 1 75 ? 31.826  -10.930 -16.936 1.00 0.00 ? 75  PRO A HG2  9  
ATOM   10299 H  HG3  . PRO A 1 75 ? 32.136  -9.313  -17.596 1.00 0.00 ? 75  PRO A HG3  9  
ATOM   10300 H  HD2  . PRO A 1 75 ? 29.751  -10.565 -17.871 1.00 0.00 ? 75  PRO A HD2  9  
ATOM   10301 H  HD3  . PRO A 1 75 ? 30.393  -9.453  -19.097 1.00 0.00 ? 75  PRO A HD3  9  
ATOM   10302 N  N    . SER A 1 76 ? 32.999  -14.223 -19.637 1.00 0.00 ? 76  SER A N    9  
ATOM   10303 C  CA   . SER A 1 76 ? 33.242  -15.575 -19.145 1.00 0.00 ? 76  SER A CA   9  
ATOM   10304 C  C    . SER A 1 76 ? 34.721  -15.781 -18.832 1.00 0.00 ? 76  SER A C    9  
ATOM   10305 O  O    . SER A 1 76 ? 35.074  -16.483 -17.885 1.00 0.00 ? 76  SER A O    9  
ATOM   10306 C  CB   . SER A 1 76 ? 32.779  -16.606 -20.176 1.00 0.00 ? 76  SER A CB   9  
ATOM   10307 O  OG   . SER A 1 76 ? 31.367  -16.726 -20.179 1.00 0.00 ? 76  SER A OG   9  
ATOM   10308 H  H    . SER A 1 76 ? 33.362  -13.958 -20.508 1.00 0.00 ? 76  SER A H    9  
ATOM   10309 H  HA   . SER A 1 76 ? 32.672  -15.705 -18.238 1.00 0.00 ? 76  SER A HA   9  
ATOM   10310 H  HB2  . SER A 1 76 ? 33.103  -16.300 -21.159 1.00 0.00 ? 76  SER A HB2  9  
ATOM   10311 H  HB3  . SER A 1 76 ? 33.210  -17.568 -19.938 1.00 0.00 ? 76  SER A HB3  9  
ATOM   10312 H  HG   . SER A 1 76 ? 31.051  -16.777 -21.084 1.00 0.00 ? 76  SER A HG   9  
ATOM   10313 N  N    . SER A 1 77 ? 35.581  -15.164 -19.636 1.00 0.00 ? 77  SER A N    9  
ATOM   10314 C  CA   . SER A 1 77 ? 37.022  -15.282 -19.448 1.00 0.00 ? 77  SER A CA   9  
ATOM   10315 C  C    . SER A 1 77 ? 37.474  -16.730 -19.607 1.00 0.00 ? 77  SER A C    9  
ATOM   10316 O  O    . SER A 1 77 ? 38.293  -17.225 -18.835 1.00 0.00 ? 77  SER A O    9  
ATOM   10317 C  CB   . SER A 1 77 ? 37.422  -14.760 -18.066 1.00 0.00 ? 77  SER A CB   9  
ATOM   10318 O  OG   . SER A 1 77 ? 37.444  -13.343 -18.043 1.00 0.00 ? 77  SER A OG   9  
ATOM   10319 H  H    . SER A 1 77 ? 35.238  -14.618 -20.374 1.00 0.00 ? 77  SER A H    9  
ATOM   10320 H  HA   . SER A 1 77 ? 37.505  -14.681 -20.204 1.00 0.00 ? 77  SER A HA   9  
ATOM   10321 H  HB2  . SER A 1 77 ? 36.711  -15.109 -17.333 1.00 0.00 ? 77  SER A HB2  9  
ATOM   10322 H  HB3  . SER A 1 77 ? 38.407  -15.128 -17.817 1.00 0.00 ? 77  SER A HB3  9  
ATOM   10323 H  HG   . SER A 1 77 ? 36.606  -13.004 -18.365 1.00 0.00 ? 77  SER A HG   9  
ATOM   10324 N  N    . GLY A 1 78 ? 36.933  -17.404 -20.618 1.00 0.00 ? 78  GLY A N    9  
ATOM   10325 C  CA   . GLY A 1 78 ? 37.291  -18.789 -20.861 1.00 0.00 ? 78  GLY A CA   9  
ATOM   10326 C  C    . GLY A 1 78 ? 37.382  -19.598 -19.583 1.00 0.00 ? 78  GLY A C    9  
ATOM   10327 O  O    . GLY A 1 78 ? 36.350  -20.039 -19.078 1.00 0.00 ? 78  GLY A O    9  
ATOM   10328 H  H    . GLY A 1 78 ? 36.285  -16.958 -21.202 1.00 0.00 ? 78  GLY A H    9  
ATOM   10329 H  HA2  . GLY A 1 78 ? 36.547  -19.235 -21.505 1.00 0.00 ? 78  GLY A HA2  9  
ATOM   10330 H  HA3  . GLY A 1 78 ? 38.248  -18.819 -21.361 1.00 0.00 ? 78  GLY A HA3  9  
HETATM 10331 ZN ZN   . ZN  B 2 .  ? -8.074  1.004   2.146   1.00 0.00 ? 201 ZN  A ZN   9  
HETATM 10332 ZN ZN   . ZN  C 2 .  ? 4.301   0.412   -7.012  1.00 0.00 ? 401 ZN  A ZN   9  
ATOM   10333 N  N    . GLY A 1 1  ? -6.595  -28.721 18.826  1.00 0.00 ? 1   GLY A N    10 
ATOM   10334 C  CA   . GLY A 1 1  ? -6.250  -27.311 18.834  1.00 0.00 ? 1   GLY A CA   10 
ATOM   10335 C  C    . GLY A 1 1  ? -6.571  -26.628 17.520  1.00 0.00 ? 1   GLY A C    10 
ATOM   10336 O  O    . GLY A 1 1  ? -5.742  -26.596 16.611  1.00 0.00 ? 1   GLY A O    10 
ATOM   10337 H  H1   . GLY A 1 1  ? -7.496  -29.002 18.560  1.00 0.00 ? 1   GLY A H1   10 
ATOM   10338 H  HA2  . GLY A 1 1  ? -6.799  -26.823 19.626  1.00 0.00 ? 1   GLY A HA2  10 
ATOM   10339 H  HA3  . GLY A 1 1  ? -5.192  -27.212 19.029  1.00 0.00 ? 1   GLY A HA3  10 
ATOM   10340 N  N    . SER A 1 2  ? -7.779  -26.082 17.418  1.00 0.00 ? 2   SER A N    10 
ATOM   10341 C  CA   . SER A 1 2  ? -8.210  -25.401 16.203  1.00 0.00 ? 2   SER A CA   10 
ATOM   10342 C  C    . SER A 1 2  ? -8.112  -23.887 16.365  1.00 0.00 ? 2   SER A C    10 
ATOM   10343 O  O    . SER A 1 2  ? -8.237  -23.360 17.470  1.00 0.00 ? 2   SER A O    10 
ATOM   10344 C  CB   . SER A 1 2  ? -9.646  -25.796 15.853  1.00 0.00 ? 2   SER A CB   10 
ATOM   10345 O  OG   . SER A 1 2  ? -9.706  -27.127 15.372  1.00 0.00 ? 2   SER A OG   10 
ATOM   10346 H  H    . SER A 1 2  ? -8.395  -26.141 18.178  1.00 0.00 ? 2   SER A H    10 
ATOM   10347 H  HA   . SER A 1 2  ? -7.555  -25.708 15.401  1.00 0.00 ? 2   SER A HA   10 
ATOM   10348 H  HB2  . SER A 1 2  ? -10.263 -25.717 16.735  1.00 0.00 ? 2   SER A HB2  10 
ATOM   10349 H  HB3  . SER A 1 2  ? -10.023 -25.132 15.089  1.00 0.00 ? 2   SER A HB3  10 
ATOM   10350 H  HG   . SER A 1 2  ? -10.581 -27.301 15.019  1.00 0.00 ? 2   SER A HG   10 
ATOM   10351 N  N    . SER A 1 3  ? -7.886  -23.193 15.254  1.00 0.00 ? 3   SER A N    10 
ATOM   10352 C  CA   . SER A 1 3  ? -7.768  -21.739 15.272  1.00 0.00 ? 3   SER A CA   10 
ATOM   10353 C  C    . SER A 1 3  ? -8.648  -21.109 14.197  1.00 0.00 ? 3   SER A C    10 
ATOM   10354 O  O    . SER A 1 3  ? -8.458  -21.347 13.005  1.00 0.00 ? 3   SER A O    10 
ATOM   10355 C  CB   . SER A 1 3  ? -6.310  -21.323 15.062  1.00 0.00 ? 3   SER A CB   10 
ATOM   10356 O  OG   . SER A 1 3  ? -6.208  -19.932 14.814  1.00 0.00 ? 3   SER A OG   10 
ATOM   10357 H  H    . SER A 1 3  ? -7.796  -23.670 14.402  1.00 0.00 ? 3   SER A H    10 
ATOM   10358 H  HA   . SER A 1 3  ? -8.097  -21.392 16.239  1.00 0.00 ? 3   SER A HA   10 
ATOM   10359 H  HB2  . SER A 1 3  ? -5.740  -21.562 15.947  1.00 0.00 ? 3   SER A HB2  10 
ATOM   10360 H  HB3  . SER A 1 3  ? -5.904  -21.859 14.216  1.00 0.00 ? 3   SER A HB3  10 
ATOM   10361 H  HG   . SER A 1 3  ? -5.918  -19.788 13.911  1.00 0.00 ? 3   SER A HG   10 
ATOM   10362 N  N    . GLY A 1 4  ? -9.613  -20.303 14.629  1.00 0.00 ? 4   GLY A N    10 
ATOM   10363 C  CA   . GLY A 1 4  ? -10.509 -19.651 13.692  1.00 0.00 ? 4   GLY A CA   10 
ATOM   10364 C  C    . GLY A 1 4  ? -10.750 -18.195 14.038  1.00 0.00 ? 4   GLY A C    10 
ATOM   10365 O  O    . GLY A 1 4  ? -11.209 -17.878 15.135  1.00 0.00 ? 4   GLY A O    10 
ATOM   10366 H  H    . GLY A 1 4  ? -9.718  -20.151 15.591  1.00 0.00 ? 4   GLY A H    10 
ATOM   10367 H  HA2  . GLY A 1 4  ? -10.082 -19.709 12.702  1.00 0.00 ? 4   GLY A HA2  10 
ATOM   10368 H  HA3  . GLY A 1 4  ? -11.456 -20.171 13.696  1.00 0.00 ? 4   GLY A HA3  10 
ATOM   10369 N  N    . SER A 1 5  ? -10.437 -17.306 13.101  1.00 0.00 ? 5   SER A N    10 
ATOM   10370 C  CA   . SER A 1 5  ? -10.617 -15.875 13.314  1.00 0.00 ? 5   SER A CA   10 
ATOM   10371 C  C    . SER A 1 5  ? -11.235 -15.215 12.085  1.00 0.00 ? 5   SER A C    10 
ATOM   10372 O  O    . SER A 1 5  ? -10.992 -15.635 10.954  1.00 0.00 ? 5   SER A O    10 
ATOM   10373 C  CB   . SER A 1 5  ? -9.276  -15.214 13.640  1.00 0.00 ? 5   SER A CB   10 
ATOM   10374 O  OG   . SER A 1 5  ? -8.488  -15.056 12.473  1.00 0.00 ? 5   SER A OG   10 
ATOM   10375 H  H    . SER A 1 5  ? -10.074 -17.620 12.246  1.00 0.00 ? 5   SER A H    10 
ATOM   10376 H  HA   . SER A 1 5  ? -11.285 -15.746 14.152  1.00 0.00 ? 5   SER A HA   10 
ATOM   10377 H  HB2  . SER A 1 5  ? -9.453  -14.242 14.075  1.00 0.00 ? 5   SER A HB2  10 
ATOM   10378 H  HB3  . SER A 1 5  ? -8.736  -15.830 14.345  1.00 0.00 ? 5   SER A HB3  10 
ATOM   10379 H  HG   . SER A 1 5  ? -8.374  -15.908 12.046  1.00 0.00 ? 5   SER A HG   10 
ATOM   10380 N  N    . SER A 1 6  ? -12.037 -14.181 12.317  1.00 0.00 ? 6   SER A N    10 
ATOM   10381 C  CA   . SER A 1 6  ? -12.695 -13.465 11.230  1.00 0.00 ? 6   SER A CA   10 
ATOM   10382 C  C    . SER A 1 6  ? -12.335 -11.982 11.260  1.00 0.00 ? 6   SER A C    10 
ATOM   10383 O  O    . SER A 1 6  ? -11.772 -11.488 12.236  1.00 0.00 ? 6   SER A O    10 
ATOM   10384 C  CB   . SER A 1 6  ? -14.212 -13.636 11.323  1.00 0.00 ? 6   SER A CB   10 
ATOM   10385 O  OG   . SER A 1 6  ? -14.741 -12.905 12.416  1.00 0.00 ? 6   SER A OG   10 
ATOM   10386 H  H    . SER A 1 6  ? -12.192 -13.894 13.241  1.00 0.00 ? 6   SER A H    10 
ATOM   10387 H  HA   . SER A 1 6  ? -12.350 -13.888 10.298  1.00 0.00 ? 6   SER A HA   10 
ATOM   10388 H  HB2  . SER A 1 6  ? -14.669 -13.279 10.412  1.00 0.00 ? 6   SER A HB2  10 
ATOM   10389 H  HB3  . SER A 1 6  ? -14.446 -14.682 11.458  1.00 0.00 ? 6   SER A HB3  10 
ATOM   10390 H  HG   . SER A 1 6  ? -14.172 -13.015 13.181  1.00 0.00 ? 6   SER A HG   10 
ATOM   10391 N  N    . GLY A 1 7  ? -12.666 -11.278 10.182  1.00 0.00 ? 7   GLY A N    10 
ATOM   10392 C  CA   . GLY A 1 7  ? -12.371 -9.859  10.104  1.00 0.00 ? 7   GLY A CA   10 
ATOM   10393 C  C    . GLY A 1 7  ? -12.163 -9.387  8.679   1.00 0.00 ? 7   GLY A C    10 
ATOM   10394 O  O    . GLY A 1 7  ? -11.618 -10.117 7.849   1.00 0.00 ? 7   GLY A O    10 
ATOM   10395 H  H    . GLY A 1 7  ? -13.114 -11.725 9.434   1.00 0.00 ? 7   GLY A H    10 
ATOM   10396 H  HA2  . GLY A 1 7  ? -13.191 -9.307  10.539  1.00 0.00 ? 7   GLY A HA2  10 
ATOM   10397 H  HA3  . GLY A 1 7  ? -11.475 -9.658  10.672  1.00 0.00 ? 7   GLY A HA3  10 
ATOM   10398 N  N    . LEU A 1 8  ? -12.598 -8.166  8.392   1.00 0.00 ? 8   LEU A N    10 
ATOM   10399 C  CA   . LEU A 1 8  ? -12.458 -7.598  7.055   1.00 0.00 ? 8   LEU A CA   10 
ATOM   10400 C  C    . LEU A 1 8  ? -11.020 -7.158  6.799   1.00 0.00 ? 8   LEU A C    10 
ATOM   10401 O  O    . LEU A 1 8  ? -10.243 -6.967  7.734   1.00 0.00 ? 8   LEU A O    10 
ATOM   10402 C  CB   . LEU A 1 8  ? -13.405 -6.409  6.883   1.00 0.00 ? 8   LEU A CB   10 
ATOM   10403 C  CG   . LEU A 1 8  ? -14.894 -6.706  7.062   1.00 0.00 ? 8   LEU A CG   10 
ATOM   10404 C  CD1  . LEU A 1 8  ? -15.671 -5.420  7.300   1.00 0.00 ? 8   LEU A CD1  10 
ATOM   10405 C  CD2  . LEU A 1 8  ? -15.441 -7.445  5.849   1.00 0.00 ? 8   LEU A CD2  10 
ATOM   10406 H  H    . LEU A 1 8  ? -13.024 -7.632  9.094   1.00 0.00 ? 8   LEU A H    10 
ATOM   10407 H  HA   . LEU A 1 8  ? -12.720 -8.364  6.341   1.00 0.00 ? 8   LEU A HA   10 
ATOM   10408 H  HB2  . LEU A 1 8  ? -13.129 -5.658  7.607   1.00 0.00 ? 8   LEU A HB2  10 
ATOM   10409 H  HB3  . LEU A 1 8  ? -13.263 -6.016  5.886   1.00 0.00 ? 8   LEU A HB3  10 
ATOM   10410 H  HG   . LEU A 1 8  ? -15.027 -7.340  7.928   1.00 0.00 ? 8   LEU A HG   10 
ATOM   10411 H  HD11 . LEU A 1 8  ? -15.191 -4.608  6.775   1.00 0.00 ? 8   LEU A HD11 10 
ATOM   10412 H  HD12 . LEU A 1 8  ? -15.692 -5.203  8.357   1.00 0.00 ? 8   LEU A HD12 10 
ATOM   10413 H  HD13 . LEU A 1 8  ? -16.681 -5.538  6.936   1.00 0.00 ? 8   LEU A HD13 10 
ATOM   10414 H  HD21 . LEU A 1 8  ? -16.120 -8.219  6.175   1.00 0.00 ? 8   LEU A HD21 10 
ATOM   10415 H  HD22 . LEU A 1 8  ? -14.623 -7.891  5.301   1.00 0.00 ? 8   LEU A HD22 10 
ATOM   10416 H  HD23 . LEU A 1 8  ? -15.966 -6.750  5.211   1.00 0.00 ? 8   LEU A HD23 10 
ATOM   10417 N  N    . GLN A 1 9  ? -10.674 -6.997  5.526   1.00 0.00 ? 9   GLN A N    10 
ATOM   10418 C  CA   . GLN A 1 9  ? -9.330  -6.578  5.147   1.00 0.00 ? 9   GLN A CA   10 
ATOM   10419 C  C    . GLN A 1 9  ? -9.373  -5.612  3.967   1.00 0.00 ? 9   GLN A C    10 
ATOM   10420 O  O    . GLN A 1 9  ? -9.759  -5.985  2.859   1.00 0.00 ? 9   GLN A O    10 
ATOM   10421 C  CB   . GLN A 1 9  ? -8.474  -7.795  4.793   1.00 0.00 ? 9   GLN A CB   10 
ATOM   10422 C  CG   . GLN A 1 9  ? -7.021  -7.454  4.505   1.00 0.00 ? 9   GLN A CG   10 
ATOM   10423 C  CD   . GLN A 1 9  ? -6.148  -7.526  5.742   1.00 0.00 ? 9   GLN A CD   10 
ATOM   10424 O  OE1  . GLN A 1 9  ? -6.148  -8.528  6.459   1.00 0.00 ? 9   GLN A OE1  10 
ATOM   10425 N  NE2  . GLN A 1 9  ? -5.397  -6.462  6.000   1.00 0.00 ? 9   GLN A NE2  10 
ATOM   10426 H  H    . GLN A 1 9  ? -11.338 -7.164  4.825   1.00 0.00 ? 9   GLN A H    10 
ATOM   10427 H  HA   . GLN A 1 9  ? -8.889  -6.073  5.993   1.00 0.00 ? 9   GLN A HA   10 
ATOM   10428 H  HB2  . GLN A 1 9  ? -8.501  -8.491  5.618   1.00 0.00 ? 9   GLN A HB2  10 
ATOM   10429 H  HB3  . GLN A 1 9  ? -8.890  -8.271  3.917   1.00 0.00 ? 9   GLN A HB3  10 
ATOM   10430 H  HG2  . GLN A 1 9  ? -6.639  -8.151  3.773   1.00 0.00 ? 9   GLN A HG2  10 
ATOM   10431 H  HG3  . GLN A 1 9  ? -6.972  -6.452  4.106   1.00 0.00 ? 9   GLN A HG3  10 
ATOM   10432 H  HE21 . GLN A 1 9  ? -5.449  -5.700  5.386   1.00 0.00 ? 9   GLN A HE21 10 
ATOM   10433 H  HE22 . GLN A 1 9  ? -4.824  -6.481  6.794   1.00 0.00 ? 9   GLN A HE22 10 
ATOM   10434 N  N    . CYS A 1 10 ? -8.975  -4.368  4.213   1.00 0.00 ? 10  CYS A N    10 
ATOM   10435 C  CA   . CYS A 1 10 ? -8.968  -3.347  3.172   1.00 0.00 ? 10  CYS A CA   10 
ATOM   10436 C  C    . CYS A 1 10 ? -7.862  -3.614  2.155   1.00 0.00 ? 10  CYS A C    10 
ATOM   10437 O  O    . CYS A 1 10 ? -6.820  -4.177  2.490   1.00 0.00 ? 10  CYS A O    10 
ATOM   10438 C  CB   . CYS A 1 10 ? -8.784  -1.960  3.790   1.00 0.00 ? 10  CYS A CB   10 
ATOM   10439 S  SG   . CYS A 1 10 ? -8.145  -0.708  2.631   1.00 0.00 ? 10  CYS A SG   10 
ATOM   10440 H  H    . CYS A 1 10 ? -8.678  -4.130  5.117   1.00 0.00 ? 10  CYS A H    10 
ATOM   10441 H  HA   . CYS A 1 10 ? -9.921  -3.383  2.666   1.00 0.00 ? 10  CYS A HA   10 
ATOM   10442 H  HB2  . CYS A 1 10 ? -9.736  -1.609  4.159   1.00 0.00 ? 10  CYS A HB2  10 
ATOM   10443 H  HB3  . CYS A 1 10 ? -8.089  -2.031  4.614   1.00 0.00 ? 10  CYS A HB3  10 
ATOM   10444 N  N    . GLU A 1 11 ? -8.097  -3.206  0.912   1.00 0.00 ? 11  GLU A N    10 
ATOM   10445 C  CA   . GLU A 1 11 ? -7.121  -3.402  -0.153  1.00 0.00 ? 11  GLU A CA   10 
ATOM   10446 C  C    . GLU A 1 11 ? -6.329  -2.122  -0.407  1.00 0.00 ? 11  GLU A C    10 
ATOM   10447 O  O    . GLU A 1 11 ? -5.164  -2.169  -0.803  1.00 0.00 ? 11  GLU A O    10 
ATOM   10448 C  CB   . GLU A 1 11 ? -7.820  -3.846  -1.440  1.00 0.00 ? 11  GLU A CB   10 
ATOM   10449 C  CG   . GLU A 1 11 ? -8.840  -2.845  -1.955  1.00 0.00 ? 11  GLU A CG   10 
ATOM   10450 C  CD   . GLU A 1 11 ? -9.875  -3.482  -2.863  1.00 0.00 ? 11  GLU A CD   10 
ATOM   10451 O  OE1  . GLU A 1 11 ? -10.830 -4.091  -2.337  1.00 0.00 ? 11  GLU A OE1  10 
ATOM   10452 O  OE2  . GLU A 1 11 ? -9.729  -3.373  -4.098  1.00 0.00 ? 11  GLU A OE2  10 
ATOM   10453 H  H    . GLU A 1 11 ? -8.947  -2.763  0.707   1.00 0.00 ? 11  GLU A H    10 
ATOM   10454 H  HA   . GLU A 1 11 ? -6.439  -4.177  0.161   1.00 0.00 ? 11  GLU A HA   10 
ATOM   10455 H  HB2  . GLU A 1 11 ? -7.074  -3.997  -2.207  1.00 0.00 ? 11  GLU A HB2  10 
ATOM   10456 H  HB3  . GLU A 1 11 ? -8.326  -4.782  -1.255  1.00 0.00 ? 11  GLU A HB3  10 
ATOM   10457 H  HG2  . GLU A 1 11 ? -9.348  -2.402  -1.112  1.00 0.00 ? 11  GLU A HG2  10 
ATOM   10458 H  HG3  . GLU A 1 11 ? -8.323  -2.075  -2.508  1.00 0.00 ? 11  GLU A HG3  10 
ATOM   10459 N  N    . ILE A 1 12 ? -6.970  -0.981  -0.177  1.00 0.00 ? 12  ILE A N    10 
ATOM   10460 C  CA   . ILE A 1 12 ? -6.326  0.311   -0.381  1.00 0.00 ? 12  ILE A CA   10 
ATOM   10461 C  C    . ILE A 1 12 ? -4.984  0.375   0.341   1.00 0.00 ? 12  ILE A C    10 
ATOM   10462 O  O    . ILE A 1 12 ? -3.939  0.559   -0.284  1.00 0.00 ? 12  ILE A O    10 
ATOM   10463 C  CB   . ILE A 1 12 ? -7.217  1.467   0.111   1.00 0.00 ? 12  ILE A CB   10 
ATOM   10464 C  CG1  . ILE A 1 12 ? -8.518  1.514   -0.692  1.00 0.00 ? 12  ILE A CG1  10 
ATOM   10465 C  CG2  . ILE A 1 12 ? -6.474  2.790   0.002   1.00 0.00 ? 12  ILE A CG2  10 
ATOM   10466 C  CD1  . ILE A 1 12 ? -9.702  0.921   0.042   1.00 0.00 ? 12  ILE A CD1  10 
ATOM   10467 H  H    . ILE A 1 12 ? -7.897  -1.009  0.137   1.00 0.00 ? 12  ILE A H    10 
ATOM   10468 H  HA   . ILE A 1 12 ? -6.159  0.436   -1.441  1.00 0.00 ? 12  ILE A HA   10 
ATOM   10469 H  HB   . ILE A 1 12 ? -7.449  1.296   1.151   1.00 0.00 ? 12  ILE A HB   10 
ATOM   10470 H  HG12 . ILE A 1 12 ? -8.754  2.540   -0.925  1.00 0.00 ? 12  ILE A HG12 10 
ATOM   10471 H  HG13 . ILE A 1 12 ? -8.386  0.961   -1.610  1.00 0.00 ? 12  ILE A HG13 10 
ATOM   10472 H  HG21 . ILE A 1 12 ? -6.860  3.481   0.737   1.00 0.00 ? 12  ILE A HG21 10 
ATOM   10473 H  HG22 . ILE A 1 12 ? -5.421  2.628   0.181   1.00 0.00 ? 12  ILE A HG22 10 
ATOM   10474 H  HG23 . ILE A 1 12 ? -6.612  3.201   -0.986  1.00 0.00 ? 12  ILE A HG23 10 
ATOM   10475 H  HD11 . ILE A 1 12 ? -9.461  -0.081  0.364   1.00 0.00 ? 12  ILE A HD11 10 
ATOM   10476 H  HD12 . ILE A 1 12 ? -9.935  1.531   0.902   1.00 0.00 ? 12  ILE A HD12 10 
ATOM   10477 H  HD13 . ILE A 1 12 ? -10.556 0.890   -0.619  1.00 0.00 ? 12  ILE A HD13 10 
ATOM   10478 N  N    . CYS A 1 13 ? -5.020  0.221   1.660   1.00 0.00 ? 13  CYS A N    10 
ATOM   10479 C  CA   . CYS A 1 13 ? -3.807  0.260   2.468   1.00 0.00 ? 13  CYS A CA   10 
ATOM   10480 C  C    . CYS A 1 13 ? -3.494  -1.117  3.046   1.00 0.00 ? 13  CYS A C    10 
ATOM   10481 O  O    . CYS A 1 13 ? -2.333  -1.516  3.132   1.00 0.00 ? 13  CYS A O    10 
ATOM   10482 C  CB   . CYS A 1 13 ? -3.956  1.279   3.600   1.00 0.00 ? 13  CYS A CB   10 
ATOM   10483 S  SG   . CYS A 1 13 ? -5.345  0.940   4.728   1.00 0.00 ? 13  CYS A SG   10 
ATOM   10484 H  H    . CYS A 1 13 ? -5.884  0.078   2.102   1.00 0.00 ? 13  CYS A H    10 
ATOM   10485 H  HA   . CYS A 1 13 ? -2.991  0.562   1.828   1.00 0.00 ? 13  CYS A HA   10 
ATOM   10486 H  HB2  . CYS A 1 13 ? -3.050  1.286   4.188   1.00 0.00 ? 13  CYS A HB2  10 
ATOM   10487 H  HB3  . CYS A 1 13 ? -4.109  2.259   3.173   1.00 0.00 ? 13  CYS A HB3  10 
ATOM   10488 N  N    . GLY A 1 14 ? -4.538  -1.838  3.441   1.00 0.00 ? 14  GLY A N    10 
ATOM   10489 C  CA   . GLY A 1 14 ? -4.354  -3.162  4.006   1.00 0.00 ? 14  GLY A CA   10 
ATOM   10490 C  C    . GLY A 1 14 ? -4.742  -3.227  5.470   1.00 0.00 ? 14  GLY A C    10 
ATOM   10491 O  O    . GLY A 1 14 ? -4.096  -3.914  6.261   1.00 0.00 ? 14  GLY A O    10 
ATOM   10492 H  H    . GLY A 1 14 ? -5.441  -1.468  3.349   1.00 0.00 ? 14  GLY A H    10 
ATOM   10493 H  HA2  . GLY A 1 14 ? -4.959  -3.865  3.453   1.00 0.00 ? 14  GLY A HA2  10 
ATOM   10494 H  HA3  . GLY A 1 14 ? -3.316  -3.441  3.909   1.00 0.00 ? 14  GLY A HA3  10 
ATOM   10495 N  N    . PHE A 1 15 ? -5.799  -2.508  5.833   1.00 0.00 ? 15  PHE A N    10 
ATOM   10496 C  CA   . PHE A 1 15 ? -6.271  -2.485  7.213   1.00 0.00 ? 15  PHE A CA   10 
ATOM   10497 C  C    . PHE A 1 15 ? -7.193  -3.668  7.493   1.00 0.00 ? 15  PHE A C    10 
ATOM   10498 O  O    . PHE A 1 15 ? -7.524  -4.439  6.592   1.00 0.00 ? 15  PHE A O    10 
ATOM   10499 C  CB   . PHE A 1 15 ? -7.004  -1.173  7.501   1.00 0.00 ? 15  PHE A CB   10 
ATOM   10500 C  CG   . PHE A 1 15 ? -7.206  -0.909  8.966   1.00 0.00 ? 15  PHE A CG   10 
ATOM   10501 C  CD1  . PHE A 1 15 ? -6.120  -0.783  9.817   1.00 0.00 ? 15  PHE A CD1  10 
ATOM   10502 C  CD2  . PHE A 1 15 ? -8.482  -0.787  9.492   1.00 0.00 ? 15  PHE A CD2  10 
ATOM   10503 C  CE1  . PHE A 1 15 ? -6.303  -0.540  11.166  1.00 0.00 ? 15  PHE A CE1  10 
ATOM   10504 C  CE2  . PHE A 1 15 ? -8.671  -0.543  10.839  1.00 0.00 ? 15  PHE A CE2  10 
ATOM   10505 C  CZ   . PHE A 1 15 ? -7.580  -0.421  11.677  1.00 0.00 ? 15  PHE A CZ   10 
ATOM   10506 H  H    . PHE A 1 15 ? -6.274  -1.981  5.156   1.00 0.00 ? 15  PHE A H    10 
ATOM   10507 H  HA   . PHE A 1 15 ? -5.409  -2.555  7.858   1.00 0.00 ? 15  PHE A HA   10 
ATOM   10508 H  HB2  . PHE A 1 15 ? -6.434  -0.353  7.093   1.00 0.00 ? 15  PHE A HB2  10 
ATOM   10509 H  HB3  . PHE A 1 15 ? -7.975  -1.201  7.031   1.00 0.00 ? 15  PHE A HB3  10 
ATOM   10510 H  HD1  . PHE A 1 15 ? -5.120  -0.876  9.418   1.00 0.00 ? 15  PHE A HD1  10 
ATOM   10511 H  HD2  . PHE A 1 15 ? -9.337  -0.884  8.838   1.00 0.00 ? 15  PHE A HD2  10 
ATOM   10512 H  HE1  . PHE A 1 15 ? -5.448  -0.444  11.818  1.00 0.00 ? 15  PHE A HE1  10 
ATOM   10513 H  HE2  . PHE A 1 15 ? -9.671  -0.451  11.236  1.00 0.00 ? 15  PHE A HE2  10 
ATOM   10514 H  HZ   . PHE A 1 15 ? -7.725  -0.230  12.730  1.00 0.00 ? 15  PHE A HZ   10 
ATOM   10515 N  N    . THR A 1 16 ? -7.604  -3.806  8.750   1.00 0.00 ? 16  THR A N    10 
ATOM   10516 C  CA   . THR A 1 16 ? -8.485  -4.895  9.150   1.00 0.00 ? 16  THR A CA   10 
ATOM   10517 C  C    . THR A 1 16 ? -9.459  -4.444  10.233  1.00 0.00 ? 16  THR A C    10 
ATOM   10518 O  O    . THR A 1 16 ? -9.061  -3.825  11.220  1.00 0.00 ? 16  THR A O    10 
ATOM   10519 C  CB   . THR A 1 16 ? -7.684  -6.105  9.667   1.00 0.00 ? 16  THR A CB   10 
ATOM   10520 O  OG1  . THR A 1 16 ? -6.531  -5.657  10.389  1.00 0.00 ? 16  THR A OG1  10 
ATOM   10521 C  CG2  . THR A 1 16 ? -7.252  -7.000  8.516   1.00 0.00 ? 16  THR A CG2  10 
ATOM   10522 H  H    . THR A 1 16 ? -7.305  -3.159  9.423   1.00 0.00 ? 16  THR A H    10 
ATOM   10523 H  HA   . THR A 1 16 ? -9.047  -5.206  8.282   1.00 0.00 ? 16  THR A HA   10 
ATOM   10524 H  HB   . THR A 1 16 ? -8.315  -6.678  10.332  1.00 0.00 ? 16  THR A HB   10 
ATOM   10525 H  HG1  . THR A 1 16 ? -6.016  -6.416  10.672  1.00 0.00 ? 16  THR A HG1  10 
ATOM   10526 H  HG21 . THR A 1 16 ? -6.390  -6.570  8.029   1.00 0.00 ? 16  THR A HG21 10 
ATOM   10527 H  HG22 . THR A 1 16 ? -8.061  -7.088  7.805   1.00 0.00 ? 16  THR A HG22 10 
ATOM   10528 H  HG23 . THR A 1 16 ? -7.000  -7.978  8.896   1.00 0.00 ? 16  THR A HG23 10 
ATOM   10529 N  N    . CYS A 1 17 ? -10.735 -4.759  10.043  1.00 0.00 ? 17  CYS A N    10 
ATOM   10530 C  CA   . CYS A 1 17 ? -11.767 -4.386  11.004  1.00 0.00 ? 17  CYS A CA   10 
ATOM   10531 C  C    . CYS A 1 17 ? -12.789 -5.506  11.167  1.00 0.00 ? 17  CYS A C    10 
ATOM   10532 O  O    . CYS A 1 17 ? -13.086 -6.231  10.218  1.00 0.00 ? 17  CYS A O    10 
ATOM   10533 C  CB   . CYS A 1 17 ? -12.467 -3.101  10.560  1.00 0.00 ? 17  CYS A CB   10 
ATOM   10534 S  SG   . CYS A 1 17 ? -13.621 -3.326  9.187   1.00 0.00 ? 17  CYS A SG   10 
ATOM   10535 H  H    . CYS A 1 17 ? -10.991 -5.254  9.236   1.00 0.00 ? 17  CYS A H    10 
ATOM   10536 H  HA   . CYS A 1 17 ? -11.285 -4.213  11.955  1.00 0.00 ? 17  CYS A HA   10 
ATOM   10537 H  HB2  . CYS A 1 17 ? -13.023 -2.696  11.392  1.00 0.00 ? 17  CYS A HB2  10 
ATOM   10538 H  HB3  . CYS A 1 17 ? -11.722 -2.383  10.250  1.00 0.00 ? 17  CYS A HB3  10 
ATOM   10539 H  HG   . CYS A 1 17 ? -12.953 -3.147  8.057   1.00 0.00 ? 17  CYS A HG   10 
ATOM   10540 N  N    . ARG A 1 18 ? -13.322 -5.642  12.377  1.00 0.00 ? 18  ARG A N    10 
ATOM   10541 C  CA   . ARG A 1 18 ? -14.309 -6.676  12.666  1.00 0.00 ? 18  ARG A CA   10 
ATOM   10542 C  C    . ARG A 1 18 ? -15.706 -6.223  12.253  1.00 0.00 ? 18  ARG A C    10 
ATOM   10543 O  O    . ARG A 1 18 ? -16.458 -6.981  11.641  1.00 0.00 ? 18  ARG A O    10 
ATOM   10544 C  CB   . ARG A 1 18 ? -14.293 -7.025  14.155  1.00 0.00 ? 18  ARG A CB   10 
ATOM   10545 C  CG   . ARG A 1 18 ? -13.151 -7.946  14.552  1.00 0.00 ? 18  ARG A CG   10 
ATOM   10546 C  CD   . ARG A 1 18 ? -11.829 -7.196  14.622  1.00 0.00 ? 18  ARG A CD   10 
ATOM   10547 N  NE   . ARG A 1 18 ? -10.688 -8.077  14.391  1.00 0.00 ? 18  ARG A NE   10 
ATOM   10548 C  CZ   . ARG A 1 18 ? -9.476  -7.640  14.066  1.00 0.00 ? 18  ARG A CZ   10 
ATOM   10549 N  NH1  . ARG A 1 18 ? -9.250  -6.341  13.934  1.00 0.00 ? 18  ARG A NH1  10 
ATOM   10550 N  NH2  . ARG A 1 18 ? -8.488  -8.504  13.872  1.00 0.00 ? 18  ARG A NH2  10 
ATOM   10551 H  H    . ARG A 1 18 ? -13.045 -5.033  13.093  1.00 0.00 ? 18  ARG A H    10 
ATOM   10552 H  HA   . ARG A 1 18 ? -14.045 -7.554  12.096  1.00 0.00 ? 18  ARG A HA   10 
ATOM   10553 H  HB2  . ARG A 1 18 ? -14.205 -6.112  14.726  1.00 0.00 ? 18  ARG A HB2  10 
ATOM   10554 H  HB3  . ARG A 1 18 ? -15.223 -7.510  14.408  1.00 0.00 ? 18  ARG A HB3  10 
ATOM   10555 H  HG2  . ARG A 1 18 ? -13.363 -8.369  15.523  1.00 0.00 ? 18  ARG A HG2  10 
ATOM   10556 H  HG3  . ARG A 1 18 ? -13.068 -8.737  13.822  1.00 0.00 ? 18  ARG A HG3  10 
ATOM   10557 H  HD2  . ARG A 1 18 ? -11.830 -6.421  13.871  1.00 0.00 ? 18  ARG A HD2  10 
ATOM   10558 H  HD3  . ARG A 1 18 ? -11.736 -6.749  15.600  1.00 0.00 ? 18  ARG A HD3  10 
ATOM   10559 H  HE   . ARG A 1 18 ? -10.833 -9.042  14.483  1.00 0.00 ? 18  ARG A HE   10 
ATOM   10560 H  HH11 . ARG A 1 18 ? -9.992  -5.687  14.081  1.00 0.00 ? 18  ARG A HH11 10 
ATOM   10561 H  HH12 . ARG A 1 18 ? -8.336  -6.014  13.690  1.00 0.00 ? 18  ARG A HH12 10 
ATOM   10562 H  HH21 . ARG A 1 18 ? -8.655  -9.485  13.971  1.00 0.00 ? 18  ARG A HH21 10 
ATOM   10563 H  HH22 . ARG A 1 18 ? -7.577  -8.175  13.627  1.00 0.00 ? 18  ARG A HH22 10 
ATOM   10564 N  N    . GLN A 1 19 ? -16.046 -4.984  12.593  1.00 0.00 ? 19  GLN A N    10 
ATOM   10565 C  CA   . GLN A 1 19 ? -17.354 -4.432  12.259  1.00 0.00 ? 19  GLN A CA   10 
ATOM   10566 C  C    . GLN A 1 19 ? -17.342 -3.809  10.867  1.00 0.00 ? 19  GLN A C    10 
ATOM   10567 O  O    . GLN A 1 19 ? -16.521 -2.940  10.571  1.00 0.00 ? 19  GLN A O    10 
ATOM   10568 C  CB   . GLN A 1 19 ? -17.769 -3.387  13.296  1.00 0.00 ? 19  GLN A CB   10 
ATOM   10569 C  CG   . GLN A 1 19 ? -17.904 -3.945  14.703  1.00 0.00 ? 19  GLN A CG   10 
ATOM   10570 C  CD   . GLN A 1 19 ? -19.296 -4.471  14.991  1.00 0.00 ? 19  GLN A CD   10 
ATOM   10571 O  OE1  . GLN A 1 19 ? -19.542 -5.676  14.935  1.00 0.00 ? 19  GLN A OE1  10 
ATOM   10572 N  NE2  . GLN A 1 19 ? -20.218 -3.567  15.303  1.00 0.00 ? 19  GLN A NE2  10 
ATOM   10573 H  H    . GLN A 1 19 ? -15.403 -4.429  13.080  1.00 0.00 ? 19  GLN A H    10 
ATOM   10574 H  HA   . GLN A 1 19 ? -18.068 -5.241  12.271  1.00 0.00 ? 19  GLN A HA   10 
ATOM   10575 H  HB2  . GLN A 1 19 ? -17.030 -2.600  13.313  1.00 0.00 ? 19  GLN A HB2  10 
ATOM   10576 H  HB3  . GLN A 1 19 ? -18.722 -2.968  13.005  1.00 0.00 ? 19  GLN A HB3  10 
ATOM   10577 H  HG2  . GLN A 1 19 ? -17.199 -4.754  14.825  1.00 0.00 ? 19  GLN A HG2  10 
ATOM   10578 H  HG3  . GLN A 1 19 ? -17.677 -3.162  15.410  1.00 0.00 ? 19  GLN A HG3  10 
ATOM   10579 H  HE21 . GLN A 1 19 ? -19.950 -2.624  15.328  1.00 0.00 ? 19  GLN A HE21 10 
ATOM   10580 H  HE22 . GLN A 1 19 ? -21.126 -3.879  15.494  1.00 0.00 ? 19  GLN A HE22 10 
ATOM   10581 N  N    . LYS A 1 20 ? -18.257 -4.258  10.016  1.00 0.00 ? 20  LYS A N    10 
ATOM   10582 C  CA   . LYS A 1 20 ? -18.354 -3.744  8.654   1.00 0.00 ? 20  LYS A CA   10 
ATOM   10583 C  C    . LYS A 1 20 ? -18.361 -2.219  8.648   1.00 0.00 ? 20  LYS A C    10 
ATOM   10584 O  O    . LYS A 1 20 ? -17.588 -1.588  7.927   1.00 0.00 ? 20  LYS A O    10 
ATOM   10585 C  CB   . LYS A 1 20 ? -19.620 -4.273  7.976   1.00 0.00 ? 20  LYS A CB   10 
ATOM   10586 C  CG   . LYS A 1 20 ? -19.885 -3.654  6.615   1.00 0.00 ? 20  LYS A CG   10 
ATOM   10587 C  CD   . LYS A 1 20 ? -18.984 -4.251  5.546   1.00 0.00 ? 20  LYS A CD   10 
ATOM   10588 C  CE   . LYS A 1 20 ? -19.502 -3.949  4.148   1.00 0.00 ? 20  LYS A CE   10 
ATOM   10589 N  NZ   . LYS A 1 20 ? -20.455 -4.990  3.674   1.00 0.00 ? 20  LYS A NZ   10 
ATOM   10590 H  H    . LYS A 1 20 ? -18.885 -4.951  10.310  1.00 0.00 ? 20  LYS A H    10 
ATOM   10591 H  HA   . LYS A 1 20 ? -17.491 -4.091  8.107   1.00 0.00 ? 20  LYS A HA   10 
ATOM   10592 H  HB2  . LYS A 1 20 ? -19.527 -5.342  7.851   1.00 0.00 ? 20  LYS A HB2  10 
ATOM   10593 H  HB3  . LYS A 1 20 ? -20.468 -4.066  8.613   1.00 0.00 ? 20  LYS A HB3  10 
ATOM   10594 H  HG2  . LYS A 1 20 ? -20.914 -3.832  6.342   1.00 0.00 ? 20  LYS A HG2  10 
ATOM   10595 H  HG3  . LYS A 1 20 ? -19.704 -2.590  6.672   1.00 0.00 ? 20  LYS A HG3  10 
ATOM   10596 H  HD2  . LYS A 1 20 ? -17.993 -3.833  5.649   1.00 0.00 ? 20  LYS A HD2  10 
ATOM   10597 H  HD3  . LYS A 1 20 ? -18.940 -5.322  5.682   1.00 0.00 ? 20  LYS A HD3  10 
ATOM   10598 H  HE2  . LYS A 1 20 ? -20.003 -2.994  4.163   1.00 0.00 ? 20  LYS A HE2  10 
ATOM   10599 H  HE3  . LYS A 1 20 ? -18.662 -3.905  3.470   1.00 0.00 ? 20  LYS A HE3  10 
ATOM   10600 H  HZ1  . LYS A 1 20 ? -20.875 -4.703  2.767   1.00 0.00 ? 20  LYS A HZ1  10 
ATOM   10601 H  HZ2  . LYS A 1 20 ? -21.216 -5.121  4.369   1.00 0.00 ? 20  LYS A HZ2  10 
ATOM   10602 H  HZ3  . LYS A 1 20 ? -19.960 -5.895  3.543   1.00 0.00 ? 20  LYS A HZ3  10 
ATOM   10603 N  N    . ALA A 1 21 ? -19.237 -1.632  9.456   1.00 0.00 ? 21  ALA A N    10 
ATOM   10604 C  CA   . ALA A 1 21 ? -19.341 -0.180  9.545   1.00 0.00 ? 21  ALA A CA   10 
ATOM   10605 C  C    . ALA A 1 21 ? -17.962 0.465   9.619   1.00 0.00 ? 21  ALA A C    10 
ATOM   10606 O  O    . ALA A 1 21 ? -17.654 1.384   8.860   1.00 0.00 ? 21  ALA A O    10 
ATOM   10607 C  CB   . ALA A 1 21 ? -20.177 0.215   10.754  1.00 0.00 ? 21  ALA A CB   10 
ATOM   10608 H  H    . ALA A 1 21 ? -19.827 -2.188  10.006  1.00 0.00 ? 21  ALA A H    10 
ATOM   10609 H  HA   . ALA A 1 21 ? -19.846 0.173   8.658   1.00 0.00 ? 21  ALA A HA   10 
ATOM   10610 H  HB1  . ALA A 1 21 ? -19.654 -0.061  11.658  1.00 0.00 ? 21  ALA A HB1  10 
ATOM   10611 H  HB2  . ALA A 1 21 ? -20.341 1.283   10.744  1.00 0.00 ? 21  ALA A HB2  10 
ATOM   10612 H  HB3  . ALA A 1 21 ? -21.127 -0.296  10.717  1.00 0.00 ? 21  ALA A HB3  10 
ATOM   10613 N  N    . SER A 1 22 ? -17.134 -0.021  10.539  1.00 0.00 ? 22  SER A N    10 
ATOM   10614 C  CA   . SER A 1 22 ? -15.788 0.512   10.715  1.00 0.00 ? 22  SER A CA   10 
ATOM   10615 C  C    . SER A 1 22 ? -15.089 0.677   9.369   1.00 0.00 ? 22  SER A C    10 
ATOM   10616 O  O    . SER A 1 22 ? -14.460 1.703   9.104   1.00 0.00 ? 22  SER A O    10 
ATOM   10617 C  CB   . SER A 1 22 ? -14.967 -0.407  11.620  1.00 0.00 ? 22  SER A CB   10 
ATOM   10618 O  OG   . SER A 1 22 ? -15.363 -0.277  12.974  1.00 0.00 ? 22  SER A OG   10 
ATOM   10619 H  H    . SER A 1 22 ? -17.437 -0.754  11.114  1.00 0.00 ? 22  SER A H    10 
ATOM   10620 H  HA   . SER A 1 22 ? -15.874 1.481   11.183  1.00 0.00 ? 22  SER A HA   10 
ATOM   10621 H  HB2  . SER A 1 22 ? -15.110 -1.432  11.313  1.00 0.00 ? 22  SER A HB2  10 
ATOM   10622 H  HB3  . SER A 1 22 ? -13.921 -0.149  11.537  1.00 0.00 ? 22  SER A HB3  10 
ATOM   10623 H  HG   . SER A 1 22 ? -15.153 -1.085  13.449  1.00 0.00 ? 22  SER A HG   10 
ATOM   10624 N  N    . LEU A 1 23 ? -15.203 -0.340  8.522   1.00 0.00 ? 23  LEU A N    10 
ATOM   10625 C  CA   . LEU A 1 23 ? -14.582 -0.310  7.202   1.00 0.00 ? 23  LEU A CA   10 
ATOM   10626 C  C    . LEU A 1 23 ? -15.016 0.928   6.424   1.00 0.00 ? 23  LEU A C    10 
ATOM   10627 O  O    . LEU A 1 23 ? -14.183 1.711   5.970   1.00 0.00 ? 23  LEU A O    10 
ATOM   10628 C  CB   . LEU A 1 23 ? -14.944 -1.572  6.418   1.00 0.00 ? 23  LEU A CB   10 
ATOM   10629 C  CG   . LEU A 1 23 ? -14.097 -1.858  5.177   1.00 0.00 ? 23  LEU A CG   10 
ATOM   10630 C  CD1  . LEU A 1 23 ? -12.644 -2.085  5.563   1.00 0.00 ? 23  LEU A CD1  10 
ATOM   10631 C  CD2  . LEU A 1 23 ? -14.645 -3.060  4.422   1.00 0.00 ? 23  LEU A CD2  10 
ATOM   10632 H  H    . LEU A 1 23 ? -15.716 -1.130  8.789   1.00 0.00 ? 23  LEU A H    10 
ATOM   10633 H  HA   . LEU A 1 23 ? -13.511 -0.277  7.340   1.00 0.00 ? 23  LEU A HA   10 
ATOM   10634 H  HB2  . LEU A 1 23 ? -14.848 -2.415  7.084   1.00 0.00 ? 23  LEU A HB2  10 
ATOM   10635 H  HB3  . LEU A 1 23 ? -15.974 -1.481  6.103   1.00 0.00 ? 23  LEU A HB3  10 
ATOM   10636 H  HG   . LEU A 1 23 ? -14.136 -1.001  4.517   1.00 0.00 ? 23  LEU A HG   10 
ATOM   10637 H  HD11 . LEU A 1 23 ? -12.392 -3.125  5.418   1.00 0.00 ? 23  LEU A HD11 10 
ATOM   10638 H  HD12 . LEU A 1 23 ? -12.502 -1.822  6.601   1.00 0.00 ? 23  LEU A HD12 10 
ATOM   10639 H  HD13 . LEU A 1 23 ? -12.007 -1.469  4.946   1.00 0.00 ? 23  LEU A HD13 10 
ATOM   10640 H  HD21 . LEU A 1 23 ? -15.540 -3.414  4.911   1.00 0.00 ? 23  LEU A HD21 10 
ATOM   10641 H  HD22 . LEU A 1 23 ? -13.905 -3.847  4.413   1.00 0.00 ? 23  LEU A HD22 10 
ATOM   10642 H  HD23 . LEU A 1 23 ? -14.878 -2.772  3.408   1.00 0.00 ? 23  LEU A HD23 10 
ATOM   10643 N  N    . ASN A 1 24 ? -16.326 1.099   6.277   1.00 0.00 ? 24  ASN A N    10 
ATOM   10644 C  CA   . ASN A 1 24 ? -16.871 2.243   5.555   1.00 0.00 ? 24  ASN A CA   10 
ATOM   10645 C  C    . ASN A 1 24 ? -16.215 3.541   6.018   1.00 0.00 ? 24  ASN A C    10 
ATOM   10646 O  O    . ASN A 1 24 ? -15.776 4.351   5.201   1.00 0.00 ? 24  ASN A O    10 
ATOM   10647 C  CB   . ASN A 1 24 ? -18.386 2.325   5.756   1.00 0.00 ? 24  ASN A CB   10 
ATOM   10648 C  CG   . ASN A 1 24 ? -19.134 1.288   4.941   1.00 0.00 ? 24  ASN A CG   10 
ATOM   10649 O  OD1  . ASN A 1 24 ? -18.604 0.744   3.972   1.00 0.00 ? 24  ASN A OD1  10 
ATOM   10650 N  ND2  . ASN A 1 24 ? -20.373 1.010   5.331   1.00 0.00 ? 24  ASN A ND2  10 
ATOM   10651 H  H    . ASN A 1 24 ? -16.941 0.440   6.662   1.00 0.00 ? 24  ASN A H    10 
ATOM   10652 H  HA   . ASN A 1 24 ? -16.663 2.102   4.505   1.00 0.00 ? 24  ASN A HA   10 
ATOM   10653 H  HB2  . ASN A 1 24 ? -18.613 2.166   6.801   1.00 0.00 ? 24  ASN A HB2  10 
ATOM   10654 H  HB3  . ASN A 1 24 ? -18.730 3.305   5.463   1.00 0.00 ? 24  ASN A HB3  10 
ATOM   10655 H  HD21 . ASN A 1 24 ? -20.730 1.483   6.112   1.00 0.00 ? 24  ASN A HD21 10 
ATOM   10656 H  HD22 . ASN A 1 24 ? -20.879 0.343   4.822   1.00 0.00 ? 24  ASN A HD22 10 
ATOM   10657 N  N    . TRP A 1 25 ? -16.151 3.730   7.330   1.00 0.00 ? 25  TRP A N    10 
ATOM   10658 C  CA   . TRP A 1 25 ? -15.548 4.928   7.902   1.00 0.00 ? 25  TRP A CA   10 
ATOM   10659 C  C    . TRP A 1 25 ? -14.047 4.962   7.636   1.00 0.00 ? 25  TRP A C    10 
ATOM   10660 O  O    . TRP A 1 25 ? -13.440 6.032   7.583   1.00 0.00 ? 25  TRP A O    10 
ATOM   10661 C  CB   . TRP A 1 25 ? -15.813 4.990   9.407   1.00 0.00 ? 25  TRP A CB   10 
ATOM   10662 C  CG   . TRP A 1 25 ? -15.019 6.051   10.107  1.00 0.00 ? 25  TRP A CG   10 
ATOM   10663 C  CD1  . TRP A 1 25 ? -13.663 6.087   10.268  1.00 0.00 ? 25  TRP A CD1  10 
ATOM   10664 C  CD2  . TRP A 1 25 ? -15.532 7.228   10.741  1.00 0.00 ? 25  TRP A CD2  10 
ATOM   10665 N  NE1  . TRP A 1 25 ? -13.302 7.215   10.965  1.00 0.00 ? 25  TRP A NE1  10 
ATOM   10666 C  CE2  . TRP A 1 25 ? -14.430 7.932   11.266  1.00 0.00 ? 25  TRP A CE2  10 
ATOM   10667 C  CE3  . TRP A 1 25 ? -16.814 7.756   10.915  1.00 0.00 ? 25  TRP A CE3  10 
ATOM   10668 C  CZ2  . TRP A 1 25 ? -14.575 9.134   11.952  1.00 0.00 ? 25  TRP A CZ2  10 
ATOM   10669 C  CZ3  . TRP A 1 25 ? -16.955 8.949   11.597  1.00 0.00 ? 25  TRP A CZ3  10 
ATOM   10670 C  CH2  . TRP A 1 25 ? -15.841 9.628   12.108  1.00 0.00 ? 25  TRP A CH2  10 
ATOM   10671 H  H    . TRP A 1 25 ? -16.519 3.047   7.931   1.00 0.00 ? 25  TRP A H    10 
ATOM   10672 H  HA   . TRP A 1 25 ? -16.005 5.785   7.429   1.00 0.00 ? 25  TRP A HA   10 
ATOM   10673 H  HB2  . TRP A 1 25 ? -16.860 5.194   9.573   1.00 0.00 ? 25  TRP A HB2  10 
ATOM   10674 H  HB3  . TRP A 1 25 ? -15.560 4.037   9.849   1.00 0.00 ? 25  TRP A HB3  10 
ATOM   10675 H  HD1  . TRP A 1 25 ? -12.986 5.332   9.899   1.00 0.00 ? 25  TRP A HD1  10 
ATOM   10676 H  HE1  . TRP A 1 25 ? -12.386 7.466   11.205  1.00 0.00 ? 25  TRP A HE1  10 
ATOM   10677 H  HE3  . TRP A 1 25 ? -17.684 7.247   10.529  1.00 0.00 ? 25  TRP A HE3  10 
ATOM   10678 H  HZ2  . TRP A 1 25 ? -13.726 9.670   12.352  1.00 0.00 ? 25  TRP A HZ2  10 
ATOM   10679 H  HZ3  . TRP A 1 25 ? -17.938 9.372   11.742  1.00 0.00 ? 25  TRP A HZ3  10 
ATOM   10680 H  HH2  . TRP A 1 25 ? -15.999 10.557  12.634  1.00 0.00 ? 25  TRP A HH2  10 
ATOM   10681 N  N    . HIS A 1 26 ? -13.453 3.784   7.468   1.00 0.00 ? 26  HIS A N    10 
ATOM   10682 C  CA   . HIS A 1 26 ? -12.022 3.680   7.207   1.00 0.00 ? 26  HIS A CA   10 
ATOM   10683 C  C    . HIS A 1 26 ? -11.725 3.880   5.724   1.00 0.00 ? 26  HIS A C    10 
ATOM   10684 O  O    . HIS A 1 26 ? -10.580 4.114   5.337   1.00 0.00 ? 26  HIS A O    10 
ATOM   10685 C  CB   . HIS A 1 26 ? -11.496 2.319   7.665   1.00 0.00 ? 26  HIS A CB   10 
ATOM   10686 C  CG   . HIS A 1 26 ? -10.252 1.887   6.952   1.00 0.00 ? 26  HIS A CG   10 
ATOM   10687 N  ND1  . HIS A 1 26 ? -8.985  2.117   7.444   1.00 0.00 ? 26  HIS A ND1  10 
ATOM   10688 C  CD2  . HIS A 1 26 ? -10.086 1.233   5.779   1.00 0.00 ? 26  HIS A CD2  10 
ATOM   10689 C  CE1  . HIS A 1 26 ? -8.092  1.626   6.603   1.00 0.00 ? 26  HIS A CE1  10 
ATOM   10690 N  NE2  . HIS A 1 26 ? -8.735  1.083   5.584   1.00 0.00 ? 26  HIS A NE2  10 
ATOM   10691 H  H    . HIS A 1 26 ? -13.990 2.967   7.522   1.00 0.00 ? 26  HIS A H    10 
ATOM   10692 H  HA   . HIS A 1 26 ? -11.525 4.456   7.769   1.00 0.00 ? 26  HIS A HA   10 
ATOM   10693 H  HB2  . HIS A 1 26 ? -11.275 2.363   8.721   1.00 0.00 ? 26  HIS A HB2  10 
ATOM   10694 H  HB3  . HIS A 1 26 ? -12.256 1.570   7.492   1.00 0.00 ? 26  HIS A HB3  10 
ATOM   10695 H  HD1  . HIS A 1 26 ? -8.771  2.575   8.283   1.00 0.00 ? 26  HIS A HD1  10 
ATOM   10696 H  HD2  . HIS A 1 26 ? -10.870 0.893   5.117   1.00 0.00 ? 26  HIS A HD2  10 
ATOM   10697 H  HE1  . HIS A 1 26 ? -7.020  1.660   6.726   1.00 0.00 ? 26  HIS A HE1  10 
ATOM   10698 N  N    . GLN A 1 27 ? -12.763 3.786   4.899   1.00 0.00 ? 27  GLN A N    10 
ATOM   10699 C  CA   . GLN A 1 27 ? -12.612 3.956   3.459   1.00 0.00 ? 27  GLN A CA   10 
ATOM   10700 C  C    . GLN A 1 27 ? -12.844 5.408   3.054   1.00 0.00 ? 27  GLN A C    10 
ATOM   10701 O  O    . GLN A 1 27 ? -12.116 5.956   2.226   1.00 0.00 ? 27  GLN A O    10 
ATOM   10702 C  CB   . GLN A 1 27 ? -13.586 3.044   2.712   1.00 0.00 ? 27  GLN A CB   10 
ATOM   10703 C  CG   . GLN A 1 27 ? -13.371 1.565   2.989   1.00 0.00 ? 27  GLN A CG   10 
ATOM   10704 C  CD   . GLN A 1 27 ? -12.421 0.918   2.000   1.00 0.00 ? 27  GLN A CD   10 
ATOM   10705 O  OE1  . GLN A 1 27 ? -12.501 1.160   0.796   1.00 0.00 ? 27  GLN A OE1  10 
ATOM   10706 N  NE2  . GLN A 1 27 ? -11.514 0.090   2.505   1.00 0.00 ? 27  GLN A NE2  10 
ATOM   10707 H  H    . GLN A 1 27 ? -13.651 3.599   5.268   1.00 0.00 ? 27  GLN A H    10 
ATOM   10708 H  HA   . GLN A 1 27 ? -11.602 3.679   3.197   1.00 0.00 ? 27  GLN A HA   10 
ATOM   10709 H  HB2  . GLN A 1 27 ? -14.594 3.300   3.002   1.00 0.00 ? 27  GLN A HB2  10 
ATOM   10710 H  HB3  . GLN A 1 27 ? -13.473 3.209   1.650   1.00 0.00 ? 27  GLN A HB3  10 
ATOM   10711 H  HG2  . GLN A 1 27 ? -12.961 1.454   3.982   1.00 0.00 ? 27  GLN A HG2  10 
ATOM   10712 H  HG3  . GLN A 1 27 ? -14.323 1.060   2.935   1.00 0.00 ? 27  GLN A HG3  10 
ATOM   10713 H  HE21 . GLN A 1 27 ? -11.511 -0.056  3.475   1.00 0.00 ? 27  GLN A HE21 10 
ATOM   10714 H  HE22 . GLN A 1 27 ? -10.889 -0.343  1.889   1.00 0.00 ? 27  GLN A HE22 10 
ATOM   10715 N  N    . ARG A 1 28 ? -13.861 6.026   3.644   1.00 0.00 ? 28  ARG A N    10 
ATOM   10716 C  CA   . ARG A 1 28 ? -14.190 7.415   3.344   1.00 0.00 ? 28  ARG A CA   10 
ATOM   10717 C  C    . ARG A 1 28 ? -12.953 8.301   3.450   1.00 0.00 ? 28  ARG A C    10 
ATOM   10718 O  O    . ARG A 1 28 ? -12.788 9.251   2.685   1.00 0.00 ? 28  ARG A O    10 
ATOM   10719 C  CB   . ARG A 1 28 ? -15.277 7.921   4.294   1.00 0.00 ? 28  ARG A CB   10 
ATOM   10720 C  CG   . ARG A 1 28 ? -14.757 8.283   5.676   1.00 0.00 ? 28  ARG A CG   10 
ATOM   10721 C  CD   . ARG A 1 28 ? -15.890 8.670   6.614   1.00 0.00 ? 28  ARG A CD   10 
ATOM   10722 N  NE   . ARG A 1 28 ? -16.192 10.097  6.546   1.00 0.00 ? 28  ARG A NE   10 
ATOM   10723 C  CZ   . ARG A 1 28 ? -17.427 10.586  6.498   1.00 0.00 ? 28  ARG A CZ   10 
ATOM   10724 N  NH1  . ARG A 1 28 ? -18.468 9.765   6.509   1.00 0.00 ? 28  ARG A NH1  10 
ATOM   10725 N  NH2  . ARG A 1 28 ? -17.621 11.897  6.438   1.00 0.00 ? 28  ARG A NH2  10 
ATOM   10726 H  H    . ARG A 1 28 ? -14.405 5.537   4.297   1.00 0.00 ? 28  ARG A H    10 
ATOM   10727 H  HA   . ARG A 1 28 ? -14.562 7.456   2.331   1.00 0.00 ? 28  ARG A HA   10 
ATOM   10728 H  HB2  . ARG A 1 28 ? -15.734 8.800   3.865   1.00 0.00 ? 28  ARG A HB2  10 
ATOM   10729 H  HB3  . ARG A 1 28 ? -16.027 7.153   4.405   1.00 0.00 ? 28  ARG A HB3  10 
ATOM   10730 H  HG2  . ARG A 1 28 ? -14.238 7.431   6.090   1.00 0.00 ? 28  ARG A HG2  10 
ATOM   10731 H  HG3  . ARG A 1 28 ? -14.074 9.114   5.587   1.00 0.00 ? 28  ARG A HG3  10 
ATOM   10732 H  HD2  . ARG A 1 28 ? -16.773 8.112   6.340   1.00 0.00 ? 28  ARG A HD2  10 
ATOM   10733 H  HD3  . ARG A 1 28 ? -15.605 8.419   7.624   1.00 0.00 ? 28  ARG A HD3  10 
ATOM   10734 H  HE   . ARG A 1 28 ? -15.437 10.721  6.536   1.00 0.00 ? 28  ARG A HE   10 
ATOM   10735 H  HH11 . ARG A 1 28 ? -18.325 8.777   6.556   1.00 0.00 ? 28  ARG A HH11 10 
ATOM   10736 H  HH12 . ARG A 1 28 ? -19.397 10.136  6.474   1.00 0.00 ? 28  ARG A HH12 10 
ATOM   10737 H  HH21 . ARG A 1 28 ? -16.838 12.518  6.429   1.00 0.00 ? 28  ARG A HH21 10 
ATOM   10738 H  HH22 . ARG A 1 28 ? -18.550 12.263  6.401   1.00 0.00 ? 28  ARG A HH22 10 
ATOM   10739 N  N    . LYS A 1 29 ? -12.085 7.985   4.405   1.00 0.00 ? 29  LYS A N    10 
ATOM   10740 C  CA   . LYS A 1 29 ? -10.861 8.751   4.613   1.00 0.00 ? 29  LYS A CA   10 
ATOM   10741 C  C    . LYS A 1 29 ? -9.930  8.625   3.411   1.00 0.00 ? 29  LYS A C    10 
ATOM   10742 O  O    . LYS A 1 29 ? -9.317  9.603   2.983   1.00 0.00 ? 29  LYS A O    10 
ATOM   10743 C  CB   . LYS A 1 29 ? -10.146 8.275   5.879   1.00 0.00 ? 29  LYS A CB   10 
ATOM   10744 C  CG   . LYS A 1 29 ? -9.290  7.038   5.665   1.00 0.00 ? 29  LYS A CG   10 
ATOM   10745 C  CD   . LYS A 1 29 ? -8.491  6.691   6.910   1.00 0.00 ? 29  LYS A CD   10 
ATOM   10746 C  CE   . LYS A 1 29 ? -9.268  5.761   7.830   1.00 0.00 ? 29  LYS A CE   10 
ATOM   10747 N  NZ   . LYS A 1 29 ? -8.791  5.849   9.238   1.00 0.00 ? 29  LYS A NZ   10 
ATOM   10748 H  H    . LYS A 1 29 ? -12.271 7.216   4.984   1.00 0.00 ? 29  LYS A H    10 
ATOM   10749 H  HA   . LYS A 1 29 ? -11.136 9.788   4.733   1.00 0.00 ? 29  LYS A HA   10 
ATOM   10750 H  HB2  . LYS A 1 29 ? -9.509  9.070   6.239   1.00 0.00 ? 29  LYS A HB2  10 
ATOM   10751 H  HB3  . LYS A 1 29 ? -10.886 8.048   6.633   1.00 0.00 ? 29  LYS A HB3  10 
ATOM   10752 H  HG2  . LYS A 1 29 ? -9.931  6.205   5.418   1.00 0.00 ? 29  LYS A HG2  10 
ATOM   10753 H  HG3  . LYS A 1 29 ? -8.606  7.222   4.849   1.00 0.00 ? 29  LYS A HG3  10 
ATOM   10754 H  HD2  . LYS A 1 29 ? -7.574  6.203   6.615   1.00 0.00 ? 29  LYS A HD2  10 
ATOM   10755 H  HD3  . LYS A 1 29 ? -8.260  7.602   7.445   1.00 0.00 ? 29  LYS A HD3  10 
ATOM   10756 H  HE2  . LYS A 1 29 ? -10.312 6.032   7.794   1.00 0.00 ? 29  LYS A HE2  10 
ATOM   10757 H  HE3  . LYS A 1 29 ? -9.147  4.747   7.480   1.00 0.00 ? 29  LYS A HE3  10 
ATOM   10758 H  HZ1  . LYS A 1 29 ? -9.348  6.556   9.760   1.00 0.00 ? 29  LYS A HZ1  10 
ATOM   10759 H  HZ2  . LYS A 1 29 ? -7.790  6.128   9.259   1.00 0.00 ? 29  LYS A HZ2  10 
ATOM   10760 H  HZ3  . LYS A 1 29 ? -8.894  4.927   9.708   1.00 0.00 ? 29  LYS A HZ3  10 
ATOM   10761 N  N    . HIS A 1 30 ? -9.829  7.414   2.871   1.00 0.00 ? 30  HIS A N    10 
ATOM   10762 C  CA   . HIS A 1 30 ? -8.973  7.161   1.717   1.00 0.00 ? 30  HIS A CA   10 
ATOM   10763 C  C    . HIS A 1 30 ? -9.264  8.156   0.597   1.00 0.00 ? 30  HIS A C    10 
ATOM   10764 O  O    . HIS A 1 30 ? -8.346  8.699   -0.017  1.00 0.00 ? 30  HIS A O    10 
ATOM   10765 C  CB   . HIS A 1 30 ? -9.173  5.732   1.211   1.00 0.00 ? 30  HIS A CB   10 
ATOM   10766 C  CG   . HIS A 1 30 ? -8.472  4.700   2.039   1.00 0.00 ? 30  HIS A CG   10 
ATOM   10767 N  ND1  . HIS A 1 30 ? -7.201  4.876   2.543   1.00 0.00 ? 30  HIS A ND1  10 
ATOM   10768 C  CD2  . HIS A 1 30 ? -8.873  3.475   2.453   1.00 0.00 ? 30  HIS A CD2  10 
ATOM   10769 C  CE1  . HIS A 1 30 ? -6.849  3.803   3.229   1.00 0.00 ? 30  HIS A CE1  10 
ATOM   10770 N  NE2  . HIS A 1 30 ? -7.847  2.938   3.190   1.00 0.00 ? 30  HIS A NE2  10 
ATOM   10771 H  H    . HIS A 1 30 ? -10.342 6.674   3.257   1.00 0.00 ? 30  HIS A H    10 
ATOM   10772 H  HA   . HIS A 1 30 ? -7.948  7.282   2.032   1.00 0.00 ? 30  HIS A HA   10 
ATOM   10773 H  HB2  . HIS A 1 30 ? -10.228 5.500   1.216   1.00 0.00 ? 30  HIS A HB2  10 
ATOM   10774 H  HB3  . HIS A 1 30 ? -8.798  5.659   0.200   1.00 0.00 ? 30  HIS A HB3  10 
ATOM   10775 H  HD1  . HIS A 1 30 ? -6.639  5.668   2.415   1.00 0.00 ? 30  HIS A HD1  10 
ATOM   10776 H  HD2  . HIS A 1 30 ? -9.824  3.006   2.242   1.00 0.00 ? 30  HIS A HD2  10 
ATOM   10777 H  HE1  . HIS A 1 30 ? -5.907  3.657   3.736   1.00 0.00 ? 30  HIS A HE1  10 
ATOM   10778 N  N    . ALA A 1 31 ? -10.546 8.388   0.337   1.00 0.00 ? 31  ALA A N    10 
ATOM   10779 C  CA   . ALA A 1 31 ? -10.957 9.318   -0.708  1.00 0.00 ? 31  ALA A CA   10 
ATOM   10780 C  C    . ALA A 1 31 ? -10.287 10.676  -0.529  1.00 0.00 ? 31  ALA A C    10 
ATOM   10781 O  O    . ALA A 1 31 ? -9.938  11.339  -1.505  1.00 0.00 ? 31  ALA A O    10 
ATOM   10782 C  CB   . ALA A 1 31 ? -12.471 9.470   -0.714  1.00 0.00 ? 31  ALA A CB   10 
ATOM   10783 H  H    . ALA A 1 31 ? -11.232 7.925   0.861   1.00 0.00 ? 31  ALA A H    10 
ATOM   10784 H  HA   . ALA A 1 31 ? -10.658 8.903   -1.660  1.00 0.00 ? 31  ALA A HA   10 
ATOM   10785 H  HB1  . ALA A 1 31 ? -12.896 8.854   0.065   1.00 0.00 ? 31  ALA A HB1  10 
ATOM   10786 H  HB2  . ALA A 1 31 ? -12.729 10.504  -0.537  1.00 0.00 ? 31  ALA A HB2  10 
ATOM   10787 H  HB3  . ALA A 1 31 ? -12.860 9.160   -1.672  1.00 0.00 ? 31  ALA A HB3  10 
ATOM   10788 N  N    . GLU A 1 32 ? -10.111 11.084  0.724   1.00 0.00 ? 32  GLU A N    10 
ATOM   10789 C  CA   . GLU A 1 32 ? -9.484  12.364  1.029   1.00 0.00 ? 32  GLU A CA   10 
ATOM   10790 C  C    . GLU A 1 32 ? -7.963  12.246  1.001   1.00 0.00 ? 32  GLU A C    10 
ATOM   10791 O  O    . GLU A 1 32 ? -7.267  13.145  0.528   1.00 0.00 ? 32  GLU A O    10 
ATOM   10792 C  CB   . GLU A 1 32 ? -9.942  12.868  2.400   1.00 0.00 ? 32  GLU A CB   10 
ATOM   10793 C  CG   . GLU A 1 32 ? -11.435 13.140  2.480   1.00 0.00 ? 32  GLU A CG   10 
ATOM   10794 C  CD   . GLU A 1 32 ? -11.982 12.983  3.886   1.00 0.00 ? 32  GLU A CD   10 
ATOM   10795 O  OE1  . GLU A 1 32 ? -11.779 13.902  4.707   1.00 0.00 ? 32  GLU A OE1  10 
ATOM   10796 O  OE2  . GLU A 1 32 ? -12.611 11.942  4.165   1.00 0.00 ? 32  GLU A OE2  10 
ATOM   10797 H  H    . GLU A 1 32 ? -10.411 10.510  1.460   1.00 0.00 ? 32  GLU A H    10 
ATOM   10798 H  HA   . GLU A 1 32 ? -9.792  13.072  0.275   1.00 0.00 ? 32  GLU A HA   10 
ATOM   10799 H  HB2  . GLU A 1 32 ? -9.692  12.127  3.144   1.00 0.00 ? 32  GLU A HB2  10 
ATOM   10800 H  HB3  . GLU A 1 32 ? -9.418  13.784  2.627   1.00 0.00 ? 32  GLU A HB3  10 
ATOM   10801 H  HG2  . GLU A 1 32 ? -11.622 14.151  2.149   1.00 0.00 ? 32  GLU A HG2  10 
ATOM   10802 H  HG3  . GLU A 1 32 ? -11.950 12.449  1.830   1.00 0.00 ? 32  GLU A HG3  10 
ATOM   10803 N  N    . THR A 1 33 ? -7.453  11.130  1.512   1.00 0.00 ? 33  THR A N    10 
ATOM   10804 C  CA   . THR A 1 33 ? -6.015  10.893  1.547   1.00 0.00 ? 33  THR A CA   10 
ATOM   10805 C  C    . THR A 1 33 ? -5.424  10.890  0.142   1.00 0.00 ? 33  THR A C    10 
ATOM   10806 O  O    . THR A 1 33 ? -4.454  11.595  -0.135  1.00 0.00 ? 33  THR A O    10 
ATOM   10807 C  CB   . THR A 1 33 ? -5.683  9.555   2.235   1.00 0.00 ? 33  THR A CB   10 
ATOM   10808 O  OG1  . THR A 1 33 ? -6.394  9.451   3.473   1.00 0.00 ? 33  THR A OG1  10 
ATOM   10809 C  CG2  . THR A 1 33 ? -4.188  9.435   2.491   1.00 0.00 ? 33  THR A CG2  10 
ATOM   10810 H  H    . THR A 1 33 ? -8.059  10.450  1.874   1.00 0.00 ? 33  THR A H    10 
ATOM   10811 H  HA   . THR A 1 33 ? -5.560  11.690  2.117   1.00 0.00 ? 33  THR A HA   10 
ATOM   10812 H  HB   . THR A 1 33 ? -5.987  8.748   1.584   1.00 0.00 ? 33  THR A HB   10 
ATOM   10813 H  HG1  . THR A 1 33 ? -6.208  8.601   3.879   1.00 0.00 ? 33  THR A HG1  10 
ATOM   10814 H  HG21 . THR A 1 33 ? -3.648  9.989   1.738   1.00 0.00 ? 33  THR A HG21 10 
ATOM   10815 H  HG22 . THR A 1 33 ? -3.898  8.396   2.451   1.00 0.00 ? 33  THR A HG22 10 
ATOM   10816 H  HG23 . THR A 1 33 ? -3.957  9.836   3.467   1.00 0.00 ? 33  THR A HG23 10 
ATOM   10817 N  N    . VAL A 1 34 ? -6.014  10.092  -0.742  1.00 0.00 ? 34  VAL A N    10 
ATOM   10818 C  CA   . VAL A 1 34 ? -5.546  9.999   -2.119  1.00 0.00 ? 34  VAL A CA   10 
ATOM   10819 C  C    . VAL A 1 34 ? -5.105  11.361  -2.644  1.00 0.00 ? 34  VAL A C    10 
ATOM   10820 O  O    . VAL A 1 34 ? -4.130  11.465  -3.387  1.00 0.00 ? 34  VAL A O    10 
ATOM   10821 C  CB   . VAL A 1 34 ? -6.639  9.434   -3.046  1.00 0.00 ? 34  VAL A CB   10 
ATOM   10822 C  CG1  . VAL A 1 34 ? -6.903  7.969   -2.730  1.00 0.00 ? 34  VAL A CG1  10 
ATOM   10823 C  CG2  . VAL A 1 34 ? -7.915  10.252  -2.925  1.00 0.00 ? 34  VAL A CG2  10 
ATOM   10824 H  H    . VAL A 1 34 ? -6.783  9.554   -0.461  1.00 0.00 ? 34  VAL A H    10 
ATOM   10825 H  HA   . VAL A 1 34 ? -4.702  9.325   -2.141  1.00 0.00 ? 34  VAL A HA   10 
ATOM   10826 H  HB   . VAL A 1 34 ? -6.288  9.501   -4.066  1.00 0.00 ? 34  VAL A HB   10 
ATOM   10827 H  HG11 . VAL A 1 34 ? -7.228  7.461   -3.626  1.00 0.00 ? 34  VAL A HG11 10 
ATOM   10828 H  HG12 . VAL A 1 34 ? -5.997  7.511   -2.362  1.00 0.00 ? 34  VAL A HG12 10 
ATOM   10829 H  HG13 . VAL A 1 34 ? -7.674  7.898   -1.977  1.00 0.00 ? 34  VAL A HG13 10 
ATOM   10830 H  HG21 . VAL A 1 34 ? -7.853  10.888  -2.054  1.00 0.00 ? 34  VAL A HG21 10 
ATOM   10831 H  HG22 . VAL A 1 34 ? -8.037  10.863  -3.808  1.00 0.00 ? 34  VAL A HG22 10 
ATOM   10832 H  HG23 . VAL A 1 34 ? -8.761  9.589   -2.827  1.00 0.00 ? 34  VAL A HG23 10 
ATOM   10833 N  N    . ALA A 1 35 ? -5.829  12.403  -2.250  1.00 0.00 ? 35  ALA A N    10 
ATOM   10834 C  CA   . ALA A 1 35 ? -5.511  13.760  -2.677  1.00 0.00 ? 35  ALA A CA   10 
ATOM   10835 C  C    . ALA A 1 35 ? -4.029  14.062  -2.486  1.00 0.00 ? 35  ALA A C    10 
ATOM   10836 O  O    . ALA A 1 35 ? -3.344  14.477  -3.421  1.00 0.00 ? 35  ALA A O    10 
ATOM   10837 C  CB   . ALA A 1 35 ? -6.360  14.766  -1.915  1.00 0.00 ? 35  ALA A CB   10 
ATOM   10838 H  H    . ALA A 1 35 ? -6.595  12.256  -1.656  1.00 0.00 ? 35  ALA A H    10 
ATOM   10839 H  HA   . ALA A 1 35 ? -5.752  13.844  -3.727  1.00 0.00 ? 35  ALA A HA   10 
ATOM   10840 H  HB1  . ALA A 1 35 ? -5.746  15.272  -1.184  1.00 0.00 ? 35  ALA A HB1  10 
ATOM   10841 H  HB2  . ALA A 1 35 ? -6.768  15.489  -2.606  1.00 0.00 ? 35  ALA A HB2  10 
ATOM   10842 H  HB3  . ALA A 1 35 ? -7.166  14.251  -1.414  1.00 0.00 ? 35  ALA A HB3  10 
ATOM   10843 N  N    . ALA A 1 36 ? -3.539  13.853  -1.268  1.00 0.00 ? 36  ALA A N    10 
ATOM   10844 C  CA   . ALA A 1 36 ? -2.138  14.102  -0.955  1.00 0.00 ? 36  ALA A CA   10 
ATOM   10845 C  C    . ALA A 1 36 ? -1.220  13.438  -1.976  1.00 0.00 ? 36  ALA A C    10 
ATOM   10846 O  O    . ALA A 1 36 ? -0.292  14.063  -2.491  1.00 0.00 ? 36  ALA A O    10 
ATOM   10847 C  CB   . ALA A 1 36 ? -1.815  13.609  0.448   1.00 0.00 ? 36  ALA A CB   10 
ATOM   10848 H  H    . ALA A 1 36 ? -4.135  13.522  -0.564  1.00 0.00 ? 36  ALA A H    10 
ATOM   10849 H  HA   . ALA A 1 36 ? -1.975  15.170  -0.980  1.00 0.00 ? 36  ALA A HA   10 
ATOM   10850 H  HB1  . ALA A 1 36 ? -0.772  13.331  0.499   1.00 0.00 ? 36  ALA A HB1  10 
ATOM   10851 H  HB2  . ALA A 1 36 ? -2.015  14.394  1.161   1.00 0.00 ? 36  ALA A HB2  10 
ATOM   10852 H  HB3  . ALA A 1 36 ? -2.427  12.749  0.677   1.00 0.00 ? 36  ALA A HB3  10 
ATOM   10853 N  N    . LEU A 1 37 ? -1.485  12.169  -2.264  1.00 0.00 ? 37  LEU A N    10 
ATOM   10854 C  CA   . LEU A 1 37 ? -0.682  11.419  -3.225  1.00 0.00 ? 37  LEU A CA   10 
ATOM   10855 C  C    . LEU A 1 37 ? -0.673  12.111  -4.584  1.00 0.00 ? 37  LEU A C    10 
ATOM   10856 O  O    . LEU A 1 37 ? -1.691  12.157  -5.275  1.00 0.00 ? 37  LEU A O    10 
ATOM   10857 C  CB   . LEU A 1 37 ? -1.222  9.995   -3.368  1.00 0.00 ? 37  LEU A CB   10 
ATOM   10858 C  CG   . LEU A 1 37 ? -1.693  9.323   -2.078  1.00 0.00 ? 37  LEU A CG   10 
ATOM   10859 C  CD1  . LEU A 1 37 ? -2.198  7.917   -2.362  1.00 0.00 ? 37  LEU A CD1  10 
ATOM   10860 C  CD2  . LEU A 1 37 ? -0.569  9.290   -1.052  1.00 0.00 ? 37  LEU A CD2  10 
ATOM   10861 H  H    . LEU A 1 37 ? -2.238  11.724  -1.822  1.00 0.00 ? 37  LEU A H    10 
ATOM   10862 H  HA   . LEU A 1 37 ? 0.329   11.377  -2.849  1.00 0.00 ? 37  LEU A HA   10 
ATOM   10863 H  HB2  . LEU A 1 37 ? -2.058  10.025  -4.049  1.00 0.00 ? 37  LEU A HB2  10 
ATOM   10864 H  HB3  . LEU A 1 37 ? -0.436  9.386   -3.791  1.00 0.00 ? 37  LEU A HB3  10 
ATOM   10865 H  HG   . LEU A 1 37 ? -2.511  9.893   -1.660  1.00 0.00 ? 37  LEU A HG   10 
ATOM   10866 H  HD11 . LEU A 1 37 ? -1.710  7.530   -3.243  1.00 0.00 ? 37  LEU A HD11 10 
ATOM   10867 H  HD12 . LEU A 1 37 ? -3.266  7.944   -2.525  1.00 0.00 ? 37  LEU A HD12 10 
ATOM   10868 H  HD13 . LEU A 1 37 ? -1.980  7.278   -1.519  1.00 0.00 ? 37  LEU A HD13 10 
ATOM   10869 H  HD21 . LEU A 1 37 ? -0.184  8.284   -0.973  1.00 0.00 ? 37  LEU A HD21 10 
ATOM   10870 H  HD22 . LEU A 1 37 ? -0.949  9.606   -0.091  1.00 0.00 ? 37  LEU A HD22 10 
ATOM   10871 H  HD23 . LEU A 1 37 ? 0.222   9.955   -1.364  1.00 0.00 ? 37  LEU A HD23 10 
ATOM   10872 N  N    . ARG A 1 38 ? 0.484   12.644  -4.963  1.00 0.00 ? 38  ARG A N    10 
ATOM   10873 C  CA   . ARG A 1 38 ? 0.626   13.332  -6.240  1.00 0.00 ? 38  ARG A CA   10 
ATOM   10874 C  C    . ARG A 1 38 ? 1.644   12.624  -7.129  1.00 0.00 ? 38  ARG A C    10 
ATOM   10875 O  O    . ARG A 1 38 ? 1.626   12.772  -8.351  1.00 0.00 ? 38  ARG A O    10 
ATOM   10876 C  CB   . ARG A 1 38 ? 1.051   14.785  -6.017  1.00 0.00 ? 38  ARG A CB   10 
ATOM   10877 C  CG   . ARG A 1 38 ? 2.369   14.926  -5.274  1.00 0.00 ? 38  ARG A CG   10 
ATOM   10878 C  CD   . ARG A 1 38 ? 2.153   15.056  -3.775  1.00 0.00 ? 38  ARG A CD   10 
ATOM   10879 N  NE   . ARG A 1 38 ? 1.218   16.130  -3.448  1.00 0.00 ? 38  ARG A NE   10 
ATOM   10880 C  CZ   . ARG A 1 38 ? 1.580   17.399  -3.300  1.00 0.00 ? 38  ARG A CZ   10 
ATOM   10881 N  NH1  . ARG A 1 38 ? 2.849   17.752  -3.450  1.00 0.00 ? 38  ARG A NH1  10 
ATOM   10882 N  NH2  . ARG A 1 38 ? 0.671   18.319  -3.002  1.00 0.00 ? 38  ARG A NH2  10 
ATOM   10883 H  H    . ARG A 1 38 ? 1.260   12.575  -4.369  1.00 0.00 ? 38  ARG A H    10 
ATOM   10884 H  HA   . ARG A 1 38 ? -0.335  13.319  -6.733  1.00 0.00 ? 38  ARG A HA   10 
ATOM   10885 H  HB2  . ARG A 1 38 ? 1.150   15.270  -6.977  1.00 0.00 ? 38  ARG A HB2  10 
ATOM   10886 H  HB3  . ARG A 1 38 ? 0.285   15.287  -5.446  1.00 0.00 ? 38  ARG A HB3  10 
ATOM   10887 H  HG2  . ARG A 1 38 ? 2.975   14.052  -5.465  1.00 0.00 ? 38  ARG A HG2  10 
ATOM   10888 H  HG3  . ARG A 1 38 ? 2.881   15.807  -5.633  1.00 0.00 ? 38  ARG A HG3  10 
ATOM   10889 H  HD2  . ARG A 1 38 ? 1.760   14.123  -3.399  1.00 0.00 ? 38  ARG A HD2  10 
ATOM   10890 H  HD3  . ARG A 1 38 ? 3.103   15.262  -3.304  1.00 0.00 ? 38  ARG A HD3  10 
ATOM   10891 H  HE   . ARG A 1 38 ? 0.275   15.891  -3.332  1.00 0.00 ? 38  ARG A HE   10 
ATOM   10892 H  HH11 . ARG A 1 38 ? 3.536   17.062  -3.676  1.00 0.00 ? 38  ARG A HH11 10 
ATOM   10893 H  HH12 . ARG A 1 38 ? 3.119   18.709  -3.340  1.00 0.00 ? 38  ARG A HH12 10 
ATOM   10894 H  HH21 . ARG A 1 38 ? -0.287  18.057  -2.889  1.00 0.00 ? 38  ARG A HH21 10 
ATOM   10895 H  HH22 . ARG A 1 38 ? 0.944   19.274  -2.891  1.00 0.00 ? 38  ARG A HH22 10 
ATOM   10896 N  N    . PHE A 1 39 ? 2.531   11.855  -6.506  1.00 0.00 ? 39  PHE A N    10 
ATOM   10897 C  CA   . PHE A 1 39 ? 3.558   11.124  -7.240  1.00 0.00 ? 39  PHE A CA   10 
ATOM   10898 C  C    . PHE A 1 39 ? 3.164   9.661   -7.417  1.00 0.00 ? 39  PHE A C    10 
ATOM   10899 O  O    . PHE A 1 39 ? 3.288   8.844   -6.505  1.00 0.00 ? 39  PHE A O    10 
ATOM   10900 C  CB   . PHE A 1 39 ? 4.900   11.218  -6.511  1.00 0.00 ? 39  PHE A CB   10 
ATOM   10901 C  CG   . PHE A 1 39 ? 5.324   12.628  -6.215  1.00 0.00 ? 39  PHE A CG   10 
ATOM   10902 C  CD1  . PHE A 1 39 ? 6.009   13.373  -7.162  1.00 0.00 ? 39  PHE A CD1  10 
ATOM   10903 C  CD2  . PHE A 1 39 ? 5.039   13.209  -4.990  1.00 0.00 ? 39  PHE A CD2  10 
ATOM   10904 C  CE1  . PHE A 1 39 ? 6.400   14.671  -6.893  1.00 0.00 ? 39  PHE A CE1  10 
ATOM   10905 C  CE2  . PHE A 1 39 ? 5.427   14.507  -4.716  1.00 0.00 ? 39  PHE A CE2  10 
ATOM   10906 C  CZ   . PHE A 1 39 ? 6.110   15.238  -5.668  1.00 0.00 ? 39  PHE A CZ   10 
ATOM   10907 H  H    . PHE A 1 39 ? 2.494   11.777  -5.530  1.00 0.00 ? 39  PHE A H    10 
ATOM   10908 H  HA   . PHE A 1 39 ? 3.655   11.579  -8.214  1.00 0.00 ? 39  PHE A HA   10 
ATOM   10909 H  HB2  . PHE A 1 39 ? 4.829   10.690  -5.572  1.00 0.00 ? 39  PHE A HB2  10 
ATOM   10910 H  HB3  . PHE A 1 39 ? 5.665   10.761  -7.120  1.00 0.00 ? 39  PHE A HB3  10 
ATOM   10911 H  HD1  . PHE A 1 39 ? 6.237   12.929  -8.121  1.00 0.00 ? 39  PHE A HD1  10 
ATOM   10912 H  HD2  . PHE A 1 39 ? 4.506   12.638  -4.244  1.00 0.00 ? 39  PHE A HD2  10 
ATOM   10913 H  HE1  . PHE A 1 39 ? 6.934   15.240  -7.640  1.00 0.00 ? 39  PHE A HE1  10 
ATOM   10914 H  HE2  . PHE A 1 39 ? 5.200   14.948  -3.757  1.00 0.00 ? 39  PHE A HE2  10 
ATOM   10915 H  HZ   . PHE A 1 39 ? 6.415   16.252  -5.456  1.00 0.00 ? 39  PHE A HZ   10 
ATOM   10916 N  N    . PRO A 1 40 ? 2.675   9.321   -8.619  1.00 0.00 ? 40  PRO A N    10 
ATOM   10917 C  CA   . PRO A 1 40 ? 2.252   7.956   -8.945  1.00 0.00 ? 40  PRO A CA   10 
ATOM   10918 C  C    . PRO A 1 40 ? 3.429   6.992   -9.042  1.00 0.00 ? 40  PRO A C    10 
ATOM   10919 O  O    . PRO A 1 40 ? 4.585   7.412   -9.109  1.00 0.00 ? 40  PRO A O    10 
ATOM   10920 C  CB   . PRO A 1 40 ? 1.573   8.111   -10.308 1.00 0.00 ? 40  PRO A CB   10 
ATOM   10921 C  CG   . PRO A 1 40 ? 2.194   9.326   -10.905 1.00 0.00 ? 40  PRO A CG   10 
ATOM   10922 C  CD   . PRO A 1 40 ? 2.498   10.244  -9.753  1.00 0.00 ? 40  PRO A CD   10 
ATOM   10923 H  HA   . PRO A 1 40 ? 1.538   7.580   -8.226  1.00 0.00 ? 40  PRO A HA   10 
ATOM   10924 H  HB2  . PRO A 1 40 ? 1.763   7.233   -10.909 1.00 0.00 ? 40  PRO A HB2  10 
ATOM   10925 H  HB3  . PRO A 1 40 ? 0.510   8.238   -10.172 1.00 0.00 ? 40  PRO A HB3  10 
ATOM   10926 H  HG2  . PRO A 1 40 ? 3.104   9.058   -11.421 1.00 0.00 ? 40  PRO A HG2  10 
ATOM   10927 H  HG3  . PRO A 1 40 ? 1.500   9.797   -11.585 1.00 0.00 ? 40  PRO A HG3  10 
ATOM   10928 H  HD2  . PRO A 1 40 ? 3.404   10.800  -9.942  1.00 0.00 ? 40  PRO A HD2  10 
ATOM   10929 H  HD3  . PRO A 1 40 ? 1.671   10.916  -9.577  1.00 0.00 ? 40  PRO A HD3  10 
ATOM   10930 N  N    . CYS A 1 41 ? 3.129   5.698   -9.050  1.00 0.00 ? 41  CYS A N    10 
ATOM   10931 C  CA   . CYS A 1 41 ? 4.162   4.673   -9.139  1.00 0.00 ? 41  CYS A CA   10 
ATOM   10932 C  C    . CYS A 1 41 ? 4.259   4.121   -10.559 1.00 0.00 ? 41  CYS A C    10 
ATOM   10933 O  O    . CYS A 1 41 ? 3.376   3.397   -11.015 1.00 0.00 ? 41  CYS A O    10 
ATOM   10934 C  CB   . CYS A 1 41 ? 3.869   3.537   -8.157  1.00 0.00 ? 41  CYS A CB   10 
ATOM   10935 S  SG   . CYS A 1 41 ? 5.252   2.372   -7.934  1.00 0.00 ? 41  CYS A SG   10 
ATOM   10936 H  H    . CYS A 1 41 ? 2.189   5.424   -8.994  1.00 0.00 ? 41  CYS A H    10 
ATOM   10937 H  HA   . CYS A 1 41 ? 5.105   5.129   -8.878  1.00 0.00 ? 41  CYS A HA   10 
ATOM   10938 H  HB2  . CYS A 1 41 ? 3.636   3.958   -7.190  1.00 0.00 ? 41  CYS A HB2  10 
ATOM   10939 H  HB3  . CYS A 1 41 ? 3.019   2.974   -8.513  1.00 0.00 ? 41  CYS A HB3  10 
ATOM   10940 N  N    . GLU A 1 42 ? 5.340   4.470   -11.250 1.00 0.00 ? 42  GLU A N    10 
ATOM   10941 C  CA   . GLU A 1 42 ? 5.552   4.009   -12.617 1.00 0.00 ? 42  GLU A CA   10 
ATOM   10942 C  C    . GLU A 1 42 ? 5.780   2.501   -12.655 1.00 0.00 ? 42  GLU A C    10 
ATOM   10943 O  O    . GLU A 1 42 ? 5.992   1.920   -13.719 1.00 0.00 ? 42  GLU A O    10 
ATOM   10944 C  CB   . GLU A 1 42 ? 6.747   4.732   -13.243 1.00 0.00 ? 42  GLU A CB   10 
ATOM   10945 C  CG   . GLU A 1 42 ? 8.087   4.295   -12.675 1.00 0.00 ? 42  GLU A CG   10 
ATOM   10946 C  CD   . GLU A 1 42 ? 9.234   5.164   -13.154 1.00 0.00 ? 42  GLU A CD   10 
ATOM   10947 O  OE1  . GLU A 1 42 ? 9.017   6.377   -13.354 1.00 0.00 ? 42  GLU A OE1  10 
ATOM   10948 O  OE2  . GLU A 1 42 ? 10.350  4.630   -13.327 1.00 0.00 ? 42  GLU A OE2  10 
ATOM   10949 H  H    . GLU A 1 42 ? 6.009   5.050   -10.832 1.00 0.00 ? 42  GLU A H    10 
ATOM   10950 H  HA   . GLU A 1 42 ? 4.665   4.242   -13.187 1.00 0.00 ? 42  GLU A HA   10 
ATOM   10951 H  HB2  . GLU A 1 42 ? 6.750   4.543   -14.306 1.00 0.00 ? 42  GLU A HB2  10 
ATOM   10952 H  HB3  . GLU A 1 42 ? 6.638   5.793   -13.075 1.00 0.00 ? 42  GLU A HB3  10 
ATOM   10953 H  HG2  . GLU A 1 42 ? 8.042   4.347   -11.598 1.00 0.00 ? 42  GLU A HG2  10 
ATOM   10954 H  HG3  . GLU A 1 42 ? 8.277   3.276   -12.978 1.00 0.00 ? 42  GLU A HG3  10 
ATOM   10955 N  N    . PHE A 1 43 ? 5.733   1.872   -11.485 1.00 0.00 ? 43  PHE A N    10 
ATOM   10956 C  CA   . PHE A 1 43 ? 5.936   0.432   -11.382 1.00 0.00 ? 43  PHE A CA   10 
ATOM   10957 C  C    . PHE A 1 43 ? 4.600   -0.305  -11.360 1.00 0.00 ? 43  PHE A C    10 
ATOM   10958 O  O    . PHE A 1 43 ? 4.327   -1.146  -12.216 1.00 0.00 ? 43  PHE A O    10 
ATOM   10959 C  CB   . PHE A 1 43 ? 6.737   0.097   -10.122 1.00 0.00 ? 43  PHE A CB   10 
ATOM   10960 C  CG   . PHE A 1 43 ? 8.221   0.047   -10.351 1.00 0.00 ? 43  PHE A CG   10 
ATOM   10961 C  CD1  . PHE A 1 43 ? 8.972   1.211   -10.361 1.00 0.00 ? 43  PHE A CD1  10 
ATOM   10962 C  CD2  . PHE A 1 43 ? 8.864   -1.163  -10.555 1.00 0.00 ? 43  PHE A CD2  10 
ATOM   10963 C  CE1  . PHE A 1 43 ? 10.338  1.169   -10.572 1.00 0.00 ? 43  PHE A CE1  10 
ATOM   10964 C  CE2  . PHE A 1 43 ? 10.229  -1.212  -10.766 1.00 0.00 ? 43  PHE A CE2  10 
ATOM   10965 C  CZ   . PHE A 1 43 ? 10.967  -0.044  -10.774 1.00 0.00 ? 43  PHE A CZ   10 
ATOM   10966 H  H    . PHE A 1 43 ? 5.560   2.390   -10.670 1.00 0.00 ? 43  PHE A H    10 
ATOM   10967 H  HA   . PHE A 1 43 ? 6.494   0.114   -12.249 1.00 0.00 ? 43  PHE A HA   10 
ATOM   10968 H  HB2  . PHE A 1 43 ? 6.542   0.847   -9.370  1.00 0.00 ? 43  PHE A HB2  10 
ATOM   10969 H  HB3  . PHE A 1 43 ? 6.425   -0.868  -9.752  1.00 0.00 ? 43  PHE A HB3  10 
ATOM   10970 H  HD1  . PHE A 1 43 ? 8.482   2.161   -10.202 1.00 0.00 ? 43  PHE A HD1  10 
ATOM   10971 H  HD2  . PHE A 1 43 ? 8.287   -2.077  -10.549 1.00 0.00 ? 43  PHE A HD2  10 
ATOM   10972 H  HE1  . PHE A 1 43 ? 10.912  2.083   -10.577 1.00 0.00 ? 43  PHE A HE1  10 
ATOM   10973 H  HE2  . PHE A 1 43 ? 10.717  -2.162  -10.924 1.00 0.00 ? 43  PHE A HE2  10 
ATOM   10974 H  HZ   . PHE A 1 43 ? 12.033  -0.080  -10.939 1.00 0.00 ? 43  PHE A HZ   10 
ATOM   10975 N  N    . CYS A 1 44 ? 3.770   0.017   -10.373 1.00 0.00 ? 44  CYS A N    10 
ATOM   10976 C  CA   . CYS A 1 44 ? 2.462   -0.613  -10.236 1.00 0.00 ? 44  CYS A CA   10 
ATOM   10977 C  C    . CYS A 1 44 ? 1.345   0.381   -10.540 1.00 0.00 ? 44  CYS A C    10 
ATOM   10978 O  O    . CYS A 1 44 ? 0.284   0.005   -11.037 1.00 0.00 ? 44  CYS A O    10 
ATOM   10979 C  CB   . CYS A 1 44 ? 2.289   -1.176  -8.824  1.00 0.00 ? 44  CYS A CB   10 
ATOM   10980 S  SG   . CYS A 1 44 ? 2.447   0.069   -7.503  1.00 0.00 ? 44  CYS A SG   10 
ATOM   10981 H  H    . CYS A 1 44 ? 4.043   0.696   -9.720  1.00 0.00 ? 44  CYS A H    10 
ATOM   10982 H  HA   . CYS A 1 44 ? 2.409   -1.424  -10.947 1.00 0.00 ? 44  CYS A HA   10 
ATOM   10983 H  HB2  . CYS A 1 44 ? 1.308   -1.620  -8.740  1.00 0.00 ? 44  CYS A HB2  10 
ATOM   10984 H  HB3  . CYS A 1 44 ? 3.038   -1.935  -8.653  1.00 0.00 ? 44  CYS A HB3  10 
ATOM   10985 N  N    . GLY A 1 45 ? 1.592   1.652   -10.237 1.00 0.00 ? 45  GLY A N    10 
ATOM   10986 C  CA   . GLY A 1 45 ? 0.598   2.680   -10.485 1.00 0.00 ? 45  GLY A CA   10 
ATOM   10987 C  C    . GLY A 1 45 ? 0.155   3.376   -9.213  1.00 0.00 ? 45  GLY A C    10 
ATOM   10988 O  O    . GLY A 1 45 ? -0.613  4.337   -9.257  1.00 0.00 ? 45  GLY A O    10 
ATOM   10989 H  H    . GLY A 1 45 ? 2.456   1.893   -9.842  1.00 0.00 ? 45  GLY A H    10 
ATOM   10990 H  HA2  . GLY A 1 45 ? 1.015   3.414   -11.158 1.00 0.00 ? 45  GLY A HA2  10 
ATOM   10991 H  HA3  . GLY A 1 45 ? -0.264  2.226   -10.952 1.00 0.00 ? 45  GLY A HA3  10 
ATOM   10992 N  N    . LYS A 1 46 ? 0.639   2.890   -8.075  1.00 0.00 ? 46  LYS A N    10 
ATOM   10993 C  CA   . LYS A 1 46 ? 0.289   3.471   -6.784  1.00 0.00 ? 46  LYS A CA   10 
ATOM   10994 C  C    . LYS A 1 46 ? 0.533   4.976   -6.780  1.00 0.00 ? 46  LYS A C    10 
ATOM   10995 O  O    . LYS A 1 46 ? 0.936   5.551   -7.792  1.00 0.00 ? 46  LYS A O    10 
ATOM   10996 C  CB   . LYS A 1 46 ? 1.099   2.809   -5.667  1.00 0.00 ? 46  LYS A CB   10 
ATOM   10997 C  CG   . LYS A 1 46 ? 0.460   1.544   -5.120  1.00 0.00 ? 46  LYS A CG   10 
ATOM   10998 C  CD   . LYS A 1 46 ? 1.380   0.834   -4.141  1.00 0.00 ? 46  LYS A CD   10 
ATOM   10999 C  CE   . LYS A 1 46 ? 0.590   0.084   -3.078  1.00 0.00 ? 46  LYS A CE   10 
ATOM   11000 N  NZ   . LYS A 1 46 ? -0.293  -0.956  -3.674  1.00 0.00 ? 46  LYS A NZ   10 
ATOM   11001 H  H    . LYS A 1 46 ? 1.248   2.122   -8.104  1.00 0.00 ? 46  LYS A H    10 
ATOM   11002 H  HA   . LYS A 1 46 ? -0.761  3.288   -6.612  1.00 0.00 ? 46  LYS A HA   10 
ATOM   11003 H  HB2  . LYS A 1 46 ? 2.077   2.557   -6.049  1.00 0.00 ? 46  LYS A HB2  10 
ATOM   11004 H  HB3  . LYS A 1 46 ? 1.210   3.512   -4.854  1.00 0.00 ? 46  LYS A HB3  10 
ATOM   11005 H  HG2  . LYS A 1 46 ? -0.456  1.805   -4.611  1.00 0.00 ? 46  LYS A HG2  10 
ATOM   11006 H  HG3  . LYS A 1 46 ? 0.241   0.878   -5.942  1.00 0.00 ? 46  LYS A HG3  10 
ATOM   11007 H  HD2  . LYS A 1 46 ? 1.992   0.128   -4.682  1.00 0.00 ? 46  LYS A HD2  10 
ATOM   11008 H  HD3  . LYS A 1 46 ? 2.012   1.566   -3.658  1.00 0.00 ? 46  LYS A HD3  10 
ATOM   11009 H  HE2  . LYS A 1 46 ? 1.284   -0.389  -2.400  1.00 0.00 ? 46  LYS A HE2  10 
ATOM   11010 H  HE3  . LYS A 1 46 ? -0.017  0.792   -2.534  1.00 0.00 ? 46  LYS A HE3  10 
ATOM   11011 H  HZ1  . LYS A 1 46 ? -0.215  -0.939  -4.711  1.00 0.00 ? 46  LYS A HZ1  10 
ATOM   11012 H  HZ2  . LYS A 1 46 ? -1.283  -0.778  -3.409  1.00 0.00 ? 46  LYS A HZ2  10 
ATOM   11013 H  HZ3  . LYS A 1 46 ? -0.017  -1.898  -3.331  1.00 0.00 ? 46  LYS A HZ3  10 
ATOM   11014 N  N    . ARG A 1 47 ? 0.289   5.608   -5.637  1.00 0.00 ? 47  ARG A N    10 
ATOM   11015 C  CA   . ARG A 1 47 ? 0.483   7.047   -5.502  1.00 0.00 ? 47  ARG A CA   10 
ATOM   11016 C  C    . ARG A 1 47 ? 0.908   7.407   -4.082  1.00 0.00 ? 47  ARG A C    10 
ATOM   11017 O  O    . ARG A 1 47 ? 0.366   6.882   -3.109  1.00 0.00 ? 47  ARG A O    10 
ATOM   11018 C  CB   . ARG A 1 47 ? -0.802  7.792   -5.867  1.00 0.00 ? 47  ARG A CB   10 
ATOM   11019 C  CG   . ARG A 1 47 ? -1.230  7.597   -7.312  1.00 0.00 ? 47  ARG A CG   10 
ATOM   11020 C  CD   . ARG A 1 47 ? -2.501  8.370   -7.626  1.00 0.00 ? 47  ARG A CD   10 
ATOM   11021 N  NE   . ARG A 1 47 ? -2.704  8.531   -9.063  1.00 0.00 ? 47  ARG A NE   10 
ATOM   11022 C  CZ   . ARG A 1 47 ? -3.375  9.543   -9.602  1.00 0.00 ? 47  ARG A CZ   10 
ATOM   11023 N  NH1  . ARG A 1 47 ? -3.906  10.478  -8.827  1.00 0.00 ? 47  ARG A NH1  10 
ATOM   11024 N  NH2  . ARG A 1 47 ? -3.517  9.620   -10.919 1.00 0.00 ? 47  ARG A NH2  10 
ATOM   11025 H  H    . ARG A 1 47 ? -0.030  5.095   -4.866  1.00 0.00 ? 47  ARG A H    10 
ATOM   11026 H  HA   . ARG A 1 47 ? 1.266   7.341   -6.185  1.00 0.00 ? 47  ARG A HA   10 
ATOM   11027 H  HB2  . ARG A 1 47 ? -1.600  7.445   -5.228  1.00 0.00 ? 47  ARG A HB2  10 
ATOM   11028 H  HB3  . ARG A 1 47 ? -0.651  8.848   -5.699  1.00 0.00 ? 47  ARG A HB3  10 
ATOM   11029 H  HG2  . ARG A 1 47 ? -0.441  7.946   -7.962  1.00 0.00 ? 47  ARG A HG2  10 
ATOM   11030 H  HG3  . ARG A 1 47 ? -1.405  6.546   -7.487  1.00 0.00 ? 47  ARG A HG3  10 
ATOM   11031 H  HD2  . ARG A 1 47 ? -3.343  7.836   -7.211  1.00 0.00 ? 47  ARG A HD2  10 
ATOM   11032 H  HD3  . ARG A 1 47 ? -2.435  9.346   -7.169  1.00 0.00 ? 47  ARG A HD3  10 
ATOM   11033 H  HE   . ARG A 1 47 ? -2.320  7.851   -9.654  1.00 0.00 ? 47  ARG A HE   10 
ATOM   11034 H  HH11 . ARG A 1 47 ? -3.800  10.423  -7.834  1.00 0.00 ? 47  ARG A HH11 10 
ATOM   11035 H  HH12 . ARG A 1 47 ? -4.410  11.240  -9.235  1.00 0.00 ? 47  ARG A HH12 10 
ATOM   11036 H  HH21 . ARG A 1 47 ? -3.118  8.916   -11.507 1.00 0.00 ? 47  ARG A HH21 10 
ATOM   11037 H  HH22 . ARG A 1 47 ? -4.022  10.381  -11.324 1.00 0.00 ? 47  ARG A HH22 10 
ATOM   11038 N  N    . PHE A 1 48 ? 1.880   8.306   -3.971  1.00 0.00 ? 48  PHE A N    10 
ATOM   11039 C  CA   . PHE A 1 48 ? 2.379   8.736   -2.669  1.00 0.00 ? 48  PHE A CA   10 
ATOM   11040 C  C    . PHE A 1 48 ? 2.355   10.257  -2.553  1.00 0.00 ? 48  PHE A C    10 
ATOM   11041 O  O    . PHE A 1 48 ? 2.376   10.967  -3.558  1.00 0.00 ? 48  PHE A O    10 
ATOM   11042 C  CB   . PHE A 1 48 ? 3.802   8.219   -2.448  1.00 0.00 ? 48  PHE A CB   10 
ATOM   11043 C  CG   . PHE A 1 48 ? 3.910   6.722   -2.501  1.00 0.00 ? 48  PHE A CG   10 
ATOM   11044 C  CD1  . PHE A 1 48 ? 3.644   6.035   -3.674  1.00 0.00 ? 48  PHE A CD1  10 
ATOM   11045 C  CD2  . PHE A 1 48 ? 4.279   6.001   -1.376  1.00 0.00 ? 48  PHE A CD2  10 
ATOM   11046 C  CE1  . PHE A 1 48 ? 3.743   4.658   -3.725  1.00 0.00 ? 48  PHE A CE1  10 
ATOM   11047 C  CE2  . PHE A 1 48 ? 4.380   4.623   -1.421  1.00 0.00 ? 48  PHE A CE2  10 
ATOM   11048 C  CZ   . PHE A 1 48 ? 4.112   3.951   -2.597  1.00 0.00 ? 48  PHE A CZ   10 
ATOM   11049 H  H    . PHE A 1 48 ? 2.273   8.689   -4.783  1.00 0.00 ? 48  PHE A H    10 
ATOM   11050 H  HA   . PHE A 1 48 ? 1.732   8.319   -1.913  1.00 0.00 ? 48  PHE A HA   10 
ATOM   11051 H  HB2  . PHE A 1 48 ? 4.447   8.625   -3.213  1.00 0.00 ? 48  PHE A HB2  10 
ATOM   11052 H  HB3  . PHE A 1 48 ? 4.149   8.545   -1.479  1.00 0.00 ? 48  PHE A HB3  10 
ATOM   11053 H  HD1  . PHE A 1 48 ? 3.356   6.586   -4.558  1.00 0.00 ? 48  PHE A HD1  10 
ATOM   11054 H  HD2  . PHE A 1 48 ? 4.489   6.526   -0.455  1.00 0.00 ? 48  PHE A HD2  10 
ATOM   11055 H  HE1  . PHE A 1 48 ? 3.533   4.134   -4.646  1.00 0.00 ? 48  PHE A HE1  10 
ATOM   11056 H  HE2  . PHE A 1 48 ? 4.669   4.074   -0.537  1.00 0.00 ? 48  PHE A HE2  10 
ATOM   11057 H  HZ   . PHE A 1 48 ? 4.189   2.874   -2.634  1.00 0.00 ? 48  PHE A HZ   10 
ATOM   11058 N  N    . GLU A 1 49 ? 2.310   10.750  -1.319  1.00 0.00 ? 49  GLU A N    10 
ATOM   11059 C  CA   . GLU A 1 49 ? 2.282   12.187  -1.072  1.00 0.00 ? 49  GLU A CA   10 
ATOM   11060 C  C    . GLU A 1 49 ? 3.608   12.833  -1.463  1.00 0.00 ? 49  GLU A C    10 
ATOM   11061 O  O    . GLU A 1 49 ? 3.709   14.055  -1.569  1.00 0.00 ? 49  GLU A O    10 
ATOM   11062 C  CB   . GLU A 1 49 ? 1.981   12.467  0.402   1.00 0.00 ? 49  GLU A CB   10 
ATOM   11063 C  CG   . GLU A 1 49 ? 2.773   11.595  1.361   1.00 0.00 ? 49  GLU A CG   10 
ATOM   11064 C  CD   . GLU A 1 49 ? 3.053   12.286  2.682   1.00 0.00 ? 49  GLU A CD   10 
ATOM   11065 O  OE1  . GLU A 1 49 ? 2.184   13.052  3.148   1.00 0.00 ? 49  GLU A OE1  10 
ATOM   11066 O  OE2  . GLU A 1 49 ? 4.143   12.060  3.249   1.00 0.00 ? 49  GLU A OE2  10 
ATOM   11067 H  H    . GLU A 1 49 ? 2.295   10.133  -0.558  1.00 0.00 ? 49  GLU A H    10 
ATOM   11068 H  HA   . GLU A 1 49 ? 1.495   12.612  -1.677  1.00 0.00 ? 49  GLU A HA   10 
ATOM   11069 H  HB2  . GLU A 1 49 ? 2.210   13.501  0.614   1.00 0.00 ? 49  GLU A HB2  10 
ATOM   11070 H  HB3  . GLU A 1 49 ? 0.929   12.298  0.580   1.00 0.00 ? 49  GLU A HB3  10 
ATOM   11071 H  HG2  . GLU A 1 49 ? 2.210   10.694  1.557   1.00 0.00 ? 49  GLU A HG2  10 
ATOM   11072 H  HG3  . GLU A 1 49 ? 3.714   11.337  0.900   1.00 0.00 ? 49  GLU A HG3  10 
ATOM   11073 N  N    . LYS A 1 50 ? 4.623   12.003  -1.676  1.00 0.00 ? 50  LYS A N    10 
ATOM   11074 C  CA   . LYS A 1 50 ? 5.943   12.490  -2.057  1.00 0.00 ? 50  LYS A CA   10 
ATOM   11075 C  C    . LYS A 1 50 ? 6.753   11.392  -2.738  1.00 0.00 ? 50  LYS A C    10 
ATOM   11076 O  O    . LYS A 1 50 ? 6.450   10.204  -2.627  1.00 0.00 ? 50  LYS A O    10 
ATOM   11077 C  CB   . LYS A 1 50 ? 6.694   13.003  -0.826  1.00 0.00 ? 50  LYS A CB   10 
ATOM   11078 C  CG   . LYS A 1 50 ? 6.321   12.283  0.458   1.00 0.00 ? 50  LYS A CG   10 
ATOM   11079 C  CD   . LYS A 1 50 ? 7.281   12.621  1.586   1.00 0.00 ? 50  LYS A CD   10 
ATOM   11080 C  CE   . LYS A 1 50 ? 7.082   14.045  2.080   1.00 0.00 ? 50  LYS A CE   10 
ATOM   11081 N  NZ   . LYS A 1 50 ? 8.018   14.385  3.188   1.00 0.00 ? 50  LYS A NZ   10 
ATOM   11082 H  H    . LYS A 1 50 ? 4.480   11.038  -1.576  1.00 0.00 ? 50  LYS A H    10 
ATOM   11083 H  HA   . LYS A 1 50 ? 5.809   13.305  -2.752  1.00 0.00 ? 50  LYS A HA   10 
ATOM   11084 H  HB2  . LYS A 1 50 ? 7.755   12.880  -0.989  1.00 0.00 ? 50  LYS A HB2  10 
ATOM   11085 H  HB3  . LYS A 1 50 ? 6.478   14.055  -0.700  1.00 0.00 ? 50  LYS A HB3  10 
ATOM   11086 H  HG2  . LYS A 1 50 ? 5.324   12.578  0.749   1.00 0.00 ? 50  LYS A HG2  10 
ATOM   11087 H  HG3  . LYS A 1 50 ? 6.347   11.217  0.283   1.00 0.00 ? 50  LYS A HG3  10 
ATOM   11088 H  HD2  . LYS A 1 50 ? 7.113   11.940  2.407   1.00 0.00 ? 50  LYS A HD2  10 
ATOM   11089 H  HD3  . LYS A 1 50 ? 8.296   12.512  1.229   1.00 0.00 ? 50  LYS A HD3  10 
ATOM   11090 H  HE2  . LYS A 1 50 ? 7.249   14.724  1.259   1.00 0.00 ? 50  LYS A HE2  10 
ATOM   11091 H  HE3  . LYS A 1 50 ? 6.067   14.151  2.434   1.00 0.00 ? 50  LYS A HE3  10 
ATOM   11092 H  HZ1  . LYS A 1 50 ? 8.938   14.679  2.800   1.00 0.00 ? 50  LYS A HZ1  10 
ATOM   11093 H  HZ2  . LYS A 1 50 ? 8.162   13.557  3.800   1.00 0.00 ? 50  LYS A HZ2  10 
ATOM   11094 H  HZ3  . LYS A 1 50 ? 7.630   15.162  3.758   1.00 0.00 ? 50  LYS A HZ3  10 
ATOM   11095 N  N    . PRO A 1 51 ? 7.810   11.795  -3.459  1.00 0.00 ? 51  PRO A N    10 
ATOM   11096 C  CA   . PRO A 1 51 ? 8.687   10.860  -4.170  1.00 0.00 ? 51  PRO A CA   10 
ATOM   11097 C  C    . PRO A 1 51 ? 9.532   10.020  -3.219  1.00 0.00 ? 51  PRO A C    10 
ATOM   11098 O  O    . PRO A 1 51 ? 9.717   8.822   -3.431  1.00 0.00 ? 51  PRO A O    10 
ATOM   11099 C  CB   . PRO A 1 51 ? 9.578   11.779  -5.010  1.00 0.00 ? 51  PRO A CB   10 
ATOM   11100 C  CG   . PRO A 1 51 ? 9.586   13.074  -4.274  1.00 0.00 ? 51  PRO A CG   10 
ATOM   11101 C  CD   . PRO A 1 51 ? 8.231   13.196  -3.635  1.00 0.00 ? 51  PRO A CD   10 
ATOM   11102 H  HA   . PRO A 1 51 ? 8.125   10.207  -4.822  1.00 0.00 ? 51  PRO A HA   10 
ATOM   11103 H  HB2  . PRO A 1 51 ? 10.571  11.356  -5.078  1.00 0.00 ? 51  PRO A HB2  10 
ATOM   11104 H  HB3  . PRO A 1 51 ? 9.159   11.888  -5.998  1.00 0.00 ? 51  PRO A HB3  10 
ATOM   11105 H  HG2  . PRO A 1 51 ? 10.358  13.063  -3.520  1.00 0.00 ? 51  PRO A HG2  10 
ATOM   11106 H  HG3  . PRO A 1 51 ? 9.748   13.888  -4.966  1.00 0.00 ? 51  PRO A HG3  10 
ATOM   11107 H  HD2  . PRO A 1 51 ? 8.307   13.698  -2.681  1.00 0.00 ? 51  PRO A HD2  10 
ATOM   11108 H  HD3  . PRO A 1 51 ? 7.551   13.723  -4.288  1.00 0.00 ? 51  PRO A HD3  10 
ATOM   11109 N  N    . ASP A 1 52 ? 10.043  10.656  -2.171  1.00 0.00 ? 52  ASP A N    10 
ATOM   11110 C  CA   . ASP A 1 52 ? 10.868  9.967   -1.186  1.00 0.00 ? 52  ASP A CA   10 
ATOM   11111 C  C    . ASP A 1 52 ? 10.247  8.629   -0.797  1.00 0.00 ? 52  ASP A C    10 
ATOM   11112 O  O    . ASP A 1 52 ? 10.955  7.652   -0.555  1.00 0.00 ? 52  ASP A O    10 
ATOM   11113 C  CB   . ASP A 1 52 ? 11.051  10.839  0.058   1.00 0.00 ? 52  ASP A CB   10 
ATOM   11114 C  CG   . ASP A 1 52 ? 11.406  10.026  1.287   1.00 0.00 ? 52  ASP A CG   10 
ATOM   11115 O  OD1  . ASP A 1 52 ? 10.524  9.301   1.794   1.00 0.00 ? 52  ASP A OD1  10 
ATOM   11116 O  OD2  . ASP A 1 52 ? 12.565  10.116  1.744   1.00 0.00 ? 52  ASP A OD2  10 
ATOM   11117 H  H    . ASP A 1 52 ? 9.860   11.613  -2.056  1.00 0.00 ? 52  ASP A H    10 
ATOM   11118 H  HA   . ASP A 1 52 ? 11.834  9.785   -1.631  1.00 0.00 ? 52  ASP A HA   10 
ATOM   11119 H  HB2  . ASP A 1 52 ? 11.844  11.550  -0.122  1.00 0.00 ? 52  ASP A HB2  10 
ATOM   11120 H  HB3  . ASP A 1 52 ? 10.132  11.372  0.253   1.00 0.00 ? 52  ASP A HB3  10 
ATOM   11121 N  N    . SER A 1 53 ? 8.919   8.593   -0.739  1.00 0.00 ? 53  SER A N    10 
ATOM   11122 C  CA   . SER A 1 53 ? 8.203   7.377   -0.375  1.00 0.00 ? 53  SER A CA   10 
ATOM   11123 C  C    . SER A 1 53 ? 8.032   6.464   -1.586  1.00 0.00 ? 53  SER A C    10 
ATOM   11124 O  O    . SER A 1 53 ? 7.994   5.240   -1.455  1.00 0.00 ? 53  SER A O    10 
ATOM   11125 C  CB   . SER A 1 53 ? 6.834   7.723   0.213   1.00 0.00 ? 53  SER A CB   10 
ATOM   11126 O  OG   . SER A 1 53 ? 6.965   8.331   1.487   1.00 0.00 ? 53  SER A OG   10 
ATOM   11127 H  H    . SER A 1 53 ? 8.410   9.406   -0.943  1.00 0.00 ? 53  SER A H    10 
ATOM   11128 H  HA   . SER A 1 53 ? 8.786   6.859   0.372   1.00 0.00 ? 53  SER A HA   10 
ATOM   11129 H  HB2  . SER A 1 53 ? 6.323   8.406   -0.448  1.00 0.00 ? 53  SER A HB2  10 
ATOM   11130 H  HB3  . SER A 1 53 ? 6.251   6.819   0.317   1.00 0.00 ? 53  SER A HB3  10 
ATOM   11131 H  HG   . SER A 1 53 ? 6.618   9.225   1.452   1.00 0.00 ? 53  SER A HG   10 
ATOM   11132 N  N    . VAL A 1 54 ? 7.931   7.068   -2.765  1.00 0.00 ? 54  VAL A N    10 
ATOM   11133 C  CA   . VAL A 1 54 ? 7.765   6.311   -4.000  1.00 0.00 ? 54  VAL A CA   10 
ATOM   11134 C  C    . VAL A 1 54 ? 9.039   5.551   -4.353  1.00 0.00 ? 54  VAL A C    10 
ATOM   11135 O  O    . VAL A 1 54 ? 8.990   4.501   -4.994  1.00 0.00 ? 54  VAL A O    10 
ATOM   11136 C  CB   . VAL A 1 54 ? 7.388   7.232   -5.176  1.00 0.00 ? 54  VAL A CB   10 
ATOM   11137 C  CG1  . VAL A 1 54 ? 7.954   6.691   -6.481  1.00 0.00 ? 54  VAL A CG1  10 
ATOM   11138 C  CG2  . VAL A 1 54 ? 5.877   7.389   -5.265  1.00 0.00 ? 54  VAL A CG2  10 
ATOM   11139 H  H    . VAL A 1 54 ? 7.968   8.047   -2.805  1.00 0.00 ? 54  VAL A H    10 
ATOM   11140 H  HA   . VAL A 1 54 ? 6.963   5.603   -3.853  1.00 0.00 ? 54  VAL A HA   10 
ATOM   11141 H  HB   . VAL A 1 54 ? 7.820   8.206   -4.998  1.00 0.00 ? 54  VAL A HB   10 
ATOM   11142 H  HG11 . VAL A 1 54 ? 7.749   7.391   -7.278  1.00 0.00 ? 54  VAL A HG11 10 
ATOM   11143 H  HG12 . VAL A 1 54 ? 9.021   6.557   -6.382  1.00 0.00 ? 54  VAL A HG12 10 
ATOM   11144 H  HG13 . VAL A 1 54 ? 7.491   5.742   -6.708  1.00 0.00 ? 54  VAL A HG13 10 
ATOM   11145 H  HG21 . VAL A 1 54 ? 5.476   6.633   -5.924  1.00 0.00 ? 54  VAL A HG21 10 
ATOM   11146 H  HG22 . VAL A 1 54 ? 5.444   7.276   -4.282  1.00 0.00 ? 54  VAL A HG22 10 
ATOM   11147 H  HG23 . VAL A 1 54 ? 5.639   8.368   -5.653  1.00 0.00 ? 54  VAL A HG23 10 
ATOM   11148 N  N    . ALA A 1 55 ? 10.178  6.088   -3.930  1.00 0.00 ? 55  ALA A N    10 
ATOM   11149 C  CA   . ALA A 1 55 ? 11.465  5.458   -4.199  1.00 0.00 ? 55  ALA A CA   10 
ATOM   11150 C  C    . ALA A 1 55 ? 11.690  4.257   -3.287  1.00 0.00 ? 55  ALA A C    10 
ATOM   11151 O  O    . ALA A 1 55 ? 12.207  3.227   -3.719  1.00 0.00 ? 55  ALA A O    10 
ATOM   11152 C  CB   . ALA A 1 55 ? 12.592  6.468   -4.032  1.00 0.00 ? 55  ALA A CB   10 
ATOM   11153 H  H    . ALA A 1 55 ? 10.153  6.926   -3.424  1.00 0.00 ? 55  ALA A H    10 
ATOM   11154 H  HA   . ALA A 1 55 ? 11.465  5.123   -5.226  1.00 0.00 ? 55  ALA A HA   10 
ATOM   11155 H  HB1  . ALA A 1 55 ? 12.235  7.312   -3.460  1.00 0.00 ? 55  ALA A HB1  10 
ATOM   11156 H  HB2  . ALA A 1 55 ? 13.417  6.004   -3.513  1.00 0.00 ? 55  ALA A HB2  10 
ATOM   11157 H  HB3  . ALA A 1 55 ? 12.920  6.804   -5.004  1.00 0.00 ? 55  ALA A HB3  10 
ATOM   11158 N  N    . ALA A 1 56 ? 11.299  4.396   -2.025  1.00 0.00 ? 56  ALA A N    10 
ATOM   11159 C  CA   . ALA A 1 56 ? 11.457  3.322   -1.053  1.00 0.00 ? 56  ALA A CA   10 
ATOM   11160 C  C    . ALA A 1 56 ? 10.446  2.207   -1.298  1.00 0.00 ? 56  ALA A C    10 
ATOM   11161 O  O    . ALA A 1 56 ? 10.738  1.031   -1.080  1.00 0.00 ? 56  ALA A O    10 
ATOM   11162 C  CB   . ALA A 1 56 ? 11.316  3.864   0.362   1.00 0.00 ? 56  ALA A CB   10 
ATOM   11163 H  H    . ALA A 1 56 ? 10.894  5.242   -1.741  1.00 0.00 ? 56  ALA A H    10 
ATOM   11164 H  HA   . ALA A 1 56 ? 12.454  2.919   -1.160  1.00 0.00 ? 56  ALA A HA   10 
ATOM   11165 H  HB1  . ALA A 1 56 ? 10.387  3.515   0.789   1.00 0.00 ? 56  ALA A HB1  10 
ATOM   11166 H  HB2  . ALA A 1 56 ? 12.142  3.518   0.964   1.00 0.00 ? 56  ALA A HB2  10 
ATOM   11167 H  HB3  . ALA A 1 56 ? 11.316  4.943   0.334   1.00 0.00 ? 56  ALA A HB3  10 
ATOM   11168 N  N    . HIS A 1 57 ? 9.254   2.585   -1.751  1.00 0.00 ? 57  HIS A N    10 
ATOM   11169 C  CA   . HIS A 1 57 ? 8.199   1.616   -2.025  1.00 0.00 ? 57  HIS A CA   10 
ATOM   11170 C  C    . HIS A 1 57 ? 8.655   0.593   -3.061  1.00 0.00 ? 57  HIS A C    10 
ATOM   11171 O  O    . HIS A 1 57 ? 8.252   -0.569  -3.020  1.00 0.00 ? 57  HIS A O    10 
ATOM   11172 C  CB   . HIS A 1 57 ? 6.938   2.329   -2.516  1.00 0.00 ? 57  HIS A CB   10 
ATOM   11173 C  CG   . HIS A 1 57 ? 6.064   1.473   -3.380  1.00 0.00 ? 57  HIS A CG   10 
ATOM   11174 N  ND1  . HIS A 1 57 ? 5.437   0.334   -2.922  1.00 0.00 ? 57  HIS A ND1  10 
ATOM   11175 C  CD2  . HIS A 1 57 ? 5.714   1.597   -4.682  1.00 0.00 ? 57  HIS A CD2  10 
ATOM   11176 C  CE1  . HIS A 1 57 ? 4.739   -0.207  -3.905  1.00 0.00 ? 57  HIS A CE1  10 
ATOM   11177 N  NE2  . HIS A 1 57 ? 4.890   0.540   -4.984  1.00 0.00 ? 57  HIS A NE2  10 
ATOM   11178 H  H    . HIS A 1 57 ? 9.081   3.537   -1.904  1.00 0.00 ? 57  HIS A H    10 
ATOM   11179 H  HA   . HIS A 1 57 ? 7.974   1.101   -1.103  1.00 0.00 ? 57  HIS A HA   10 
ATOM   11180 H  HB2  . HIS A 1 57 ? 6.355   2.643   -1.663  1.00 0.00 ? 57  HIS A HB2  10 
ATOM   11181 H  HB3  . HIS A 1 57 ? 7.225   3.199   -3.090  1.00 0.00 ? 57  HIS A HB3  10 
ATOM   11182 H  HD1  . HIS A 1 57 ? 5.496   -0.025  -2.013  1.00 0.00 ? 57  HIS A HD1  10 
ATOM   11183 H  HD2  . HIS A 1 57 ? 6.024   2.381   -5.359  1.00 0.00 ? 57  HIS A HD2  10 
ATOM   11184 H  HE1  . HIS A 1 57 ? 4.146   -1.107  -3.839  1.00 0.00 ? 57  HIS A HE1  10 
ATOM   11185 N  N    . ARG A 1 58 ? 9.498   1.035   -3.989  1.00 0.00 ? 58  ARG A N    10 
ATOM   11186 C  CA   . ARG A 1 58 ? 10.008  0.158   -5.037  1.00 0.00 ? 58  ARG A CA   10 
ATOM   11187 C  C    . ARG A 1 58 ? 11.028  -0.827  -4.473  1.00 0.00 ? 58  ARG A C    10 
ATOM   11188 O  O    . ARG A 1 58 ? 11.299  -1.867  -5.073  1.00 0.00 ? 58  ARG A O    10 
ATOM   11189 C  CB   . ARG A 1 58 ? 10.644  0.983   -6.157  1.00 0.00 ? 58  ARG A CB   10 
ATOM   11190 C  CG   . ARG A 1 58 ? 9.689   1.975   -6.801  1.00 0.00 ? 58  ARG A CG   10 
ATOM   11191 C  CD   . ARG A 1 58 ? 10.429  3.185   -7.350  1.00 0.00 ? 58  ARG A CD   10 
ATOM   11192 N  NE   . ARG A 1 58 ? 11.529  2.800   -8.231  1.00 0.00 ? 58  ARG A NE   10 
ATOM   11193 C  CZ   . ARG A 1 58 ? 12.661  3.486   -8.334  1.00 0.00 ? 58  ARG A CZ   10 
ATOM   11194 N  NH1  . ARG A 1 58 ? 12.843  4.585   -7.615  1.00 0.00 ? 58  ARG A NH1  10 
ATOM   11195 N  NH2  . ARG A 1 58 ? 13.616  3.073   -9.158  1.00 0.00 ? 58  ARG A NH2  10 
ATOM   11196 H  H    . ARG A 1 58 ? 9.784   1.972   -3.969  1.00 0.00 ? 58  ARG A H    10 
ATOM   11197 H  HA   . ARG A 1 58 ? 9.174   -0.397  -5.440  1.00 0.00 ? 58  ARG A HA   10 
ATOM   11198 H  HB2  . ARG A 1 58 ? 11.481  1.534   -5.752  1.00 0.00 ? 58  ARG A HB2  10 
ATOM   11199 H  HB3  . ARG A 1 58 ? 11.003  0.312   -6.922  1.00 0.00 ? 58  ARG A HB3  10 
ATOM   11200 H  HG2  . ARG A 1 58 ? 9.170   1.486   -7.612  1.00 0.00 ? 58  ARG A HG2  10 
ATOM   11201 H  HG3  . ARG A 1 58 ? 8.976   2.305   -6.061  1.00 0.00 ? 58  ARG A HG3  10 
ATOM   11202 H  HD2  . ARG A 1 58 ? 9.732   3.794   -7.906  1.00 0.00 ? 58  ARG A HD2  10 
ATOM   11203 H  HD3  . ARG A 1 58 ? 10.825  3.754   -6.522  1.00 0.00 ? 58  ARG A HD3  10 
ATOM   11204 H  HE   . ARG A 1 58 ? 11.416  1.991   -8.771  1.00 0.00 ? 58  ARG A HE   10 
ATOM   11205 H  HH11 . ARG A 1 58 ? 12.126  4.899   -6.993  1.00 0.00 ? 58  ARG A HH11 10 
ATOM   11206 H  HH12 . ARG A 1 58 ? 13.697  5.099   -7.694  1.00 0.00 ? 58  ARG A HH12 10 
ATOM   11207 H  HH21 . ARG A 1 58 ? 13.483  2.244   -9.702  1.00 0.00 ? 58  ARG A HH21 10 
ATOM   11208 H  HH22 . ARG A 1 58 ? 14.468  3.589   -9.236  1.00 0.00 ? 58  ARG A HH22 10 
ATOM   11209 N  N    . SER A 1 59 ? 11.591  -0.491  -3.317  1.00 0.00 ? 59  SER A N    10 
ATOM   11210 C  CA   . SER A 1 59 ? 12.585  -1.343  -2.674  1.00 0.00 ? 59  SER A CA   10 
ATOM   11211 C  C    . SER A 1 59 ? 11.924  -2.293  -1.680  1.00 0.00 ? 59  SER A C    10 
ATOM   11212 O  O    . SER A 1 59 ? 12.576  -3.170  -1.114  1.00 0.00 ? 59  SER A O    10 
ATOM   11213 C  CB   . SER A 1 59 ? 13.635  -0.489  -1.961  1.00 0.00 ? 59  SER A CB   10 
ATOM   11214 O  OG   . SER A 1 59 ? 14.756  -1.270  -1.585  1.00 0.00 ? 59  SER A OG   10 
ATOM   11215 H  H    . SER A 1 59 ? 11.334  0.352   -2.887  1.00 0.00 ? 59  SER A H    10 
ATOM   11216 H  HA   . SER A 1 59 ? 13.069  -1.926  -3.444  1.00 0.00 ? 59  SER A HA   10 
ATOM   11217 H  HB2  . SER A 1 59 ? 13.965  0.298   -2.621  1.00 0.00 ? 59  SER A HB2  10 
ATOM   11218 H  HB3  . SER A 1 59 ? 13.199  -0.055  -1.073  1.00 0.00 ? 59  SER A HB3  10 
ATOM   11219 H  HG   . SER A 1 59 ? 14.636  -1.592  -0.689  1.00 0.00 ? 59  SER A HG   10 
ATOM   11220 N  N    . LYS A 1 60 ? 10.624  -2.112  -1.472  1.00 0.00 ? 60  LYS A N    10 
ATOM   11221 C  CA   . LYS A 1 60 ? 9.872   -2.952  -0.548  1.00 0.00 ? 60  LYS A CA   10 
ATOM   11222 C  C    . LYS A 1 60 ? 8.775   -3.718  -1.279  1.00 0.00 ? 60  LYS A C    10 
ATOM   11223 O  O    . LYS A 1 60 ? 8.411   -4.827  -0.887  1.00 0.00 ? 60  LYS A O    10 
ATOM   11224 C  CB   . LYS A 1 60 ? 9.259   -2.099  0.565   1.00 0.00 ? 60  LYS A CB   10 
ATOM   11225 C  CG   . LYS A 1 60 ? 10.272  -1.612  1.587   1.00 0.00 ? 60  LYS A CG   10 
ATOM   11226 C  CD   . LYS A 1 60 ? 9.649   -0.634  2.568   1.00 0.00 ? 60  LYS A CD   10 
ATOM   11227 C  CE   . LYS A 1 60 ? 10.645  -0.204  3.634   1.00 0.00 ? 60  LYS A CE   10 
ATOM   11228 N  NZ   . LYS A 1 60 ? 10.114  0.907   4.472   1.00 0.00 ? 60  LYS A NZ   10 
ATOM   11229 H  H    . LYS A 1 60 ? 10.159  -1.395  -1.953  1.00 0.00 ? 60  LYS A H    10 
ATOM   11230 H  HA   . LYS A 1 60 ? 10.559  -3.661  -0.110  1.00 0.00 ? 60  LYS A HA   10 
ATOM   11231 H  HB2  . LYS A 1 60 ? 8.784   -1.237  0.121   1.00 0.00 ? 60  LYS A HB2  10 
ATOM   11232 H  HB3  . LYS A 1 60 ? 8.512   -2.685  1.081   1.00 0.00 ? 60  LYS A HB3  10 
ATOM   11233 H  HG2  . LYS A 1 60 ? 10.654  -2.461  2.134   1.00 0.00 ? 60  LYS A HG2  10 
ATOM   11234 H  HG3  . LYS A 1 60 ? 11.084  -1.121  1.069   1.00 0.00 ? 60  LYS A HG3  10 
ATOM   11235 H  HD2  . LYS A 1 60 ? 9.315   0.240   2.029   1.00 0.00 ? 60  LYS A HD2  10 
ATOM   11236 H  HD3  . LYS A 1 60 ? 8.804   -1.108  3.047   1.00 0.00 ? 60  LYS A HD3  10 
ATOM   11237 H  HE2  . LYS A 1 60 ? 10.862  -1.049  4.268   1.00 0.00 ? 60  LYS A HE2  10 
ATOM   11238 H  HE3  . LYS A 1 60 ? 11.552  0.125   3.149   1.00 0.00 ? 60  LYS A HE3  10 
ATOM   11239 H  HZ1  . LYS A 1 60 ? 9.187   0.647   4.865   1.00 0.00 ? 60  LYS A HZ1  10 
ATOM   11240 H  HZ2  . LYS A 1 60 ? 10.005  1.767   3.898   1.00 0.00 ? 60  LYS A HZ2  10 
ATOM   11241 H  HZ3  . LYS A 1 60 ? 10.767  1.107   5.257   1.00 0.00 ? 60  LYS A HZ3  10 
ATOM   11242 N  N    . SER A 1 61 ? 8.251   -3.120  -2.345  1.00 0.00 ? 61  SER A N    10 
ATOM   11243 C  CA   . SER A 1 61 ? 7.193   -3.746  -3.129  1.00 0.00 ? 61  SER A CA   10 
ATOM   11244 C  C    . SER A 1 61 ? 7.714   -4.176  -4.497  1.00 0.00 ? 61  SER A C    10 
ATOM   11245 O  O    . SER A 1 61 ? 7.247   -5.161  -5.071  1.00 0.00 ? 61  SER A O    10 
ATOM   11246 C  CB   . SER A 1 61 ? 6.017   -2.782  -3.299  1.00 0.00 ? 61  SER A CB   10 
ATOM   11247 O  OG   . SER A 1 61 ? 5.161   -2.818  -2.170  1.00 0.00 ? 61  SER A OG   10 
ATOM   11248 H  H    . SER A 1 61 ? 8.583   -2.236  -2.608  1.00 0.00 ? 61  SER A H    10 
ATOM   11249 H  HA   . SER A 1 61 ? 6.856   -4.621  -2.594  1.00 0.00 ? 61  SER A HA   10 
ATOM   11250 H  HB2  . SER A 1 61 ? 6.393   -1.777  -3.418  1.00 0.00 ? 61  SER A HB2  10 
ATOM   11251 H  HB3  . SER A 1 61 ? 5.450   -3.061  -4.175  1.00 0.00 ? 61  SER A HB3  10 
ATOM   11252 H  HG   . SER A 1 61 ? 5.687   -2.907  -1.372  1.00 0.00 ? 61  SER A HG   10 
ATOM   11253 N  N    . HIS A 1 62 ? 8.684   -3.430  -5.016  1.00 0.00 ? 62  HIS A N    10 
ATOM   11254 C  CA   . HIS A 1 62 ? 9.270   -3.734  -6.317  1.00 0.00 ? 62  HIS A CA   10 
ATOM   11255 C  C    . HIS A 1 62 ? 10.756  -4.052  -6.183  1.00 0.00 ? 62  HIS A C    10 
ATOM   11256 O  O    . HIS A 1 62 ? 11.561  -3.760  -7.068  1.00 0.00 ? 62  HIS A O    10 
ATOM   11257 C  CB   . HIS A 1 62 ? 9.072   -2.560  -7.275  1.00 0.00 ? 62  HIS A CB   10 
ATOM   11258 C  CG   . HIS A 1 62 ? 7.634   -2.231  -7.531  1.00 0.00 ? 62  HIS A CG   10 
ATOM   11259 N  ND1  . HIS A 1 62 ? 6.773   -3.082  -8.191  1.00 0.00 ? 62  HIS A ND1  10 
ATOM   11260 C  CD2  . HIS A 1 62 ? 6.905   -1.136  -7.209  1.00 0.00 ? 62  HIS A CD2  10 
ATOM   11261 C  CE1  . HIS A 1 62 ? 5.577   -2.525  -8.266  1.00 0.00 ? 62  HIS A CE1  10 
ATOM   11262 N  NE2  . HIS A 1 62 ? 5.631   -1.343  -7.677  1.00 0.00 ? 62  HIS A NE2  10 
ATOM   11263 H  H    . HIS A 1 62 ? 9.015   -2.658  -4.511  1.00 0.00 ? 62  HIS A H    10 
ATOM   11264 H  HA   . HIS A 1 62 ? 8.764   -4.601  -6.714  1.00 0.00 ? 62  HIS A HA   10 
ATOM   11265 H  HB2  . HIS A 1 62 ? 9.544   -1.681  -6.860  1.00 0.00 ? 62  HIS A HB2  10 
ATOM   11266 H  HB3  . HIS A 1 62 ? 9.533   -2.796  -8.224  1.00 0.00 ? 62  HIS A HB3  10 
ATOM   11267 H  HD1  . HIS A 1 62 ? 7.004   -3.963  -8.552  1.00 0.00 ? 62  HIS A HD1  10 
ATOM   11268 H  HD2  . HIS A 1 62 ? 7.260   -0.261  -6.683  1.00 0.00 ? 62  HIS A HD2  10 
ATOM   11269 H  HE1  . HIS A 1 62 ? 4.704   -2.960  -8.728  1.00 0.00 ? 62  HIS A HE1  10 
A