data_2D9Y
# 
_entry.id   2D9Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2D9Y         
RCSB  RCSB025169   
WWPDB D_1000025169 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002000946.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2D9Y 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-13 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, H.'                                                 1 
'Tochio, N.'                                             2 
'Koshiba, S.'                                            3 
'Inoue, M.'                                              4 
'Kigawa, T.'                                             5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the PH domain of PEPP-3 from human' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, H.'       1 
primary 'Tochio, N.'   2 
primary 'Koshiba, S.'  3 
primary 'Inoue, M.'    4 
primary 'Kigawa, T.'   5 
primary 'Yokoyama, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Pleckstrin homology domain-containing protein family A member 6' 
_entity.formula_weight             12918.397 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PH domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphoinositol 3-phosphate-binding protein 3, PEPP-3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAE
HAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAE
HAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002000946.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ASN n 
1 9   ALA n 
1 10  PRO n 
1 11  VAL n 
1 12  THR n 
1 13  LYS n 
1 14  ALA n 
1 15  GLY n 
1 16  TRP n 
1 17  LEU n 
1 18  PHE n 
1 19  LYS n 
1 20  GLN n 
1 21  ALA n 
1 22  SER n 
1 23  SER n 
1 24  GLY n 
1 25  VAL n 
1 26  LYS n 
1 27  GLN n 
1 28  TRP n 
1 29  ASN n 
1 30  LYS n 
1 31  ARG n 
1 32  TRP n 
1 33  PHE n 
1 34  VAL n 
1 35  LEU n 
1 36  VAL n 
1 37  ASP n 
1 38  ARG n 
1 39  CYS n 
1 40  LEU n 
1 41  PHE n 
1 42  TYR n 
1 43  TYR n 
1 44  LYS n 
1 45  ASP n 
1 46  GLU n 
1 47  LYS n 
1 48  GLU n 
1 49  GLU n 
1 50  SER n 
1 51  ILE n 
1 52  LEU n 
1 53  GLY n 
1 54  SER n 
1 55  ILE n 
1 56  PRO n 
1 57  LEU n 
1 58  LEU n 
1 59  SER n 
1 60  PHE n 
1 61  ARG n 
1 62  VAL n 
1 63  ALA n 
1 64  ALA n 
1 65  VAL n 
1 66  GLN n 
1 67  PRO n 
1 68  SER n 
1 69  ASP n 
1 70  ASN n 
1 71  ILE n 
1 72  SER n 
1 73  ARG n 
1 74  LYS n 
1 75  HIS n 
1 76  THR n 
1 77  PHE n 
1 78  LYS n 
1 79  ALA n 
1 80  GLU n 
1 81  HIS n 
1 82  ALA n 
1 83  GLY n 
1 84  VAL n 
1 85  ARG n 
1 86  THR n 
1 87  TYR n 
1 88  PHE n 
1 89  PHE n 
1 90  SER n 
1 91  ALA n 
1 92  GLU n 
1 93  SER n 
1 94  PRO n 
1 95  GLU n 
1 96  GLU n 
1 97  GLN n 
1 98  GLU n 
1 99  ALA n 
1 100 TRP n 
1 101 ILE n 
1 102 GLN n 
1 103 ALA n 
1 104 MET n 
1 105 GLY n 
1 106 GLU n 
1 107 ALA n 
1 108 ALA n 
1 109 ARG n 
1 110 VAL n 
1 111 GLN n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 SER n 
1 116 SER n 
1 117 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PLEKHA6 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050711-08 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PLEA6_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y2H5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTY
FFSAESPEEQEAWIQAMGEAARVQ
;
_struct_ref.pdbx_align_begin           57 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2D9Y 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 111 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y2H5 
_struct_ref_seq.db_align_beg                  57 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  160 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       111 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2D9Y GLY A 1   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 1   1  
1 2D9Y SER A 2   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 2   2  
1 2D9Y SER A 3   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 3   3  
1 2D9Y GLY A 4   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 4   4  
1 2D9Y SER A 5   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 5   5  
1 2D9Y SER A 6   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 6   6  
1 2D9Y GLY A 7   ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 7   7  
1 2D9Y SER A 112 ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 112 8  
1 2D9Y GLY A 113 ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 113 9  
1 2D9Y PRO A 114 ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 114 10 
1 2D9Y SER A 115 ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 115 11 
1 2D9Y SER A 116 ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 116 12 
1 2D9Y GLY A 117 ? UNP Q9Y2H5 ? ? 'CLONING ARTIFACT' 117 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.14mM PH domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2D9Y 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2D9Y 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2D9Y 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRview 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.932    'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2D9Y 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2D9Y 
_struct.title                     'Solution structure of the PH domain of PEPP-3 from human' 
_struct.pdbx_descriptor           'Pleckstrin homology domain-containing protein family A member 6' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2D9Y 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;PH domain, PEPP-3, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        94 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ALA 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        107 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         94 
_struct_conf.end_auth_comp_id        ALA 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         107 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 53 ? PRO A 56 ? GLY A 53 PRO A 56 
A 2 CYS A 39 ? TYR A 43 ? CYS A 39 TYR A 43 
A 3 TRP A 28 ? VAL A 36 ? TRP A 28 VAL A 36 
A 4 LYS A 13 ? GLN A 20 ? LYS A 13 GLN A 20 
A 5 THR A 86 ? SER A 90 ? THR A 86 SER A 90 
A 6 THR A 76 ? GLU A 80 ? THR A 76 GLU A 80 
A 7 ARG A 61 ? ALA A 64 ? ARG A 61 ALA A 64 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 55 ? O ILE A 55 N LEU A 40 ? N LEU A 40 
A 2 3 O CYS A 39 ? O CYS A 39 N VAL A 36 ? N VAL A 36 
A 3 4 O ARG A 31 ? O ARG A 31 N LEU A 17 ? N LEU A 17 
A 4 5 N PHE A 18 ? N PHE A 18 O SER A 90 ? O SER A 90 
A 5 6 O TYR A 87 ? O TYR A 87 N ALA A 79 ? N ALA A 79 
A 6 7 O LYS A 78 ? O LYS A 78 N ALA A 63 ? N ALA A 63 
# 
_database_PDB_matrix.entry_id          2D9Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2D9Y 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -17.105 13.765  11.625  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -15.832 13.099  11.422  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -14.717 13.715  12.244  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -14.640 14.936  12.381  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -17.576 13.667  12.479  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -15.934 12.059  11.695  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -15.569 13.162  10.376  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -13.853 12.869  12.795  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -12.740 13.338  13.613  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -11.487 12.507  13.353  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -11.566 11.300  13.124  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -13.109 13.276  15.096  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -11.972 13.496  15.914  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -13.968 11.907  12.649  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -12.540 14.364  13.343  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -13.846 14.034  15.314  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -13.517 12.301  15.322  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -12.238 13.953  16.715  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -10.332 13.162  13.391  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -9.061  12.486  13.156  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -8.237  12.419  14.438  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -8.639  12.941  15.477  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -8.269  13.208  12.064  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -8.830  12.969  10.785  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -10.334 14.125  13.579  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -9.277  11.480  12.828  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -8.282  14.270  12.256  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -7.249  12.853  12.069  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -8.886  12.023  10.631  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -7.078  11.771  14.356  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -6.214  11.646  15.515  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -4.783  11.319  15.139  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -4.510  10.265  14.566  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -6.809  11.374  13.501  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -6.229  12.577  16.063  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -6.596  10.860  16.151  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -3.866  12.227  15.460  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -2.456  12.032  15.147  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -1.688  11.550  16.375  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -1.669  12.216  17.410  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -1.842  13.334  14.628  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -0.444  13.201  14.444  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -4.147  13.048  15.917  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -2.388  11.280  14.376  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -2.295  13.590  13.682  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -2.026  14.125  15.341  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 0.018   13.714  15.111  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -1.057  10.387  16.251  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -0.291  9.812   17.351  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 1.087   9.362   16.875  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 1.296   9.112   15.689  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -1.045  8.629   17.961  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -0.401  8.166   19.136  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -1.110  9.903   15.400  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -0.167  10.576  18.103  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -2.049  8.935   18.212  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -1.083  7.821   17.244  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 0.472   7.835   18.914  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 2.025   9.261   17.812  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 3.372   8.841   17.471  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 3.388   7.691   16.483  1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 3.420   7.905   15.272  1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 1.801   9.473   18.742  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 3.900   9.679   17.041  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 3.880   8.533   18.373  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ASN A 1 8   ? 3.368   6.468   17.002  1.00 0.00 ? 8   ASN A N    1  
ATOM 67    C CA   . ASN A 1 8   ? 3.382   5.279   16.157  1.00 0.00 ? 8   ASN A CA   1  
ATOM 68    C C    . ASN A 1 8   ? 1.964   4.859   15.784  1.00 0.00 ? 8   ASN A C    1  
ATOM 69    O O    . ASN A 1 8   ? 1.061   4.876   16.619  1.00 0.00 ? 8   ASN A O    1  
ATOM 70    C CB   . ASN A 1 8   ? 4.095   4.129   16.871  1.00 0.00 ? 8   ASN A CB   1  
ATOM 71    C CG   . ASN A 1 8   ? 4.186   2.883   16.012  1.00 0.00 ? 8   ASN A CG   1  
ATOM 72    O OD1  . ASN A 1 8   ? 3.843   2.904   14.830  1.00 0.00 ? 8   ASN A OD1  1  
ATOM 73    N ND2  . ASN A 1 8   ? 4.649   1.788   16.605  1.00 0.00 ? 8   ASN A ND2  1  
ATOM 74    H H    . ASN A 1 8   ? 3.342   6.361   17.976  1.00 0.00 ? 8   ASN A H    1  
ATOM 75    H HA   . ASN A 1 8   ? 3.923   5.521   15.255  1.00 0.00 ? 8   ASN A HA   1  
ATOM 76    H HB2  . ASN A 1 8   ? 5.098   4.439   17.128  1.00 0.00 ? 8   ASN A HB2  1  
ATOM 77    H HB3  . ASN A 1 8   ? 3.556   3.884   17.774  1.00 0.00 ? 8   ASN A HB3  1  
ATOM 78    H HD21 . ASN A 1 8   ? 4.903   1.845   17.550  1.00 0.00 ? 8   ASN A HD21 1  
ATOM 79    H HD22 . ASN A 1 8   ? 4.719   0.968   16.073  1.00 0.00 ? 8   ASN A HD22 1  
ATOM 80    N N    . ALA A 1 9   ? 1.777   4.483   14.523  1.00 0.00 ? 9   ALA A N    1  
ATOM 81    C CA   . ALA A 1 9   ? 0.469   4.057   14.039  1.00 0.00 ? 9   ALA A CA   1  
ATOM 82    C C    . ALA A 1 9   ? 0.319   2.542   14.128  1.00 0.00 ? 9   ALA A C    1  
ATOM 83    O O    . ALA A 1 9   ? 1.277   1.787   13.958  1.00 0.00 ? 9   ALA A O    1  
ATOM 84    C CB   . ALA A 1 9   ? 0.257   4.527   12.608  1.00 0.00 ? 9   ALA A CB   1  
ATOM 85    H H    . ALA A 1 9   ? 2.536   4.491   13.904  1.00 0.00 ? 9   ALA A H    1  
ATOM 86    H HA   . ALA A 1 9   ? -0.284  4.520   14.660  1.00 0.00 ? 9   ALA A HA   1  
ATOM 87    H HB1  . ALA A 1 9   ? 1.171   4.393   12.046  1.00 0.00 ? 9   ALA A HB1  1  
ATOM 88    H HB2  . ALA A 1 9   ? -0.534  3.949   12.153  1.00 0.00 ? 9   ALA A HB2  1  
ATOM 89    H HB3  . ALA A 1 9   ? -0.014  5.572   12.609  1.00 0.00 ? 9   ALA A HB3  1  
ATOM 90    N N    . PRO A 1 10  ? -0.912  2.084   14.401  1.00 0.00 ? 10  PRO A N    1  
ATOM 91    C CA   . PRO A 1 10  ? -1.217  0.655   14.519  1.00 0.00 ? 10  PRO A CA   1  
ATOM 92    C C    . PRO A 1 10  ? -1.139  -0.067  13.178  1.00 0.00 ? 10  PRO A C    1  
ATOM 93    O O    . PRO A 1 10  ? -1.184  0.561   12.120  1.00 0.00 ? 10  PRO A O    1  
ATOM 94    C CB   . PRO A 1 10  ? -2.652  0.641   15.052  1.00 0.00 ? 10  PRO A CB   1  
ATOM 95    C CG   . PRO A 1 10  ? -3.234  1.937   14.605  1.00 0.00 ? 10  PRO A CG   1  
ATOM 96    C CD   . PRO A 1 10  ? -2.101  2.926   14.615  1.00 0.00 ? 10  PRO A CD   1  
ATOM 97    H HA   . PRO A 1 10  ? -0.563  0.167   15.228  1.00 0.00 ? 10  PRO A HA   1  
ATOM 98    H HB2  . PRO A 1 10  ? -3.186  -0.199  14.631  1.00 0.00 ? 10  PRO A HB2  1  
ATOM 99    H HB3  . PRO A 1 10  ? -2.639  0.564   16.129  1.00 0.00 ? 10  PRO A HB3  1  
ATOM 100   H HG2  . PRO A 1 10  ? -3.634  1.836   13.608  1.00 0.00 ? 10  PRO A HG2  1  
ATOM 101   H HG3  . PRO A 1 10  ? -4.008  2.248   15.292  1.00 0.00 ? 10  PRO A HG3  1  
ATOM 102   H HD2  . PRO A 1 10  ? -2.217  3.641   13.814  1.00 0.00 ? 10  PRO A HD2  1  
ATOM 103   H HD3  . PRO A 1 10  ? -2.049  3.430   15.569  1.00 0.00 ? 10  PRO A HD3  1  
ATOM 104   N N    . VAL A 1 11  ? -1.023  -1.390  13.229  1.00 0.00 ? 11  VAL A N    1  
ATOM 105   C CA   . VAL A 1 11  ? -0.941  -2.198  12.018  1.00 0.00 ? 11  VAL A CA   1  
ATOM 106   C C    . VAL A 1 11  ? -2.291  -2.272  11.314  1.00 0.00 ? 11  VAL A C    1  
ATOM 107   O O    . VAL A 1 11  ? -3.338  -2.350  11.960  1.00 0.00 ? 11  VAL A O    1  
ATOM 108   C CB   . VAL A 1 11  ? -0.457  -3.627  12.328  1.00 0.00 ? 11  VAL A CB   1  
ATOM 109   C CG1  . VAL A 1 11  ? -0.597  -4.516  11.102  1.00 0.00 ? 11  VAL A CG1  1  
ATOM 110   C CG2  . VAL A 1 11  ? 0.982   -3.607  12.821  1.00 0.00 ? 11  VAL A CG2  1  
ATOM 111   H H    . VAL A 1 11  ? -0.993  -1.834  14.103  1.00 0.00 ? 11  VAL A H    1  
ATOM 112   H HA   . VAL A 1 11  ? -0.225  -1.734  11.355  1.00 0.00 ? 11  VAL A HA   1  
ATOM 113   H HB   . VAL A 1 11  ? -1.078  -4.033  13.113  1.00 0.00 ? 11  VAL A HB   1  
ATOM 114   H HG11 . VAL A 1 11  ? -0.035  -5.426  11.252  1.00 0.00 ? 11  VAL A HG11 1  
ATOM 115   H HG12 . VAL A 1 11  ? -1.639  -4.756  10.948  1.00 0.00 ? 11  VAL A HG12 1  
ATOM 116   H HG13 . VAL A 1 11  ? -0.216  -3.997  10.236  1.00 0.00 ? 11  VAL A HG13 1  
ATOM 117   H HG21 . VAL A 1 11  ? 1.000   -3.339  13.867  1.00 0.00 ? 11  VAL A HG21 1  
ATOM 118   H HG22 . VAL A 1 11  ? 1.421   -4.586  12.692  1.00 0.00 ? 11  VAL A HG22 1  
ATOM 119   H HG23 . VAL A 1 11  ? 1.547   -2.882  12.253  1.00 0.00 ? 11  VAL A HG23 1  
ATOM 120   N N    . THR A 1 12  ? -2.262  -2.247  9.985   1.00 0.00 ? 12  THR A N    1  
ATOM 121   C CA   . THR A 1 12  ? -3.484  -2.311  9.193   1.00 0.00 ? 12  THR A CA   1  
ATOM 122   C C    . THR A 1 12  ? -3.816  -3.748  8.809   1.00 0.00 ? 12  THR A C    1  
ATOM 123   O O    . THR A 1 12  ? -4.934  -4.217  9.022   1.00 0.00 ? 12  THR A O    1  
ATOM 124   C CB   . THR A 1 12  ? -3.367  -1.463  7.912   1.00 0.00 ? 12  THR A CB   1  
ATOM 125   O OG1  . THR A 1 12  ? -2.633  -0.264  8.184   1.00 0.00 ? 12  THR A OG1  1  
ATOM 126   C CG2  . THR A 1 12  ? -4.744  -1.110  7.370   1.00 0.00 ? 12  THR A CG2  1  
ATOM 127   H H    . THR A 1 12  ? -1.398  -2.184  9.529   1.00 0.00 ? 12  THR A H    1  
ATOM 128   H HA   . THR A 1 12  ? -4.290  -1.913  9.791   1.00 0.00 ? 12  THR A HA   1  
ATOM 129   H HB   . THR A 1 12  ? -2.839  -2.038  7.165   1.00 0.00 ? 12  THR A HB   1  
ATOM 130   H HG1  . THR A 1 12  ? -1.971  -0.439  8.857   1.00 0.00 ? 12  THR A HG1  1  
ATOM 131   H HG21 . THR A 1 12  ? -5.106  -1.918  6.753   1.00 0.00 ? 12  THR A HG21 1  
ATOM 132   H HG22 . THR A 1 12  ? -4.677  -0.208  6.780   1.00 0.00 ? 12  THR A HG22 1  
ATOM 133   H HG23 . THR A 1 12  ? -5.424  -0.952  8.193   1.00 0.00 ? 12  THR A HG23 1  
ATOM 134   N N    . LYS A 1 13  ? -2.837  -4.445  8.241   1.00 0.00 ? 13  LYS A N    1  
ATOM 135   C CA   . LYS A 1 13  ? -3.024  -5.831  7.828   1.00 0.00 ? 13  LYS A CA   1  
ATOM 136   C C    . LYS A 1 13  ? -1.691  -6.573  7.794   1.00 0.00 ? 13  LYS A C    1  
ATOM 137   O O    . LYS A 1 13  ? -0.667  -6.010  7.408   1.00 0.00 ? 13  LYS A O    1  
ATOM 138   C CB   . LYS A 1 13  ? -3.687  -5.889  6.450   1.00 0.00 ? 13  LYS A CB   1  
ATOM 139   C CG   . LYS A 1 13  ? -4.068  -7.294  6.017   1.00 0.00 ? 13  LYS A CG   1  
ATOM 140   C CD   . LYS A 1 13  ? -4.802  -7.288  4.687   1.00 0.00 ? 13  LYS A CD   1  
ATOM 141   C CE   . LYS A 1 13  ? -5.498  -8.616  4.428   1.00 0.00 ? 13  LYS A CE   1  
ATOM 142   N NZ   . LYS A 1 13  ? -6.507  -8.927  5.479   1.00 0.00 ? 13  LYS A NZ   1  
ATOM 143   H H    . LYS A 1 13  ? -1.967  -4.016  8.096   1.00 0.00 ? 13  LYS A H    1  
ATOM 144   H HA   . LYS A 1 13  ? -3.669  -6.308  8.549   1.00 0.00 ? 13  LYS A HA   1  
ATOM 145   H HB2  . LYS A 1 13  ? -4.583  -5.285  6.469   1.00 0.00 ? 13  LYS A HB2  1  
ATOM 146   H HB3  . LYS A 1 13  ? -3.005  -5.482  5.718   1.00 0.00 ? 13  LYS A HB3  1  
ATOM 147   H HG2  . LYS A 1 13  ? -3.171  -7.887  5.918   1.00 0.00 ? 13  LYS A HG2  1  
ATOM 148   H HG3  . LYS A 1 13  ? -4.709  -7.731  6.770   1.00 0.00 ? 13  LYS A HG3  1  
ATOM 149   H HD2  . LYS A 1 13  ? -5.542  -6.502  4.697   1.00 0.00 ? 13  LYS A HD2  1  
ATOM 150   H HD3  . LYS A 1 13  ? -4.090  -7.105  3.894   1.00 0.00 ? 13  LYS A HD3  1  
ATOM 151   H HE2  . LYS A 1 13  ? -5.993  -8.567  3.470   1.00 0.00 ? 13  LYS A HE2  1  
ATOM 152   H HE3  . LYS A 1 13  ? -4.756  -9.399  4.411   1.00 0.00 ? 13  LYS A HE3  1  
ATOM 153   H HZ1  . LYS A 1 13  ? -6.075  -9.507  6.227   1.00 0.00 ? 13  LYS A HZ1  1  
ATOM 154   H HZ2  . LYS A 1 13  ? -7.303  -9.451  5.066   1.00 0.00 ? 13  LYS A HZ2  1  
ATOM 155   H HZ3  . LYS A 1 13  ? -6.866  -8.047  5.901   1.00 0.00 ? 13  LYS A HZ3  1  
ATOM 156   N N    . ALA A 1 14  ? -1.713  -7.838  8.199   1.00 0.00 ? 14  ALA A N    1  
ATOM 157   C CA   . ALA A 1 14  ? -0.508  -8.657  8.211   1.00 0.00 ? 14  ALA A CA   1  
ATOM 158   C C    . ALA A 1 14  ? -0.839  -10.125 7.964   1.00 0.00 ? 14  ALA A C    1  
ATOM 159   O O    . ALA A 1 14  ? -1.681  -10.705 8.648   1.00 0.00 ? 14  ALA A O    1  
ATOM 160   C CB   . ALA A 1 14  ? 0.227   -8.495  9.533   1.00 0.00 ? 14  ALA A CB   1  
ATOM 161   H H    . ALA A 1 14  ? -2.561  -8.230  8.495   1.00 0.00 ? 14  ALA A H    1  
ATOM 162   H HA   . ALA A 1 14  ? 0.142   -8.307  7.421   1.00 0.00 ? 14  ALA A HA   1  
ATOM 163   H HB1  . ALA A 1 14  ? 1.201   -8.959  9.462   1.00 0.00 ? 14  ALA A HB1  1  
ATOM 164   H HB2  . ALA A 1 14  ? 0.343   -7.445  9.754   1.00 0.00 ? 14  ALA A HB2  1  
ATOM 165   H HB3  . ALA A 1 14  ? -0.341  -8.969  10.320  1.00 0.00 ? 14  ALA A HB3  1  
ATOM 166   N N    . GLY A 1 15  ? -0.171  -10.721 6.980   1.00 0.00 ? 15  GLY A N    1  
ATOM 167   C CA   . GLY A 1 15  ? -0.409  -12.116 6.660   1.00 0.00 ? 15  GLY A CA   1  
ATOM 168   C C    . GLY A 1 15  ? 0.621   -12.675 5.699   1.00 0.00 ? 15  GLY A C    1  
ATOM 169   O O    . GLY A 1 15  ? 1.378   -11.923 5.085   1.00 0.00 ? 15  GLY A O    1  
ATOM 170   H H    . GLY A 1 15  ? 0.489   -10.208 6.468   1.00 0.00 ? 15  GLY A H    1  
ATOM 171   H HA2  . GLY A 1 15  ? -0.385  -12.693 7.573   1.00 0.00 ? 15  GLY A HA2  1  
ATOM 172   H HA3  . GLY A 1 15  ? -1.388  -12.208 6.213   1.00 0.00 ? 15  GLY A HA3  1  
ATOM 173   N N    . TRP A 1 16  ? 0.652   -13.996 5.571   1.00 0.00 ? 16  TRP A N    1  
ATOM 174   C CA   . TRP A 1 16  ? 1.600   -14.655 4.679   1.00 0.00 ? 16  TRP A CA   1  
ATOM 175   C C    . TRP A 1 16  ? 1.188   -14.479 3.221   1.00 0.00 ? 16  TRP A C    1  
ATOM 176   O O    . TRP A 1 16  ? 0.069   -14.820 2.836   1.00 0.00 ? 16  TRP A O    1  
ATOM 177   C CB   . TRP A 1 16  ? 1.700   -16.143 5.017   1.00 0.00 ? 16  TRP A CB   1  
ATOM 178   C CG   . TRP A 1 16  ? 2.367   -16.410 6.332   1.00 0.00 ? 16  TRP A CG   1  
ATOM 179   C CD1  . TRP A 1 16  ? 1.756   -16.729 7.511   1.00 0.00 ? 16  TRP A CD1  1  
ATOM 180   C CD2  . TRP A 1 16  ? 3.772   -16.377 6.603   1.00 0.00 ? 16  TRP A CD2  1  
ATOM 181   N NE1  . TRP A 1 16  ? 2.697   -16.898 8.498   1.00 0.00 ? 16  TRP A NE1  1  
ATOM 182   C CE2  . TRP A 1 16  ? 3.942   -16.688 7.966   1.00 0.00 ? 16  TRP A CE2  1  
ATOM 183   C CE3  . TRP A 1 16  ? 4.905   -16.119 5.826   1.00 0.00 ? 16  TRP A CE3  1  
ATOM 184   C CZ2  . TRP A 1 16  ? 5.197   -16.745 8.566   1.00 0.00 ? 16  TRP A CZ2  1  
ATOM 185   C CZ3  . TRP A 1 16  ? 6.149   -16.175 6.423   1.00 0.00 ? 16  TRP A CZ3  1  
ATOM 186   C CH2  . TRP A 1 16  ? 6.288   -16.487 7.782   1.00 0.00 ? 16  TRP A CH2  1  
ATOM 187   H H    . TRP A 1 16  ? 0.023   -14.542 6.088   1.00 0.00 ? 16  TRP A H    1  
ATOM 188   H HA   . TRP A 1 16  ? 2.566   -14.196 4.825   1.00 0.00 ? 16  TRP A HA   1  
ATOM 189   H HB2  . TRP A 1 16  ? 0.707   -16.565 5.055   1.00 0.00 ? 16  TRP A HB2  1  
ATOM 190   H HB3  . TRP A 1 16  ? 2.270   -16.642 4.246   1.00 0.00 ? 16  TRP A HB3  1  
ATOM 191   H HD1  . TRP A 1 16  ? 0.688   -16.829 7.635   1.00 0.00 ? 16  TRP A HD1  1  
ATOM 192   H HE1  . TRP A 1 16  ? 2.507   -17.131 9.431   1.00 0.00 ? 16  TRP A HE1  1  
ATOM 193   H HE3  . TRP A 1 16  ? 4.818   -15.876 4.777   1.00 0.00 ? 16  TRP A HE3  1  
ATOM 194   H HZ2  . TRP A 1 16  ? 5.320   -16.985 9.612   1.00 0.00 ? 16  TRP A HZ2  1  
ATOM 195   H HZ3  . TRP A 1 16  ? 7.036   -15.977 5.838   1.00 0.00 ? 16  TRP A HZ3  1  
ATOM 196   H HH2  . TRP A 1 16  ? 7.279   -16.520 8.206   1.00 0.00 ? 16  TRP A HH2  1  
ATOM 197   N N    . LEU A 1 17  ? 2.098   -13.945 2.414   1.00 0.00 ? 17  LEU A N    1  
ATOM 198   C CA   . LEU A 1 17  ? 1.829   -13.724 0.997   1.00 0.00 ? 17  LEU A CA   1  
ATOM 199   C C    . LEU A 1 17  ? 3.025   -14.137 0.145   1.00 0.00 ? 17  LEU A C    1  
ATOM 200   O O    . LEU A 1 17  ? 4.176   -13.954 0.542   1.00 0.00 ? 17  LEU A O    1  
ATOM 201   C CB   . LEU A 1 17  ? 1.492   -12.253 0.745   1.00 0.00 ? 17  LEU A CB   1  
ATOM 202   C CG   . LEU A 1 17  ? 0.056   -11.830 1.059   1.00 0.00 ? 17  LEU A CG   1  
ATOM 203   C CD1  . LEU A 1 17  ? -0.078  -10.316 1.004   1.00 0.00 ? 17  LEU A CD1  1  
ATOM 204   C CD2  . LEU A 1 17  ? -0.917  -12.489 0.091   1.00 0.00 ? 17  LEU A CD2  1  
ATOM 205   H H    . LEU A 1 17  ? 2.972   -13.693 2.778   1.00 0.00 ? 17  LEU A H    1  
ATOM 206   H HA   . LEU A 1 17  ? 0.979   -14.331 0.723   1.00 0.00 ? 17  LEU A HA   1  
ATOM 207   H HB2  . LEU A 1 17  ? 2.153   -11.654 1.353   1.00 0.00 ? 17  LEU A HB2  1  
ATOM 208   H HB3  . LEU A 1 17  ? 1.679   -12.046 -0.299  1.00 0.00 ? 17  LEU A HB3  1  
ATOM 209   H HG   . LEU A 1 17  ? -0.197  -12.152 2.060   1.00 0.00 ? 17  LEU A HG   1  
ATOM 210   H HD11 . LEU A 1 17  ? -0.064  -9.918  2.007   1.00 0.00 ? 17  LEU A HD11 1  
ATOM 211   H HD12 . LEU A 1 17  ? -1.010  -10.055 0.526   1.00 0.00 ? 17  LEU A HD12 1  
ATOM 212   H HD13 . LEU A 1 17  ? 0.744   -9.902  0.440   1.00 0.00 ? 17  LEU A HD13 1  
ATOM 213   H HD21 . LEU A 1 17  ? -1.189  -11.784 -0.680  1.00 0.00 ? 17  LEU A HD21 1  
ATOM 214   H HD22 . LEU A 1 17  ? -1.803  -12.797 0.627   1.00 0.00 ? 17  LEU A HD22 1  
ATOM 215   H HD23 . LEU A 1 17  ? -0.448  -13.352 -0.358  1.00 0.00 ? 17  LEU A HD23 1  
ATOM 216   N N    . PHE A 1 18  ? 2.744   -14.693 -1.029  1.00 0.00 ? 18  PHE A N    1  
ATOM 217   C CA   . PHE A 1 18  ? 3.797   -15.131 -1.938  1.00 0.00 ? 18  PHE A CA   1  
ATOM 218   C C    . PHE A 1 18  ? 4.106   -14.051 -2.971  1.00 0.00 ? 18  PHE A C    1  
ATOM 219   O O    . PHE A 1 18  ? 3.208   -13.538 -3.638  1.00 0.00 ? 18  PHE A O    1  
ATOM 220   C CB   . PHE A 1 18  ? 3.385   -16.424 -2.644  1.00 0.00 ? 18  PHE A CB   1  
ATOM 221   C CG   . PHE A 1 18  ? 3.405   -17.629 -1.747  1.00 0.00 ? 18  PHE A CG   1  
ATOM 222   C CD1  . PHE A 1 18  ? 2.675   -17.644 -0.569  1.00 0.00 ? 18  PHE A CD1  1  
ATOM 223   C CD2  . PHE A 1 18  ? 4.153   -18.746 -2.081  1.00 0.00 ? 18  PHE A CD2  1  
ATOM 224   C CE1  . PHE A 1 18  ? 2.693   -18.751 0.259   1.00 0.00 ? 18  PHE A CE1  1  
ATOM 225   C CE2  . PHE A 1 18  ? 4.175   -19.856 -1.258  1.00 0.00 ? 18  PHE A CE2  1  
ATOM 226   C CZ   . PHE A 1 18  ? 3.442   -19.859 -0.087  1.00 0.00 ? 18  PHE A CZ   1  
ATOM 227   H H    . PHE A 1 18  ? 1.806   -14.812 -1.289  1.00 0.00 ? 18  PHE A H    1  
ATOM 228   H HA   . PHE A 1 18  ? 4.683   -15.317 -1.353  1.00 0.00 ? 18  PHE A HA   1  
ATOM 229   H HB2  . PHE A 1 18  ? 2.381   -16.314 -3.027  1.00 0.00 ? 18  PHE A HB2  1  
ATOM 230   H HB3  . PHE A 1 18  ? 4.061   -16.609 -3.465  1.00 0.00 ? 18  PHE A HB3  1  
ATOM 231   H HD1  . PHE A 1 18  ? 2.087   -16.780 -0.298  1.00 0.00 ? 18  PHE A HD1  1  
ATOM 232   H HD2  . PHE A 1 18  ? 4.727   -18.745 -2.998  1.00 0.00 ? 18  PHE A HD2  1  
ATOM 233   H HE1  . PHE A 1 18  ? 2.119   -18.751 1.173   1.00 0.00 ? 18  PHE A HE1  1  
ATOM 234   H HE2  . PHE A 1 18  ? 4.762   -20.720 -1.531  1.00 0.00 ? 18  PHE A HE2  1  
ATOM 235   H HZ   . PHE A 1 18  ? 3.458   -20.725 0.558   1.00 0.00 ? 18  PHE A HZ   1  
ATOM 236   N N    . LYS A 1 19  ? 5.384   -13.711 -3.098  1.00 0.00 ? 19  LYS A N    1  
ATOM 237   C CA   . LYS A 1 19  ? 5.816   -12.694 -4.049  1.00 0.00 ? 19  LYS A CA   1  
ATOM 238   C C    . LYS A 1 19  ? 6.629   -13.316 -5.180  1.00 0.00 ? 19  LYS A C    1  
ATOM 239   O O    . LYS A 1 19  ? 7.684   -13.903 -4.946  1.00 0.00 ? 19  LYS A O    1  
ATOM 240   C CB   . LYS A 1 19  ? 6.646   -11.622 -3.339  1.00 0.00 ? 19  LYS A CB   1  
ATOM 241   C CG   . LYS A 1 19  ? 6.905   -10.391 -4.190  1.00 0.00 ? 19  LYS A CG   1  
ATOM 242   C CD   . LYS A 1 19  ? 7.269   -9.188  -3.335  1.00 0.00 ? 19  LYS A CD   1  
ATOM 243   C CE   . LYS A 1 19  ? 8.752   -9.174  -2.998  1.00 0.00 ? 19  LYS A CE   1  
ATOM 244   N NZ   . LYS A 1 19  ? 9.173   -10.416 -2.293  1.00 0.00 ? 19  LYS A NZ   1  
ATOM 245   H H    . LYS A 1 19  ? 6.055   -14.156 -2.537  1.00 0.00 ? 19  LYS A H    1  
ATOM 246   H HA   . LYS A 1 19  ? 4.932   -12.235 -4.467  1.00 0.00 ? 19  LYS A HA   1  
ATOM 247   H HB2  . LYS A 1 19  ? 6.125   -11.313 -2.445  1.00 0.00 ? 19  LYS A HB2  1  
ATOM 248   H HB3  . LYS A 1 19  ? 7.599   -12.048 -3.061  1.00 0.00 ? 19  LYS A HB3  1  
ATOM 249   H HG2  . LYS A 1 19  ? 7.720   -10.597 -4.868  1.00 0.00 ? 19  LYS A HG2  1  
ATOM 250   H HG3  . LYS A 1 19  ? 6.013   -10.161 -4.756  1.00 0.00 ? 19  LYS A HG3  1  
ATOM 251   H HD2  . LYS A 1 19  ? 7.026   -8.286  -3.876  1.00 0.00 ? 19  LYS A HD2  1  
ATOM 252   H HD3  . LYS A 1 19  ? 6.700   -9.225  -2.417  1.00 0.00 ? 19  LYS A HD3  1  
ATOM 253   H HE2  . LYS A 1 19  ? 9.316   -9.081  -3.914  1.00 0.00 ? 19  LYS A HE2  1  
ATOM 254   H HE3  . LYS A 1 19  ? 8.955   -8.323  -2.363  1.00 0.00 ? 19  LYS A HE3  1  
ATOM 255   H HZ1  . LYS A 1 19  ? 8.376   -10.807 -1.751  1.00 0.00 ? 19  LYS A HZ1  1  
ATOM 256   H HZ2  . LYS A 1 19  ? 9.954   -10.208 -1.638  1.00 0.00 ? 19  LYS A HZ2  1  
ATOM 257   H HZ3  . LYS A 1 19  ? 9.493   -11.127 -2.982  1.00 0.00 ? 19  LYS A HZ3  1  
ATOM 258   N N    . GLN A 1 20  ? 6.130   -13.181 -6.404  1.00 0.00 ? 20  GLN A N    1  
ATOM 259   C CA   . GLN A 1 20  ? 6.812   -13.730 -7.571  1.00 0.00 ? 20  GLN A CA   1  
ATOM 260   C C    . GLN A 1 20  ? 8.321   -13.544 -7.456  1.00 0.00 ? 20  GLN A C    1  
ATOM 261   O O    . GLN A 1 20  ? 8.794   -12.544 -6.918  1.00 0.00 ? 20  GLN A O    1  
ATOM 262   C CB   . GLN A 1 20  ? 6.299   -13.062 -8.848  1.00 0.00 ? 20  GLN A CB   1  
ATOM 263   C CG   . GLN A 1 20  ? 6.404   -13.946 -10.081 1.00 0.00 ? 20  GLN A CG   1  
ATOM 264   C CD   . GLN A 1 20  ? 5.500   -13.486 -11.207 1.00 0.00 ? 20  GLN A CD   1  
ATOM 265   O OE1  . GLN A 1 20  ? 5.606   -12.354 -11.681 1.00 0.00 ? 20  GLN A OE1  1  
ATOM 266   N NE2  . GLN A 1 20  ? 4.603   -14.363 -11.643 1.00 0.00 ? 20  GLN A NE2  1  
ATOM 267   H H    . GLN A 1 20  ? 5.284   -12.702 -6.526  1.00 0.00 ? 20  GLN A H    1  
ATOM 268   H HA   . GLN A 1 20  ? 6.594   -14.786 -7.615  1.00 0.00 ? 20  GLN A HA   1  
ATOM 269   H HB2  . GLN A 1 20  ? 5.262   -12.795 -8.710  1.00 0.00 ? 20  GLN A HB2  1  
ATOM 270   H HB3  . GLN A 1 20  ? 6.873   -12.165 -9.026  1.00 0.00 ? 20  GLN A HB3  1  
ATOM 271   H HG2  . GLN A 1 20  ? 7.425   -13.934 -10.431 1.00 0.00 ? 20  GLN A HG2  1  
ATOM 272   H HG3  . GLN A 1 20  ? 6.130   -14.955 -9.808  1.00 0.00 ? 20  GLN A HG3  1  
ATOM 273   H HE21 . GLN A 1 20  ? 4.575   -15.246 -11.218 1.00 0.00 ? 20  GLN A HE21 1  
ATOM 274   H HE22 . GLN A 1 20  ? 4.006   -14.092 -12.370 1.00 0.00 ? 20  GLN A HE22 1  
ATOM 275   N N    . ALA A 1 21  ? 9.072   -14.515 -7.966  1.00 0.00 ? 21  ALA A N    1  
ATOM 276   C CA   . ALA A 1 21  ? 10.528  -14.457 -7.923  1.00 0.00 ? 21  ALA A CA   1  
ATOM 277   C C    . ALA A 1 21  ? 11.057  -13.297 -8.759  1.00 0.00 ? 21  ALA A C    1  
ATOM 278   O O    . ALA A 1 21  ? 11.182  -13.404 -9.979  1.00 0.00 ? 21  ALA A O    1  
ATOM 279   C CB   . ALA A 1 21  ? 11.122  -15.772 -8.406  1.00 0.00 ? 21  ALA A CB   1  
ATOM 280   H H    . ALA A 1 21  ? 8.636   -15.287 -8.383  1.00 0.00 ? 21  ALA A H    1  
ATOM 281   H HA   . ALA A 1 21  ? 10.826  -14.312 -6.894  1.00 0.00 ? 21  ALA A HA   1  
ATOM 282   H HB1  . ALA A 1 21  ? 10.345  -16.375 -8.852  1.00 0.00 ? 21  ALA A HB1  1  
ATOM 283   H HB2  . ALA A 1 21  ? 11.890  -15.572 -9.139  1.00 0.00 ? 21  ALA A HB2  1  
ATOM 284   H HB3  . ALA A 1 21  ? 11.553  -16.301 -7.569  1.00 0.00 ? 21  ALA A HB3  1  
ATOM 285   N N    . SER A 1 22  ? 11.365  -12.187 -8.095  1.00 0.00 ? 22  SER A N    1  
ATOM 286   C CA   . SER A 1 22  ? 11.876  -11.005 -8.778  1.00 0.00 ? 22  SER A CA   1  
ATOM 287   C C    . SER A 1 22  ? 13.025  -11.371 -9.712  1.00 0.00 ? 22  SER A C    1  
ATOM 288   O O    . SER A 1 22  ? 13.089  -10.903 -10.849 1.00 0.00 ? 22  SER A O    1  
ATOM 289   C CB   . SER A 1 22  ? 12.344  -9.964  -7.759  1.00 0.00 ? 22  SER A CB   1  
ATOM 290   O OG   . SER A 1 22  ? 12.764  -8.773  -8.402  1.00 0.00 ? 22  SER A OG   1  
ATOM 291   H H    . SER A 1 22  ? 11.243  -12.163 -7.122  1.00 0.00 ? 22  SER A H    1  
ATOM 292   H HA   . SER A 1 22  ? 11.071  -10.586 -9.363  1.00 0.00 ? 22  SER A HA   1  
ATOM 293   H HB2  . SER A 1 22  ? 11.531  -9.729  -7.089  1.00 0.00 ? 22  SER A HB2  1  
ATOM 294   H HB3  . SER A 1 22  ? 13.172  -10.365 -7.193  1.00 0.00 ? 22  SER A HB3  1  
ATOM 295   H HG   . SER A 1 22  ? 12.437  -8.013  -7.914  1.00 0.00 ? 22  SER A HG   1  
ATOM 296   N N    . SER A 1 23  ? 13.932  -12.211 -9.223  1.00 0.00 ? 23  SER A N    1  
ATOM 297   C CA   . SER A 1 23  ? 15.082  -12.638 -10.011 1.00 0.00 ? 23  SER A CA   1  
ATOM 298   C C    . SER A 1 23  ? 15.282  -14.147 -9.906  1.00 0.00 ? 23  SER A C    1  
ATOM 299   O O    . SER A 1 23  ? 16.401  -14.624 -9.720  1.00 0.00 ? 23  SER A O    1  
ATOM 300   C CB   . SER A 1 23  ? 16.345  -11.911 -9.545  1.00 0.00 ? 23  SER A CB   1  
ATOM 301   O OG   . SER A 1 23  ? 17.450  -12.225 -10.375 1.00 0.00 ? 23  SER A OG   1  
ATOM 302   H H    . SER A 1 23  ? 13.826  -12.549 -8.309  1.00 0.00 ? 23  SER A H    1  
ATOM 303   H HA   . SER A 1 23  ? 14.890  -12.383 -11.043 1.00 0.00 ? 23  SER A HA   1  
ATOM 304   H HB2  . SER A 1 23  ? 16.177  -10.845 -9.579  1.00 0.00 ? 23  SER A HB2  1  
ATOM 305   H HB3  . SER A 1 23  ? 16.574  -12.207 -8.532  1.00 0.00 ? 23  SER A HB3  1  
ATOM 306   H HG   . SER A 1 23  ? 17.170  -12.229 -11.293 1.00 0.00 ? 23  SER A HG   1  
ATOM 307   N N    . GLY A 1 24  ? 14.188  -14.893 -10.027 1.00 0.00 ? 24  GLY A N    1  
ATOM 308   C CA   . GLY A 1 24  ? 14.264  -16.340 -9.943  1.00 0.00 ? 24  GLY A CA   1  
ATOM 309   C C    . GLY A 1 24  ? 13.741  -17.021 -11.192 1.00 0.00 ? 24  GLY A C    1  
ATOM 310   O O    . GLY A 1 24  ? 13.848  -16.481 -12.294 1.00 0.00 ? 24  GLY A O    1  
ATOM 311   H H    . GLY A 1 24  ? 13.323  -14.457 -10.174 1.00 0.00 ? 24  GLY A H    1  
ATOM 312   H HA2  . GLY A 1 24  ? 15.294  -16.627 -9.793  1.00 0.00 ? 24  GLY A HA2  1  
ATOM 313   H HA3  . GLY A 1 24  ? 13.681  -16.670 -9.096  1.00 0.00 ? 24  GLY A HA3  1  
ATOM 314   N N    . VAL A 1 25  ? 13.175  -18.212 -11.022 1.00 0.00 ? 25  VAL A N    1  
ATOM 315   C CA   . VAL A 1 25  ? 12.634  -18.968 -12.145 1.00 0.00 ? 25  VAL A CA   1  
ATOM 316   C C    . VAL A 1 25  ? 11.111  -19.012 -12.096 1.00 0.00 ? 25  VAL A C    1  
ATOM 317   O O    . VAL A 1 25  ? 10.519  -20.040 -11.766 1.00 0.00 ? 25  VAL A O    1  
ATOM 318   C CB   . VAL A 1 25  ? 13.178  -20.409 -12.165 1.00 0.00 ? 25  VAL A CB   1  
ATOM 319   C CG1  . VAL A 1 25  ? 14.666  -20.414 -12.483 1.00 0.00 ? 25  VAL A CG1  1  
ATOM 320   C CG2  . VAL A 1 25  ? 12.907  -21.099 -10.836 1.00 0.00 ? 25  VAL A CG2  1  
ATOM 321   H H    . VAL A 1 25  ? 13.119  -18.590 -10.120 1.00 0.00 ? 25  VAL A H    1  
ATOM 322   H HA   . VAL A 1 25  ? 12.941  -18.478 -13.057 1.00 0.00 ? 25  VAL A HA   1  
ATOM 323   H HB   . VAL A 1 25  ? 12.664  -20.956 -12.942 1.00 0.00 ? 25  VAL A HB   1  
ATOM 324   H HG11 . VAL A 1 25  ? 15.162  -19.657 -11.895 1.00 0.00 ? 25  VAL A HG11 1  
ATOM 325   H HG12 . VAL A 1 25  ? 15.081  -21.384 -12.249 1.00 0.00 ? 25  VAL A HG12 1  
ATOM 326   H HG13 . VAL A 1 25  ? 14.809  -20.205 -13.533 1.00 0.00 ? 25  VAL A HG13 1  
ATOM 327   H HG21 . VAL A 1 25  ? 13.833  -21.481 -10.434 1.00 0.00 ? 25  VAL A HG21 1  
ATOM 328   H HG22 . VAL A 1 25  ? 12.479  -20.389 -10.142 1.00 0.00 ? 25  VAL A HG22 1  
ATOM 329   H HG23 . VAL A 1 25  ? 12.216  -21.914 -10.988 1.00 0.00 ? 25  VAL A HG23 1  
ATOM 330   N N    . LYS A 1 26  ? 10.482  -17.890 -12.426 1.00 0.00 ? 26  LYS A N    1  
ATOM 331   C CA   . LYS A 1 26  ? 9.026   -17.799 -12.421 1.00 0.00 ? 26  LYS A CA   1  
ATOM 332   C C    . LYS A 1 26  ? 8.435   -18.594 -11.262 1.00 0.00 ? 26  LYS A C    1  
ATOM 333   O O    . LYS A 1 26  ? 7.366   -19.190 -11.389 1.00 0.00 ? 26  LYS A O    1  
ATOM 334   C CB   . LYS A 1 26  ? 8.459   -18.311 -13.747 1.00 0.00 ? 26  LYS A CB   1  
ATOM 335   C CG   . LYS A 1 26  ? 8.314   -17.231 -14.805 1.00 0.00 ? 26  LYS A CG   1  
ATOM 336   C CD   . LYS A 1 26  ? 7.074   -16.384 -14.572 1.00 0.00 ? 26  LYS A CD   1  
ATOM 337   C CE   . LYS A 1 26  ? 5.848   -17.001 -15.226 1.00 0.00 ? 26  LYS A CE   1  
ATOM 338   N NZ   . LYS A 1 26  ? 5.864   -16.830 -16.706 1.00 0.00 ? 26  LYS A NZ   1  
ATOM 339   H H    . LYS A 1 26  ? 11.009  -17.103 -12.680 1.00 0.00 ? 26  LYS A H    1  
ATOM 340   H HA   . LYS A 1 26  ? 8.759   -16.760 -12.303 1.00 0.00 ? 26  LYS A HA   1  
ATOM 341   H HB2  . LYS A 1 26  ? 9.114   -19.078 -14.132 1.00 0.00 ? 26  LYS A HB2  1  
ATOM 342   H HB3  . LYS A 1 26  ? 7.484   -18.740 -13.565 1.00 0.00 ? 26  LYS A HB3  1  
ATOM 343   H HG2  . LYS A 1 26  ? 9.184   -16.592 -14.775 1.00 0.00 ? 26  LYS A HG2  1  
ATOM 344   H HG3  . LYS A 1 26  ? 8.243   -17.699 -15.777 1.00 0.00 ? 26  LYS A HG3  1  
ATOM 345   H HD2  . LYS A 1 26  ? 6.899   -16.303 -13.510 1.00 0.00 ? 26  LYS A HD2  1  
ATOM 346   H HD3  . LYS A 1 26  ? 7.238   -15.400 -14.988 1.00 0.00 ? 26  LYS A HD3  1  
ATOM 347   H HE2  . LYS A 1 26  ? 5.823   -18.054 -14.994 1.00 0.00 ? 26  LYS A HE2  1  
ATOM 348   H HE3  . LYS A 1 26  ? 4.965   -16.523 -14.827 1.00 0.00 ? 26  LYS A HE3  1  
ATOM 349   H HZ1  . LYS A 1 26  ? 5.056   -16.248 -17.007 1.00 0.00 ? 26  LYS A HZ1  1  
ATOM 350   H HZ2  . LYS A 1 26  ? 5.801   -17.757 -17.173 1.00 0.00 ? 26  LYS A HZ2  1  
ATOM 351   H HZ3  . LYS A 1 26  ? 6.744   -16.363 -17.002 1.00 0.00 ? 26  LYS A HZ3  1  
ATOM 352   N N    . GLN A 1 27  ? 9.137   -18.596 -10.133 1.00 0.00 ? 27  GLN A N    1  
ATOM 353   C CA   . GLN A 1 27  ? 8.679   -19.317 -8.951  1.00 0.00 ? 27  GLN A CA   1  
ATOM 354   C C    . GLN A 1 27  ? 8.004   -18.371 -7.963  1.00 0.00 ? 27  GLN A C    1  
ATOM 355   O O    . GLN A 1 27  ? 8.021   -17.154 -8.144  1.00 0.00 ? 27  GLN A O    1  
ATOM 356   C CB   . GLN A 1 27  ? 9.853   -20.027 -8.275  1.00 0.00 ? 27  GLN A CB   1  
ATOM 357   C CG   . GLN A 1 27  ? 10.906  -19.076 -7.729  1.00 0.00 ? 27  GLN A CG   1  
ATOM 358   C CD   . GLN A 1 27  ? 12.077  -19.802 -7.097  1.00 0.00 ? 27  GLN A CD   1  
ATOM 359   O OE1  . GLN A 1 27  ? 11.966  -20.967 -6.712  1.00 0.00 ? 27  GLN A OE1  1  
ATOM 360   N NE2  . GLN A 1 27  ? 13.209  -19.117 -6.987  1.00 0.00 ? 27  GLN A NE2  1  
ATOM 361   H H    . GLN A 1 27  ? 9.981   -18.101 -10.094 1.00 0.00 ? 27  GLN A H    1  
ATOM 362   H HA   . GLN A 1 27  ? 7.960   -20.056 -9.271  1.00 0.00 ? 27  GLN A HA   1  
ATOM 363   H HB2  . GLN A 1 27  ? 9.476   -20.621 -7.456  1.00 0.00 ? 27  GLN A HB2  1  
ATOM 364   H HB3  . GLN A 1 27  ? 10.327  -20.679 -8.994  1.00 0.00 ? 27  GLN A HB3  1  
ATOM 365   H HG2  . GLN A 1 27  ? 11.276  -18.465 -8.539  1.00 0.00 ? 27  GLN A HG2  1  
ATOM 366   H HG3  . GLN A 1 27  ? 10.449  -18.443 -6.982  1.00 0.00 ? 27  GLN A HG3  1  
ATOM 367   H HE21 . GLN A 1 27  ? 13.224  -18.193 -7.314  1.00 0.00 ? 27  GLN A HE21 1  
ATOM 368   H HE22 . GLN A 1 27  ? 13.982  -19.562 -6.582  1.00 0.00 ? 27  GLN A HE22 1  
ATOM 369   N N    . TRP A 1 28  ? 7.411   -18.939 -6.920  1.00 0.00 ? 28  TRP A N    1  
ATOM 370   C CA   . TRP A 1 28  ? 6.729   -18.146 -5.903  1.00 0.00 ? 28  TRP A CA   1  
ATOM 371   C C    . TRP A 1 28  ? 7.236   -18.498 -4.508  1.00 0.00 ? 28  TRP A C    1  
ATOM 372   O O    . TRP A 1 28  ? 7.183   -19.654 -4.093  1.00 0.00 ? 28  TRP A O    1  
ATOM 373   C CB   . TRP A 1 28  ? 5.218   -18.368 -5.982  1.00 0.00 ? 28  TRP A CB   1  
ATOM 374   C CG   . TRP A 1 28  ? 4.598   -17.799 -7.222  1.00 0.00 ? 28  TRP A CG   1  
ATOM 375   C CD1  . TRP A 1 28  ? 4.639   -18.332 -8.478  1.00 0.00 ? 28  TRP A CD1  1  
ATOM 376   C CD2  . TRP A 1 28  ? 3.846   -16.585 -7.324  1.00 0.00 ? 28  TRP A CD2  1  
ATOM 377   N NE1  . TRP A 1 28  ? 3.958   -17.523 -9.355  1.00 0.00 ? 28  TRP A NE1  1  
ATOM 378   C CE2  . TRP A 1 28  ? 3.461   -16.445 -8.672  1.00 0.00 ? 28  TRP A CE2  1  
ATOM 379   C CE3  . TRP A 1 28  ? 3.458   -15.603 -6.408  1.00 0.00 ? 28  TRP A CE3  1  
ATOM 380   C CZ2  . TRP A 1 28  ? 2.709   -15.364 -9.123  1.00 0.00 ? 28  TRP A CZ2  1  
ATOM 381   C CZ3  . TRP A 1 28  ? 2.712   -14.530 -6.857  1.00 0.00 ? 28  TRP A CZ3  1  
ATOM 382   C CH2  . TRP A 1 28  ? 2.343   -14.418 -8.204  1.00 0.00 ? 28  TRP A CH2  1  
ATOM 383   H H    . TRP A 1 28  ? 7.431   -19.915 -6.830  1.00 0.00 ? 28  TRP A H    1  
ATOM 384   H HA   . TRP A 1 28  ? 6.942   -17.105 -6.098  1.00 0.00 ? 28  TRP A HA   1  
ATOM 385   H HB2  . TRP A 1 28  ? 5.015   -19.428 -5.964  1.00 0.00 ? 28  TRP A HB2  1  
ATOM 386   H HB3  . TRP A 1 28  ? 4.748   -17.900 -5.128  1.00 0.00 ? 28  TRP A HB3  1  
ATOM 387   H HD1  . TRP A 1 28  ? 5.140   -19.254 -8.731  1.00 0.00 ? 28  TRP A HD1  1  
ATOM 388   H HE1  . TRP A 1 28  ? 3.845   -17.692 -10.314 1.00 0.00 ? 28  TRP A HE1  1  
ATOM 389   H HE3  . TRP A 1 28  ? 3.732   -15.673 -5.366  1.00 0.00 ? 28  TRP A HE3  1  
ATOM 390   H HZ2  . TRP A 1 28  ? 2.417   -15.263 -10.158 1.00 0.00 ? 28  TRP A HZ2  1  
ATOM 391   H HZ3  . TRP A 1 28  ? 2.403   -13.762 -6.164  1.00 0.00 ? 28  TRP A HZ3  1  
ATOM 392   H HH2  . TRP A 1 28  ? 1.761   -13.563 -8.511  1.00 0.00 ? 28  TRP A HH2  1  
ATOM 393   N N    . ASN A 1 29  ? 7.725   -17.492 -3.790  1.00 0.00 ? 29  ASN A N    1  
ATOM 394   C CA   . ASN A 1 29  ? 8.241   -17.696 -2.441  1.00 0.00 ? 29  ASN A CA   1  
ATOM 395   C C    . ASN A 1 29  ? 7.358   -16.999 -1.410  1.00 0.00 ? 29  ASN A C    1  
ATOM 396   O O    . ASN A 1 29  ? 6.851   -15.904 -1.649  1.00 0.00 ? 29  ASN A O    1  
ATOM 397   C CB   . ASN A 1 29  ? 9.675   -17.175 -2.337  1.00 0.00 ? 29  ASN A CB   1  
ATOM 398   C CG   . ASN A 1 29  ? 10.581  -17.757 -3.405  1.00 0.00 ? 29  ASN A CG   1  
ATOM 399   O OD1  . ASN A 1 29  ? 11.026  -18.900 -3.302  1.00 0.00 ? 29  ASN A OD1  1  
ATOM 400   N ND2  . ASN A 1 29  ? 10.858  -16.971 -4.438  1.00 0.00 ? 29  ASN A ND2  1  
ATOM 401   H H    . ASN A 1 29  ? 7.740   -16.591 -4.176  1.00 0.00 ? 29  ASN A H    1  
ATOM 402   H HA   . ASN A 1 29  ? 8.237   -18.758 -2.242  1.00 0.00 ? 29  ASN A HA   1  
ATOM 403   H HB2  . ASN A 1 29  ? 9.670   -16.100 -2.444  1.00 0.00 ? 29  ASN A HB2  1  
ATOM 404   H HB3  . ASN A 1 29  ? 10.077  -17.434 -1.369  1.00 0.00 ? 29  ASN A HB3  1  
ATOM 405   H HD21 . ASN A 1 29  ? 10.468  -16.072 -4.454  1.00 0.00 ? 29  ASN A HD21 1  
ATOM 406   H HD22 . ASN A 1 29  ? 11.441  -17.322 -5.144  1.00 0.00 ? 29  ASN A HD22 1  
ATOM 407   N N    . LYS A 1 30  ? 7.180   -17.642 -0.261  1.00 0.00 ? 30  LYS A N    1  
ATOM 408   C CA   . LYS A 1 30  ? 6.361   -17.085 0.809   1.00 0.00 ? 30  LYS A CA   1  
ATOM 409   C C    . LYS A 1 30  ? 7.139   -16.040 1.602   1.00 0.00 ? 30  LYS A C    1  
ATOM 410   O O    . LYS A 1 30  ? 8.356   -16.144 1.756   1.00 0.00 ? 30  LYS A O    1  
ATOM 411   C CB   . LYS A 1 30  ? 5.882   -18.198 1.745   1.00 0.00 ? 30  LYS A CB   1  
ATOM 412   C CG   . LYS A 1 30  ? 5.278   -17.684 3.040   1.00 0.00 ? 30  LYS A CG   1  
ATOM 413   C CD   . LYS A 1 30  ? 5.157   -18.790 4.076   1.00 0.00 ? 30  LYS A CD   1  
ATOM 414   C CE   . LYS A 1 30  ? 3.857   -19.563 3.918   1.00 0.00 ? 30  LYS A CE   1  
ATOM 415   N NZ   . LYS A 1 30  ? 3.998   -20.695 2.960   1.00 0.00 ? 30  LYS A NZ   1  
ATOM 416   H H    . LYS A 1 30  ? 7.611   -18.513 -0.129  1.00 0.00 ? 30  LYS A H    1  
ATOM 417   H HA   . LYS A 1 30  ? 5.503   -16.612 0.358   1.00 0.00 ? 30  LYS A HA   1  
ATOM 418   H HB2  . LYS A 1 30  ? 5.136   -18.786 1.232   1.00 0.00 ? 30  LYS A HB2  1  
ATOM 419   H HB3  . LYS A 1 30  ? 6.722   -18.831 1.990   1.00 0.00 ? 30  LYS A HB3  1  
ATOM 420   H HG2  . LYS A 1 30  ? 5.909   -16.902 3.436   1.00 0.00 ? 30  LYS A HG2  1  
ATOM 421   H HG3  . LYS A 1 30  ? 4.294   -17.287 2.835   1.00 0.00 ? 30  LYS A HG3  1  
ATOM 422   H HD2  . LYS A 1 30  ? 5.986   -19.473 3.959   1.00 0.00 ? 30  LYS A HD2  1  
ATOM 423   H HD3  . LYS A 1 30  ? 5.188   -18.351 5.063   1.00 0.00 ? 30  LYS A HD3  1  
ATOM 424   H HE2  . LYS A 1 30  ? 3.565   -19.951 4.881   1.00 0.00 ? 30  LYS A HE2  1  
ATOM 425   H HE3  . LYS A 1 30  ? 3.095   -18.889 3.555   1.00 0.00 ? 30  LYS A HE3  1  
ATOM 426   H HZ1  . LYS A 1 30  ? 3.074   -20.925 2.541   1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 427   H HZ2  . LYS A 1 30  ? 4.362   -21.535 3.452   1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 428   H HZ3  . LYS A 1 30  ? 4.658   -20.439 2.199   1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 429   N N    . ARG A 1 31  ? 6.429   -15.034 2.102   1.00 0.00 ? 31  ARG A N    1  
ATOM 430   C CA   . ARG A 1 31  ? 7.054   -13.970 2.879   1.00 0.00 ? 31  ARG A CA   1  
ATOM 431   C C    . ARG A 1 31  ? 6.025   -13.258 3.752   1.00 0.00 ? 31  ARG A C    1  
ATOM 432   O O    . ARG A 1 31  ? 4.865   -13.112 3.367   1.00 0.00 ? 31  ARG A O    1  
ATOM 433   C CB   . ARG A 1 31  ? 7.734   -12.963 1.950   1.00 0.00 ? 31  ARG A CB   1  
ATOM 434   C CG   . ARG A 1 31  ? 8.962   -12.306 2.558   1.00 0.00 ? 31  ARG A CG   1  
ATOM 435   C CD   . ARG A 1 31  ? 10.088  -13.308 2.758   1.00 0.00 ? 31  ARG A CD   1  
ATOM 436   N NE   . ARG A 1 31  ? 11.403  -12.686 2.630   1.00 0.00 ? 31  ARG A NE   1  
ATOM 437   C CZ   . ARG A 1 31  ? 11.864  -12.168 1.496   1.00 0.00 ? 31  ARG A CZ   1  
ATOM 438   N NH1  . ARG A 1 31  ? 11.120  -12.198 0.400   1.00 0.00 ? 31  ARG A NH1  1  
ATOM 439   N NH2  . ARG A 1 31  ? 13.071  -11.620 1.459   1.00 0.00 ? 31  ARG A NH2  1  
ATOM 440   H H    . ARG A 1 31  ? 5.462   -15.006 1.945   1.00 0.00 ? 31  ARG A H    1  
ATOM 441   H HA   . ARG A 1 31  ? 7.801   -14.419 3.517   1.00 0.00 ? 31  ARG A HA   1  
ATOM 442   H HB2  . ARG A 1 31  ? 8.035   -13.471 1.046   1.00 0.00 ? 31  ARG A HB2  1  
ATOM 443   H HB3  . ARG A 1 31  ? 7.025   -12.188 1.698   1.00 0.00 ? 31  ARG A HB3  1  
ATOM 444   H HG2  . ARG A 1 31  ? 9.305   -11.523 1.897   1.00 0.00 ? 31  ARG A HG2  1  
ATOM 445   H HG3  . ARG A 1 31  ? 8.695   -11.881 3.514   1.00 0.00 ? 31  ARG A HG3  1  
ATOM 446   H HD2  . ARG A 1 31  ? 9.999   -13.737 3.745   1.00 0.00 ? 31  ARG A HD2  1  
ATOM 447   H HD3  . ARG A 1 31  ? 9.994   -14.087 2.017   1.00 0.00 ? 31  ARG A HD3  1  
ATOM 448   H HE   . ARG A 1 31  ? 11.970  -12.653 3.428   1.00 0.00 ? 31  ARG A HE   1  
ATOM 449   H HH11 . ARG A 1 31  ? 10.209  -12.610 0.425   1.00 0.00 ? 31  ARG A HH11 1  
ATOM 450   H HH12 . ARG A 1 31  ? 11.469  -11.807 -0.452  1.00 0.00 ? 31  ARG A HH12 1  
ATOM 451   H HH21 . ARG A 1 31  ? 13.635  -11.595 2.284   1.00 0.00 ? 31  ARG A HH21 1  
ATOM 452   H HH22 . ARG A 1 31  ? 13.417  -11.231 0.606   1.00 0.00 ? 31  ARG A HH22 1  
ATOM 453   N N    . TRP A 1 32  ? 6.457   -12.819 4.928   1.00 0.00 ? 32  TRP A N    1  
ATOM 454   C CA   . TRP A 1 32  ? 5.573   -12.123 5.857   1.00 0.00 ? 32  TRP A CA   1  
ATOM 455   C C    . TRP A 1 32  ? 5.383   -10.669 5.441   1.00 0.00 ? 32  TRP A C    1  
ATOM 456   O O    . TRP A 1 32  ? 6.347   -9.910  5.342   1.00 0.00 ? 32  TRP A O    1  
ATOM 457   C CB   . TRP A 1 32  ? 6.136   -12.191 7.277   1.00 0.00 ? 32  TRP A CB   1  
ATOM 458   C CG   . TRP A 1 32  ? 5.179   -11.697 8.320   1.00 0.00 ? 32  TRP A CG   1  
ATOM 459   C CD1  . TRP A 1 32  ? 5.373   -10.656 9.182   1.00 0.00 ? 32  TRP A CD1  1  
ATOM 460   C CD2  . TRP A 1 32  ? 3.881   -12.225 8.610   1.00 0.00 ? 32  TRP A CD2  1  
ATOM 461   N NE1  . TRP A 1 32  ? 4.272   -10.505 9.991   1.00 0.00 ? 32  TRP A NE1  1  
ATOM 462   C CE2  . TRP A 1 32  ? 3.343   -11.455 9.659   1.00 0.00 ? 32  TRP A CE2  1  
ATOM 463   C CE3  . TRP A 1 32  ? 3.119   -13.272 8.084   1.00 0.00 ? 32  TRP A CE3  1  
ATOM 464   C CZ2  . TRP A 1 32  ? 2.080   -11.701 10.191  1.00 0.00 ? 32  TRP A CZ2  1  
ATOM 465   C CZ3  . TRP A 1 32  ? 1.866   -13.515 8.613   1.00 0.00 ? 32  TRP A CZ3  1  
ATOM 466   C CH2  . TRP A 1 32  ? 1.356   -12.732 9.657   1.00 0.00 ? 32  TRP A CH2  1  
ATOM 467   H H    . TRP A 1 32  ? 7.394   -12.966 5.179   1.00 0.00 ? 32  TRP A H    1  
ATOM 468   H HA   . TRP A 1 32  ? 4.614   -12.620 5.835   1.00 0.00 ? 32  TRP A HA   1  
ATOM 469   H HB2  . TRP A 1 32  ? 6.384   -13.215 7.511   1.00 0.00 ? 32  TRP A HB2  1  
ATOM 470   H HB3  . TRP A 1 32  ? 7.030   -11.586 7.331   1.00 0.00 ? 32  TRP A HB3  1  
ATOM 471   H HD1  . TRP A 1 32  ? 6.266   -10.051 9.214   1.00 0.00 ? 32  TRP A HD1  1  
ATOM 472   H HE1  . TRP A 1 32  ? 4.170   -9.826  10.691  1.00 0.00 ? 32  TRP A HE1  1  
ATOM 473   H HE3  . TRP A 1 32  ? 3.494   -13.886 7.279   1.00 0.00 ? 32  TRP A HE3  1  
ATOM 474   H HZ2  . TRP A 1 32  ? 1.673   -11.106 10.996  1.00 0.00 ? 32  TRP A HZ2  1  
ATOM 475   H HZ3  . TRP A 1 32  ? 1.263   -14.320 8.220   1.00 0.00 ? 32  TRP A HZ3  1  
ATOM 476   H HH2  . TRP A 1 32  ? 0.373   -12.958 10.040  1.00 0.00 ? 32  TRP A HH2  1  
ATOM 477   N N    . PHE A 1 33  ? 4.134   -10.286 5.198   1.00 0.00 ? 33  PHE A N    1  
ATOM 478   C CA   . PHE A 1 33  ? 3.817   -8.922  4.791   1.00 0.00 ? 33  PHE A CA   1  
ATOM 479   C C    . PHE A 1 33  ? 2.987   -8.215  5.859   1.00 0.00 ? 33  PHE A C    1  
ATOM 480   O O    . PHE A 1 33  ? 2.081   -8.804  6.447   1.00 0.00 ? 33  PHE A O    1  
ATOM 481   C CB   . PHE A 1 33  ? 3.062   -8.926  3.461   1.00 0.00 ? 33  PHE A CB   1  
ATOM 482   C CG   . PHE A 1 33  ? 3.924   -9.275  2.282   1.00 0.00 ? 33  PHE A CG   1  
ATOM 483   C CD1  . PHE A 1 33  ? 4.183   -10.599 1.964   1.00 0.00 ? 33  PHE A CD1  1  
ATOM 484   C CD2  . PHE A 1 33  ? 4.478   -8.280  1.493   1.00 0.00 ? 33  PHE A CD2  1  
ATOM 485   C CE1  . PHE A 1 33  ? 4.976   -10.924 0.880   1.00 0.00 ? 33  PHE A CE1  1  
ATOM 486   C CE2  . PHE A 1 33  ? 5.271   -8.599  0.407   1.00 0.00 ? 33  PHE A CE2  1  
ATOM 487   C CZ   . PHE A 1 33  ? 5.522   -9.923  0.101   1.00 0.00 ? 33  PHE A CZ   1  
ATOM 488   H H    . PHE A 1 33  ? 3.407   -10.937 5.293   1.00 0.00 ? 33  PHE A H    1  
ATOM 489   H HA   . PHE A 1 33  ? 4.748   -8.390  4.665   1.00 0.00 ? 33  PHE A HA   1  
ATOM 490   H HB2  . PHE A 1 33  ? 2.262   -9.649  3.512   1.00 0.00 ? 33  PHE A HB2  1  
ATOM 491   H HB3  . PHE A 1 33  ? 2.645   -7.945  3.289   1.00 0.00 ? 33  PHE A HB3  1  
ATOM 492   H HD1  . PHE A 1 33  ? 3.756   -11.383 2.573   1.00 0.00 ? 33  PHE A HD1  1  
ATOM 493   H HD2  . PHE A 1 33  ? 4.284   -7.245  1.731   1.00 0.00 ? 33  PHE A HD2  1  
ATOM 494   H HE1  . PHE A 1 33  ? 5.169   -11.960 0.643   1.00 0.00 ? 33  PHE A HE1  1  
ATOM 495   H HE2  . PHE A 1 33  ? 5.697   -7.814  -0.200  1.00 0.00 ? 33  PHE A HE2  1  
ATOM 496   H HZ   . PHE A 1 33  ? 6.141   -10.174 -0.747  1.00 0.00 ? 33  PHE A HZ   1  
ATOM 497   N N    . VAL A 1 34  ? 3.305   -6.947  6.103   1.00 0.00 ? 34  VAL A N    1  
ATOM 498   C CA   . VAL A 1 34  ? 2.589   -6.159  7.099   1.00 0.00 ? 34  VAL A CA   1  
ATOM 499   C C    . VAL A 1 34  ? 2.193   -4.797  6.540   1.00 0.00 ? 34  VAL A C    1  
ATOM 500   O O    . VAL A 1 34  ? 2.980   -3.850  6.566   1.00 0.00 ? 34  VAL A O    1  
ATOM 501   C CB   . VAL A 1 34  ? 3.437   -5.954  8.368   1.00 0.00 ? 34  VAL A CB   1  
ATOM 502   C CG1  . VAL A 1 34  ? 2.710   -5.056  9.357   1.00 0.00 ? 34  VAL A CG1  1  
ATOM 503   C CG2  . VAL A 1 34  ? 3.778   -7.293  9.002   1.00 0.00 ? 34  VAL A CG2  1  
ATOM 504   H H    . VAL A 1 34  ? 4.037   -6.533  5.601   1.00 0.00 ? 34  VAL A H    1  
ATOM 505   H HA   . VAL A 1 34  ? 1.694   -6.699  7.372   1.00 0.00 ? 34  VAL A HA   1  
ATOM 506   H HB   . VAL A 1 34  ? 4.359   -5.467  8.085   1.00 0.00 ? 34  VAL A HB   1  
ATOM 507   H HG11 . VAL A 1 34  ? 3.129   -5.194  10.343  1.00 0.00 ? 34  VAL A HG11 1  
ATOM 508   H HG12 . VAL A 1 34  ? 2.822   -4.024  9.058   1.00 0.00 ? 34  VAL A HG12 1  
ATOM 509   H HG13 . VAL A 1 34  ? 1.661   -5.314  9.373   1.00 0.00 ? 34  VAL A HG13 1  
ATOM 510   H HG21 . VAL A 1 34  ? 4.848   -7.439  8.980   1.00 0.00 ? 34  VAL A HG21 1  
ATOM 511   H HG22 . VAL A 1 34  ? 3.434   -7.305  10.027  1.00 0.00 ? 34  VAL A HG22 1  
ATOM 512   H HG23 . VAL A 1 34  ? 3.295   -8.087  8.452   1.00 0.00 ? 34  VAL A HG23 1  
ATOM 513   N N    . LEU A 1 35  ? 0.967   -4.704  6.035   1.00 0.00 ? 35  LEU A N    1  
ATOM 514   C CA   . LEU A 1 35  ? 0.465   -3.457  5.470   1.00 0.00 ? 35  LEU A CA   1  
ATOM 515   C C    . LEU A 1 35  ? 0.513   -2.333  6.500   1.00 0.00 ? 35  LEU A C    1  
ATOM 516   O O    . LEU A 1 35  ? 0.051   -2.493  7.630   1.00 0.00 ? 35  LEU A O    1  
ATOM 517   C CB   . LEU A 1 35  ? -0.968  -3.642  4.967   1.00 0.00 ? 35  LEU A CB   1  
ATOM 518   C CG   . LEU A 1 35  ? -1.707  -2.367  4.561   1.00 0.00 ? 35  LEU A CG   1  
ATOM 519   C CD1  . LEU A 1 35  ? -0.938  -1.626  3.478   1.00 0.00 ? 35  LEU A CD1  1  
ATOM 520   C CD2  . LEU A 1 35  ? -3.116  -2.695  4.088   1.00 0.00 ? 35  LEU A CD2  1  
ATOM 521   H H    . LEU A 1 35  ? 0.386   -5.493  6.043   1.00 0.00 ? 35  LEU A H    1  
ATOM 522   H HA   . LEU A 1 35  ? 1.099   -3.192  4.637   1.00 0.00 ? 35  LEU A HA   1  
ATOM 523   H HB2  . LEU A 1 35  ? -0.935  -4.293  4.107   1.00 0.00 ? 35  LEU A HB2  1  
ATOM 524   H HB3  . LEU A 1 35  ? -1.535  -4.118  5.755   1.00 0.00 ? 35  LEU A HB3  1  
ATOM 525   H HG   . LEU A 1 35  ? -1.785  -1.715  5.420   1.00 0.00 ? 35  LEU A HG   1  
ATOM 526   H HD11 . LEU A 1 35  ? -0.623  -0.665  3.855   1.00 0.00 ? 35  LEU A HD11 1  
ATOM 527   H HD12 . LEU A 1 35  ? -1.574  -1.485  2.617   1.00 0.00 ? 35  LEU A HD12 1  
ATOM 528   H HD13 . LEU A 1 35  ? -0.071  -2.204  3.193   1.00 0.00 ? 35  LEU A HD13 1  
ATOM 529   H HD21 . LEU A 1 35  ? -3.453  -1.929  3.404   1.00 0.00 ? 35  LEU A HD21 1  
ATOM 530   H HD22 . LEU A 1 35  ? -3.781  -2.736  4.938   1.00 0.00 ? 35  LEU A HD22 1  
ATOM 531   H HD23 . LEU A 1 35  ? -3.113  -3.650  3.585   1.00 0.00 ? 35  LEU A HD23 1  
ATOM 532   N N    . VAL A 1 36  ? 1.074   -1.196  6.103   1.00 0.00 ? 36  VAL A N    1  
ATOM 533   C CA   . VAL A 1 36  ? 1.180   -0.044  6.990   1.00 0.00 ? 36  VAL A CA   1  
ATOM 534   C C    . VAL A 1 36  ? 0.535   1.190   6.368   1.00 0.00 ? 36  VAL A C    1  
ATOM 535   O O    . VAL A 1 36  ? -0.065  1.116   5.296   1.00 0.00 ? 36  VAL A O    1  
ATOM 536   C CB   . VAL A 1 36  ? 2.649   0.272   7.327   1.00 0.00 ? 36  VAL A CB   1  
ATOM 537   C CG1  . VAL A 1 36  ? 3.253   1.189   6.275   1.00 0.00 ? 36  VAL A CG1  1  
ATOM 538   C CG2  . VAL A 1 36  ? 2.756   0.893   8.712   1.00 0.00 ? 36  VAL A CG2  1  
ATOM 539   H H    . VAL A 1 36  ? 1.425   -1.129  5.190   1.00 0.00 ? 36  VAL A H    1  
ATOM 540   H HA   . VAL A 1 36  ? 0.664   -0.283  7.910   1.00 0.00 ? 36  VAL A HA   1  
ATOM 541   H HB   . VAL A 1 36  ? 3.204   -0.654  7.328   1.00 0.00 ? 36  VAL A HB   1  
ATOM 542   H HG11 . VAL A 1 36  ? 3.053   0.789   5.292   1.00 0.00 ? 36  VAL A HG11 1  
ATOM 543   H HG12 . VAL A 1 36  ? 2.816   2.173   6.360   1.00 0.00 ? 36  VAL A HG12 1  
ATOM 544   H HG13 . VAL A 1 36  ? 4.321   1.255   6.425   1.00 0.00 ? 36  VAL A HG13 1  
ATOM 545   H HG21 . VAL A 1 36  ? 1.841   0.714   9.257   1.00 0.00 ? 36  VAL A HG21 1  
ATOM 546   H HG22 . VAL A 1 36  ? 3.584   0.448   9.244   1.00 0.00 ? 36  VAL A HG22 1  
ATOM 547   H HG23 . VAL A 1 36  ? 2.918   1.957   8.619   1.00 0.00 ? 36  VAL A HG23 1  
ATOM 548   N N    . ASP A 1 37  ? 0.664   2.324   7.049   1.00 0.00 ? 37  ASP A N    1  
ATOM 549   C CA   . ASP A 1 37  ? 0.096   3.576   6.562   1.00 0.00 ? 37  ASP A CA   1  
ATOM 550   C C    . ASP A 1 37  ? 0.691   3.953   5.209   1.00 0.00 ? 37  ASP A C    1  
ATOM 551   O O    . ASP A 1 37  ? 1.891   4.202   5.095   1.00 0.00 ? 37  ASP A O    1  
ATOM 552   C CB   . ASP A 1 37  ? 0.341   4.698   7.572   1.00 0.00 ? 37  ASP A CB   1  
ATOM 553   C CG   . ASP A 1 37  ? -0.764  4.800   8.604   1.00 0.00 ? 37  ASP A CG   1  
ATOM 554   O OD1  . ASP A 1 37  ? -1.239  3.743   9.072   1.00 0.00 ? 37  ASP A OD1  1  
ATOM 555   O OD2  . ASP A 1 37  ? -1.155  5.936   8.945   1.00 0.00 ? 37  ASP A OD2  1  
ATOM 556   H H    . ASP A 1 37  ? 1.154   2.319   7.898   1.00 0.00 ? 37  ASP A H    1  
ATOM 557   H HA   . ASP A 1 37  ? -0.968  3.434   6.447   1.00 0.00 ? 37  ASP A HA   1  
ATOM 558   H HB2  . ASP A 1 37  ? 1.273   4.513   8.087   1.00 0.00 ? 37  ASP A HB2  1  
ATOM 559   H HB3  . ASP A 1 37  ? 0.406   5.639   7.046   1.00 0.00 ? 37  ASP A HB3  1  
ATOM 560   N N    . ARG A 1 38  ? -0.157  3.993   4.186   1.00 0.00 ? 38  ARG A N    1  
ATOM 561   C CA   . ARG A 1 38  ? 0.285   4.337   2.840   1.00 0.00 ? 38  ARG A CA   1  
ATOM 562   C C    . ARG A 1 38  ? 1.620   3.671   2.520   1.00 0.00 ? 38  ARG A C    1  
ATOM 563   O O    . ARG A 1 38  ? 2.493   4.276   1.897   1.00 0.00 ? 38  ARG A O    1  
ATOM 564   C CB   . ARG A 1 38  ? 0.413   5.855   2.695   1.00 0.00 ? 38  ARG A CB   1  
ATOM 565   C CG   . ARG A 1 38  ? -0.925  6.573   2.616   1.00 0.00 ? 38  ARG A CG   1  
ATOM 566   C CD   . ARG A 1 38  ? -0.820  7.857   1.808   1.00 0.00 ? 38  ARG A CD   1  
ATOM 567   N NE   . ARG A 1 38  ? -2.092  8.571   1.747   1.00 0.00 ? 38  ARG A NE   1  
ATOM 568   C CZ   . ARG A 1 38  ? -2.512  9.407   2.690   1.00 0.00 ? 38  ARG A CZ   1  
ATOM 569   N NH1  . ARG A 1 38  ? -1.763  9.632   3.761   1.00 0.00 ? 38  ARG A NH1  1  
ATOM 570   N NH2  . ARG A 1 38  ? -3.682  10.019  2.563   1.00 0.00 ? 38  ARG A NH2  1  
ATOM 571   H H    . ARG A 1 38  ? -1.102  3.784   4.340   1.00 0.00 ? 38  ARG A H    1  
ATOM 572   H HA   . ARG A 1 38  ? -0.459  3.979   2.145   1.00 0.00 ? 38  ARG A HA   1  
ATOM 573   H HB2  . ARG A 1 38  ? 0.954   6.242   3.546   1.00 0.00 ? 38  ARG A HB2  1  
ATOM 574   H HB3  . ARG A 1 38  ? 0.968   6.073   1.796   1.00 0.00 ? 38  ARG A HB3  1  
ATOM 575   H HG2  . ARG A 1 38  ? -1.645  5.922   2.143   1.00 0.00 ? 38  ARG A HG2  1  
ATOM 576   H HG3  . ARG A 1 38  ? -1.254  6.813   3.615   1.00 0.00 ? 38  ARG A HG3  1  
ATOM 577   H HD2  . ARG A 1 38  ? -0.081  8.497   2.267   1.00 0.00 ? 38  ARG A HD2  1  
ATOM 578   H HD3  . ARG A 1 38  ? -0.507  7.610   0.804   1.00 0.00 ? 38  ARG A HD3  1  
ATOM 579   H HE   . ARG A 1 38  ? -2.661  8.419   0.964   1.00 0.00 ? 38  ARG A HE   1  
ATOM 580   H HH11 . ARG A 1 38  ? -0.881  9.173   3.859   1.00 0.00 ? 38  ARG A HH11 1  
ATOM 581   H HH12 . ARG A 1 38  ? -2.081  10.263  4.470   1.00 0.00 ? 38  ARG A HH12 1  
ATOM 582   H HH21 . ARG A 1 38  ? -4.249  9.852   1.757   1.00 0.00 ? 38  ARG A HH21 1  
ATOM 583   H HH22 . ARG A 1 38  ? -3.997  10.647  3.274   1.00 0.00 ? 38  ARG A HH22 1  
ATOM 584   N N    . CYS A 1 39  ? 1.771   2.423   2.949   1.00 0.00 ? 39  CYS A N    1  
ATOM 585   C CA   . CYS A 1 39  ? 3.000   1.675   2.709   1.00 0.00 ? 39  CYS A CA   1  
ATOM 586   C C    . CYS A 1 39  ? 2.809   0.197   3.034   1.00 0.00 ? 39  CYS A C    1  
ATOM 587   O O    . CYS A 1 39  ? 1.852   -0.182  3.710   1.00 0.00 ? 39  CYS A O    1  
ATOM 588   C CB   . CYS A 1 39  ? 4.143   2.250   3.546   1.00 0.00 ? 39  CYS A CB   1  
ATOM 589   S SG   . CYS A 1 39  ? 5.088   3.548   2.714   1.00 0.00 ? 39  CYS A SG   1  
ATOM 590   H H    . CYS A 1 39  ? 1.039   1.994   3.440   1.00 0.00 ? 39  CYS A H    1  
ATOM 591   H HA   . CYS A 1 39  ? 3.247   1.772   1.663   1.00 0.00 ? 39  CYS A HA   1  
ATOM 592   H HB2  . CYS A 1 39  ? 3.738   2.671   4.455   1.00 0.00 ? 39  CYS A HB2  1  
ATOM 593   H HB3  . CYS A 1 39  ? 4.828   1.455   3.801   1.00 0.00 ? 39  CYS A HB3  1  
ATOM 594   H HG   . CYS A 1 39  ? 4.237   4.485   2.322   1.00 0.00 ? 39  CYS A HG   1  
ATOM 595   N N    . LEU A 1 40  ? 3.724   -0.633  2.546   1.00 0.00 ? 40  LEU A N    1  
ATOM 596   C CA   . LEU A 1 40  ? 3.657   -2.071  2.783   1.00 0.00 ? 40  LEU A CA   1  
ATOM 597   C C    . LEU A 1 40  ? 5.045   -2.646  3.042   1.00 0.00 ? 40  LEU A C    1  
ATOM 598   O O    . LEU A 1 40  ? 5.920   -2.599  2.177   1.00 0.00 ? 40  LEU A O    1  
ATOM 599   C CB   . LEU A 1 40  ? 3.016   -2.775  1.585   1.00 0.00 ? 40  LEU A CB   1  
ATOM 600   C CG   . LEU A 1 40  ? 3.170   -4.296  1.540   1.00 0.00 ? 40  LEU A CG   1  
ATOM 601   C CD1  . LEU A 1 40  ? 2.726   -4.917  2.855   1.00 0.00 ? 40  LEU A CD1  1  
ATOM 602   C CD2  . LEU A 1 40  ? 2.377   -4.877  0.379   1.00 0.00 ? 40  LEU A CD2  1  
ATOM 603   H H    . LEU A 1 40  ? 4.464   -0.272  2.015   1.00 0.00 ? 40  LEU A H    1  
ATOM 604   H HA   . LEU A 1 40  ? 3.043   -2.234  3.656   1.00 0.00 ? 40  LEU A HA   1  
ATOM 605   H HB2  . LEU A 1 40  ? 1.961   -2.550  1.595   1.00 0.00 ? 40  LEU A HB2  1  
ATOM 606   H HB3  . LEU A 1 40  ? 3.461   -2.369  0.688   1.00 0.00 ? 40  LEU A HB3  1  
ATOM 607   H HG   . LEU A 1 40  ? 4.212   -4.541  1.390   1.00 0.00 ? 40  LEU A HG   1  
ATOM 608   H HD11 . LEU A 1 40  ? 3.402   -4.616  3.641   1.00 0.00 ? 40  LEU A HD11 1  
ATOM 609   H HD12 . LEU A 1 40  ? 2.733   -5.993  2.765   1.00 0.00 ? 40  LEU A HD12 1  
ATOM 610   H HD13 . LEU A 1 40  ? 1.727   -4.582  3.092   1.00 0.00 ? 40  LEU A HD13 1  
ATOM 611   H HD21 . LEU A 1 40  ? 2.389   -4.183  -0.449  1.00 0.00 ? 40  LEU A HD21 1  
ATOM 612   H HD22 . LEU A 1 40  ? 1.356   -5.048  0.690   1.00 0.00 ? 40  LEU A HD22 1  
ATOM 613   H HD23 . LEU A 1 40  ? 2.821   -5.812  0.072   1.00 0.00 ? 40  LEU A HD23 1  
ATOM 614   N N    . PHE A 1 41  ? 5.240   -3.191  4.239   1.00 0.00 ? 41  PHE A N    1  
ATOM 615   C CA   . PHE A 1 41  ? 6.522   -3.777  4.612   1.00 0.00 ? 41  PHE A CA   1  
ATOM 616   C C    . PHE A 1 41  ? 6.439   -5.300  4.629   1.00 0.00 ? 41  PHE A C    1  
ATOM 617   O O    . PHE A 1 41  ? 5.352   -5.875  4.563   1.00 0.00 ? 41  PHE A O    1  
ATOM 618   C CB   . PHE A 1 41  ? 6.961   -3.263  5.985   1.00 0.00 ? 41  PHE A CB   1  
ATOM 619   C CG   . PHE A 1 41  ? 7.351   -1.813  5.986   1.00 0.00 ? 41  PHE A CG   1  
ATOM 620   C CD1  . PHE A 1 41  ? 8.543   -1.403  5.411   1.00 0.00 ? 41  PHE A CD1  1  
ATOM 621   C CD2  . PHE A 1 41  ? 6.526   -0.860  6.561   1.00 0.00 ? 41  PHE A CD2  1  
ATOM 622   C CE1  . PHE A 1 41  ? 8.905   -0.069  5.411   1.00 0.00 ? 41  PHE A CE1  1  
ATOM 623   C CE2  . PHE A 1 41  ? 6.883   0.475   6.564   1.00 0.00 ? 41  PHE A CE2  1  
ATOM 624   C CZ   . PHE A 1 41  ? 8.073   0.872   5.987   1.00 0.00 ? 41  PHE A CZ   1  
ATOM 625   H H    . PHE A 1 41  ? 4.504   -3.198  4.886   1.00 0.00 ? 41  PHE A H    1  
ATOM 626   H HA   . PHE A 1 41  ? 7.250   -3.476  3.875   1.00 0.00 ? 41  PHE A HA   1  
ATOM 627   H HB2  . PHE A 1 41  ? 6.148   -3.388  6.685   1.00 0.00 ? 41  PHE A HB2  1  
ATOM 628   H HB3  . PHE A 1 41  ? 7.811   -3.838  6.321   1.00 0.00 ? 41  PHE A HB3  1  
ATOM 629   H HD1  . PHE A 1 41  ? 9.194   -2.136  4.959   1.00 0.00 ? 41  PHE A HD1  1  
ATOM 630   H HD2  . PHE A 1 41  ? 5.594   -1.169  7.013   1.00 0.00 ? 41  PHE A HD2  1  
ATOM 631   H HE1  . PHE A 1 41  ? 9.837   0.239   4.959   1.00 0.00 ? 41  PHE A HE1  1  
ATOM 632   H HE2  . PHE A 1 41  ? 6.230   1.208   7.016   1.00 0.00 ? 41  PHE A HE2  1  
ATOM 633   H HZ   . PHE A 1 41  ? 8.354   1.914   5.989   1.00 0.00 ? 41  PHE A HZ   1  
ATOM 634   N N    . TYR A 1 42  ? 7.595   -5.949  4.718   1.00 0.00 ? 42  TYR A N    1  
ATOM 635   C CA   . TYR A 1 42  ? 7.655   -7.405  4.740   1.00 0.00 ? 42  TYR A CA   1  
ATOM 636   C C    . TYR A 1 42  ? 8.930   -7.888  5.425   1.00 0.00 ? 42  TYR A C    1  
ATOM 637   O O    . TYR A 1 42  ? 9.963   -7.218  5.383   1.00 0.00 ? 42  TYR A O    1  
ATOM 638   C CB   . TYR A 1 42  ? 7.586   -7.961  3.317   1.00 0.00 ? 42  TYR A CB   1  
ATOM 639   C CG   . TYR A 1 42  ? 8.885   -7.836  2.554   1.00 0.00 ? 42  TYR A CG   1  
ATOM 640   C CD1  . TYR A 1 42  ? 9.907   -8.761  2.726   1.00 0.00 ? 42  TYR A CD1  1  
ATOM 641   C CD2  . TYR A 1 42  ? 9.091   -6.792  1.660   1.00 0.00 ? 42  TYR A CD2  1  
ATOM 642   C CE1  . TYR A 1 42  ? 11.096  -8.650  2.032   1.00 0.00 ? 42  TYR A CE1  1  
ATOM 643   C CE2  . TYR A 1 42  ? 10.276  -6.674  0.960   1.00 0.00 ? 42  TYR A CE2  1  
ATOM 644   C CZ   . TYR A 1 42  ? 11.276  -7.605  1.150   1.00 0.00 ? 42  TYR A CZ   1  
ATOM 645   O OH   . TYR A 1 42  ? 12.458  -7.491  0.455   1.00 0.00 ? 42  TYR A OH   1  
ATOM 646   H H    . TYR A 1 42  ? 8.429   -5.436  4.767   1.00 0.00 ? 42  TYR A H    1  
ATOM 647   H HA   . TYR A 1 42  ? 6.802   -7.764  5.298   1.00 0.00 ? 42  TYR A HA   1  
ATOM 648   H HB2  . TYR A 1 42  ? 7.327   -9.008  3.359   1.00 0.00 ? 42  TYR A HB2  1  
ATOM 649   H HB3  . TYR A 1 42  ? 6.825   -7.429  2.766   1.00 0.00 ? 42  TYR A HB3  1  
ATOM 650   H HD1  . TYR A 1 42  ? 9.763   -9.579  3.418   1.00 0.00 ? 42  TYR A HD1  1  
ATOM 651   H HD2  . TYR A 1 42  ? 8.306   -6.065  1.513   1.00 0.00 ? 42  TYR A HD2  1  
ATOM 652   H HE1  . TYR A 1 42  ? 11.879  -9.379  2.180   1.00 0.00 ? 42  TYR A HE1  1  
ATOM 653   H HE2  . TYR A 1 42  ? 10.417  -5.855  0.269   1.00 0.00 ? 42  TYR A HE2  1  
ATOM 654   H HH   . TYR A 1 42  ? 12.289  -7.600  -0.484  1.00 0.00 ? 42  TYR A HH   1  
ATOM 655   N N    . TYR A 1 43  ? 8.850   -9.054  6.056   1.00 0.00 ? 43  TYR A N    1  
ATOM 656   C CA   . TYR A 1 43  ? 9.995   -9.627  6.752   1.00 0.00 ? 43  TYR A CA   1  
ATOM 657   C C    . TYR A 1 43  ? 10.169  -11.100 6.395   1.00 0.00 ? 43  TYR A C    1  
ATOM 658   O O    . TYR A 1 43  ? 9.278   -11.720 5.815   1.00 0.00 ? 43  TYR A O    1  
ATOM 659   C CB   . TYR A 1 43  ? 9.828   -9.473  8.265   1.00 0.00 ? 43  TYR A CB   1  
ATOM 660   C CG   . TYR A 1 43  ? 9.267   -8.132  8.680   1.00 0.00 ? 43  TYR A CG   1  
ATOM 661   C CD1  . TYR A 1 43  ? 7.993   -7.739  8.289   1.00 0.00 ? 43  TYR A CD1  1  
ATOM 662   C CD2  . TYR A 1 43  ? 10.011  -7.258  9.462   1.00 0.00 ? 43  TYR A CD2  1  
ATOM 663   C CE1  . TYR A 1 43  ? 7.477   -6.514  8.665   1.00 0.00 ? 43  TYR A CE1  1  
ATOM 664   C CE2  . TYR A 1 43  ? 9.503   -6.031  9.844   1.00 0.00 ? 43  TYR A CE2  1  
ATOM 665   C CZ   . TYR A 1 43  ? 8.236   -5.664  9.442   1.00 0.00 ? 43  TYR A CZ   1  
ATOM 666   O OH   . TYR A 1 43  ? 7.725   -4.443  9.820   1.00 0.00 ? 43  TYR A OH   1  
ATOM 667   H H    . TYR A 1 43  ? 7.999   -9.541  6.055   1.00 0.00 ? 43  TYR A H    1  
ATOM 668   H HA   . TYR A 1 43  ? 10.877  -9.086  6.441   1.00 0.00 ? 43  TYR A HA   1  
ATOM 669   H HB2  . TYR A 1 43  ? 9.157   -10.238 8.626   1.00 0.00 ? 43  TYR A HB2  1  
ATOM 670   H HB3  . TYR A 1 43  ? 10.791  -9.592  8.741   1.00 0.00 ? 43  TYR A HB3  1  
ATOM 671   H HD1  . TYR A 1 43  ? 7.401   -8.407  7.681   1.00 0.00 ? 43  TYR A HD1  1  
ATOM 672   H HD2  . TYR A 1 43  ? 11.004  -7.549  9.775   1.00 0.00 ? 43  TYR A HD2  1  
ATOM 673   H HE1  . TYR A 1 43  ? 6.485   -6.226  8.351   1.00 0.00 ? 43  TYR A HE1  1  
ATOM 674   H HE2  . TYR A 1 43  ? 10.097  -5.365  10.453  1.00 0.00 ? 43  TYR A HE2  1  
ATOM 675   H HH   . TYR A 1 43  ? 6.866   -4.569  10.230  1.00 0.00 ? 43  TYR A HH   1  
ATOM 676   N N    . LYS A 1 44  ? 11.324  -11.655 6.748   1.00 0.00 ? 44  LYS A N    1  
ATOM 677   C CA   . LYS A 1 44  ? 11.617  -13.055 6.468   1.00 0.00 ? 44  LYS A CA   1  
ATOM 678   C C    . LYS A 1 44  ? 10.527  -13.962 7.030   1.00 0.00 ? 44  LYS A C    1  
ATOM 679   O O    . LYS A 1 44  ? 10.142  -14.949 6.402   1.00 0.00 ? 44  LYS A O    1  
ATOM 680   C CB   . LYS A 1 44  ? 12.974  -13.442 7.061   1.00 0.00 ? 44  LYS A CB   1  
ATOM 681   C CG   . LYS A 1 44  ? 13.580  -14.686 6.433   1.00 0.00 ? 44  LYS A CG   1  
ATOM 682   C CD   . LYS A 1 44  ? 14.118  -14.402 5.041   1.00 0.00 ? 44  LYS A CD   1  
ATOM 683   C CE   . LYS A 1 44  ? 15.296  -15.303 4.705   1.00 0.00 ? 44  LYS A CE   1  
ATOM 684   N NZ   . LYS A 1 44  ? 15.674  -15.208 3.267   1.00 0.00 ? 44  LYS A NZ   1  
ATOM 685   H H    . LYS A 1 44  ? 11.995  -11.109 7.209   1.00 0.00 ? 44  LYS A H    1  
ATOM 686   H HA   . LYS A 1 44  ? 11.654  -13.179 5.396   1.00 0.00 ? 44  LYS A HA   1  
ATOM 687   H HB2  . LYS A 1 44  ? 13.662  -12.622 6.921   1.00 0.00 ? 44  LYS A HB2  1  
ATOM 688   H HB3  . LYS A 1 44  ? 12.852  -13.622 8.120   1.00 0.00 ? 44  LYS A HB3  1  
ATOM 689   H HG2  . LYS A 1 44  ? 14.390  -15.034 7.057   1.00 0.00 ? 44  LYS A HG2  1  
ATOM 690   H HG3  . LYS A 1 44  ? 12.819  -15.451 6.367   1.00 0.00 ? 44  LYS A HG3  1  
ATOM 691   H HD2  . LYS A 1 44  ? 13.333  -14.571 4.319   1.00 0.00 ? 44  LYS A HD2  1  
ATOM 692   H HD3  . LYS A 1 44  ? 14.439  -13.371 4.992   1.00 0.00 ? 44  LYS A HD3  1  
ATOM 693   H HE2  . LYS A 1 44  ? 16.141  -15.010 5.310   1.00 0.00 ? 44  LYS A HE2  1  
ATOM 694   H HE3  . LYS A 1 44  ? 15.028  -16.324 4.931   1.00 0.00 ? 44  LYS A HE3  1  
ATOM 695   H HZ1  . LYS A 1 44  ? 16.488  -14.572 3.153   1.00 0.00 ? 44  LYS A HZ1  1  
ATOM 696   H HZ2  . LYS A 1 44  ? 14.877  -14.836 2.712   1.00 0.00 ? 44  LYS A HZ2  1  
ATOM 697   H HZ3  . LYS A 1 44  ? 15.928  -16.148 2.902   1.00 0.00 ? 44  LYS A HZ3  1  
ATOM 698   N N    . ASP A 1 45  ? 10.033  -13.622 8.215   1.00 0.00 ? 45  ASP A N    1  
ATOM 699   C CA   . ASP A 1 45  ? 8.986   -14.404 8.860   1.00 0.00 ? 45  ASP A CA   1  
ATOM 700   C C    . ASP A 1 45  ? 8.088   -13.512 9.713   1.00 0.00 ? 45  ASP A C    1  
ATOM 701   O O    . ASP A 1 45  ? 8.293   -12.301 9.787   1.00 0.00 ? 45  ASP A O    1  
ATOM 702   C CB   . ASP A 1 45  ? 9.601   -15.505 9.725   1.00 0.00 ? 45  ASP A CB   1  
ATOM 703   C CG   . ASP A 1 45  ? 10.699  -14.984 10.632  1.00 0.00 ? 45  ASP A CG   1  
ATOM 704   O OD1  . ASP A 1 45  ? 11.177  -13.855 10.396  1.00 0.00 ? 45  ASP A OD1  1  
ATOM 705   O OD2  . ASP A 1 45  ? 11.078  -15.704 11.578  1.00 0.00 ? 45  ASP A OD2  1  
ATOM 706   H H    . ASP A 1 45  ? 10.381  -12.824 8.666   1.00 0.00 ? 45  ASP A H    1  
ATOM 707   H HA   . ASP A 1 45  ? 8.387   -14.860 8.086   1.00 0.00 ? 45  ASP A HA   1  
ATOM 708   H HB2  . ASP A 1 45  ? 8.830   -15.944 10.341  1.00 0.00 ? 45  ASP A HB2  1  
ATOM 709   H HB3  . ASP A 1 45  ? 10.020  -16.266 9.083   1.00 0.00 ? 45  ASP A HB3  1  
ATOM 710   N N    . GLU A 1 46  ? 7.095   -14.120 10.353  1.00 0.00 ? 46  GLU A N    1  
ATOM 711   C CA   . GLU A 1 46  ? 6.166   -13.380 11.199  1.00 0.00 ? 46  GLU A CA   1  
ATOM 712   C C    . GLU A 1 46  ? 6.869   -12.849 12.445  1.00 0.00 ? 46  GLU A C    1  
ATOM 713   O O    . GLU A 1 46  ? 6.338   -11.995 13.155  1.00 0.00 ? 46  GLU A O    1  
ATOM 714   C CB   . GLU A 1 46  ? 4.989   -14.270 11.604  1.00 0.00 ? 46  GLU A CB   1  
ATOM 715   C CG   . GLU A 1 46  ? 5.387   -15.438 12.491  1.00 0.00 ? 46  GLU A CG   1  
ATOM 716   C CD   . GLU A 1 46  ? 5.331   -15.095 13.967  1.00 0.00 ? 46  GLU A CD   1  
ATOM 717   O OE1  . GLU A 1 46  ? 4.691   -14.082 14.317  1.00 0.00 ? 46  GLU A OE1  1  
ATOM 718   O OE2  . GLU A 1 46  ? 5.927   -15.841 14.772  1.00 0.00 ? 46  GLU A OE2  1  
ATOM 719   H H    . GLU A 1 46  ? 6.984   -15.089 10.254  1.00 0.00 ? 46  GLU A H    1  
ATOM 720   H HA   . GLU A 1 46  ? 5.792   -12.543 10.628  1.00 0.00 ? 46  GLU A HA   1  
ATOM 721   H HB2  . GLU A 1 46  ? 4.265   -13.671 12.136  1.00 0.00 ? 46  GLU A HB2  1  
ATOM 722   H HB3  . GLU A 1 46  ? 4.529   -14.665 10.710  1.00 0.00 ? 46  GLU A HB3  1  
ATOM 723   H HG2  . GLU A 1 46  ? 4.715   -16.262 12.303  1.00 0.00 ? 46  GLU A HG2  1  
ATOM 724   H HG3  . GLU A 1 46  ? 6.396   -15.735 12.243  1.00 0.00 ? 46  GLU A HG3  1  
ATOM 725   N N    . LYS A 1 47  ? 8.066   -13.363 12.705  1.00 0.00 ? 47  LYS A N    1  
ATOM 726   C CA   . LYS A 1 47  ? 8.844   -12.942 13.865  1.00 0.00 ? 47  LYS A CA   1  
ATOM 727   C C    . LYS A 1 47  ? 9.060   -11.432 13.856  1.00 0.00 ? 47  LYS A C    1  
ATOM 728   O O    . LYS A 1 47  ? 9.234   -10.816 14.907  1.00 0.00 ? 47  LYS A O    1  
ATOM 729   C CB   . LYS A 1 47  ? 10.195  -13.661 13.886  1.00 0.00 ? 47  LYS A CB   1  
ATOM 730   C CG   . LYS A 1 47  ? 10.114  -15.094 14.383  1.00 0.00 ? 47  LYS A CG   1  
ATOM 731   C CD   . LYS A 1 47  ? 10.303  -15.174 15.889  1.00 0.00 ? 47  LYS A CD   1  
ATOM 732   C CE   . LYS A 1 47  ? 9.053   -14.730 16.632  1.00 0.00 ? 47  LYS A CE   1  
ATOM 733   N NZ   . LYS A 1 47  ? 9.084   -15.139 18.064  1.00 0.00 ? 47  LYS A NZ   1  
ATOM 734   H H    . LYS A 1 47  ? 8.436   -14.041 12.102  1.00 0.00 ? 47  LYS A H    1  
ATOM 735   H HA   . LYS A 1 47  ? 8.289   -13.210 14.751  1.00 0.00 ? 47  LYS A HA   1  
ATOM 736   H HB2  . LYS A 1 47  ? 10.600  -13.672 12.885  1.00 0.00 ? 47  LYS A HB2  1  
ATOM 737   H HB3  . LYS A 1 47  ? 10.869  -13.116 14.532  1.00 0.00 ? 47  LYS A HB3  1  
ATOM 738   H HG2  . LYS A 1 47  ? 9.144   -15.498 14.131  1.00 0.00 ? 47  LYS A HG2  1  
ATOM 739   H HG3  . LYS A 1 47  ? 10.885  -15.677 13.901  1.00 0.00 ? 47  LYS A HG3  1  
ATOM 740   H HD2  . LYS A 1 47  ? 10.527  -16.195 16.161  1.00 0.00 ? 47  LYS A HD2  1  
ATOM 741   H HD3  . LYS A 1 47  ? 11.127  -14.534 16.173  1.00 0.00 ? 47  LYS A HD3  1  
ATOM 742   H HE2  . LYS A 1 47  ? 8.978   -13.655 16.575  1.00 0.00 ? 47  LYS A HE2  1  
ATOM 743   H HE3  . LYS A 1 47  ? 8.191   -15.177 16.158  1.00 0.00 ? 47  LYS A HE3  1  
ATOM 744   H HZ1  . LYS A 1 47  ? 10.005  -14.899 18.483  1.00 0.00 ? 47  LYS A HZ1  1  
ATOM 745   H HZ2  . LYS A 1 47  ? 8.936   -16.165 18.146  1.00 0.00 ? 47  LYS A HZ2  1  
ATOM 746   H HZ3  . LYS A 1 47  ? 8.336   -14.648 18.593  1.00 0.00 ? 47  LYS A HZ3  1  
ATOM 747   N N    . GLU A 1 48  ? 9.046   -10.843 12.664  1.00 0.00 ? 48  GLU A N    1  
ATOM 748   C CA   . GLU A 1 48  ? 9.239   -9.405  12.521  1.00 0.00 ? 48  GLU A CA   1  
ATOM 749   C C    . GLU A 1 48  ? 10.586  -8.978  13.097  1.00 0.00 ? 48  GLU A C    1  
ATOM 750   O O    . GLU A 1 48  ? 10.680  -7.975  13.804  1.00 0.00 ? 48  GLU A O    1  
ATOM 751   C CB   . GLU A 1 48  ? 8.110   -8.644  13.219  1.00 0.00 ? 48  GLU A CB   1  
ATOM 752   C CG   . GLU A 1 48  ? 6.833   -8.565  12.399  1.00 0.00 ? 48  GLU A CG   1  
ATOM 753   C CD   . GLU A 1 48  ? 5.879   -7.501  12.907  1.00 0.00 ? 48  GLU A CD   1  
ATOM 754   O OE1  . GLU A 1 48  ? 5.606   -7.482  14.125  1.00 0.00 ? 48  GLU A OE1  1  
ATOM 755   O OE2  . GLU A 1 48  ? 5.406   -6.688  12.086  1.00 0.00 ? 48  GLU A OE2  1  
ATOM 756   H H    . GLU A 1 48  ? 8.902   -11.389 11.863  1.00 0.00 ? 48  GLU A H    1  
ATOM 757   H HA   . GLU A 1 48  ? 9.221   -9.172  11.468  1.00 0.00 ? 48  GLU A HA   1  
ATOM 758   H HB2  . GLU A 1 48  ? 7.884   -9.136  14.153  1.00 0.00 ? 48  GLU A HB2  1  
ATOM 759   H HB3  . GLU A 1 48  ? 8.444   -7.638  13.424  1.00 0.00 ? 48  GLU A HB3  1  
ATOM 760   H HG2  . GLU A 1 48  ? 7.090   -8.337  11.376  1.00 0.00 ? 48  GLU A HG2  1  
ATOM 761   H HG3  . GLU A 1 48  ? 6.335   -9.523  12.439  1.00 0.00 ? 48  GLU A HG3  1  
ATOM 762   N N    . GLU A 1 49  ? 11.626  -9.747  12.788  1.00 0.00 ? 49  GLU A N    1  
ATOM 763   C CA   . GLU A 1 49  ? 12.967  -9.448  13.276  1.00 0.00 ? 49  GLU A CA   1  
ATOM 764   C C    . GLU A 1 49  ? 13.469  -8.122  12.711  1.00 0.00 ? 49  GLU A C    1  
ATOM 765   O O    . GLU A 1 49  ? 13.612  -7.140  13.439  1.00 0.00 ? 49  GLU A O    1  
ATOM 766   C CB   . GLU A 1 49  ? 13.933  -10.574 12.899  1.00 0.00 ? 49  GLU A CB   1  
ATOM 767   C CG   . GLU A 1 49  ? 13.501  -11.941 13.403  1.00 0.00 ? 49  GLU A CG   1  
ATOM 768   C CD   . GLU A 1 49  ? 13.651  -12.083 14.905  1.00 0.00 ? 49  GLU A CD   1  
ATOM 769   O OE1  . GLU A 1 49  ? 13.713  -11.046 15.597  1.00 0.00 ? 49  GLU A OE1  1  
ATOM 770   O OE2  . GLU A 1 49  ? 13.706  -13.234 15.388  1.00 0.00 ? 49  GLU A OE2  1  
ATOM 771   H H    . GLU A 1 49  ? 11.488  -10.533 12.220  1.00 0.00 ? 49  GLU A H    1  
ATOM 772   H HA   . GLU A 1 49  ? 12.920  -9.373  14.352  1.00 0.00 ? 49  GLU A HA   1  
ATOM 773   H HB2  . GLU A 1 49  ? 14.014  -10.618 11.823  1.00 0.00 ? 49  GLU A HB2  1  
ATOM 774   H HB3  . GLU A 1 49  ? 14.905  -10.351 13.315  1.00 0.00 ? 49  GLU A HB3  1  
ATOM 775   H HG2  . GLU A 1 49  ? 12.464  -12.094 13.144  1.00 0.00 ? 49  GLU A HG2  1  
ATOM 776   H HG3  . GLU A 1 49  ? 14.106  -12.695 12.922  1.00 0.00 ? 49  GLU A HG3  1  
ATOM 777   N N    . SER A 1 50  ? 13.735  -8.103  11.409  1.00 0.00 ? 50  SER A N    1  
ATOM 778   C CA   . SER A 1 50  ? 14.225  -6.900  10.747  1.00 0.00 ? 50  SER A CA   1  
ATOM 779   C C    . SER A 1 50  ? 13.621  -6.763  9.353   1.00 0.00 ? 50  SER A C    1  
ATOM 780   O O    . SER A 1 50  ? 13.541  -7.735  8.601   1.00 0.00 ? 50  SER A O    1  
ATOM 781   C CB   . SER A 1 50  ? 15.752  -6.930  10.652  1.00 0.00 ? 50  SER A CB   1  
ATOM 782   O OG   . SER A 1 50  ? 16.347  -6.595  11.894  1.00 0.00 ? 50  SER A OG   1  
ATOM 783   H H    . SER A 1 50  ? 13.601  -8.919  10.882  1.00 0.00 ? 50  SER A H    1  
ATOM 784   H HA   . SER A 1 50  ? 13.927  -6.050  11.341  1.00 0.00 ? 50  SER A HA   1  
ATOM 785   H HB2  . SER A 1 50  ? 16.073  -7.921  10.369  1.00 0.00 ? 50  SER A HB2  1  
ATOM 786   H HB3  . SER A 1 50  ? 16.078  -6.220  9.906   1.00 0.00 ? 50  SER A HB3  1  
ATOM 787   H HG   . SER A 1 50  ? 16.950  -5.858  11.771  1.00 0.00 ? 50  SER A HG   1  
ATOM 788   N N    . ILE A 1 51  ? 13.196  -5.550  9.016   1.00 0.00 ? 51  ILE A N    1  
ATOM 789   C CA   . ILE A 1 51  ? 12.600  -5.285  7.712   1.00 0.00 ? 51  ILE A CA   1  
ATOM 790   C C    . ILE A 1 51  ? 13.595  -5.550  6.588   1.00 0.00 ? 51  ILE A C    1  
ATOM 791   O O    . ILE A 1 51  ? 14.666  -4.944  6.536   1.00 0.00 ? 51  ILE A O    1  
ATOM 792   C CB   . ILE A 1 51  ? 12.099  -3.832  7.607   1.00 0.00 ? 51  ILE A CB   1  
ATOM 793   C CG1  . ILE A 1 51  ? 11.003  -3.571  8.643   1.00 0.00 ? 51  ILE A CG1  1  
ATOM 794   C CG2  . ILE A 1 51  ? 11.588  -3.548  6.203   1.00 0.00 ? 51  ILE A CG2  1  
ATOM 795   C CD1  . ILE A 1 51  ? 10.640  -2.109  8.783   1.00 0.00 ? 51  ILE A CD1  1  
ATOM 796   H H    . ILE A 1 51  ? 13.287  -4.816  9.658   1.00 0.00 ? 51  ILE A H    1  
ATOM 797   H HA   . ILE A 1 51  ? 11.753  -5.945  7.593   1.00 0.00 ? 51  ILE A HA   1  
ATOM 798   H HB   . ILE A 1 51  ? 12.932  -3.173  7.801   1.00 0.00 ? 51  ILE A HB   1  
ATOM 799   H HG12 . ILE A 1 51  ? 10.112  -4.108  8.357   1.00 0.00 ? 51  ILE A HG12 1  
ATOM 800   H HG13 . ILE A 1 51  ? 11.338  -3.925  9.607   1.00 0.00 ? 51  ILE A HG13 1  
ATOM 801   H HG21 . ILE A 1 51  ? 12.303  -3.909  5.479   1.00 0.00 ? 51  ILE A HG21 1  
ATOM 802   H HG22 . ILE A 1 51  ? 10.644  -4.051  6.056   1.00 0.00 ? 51  ILE A HG22 1  
ATOM 803   H HG23 . ILE A 1 51  ? 11.453  -2.484  6.077   1.00 0.00 ? 51  ILE A HG23 1  
ATOM 804   H HD11 . ILE A 1 51  ? 10.954  -1.574  7.899   1.00 0.00 ? 51  ILE A HD11 1  
ATOM 805   H HD12 . ILE A 1 51  ? 9.572   -2.013  8.903   1.00 0.00 ? 51  ILE A HD12 1  
ATOM 806   H HD13 . ILE A 1 51  ? 11.139  -1.696  9.648   1.00 0.00 ? 51  ILE A HD13 1  
ATOM 807   N N    . LEU A 1 52  ? 13.234  -6.458  5.688   1.00 0.00 ? 52  LEU A N    1  
ATOM 808   C CA   . LEU A 1 52  ? 14.095  -6.803  4.562   1.00 0.00 ? 52  LEU A CA   1  
ATOM 809   C C    . LEU A 1 52  ? 13.899  -5.826  3.407   1.00 0.00 ? 52  LEU A C    1  
ATOM 810   O O    . LEU A 1 52  ? 14.861  -5.270  2.880   1.00 0.00 ? 52  LEU A O    1  
ATOM 811   C CB   . LEU A 1 52  ? 13.806  -8.230  4.092   1.00 0.00 ? 52  LEU A CB   1  
ATOM 812   C CG   . LEU A 1 52  ? 13.888  -9.319  5.162   1.00 0.00 ? 52  LEU A CG   1  
ATOM 813   C CD1  . LEU A 1 52  ? 12.931  -10.456 4.841   1.00 0.00 ? 52  LEU A CD1  1  
ATOM 814   C CD2  . LEU A 1 52  ? 15.314  -9.837  5.287   1.00 0.00 ? 52  LEU A CD2  1  
ATOM 815   H H    . LEU A 1 52  ? 12.369  -6.907  5.782   1.00 0.00 ? 52  LEU A H    1  
ATOM 816   H HA   . LEU A 1 52  ? 15.119  -6.744  4.897   1.00 0.00 ? 52  LEU A HA   1  
ATOM 817   H HB2  . LEU A 1 52  ? 12.808  -8.246  3.680   1.00 0.00 ? 52  LEU A HB2  1  
ATOM 818   H HB3  . LEU A 1 52  ? 14.518  -8.472  3.316   1.00 0.00 ? 52  LEU A HB3  1  
ATOM 819   H HG   . LEU A 1 52  ? 13.599  -8.899  6.116   1.00 0.00 ? 52  LEU A HG   1  
ATOM 820   H HD11 . LEU A 1 52  ? 11.932  -10.182 5.143   1.00 0.00 ? 52  LEU A HD11 1  
ATOM 821   H HD12 . LEU A 1 52  ? 13.237  -11.345 5.374   1.00 0.00 ? 52  LEU A HD12 1  
ATOM 822   H HD13 . LEU A 1 52  ? 12.947  -10.651 3.779   1.00 0.00 ? 52  LEU A HD13 1  
ATOM 823   H HD21 . LEU A 1 52  ? 15.321  -10.906 5.136   1.00 0.00 ? 52  LEU A HD21 1  
ATOM 824   H HD22 . LEU A 1 52  ? 15.694  -9.610  6.272   1.00 0.00 ? 52  LEU A HD22 1  
ATOM 825   H HD23 . LEU A 1 52  ? 15.935  -9.363  4.542   1.00 0.00 ? 52  LEU A HD23 1  
ATOM 826   N N    . GLY A 1 53  ? 12.643  -5.620  3.019   1.00 0.00 ? 53  GLY A N    1  
ATOM 827   C CA   . GLY A 1 53  ? 12.343  -4.707  1.931   1.00 0.00 ? 53  GLY A CA   1  
ATOM 828   C C    . GLY A 1 53  ? 11.014  -4.003  2.115   1.00 0.00 ? 53  GLY A C    1  
ATOM 829   O O    . GLY A 1 53  ? 10.126  -4.508  2.802   1.00 0.00 ? 53  GLY A O    1  
ATOM 830   H H    . GLY A 1 53  ? 11.915  -6.091  3.476   1.00 0.00 ? 53  GLY A H    1  
ATOM 831   H HA2  . GLY A 1 53  ? 13.127  -3.966  1.871   1.00 0.00 ? 53  GLY A HA2  1  
ATOM 832   H HA3  . GLY A 1 53  ? 12.317  -5.265  1.007   1.00 0.00 ? 53  GLY A HA3  1  
ATOM 833   N N    . SER A 1 54  ? 10.877  -2.832  1.502   1.00 0.00 ? 54  SER A N    1  
ATOM 834   C CA   . SER A 1 54  ? 9.648   -2.054  1.605   1.00 0.00 ? 54  SER A CA   1  
ATOM 835   C C    . SER A 1 54  ? 9.042   -1.808  0.227   1.00 0.00 ? 54  SER A C    1  
ATOM 836   O O    . SER A 1 54  ? 9.747   -1.816  -0.783  1.00 0.00 ? 54  SER A O    1  
ATOM 837   C CB   . SER A 1 54  ? 9.921   -0.718  2.300   1.00 0.00 ? 54  SER A CB   1  
ATOM 838   O OG   . SER A 1 54  ? 8.800   0.143   2.210   1.00 0.00 ? 54  SER A OG   1  
ATOM 839   H H    . SER A 1 54  ? 11.621  -2.482  0.968   1.00 0.00 ? 54  SER A H    1  
ATOM 840   H HA   . SER A 1 54  ? 8.946   -2.621  2.198   1.00 0.00 ? 54  SER A HA   1  
ATOM 841   H HB2  . SER A 1 54  ? 10.142  -0.896  3.342   1.00 0.00 ? 54  SER A HB2  1  
ATOM 842   H HB3  . SER A 1 54  ? 10.768  -0.238  1.830   1.00 0.00 ? 54  SER A HB3  1  
ATOM 843   H HG   . SER A 1 54  ? 9.075   0.991   1.855   1.00 0.00 ? 54  SER A HG   1  
ATOM 844   N N    . ILE A 1 55  ? 7.732   -1.591  0.194   1.00 0.00 ? 55  ILE A N    1  
ATOM 845   C CA   . ILE A 1 55  ? 7.031   -1.342  -1.060  1.00 0.00 ? 55  ILE A CA   1  
ATOM 846   C C    . ILE A 1 55  ? 6.104   -0.137  -0.942  1.00 0.00 ? 55  ILE A C    1  
ATOM 847   O O    . ILE A 1 55  ? 5.157   -0.126  -0.154  1.00 0.00 ? 55  ILE A O    1  
ATOM 848   C CB   . ILE A 1 55  ? 6.207   -2.568  -1.498  1.00 0.00 ? 55  ILE A CB   1  
ATOM 849   C CG1  . ILE A 1 55  ? 7.067   -3.833  -1.442  1.00 0.00 ? 55  ILE A CG1  1  
ATOM 850   C CG2  . ILE A 1 55  ? 5.651   -2.360  -2.898  1.00 0.00 ? 55  ILE A CG2  1  
ATOM 851   C CD1  . ILE A 1 55  ? 6.265   -5.099  -1.238  1.00 0.00 ? 55  ILE A CD1  1  
ATOM 852   H H    . ILE A 1 55  ? 7.224   -1.597  1.032   1.00 0.00 ? 55  ILE A H    1  
ATOM 853   H HA   . ILE A 1 55  ? 7.771   -1.140  -1.821  1.00 0.00 ? 55  ILE A HA   1  
ATOM 854   H HB   . ILE A 1 55  ? 5.376   -2.676  -0.819  1.00 0.00 ? 55  ILE A HB   1  
ATOM 855   H HG12 . ILE A 1 55  ? 7.612   -3.931  -2.367  1.00 0.00 ? 55  ILE A HG12 1  
ATOM 856   H HG13 . ILE A 1 55  ? 7.767   -3.747  -0.623  1.00 0.00 ? 55  ILE A HG13 1  
ATOM 857   H HG21 . ILE A 1 55  ? 6.374   -2.699  -3.626  1.00 0.00 ? 55  ILE A HG21 1  
ATOM 858   H HG22 . ILE A 1 55  ? 4.738   -2.924  -3.010  1.00 0.00 ? 55  ILE A HG22 1  
ATOM 859   H HG23 . ILE A 1 55  ? 5.449   -1.311  -3.054  1.00 0.00 ? 55  ILE A HG23 1  
ATOM 860   H HD11 . ILE A 1 55  ? 5.705   -5.028  -0.317  1.00 0.00 ? 55  ILE A HD11 1  
ATOM 861   H HD12 . ILE A 1 55  ? 5.584   -5.232  -2.065  1.00 0.00 ? 55  ILE A HD12 1  
ATOM 862   H HD13 . ILE A 1 55  ? 6.936   -5.945  -1.186  1.00 0.00 ? 55  ILE A HD13 1  
ATOM 863   N N    . PRO A 1 56  ? 6.379   0.902   -1.743  1.00 0.00 ? 56  PRO A N    1  
ATOM 864   C CA   . PRO A 1 56  ? 5.580   2.131   -1.749  1.00 0.00 ? 56  PRO A CA   1  
ATOM 865   C C    . PRO A 1 56  ? 4.191   1.917   -2.341  1.00 0.00 ? 56  PRO A C    1  
ATOM 866   O O    . PRO A 1 56  ? 4.045   1.323   -3.410  1.00 0.00 ? 56  PRO A O    1  
ATOM 867   C CB   . PRO A 1 56  ? 6.395   3.081   -2.630  1.00 0.00 ? 56  PRO A CB   1  
ATOM 868   C CG   . PRO A 1 56  ? 7.187   2.186   -3.519  1.00 0.00 ? 56  PRO A CG   1  
ATOM 869   C CD   . PRO A 1 56  ? 7.491   0.958   -2.707  1.00 0.00 ? 56  PRO A CD   1  
ATOM 870   H HA   . PRO A 1 56  ? 5.486   2.548   -0.757  1.00 0.00 ? 56  PRO A HA   1  
ATOM 871   H HB2  . PRO A 1 56  ? 5.727   3.712   -3.198  1.00 0.00 ? 56  PRO A HB2  1  
ATOM 872   H HB3  . PRO A 1 56  ? 7.037   3.690   -2.011  1.00 0.00 ? 56  PRO A HB3  1  
ATOM 873   H HG2  . PRO A 1 56  ? 6.606   1.925   -4.390  1.00 0.00 ? 56  PRO A HG2  1  
ATOM 874   H HG3  . PRO A 1 56  ? 8.104   2.677   -3.812  1.00 0.00 ? 56  PRO A HG3  1  
ATOM 875   H HD2  . PRO A 1 56  ? 7.500   0.081   -3.337  1.00 0.00 ? 56  PRO A HD2  1  
ATOM 876   H HD3  . PRO A 1 56  ? 8.437   1.067   -2.197  1.00 0.00 ? 56  PRO A HD3  1  
ATOM 877   N N    . LEU A 1 57  ? 3.173   2.403   -1.639  1.00 0.00 ? 57  LEU A N    1  
ATOM 878   C CA   . LEU A 1 57  ? 1.794   2.264   -2.096  1.00 0.00 ? 57  LEU A CA   1  
ATOM 879   C C    . LEU A 1 57  ? 1.168   3.630   -2.358  1.00 0.00 ? 57  LEU A C    1  
ATOM 880   O O    . LEU A 1 57  ? 0.104   3.950   -1.826  1.00 0.00 ? 57  LEU A O    1  
ATOM 881   C CB   . LEU A 1 57  ? 0.967   1.502   -1.060  1.00 0.00 ? 57  LEU A CB   1  
ATOM 882   C CG   . LEU A 1 57  ? 1.211   -0.005  -0.983  1.00 0.00 ? 57  LEU A CG   1  
ATOM 883   C CD1  . LEU A 1 57  ? 0.543   -0.592  0.251   1.00 0.00 ? 57  LEU A CD1  1  
ATOM 884   C CD2  . LEU A 1 57  ? 0.706   -0.692  -2.243  1.00 0.00 ? 57  LEU A CD2  1  
ATOM 885   H H    . LEU A 1 57  ? 3.351   2.865   -0.795  1.00 0.00 ? 57  LEU A H    1  
ATOM 886   H HA   . LEU A 1 57  ? 1.805   1.704   -3.019  1.00 0.00 ? 57  LEU A HA   1  
ATOM 887   H HB2  . LEU A 1 57  ? 1.184   1.922   -0.089  1.00 0.00 ? 57  LEU A HB2  1  
ATOM 888   H HB3  . LEU A 1 57  ? -0.077  1.658   -1.291  1.00 0.00 ? 57  LEU A HB3  1  
ATOM 889   H HG   . LEU A 1 57  ? 2.274   -0.188  -0.905  1.00 0.00 ? 57  LEU A HG   1  
ATOM 890   H HD11 . LEU A 1 57  ? 0.941   -0.119  1.135   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 891   H HD12 . LEU A 1 57  ? 0.734   -1.654  0.293   1.00 0.00 ? 57  LEU A HD12 1  
ATOM 892   H HD13 . LEU A 1 57  ? -0.523  -0.421  0.199   1.00 0.00 ? 57  LEU A HD13 1  
ATOM 893   H HD21 . LEU A 1 57  ? 0.614   -1.753  -2.062  1.00 0.00 ? 57  LEU A HD21 1  
ATOM 894   H HD22 . LEU A 1 57  ? 1.404   -0.524  -3.050  1.00 0.00 ? 57  LEU A HD22 1  
ATOM 895   H HD23 . LEU A 1 57  ? -0.259  -0.288  -2.511  1.00 0.00 ? 57  LEU A HD23 1  
ATOM 896   N N    . LEU A 1 58  ? 1.833   4.431   -3.184  1.00 0.00 ? 58  LEU A N    1  
ATOM 897   C CA   . LEU A 1 58  ? 1.340   5.763   -3.520  1.00 0.00 ? 58  LEU A CA   1  
ATOM 898   C C    . LEU A 1 58  ? 0.864   5.818   -4.968  1.00 0.00 ? 58  LEU A C    1  
ATOM 899   O O    . LEU A 1 58  ? 1.653   5.654   -5.898  1.00 0.00 ? 58  LEU A O    1  
ATOM 900   C CB   . LEU A 1 58  ? 2.436   6.806   -3.291  1.00 0.00 ? 58  LEU A CB   1  
ATOM 901   C CG   . LEU A 1 58  ? 2.043   8.260   -3.554  1.00 0.00 ? 58  LEU A CG   1  
ATOM 902   C CD1  . LEU A 1 58  ? 0.993   8.719   -2.554  1.00 0.00 ? 58  LEU A CD1  1  
ATOM 903   C CD2  . LEU A 1 58  ? 3.268   9.162   -3.495  1.00 0.00 ? 58  LEU A CD2  1  
ATOM 904   H H    . LEU A 1 58  ? 2.674   4.121   -3.577  1.00 0.00 ? 58  LEU A H    1  
ATOM 905   H HA   . LEU A 1 58  ? 0.506   5.981   -2.870  1.00 0.00 ? 58  LEU A HA   1  
ATOM 906   H HB2  . LEU A 1 58  ? 2.754   6.730   -2.263  1.00 0.00 ? 58  LEU A HB2  1  
ATOM 907   H HB3  . LEU A 1 58  ? 3.264   6.563   -3.941  1.00 0.00 ? 58  LEU A HB3  1  
ATOM 908   H HG   . LEU A 1 58  ? 1.617   8.338   -4.544  1.00 0.00 ? 58  LEU A HG   1  
ATOM 909   H HD11 . LEU A 1 58  ? 0.094   8.137   -2.684  1.00 0.00 ? 58  LEU A HD11 1  
ATOM 910   H HD12 . LEU A 1 58  ? 0.773   9.763   -2.717  1.00 0.00 ? 58  LEU A HD12 1  
ATOM 911   H HD13 . LEU A 1 58  ? 1.368   8.583   -1.550  1.00 0.00 ? 58  LEU A HD13 1  
ATOM 912   H HD21 . LEU A 1 58  ? 3.253   9.728   -2.576  1.00 0.00 ? 58  LEU A HD21 1  
ATOM 913   H HD22 . LEU A 1 58  ? 3.255   9.840   -4.336  1.00 0.00 ? 58  LEU A HD22 1  
ATOM 914   H HD23 . LEU A 1 58  ? 4.162   8.557   -3.532  1.00 0.00 ? 58  LEU A HD23 1  
ATOM 915   N N    . SER A 1 59  ? -0.431  6.053   -5.151  1.00 0.00 ? 59  SER A N    1  
ATOM 916   C CA   . SER A 1 59  ? -1.013  6.129   -6.485  1.00 0.00 ? 59  SER A CA   1  
ATOM 917   C C    . SER A 1 59  ? -0.834  4.811   -7.232  1.00 0.00 ? 59  SER A C    1  
ATOM 918   O O    . SER A 1 59  ? -0.816  4.778   -8.462  1.00 0.00 ? 59  SER A O    1  
ATOM 919   C CB   . SER A 1 59  ? -0.373  7.269   -7.280  1.00 0.00 ? 59  SER A CB   1  
ATOM 920   O OG   . SER A 1 59  ? -1.074  8.485   -7.082  1.00 0.00 ? 59  SER A OG   1  
ATOM 921   H H    . SER A 1 59  ? -1.010  6.176   -4.369  1.00 0.00 ? 59  SER A H    1  
ATOM 922   H HA   . SER A 1 59  ? -2.069  6.327   -6.376  1.00 0.00 ? 59  SER A HA   1  
ATOM 923   H HB2  . SER A 1 59  ? 0.648   7.400   -6.957  1.00 0.00 ? 59  SER A HB2  1  
ATOM 924   H HB3  . SER A 1 59  ? -0.390  7.025   -8.332  1.00 0.00 ? 59  SER A HB3  1  
ATOM 925   H HG   . SER A 1 59  ? -2.012  8.303   -6.992  1.00 0.00 ? 59  SER A HG   1  
ATOM 926   N N    . PHE A 1 60  ? -0.703  3.724   -6.478  1.00 0.00 ? 60  PHE A N    1  
ATOM 927   C CA   . PHE A 1 60  ? -0.524  2.402   -7.066  1.00 0.00 ? 60  PHE A CA   1  
ATOM 928   C C    . PHE A 1 60  ? -1.860  1.828   -7.530  1.00 0.00 ? 60  PHE A C    1  
ATOM 929   O O    . PHE A 1 60  ? -2.923  2.311   -7.142  1.00 0.00 ? 60  PHE A O    1  
ATOM 930   C CB   . PHE A 1 60  ? 0.128   1.455   -6.057  1.00 0.00 ? 60  PHE A CB   1  
ATOM 931   C CG   . PHE A 1 60  ? 1.629   1.455   -6.119  1.00 0.00 ? 60  PHE A CG   1  
ATOM 932   C CD1  . PHE A 1 60  ? 2.349   2.597   -5.808  1.00 0.00 ? 60  PHE A CD1  1  
ATOM 933   C CD2  . PHE A 1 60  ? 2.320   0.312   -6.488  1.00 0.00 ? 60  PHE A CD2  1  
ATOM 934   C CE1  . PHE A 1 60  ? 3.730   2.599   -5.864  1.00 0.00 ? 60  PHE A CE1  1  
ATOM 935   C CE2  . PHE A 1 60  ? 3.701   0.308   -6.546  1.00 0.00 ? 60  PHE A CE2  1  
ATOM 936   C CZ   . PHE A 1 60  ? 4.407   1.453   -6.233  1.00 0.00 ? 60  PHE A CZ   1  
ATOM 937   H H    . PHE A 1 60  ? -0.726  3.814   -5.502  1.00 0.00 ? 60  PHE A H    1  
ATOM 938   H HA   . PHE A 1 60  ? 0.126   2.506   -7.922  1.00 0.00 ? 60  PHE A HA   1  
ATOM 939   H HB2  . PHE A 1 60  ? -0.162  1.748   -5.059  1.00 0.00 ? 60  PHE A HB2  1  
ATOM 940   H HB3  . PHE A 1 60  ? -0.213  0.449   -6.246  1.00 0.00 ? 60  PHE A HB3  1  
ATOM 941   H HD1  . PHE A 1 60  ? 1.821   3.494   -5.518  1.00 0.00 ? 60  PHE A HD1  1  
ATOM 942   H HD2  . PHE A 1 60  ? 1.768   -0.585  -6.733  1.00 0.00 ? 60  PHE A HD2  1  
ATOM 943   H HE1  . PHE A 1 60  ? 4.279   3.495   -5.619  1.00 0.00 ? 60  PHE A HE1  1  
ATOM 944   H HE2  . PHE A 1 60  ? 4.227   -0.590  -6.835  1.00 0.00 ? 60  PHE A HE2  1  
ATOM 945   H HZ   . PHE A 1 60  ? 5.485   1.452   -6.279  1.00 0.00 ? 60  PHE A HZ   1  
ATOM 946   N N    . ARG A 1 61  ? -1.796  0.794   -8.363  1.00 0.00 ? 61  ARG A N    1  
ATOM 947   C CA   . ARG A 1 61  ? -2.999  0.155   -8.881  1.00 0.00 ? 61  ARG A CA   1  
ATOM 948   C C    . ARG A 1 61  ? -3.073  -1.303  -8.438  1.00 0.00 ? 61  ARG A C    1  
ATOM 949   O O    . ARG A 1 61  ? -2.524  -2.190  -9.092  1.00 0.00 ? 61  ARG A O    1  
ATOM 950   C CB   . ARG A 1 61  ? -3.029  0.238   -10.408 1.00 0.00 ? 61  ARG A CB   1  
ATOM 951   C CG   . ARG A 1 61  ? -4.375  -0.129  -11.012 1.00 0.00 ? 61  ARG A CG   1  
ATOM 952   C CD   . ARG A 1 61  ? -4.395  0.109   -12.514 1.00 0.00 ? 61  ARG A CD   1  
ATOM 953   N NE   . ARG A 1 61  ? -4.360  1.532   -12.843 1.00 0.00 ? 61  ARG A NE   1  
ATOM 954   C CZ   . ARG A 1 61  ? -5.428  2.320   -12.809 1.00 0.00 ? 61  ARG A CZ   1  
ATOM 955   N NH1  . ARG A 1 61  ? -6.610  1.827   -12.463 1.00 0.00 ? 61  ARG A NH1  1  
ATOM 956   N NH2  . ARG A 1 61  ? -5.317  3.605   -13.122 1.00 0.00 ? 61  ARG A NH2  1  
ATOM 957   H H    . ARG A 1 61  ? -0.918  0.454   -8.636  1.00 0.00 ? 61  ARG A H    1  
ATOM 958   H HA   . ARG A 1 61  ? -3.853  0.683   -8.484  1.00 0.00 ? 61  ARG A HA   1  
ATOM 959   H HB2  . ARG A 1 61  ? -2.788  1.247   -10.707 1.00 0.00 ? 61  ARG A HB2  1  
ATOM 960   H HB3  . ARG A 1 61  ? -2.284  -0.435  -10.807 1.00 0.00 ? 61  ARG A HB3  1  
ATOM 961   H HG2  . ARG A 1 61  ? -4.571  -1.174  -10.822 1.00 0.00 ? 61  ARG A HG2  1  
ATOM 962   H HG3  . ARG A 1 61  ? -5.142  0.474   -10.550 1.00 0.00 ? 61  ARG A HG3  1  
ATOM 963   H HD2  . ARG A 1 61  ? -3.535  -0.373  -12.953 1.00 0.00 ? 61  ARG A HD2  1  
ATOM 964   H HD3  . ARG A 1 61  ? -5.297  -0.323  -12.921 1.00 0.00 ? 61  ARG A HD3  1  
ATOM 965   H HE   . ARG A 1 61  ? -3.497  1.917   -13.102 1.00 0.00 ? 61  ARG A HE   1  
ATOM 966   H HH11 . ARG A 1 61  ? -6.697  0.860   -12.225 1.00 0.00 ? 61  ARG A HH11 1  
ATOM 967   H HH12 . ARG A 1 61  ? -7.412  2.424   -12.437 1.00 0.00 ? 61  ARG A HH12 1  
ATOM 968   H HH21 . ARG A 1 61  ? -4.428  3.980   -13.384 1.00 0.00 ? 61  ARG A HH21 1  
ATOM 969   H HH22 . ARG A 1 61  ? -6.121  4.197   -13.097 1.00 0.00 ? 61  ARG A HH22 1  
ATOM 970   N N    . VAL A 1 62  ? -3.756  -1.544  -7.323  1.00 0.00 ? 62  VAL A N    1  
ATOM 971   C CA   . VAL A 1 62  ? -3.903  -2.894  -6.793  1.00 0.00 ? 62  VAL A CA   1  
ATOM 972   C C    . VAL A 1 62  ? -5.244  -3.499  -7.193  1.00 0.00 ? 62  VAL A C    1  
ATOM 973   O O    . VAL A 1 62  ? -6.295  -2.894  -6.986  1.00 0.00 ? 62  VAL A O    1  
ATOM 974   C CB   . VAL A 1 62  ? -3.782  -2.911  -5.258  1.00 0.00 ? 62  VAL A CB   1  
ATOM 975   C CG1  . VAL A 1 62  ? -3.753  -4.341  -4.740  1.00 0.00 ? 62  VAL A CG1  1  
ATOM 976   C CG2  . VAL A 1 62  ? -2.544  -2.148  -4.813  1.00 0.00 ? 62  VAL A CG2  1  
ATOM 977   H H    . VAL A 1 62  ? -4.171  -0.796  -6.846  1.00 0.00 ? 62  VAL A H    1  
ATOM 978   H HA   . VAL A 1 62  ? -3.108  -3.502  -7.202  1.00 0.00 ? 62  VAL A HA   1  
ATOM 979   H HB   . VAL A 1 62  ? -4.650  -2.419  -4.844  1.00 0.00 ? 62  VAL A HB   1  
ATOM 980   H HG11 . VAL A 1 62  ? -4.284  -4.394  -3.801  1.00 0.00 ? 62  VAL A HG11 1  
ATOM 981   H HG12 . VAL A 1 62  ? -4.224  -4.994  -5.459  1.00 0.00 ? 62  VAL A HG12 1  
ATOM 982   H HG13 . VAL A 1 62  ? -2.728  -4.648  -4.590  1.00 0.00 ? 62  VAL A HG13 1  
ATOM 983   H HG21 . VAL A 1 62  ? -2.007  -2.731  -4.080  1.00 0.00 ? 62  VAL A HG21 1  
ATOM 984   H HG22 . VAL A 1 62  ? -1.906  -1.967  -5.666  1.00 0.00 ? 62  VAL A HG22 1  
ATOM 985   H HG23 . VAL A 1 62  ? -2.838  -1.205  -4.378  1.00 0.00 ? 62  VAL A HG23 1  
ATOM 986   N N    . ALA A 1 63  ? -5.199  -4.696  -7.768  1.00 0.00 ? 63  ALA A N    1  
ATOM 987   C CA   . ALA A 1 63  ? -6.411  -5.385  -8.195  1.00 0.00 ? 63  ALA A CA   1  
ATOM 988   C C    . ALA A 1 63  ? -6.099  -6.796  -8.680  1.00 0.00 ? 63  ALA A C    1  
ATOM 989   O O    . ALA A 1 63  ? -4.945  -7.131  -8.946  1.00 0.00 ? 63  ALA A O    1  
ATOM 990   C CB   . ALA A 1 63  ? -7.110  -4.592  -9.290  1.00 0.00 ? 63  ALA A CB   1  
ATOM 991   H H    . ALA A 1 63  ? -4.330  -5.128  -7.907  1.00 0.00 ? 63  ALA A H    1  
ATOM 992   H HA   . ALA A 1 63  ? -7.077  -5.445  -7.347  1.00 0.00 ? 63  ALA A HA   1  
ATOM 993   H HB1  . ALA A 1 63  ? -8.070  -5.041  -9.501  1.00 0.00 ? 63  ALA A HB1  1  
ATOM 994   H HB2  . ALA A 1 63  ? -7.254  -3.574  -8.960  1.00 0.00 ? 63  ALA A HB2  1  
ATOM 995   H HB3  . ALA A 1 63  ? -6.504  -4.599  -10.183 1.00 0.00 ? 63  ALA A HB3  1  
ATOM 996   N N    . ALA A 1 64  ? -7.135  -7.621  -8.792  1.00 0.00 ? 64  ALA A N    1  
ATOM 997   C CA   . ALA A 1 64  ? -6.970  -8.997  -9.245  1.00 0.00 ? 64  ALA A CA   1  
ATOM 998   C C    . ALA A 1 64  ? -6.105  -9.062  -10.499 1.00 0.00 ? 64  ALA A C    1  
ATOM 999   O O    . ALA A 1 64  ? -6.246  -8.242  -11.406 1.00 0.00 ? 64  ALA A O    1  
ATOM 1000  C CB   . ALA A 1 64  ? -8.328  -9.632  -9.505  1.00 0.00 ? 64  ALA A CB   1  
ATOM 1001  H H    . ALA A 1 64  ? -8.031  -7.297  -8.565  1.00 0.00 ? 64  ALA A H    1  
ATOM 1002  H HA   . ALA A 1 64  ? -6.485  -9.553  -8.456  1.00 0.00 ? 64  ALA A HA   1  
ATOM 1003  H HB1  . ALA A 1 64  ? -8.208  -10.477 -10.168 1.00 0.00 ? 64  ALA A HB1  1  
ATOM 1004  H HB2  . ALA A 1 64  ? -8.754  -9.965  -8.571  1.00 0.00 ? 64  ALA A HB2  1  
ATOM 1005  H HB3  . ALA A 1 64  ? -8.984  -8.906  -9.962  1.00 0.00 ? 64  ALA A HB3  1  
ATOM 1006  N N    . VAL A 1 65  ? -5.207  -10.041 -10.543 1.00 0.00 ? 65  VAL A N    1  
ATOM 1007  C CA   . VAL A 1 65  ? -4.319  -10.213 -11.686 1.00 0.00 ? 65  VAL A CA   1  
ATOM 1008  C C    . VAL A 1 65  ? -5.111  -10.412 -12.973 1.00 0.00 ? 65  VAL A C    1  
ATOM 1009  O O    . VAL A 1 65  ? -6.334  -10.550 -12.945 1.00 0.00 ? 65  VAL A O    1  
ATOM 1010  C CB   . VAL A 1 65  ? -3.375  -11.414 -11.487 1.00 0.00 ? 65  VAL A CB   1  
ATOM 1011  C CG1  . VAL A 1 65  ? -2.276  -11.071 -10.493 1.00 0.00 ? 65  VAL A CG1  1  
ATOM 1012  C CG2  . VAL A 1 65  ? -4.157  -12.636 -11.029 1.00 0.00 ? 65  VAL A CG2  1  
ATOM 1013  H H    . VAL A 1 65  ? -5.142  -10.664 -9.789  1.00 0.00 ? 65  VAL A H    1  
ATOM 1014  H HA   . VAL A 1 65  ? -3.717  -9.321  -11.779 1.00 0.00 ? 65  VAL A HA   1  
ATOM 1015  H HB   . VAL A 1 65  ? -2.912  -11.643 -12.436 1.00 0.00 ? 65  VAL A HB   1  
ATOM 1016  H HG11 . VAL A 1 65  ? -2.434  -11.622 -9.578  1.00 0.00 ? 65  VAL A HG11 1  
ATOM 1017  H HG12 . VAL A 1 65  ? -1.316  -11.333 -10.912 1.00 0.00 ? 65  VAL A HG12 1  
ATOM 1018  H HG13 . VAL A 1 65  ? -2.300  -10.011 -10.282 1.00 0.00 ? 65  VAL A HG13 1  
ATOM 1019  H HG21 . VAL A 1 65  ? -5.143  -12.616 -11.468 1.00 0.00 ? 65  VAL A HG21 1  
ATOM 1020  H HG22 . VAL A 1 65  ? -3.641  -13.532 -11.343 1.00 0.00 ? 65  VAL A HG22 1  
ATOM 1021  H HG23 . VAL A 1 65  ? -4.240  -12.628 -9.953  1.00 0.00 ? 65  VAL A HG23 1  
ATOM 1022  N N    . GLN A 1 66  ? -4.406  -10.425 -14.100 1.00 0.00 ? 66  GLN A N    1  
ATOM 1023  C CA   . GLN A 1 66  ? -5.045  -10.606 -15.398 1.00 0.00 ? 66  GLN A CA   1  
ATOM 1024  C C    . GLN A 1 66  ? -4.583  -11.902 -16.055 1.00 0.00 ? 66  GLN A C    1  
ATOM 1025  O O    . GLN A 1 66  ? -3.533  -12.455 -15.725 1.00 0.00 ? 66  GLN A O    1  
ATOM 1026  C CB   . GLN A 1 66  ? -4.736  -9.419  -16.312 1.00 0.00 ? 66  GLN A CB   1  
ATOM 1027  C CG   . GLN A 1 66  ? -5.712  -8.264  -16.160 1.00 0.00 ? 66  GLN A CG   1  
ATOM 1028  C CD   . GLN A 1 66  ? -5.850  -7.444  -17.428 1.00 0.00 ? 66  GLN A CD   1  
ATOM 1029  O OE1  . GLN A 1 66  ? -5.648  -7.950  -18.532 1.00 0.00 ? 66  GLN A OE1  1  
ATOM 1030  N NE2  . GLN A 1 66  ? -6.195  -6.171  -17.276 1.00 0.00 ? 66  GLN A NE2  1  
ATOM 1031  H H    . GLN A 1 66  ? -3.435  -10.309 -14.057 1.00 0.00 ? 66  GLN A H    1  
ATOM 1032  H HA   . GLN A 1 66  ? -6.111  -10.658 -15.238 1.00 0.00 ? 66  GLN A HA   1  
ATOM 1033  H HB2  . GLN A 1 66  ? -3.744  -9.056  -16.088 1.00 0.00 ? 66  GLN A HB2  1  
ATOM 1034  H HB3  . GLN A 1 66  ? -4.765  -9.753  -17.339 1.00 0.00 ? 66  GLN A HB3  1  
ATOM 1035  H HG2  . GLN A 1 66  ? -6.682  -8.661  -15.900 1.00 0.00 ? 66  GLN A HG2  1  
ATOM 1036  H HG3  . GLN A 1 66  ? -5.365  -7.618  -15.367 1.00 0.00 ? 66  GLN A HG3  1  
ATOM 1037  H HE21 . GLN A 1 66  ? -6.338  -5.836  -16.365 1.00 0.00 ? 66  GLN A HE21 1  
ATOM 1038  H HE22 . GLN A 1 66  ? -6.290  -5.618  -18.078 1.00 0.00 ? 66  GLN A HE22 1  
ATOM 1039  N N    . PRO A 1 67  ? -5.384  -12.401 -17.008 1.00 0.00 ? 67  PRO A N    1  
ATOM 1040  C CA   . PRO A 1 67  ? -5.078  -13.639 -17.732 1.00 0.00 ? 67  PRO A CA   1  
ATOM 1041  C C    . PRO A 1 67  ? -3.891  -13.480 -18.676 1.00 0.00 ? 67  PRO A C    1  
ATOM 1042  O O    . PRO A 1 67  ? -3.375  -14.461 -19.210 1.00 0.00 ? 67  PRO A O    1  
ATOM 1043  C CB   . PRO A 1 67  ? -6.359  -13.912 -18.525 1.00 0.00 ? 67  PRO A CB   1  
ATOM 1044  C CG   . PRO A 1 67  ? -6.993  -12.575 -18.693 1.00 0.00 ? 67  PRO A CG   1  
ATOM 1045  C CD   . PRO A 1 67  ? -6.651  -11.795 -17.453 1.00 0.00 ? 67  PRO A CD   1  
ATOM 1046  H HA   . PRO A 1 67  ? -4.890  -14.459 -17.054 1.00 0.00 ? 67  PRO A HA   1  
ATOM 1047  H HB2  . PRO A 1 67  ? -6.107  -14.353 -19.479 1.00 0.00 ? 67  PRO A HB2  1  
ATOM 1048  H HB3  . PRO A 1 67  ? -6.995  -14.583 -17.968 1.00 0.00 ? 67  PRO A HB3  1  
ATOM 1049  H HG2  . PRO A 1 67  ? -6.592  -12.085 -19.566 1.00 0.00 ? 67  PRO A HG2  1  
ATOM 1050  H HG3  . PRO A 1 67  ? -8.064  -12.685 -18.781 1.00 0.00 ? 67  PRO A HG3  1  
ATOM 1051  H HD2  . PRO A 1 67  ? -6.516  -10.750 -17.689 1.00 0.00 ? 67  PRO A HD2  1  
ATOM 1052  H HD3  . PRO A 1 67  ? -7.420  -11.919 -16.705 1.00 0.00 ? 67  PRO A HD3  1  
ATOM 1053  N N    . SER A 1 68  ? -3.463  -12.238 -18.876 1.00 0.00 ? 68  SER A N    1  
ATOM 1054  C CA   . SER A 1 68  ? -2.338  -11.950 -19.759 1.00 0.00 ? 68  SER A CA   1  
ATOM 1055  C C    . SER A 1 68  ? -1.051  -11.775 -18.959 1.00 0.00 ? 68  SER A C    1  
ATOM 1056  O O    . SER A 1 68  ? 0.000   -11.455 -19.515 1.00 0.00 ? 68  SER A O    1  
ATOM 1057  C CB   . SER A 1 68  ? -2.616  -10.690 -20.581 1.00 0.00 ? 68  SER A CB   1  
ATOM 1058  O OG   . SER A 1 68  ? -3.432  -10.982 -21.702 1.00 0.00 ? 68  SER A OG   1  
ATOM 1059  H H    . SER A 1 68  ? -3.916  -11.497 -18.422 1.00 0.00 ? 68  SER A H    1  
ATOM 1060  H HA   . SER A 1 68  ? -2.220  -12.788 -20.430 1.00 0.00 ? 68  SER A HA   1  
ATOM 1061  H HB2  . SER A 1 68  ? -3.122  -9.964  -19.962 1.00 0.00 ? 68  SER A HB2  1  
ATOM 1062  H HB3  . SER A 1 68  ? -1.681  -10.277 -20.929 1.00 0.00 ? 68  SER A HB3  1  
ATOM 1063  H HG   . SER A 1 68  ? -4.353  -11.008 -21.430 1.00 0.00 ? 68  SER A HG   1  
ATOM 1064  N N    . ASP A 1 69  ? -1.141  -11.987 -17.651 1.00 0.00 ? 69  ASP A N    1  
ATOM 1065  C CA   . ASP A 1 69  ? 0.016   -11.854 -16.773 1.00 0.00 ? 69  ASP A CA   1  
ATOM 1066  C C    . ASP A 1 69  ? 0.625   -13.219 -16.467 1.00 0.00 ? 69  ASP A C    1  
ATOM 1067  O O    . ASP A 1 69  ? 1.430   -13.358 -15.547 1.00 0.00 ? 69  ASP A O    1  
ATOM 1068  C CB   . ASP A 1 69  ? -0.383  -11.157 -15.471 1.00 0.00 ? 69  ASP A CB   1  
ATOM 1069  C CG   . ASP A 1 69  ? -0.844  -9.731  -15.696 1.00 0.00 ? 69  ASP A CG   1  
ATOM 1070  O OD1  . ASP A 1 69  ? -0.238  -9.037  -16.539 1.00 0.00 ? 69  ASP A OD1  1  
ATOM 1071  O OD2  . ASP A 1 69  ? -1.812  -9.308  -15.030 1.00 0.00 ? 69  ASP A OD2  1  
ATOM 1072  H H    . ASP A 1 69  ? -2.007  -12.240 -17.266 1.00 0.00 ? 69  ASP A H    1  
ATOM 1073  H HA   . ASP A 1 69  ? 0.751   -11.251 -17.283 1.00 0.00 ? 69  ASP A HA   1  
ATOM 1074  H HB2  . ASP A 1 69  ? -1.189  -11.707 -15.008 1.00 0.00 ? 69  ASP A HB2  1  
ATOM 1075  H HB3  . ASP A 1 69  ? 0.467   -11.141 -14.804 1.00 0.00 ? 69  ASP A HB3  1  
ATOM 1076  N N    . ASN A 1 70  ? 0.236   -14.223 -17.246 1.00 0.00 ? 70  ASN A N    1  
ATOM 1077  C CA   . ASN A 1 70  ? 0.743   -15.578 -17.058 1.00 0.00 ? 70  ASN A CA   1  
ATOM 1078  C C    . ASN A 1 70  ? 0.685   -15.980 -15.587 1.00 0.00 ? 70  ASN A C    1  
ATOM 1079  O O    . ASN A 1 70  ? 1.631   -16.562 -15.055 1.00 0.00 ? 70  ASN A O    1  
ATOM 1080  C CB   . ASN A 1 70  ? 2.181   -15.682 -17.571 1.00 0.00 ? 70  ASN A CB   1  
ATOM 1081  C CG   . ASN A 1 70  ? 2.517   -17.074 -18.068 1.00 0.00 ? 70  ASN A CG   1  
ATOM 1082  O OD1  . ASN A 1 70  ? 3.142   -17.865 -17.361 1.00 0.00 ? 70  ASN A OD1  1  
ATOM 1083  N ND2  . ASN A 1 70  ? 2.103   -17.381 -19.292 1.00 0.00 ? 70  ASN A ND2  1  
ATOM 1084  H H    . ASN A 1 70  ? -0.408  -14.050 -17.964 1.00 0.00 ? 70  ASN A H    1  
ATOM 1085  H HA   . ASN A 1 70  ? 0.117   -16.248 -17.627 1.00 0.00 ? 70  ASN A HA   1  
ATOM 1086  H HB2  . ASN A 1 70  ? 2.317   -14.987 -18.386 1.00 0.00 ? 70  ASN A HB2  1  
ATOM 1087  H HB3  . ASN A 1 70  ? 2.861   -15.431 -16.771 1.00 0.00 ? 70  ASN A HB3  1  
ATOM 1088  H HD21 . ASN A 1 70  ? 1.611   -16.701 -19.799 1.00 0.00 ? 70  ASN A HD21 1  
ATOM 1089  H HD22 . ASN A 1 70  ? 2.307   -18.275 -19.639 1.00 0.00 ? 70  ASN A HD22 1  
ATOM 1090  N N    . ILE A 1 71  ? -0.430  -15.667 -14.937 1.00 0.00 ? 71  ILE A N    1  
ATOM 1091  C CA   . ILE A 1 71  ? -0.611  -15.998 -13.529 1.00 0.00 ? 71  ILE A CA   1  
ATOM 1092  C C    . ILE A 1 71  ? -1.502  -17.224 -13.363 1.00 0.00 ? 71  ILE A C    1  
ATOM 1093  O O    . ILE A 1 71  ? -2.723  -17.140 -13.491 1.00 0.00 ? 71  ILE A O    1  
ATOM 1094  C CB   . ILE A 1 71  ? -1.227  -14.821 -12.749 1.00 0.00 ? 71  ILE A CB   1  
ATOM 1095  C CG1  . ILE A 1 71  ? -0.310  -13.598 -12.820 1.00 0.00 ? 71  ILE A CG1  1  
ATOM 1096  C CG2  . ILE A 1 71  ? -1.478  -15.218 -11.302 1.00 0.00 ? 71  ILE A CG2  1  
ATOM 1097  C CD1  . ILE A 1 71  ? 1.117   -13.888 -12.412 1.00 0.00 ? 71  ILE A CD1  1  
ATOM 1098  H H    . ILE A 1 71  ? -1.148  -15.203 -15.415 1.00 0.00 ? 71  ILE A H    1  
ATOM 1099  H HA   . ILE A 1 71  ? 0.361   -16.212 -13.109 1.00 0.00 ? 71  ILE A HA   1  
ATOM 1100  H HB   . ILE A 1 71  ? -2.177  -14.577 -13.200 1.00 0.00 ? 71  ILE A HB   1  
ATOM 1101  H HG12 . ILE A 1 71  ? -0.296  -13.225 -13.832 1.00 0.00 ? 71  ILE A HG12 1  
ATOM 1102  H HG13 . ILE A 1 71  ? -0.694  -12.831 -12.164 1.00 0.00 ? 71  ILE A HG13 1  
ATOM 1103  H HG21 . ILE A 1 71  ? -1.661  -14.332 -10.712 1.00 0.00 ? 71  ILE A HG21 1  
ATOM 1104  H HG22 . ILE A 1 71  ? -2.339  -15.867 -11.251 1.00 0.00 ? 71  ILE A HG22 1  
ATOM 1105  H HG23 . ILE A 1 71  ? -0.613  -15.736 -10.915 1.00 0.00 ? 71  ILE A HG23 1  
ATOM 1106  H HD11 . ILE A 1 71  ? 1.151   -14.808 -11.848 1.00 0.00 ? 71  ILE A HD11 1  
ATOM 1107  H HD12 . ILE A 1 71  ? 1.732   -13.983 -13.294 1.00 0.00 ? 71  ILE A HD12 1  
ATOM 1108  H HD13 . ILE A 1 71  ? 1.488   -13.078 -11.800 1.00 0.00 ? 71  ILE A HD13 1  
ATOM 1109  N N    . SER A 1 72  ? -0.882  -18.364 -13.075 1.00 0.00 ? 72  SER A N    1  
ATOM 1110  C CA   . SER A 1 72  ? -1.618  -19.610 -12.892 1.00 0.00 ? 72  SER A CA   1  
ATOM 1111  C C    . SER A 1 72  ? -1.818  -19.911 -11.410 1.00 0.00 ? 72  SER A C    1  
ATOM 1112  O O    . SER A 1 72  ? -1.393  -20.954 -10.914 1.00 0.00 ? 72  SER A O    1  
ATOM 1113  C CB   . SER A 1 72  ? -0.877  -20.768 -13.564 1.00 0.00 ? 72  SER A CB   1  
ATOM 1114  O OG   . SER A 1 72  ? -0.795  -20.577 -14.965 1.00 0.00 ? 72  SER A OG   1  
ATOM 1115  H H    . SER A 1 72  ? 0.094   -18.368 -12.985 1.00 0.00 ? 72  SER A H    1  
ATOM 1116  H HA   . SER A 1 72  ? -2.585  -19.495 -13.358 1.00 0.00 ? 72  SER A HA   1  
ATOM 1117  H HB2  . SER A 1 72  ? 0.123   -20.833 -13.163 1.00 0.00 ? 72  SER A HB2  1  
ATOM 1118  H HB3  . SER A 1 72  ? -1.404  -21.691 -13.368 1.00 0.00 ? 72  SER A HB3  1  
ATOM 1119  H HG   . SER A 1 72  ? -1.526  -21.029 -15.393 1.00 0.00 ? 72  SER A HG   1  
ATOM 1120  N N    . ARG A 1 73  ? -2.469  -18.989 -10.709 1.00 0.00 ? 73  ARG A N    1  
ATOM 1121  C CA   . ARG A 1 73  ? -2.726  -19.153 -9.283  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1122  C C    . ARG A 1 73  ? -4.028  -18.467 -8.882  1.00 0.00 ? 73  ARG A C    1  
ATOM 1123  O O    . ARG A 1 73  ? -4.265  -17.309 -9.228  1.00 0.00 ? 73  ARG A O    1  
ATOM 1124  C CB   . ARG A 1 73  ? -1.564  -18.585 -8.465  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1125  C CG   . ARG A 1 73  ? -0.295  -19.417 -8.551  1.00 0.00 ? 73  ARG A CG   1  
ATOM 1126  C CD   . ARG A 1 73  ? 0.604   -19.187 -7.346  1.00 0.00 ? 73  ARG A CD   1  
ATOM 1127  N NE   . ARG A 1 73  ? 0.196   -19.993 -6.198  1.00 0.00 ? 73  ARG A NE   1  
ATOM 1128  C CZ   . ARG A 1 73  ? 0.410   -21.301 -6.105  1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1129  N NH1  . ARG A 1 73  ? 1.024   -21.947 -7.086  1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1130  N NH2  . ARG A 1 73  ? 0.009   -21.965 -5.028  1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1131  H H    . ARG A 1 73  ? -2.784  -18.178 -11.160 1.00 0.00 ? 73  ARG A H    1  
ATOM 1132  H HA   . ARG A 1 73  ? -2.813  -20.210 -9.081  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1133  H HB2  . ARG A 1 73  ? -1.341  -17.590 -8.822  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1134  H HB3  . ARG A 1 73  ? -1.863  -18.529 -7.429  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1135  H HG2  . ARG A 1 73  ? -0.562  -20.462 -8.592  1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1136  H HG3  . ARG A 1 73  ? 0.242   -19.145 -9.447  1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1137  H HD2  . ARG A 1 73  ? 1.617   -19.447 -7.614  1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1138  H HD3  . ARG A 1 73  ? 0.560   -18.143 -7.075  1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1139  H HE   . ARG A 1 73  ? -0.259  -19.535 -5.461  1.00 0.00 ? 73  ARG A HE   1  
ATOM 1140  H HH11 . ARG A 1 73  ? 1.327   -21.449 -7.898  1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1141  H HH12 . ARG A 1 73  ? 1.184   -22.932 -7.013  1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1142  H HH21 . ARG A 1 73  ? -0.454  -21.481 -4.286  1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1143  H HH22 . ARG A 1 73  ? 0.170   -22.949 -4.959  1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1144  N N    . LYS A 1 74  ? -4.870  -19.188 -8.150  1.00 0.00 ? 74  LYS A N    1  
ATOM 1145  C CA   . LYS A 1 74  ? -6.149  -18.650 -7.700  1.00 0.00 ? 74  LYS A CA   1  
ATOM 1146  C C    . LYS A 1 74  ? -5.952  -17.676 -6.543  1.00 0.00 ? 74  LYS A C    1  
ATOM 1147  O O    . LYS A 1 74  ? -5.033  -17.830 -5.738  1.00 0.00 ? 74  LYS A O    1  
ATOM 1148  C CB   . LYS A 1 74  ? -7.081  -19.785 -7.273  1.00 0.00 ? 74  LYS A CB   1  
ATOM 1149  C CG   . LYS A 1 74  ? -7.945  -20.321 -8.401  1.00 0.00 ? 74  LYS A CG   1  
ATOM 1150  C CD   . LYS A 1 74  ? -9.261  -19.569 -8.502  1.00 0.00 ? 74  LYS A CD   1  
ATOM 1151  C CE   . LYS A 1 74  ? -9.060  -18.162 -9.043  1.00 0.00 ? 74  LYS A CE   1  
ATOM 1152  N NZ   . LYS A 1 74  ? -10.261 -17.671 -9.773  1.00 0.00 ? 74  LYS A NZ   1  
ATOM 1153  H H    . LYS A 1 74  ? -4.625  -20.106 -7.905  1.00 0.00 ? 74  LYS A H    1  
ATOM 1154  H HA   . LYS A 1 74  ? -6.595  -18.121 -8.528  1.00 0.00 ? 74  LYS A HA   1  
ATOM 1155  H HB2  . LYS A 1 74  ? -6.485  -20.598 -6.886  1.00 0.00 ? 74  LYS A HB2  1  
ATOM 1156  H HB3  . LYS A 1 74  ? -7.733  -19.424 -6.490  1.00 0.00 ? 74  LYS A HB3  1  
ATOM 1157  H HG2  . LYS A 1 74  ? -7.410  -20.215 -9.333  1.00 0.00 ? 74  LYS A HG2  1  
ATOM 1158  H HG3  . LYS A 1 74  ? -8.150  -21.367 -8.220  1.00 0.00 ? 74  LYS A HG3  1  
ATOM 1159  H HD2  . LYS A 1 74  ? -9.923  -20.106 -9.165  1.00 0.00 ? 74  LYS A HD2  1  
ATOM 1160  H HD3  . LYS A 1 74  ? -9.706  -19.507 -7.519  1.00 0.00 ? 74  LYS A HD3  1  
ATOM 1161  H HE2  . LYS A 1 74  ? -8.855  -17.499 -8.217  1.00 0.00 ? 74  LYS A HE2  1  
ATOM 1162  H HE3  . LYS A 1 74  ? -8.216  -18.168 -9.718  1.00 0.00 ? 74  LYS A HE3  1  
ATOM 1163  H HZ1  . LYS A 1 74  ? -10.354 -16.642 -9.657  1.00 0.00 ? 74  LYS A HZ1  1  
ATOM 1164  H HZ2  . LYS A 1 74  ? -11.117 -18.129 -9.401  1.00 0.00 ? 74  LYS A HZ2  1  
ATOM 1165  H HZ3  . LYS A 1 74  ? -10.177 -17.889 -10.787 1.00 0.00 ? 74  LYS A HZ3  1  
ATOM 1166  N N    . HIS A 1 75  ? -6.821  -16.673 -6.465  1.00 0.00 ? 75  HIS A N    1  
ATOM 1167  C CA   . HIS A 1 75  ? -6.744  -15.675 -5.404  1.00 0.00 ? 75  HIS A CA   1  
ATOM 1168  C C    . HIS A 1 75  ? -5.424  -14.913 -5.471  1.00 0.00 ? 75  HIS A C    1  
ATOM 1169  O O    . HIS A 1 75  ? -4.684  -14.845 -4.489  1.00 0.00 ? 75  HIS A O    1  
ATOM 1170  C CB   . HIS A 1 75  ? -6.893  -16.341 -4.036  1.00 0.00 ? 75  HIS A CB   1  
ATOM 1171  C CG   . HIS A 1 75  ? -7.751  -17.569 -4.059  1.00 0.00 ? 75  HIS A CG   1  
ATOM 1172  N ND1  . HIS A 1 75  ? -9.009  -17.599 -4.622  1.00 0.00 ? 75  HIS A ND1  1  
ATOM 1173  C CD2  . HIS A 1 75  ? -7.523  -18.817 -3.584  1.00 0.00 ? 75  HIS A CD2  1  
ATOM 1174  C CE1  . HIS A 1 75  ? -9.519  -18.810 -4.491  1.00 0.00 ? 75  HIS A CE1  1  
ATOM 1175  N NE2  . HIS A 1 75  ? -8.637  -19.569 -3.866  1.00 0.00 ? 75  HIS A NE2  1  
ATOM 1176  H H    . HIS A 1 75  ? -7.531  -16.603 -7.136  1.00 0.00 ? 75  HIS A H    1  
ATOM 1177  H HA   . HIS A 1 75  ? -7.555  -14.977 -5.546  1.00 0.00 ? 75  HIS A HA   1  
ATOM 1178  H HB2  . HIS A 1 75  ? -5.917  -16.626 -3.673  1.00 0.00 ? 75  HIS A HB2  1  
ATOM 1179  H HB3  . HIS A 1 75  ? -7.338  -15.638 -3.347  1.00 0.00 ? 75  HIS A HB3  1  
ATOM 1180  H HD1  . HIS A 1 75  ? -9.461  -16.844 -5.052  1.00 0.00 ? 75  HIS A HD1  1  
ATOM 1181  H HD2  . HIS A 1 75  ? -6.631  -19.158 -3.078  1.00 0.00 ? 75  HIS A HD2  1  
ATOM 1182  H HE1  . HIS A 1 75  ? -10.491 -19.128 -4.838  1.00 0.00 ? 75  HIS A HE1  1  
ATOM 1183  H HE2  . HIS A 1 75  ? -8.795  -20.487 -3.565  1.00 0.00 ? 75  HIS A HE2  1  
ATOM 1184  N N    . THR A 1 76  ? -5.134  -14.341 -6.635  1.00 0.00 ? 76  THR A N    1  
ATOM 1185  C CA   . THR A 1 76  ? -3.903  -13.586 -6.830  1.00 0.00 ? 76  THR A CA   1  
ATOM 1186  C C    . THR A 1 76  ? -4.196  -12.172 -7.319  1.00 0.00 ? 76  THR A C    1  
ATOM 1187  O O    . THR A 1 76  ? -5.167  -11.943 -8.041  1.00 0.00 ? 76  THR A O    1  
ATOM 1188  C CB   . THR A 1 76  ? -2.970  -14.282 -7.840  1.00 0.00 ? 76  THR A CB   1  
ATOM 1189  O OG1  . THR A 1 76  ? -2.963  -15.695 -7.606  1.00 0.00 ? 76  THR A OG1  1  
ATOM 1190  C CG2  . THR A 1 76  ? -1.554  -13.738 -7.733  1.00 0.00 ? 76  THR A CG2  1  
ATOM 1191  H H    . THR A 1 76  ? -5.764  -14.431 -7.381  1.00 0.00 ? 76  THR A H    1  
ATOM 1192  H HA   . THR A 1 76  ? -3.392  -13.530 -5.880  1.00 0.00 ? 76  THR A HA   1  
ATOM 1193  H HB   . THR A 1 76  ? -3.339  -14.092 -8.838  1.00 0.00 ? 76  THR A HB   1  
ATOM 1194  H HG1  . THR A 1 76  ? -2.982  -15.863 -6.661  1.00 0.00 ? 76  THR A HG1  1  
ATOM 1195  H HG21 . THR A 1 76  ? -1.566  -12.670 -7.893  1.00 0.00 ? 76  THR A HG21 1  
ATOM 1196  H HG22 . THR A 1 76  ? -0.931  -14.207 -8.480  1.00 0.00 ? 76  THR A HG22 1  
ATOM 1197  H HG23 . THR A 1 76  ? -1.160  -13.951 -6.751  1.00 0.00 ? 76  THR A HG23 1  
ATOM 1198  N N    . PHE A 1 77  ? -3.352  -11.226 -6.921  1.00 0.00 ? 77  PHE A N    1  
ATOM 1199  C CA   . PHE A 1 77  ? -3.522  -9.834  -7.318  1.00 0.00 ? 77  PHE A CA   1  
ATOM 1200  C C    . PHE A 1 77  ? -2.181  -9.207  -7.691  1.00 0.00 ? 77  PHE A C    1  
ATOM 1201  O O    . PHE A 1 77  ? -1.122  -9.697  -7.296  1.00 0.00 ? 77  PHE A O    1  
ATOM 1202  C CB   . PHE A 1 77  ? -4.173  -9.034  -6.188  1.00 0.00 ? 77  PHE A CB   1  
ATOM 1203  C CG   . PHE A 1 77  ? -3.564  -9.296  -4.840  1.00 0.00 ? 77  PHE A CG   1  
ATOM 1204  C CD1  . PHE A 1 77  ? -3.695  -10.535 -4.234  1.00 0.00 ? 77  PHE A CD1  1  
ATOM 1205  C CD2  . PHE A 1 77  ? -2.861  -8.302  -4.178  1.00 0.00 ? 77  PHE A CD2  1  
ATOM 1206  C CE1  . PHE A 1 77  ? -3.135  -10.779 -2.994  1.00 0.00 ? 77  PHE A CE1  1  
ATOM 1207  C CE2  . PHE A 1 77  ? -2.298  -8.540  -2.939  1.00 0.00 ? 77  PHE A CE2  1  
ATOM 1208  C CZ   . PHE A 1 77  ? -2.437  -9.780  -2.345  1.00 0.00 ? 77  PHE A CZ   1  
ATOM 1209  H H    . PHE A 1 77  ? -2.597  -11.471 -6.345  1.00 0.00 ? 77  PHE A H    1  
ATOM 1210  H HA   . PHE A 1 77  ? -4.168  -9.813  -8.181  1.00 0.00 ? 77  PHE A HA   1  
ATOM 1211  H HB2  . PHE A 1 77  ? -4.073  -7.980  -6.397  1.00 0.00 ? 77  PHE A HB2  1  
ATOM 1212  H HB3  . PHE A 1 77  ? -5.221  -9.289  -6.135  1.00 0.00 ? 77  PHE A HB3  1  
ATOM 1213  H HD1  . PHE A 1 77  ? -4.241  -11.318 -4.741  1.00 0.00 ? 77  PHE A HD1  1  
ATOM 1214  H HD2  . PHE A 1 77  ? -2.752  -7.332  -4.640  1.00 0.00 ? 77  PHE A HD2  1  
ATOM 1215  H HE1  . PHE A 1 77  ? -3.245  -11.750 -2.534  1.00 0.00 ? 77  PHE A HE1  1  
ATOM 1216  H HE2  . PHE A 1 77  ? -1.753  -7.757  -2.433  1.00 0.00 ? 77  PHE A HE2  1  
ATOM 1217  H HZ   . PHE A 1 77  ? -1.998  -9.969  -1.377  1.00 0.00 ? 77  PHE A HZ   1  
ATOM 1218  N N    . LYS A 1 78  ? -2.235  -8.122  -8.456  1.00 0.00 ? 78  LYS A N    1  
ATOM 1219  C CA   . LYS A 1 78  ? -1.026  -7.427  -8.883  1.00 0.00 ? 78  LYS A CA   1  
ATOM 1220  C C    . LYS A 1 78  ? -1.086  -5.950  -8.505  1.00 0.00 ? 78  LYS A C    1  
ATOM 1221  O O    . LYS A 1 78  ? -2.155  -5.341  -8.508  1.00 0.00 ? 78  LYS A O    1  
ATOM 1222  C CB   . LYS A 1 78  ? -0.840  -7.569  -10.396 1.00 0.00 ? 78  LYS A CB   1  
ATOM 1223  C CG   . LYS A 1 78  ? -1.932  -6.896  -11.209 1.00 0.00 ? 78  LYS A CG   1  
ATOM 1224  C CD   . LYS A 1 78  ? -1.419  -6.449  -12.568 1.00 0.00 ? 78  LYS A CD   1  
ATOM 1225  C CE   . LYS A 1 78  ? -2.381  -5.476  -13.234 1.00 0.00 ? 78  LYS A CE   1  
ATOM 1226  N NZ   . LYS A 1 78  ? -1.898  -5.050  -14.576 1.00 0.00 ? 78  LYS A NZ   1  
ATOM 1227  H H    . LYS A 1 78  ? -3.109  -7.779  -8.739  1.00 0.00 ? 78  LYS A H    1  
ATOM 1228  H HA   . LYS A 1 78  ? -0.186  -7.881  -8.381  1.00 0.00 ? 78  LYS A HA   1  
ATOM 1229  H HB2  . LYS A 1 78  ? 0.108   -7.131  -10.672 1.00 0.00 ? 78  LYS A HB2  1  
ATOM 1230  H HB3  . LYS A 1 78  ? -0.828  -8.620  -10.647 1.00 0.00 ? 78  LYS A HB3  1  
ATOM 1231  H HG2  . LYS A 1 78  ? -2.742  -7.595  -11.355 1.00 0.00 ? 78  LYS A HG2  1  
ATOM 1232  H HG3  . LYS A 1 78  ? -2.291  -6.033  -10.668 1.00 0.00 ? 78  LYS A HG3  1  
ATOM 1233  H HD2  . LYS A 1 78  ? -0.464  -5.962  -12.441 1.00 0.00 ? 78  LYS A HD2  1  
ATOM 1234  H HD3  . LYS A 1 78  ? -1.302  -7.316  -13.202 1.00 0.00 ? 78  LYS A HD3  1  
ATOM 1235  H HE2  . LYS A 1 78  ? -3.341  -5.957  -13.342 1.00 0.00 ? 78  LYS A HE2  1  
ATOM 1236  H HE3  . LYS A 1 78  ? -2.483  -4.605  -12.604 1.00 0.00 ? 78  LYS A HE3  1  
ATOM 1237  H HZ1  . LYS A 1 78  ? -2.641  -4.517  -15.071 1.00 0.00 ? 78  LYS A HZ1  1  
ATOM 1238  H HZ2  . LYS A 1 78  ? -1.647  -5.883  -15.147 1.00 0.00 ? 78  LYS A HZ2  1  
ATOM 1239  H HZ3  . LYS A 1 78  ? -1.058  -4.445  -14.479 1.00 0.00 ? 78  LYS A HZ3  1  
ATOM 1240  N N    . ALA A 1 79  ? 0.070   -5.380  -8.180  1.00 0.00 ? 79  ALA A N    1  
ATOM 1241  C CA   . ALA A 1 79  ? 0.150   -3.975  -7.803  1.00 0.00 ? 79  ALA A CA   1  
ATOM 1242  C C    . ALA A 1 79  ? 1.275   -3.268  -8.551  1.00 0.00 ? 79  ALA A C    1  
ATOM 1243  O O    . ALA A 1 79  ? 2.453   -3.530  -8.309  1.00 0.00 ? 79  ALA A O    1  
ATOM 1244  C CB   . ALA A 1 79  ? 0.348   -3.842  -6.300  1.00 0.00 ? 79  ALA A CB   1  
ATOM 1245  H H    . ALA A 1 79  ? 0.889   -5.918  -8.196  1.00 0.00 ? 79  ALA A H    1  
ATOM 1246  H HA   . ALA A 1 79  ? -0.789  -3.507  -8.060  1.00 0.00 ? 79  ALA A HA   1  
ATOM 1247  H HB1  . ALA A 1 79  ? 1.158   -3.155  -6.104  1.00 0.00 ? 79  ALA A HB1  1  
ATOM 1248  H HB2  . ALA A 1 79  ? -0.559  -3.469  -5.849  1.00 0.00 ? 79  ALA A HB2  1  
ATOM 1249  H HB3  . ALA A 1 79  ? 0.587   -4.809  -5.882  1.00 0.00 ? 79  ALA A HB3  1  
ATOM 1250  N N    . GLU A 1 80  ? 0.904   -2.373  -9.461  1.00 0.00 ? 80  GLU A N    1  
ATOM 1251  C CA   . GLU A 1 80  ? 1.884   -1.630  -10.245 1.00 0.00 ? 80  GLU A CA   1  
ATOM 1252  C C    . GLU A 1 80  ? 1.497   -0.158  -10.345 1.00 0.00 ? 80  GLU A C    1  
ATOM 1253  O O    . GLU A 1 80  ? 0.317   0.191   -10.299 1.00 0.00 ? 80  GLU A O    1  
ATOM 1254  C CB   . GLU A 1 80  ? 2.010   -2.232  -11.646 1.00 0.00 ? 80  GLU A CB   1  
ATOM 1255  C CG   . GLU A 1 80  ? 0.842   -1.898  -12.559 1.00 0.00 ? 80  GLU A CG   1  
ATOM 1256  C CD   . GLU A 1 80  ? 1.008   -2.473  -13.953 1.00 0.00 ? 80  GLU A CD   1  
ATOM 1257  O OE1  . GLU A 1 80  ? 0.776   -3.688  -14.124 1.00 0.00 ? 80  GLU A OE1  1  
ATOM 1258  O OE2  . GLU A 1 80  ? 1.370   -1.708  -14.871 1.00 0.00 ? 80  GLU A OE2  1  
ATOM 1259  H H    . GLU A 1 80  ? -0.051  -2.208  -9.608  1.00 0.00 ? 80  GLU A H    1  
ATOM 1260  H HA   . GLU A 1 80  ? 2.836   -1.707  -9.744  1.00 0.00 ? 80  GLU A HA   1  
ATOM 1261  H HB2  . GLU A 1 80  ? 2.915   -1.862  -12.104 1.00 0.00 ? 80  GLU A HB2  1  
ATOM 1262  H HB3  . GLU A 1 80  ? 2.075   -3.306  -11.559 1.00 0.00 ? 80  GLU A HB3  1  
ATOM 1263  H HG2  . GLU A 1 80  ? -0.063  -2.299  -12.127 1.00 0.00 ? 80  GLU A HG2  1  
ATOM 1264  H HG3  . GLU A 1 80  ? 0.757   -0.824  -12.637 1.00 0.00 ? 80  GLU A HG3  1  
ATOM 1265  N N    . HIS A 1 81  ? 2.501   0.704   -10.481 1.00 0.00 ? 81  HIS A N    1  
ATOM 1266  C CA   . HIS A 1 81  ? 2.267   2.139   -10.588 1.00 0.00 ? 81  HIS A CA   1  
ATOM 1267  C C    . HIS A 1 81  ? 2.089   2.554   -12.045 1.00 0.00 ? 81  HIS A C    1  
ATOM 1268  O O    . HIS A 1 81  ? 2.028   3.743   -12.359 1.00 0.00 ? 81  HIS A O    1  
ATOM 1269  C CB   . HIS A 1 81  ? 3.427   2.914   -9.962  1.00 0.00 ? 81  HIS A CB   1  
ATOM 1270  C CG   . HIS A 1 81  ? 3.086   4.332   -9.620  1.00 0.00 ? 81  HIS A CG   1  
ATOM 1271  N ND1  . HIS A 1 81  ? 4.033   5.271   -9.273  1.00 0.00 ? 81  HIS A ND1  1  
ATOM 1272  C CD2  . HIS A 1 81  ? 1.892   4.969   -9.575  1.00 0.00 ? 81  HIS A CD2  1  
ATOM 1273  C CE1  . HIS A 1 81  ? 3.437   6.424   -9.027  1.00 0.00 ? 81  HIS A CE1  1  
ATOM 1274  N NE2  . HIS A 1 81  ? 2.138   6.268   -9.204  1.00 0.00 ? 81  HIS A NE2  1  
ATOM 1275  H H    . HIS A 1 81  ? 3.420   0.365   -10.511 1.00 0.00 ? 81  HIS A H    1  
ATOM 1276  H HA   . HIS A 1 81  ? 1.360   2.369   -10.048 1.00 0.00 ? 81  HIS A HA   1  
ATOM 1277  H HB2  . HIS A 1 81  ? 3.734   2.418   -9.053  1.00 0.00 ? 81  HIS A HB2  1  
ATOM 1278  H HB3  . HIS A 1 81  ? 4.256   2.930   -10.655 1.00 0.00 ? 81  HIS A HB3  1  
ATOM 1279  H HD1  . HIS A 1 81  ? 4.999   5.115   -9.213  1.00 0.00 ? 81  HIS A HD1  1  
ATOM 1280  H HD2  . HIS A 1 81  ? 0.925   4.536   -9.791  1.00 0.00 ? 81  HIS A HD2  1  
ATOM 1281  H HE1  . HIS A 1 81  ? 3.928   7.340   -8.732  1.00 0.00 ? 81  HIS A HE1  1  
ATOM 1282  H HE2  . HIS A 1 81  ? 1.456   6.943   -9.005  1.00 0.00 ? 81  HIS A HE2  1  
ATOM 1283  N N    . ALA A 1 82  ? 2.008   1.567   -12.931 1.00 0.00 ? 82  ALA A N    1  
ATOM 1284  C CA   . ALA A 1 82  ? 1.836   1.830   -14.354 1.00 0.00 ? 82  ALA A CA   1  
ATOM 1285  C C    . ALA A 1 82  ? 3.109   2.409   -14.963 1.00 0.00 ? 82  ALA A C    1  
ATOM 1286  O O    . ALA A 1 82  ? 3.055   3.326   -15.781 1.00 0.00 ? 82  ALA A O    1  
ATOM 1287  C CB   . ALA A 1 82  ? 0.664   2.773   -14.579 1.00 0.00 ? 82  ALA A CB   1  
ATOM 1288  H H    . ALA A 1 82  ? 2.063   0.640   -12.619 1.00 0.00 ? 82  ALA A H    1  
ATOM 1289  H HA   . ALA A 1 82  ? 1.611   0.892   -14.842 1.00 0.00 ? 82  ALA A HA   1  
ATOM 1290  H HB1  . ALA A 1 82  ? 1.032   3.723   -14.940 1.00 0.00 ? 82  ALA A HB1  1  
ATOM 1291  H HB2  . ALA A 1 82  ? -0.007  2.346   -15.308 1.00 0.00 ? 82  ALA A HB2  1  
ATOM 1292  H HB3  . ALA A 1 82  ? 0.138   2.922   -13.648 1.00 0.00 ? 82  ALA A HB3  1  
ATOM 1293  N N    . GLY A 1 83  ? 4.254   1.869   -14.556 1.00 0.00 ? 83  GLY A N    1  
ATOM 1294  C CA   . GLY A 1 83  ? 5.524   2.346   -15.071 1.00 0.00 ? 83  GLY A CA   1  
ATOM 1295  C C    . GLY A 1 83  ? 6.681   2.027   -14.146 1.00 0.00 ? 83  GLY A C    1  
ATOM 1296  O O    . GLY A 1 83  ? 7.721   1.537   -14.586 1.00 0.00 ? 83  GLY A O    1  
ATOM 1297  H H    . GLY A 1 83  ? 4.235   1.140   -13.901 1.00 0.00 ? 83  GLY A H    1  
ATOM 1298  H HA2  . GLY A 1 83  ? 5.706   1.885   -16.031 1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1299  H HA3  . GLY A 1 83  ? 5.467   3.416   -15.202 1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1300  N N    . VAL A 1 84  ? 6.502   2.307   -12.859 1.00 0.00 ? 84  VAL A N    1  
ATOM 1301  C CA   . VAL A 1 84  ? 7.540   2.048   -11.868 1.00 0.00 ? 84  VAL A CA   1  
ATOM 1302  C C    . VAL A 1 84  ? 7.899   0.567   -11.823 1.00 0.00 ? 84  VAL A C    1  
ATOM 1303  O O    . VAL A 1 84  ? 8.949   0.157   -12.317 1.00 0.00 ? 84  VAL A O    1  
ATOM 1304  C CB   . VAL A 1 84  ? 7.102   2.503   -10.464 1.00 0.00 ? 84  VAL A CB   1  
ATOM 1305  C CG1  . VAL A 1 84  ? 7.983   1.869   -9.398  1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1306  C CG2  . VAL A 1 84  ? 7.135   4.020   -10.361 1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1307  H H    . VAL A 1 84  ? 5.651   2.697   -12.568 1.00 0.00 ? 84  VAL A H    1  
ATOM 1308  H HA   . VAL A 1 84  ? 8.418   2.613   -12.149 1.00 0.00 ? 84  VAL A HA   1  
ATOM 1309  H HB   . VAL A 1 84  ? 6.086   2.174   -10.301 1.00 0.00 ? 84  VAL A HB   1  
ATOM 1310  H HG11 . VAL A 1 84  ? 9.021   2.058   -9.630  1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1311  H HG12 . VAL A 1 84  ? 7.746   2.295   -8.434  1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1312  H HG13 . VAL A 1 84  ? 7.809   0.804   -9.374  1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1313  H HG21 . VAL A 1 84  ? 8.109   4.380   -10.657 1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1314  H HG22 . VAL A 1 84  ? 6.382   4.442   -11.012 1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1315  H HG23 . VAL A 1 84  ? 6.936   4.317   -9.342  1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1316  N N    . ARG A 1 85  ? 7.019   -0.230  -11.226 1.00 0.00 ? 85  ARG A N    1  
ATOM 1317  C CA   . ARG A 1 85  ? 7.243   -1.667  -11.114 1.00 0.00 ? 85  ARG A CA   1  
ATOM 1318  C C    . ARG A 1 85  ? 5.919   -2.415  -10.981 1.00 0.00 ? 85  ARG A C    1  
ATOM 1319  O O    . ARG A 1 85  ? 4.914   -1.848  -10.552 1.00 0.00 ? 85  ARG A O    1  
ATOM 1320  C CB   . ARG A 1 85  ? 8.138   -1.973  -9.912  1.00 0.00 ? 85  ARG A CB   1  
ATOM 1321  C CG   . ARG A 1 85  ? 8.994   -3.216  -10.091 1.00 0.00 ? 85  ARG A CG   1  
ATOM 1322  C CD   . ARG A 1 85  ? 10.326  -2.885  -10.747 1.00 0.00 ? 85  ARG A CD   1  
ATOM 1323  N NE   . ARG A 1 85  ? 10.225  -2.849  -12.203 1.00 0.00 ? 85  ARG A NE   1  
ATOM 1324  C CZ   . ARG A 1 85  ? 10.055  -3.930  -12.956 1.00 0.00 ? 85  ARG A CZ   1  
ATOM 1325  N NH1  . ARG A 1 85  ? 9.967   -5.127  -12.391 1.00 0.00 ? 85  ARG A NH1  1  
ATOM 1326  N NH2  . ARG A 1 85  ? 9.972   -3.816  -14.275 1.00 0.00 ? 85  ARG A NH2  1  
ATOM 1327  H H    . ARG A 1 85  ? 6.200   0.156   -10.851 1.00 0.00 ? 85  ARG A H    1  
ATOM 1328  H HA   . ARG A 1 85  ? 7.740   -1.996  -12.015 1.00 0.00 ? 85  ARG A HA   1  
ATOM 1329  H HB2  . ARG A 1 85  ? 8.794   -1.132  -9.742  1.00 0.00 ? 85  ARG A HB2  1  
ATOM 1330  H HB3  . ARG A 1 85  ? 7.514   -2.115  -9.042  1.00 0.00 ? 85  ARG A HB3  1  
ATOM 1331  H HG2  . ARG A 1 85  ? 9.182   -3.656  -9.123  1.00 0.00 ? 85  ARG A HG2  1  
ATOM 1332  H HG3  . ARG A 1 85  ? 8.462   -3.922  -10.712 1.00 0.00 ? 85  ARG A HG3  1  
ATOM 1333  H HD2  . ARG A 1 85  ? 10.655  -1.919  -10.394 1.00 0.00 ? 85  ARG A HD2  1  
ATOM 1334  H HD3  . ARG A 1 85  ? 11.047  -3.637  -10.464 1.00 0.00 ? 85  ARG A HD3  1  
ATOM 1335  H HE   . ARG A 1 85  ? 10.287  -1.974  -12.641 1.00 0.00 ? 85  ARG A HE   1  
ATOM 1336  H HH11 . ARG A 1 85  ? 10.028  -5.216  -11.397 1.00 0.00 ? 85  ARG A HH11 1  
ATOM 1337  H HH12 . ARG A 1 85  ? 9.838   -5.940  -12.960 1.00 0.00 ? 85  ARG A HH12 1  
ATOM 1338  H HH21 . ARG A 1 85  ? 10.038  -2.915  -14.704 1.00 0.00 ? 85  ARG A HH21 1  
ATOM 1339  H HH22 . ARG A 1 85  ? 9.845   -4.630  -14.840 1.00 0.00 ? 85  ARG A HH22 1  
ATOM 1340  N N    . THR A 1 86  ? 5.927   -3.691  -11.352 1.00 0.00 ? 86  THR A N    1  
ATOM 1341  C CA   . THR A 1 86  ? 4.728   -4.516  -11.276 1.00 0.00 ? 86  THR A CA   1  
ATOM 1342  C C    . THR A 1 86  ? 4.897   -5.639  -10.259 1.00 0.00 ? 86  THR A C    1  
ATOM 1343  O O    . THR A 1 86  ? 5.541   -6.650  -10.538 1.00 0.00 ? 86  THR A O    1  
ATOM 1344  C CB   . THR A 1 86  ? 4.379   -5.128  -12.646 1.00 0.00 ? 86  THR A CB   1  
ATOM 1345  O OG1  . THR A 1 86  ? 4.286   -4.096  -13.634 1.00 0.00 ? 86  THR A OG1  1  
ATOM 1346  C CG2  . THR A 1 86  ? 3.065   -5.892  -12.578 1.00 0.00 ? 86  THR A CG2  1  
ATOM 1347  H H    . THR A 1 86  ? 6.759   -4.086  -11.686 1.00 0.00 ? 86  THR A H    1  
ATOM 1348  H HA   . THR A 1 86  ? 3.907   -3.884  -10.967 1.00 0.00 ? 86  THR A HA   1  
ATOM 1349  H HB   . THR A 1 86  ? 5.164   -5.815  -12.927 1.00 0.00 ? 86  THR A HB   1  
ATOM 1350  H HG1  . THR A 1 86  ? 3.805   -4.425  -14.397 1.00 0.00 ? 86  THR A HG1  1  
ATOM 1351  H HG21 . THR A 1 86  ? 2.874   -6.365  -13.530 1.00 0.00 ? 86  THR A HG21 1  
ATOM 1352  H HG22 . THR A 1 86  ? 2.262   -5.207  -12.350 1.00 0.00 ? 86  THR A HG22 1  
ATOM 1353  H HG23 . THR A 1 86  ? 3.126   -6.645  -11.808 1.00 0.00 ? 86  THR A HG23 1  
ATOM 1354  N N    . TYR A 1 87  ? 4.314   -5.455  -9.080  1.00 0.00 ? 87  TYR A N    1  
ATOM 1355  C CA   . TYR A 1 87  ? 4.402   -6.453  -8.020  1.00 0.00 ? 87  TYR A CA   1  
ATOM 1356  C C    . TYR A 1 87  ? 3.263   -7.463  -8.127  1.00 0.00 ? 87  TYR A C    1  
ATOM 1357  O O    . TYR A 1 87  ? 2.207   -7.168  -8.687  1.00 0.00 ? 87  TYR A O    1  
ATOM 1358  C CB   . TYR A 1 87  ? 4.370   -5.775  -6.649  1.00 0.00 ? 87  TYR A CB   1  
ATOM 1359  C CG   . TYR A 1 87  ? 5.574   -4.901  -6.378  1.00 0.00 ? 87  TYR A CG   1  
ATOM 1360  C CD1  . TYR A 1 87  ? 5.686   -3.642  -6.954  1.00 0.00 ? 87  TYR A CD1  1  
ATOM 1361  C CD2  . TYR A 1 87  ? 6.599   -5.335  -5.547  1.00 0.00 ? 87  TYR A CD2  1  
ATOM 1362  C CE1  . TYR A 1 87  ? 6.784   -2.840  -6.710  1.00 0.00 ? 87  TYR A CE1  1  
ATOM 1363  C CE2  . TYR A 1 87  ? 7.700   -4.539  -5.296  1.00 0.00 ? 87  TYR A CE2  1  
ATOM 1364  C CZ   . TYR A 1 87  ? 7.788   -3.293  -5.880  1.00 0.00 ? 87  TYR A CZ   1  
ATOM 1365  O OH   . TYR A 1 87  ? 8.884   -2.498  -5.634  1.00 0.00 ? 87  TYR A OH   1  
ATOM 1366  H H    . TYR A 1 87  ? 3.814   -4.628  -8.917  1.00 0.00 ? 87  TYR A H    1  
ATOM 1367  H HA   . TYR A 1 87  ? 5.341   -6.974  -8.132  1.00 0.00 ? 87  TYR A HA   1  
ATOM 1368  H HB2  . TYR A 1 87  ? 3.490   -5.156  -6.581  1.00 0.00 ? 87  TYR A HB2  1  
ATOM 1369  H HB3  . TYR A 1 87  ? 4.331   -6.534  -5.881  1.00 0.00 ? 87  TYR A HB3  1  
ATOM 1370  H HD1  . TYR A 1 87  ? 4.898   -3.290  -7.604  1.00 0.00 ? 87  TYR A HD1  1  
ATOM 1371  H HD2  . TYR A 1 87  ? 6.527   -6.312  -5.091  1.00 0.00 ? 87  TYR A HD2  1  
ATOM 1372  H HE1  . TYR A 1 87  ? 6.854   -1.863  -7.167  1.00 0.00 ? 87  TYR A HE1  1  
ATOM 1373  H HE2  . TYR A 1 87  ? 8.487   -4.894  -4.646  1.00 0.00 ? 87  TYR A HE2  1  
ATOM 1374  H HH   . TYR A 1 87  ? 8.919   -2.282  -4.699  1.00 0.00 ? 87  TYR A HH   1  
ATOM 1375  N N    . PHE A 1 88  ? 3.486   -8.655  -7.584  1.00 0.00 ? 88  PHE A N    1  
ATOM 1376  C CA   . PHE A 1 88  ? 2.480   -9.710  -7.617  1.00 0.00 ? 88  PHE A CA   1  
ATOM 1377  C C    . PHE A 1 88  ? 2.393   -10.422 -6.270  1.00 0.00 ? 88  PHE A C    1  
ATOM 1378  O O    . PHE A 1 88  ? 3.409   -10.670 -5.620  1.00 0.00 ? 88  PHE A O    1  
ATOM 1379  C CB   . PHE A 1 88  ? 2.804   -10.719 -8.720  1.00 0.00 ? 88  PHE A CB   1  
ATOM 1380  C CG   . PHE A 1 88  ? 2.483   -10.222 -10.101 1.00 0.00 ? 88  PHE A CG   1  
ATOM 1381  C CD1  . PHE A 1 88  ? 1.184   -10.258 -10.580 1.00 0.00 ? 88  PHE A CD1  1  
ATOM 1382  C CD2  . PHE A 1 88  ? 3.481   -9.718  -10.920 1.00 0.00 ? 88  PHE A CD2  1  
ATOM 1383  C CE1  . PHE A 1 88  ? 0.885   -9.801  -11.850 1.00 0.00 ? 88  PHE A CE1  1  
ATOM 1384  C CE2  . PHE A 1 88  ? 3.188   -9.260  -12.190 1.00 0.00 ? 88  PHE A CE2  1  
ATOM 1385  C CZ   . PHE A 1 88  ? 1.889   -9.302  -12.656 1.00 0.00 ? 88  PHE A CZ   1  
ATOM 1386  H H    . PHE A 1 88  ? 4.348   -8.829  -7.150  1.00 0.00 ? 88  PHE A H    1  
ATOM 1387  H HA   . PHE A 1 88  ? 1.526   -9.251  -7.830  1.00 0.00 ? 88  PHE A HA   1  
ATOM 1388  H HB2  . PHE A 1 88  ? 3.859   -10.950 -8.688  1.00 0.00 ? 88  PHE A HB2  1  
ATOM 1389  H HB3  . PHE A 1 88  ? 2.237   -11.622 -8.551  1.00 0.00 ? 88  PHE A HB3  1  
ATOM 1390  H HD1  . PHE A 1 88  ? 0.397   -10.649 -9.949  1.00 0.00 ? 88  PHE A HD1  1  
ATOM 1391  H HD2  . PHE A 1 88  ? 4.498   -9.686  -10.557 1.00 0.00 ? 88  PHE A HD2  1  
ATOM 1392  H HE1  . PHE A 1 88  ? -0.132  -9.836  -12.210 1.00 0.00 ? 88  PHE A HE1  1  
ATOM 1393  H HE2  . PHE A 1 88  ? 3.975   -8.870  -12.819 1.00 0.00 ? 88  PHE A HE2  1  
ATOM 1394  H HZ   . PHE A 1 88  ? 1.657   -8.944  -13.648 1.00 0.00 ? 88  PHE A HZ   1  
ATOM 1395  N N    . PHE A 1 89  ? 1.173   -10.749 -5.857  1.00 0.00 ? 89  PHE A N    1  
ATOM 1396  C CA   . PHE A 1 89  ? 0.953   -11.431 -4.588  1.00 0.00 ? 89  PHE A CA   1  
ATOM 1397  C C    . PHE A 1 89  ? -0.152  -12.476 -4.716  1.00 0.00 ? 89  PHE A C    1  
ATOM 1398  O O    . PHE A 1 89  ? -1.193  -12.223 -5.321  1.00 0.00 ? 89  PHE A O    1  
ATOM 1399  C CB   . PHE A 1 89  ? 0.590   -10.421 -3.498  1.00 0.00 ? 89  PHE A CB   1  
ATOM 1400  C CG   . PHE A 1 89  ? 1.535   -9.256  -3.421  1.00 0.00 ? 89  PHE A CG   1  
ATOM 1401  C CD1  . PHE A 1 89  ? 2.878   -9.454  -3.145  1.00 0.00 ? 89  PHE A CD1  1  
ATOM 1402  C CD2  . PHE A 1 89  ? 1.080   -7.963  -3.626  1.00 0.00 ? 89  PHE A CD2  1  
ATOM 1403  C CE1  . PHE A 1 89  ? 3.750   -8.384  -3.074  1.00 0.00 ? 89  PHE A CE1  1  
ATOM 1404  C CE2  . PHE A 1 89  ? 1.948   -6.889  -3.556  1.00 0.00 ? 89  PHE A CE2  1  
ATOM 1405  C CZ   . PHE A 1 89  ? 3.284   -7.100  -3.281  1.00 0.00 ? 89  PHE A CZ   1  
ATOM 1406  H H    . PHE A 1 89  ? 0.402   -10.525 -6.420  1.00 0.00 ? 89  PHE A H    1  
ATOM 1407  H HA   . PHE A 1 89  ? 1.872   -11.927 -4.315  1.00 0.00 ? 89  PHE A HA   1  
ATOM 1408  H HB2  . PHE A 1 89  ? -0.399  -10.033 -3.691  1.00 0.00 ? 89  PHE A HB2  1  
ATOM 1409  H HB3  . PHE A 1 89  ? 0.596   -10.918 -2.539  1.00 0.00 ? 89  PHE A HB3  1  
ATOM 1410  H HD1  . PHE A 1 89  ? 3.245   -10.457 -2.984  1.00 0.00 ? 89  PHE A HD1  1  
ATOM 1411  H HD2  . PHE A 1 89  ? 0.034   -7.797  -3.842  1.00 0.00 ? 89  PHE A HD2  1  
ATOM 1412  H HE1  . PHE A 1 89  ? 4.795   -8.551  -2.858  1.00 0.00 ? 89  PHE A HE1  1  
ATOM 1413  H HE2  . PHE A 1 89  ? 1.580   -5.887  -3.719  1.00 0.00 ? 89  PHE A HE2  1  
ATOM 1414  H HZ   . PHE A 1 89  ? 3.963   -6.262  -3.225  1.00 0.00 ? 89  PHE A HZ   1  
ATOM 1415  N N    . SER A 1 90  ? 0.085   -13.652 -4.144  1.00 0.00 ? 90  SER A N    1  
ATOM 1416  C CA   . SER A 1 90  ? -0.887  -14.738 -4.197  1.00 0.00 ? 90  SER A CA   1  
ATOM 1417  C C    . SER A 1 90  ? -1.358  -15.115 -2.796  1.00 0.00 ? 90  SER A C    1  
ATOM 1418  O O    . SER A 1 90  ? -0.568  -15.552 -1.960  1.00 0.00 ? 90  SER A O    1  
ATOM 1419  C CB   . SER A 1 90  ? -0.280  -15.960 -4.889  1.00 0.00 ? 90  SER A CB   1  
ATOM 1420  O OG   . SER A 1 90  ? -1.150  -17.076 -4.809  1.00 0.00 ? 90  SER A OG   1  
ATOM 1421  H H    . SER A 1 90  ? 0.935   -13.793 -3.676  1.00 0.00 ? 90  SER A H    1  
ATOM 1422  H HA   . SER A 1 90  ? -1.736  -14.395 -4.770  1.00 0.00 ? 90  SER A HA   1  
ATOM 1423  H HB2  . SER A 1 90  ? -0.103  -15.731 -5.929  1.00 0.00 ? 90  SER A HB2  1  
ATOM 1424  H HB3  . SER A 1 90  ? 0.656   -16.213 -4.412  1.00 0.00 ? 90  SER A HB3  1  
ATOM 1425  H HG   . SER A 1 90  ? -1.811  -17.017 -5.502  1.00 0.00 ? 90  SER A HG   1  
ATOM 1426  N N    . ALA A 1 91  ? -2.653  -14.942 -2.548  1.00 0.00 ? 91  ALA A N    1  
ATOM 1427  C CA   . ALA A 1 91  ? -3.231  -15.265 -1.250  1.00 0.00 ? 91  ALA A CA   1  
ATOM 1428  C C    . ALA A 1 91  ? -3.601  -16.742 -1.166  1.00 0.00 ? 91  ALA A C    1  
ATOM 1429  O O    . ALA A 1 91  ? -4.230  -17.285 -2.073  1.00 0.00 ? 91  ALA A O    1  
ATOM 1430  C CB   . ALA A 1 91  ? -4.453  -14.397 -0.985  1.00 0.00 ? 91  ALA A CB   1  
ATOM 1431  H H    . ALA A 1 91  ? -3.232  -14.590 -3.255  1.00 0.00 ? 91  ALA A H    1  
ATOM 1432  H HA   . ALA A 1 91  ? -2.493  -15.046 -0.491  1.00 0.00 ? 91  ALA A HA   1  
ATOM 1433  H HB1  . ALA A 1 91  ? -5.318  -14.842 -1.456  1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1434  H HB2  . ALA A 1 91  ? -4.619  -14.325 0.079   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1435  H HB3  . ALA A 1 91  ? -4.288  -13.411 -1.393  1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1436  N N    . GLU A 1 92  ? -3.206  -17.385 -0.072  1.00 0.00 ? 92  GLU A N    1  
ATOM 1437  C CA   . GLU A 1 92  ? -3.496  -18.800 0.128   1.00 0.00 ? 92  GLU A CA   1  
ATOM 1438  C C    . GLU A 1 92  ? -5.001  -19.052 0.134   1.00 0.00 ? 92  GLU A C    1  
ATOM 1439  O O    . GLU A 1 92  ? -5.459  -20.145 -0.198  1.00 0.00 ? 92  GLU A O    1  
ATOM 1440  C CB   . GLU A 1 92  ? -2.880  -19.289 1.441   1.00 0.00 ? 92  GLU A CB   1  
ATOM 1441  C CG   . GLU A 1 92  ? -1.378  -19.077 1.526   1.00 0.00 ? 92  GLU A CG   1  
ATOM 1442  C CD   . GLU A 1 92  ? -0.730  -19.920 2.607   1.00 0.00 ? 92  GLU A CD   1  
ATOM 1443  O OE1  . GLU A 1 92  ? -0.921  -19.604 3.800   1.00 0.00 ? 92  GLU A OE1  1  
ATOM 1444  O OE2  . GLU A 1 92  ? -0.032  -20.896 2.260   1.00 0.00 ? 92  GLU A OE2  1  
ATOM 1445  H H    . GLU A 1 92  ? -2.708  -16.897 0.617   1.00 0.00 ? 92  GLU A H    1  
ATOM 1446  H HA   . GLU A 1 92  ? -3.055  -19.348 -0.691  1.00 0.00 ? 92  GLU A HA   1  
ATOM 1447  H HB2  . GLU A 1 92  ? -3.345  -18.761 2.261   1.00 0.00 ? 92  GLU A HB2  1  
ATOM 1448  H HB3  . GLU A 1 92  ? -3.080  -20.345 1.547   1.00 0.00 ? 92  GLU A HB3  1  
ATOM 1449  H HG2  . GLU A 1 92  ? -0.937  -19.337 0.575   1.00 0.00 ? 92  GLU A HG2  1  
ATOM 1450  H HG3  . GLU A 1 92  ? -1.186  -18.036 1.738   1.00 0.00 ? 92  GLU A HG3  1  
ATOM 1451  N N    . SER A 1 93  ? -5.764  -18.033 0.515   1.00 0.00 ? 93  SER A N    1  
ATOM 1452  C CA   . SER A 1 93  ? -7.217  -18.144 0.569   1.00 0.00 ? 93  SER A CA   1  
ATOM 1453  C C    . SER A 1 93  ? -7.877  -17.022 -0.227  1.00 0.00 ? 93  SER A C    1  
ATOM 1454  O O    . SER A 1 93  ? -7.320  -15.938 -0.400  1.00 0.00 ? 93  SER A O    1  
ATOM 1455  C CB   . SER A 1 93  ? -7.699  -18.106 2.021   1.00 0.00 ? 93  SER A CB   1  
ATOM 1456  O OG   . SER A 1 93  ? -7.682  -19.400 2.598   1.00 0.00 ? 93  SER A OG   1  
ATOM 1457  H H    . SER A 1 93  ? -5.339  -17.186 0.769   1.00 0.00 ? 93  SER A H    1  
ATOM 1458  H HA   . SER A 1 93  ? -7.493  -19.091 0.132   1.00 0.00 ? 93  SER A HA   1  
ATOM 1459  H HB2  . SER A 1 93  ? -7.052  -17.461 2.596   1.00 0.00 ? 93  SER A HB2  1  
ATOM 1460  H HB3  . SER A 1 93  ? -8.709  -17.724 2.052   1.00 0.00 ? 93  SER A HB3  1  
ATOM 1461  H HG   . SER A 1 93  ? -6.793  -19.607 2.894   1.00 0.00 ? 93  SER A HG   1  
ATOM 1462  N N    . PRO A 1 94  ? -9.095  -17.288 -0.723  1.00 0.00 ? 94  PRO A N    1  
ATOM 1463  C CA   . PRO A 1 94  ? -9.859  -16.314 -1.509  1.00 0.00 ? 94  PRO A CA   1  
ATOM 1464  C C    . PRO A 1 94  ? -10.351 -15.145 -0.662  1.00 0.00 ? 94  PRO A C    1  
ATOM 1465  O O    . PRO A 1 94  ? -10.361 -14.001 -1.115  1.00 0.00 ? 94  PRO A O    1  
ATOM 1466  C CB   . PRO A 1 94  ? -11.043 -17.132 -2.032  1.00 0.00 ? 94  PRO A CB   1  
ATOM 1467  C CG   . PRO A 1 94  ? -11.203 -18.238 -1.047  1.00 0.00 ? 94  PRO A CG   1  
ATOM 1468  C CD   . PRO A 1 94  ? -9.819  -18.559 -0.555  1.00 0.00 ? 94  PRO A CD   1  
ATOM 1469  H HA   . PRO A 1 94  ? -9.284  -15.937 -2.341  1.00 0.00 ? 94  PRO A HA   1  
ATOM 1470  H HB2  . PRO A 1 94  ? -11.924 -16.507 -2.073  1.00 0.00 ? 94  PRO A HB2  1  
ATOM 1471  H HB3  . PRO A 1 94  ? -10.816 -17.510 -3.017  1.00 0.00 ? 94  PRO A HB3  1  
ATOM 1472  H HG2  . PRO A 1 94  ? -11.827 -17.914 -0.228  1.00 0.00 ? 94  PRO A HG2  1  
ATOM 1473  H HG3  . PRO A 1 94  ? -11.637 -19.100 -1.532  1.00 0.00 ? 94  PRO A HG3  1  
ATOM 1474  H HD2  . PRO A 1 94  ? -9.847  -18.852 0.484   1.00 0.00 ? 94  PRO A HD2  1  
ATOM 1475  H HD3  . PRO A 1 94  ? -9.375  -19.337 -1.157  1.00 0.00 ? 94  PRO A HD3  1  
ATOM 1476  N N    . GLU A 1 95  ? -10.759 -15.441 0.568   1.00 0.00 ? 95  GLU A N    1  
ATOM 1477  C CA   . GLU A 1 95  ? -11.253 -14.413 1.476   1.00 0.00 ? 95  GLU A CA   1  
ATOM 1478  C C    . GLU A 1 95  ? -10.166 -13.384 1.776   1.00 0.00 ? 95  GLU A C    1  
ATOM 1479  O O    . GLU A 1 95  ? -10.459 -12.232 2.091   1.00 0.00 ? 95  GLU A O    1  
ATOM 1480  C CB   . GLU A 1 95  ? -11.745 -15.046 2.779   1.00 0.00 ? 95  GLU A CB   1  
ATOM 1481  C CG   . GLU A 1 95  ? -10.658 -15.776 3.550   1.00 0.00 ? 95  GLU A CG   1  
ATOM 1482  C CD   . GLU A 1 95  ? -11.018 -15.989 5.007   1.00 0.00 ? 95  GLU A CD   1  
ATOM 1483  O OE1  . GLU A 1 95  ? -10.874 -15.035 5.800   1.00 0.00 ? 95  GLU A OE1  1  
ATOM 1484  O OE2  . GLU A 1 95  ? -11.445 -17.110 5.355   1.00 0.00 ? 95  GLU A OE2  1  
ATOM 1485  H H    . GLU A 1 95  ? -10.727 -16.372 0.871   1.00 0.00 ? 95  GLU A H    1  
ATOM 1486  H HA   . GLU A 1 95  ? -12.080 -13.914 0.994   1.00 0.00 ? 95  GLU A HA   1  
ATOM 1487  H HB2  . GLU A 1 95  ? -12.148 -14.270 3.413   1.00 0.00 ? 95  GLU A HB2  1  
ATOM 1488  H HB3  . GLU A 1 95  ? -12.529 -15.752 2.548   1.00 0.00 ? 95  GLU A HB3  1  
ATOM 1489  H HG2  . GLU A 1 95  ? -10.495 -16.740 3.091   1.00 0.00 ? 95  GLU A HG2  1  
ATOM 1490  H HG3  . GLU A 1 95  ? -9.748  -15.196 3.500   1.00 0.00 ? 95  GLU A HG3  1  
ATOM 1491  N N    . GLU A 1 96  ? -8.911  -13.811 1.676   1.00 0.00 ? 96  GLU A N    1  
ATOM 1492  C CA   . GLU A 1 96  ? -7.781  -12.928 1.938   1.00 0.00 ? 96  GLU A CA   1  
ATOM 1493  C C    . GLU A 1 96  ? -7.497  -12.037 0.733   1.00 0.00 ? 96  GLU A C    1  
ATOM 1494  O O    . GLU A 1 96  ? -7.491  -10.811 0.843   1.00 0.00 ? 96  GLU A O    1  
ATOM 1495  C CB   . GLU A 1 96  ? -6.536  -13.746 2.287   1.00 0.00 ? 96  GLU A CB   1  
ATOM 1496  C CG   . GLU A 1 96  ? -6.415  -14.070 3.766   1.00 0.00 ? 96  GLU A CG   1  
ATOM 1497  C CD   . GLU A 1 96  ? -5.463  -15.219 4.036   1.00 0.00 ? 96  GLU A CD   1  
ATOM 1498  O OE1  . GLU A 1 96  ? -4.376  -15.245 3.421   1.00 0.00 ? 96  GLU A OE1  1  
ATOM 1499  O OE2  . GLU A 1 96  ? -5.805  -16.092 4.861   1.00 0.00 ? 96  GLU A OE2  1  
ATOM 1500  H H    . GLU A 1 96  ? -8.742  -14.742 1.421   1.00 0.00 ? 96  GLU A H    1  
ATOM 1501  H HA   . GLU A 1 96  ? -8.037  -12.303 2.780   1.00 0.00 ? 96  GLU A HA   1  
ATOM 1502  H HB2  . GLU A 1 96  ? -6.565  -14.675 1.736   1.00 0.00 ? 96  GLU A HB2  1  
ATOM 1503  H HB3  . GLU A 1 96  ? -5.660  -13.189 1.989   1.00 0.00 ? 96  GLU A HB3  1  
ATOM 1504  H HG2  . GLU A 1 96  ? -6.054  -13.195 4.285   1.00 0.00 ? 96  GLU A HG2  1  
ATOM 1505  H HG3  . GLU A 1 96  ? -7.391  -14.334 4.145   1.00 0.00 ? 96  GLU A HG3  1  
ATOM 1506  N N    . GLN A 1 97  ? -7.260  -12.662 -0.416  1.00 0.00 ? 97  GLN A N    1  
ATOM 1507  C CA   . GLN A 1 97  ? -6.973  -11.926 -1.641  1.00 0.00 ? 97  GLN A CA   1  
ATOM 1508  C C    . GLN A 1 97  ? -7.775  -10.629 -1.698  1.00 0.00 ? 97  GLN A C    1  
ATOM 1509  O O    . GLN A 1 97  ? -7.207  -9.539  -1.732  1.00 0.00 ? 97  GLN A O    1  
ATOM 1510  C CB   . GLN A 1 97  ? -7.288  -12.788 -2.865  1.00 0.00 ? 97  GLN A CB   1  
ATOM 1511  C CG   . GLN A 1 97  ? -7.156  -12.044 -4.184  1.00 0.00 ? 97  GLN A CG   1  
ATOM 1512  C CD   . GLN A 1 97  ? -8.079  -12.588 -5.256  1.00 0.00 ? 97  GLN A CD   1  
ATOM 1513  O OE1  . GLN A 1 97  ? -9.019  -13.328 -4.965  1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1514  N NE2  . GLN A 1 97  ? -7.815  -12.223 -6.505  1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1515  H H    . GLN A 1 97  ? -7.279  -13.641 -0.439  1.00 0.00 ? 97  GLN A H    1  
ATOM 1516  H HA   . GLN A 1 97  ? -5.921  -11.684 -1.644  1.00 0.00 ? 97  GLN A HA   1  
ATOM 1517  H HB2  . GLN A 1 97  ? -6.612  -13.629 -2.881  1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1518  H HB3  . GLN A 1 97  ? -8.302  -13.152 -2.782  1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1519  H HG2  . GLN A 1 97  ? -7.394  -11.003 -4.021  1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1520  H HG3  . GLN A 1 97  ? -6.136  -12.129 -4.529  1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1521  H HE21 . GLN A 1 97  ? -7.049  -11.632 -6.663  1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1522  H HE22 . GLN A 1 97  ? -8.395  -12.561 -7.218  1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1523  N N    . GLU A 1 98  ? -9.098  -10.758 -1.708  1.00 0.00 ? 98  GLU A N    1  
ATOM 1524  C CA   . GLU A 1 98  ? -9.977  -9.596  -1.761  1.00 0.00 ? 98  GLU A CA   1  
ATOM 1525  C C    . GLU A 1 98  ? -9.622  -8.594  -0.666  1.00 0.00 ? 98  GLU A C    1  
ATOM 1526  O O    . GLU A 1 98  ? -9.338  -7.429  -0.944  1.00 0.00 ? 98  GLU A O    1  
ATOM 1527  C CB   . GLU A 1 98  ? -11.439 -10.027 -1.619  1.00 0.00 ? 98  GLU A CB   1  
ATOM 1528  C CG   . GLU A 1 98  ? -11.894 -10.999 -2.695  1.00 0.00 ? 98  GLU A CG   1  
ATOM 1529  C CD   . GLU A 1 98  ? -13.223 -11.651 -2.367  1.00 0.00 ? 98  GLU A CD   1  
ATOM 1530  O OE1  . GLU A 1 98  ? -14.253 -10.948 -2.398  1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1531  O OE2  . GLU A 1 98  ? -13.231 -12.867 -2.080  1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1532  H H    . GLU A 1 98  ? -9.492  -11.655 -1.679  1.00 0.00 ? 98  GLU A H    1  
ATOM 1533  H HA   . GLU A 1 98  ? -9.843  -9.122  -2.722  1.00 0.00 ? 98  GLU A HA   1  
ATOM 1534  H HB2  . GLU A 1 98  ? -11.570 -10.498 -0.657  1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1535  H HB3  . GLU A 1 98  ? -12.066 -9.149  -1.669  1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1536  H HG2  . GLU A 1 98  ? -11.994 -10.463 -3.627  1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1537  H HG3  . GLU A 1 98  ? -11.147 -11.771 -2.803  1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1538  N N    . ALA A 1 99  ? -9.642  -9.056  0.579   1.00 0.00 ? 99  ALA A N    1  
ATOM 1539  C CA   . ALA A 1 99  ? -9.322  -8.203  1.717   1.00 0.00 ? 99  ALA A CA   1  
ATOM 1540  C C    . ALA A 1 99  ? -8.107  -7.330  1.422   1.00 0.00 ? 99  ALA A C    1  
ATOM 1541  O O    . ALA A 1 99  ? -8.125  -6.123  1.664   1.00 0.00 ? 99  ALA A O    1  
ATOM 1542  C CB   . ALA A 1 99  ? -9.079  -9.047  2.959   1.00 0.00 ? 99  ALA A CB   1  
ATOM 1543  H H    . ALA A 1 99  ? -9.877  -9.994  0.737   1.00 0.00 ? 99  ALA A H    1  
ATOM 1544  H HA   . ALA A 1 99  ? -10.173 -7.565  1.906   1.00 0.00 ? 99  ALA A HA   1  
ATOM 1545  H HB1  . ALA A 1 99  ? -8.153  -8.743  3.424   1.00 0.00 ? 99  ALA A HB1  1  
ATOM 1546  H HB2  . ALA A 1 99  ? -9.894  -8.909  3.653   1.00 0.00 ? 99  ALA A HB2  1  
ATOM 1547  H HB3  . ALA A 1 99  ? -9.016  -10.088 2.679   1.00 0.00 ? 99  ALA A HB3  1  
ATOM 1548  N N    . TRP A 1 100 ? -7.053  -7.947  0.900   1.00 0.00 ? 100 TRP A N    1  
ATOM 1549  C CA   . TRP A 1 100 ? -5.829  -7.225  0.573   1.00 0.00 ? 100 TRP A CA   1  
ATOM 1550  C C    . TRP A 1 100 ? -6.082  -6.189  -0.516  1.00 0.00 ? 100 TRP A C    1  
ATOM 1551  O O    . TRP A 1 100 ? -5.895  -4.991  -0.301  1.00 0.00 ? 100 TRP A O    1  
ATOM 1552  C CB   . TRP A 1 100 ? -4.741  -8.202  0.122   1.00 0.00 ? 100 TRP A CB   1  
ATOM 1553  C CG   . TRP A 1 100 ? -4.009  -8.843  1.262   1.00 0.00 ? 100 TRP A CG   1  
ATOM 1554  C CD1  . TRP A 1 100 ? -4.224  -10.089 1.778   1.00 0.00 ? 100 TRP A CD1  1  
ATOM 1555  C CD2  . TRP A 1 100 ? -2.945  -8.268  2.028   1.00 0.00 ? 100 TRP A CD2  1  
ATOM 1556  N NE1  . TRP A 1 100 ? -3.358  -10.324 2.818   1.00 0.00 ? 100 TRP A NE1  1  
ATOM 1557  C CE2  . TRP A 1 100 ? -2.562  -9.222  2.991   1.00 0.00 ? 100 TRP A CE2  1  
ATOM 1558  C CE3  . TRP A 1 100 ? -2.276  -7.041  1.993   1.00 0.00 ? 100 TRP A CE3  1  
ATOM 1559  C CZ2  . TRP A 1 100 ? -1.543  -8.985  3.909   1.00 0.00 ? 100 TRP A CZ2  1  
ATOM 1560  C CZ3  . TRP A 1 100 ? -1.265  -6.808  2.905   1.00 0.00 ? 100 TRP A CZ3  1  
ATOM 1561  C CH2  . TRP A 1 100 ? -0.905  -7.776  3.852   1.00 0.00 ? 100 TRP A CH2  1  
ATOM 1562  H H    . TRP A 1 100 ? -7.100  -8.912  0.730   1.00 0.00 ? 100 TRP A H    1  
ATOM 1563  H HA   . TRP A 1 100 ? -5.496  -6.718  1.467   1.00 0.00 ? 100 TRP A HA   1  
ATOM 1564  H HB2  . TRP A 1 100 ? -5.192  -8.986  -0.467  1.00 0.00 ? 100 TRP A HB2  1  
ATOM 1565  H HB3  . TRP A 1 100 ? -4.020  -7.672  -0.482  1.00 0.00 ? 100 TRP A HB3  1  
ATOM 1566  H HD1  . TRP A 1 100 ? -4.971  -10.777 1.412   1.00 0.00 ? 100 TRP A HD1  1  
ATOM 1567  H HE1  . TRP A 1 100 ? -3.316  -11.147 3.349   1.00 0.00 ? 100 TRP A HE1  1  
ATOM 1568  H HE3  . TRP A 1 100 ? -2.539  -6.283  1.271   1.00 0.00 ? 100 TRP A HE3  1  
ATOM 1569  H HZ2  . TRP A 1 100 ? -1.253  -9.721  4.645   1.00 0.00 ? 100 TRP A HZ2  1  
ATOM 1570  H HZ3  . TRP A 1 100 ? -0.737  -5.865  2.894   1.00 0.00 ? 100 TRP A HZ3  1  
ATOM 1571  H HH2  . TRP A 1 100 ? -0.110  -7.550  4.546   1.00 0.00 ? 100 TRP A HH2  1  
ATOM 1572  N N    . ILE A 1 101 ? -6.508  -6.657  -1.684  1.00 0.00 ? 101 ILE A N    1  
ATOM 1573  C CA   . ILE A 1 101 ? -6.788  -5.769  -2.806  1.00 0.00 ? 101 ILE A CA   1  
ATOM 1574  C C    . ILE A 1 101 ? -7.449  -4.479  -2.334  1.00 0.00 ? 101 ILE A C    1  
ATOM 1575  O O    . ILE A 1 101 ? -7.201  -3.406  -2.884  1.00 0.00 ? 101 ILE A O    1  
ATOM 1576  C CB   . ILE A 1 101 ? -7.696  -6.447  -3.848  1.00 0.00 ? 101 ILE A CB   1  
ATOM 1577  C CG1  . ILE A 1 101 ? -6.969  -7.623  -4.503  1.00 0.00 ? 101 ILE A CG1  1  
ATOM 1578  C CG2  . ILE A 1 101 ? -8.141  -5.441  -4.899  1.00 0.00 ? 101 ILE A CG2  1  
ATOM 1579  C CD1  . ILE A 1 101 ? -7.893  -8.581  -5.222  1.00 0.00 ? 101 ILE A CD1  1  
ATOM 1580  H H    . ILE A 1 101 ? -6.638  -7.621  -1.794  1.00 0.00 ? 101 ILE A H    1  
ATOM 1581  H HA   . ILE A 1 101 ? -5.848  -5.526  -3.281  1.00 0.00 ? 101 ILE A HA   1  
ATOM 1582  H HB   . ILE A 1 101 ? -8.576  -6.814  -3.341  1.00 0.00 ? 101 ILE A HB   1  
ATOM 1583  H HG12 . ILE A 1 101 ? -6.260  -7.245  -5.221  1.00 0.00 ? 101 ILE A HG12 1  
ATOM 1584  H HG13 . ILE A 1 101 ? -6.441  -8.179  -3.741  1.00 0.00 ? 101 ILE A HG13 1  
ATOM 1585  H HG21 . ILE A 1 101 ? -7.272  -5.008  -5.372  1.00 0.00 ? 101 ILE A HG21 1  
ATOM 1586  H HG22 . ILE A 1 101 ? -8.744  -5.940  -5.642  1.00 0.00 ? 101 ILE A HG22 1  
ATOM 1587  H HG23 . ILE A 1 101 ? -8.720  -4.661  -4.428  1.00 0.00 ? 101 ILE A HG23 1  
ATOM 1588  H HD11 . ILE A 1 101 ? -8.405  -9.199  -4.500  1.00 0.00 ? 101 ILE A HD11 1  
ATOM 1589  H HD12 . ILE A 1 101 ? -8.617  -8.021  -5.795  1.00 0.00 ? 101 ILE A HD12 1  
ATOM 1590  H HD13 . ILE A 1 101 ? -7.315  -9.208  -5.886  1.00 0.00 ? 101 ILE A HD13 1  
ATOM 1591  N N    . GLN A 1 102 ? -8.290  -4.591  -1.311  1.00 0.00 ? 102 GLN A N    1  
ATOM 1592  C CA   . GLN A 1 102 ? -8.987  -3.433  -0.764  1.00 0.00 ? 102 GLN A CA   1  
ATOM 1593  C C    . GLN A 1 102 ? -8.133  -2.729  0.285   1.00 0.00 ? 102 GLN A C    1  
ATOM 1594  O O    . GLN A 1 102 ? -8.054  -1.502  0.315   1.00 0.00 ? 102 GLN A O    1  
ATOM 1595  C CB   . GLN A 1 102 ? -10.323 -3.857  -0.151  1.00 0.00 ? 102 GLN A CB   1  
ATOM 1596  C CG   . GLN A 1 102 ? -11.131 -4.789  -1.039  1.00 0.00 ? 102 GLN A CG   1  
ATOM 1597  C CD   . GLN A 1 102 ? -12.623 -4.683  -0.792  1.00 0.00 ? 102 GLN A CD   1  
ATOM 1598  O OE1  . GLN A 1 102 ? -13.072 -4.646  0.354   1.00 0.00 ? 102 GLN A OE1  1  
ATOM 1599  N NE2  . GLN A 1 102 ? -13.399 -4.633  -1.867  1.00 0.00 ? 102 GLN A NE2  1  
ATOM 1600  H H    . GLN A 1 102 ? -8.446  -5.473  -0.915  1.00 0.00 ? 102 GLN A H    1  
ATOM 1601  H HA   . GLN A 1 102 ? -9.175  -2.746  -1.575  1.00 0.00 ? 102 GLN A HA   1  
ATOM 1602  H HB2  . GLN A 1 102 ? -10.132 -4.360  0.784   1.00 0.00 ? 102 GLN A HB2  1  
ATOM 1603  H HB3  . GLN A 1 102 ? -10.914 -2.973  0.039   1.00 0.00 ? 102 GLN A HB3  1  
ATOM 1604  H HG2  . GLN A 1 102 ? -10.935 -4.542  -2.072  1.00 0.00 ? 102 GLN A HG2  1  
ATOM 1605  H HG3  . GLN A 1 102 ? -10.820 -5.805  -0.849  1.00 0.00 ? 102 GLN A HG3  1  
ATOM 1606  H HE21 . GLN A 1 102 ? -12.971 -4.669  -2.749  1.00 0.00 ? 102 GLN A HE21 1  
ATOM 1607  H HE22 . GLN A 1 102 ? -14.367 -4.566  -1.737  1.00 0.00 ? 102 GLN A HE22 1  
ATOM 1608  N N    . ALA A 1 103 ? -7.494  -3.516  1.146   1.00 0.00 ? 103 ALA A N    1  
ATOM 1609  C CA   . ALA A 1 103 ? -6.645  -2.969  2.196   1.00 0.00 ? 103 ALA A CA   1  
ATOM 1610  C C    . ALA A 1 103 ? -5.496  -2.158  1.606   1.00 0.00 ? 103 ALA A C    1  
ATOM 1611  O O    . ALA A 1 103 ? -5.402  -0.950  1.821   1.00 0.00 ? 103 ALA A O    1  
ATOM 1612  C CB   . ALA A 1 103 ? -6.106  -4.087  3.076   1.00 0.00 ? 103 ALA A CB   1  
ATOM 1613  H H    . ALA A 1 103 ? -7.596  -4.488  1.071   1.00 0.00 ? 103 ALA A H    1  
ATOM 1614  H HA   . ALA A 1 103 ? -7.251  -2.320  2.812   1.00 0.00 ? 103 ALA A HA   1  
ATOM 1615  H HB1  . ALA A 1 103 ? -6.535  -5.028  2.763   1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1616  H HB2  . ALA A 1 103 ? -5.032  -4.132  2.983   1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1617  H HB3  . ALA A 1 103 ? -6.372  -3.895  4.105   1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1618  N N    . MET A 1 104 ? -4.624  -2.831  0.862   1.00 0.00 ? 104 MET A N    1  
ATOM 1619  C CA   . MET A 1 104 ? -3.481  -2.171  0.241   1.00 0.00 ? 104 MET A CA   1  
ATOM 1620  C C    . MET A 1 104 ? -3.926  -1.301  -0.930  1.00 0.00 ? 104 MET A C    1  
ATOM 1621  O O    . MET A 1 104 ? -3.197  -0.413  -1.369  1.00 0.00 ? 104 MET A O    1  
ATOM 1622  C CB   . MET A 1 104 ? -2.464  -3.209  -0.238  1.00 0.00 ? 104 MET A CB   1  
ATOM 1623  C CG   . MET A 1 104 ? -2.895  -3.947  -1.495  1.00 0.00 ? 104 MET A CG   1  
ATOM 1624  S SD   . MET A 1 104 ? -1.566  -4.934  -2.211  1.00 0.00 ? 104 MET A SD   1  
ATOM 1625  C CE   . MET A 1 104 ? -1.124  -5.969  -0.817  1.00 0.00 ? 104 MET A CE   1  
ATOM 1626  H H    . MET A 1 104 ? -4.752  -3.793  0.727   1.00 0.00 ? 104 MET A H    1  
ATOM 1627  H HA   . MET A 1 104 ? -3.017  -1.542  0.985   1.00 0.00 ? 104 MET A HA   1  
ATOM 1628  H HB2  . MET A 1 104 ? -1.528  -2.711  -0.441  1.00 0.00 ? 104 MET A HB2  1  
ATOM 1629  H HB3  . MET A 1 104 ? -2.313  -3.936  0.546   1.00 0.00 ? 104 MET A HB3  1  
ATOM 1630  H HG2  . MET A 1 104 ? -3.716  -4.603  -1.248  1.00 0.00 ? 104 MET A HG2  1  
ATOM 1631  H HG3  . MET A 1 104 ? -3.222  -3.223  -2.226  1.00 0.00 ? 104 MET A HG3  1  
ATOM 1632  H HE1  . MET A 1 104 ? -0.934  -5.349  0.046   1.00 0.00 ? 104 MET A HE1  1  
ATOM 1633  H HE2  . MET A 1 104 ? -1.936  -6.647  -0.602  1.00 0.00 ? 104 MET A HE2  1  
ATOM 1634  H HE3  . MET A 1 104 ? -0.236  -6.535  -1.057  1.00 0.00 ? 104 MET A HE3  1  
ATOM 1635  N N    . GLY A 1 105 ? -5.129  -1.563  -1.433  1.00 0.00 ? 105 GLY A N    1  
ATOM 1636  C CA   . GLY A 1 105 ? -5.650  -0.796  -2.549  1.00 0.00 ? 105 GLY A CA   1  
ATOM 1637  C C    . GLY A 1 105 ? -6.116  0.586   -2.135  1.00 0.00 ? 105 GLY A C    1  
ATOM 1638  O O    . GLY A 1 105 ? -5.782  1.579   -2.780  1.00 0.00 ? 105 GLY A O    1  
ATOM 1639  H H    . GLY A 1 105 ? -5.667  -2.284  -1.043  1.00 0.00 ? 105 GLY A H    1  
ATOM 1640  H HA2  . GLY A 1 105 ? -4.875  -0.694  -3.295  1.00 0.00 ? 105 GLY A HA2  1  
ATOM 1641  H HA3  . GLY A 1 105 ? -6.483  -1.330  -2.981  1.00 0.00 ? 105 GLY A HA3  1  
ATOM 1642  N N    . GLU A 1 106 ? -6.891  0.649   -1.057  1.00 0.00 ? 106 GLU A N    1  
ATOM 1643  C CA   . GLU A 1 106 ? -7.406  1.920   -0.561  1.00 0.00 ? 106 GLU A CA   1  
ATOM 1644  C C    . GLU A 1 106 ? -6.266  2.891   -0.268  1.00 0.00 ? 106 GLU A C    1  
ATOM 1645  O O    . GLU A 1 106 ? -6.288  4.041   -0.707  1.00 0.00 ? 106 GLU A O    1  
ATOM 1646  C CB   . GLU A 1 106 ? -8.239  1.699   0.703   1.00 0.00 ? 106 GLU A CB   1  
ATOM 1647  C CG   . GLU A 1 106 ? -7.429  1.769   1.987   1.00 0.00 ? 106 GLU A CG   1  
ATOM 1648  C CD   . GLU A 1 106 ? -8.294  1.673   3.229   1.00 0.00 ? 106 GLU A CD   1  
ATOM 1649  O OE1  . GLU A 1 106 ? -9.138  2.571   3.434   1.00 0.00 ? 106 GLU A OE1  1  
ATOM 1650  O OE2  . GLU A 1 106 ? -8.127  0.701   3.995   1.00 0.00 ? 106 GLU A OE2  1  
ATOM 1651  H H    . GLU A 1 106 ? -7.123  -0.178  -0.586  1.00 0.00 ? 106 GLU A H    1  
ATOM 1652  H HA   . GLU A 1 106 ? -8.036  2.344   -1.327  1.00 0.00 ? 106 GLU A HA   1  
ATOM 1653  H HB2  . GLU A 1 106 ? -9.011  2.453   0.747   1.00 0.00 ? 106 GLU A HB2  1  
ATOM 1654  H HB3  . GLU A 1 106 ? -8.703  0.725   0.648   1.00 0.00 ? 106 GLU A HB3  1  
ATOM 1655  H HG2  . GLU A 1 106 ? -6.722  0.953   1.996   1.00 0.00 ? 106 GLU A HG2  1  
ATOM 1656  H HG3  . GLU A 1 106 ? -6.895  2.707   2.010   1.00 0.00 ? 106 GLU A HG3  1  
ATOM 1657  N N    . ALA A 1 107 ? -5.272  2.420   0.478   1.00 0.00 ? 107 ALA A N    1  
ATOM 1658  C CA   . ALA A 1 107 ? -4.123  3.246   0.829   1.00 0.00 ? 107 ALA A CA   1  
ATOM 1659  C C    . ALA A 1 107 ? -3.468  3.834   -0.417  1.00 0.00 ? 107 ALA A C    1  
ATOM 1660  O O    . ALA A 1 107 ? -2.821  4.878   -0.355  1.00 0.00 ? 107 ALA A O    1  
ATOM 1661  C CB   . ALA A 1 107 ? -3.112  2.433   1.624   1.00 0.00 ? 107 ALA A CB   1  
ATOM 1662  H H    . ALA A 1 107 ? -5.312  1.495   0.799   1.00 0.00 ? 107 ALA A H    1  
ATOM 1663  H HA   . ALA A 1 107 ? -4.471  4.054   1.456   1.00 0.00 ? 107 ALA A HA   1  
ATOM 1664  H HB1  . ALA A 1 107 ? -2.584  1.766   0.958   1.00 0.00 ? 107 ALA A HB1  1  
ATOM 1665  H HB2  . ALA A 1 107 ? -2.408  3.100   2.100   1.00 0.00 ? 107 ALA A HB2  1  
ATOM 1666  H HB3  . ALA A 1 107 ? -3.628  1.856   2.377   1.00 0.00 ? 107 ALA A HB3  1  
ATOM 1667  N N    . ALA A 1 108 ? -3.641  3.155   -1.547  1.00 0.00 ? 108 ALA A N    1  
ATOM 1668  C CA   . ALA A 1 108 ? -3.068  3.612   -2.807  1.00 0.00 ? 108 ALA A CA   1  
ATOM 1669  C C    . ALA A 1 108 ? -4.016  4.565   -3.527  1.00 0.00 ? 108 ALA A C    1  
ATOM 1670  O O    . ALA A 1 108 ? -3.579  5.495   -4.205  1.00 0.00 ? 108 ALA A O    1  
ATOM 1671  C CB   . ALA A 1 108 ? -2.735  2.423   -3.696  1.00 0.00 ? 108 ALA A CB   1  
ATOM 1672  H H    . ALA A 1 108 ? -4.167  2.329   -1.532  1.00 0.00 ? 108 ALA A H    1  
ATOM 1673  H HA   . ALA A 1 108 ? -2.148  4.134   -2.586  1.00 0.00 ? 108 ALA A HA   1  
ATOM 1674  H HB1  . ALA A 1 108 ? -1.740  2.070   -3.465  1.00 0.00 ? 108 ALA A HB1  1  
ATOM 1675  H HB2  . ALA A 1 108 ? -3.448  1.631   -3.521  1.00 0.00 ? 108 ALA A HB2  1  
ATOM 1676  H HB3  . ALA A 1 108 ? -2.779  2.725   -4.732  1.00 0.00 ? 108 ALA A HB3  1  
ATOM 1677  N N    . ARG A 1 109 ? -5.315  4.326   -3.378  1.00 0.00 ? 109 ARG A N    1  
ATOM 1678  C CA   . ARG A 1 109 ? -6.324  5.162   -4.016  1.00 0.00 ? 109 ARG A CA   1  
ATOM 1679  C C    . ARG A 1 109 ? -6.607  6.407   -3.180  1.00 0.00 ? 109 ARG A C    1  
ATOM 1680  O O    . ARG A 1 109 ? -6.401  6.412   -1.966  1.00 0.00 ? 109 ARG A O    1  
ATOM 1681  C CB   . ARG A 1 109 ? -7.616  4.370   -4.224  1.00 0.00 ? 109 ARG A CB   1  
ATOM 1682  C CG   . ARG A 1 109 ? -8.561  4.423   -3.035  1.00 0.00 ? 109 ARG A CG   1  
ATOM 1683  C CD   . ARG A 1 109 ? -9.586  3.301   -3.088  1.00 0.00 ? 109 ARG A CD   1  
ATOM 1684  N NE   . ARG A 1 109 ? -10.334 3.183   -1.839  1.00 0.00 ? 109 ARG A NE   1  
ATOM 1685  C CZ   . ARG A 1 109 ? -11.292 4.027   -1.473  1.00 0.00 ? 109 ARG A CZ   1  
ATOM 1686  N NH1  . ARG A 1 109 ? -11.618 5.045   -2.257  1.00 0.00 ? 109 ARG A NH1  1  
ATOM 1687  N NH2  . ARG A 1 109 ? -11.926 3.853   -0.320  1.00 0.00 ? 109 ARG A NH2  1  
ATOM 1688  H H    . ARG A 1 109 ? -5.601  3.569   -2.825  1.00 0.00 ? 109 ARG A H    1  
ATOM 1689  H HA   . ARG A 1 109 ? -5.941  5.468   -4.978  1.00 0.00 ? 109 ARG A HA   1  
ATOM 1690  H HB2  . ARG A 1 109 ? -8.134  4.768   -5.085  1.00 0.00 ? 109 ARG A HB2  1  
ATOM 1691  H HB3  . ARG A 1 109 ? -7.364  3.337   -4.411  1.00 0.00 ? 109 ARG A HB3  1  
ATOM 1692  H HG2  . ARG A 1 109 ? -7.986  4.327   -2.126  1.00 0.00 ? 109 ARG A HG2  1  
ATOM 1693  H HG3  . ARG A 1 109 ? -9.077  5.371   -3.039  1.00 0.00 ? 109 ARG A HG3  1  
ATOM 1694  H HD2  . ARG A 1 109 ? -10.278 3.502   -3.892  1.00 0.00 ? 109 ARG A HD2  1  
ATOM 1695  H HD3  . ARG A 1 109 ? -9.073  2.371   -3.279  1.00 0.00 ? 109 ARG A HD3  1  
ATOM 1696  H HE   . ARG A 1 109 ? -10.109 2.437   -1.244  1.00 0.00 ? 109 ARG A HE   1  
ATOM 1697  H HH11 . ARG A 1 109 ? -11.142 5.178   -3.126  1.00 0.00 ? 109 ARG A HH11 1  
ATOM 1698  H HH12 . ARG A 1 109 ? -12.340 5.679   -1.979  1.00 0.00 ? 109 ARG A HH12 1  
ATOM 1699  H HH21 . ARG A 1 109 ? -11.683 3.086   0.273   1.00 0.00 ? 109 ARG A HH21 1  
ATOM 1700  H HH22 . ARG A 1 109 ? -12.647 4.489   -0.046  1.00 0.00 ? 109 ARG A HH22 1  
ATOM 1701  N N    . VAL A 1 110 ? -7.080  7.461   -3.838  1.00 0.00 ? 110 VAL A N    1  
ATOM 1702  C CA   . VAL A 1 110 ? -7.391  8.711   -3.156  1.00 0.00 ? 110 VAL A CA   1  
ATOM 1703  C C    . VAL A 1 110 ? -8.760  9.238   -3.573  1.00 0.00 ? 110 VAL A C    1  
ATOM 1704  O O    . VAL A 1 110 ? -8.954  9.649   -4.716  1.00 0.00 ? 110 VAL A O    1  
ATOM 1705  C CB   . VAL A 1 110 ? -6.329  9.788   -3.445  1.00 0.00 ? 110 VAL A CB   1  
ATOM 1706  C CG1  . VAL A 1 110 ? -6.670  11.082  -2.723  1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1707  C CG2  . VAL A 1 110 ? -4.947  9.293   -3.045  1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1708  H H    . VAL A 1 110 ? -7.223  7.395   -4.805  1.00 0.00 ? 110 VAL A H    1  
ATOM 1709  H HA   . VAL A 1 110 ? -7.399  8.519   -2.093  1.00 0.00 ? 110 VAL A HA   1  
ATOM 1710  H HB   . VAL A 1 110 ? -6.324  9.984   -4.507  1.00 0.00 ? 110 VAL A HB   1  
ATOM 1711  H HG11 . VAL A 1 110 ? -6.660  11.901  -3.428  1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1712  H HG12 . VAL A 1 110 ? -7.652  11.000  -2.280  1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1713  H HG13 . VAL A 1 110 ? -5.939  11.266  -1.949  1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1714  H HG21 . VAL A 1 110 ? -4.830  9.381   -1.975  1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1715  H HG22 . VAL A 1 110 ? -4.836  8.258   -3.335  1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1716  H HG23 . VAL A 1 110 ? -4.194  9.888   -3.540  1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1717  N N    . GLN A 1 111 ? -9.704  9.223   -2.638  1.00 0.00 ? 111 GLN A N    1  
ATOM 1718  C CA   . GLN A 1 111 ? -11.055 9.699   -2.909  1.00 0.00 ? 111 GLN A CA   1  
ATOM 1719  C C    . GLN A 1 111 ? -11.077 11.217  -3.058  1.00 0.00 ? 111 GLN A C    1  
ATOM 1720  O O    . GLN A 1 111 ? -10.133 11.903  -2.665  1.00 0.00 ? 111 GLN A O    1  
ATOM 1721  C CB   . GLN A 1 111 ? -12.004 9.271   -1.788  1.00 0.00 ? 111 GLN A CB   1  
ATOM 1722  C CG   . GLN A 1 111 ? -11.716 9.946   -0.456  1.00 0.00 ? 111 GLN A CG   1  
ATOM 1723  C CD   . GLN A 1 111 ? -10.531 9.334   0.264   1.00 0.00 ? 111 GLN A CD   1  
ATOM 1724  O OE1  . GLN A 1 111 ? -9.471  9.951   0.375   1.00 0.00 ? 111 GLN A OE1  1  
ATOM 1725  N NE2  . GLN A 1 111 ? -10.704 8.113   0.758   1.00 0.00 ? 111 GLN A NE2  1  
ATOM 1726  H H    . GLN A 1 111 ? -9.487  8.883   -1.745  1.00 0.00 ? 111 GLN A H    1  
ATOM 1727  H HA   . GLN A 1 111 ? -11.383 9.255   -3.836  1.00 0.00 ? 111 GLN A HA   1  
ATOM 1728  H HB2  . GLN A 1 111 ? -13.016 9.512   -2.078  1.00 0.00 ? 111 GLN A HB2  1  
ATOM 1729  H HB3  . GLN A 1 111 ? -11.921 8.203   -1.651  1.00 0.00 ? 111 GLN A HB3  1  
ATOM 1730  H HG2  . GLN A 1 111 ? -11.509 10.991  -0.634  1.00 0.00 ? 111 GLN A HG2  1  
ATOM 1731  H HG3  . GLN A 1 111 ? -12.588 9.855   0.174   1.00 0.00 ? 111 GLN A HG3  1  
ATOM 1732  H HE21 . GLN A 1 111 ? -11.575 7.682   0.630   1.00 0.00 ? 111 GLN A HE21 1  
ATOM 1733  H HE22 . GLN A 1 111 ? -9.954  7.694   1.227   1.00 0.00 ? 111 GLN A HE22 1  
ATOM 1734  N N    . SER A 1 112 ? -12.160 11.735  -3.627  1.00 0.00 ? 112 SER A N    1  
ATOM 1735  C CA   . SER A 1 112 ? -12.304 13.172  -3.832  1.00 0.00 ? 112 SER A CA   1  
ATOM 1736  C C    . SER A 1 112 ? -10.994 13.784  -4.320  1.00 0.00 ? 112 SER A C    1  
ATOM 1737  O O    . SER A 1 112 ? -10.547 14.810  -3.809  1.00 0.00 ? 112 SER A O    1  
ATOM 1738  C CB   . SER A 1 112 ? -12.746 13.852  -2.535  1.00 0.00 ? 112 SER A CB   1  
ATOM 1739  O OG   . SER A 1 112 ? -11.766 13.703  -1.522  1.00 0.00 ? 112 SER A OG   1  
ATOM 1740  H H    . SER A 1 112 ? -12.879 11.136  -3.919  1.00 0.00 ? 112 SER A H    1  
ATOM 1741  H HA   . SER A 1 112 ? -13.062 13.325  -4.586  1.00 0.00 ? 112 SER A HA   1  
ATOM 1742  H HB2  . SER A 1 112 ? -12.901 14.904  -2.718  1.00 0.00 ? 112 SER A HB2  1  
ATOM 1743  H HB3  . SER A 1 112 ? -13.669 13.405  -2.195  1.00 0.00 ? 112 SER A HB3  1  
ATOM 1744  H HG   . SER A 1 112 ? -10.891 13.751  -1.913  1.00 0.00 ? 112 SER A HG   1  
ATOM 1745  N N    . GLY A 1 113 ? -10.383 13.146  -5.313  1.00 0.00 ? 113 GLY A N    1  
ATOM 1746  C CA   . GLY A 1 113 ? -9.131  13.641  -5.854  1.00 0.00 ? 113 GLY A CA   1  
ATOM 1747  C C    . GLY A 1 113 ? -9.189  13.850  -7.354  1.00 0.00 ? 113 GLY A C    1  
ATOM 1748  O O    . GLY A 1 113 ? -10.004 13.249  -8.055  1.00 0.00 ? 113 GLY A O    1  
ATOM 1749  H H    . GLY A 1 113 ? -10.786 12.332  -5.682  1.00 0.00 ? 113 GLY A H    1  
ATOM 1750  H HA2  . GLY A 1 113 ? -8.892  14.581  -5.379  1.00 0.00 ? 113 GLY A HA2  1  
ATOM 1751  H HA3  . GLY A 1 113 ? -8.349  12.929  -5.632  1.00 0.00 ? 113 GLY A HA3  1  
ATOM 1752  N N    . PRO A 1 114 ? -8.310  14.723  -7.869  1.00 0.00 ? 114 PRO A N    1  
ATOM 1753  C CA   . PRO A 1 114 ? -8.247  15.032  -9.300  1.00 0.00 ? 114 PRO A CA   1  
ATOM 1754  C C    . PRO A 1 114 ? -7.715  13.862  -10.122 1.00 0.00 ? 114 PRO A C    1  
ATOM 1755  O O    . PRO A 1 114 ? -7.399  12.803  -9.580  1.00 0.00 ? 114 PRO A O    1  
ATOM 1756  C CB   . PRO A 1 114 ? -7.278  16.215  -9.365  1.00 0.00 ? 114 PRO A CB   1  
ATOM 1757  C CG   . PRO A 1 114 ? -6.427  16.075  -8.151  1.00 0.00 ? 114 PRO A CG   1  
ATOM 1758  C CD   . PRO A 1 114 ? -7.311  15.476  -7.092  1.00 0.00 ? 114 PRO A CD   1  
ATOM 1759  H HA   . PRO A 1 114 ? -9.210  15.331  -9.685  1.00 0.00 ? 114 PRO A HA   1  
ATOM 1760  H HB2  . PRO A 1 114 ? -6.690  16.153  -10.270 1.00 0.00 ? 114 PRO A HB2  1  
ATOM 1761  H HB3  . PRO A 1 114 ? -7.834  17.141  -9.354  1.00 0.00 ? 114 PRO A HB3  1  
ATOM 1762  H HG2  . PRO A 1 114 ? -5.595  15.420  -8.359  1.00 0.00 ? 114 PRO A HG2  1  
ATOM 1763  H HG3  . PRO A 1 114 ? -6.073  17.046  -7.837  1.00 0.00 ? 114 PRO A HG3  1  
ATOM 1764  H HD2  . PRO A 1 114 ? -6.742  14.817  -6.454  1.00 0.00 ? 114 PRO A HD2  1  
ATOM 1765  H HD3  . PRO A 1 114 ? -7.783  16.254  -6.510  1.00 0.00 ? 114 PRO A HD3  1  
ATOM 1766  N N    . SER A 1 115 ? -7.618  14.061  -11.432 1.00 0.00 ? 115 SER A N    1  
ATOM 1767  C CA   . SER A 1 115 ? -7.128  13.021  -12.329 1.00 0.00 ? 115 SER A CA   1  
ATOM 1768  C C    . SER A 1 115 ? -7.744  11.669  -11.983 1.00 0.00 ? 115 SER A C    1  
ATOM 1769  O O    . SER A 1 115 ? -7.059  10.647  -11.970 1.00 0.00 ? 115 SER A O    1  
ATOM 1770  C CB   . SER A 1 115 ? -5.602  12.933  -12.256 1.00 0.00 ? 115 SER A CB   1  
ATOM 1771  O OG   . SER A 1 115 ? -5.078  12.227  -13.367 1.00 0.00 ? 115 SER A OG   1  
ATOM 1772  H H    . SER A 1 115 ? -7.886  14.927  -11.805 1.00 0.00 ? 115 SER A H    1  
ATOM 1773  H HA   . SER A 1 115 ? -7.416  13.288  -13.335 1.00 0.00 ? 115 SER A HA   1  
ATOM 1774  H HB2  . SER A 1 115 ? -5.186  13.929  -12.249 1.00 0.00 ? 115 SER A HB2  1  
ATOM 1775  H HB3  . SER A 1 115 ? -5.318  12.417  -11.350 1.00 0.00 ? 115 SER A HB3  1  
ATOM 1776  H HG   . SER A 1 115 ? -4.544  12.819  -13.900 1.00 0.00 ? 115 SER A HG   1  
ATOM 1777  N N    . SER A 1 116 ? -9.044  11.673  -11.702 1.00 0.00 ? 116 SER A N    1  
ATOM 1778  C CA   . SER A 1 116 ? -9.753  10.449  -11.351 1.00 0.00 ? 116 SER A CA   1  
ATOM 1779  C C    . SER A 1 116 ? -11.236 10.563  -11.694 1.00 0.00 ? 116 SER A C    1  
ATOM 1780  O O    . SER A 1 116 ? -11.881 11.564  -11.384 1.00 0.00 ? 116 SER A O    1  
ATOM 1781  C CB   . SER A 1 116 ? -9.584  10.145  -9.861  1.00 0.00 ? 116 SER A CB   1  
ATOM 1782  O OG   . SER A 1 116 ? -10.488 9.138   -9.440  1.00 0.00 ? 116 SER A OG   1  
ATOM 1783  H H    . SER A 1 116 ? -9.536  12.521  -11.729 1.00 0.00 ? 116 SER A H    1  
ATOM 1784  H HA   . SER A 1 116 ? -9.324  9.641   -11.925 1.00 0.00 ? 116 SER A HA   1  
ATOM 1785  H HB2  . SER A 1 116 ? -8.576  9.807   -9.678  1.00 0.00 ? 116 SER A HB2  1  
ATOM 1786  H HB3  . SER A 1 116 ? -9.772  11.043  -9.290  1.00 0.00 ? 116 SER A HB3  1  
ATOM 1787  H HG   . SER A 1 116 ? -10.657 9.232   -8.500  1.00 0.00 ? 116 SER A HG   1  
ATOM 1788  N N    . GLY A 1 117 ? -11.770 9.528   -12.336 1.00 0.00 ? 117 GLY A N    1  
ATOM 1789  C CA   . GLY A 1 117 ? -13.172 9.531   -12.711 1.00 0.00 ? 117 GLY A CA   1  
ATOM 1790  C C    . GLY A 1 117 ? -13.917 8.324   -12.177 1.00 0.00 ? 117 GLY A C    1  
ATOM 1791  O O    . GLY A 1 117 ? -14.514 8.380   -11.102 1.00 0.00 ? 117 GLY A O    1  
ATOM 1792  H H    . GLY A 1 117 ? -11.207 8.757   -12.557 1.00 0.00 ? 117 GLY A H    1  
ATOM 1793  H HA2  . GLY A 1 117 ? -13.635 10.427  -12.324 1.00 0.00 ? 117 GLY A HA2  1  
ATOM 1794  H HA3  . GLY A 1 117 ? -13.244 9.537   -13.788 1.00 0.00 ? 117 GLY A HA3  1  
ATOM 1795  N N    . GLY A 1 1   ? 15.167  13.881  -1.920  1.00 0.00 ? 1   GLY A N    2  
ATOM 1796  C CA   . GLY A 1 1   ? 15.110  14.174  -0.500  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1797  C C    . GLY A 1 1   ? 13.770  13.816  0.112   1.00 0.00 ? 1   GLY A C    2  
ATOM 1798  O O    . GLY A 1 1   ? 12.721  14.202  -0.404  1.00 0.00 ? 1   GLY A O    2  
ATOM 1799  H H1   . GLY A 1 1   ? 14.342  13.680  -2.411  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1800  H HA2  . GLY A 1 1   ? 15.885  13.616  0.003   1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1801  H HA3  . GLY A 1 1   ? 15.288  15.230  -0.355  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1802  N N    . SER A 1 2   ? 13.804  13.076  1.215   1.00 0.00 ? 2   SER A N    2  
ATOM 1803  C CA   . SER A 1 2   ? 12.583  12.661  1.895   1.00 0.00 ? 2   SER A CA   2  
ATOM 1804  C C    . SER A 1 2   ? 11.864  13.862  2.502   1.00 0.00 ? 2   SER A C    2  
ATOM 1805  O O    . SER A 1 2   ? 12.498  14.797  2.991   1.00 0.00 ? 2   SER A O    2  
ATOM 1806  C CB   . SER A 1 2   ? 12.905  11.640  2.988   1.00 0.00 ? 2   SER A CB   2  
ATOM 1807  O OG   . SER A 1 2   ? 13.108  10.350  2.438   1.00 0.00 ? 2   SER A OG   2  
ATOM 1808  H H    . SER A 1 2   ? 14.672  12.800  1.579   1.00 0.00 ? 2   SER A H    2  
ATOM 1809  H HA   . SER A 1 2   ? 11.936  12.200  1.164   1.00 0.00 ? 2   SER A HA   2  
ATOM 1810  H HB2  . SER A 1 2   ? 13.801  11.942  3.507   1.00 0.00 ? 2   SER A HB2  2  
ATOM 1811  H HB3  . SER A 1 2   ? 12.082  11.594  3.688   1.00 0.00 ? 2   SER A HB3  2  
ATOM 1812  H HG   . SER A 1 2   ? 12.275  10.008  2.106   1.00 0.00 ? 2   SER A HG   2  
ATOM 1813  N N    . SER A 1 3   ? 10.535  13.829  2.465   1.00 0.00 ? 3   SER A N    2  
ATOM 1814  C CA   . SER A 1 3   ? 9.728   14.916  3.006   1.00 0.00 ? 3   SER A CA   2  
ATOM 1815  C C    . SER A 1 3   ? 8.770   14.401  4.076   1.00 0.00 ? 3   SER A C    2  
ATOM 1816  O O    . SER A 1 3   ? 7.606   14.795  4.124   1.00 0.00 ? 3   SER A O    2  
ATOM 1817  C CB   . SER A 1 3   ? 8.942   15.602  1.888   1.00 0.00 ? 3   SER A CB   2  
ATOM 1818  O OG   . SER A 1 3   ? 9.772   16.473  1.140   1.00 0.00 ? 3   SER A OG   2  
ATOM 1819  H H    . SER A 1 3   ? 10.088  13.056  2.061   1.00 0.00 ? 3   SER A H    2  
ATOM 1820  H HA   . SER A 1 3   ? 10.398  15.634  3.456   1.00 0.00 ? 3   SER A HA   2  
ATOM 1821  H HB2  . SER A 1 3   ? 8.537   14.853  1.225   1.00 0.00 ? 3   SER A HB2  2  
ATOM 1822  H HB3  . SER A 1 3   ? 8.134   16.175  2.319   1.00 0.00 ? 3   SER A HB3  2  
ATOM 1823  H HG   . SER A 1 3   ? 9.901   16.115  0.259   1.00 0.00 ? 3   SER A HG   2  
ATOM 1824  N N    . GLY A 1 4   ? 9.270   13.515  4.933   1.00 0.00 ? 4   GLY A N    2  
ATOM 1825  C CA   . GLY A 1 4   ? 8.446   12.959  5.990   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1826  C C    . GLY A 1 4   ? 9.173   12.894  7.318   1.00 0.00 ? 4   GLY A C    2  
ATOM 1827  O O    . GLY A 1 4   ? 10.352  13.237  7.406   1.00 0.00 ? 4   GLY A O    2  
ATOM 1828  H H    . GLY A 1 4   ? 10.206  13.238  4.846   1.00 0.00 ? 4   GLY A H    2  
ATOM 1829  H HA2  . GLY A 1 4   ? 7.564   13.572  6.104   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1830  H HA3  . GLY A 1 4   ? 8.145   11.961  5.708   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1831  N N    . SER A 1 5   ? 8.469   12.453  8.356   1.00 0.00 ? 5   SER A N    2  
ATOM 1832  C CA   . SER A 1 5   ? 9.054   12.349  9.688   1.00 0.00 ? 5   SER A CA   2  
ATOM 1833  C C    . SER A 1 5   ? 8.961   10.919  10.211  1.00 0.00 ? 5   SER A C    2  
ATOM 1834  O O    . SER A 1 5   ? 8.244   10.088  9.655   1.00 0.00 ? 5   SER A O    2  
ATOM 1835  C CB   . SER A 1 5   ? 8.349   13.305  10.653  1.00 0.00 ? 5   SER A CB   2  
ATOM 1836  O OG   . SER A 1 5   ? 7.083   12.798  11.039  1.00 0.00 ? 5   SER A OG   2  
ATOM 1837  H H    . SER A 1 5   ? 7.533   12.194  8.222   1.00 0.00 ? 5   SER A H    2  
ATOM 1838  H HA   . SER A 1 5   ? 10.095  12.627  9.615   1.00 0.00 ? 5   SER A HA   2  
ATOM 1839  H HB2  . SER A 1 5   ? 8.956   13.433  11.536  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1840  H HB3  . SER A 1 5   ? 8.209   14.261  10.170  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1841  H HG   . SER A 1 5   ? 6.717   12.273  10.324  1.00 0.00 ? 5   SER A HG   2  
ATOM 1842  N N    . SER A 1 6   ? 9.691   10.641  11.287  1.00 0.00 ? 6   SER A N    2  
ATOM 1843  C CA   . SER A 1 6   ? 9.696   9.311   11.885  1.00 0.00 ? 6   SER A CA   2  
ATOM 1844  C C    . SER A 1 6   ? 8.579   9.176   12.916  1.00 0.00 ? 6   SER A C    2  
ATOM 1845  O O    . SER A 1 6   ? 8.003   10.169  13.358  1.00 0.00 ? 6   SER A O    2  
ATOM 1846  C CB   . SER A 1 6   ? 11.048  9.028   12.541  1.00 0.00 ? 6   SER A CB   2  
ATOM 1847  O OG   . SER A 1 6   ? 11.388  10.044  13.468  1.00 0.00 ? 6   SER A OG   2  
ATOM 1848  H H    . SER A 1 6   ? 10.243  11.347  11.685  1.00 0.00 ? 6   SER A H    2  
ATOM 1849  H HA   . SER A 1 6   ? 9.530   8.593   11.096  1.00 0.00 ? 6   SER A HA   2  
ATOM 1850  H HB2  . SER A 1 6   ? 11.003  8.084   13.061  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1851  H HB3  . SER A 1 6   ? 11.812  8.983   11.778  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1852  H HG   . SER A 1 6   ? 10.636  10.222  14.038  1.00 0.00 ? 6   SER A HG   2  
ATOM 1853  N N    . GLY A 1 7   ? 8.280   7.937   13.295  1.00 0.00 ? 7   GLY A N    2  
ATOM 1854  C CA   . GLY A 1 7   ? 7.234   7.693   14.271  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1855  C C    . GLY A 1 7   ? 6.603   6.324   14.114  1.00 0.00 ? 7   GLY A C    2  
ATOM 1856  O O    . GLY A 1 7   ? 6.646   5.733   13.036  1.00 0.00 ? 7   GLY A O    2  
ATOM 1857  H H    . GLY A 1 7   ? 8.773   7.183   12.909  1.00 0.00 ? 7   GLY A H    2  
ATOM 1858  H HA2  . GLY A 1 7   ? 7.655   7.772   15.262  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1859  H HA3  . GLY A 1 7   ? 6.467   8.445   14.156  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1860  N N    . ASN A 1 8   ? 6.016   5.817   15.194  1.00 0.00 ? 8   ASN A N    2  
ATOM 1861  C CA   . ASN A 1 8   ? 5.375   4.507   15.172  1.00 0.00 ? 8   ASN A CA   2  
ATOM 1862  C C    . ASN A 1 8   ? 3.905   4.627   14.779  1.00 0.00 ? 8   ASN A C    2  
ATOM 1863  O O    . ASN A 1 8   ? 3.181   5.477   15.296  1.00 0.00 ? 8   ASN A O    2  
ATOM 1864  C CB   . ASN A 1 8   ? 5.495   3.834   16.541  1.00 0.00 ? 8   ASN A CB   2  
ATOM 1865  C CG   . ASN A 1 8   ? 5.151   2.358   16.492  1.00 0.00 ? 8   ASN A CG   2  
ATOM 1866  O OD1  . ASN A 1 8   ? 6.010   1.518   16.225  1.00 0.00 ? 8   ASN A OD1  2  
ATOM 1867  N ND2  . ASN A 1 8   ? 3.889   2.036   16.749  1.00 0.00 ? 8   ASN A ND2  2  
ATOM 1868  H H    . ASN A 1 8   ? 6.013   6.336   16.025  1.00 0.00 ? 8   ASN A H    2  
ATOM 1869  H HA   . ASN A 1 8   ? 5.884   3.902   14.437  1.00 0.00 ? 8   ASN A HA   2  
ATOM 1870  H HB2  . ASN A 1 8   ? 6.510   3.936   16.897  1.00 0.00 ? 8   ASN A HB2  2  
ATOM 1871  H HB3  . ASN A 1 8   ? 4.824   4.319   17.234  1.00 0.00 ? 8   ASN A HB3  2  
ATOM 1872  H HD21 . ASN A 1 8   ? 3.259   2.759   16.954  1.00 0.00 ? 8   ASN A HD21 2  
ATOM 1873  H HD22 . ASN A 1 8   ? 3.639   1.089   16.725  1.00 0.00 ? 8   ASN A HD22 2  
ATOM 1874  N N    . ALA A 1 9   ? 3.472   3.769   13.861  1.00 0.00 ? 9   ALA A N    2  
ATOM 1875  C CA   . ALA A 1 9   ? 2.089   3.777   13.401  1.00 0.00 ? 9   ALA A CA   2  
ATOM 1876  C C    . ALA A 1 9   ? 1.453   2.399   13.553  1.00 0.00 ? 9   ALA A C    2  
ATOM 1877  O O    . ALA A 1 9   ? 2.136   1.379   13.634  1.00 0.00 ? 9   ALA A O    2  
ATOM 1878  C CB   . ALA A 1 9   ? 2.018   4.236   11.952  1.00 0.00 ? 9   ALA A CB   2  
ATOM 1879  H H    . ALA A 1 9   ? 4.097   3.115   13.486  1.00 0.00 ? 9   ALA A H    2  
ATOM 1880  H HA   . ALA A 1 9   ? 1.540   4.485   14.005  1.00 0.00 ? 9   ALA A HA   2  
ATOM 1881  H HB1  . ALA A 1 9   ? 3.019   4.353   11.562  1.00 0.00 ? 9   ALA A HB1  2  
ATOM 1882  H HB2  . ALA A 1 9   ? 1.487   3.500   11.367  1.00 0.00 ? 9   ALA A HB2  2  
ATOM 1883  H HB3  . ALA A 1 9   ? 1.499   5.182   11.900  1.00 0.00 ? 9   ALA A HB3  2  
ATOM 1884  N N    . PRO A 1 10  ? 0.112   2.368   13.593  1.00 0.00 ? 10  PRO A N    2  
ATOM 1885  C CA   . PRO A 1 10  ? -0.646  1.121   13.736  1.00 0.00 ? 10  PRO A CA   2  
ATOM 1886  C C    . PRO A 1 10  ? -0.565  0.247   12.489  1.00 0.00 ? 10  PRO A C    2  
ATOM 1887  O O    . PRO A 1 10  ? -0.203  0.719   11.411  1.00 0.00 ? 10  PRO A O    2  
ATOM 1888  C CB   . PRO A 1 10  ? -2.081  1.603   13.959  1.00 0.00 ? 10  PRO A CB   2  
ATOM 1889  C CG   . PRO A 1 10  ? -2.134  2.947   13.320  1.00 0.00 ? 10  PRO A CG   2  
ATOM 1890  C CD   . PRO A 1 10  ? -0.766  3.546   13.502  1.00 0.00 ? 10  PRO A CD   2  
ATOM 1891  H HA   . PRO A 1 10  ? -0.317  0.553   14.594  1.00 0.00 ? 10  PRO A HA   2  
ATOM 1892  H HB2  . PRO A 1 10  ? -2.772  0.915   13.491  1.00 0.00 ? 10  PRO A HB2  2  
ATOM 1893  H HB3  . PRO A 1 10  ? -2.285  1.661   15.018  1.00 0.00 ? 10  PRO A HB3  2  
ATOM 1894  H HG2  . PRO A 1 10  ? -2.362  2.846   12.270  1.00 0.00 ? 10  PRO A HG2  2  
ATOM 1895  H HG3  . PRO A 1 10  ? -2.878  3.558   13.810  1.00 0.00 ? 10  PRO A HG3  2  
ATOM 1896  H HD2  . PRO A 1 10  ? -0.505  4.157   12.651  1.00 0.00 ? 10  PRO A HD2  2  
ATOM 1897  H HD3  . PRO A 1 10  ? -0.727  4.127   14.412  1.00 0.00 ? 10  PRO A HD3  2  
ATOM 1898  N N    . VAL A 1 11  ? -0.905  -1.029  12.643  1.00 0.00 ? 11  VAL A N    2  
ATOM 1899  C CA   . VAL A 1 11  ? -0.872  -1.968  11.528  1.00 0.00 ? 11  VAL A CA   2  
ATOM 1900  C C    . VAL A 1 11  ? -2.241  -2.084  10.867  1.00 0.00 ? 11  VAL A C    2  
ATOM 1901  O O    . VAL A 1 11  ? -3.260  -2.233  11.543  1.00 0.00 ? 11  VAL A O    2  
ATOM 1902  C CB   . VAL A 1 11  ? -0.416  -3.366  11.986  1.00 0.00 ? 11  VAL A CB   2  
ATOM 1903  C CG1  . VAL A 1 11  ? -0.607  -4.382  10.870  1.00 0.00 ? 11  VAL A CG1  2  
ATOM 1904  C CG2  . VAL A 1 11  ? 1.035   -3.330  12.442  1.00 0.00 ? 11  VAL A CG2  2  
ATOM 1905  H H    . VAL A 1 11  ? -1.185  -1.345  13.527  1.00 0.00 ? 11  VAL A H    2  
ATOM 1906  H HA   . VAL A 1 11  ? -0.162  -1.600  10.802  1.00 0.00 ? 11  VAL A HA   2  
ATOM 1907  H HB   . VAL A 1 11  ? -1.027  -3.666  12.824  1.00 0.00 ? 11  VAL A HB   2  
ATOM 1908  H HG11 . VAL A 1 11  ? -1.625  -4.745  10.885  1.00 0.00 ? 11  VAL A HG11 2  
ATOM 1909  H HG12 . VAL A 1 11  ? -0.404  -3.915  9.918   1.00 0.00 ? 11  VAL A HG12 2  
ATOM 1910  H HG13 . VAL A 1 11  ? 0.071   -5.210  11.017  1.00 0.00 ? 11  VAL A HG13 2  
ATOM 1911  H HG21 . VAL A 1 11  ? 1.673   -3.128  11.594  1.00 0.00 ? 11  VAL A HG21 2  
ATOM 1912  H HG22 . VAL A 1 11  ? 1.161   -2.551  13.181  1.00 0.00 ? 11  VAL A HG22 2  
ATOM 1913  H HG23 . VAL A 1 11  ? 1.301   -4.282  12.874  1.00 0.00 ? 11  VAL A HG23 2  
ATOM 1914  N N    . THR A 1 12  ? -2.258  -2.015  9.539   1.00 0.00 ? 12  THR A N    2  
ATOM 1915  C CA   . THR A 1 12  ? -3.502  -2.111  8.785   1.00 0.00 ? 12  THR A CA   2  
ATOM 1916  C C    . THR A 1 12  ? -3.857  -3.565  8.493   1.00 0.00 ? 12  THR A C    2  
ATOM 1917  O O    . THR A 1 12  ? -4.961  -4.018  8.795   1.00 0.00 ? 12  THR A O    2  
ATOM 1918  C CB   . THR A 1 12  ? -3.414  -1.339  7.455   1.00 0.00 ? 12  THR A CB   2  
ATOM 1919  O OG1  . THR A 1 12  ? -2.675  -0.126  7.641   1.00 0.00 ? 12  THR A OG1  2  
ATOM 1920  C CG2  . THR A 1 12  ? -4.802  -1.017  6.923   1.00 0.00 ? 12  THR A CG2  2  
ATOM 1921  H H    . THR A 1 12  ? -1.414  -1.896  9.057   1.00 0.00 ? 12  THR A H    2  
ATOM 1922  H HA   . THR A 1 12  ? -4.288  -1.671  9.381   1.00 0.00 ? 12  THR A HA   2  
ATOM 1923  H HB   . THR A 1 12  ? -2.901  -1.957  6.731   1.00 0.00 ? 12  THR A HB   2  
ATOM 1924  H HG1  . THR A 1 12  ? -2.650  0.363   6.815   1.00 0.00 ? 12  THR A HG1  2  
ATOM 1925  H HG21 . THR A 1 12  ? -5.144  -1.826  6.295   1.00 0.00 ? 12  THR A HG21 2  
ATOM 1926  H HG22 . THR A 1 12  ? -4.764  -0.105  6.346   1.00 0.00 ? 12  THR A HG22 2  
ATOM 1927  H HG23 . THR A 1 12  ? -5.484  -0.892  7.751   1.00 0.00 ? 12  THR A HG23 2  
ATOM 1928  N N    . LYS A 1 13  ? -2.913  -4.292  7.905   1.00 0.00 ? 13  LYS A N    2  
ATOM 1929  C CA   . LYS A 1 13  ? -3.125  -5.696  7.573   1.00 0.00 ? 13  LYS A CA   2  
ATOM 1930  C C    . LYS A 1 13  ? -1.803  -6.457  7.557   1.00 0.00 ? 13  LYS A C    2  
ATOM 1931  O O    . LYS A 1 13  ? -0.760  -5.900  7.216   1.00 0.00 ? 13  LYS A O    2  
ATOM 1932  C CB   . LYS A 1 13  ? -3.814  -5.822  6.213   1.00 0.00 ? 13  LYS A CB   2  
ATOM 1933  C CG   . LYS A 1 13  ? -4.238  -7.241  5.874   1.00 0.00 ? 13  LYS A CG   2  
ATOM 1934  C CD   . LYS A 1 13  ? -5.064  -7.287  4.600   1.00 0.00 ? 13  LYS A CD   2  
ATOM 1935  C CE   . LYS A 1 13  ? -5.739  -8.639  4.422   1.00 0.00 ? 13  LYS A CE   2  
ATOM 1936  N NZ   . LYS A 1 13  ? -6.664  -8.949  5.548   1.00 0.00 ? 13  LYS A NZ   2  
ATOM 1937  H H    . LYS A 1 13  ? -2.053  -3.875  7.689   1.00 0.00 ? 13  LYS A H    2  
ATOM 1938  H HA   . LYS A 1 13  ? -3.763  -6.124  8.331   1.00 0.00 ? 13  LYS A HA   2  
ATOM 1939  H HB2  . LYS A 1 13  ? -4.694  -5.196  6.209   1.00 0.00 ? 13  LYS A HB2  2  
ATOM 1940  H HB3  . LYS A 1 13  ? -3.135  -5.479  5.445   1.00 0.00 ? 13  LYS A HB3  2  
ATOM 1941  H HG2  . LYS A 1 13  ? -3.355  -7.848  5.740   1.00 0.00 ? 13  LYS A HG2  2  
ATOM 1942  H HG3  . LYS A 1 13  ? -4.828  -7.635  6.689   1.00 0.00 ? 13  LYS A HG3  2  
ATOM 1943  H HD2  . LYS A 1 13  ? -5.824  -6.521  4.645   1.00 0.00 ? 13  LYS A HD2  2  
ATOM 1944  H HD3  . LYS A 1 13  ? -4.416  -7.105  3.754   1.00 0.00 ? 13  LYS A HD3  2  
ATOM 1945  H HE2  . LYS A 1 13  ? -6.300  -8.628  3.500   1.00 0.00 ? 13  LYS A HE2  2  
ATOM 1946  H HE3  . LYS A 1 13  ? -4.978  -9.403  4.371   1.00 0.00 ? 13  LYS A HE3  2  
ATOM 1947  H HZ1  . LYS A 1 13  ? -6.276  -9.723  6.125   1.00 0.00 ? 13  LYS A HZ1  2  
ATOM 1948  H HZ2  . LYS A 1 13  ? -7.592  -9.238  5.179   1.00 0.00 ? 13  LYS A HZ2  2  
ATOM 1949  H HZ3  . LYS A 1 13  ? -6.787  -8.110  6.151   1.00 0.00 ? 13  LYS A HZ3  2  
ATOM 1950  N N    . ALA A 1 14  ? -1.854  -7.732  7.927   1.00 0.00 ? 14  ALA A N    2  
ATOM 1951  C CA   . ALA A 1 14  ? -0.661  -8.569  7.951   1.00 0.00 ? 14  ALA A CA   2  
ATOM 1952  C C    . ALA A 1 14  ? -1.012  -10.032 7.702   1.00 0.00 ? 14  ALA A C    2  
ATOM 1953  O O    . ALA A 1 14  ? -1.942  -10.569 8.303   1.00 0.00 ? 14  ALA A O    2  
ATOM 1954  C CB   . ALA A 1 14  ? 0.063   -8.418  9.281   1.00 0.00 ? 14  ALA A CB   2  
ATOM 1955  H H    . ALA A 1 14  ? -2.716  -8.120  8.188   1.00 0.00 ? 14  ALA A H    2  
ATOM 1956  H HA   . ALA A 1 14  ? 0.001   -8.230  7.168   1.00 0.00 ? 14  ALA A HA   2  
ATOM 1957  H HB1  . ALA A 1 14  ? 0.738   -7.576  9.228   1.00 0.00 ? 14  ALA A HB1  2  
ATOM 1958  H HB2  . ALA A 1 14  ? -0.659  -8.252  10.067  1.00 0.00 ? 14  ALA A HB2  2  
ATOM 1959  H HB3  . ALA A 1 14  ? 0.623   -9.316  9.490   1.00 0.00 ? 14  ALA A HB3  2  
ATOM 1960  N N    . GLY A 1 15  ? -0.262  -10.672 6.810   1.00 0.00 ? 15  GLY A N    2  
ATOM 1961  C CA   . GLY A 1 15  ? -0.510  -12.067 6.496   1.00 0.00 ? 15  GLY A CA   2  
ATOM 1962  C C    . GLY A 1 15  ? 0.563   -12.661 5.605   1.00 0.00 ? 15  GLY A C    2  
ATOM 1963  O O    . GLY A 1 15  ? 1.434   -11.946 5.111   1.00 0.00 ? 15  GLY A O    2  
ATOM 1964  H H    . GLY A 1 15  ? 0.466   -10.193 6.361   1.00 0.00 ? 15  GLY A H    2  
ATOM 1965  H HA2  . GLY A 1 15  ? -0.551  -12.630 7.417   1.00 0.00 ? 15  GLY A HA2  2  
ATOM 1966  H HA3  . GLY A 1 15  ? -1.463  -12.147 5.994   1.00 0.00 ? 15  GLY A HA3  2  
ATOM 1967  N N    . TRP A 1 16  ? 0.501   -13.972 5.401   1.00 0.00 ? 16  TRP A N    2  
ATOM 1968  C CA   . TRP A 1 16  ? 1.477   -14.662 4.564   1.00 0.00 ? 16  TRP A CA   2  
ATOM 1969  C C    . TRP A 1 16  ? 1.125   -14.520 3.088   1.00 0.00 ? 16  TRP A C    2  
ATOM 1970  O O    . TRP A 1 16  ? 0.133   -15.081 2.619   1.00 0.00 ? 16  TRP A O    2  
ATOM 1971  C CB   . TRP A 1 16  ? 1.550   -16.141 4.945   1.00 0.00 ? 16  TRP A CB   2  
ATOM 1972  C CG   . TRP A 1 16  ? 2.179   -16.380 6.284   1.00 0.00 ? 16  TRP A CG   2  
ATOM 1973  C CD1  . TRP A 1 16  ? 1.533   -16.546 7.475   1.00 0.00 ? 16  TRP A CD1  2  
ATOM 1974  C CD2  . TRP A 1 16  ? 3.579   -16.479 6.567   1.00 0.00 ? 16  TRP A CD2  2  
ATOM 1975  N NE1  . TRP A 1 16  ? 2.447   -16.741 8.482   1.00 0.00 ? 16  TRP A NE1  2  
ATOM 1976  C CE2  . TRP A 1 16  ? 3.709   -16.705 7.951   1.00 0.00 ? 16  TRP A CE2  2  
ATOM 1977  C CE3  . TRP A 1 16  ? 4.735   -16.400 5.786   1.00 0.00 ? 16  TRP A CE3  2  
ATOM 1978  C CZ2  . TRP A 1 16  ? 4.949   -16.851 8.568   1.00 0.00 ? 16  TRP A CZ2  2  
ATOM 1979  C CZ3  . TRP A 1 16  ? 5.965   -16.545 6.400   1.00 0.00 ? 16  TRP A CZ3  2  
ATOM 1980  C CH2  . TRP A 1 16  ? 6.064   -16.769 7.779   1.00 0.00 ? 16  TRP A CH2  2  
ATOM 1981  H H    . TRP A 1 16  ? -0.217  -14.489 5.823   1.00 0.00 ? 16  TRP A H    2  
ATOM 1982  H HA   . TRP A 1 16  ? 2.441   -14.207 4.738   1.00 0.00 ? 16  TRP A HA   2  
ATOM 1983  H HB2  . TRP A 1 16  ? 0.551   -16.550 4.968   1.00 0.00 ? 16  TRP A HB2  2  
ATOM 1984  H HB3  . TRP A 1 16  ? 2.132   -16.668 4.202   1.00 0.00 ? 16  TRP A HB3  2  
ATOM 1985  H HD1  . TRP A 1 16  ? 0.461   -16.522 7.594   1.00 0.00 ? 16  TRP A HD1  2  
ATOM 1986  H HE1  . TRP A 1 16  ? 2.230   -16.884 9.428   1.00 0.00 ? 16  TRP A HE1  2  
ATOM 1987  H HE3  . TRP A 1 16  ? 4.679   -16.227 4.721   1.00 0.00 ? 16  TRP A HE3  2  
ATOM 1988  H HZ2  . TRP A 1 16  ? 5.042   -17.026 9.630   1.00 0.00 ? 16  TRP A HZ2  2  
ATOM 1989  H HZ3  . TRP A 1 16  ? 6.870   -16.486 5.812   1.00 0.00 ? 16  TRP A HZ3  2  
ATOM 1990  H HH2  . TRP A 1 16  ? 7.045   -16.876 8.216   1.00 0.00 ? 16  TRP A HH2  2  
ATOM 1991  N N    . LEU A 1 17  ? 1.942   -13.769 2.358   1.00 0.00 ? 17  LEU A N    2  
ATOM 1992  C CA   . LEU A 1 17  ? 1.716   -13.554 0.933   1.00 0.00 ? 17  LEU A CA   2  
ATOM 1993  C C    . LEU A 1 17  ? 2.912   -14.029 0.115   1.00 0.00 ? 17  LEU A C    2  
ATOM 1994  O O    . LEU A 1 17  ? 4.062   -13.858 0.520   1.00 0.00 ? 17  LEU A O    2  
ATOM 1995  C CB   . LEU A 1 17  ? 1.450   -12.073 0.656   1.00 0.00 ? 17  LEU A CB   2  
ATOM 1996  C CG   . LEU A 1 17  ? 0.019   -11.592 0.896   1.00 0.00 ? 17  LEU A CG   2  
ATOM 1997  C CD1  . LEU A 1 17  ? -0.058  -10.076 0.798   1.00 0.00 ? 17  LEU A CD1  2  
ATOM 1998  C CD2  . LEU A 1 17  ? -0.935  -12.242 -0.095  1.00 0.00 ? 17  LEU A CD2  2  
ATOM 1999  H H    . LEU A 1 17  ? 2.715   -13.348 2.787   1.00 0.00 ? 17  LEU A H    2  
ATOM 2000  H HA   . LEU A 1 17  ? 0.848   -14.127 0.645   1.00 0.00 ? 17  LEU A HA   2  
ATOM 2001  H HB2  . LEU A 1 17  ? 2.104   -11.495 1.292   1.00 0.00 ? 17  LEU A HB2  2  
ATOM 2002  H HB3  . LEU A 1 17  ? 1.696   -11.882 -0.379  1.00 0.00 ? 17  LEU A HB3  2  
ATOM 2003  H HG   . LEU A 1 17  ? -0.288  -11.877 1.893   1.00 0.00 ? 17  LEU A HG   2  
ATOM 2004  H HD11 . LEU A 1 17  ? -0.993  -9.792  0.339   1.00 0.00 ? 17  LEU A HD11 2  
ATOM 2005  H HD12 . LEU A 1 17  ? 0.763   -9.712  0.198   1.00 0.00 ? 17  LEU A HD12 2  
ATOM 2006  H HD13 . LEU A 1 17  ? 0.003   -9.648  1.787   1.00 0.00 ? 17  LEU A HD13 2  
ATOM 2007  H HD21 . LEU A 1 17  ? -1.919  -11.811 0.019   1.00 0.00 ? 17  LEU A HD21 2  
ATOM 2008  H HD22 . LEU A 1 17  ? -0.983  -13.304 0.095   1.00 0.00 ? 17  LEU A HD22 2  
ATOM 2009  H HD23 . LEU A 1 17  ? -0.581  -12.071 -1.101  1.00 0.00 ? 17  LEU A HD23 2  
ATOM 2010  N N    . PHE A 1 18  ? 2.633   -14.626 -1.039  1.00 0.00 ? 18  PHE A N    2  
ATOM 2011  C CA   . PHE A 1 18  ? 3.686   -15.125 -1.916  1.00 0.00 ? 18  PHE A CA   2  
ATOM 2012  C C    . PHE A 1 18  ? 4.146   -14.041 -2.886  1.00 0.00 ? 18  PHE A C    2  
ATOM 2013  O O    . PHE A 1 18  ? 3.375   -13.575 -3.725  1.00 0.00 ? 18  PHE A O    2  
ATOM 2014  C CB   . PHE A 1 18  ? 3.194   -16.347 -2.695  1.00 0.00 ? 18  PHE A CB   2  
ATOM 2015  C CG   . PHE A 1 18  ? 3.208   -17.615 -1.890  1.00 0.00 ? 18  PHE A CG   2  
ATOM 2016  C CD1  . PHE A 1 18  ? 2.341   -17.783 -0.823  1.00 0.00 ? 18  PHE A CD1  2  
ATOM 2017  C CD2  . PHE A 1 18  ? 4.086   -18.640 -2.202  1.00 0.00 ? 18  PHE A CD2  2  
ATOM 2018  C CE1  . PHE A 1 18  ? 2.351   -18.949 -0.081  1.00 0.00 ? 18  PHE A CE1  2  
ATOM 2019  C CE2  . PHE A 1 18  ? 4.101   -19.809 -1.464  1.00 0.00 ? 18  PHE A CE2  2  
ATOM 2020  C CZ   . PHE A 1 18  ? 3.232   -19.964 -0.403  1.00 0.00 ? 18  PHE A CZ   2  
ATOM 2021  H H    . PHE A 1 18  ? 1.697   -14.733 -1.308  1.00 0.00 ? 18  PHE A H    2  
ATOM 2022  H HA   . PHE A 1 18  ? 4.521   -15.415 -1.297  1.00 0.00 ? 18  PHE A HA   2  
ATOM 2023  H HB2  . PHE A 1 18  ? 2.180   -16.172 -3.021  1.00 0.00 ? 18  PHE A HB2  2  
ATOM 2024  H HB3  . PHE A 1 18  ? 3.826   -16.493 -3.558  1.00 0.00 ? 18  PHE A HB3  2  
ATOM 2025  H HD1  . PHE A 1 18  ? 1.651   -16.992 -0.570  1.00 0.00 ? 18  PHE A HD1  2  
ATOM 2026  H HD2  . PHE A 1 18  ? 4.767   -18.520 -3.034  1.00 0.00 ? 18  PHE A HD2  2  
ATOM 2027  H HE1  . PHE A 1 18  ? 1.670   -19.068 0.749   1.00 0.00 ? 18  PHE A HE1  2  
ATOM 2028  H HE2  . PHE A 1 18  ? 4.791   -20.599 -1.719  1.00 0.00 ? 18  PHE A HE2  2  
ATOM 2029  H HZ   . PHE A 1 18  ? 3.242   -20.875 0.176   1.00 0.00 ? 18  PHE A HZ   2  
ATOM 2030  N N    . LYS A 1 19  ? 5.408   -13.643 -2.765  1.00 0.00 ? 19  LYS A N    2  
ATOM 2031  C CA   . LYS A 1 19  ? 5.973   -12.614 -3.630  1.00 0.00 ? 19  LYS A CA   2  
ATOM 2032  C C    . LYS A 1 19  ? 6.641   -13.238 -4.852  1.00 0.00 ? 19  LYS A C    2  
ATOM 2033  O O    . LYS A 1 19  ? 7.537   -14.071 -4.722  1.00 0.00 ? 19  LYS A O    2  
ATOM 2034  C CB   . LYS A 1 19  ? 6.987   -11.769 -2.857  1.00 0.00 ? 19  LYS A CB   2  
ATOM 2035  C CG   . LYS A 1 19  ? 7.176   -10.374 -3.426  1.00 0.00 ? 19  LYS A CG   2  
ATOM 2036  C CD   . LYS A 1 19  ? 8.331   -9.649  -2.755  1.00 0.00 ? 19  LYS A CD   2  
ATOM 2037  C CE   . LYS A 1 19  ? 8.943   -8.604  -3.675  1.00 0.00 ? 19  LYS A CE   2  
ATOM 2038  N NZ   . LYS A 1 19  ? 9.961   -9.196  -4.587  1.00 0.00 ? 19  LYS A NZ   2  
ATOM 2039  H H    . LYS A 1 19  ? 5.974   -14.052 -2.076  1.00 0.00 ? 19  LYS A H    2  
ATOM 2040  H HA   . LYS A 1 19  ? 5.166   -11.979 -3.961  1.00 0.00 ? 19  LYS A HA   2  
ATOM 2041  H HB2  . LYS A 1 19  ? 6.655   -11.676 -1.833  1.00 0.00 ? 19  LYS A HB2  2  
ATOM 2042  H HB3  . LYS A 1 19  ? 7.943   -12.273 -2.871  1.00 0.00 ? 19  LYS A HB3  2  
ATOM 2043  H HG2  . LYS A 1 19  ? 7.379   -10.450 -4.483  1.00 0.00 ? 19  LYS A HG2  2  
ATOM 2044  H HG3  . LYS A 1 19  ? 6.269   -9.806  -3.272  1.00 0.00 ? 19  LYS A HG3  2  
ATOM 2045  H HD2  . LYS A 1 19  ? 7.969   -9.159  -1.863  1.00 0.00 ? 19  LYS A HD2  2  
ATOM 2046  H HD3  . LYS A 1 19  ? 9.091   -10.371 -2.488  1.00 0.00 ? 19  LYS A HD3  2  
ATOM 2047  H HE2  . LYS A 1 19  ? 8.158   -8.159  -4.266  1.00 0.00 ? 19  LYS A HE2  2  
ATOM 2048  H HE3  . LYS A 1 19  ? 9.414   -7.843  -3.070  1.00 0.00 ? 19  LYS A HE3  2  
ATOM 2049  H HZ1  . LYS A 1 19  ? 9.538   -9.970  -5.139  1.00 0.00 ? 19  LYS A HZ1  2  
ATOM 2050  H HZ2  . LYS A 1 19  ? 10.758  -9.573  -4.036  1.00 0.00 ? 19  LYS A HZ2  2  
ATOM 2051  H HZ3  . LYS A 1 19  ? 10.318  -8.472  -5.242  1.00 0.00 ? 19  LYS A HZ3  2  
ATOM 2052  N N    . GLN A 1 20  ? 6.199   -12.827 -6.036  1.00 0.00 ? 20  GLN A N    2  
ATOM 2053  C CA   . GLN A 1 20  ? 6.756   -13.345 -7.280  1.00 0.00 ? 20  GLN A CA   2  
ATOM 2054  C C    . GLN A 1 20  ? 8.212   -12.921 -7.443  1.00 0.00 ? 20  GLN A C    2  
ATOM 2055  O O    . GLN A 1 20  ? 8.583   -11.797 -7.105  1.00 0.00 ? 20  GLN A O    2  
ATOM 2056  C CB   . GLN A 1 20  ? 5.933   -12.857 -8.474  1.00 0.00 ? 20  GLN A CB   2  
ATOM 2057  C CG   . GLN A 1 20  ? 6.130   -13.690 -9.730  1.00 0.00 ? 20  GLN A CG   2  
ATOM 2058  C CD   . GLN A 1 20  ? 5.454   -13.085 -10.944 1.00 0.00 ? 20  GLN A CD   2  
ATOM 2059  O OE1  . GLN A 1 20  ? 5.404   -11.864 -11.097 1.00 0.00 ? 20  GLN A OE1  2  
ATOM 2060  N NE2  . GLN A 1 20  ? 4.928   -13.937 -11.816 1.00 0.00 ? 20  GLN A NE2  2  
ATOM 2061  H H    . GLN A 1 20  ? 5.483   -12.160 -6.074  1.00 0.00 ? 20  GLN A H    2  
ATOM 2062  H HA   . GLN A 1 20  ? 6.710   -14.423 -7.240  1.00 0.00 ? 20  GLN A HA   2  
ATOM 2063  H HB2  . GLN A 1 20  ? 4.886   -12.884 -8.210  1.00 0.00 ? 20  GLN A HB2  2  
ATOM 2064  H HB3  . GLN A 1 20  ? 6.214   -11.838 -8.697  1.00 0.00 ? 20  GLN A HB3  2  
ATOM 2065  H HG2  . GLN A 1 20  ? 7.188   -13.772 -9.930  1.00 0.00 ? 20  GLN A HG2  2  
ATOM 2066  H HG3  . GLN A 1 20  ? 5.720   -14.675 -9.561  1.00 0.00 ? 20  GLN A HG3  2  
ATOM 2067  H HE21 . GLN A 1 20  ? 5.005   -14.897 -11.628 1.00 0.00 ? 20  GLN A HE21 2  
ATOM 2068  H HE22 . GLN A 1 20  ? 4.485   -13.573 -12.609 1.00 0.00 ? 20  GLN A HE22 2  
ATOM 2069  N N    . ALA A 1 21  ? 9.032   -13.828 -7.964  1.00 0.00 ? 21  ALA A N    2  
ATOM 2070  C CA   . ALA A 1 21  ? 10.447  -13.547 -8.174  1.00 0.00 ? 21  ALA A CA   2  
ATOM 2071  C C    . ALA A 1 21  ? 10.640  -12.454 -9.220  1.00 0.00 ? 21  ALA A C    2  
ATOM 2072  O O    . ALA A 1 21  ? 10.008  -12.473 -10.275 1.00 0.00 ? 21  ALA A O    2  
ATOM 2073  C CB   . ALA A 1 21  ? 11.180  -14.814 -8.589  1.00 0.00 ? 21  ALA A CB   2  
ATOM 2074  H H    . ALA A 1 21  ? 8.677   -14.706 -8.214  1.00 0.00 ? 21  ALA A H    2  
ATOM 2075  H HA   . ALA A 1 21  ? 10.863  -13.210 -7.235  1.00 0.00 ? 21  ALA A HA   2  
ATOM 2076  H HB1  . ALA A 1 21  ? 11.198  -15.506 -7.760  1.00 0.00 ? 21  ALA A HB1  2  
ATOM 2077  H HB2  . ALA A 1 21  ? 10.671  -15.267 -9.426  1.00 0.00 ? 21  ALA A HB2  2  
ATOM 2078  H HB3  . ALA A 1 21  ? 12.192  -14.566 -8.874  1.00 0.00 ? 21  ALA A HB3  2  
ATOM 2079  N N    . SER A 1 22  ? 11.519  -11.503 -8.919  1.00 0.00 ? 22  SER A N    2  
ATOM 2080  C CA   . SER A 1 22  ? 11.792  -10.399 -9.832  1.00 0.00 ? 22  SER A CA   2  
ATOM 2081  C C    . SER A 1 22  ? 13.132  -10.595 -10.535 1.00 0.00 ? 22  SER A C    2  
ATOM 2082  O O    . SER A 1 22  ? 13.766  -9.631  -10.965 1.00 0.00 ? 22  SER A O    2  
ATOM 2083  C CB   . SER A 1 22  ? 11.791  -9.070  -9.074  1.00 0.00 ? 22  SER A CB   2  
ATOM 2084  O OG   . SER A 1 22  ? 12.636  -9.130  -7.938  1.00 0.00 ? 22  SER A OG   2  
ATOM 2085  H H    . SER A 1 22  ? 11.992  -11.543 -8.061  1.00 0.00 ? 22  SER A H    2  
ATOM 2086  H HA   . SER A 1 22  ? 11.008  -10.381 -10.574 1.00 0.00 ? 22  SER A HA   2  
ATOM 2087  H HB2  . SER A 1 22  ? 12.140  -8.285  -9.727  1.00 0.00 ? 22  SER A HB2  2  
ATOM 2088  H HB3  . SER A 1 22  ? 10.785  -8.846  -8.748  1.00 0.00 ? 22  SER A HB3  2  
ATOM 2089  H HG   . SER A 1 22  ? 13.398  -9.680  -8.134  1.00 0.00 ? 22  SER A HG   2  
ATOM 2090  N N    . SER A 1 23  ? 13.556  -11.849 -10.647 1.00 0.00 ? 23  SER A N    2  
ATOM 2091  C CA   . SER A 1 23  ? 14.822  -12.173 -11.294 1.00 0.00 ? 23  SER A CA   2  
ATOM 2092  C C    . SER A 1 23  ? 15.004  -13.683 -11.409 1.00 0.00 ? 23  SER A C    2  
ATOM 2093  O O    . SER A 1 23  ? 15.149  -14.380 -10.405 1.00 0.00 ? 23  SER A O    2  
ATOM 2094  C CB   . SER A 1 23  ? 15.989  -11.566 -10.512 1.00 0.00 ? 23  SER A CB   2  
ATOM 2095  O OG   . SER A 1 23  ? 16.196  -10.211 -10.875 1.00 0.00 ? 23  SER A OG   2  
ATOM 2096  H H    . SER A 1 23  ? 13.006  -12.574 -10.284 1.00 0.00 ? 23  SER A H    2  
ATOM 2097  H HA   . SER A 1 23  ? 14.806  -11.748 -12.287 1.00 0.00 ? 23  SER A HA   2  
ATOM 2098  H HB2  . SER A 1 23  ? 15.775  -11.614 -9.456  1.00 0.00 ? 23  SER A HB2  2  
ATOM 2099  H HB3  . SER A 1 23  ? 16.889  -12.124 -10.723 1.00 0.00 ? 23  SER A HB3  2  
ATOM 2100  H HG   . SER A 1 23  ? 15.888  -10.069 -11.773 1.00 0.00 ? 23  SER A HG   2  
ATOM 2101  N N    . GLY A 1 24  ? 14.993  -14.183 -12.641 1.00 0.00 ? 24  GLY A N    2  
ATOM 2102  C CA   . GLY A 1 24  ? 15.157  -15.607 -12.866 1.00 0.00 ? 24  GLY A CA   2  
ATOM 2103  C C    . GLY A 1 24  ? 13.848  -16.296 -13.198 1.00 0.00 ? 24  GLY A C    2  
ATOM 2104  O O    . GLY A 1 24  ? 12.871  -15.644 -13.567 1.00 0.00 ? 24  GLY A O    2  
ATOM 2105  H H    . GLY A 1 24  ? 14.874  -13.579 -13.404 1.00 0.00 ? 24  GLY A H    2  
ATOM 2106  H HA2  . GLY A 1 24  ? 15.848  -15.754 -13.683 1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2107  H HA3  . GLY A 1 24  ? 15.570  -16.055 -11.974 1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2108  N N    . VAL A 1 25  ? 13.828  -17.619 -13.070 1.00 0.00 ? 25  VAL A N    2  
ATOM 2109  C CA   . VAL A 1 25  ? 12.630  -18.397 -13.360 1.00 0.00 ? 25  VAL A CA   2  
ATOM 2110  C C    . VAL A 1 25  ? 11.410  -17.810 -12.658 1.00 0.00 ? 25  VAL A C    2  
ATOM 2111  O O    . VAL A 1 25  ? 11.532  -16.913 -11.824 1.00 0.00 ? 25  VAL A O    2  
ATOM 2112  C CB   . VAL A 1 25  ? 12.798  -19.867 -12.932 1.00 0.00 ? 25  VAL A CB   2  
ATOM 2113  C CG1  . VAL A 1 25  ? 12.428  -20.042 -11.467 1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2114  C CG2  . VAL A 1 25  ? 11.958  -20.777 -13.815 1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2115  H H    . VAL A 1 25  ? 14.639  -18.082 -12.773 1.00 0.00 ? 25  VAL A H    2  
ATOM 2116  H HA   . VAL A 1 25  ? 12.466  -18.371 -14.428 1.00 0.00 ? 25  VAL A HA   2  
ATOM 2117  H HB   . VAL A 1 25  ? 13.836  -20.140 -13.054 1.00 0.00 ? 25  VAL A HB   2  
ATOM 2118  H HG11 . VAL A 1 25  ? 12.535  -19.097 -10.954 1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2119  H HG12 . VAL A 1 25  ? 11.405  -20.380 -11.391 1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2120  H HG13 . VAL A 1 25  ? 13.084  -20.772 -11.016 1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2121  H HG21 . VAL A 1 25  ? 12.533  -21.652 -14.079 1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2122  H HG22 . VAL A 1 25  ? 11.069  -21.079 -13.279 1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2123  H HG23 . VAL A 1 25  ? 11.674  -20.248 -14.712 1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2124  N N    . LYS A 1 26  ? 10.234  -18.323 -13.001 1.00 0.00 ? 26  LYS A N    2  
ATOM 2125  C CA   . LYS A 1 26  ? 8.990   -17.853 -12.403 1.00 0.00 ? 26  LYS A CA   2  
ATOM 2126  C C    . LYS A 1 26  ? 8.692   -18.601 -11.108 1.00 0.00 ? 26  LYS A C    2  
ATOM 2127  O O    . LYS A 1 26  ? 7.914   -19.555 -11.098 1.00 0.00 ? 26  LYS A O    2  
ATOM 2128  C CB   . LYS A 1 26  ? 7.829   -18.028 -13.385 1.00 0.00 ? 26  LYS A CB   2  
ATOM 2129  C CG   . LYS A 1 26  ? 7.594   -16.817 -14.271 1.00 0.00 ? 26  LYS A CG   2  
ATOM 2130  C CD   . LYS A 1 26  ? 7.059   -17.219 -15.635 1.00 0.00 ? 26  LYS A CD   2  
ATOM 2131  C CE   . LYS A 1 26  ? 8.127   -17.906 -16.472 1.00 0.00 ? 26  LYS A CE   2  
ATOM 2132  N NZ   . LYS A 1 26  ? 8.122   -19.382 -16.275 1.00 0.00 ? 26  LYS A NZ   2  
ATOM 2133  H H    . LYS A 1 26  ? 10.201  -19.037 -13.673 1.00 0.00 ? 26  LYS A H    2  
ATOM 2134  H HA   . LYS A 1 26  ? 9.106   -16.803 -12.179 1.00 0.00 ? 26  LYS A HA   2  
ATOM 2135  H HB2  . LYS A 1 26  ? 8.036   -18.878 -14.020 1.00 0.00 ? 26  LYS A HB2  2  
ATOM 2136  H HB3  . LYS A 1 26  ? 6.925   -18.220 -12.825 1.00 0.00 ? 26  LYS A HB3  2  
ATOM 2137  H HG2  . LYS A 1 26  ? 6.877   -16.167 -13.793 1.00 0.00 ? 26  LYS A HG2  2  
ATOM 2138  H HG3  . LYS A 1 26  ? 8.529   -16.291 -14.402 1.00 0.00 ? 26  LYS A HG3  2  
ATOM 2139  H HD2  . LYS A 1 26  ? 6.230   -17.899 -15.501 1.00 0.00 ? 26  LYS A HD2  2  
ATOM 2140  H HD3  . LYS A 1 26  ? 6.720   -16.334 -16.155 1.00 0.00 ? 26  LYS A HD3  2  
ATOM 2141  H HE2  . LYS A 1 26  ? 7.944   -17.690 -17.513 1.00 0.00 ? 26  LYS A HE2  2  
ATOM 2142  H HE3  . LYS A 1 26  ? 9.094   -17.517 -16.188 1.00 0.00 ? 26  LYS A HE3  2  
ATOM 2143  H HZ1  . LYS A 1 26  ? 7.245   -19.676 -15.798 1.00 0.00 ? 26  LYS A HZ1  2  
ATOM 2144  H HZ2  . LYS A 1 26  ? 8.933   -19.668 -15.691 1.00 0.00 ? 26  LYS A HZ2  2  
ATOM 2145  H HZ3  . LYS A 1 26  ? 8.182   -19.866 -17.194 1.00 0.00 ? 26  LYS A HZ3  2  
ATOM 2146  N N    . GLN A 1 27  ? 9.313   -18.162 -10.019 1.00 0.00 ? 27  GLN A N    2  
ATOM 2147  C CA   . GLN A 1 27  ? 9.113   -18.791 -8.719  1.00 0.00 ? 27  GLN A CA   2  
ATOM 2148  C C    . GLN A 1 27  ? 8.554   -17.792 -7.711  1.00 0.00 ? 27  GLN A C    2  
ATOM 2149  O O    . GLN A 1 27  ? 8.616   -16.581 -7.923  1.00 0.00 ? 27  GLN A O    2  
ATOM 2150  C CB   . GLN A 1 27  ? 10.429  -19.373 -8.202  1.00 0.00 ? 27  GLN A CB   2  
ATOM 2151  C CG   . GLN A 1 27  ? 11.599  -18.407 -8.293  1.00 0.00 ? 27  GLN A CG   2  
ATOM 2152  C CD   . GLN A 1 27  ? 12.915  -19.044 -7.892  1.00 0.00 ? 27  GLN A CD   2  
ATOM 2153  O OE1  . GLN A 1 27  ? 13.078  -20.262 -7.971  1.00 0.00 ? 27  GLN A OE1  2  
ATOM 2154  N NE2  . GLN A 1 27  ? 13.863  -18.221 -7.458  1.00 0.00 ? 27  GLN A NE2  2  
ATOM 2155  H H    . GLN A 1 27  ? 9.921   -17.397 -10.091 1.00 0.00 ? 27  GLN A H    2  
ATOM 2156  H HA   . GLN A 1 27  ? 8.401   -19.592 -8.845  1.00 0.00 ? 27  GLN A HA   2  
ATOM 2157  H HB2  . GLN A 1 27  ? 10.303  -19.655 -7.167  1.00 0.00 ? 27  GLN A HB2  2  
ATOM 2158  H HB3  . GLN A 1 27  ? 10.672  -20.253 -8.779  1.00 0.00 ? 27  GLN A HB3  2  
ATOM 2159  H HG2  . GLN A 1 27  ? 11.682  -18.057 -9.312  1.00 0.00 ? 27  GLN A HG2  2  
ATOM 2160  H HG3  . GLN A 1 27  ? 11.408  -17.568 -7.640  1.00 0.00 ? 27  GLN A HG3  2  
ATOM 2161  H HE21 . GLN A 1 27  ? 13.662  -17.262 -7.421  1.00 0.00 ? 27  GLN A HE21 2  
ATOM 2162  H HE22 . GLN A 1 27  ? 14.723  -18.606 -7.191  1.00 0.00 ? 27  GLN A HE22 2  
ATOM 2163  N N    . TRP A 1 28  ? 8.009   -18.307 -6.615  1.00 0.00 ? 28  TRP A N    2  
ATOM 2164  C CA   . TRP A 1 28  ? 7.439   -17.459 -5.574  1.00 0.00 ? 28  TRP A CA   2  
ATOM 2165  C C    . TRP A 1 28  ? 8.071   -17.760 -4.220  1.00 0.00 ? 28  TRP A C    2  
ATOM 2166  O O    . TRP A 1 28  ? 8.367   -18.912 -3.905  1.00 0.00 ? 28  TRP A O    2  
ATOM 2167  C CB   . TRP A 1 28  ? 5.924   -17.657 -5.499  1.00 0.00 ? 28  TRP A CB   2  
ATOM 2168  C CG   . TRP A 1 28  ? 5.219   -17.339 -6.783  1.00 0.00 ? 28  TRP A CG   2  
ATOM 2169  C CD1  . TRP A 1 28  ? 5.351   -17.995 -7.974  1.00 0.00 ? 28  TRP A CD1  2  
ATOM 2170  C CD2  . TRP A 1 28  ? 4.275   -16.286 -7.005  1.00 0.00 ? 28  TRP A CD2  2  
ATOM 2171  N NE1  . TRP A 1 28  ? 4.546   -17.412 -8.923  1.00 0.00 ? 28  TRP A NE1  2  
ATOM 2172  C CE2  . TRP A 1 28  ? 3.874   -16.363 -8.353  1.00 0.00 ? 28  TRP A CE2  2  
ATOM 2173  C CE3  . TRP A 1 28  ? 3.727   -15.288 -6.195  1.00 0.00 ? 28  TRP A CE3  2  
ATOM 2174  C CZ2  . TRP A 1 28  ? 2.953   -15.478 -8.907  1.00 0.00 ? 28  TRP A CZ2  2  
ATOM 2175  C CZ3  . TRP A 1 28  ? 2.813   -14.410 -6.747  1.00 0.00 ? 28  TRP A CZ3  2  
ATOM 2176  C CH2  . TRP A 1 28  ? 2.433   -14.510 -8.091  1.00 0.00 ? 28  TRP A CH2  2  
ATOM 2177  H H    . TRP A 1 28  ? 7.989   -19.281 -6.503  1.00 0.00 ? 28  TRP A H    2  
ATOM 2178  H HA   . TRP A 1 28  ? 7.646   -16.432 -5.834  1.00 0.00 ? 28  TRP A HA   2  
ATOM 2179  H HB2  . TRP A 1 28  ? 5.714   -18.686 -5.249  1.00 0.00 ? 28  TRP A HB2  2  
ATOM 2180  H HB3  . TRP A 1 28  ? 5.522   -17.014 -4.730  1.00 0.00 ? 28  TRP A HB3  2  
ATOM 2181  H HD1  . TRP A 1 28  ? 5.999   -18.843 -8.133  1.00 0.00 ? 28  TRP A HD1  2  
ATOM 2182  H HE1  . TRP A 1 28  ? 4.464   -17.703 -9.856  1.00 0.00 ? 28  TRP A HE1  2  
ATOM 2183  H HE3  . TRP A 1 28  ? 4.008   -15.195 -5.156  1.00 0.00 ? 28  TRP A HE3  2  
ATOM 2184  H HZ2  . TRP A 1 28  ? 2.650   -15.542 -9.942  1.00 0.00 ? 28  TRP A HZ2  2  
ATOM 2185  H HZ3  . TRP A 1 28  ? 2.380   -13.632 -6.136  1.00 0.00 ? 28  TRP A HZ3  2  
ATOM 2186  H HH2  . TRP A 1 28  ? 1.716   -13.803 -8.480  1.00 0.00 ? 28  TRP A HH2  2  
ATOM 2187  N N    . ASN A 1 29  ? 8.275   -16.717 -3.421  1.00 0.00 ? 29  ASN A N    2  
ATOM 2188  C CA   . ASN A 1 29  ? 8.872   -16.872 -2.100  1.00 0.00 ? 29  ASN A CA   2  
ATOM 2189  C C    . ASN A 1 29  ? 7.902   -16.429 -1.009  1.00 0.00 ? 29  ASN A C    2  
ATOM 2190  O O    . ASN A 1 29  ? 7.697   -15.235 -0.791  1.00 0.00 ? 29  ASN A O    2  
ATOM 2191  C CB   . ASN A 1 29  ? 10.167  -16.062 -2.005  1.00 0.00 ? 29  ASN A CB   2  
ATOM 2192  C CG   . ASN A 1 29  ? 11.354  -16.799 -2.595  1.00 0.00 ? 29  ASN A CG   2  
ATOM 2193  O OD1  . ASN A 1 29  ? 12.137  -17.416 -1.872  1.00 0.00 ? 29  ASN A OD1  2  
ATOM 2194  N ND2  . ASN A 1 29  ? 11.493  -16.738 -3.914  1.00 0.00 ? 29  ASN A ND2  2  
ATOM 2195  H H    . ASN A 1 29  ? 8.017   -15.823 -3.728  1.00 0.00 ? 29  ASN A H    2  
ATOM 2196  H HA   . ASN A 1 29  ? 9.101   -17.917 -1.960  1.00 0.00 ? 29  ASN A HA   2  
ATOM 2197  H HB2  . ASN A 1 29  ? 10.043  -15.132 -2.541  1.00 0.00 ? 29  ASN A HB2  2  
ATOM 2198  H HB3  . ASN A 1 29  ? 10.377  -15.850 -0.968  1.00 0.00 ? 29  ASN A HB3  2  
ATOM 2199  H HD21 . ASN A 1 29  ? 10.831  -16.228 -4.426  1.00 0.00 ? 29  ASN A HD21 2  
ATOM 2200  H HD22 . ASN A 1 29  ? 12.251  -17.206 -4.321  1.00 0.00 ? 29  ASN A HD22 2  
ATOM 2201  N N    . LYS A 1 30  ? 7.306   -17.400 -0.325  1.00 0.00 ? 30  LYS A N    2  
ATOM 2202  C CA   . LYS A 1 30  ? 6.358   -17.113 0.745   1.00 0.00 ? 30  LYS A CA   2  
ATOM 2203  C C    . LYS A 1 30  ? 7.034   -16.349 1.879   1.00 0.00 ? 30  LYS A C    2  
ATOM 2204  O O    . LYS A 1 30  ? 8.036   -16.801 2.433   1.00 0.00 ? 30  LYS A O    2  
ATOM 2205  C CB   . LYS A 1 30  ? 5.753   -18.413 1.280   1.00 0.00 ? 30  LYS A CB   2  
ATOM 2206  C CG   . LYS A 1 30  ? 4.737   -18.199 2.389   1.00 0.00 ? 30  LYS A CG   2  
ATOM 2207  C CD   . LYS A 1 30  ? 4.584   -19.440 3.252   1.00 0.00 ? 30  LYS A CD   2  
ATOM 2208  C CE   . LYS A 1 30  ? 3.405   -19.314 4.205   1.00 0.00 ? 30  LYS A CE   2  
ATOM 2209  N NZ   . LYS A 1 30  ? 2.816   -20.641 4.536   1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2210  H H    . LYS A 1 30  ? 7.510   -18.334 -0.546  1.00 0.00 ? 30  LYS A H    2  
ATOM 2211  H HA   . LYS A 1 30  ? 5.570   -16.501 0.334   1.00 0.00 ? 30  LYS A HA   2  
ATOM 2212  H HB2  . LYS A 1 30  ? 5.264   -18.930 0.467   1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2213  H HB3  . LYS A 1 30  ? 6.548   -19.035 1.664   1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2214  H HG2  . LYS A 1 30  ? 5.064   -17.379 3.011   1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2215  H HG3  . LYS A 1 30  ? 3.780   -17.959 1.947   1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2216  H HD2  . LYS A 1 30  ? 4.425   -20.296 2.613   1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2217  H HD3  . LYS A 1 30  ? 5.488   -19.581 3.828   1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2218  H HE2  . LYS A 1 30  ? 3.744   -18.843 5.115   1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2219  H HE3  . LYS A 1 30  ? 2.648   -18.699 3.741   1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2220  H HZ1  . LYS A 1 30  ? 2.847   -20.799 5.564   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2221  H HZ2  . LYS A 1 30  ? 3.351   -21.398 4.064   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2222  H HZ3  . LYS A 1 30  ? 1.826   -20.682 4.220   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2223  N N    . ARG A 1 31  ? 6.477   -15.192 2.221   1.00 0.00 ? 31  ARG A N    2  
ATOM 2224  C CA   . ARG A 1 31  ? 7.026   -14.366 3.289   1.00 0.00 ? 31  ARG A CA   2  
ATOM 2225  C C    . ARG A 1 31  ? 5.910   -13.712 4.099   1.00 0.00 ? 31  ARG A C    2  
ATOM 2226  O O    . ARG A 1 31  ? 4.729   -13.899 3.809   1.00 0.00 ? 31  ARG A O    2  
ATOM 2227  C CB   . ARG A 1 31  ? 7.948   -13.291 2.710   1.00 0.00 ? 31  ARG A CB   2  
ATOM 2228  C CG   . ARG A 1 31  ? 9.396   -13.733 2.586   1.00 0.00 ? 31  ARG A CG   2  
ATOM 2229  C CD   . ARG A 1 31  ? 10.043  -13.915 3.950   1.00 0.00 ? 31  ARG A CD   2  
ATOM 2230  N NE   . ARG A 1 31  ? 11.080  -14.942 3.932   1.00 0.00 ? 31  ARG A NE   2  
ATOM 2231  C CZ   . ARG A 1 31  ? 12.278  -14.768 3.384   1.00 0.00 ? 31  ARG A CZ   2  
ATOM 2232  N NH1  . ARG A 1 31  ? 12.588  -13.612 2.813   1.00 0.00 ? 31  ARG A NH1  2  
ATOM 2233  N NH2  . ARG A 1 31  ? 13.169  -15.751 3.408   1.00 0.00 ? 31  ARG A NH2  2  
ATOM 2234  H H    . ARG A 1 31  ? 5.679   -14.885 1.742   1.00 0.00 ? 31  ARG A H    2  
ATOM 2235  H HA   . ARG A 1 31  ? 7.601   -15.007 3.942   1.00 0.00 ? 31  ARG A HA   2  
ATOM 2236  H HB2  . ARG A 1 31  ? 7.592   -13.019 1.728   1.00 0.00 ? 31  ARG A HB2  2  
ATOM 2237  H HB3  . ARG A 1 31  ? 7.913   -12.422 3.350   1.00 0.00 ? 31  ARG A HB3  2  
ATOM 2238  H HG2  . ARG A 1 31  ? 9.432   -14.673 2.055   1.00 0.00 ? 31  ARG A HG2  2  
ATOM 2239  H HG3  . ARG A 1 31  ? 9.945   -12.985 2.033   1.00 0.00 ? 31  ARG A HG3  2  
ATOM 2240  H HD2  . ARG A 1 31  ? 10.484  -12.977 4.252   1.00 0.00 ? 31  ARG A HD2  2  
ATOM 2241  H HD3  . ARG A 1 31  ? 9.280   -14.199 4.660   1.00 0.00 ? 31  ARG A HD3  2  
ATOM 2242  H HE   . ARG A 1 31  ? 10.873  -15.804 4.348   1.00 0.00 ? 31  ARG A HE   2  
ATOM 2243  H HH11 . ARG A 1 31  ? 11.919  -12.869 2.795   1.00 0.00 ? 31  ARG A HH11 2  
ATOM 2244  H HH12 . ARG A 1 31  ? 13.491  -13.483 2.403   1.00 0.00 ? 31  ARG A HH12 2  
ATOM 2245  H HH21 . ARG A 1 31  ? 12.939  -16.624 3.837   1.00 0.00 ? 31  ARG A HH21 2  
ATOM 2246  H HH22 . ARG A 1 31  ? 14.070  -15.619 2.995   1.00 0.00 ? 31  ARG A HH22 2  
ATOM 2247  N N    . TRP A 1 32  ? 6.294   -12.947 5.114   1.00 0.00 ? 32  TRP A N    2  
ATOM 2248  C CA   . TRP A 1 32  ? 5.325   -12.266 5.966   1.00 0.00 ? 32  TRP A CA   2  
ATOM 2249  C C    . TRP A 1 32  ? 5.172   -10.805 5.556   1.00 0.00 ? 32  TRP A C    2  
ATOM 2250  O O    . TRP A 1 32  ? 6.105   -10.013 5.686   1.00 0.00 ? 32  TRP A O    2  
ATOM 2251  C CB   . TRP A 1 32  ? 5.754   -12.355 7.432   1.00 0.00 ? 32  TRP A CB   2  
ATOM 2252  C CG   . TRP A 1 32  ? 4.770   -11.733 8.377   1.00 0.00 ? 32  TRP A CG   2  
ATOM 2253  C CD1  . TRP A 1 32  ? 4.956   -10.610 9.132   1.00 0.00 ? 32  TRP A CD1  2  
ATOM 2254  C CD2  . TRP A 1 32  ? 3.449   -12.201 8.669   1.00 0.00 ? 32  TRP A CD2  2  
ATOM 2255  N NE1  . TRP A 1 32  ? 3.830   -10.351 9.875   1.00 0.00 ? 32  TRP A NE1  2  
ATOM 2256  C CE2  . TRP A 1 32  ? 2.890   -11.312 9.608   1.00 0.00 ? 32  TRP A CE2  2  
ATOM 2257  C CE3  . TRP A 1 32  ? 2.682   -13.282 8.226   1.00 0.00 ? 32  TRP A CE3  2  
ATOM 2258  C CZ2  . TRP A 1 32  ? 1.603   -11.474 10.112  1.00 0.00 ? 32  TRP A CZ2  2  
ATOM 2259  C CZ3  . TRP A 1 32  ? 1.404   -13.442 8.727   1.00 0.00 ? 32  TRP A CZ3  2  
ATOM 2260  C CH2  . TRP A 1 32  ? 0.875   -12.542 9.662   1.00 0.00 ? 32  TRP A CH2  2  
ATOM 2261  H H    . TRP A 1 32  ? 7.251   -12.836 5.296   1.00 0.00 ? 32  TRP A H    2  
ATOM 2262  H HA   . TRP A 1 32  ? 4.374   -12.763 5.848   1.00 0.00 ? 32  TRP A HA   2  
ATOM 2263  H HB2  . TRP A 1 32  ? 5.867   -13.393 7.705   1.00 0.00 ? 32  TRP A HB2  2  
ATOM 2264  H HB3  . TRP A 1 32  ? 6.700   -11.848 7.554   1.00 0.00 ? 32  TRP A HB3  2  
ATOM 2265  H HD1  . TRP A 1 32  ? 5.862   -10.023 9.135   1.00 0.00 ? 32  TRP A HD1  2  
ATOM 2266  H HE1  . TRP A 1 32  ? 3.717   -9.600  10.494  1.00 0.00 ? 32  TRP A HE1  2  
ATOM 2267  H HE3  . TRP A 1 32  ? 3.073   -13.986 7.506   1.00 0.00 ? 32  TRP A HE3  2  
ATOM 2268  H HZ2  . TRP A 1 32  ? 1.180   -10.789 10.832  1.00 0.00 ? 32  TRP A HZ2  2  
ATOM 2269  H HZ3  . TRP A 1 32  ? 0.797   -14.272 8.397   1.00 0.00 ? 32  TRP A HZ3  2  
ATOM 2270  H HH2  . TRP A 1 32  ? -0.128  -12.706 10.026  1.00 0.00 ? 32  TRP A HH2  2  
ATOM 2271  N N    . PHE A 1 33  ? 3.989   -10.455 5.062   1.00 0.00 ? 33  PHE A N    2  
ATOM 2272  C CA   . PHE A 1 33  ? 3.714   -9.089  4.632   1.00 0.00 ? 33  PHE A CA   2  
ATOM 2273  C C    . PHE A 1 33  ? 2.926   -8.332  5.697   1.00 0.00 ? 33  PHE A C    2  
ATOM 2274  O O    . PHE A 1 33  ? 2.020   -8.883  6.324   1.00 0.00 ? 33  PHE A O    2  
ATOM 2275  C CB   . PHE A 1 33  ? 2.937   -9.094  3.313   1.00 0.00 ? 33  PHE A CB   2  
ATOM 2276  C CG   . PHE A 1 33  ? 3.812   -9.251  2.103   1.00 0.00 ? 33  PHE A CG   2  
ATOM 2277  C CD1  . PHE A 1 33  ? 4.214   -10.508 1.681   1.00 0.00 ? 33  PHE A CD1  2  
ATOM 2278  C CD2  . PHE A 1 33  ? 4.233   -8.142  1.387   1.00 0.00 ? 33  PHE A CD2  2  
ATOM 2279  C CE1  . PHE A 1 33  ? 5.019   -10.657 0.567   1.00 0.00 ? 33  PHE A CE1  2  
ATOM 2280  C CE2  . PHE A 1 33  ? 5.038   -8.285  0.272   1.00 0.00 ? 33  PHE A CE2  2  
ATOM 2281  C CZ   . PHE A 1 33  ? 5.432   -9.544  -0.137  1.00 0.00 ? 33  PHE A CZ   2  
ATOM 2282  H H    . PHE A 1 33  ? 3.284   -11.133 4.983   1.00 0.00 ? 33  PHE A H    2  
ATOM 2283  H HA   . PHE A 1 33  ? 4.660   -8.594  4.481   1.00 0.00 ? 33  PHE A HA   2  
ATOM 2284  H HB2  . PHE A 1 33  ? 2.232   -9.911  3.322   1.00 0.00 ? 33  PHE A HB2  2  
ATOM 2285  H HB3  . PHE A 1 33  ? 2.400   -8.162  3.218   1.00 0.00 ? 33  PHE A HB3  2  
ATOM 2286  H HD1  . PHE A 1 33  ? 3.891   -11.381 2.233   1.00 0.00 ? 33  PHE A HD1  2  
ATOM 2287  H HD2  . PHE A 1 33  ? 3.927   -7.157  1.706   1.00 0.00 ? 33  PHE A HD2  2  
ATOM 2288  H HE1  . PHE A 1 33  ? 5.325   -11.643 0.250   1.00 0.00 ? 33  PHE A HE1  2  
ATOM 2289  H HE2  . PHE A 1 33  ? 5.359   -7.413  -0.277  1.00 0.00 ? 33  PHE A HE2  2  
ATOM 2290  H HZ   . PHE A 1 33  ? 6.060   -9.658  -1.008  1.00 0.00 ? 33  PHE A HZ   2  
ATOM 2291  N N    . VAL A 1 34  ? 3.278   -7.066  5.897   1.00 0.00 ? 34  VAL A N    2  
ATOM 2292  C CA   . VAL A 1 34  ? 2.604   -6.232  6.885   1.00 0.00 ? 34  VAL A CA   2  
ATOM 2293  C C    . VAL A 1 34  ? 2.249   -4.869  6.303   1.00 0.00 ? 34  VAL A C    2  
ATOM 2294  O O    . VAL A 1 34  ? 3.079   -3.959  6.274   1.00 0.00 ? 34  VAL A O    2  
ATOM 2295  C CB   . VAL A 1 34  ? 3.477   -6.032  8.139   1.00 0.00 ? 34  VAL A CB   2  
ATOM 2296  C CG1  . VAL A 1 34  ? 2.742   -5.192  9.172   1.00 0.00 ? 34  VAL A CG1  2  
ATOM 2297  C CG2  . VAL A 1 34  ? 3.884   -7.376  8.724   1.00 0.00 ? 34  VAL A CG2  2  
ATOM 2298  H H    . VAL A 1 34  ? 4.007   -6.684  5.366   1.00 0.00 ? 34  VAL A H    2  
ATOM 2299  H HA   . VAL A 1 34  ? 1.695   -6.734  7.182   1.00 0.00 ? 34  VAL A HA   2  
ATOM 2300  H HB   . VAL A 1 34  ? 4.372   -5.503  7.848   1.00 0.00 ? 34  VAL A HB   2  
ATOM 2301  H HG11 . VAL A 1 34  ? 2.395   -4.278  8.712   1.00 0.00 ? 34  VAL A HG11 2  
ATOM 2302  H HG12 . VAL A 1 34  ? 1.898   -5.747  9.554   1.00 0.00 ? 34  VAL A HG12 2  
ATOM 2303  H HG13 . VAL A 1 34  ? 3.413   -4.953  9.984   1.00 0.00 ? 34  VAL A HG13 2  
ATOM 2304  H HG21 . VAL A 1 34  ? 3.061   -8.070  8.637   1.00 0.00 ? 34  VAL A HG21 2  
ATOM 2305  H HG22 . VAL A 1 34  ? 4.737   -7.760  8.184   1.00 0.00 ? 34  VAL A HG22 2  
ATOM 2306  H HG23 . VAL A 1 34  ? 4.143   -7.252  9.765   1.00 0.00 ? 34  VAL A HG23 2  
ATOM 2307  N N    . LEU A 1 35  ? 1.011   -4.733  5.841   1.00 0.00 ? 35  LEU A N    2  
ATOM 2308  C CA   . LEU A 1 35  ? 0.544   -3.479  5.259   1.00 0.00 ? 35  LEU A CA   2  
ATOM 2309  C C    . LEU A 1 35  ? 0.637   -2.342  6.272   1.00 0.00 ? 35  LEU A C    2  
ATOM 2310  O O    . LEU A 1 35  ? -0.043  -2.354  7.298   1.00 0.00 ? 35  LEU A O    2  
ATOM 2311  C CB   . LEU A 1 35  ? -0.898  -3.627  4.771   1.00 0.00 ? 35  LEU A CB   2  
ATOM 2312  C CG   . LEU A 1 35  ? -1.615  -2.329  4.397   1.00 0.00 ? 35  LEU A CG   2  
ATOM 2313  C CD1  . LEU A 1 35  ? -0.978  -1.702  3.166   1.00 0.00 ? 35  LEU A CD1  2  
ATOM 2314  C CD2  . LEU A 1 35  ? -3.096  -2.588  4.160   1.00 0.00 ? 35  LEU A CD2  2  
ATOM 2315  H H    . LEU A 1 35  ? 0.396   -5.494  5.891   1.00 0.00 ? 35  LEU A H    2  
ATOM 2316  H HA   . LEU A 1 35  ? 1.180   -3.248  4.417   1.00 0.00 ? 35  LEU A HA   2  
ATOM 2317  H HB2  . LEU A 1 35  ? -0.888  -4.262  3.898   1.00 0.00 ? 35  LEU A HB2  2  
ATOM 2318  H HB3  . LEU A 1 35  ? -1.465  -4.105  5.556   1.00 0.00 ? 35  LEU A HB3  2  
ATOM 2319  H HG   . LEU A 1 35  ? -1.524  -1.626  5.214   1.00 0.00 ? 35  LEU A HG   2  
ATOM 2320  H HD11 . LEU A 1 35  ? -1.227  -0.653  3.127   1.00 0.00 ? 35  LEU A HD11 2  
ATOM 2321  H HD12 . LEU A 1 35  ? -1.349  -2.193  2.279   1.00 0.00 ? 35  LEU A HD12 2  
ATOM 2322  H HD13 . LEU A 1 35  ? 0.095   -1.817  3.219   1.00 0.00 ? 35  LEU A HD13 2  
ATOM 2323  H HD21 . LEU A 1 35  ? -3.411  -3.437  4.748   1.00 0.00 ? 35  LEU A HD21 2  
ATOM 2324  H HD22 . LEU A 1 35  ? -3.262  -2.795  3.112   1.00 0.00 ? 35  LEU A HD22 2  
ATOM 2325  H HD23 . LEU A 1 35  ? -3.665  -1.717  4.450   1.00 0.00 ? 35  LEU A HD23 2  
ATOM 2326  N N    . VAL A 1 36  ? 1.481   -1.359  5.974   1.00 0.00 ? 36  VAL A N    2  
ATOM 2327  C CA   . VAL A 1 36  ? 1.660   -0.212  6.856   1.00 0.00 ? 36  VAL A CA   2  
ATOM 2328  C C    . VAL A 1 36  ? 0.998   1.034   6.278   1.00 0.00 ? 36  VAL A C    2  
ATOM 2329  O O    . VAL A 1 36  ? 0.403   0.991   5.202   1.00 0.00 ? 36  VAL A O    2  
ATOM 2330  C CB   . VAL A 1 36  ? 3.152   0.079   7.103   1.00 0.00 ? 36  VAL A CB   2  
ATOM 2331  C CG1  . VAL A 1 36  ? 3.718   0.945   5.988   1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2332  C CG2  . VAL A 1 36  ? 3.348   0.744   8.457   1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2333  H H    . VAL A 1 36  ? 1.995   -1.406  5.141   1.00 0.00 ? 36  VAL A H    2  
ATOM 2334  H HA   . VAL A 1 36  ? 1.199   -0.445  7.805   1.00 0.00 ? 36  VAL A HA   2  
ATOM 2335  H HB   . VAL A 1 36  ? 3.686   -0.860  7.105   1.00 0.00 ? 36  VAL A HB   2  
ATOM 2336  H HG11 . VAL A 1 36  ? 3.807   1.965   6.334   1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2337  H HG12 . VAL A 1 36  ? 4.691   0.574   5.702   1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2338  H HG13 . VAL A 1 36  ? 3.055   0.913   5.135   1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2339  H HG21 . VAL A 1 36  ? 2.410   0.753   8.992   1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2340  H HG22 . VAL A 1 36  ? 4.082   0.191   9.026   1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2341  H HG23 . VAL A 1 36  ? 3.692   1.757   8.315   1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2342  N N    . ASP A 1 37  ? 1.107   2.144   7.001   1.00 0.00 ? 37  ASP A N    2  
ATOM 2343  C CA   . ASP A 1 37  ? 0.521   3.404   6.560   1.00 0.00 ? 37  ASP A CA   2  
ATOM 2344  C C    . ASP A 1 37  ? 1.052   3.799   5.185   1.00 0.00 ? 37  ASP A C    2  
ATOM 2345  O O    . ASP A 1 37  ? 2.248   4.036   5.016   1.00 0.00 ? 37  ASP A O    2  
ATOM 2346  C CB   . ASP A 1 37  ? 0.817   4.511   7.572   1.00 0.00 ? 37  ASP A CB   2  
ATOM 2347  C CG   . ASP A 1 37  ? -0.254  4.621   8.640   1.00 0.00 ? 37  ASP A CG   2  
ATOM 2348  O OD1  . ASP A 1 37  ? -1.357  5.112   8.324   1.00 0.00 ? 37  ASP A OD1  2  
ATOM 2349  O OD2  . ASP A 1 37  ? 0.013   4.217   9.791   1.00 0.00 ? 37  ASP A OD2  2  
ATOM 2350  H H    . ASP A 1 37  ? 1.594   2.115   7.851   1.00 0.00 ? 37  ASP A H    2  
ATOM 2351  H HA   . ASP A 1 37  ? -0.548  3.267   6.492   1.00 0.00 ? 37  ASP A HA   2  
ATOM 2352  H HB2  . ASP A 1 37  ? 1.761   4.305   8.055   1.00 0.00 ? 37  ASP A HB2  2  
ATOM 2353  H HB3  . ASP A 1 37  ? 0.882   5.456   7.054   1.00 0.00 ? 37  ASP A HB3  2  
ATOM 2354  N N    . ARG A 1 38  ? 0.156   3.866   4.207   1.00 0.00 ? 38  ARG A N    2  
ATOM 2355  C CA   . ARG A 1 38  ? 0.535   4.229   2.847   1.00 0.00 ? 38  ARG A CA   2  
ATOM 2356  C C    . ARG A 1 38  ? 1.833   3.536   2.440   1.00 0.00 ? 38  ARG A C    2  
ATOM 2357  O O    . ARG A 1 38  ? 2.665   4.116   1.742   1.00 0.00 ? 38  ARG A O    2  
ATOM 2358  C CB   . ARG A 1 38  ? 0.695   5.746   2.727   1.00 0.00 ? 38  ARG A CB   2  
ATOM 2359  C CG   . ARG A 1 38  ? -0.591  6.467   2.362   1.00 0.00 ? 38  ARG A CG   2  
ATOM 2360  C CD   . ARG A 1 38  ? -0.312  7.761   1.613   1.00 0.00 ? 38  ARG A CD   2  
ATOM 2361  N NE   . ARG A 1 38  ? -0.169  8.898   2.520   1.00 0.00 ? 38  ARG A NE   2  
ATOM 2362  C CZ   . ARG A 1 38  ? -0.170  10.163  2.117   1.00 0.00 ? 38  ARG A CZ   2  
ATOM 2363  N NH1  . ARG A 1 38  ? -0.307  10.453  0.830   1.00 0.00 ? 38  ARG A NH1  2  
ATOM 2364  N NH2  . ARG A 1 38  ? -0.035  11.143  3.002   1.00 0.00 ? 38  ARG A NH2  2  
ATOM 2365  H H    . ARG A 1 38  ? -0.783  3.665   4.403   1.00 0.00 ? 38  ARG A H    2  
ATOM 2366  H HA   . ARG A 1 38  ? -0.254  3.906   2.184   1.00 0.00 ? 38  ARG A HA   2  
ATOM 2367  H HB2  . ARG A 1 38  ? 1.044   6.135   3.673   1.00 0.00 ? 38  ARG A HB2  2  
ATOM 2368  H HB3  . ARG A 1 38  ? 1.431   5.959   1.966   1.00 0.00 ? 38  ARG A HB3  2  
ATOM 2369  H HG2  . ARG A 1 38  ? -1.188  5.823   1.733   1.00 0.00 ? 38  ARG A HG2  2  
ATOM 2370  H HG3  . ARG A 1 38  ? -1.135  6.695   3.267   1.00 0.00 ? 38  ARG A HG3  2  
ATOM 2371  H HD2  . ARG A 1 38  ? 0.602   7.645   1.050   1.00 0.00 ? 38  ARG A HD2  2  
ATOM 2372  H HD3  . ARG A 1 38  ? -1.130  7.953   0.936   1.00 0.00 ? 38  ARG A HD3  2  
ATOM 2373  H HE   . ARG A 1 38  ? -0.067  8.706   3.475   1.00 0.00 ? 38  ARG A HE   2  
ATOM 2374  H HH11 . ARG A 1 38  ? -0.409  9.717   0.161   1.00 0.00 ? 38  ARG A HH11 2  
ATOM 2375  H HH12 . ARG A 1 38  ? -0.308  11.407  0.530   1.00 0.00 ? 38  ARG A HH12 2  
ATOM 2376  H HH21 . ARG A 1 38  ? 0.068   10.928  3.973   1.00 0.00 ? 38  ARG A HH21 2  
ATOM 2377  H HH22 . ARG A 1 38  ? -0.036  12.095  2.698   1.00 0.00 ? 38  ARG A HH22 2  
ATOM 2378  N N    . CYS A 1 39  ? 1.998   2.295   2.883   1.00 0.00 ? 39  CYS A N    2  
ATOM 2379  C CA   . CYS A 1 39  ? 3.195   1.523   2.567   1.00 0.00 ? 39  CYS A CA   2  
ATOM 2380  C C    . CYS A 1 39  ? 3.014   0.058   2.949   1.00 0.00 ? 39  CYS A C    2  
ATOM 2381  O O    . CYS A 1 39  ? 2.010   -0.317  3.558   1.00 0.00 ? 39  CYS A O    2  
ATOM 2382  C CB   . CYS A 1 39  ? 4.409   2.106   3.292   1.00 0.00 ? 39  CYS A CB   2  
ATOM 2383  S SG   . CYS A 1 39  ? 5.293   3.372   2.352   1.00 0.00 ? 39  CYS A SG   2  
ATOM 2384  H H    . CYS A 1 39  ? 1.299   1.887   3.436   1.00 0.00 ? 39  CYS A H    2  
ATOM 2385  H HA   . CYS A 1 39  ? 3.358   1.587   1.502   1.00 0.00 ? 39  CYS A HA   2  
ATOM 2386  H HB2  . CYS A 1 39  ? 4.084   2.554   4.220   1.00 0.00 ? 39  CYS A HB2  2  
ATOM 2387  H HB3  . CYS A 1 39  ? 5.105   1.310   3.510   1.00 0.00 ? 39  CYS A HB3  2  
ATOM 2388  H HG   . CYS A 1 39  ? 6.592   3.161   2.504   1.00 0.00 ? 39  CYS A HG   2  
ATOM 2389  N N    . LEU A 1 40  ? 3.989   -0.767  2.587   1.00 0.00 ? 40  LEU A N    2  
ATOM 2390  C CA   . LEU A 1 40  ? 3.938   -2.193  2.890   1.00 0.00 ? 40  LEU A CA   2  
ATOM 2391  C C    . LEU A 1 40  ? 5.341   -2.765  3.060   1.00 0.00 ? 40  LEU A C    2  
ATOM 2392  O O    . LEU A 1 40  ? 6.217   -2.548  2.223   1.00 0.00 ? 40  LEU A O    2  
ATOM 2393  C CB   . LEU A 1 40  ? 3.199   -2.944  1.781   1.00 0.00 ? 40  LEU A CB   2  
ATOM 2394  C CG   . LEU A 1 40  ? 3.347   -4.466  1.788   1.00 0.00 ? 40  LEU A CG   2  
ATOM 2395  C CD1  . LEU A 1 40  ? 2.751   -5.054  3.057   1.00 0.00 ? 40  LEU A CD1  2  
ATOM 2396  C CD2  . LEU A 1 40  ? 2.687   -5.071  0.557   1.00 0.00 ? 40  LEU A CD2  2  
ATOM 2397  H H    . LEU A 1 40  ? 4.764   -0.410  2.104   1.00 0.00 ? 40  LEU A H    2  
ATOM 2398  H HA   . LEU A 1 40  ? 3.398   -2.315  3.818   1.00 0.00 ? 40  LEU A HA   2  
ATOM 2399  H HB2  . LEU A 1 40  ? 2.149   -2.714  1.868   1.00 0.00 ? 40  LEU A HB2  2  
ATOM 2400  H HB3  . LEU A 1 40  ? 3.569   -2.579  0.833   1.00 0.00 ? 40  LEU A HB3  2  
ATOM 2401  H HG   . LEU A 1 40  ? 4.398   -4.720  1.764   1.00 0.00 ? 40  LEU A HG   2  
ATOM 2402  H HD11 . LEU A 1 40  ? 2.895   -4.365  3.875   1.00 0.00 ? 40  LEU A HD11 2  
ATOM 2403  H HD12 . LEU A 1 40  ? 3.241   -5.990  3.284   1.00 0.00 ? 40  LEU A HD12 2  
ATOM 2404  H HD13 . LEU A 1 40  ? 1.695   -5.227  2.913   1.00 0.00 ? 40  LEU A HD13 2  
ATOM 2405  H HD21 . LEU A 1 40  ? 1.911   -4.409  0.203   1.00 0.00 ? 40  LEU A HD21 2  
ATOM 2406  H HD22 . LEU A 1 40  ? 2.254   -6.027  0.814   1.00 0.00 ? 40  LEU A HD22 2  
ATOM 2407  H HD23 . LEU A 1 40  ? 3.427   -5.207  -0.218  1.00 0.00 ? 40  LEU A HD23 2  
ATOM 2408  N N    . PHE A 1 41  ? 5.548   -3.499  4.148   1.00 0.00 ? 41  PHE A N    2  
ATOM 2409  C CA   . PHE A 1 41  ? 6.845   -4.104  4.428   1.00 0.00 ? 41  PHE A CA   2  
ATOM 2410  C C    . PHE A 1 41  ? 6.708   -5.608  4.649   1.00 0.00 ? 41  PHE A C    2  
ATOM 2411  O O    . PHE A 1 41  ? 5.686   -6.083  5.145   1.00 0.00 ? 41  PHE A O    2  
ATOM 2412  C CB   . PHE A 1 41  ? 7.481   -3.453  5.657   1.00 0.00 ? 41  PHE A CB   2  
ATOM 2413  C CG   . PHE A 1 41  ? 7.829   -2.005  5.456   1.00 0.00 ? 41  PHE A CG   2  
ATOM 2414  C CD1  . PHE A 1 41  ? 9.022   -1.644  4.851   1.00 0.00 ? 41  PHE A CD1  2  
ATOM 2415  C CD2  . PHE A 1 41  ? 6.963   -1.007  5.871   1.00 0.00 ? 41  PHE A CD2  2  
ATOM 2416  C CE1  . PHE A 1 41  ? 9.345   -0.313  4.665   1.00 0.00 ? 41  PHE A CE1  2  
ATOM 2417  C CE2  . PHE A 1 41  ? 7.280   0.326   5.688   1.00 0.00 ? 41  PHE A CE2  2  
ATOM 2418  C CZ   . PHE A 1 41  ? 8.472   0.673   5.083   1.00 0.00 ? 41  PHE A CZ   2  
ATOM 2419  H H    . PHE A 1 41  ? 4.810   -3.637  4.779   1.00 0.00 ? 41  PHE A H    2  
ATOM 2420  H HA   . PHE A 1 41  ? 7.480   -3.935  3.572   1.00 0.00 ? 41  PHE A HA   2  
ATOM 2421  H HB2  . PHE A 1 41  ? 6.793   -3.515  6.486   1.00 0.00 ? 41  PHE A HB2  2  
ATOM 2422  H HB3  . PHE A 1 41  ? 8.389   -3.982  5.907   1.00 0.00 ? 41  PHE A HB3  2  
ATOM 2423  H HD1  . PHE A 1 41  ? 9.705   -2.413  4.523   1.00 0.00 ? 41  PHE A HD1  2  
ATOM 2424  H HD2  . PHE A 1 41  ? 6.030   -1.278  6.344   1.00 0.00 ? 41  PHE A HD2  2  
ATOM 2425  H HE1  . PHE A 1 41  ? 10.277  -0.044  4.192   1.00 0.00 ? 41  PHE A HE1  2  
ATOM 2426  H HE2  . PHE A 1 41  ? 6.596   1.094   6.016   1.00 0.00 ? 41  PHE A HE2  2  
ATOM 2427  H HZ   . PHE A 1 41  ? 8.723   1.714   4.939   1.00 0.00 ? 41  PHE A HZ   2  
ATOM 2428  N N    . TYR A 1 42  ? 7.743   -6.351  4.277   1.00 0.00 ? 42  TYR A N    2  
ATOM 2429  C CA   . TYR A 1 42  ? 7.738   -7.801  4.431   1.00 0.00 ? 42  TYR A CA   2  
ATOM 2430  C C    . TYR A 1 42  ? 8.902   -8.260  5.305   1.00 0.00 ? 42  TYR A C    2  
ATOM 2431  O O    . TYR A 1 42  ? 9.822   -7.493  5.586   1.00 0.00 ? 42  TYR A O    2  
ATOM 2432  C CB   . TYR A 1 42  ? 7.814   -8.481  3.063   1.00 0.00 ? 42  TYR A CB   2  
ATOM 2433  C CG   . TYR A 1 42  ? 9.091   -8.185  2.310   1.00 0.00 ? 42  TYR A CG   2  
ATOM 2434  C CD1  . TYR A 1 42  ? 9.192   -7.071  1.486   1.00 0.00 ? 42  TYR A CD1  2  
ATOM 2435  C CD2  . TYR A 1 42  ? 10.196  -9.020  2.421   1.00 0.00 ? 42  TYR A CD2  2  
ATOM 2436  C CE1  . TYR A 1 42  ? 10.356  -6.797  0.795   1.00 0.00 ? 42  TYR A CE1  2  
ATOM 2437  C CE2  . TYR A 1 42  ? 11.365  -8.753  1.735   1.00 0.00 ? 42  TYR A CE2  2  
ATOM 2438  C CZ   . TYR A 1 42  ? 11.440  -7.640  0.923   1.00 0.00 ? 42  TYR A CZ   2  
ATOM 2439  O OH   . TYR A 1 42  ? 12.602  -7.371  0.237   1.00 0.00 ? 42  TYR A OH   2  
ATOM 2440  H H    . TYR A 1 42  ? 8.530   -5.915  3.887   1.00 0.00 ? 42  TYR A H    2  
ATOM 2441  H HA   . TYR A 1 42  ? 6.811   -8.081  4.910   1.00 0.00 ? 42  TYR A HA   2  
ATOM 2442  H HB2  . TYR A 1 42  ? 7.748   -9.550  3.196   1.00 0.00 ? 42  TYR A HB2  2  
ATOM 2443  H HB3  . TYR A 1 42  ? 6.985   -8.147  2.456   1.00 0.00 ? 42  TYR A HB3  2  
ATOM 2444  H HD1  . TYR A 1 42  ? 8.341   -6.412  1.387   1.00 0.00 ? 42  TYR A HD1  2  
ATOM 2445  H HD2  . TYR A 1 42  ? 10.134  -9.891  3.057   1.00 0.00 ? 42  TYR A HD2  2  
ATOM 2446  H HE1  . TYR A 1 42  ? 10.416  -5.925  0.159   1.00 0.00 ? 42  TYR A HE1  2  
ATOM 2447  H HE2  . TYR A 1 42  ? 12.214  -9.413  1.835   1.00 0.00 ? 42  TYR A HE2  2  
ATOM 2448  H HH   . TYR A 1 42  ? 13.282  -7.093  0.855   1.00 0.00 ? 42  TYR A HH   2  
ATOM 2449  N N    . TYR A 1 43  ? 8.853   -9.518  5.730   1.00 0.00 ? 43  TYR A N    2  
ATOM 2450  C CA   . TYR A 1 43  ? 9.901   -10.080 6.573   1.00 0.00 ? 43  TYR A CA   2  
ATOM 2451  C C    . TYR A 1 43  ? 9.947   -11.600 6.445   1.00 0.00 ? 43  TYR A C    2  
ATOM 2452  O O    . TYR A 1 43  ? 9.105   -12.205 5.780   1.00 0.00 ? 43  TYR A O    2  
ATOM 2453  C CB   . TYR A 1 43  ? 9.675   -9.687  8.034   1.00 0.00 ? 43  TYR A CB   2  
ATOM 2454  C CG   . TYR A 1 43  ? 9.106   -8.297  8.206   1.00 0.00 ? 43  TYR A CG   2  
ATOM 2455  C CD1  . TYR A 1 43  ? 7.825   -7.990  7.766   1.00 0.00 ? 43  TYR A CD1  2  
ATOM 2456  C CD2  . TYR A 1 43  ? 9.850   -7.291  8.811   1.00 0.00 ? 43  TYR A CD2  2  
ATOM 2457  C CE1  . TYR A 1 43  ? 7.301   -6.721  7.921   1.00 0.00 ? 43  TYR A CE1  2  
ATOM 2458  C CE2  . TYR A 1 43  ? 9.334   -6.019  8.971   1.00 0.00 ? 43  TYR A CE2  2  
ATOM 2459  C CZ   . TYR A 1 43  ? 8.059   -5.739  8.524   1.00 0.00 ? 43  TYR A CZ   2  
ATOM 2460  O OH   . TYR A 1 43  ? 7.541   -4.474  8.681   1.00 0.00 ? 43  TYR A OH   2  
ATOM 2461  H H    . TYR A 1 43  ? 8.094   -10.081 5.473   1.00 0.00 ? 43  TYR A H    2  
ATOM 2462  H HA   . TYR A 1 43  ? 10.846  -9.674  6.244   1.00 0.00 ? 43  TYR A HA   2  
ATOM 2463  H HB2  . TYR A 1 43  ? 8.987   -10.385 8.485   1.00 0.00 ? 43  TYR A HB2  2  
ATOM 2464  H HB3  . TYR A 1 43  ? 10.618  -9.728  8.561   1.00 0.00 ? 43  TYR A HB3  2  
ATOM 2465  H HD1  . TYR A 1 43  ? 7.233   -8.762  7.295   1.00 0.00 ? 43  TYR A HD1  2  
ATOM 2466  H HD2  . TYR A 1 43  ? 10.848  -7.513  9.160   1.00 0.00 ? 43  TYR A HD2  2  
ATOM 2467  H HE1  . TYR A 1 43  ? 6.303   -6.502  7.571   1.00 0.00 ? 43  TYR A HE1  2  
ATOM 2468  H HE2  . TYR A 1 43  ? 9.927   -5.250  9.442   1.00 0.00 ? 43  TYR A HE2  2  
ATOM 2469  H HH   . TYR A 1 43  ? 7.970   -3.874  8.066   1.00 0.00 ? 43  TYR A HH   2  
ATOM 2470  N N    . LYS A 1 44  ? 10.936  -12.212 7.087   1.00 0.00 ? 44  LYS A N    2  
ATOM 2471  C CA   . LYS A 1 44  ? 11.093  -13.661 7.048   1.00 0.00 ? 44  LYS A CA   2  
ATOM 2472  C C    . LYS A 1 44  ? 9.838   -14.358 7.564   1.00 0.00 ? 44  LYS A C    2  
ATOM 2473  O O    . LYS A 1 44  ? 9.320   -15.275 6.927   1.00 0.00 ? 44  LYS A O    2  
ATOM 2474  C CB   . LYS A 1 44  ? 12.305  -14.086 7.881   1.00 0.00 ? 44  LYS A CB   2  
ATOM 2475  C CG   . LYS A 1 44  ? 13.608  -14.088 7.101   1.00 0.00 ? 44  LYS A CG   2  
ATOM 2476  C CD   . LYS A 1 44  ? 14.803  -13.861 8.012   1.00 0.00 ? 44  LYS A CD   2  
ATOM 2477  C CE   . LYS A 1 44  ? 16.076  -13.627 7.213   1.00 0.00 ? 44  LYS A CE   2  
ATOM 2478  N NZ   . LYS A 1 44  ? 17.238  -13.327 8.096   1.00 0.00 ? 44  LYS A NZ   2  
ATOM 2479  H H    . LYS A 1 44  ? 11.576  -11.675 7.600   1.00 0.00 ? 44  LYS A H    2  
ATOM 2480  H HA   . LYS A 1 44  ? 11.254  -13.950 6.020   1.00 0.00 ? 44  LYS A HA   2  
ATOM 2481  H HB2  . LYS A 1 44  ? 12.409  -13.407 8.715   1.00 0.00 ? 44  LYS A HB2  2  
ATOM 2482  H HB3  . LYS A 1 44  ? 12.134  -15.083 8.259   1.00 0.00 ? 44  LYS A HB3  2  
ATOM 2483  H HG2  . LYS A 1 44  ? 13.721  -15.042 6.609   1.00 0.00 ? 44  LYS A HG2  2  
ATOM 2484  H HG3  . LYS A 1 44  ? 13.576  -13.301 6.362   1.00 0.00 ? 44  LYS A HG3  2  
ATOM 2485  H HD2  . LYS A 1 44  ? 14.615  -12.995 8.629   1.00 0.00 ? 44  LYS A HD2  2  
ATOM 2486  H HD3  . LYS A 1 44  ? 14.936  -14.730 8.640   1.00 0.00 ? 44  LYS A HD3  2  
ATOM 2487  H HE2  . LYS A 1 44  ? 16.292  -14.514 6.638   1.00 0.00 ? 44  LYS A HE2  2  
ATOM 2488  H HE3  . LYS A 1 44  ? 15.918  -12.794 6.545   1.00 0.00 ? 44  LYS A HE3  2  
ATOM 2489  H HZ1  . LYS A 1 44  ? 18.126  -13.439 7.567   1.00 0.00 ? 44  LYS A HZ1  2  
ATOM 2490  H HZ2  . LYS A 1 44  ? 17.247  -13.977 8.908   1.00 0.00 ? 44  LYS A HZ2  2  
ATOM 2491  H HZ3  . LYS A 1 44  ? 17.176  -12.351 8.448   1.00 0.00 ? 44  LYS A HZ3  2  
ATOM 2492  N N    . ASP A 1 45  ? 9.355   -13.917 8.720   1.00 0.00 ? 45  ASP A N    2  
ATOM 2493  C CA   . ASP A 1 45  ? 8.159   -14.497 9.320   1.00 0.00 ? 45  ASP A CA   2  
ATOM 2494  C C    . ASP A 1 45  ? 7.410   -13.460 10.151  1.00 0.00 ? 45  ASP A C    2  
ATOM 2495  O O    . ASP A 1 45  ? 7.780   -12.286 10.175  1.00 0.00 ? 45  ASP A O    2  
ATOM 2496  C CB   . ASP A 1 45  ? 8.531   -15.696 10.193  1.00 0.00 ? 45  ASP A CB   2  
ATOM 2497  C CG   . ASP A 1 45  ? 9.792   -15.455 11.000  1.00 0.00 ? 45  ASP A CG   2  
ATOM 2498  O OD1  . ASP A 1 45  ? 10.151  -14.277 11.203  1.00 0.00 ? 45  ASP A OD1  2  
ATOM 2499  O OD2  . ASP A 1 45  ? 10.421  -16.446 11.429  1.00 0.00 ? 45  ASP A OD2  2  
ATOM 2500  H H    . ASP A 1 45  ? 9.813   -13.183 9.180   1.00 0.00 ? 45  ASP A H    2  
ATOM 2501  H HA   . ASP A 1 45  ? 7.516   -14.832 8.520   1.00 0.00 ? 45  ASP A HA   2  
ATOM 2502  H HB2  . ASP A 1 45  ? 7.721   -15.899 10.879  1.00 0.00 ? 45  ASP A HB2  2  
ATOM 2503  H HB3  . ASP A 1 45  ? 8.688   -16.558 9.562   1.00 0.00 ? 45  ASP A HB3  2  
ATOM 2504  N N    . GLU A 1 46  ? 6.355   -13.901 10.829  1.00 0.00 ? 46  GLU A N    2  
ATOM 2505  C CA   . GLU A 1 46  ? 5.554   -13.010 11.659  1.00 0.00 ? 46  GLU A CA   2  
ATOM 2506  C C    . GLU A 1 46  ? 6.429   -12.272 12.667  1.00 0.00 ? 46  GLU A C    2  
ATOM 2507  O O    . GLU A 1 46  ? 6.285   -11.065 12.866  1.00 0.00 ? 46  GLU A O    2  
ATOM 2508  C CB   . GLU A 1 46  ? 4.467   -13.799 12.392  1.00 0.00 ? 46  GLU A CB   2  
ATOM 2509  C CG   . GLU A 1 46  ? 4.982   -15.058 13.070  1.00 0.00 ? 46  GLU A CG   2  
ATOM 2510  C CD   . GLU A 1 46  ? 3.892   -15.809 13.809  1.00 0.00 ? 46  GLU A CD   2  
ATOM 2511  O OE1  . GLU A 1 46  ? 3.577   -15.422 14.954  1.00 0.00 ? 46  GLU A OE1  2  
ATOM 2512  O OE2  . GLU A 1 46  ? 3.354   -16.784 13.244  1.00 0.00 ? 46  GLU A OE2  2  
ATOM 2513  H H    . GLU A 1 46  ? 6.110   -14.848 10.769  1.00 0.00 ? 46  GLU A H    2  
ATOM 2514  H HA   . GLU A 1 46  ? 5.084   -12.286 11.010  1.00 0.00 ? 46  GLU A HA   2  
ATOM 2515  H HB2  . GLU A 1 46  ? 4.023   -13.164 13.144  1.00 0.00 ? 46  GLU A HB2  2  
ATOM 2516  H HB3  . GLU A 1 46  ? 3.705   -14.085 11.681  1.00 0.00 ? 46  GLU A HB3  2  
ATOM 2517  H HG2  . GLU A 1 46  ? 5.401   -15.710 12.319  1.00 0.00 ? 46  GLU A HG2  2  
ATOM 2518  H HG3  . GLU A 1 46  ? 5.751   -14.782 13.776  1.00 0.00 ? 46  GLU A HG3  2  
ATOM 2519  N N    . LYS A 1 47  ? 7.337   -13.005 13.302  1.00 0.00 ? 47  LYS A N    2  
ATOM 2520  C CA   . LYS A 1 47  ? 8.238   -12.422 14.289  1.00 0.00 ? 47  LYS A CA   2  
ATOM 2521  C C    . LYS A 1 47  ? 8.617   -10.996 13.905  1.00 0.00 ? 47  LYS A C    2  
ATOM 2522  O O    . LYS A 1 47  ? 8.725   -10.120 14.763  1.00 0.00 ? 47  LYS A O    2  
ATOM 2523  C CB   . LYS A 1 47  ? 9.499   -13.278 14.427  1.00 0.00 ? 47  LYS A CB   2  
ATOM 2524  C CG   . LYS A 1 47  ? 9.228   -14.685 14.930  1.00 0.00 ? 47  LYS A CG   2  
ATOM 2525  C CD   . LYS A 1 47  ? 9.230   -14.746 16.448  1.00 0.00 ? 47  LYS A CD   2  
ATOM 2526  C CE   . LYS A 1 47  ? 10.643  -14.685 17.006  1.00 0.00 ? 47  LYS A CE   2  
ATOM 2527  N NZ   . LYS A 1 47  ? 10.671  -14.933 18.474  1.00 0.00 ? 47  LYS A NZ   2  
ATOM 2528  H H    . LYS A 1 47  ? 7.404   -13.962 13.100  1.00 0.00 ? 47  LYS A H    2  
ATOM 2529  H HA   . LYS A 1 47  ? 7.722   -12.401 15.237  1.00 0.00 ? 47  LYS A HA   2  
ATOM 2530  H HB2  . LYS A 1 47  ? 9.979   -13.348 13.462  1.00 0.00 ? 47  LYS A HB2  2  
ATOM 2531  H HB3  . LYS A 1 47  ? 10.173  -12.795 15.120  1.00 0.00 ? 47  LYS A HB3  2  
ATOM 2532  H HG2  . LYS A 1 47  ? 8.262   -15.006 14.569  1.00 0.00 ? 47  LYS A HG2  2  
ATOM 2533  H HG3  . LYS A 1 47  ? 9.994   -15.347 14.551  1.00 0.00 ? 47  LYS A HG3  2  
ATOM 2534  H HD2  . LYS A 1 47  ? 8.666   -13.909 16.834  1.00 0.00 ? 47  LYS A HD2  2  
ATOM 2535  H HD3  . LYS A 1 47  ? 8.766   -15.670 16.763  1.00 0.00 ? 47  LYS A HD3  2  
ATOM 2536  H HE2  . LYS A 1 47  ? 11.244  -15.433 16.512  1.00 0.00 ? 47  LYS A HE2  2  
ATOM 2537  H HE3  . LYS A 1 47  ? 11.053  -13.706 16.807  1.00 0.00 ? 47  LYS A HE3  2  
ATOM 2538  H HZ1  . LYS A 1 47  ? 10.492  -15.939 18.669  1.00 0.00 ? 47  LYS A HZ1  2  
ATOM 2539  H HZ2  . LYS A 1 47  ? 9.939   -14.366 18.946  1.00 0.00 ? 47  LYS A HZ2  2  
ATOM 2540  H HZ3  . LYS A 1 47  ? 11.600  -14.675 18.863  1.00 0.00 ? 47  LYS A HZ3  2  
ATOM 2541  N N    . GLU A 1 48  ? 8.818   -10.770 12.610  1.00 0.00 ? 48  GLU A N    2  
ATOM 2542  C CA   . GLU A 1 48  ? 9.185   -9.449  12.113  1.00 0.00 ? 48  GLU A CA   2  
ATOM 2543  C C    . GLU A 1 48  ? 10.491  -8.975  12.743  1.00 0.00 ? 48  GLU A C    2  
ATOM 2544  O O    . GLU A 1 48  ? 10.578  -7.855  13.247  1.00 0.00 ? 48  GLU A O    2  
ATOM 2545  C CB   . GLU A 1 48  ? 8.070   -8.442  12.405  1.00 0.00 ? 48  GLU A CB   2  
ATOM 2546  C CG   . GLU A 1 48  ? 8.106   -7.217  11.507  1.00 0.00 ? 48  GLU A CG   2  
ATOM 2547  C CD   . GLU A 1 48  ? 7.166   -6.123  11.974  1.00 0.00 ? 48  GLU A CD   2  
ATOM 2548  O OE1  . GLU A 1 48  ? 5.955   -6.399  12.105  1.00 0.00 ? 48  GLU A OE1  2  
ATOM 2549  O OE2  . GLU A 1 48  ? 7.641   -4.992  12.209  1.00 0.00 ? 48  GLU A OE2  2  
ATOM 2550  H H    . GLU A 1 48  ? 8.716   -11.509 11.974  1.00 0.00 ? 48  GLU A H    2  
ATOM 2551  H HA   . GLU A 1 48  ? 9.320   -9.522  11.045  1.00 0.00 ? 48  GLU A HA   2  
ATOM 2552  H HB2  . GLU A 1 48  ? 7.116   -8.932  12.274  1.00 0.00 ? 48  GLU A HB2  2  
ATOM 2553  H HB3  . GLU A 1 48  ? 8.157   -8.114  13.430  1.00 0.00 ? 48  GLU A HB3  2  
ATOM 2554  H HG2  . GLU A 1 48  ? 9.112   -6.825  11.495  1.00 0.00 ? 48  GLU A HG2  2  
ATOM 2555  H HG3  . GLU A 1 48  ? 7.824   -7.511  10.507  1.00 0.00 ? 48  GLU A HG3  2  
ATOM 2556  N N    . GLU A 1 49  ? 11.503  -9.835  12.712  1.00 0.00 ? 49  GLU A N    2  
ATOM 2557  C CA   . GLU A 1 49  ? 12.805  -9.505  13.281  1.00 0.00 ? 49  GLU A CA   2  
ATOM 2558  C C    . GLU A 1 49  ? 13.332  -8.193  12.706  1.00 0.00 ? 49  GLU A C    2  
ATOM 2559  O O    . GLU A 1 49  ? 13.566  -7.231  13.439  1.00 0.00 ? 49  GLU A O    2  
ATOM 2560  C CB   . GLU A 1 49  ? 13.805  -10.631 13.012  1.00 0.00 ? 49  GLU A CB   2  
ATOM 2561  C CG   . GLU A 1 49  ? 13.811  -11.708 14.083  1.00 0.00 ? 49  GLU A CG   2  
ATOM 2562  C CD   . GLU A 1 49  ? 15.023  -12.615 13.992  1.00 0.00 ? 49  GLU A CD   2  
ATOM 2563  O OE1  . GLU A 1 49  ? 16.130  -12.163 14.351  1.00 0.00 ? 49  GLU A OE1  2  
ATOM 2564  O OE2  . GLU A 1 49  ? 14.863  -13.777 13.562  1.00 0.00 ? 49  GLU A OE2  2  
ATOM 2565  H H    . GLU A 1 49  ? 11.372  -10.713 12.296  1.00 0.00 ? 49  GLU A H    2  
ATOM 2566  H HA   . GLU A 1 49  ? 12.681  -9.392  14.347  1.00 0.00 ? 49  GLU A HA   2  
ATOM 2567  H HB2  . GLU A 1 49  ? 13.563  -11.093 12.066  1.00 0.00 ? 49  GLU A HB2  2  
ATOM 2568  H HB3  . GLU A 1 49  ? 14.797  -10.207 12.952  1.00 0.00 ? 49  GLU A HB3  2  
ATOM 2569  H HG2  . GLU A 1 49  ? 13.808  -11.234 15.053  1.00 0.00 ? 49  GLU A HG2  2  
ATOM 2570  H HG3  . GLU A 1 49  ? 12.920  -12.310 13.976  1.00 0.00 ? 49  GLU A HG3  2  
ATOM 2571  N N    . SER A 1 50  ? 13.518  -8.162  11.391  1.00 0.00 ? 50  SER A N    2  
ATOM 2572  C CA   . SER A 1 50  ? 14.022  -6.971  10.717  1.00 0.00 ? 50  SER A CA   2  
ATOM 2573  C C    . SER A 1 50  ? 13.449  -6.860  9.308   1.00 0.00 ? 50  SER A C    2  
ATOM 2574  O O    . SER A 1 50  ? 13.165  -7.869  8.661   1.00 0.00 ? 50  SER A O    2  
ATOM 2575  C CB   . SER A 1 50  ? 15.551  -7.001  10.658  1.00 0.00 ? 50  SER A CB   2  
ATOM 2576  O OG   . SER A 1 50  ? 16.006  -7.998  9.759   1.00 0.00 ? 50  SER A OG   2  
ATOM 2577  H H    . SER A 1 50  ? 13.314  -8.961  10.861  1.00 0.00 ? 50  SER A H    2  
ATOM 2578  H HA   . SER A 1 50  ? 13.710  -6.110  11.289  1.00 0.00 ? 50  SER A HA   2  
ATOM 2579  H HB2  . SER A 1 50  ? 15.915  -6.041  10.326  1.00 0.00 ? 50  SER A HB2  2  
ATOM 2580  H HB3  . SER A 1 50  ? 15.942  -7.215  11.642  1.00 0.00 ? 50  SER A HB3  2  
ATOM 2581  H HG   . SER A 1 50  ? 16.954  -8.111  9.860   1.00 0.00 ? 50  SER A HG   2  
ATOM 2582  N N    . ILE A 1 51  ? 13.283  -5.628  8.839   1.00 0.00 ? 51  ILE A N    2  
ATOM 2583  C CA   . ILE A 1 51  ? 12.745  -5.385  7.506   1.00 0.00 ? 51  ILE A CA   2  
ATOM 2584  C C    . ILE A 1 51  ? 13.741  -5.798  6.428   1.00 0.00 ? 51  ILE A C    2  
ATOM 2585  O O    . ILE A 1 51  ? 14.941  -5.547  6.546   1.00 0.00 ? 51  ILE A O    2  
ATOM 2586  C CB   . ILE A 1 51  ? 12.378  -3.902  7.309   1.00 0.00 ? 51  ILE A CB   2  
ATOM 2587  C CG1  . ILE A 1 51  ? 11.258  -3.500  8.270   1.00 0.00 ? 51  ILE A CG1  2  
ATOM 2588  C CG2  . ILE A 1 51  ? 11.965  -3.646  5.867   1.00 0.00 ? 51  ILE A CG2  2  
ATOM 2589  C CD1  . ILE A 1 51  ? 11.113  -2.003  8.436   1.00 0.00 ? 51  ILE A CD1  2  
ATOM 2590  H H    . ILE A 1 51  ? 13.528  -4.865  9.402   1.00 0.00 ? 51  ILE A H    2  
ATOM 2591  H HA   . ILE A 1 51  ? 11.846  -5.975  7.397   1.00 0.00 ? 51  ILE A HA   2  
ATOM 2592  H HB   . ILE A 1 51  ? 13.254  -3.307  7.518   1.00 0.00 ? 51  ILE A HB   2  
ATOM 2593  H HG12 . ILE A 1 51  ? 10.320  -3.884  7.901   1.00 0.00 ? 51  ILE A HG12 2  
ATOM 2594  H HG13 . ILE A 1 51  ? 11.458  -3.924  9.243   1.00 0.00 ? 51  ILE A HG13 2  
ATOM 2595  H HG21 . ILE A 1 51  ? 12.737  -3.080  5.367   1.00 0.00 ? 51  ILE A HG21 2  
ATOM 2596  H HG22 . ILE A 1 51  ? 11.826  -4.589  5.360   1.00 0.00 ? 51  ILE A HG22 2  
ATOM 2597  H HG23 . ILE A 1 51  ? 11.041  -3.088  5.851   1.00 0.00 ? 51  ILE A HG23 2  
ATOM 2598  H HD11 . ILE A 1 51  ? 11.462  -1.506  7.543   1.00 0.00 ? 51  ILE A HD11 2  
ATOM 2599  H HD12 . ILE A 1 51  ? 10.075  -1.758  8.603   1.00 0.00 ? 51  ILE A HD12 2  
ATOM 2600  H HD13 . ILE A 1 51  ? 11.700  -1.676  9.282   1.00 0.00 ? 51  ILE A HD13 2  
ATOM 2601  N N    . LEU A 1 52  ? 13.235  -6.432  5.375   1.00 0.00 ? 52  LEU A N    2  
ATOM 2602  C CA   . LEU A 1 52  ? 14.080  -6.879  4.273   1.00 0.00 ? 52  LEU A CA   2  
ATOM 2603  C C    . LEU A 1 52  ? 13.885  -5.996  3.045   1.00 0.00 ? 52  LEU A C    2  
ATOM 2604  O O    . LEU A 1 52  ? 14.816  -5.777  2.271   1.00 0.00 ? 52  LEU A O    2  
ATOM 2605  C CB   . LEU A 1 52  ? 13.767  -8.335  3.923   1.00 0.00 ? 52  LEU A CB   2  
ATOM 2606  C CG   . LEU A 1 52  ? 13.965  -9.353  5.047   1.00 0.00 ? 52  LEU A CG   2  
ATOM 2607  C CD1  . LEU A 1 52  ? 13.347  -10.691 4.671   1.00 0.00 ? 52  LEU A CD1  2  
ATOM 2608  C CD2  . LEU A 1 52  ? 15.444  -9.517  5.365   1.00 0.00 ? 52  LEU A CD2  2  
ATOM 2609  H H    . LEU A 1 52  ? 12.272  -6.604  5.337   1.00 0.00 ? 52  LEU A H    2  
ATOM 2610  H HA   . LEU A 1 52  ? 15.109  -6.807  4.594   1.00 0.00 ? 52  LEU A HA   2  
ATOM 2611  H HB2  . LEU A 1 52  ? 12.736  -8.386  3.609   1.00 0.00 ? 52  LEU A HB2  2  
ATOM 2612  H HB3  . LEU A 1 52  ? 14.407  -8.622  3.100   1.00 0.00 ? 52  LEU A HB3  2  
ATOM 2613  H HG   . LEU A 1 52  ? 13.468  -8.996  5.939   1.00 0.00 ? 52  LEU A HG   2  
ATOM 2614  H HD11 . LEU A 1 52  ? 14.078  -11.290 4.149   1.00 0.00 ? 52  LEU A HD11 2  
ATOM 2615  H HD12 . LEU A 1 52  ? 12.493  -10.525 4.031   1.00 0.00 ? 52  LEU A HD12 2  
ATOM 2616  H HD13 . LEU A 1 52  ? 13.031  -11.206 5.566   1.00 0.00 ? 52  LEU A HD13 2  
ATOM 2617  H HD21 . LEU A 1 52  ? 16.031  -9.191  4.519   1.00 0.00 ? 52  LEU A HD21 2  
ATOM 2618  H HD22 . LEU A 1 52  ? 15.655  -10.556 5.571   1.00 0.00 ? 52  LEU A HD22 2  
ATOM 2619  H HD23 . LEU A 1 52  ? 15.695  -8.920  6.229   1.00 0.00 ? 52  LEU A HD23 2  
ATOM 2620  N N    . GLY A 1 53  ? 12.668  -5.490  2.873   1.00 0.00 ? 53  GLY A N    2  
ATOM 2621  C CA   . GLY A 1 53  ? 12.373  -4.635  1.738   1.00 0.00 ? 53  GLY A CA   2  
ATOM 2622  C C    . GLY A 1 53  ? 11.167  -3.748  1.978   1.00 0.00 ? 53  GLY A C    2  
ATOM 2623  O O    . GLY A 1 53  ? 10.283  -4.091  2.763   1.00 0.00 ? 53  GLY A O    2  
ATOM 2624  H H    . GLY A 1 53  ? 11.964  -5.699  3.522   1.00 0.00 ? 53  GLY A H    2  
ATOM 2625  H HA2  . GLY A 1 53  ? 13.232  -4.011  1.539   1.00 0.00 ? 53  GLY A HA2  2  
ATOM 2626  H HA3  . GLY A 1 53  ? 12.183  -5.255  0.874   1.00 0.00 ? 53  GLY A HA3  2  
ATOM 2627  N N    . SER A 1 54  ? 11.131  -2.605  1.301   1.00 0.00 ? 54  SER A N    2  
ATOM 2628  C CA   . SER A 1 54  ? 10.027  -1.664  1.449   1.00 0.00 ? 54  SER A CA   2  
ATOM 2629  C C    . SER A 1 54  ? 9.209   -1.581  0.164   1.00 0.00 ? 54  SER A C    2  
ATOM 2630  O O    . SER A 1 54  ? 9.763   -1.504  -0.933  1.00 0.00 ? 54  SER A O    2  
ATOM 2631  C CB   . SER A 1 54  ? 10.557  -0.277  1.820   1.00 0.00 ? 54  SER A CB   2  
ATOM 2632  O OG   . SER A 1 54  ? 11.006  0.421   0.672   1.00 0.00 ? 54  SER A OG   2  
ATOM 2633  H H    . SER A 1 54  ? 11.867  -2.388  0.690   1.00 0.00 ? 54  SER A H    2  
ATOM 2634  H HA   . SER A 1 54  ? 9.391   -2.021  2.244   1.00 0.00 ? 54  SER A HA   2  
ATOM 2635  H HB2  . SER A 1 54  ? 9.769   0.293   2.288   1.00 0.00 ? 54  SER A HB2  2  
ATOM 2636  H HB3  . SER A 1 54  ? 11.383  -0.383  2.508   1.00 0.00 ? 54  SER A HB3  2  
ATOM 2637  H HG   . SER A 1 54  ? 11.870  0.092   0.414   1.00 0.00 ? 54  SER A HG   2  
ATOM 2638  N N    . ILE A 1 55  ? 7.888   -1.596  0.309   1.00 0.00 ? 55  ILE A N    2  
ATOM 2639  C CA   . ILE A 1 55  ? 6.993   -1.521  -0.839  1.00 0.00 ? 55  ILE A CA   2  
ATOM 2640  C C    . ILE A 1 55  ? 6.021   -0.354  -0.703  1.00 0.00 ? 55  ILE A C    2  
ATOM 2641  O O    . ILE A 1 55  ? 5.062   -0.400  0.067   1.00 0.00 ? 55  ILE A O    2  
ATOM 2642  C CB   . ILE A 1 55  ? 6.192   -2.825  -1.014  1.00 0.00 ? 55  ILE A CB   2  
ATOM 2643  C CG1  . ILE A 1 55  ? 7.140   -4.019  -1.140  1.00 0.00 ? 55  ILE A CG1  2  
ATOM 2644  C CG2  . ILE A 1 55  ? 5.286   -2.730  -2.232  1.00 0.00 ? 55  ILE A CG2  2  
ATOM 2645  C CD1  . ILE A 1 55  ? 6.459   -5.355  -0.946  1.00 0.00 ? 55  ILE A CD1  2  
ATOM 2646  H H    . ILE A 1 55  ? 7.507   -1.658  1.209   1.00 0.00 ? 55  ILE A H    2  
ATOM 2647  H HA   . ILE A 1 55  ? 7.597   -1.372  -1.723  1.00 0.00 ? 55  ILE A HA   2  
ATOM 2648  H HB   . ILE A 1 55  ? 5.570   -2.958  -0.142  1.00 0.00 ? 55  ILE A HB   2  
ATOM 2649  H HG12 . ILE A 1 55  ? 7.586   -4.014  -2.122  1.00 0.00 ? 55  ILE A HG12 2  
ATOM 2650  H HG13 . ILE A 1 55  ? 7.918   -3.931  -0.396  1.00 0.00 ? 55  ILE A HG13 2  
ATOM 2651  H HG21 . ILE A 1 55  ? 5.687   -3.341  -3.028  1.00 0.00 ? 55  ILE A HG21 2  
ATOM 2652  H HG22 . ILE A 1 55  ? 4.298   -3.081  -1.974  1.00 0.00 ? 55  ILE A HG22 2  
ATOM 2653  H HG23 . ILE A 1 55  ? 5.230   -1.703  -2.561  1.00 0.00 ? 55  ILE A HG23 2  
ATOM 2654  H HD11 . ILE A 1 55  ? 5.840   -5.319  -0.061  1.00 0.00 ? 55  ILE A HD11 2  
ATOM 2655  H HD12 . ILE A 1 55  ? 5.845   -5.575  -1.806  1.00 0.00 ? 55  ILE A HD12 2  
ATOM 2656  H HD13 . ILE A 1 55  ? 7.206   -6.127  -0.830  1.00 0.00 ? 55  ILE A HD13 2  
ATOM 2657  N N    . PRO A 1 56  ? 6.271   0.717   -1.470  1.00 0.00 ? 56  PRO A N    2  
ATOM 2658  C CA   . PRO A 1 56  ? 5.428   1.916   -1.455  1.00 0.00 ? 56  PRO A CA   2  
ATOM 2659  C C    . PRO A 1 56  ? 4.058   1.669   -2.077  1.00 0.00 ? 56  PRO A C    2  
ATOM 2660  O O    . PRO A 1 56  ? 3.941   0.982   -3.093  1.00 0.00 ? 56  PRO A O    2  
ATOM 2661  C CB   . PRO A 1 56  ? 6.223   2.919   -2.295  1.00 0.00 ? 56  PRO A CB   2  
ATOM 2662  C CG   . PRO A 1 56  ? 7.062   2.080   -3.195  1.00 0.00 ? 56  PRO A CG   2  
ATOM 2663  C CD   . PRO A 1 56  ? 7.397   0.840   -2.412  1.00 0.00 ? 56  PRO A CD   2  
ATOM 2664  H HA   . PRO A 1 56  ? 5.303   2.301   -0.454  1.00 0.00 ? 56  PRO A HA   2  
ATOM 2665  H HB2  . PRO A 1 56  ? 5.541   3.543   -2.856  1.00 0.00 ? 56  PRO A HB2  2  
ATOM 2666  H HB3  . PRO A 1 56  ? 6.831   3.533   -1.648  1.00 0.00 ? 56  PRO A HB3  2  
ATOM 2667  H HG2  . PRO A 1 56  ? 6.504   1.823   -4.083  1.00 0.00 ? 56  PRO A HG2  2  
ATOM 2668  H HG3  . PRO A 1 56  ? 7.964   2.612   -3.457  1.00 0.00 ? 56  PRO A HG3  2  
ATOM 2669  H HD2  . PRO A 1 56  ? 7.448   -0.017  -3.066  1.00 0.00 ? 56  PRO A HD2  2  
ATOM 2670  H HD3  . PRO A 1 56  ? 8.329   0.969   -1.882  1.00 0.00 ? 56  PRO A HD3  2  
ATOM 2671  N N    . LEU A 1 57  ? 3.024   2.232   -1.462  1.00 0.00 ? 57  LEU A N    2  
ATOM 2672  C CA   . LEU A 1 57  ? 1.660   2.073   -1.956  1.00 0.00 ? 57  LEU A CA   2  
ATOM 2673  C C    . LEU A 1 57  ? 0.978   3.427   -2.116  1.00 0.00 ? 57  LEU A C    2  
ATOM 2674  O O    . LEU A 1 57  ? -0.172  3.606   -1.712  1.00 0.00 ? 57  LEU A O    2  
ATOM 2675  C CB   . LEU A 1 57  ? 0.852   1.190   -1.004  1.00 0.00 ? 57  LEU A CB   2  
ATOM 2676  C CG   . LEU A 1 57  ? 1.031   -0.319  -1.172  1.00 0.00 ? 57  LEU A CG   2  
ATOM 2677  C CD1  . LEU A 1 57  ? 0.209   -1.073  -0.138  1.00 0.00 ? 57  LEU A CD1  2  
ATOM 2678  C CD2  . LEU A 1 57  ? 0.645   -0.749  -2.580  1.00 0.00 ? 57  LEU A CD2  2  
ATOM 2679  H H    . LEU A 1 57  ? 3.180   2.767   -0.657  1.00 0.00 ? 57  LEU A H    2  
ATOM 2680  H HA   . LEU A 1 57  ? 1.712   1.593   -2.922  1.00 0.00 ? 57  LEU A HA   2  
ATOM 2681  H HB2  . LEU A 1 57  ? 1.135   1.446   0.005   1.00 0.00 ? 57  LEU A HB2  2  
ATOM 2682  H HB3  . LEU A 1 57  ? -0.195  1.418   -1.151  1.00 0.00 ? 57  LEU A HB3  2  
ATOM 2683  H HG   . LEU A 1 57  ? 2.072   -0.571  -1.018  1.00 0.00 ? 57  LEU A HG   2  
ATOM 2684  H HD11 . LEU A 1 57  ? 0.637   -0.923  0.841   1.00 0.00 ? 57  LEU A HD11 2  
ATOM 2685  H HD12 . LEU A 1 57  ? 0.212   -2.127  -0.375  1.00 0.00 ? 57  LEU A HD12 2  
ATOM 2686  H HD13 . LEU A 1 57  ? -0.807  -0.705  -0.149  1.00 0.00 ? 57  LEU A HD13 2  
ATOM 2687  H HD21 . LEU A 1 57  ? 0.642   -1.827  -2.638  1.00 0.00 ? 57  LEU A HD21 2  
ATOM 2688  H HD22 . LEU A 1 57  ? 1.361   -0.352  -3.286  1.00 0.00 ? 57  LEU A HD22 2  
ATOM 2689  H HD23 . LEU A 1 57  ? -0.339  -0.372  -2.814  1.00 0.00 ? 57  LEU A HD23 2  
ATOM 2690  N N    . LEU A 1 58  ? 1.692   4.378   -2.709  1.00 0.00 ? 58  LEU A N    2  
ATOM 2691  C CA   . LEU A 1 58  ? 1.154   5.716   -2.924  1.00 0.00 ? 58  LEU A CA   2  
ATOM 2692  C C    . LEU A 1 58  ? -0.012  5.683   -3.907  1.00 0.00 ? 58  LEU A C    2  
ATOM 2693  O O    . LEU A 1 58  ? -1.147  6.001   -3.551  1.00 0.00 ? 58  LEU A O    2  
ATOM 2694  C CB   . LEU A 1 58  ? 2.248   6.649   -3.445  1.00 0.00 ? 58  LEU A CB   2  
ATOM 2695  C CG   . LEU A 1 58  ? 1.773   7.973   -4.045  1.00 0.00 ? 58  LEU A CG   2  
ATOM 2696  C CD1  . LEU A 1 58  ? 0.720   8.615   -3.155  1.00 0.00 ? 58  LEU A CD1  2  
ATOM 2697  C CD2  . LEU A 1 58  ? 2.948   8.918   -4.251  1.00 0.00 ? 58  LEU A CD2  2  
ATOM 2698  H H    . LEU A 1 58  ? 2.602   4.175   -3.009  1.00 0.00 ? 58  LEU A H    2  
ATOM 2699  H HA   . LEU A 1 58  ? 0.798   6.087   -1.975  1.00 0.00 ? 58  LEU A HA   2  
ATOM 2700  H HB2  . LEU A 1 58  ? 2.908   6.878   -2.622  1.00 0.00 ? 58  LEU A HB2  2  
ATOM 2701  H HB3  . LEU A 1 58  ? 2.799   6.118   -4.209  1.00 0.00 ? 58  LEU A HB3  2  
ATOM 2702  H HG   . LEU A 1 58  ? 1.323   7.783   -5.010  1.00 0.00 ? 58  LEU A HG   2  
ATOM 2703  H HD11 . LEU A 1 58  ? 1.127   8.765   -2.167  1.00 0.00 ? 58  LEU A HD11 2  
ATOM 2704  H HD12 . LEU A 1 58  ? -0.143  7.968   -3.095  1.00 0.00 ? 58  LEU A HD12 2  
ATOM 2705  H HD13 . LEU A 1 58  ? 0.428   9.567   -3.573  1.00 0.00 ? 58  LEU A HD13 2  
ATOM 2706  H HD21 . LEU A 1 58  ? 3.122   9.478   -3.345  1.00 0.00 ? 58  LEU A HD21 2  
ATOM 2707  H HD22 . LEU A 1 58  ? 2.724   9.600   -5.058  1.00 0.00 ? 58  LEU A HD22 2  
ATOM 2708  H HD23 . LEU A 1 58  ? 3.831   8.346   -4.497  1.00 0.00 ? 58  LEU A HD23 2  
ATOM 2709  N N    . SER A 1 59  ? 0.275   5.294   -5.145  1.00 0.00 ? 59  SER A N    2  
ATOM 2710  C CA   . SER A 1 59  ? -0.749  5.220   -6.180  1.00 0.00 ? 59  SER A CA   2  
ATOM 2711  C C    . SER A 1 59  ? -0.713  3.868   -6.885  1.00 0.00 ? 59  SER A C    2  
ATOM 2712  O O    . SER A 1 59  ? -1.120  3.746   -8.041  1.00 0.00 ? 59  SER A O    2  
ATOM 2713  C CB   . SER A 1 59  ? -0.556  6.345   -7.200  1.00 0.00 ? 59  SER A CB   2  
ATOM 2714  O OG   . SER A 1 59  ? -1.644  6.405   -8.105  1.00 0.00 ? 59  SER A OG   2  
ATOM 2715  H H    . SER A 1 59  ? 1.199   5.053   -5.368  1.00 0.00 ? 59  SER A H    2  
ATOM 2716  H HA   . SER A 1 59  ? -1.711  5.339   -5.704  1.00 0.00 ? 59  SER A HA   2  
ATOM 2717  H HB2  . SER A 1 59  ? -0.483  7.289   -6.681  1.00 0.00 ? 59  SER A HB2  2  
ATOM 2718  H HB3  . SER A 1 59  ? 0.352   6.169   -7.757  1.00 0.00 ? 59  SER A HB3  2  
ATOM 2719  H HG   . SER A 1 59  ? -2.073  7.260   -8.035  1.00 0.00 ? 59  SER A HG   2  
ATOM 2720  N N    . PHE A 1 60  ? -0.221  2.854   -6.181  1.00 0.00 ? 60  PHE A N    2  
ATOM 2721  C CA   . PHE A 1 60  ? -0.130  1.509   -6.739  1.00 0.00 ? 60  PHE A CA   2  
ATOM 2722  C C    . PHE A 1 60  ? -1.519  0.926   -6.983  1.00 0.00 ? 60  PHE A C    2  
ATOM 2723  O O    . PHE A 1 60  ? -2.273  0.676   -6.043  1.00 0.00 ? 60  PHE A O    2  
ATOM 2724  C CB   . PHE A 1 60  ? 0.660   0.597   -5.798  1.00 0.00 ? 60  PHE A CB   2  
ATOM 2725  C CG   . PHE A 1 60  ? 2.142   0.625   -6.040  1.00 0.00 ? 60  PHE A CG   2  
ATOM 2726  C CD1  . PHE A 1 60  ? 2.887   1.751   -5.728  1.00 0.00 ? 60  PHE A CD1  2  
ATOM 2727  C CD2  . PHE A 1 60  ? 2.790   -0.474  -6.580  1.00 0.00 ? 60  PHE A CD2  2  
ATOM 2728  C CE1  . PHE A 1 60  ? 4.251   1.780   -5.950  1.00 0.00 ? 60  PHE A CE1  2  
ATOM 2729  C CE2  . PHE A 1 60  ? 4.154   -0.451  -6.804  1.00 0.00 ? 60  PHE A CE2  2  
ATOM 2730  C CZ   . PHE A 1 60  ? 4.885   0.677   -6.488  1.00 0.00 ? 60  PHE A CZ   2  
ATOM 2731  H H    . PHE A 1 60  ? 0.088   3.014   -5.265  1.00 0.00 ? 60  PHE A H    2  
ATOM 2732  H HA   . PHE A 1 60  ? 0.390   1.577   -7.682  1.00 0.00 ? 60  PHE A HA   2  
ATOM 2733  H HB2  . PHE A 1 60  ? 0.485   0.905   -4.778  1.00 0.00 ? 60  PHE A HB2  2  
ATOM 2734  H HB3  . PHE A 1 60  ? 0.321   -0.420  -5.926  1.00 0.00 ? 60  PHE A HB3  2  
ATOM 2735  H HD1  . PHE A 1 60  ? 2.392   2.614   -5.306  1.00 0.00 ? 60  PHE A HD1  2  
ATOM 2736  H HD2  . PHE A 1 60  ? 2.219   -1.358  -6.827  1.00 0.00 ? 60  PHE A HD2  2  
ATOM 2737  H HE1  . PHE A 1 60  ? 4.820   2.663   -5.702  1.00 0.00 ? 60  PHE A HE1  2  
ATOM 2738  H HE2  . PHE A 1 60  ? 4.647   -1.315  -7.225  1.00 0.00 ? 60  PHE A HE2  2  
ATOM 2739  H HZ   . PHE A 1 60  ? 5.950   0.698   -6.663  1.00 0.00 ? 60  PHE A HZ   2  
ATOM 2740  N N    . ARG A 1 61  ? -1.850  0.714   -8.253  1.00 0.00 ? 61  ARG A N    2  
ATOM 2741  C CA   . ARG A 1 61  ? -3.148  0.162   -8.622  1.00 0.00 ? 61  ARG A CA   2  
ATOM 2742  C C    . ARG A 1 61  ? -3.234  -1.317  -8.257  1.00 0.00 ? 61  ARG A C    2  
ATOM 2743  O O    . ARG A 1 61  ? -2.731  -2.176  -8.982  1.00 0.00 ? 61  ARG A O    2  
ATOM 2744  C CB   . ARG A 1 61  ? -3.396  0.344   -10.120 1.00 0.00 ? 61  ARG A CB   2  
ATOM 2745  C CG   . ARG A 1 61  ? -4.844  0.130   -10.529 1.00 0.00 ? 61  ARG A CG   2  
ATOM 2746  C CD   . ARG A 1 61  ? -5.080  0.534   -11.975 1.00 0.00 ? 61  ARG A CD   2  
ATOM 2747  N NE   . ARG A 1 61  ? -5.455  1.941   -12.096 1.00 0.00 ? 61  ARG A NE   2  
ATOM 2748  C CZ   . ARG A 1 61  ? -5.536  2.583   -13.256 1.00 0.00 ? 61  ARG A CZ   2  
ATOM 2749  N NH1  . ARG A 1 61  ? -5.272  1.948   -14.389 1.00 0.00 ? 61  ARG A NH1  2  
ATOM 2750  N NH2  . ARG A 1 61  ? -5.883  3.863   -13.284 1.00 0.00 ? 61  ARG A NH2  2  
ATOM 2751  H H    . ARG A 1 61  ? -1.206  0.934   -8.958  1.00 0.00 ? 61  ARG A H    2  
ATOM 2752  H HA   . ARG A 1 61  ? -3.905  0.701   -8.073  1.00 0.00 ? 61  ARG A HA   2  
ATOM 2753  H HB2  . ARG A 1 61  ? -3.111  1.348   -10.401 1.00 0.00 ? 61  ARG A HB2  2  
ATOM 2754  H HB3  . ARG A 1 61  ? -2.783  -0.360  -10.662 1.00 0.00 ? 61  ARG A HB3  2  
ATOM 2755  H HG2  . ARG A 1 61  ? -5.089  -0.916  -10.415 1.00 0.00 ? 61  ARG A HG2  2  
ATOM 2756  H HG3  . ARG A 1 61  ? -5.480  0.723   -9.889  1.00 0.00 ? 61  ARG A HG3  2  
ATOM 2757  H HD2  . ARG A 1 61  ? -4.173  0.364   -12.536 1.00 0.00 ? 61  ARG A HD2  2  
ATOM 2758  H HD3  . ARG A 1 61  ? -5.874  -0.076  -12.380 1.00 0.00 ? 61  ARG A HD3  2  
ATOM 2759  H HE   . ARG A 1 61  ? -5.654  2.430   -11.271 1.00 0.00 ? 61  ARG A HE   2  
ATOM 2760  H HH11 . ARG A 1 61  ? -5.011  0.983   -14.371 1.00 0.00 ? 61  ARG A HH11 2  
ATOM 2761  H HH12 . ARG A 1 61  ? -5.335  2.433   -15.262 1.00 0.00 ? 61  ARG A HH12 2  
ATOM 2762  H HH21 . ARG A 1 61  ? -6.084  4.346   -12.432 1.00 0.00 ? 61  ARG A HH21 2  
ATOM 2763  H HH22 . ARG A 1 61  ? -5.944  4.346   -14.157 1.00 0.00 ? 61  ARG A HH22 2  
ATOM 2764  N N    . VAL A 1 62  ? -3.874  -1.607  -7.129  1.00 0.00 ? 62  VAL A N    2  
ATOM 2765  C CA   . VAL A 1 62  ? -4.026  -2.982  -6.668  1.00 0.00 ? 62  VAL A CA   2  
ATOM 2766  C C    . VAL A 1 62  ? -5.356  -3.571  -7.127  1.00 0.00 ? 62  VAL A C    2  
ATOM 2767  O O    . VAL A 1 62  ? -6.415  -2.988  -6.903  1.00 0.00 ? 62  VAL A O    2  
ATOM 2768  C CB   . VAL A 1 62  ? -3.940  -3.072  -5.133  1.00 0.00 ? 62  VAL A CB   2  
ATOM 2769  C CG1  . VAL A 1 62  ? -3.987  -4.523  -4.680  1.00 0.00 ? 62  VAL A CG1  2  
ATOM 2770  C CG2  . VAL A 1 62  ? -2.679  -2.388  -4.630  1.00 0.00 ? 62  VAL A CG2  2  
ATOM 2771  H H    . VAL A 1 62  ? -4.254  -0.879  -6.594  1.00 0.00 ? 62  VAL A H    2  
ATOM 2772  H HA   . VAL A 1 62  ? -3.220  -3.566  -7.088  1.00 0.00 ? 62  VAL A HA   2  
ATOM 2773  H HB   . VAL A 1 62  ? -4.794  -2.560  -4.714  1.00 0.00 ? 62  VAL A HB   2  
ATOM 2774  H HG11 . VAL A 1 62  ? -4.405  -4.576  -3.685  1.00 0.00 ? 62  VAL A HG11 2  
ATOM 2775  H HG12 . VAL A 1 62  ? -4.602  -5.094  -5.361  1.00 0.00 ? 62  VAL A HG12 2  
ATOM 2776  H HG13 . VAL A 1 62  ? -2.987  -4.930  -4.671  1.00 0.00 ? 62  VAL A HG13 2  
ATOM 2777  H HG21 . VAL A 1 62  ? -2.725  -1.334  -4.859  1.00 0.00 ? 62  VAL A HG21 2  
ATOM 2778  H HG22 . VAL A 1 62  ? -2.599  -2.520  -3.560  1.00 0.00 ? 62  VAL A HG22 2  
ATOM 2779  H HG23 . VAL A 1 62  ? -1.816  -2.824  -5.111  1.00 0.00 ? 62  VAL A HG23 2  
ATOM 2780  N N    . ALA A 1 63  ? -5.291  -4.732  -7.771  1.00 0.00 ? 63  ALA A N    2  
ATOM 2781  C CA   . ALA A 1 63  ? -6.489  -5.402  -8.260  1.00 0.00 ? 63  ALA A CA   2  
ATOM 2782  C C    . ALA A 1 63  ? -6.170  -6.810  -8.751  1.00 0.00 ? 63  ALA A C    2  
ATOM 2783  O O    . ALA A 1 63  ? -5.031  -7.109  -9.110  1.00 0.00 ? 63  ALA A O    2  
ATOM 2784  C CB   . ALA A 1 63  ? -7.134  -4.587  -9.372  1.00 0.00 ? 63  ALA A CB   2  
ATOM 2785  H H    . ALA A 1 63  ? -4.416  -5.148  -7.920  1.00 0.00 ? 63  ALA A H    2  
ATOM 2786  H HA   . ALA A 1 63  ? -7.192  -5.468  -7.442  1.00 0.00 ? 63  ALA A HA   2  
ATOM 2787  H HB1  . ALA A 1 63  ? -6.737  -4.905  -10.326 1.00 0.00 ? 63  ALA A HB1  2  
ATOM 2788  H HB2  . ALA A 1 63  ? -8.202  -4.740  -9.357  1.00 0.00 ? 63  ALA A HB2  2  
ATOM 2789  H HB3  . ALA A 1 63  ? -6.917  -3.540  -9.222  1.00 0.00 ? 63  ALA A HB3  2  
ATOM 2790  N N    . ALA A 1 64  ? -7.181  -7.672  -8.762  1.00 0.00 ? 64  ALA A N    2  
ATOM 2791  C CA   . ALA A 1 64  ? -7.008  -9.048  -9.210  1.00 0.00 ? 64  ALA A CA   2  
ATOM 2792  C C    . ALA A 1 64  ? -6.146  -9.112  -10.467 1.00 0.00 ? 64  ALA A C    2  
ATOM 2793  O O    . ALA A 1 64  ? -6.239  -8.249  -11.340 1.00 0.00 ? 64  ALA A O    2  
ATOM 2794  C CB   . ALA A 1 64  ? -8.361  -9.696  -9.462  1.00 0.00 ? 64  ALA A CB   2  
ATOM 2795  H H    . ALA A 1 64  ? -8.066  -7.374  -8.464  1.00 0.00 ? 64  ALA A H    2  
ATOM 2796  H HA   . ALA A 1 64  ? -6.515  -9.597  -8.420  1.00 0.00 ? 64  ALA A HA   2  
ATOM 2797  H HB1  . ALA A 1 64  ? -8.252  -10.771 -9.453  1.00 0.00 ? 64  ALA A HB1  2  
ATOM 2798  H HB2  . ALA A 1 64  ? -9.053  -9.397  -8.688  1.00 0.00 ? 64  ALA A HB2  2  
ATOM 2799  H HB3  . ALA A 1 64  ? -8.738  -9.380  -10.424 1.00 0.00 ? 64  ALA A HB3  2  
ATOM 2800  N N    . VAL A 1 65  ? -5.307  -10.139 -10.552 1.00 0.00 ? 65  VAL A N    2  
ATOM 2801  C CA   . VAL A 1 65  ? -4.429  -10.316 -11.702 1.00 0.00 ? 65  VAL A CA   2  
ATOM 2802  C C    . VAL A 1 65  ? -5.232  -10.433 -12.993 1.00 0.00 ? 65  VAL A C    2  
ATOM 2803  O O    . VAL A 1 65  ? -6.462  -10.448 -12.971 1.00 0.00 ? 65  VAL A O    2  
ATOM 2804  C CB   . VAL A 1 65  ? -3.544  -11.567 -11.546 1.00 0.00 ? 65  VAL A CB   2  
ATOM 2805  C CG1  . VAL A 1 65  ? -2.418  -11.304 -10.557 1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2806  C CG2  . VAL A 1 65  ? -4.381  -12.760 -11.110 1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2807  H H    . VAL A 1 65  ? -5.279  -10.795 -9.824  1.00 0.00 ? 65  VAL A H    2  
ATOM 2808  H HA   . VAL A 1 65  ? -3.785  -9.451  -11.767 1.00 0.00 ? 65  VAL A HA   2  
ATOM 2809  H HB   . VAL A 1 65  ? -3.104  -11.794 -12.506 1.00 0.00 ? 65  VAL A HB   2  
ATOM 2810  H HG11 . VAL A 1 65  ? -1.651  -10.712 -11.034 1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2811  H HG12 . VAL A 1 65  ? -2.807  -10.771 -9.702  1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2812  H HG13 . VAL A 1 65  ? -1.996  -12.245 -10.234 1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2813  H HG21 . VAL A 1 65  ? -5.311  -12.766 -11.658 1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2814  H HG22 . VAL A 1 65  ? -3.839  -13.673 -11.310 1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2815  H HG23 . VAL A 1 65  ? -4.586  -12.689 -10.052 1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2816  N N    . GLN A 1 66  ? -4.526  -10.515 -14.117 1.00 0.00 ? 66  GLN A N    2  
ATOM 2817  C CA   . GLN A 1 66  ? -5.173  -10.630 -15.418 1.00 0.00 ? 66  GLN A CA   2  
ATOM 2818  C C    . GLN A 1 66  ? -5.015  -12.038 -15.982 1.00 0.00 ? 66  GLN A C    2  
ATOM 2819  O O    . GLN A 1 66  ? -4.102  -12.780 -15.618 1.00 0.00 ? 66  GLN A O    2  
ATOM 2820  C CB   . GLN A 1 66  ? -4.589  -9.608  -16.394 1.00 0.00 ? 66  GLN A CB   2  
ATOM 2821  C CG   . GLN A 1 66  ? -5.242  -8.238  -16.305 1.00 0.00 ? 66  GLN A CG   2  
ATOM 2822  C CD   . GLN A 1 66  ? -5.015  -7.401  -17.548 1.00 0.00 ? 66  GLN A CD   2  
ATOM 2823  O OE1  . GLN A 1 66  ? -5.963  -7.008  -18.228 1.00 0.00 ? 66  GLN A OE1  2  
ATOM 2824  N NE2  . GLN A 1 66  ? -3.753  -7.121  -17.851 1.00 0.00 ? 66  GLN A NE2  2  
ATOM 2825  H H    . GLN A 1 66  ? -3.548  -10.497 -14.069 1.00 0.00 ? 66  GLN A H    2  
ATOM 2826  H HA   . GLN A 1 66  ? -6.225  -10.426 -15.284 1.00 0.00 ? 66  GLN A HA   2  
ATOM 2827  H HB2  . GLN A 1 66  ? -3.535  -9.495  -16.190 1.00 0.00 ? 66  GLN A HB2  2  
ATOM 2828  H HB3  . GLN A 1 66  ? -4.715  -9.977  -17.402 1.00 0.00 ? 66  GLN A HB3  2  
ATOM 2829  H HG2  . GLN A 1 66  ? -6.306  -8.369  -16.167 1.00 0.00 ? 66  GLN A HG2  2  
ATOM 2830  H HG3  . GLN A 1 66  ? -4.833  -7.714  -15.454 1.00 0.00 ? 66  GLN A HG3  2  
ATOM 2831  H HE21 . GLN A 1 66  ? -3.048  -7.469  -17.263 1.00 0.00 ? 66  GLN A HE21 2  
ATOM 2832  H HE22 . GLN A 1 66  ? -3.577  -6.582  -18.649 1.00 0.00 ? 66  GLN A HE22 2  
ATOM 2833  N N    . PRO A 1 67  ? -5.924  -12.418 -16.893 1.00 0.00 ? 67  PRO A N    2  
ATOM 2834  C CA   . PRO A 1 67  ? -5.905  -13.739 -17.527 1.00 0.00 ? 67  PRO A CA   2  
ATOM 2835  C C    . PRO A 1 67  ? -4.732  -13.906 -18.485 1.00 0.00 ? 67  PRO A C    2  
ATOM 2836  O O    . PRO A 1 67  ? -4.479  -15.001 -18.988 1.00 0.00 ? 67  PRO A O    2  
ATOM 2837  C CB   . PRO A 1 67  ? -7.231  -13.785 -18.291 1.00 0.00 ? 67  PRO A CB   2  
ATOM 2838  C CG   . PRO A 1 67  ? -7.567  -12.357 -18.552 1.00 0.00 ? 67  PRO A CG   2  
ATOM 2839  C CD   . PRO A 1 67  ? -7.039  -11.585 -17.373 1.00 0.00 ? 67  PRO A CD   2  
ATOM 2840  H HA   . PRO A 1 67  ? -5.884  -14.531 -16.792 1.00 0.00 ? 67  PRO A HA   2  
ATOM 2841  H HB2  . PRO A 1 67  ? -7.100  -14.335 -19.212 1.00 0.00 ? 67  PRO A HB2  2  
ATOM 2842  H HB3  . PRO A 1 67  ? -7.985  -14.262 -17.683 1.00 0.00 ? 67  PRO A HB3  2  
ATOM 2843  H HG2  . PRO A 1 67  ? -7.087  -12.027 -19.461 1.00 0.00 ? 67  PRO A HG2  2  
ATOM 2844  H HG3  . PRO A 1 67  ? -8.638  -12.240 -18.626 1.00 0.00 ? 67  PRO A HG3  2  
ATOM 2845  H HD2  . PRO A 1 67  ? -6.688  -10.613 -17.686 1.00 0.00 ? 67  PRO A HD2  2  
ATOM 2846  H HD3  . PRO A 1 67  ? -7.802  -11.488 -16.614 1.00 0.00 ? 67  PRO A HD3  2  
ATOM 2847  N N    . SER A 1 68  ? -4.017  -12.813 -18.735 1.00 0.00 ? 68  SER A N    2  
ATOM 2848  C CA   . SER A 1 68  ? -2.872  -12.838 -19.637 1.00 0.00 ? 68  SER A CA   2  
ATOM 2849  C C    . SER A 1 68  ? -1.587  -13.147 -18.874 1.00 0.00 ? 68  SER A C    2  
ATOM 2850  O O    . SER A 1 68  ? -0.601  -13.602 -19.455 1.00 0.00 ? 68  SER A O    2  
ATOM 2851  C CB   . SER A 1 68  ? -2.738  -11.498 -20.363 1.00 0.00 ? 68  SER A CB   2  
ATOM 2852  O OG   . SER A 1 68  ? -3.853  -11.261 -21.205 1.00 0.00 ? 68  SER A OG   2  
ATOM 2853  H H    . SER A 1 68  ? -4.269  -11.969 -18.304 1.00 0.00 ? 68  SER A H    2  
ATOM 2854  H HA   . SER A 1 68  ? -3.040  -13.617 -20.365 1.00 0.00 ? 68  SER A HA   2  
ATOM 2855  H HB2  . SER A 1 68  ? -2.675  -10.703 -19.636 1.00 0.00 ? 68  SER A HB2  2  
ATOM 2856  H HB3  . SER A 1 68  ? -1.842  -11.507 -20.966 1.00 0.00 ? 68  SER A HB3  2  
ATOM 2857  H HG   . SER A 1 68  ? -3.565  -11.243 -22.120 1.00 0.00 ? 68  SER A HG   2  
ATOM 2858  N N    . ASP A 1 69  ? -1.606  -12.895 -17.570 1.00 0.00 ? 69  ASP A N    2  
ATOM 2859  C CA   . ASP A 1 69  ? -0.443  -13.146 -16.726 1.00 0.00 ? 69  ASP A CA   2  
ATOM 2860  C C    . ASP A 1 69  ? -0.274  -14.640 -16.466 1.00 0.00 ? 69  ASP A C    2  
ATOM 2861  O O    . ASP A 1 69  ? 0.818   -15.102 -16.137 1.00 0.00 ? 69  ASP A O    2  
ATOM 2862  C CB   . ASP A 1 69  ? -0.578  -12.397 -15.400 1.00 0.00 ? 69  ASP A CB   2  
ATOM 2863  C CG   . ASP A 1 69  ? -0.089  -10.965 -15.492 1.00 0.00 ? 69  ASP A CG   2  
ATOM 2864  O OD1  . ASP A 1 69  ? 1.119   -10.764 -15.739 1.00 0.00 ? 69  ASP A OD1  2  
ATOM 2865  O OD2  . ASP A 1 69  ? -0.914  -10.044 -15.318 1.00 0.00 ? 69  ASP A OD2  2  
ATOM 2866  H H    . ASP A 1 69  ? -2.421  -12.533 -17.165 1.00 0.00 ? 69  ASP A H    2  
ATOM 2867  H HA   . ASP A 1 69  ? 0.430   -12.783 -17.247 1.00 0.00 ? 69  ASP A HA   2  
ATOM 2868  H HB2  . ASP A 1 69  ? -1.617  -12.384 -15.105 1.00 0.00 ? 69  ASP A HB2  2  
ATOM 2869  H HB3  . ASP A 1 69  ? 0.001   -12.908 -14.645 1.00 0.00 ? 69  ASP A HB3  2  
ATOM 2870  N N    . ASN A 1 70  ? -1.362  -15.389 -16.613 1.00 0.00 ? 70  ASN A N    2  
ATOM 2871  C CA   . ASN A 1 70  ? -1.334  -16.830 -16.392 1.00 0.00 ? 70  ASN A CA   2  
ATOM 2872  C C    . ASN A 1 70  ? -0.826  -17.155 -14.990 1.00 0.00 ? 70  ASN A C    2  
ATOM 2873  O O    . ASN A 1 70  ? 0.044   -18.010 -14.818 1.00 0.00 ? 70  ASN A O    2  
ATOM 2874  C CB   . ASN A 1 70  ? -0.448  -17.510 -17.438 1.00 0.00 ? 70  ASN A CB   2  
ATOM 2875  C CG   . ASN A 1 70  ? -0.891  -18.930 -17.735 1.00 0.00 ? 70  ASN A CG   2  
ATOM 2876  O OD1  . ASN A 1 70  ? -1.771  -19.157 -18.565 1.00 0.00 ? 70  ASN A OD1  2  
ATOM 2877  N ND2  . ASN A 1 70  ? -0.281  -19.894 -17.054 1.00 0.00 ? 70  ASN A ND2  2  
ATOM 2878  H H    . ASN A 1 70  ? -2.204  -14.962 -16.876 1.00 0.00 ? 70  ASN A H    2  
ATOM 2879  H HA   . ASN A 1 70  ? -2.343  -17.200 -16.491 1.00 0.00 ? 70  ASN A HA   2  
ATOM 2880  H HB2  . ASN A 1 70  ? -0.486  -16.943 -18.357 1.00 0.00 ? 70  ASN A HB2  2  
ATOM 2881  H HB3  . ASN A 1 70  ? 0.569   -17.537 -17.078 1.00 0.00 ? 70  ASN A HB3  2  
ATOM 2882  H HD21 . ASN A 1 70  ? 0.410   -19.639 -16.408 1.00 0.00 ? 70  ASN A HD21 2  
ATOM 2883  H HD22 . ASN A 1 70  ? -0.547  -20.821 -17.227 1.00 0.00 ? 70  ASN A HD22 2  
ATOM 2884  N N    . ILE A 1 71  ? -1.375  -16.469 -13.994 1.00 0.00 ? 71  ILE A N    2  
ATOM 2885  C CA   . ILE A 1 71  ? -0.979  -16.687 -12.608 1.00 0.00 ? 71  ILE A CA   2  
ATOM 2886  C C    . ILE A 1 71  ? -1.626  -17.946 -12.043 1.00 0.00 ? 71  ILE A C    2  
ATOM 2887  O O    . ILE A 1 71  ? -2.705  -17.890 -11.453 1.00 0.00 ? 71  ILE A O    2  
ATOM 2888  C CB   . ILE A 1 71  ? -1.355  -15.486 -11.720 1.00 0.00 ? 71  ILE A CB   2  
ATOM 2889  C CG1  . ILE A 1 71  ? -0.653  -14.219 -12.213 1.00 0.00 ? 71  ILE A CG1  2  
ATOM 2890  C CG2  . ILE A 1 71  ? -0.995  -15.767 -10.269 1.00 0.00 ? 71  ILE A CG2  2  
ATOM 2891  C CD1  . ILE A 1 71  ? 0.839   -14.220 -11.967 1.00 0.00 ? 71  ILE A CD1  2  
ATOM 2892  H H    . ILE A 1 71  ? -2.063  -15.802 -14.195 1.00 0.00 ? 71  ILE A H    2  
ATOM 2893  H HA   . ILE A 1 71  ? 0.095   -16.804 -12.583 1.00 0.00 ? 71  ILE A HA   2  
ATOM 2894  H HB   . ILE A 1 71  ? -2.423  -15.344 -11.780 1.00 0.00 ? 71  ILE A HB   2  
ATOM 2895  H HG12 . ILE A 1 71  ? -0.813  -14.116 -13.275 1.00 0.00 ? 71  ILE A HG12 2  
ATOM 2896  H HG13 . ILE A 1 71  ? -1.074  -13.363 -11.705 1.00 0.00 ? 71  ILE A HG13 2  
ATOM 2897  H HG21 . ILE A 1 71  ? -0.155  -15.153 -9.981  1.00 0.00 ? 71  ILE A HG21 2  
ATOM 2898  H HG22 . ILE A 1 71  ? -1.840  -15.537 -9.638  1.00 0.00 ? 71  ILE A HG22 2  
ATOM 2899  H HG23 . ILE A 1 71  ? -0.735  -16.809 -10.157 1.00 0.00 ? 71  ILE A HG23 2  
ATOM 2900  H HD11 . ILE A 1 71  ? 1.092   -13.426 -11.280 1.00 0.00 ? 71  ILE A HD11 2  
ATOM 2901  H HD12 . ILE A 1 71  ? 1.134   -15.169 -11.545 1.00 0.00 ? 71  ILE A HD12 2  
ATOM 2902  H HD13 . ILE A 1 71  ? 1.358   -14.065 -12.902 1.00 0.00 ? 71  ILE A HD13 2  
ATOM 2903  N N    . SER A 1 72  ? -0.959  -19.081 -12.225 1.00 0.00 ? 72  SER A N    2  
ATOM 2904  C CA   . SER A 1 72  ? -1.470  -20.356 -11.735 1.00 0.00 ? 72  SER A CA   2  
ATOM 2905  C C    . SER A 1 72  ? -2.173  -20.178 -10.392 1.00 0.00 ? 72  SER A C    2  
ATOM 2906  O O    . SER A 1 72  ? -3.371  -20.435 -10.268 1.00 0.00 ? 72  SER A O    2  
ATOM 2907  C CB   . SER A 1 72  ? -0.331  -21.367 -11.597 1.00 0.00 ? 72  SER A CB   2  
ATOM 2908  O OG   . SER A 1 72  ? -0.832  -22.668 -11.344 1.00 0.00 ? 72  SER A OG   2  
ATOM 2909  H H    . SER A 1 72  ? -0.104  -19.061 -12.704 1.00 0.00 ? 72  SER A H    2  
ATOM 2910  H HA   . SER A 1 72  ? -2.184  -20.726 -12.456 1.00 0.00 ? 72  SER A HA   2  
ATOM 2911  H HB2  . SER A 1 72  ? 0.242   -21.387 -12.511 1.00 0.00 ? 72  SER A HB2  2  
ATOM 2912  H HB3  . SER A 1 72  ? 0.309   -21.075 -10.777 1.00 0.00 ? 72  SER A HB3  2  
ATOM 2913  H HG   . SER A 1 72  ? -0.254  -23.119 -10.724 1.00 0.00 ? 72  SER A HG   2  
ATOM 2914  N N    . ARG A 1 73  ? -1.420  -19.738 -9.390  1.00 0.00 ? 73  ARG A N    2  
ATOM 2915  C CA   . ARG A 1 73  ? -1.969  -19.528 -8.056  1.00 0.00 ? 73  ARG A CA   2  
ATOM 2916  C C    . ARG A 1 73  ? -3.265  -18.724 -8.123  1.00 0.00 ? 73  ARG A C    2  
ATOM 2917  O O    . ARG A 1 73  ? -3.310  -17.647 -8.716  1.00 0.00 ? 73  ARG A O    2  
ATOM 2918  C CB   . ARG A 1 73  ? -0.953  -18.805 -7.171  1.00 0.00 ? 73  ARG A CB   2  
ATOM 2919  C CG   . ARG A 1 73  ? 0.241   -19.664 -6.787  1.00 0.00 ? 73  ARG A CG   2  
ATOM 2920  C CD   . ARG A 1 73  ? 1.196   -18.914 -5.871  1.00 0.00 ? 73  ARG A CD   2  
ATOM 2921  N NE   . ARG A 1 73  ? 0.848   -19.081 -4.463  1.00 0.00 ? 73  ARG A NE   2  
ATOM 2922  C CZ   . ARG A 1 73  ? 1.068   -20.199 -3.780  1.00 0.00 ? 73  ARG A CZ   2  
ATOM 2923  N NH1  . ARG A 1 73  ? 1.633   -21.242 -4.372  1.00 0.00 ? 73  ARG A NH1  2  
ATOM 2924  N NH2  . ARG A 1 73  ? 0.724   -20.275 -2.500  1.00 0.00 ? 73  ARG A NH2  2  
ATOM 2925  H H    . ARG A 1 73  ? -0.471  -19.552 -9.551  1.00 0.00 ? 73  ARG A H    2  
ATOM 2926  H HA   . ARG A 1 73  ? -2.181  -20.496 -7.628  1.00 0.00 ? 73  ARG A HA   2  
ATOM 2927  H HB2  . ARG A 1 73  ? -0.588  -17.935 -7.698  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 2928  H HB3  . ARG A 1 73  ? -1.445  -18.486 -6.265  1.00 0.00 ? 73  ARG A HB3  2  
ATOM 2929  H HG2  . ARG A 1 73  ? -0.112  -20.546 -6.275  1.00 0.00 ? 73  ARG A HG2  2  
ATOM 2930  H HG3  . ARG A 1 73  ? 0.768   -19.952 -7.685  1.00 0.00 ? 73  ARG A HG3  2  
ATOM 2931  H HD2  . ARG A 1 73  ? 2.196   -19.287 -6.032  1.00 0.00 ? 73  ARG A HD2  2  
ATOM 2932  H HD3  . ARG A 1 73  ? 1.160   -17.863 -6.119  1.00 0.00 ? 73  ARG A HD3  2  
ATOM 2933  H HE   . ARG A 1 73  ? 0.429   -18.323 -4.005  1.00 0.00 ? 73  ARG A HE   2  
ATOM 2934  H HH11 . ARG A 1 73  ? 1.895   -21.187 -5.336  1.00 0.00 ? 73  ARG A HH11 2  
ATOM 2935  H HH12 . ARG A 1 73  ? 1.799   -22.082 -3.855  1.00 0.00 ? 73  ARG A HH12 2  
ATOM 2936  H HH21 . ARG A 1 73  ? 0.298   -19.490 -2.050  1.00 0.00 ? 73  ARG A HH21 2  
ATOM 2937  H HH22 . ARG A 1 73  ? 0.890   -21.116 -1.987  1.00 0.00 ? 73  ARG A HH22 2  
ATOM 2938  N N    . LYS A 1 74  ? -4.317  -19.256 -7.509  1.00 0.00 ? 74  LYS A N    2  
ATOM 2939  C CA   . LYS A 1 74  ? -5.614  -18.590 -7.497  1.00 0.00 ? 74  LYS A CA   2  
ATOM 2940  C C    . LYS A 1 74  ? -5.643  -17.475 -6.457  1.00 0.00 ? 74  LYS A C    2  
ATOM 2941  O O    . LYS A 1 74  ? -4.710  -17.325 -5.667  1.00 0.00 ? 74  LYS A O    2  
ATOM 2942  C CB   . LYS A 1 74  ? -6.726  -19.600 -7.209  1.00 0.00 ? 74  LYS A CB   2  
ATOM 2943  C CG   . LYS A 1 74  ? -7.124  -20.429 -8.418  1.00 0.00 ? 74  LYS A CG   2  
ATOM 2944  C CD   . LYS A 1 74  ? -8.548  -20.945 -8.297  1.00 0.00 ? 74  LYS A CD   2  
ATOM 2945  C CE   . LYS A 1 74  ? -9.556  -19.916 -8.786  1.00 0.00 ? 74  LYS A CE   2  
ATOM 2946  N NZ   . LYS A 1 74  ? -9.670  -19.913 -10.271 1.00 0.00 ? 74  LYS A NZ   2  
ATOM 2947  H H    . LYS A 1 74  ? -4.218  -20.119 -7.053  1.00 0.00 ? 74  LYS A H    2  
ATOM 2948  H HA   . LYS A 1 74  ? -5.774  -18.159 -8.474  1.00 0.00 ? 74  LYS A HA   2  
ATOM 2949  H HB2  . LYS A 1 74  ? -6.394  -20.272 -6.431  1.00 0.00 ? 74  LYS A HB2  2  
ATOM 2950  H HB3  . LYS A 1 74  ? -7.600  -19.066 -6.862  1.00 0.00 ? 74  LYS A HB3  2  
ATOM 2951  H HG2  . LYS A 1 74  ? -7.048  -19.817 -9.304  1.00 0.00 ? 74  LYS A HG2  2  
ATOM 2952  H HG3  . LYS A 1 74  ? -6.452  -21.272 -8.502  1.00 0.00 ? 74  LYS A HG3  2  
ATOM 2953  H HD2  . LYS A 1 74  ? -8.649  -21.841 -8.890  1.00 0.00 ? 74  LYS A HD2  2  
ATOM 2954  H HD3  . LYS A 1 74  ? -8.753  -21.172 -7.260  1.00 0.00 ? 74  LYS A HD3  2  
ATOM 2955  H HE2  . LYS A 1 74  ? -10.521 -20.146 -8.360  1.00 0.00 ? 74  LYS A HE2  2  
ATOM 2956  H HE3  . LYS A 1 74  ? -9.241  -18.937 -8.456  1.00 0.00 ? 74  LYS A HE3  2  
ATOM 2957  H HZ1  . LYS A 1 74  ? -10.671 -19.919 -10.552 1.00 0.00 ? 74  LYS A HZ1  2  
ATOM 2958  H HZ2  . LYS A 1 74  ? -9.206  -20.756 -10.666 1.00 0.00 ? 74  LYS A HZ2  2  
ATOM 2959  H HZ3  . LYS A 1 74  ? -9.215  -19.064 -10.663 1.00 0.00 ? 74  LYS A HZ3  2  
ATOM 2960  N N    . HIS A 1 75  ? -6.720  -16.696 -6.461  1.00 0.00 ? 75  HIS A N    2  
ATOM 2961  C CA   . HIS A 1 75  ? -6.871  -15.596 -5.515  1.00 0.00 ? 75  HIS A CA   2  
ATOM 2962  C C    . HIS A 1 75  ? -5.595  -14.762 -5.444  1.00 0.00 ? 75  HIS A C    2  
ATOM 2963  O O    . HIS A 1 75  ? -5.070  -14.503 -4.360  1.00 0.00 ? 75  HIS A O    2  
ATOM 2964  C CB   . HIS A 1 75  ? -7.222  -16.132 -4.127  1.00 0.00 ? 75  HIS A CB   2  
ATOM 2965  C CG   . HIS A 1 75  ? -8.032  -17.392 -4.159  1.00 0.00 ? 75  HIS A CG   2  
ATOM 2966  N ND1  . HIS A 1 75  ? -9.281  -17.468 -4.738  1.00 0.00 ? 75  HIS A ND1  2  
ATOM 2967  C CD2  . HIS A 1 75  ? -7.764  -18.629 -3.681  1.00 0.00 ? 75  HIS A CD2  2  
ATOM 2968  C CE1  . HIS A 1 75  ? -9.747  -18.698 -4.613  1.00 0.00 ? 75  HIS A CE1  2  
ATOM 2969  N NE2  . HIS A 1 75  ? -8.845  -19.423 -3.975  1.00 0.00 ? 75  HIS A NE2  2  
ATOM 2970  H H    . HIS A 1 75  ? -7.430  -16.866 -7.114  1.00 0.00 ? 75  HIS A H    2  
ATOM 2971  H HA   . HIS A 1 75  ? -7.677  -14.968 -5.863  1.00 0.00 ? 75  HIS A HA   2  
ATOM 2972  H HB2  . HIS A 1 75  ? -6.309  -16.339 -3.587  1.00 0.00 ? 75  HIS A HB2  2  
ATOM 2973  H HB3  . HIS A 1 75  ? -7.790  -15.385 -3.592  1.00 0.00 ? 75  HIS A HB3  2  
ATOM 2974  H HD1  . HIS A 1 75  ? -9.756  -16.731 -5.174  1.00 0.00 ? 75  HIS A HD1  2  
ATOM 2975  H HD2  . HIS A 1 75  ? -6.866  -18.937 -3.163  1.00 0.00 ? 75  HIS A HD2  2  
ATOM 2976  H HE1  . HIS A 1 75  ? -10.702 -19.052 -4.971  1.00 0.00 ? 75  HIS A HE1  2  
ATOM 2977  H HE2  . HIS A 1 75  ? -8.973  -20.347 -3.676  1.00 0.00 ? 75  HIS A HE2  2  
ATOM 2978  N N    . THR A 1 76  ? -5.100  -14.345 -6.605  1.00 0.00 ? 76  THR A N    2  
ATOM 2979  C CA   . THR A 1 76  ? -3.886  -13.543 -6.674  1.00 0.00 ? 76  THR A CA   2  
ATOM 2980  C C    . THR A 1 76  ? -4.178  -12.147 -7.214  1.00 0.00 ? 76  THR A C    2  
ATOM 2981  O O    . THR A 1 76  ? -5.129  -11.950 -7.971  1.00 0.00 ? 76  THR A O    2  
ATOM 2982  C CB   . THR A 1 76  ? -2.820  -14.211 -7.564  1.00 0.00 ? 76  THR A CB   2  
ATOM 2983  O OG1  . THR A 1 76  ? -2.694  -15.596 -7.219  1.00 0.00 ? 76  THR A OG1  2  
ATOM 2984  C CG2  . THR A 1 76  ? -1.474  -13.520 -7.409  1.00 0.00 ? 76  THR A CG2  2  
ATOM 2985  H H    . THR A 1 76  ? -5.564  -14.584 -7.434  1.00 0.00 ? 76  THR A H    2  
ATOM 2986  H HA   . THR A 1 76  ? -3.486  -13.455 -5.674  1.00 0.00 ? 76  THR A HA   2  
ATOM 2987  H HB   . THR A 1 76  ? -3.133  -14.132 -8.595  1.00 0.00 ? 76  THR A HB   2  
ATOM 2988  H HG1  . THR A 1 76  ? -3.564  -15.965 -7.052  1.00 0.00 ? 76  THR A HG1  2  
ATOM 2989  H HG21 . THR A 1 76  ? -0.697  -14.150 -7.815  1.00 0.00 ? 76  THR A HG21 2  
ATOM 2990  H HG22 . THR A 1 76  ? -1.281  -13.338 -6.362  1.00 0.00 ? 76  THR A HG22 2  
ATOM 2991  H HG23 . THR A 1 76  ? -1.490  -12.581 -7.941  1.00 0.00 ? 76  THR A HG23 2  
ATOM 2992  N N    . PHE A 1 77  ? -3.355  -11.181 -6.821  1.00 0.00 ? 77  PHE A N    2  
ATOM 2993  C CA   . PHE A 1 77  ? -3.526  -9.803  -7.266  1.00 0.00 ? 77  PHE A CA   2  
ATOM 2994  C C    . PHE A 1 77  ? -2.184  -9.182  -7.641  1.00 0.00 ? 77  PHE A C    2  
ATOM 2995  O O    . PHE A 1 77  ? -1.127  -9.658  -7.225  1.00 0.00 ? 77  PHE A O    2  
ATOM 2996  C CB   . PHE A 1 77  ? -4.197  -8.971  -6.171  1.00 0.00 ? 77  PHE A CB   2  
ATOM 2997  C CG   . PHE A 1 77  ? -3.663  -9.249  -4.795  1.00 0.00 ? 77  PHE A CG   2  
ATOM 2998  C CD1  . PHE A 1 77  ? -3.828  -10.494 -4.211  1.00 0.00 ? 77  PHE A CD1  2  
ATOM 2999  C CD2  . PHE A 1 77  ? -2.996  -8.264  -4.084  1.00 0.00 ? 77  PHE A CD2  2  
ATOM 3000  C CE1  . PHE A 1 77  ? -3.338  -10.753 -2.945  1.00 0.00 ? 77  PHE A CE1  2  
ATOM 3001  C CE2  . PHE A 1 77  ? -2.503  -8.517  -2.818  1.00 0.00 ? 77  PHE A CE2  2  
ATOM 3002  C CZ   . PHE A 1 77  ? -2.675  -9.763  -2.247  1.00 0.00 ? 77  PHE A CZ   2  
ATOM 3003  H H    . PHE A 1 77  ? -2.614  -11.400 -6.217  1.00 0.00 ? 77  PHE A H    2  
ATOM 3004  H HA   . PHE A 1 77  ? -4.161  -9.813  -8.138  1.00 0.00 ? 77  PHE A HA   2  
ATOM 3005  H HB2  . PHE A 1 77  ? -4.044  -7.923  -6.380  1.00 0.00 ? 77  PHE A HB2  2  
ATOM 3006  H HB3  . PHE A 1 77  ? -5.256  -9.183  -6.166  1.00 0.00 ? 77  PHE A HB3  2  
ATOM 3007  H HD1  . PHE A 1 77  ? -4.347  -11.270 -4.756  1.00 0.00 ? 77  PHE A HD1  2  
ATOM 3008  H HD2  . PHE A 1 77  ? -2.862  -7.288  -4.529  1.00 0.00 ? 77  PHE A HD2  2  
ATOM 3009  H HE1  . PHE A 1 77  ? -3.474  -11.729 -2.502  1.00 0.00 ? 77  PHE A HE1  2  
ATOM 3010  H HE2  . PHE A 1 77  ? -1.985  -7.740  -2.275  1.00 0.00 ? 77  PHE A HE2  2  
ATOM 3011  H HZ   . PHE A 1 77  ? -2.291  -9.963  -1.259  1.00 0.00 ? 77  PHE A HZ   2  
ATOM 3012  N N    . LYS A 1 78  ? -2.233  -8.115  -8.431  1.00 0.00 ? 78  LYS A N    2  
ATOM 3013  C CA   . LYS A 1 78  ? -1.022  -7.426  -8.863  1.00 0.00 ? 78  LYS A CA   2  
ATOM 3014  C C    . LYS A 1 78  ? -1.072  -5.949  -8.485  1.00 0.00 ? 78  LYS A C    2  
ATOM 3015  O O    . LYS A 1 78  ? -2.146  -5.353  -8.412  1.00 0.00 ? 78  LYS A O    2  
ATOM 3016  C CB   . LYS A 1 78  ? -0.842  -7.570  -10.376 1.00 0.00 ? 78  LYS A CB   2  
ATOM 3017  C CG   . LYS A 1 78  ? -2.020  -7.050  -11.181 1.00 0.00 ? 78  LYS A CG   2  
ATOM 3018  C CD   . LYS A 1 78  ? -1.648  -6.834  -12.639 1.00 0.00 ? 78  LYS A CD   2  
ATOM 3019  C CE   . LYS A 1 78  ? -2.722  -6.050  -13.377 1.00 0.00 ? 78  LYS A CE   2  
ATOM 3020  N NZ   . LYS A 1 78  ? -2.402  -5.899  -14.824 1.00 0.00 ? 78  LYS A NZ   2  
ATOM 3021  H H    . LYS A 1 78  ? -3.105  -7.781  -8.730  1.00 0.00 ? 78  LYS A H    2  
ATOM 3022  H HA   . LYS A 1 78  ? -0.183  -7.886  -8.364  1.00 0.00 ? 78  LYS A HA   2  
ATOM 3023  H HB2  . LYS A 1 78  ? 0.040   -7.023  -10.675 1.00 0.00 ? 78  LYS A HB2  2  
ATOM 3024  H HB3  . LYS A 1 78  ? -0.704  -8.615  -10.613 1.00 0.00 ? 78  LYS A HB3  2  
ATOM 3025  H HG2  . LYS A 1 78  ? -2.825  -7.769  -11.129 1.00 0.00 ? 78  LYS A HG2  2  
ATOM 3026  H HG3  . LYS A 1 78  ? -2.347  -6.111  -10.759 1.00 0.00 ? 78  LYS A HG3  2  
ATOM 3027  H HD2  . LYS A 1 78  ? -0.720  -6.285  -12.687 1.00 0.00 ? 78  LYS A HD2  2  
ATOM 3028  H HD3  . LYS A 1 78  ? -1.525  -7.796  -13.116 1.00 0.00 ? 78  LYS A HD3  2  
ATOM 3029  H HE2  . LYS A 1 78  ? -3.662  -6.570  -13.278 1.00 0.00 ? 78  LYS A HE2  2  
ATOM 3030  H HE3  . LYS A 1 78  ? -2.804  -5.070  -12.931 1.00 0.00 ? 78  LYS A HE3  2  
ATOM 3031  H HZ1  . LYS A 1 78  ? -2.745  -6.726  -15.353 1.00 0.00 ? 78  LYS A HZ1  2  
ATOM 3032  H HZ2  . LYS A 1 78  ? -1.374  -5.820  -14.956 1.00 0.00 ? 78  LYS A HZ2  2  
ATOM 3033  H HZ3  . LYS A 1 78  ? -2.857  -5.044  -15.204 1.00 0.00 ? 78  LYS A HZ3  2  
ATOM 3034  N N    . ALA A 1 79  ? 0.098   -5.365  -8.245  1.00 0.00 ? 79  ALA A N    2  
ATOM 3035  C CA   . ALA A 1 79  ? 0.187   -3.957  -7.878  1.00 0.00 ? 79  ALA A CA   2  
ATOM 3036  C C    . ALA A 1 79  ? 1.088   -3.194  -8.843  1.00 0.00 ? 79  ALA A C    2  
ATOM 3037  O O    . ALA A 1 79  ? 2.309   -3.343  -8.816  1.00 0.00 ? 79  ALA A O    2  
ATOM 3038  C CB   . ALA A 1 79  ? 0.699   -3.816  -6.452  1.00 0.00 ? 79  ALA A CB   2  
ATOM 3039  H H    . ALA A 1 79  ? 0.920   -5.893  -8.319  1.00 0.00 ? 79  ALA A H    2  
ATOM 3040  H HA   . ALA A 1 79  ? -0.807  -3.537  -7.921  1.00 0.00 ? 79  ALA A HA   2  
ATOM 3041  H HB1  . ALA A 1 79  ? 0.047   -4.356  -5.781  1.00 0.00 ? 79  ALA A HB1  2  
ATOM 3042  H HB2  . ALA A 1 79  ? 1.698   -4.220  -6.386  1.00 0.00 ? 79  ALA A HB2  2  
ATOM 3043  H HB3  . ALA A 1 79  ? 0.714   -2.772  -6.177  1.00 0.00 ? 79  ALA A HB3  2  
ATOM 3044  N N    . GLU A 1 80  ? 0.476   -2.378  -9.696  1.00 0.00 ? 80  GLU A N    2  
ATOM 3045  C CA   . GLU A 1 80  ? 1.224   -1.593  -10.671 1.00 0.00 ? 80  GLU A CA   2  
ATOM 3046  C C    . GLU A 1 80  ? 1.280   -0.125  -10.260 1.00 0.00 ? 80  GLU A C    2  
ATOM 3047  O O    . GLU A 1 80  ? 0.394   0.371   -9.564  1.00 0.00 ? 80  GLU A O    2  
ATOM 3048  C CB   . GLU A 1 80  ? 0.590   -1.722  -12.058 1.00 0.00 ? 80  GLU A CB   2  
ATOM 3049  C CG   . GLU A 1 80  ? 1.113   -0.710  -13.063 1.00 0.00 ? 80  GLU A CG   2  
ATOM 3050  C CD   . GLU A 1 80  ? 0.960   -1.179  -14.497 1.00 0.00 ? 80  GLU A CD   2  
ATOM 3051  O OE1  . GLU A 1 80  ? -0.071  -1.814  -14.805 1.00 0.00 ? 80  GLU A OE1  2  
ATOM 3052  O OE2  . GLU A 1 80  ? 1.869   -0.912  -15.310 1.00 0.00 ? 80  GLU A OE2  2  
ATOM 3053  H H    . GLU A 1 80  ? -0.500  -2.303  -9.669  1.00 0.00 ? 80  GLU A H    2  
ATOM 3054  H HA   . GLU A 1 80  ? 2.230   -1.983  -10.709 1.00 0.00 ? 80  GLU A HA   2  
ATOM 3055  H HB2  . GLU A 1 80  ? 0.786   -2.713  -12.439 1.00 0.00 ? 80  GLU A HB2  2  
ATOM 3056  H HB3  . GLU A 1 80  ? -0.478  -1.587  -11.965 1.00 0.00 ? 80  GLU A HB3  2  
ATOM 3057  H HG2  . GLU A 1 80  ? 0.567   0.214   -12.942 1.00 0.00 ? 80  GLU A HG2  2  
ATOM 3058  H HG3  . GLU A 1 80  ? 2.161   -0.536  -12.867 1.00 0.00 ? 80  GLU A HG3  2  
ATOM 3059  N N    . HIS A 1 81  ? 2.329   0.566   -10.695 1.00 0.00 ? 81  HIS A N    2  
ATOM 3060  C CA   . HIS A 1 81  ? 2.502   1.978   -10.373 1.00 0.00 ? 81  HIS A CA   2  
ATOM 3061  C C    . HIS A 1 81  ? 2.732   2.800   -11.637 1.00 0.00 ? 81  HIS A C    2  
ATOM 3062  O O    . HIS A 1 81  ? 2.663   2.278   -12.749 1.00 0.00 ? 81  HIS A O    2  
ATOM 3063  C CB   . HIS A 1 81  ? 3.675   2.163   -9.409  1.00 0.00 ? 81  HIS A CB   2  
ATOM 3064  C CG   . HIS A 1 81  ? 3.539   3.362   -8.523  1.00 0.00 ? 81  HIS A CG   2  
ATOM 3065  N ND1  . HIS A 1 81  ? 4.618   4.006   -7.956  1.00 0.00 ? 81  HIS A ND1  2  
ATOM 3066  C CD2  . HIS A 1 81  ? 2.441   4.036   -8.108  1.00 0.00 ? 81  HIS A CD2  2  
ATOM 3067  C CE1  . HIS A 1 81  ? 4.190   5.023   -7.229  1.00 0.00 ? 81  HIS A CE1  2  
ATOM 3068  N NE2  . HIS A 1 81  ? 2.872   5.063   -7.305  1.00 0.00 ? 81  HIS A NE2  2  
ATOM 3069  H H    . HIS A 1 81  ? 3.003   0.116   -11.246 1.00 0.00 ? 81  HIS A H    2  
ATOM 3070  H HA   . HIS A 1 81  ? 1.598   2.322   -9.894  1.00 0.00 ? 81  HIS A HA   2  
ATOM 3071  H HB2  . HIS A 1 81  ? 3.754   1.291   -8.777  1.00 0.00 ? 81  HIS A HB2  2  
ATOM 3072  H HB3  . HIS A 1 81  ? 4.587   2.273   -9.979  1.00 0.00 ? 81  HIS A HB3  2  
ATOM 3073  H HD1  . HIS A 1 81  ? 5.558   3.754   -8.068  1.00 0.00 ? 81  HIS A HD1  2  
ATOM 3074  H HD2  . HIS A 1 81  ? 1.414   3.809   -8.361  1.00 0.00 ? 81  HIS A HD2  2  
ATOM 3075  H HE1  . HIS A 1 81  ? 4.811   5.705   -6.668  1.00 0.00 ? 81  HIS A HE1  2  
ATOM 3076  H HE2  . HIS A 1 81  ? 2.296   5.667   -6.792  1.00 0.00 ? 81  HIS A HE2  2  
ATOM 3077  N N    . ALA A 1 82  ? 3.006   4.088   -11.458 1.00 0.00 ? 82  ALA A N    2  
ATOM 3078  C CA   . ALA A 1 82  ? 3.247   4.981   -12.584 1.00 0.00 ? 82  ALA A CA   2  
ATOM 3079  C C    . ALA A 1 82  ? 4.528   4.603   -13.320 1.00 0.00 ? 82  ALA A C    2  
ATOM 3080  O O    . ALA A 1 82  ? 5.544   5.288   -13.209 1.00 0.00 ? 82  ALA A O    2  
ATOM 3081  C CB   . ALA A 1 82  ? 3.316   6.425   -12.108 1.00 0.00 ? 82  ALA A CB   2  
ATOM 3082  H H    . ALA A 1 82  ? 3.047   4.446   -10.547 1.00 0.00 ? 82  ALA A H    2  
ATOM 3083  H HA   . ALA A 1 82  ? 2.413   4.892   -13.266 1.00 0.00 ? 82  ALA A HA   2  
ATOM 3084  H HB1  . ALA A 1 82  ? 3.910   7.003   -12.800 1.00 0.00 ? 82  ALA A HB1  2  
ATOM 3085  H HB2  . ALA A 1 82  ? 2.318   6.835   -12.059 1.00 0.00 ? 82  ALA A HB2  2  
ATOM 3086  H HB3  . ALA A 1 82  ? 3.768   6.459   -11.128 1.00 0.00 ? 82  ALA A HB3  2  
ATOM 3087  N N    . GLY A 1 83  ? 4.473   3.508   -14.072 1.00 0.00 ? 83  GLY A N    2  
ATOM 3088  C CA   . GLY A 1 83  ? 5.636   3.058   -14.814 1.00 0.00 ? 83  GLY A CA   2  
ATOM 3089  C C    . GLY A 1 83  ? 6.842   2.836   -13.923 1.00 0.00 ? 83  GLY A C    2  
ATOM 3090  O O    . GLY A 1 83  ? 7.939   3.308   -14.223 1.00 0.00 ? 83  GLY A O    2  
ATOM 3091  H H    . GLY A 1 83  ? 3.635   3.001   -14.123 1.00 0.00 ? 83  GLY A H    2  
ATOM 3092  H HA2  . GLY A 1 83  ? 5.395   2.131   -15.313 1.00 0.00 ? 83  GLY A HA2  2  
ATOM 3093  H HA3  . GLY A 1 83  ? 5.884   3.801   -15.557 1.00 0.00 ? 83  GLY A HA3  2  
ATOM 3094  N N    . VAL A 1 84  ? 6.639   2.119   -12.823 1.00 0.00 ? 84  VAL A N    2  
ATOM 3095  C CA   . VAL A 1 84  ? 7.719   1.836   -11.884 1.00 0.00 ? 84  VAL A CA   2  
ATOM 3096  C C    . VAL A 1 84  ? 8.019   0.343   -11.826 1.00 0.00 ? 84  VAL A C    2  
ATOM 3097  O O    . VAL A 1 84  ? 9.076   -0.106  -12.270 1.00 0.00 ? 84  VAL A O    2  
ATOM 3098  C CB   . VAL A 1 84  ? 7.377   2.336   -10.468 1.00 0.00 ? 84  VAL A CB   2  
ATOM 3099  C CG1  . VAL A 1 84  ? 8.538   2.084   -9.518  1.00 0.00 ? 84  VAL A CG1  2  
ATOM 3100  C CG2  . VAL A 1 84  ? 7.012   3.812   -10.498 1.00 0.00 ? 84  VAL A CG2  2  
ATOM 3101  H H    . VAL A 1 84  ? 5.742   1.770   -12.638 1.00 0.00 ? 84  VAL A H    2  
ATOM 3102  H HA   . VAL A 1 84  ? 8.602   2.358   -12.224 1.00 0.00 ? 84  VAL A HA   2  
ATOM 3103  H HB   . VAL A 1 84  ? 6.521   1.782   -10.110 1.00 0.00 ? 84  VAL A HB   2  
ATOM 3104  H HG11 . VAL A 1 84  ? 9.322   2.802   -9.710  1.00 0.00 ? 84  VAL A HG11 2  
ATOM 3105  H HG12 . VAL A 1 84  ? 8.197   2.185   -8.498  1.00 0.00 ? 84  VAL A HG12 2  
ATOM 3106  H HG13 . VAL A 1 84  ? 8.919   1.085   -9.673  1.00 0.00 ? 84  VAL A HG13 2  
ATOM 3107  H HG21 . VAL A 1 84  ? 5.951   3.917   -10.667 1.00 0.00 ? 84  VAL A HG21 2  
ATOM 3108  H HG22 . VAL A 1 84  ? 7.273   4.267   -9.553  1.00 0.00 ? 84  VAL A HG22 2  
ATOM 3109  H HG23 . VAL A 1 84  ? 7.554   4.301   -11.294 1.00 0.00 ? 84  VAL A HG23 2  
ATOM 3110  N N    . ARG A 1 85  ? 7.083   -0.423  -11.276 1.00 0.00 ? 85  ARG A N    2  
ATOM 3111  C CA   . ARG A 1 85  ? 7.247   -1.867  -11.158 1.00 0.00 ? 85  ARG A CA   2  
ATOM 3112  C C    . ARG A 1 85  ? 5.906   -2.548  -10.905 1.00 0.00 ? 85  ARG A C    2  
ATOM 3113  O O    . ARG A 1 85  ? 4.997   -1.957  -10.321 1.00 0.00 ? 85  ARG A O    2  
ATOM 3114  C CB   . ARG A 1 85  ? 8.222   -2.200  -10.028 1.00 0.00 ? 85  ARG A CB   2  
ATOM 3115  C CG   . ARG A 1 85  ? 8.771   -3.616  -10.094 1.00 0.00 ? 85  ARG A CG   2  
ATOM 3116  C CD   . ARG A 1 85  ? 10.038  -3.684  -10.933 1.00 0.00 ? 85  ARG A CD   2  
ATOM 3117  N NE   . ARG A 1 85  ? 10.367  -5.054  -11.317 1.00 0.00 ? 85  ARG A NE   2  
ATOM 3118  C CZ   . ARG A 1 85  ? 11.274  -5.361  -12.237 1.00 0.00 ? 85  ARG A CZ   2  
ATOM 3119  N NH1  . ARG A 1 85  ? 11.940  -4.401  -12.863 1.00 0.00 ? 85  ARG A NH1  2  
ATOM 3120  N NH2  . ARG A 1 85  ? 11.518  -6.632  -12.531 1.00 0.00 ? 85  ARG A NH2  2  
ATOM 3121  H H    . ARG A 1 85  ? 6.261   -0.007  -10.940 1.00 0.00 ? 85  ARG A H    2  
ATOM 3122  H HA   . ARG A 1 85  ? 7.652   -2.231  -12.090 1.00 0.00 ? 85  ARG A HA   2  
ATOM 3123  H HB2  . ARG A 1 85  ? 9.055   -1.513  -10.072 1.00 0.00 ? 85  ARG A HB2  2  
ATOM 3124  H HB3  . ARG A 1 85  ? 7.715   -2.078  -9.083  1.00 0.00 ? 85  ARG A HB3  2  
ATOM 3125  H HG2  . ARG A 1 85  ? 8.997   -3.952  -9.093  1.00 0.00 ? 85  ARG A HG2  2  
ATOM 3126  H HG3  . ARG A 1 85  ? 8.024   -4.261  -10.533 1.00 0.00 ? 85  ARG A HG3  2  
ATOM 3127  H HD2  . ARG A 1 85  ? 9.894   -3.095  -11.826 1.00 0.00 ? 85  ARG A HD2  2  
ATOM 3128  H HD3  . ARG A 1 85  ? 10.855  -3.274  -10.359 1.00 0.00 ? 85  ARG A HD3  2  
ATOM 3129  H HE   . ARG A 1 85  ? 9.887   -5.779  -10.866 1.00 0.00 ? 85  ARG A HE   2  
ATOM 3130  H HH11 . ARG A 1 85  ? 11.759  -3.443  -12.643 1.00 0.00 ? 85  ARG A HH11 2  
ATOM 3131  H HH12 . ARG A 1 85  ? 12.623  -4.635  -13.555 1.00 0.00 ? 85  ARG A HH12 2  
ATOM 3132  H HH21 . ARG A 1 85  ? 11.019  -7.359  -12.061 1.00 0.00 ? 85  ARG A HH21 2  
ATOM 3133  H HH22 . ARG A 1 85  ? 12.201  -6.862  -13.224 1.00 0.00 ? 85  ARG A HH22 2  
ATOM 3134  N N    . THR A 1 86  ? 5.788   -3.796  -11.348 1.00 0.00 ? 86  THR A N    2  
ATOM 3135  C CA   . THR A 1 86  ? 4.558   -4.557  -11.171 1.00 0.00 ? 86  THR A CA   2  
ATOM 3136  C C    . THR A 1 86  ? 4.775   -5.742  -10.236 1.00 0.00 ? 86  THR A C    2  
ATOM 3137  O O    . THR A 1 86  ? 5.420   -6.725  -10.603 1.00 0.00 ? 86  THR A O    2  
ATOM 3138  C CB   . THR A 1 86  ? 4.018   -5.073  -12.518 1.00 0.00 ? 86  THR A CB   2  
ATOM 3139  O OG1  . THR A 1 86  ? 4.313   -4.132  -13.557 1.00 0.00 ? 86  THR A OG1  2  
ATOM 3140  C CG2  . THR A 1 86  ? 2.516   -5.303  -12.447 1.00 0.00 ? 86  THR A CG2  2  
ATOM 3141  H H    . THR A 1 86  ? 6.548   -4.213  -11.805 1.00 0.00 ? 86  THR A H    2  
ATOM 3142  H HA   . THR A 1 86  ? 3.818   -3.900  -10.738 1.00 0.00 ? 86  THR A HA   2  
ATOM 3143  H HB   . THR A 1 86  ? 4.501   -6.013  -12.746 1.00 0.00 ? 86  THR A HB   2  
ATOM 3144  H HG1  . THR A 1 86  ? 5.202   -3.790  -13.436 1.00 0.00 ? 86  THR A HG1  2  
ATOM 3145  H HG21 . THR A 1 86  ? 2.014   -4.359  -12.296 1.00 0.00 ? 86  THR A HG21 2  
ATOM 3146  H HG22 . THR A 1 86  ? 2.293   -5.966  -11.624 1.00 0.00 ? 86  THR A HG22 2  
ATOM 3147  H HG23 . THR A 1 86  ? 2.176   -5.748  -13.370 1.00 0.00 ? 86  THR A HG23 2  
ATOM 3148  N N    . TYR A 1 87  ? 4.232   -5.643  -9.028  1.00 0.00 ? 87  TYR A N    2  
ATOM 3149  C CA   . TYR A 1 87  ? 4.367   -6.706  -8.040  1.00 0.00 ? 87  TYR A CA   2  
ATOM 3150  C C    . TYR A 1 87  ? 3.223   -7.709  -8.159  1.00 0.00 ? 87  TYR A C    2  
ATOM 3151  O O    . TYR A 1 87  ? 2.263   -7.488  -8.896  1.00 0.00 ? 87  TYR A O    2  
ATOM 3152  C CB   . TYR A 1 87  ? 4.399   -6.118  -6.628  1.00 0.00 ? 87  TYR A CB   2  
ATOM 3153  C CG   . TYR A 1 87  ? 5.678   -5.375  -6.311  1.00 0.00 ? 87  TYR A CG   2  
ATOM 3154  C CD1  . TYR A 1 87  ? 5.959   -4.151  -6.905  1.00 0.00 ? 87  TYR A CD1  2  
ATOM 3155  C CD2  . TYR A 1 87  ? 6.605   -5.898  -5.418  1.00 0.00 ? 87  TYR A CD2  2  
ATOM 3156  C CE1  . TYR A 1 87  ? 7.126   -3.469  -6.619  1.00 0.00 ? 87  TYR A CE1  2  
ATOM 3157  C CE2  . TYR A 1 87  ? 7.774   -5.223  -5.125  1.00 0.00 ? 87  TYR A CE2  2  
ATOM 3158  C CZ   . TYR A 1 87  ? 8.030   -4.009  -5.728  1.00 0.00 ? 87  TYR A CZ   2  
ATOM 3159  O OH   . TYR A 1 87  ? 9.193   -3.334  -5.439  1.00 0.00 ? 87  TYR A OH   2  
ATOM 3160  H H    . TYR A 1 87  ? 3.729   -4.835  -8.795  1.00 0.00 ? 87  TYR A H    2  
ATOM 3161  H HA   . TYR A 1 87  ? 5.300   -7.217  -8.228  1.00 0.00 ? 87  TYR A HA   2  
ATOM 3162  H HB2  . TYR A 1 87  ? 3.578   -5.427  -6.514  1.00 0.00 ? 87  TYR A HB2  2  
ATOM 3163  H HB3  . TYR A 1 87  ? 4.293   -6.918  -5.910  1.00 0.00 ? 87  TYR A HB3  2  
ATOM 3164  H HD1  . TYR A 1 87  ? 5.249   -3.731  -7.602  1.00 0.00 ? 87  TYR A HD1  2  
ATOM 3165  H HD2  . TYR A 1 87  ? 6.401   -6.849  -4.948  1.00 0.00 ? 87  TYR A HD2  2  
ATOM 3166  H HE1  . TYR A 1 87  ? 7.326   -2.519  -7.090  1.00 0.00 ? 87  TYR A HE1  2  
ATOM 3167  H HE2  . TYR A 1 87  ? 8.482   -5.645  -4.427  1.00 0.00 ? 87  TYR A HE2  2  
ATOM 3168  H HH   . TYR A 1 87  ? 9.594   -3.709  -4.651  1.00 0.00 ? 87  TYR A HH   2  
ATOM 3169  N N    . PHE A 1 88  ? 3.335   -8.813  -7.427  1.00 0.00 ? 88  PHE A N    2  
ATOM 3170  C CA   . PHE A 1 88  ? 2.311   -9.851  -7.449  1.00 0.00 ? 88  PHE A CA   2  
ATOM 3171  C C    . PHE A 1 88  ? 2.213   -10.547 -6.094  1.00 0.00 ? 88  PHE A C    2  
ATOM 3172  O O    . PHE A 1 88  ? 3.208   -11.043 -5.565  1.00 0.00 ? 88  PHE A O    2  
ATOM 3173  C CB   . PHE A 1 88  ? 2.620   -10.878 -8.541  1.00 0.00 ? 88  PHE A CB   2  
ATOM 3174  C CG   . PHE A 1 88  ? 2.307   -10.391 -9.927  1.00 0.00 ? 88  PHE A CG   2  
ATOM 3175  C CD1  . PHE A 1 88  ? 3.137   -9.478  -10.559 1.00 0.00 ? 88  PHE A CD1  2  
ATOM 3176  C CD2  . PHE A 1 88  ? 1.184   -10.846 -10.598 1.00 0.00 ? 88  PHE A CD2  2  
ATOM 3177  C CE1  . PHE A 1 88  ? 2.851   -9.029  -11.834 1.00 0.00 ? 88  PHE A CE1  2  
ATOM 3178  C CE2  . PHE A 1 88  ? 0.893   -10.400 -11.874 1.00 0.00 ? 88  PHE A CE2  2  
ATOM 3179  C CZ   . PHE A 1 88  ? 1.728   -9.491  -12.492 1.00 0.00 ? 88  PHE A CZ   2  
ATOM 3180  H H    . PHE A 1 88  ? 4.125   -8.931  -6.858  1.00 0.00 ? 88  PHE A H    2  
ATOM 3181  H HA   . PHE A 1 88  ? 1.366   -9.379  -7.667  1.00 0.00 ? 88  PHE A HA   2  
ATOM 3182  H HB2  . PHE A 1 88  ? 3.670   -11.125 -8.506  1.00 0.00 ? 88  PHE A HB2  2  
ATOM 3183  H HB3  . PHE A 1 88  ? 2.038   -11.769 -8.361  1.00 0.00 ? 88  PHE A HB3  2  
ATOM 3184  H HD1  . PHE A 1 88  ? 4.016   -9.117  -10.045 1.00 0.00 ? 88  PHE A HD1  2  
ATOM 3185  H HD2  . PHE A 1 88  ? 0.530   -11.558 -10.115 1.00 0.00 ? 88  PHE A HD2  2  
ATOM 3186  H HE1  . PHE A 1 88  ? 3.505   -8.318  -12.315 1.00 0.00 ? 88  PHE A HE1  2  
ATOM 3187  H HE2  . PHE A 1 88  ? 0.015   -10.764 -12.386 1.00 0.00 ? 88  PHE A HE2  2  
ATOM 3188  H HZ   . PHE A 1 88  ? 1.502   -9.140  -13.488 1.00 0.00 ? 88  PHE A HZ   2  
ATOM 3189  N N    . PHE A 1 89  ? 1.006   -10.579 -5.539  1.00 0.00 ? 89  PHE A N    2  
ATOM 3190  C CA   . PHE A 1 89  ? 0.776   -11.212 -4.245  1.00 0.00 ? 89  PHE A CA   2  
ATOM 3191  C C    . PHE A 1 89  ? -0.372  -12.213 -4.326  1.00 0.00 ? 89  PHE A C    2  
ATOM 3192  O O    . PHE A 1 89  ? -1.488  -11.864 -4.712  1.00 0.00 ? 89  PHE A O    2  
ATOM 3193  C CB   . PHE A 1 89  ? 0.472   -10.154 -3.183  1.00 0.00 ? 89  PHE A CB   2  
ATOM 3194  C CG   . PHE A 1 89  ? 1.489   -9.049  -3.128  1.00 0.00 ? 89  PHE A CG   2  
ATOM 3195  C CD1  . PHE A 1 89  ? 2.753   -9.279  -2.608  1.00 0.00 ? 89  PHE A CD1  2  
ATOM 3196  C CD2  . PHE A 1 89  ? 1.181   -7.782  -3.596  1.00 0.00 ? 89  PHE A CD2  2  
ATOM 3197  C CE1  . PHE A 1 89  ? 3.690   -8.264  -2.555  1.00 0.00 ? 89  PHE A CE1  2  
ATOM 3198  C CE2  . PHE A 1 89  ? 2.114   -6.764  -3.547  1.00 0.00 ? 89  PHE A CE2  2  
ATOM 3199  C CZ   . PHE A 1 89  ? 3.371   -7.006  -3.027  1.00 0.00 ? 89  PHE A CZ   2  
ATOM 3200  H H    . PHE A 1 89  ? 0.252   -10.166 -6.010  1.00 0.00 ? 89  PHE A H    2  
ATOM 3201  H HA   . PHE A 1 89  ? 1.678   -11.737 -3.970  1.00 0.00 ? 89  PHE A HA   2  
ATOM 3202  H HB2  . PHE A 1 89  ? -0.489  -9.709  -3.393  1.00 0.00 ? 89  PHE A HB2  2  
ATOM 3203  H HB3  . PHE A 1 89  ? 0.441   -10.627 -2.213  1.00 0.00 ? 89  PHE A HB3  2  
ATOM 3204  H HD1  . PHE A 1 89  ? 3.004   -10.263 -2.240  1.00 0.00 ? 89  PHE A HD1  2  
ATOM 3205  H HD2  . PHE A 1 89  ? 0.198   -7.592  -4.004  1.00 0.00 ? 89  PHE A HD2  2  
ATOM 3206  H HE1  . PHE A 1 89  ? 4.671   -8.456  -2.148  1.00 0.00 ? 89  PHE A HE1  2  
ATOM 3207  H HE2  . PHE A 1 89  ? 1.861   -5.781  -3.916  1.00 0.00 ? 89  PHE A HE2  2  
ATOM 3208  H HZ   . PHE A 1 89  ? 4.101   -6.211  -2.986  1.00 0.00 ? 89  PHE A HZ   2  
ATOM 3209  N N    . SER A 1 90  ? -0.090  -13.459 -3.959  1.00 0.00 ? 90  SER A N    2  
ATOM 3210  C CA   . SER A 1 90  ? -1.098  -14.513 -3.994  1.00 0.00 ? 90  SER A CA   2  
ATOM 3211  C C    . SER A 1 90  ? -1.547  -14.881 -2.583  1.00 0.00 ? 90  SER A C    2  
ATOM 3212  O O    . SER A 1 90  ? -0.726  -15.038 -1.679  1.00 0.00 ? 90  SER A O    2  
ATOM 3213  C CB   . SER A 1 90  ? -0.548  -15.750 -4.706  1.00 0.00 ? 90  SER A CB   2  
ATOM 3214  O OG   . SER A 1 90  ? -1.510  -16.790 -4.736  1.00 0.00 ? 90  SER A OG   2  
ATOM 3215  H H    . SER A 1 90  ? 0.818   -13.675 -3.660  1.00 0.00 ? 90  SER A H    2  
ATOM 3216  H HA   . SER A 1 90  ? -1.949  -14.140 -4.544  1.00 0.00 ? 90  SER A HA   2  
ATOM 3217  H HB2  . SER A 1 90  ? -0.283  -15.491 -5.720  1.00 0.00 ? 90  SER A HB2  2  
ATOM 3218  H HB3  . SER A 1 90  ? 0.330   -16.102 -4.183  1.00 0.00 ? 90  SER A HB3  2  
ATOM 3219  H HG   . SER A 1 90  ? -2.386  -16.413 -4.841  1.00 0.00 ? 90  SER A HG   2  
ATOM 3220  N N    . ALA A 1 91  ? -2.856  -15.019 -2.403  1.00 0.00 ? 91  ALA A N    2  
ATOM 3221  C CA   . ALA A 1 91  ? -3.416  -15.371 -1.104  1.00 0.00 ? 91  ALA A CA   2  
ATOM 3222  C C    . ALA A 1 91  ? -3.855  -16.831 -1.073  1.00 0.00 ? 91  ALA A C    2  
ATOM 3223  O O    . ALA A 1 91  ? -4.505  -17.312 -2.000  1.00 0.00 ? 91  ALA A O    2  
ATOM 3224  C CB   . ALA A 1 91  ? -4.586  -14.458 -0.768  1.00 0.00 ? 91  ALA A CB   2  
ATOM 3225  H H    . ALA A 1 91  ? -3.460  -14.881 -3.162  1.00 0.00 ? 91  ALA A H    2  
ATOM 3226  H HA   . ALA A 1 91  ? -2.649  -15.220 -0.358  1.00 0.00 ? 91  ALA A HA   2  
ATOM 3227  H HB1  . ALA A 1 91  ? -4.942  -14.682 0.227   1.00 0.00 ? 91  ALA A HB1  2  
ATOM 3228  H HB2  . ALA A 1 91  ? -4.264  -13.429 -0.813  1.00 0.00 ? 91  ALA A HB2  2  
ATOM 3229  H HB3  . ALA A 1 91  ? -5.382  -14.618 -1.480  1.00 0.00 ? 91  ALA A HB3  2  
ATOM 3230  N N    . GLU A 1 92  ? -3.495  -17.530 0.000   1.00 0.00 ? 92  GLU A N    2  
ATOM 3231  C CA   . GLU A 1 92  ? -3.851  -18.936 0.149   1.00 0.00 ? 92  GLU A CA   2  
ATOM 3232  C C    . GLU A 1 92  ? -5.353  -19.139 -0.035  1.00 0.00 ? 92  GLU A C    2  
ATOM 3233  O O    . GLU A 1 92  ? -5.785  -20.066 -0.720  1.00 0.00 ? 92  GLU A O    2  
ATOM 3234  C CB   . GLU A 1 92  ? -3.421  -19.450 1.524   1.00 0.00 ? 92  GLU A CB   2  
ATOM 3235  C CG   . GLU A 1 92  ? -1.946  -19.236 1.820   1.00 0.00 ? 92  GLU A CG   2  
ATOM 3236  C CD   . GLU A 1 92  ? -1.436  -20.137 2.928   1.00 0.00 ? 92  GLU A CD   2  
ATOM 3237  O OE1  . GLU A 1 92  ? -1.973  -20.055 4.053   1.00 0.00 ? 92  GLU A OE1  2  
ATOM 3238  O OE2  . GLU A 1 92  ? -0.501  -20.924 2.671   1.00 0.00 ? 92  GLU A OE2  2  
ATOM 3239  H H    . GLU A 1 92  ? -2.978  -17.090 0.706   1.00 0.00 ? 92  GLU A H    2  
ATOM 3240  H HA   . GLU A 1 92  ? -3.329  -19.493 -0.613  1.00 0.00 ? 92  GLU A HA   2  
ATOM 3241  H HB2  . GLU A 1 92  ? -3.997  -18.941 2.283   1.00 0.00 ? 92  GLU A HB2  2  
ATOM 3242  H HB3  . GLU A 1 92  ? -3.627  -20.509 1.579   1.00 0.00 ? 92  GLU A HB3  2  
ATOM 3243  H HG2  . GLU A 1 92  ? -1.379  -19.438 0.923   1.00 0.00 ? 92  GLU A HG2  2  
ATOM 3244  H HG3  . GLU A 1 92  ? -1.796  -18.208 2.115   1.00 0.00 ? 92  GLU A HG3  2  
ATOM 3245  N N    . SER A 1 93  ? -6.142  -18.266 0.582   1.00 0.00 ? 93  SER A N    2  
ATOM 3246  C CA   . SER A 1 93  ? -7.595  -18.351 0.491   1.00 0.00 ? 93  SER A CA   2  
ATOM 3247  C C    . SER A 1 93  ? -8.161  -17.165 -0.284  1.00 0.00 ? 93  SER A C    2  
ATOM 3248  O O    . SER A 1 93  ? -7.527  -16.118 -0.417  1.00 0.00 ? 93  SER A O    2  
ATOM 3249  C CB   . SER A 1 93  ? -8.213  -18.404 1.889   1.00 0.00 ? 93  SER A CB   2  
ATOM 3250  O OG   . SER A 1 93  ? -8.244  -19.731 2.384   1.00 0.00 ? 93  SER A OG   2  
ATOM 3251  H H    . SER A 1 93  ? -5.737  -17.548 1.114   1.00 0.00 ? 93  SER A H    2  
ATOM 3252  H HA   . SER A 1 93  ? -7.841  -19.261 -0.037  1.00 0.00 ? 93  SER A HA   2  
ATOM 3253  H HB2  . SER A 1 93  ? -7.628  -17.795 2.562   1.00 0.00 ? 93  SER A HB2  2  
ATOM 3254  H HB3  . SER A 1 93  ? -9.224  -18.024 1.847   1.00 0.00 ? 93  SER A HB3  2  
ATOM 3255  H HG   . SER A 1 93  ? -7.354  -20.093 2.386   1.00 0.00 ? 93  SER A HG   2  
ATOM 3256  N N    . PRO A 1 94  ? -9.385  -17.331 -0.807  1.00 0.00 ? 94  PRO A N    2  
ATOM 3257  C CA   . PRO A 1 94  ? -10.065 -16.285 -1.577  1.00 0.00 ? 94  PRO A CA   2  
ATOM 3258  C C    . PRO A 1 94  ? -10.490 -15.108 -0.706  1.00 0.00 ? 94  PRO A C    2  
ATOM 3259  O O    . PRO A 1 94  ? -10.412 -13.954 -1.126  1.00 0.00 ? 94  PRO A O    2  
ATOM 3260  C CB   . PRO A 1 94  ? -11.293 -17.003 -2.143  1.00 0.00 ? 94  PRO A CB   2  
ATOM 3261  C CG   . PRO A 1 94  ? -11.548 -18.122 -1.193  1.00 0.00 ? 94  PRO A CG   2  
ATOM 3262  C CD   . PRO A 1 94  ? -10.199 -18.552 -0.688  1.00 0.00 ? 94  PRO A CD   2  
ATOM 3263  H HA   . PRO A 1 94  ? -9.450  -15.926 -2.389  1.00 0.00 ? 94  PRO A HA   2  
ATOM 3264  H HB2  . PRO A 1 94  ? -12.128 -16.317 -2.181  1.00 0.00 ? 94  PRO A HB2  2  
ATOM 3265  H HB3  . PRO A 1 94  ? -11.075 -17.369 -3.135  1.00 0.00 ? 94  PRO A HB3  2  
ATOM 3266  H HG2  . PRO A 1 94  ? -12.163 -17.777 -0.376  1.00 0.00 ? 94  PRO A HG2  2  
ATOM 3267  H HG3  . PRO A 1 94  ? -12.032 -18.938 -1.710  1.00 0.00 ? 94  PRO A HG3  2  
ATOM 3268  H HD2  . PRO A 1 94  ? -10.266 -18.871 0.342   1.00 0.00 ? 94  PRO A HD2  2  
ATOM 3269  H HD3  . PRO A 1 94  ? -9.799  -19.343 -1.305  1.00 0.00 ? 94  PRO A HD3  2  
ATOM 3270  N N    . GLU A 1 95  ? -10.940 -15.408 0.508   1.00 0.00 ? 95  GLU A N    2  
ATOM 3271  C CA   . GLU A 1 95  ? -11.378 -14.373 1.437   1.00 0.00 ? 95  GLU A CA   2  
ATOM 3272  C C    . GLU A 1 95  ? -10.247 -13.393 1.732   1.00 0.00 ? 95  GLU A C    2  
ATOM 3273  O O    . GLU A 1 95  ? -10.488 -12.237 2.078   1.00 0.00 ? 95  GLU A O    2  
ATOM 3274  C CB   . GLU A 1 95  ? -11.875 -15.003 2.740   1.00 0.00 ? 95  GLU A CB   2  
ATOM 3275  C CG   . GLU A 1 95  ? -10.758 -15.532 3.624   1.00 0.00 ? 95  GLU A CG   2  
ATOM 3276  C CD   . GLU A 1 95  ? -11.277 -16.216 4.875   1.00 0.00 ? 95  GLU A CD   2  
ATOM 3277  O OE1  . GLU A 1 95  ? -12.306 -16.919 4.782   1.00 0.00 ? 95  GLU A OE1  2  
ATOM 3278  O OE2  . GLU A 1 95  ? -10.657 -16.047 5.945   1.00 0.00 ? 95  GLU A OE2  2  
ATOM 3279  H H    . GLU A 1 95  ? -10.979 -16.347 0.785   1.00 0.00 ? 95  GLU A H    2  
ATOM 3280  H HA   . GLU A 1 95  ? -12.193 -13.836 0.976   1.00 0.00 ? 95  GLU A HA   2  
ATOM 3281  H HB2  . GLU A 1 95  ? -12.426 -14.261 3.298   1.00 0.00 ? 95  GLU A HB2  2  
ATOM 3282  H HB3  . GLU A 1 95  ? -12.534 -15.824 2.500   1.00 0.00 ? 95  GLU A HB3  2  
ATOM 3283  H HG2  . GLU A 1 95  ? -10.176 -16.245 3.059   1.00 0.00 ? 95  GLU A HG2  2  
ATOM 3284  H HG3  . GLU A 1 95  ? -10.127 -14.707 3.919   1.00 0.00 ? 95  GLU A HG3  2  
ATOM 3285  N N    . GLU A 1 96  ? -9.012  -13.864 1.594   1.00 0.00 ? 96  GLU A N    2  
ATOM 3286  C CA   . GLU A 1 96  ? -7.843  -13.030 1.847   1.00 0.00 ? 96  GLU A CA   2  
ATOM 3287  C C    . GLU A 1 96  ? -7.558  -12.117 0.657   1.00 0.00 ? 96  GLU A C    2  
ATOM 3288  O O    . GLU A 1 96  ? -7.481  -10.898 0.803   1.00 0.00 ? 96  GLU A O    2  
ATOM 3289  C CB   . GLU A 1 96  ? -6.620  -13.901 2.139   1.00 0.00 ? 96  GLU A CB   2  
ATOM 3290  C CG   . GLU A 1 96  ? -6.445  -14.229 3.612   1.00 0.00 ? 96  GLU A CG   2  
ATOM 3291  C CD   . GLU A 1 96  ? -5.692  -15.527 3.836   1.00 0.00 ? 96  GLU A CD   2  
ATOM 3292  O OE1  . GLU A 1 96  ? -4.549  -15.641 3.346   1.00 0.00 ? 96  GLU A OE1  2  
ATOM 3293  O OE2  . GLU A 1 96  ? -6.246  -16.428 4.499   1.00 0.00 ? 96  GLU A OE2  2  
ATOM 3294  H H    . GLU A 1 96  ? -8.883  -14.795 1.315   1.00 0.00 ? 96  GLU A H    2  
ATOM 3295  H HA   . GLU A 1 96  ? -8.053  -12.419 2.712   1.00 0.00 ? 96  GLU A HA   2  
ATOM 3296  H HB2  . GLU A 1 96  ? -6.715  -14.828 1.593   1.00 0.00 ? 96  GLU A HB2  2  
ATOM 3297  H HB3  . GLU A 1 96  ? -5.735  -13.383 1.800   1.00 0.00 ? 96  GLU A HB3  2  
ATOM 3298  H HG2  . GLU A 1 96  ? -5.896  -13.428 4.084   1.00 0.00 ? 96  GLU A HG2  2  
ATOM 3299  H HG3  . GLU A 1 96  ? -7.420  -14.313 4.068   1.00 0.00 ? 96  GLU A HG3  2  
ATOM 3300  N N    . GLN A 1 97  ? -7.402  -12.718 -0.518  1.00 0.00 ? 97  GLN A N    2  
ATOM 3301  C CA   . GLN A 1 97  ? -7.125  -11.960 -1.732  1.00 0.00 ? 97  GLN A CA   2  
ATOM 3302  C C    . GLN A 1 97  ? -7.958  -10.684 -1.780  1.00 0.00 ? 97  GLN A C    2  
ATOM 3303  O O    . GLN A 1 97  ? -7.418  -9.578  -1.779  1.00 0.00 ? 97  GLN A O    2  
ATOM 3304  C CB   . GLN A 1 97  ? -7.408  -12.815 -2.968  1.00 0.00 ? 97  GLN A CB   2  
ATOM 3305  C CG   . GLN A 1 97  ? -7.197  -12.077 -4.280  1.00 0.00 ? 97  GLN A CG   2  
ATOM 3306  C CD   . GLN A 1 97  ? -8.059  -12.621 -5.402  1.00 0.00 ? 97  GLN A CD   2  
ATOM 3307  O OE1  . GLN A 1 97  ? -9.024  -13.348 -5.162  1.00 0.00 ? 97  GLN A OE1  2  
ATOM 3308  N NE2  . GLN A 1 97  ? -7.716  -12.271 -6.636  1.00 0.00 ? 97  GLN A NE2  2  
ATOM 3309  H H    . GLN A 1 97  ? -7.475  -13.693 -0.569  1.00 0.00 ? 97  GLN A H    2  
ATOM 3310  H HA   . GLN A 1 97  ? -6.079  -11.692 -1.724  1.00 0.00 ? 97  GLN A HA   2  
ATOM 3311  H HB2  . GLN A 1 97  ? -6.755  -13.675 -2.955  1.00 0.00 ? 97  GLN A HB2  2  
ATOM 3312  H HB3  . GLN A 1 97  ? -8.434  -13.151 -2.931  1.00 0.00 ? 97  GLN A HB3  2  
ATOM 3313  H HG2  . GLN A 1 97  ? -7.439  -11.034 -4.135  1.00 0.00 ? 97  GLN A HG2  2  
ATOM 3314  H HG3  . GLN A 1 97  ? -6.160  -12.168 -4.566  1.00 0.00 ? 97  GLN A HG3  2  
ATOM 3315  H HE21 . GLN A 1 97  ? -6.934  -11.691 -6.752  1.00 0.00 ? 97  GLN A HE21 2  
ATOM 3316  H HE22 . GLN A 1 97  ? -8.255  -12.610 -7.380  1.00 0.00 ? 97  GLN A HE22 2  
ATOM 3317  N N    . GLU A 1 98  ? -9.277  -10.845 -1.821  1.00 0.00 ? 98  GLU A N    2  
ATOM 3318  C CA   . GLU A 1 98  ? -10.185 -9.705  -1.870  1.00 0.00 ? 98  GLU A CA   2  
ATOM 3319  C C    . GLU A 1 98  ? -9.855  -8.700  -0.770  1.00 0.00 ? 98  GLU A C    2  
ATOM 3320  O O    . GLU A 1 98  ? -9.612  -7.525  -1.041  1.00 0.00 ? 98  GLU A O    2  
ATOM 3321  C CB   . GLU A 1 98  ? -11.635 -10.173 -1.731  1.00 0.00 ? 98  GLU A CB   2  
ATOM 3322  C CG   . GLU A 1 98  ? -12.052 -11.185 -2.784  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3323  C CD   . GLU A 1 98  ? -13.348 -11.890 -2.436  1.00 0.00 ? 98  GLU A CD   2  
ATOM 3324  O OE1  . GLU A 1 98  ? -13.474 -12.365 -1.287  1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3325  O OE2  . GLU A 1 98  ? -14.236 -11.968 -3.310  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3326  H H    . GLU A 1 98  ? -9.648  -11.752 -1.819  1.00 0.00 ? 98  GLU A H    2  
ATOM 3327  H HA   . GLU A 1 98  ? -10.062 -9.225  -2.828  1.00 0.00 ? 98  GLU A HA   2  
ATOM 3328  H HB2  . GLU A 1 98  ? -11.764 -10.623 -0.757  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3329  H HB3  . GLU A 1 98  ? -12.286 -9.315  -1.809  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3330  H HG2  . GLU A 1 98  ? -12.181 -10.673 -3.726  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3331  H HG3  . GLU A 1 98  ? -11.272 -11.925 -2.883  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3332  N N    . ALA A 1 99  ? -9.851  -9.172  0.473   1.00 0.00 ? 99  ALA A N    2  
ATOM 3333  C CA   . ALA A 1 99  ? -9.550  -8.316  1.613   1.00 0.00 ? 99  ALA A CA   2  
ATOM 3334  C C    . ALA A 1 99  ? -8.328  -7.446  1.340   1.00 0.00 ? 99  ALA A C    2  
ATOM 3335  O O    . ALA A 1 99  ? -8.355  -6.235  1.560   1.00 0.00 ? 99  ALA A O    2  
ATOM 3336  C CB   . ALA A 1 99  ? -9.333  -9.157  2.862   1.00 0.00 ? 99  ALA A CB   2  
ATOM 3337  H H    . ALA A 1 99  ? -10.053 -10.118 0.625   1.00 0.00 ? 99  ALA A H    2  
ATOM 3338  H HA   . ALA A 1 99  ? -10.404 -7.676  1.785   1.00 0.00 ? 99  ALA A HA   2  
ATOM 3339  H HB1  . ALA A 1 99  ? -9.002  -8.522  3.670   1.00 0.00 ? 99  ALA A HB1  2  
ATOM 3340  H HB2  . ALA A 1 99  ? -10.260 -9.638  3.138   1.00 0.00 ? 99  ALA A HB2  2  
ATOM 3341  H HB3  . ALA A 1 99  ? -8.583  -9.908  2.664   1.00 0.00 ? 99  ALA A HB3  2  
ATOM 3342  N N    . TRP A 1 100 ? -7.258  -8.071  0.862   1.00 0.00 ? 100 TRP A N    2  
ATOM 3343  C CA   . TRP A 1 100 ? -6.025  -7.353  0.560   1.00 0.00 ? 100 TRP A CA   2  
ATOM 3344  C C    . TRP A 1 100 ? -6.256  -6.308  -0.527  1.00 0.00 ? 100 TRP A C    2  
ATOM 3345  O O    . TRP A 1 100 ? -6.004  -5.120  -0.322  1.00 0.00 ? 100 TRP A O    2  
ATOM 3346  C CB   . TRP A 1 100 ? -4.936  -8.332  0.120   1.00 0.00 ? 100 TRP A CB   2  
ATOM 3347  C CG   . TRP A 1 100 ? -4.168  -8.920  1.265   1.00 0.00 ? 100 TRP A CG   2  
ATOM 3348  C CD1  . TRP A 1 100 ? -4.359  -10.146 1.836   1.00 0.00 ? 100 TRP A CD1  2  
ATOM 3349  C CD2  . TRP A 1 100 ? -3.090  -8.306  1.979   1.00 0.00 ? 100 TRP A CD2  2  
ATOM 3350  N NE1  . TRP A 1 100 ? -3.464  -10.331 2.862   1.00 0.00 ? 100 TRP A NE1  2  
ATOM 3351  C CE2  . TRP A 1 100 ? -2.674  -9.218  2.969   1.00 0.00 ? 100 TRP A CE2  2  
ATOM 3352  C CE3  . TRP A 1 100 ? -2.433  -7.077  1.877   1.00 0.00 ? 100 TRP A CE3  2  
ATOM 3353  C CZ2  . TRP A 1 100 ? -1.634  -8.936  3.851   1.00 0.00 ? 100 TRP A CZ2  2  
ATOM 3354  C CZ3  . TRP A 1 100 ? -1.401  -6.798  2.753   1.00 0.00 ? 100 TRP A CZ3  2  
ATOM 3355  C CH2  . TRP A 1 100 ? -1.009  -7.725  3.728   1.00 0.00 ? 100 TRP A CH2  2  
ATOM 3356  H H    . TRP A 1 100 ? -7.298  -9.038  0.708   1.00 0.00 ? 100 TRP A H    2  
ATOM 3357  H HA   . TRP A 1 100 ? -5.705  -6.853  1.461   1.00 0.00 ? 100 TRP A HA   2  
ATOM 3358  H HB2  . TRP A 1 100 ? -5.389  -9.143  -0.429  1.00 0.00 ? 100 TRP A HB2  2  
ATOM 3359  H HB3  . TRP A 1 100 ? -4.236  -7.815  -0.521  1.00 0.00 ? 100 TRP A HB3  2  
ATOM 3360  H HD1  . TRP A 1 100 ? -5.109  -10.854 1.518   1.00 0.00 ? 100 TRP A HD1  2  
ATOM 3361  H HE1  . TRP A 1 100 ? -3.402  -11.132 3.424   1.00 0.00 ? 100 TRP A HE1  2  
ATOM 3362  H HE3  . TRP A 1 100 ? -2.721  -6.350  1.132   1.00 0.00 ? 100 TRP A HE3  2  
ATOM 3363  H HZ2  . TRP A 1 100 ? -1.319  -9.639  4.608   1.00 0.00 ? 100 TRP A HZ2  2  
ATOM 3364  H HZ3  . TRP A 1 100 ? -0.882  -5.853  2.689   1.00 0.00 ? 100 TRP A HZ3  2  
ATOM 3365  H HH2  . TRP A 1 100 ? -0.198  -7.465  4.391   1.00 0.00 ? 100 TRP A HH2  2  
ATOM 3366  N N    . ILE A 1 101 ? -6.736  -6.757  -1.681  1.00 0.00 ? 101 ILE A N    2  
ATOM 3367  C CA   . ILE A 1 101 ? -7.002  -5.860  -2.799  1.00 0.00 ? 101 ILE A CA   2  
ATOM 3368  C C    . ILE A 1 101 ? -7.611  -4.547  -2.317  1.00 0.00 ? 101 ILE A C    2  
ATOM 3369  O O    . ILE A 1 101 ? -7.309  -3.480  -2.850  1.00 0.00 ? 101 ILE A O    2  
ATOM 3370  C CB   . ILE A 1 101 ? -7.950  -6.506  -3.827  1.00 0.00 ? 101 ILE A CB   2  
ATOM 3371  C CG1  . ILE A 1 101 ? -7.244  -7.652  -4.554  1.00 0.00 ? 101 ILE A CG1  2  
ATOM 3372  C CG2  . ILE A 1 101 ? -8.442  -5.464  -4.820  1.00 0.00 ? 101 ILE A CG2  2  
ATOM 3373  C CD1  . ILE A 1 101 ? -8.170  -8.483  -5.414  1.00 0.00 ? 101 ILE A CD1  2  
ATOM 3374  H H    . ILE A 1 101 ? -6.917  -7.715  -1.784  1.00 0.00 ? 101 ILE A H    2  
ATOM 3375  H HA   . ILE A 1 101 ? -6.061  -5.650  -3.288  1.00 0.00 ? 101 ILE A HA   2  
ATOM 3376  H HB   . ILE A 1 101 ? -8.805  -6.897  -3.298  1.00 0.00 ? 101 ILE A HB   2  
ATOM 3377  H HG12 . ILE A 1 101 ? -6.475  -7.246  -5.192  1.00 0.00 ? 101 ILE A HG12 2  
ATOM 3378  H HG13 . ILE A 1 101 ? -6.791  -8.307  -3.824  1.00 0.00 ? 101 ILE A HG13 2  
ATOM 3379  H HG21 . ILE A 1 101 ? -7.690  -4.698  -4.941  1.00 0.00 ? 101 ILE A HG21 2  
ATOM 3380  H HG22 . ILE A 1 101 ? -8.630  -5.937  -5.773  1.00 0.00 ? 101 ILE A HG22 2  
ATOM 3381  H HG23 . ILE A 1 101 ? -9.354  -5.018  -4.453  1.00 0.00 ? 101 ILE A HG23 2  
ATOM 3382  H HD11 . ILE A 1 101 ? -8.491  -7.900  -6.265  1.00 0.00 ? 101 ILE A HD11 2  
ATOM 3383  H HD12 . ILE A 1 101 ? -7.650  -9.364  -5.757  1.00 0.00 ? 101 ILE A HD12 2  
ATOM 3384  H HD13 . ILE A 1 101 ? -9.033  -8.777  -4.834  1.00 0.00 ? 101 ILE A HD13 2  
ATOM 3385  N N    . GLN A 1 102 ? -8.467  -4.635  -1.304  1.00 0.00 ? 102 GLN A N    2  
ATOM 3386  C CA   . GLN A 1 102 ? -9.117  -3.454  -0.750  1.00 0.00 ? 102 GLN A CA   2  
ATOM 3387  C C    . GLN A 1 102 ? -8.212  -2.759  0.262   1.00 0.00 ? 102 GLN A C    2  
ATOM 3388  O O    . GLN A 1 102 ? -7.836  -1.601  0.080   1.00 0.00 ? 102 GLN A O    2  
ATOM 3389  C CB   . GLN A 1 102 ? -10.442 -3.838  -0.088  1.00 0.00 ? 102 GLN A CB   2  
ATOM 3390  C CG   . GLN A 1 102 ? -11.499 -4.313  -1.072  1.00 0.00 ? 102 GLN A CG   2  
ATOM 3391  C CD   . GLN A 1 102 ? -12.353 -3.178  -1.603  1.00 0.00 ? 102 GLN A CD   2  
ATOM 3392  O OE1  . GLN A 1 102 ? -11.898 -2.039  -1.706  1.00 0.00 ? 102 GLN A OE1  2  
ATOM 3393  N NE2  . GLN A 1 102 ? -13.599 -3.485  -1.945  1.00 0.00 ? 102 GLN A NE2  2  
ATOM 3394  H H    . GLN A 1 102 ? -8.667  -5.514  -0.922  1.00 0.00 ? 102 GLN A H    2  
ATOM 3395  H HA   . GLN A 1 102 ? -9.317  -2.773  -1.563  1.00 0.00 ? 102 GLN A HA   2  
ATOM 3396  H HB2  . GLN A 1 102 ? -10.259 -4.631  0.622   1.00 0.00 ? 102 GLN A HB2  2  
ATOM 3397  H HB3  . GLN A 1 102 ? -10.831 -2.978  0.438   1.00 0.00 ? 102 GLN A HB3  2  
ATOM 3398  H HG2  . GLN A 1 102 ? -11.007 -4.793  -1.905  1.00 0.00 ? 102 GLN A HG2  2  
ATOM 3399  H HG3  . GLN A 1 102 ? -12.141 -5.025  -0.575  1.00 0.00 ? 102 GLN A HG3  2  
ATOM 3400  H HE21 . GLN A 1 102 ? -13.893 -4.414  -1.835  1.00 0.00 ? 102 GLN A HE21 2  
ATOM 3401  H HE22 . GLN A 1 102 ? -14.173 -2.771  -2.290  1.00 0.00 ? 102 GLN A HE22 2  
ATOM 3402  N N    . ALA A 1 103 ? -7.867  -3.473  1.328   1.00 0.00 ? 103 ALA A N    2  
ATOM 3403  C CA   . ALA A 1 103 ? -7.005  -2.925  2.368   1.00 0.00 ? 103 ALA A CA   2  
ATOM 3404  C C    . ALA A 1 103 ? -5.846  -2.139  1.763   1.00 0.00 ? 103 ALA A C    2  
ATOM 3405  O O    . ALA A 1 103 ? -5.728  -0.932  1.969   1.00 0.00 ? 103 ALA A O    2  
ATOM 3406  C CB   . ALA A 1 103 ? -6.479  -4.040  3.260   1.00 0.00 ? 103 ALA A CB   2  
ATOM 3407  H H    . ALA A 1 103 ? -8.199  -4.390  1.416   1.00 0.00 ? 103 ALA A H    2  
ATOM 3408  H HA   . ALA A 1 103 ? -7.599  -2.259  2.977   1.00 0.00 ? 103 ALA A HA   2  
ATOM 3409  H HB1  . ALA A 1 103 ? -6.545  -3.734  4.294   1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3410  H HB2  . ALA A 1 103 ? -7.072  -4.930  3.109   1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3411  H HB3  . ALA A 1 103 ? -5.449  -4.246  3.010   1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3412  N N    . MET A 1 104 ? -4.993  -2.832  1.016   1.00 0.00 ? 104 MET A N    2  
ATOM 3413  C CA   . MET A 1 104 ? -3.844  -2.198  0.380   1.00 0.00 ? 104 MET A CA   2  
ATOM 3414  C C    . MET A 1 104 ? -4.281  -1.347  -0.808  1.00 0.00 ? 104 MET A C    2  
ATOM 3415  O O    . MET A 1 104 ? -3.545  -0.471  -1.260  1.00 0.00 ? 104 MET A O    2  
ATOM 3416  C CB   . MET A 1 104 ? -2.838  -3.256  -0.077  1.00 0.00 ? 104 MET A CB   2  
ATOM 3417  C CG   . MET A 1 104 ? -3.304  -4.055  -1.284  1.00 0.00 ? 104 MET A CG   2  
ATOM 3418  S SD   . MET A 1 104 ? -1.933  -4.679  -2.275  1.00 0.00 ? 104 MET A SD   2  
ATOM 3419  C CE   . MET A 1 104 ? -0.819  -5.246  -0.992  1.00 0.00 ? 104 MET A CE   2  
ATOM 3420  H H    . MET A 1 104 ? -5.140  -3.793  0.888   1.00 0.00 ? 104 MET A H    2  
ATOM 3421  H HA   . MET A 1 104 ? -3.372  -1.559  1.112   1.00 0.00 ? 104 MET A HA   2  
ATOM 3422  H HB2  . MET A 1 104 ? -1.910  -2.767  -0.333  1.00 0.00 ? 104 MET A HB2  2  
ATOM 3423  H HB3  . MET A 1 104 ? -2.662  -3.944  0.736   1.00 0.00 ? 104 MET A HB3  2  
ATOM 3424  H HG2  . MET A 1 104 ? -3.890  -4.894  -0.939  1.00 0.00 ? 104 MET A HG2  2  
ATOM 3425  H HG3  . MET A 1 104 ? -3.919  -3.420  -1.903  1.00 0.00 ? 104 MET A HG3  2  
ATOM 3426  H HE1  . MET A 1 104 ? -1.353  -5.316  -0.056  1.00 0.00 ? 104 MET A HE1  2  
ATOM 3427  H HE2  . MET A 1 104 ? -0.429  -6.218  -1.258  1.00 0.00 ? 104 MET A HE2  2  
ATOM 3428  H HE3  . MET A 1 104 ? -0.002  -4.546  -0.889  1.00 0.00 ? 104 MET A HE3  2  
ATOM 3429  N N    . GLY A 1 105 ? -5.483  -1.612  -1.310  1.00 0.00 ? 105 GLY A N    2  
ATOM 3430  C CA   . GLY A 1 105 ? -5.996  -0.862  -2.442  1.00 0.00 ? 105 GLY A CA   2  
ATOM 3431  C C    . GLY A 1 105 ? -6.261  0.591   -2.102  1.00 0.00 ? 105 GLY A C    2  
ATOM 3432  O O    . GLY A 1 105 ? -5.791  1.492   -2.797  1.00 0.00 ? 105 GLY A O    2  
ATOM 3433  H H    . GLY A 1 105 ? -6.026  -2.322  -0.908  1.00 0.00 ? 105 GLY A H    2  
ATOM 3434  H HA2  . GLY A 1 105 ? -5.277  -0.908  -3.246  1.00 0.00 ? 105 GLY A HA2  2  
ATOM 3435  H HA3  . GLY A 1 105 ? -6.919  -1.316  -2.771  1.00 0.00 ? 105 GLY A HA3  2  
ATOM 3436  N N    . GLU A 1 106 ? -7.016  0.820   -1.032  1.00 0.00 ? 106 GLU A N    2  
ATOM 3437  C CA   . GLU A 1 106 ? -7.344  2.175   -0.605  1.00 0.00 ? 106 GLU A CA   2  
ATOM 3438  C C    . GLU A 1 106 ? -6.078  3.001   -0.397  1.00 0.00 ? 106 GLU A C    2  
ATOM 3439  O O    . GLU A 1 106 ? -5.965  4.119   -0.898  1.00 0.00 ? 106 GLU A O    2  
ATOM 3440  C CB   . GLU A 1 106 ? -8.162  2.141   0.688   1.00 0.00 ? 106 GLU A CB   2  
ATOM 3441  C CG   . GLU A 1 106 ? -7.315  1.990   1.940   1.00 0.00 ? 106 GLU A CG   2  
ATOM 3442  C CD   . GLU A 1 106 ? -8.150  1.916   3.204   1.00 0.00 ? 106 GLU A CD   2  
ATOM 3443  O OE1  . GLU A 1 106 ? -8.871  0.912   3.381   1.00 0.00 ? 106 GLU A OE1  2  
ATOM 3444  O OE2  . GLU A 1 106 ? -8.081  2.862   4.016   1.00 0.00 ? 106 GLU A OE2  2  
ATOM 3445  H H    . GLU A 1 106 ? -7.361  0.060   -0.519  1.00 0.00 ? 106 GLU A H    2  
ATOM 3446  H HA   . GLU A 1 106 ? -7.935  2.634   -1.382  1.00 0.00 ? 106 GLU A HA   2  
ATOM 3447  H HB2  . GLU A 1 106 ? -8.725  3.060   0.767   1.00 0.00 ? 106 GLU A HB2  2  
ATOM 3448  H HB3  . GLU A 1 106 ? -8.850  1.311   0.642   1.00 0.00 ? 106 GLU A HB3  2  
ATOM 3449  H HG2  . GLU A 1 106 ? -6.732  1.085   1.859   1.00 0.00 ? 106 GLU A HG2  2  
ATOM 3450  H HG3  . GLU A 1 106 ? -6.650  2.839   2.015   1.00 0.00 ? 106 GLU A HG3  2  
ATOM 3451  N N    . ALA A 1 107 ? -5.128  2.442   0.345   1.00 0.00 ? 107 ALA A N    2  
ATOM 3452  C CA   . ALA A 1 107 ? -3.870  3.125   0.618   1.00 0.00 ? 107 ALA A CA   2  
ATOM 3453  C C    . ALA A 1 107 ? -3.286  3.730   -0.654  1.00 0.00 ? 107 ALA A C    2  
ATOM 3454  O O    . ALA A 1 107 ? -2.630  4.770   -0.614  1.00 0.00 ? 107 ALA A O    2  
ATOM 3455  C CB   . ALA A 1 107 ? -2.875  2.165   1.253   1.00 0.00 ? 107 ALA A CB   2  
ATOM 3456  H H    . ALA A 1 107 ? -5.277  1.548   0.717   1.00 0.00 ? 107 ALA A H    2  
ATOM 3457  H HA   . ALA A 1 107 ? -4.067  3.919   1.324   1.00 0.00 ? 107 ALA A HA   2  
ATOM 3458  H HB1  . ALA A 1 107 ? -1.872  2.539   1.107   1.00 0.00 ? 107 ALA A HB1  2  
ATOM 3459  H HB2  . ALA A 1 107 ? -3.079  2.083   2.310   1.00 0.00 ? 107 ALA A HB2  2  
ATOM 3460  H HB3  . ALA A 1 107 ? -2.967  1.194   0.791   1.00 0.00 ? 107 ALA A HB3  2  
ATOM 3461  N N    . ALA A 1 108 ? -3.530  3.071   -1.783  1.00 0.00 ? 108 ALA A N    2  
ATOM 3462  C CA   . ALA A 1 108 ? -3.029  3.545   -3.067  1.00 0.00 ? 108 ALA A CA   2  
ATOM 3463  C C    . ALA A 1 108 ? -3.913  4.655   -3.625  1.00 0.00 ? 108 ALA A C    2  
ATOM 3464  O O    . ALA A 1 108 ? -3.425  5.589   -4.261  1.00 0.00 ? 108 ALA A O    2  
ATOM 3465  C CB   . ALA A 1 108 ? -2.938  2.392   -4.056  1.00 0.00 ? 108 ALA A CB   2  
ATOM 3466  H H    . ALA A 1 108 ? -4.059  2.247   -1.750  1.00 0.00 ? 108 ALA A H    2  
ATOM 3467  H HA   . ALA A 1 108 ? -2.033  3.934   -2.914  1.00 0.00 ? 108 ALA A HA   2  
ATOM 3468  H HB1  . ALA A 1 108 ? -3.752  1.703   -3.879  1.00 0.00 ? 108 ALA A HB1  2  
ATOM 3469  H HB2  . ALA A 1 108 ? -3.004  2.776   -5.063  1.00 0.00 ? 108 ALA A HB2  2  
ATOM 3470  H HB3  . ALA A 1 108 ? -1.997  1.879   -3.926  1.00 0.00 ? 108 ALA A HB3  2  
ATOM 3471  N N    . ARG A 1 109 ? -5.216  4.545   -3.384  1.00 0.00 ? 109 ARG A N    2  
ATOM 3472  C CA   . ARG A 1 109 ? -6.168  5.539   -3.865  1.00 0.00 ? 109 ARG A CA   2  
ATOM 3473  C C    . ARG A 1 109 ? -5.905  6.898   -3.223  1.00 0.00 ? 109 ARG A C    2  
ATOM 3474  O O    . ARG A 1 109 ? -5.407  6.981   -2.100  1.00 0.00 ? 109 ARG A O    2  
ATOM 3475  C CB   . ARG A 1 109 ? -7.600  5.090   -3.566  1.00 0.00 ? 109 ARG A CB   2  
ATOM 3476  C CG   . ARG A 1 109 ? -8.222  4.261   -4.678  1.00 0.00 ? 109 ARG A CG   2  
ATOM 3477  C CD   . ARG A 1 109 ? -9.457  3.517   -4.193  1.00 0.00 ? 109 ARG A CD   2  
ATOM 3478  N NE   . ARG A 1 109 ? -10.111 2.781   -5.272  1.00 0.00 ? 109 ARG A NE   2  
ATOM 3479  C CZ   . ARG A 1 109 ? -11.109 1.926   -5.078  1.00 0.00 ? 109 ARG A CZ   2  
ATOM 3480  N NH1  . ARG A 1 109 ? -11.565 1.701   -3.854  1.00 0.00 ? 109 ARG A NH1  2  
ATOM 3481  N NH2  . ARG A 1 109 ? -11.652 1.294   -6.111  1.00 0.00 ? 109 ARG A NH2  2  
ATOM 3482  H H    . ARG A 1 109 ? -5.544  3.777   -2.871  1.00 0.00 ? 109 ARG A H    2  
ATOM 3483  H HA   . ARG A 1 109 ? -6.043  5.628   -4.933  1.00 0.00 ? 109 ARG A HA   2  
ATOM 3484  H HB2  . ARG A 1 109 ? -7.599  4.498   -2.663  1.00 0.00 ? 109 ARG A HB2  2  
ATOM 3485  H HB3  . ARG A 1 109 ? -8.213  5.965   -3.412  1.00 0.00 ? 109 ARG A HB3  2  
ATOM 3486  H HG2  . ARG A 1 109 ? -8.506  4.917   -5.488  1.00 0.00 ? 109 ARG A HG2  2  
ATOM 3487  H HG3  . ARG A 1 109 ? -7.495  3.544   -5.030  1.00 0.00 ? 109 ARG A HG3  2  
ATOM 3488  H HD2  . ARG A 1 109 ? -9.162  2.821   -3.423  1.00 0.00 ? 109 ARG A HD2  2  
ATOM 3489  H HD3  . ARG A 1 109 ? -10.154 4.233   -3.784  1.00 0.00 ? 109 ARG A HD3  2  
ATOM 3490  H HE   . ARG A 1 109 ? -9.789  2.932   -6.185  1.00 0.00 ? 109 ARG A HE   2  
ATOM 3491  H HH11 . ARG A 1 109 ? -11.158 2.176   -3.075  1.00 0.00 ? 109 ARG A HH11 2  
ATOM 3492  H HH12 . ARG A 1 109 ? -12.318 1.057   -3.711  1.00 0.00 ? 109 ARG A HH12 2  
ATOM 3493  H HH21 . ARG A 1 109 ? -11.311 1.461   -7.035  1.00 0.00 ? 109 ARG A HH21 2  
ATOM 3494  H HH22 . ARG A 1 109 ? -12.403 0.651   -5.964  1.00 0.00 ? 109 ARG A HH22 2  
ATOM 3495  N N    . VAL A 1 110 ? -6.244  7.962   -3.944  1.00 0.00 ? 110 VAL A N    2  
ATOM 3496  C CA   . VAL A 1 110 ? -6.046  9.318   -3.446  1.00 0.00 ? 110 VAL A CA   2  
ATOM 3497  C C    . VAL A 1 110 ? -7.209  10.223  -3.835  1.00 0.00 ? 110 VAL A C    2  
ATOM 3498  O O    . VAL A 1 110 ? -7.475  10.433  -5.018  1.00 0.00 ? 110 VAL A O    2  
ATOM 3499  C CB   . VAL A 1 110 ? -4.735  9.927   -3.980  1.00 0.00 ? 110 VAL A CB   2  
ATOM 3500  C CG1  . VAL A 1 110 ? -4.620  11.387  -3.573  1.00 0.00 ? 110 VAL A CG1  2  
ATOM 3501  C CG2  . VAL A 1 110 ? -3.538  9.130   -3.486  1.00 0.00 ? 110 VAL A CG2  2  
ATOM 3502  H H    . VAL A 1 110 ? -6.637  7.833   -4.832  1.00 0.00 ? 110 VAL A H    2  
ATOM 3503  H HA   . VAL A 1 110 ? -5.983  9.272   -2.368  1.00 0.00 ? 110 VAL A HA   2  
ATOM 3504  H HB   . VAL A 1 110 ? -4.753  9.877   -5.059  1.00 0.00 ? 110 VAL A HB   2  
ATOM 3505  H HG11 . VAL A 1 110 ? -5.338  11.602  -2.795  1.00 0.00 ? 110 VAL A HG11 2  
ATOM 3506  H HG12 . VAL A 1 110 ? -3.622  11.581  -3.206  1.00 0.00 ? 110 VAL A HG12 2  
ATOM 3507  H HG13 . VAL A 1 110 ? -4.818  12.016  -4.428  1.00 0.00 ? 110 VAL A HG13 2  
ATOM 3508  H HG21 . VAL A 1 110 ? -3.627  8.105   -3.814  1.00 0.00 ? 110 VAL A HG21 2  
ATOM 3509  H HG22 . VAL A 1 110 ? -2.630  9.558   -3.886  1.00 0.00 ? 110 VAL A HG22 2  
ATOM 3510  H HG23 . VAL A 1 110 ? -3.505  9.161   -2.407  1.00 0.00 ? 110 VAL A HG23 2  
ATOM 3511  N N    . GLN A 1 111 ? -7.899  10.755  -2.832  1.00 0.00 ? 111 GLN A N    2  
ATOM 3512  C CA   . GLN A 1 111 ? -9.036  11.637  -3.070  1.00 0.00 ? 111 GLN A CA   2  
ATOM 3513  C C    . GLN A 1 111 ? -8.568  13.020  -3.511  1.00 0.00 ? 111 GLN A C    2  
ATOM 3514  O O    . GLN A 1 111 ? -7.469  13.454  -3.165  1.00 0.00 ? 111 GLN A O    2  
ATOM 3515  C CB   . GLN A 1 111 ? -9.891  11.754  -1.808  1.00 0.00 ? 111 GLN A CB   2  
ATOM 3516  C CG   . GLN A 1 111 ? -10.753 10.530  -1.542  1.00 0.00 ? 111 GLN A CG   2  
ATOM 3517  C CD   . GLN A 1 111 ? -9.939  9.326   -1.110  1.00 0.00 ? 111 GLN A CD   2  
ATOM 3518  O OE1  . GLN A 1 111 ? -8.912  9.462   -0.445  1.00 0.00 ? 111 GLN A OE1  2  
ATOM 3519  N NE2  . GLN A 1 111 ? -10.395 8.137   -1.487  1.00 0.00 ? 111 GLN A NE2  2  
ATOM 3520  H H    . GLN A 1 111 ? -7.639  10.549  -1.910  1.00 0.00 ? 111 GLN A H    2  
ATOM 3521  H HA   . GLN A 1 111 ? -9.631  11.204  -3.859  1.00 0.00 ? 111 GLN A HA   2  
ATOM 3522  H HB2  . GLN A 1 111 ? -9.241  11.901  -0.958  1.00 0.00 ? 111 GLN A HB2  2  
ATOM 3523  H HB3  . GLN A 1 111 ? -10.542 12.610  -1.906  1.00 0.00 ? 111 GLN A HB3  2  
ATOM 3524  H HG2  . GLN A 1 111 ? -11.460 10.766  -0.760  1.00 0.00 ? 111 GLN A HG2  2  
ATOM 3525  H HG3  . GLN A 1 111 ? -11.288 10.280  -2.446  1.00 0.00 ? 111 GLN A HG3  2  
ATOM 3526  H HE21 . GLN A 1 111 ? -11.220 8.105   -2.017  1.00 0.00 ? 111 GLN A HE21 2  
ATOM 3527  H HE22 . GLN A 1 111 ? -9.889  7.342   -1.223  1.00 0.00 ? 111 GLN A HE22 2  
ATOM 3528  N N    . SER A 1 112 ? -9.409  13.708  -4.277  1.00 0.00 ? 112 SER A N    2  
ATOM 3529  C CA   . SER A 1 112 ? -9.079  15.041  -4.768  1.00 0.00 ? 112 SER A CA   2  
ATOM 3530  C C    . SER A 1 112 ? -9.485  16.109  -3.757  1.00 0.00 ? 112 SER A C    2  
ATOM 3531  O O    . SER A 1 112 ? -10.462 15.949  -3.027  1.00 0.00 ? 112 SER A O    2  
ATOM 3532  C CB   . SER A 1 112 ? -9.774  15.299  -6.107  1.00 0.00 ? 112 SER A CB   2  
ATOM 3533  O OG   . SER A 1 112 ? -9.253  16.457  -6.736  1.00 0.00 ? 112 SER A OG   2  
ATOM 3534  H H    . SER A 1 112 ? -10.271 13.308  -4.518  1.00 0.00 ? 112 SER A H    2  
ATOM 3535  H HA   . SER A 1 112 ? -8.010  15.086  -4.913  1.00 0.00 ? 112 SER A HA   2  
ATOM 3536  H HB2  . SER A 1 112 ? -9.623  14.452  -6.758  1.00 0.00 ? 112 SER A HB2  2  
ATOM 3537  H HB3  . SER A 1 112 ? -10.832 15.441  -5.939  1.00 0.00 ? 112 SER A HB3  2  
ATOM 3538  H HG   . SER A 1 112 ? -8.326  16.318  -6.945  1.00 0.00 ? 112 SER A HG   2  
ATOM 3539  N N    . GLY A 1 113 ? -8.726  17.199  -3.721  1.00 0.00 ? 113 GLY A N    2  
ATOM 3540  C CA   . GLY A 1 113 ? -9.021  18.278  -2.796  1.00 0.00 ? 113 GLY A CA   2  
ATOM 3541  C C    . GLY A 1 113 ? -8.040  19.428  -2.914  1.00 0.00 ? 113 GLY A C    2  
ATOM 3542  O O    . GLY A 1 113 ? -8.409  20.556  -3.242  1.00 0.00 ? 113 GLY A O    2  
ATOM 3543  H H    . GLY A 1 113 ? -7.959  17.272  -4.327  1.00 0.00 ? 113 GLY A H    2  
ATOM 3544  H HA2  . GLY A 1 113 ? -10.016 18.646  -2.995  1.00 0.00 ? 113 GLY A HA2  2  
ATOM 3545  H HA3  . GLY A 1 113 ? -8.985  17.893  -1.788  1.00 0.00 ? 113 GLY A HA3  2  
ATOM 3546  N N    . PRO A 1 114 ? -6.757  19.147  -2.641  1.00 0.00 ? 114 PRO A N    2  
ATOM 3547  C CA   . PRO A 1 114 ? -5.694  20.154  -2.711  1.00 0.00 ? 114 PRO A CA   2  
ATOM 3548  C C    . PRO A 1 114 ? -5.397  20.585  -4.143  1.00 0.00 ? 114 PRO A C    2  
ATOM 3549  O O    . PRO A 1 114 ? -4.875  21.675  -4.378  1.00 0.00 ? 114 PRO A O    2  
ATOM 3550  C CB   . PRO A 1 114 ? -4.485  19.435  -2.107  1.00 0.00 ? 114 PRO A CB   2  
ATOM 3551  C CG   . PRO A 1 114 ? -4.753  17.987  -2.332  1.00 0.00 ? 114 PRO A CG   2  
ATOM 3552  C CD   . PRO A 1 114 ? -6.246  17.824  -2.244  1.00 0.00 ? 114 PRO A CD   2  
ATOM 3553  H HA   . PRO A 1 114 ? -5.932  21.024  -2.116  1.00 0.00 ? 114 PRO A HA   2  
ATOM 3554  H HB2  . PRO A 1 114 ? -3.584  19.754  -2.613  1.00 0.00 ? 114 PRO A HB2  2  
ATOM 3555  H HB3  . PRO A 1 114 ? -4.414  19.665  -1.055  1.00 0.00 ? 114 PRO A HB3  2  
ATOM 3556  H HG2  . PRO A 1 114 ? -4.401  17.696  -3.310  1.00 0.00 ? 114 PRO A HG2  2  
ATOM 3557  H HG3  . PRO A 1 114 ? -4.267  17.401  -1.566  1.00 0.00 ? 114 PRO A HG3  2  
ATOM 3558  H HD2  . PRO A 1 114 ? -6.582  17.059  -2.928  1.00 0.00 ? 114 PRO A HD2  2  
ATOM 3559  H HD3  . PRO A 1 114 ? -6.540  17.586  -1.233  1.00 0.00 ? 114 PRO A HD3  2  
ATOM 3560  N N    . SER A 1 115 ? -5.732  19.723  -5.098  1.00 0.00 ? 115 SER A N    2  
ATOM 3561  C CA   . SER A 1 115 ? -5.498  20.013  -6.507  1.00 0.00 ? 115 SER A CA   2  
ATOM 3562  C C    . SER A 1 115 ? -6.590  19.398  -7.377  1.00 0.00 ? 115 SER A C    2  
ATOM 3563  O O    . SER A 1 115 ? -7.323  18.512  -6.939  1.00 0.00 ? 115 SER A O    2  
ATOM 3564  C CB   . SER A 1 115 ? -4.128  19.485  -6.938  1.00 0.00 ? 115 SER A CB   2  
ATOM 3565  O OG   . SER A 1 115 ? -4.031  18.087  -6.726  1.00 0.00 ? 115 SER A OG   2  
ATOM 3566  H H    . SER A 1 115 ? -6.145  18.869  -4.847  1.00 0.00 ? 115 SER A H    2  
ATOM 3567  H HA   . SER A 1 115 ? -5.516  21.086  -6.632  1.00 0.00 ? 115 SER A HA   2  
ATOM 3568  H HB2  . SER A 1 115 ? -3.981  19.689  -7.987  1.00 0.00 ? 115 SER A HB2  2  
ATOM 3569  H HB3  . SER A 1 115 ? -3.358  19.979  -6.363  1.00 0.00 ? 115 SER A HB3  2  
ATOM 3570  H HG   . SER A 1 115 ? -4.800  17.652  -7.102  1.00 0.00 ? 115 SER A HG   2  
ATOM 3571  N N    . SER A 1 116 ? -6.691  19.875  -8.614  1.00 0.00 ? 116 SER A N    2  
ATOM 3572  C CA   . SER A 1 116 ? -7.695  19.375  -9.546  1.00 0.00 ? 116 SER A CA   2  
ATOM 3573  C C    . SER A 1 116 ? -9.100  19.559  -8.981  1.00 0.00 ? 116 SER A C    2  
ATOM 3574  O O    . SER A 1 116 ? -9.938  18.663  -9.067  1.00 0.00 ? 116 SER A O    2  
ATOM 3575  C CB   . SER A 1 116 ? -7.446  17.897  -9.853  1.00 0.00 ? 116 SER A CB   2  
ATOM 3576  O OG   . SER A 1 116 ? -6.180  17.708  -10.462 1.00 0.00 ? 116 SER A OG   2  
ATOM 3577  H H    . SER A 1 116 ? -6.077  20.581  -8.906  1.00 0.00 ? 116 SER A H    2  
ATOM 3578  H HA   . SER A 1 116 ? -7.610  19.943  -10.461 1.00 0.00 ? 116 SER A HA   2  
ATOM 3579  H HB2  . SER A 1 116 ? -7.478  17.331  -8.935  1.00 0.00 ? 116 SER A HB2  2  
ATOM 3580  H HB3  . SER A 1 116 ? -8.212  17.538  -10.524 1.00 0.00 ? 116 SER A HB3  2  
ATOM 3581  H HG   . SER A 1 116 ? -6.251  17.871  -11.405 1.00 0.00 ? 116 SER A HG   2  
ATOM 3582  N N    . GLY A 1 117 ? -9.350  20.730  -8.402  1.00 0.00 ? 117 GLY A N    2  
ATOM 3583  C CA   . GLY A 1 117 ? -10.653 21.012  -7.831  1.00 0.00 ? 117 GLY A CA   2  
ATOM 3584  C C    . GLY A 1 117 ? -11.494 21.908  -8.719  1.00 0.00 ? 117 GLY A C    2  
ATOM 3585  O O    . GLY A 1 117 ? -12.539 22.404  -8.300  1.00 0.00 ? 117 GLY A O    2  
ATOM 3586  H H    . GLY A 1 117 ? -8.642  21.408  -8.363  1.00 0.00 ? 117 GLY A H    2  
ATOM 3587  H HA2  . GLY A 1 117 ? -11.177 20.080  -7.678  1.00 0.00 ? 117 GLY A HA2  2  
ATOM 3588  H HA3  . GLY A 1 117 ? -10.518 21.498  -6.876  1.00 0.00 ? 117 GLY A HA3  2  
ATOM 3589  N N    . GLY A 1 1   ? 16.218  6.318   -0.334  1.00 0.00 ? 1   GLY A N    3  
ATOM 3590  C CA   . GLY A 1 1   ? 15.132  5.870   0.519   1.00 0.00 ? 1   GLY A CA   3  
ATOM 3591  C C    . GLY A 1 1   ? 15.529  5.815   1.981   1.00 0.00 ? 1   GLY A C    3  
ATOM 3592  O O    . GLY A 1 1   ? 16.560  5.240   2.330   1.00 0.00 ? 1   GLY A O    3  
ATOM 3593  H H1   . GLY A 1 1   ? 16.861  6.977   0.001   1.00 0.00 ? 1   GLY A H1   3  
ATOM 3594  H HA2  . GLY A 1 1   ? 14.299  6.547   0.408   1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3595  H HA3  . GLY A 1 1   ? 14.826  4.883   0.204   1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3596  N N    . SER A 1 2   ? 14.709  6.415   2.838   1.00 0.00 ? 2   SER A N    3  
ATOM 3597  C CA   . SER A 1 2   ? 14.983  6.437   4.270   1.00 0.00 ? 2   SER A CA   3  
ATOM 3598  C C    . SER A 1 2   ? 13.996  5.551   5.025   1.00 0.00 ? 2   SER A C    3  
ATOM 3599  O O    . SER A 1 2   ? 12.801  5.544   4.732   1.00 0.00 ? 2   SER A O    3  
ATOM 3600  C CB   . SER A 1 2   ? 14.911  7.869   4.803   1.00 0.00 ? 2   SER A CB   3  
ATOM 3601  O OG   . SER A 1 2   ? 16.107  8.577   4.527   1.00 0.00 ? 2   SER A OG   3  
ATOM 3602  H H    . SER A 1 2   ? 13.902  6.856   2.498   1.00 0.00 ? 2   SER A H    3  
ATOM 3603  H HA   . SER A 1 2   ? 15.981  6.055   4.423   1.00 0.00 ? 2   SER A HA   3  
ATOM 3604  H HB2  . SER A 1 2   ? 14.086  8.384   4.334   1.00 0.00 ? 2   SER A HB2  3  
ATOM 3605  H HB3  . SER A 1 2   ? 14.759  7.845   5.872   1.00 0.00 ? 2   SER A HB3  3  
ATOM 3606  H HG   . SER A 1 2   ? 15.913  9.514   4.446   1.00 0.00 ? 2   SER A HG   3  
ATOM 3607  N N    . SER A 1 3   ? 14.507  4.804   5.999   1.00 0.00 ? 3   SER A N    3  
ATOM 3608  C CA   . SER A 1 3   ? 13.673  3.911   6.794   1.00 0.00 ? 3   SER A CA   3  
ATOM 3609  C C    . SER A 1 3   ? 13.586  4.392   8.240   1.00 0.00 ? 3   SER A C    3  
ATOM 3610  O O    . SER A 1 3   ? 14.603  4.662   8.878   1.00 0.00 ? 3   SER A O    3  
ATOM 3611  C CB   . SER A 1 3   ? 14.229  2.486   6.752   1.00 0.00 ? 3   SER A CB   3  
ATOM 3612  O OG   . SER A 1 3   ? 15.372  2.360   7.581   1.00 0.00 ? 3   SER A OG   3  
ATOM 3613  H H    . SER A 1 3   ? 15.468  4.853   6.185   1.00 0.00 ? 3   SER A H    3  
ATOM 3614  H HA   . SER A 1 3   ? 12.682  3.914   6.366   1.00 0.00 ? 3   SER A HA   3  
ATOM 3615  H HB2  . SER A 1 3   ? 13.473  1.797   7.094   1.00 0.00 ? 3   SER A HB2  3  
ATOM 3616  H HB3  . SER A 1 3   ? 14.507  2.242   5.736   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3617  H HG   . SER A 1 3   ? 16.165  2.426   7.045   1.00 0.00 ? 3   SER A HG   3  
ATOM 3618  N N    . GLY A 1 4   ? 12.363  4.497   8.750   1.00 0.00 ? 4   GLY A N    3  
ATOM 3619  C CA   . GLY A 1 4   ? 12.164  4.945   10.116  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3620  C C    . GLY A 1 4   ? 11.085  6.004   10.227  1.00 0.00 ? 4   GLY A C    3  
ATOM 3621  O O    . GLY A 1 4   ? 11.372  7.200   10.178  1.00 0.00 ? 4   GLY A O    3  
ATOM 3622  H H    . GLY A 1 4   ? 11.589  4.267   8.194   1.00 0.00 ? 4   GLY A H    3  
ATOM 3623  H HA2  . GLY A 1 4   ? 11.887  4.098   10.725  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3624  H HA3  . GLY A 1 4   ? 13.093  5.354   10.486  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3625  N N    . SER A 1 5   ? 9.840   5.564   10.376  1.00 0.00 ? 5   SER A N    3  
ATOM 3626  C CA   . SER A 1 5   ? 8.713   6.483   10.490  1.00 0.00 ? 5   SER A CA   3  
ATOM 3627  C C    . SER A 1 5   ? 8.888   7.413   11.686  1.00 0.00 ? 5   SER A C    3  
ATOM 3628  O O    . SER A 1 5   ? 9.511   7.048   12.684  1.00 0.00 ? 5   SER A O    3  
ATOM 3629  C CB   . SER A 1 5   ? 7.404   5.703   10.623  1.00 0.00 ? 5   SER A CB   3  
ATOM 3630  O OG   . SER A 1 5   ? 6.308   6.577   10.829  1.00 0.00 ? 5   SER A OG   3  
ATOM 3631  H H    . SER A 1 5   ? 9.675   4.598   10.409  1.00 0.00 ? 5   SER A H    3  
ATOM 3632  H HA   . SER A 1 5   ? 8.678   7.077   9.589   1.00 0.00 ? 5   SER A HA   3  
ATOM 3633  H HB2  . SER A 1 5   ? 7.231   5.136   9.721   1.00 0.00 ? 5   SER A HB2  3  
ATOM 3634  H HB3  . SER A 1 5   ? 7.474   5.028   11.464  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3635  H HG   . SER A 1 5   ? 6.012   6.925   9.984   1.00 0.00 ? 5   SER A HG   3  
ATOM 3636  N N    . SER A 1 6   ? 8.335   8.616   11.578  1.00 0.00 ? 6   SER A N    3  
ATOM 3637  C CA   . SER A 1 6   ? 8.433   9.601   12.649  1.00 0.00 ? 6   SER A CA   3  
ATOM 3638  C C    . SER A 1 6   ? 7.289   9.437   13.645  1.00 0.00 ? 6   SER A C    3  
ATOM 3639  O O    . SER A 1 6   ? 7.496   9.475   14.857  1.00 0.00 ? 6   SER A O    3  
ATOM 3640  C CB   . SER A 1 6   ? 8.420   11.018  12.070  1.00 0.00 ? 6   SER A CB   3  
ATOM 3641  O OG   . SER A 1 6   ? 7.151   11.335  11.527  1.00 0.00 ? 6   SER A OG   3  
ATOM 3642  H H    . SER A 1 6   ? 7.852   8.848   10.757  1.00 0.00 ? 6   SER A H    3  
ATOM 3643  H HA   . SER A 1 6   ? 9.368   9.440   13.163  1.00 0.00 ? 6   SER A HA   3  
ATOM 3644  H HB2  . SER A 1 6   ? 8.651   11.725  12.852  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3645  H HB3  . SER A 1 6   ? 9.162   11.090  11.288  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3646  H HG   . SER A 1 6   ? 6.686   11.927  12.123  1.00 0.00 ? 6   SER A HG   3  
ATOM 3647  N N    . GLY A 1 7   ? 6.080   9.253   13.123  1.00 0.00 ? 7   GLY A N    3  
ATOM 3648  C CA   . GLY A 1 7   ? 4.920   9.085   13.979  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3649  C C    . GLY A 1 7   ? 4.437   7.649   14.026  1.00 0.00 ? 7   GLY A C    3  
ATOM 3650  O O    . GLY A 1 7   ? 3.730   7.195   13.127  1.00 0.00 ? 7   GLY A O    3  
ATOM 3651  H H    . GLY A 1 7   ? 5.975   9.231   12.148  1.00 0.00 ? 7   GLY A H    3  
ATOM 3652  H HA2  . GLY A 1 7   ? 5.176   9.401   14.979  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3653  H HA3  . GLY A 1 7   ? 4.120   9.709   13.608  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3654  N N    . ASN A 1 8   ? 4.820   6.931   15.077  1.00 0.00 ? 8   ASN A N    3  
ATOM 3655  C CA   . ASN A 1 8   ? 4.423   5.537   15.236  1.00 0.00 ? 8   ASN A CA   3  
ATOM 3656  C C    . ASN A 1 8   ? 3.003   5.314   14.724  1.00 0.00 ? 8   ASN A C    3  
ATOM 3657  O O    . ASN A 1 8   ? 2.033   5.741   15.349  1.00 0.00 ? 8   ASN A O    3  
ATOM 3658  C CB   . ASN A 1 8   ? 4.519   5.122   16.706  1.00 0.00 ? 8   ASN A CB   3  
ATOM 3659  C CG   . ASN A 1 8   ? 5.950   5.092   17.206  1.00 0.00 ? 8   ASN A CG   3  
ATOM 3660  O OD1  . ASN A 1 8   ? 6.755   4.269   16.769  1.00 0.00 ? 8   ASN A OD1  3  
ATOM 3661  N ND2  . ASN A 1 8   ? 6.274   5.992   18.127  1.00 0.00 ? 8   ASN A ND2  3  
ATOM 3662  H H    . ASN A 1 8   ? 5.384   7.349   15.761  1.00 0.00 ? 8   ASN A H    3  
ATOM 3663  H HA   . ASN A 1 8   ? 5.102   4.931   14.655  1.00 0.00 ? 8   ASN A HA   3  
ATOM 3664  H HB2  . ASN A 1 8   ? 3.962   5.825   17.308  1.00 0.00 ? 8   ASN A HB2  3  
ATOM 3665  H HB3  . ASN A 1 8   ? 4.094   4.137   16.824  1.00 0.00 ? 8   ASN A HB3  3  
ATOM 3666  H HD21 . ASN A 1 8   ? 5.581   6.616   18.429  1.00 0.00 ? 8   ASN A HD21 3  
ATOM 3667  H HD22 . ASN A 1 8   ? 7.193   5.995   18.468  1.00 0.00 ? 8   ASN A HD22 3  
ATOM 3668  N N    . ALA A 1 9   ? 2.890   4.641   13.583  1.00 0.00 ? 9   ALA A N    3  
ATOM 3669  C CA   . ALA A 1 9   ? 1.590   4.359   12.989  1.00 0.00 ? 9   ALA A CA   3  
ATOM 3670  C C    . ALA A 1 9   ? 1.177   2.911   13.233  1.00 0.00 ? 9   ALA A C    3  
ATOM 3671  O O    . ALA A 1 9   ? 2.010   2.009   13.319  1.00 0.00 ? 9   ALA A O    3  
ATOM 3672  C CB   . ALA A 1 9   ? 1.615   4.658   11.497  1.00 0.00 ? 9   ALA A CB   3  
ATOM 3673  H H    . ALA A 1 9   ? 3.701   4.327   13.132  1.00 0.00 ? 9   ALA A H    3  
ATOM 3674  H HA   . ALA A 1 9   ? 0.863   5.013   13.450  1.00 0.00 ? 9   ALA A HA   3  
ATOM 3675  H HB1  . ALA A 1 9   ? 2.356   4.033   11.018  1.00 0.00 ? 9   ALA A HB1  3  
ATOM 3676  H HB2  . ALA A 1 9   ? 0.643   4.455   11.073  1.00 0.00 ? 9   ALA A HB2  3  
ATOM 3677  H HB3  . ALA A 1 9   ? 1.866   5.696   11.343  1.00 0.00 ? 9   ALA A HB3  3  
ATOM 3678  N N    . PRO A 1 10  ? -0.139  2.682   13.350  1.00 0.00 ? 10  PRO A N    3  
ATOM 3679  C CA   . PRO A 1 10  ? -0.692  1.345   13.586  1.00 0.00 ? 10  PRO A CA   3  
ATOM 3680  C C    . PRO A 1 10  ? -0.541  0.432   12.374  1.00 0.00 ? 10  PRO A C    3  
ATOM 3681  O O    . PRO A 1 10  ? -0.008  0.838   11.342  1.00 0.00 ? 10  PRO A O    3  
ATOM 3682  C CB   . PRO A 1 10  ? -2.172  1.618   13.869  1.00 0.00 ? 10  PRO A CB   3  
ATOM 3683  C CG   . PRO A 1 10  ? -2.458  2.907   13.178  1.00 0.00 ? 10  PRO A CG   3  
ATOM 3684  C CD   . PRO A 1 10  ? -1.190  3.710   13.258  1.00 0.00 ? 10  PRO A CD   3  
ATOM 3685  H HA   . PRO A 1 10  ? -0.240  0.876   14.448  1.00 0.00 ? 10  PRO A HA   3  
ATOM 3686  H HB2  . PRO A 1 10  ? -2.772  0.813   13.469  1.00 0.00 ? 10  PRO A HB2  3  
ATOM 3687  H HB3  . PRO A 1 10  ? -2.330  1.698   14.934  1.00 0.00 ? 10  PRO A HB3  3  
ATOM 3688  H HG2  . PRO A 1 10  ? -2.719  2.721   12.147  1.00 0.00 ? 10  PRO A HG2  3  
ATOM 3689  H HG3  . PRO A 1 10  ? -3.261  3.423   13.683  1.00 0.00 ? 10  PRO A HG3  3  
ATOM 3690  H HD2  . PRO A 1 10  ? -1.066  4.310   12.369  1.00 0.00 ? 10  PRO A HD2  3  
ATOM 3691  H HD3  . PRO A 1 10  ? -1.194  4.335   14.140  1.00 0.00 ? 10  PRO A HD3  3  
ATOM 3692  N N    . VAL A 1 11  ? -1.014  -0.803  12.507  1.00 0.00 ? 11  VAL A N    3  
ATOM 3693  C CA   . VAL A 1 11  ? -0.933  -1.773  11.421  1.00 0.00 ? 11  VAL A CA   3  
ATOM 3694  C C    . VAL A 1 11  ? -2.287  -1.958  10.747  1.00 0.00 ? 11  VAL A C    3  
ATOM 3695  O O    . VAL A 1 11  ? -3.280  -2.282  11.400  1.00 0.00 ? 11  VAL A O    3  
ATOM 3696  C CB   . VAL A 1 11  ? -0.432  -3.139  11.926  1.00 0.00 ? 11  VAL A CB   3  
ATOM 3697  C CG1  . VAL A 1 11  ? -0.531  -4.184  10.825  1.00 0.00 ? 11  VAL A CG1  3  
ATOM 3698  C CG2  . VAL A 1 11  ? 0.995   -3.027  12.440  1.00 0.00 ? 11  VAL A CG2  3  
ATOM 3699  H H    . VAL A 1 11  ? -1.428  -1.067  13.354  1.00 0.00 ? 11  VAL A H    3  
ATOM 3700  H HA   . VAL A 1 11  ? -0.226  -1.401  10.693  1.00 0.00 ? 11  VAL A HA   3  
ATOM 3701  H HB   . VAL A 1 11  ? -1.063  -3.451  12.745  1.00 0.00 ? 11  VAL A HB   3  
ATOM 3702  H HG11 . VAL A 1 11  ? 0.295   -4.876  10.911  1.00 0.00 ? 11  VAL A HG11 3  
ATOM 3703  H HG12 . VAL A 1 11  ? -1.463  -4.721  10.921  1.00 0.00 ? 11  VAL A HG12 3  
ATOM 3704  H HG13 . VAL A 1 11  ? -0.492  -3.697  9.862   1.00 0.00 ? 11  VAL A HG13 3  
ATOM 3705  H HG21 . VAL A 1 11  ? 1.336   -3.997  12.770  1.00 0.00 ? 11  VAL A HG21 3  
ATOM 3706  H HG22 . VAL A 1 11  ? 1.637   -2.671  11.646  1.00 0.00 ? 11  VAL A HG22 3  
ATOM 3707  H HG23 . VAL A 1 11  ? 1.028   -2.333  13.266  1.00 0.00 ? 11  VAL A HG23 3  
ATOM 3708  N N    . THR A 1 12  ? -2.322  -1.750  9.434   1.00 0.00 ? 12  THR A N    3  
ATOM 3709  C CA   . THR A 1 12  ? -3.555  -1.892  8.670   1.00 0.00 ? 12  THR A CA   3  
ATOM 3710  C C    . THR A 1 12  ? -3.912  -3.361  8.471   1.00 0.00 ? 12  THR A C    3  
ATOM 3711  O O    . THR A 1 12  ? -4.976  -3.815  8.892   1.00 0.00 ? 12  THR A O    3  
ATOM 3712  C CB   . THR A 1 12  ? -3.444  -1.212  7.293   1.00 0.00 ? 12  THR A CB   3  
ATOM 3713  O OG1  . THR A 1 12  ? -3.056  0.157   7.452   1.00 0.00 ? 12  THR A OG1  3  
ATOM 3714  C CG2  . THR A 1 12  ? -4.767  -1.285  6.545   1.00 0.00 ? 12  THR A CG2  3  
ATOM 3715  H H    . THR A 1 12  ? -1.498  -1.493  8.970   1.00 0.00 ? 12  THR A H    3  
ATOM 3716  H HA   . THR A 1 12  ? -4.348  -1.411  9.223   1.00 0.00 ? 12  THR A HA   3  
ATOM 3717  H HB   . THR A 1 12  ? -2.691  -1.727  6.713   1.00 0.00 ? 12  THR A HB   3  
ATOM 3718  H HG1  . THR A 1 12  ? -3.420  0.500   8.272   1.00 0.00 ? 12  THR A HG1  3  
ATOM 3719  H HG21 . THR A 1 12  ? -5.567  -0.972  7.198   1.00 0.00 ? 12  THR A HG21 3  
ATOM 3720  H HG22 . THR A 1 12  ? -4.941  -2.301  6.221   1.00 0.00 ? 12  THR A HG22 3  
ATOM 3721  H HG23 . THR A 1 12  ? -4.730  -0.635  5.684   1.00 0.00 ? 12  THR A HG23 3  
ATOM 3722  N N    . LYS A 1 13  ? -3.015  -4.101  7.828   1.00 0.00 ? 13  LYS A N    3  
ATOM 3723  C CA   . LYS A 1 13  ? -3.233  -5.521  7.575   1.00 0.00 ? 13  LYS A CA   3  
ATOM 3724  C C    . LYS A 1 13  ? -1.911  -6.281  7.566   1.00 0.00 ? 13  LYS A C    3  
ATOM 3725  O O    . LYS A 1 13  ? -0.854  -5.704  7.318   1.00 0.00 ? 13  LYS A O    3  
ATOM 3726  C CB   . LYS A 1 13  ? -3.956  -5.716  6.240   1.00 0.00 ? 13  LYS A CB   3  
ATOM 3727  C CG   . LYS A 1 13  ? -4.477  -7.128  6.032   1.00 0.00 ? 13  LYS A CG   3  
ATOM 3728  C CD   . LYS A 1 13  ? -5.330  -7.228  4.779   1.00 0.00 ? 13  LYS A CD   3  
ATOM 3729  C CE   . LYS A 1 13  ? -5.868  -8.637  4.581   1.00 0.00 ? 13  LYS A CE   3  
ATOM 3730  N NZ   . LYS A 1 13  ? -6.674  -9.091  5.747   1.00 0.00 ? 13  LYS A NZ   3  
ATOM 3731  H H    . LYS A 1 13  ? -2.185  -3.682  7.517   1.00 0.00 ? 13  LYS A H    3  
ATOM 3732  H HA   . LYS A 1 13  ? -3.852  -5.908  8.370   1.00 0.00 ? 13  LYS A HA   3  
ATOM 3733  H HB2  . LYS A 1 13  ? -4.793  -5.035  6.195   1.00 0.00 ? 13  LYS A HB2  3  
ATOM 3734  H HB3  . LYS A 1 13  ? -3.271  -5.486  5.437   1.00 0.00 ? 13  LYS A HB3  3  
ATOM 3735  H HG2  . LYS A 1 13  ? -3.639  -7.801  5.938   1.00 0.00 ? 13  LYS A HG2  3  
ATOM 3736  H HG3  . LYS A 1 13  ? -5.075  -7.410  6.887   1.00 0.00 ? 13  LYS A HG3  3  
ATOM 3737  H HD2  . LYS A 1 13  ? -6.164  -6.546  4.865   1.00 0.00 ? 13  LYS A HD2  3  
ATOM 3738  H HD3  . LYS A 1 13  ? -4.729  -6.957  3.922   1.00 0.00 ? 13  LYS A HD3  3  
ATOM 3739  H HE2  . LYS A 1 13  ? -6.488  -8.651  3.698   1.00 0.00 ? 13  LYS A HE2  3  
ATOM 3740  H HE3  . LYS A 1 13  ? -5.034  -9.310  4.447   1.00 0.00 ? 13  LYS A HE3  3  
ATOM 3741  H HZ1  . LYS A 1 13  ? -7.633  -9.351  5.439   1.00 0.00 ? 13  LYS A HZ1  3  
ATOM 3742  H HZ2  . LYS A 1 13  ? -6.744  -8.330  6.453   1.00 0.00 ? 13  LYS A HZ2  3  
ATOM 3743  H HZ3  . LYS A 1 13  ? -6.228  -9.920  6.190   1.00 0.00 ? 13  LYS A HZ3  3  
ATOM 3744  N N    . ALA A 1 14  ? -1.980  -7.581  7.837   1.00 0.00 ? 14  ALA A N    3  
ATOM 3745  C CA   . ALA A 1 14  ? -0.789  -8.421  7.856   1.00 0.00 ? 14  ALA A CA   3  
ATOM 3746  C C    . ALA A 1 14  ? -1.149  -9.889  7.659   1.00 0.00 ? 14  ALA A C    3  
ATOM 3747  O O    . ALA A 1 14  ? -2.043  -10.414 8.322   1.00 0.00 ? 14  ALA A O    3  
ATOM 3748  C CB   . ALA A 1 14  ? -0.031  -8.232  9.162   1.00 0.00 ? 14  ALA A CB   3  
ATOM 3749  H H    . ALA A 1 14  ? -2.852  -7.984  8.027   1.00 0.00 ? 14  ALA A H    3  
ATOM 3750  H HA   . ALA A 1 14  ? -0.145  -8.107  7.047   1.00 0.00 ? 14  ALA A HA   3  
ATOM 3751  H HB1  . ALA A 1 14  ? 0.750   -7.499  9.021   1.00 0.00 ? 14  ALA A HB1  3  
ATOM 3752  H HB2  . ALA A 1 14  ? -0.712  -7.891  9.927   1.00 0.00 ? 14  ALA A HB2  3  
ATOM 3753  H HB3  . ALA A 1 14  ? 0.408   -9.172  9.462   1.00 0.00 ? 14  ALA A HB3  3  
ATOM 3754  N N    . GLY A 1 15  ? -0.448  -10.548 6.741   1.00 0.00 ? 15  GLY A N    3  
ATOM 3755  C CA   . GLY A 1 15  ? -0.711  -11.950 6.472   1.00 0.00 ? 15  GLY A CA   3  
ATOM 3756  C C    . GLY A 1 15  ? 0.360   -12.584 5.606   1.00 0.00 ? 15  GLY A C    3  
ATOM 3757  O O    . GLY A 1 15  ? 1.146   -11.885 4.968   1.00 0.00 ? 15  GLY A O    3  
ATOM 3758  H H    . GLY A 1 15  ? 0.252   -10.078 6.242   1.00 0.00 ? 15  GLY A H    3  
ATOM 3759  H HA2  . GLY A 1 15  ? -0.762  -12.482 7.411   1.00 0.00 ? 15  GLY A HA2  3  
ATOM 3760  H HA3  . GLY A 1 15  ? -1.662  -12.036 5.969   1.00 0.00 ? 15  GLY A HA3  3  
ATOM 3761  N N    . TRP A 1 16  ? 0.390   -13.912 5.584   1.00 0.00 ? 16  TRP A N    3  
ATOM 3762  C CA   . TRP A 1 16  ? 1.374   -14.640 4.791   1.00 0.00 ? 16  TRP A CA   3  
ATOM 3763  C C    . TRP A 1 16  ? 1.028   -14.581 3.307   1.00 0.00 ? 16  TRP A C    3  
ATOM 3764  O O    . TRP A 1 16  ? -0.037  -15.037 2.889   1.00 0.00 ? 16  TRP A O    3  
ATOM 3765  C CB   . TRP A 1 16  ? 1.453   -16.097 5.251   1.00 0.00 ? 16  TRP A CB   3  
ATOM 3766  C CG   . TRP A 1 16  ? 2.179   -16.271 6.551   1.00 0.00 ? 16  TRP A CG   3  
ATOM 3767  C CD1  . TRP A 1 16  ? 1.619   -16.442 7.785   1.00 0.00 ? 16  TRP A CD1  3  
ATOM 3768  C CD2  . TRP A 1 16  ? 3.597   -16.288 6.745   1.00 0.00 ? 16  TRP A CD2  3  
ATOM 3769  N NE1  . TRP A 1 16  ? 2.605   -16.565 8.735   1.00 0.00 ? 16  TRP A NE1  3  
ATOM 3770  C CE2  . TRP A 1 16  ? 3.827   -16.474 8.122   1.00 0.00 ? 16  TRP A CE2  3  
ATOM 3771  C CE3  . TRP A 1 16  ? 4.695   -16.166 5.889   1.00 0.00 ? 16  TRP A CE3  3  
ATOM 3772  C CZ2  . TRP A 1 16  ? 5.109   -16.540 8.660   1.00 0.00 ? 16  TRP A CZ2  3  
ATOM 3773  C CZ3  . TRP A 1 16  ? 5.967   -16.231 6.425   1.00 0.00 ? 16  TRP A CZ3  3  
ATOM 3774  C CH2  . TRP A 1 16  ? 6.166   -16.417 7.799   1.00 0.00 ? 16  TRP A CH2  3  
ATOM 3775  H H    . TRP A 1 16  ? -0.263  -14.414 6.114   1.00 0.00 ? 16  TRP A H    3  
ATOM 3776  H HA   . TRP A 1 16  ? 2.335   -14.171 4.944   1.00 0.00 ? 16  TRP A HA   3  
ATOM 3777  H HB2  . TRP A 1 16  ? 0.452   -16.484 5.374   1.00 0.00 ? 16  TRP A HB2  3  
ATOM 3778  H HB3  . TRP A 1 16  ? 1.970   -16.676 4.500   1.00 0.00 ? 16  TRP A HB3  3  
ATOM 3779  H HD1  . TRP A 1 16  ? 0.557   -16.473 7.973   1.00 0.00 ? 16  TRP A HD1  3  
ATOM 3780  H HE1  . TRP A 1 16  ? 2.457   -16.697 9.695   1.00 0.00 ? 16  TRP A HE1  3  
ATOM 3781  H HE3  . TRP A 1 16  ? 4.562   -16.021 4.827   1.00 0.00 ? 16  TRP A HE3  3  
ATOM 3782  H HZ2  . TRP A 1 16  ? 5.279   -16.684 9.717   1.00 0.00 ? 16  TRP A HZ2  3  
ATOM 3783  H HZ3  . TRP A 1 16  ? 6.828   -16.138 5.779   1.00 0.00 ? 16  TRP A HZ3  3  
ATOM 3784  H HH2  . TRP A 1 16  ? 7.177   -16.462 8.174   1.00 0.00 ? 16  TRP A HH2  3  
ATOM 3785  N N    . LEU A 1 17  ? 1.934   -14.017 2.515   1.00 0.00 ? 17  LEU A N    3  
ATOM 3786  C CA   . LEU A 1 17  ? 1.724   -13.899 1.077   1.00 0.00 ? 17  LEU A CA   3  
ATOM 3787  C C    . LEU A 1 17  ? 2.939   -14.405 0.306   1.00 0.00 ? 17  LEU A C    3  
ATOM 3788  O O    . LEU A 1 17  ? 4.037   -14.507 0.854   1.00 0.00 ? 17  LEU A O    3  
ATOM 3789  C CB   . LEU A 1 17  ? 1.437   -12.444 0.701   1.00 0.00 ? 17  LEU A CB   3  
ATOM 3790  C CG   . LEU A 1 17  ? 0.051   -11.916 1.072   1.00 0.00 ? 17  LEU A CG   3  
ATOM 3791  C CD1  . LEU A 1 17  ? 0.035   -10.395 1.046   1.00 0.00 ? 17  LEU A CD1  3  
ATOM 3792  C CD2  . LEU A 1 17  ? -1.004  -12.479 0.131   1.00 0.00 ? 17  LEU A CD2  3  
ATOM 3793  H H    . LEU A 1 17  ? 2.763   -13.673 2.906   1.00 0.00 ? 17  LEU A H    3  
ATOM 3794  H HA   . LEU A 1 17  ? 0.869   -14.505 0.815   1.00 0.00 ? 17  LEU A HA   3  
ATOM 3795  H HB2  . LEU A 1 17  ? 2.170   -11.825 1.195   1.00 0.00 ? 17  LEU A HB2  3  
ATOM 3796  H HB3  . LEU A 1 17  ? 1.553   -12.351 -0.370  1.00 0.00 ? 17  LEU A HB3  3  
ATOM 3797  H HG   . LEU A 1 17  ? -0.191  -12.234 2.077   1.00 0.00 ? 17  LEU A HG   3  
ATOM 3798  H HD11 . LEU A 1 17  ? -0.683  -10.031 1.765   1.00 0.00 ? 17  LEU A HD11 3  
ATOM 3799  H HD12 . LEU A 1 17  ? -0.240  -10.055 0.058   1.00 0.00 ? 17  LEU A HD12 3  
ATOM 3800  H HD13 . LEU A 1 17  ? 1.017   -10.021 1.295   1.00 0.00 ? 17  LEU A HD13 3  
ATOM 3801  H HD21 . LEU A 1 17  ? -0.934  -13.556 0.115   1.00 0.00 ? 17  LEU A HD21 3  
ATOM 3802  H HD22 . LEU A 1 17  ? -0.839  -12.093 -0.865  1.00 0.00 ? 17  LEU A HD22 3  
ATOM 3803  H HD23 . LEU A 1 17  ? -1.985  -12.186 0.473   1.00 0.00 ? 17  LEU A HD23 3  
ATOM 3804  N N    . PHE A 1 18  ? 2.736   -14.720 -0.969  1.00 0.00 ? 18  PHE A N    3  
ATOM 3805  C CA   . PHE A 1 18  ? 3.815   -15.214 -1.816  1.00 0.00 ? 18  PHE A CA   3  
ATOM 3806  C C    . PHE A 1 18  ? 4.223   -14.164 -2.846  1.00 0.00 ? 18  PHE A C    3  
ATOM 3807  O O    . PHE A 1 18  ? 3.442   -13.807 -3.728  1.00 0.00 ? 18  PHE A O    3  
ATOM 3808  C CB   . PHE A 1 18  ? 3.387   -16.501 -2.525  1.00 0.00 ? 18  PHE A CB   3  
ATOM 3809  C CG   . PHE A 1 18  ? 3.355   -17.701 -1.622  1.00 0.00 ? 18  PHE A CG   3  
ATOM 3810  C CD1  . PHE A 1 18  ? 2.505   -17.740 -0.529  1.00 0.00 ? 18  PHE A CD1  3  
ATOM 3811  C CD2  . PHE A 1 18  ? 4.176   -18.790 -1.867  1.00 0.00 ? 18  PHE A CD2  3  
ATOM 3812  C CE1  . PHE A 1 18  ? 2.475   -18.842 0.303   1.00 0.00 ? 18  PHE A CE1  3  
ATOM 3813  C CE2  . PHE A 1 18  ? 4.150   -19.896 -1.038  1.00 0.00 ? 18  PHE A CE2  3  
ATOM 3814  C CZ   . PHE A 1 18  ? 3.297   -19.922 0.048   1.00 0.00 ? 18  PHE A CZ   3  
ATOM 3815  H H    . PHE A 1 18  ? 1.838   -14.617 -1.349  1.00 0.00 ? 18  PHE A H    3  
ATOM 3816  H HA   . PHE A 1 18  ? 4.662   -15.427 -1.182  1.00 0.00 ? 18  PHE A HA   3  
ATOM 3817  H HB2  . PHE A 1 18  ? 2.396   -16.366 -2.932  1.00 0.00 ? 18  PHE A HB2  3  
ATOM 3818  H HB3  . PHE A 1 18  ? 4.077   -16.707 -3.329  1.00 0.00 ? 18  PHE A HB3  3  
ATOM 3819  H HD1  . PHE A 1 18  ? 1.860   -16.897 -0.329  1.00 0.00 ? 18  PHE A HD1  3  
ATOM 3820  H HD2  . PHE A 1 18  ? 4.844   -18.770 -2.717  1.00 0.00 ? 18  PHE A HD2  3  
ATOM 3821  H HE1  . PHE A 1 18  ? 1.807   -18.861 1.152   1.00 0.00 ? 18  PHE A HE1  3  
ATOM 3822  H HE2  . PHE A 1 18  ? 4.795   -20.738 -1.241  1.00 0.00 ? 18  PHE A HE2  3  
ATOM 3823  H HZ   . PHE A 1 18  ? 3.276   -20.784 0.697   1.00 0.00 ? 18  PHE A HZ   3  
ATOM 3824  N N    . LYS A 1 19  ? 5.451   -13.673 -2.726  1.00 0.00 ? 19  LYS A N    3  
ATOM 3825  C CA   . LYS A 1 19  ? 5.966   -12.665 -3.645  1.00 0.00 ? 19  LYS A CA   3  
ATOM 3826  C C    . LYS A 1 19  ? 6.627   -13.318 -4.855  1.00 0.00 ? 19  LYS A C    3  
ATOM 3827  O O    . LYS A 1 19  ? 7.529   -14.142 -4.710  1.00 0.00 ? 19  LYS A O    3  
ATOM 3828  C CB   . LYS A 1 19  ? 6.969   -11.757 -2.930  1.00 0.00 ? 19  LYS A CB   3  
ATOM 3829  C CG   . LYS A 1 19  ? 7.081   -10.372 -3.542  1.00 0.00 ? 19  LYS A CG   3  
ATOM 3830  C CD   . LYS A 1 19  ? 8.263   -9.605  -2.974  1.00 0.00 ? 19  LYS A CD   3  
ATOM 3831  C CE   . LYS A 1 19  ? 8.828   -8.621  -3.987  1.00 0.00 ? 19  LYS A CE   3  
ATOM 3832  N NZ   . LYS A 1 19  ? 9.842   -9.257  -4.872  1.00 0.00 ? 19  LYS A NZ   3  
ATOM 3833  H H    . LYS A 1 19  ? 6.027   -13.998 -2.002  1.00 0.00 ? 19  LYS A H    3  
ATOM 3834  H HA   . LYS A 1 19  ? 5.132   -12.069 -3.984  1.00 0.00 ? 19  LYS A HA   3  
ATOM 3835  H HB2  . LYS A 1 19  ? 6.667   -11.649 -1.899  1.00 0.00 ? 19  LYS A HB2  3  
ATOM 3836  H HB3  . LYS A 1 19  ? 7.944   -12.223 -2.963  1.00 0.00 ? 19  LYS A HB3  3  
ATOM 3837  H HG2  . LYS A 1 19  ? 7.209   -10.470 -4.610  1.00 0.00 ? 19  LYS A HG2  3  
ATOM 3838  H HG3  . LYS A 1 19  ? 6.173   -9.823  -3.336  1.00 0.00 ? 19  LYS A HG3  3  
ATOM 3839  H HD2  . LYS A 1 19  ? 7.940   -9.058  -2.100  1.00 0.00 ? 19  LYS A HD2  3  
ATOM 3840  H HD3  . LYS A 1 19  ? 9.037   -10.306 -2.696  1.00 0.00 ? 19  LYS A HD3  3  
ATOM 3841  H HE2  . LYS A 1 19  ? 8.018   -8.244  -4.593  1.00 0.00 ? 19  LYS A HE2  3  
ATOM 3842  H HE3  . LYS A 1 19  ? 9.290   -7.802  -3.455  1.00 0.00 ? 19  LYS A HE3  3  
ATOM 3843  H HZ1  . LYS A 1 19  ? 9.423   -9.468  -5.800  1.00 0.00 ? 19  LYS A HZ1  3  
ATOM 3844  H HZ2  . LYS A 1 19  ? 10.181  -10.144 -4.448  1.00 0.00 ? 19  LYS A HZ2  3  
ATOM 3845  H HZ3  . LYS A 1 19  ? 10.651  -8.618  -5.007  1.00 0.00 ? 19  LYS A HZ3  3  
ATOM 3846  N N    . GLN A 1 20  ? 6.173   -12.942 -6.046  1.00 0.00 ? 20  GLN A N    3  
ATOM 3847  C CA   . GLN A 1 20  ? 6.722   -13.491 -7.280  1.00 0.00 ? 20  GLN A CA   3  
ATOM 3848  C C    . GLN A 1 20  ? 8.138   -12.979 -7.521  1.00 0.00 ? 20  GLN A C    3  
ATOM 3849  O O    . GLN A 1 20  ? 8.361   -11.774 -7.640  1.00 0.00 ? 20  GLN A O    3  
ATOM 3850  C CB   . GLN A 1 20  ? 5.827   -13.130 -8.467  1.00 0.00 ? 20  GLN A CB   3  
ATOM 3851  C CG   . GLN A 1 20  ? 5.929   -14.109 -9.626  1.00 0.00 ? 20  GLN A CG   3  
ATOM 3852  C CD   . GLN A 1 20  ? 5.029   -13.734 -10.787 1.00 0.00 ? 20  GLN A CD   3  
ATOM 3853  O OE1  . GLN A 1 20  ? 4.855   -12.555 -11.097 1.00 0.00 ? 20  GLN A OE1  3  
ATOM 3854  N NE2  . GLN A 1 20  ? 4.451   -14.738 -11.436 1.00 0.00 ? 20  GLN A NE2  3  
ATOM 3855  H H    . GLN A 1 20  ? 5.452   -12.281 -6.096  1.00 0.00 ? 20  GLN A H    3  
ATOM 3856  H HA   . GLN A 1 20  ? 6.755   -14.566 -7.179  1.00 0.00 ? 20  GLN A HA   3  
ATOM 3857  H HB2  . GLN A 1 20  ? 4.801   -13.105 -8.134  1.00 0.00 ? 20  GLN A HB2  3  
ATOM 3858  H HB3  . GLN A 1 20  ? 6.105   -12.150 -8.826  1.00 0.00 ? 20  GLN A HB3  3  
ATOM 3859  H HG2  . GLN A 1 20  ? 6.951   -14.129 -9.975  1.00 0.00 ? 20  GLN A HG2  3  
ATOM 3860  H HG3  . GLN A 1 20  ? 5.651   -15.092 -9.275  1.00 0.00 ? 20  GLN A HG3  3  
ATOM 3861  H HE21 . GLN A 1 20  ? 4.635   -15.652 -11.132 1.00 0.00 ? 20  GLN A HE21 3  
ATOM 3862  H HE22 . GLN A 1 20  ? 3.864   -14.525 -12.190 1.00 0.00 ? 20  GLN A HE22 3  
ATOM 3863  N N    . ALA A 1 21  ? 9.092   -13.901 -7.592  1.00 0.00 ? 21  ALA A N    3  
ATOM 3864  C CA   . ALA A 1 21  ? 10.487  -13.542 -7.821  1.00 0.00 ? 21  ALA A CA   3  
ATOM 3865  C C    . ALA A 1 21  ? 10.635  -12.691 -9.078  1.00 0.00 ? 21  ALA A C    3  
ATOM 3866  O O    . ALA A 1 21  ? 9.920   -12.887 -10.060 1.00 0.00 ? 21  ALA A O    3  
ATOM 3867  C CB   . ALA A 1 21  ? 11.344  -14.795 -7.925  1.00 0.00 ? 21  ALA A CB   3  
ATOM 3868  H H    . ALA A 1 21  ? 8.853   -14.846 -7.490  1.00 0.00 ? 21  ALA A H    3  
ATOM 3869  H HA   . ALA A 1 21  ? 10.828  -12.972 -6.969  1.00 0.00 ? 21  ALA A HA   3  
ATOM 3870  H HB1  . ALA A 1 21  ? 11.043  -15.500 -7.164  1.00 0.00 ? 21  ALA A HB1  3  
ATOM 3871  H HB2  . ALA A 1 21  ? 11.213  -15.240 -8.901  1.00 0.00 ? 21  ALA A HB2  3  
ATOM 3872  H HB3  . ALA A 1 21  ? 12.382  -14.533 -7.785  1.00 0.00 ? 21  ALA A HB3  3  
ATOM 3873  N N    . SER A 1 22  ? 11.568  -11.745 -9.039  1.00 0.00 ? 22  SER A N    3  
ATOM 3874  C CA   . SER A 1 22  ? 11.807  -10.860 -10.173 1.00 0.00 ? 22  SER A CA   3  
ATOM 3875  C C    . SER A 1 22  ? 13.268  -10.918 -10.609 1.00 0.00 ? 22  SER A C    3  
ATOM 3876  O O    . SER A 1 22  ? 14.100  -11.539 -9.947  1.00 0.00 ? 22  SER A O    3  
ATOM 3877  C CB   . SER A 1 22  ? 11.427  -9.422  -9.815  1.00 0.00 ? 22  SER A CB   3  
ATOM 3878  O OG   . SER A 1 22  ? 12.352  -8.864  -8.898  1.00 0.00 ? 22  SER A OG   3  
ATOM 3879  H H    . SER A 1 22  ? 12.106  -11.637 -8.226  1.00 0.00 ? 22  SER A H    3  
ATOM 3880  H HA   . SER A 1 22  ? 11.186  -11.194 -10.991 1.00 0.00 ? 22  SER A HA   3  
ATOM 3881  H HB2  . SER A 1 22  ? 11.419  -8.821  -10.711 1.00 0.00 ? 22  SER A HB2  3  
ATOM 3882  H HB3  . SER A 1 22  ? 10.444  -9.414  -9.367  1.00 0.00 ? 22  SER A HB3  3  
ATOM 3883  H HG   . SER A 1 22  ? 12.272  -7.907  -8.905  1.00 0.00 ? 22  SER A HG   3  
ATOM 3884  N N    . SER A 1 23  ? 13.572  -10.268 -11.727 1.00 0.00 ? 23  SER A N    3  
ATOM 3885  C CA   . SER A 1 23  ? 14.931  -10.248 -12.255 1.00 0.00 ? 23  SER A CA   3  
ATOM 3886  C C    . SER A 1 23  ? 15.541  -11.646 -12.238 1.00 0.00 ? 23  SER A C    3  
ATOM 3887  O O    . SER A 1 23  ? 16.729  -11.814 -11.970 1.00 0.00 ? 23  SER A O    3  
ATOM 3888  C CB   . SER A 1 23  ? 15.803  -9.289  -11.441 1.00 0.00 ? 23  SER A CB   3  
ATOM 3889  O OG   . SER A 1 23  ? 17.130  -9.260  -11.938 1.00 0.00 ? 23  SER A OG   3  
ATOM 3890  H H    . SER A 1 23  ? 12.864  -9.792  -12.210 1.00 0.00 ? 23  SER A H    3  
ATOM 3891  H HA   . SER A 1 23  ? 14.885  -9.900  -13.276 1.00 0.00 ? 23  SER A HA   3  
ATOM 3892  H HB2  . SER A 1 23  ? 15.388  -8.294  -11.497 1.00 0.00 ? 23  SER A HB2  3  
ATOM 3893  H HB3  . SER A 1 23  ? 15.823  -9.613  -10.411 1.00 0.00 ? 23  SER A HB3  3  
ATOM 3894  H HG   . SER A 1 23  ? 17.557  -10.102 -11.760 1.00 0.00 ? 23  SER A HG   3  
ATOM 3895  N N    . GLY A 1 24  ? 14.716  -12.648 -12.528 1.00 0.00 ? 24  GLY A N    3  
ATOM 3896  C CA   . GLY A 1 24  ? 15.190  -14.020 -12.541 1.00 0.00 ? 24  GLY A CA   3  
ATOM 3897  C C    . GLY A 1 24  ? 14.098  -15.008 -12.900 1.00 0.00 ? 24  GLY A C    3  
ATOM 3898  O O    . GLY A 1 24  ? 13.069  -14.630 -13.459 1.00 0.00 ? 24  GLY A O    3  
ATOM 3899  H H    . GLY A 1 24  ? 13.777  -12.455 -12.734 1.00 0.00 ? 24  GLY A H    3  
ATOM 3900  H HA2  . GLY A 1 24  ? 15.990  -14.105 -13.261 1.00 0.00 ? 24  GLY A HA2  3  
ATOM 3901  H HA3  . GLY A 1 24  ? 15.574  -14.265 -11.561 1.00 0.00 ? 24  GLY A HA3  3  
ATOM 3902  N N    . VAL A 1 25  ? 14.322  -16.278 -12.578 1.00 0.00 ? 25  VAL A N    3  
ATOM 3903  C CA   . VAL A 1 25  ? 13.350  -17.324 -12.870 1.00 0.00 ? 25  VAL A CA   3  
ATOM 3904  C C    . VAL A 1 25  ? 11.966  -16.948 -12.351 1.00 0.00 ? 25  VAL A C    3  
ATOM 3905  O O    . VAL A 1 25  ? 11.829  -16.075 -11.494 1.00 0.00 ? 25  VAL A O    3  
ATOM 3906  C CB   . VAL A 1 25  ? 13.770  -18.670 -12.252 1.00 0.00 ? 25  VAL A CB   3  
ATOM 3907  C CG1  . VAL A 1 25  ? 13.298  -18.767 -10.810 1.00 0.00 ? 25  VAL A CG1  3  
ATOM 3908  C CG2  . VAL A 1 25  ? 13.229  -19.827 -13.078 1.00 0.00 ? 25  VAL A CG2  3  
ATOM 3909  H H    . VAL A 1 25  ? 15.162  -16.517 -12.133 1.00 0.00 ? 25  VAL A H    3  
ATOM 3910  H HA   . VAL A 1 25  ? 13.300  -17.444 -13.943 1.00 0.00 ? 25  VAL A HA   3  
ATOM 3911  H HB   . VAL A 1 25  ? 14.849  -18.725 -12.259 1.00 0.00 ? 25  VAL A HB   3  
ATOM 3912  H HG11 . VAL A 1 25  ? 14.019  -19.326 -10.232 1.00 0.00 ? 25  VAL A HG11 3  
ATOM 3913  H HG12 . VAL A 1 25  ? 13.196  -17.774 -10.397 1.00 0.00 ? 25  VAL A HG12 3  
ATOM 3914  H HG13 . VAL A 1 25  ? 12.343  -19.271 -10.777 1.00 0.00 ? 25  VAL A HG13 3  
ATOM 3915  H HG21 . VAL A 1 25  ? 13.328  -19.597 -14.128 1.00 0.00 ? 25  VAL A HG21 3  
ATOM 3916  H HG22 . VAL A 1 25  ? 13.788  -20.724 -12.852 1.00 0.00 ? 25  VAL A HG22 3  
ATOM 3917  H HG23 . VAL A 1 25  ? 12.187  -19.984 -12.840 1.00 0.00 ? 25  VAL A HG23 3  
ATOM 3918  N N    . LYS A 1 26  ? 10.943  -17.615 -12.873 1.00 0.00 ? 26  LYS A N    3  
ATOM 3919  C CA   . LYS A 1 26  ? 9.569   -17.354 -12.462 1.00 0.00 ? 26  LYS A CA   3  
ATOM 3920  C C    . LYS A 1 26  ? 9.143   -18.309 -11.351 1.00 0.00 ? 26  LYS A C    3  
ATOM 3921  O O    . LYS A 1 26  ? 8.530   -19.343 -11.611 1.00 0.00 ? 26  LYS A O    3  
ATOM 3922  C CB   . LYS A 1 26  ? 8.622   -17.491 -13.657 1.00 0.00 ? 26  LYS A CB   3  
ATOM 3923  C CG   . LYS A 1 26  ? 8.437   -16.201 -14.437 1.00 0.00 ? 26  LYS A CG   3  
ATOM 3924  C CD   . LYS A 1 26  ? 7.281   -16.304 -15.418 1.00 0.00 ? 26  LYS A CD   3  
ATOM 3925  C CE   . LYS A 1 26  ? 6.997   -14.968 -16.087 1.00 0.00 ? 26  LYS A CE   3  
ATOM 3926  N NZ   . LYS A 1 26  ? 5.737   -15.002 -16.880 1.00 0.00 ? 26  LYS A NZ   3  
ATOM 3927  H H    . LYS A 1 26  ? 11.117  -18.301 -13.553 1.00 0.00 ? 26  LYS A H    3  
ATOM 3928  H HA   . LYS A 1 26  ? 9.521   -16.343 -12.089 1.00 0.00 ? 26  LYS A HA   3  
ATOM 3929  H HB2  . LYS A 1 26  ? 9.015   -18.240 -14.328 1.00 0.00 ? 26  LYS A HB2  3  
ATOM 3930  H HB3  . LYS A 1 26  ? 7.655   -17.813 -13.299 1.00 0.00 ? 26  LYS A HB3  3  
ATOM 3931  H HG2  . LYS A 1 26  ? 8.236   -15.398 -13.744 1.00 0.00 ? 26  LYS A HG2  3  
ATOM 3932  H HG3  . LYS A 1 26  ? 9.344   -15.989 -14.984 1.00 0.00 ? 26  LYS A HG3  3  
ATOM 3933  H HD2  . LYS A 1 26  ? 7.529   -17.029 -16.179 1.00 0.00 ? 26  LYS A HD2  3  
ATOM 3934  H HD3  . LYS A 1 26  ? 6.396   -16.626 -14.886 1.00 0.00 ? 26  LYS A HD3  3  
ATOM 3935  H HE2  . LYS A 1 26  ? 6.912   -14.209 -15.324 1.00 0.00 ? 26  LYS A HE2  3  
ATOM 3936  H HE3  . LYS A 1 26  ? 7.820   -14.728 -16.744 1.00 0.00 ? 26  LYS A HE3  3  
ATOM 3937  H HZ1  . LYS A 1 26  ? 5.902   -15.473 -17.793 1.00 0.00 ? 26  LYS A HZ1  3  
ATOM 3938  H HZ2  . LYS A 1 26  ? 5.402   -14.034 -17.059 1.00 0.00 ? 26  LYS A HZ2  3  
ATOM 3939  H HZ3  . LYS A 1 26  ? 5.002   -15.522 -16.361 1.00 0.00 ? 26  LYS A HZ3  3  
ATOM 3940  N N    . GLN A 1 27  ? 9.472   -17.953 -10.113 1.00 0.00 ? 27  GLN A N    3  
ATOM 3941  C CA   . GLN A 1 27  ? 9.122   -18.778 -8.963  1.00 0.00 ? 27  GLN A CA   3  
ATOM 3942  C C    . GLN A 1 27  ? 8.359   -17.966 -7.922  1.00 0.00 ? 27  GLN A C    3  
ATOM 3943  O O    . GLN A 1 27  ? 8.297   -16.739 -8.002  1.00 0.00 ? 27  GLN A O    3  
ATOM 3944  C CB   . GLN A 1 27  ? 10.383  -19.377 -8.336  1.00 0.00 ? 27  GLN A CB   3  
ATOM 3945  C CG   . GLN A 1 27  ? 11.379  -18.333 -7.857  1.00 0.00 ? 27  GLN A CG   3  
ATOM 3946  C CD   . GLN A 1 27  ? 12.359  -18.884 -6.841  1.00 0.00 ? 27  GLN A CD   3  
ATOM 3947  O OE1  . GLN A 1 27  ? 12.054  -18.973 -5.652  1.00 0.00 ? 27  GLN A OE1  3  
ATOM 3948  N NE2  . GLN A 1 27  ? 13.546  -19.259 -7.306  1.00 0.00 ? 27  GLN A NE2  3  
ATOM 3949  H H    . GLN A 1 27  ? 9.961   -17.116 -9.970  1.00 0.00 ? 27  GLN A H    3  
ATOM 3950  H HA   . GLN A 1 27  ? 8.489   -19.580 -9.311  1.00 0.00 ? 27  GLN A HA   3  
ATOM 3951  H HB2  . GLN A 1 27  ? 10.096  -19.984 -7.491  1.00 0.00 ? 27  GLN A HB2  3  
ATOM 3952  H HB3  . GLN A 1 27  ? 10.873  -20.001 -9.068  1.00 0.00 ? 27  GLN A HB3  3  
ATOM 3953  H HG2  . GLN A 1 27  ? 11.934  -17.967 -8.708  1.00 0.00 ? 27  GLN A HG2  3  
ATOM 3954  H HG3  . GLN A 1 27  ? 10.835  -17.516 -7.405  1.00 0.00 ? 27  GLN A HG3  3  
ATOM 3955  H HE21 . GLN A 1 27  ? 13.719  -19.158 -8.265  1.00 0.00 ? 27  GLN A HE21 3  
ATOM 3956  H HE22 . GLN A 1 27  ? 14.199  -19.618 -6.671  1.00 0.00 ? 27  GLN A HE22 3  
ATOM 3957  N N    . TRP A 1 28  ? 7.780   -18.658 -6.948  1.00 0.00 ? 28  TRP A N    3  
ATOM 3958  C CA   . TRP A 1 28  ? 7.020   -18.000 -5.891  1.00 0.00 ? 28  TRP A CA   3  
ATOM 3959  C C    . TRP A 1 28  ? 7.554   -18.385 -4.516  1.00 0.00 ? 28  TRP A C    3  
ATOM 3960  O O    . TRP A 1 28  ? 7.738   -19.565 -4.219  1.00 0.00 ? 28  TRP A O    3  
ATOM 3961  C CB   . TRP A 1 28  ? 5.538   -18.366 -5.997  1.00 0.00 ? 28  TRP A CB   3  
ATOM 3962  C CG   . TRP A 1 28  ? 4.863   -17.768 -7.194  1.00 0.00 ? 28  TRP A CG   3  
ATOM 3963  C CD1  . TRP A 1 28  ? 4.992   -18.168 -8.493  1.00 0.00 ? 28  TRP A CD1  3  
ATOM 3964  C CD2  . TRP A 1 28  ? 3.954   -16.662 -7.201  1.00 0.00 ? 28  TRP A CD2  3  
ATOM 3965  N NE1  . TRP A 1 28  ? 4.219   -17.377 -9.308  1.00 0.00 ? 28  TRP A NE1  3  
ATOM 3966  C CE2  . TRP A 1 28  ? 3.572   -16.446 -8.540  1.00 0.00 ? 28  TRP A CE2  3  
ATOM 3967  C CE3  . TRP A 1 28  ? 3.425   -15.833 -6.208  1.00 0.00 ? 28  TRP A CE3  3  
ATOM 3968  C CZ2  . TRP A 1 28  ? 2.687   -15.436 -8.907  1.00 0.00 ? 28  TRP A CZ2  3  
ATOM 3969  C CZ3  . TRP A 1 28  ? 2.547   -14.831 -6.574  1.00 0.00 ? 28  TRP A CZ3  3  
ATOM 3970  C CH2  . TRP A 1 28  ? 2.184   -14.640 -7.914  1.00 0.00 ? 28  TRP A CH2  3  
ATOM 3971  H H    . TRP A 1 28  ? 7.865   -19.635 -6.938  1.00 0.00 ? 28  TRP A H    3  
ATOM 3972  H HA   . TRP A 1 28  ? 7.128   -16.933 -6.021  1.00 0.00 ? 28  TRP A HA   3  
ATOM 3973  H HB2  . TRP A 1 28  ? 5.443   -19.439 -6.062  1.00 0.00 ? 28  TRP A HB2  3  
ATOM 3974  H HB3  . TRP A 1 28  ? 5.025   -18.015 -5.113  1.00 0.00 ? 28  TRP A HB3  3  
ATOM 3975  H HD1  . TRP A 1 28  ? 5.616   -18.987 -8.817  1.00 0.00 ? 28  TRP A HD1  3  
ATOM 3976  H HE1  . TRP A 1 28  ? 4.143   -17.467 -10.281 1.00 0.00 ? 28  TRP A HE1  3  
ATOM 3977  H HE3  . TRP A 1 28  ? 3.693   -15.965 -5.170  1.00 0.00 ? 28  TRP A HE3  3  
ATOM 3978  H HZ2  . TRP A 1 28  ? 2.396   -15.276 -9.935  1.00 0.00 ? 28  TRP A HZ2  3  
ATOM 3979  H HZ3  . TRP A 1 28  ? 2.128   -14.181 -5.820  1.00 0.00 ? 28  TRP A HZ3  3  
ATOM 3980  H HH2  . TRP A 1 28  ? 1.495   -13.845 -8.154  1.00 0.00 ? 28  TRP A HH2  3  
ATOM 3981  N N    . ASN A 1 29  ? 7.802   -17.382 -3.680  1.00 0.00 ? 29  ASN A N    3  
ATOM 3982  C CA   . ASN A 1 29  ? 8.316   -17.616 -2.335  1.00 0.00 ? 29  ASN A CA   3  
ATOM 3983  C C    . ASN A 1 29  ? 7.383   -17.022 -1.285  1.00 0.00 ? 29  ASN A C    3  
ATOM 3984  O O    . ASN A 1 29  ? 6.802   -15.955 -1.486  1.00 0.00 ? 29  ASN A O    3  
ATOM 3985  C CB   . ASN A 1 29  ? 9.715   -17.015 -2.190  1.00 0.00 ? 29  ASN A CB   3  
ATOM 3986  C CG   . ASN A 1 29  ? 9.805   -15.614 -2.762  1.00 0.00 ? 29  ASN A CG   3  
ATOM 3987  O OD1  . ASN A 1 29  ? 9.436   -14.639 -2.107  1.00 0.00 ? 29  ASN A OD1  3  
ATOM 3988  N ND2  . ASN A 1 29  ? 10.296  -15.507 -3.991  1.00 0.00 ? 29  ASN A ND2  3  
ATOM 3989  H H    . ASN A 1 29  ? 7.635   -16.462 -3.974  1.00 0.00 ? 29  ASN A H    3  
ATOM 3990  H HA   . ASN A 1 29  ? 8.375   -18.684 -2.185  1.00 0.00 ? 29  ASN A HA   3  
ATOM 3991  H HB2  . ASN A 1 29  ? 9.974   -16.972 -1.142  1.00 0.00 ? 29  ASN A HB2  3  
ATOM 3992  H HB3  . ASN A 1 29  ? 10.426  -17.642 -2.707  1.00 0.00 ? 29  ASN A HB3  3  
ATOM 3993  H HD21 . ASN A 1 29  ? 10.570  -16.327 -4.453  1.00 0.00 ? 29  ASN A HD21 3  
ATOM 3994  H HD22 . ASN A 1 29  ? 10.366  -14.612 -4.385  1.00 0.00 ? 29  ASN A HD22 3  
ATOM 3995  N N    . LYS A 1 30  ? 7.243   -17.719 -0.163  1.00 0.00 ? 30  LYS A N    3  
ATOM 3996  C CA   . LYS A 1 30  ? 6.383   -17.261 0.922   1.00 0.00 ? 30  LYS A CA   3  
ATOM 3997  C C    . LYS A 1 30  ? 7.123   -16.281 1.826   1.00 0.00 ? 30  LYS A C    3  
ATOM 3998  O O    . LYS A 1 30  ? 8.315   -16.441 2.086   1.00 0.00 ? 30  LYS A O    3  
ATOM 3999  C CB   . LYS A 1 30  ? 5.884   -18.453 1.743   1.00 0.00 ? 30  LYS A CB   3  
ATOM 4000  C CG   . LYS A 1 30  ? 4.800   -18.091 2.743   1.00 0.00 ? 30  LYS A CG   3  
ATOM 4001  C CD   . LYS A 1 30  ? 4.123   -19.330 3.305   1.00 0.00 ? 30  LYS A CD   3  
ATOM 4002  C CE   . LYS A 1 30  ? 3.446   -19.041 4.635   1.00 0.00 ? 30  LYS A CE   3  
ATOM 4003  N NZ   . LYS A 1 30  ? 3.318   -20.267 5.471   1.00 0.00 ? 30  LYS A NZ   3  
ATOM 4004  H H    . LYS A 1 30  ? 7.732   -18.563 -0.061  1.00 0.00 ? 30  LYS A H    3  
ATOM 4005  H HA   . LYS A 1 30  ? 5.535   -16.758 0.482   1.00 0.00 ? 30  LYS A HA   3  
ATOM 4006  H HB2  . LYS A 1 30  ? 5.489   -19.199 1.069   1.00 0.00 ? 30  LYS A HB2  3  
ATOM 4007  H HB3  . LYS A 1 30  ? 6.718   -18.875 2.285   1.00 0.00 ? 30  LYS A HB3  3  
ATOM 4008  H HG2  . LYS A 1 30  ? 5.244   -17.537 3.557   1.00 0.00 ? 30  LYS A HG2  3  
ATOM 4009  H HG3  . LYS A 1 30  ? 4.058   -17.478 2.250   1.00 0.00 ? 30  LYS A HG3  3  
ATOM 4010  H HD2  . LYS A 1 30  ? 3.379   -19.673 2.601   1.00 0.00 ? 30  LYS A HD2  3  
ATOM 4011  H HD3  . LYS A 1 30  ? 4.866   -20.101 3.449   1.00 0.00 ? 30  LYS A HD3  3  
ATOM 4012  H HE2  . LYS A 1 30  ? 4.031   -18.310 5.171   1.00 0.00 ? 30  LYS A HE2  3  
ATOM 4013  H HE3  . LYS A 1 30  ? 2.460   -18.642 4.443   1.00 0.00 ? 30  LYS A HE3  3  
ATOM 4014  H HZ1  . LYS A 1 30  ? 3.413   -20.024 6.478   1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 4015  H HZ2  . LYS A 1 30  ? 4.061   -20.949 5.219   1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 4016  H HZ3  . LYS A 1 30  ? 2.389   -20.708 5.318   1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 4017  N N    . ARG A 1 31  ? 6.407   -15.268 2.304   1.00 0.00 ? 31  ARG A N    3  
ATOM 4018  C CA   . ARG A 1 31  ? 6.996   -14.262 3.179   1.00 0.00 ? 31  ARG A CA   3  
ATOM 4019  C C    . ARG A 1 31  ? 5.914   -13.507 3.946   1.00 0.00 ? 31  ARG A C    3  
ATOM 4020  O O    . ARG A 1 31  ? 4.784   -13.376 3.476   1.00 0.00 ? 31  ARG A O    3  
ATOM 4021  C CB   . ARG A 1 31  ? 7.841   -13.279 2.366   1.00 0.00 ? 31  ARG A CB   3  
ATOM 4022  C CG   . ARG A 1 31  ? 9.010   -12.694 3.142   1.00 0.00 ? 31  ARG A CG   3  
ATOM 4023  C CD   . ARG A 1 31  ? 10.260  -13.545 2.991   1.00 0.00 ? 31  ARG A CD   3  
ATOM 4024  N NE   . ARG A 1 31  ? 10.744  -13.568 1.613   1.00 0.00 ? 31  ARG A NE   3  
ATOM 4025  C CZ   . ARG A 1 31  ? 11.919  -14.075 1.255   1.00 0.00 ? 31  ARG A CZ   3  
ATOM 4026  N NH1  . ARG A 1 31  ? 12.725  -14.599 2.168   1.00 0.00 ? 31  ARG A NH1  3  
ATOM 4027  N NH2  . ARG A 1 31  ? 12.289  -14.058 -0.019  1.00 0.00 ? 31  ARG A NH2  3  
ATOM 4028  H H    . ARG A 1 31  ? 5.461   -15.194 2.060   1.00 0.00 ? 31  ARG A H    3  
ATOM 4029  H HA   . ARG A 1 31  ? 7.634   -14.771 3.887   1.00 0.00 ? 31  ARG A HA   3  
ATOM 4030  H HB2  . ARG A 1 31  ? 8.233   -13.790 1.499   1.00 0.00 ? 31  ARG A HB2  3  
ATOM 4031  H HB3  . ARG A 1 31  ? 7.210   -12.466 2.040   1.00 0.00 ? 31  ARG A HB3  3  
ATOM 4032  H HG2  . ARG A 1 31  ? 9.216   -11.701 2.769   1.00 0.00 ? 31  ARG A HG2  3  
ATOM 4033  H HG3  . ARG A 1 31  ? 8.745   -12.640 4.187   1.00 0.00 ? 31  ARG A HG3  3  
ATOM 4034  H HD2  . ARG A 1 31  ? 11.034  -13.142 3.627   1.00 0.00 ? 31  ARG A HD2  3  
ATOM 4035  H HD3  . ARG A 1 31  ? 10.032  -14.555 3.299   1.00 0.00 ? 31  ARG A HD3  3  
ATOM 4036  H HE   . ARG A 1 31  ? 10.165  -13.186 0.922   1.00 0.00 ? 31  ARG A HE   3  
ATOM 4037  H HH11 . ARG A 1 31  ? 12.448  -14.613 3.129   1.00 0.00 ? 31  ARG A HH11 3  
ATOM 4038  H HH12 . ARG A 1 31  ? 13.608  -14.981 1.896   1.00 0.00 ? 31  ARG A HH12 3  
ATOM 4039  H HH21 . ARG A 1 31  ? 11.684  -13.664 -0.710  1.00 0.00 ? 31  ARG A HH21 3  
ATOM 4040  H HH22 . ARG A 1 31  ? 13.173  -14.440 -0.288  1.00 0.00 ? 31  ARG A HH22 3  
ATOM 4041  N N    . TRP A 1 32  ? 6.268   -13.014 5.127   1.00 0.00 ? 32  TRP A N    3  
ATOM 4042  C CA   . TRP A 1 32  ? 5.327   -12.272 5.958   1.00 0.00 ? 32  TRP A CA   3  
ATOM 4043  C C    . TRP A 1 32  ? 5.171   -10.840 5.460   1.00 0.00 ? 32  TRP A C    3  
ATOM 4044  O O    . TRP A 1 32  ? 6.148   -10.097 5.361   1.00 0.00 ? 32  TRP A O    3  
ATOM 4045  C CB   . TRP A 1 32  ? 5.794   -12.270 7.415   1.00 0.00 ? 32  TRP A CB   3  
ATOM 4046  C CG   . TRP A 1 32  ? 4.767   -11.735 8.367   1.00 0.00 ? 32  TRP A CG   3  
ATOM 4047  C CD1  . TRP A 1 32  ? 4.922   -10.696 9.240   1.00 0.00 ? 32  TRP A CD1  3  
ATOM 4048  C CD2  . TRP A 1 32  ? 3.429   -12.213 8.542   1.00 0.00 ? 32  TRP A CD2  3  
ATOM 4049  N NE1  . TRP A 1 32  ? 3.761   -10.500 9.948   1.00 0.00 ? 32  TRP A NE1  3  
ATOM 4050  C CE2  . TRP A 1 32  ? 2.830   -11.416 9.538   1.00 0.00 ? 32  TRP A CE2  3  
ATOM 4051  C CE3  . TRP A 1 32  ? 2.678   -13.234 7.954   1.00 0.00 ? 32  TRP A CE3  3  
ATOM 4052  C CZ2  . TRP A 1 32  ? 1.516   -11.612 9.956   1.00 0.00 ? 32  TRP A CZ2  3  
ATOM 4053  C CZ3  . TRP A 1 32  ? 1.375   -13.427 8.371   1.00 0.00 ? 32  TRP A CZ3  3  
ATOM 4054  C CH2  . TRP A 1 32  ? 0.805   -12.620 9.363   1.00 0.00 ? 32  TRP A CH2  3  
ATOM 4055  H H    . TRP A 1 32  ? 7.184   -13.151 5.447   1.00 0.00 ? 32  TRP A H    3  
ATOM 4056  H HA   . TRP A 1 32  ? 4.370   -12.769 5.897   1.00 0.00 ? 32  TRP A HA   3  
ATOM 4057  H HB2  . TRP A 1 32  ? 6.029   -13.281 7.713   1.00 0.00 ? 32  TRP A HB2  3  
ATOM 4058  H HB3  . TRP A 1 32  ? 6.680   -11.659 7.500   1.00 0.00 ? 32  TRP A HB3  3  
ATOM 4059  H HD1  . TRP A 1 32  ? 5.831   -10.124 9.349   1.00 0.00 ? 32  TRP A HD1  3  
ATOM 4060  H HE1  . TRP A 1 32  ? 3.622   -9.813  10.634  1.00 0.00 ? 32  TRP A HE1  3  
ATOM 4061  H HE3  . TRP A 1 32  ? 3.101   -13.867 7.187   1.00 0.00 ? 32  TRP A HE3  3  
ATOM 4062  H HZ2  . TRP A 1 32  ? 1.062   -10.998 10.720  1.00 0.00 ? 32  TRP A HZ2  3  
ATOM 4063  H HZ3  . TRP A 1 32  ? 0.780   -14.212 7.928   1.00 0.00 ? 32  TRP A HZ3  3  
ATOM 4064  H HH2  . TRP A 1 32  ? -0.217  -12.807 9.658   1.00 0.00 ? 32  TRP A HH2  3  
ATOM 4065  N N    . PHE A 1 33  ? 3.937   -10.458 5.146   1.00 0.00 ? 33  PHE A N    3  
ATOM 4066  C CA   . PHE A 1 33  ? 3.654   -9.114  4.657   1.00 0.00 ? 33  PHE A CA   3  
ATOM 4067  C C    . PHE A 1 33  ? 2.795   -8.342  5.654   1.00 0.00 ? 33  PHE A C    3  
ATOM 4068  O O    . PHE A 1 33  ? 1.894   -8.902  6.279   1.00 0.00 ? 33  PHE A O    3  
ATOM 4069  C CB   . PHE A 1 33  ? 2.947   -9.180  3.302   1.00 0.00 ? 33  PHE A CB   3  
ATOM 4070  C CG   . PHE A 1 33  ? 3.886   -9.366  2.144   1.00 0.00 ? 33  PHE A CG   3  
ATOM 4071  C CD1  . PHE A 1 33  ? 4.249   -10.636 1.726   1.00 0.00 ? 33  PHE A CD1  3  
ATOM 4072  C CD2  . PHE A 1 33  ? 4.406   -8.270  1.474   1.00 0.00 ? 33  PHE A CD2  3  
ATOM 4073  C CE1  . PHE A 1 33  ? 5.113   -10.810 0.661   1.00 0.00 ? 33  PHE A CE1  3  
ATOM 4074  C CE2  . PHE A 1 33  ? 5.270   -8.438  0.409   1.00 0.00 ? 33  PHE A CE2  3  
ATOM 4075  C CZ   . PHE A 1 33  ? 5.625   -9.710  0.002   1.00 0.00 ? 33  PHE A CZ   3  
ATOM 4076  H H    . PHE A 1 33  ? 3.200   -11.096 5.246   1.00 0.00 ? 33  PHE A H    3  
ATOM 4077  H HA   . PHE A 1 33  ? 4.595   -8.601  4.538   1.00 0.00 ? 33  PHE A HA   3  
ATOM 4078  H HB2  . PHE A 1 33  ? 2.256   -10.010 3.304   1.00 0.00 ? 33  PHE A HB2  3  
ATOM 4079  H HB3  . PHE A 1 33  ? 2.401   -8.263  3.144   1.00 0.00 ? 33  PHE A HB3  3  
ATOM 4080  H HD1  . PHE A 1 33  ? 3.850   -11.498 2.242   1.00 0.00 ? 33  PHE A HD1  3  
ATOM 4081  H HD2  . PHE A 1 33  ? 4.130   -7.275  1.791   1.00 0.00 ? 33  PHE A HD2  3  
ATOM 4082  H HE1  . PHE A 1 33  ? 5.388   -11.806 0.347   1.00 0.00 ? 33  PHE A HE1  3  
ATOM 4083  H HE2  . PHE A 1 33  ? 5.668   -7.576  -0.105  1.00 0.00 ? 33  PHE A HE2  3  
ATOM 4084  H HZ   . PHE A 1 33  ? 6.299   -9.844  -0.830  1.00 0.00 ? 33  PHE A HZ   3  
ATOM 4085  N N    . VAL A 1 34  ? 3.081   -7.052  5.799   1.00 0.00 ? 34  VAL A N    3  
ATOM 4086  C CA   . VAL A 1 34  ? 2.336   -6.202  6.719   1.00 0.00 ? 34  VAL A CA   3  
ATOM 4087  C C    . VAL A 1 34  ? 2.084   -4.825  6.114   1.00 0.00 ? 34  VAL A C    3  
ATOM 4088  O O    . VAL A 1 34  ? 2.995   -4.003  6.011   1.00 0.00 ? 34  VAL A O    3  
ATOM 4089  C CB   . VAL A 1 34  ? 3.081   -6.034  8.056   1.00 0.00 ? 34  VAL A CB   3  
ATOM 4090  C CG1  . VAL A 1 34  ? 2.318   -5.095  8.978   1.00 0.00 ? 34  VAL A CG1  3  
ATOM 4091  C CG2  . VAL A 1 34  ? 3.297   -7.386  8.719   1.00 0.00 ? 34  VAL A CG2  3  
ATOM 4092  H H    . VAL A 1 34  ? 3.811   -6.663  5.273   1.00 0.00 ? 34  VAL A H    3  
ATOM 4093  H HA   . VAL A 1 34  ? 1.386   -6.677  6.917   1.00 0.00 ? 34  VAL A HA   3  
ATOM 4094  H HB   . VAL A 1 34  ? 4.048   -5.597  7.854   1.00 0.00 ? 34  VAL A HB   3  
ATOM 4095  H HG11 . VAL A 1 34  ? 2.947   -4.821  9.813   1.00 0.00 ? 34  VAL A HG11 3  
ATOM 4096  H HG12 . VAL A 1 34  ? 2.034   -4.206  8.433   1.00 0.00 ? 34  VAL A HG12 3  
ATOM 4097  H HG13 . VAL A 1 34  ? 1.432   -5.592  9.344   1.00 0.00 ? 34  VAL A HG13 3  
ATOM 4098  H HG21 . VAL A 1 34  ? 2.991   -8.170  8.043   1.00 0.00 ? 34  VAL A HG21 3  
ATOM 4099  H HG22 . VAL A 1 34  ? 4.344   -7.506  8.959   1.00 0.00 ? 34  VAL A HG22 3  
ATOM 4100  H HG23 . VAL A 1 34  ? 2.712   -7.441  9.625   1.00 0.00 ? 34  VAL A HG23 3  
ATOM 4101  N N    . LEU A 1 35  ? 0.841   -4.580  5.714   1.00 0.00 ? 35  LEU A N    3  
ATOM 4102  C CA   . LEU A 1 35  ? 0.467   -3.302  5.118   1.00 0.00 ? 35  LEU A CA   3  
ATOM 4103  C C    . LEU A 1 35  ? 0.559   -2.176  6.143   1.00 0.00 ? 35  LEU A C    3  
ATOM 4104  O O    . LEU A 1 35  ? -0.184  -2.152  7.124   1.00 0.00 ? 35  LEU A O    3  
ATOM 4105  C CB   . LEU A 1 35  ? -0.952  -3.376  4.552   1.00 0.00 ? 35  LEU A CB   3  
ATOM 4106  C CG   . LEU A 1 35  ? -1.572  -2.047  4.119   1.00 0.00 ? 35  LEU A CG   3  
ATOM 4107  C CD1  . LEU A 1 35  ? -0.725  -1.388  3.042   1.00 0.00 ? 35  LEU A CD1  3  
ATOM 4108  C CD2  . LEU A 1 35  ? -2.996  -2.259  3.625   1.00 0.00 ? 35  LEU A CD2  3  
ATOM 4109  H H    . LEU A 1 35  ? 0.158   -5.274  5.821   1.00 0.00 ? 35  LEU A H    3  
ATOM 4110  H HA   . LEU A 1 35  ? 1.157   -3.097  4.313   1.00 0.00 ? 35  LEU A HA   3  
ATOM 4111  H HB2  . LEU A 1 35  ? -0.930  -4.026  3.691   1.00 0.00 ? 35  LEU A HB2  3  
ATOM 4112  H HB3  . LEU A 1 35  ? -1.588  -3.808  5.311   1.00 0.00 ? 35  LEU A HB3  3  
ATOM 4113  H HG   . LEU A 1 35  ? -1.608  -1.380  4.969   1.00 0.00 ? 35  LEU A HG   3  
ATOM 4114  H HD11 . LEU A 1 35  ? -1.226  -1.470  2.089   1.00 0.00 ? 35  LEU A HD11 3  
ATOM 4115  H HD12 . LEU A 1 35  ? 0.235   -1.880  2.987   1.00 0.00 ? 35  LEU A HD12 3  
ATOM 4116  H HD13 . LEU A 1 35  ? -0.580  -0.345  3.285   1.00 0.00 ? 35  LEU A HD13 3  
ATOM 4117  H HD21 . LEU A 1 35  ? -3.391  -1.324  3.256   1.00 0.00 ? 35  LEU A HD21 3  
ATOM 4118  H HD22 . LEU A 1 35  ? -3.611  -2.613  4.440   1.00 0.00 ? 35  LEU A HD22 3  
ATOM 4119  H HD23 . LEU A 1 35  ? -2.996  -2.989  2.829   1.00 0.00 ? 35  LEU A HD23 3  
ATOM 4120  N N    . VAL A 1 36  ? 1.476   -1.242  5.908   1.00 0.00 ? 36  VAL A N    3  
ATOM 4121  C CA   . VAL A 1 36  ? 1.663   -0.111  6.809   1.00 0.00 ? 36  VAL A CA   3  
ATOM 4122  C C    . VAL A 1 36  ? 1.078   1.166   6.217   1.00 0.00 ? 36  VAL A C    3  
ATOM 4123  O O    . VAL A 1 36  ? 0.439   1.139   5.165   1.00 0.00 ? 36  VAL A O    3  
ATOM 4124  C CB   . VAL A 1 36  ? 3.154   0.117   7.121   1.00 0.00 ? 36  VAL A CB   3  
ATOM 4125  C CG1  . VAL A 1 36  ? 3.777   1.055   6.098   1.00 0.00 ? 36  VAL A CG1  3  
ATOM 4126  C CG2  . VAL A 1 36  ? 3.326   0.663   8.531   1.00 0.00 ? 36  VAL A CG2  3  
ATOM 4127  H H    . VAL A 1 36  ? 2.039   -1.315  5.110   1.00 0.00 ? 36  VAL A H    3  
ATOM 4128  H HA   . VAL A 1 36  ? 1.153   -0.334  7.735   1.00 0.00 ? 36  VAL A HA   3  
ATOM 4129  H HB   . VAL A 1 36  ? 3.663   -0.834  7.061   1.00 0.00 ? 36  VAL A HB   3  
ATOM 4130  H HG11 . VAL A 1 36  ? 3.181   1.051   5.197   1.00 0.00 ? 36  VAL A HG11 3  
ATOM 4131  H HG12 . VAL A 1 36  ? 3.813   2.056   6.502   1.00 0.00 ? 36  VAL A HG12 3  
ATOM 4132  H HG13 . VAL A 1 36  ? 4.778   0.723   5.868   1.00 0.00 ? 36  VAL A HG13 3  
ATOM 4133  H HG21 . VAL A 1 36  ? 2.363   0.712   9.016   1.00 0.00 ? 36  VAL A HG21 3  
ATOM 4134  H HG22 . VAL A 1 36  ? 3.980   0.011   9.092   1.00 0.00 ? 36  VAL A HG22 3  
ATOM 4135  H HG23 . VAL A 1 36  ? 3.757   1.651   8.484   1.00 0.00 ? 36  VAL A HG23 3  
ATOM 4136  N N    . ASP A 1 37  ? 1.301   2.284   6.899   1.00 0.00 ? 37  ASP A N    3  
ATOM 4137  C CA   . ASP A 1 37  ? 0.797   3.573   6.439   1.00 0.00 ? 37  ASP A CA   3  
ATOM 4138  C C    . ASP A 1 37  ? 1.234   3.847   5.004   1.00 0.00 ? 37  ASP A C    3  
ATOM 4139  O O    . ASP A 1 37  ? 2.427   3.936   4.714   1.00 0.00 ? 37  ASP A O    3  
ATOM 4140  C CB   . ASP A 1 37  ? 1.288   4.693   7.358   1.00 0.00 ? 37  ASP A CB   3  
ATOM 4141  C CG   . ASP A 1 37  ? 0.363   4.922   8.537   1.00 0.00 ? 37  ASP A CG   3  
ATOM 4142  O OD1  . ASP A 1 37  ? -0.306  3.957   8.963   1.00 0.00 ? 37  ASP A OD1  3  
ATOM 4143  O OD2  . ASP A 1 37  ? 0.310   6.066   9.035   1.00 0.00 ? 37  ASP A OD2  3  
ATOM 4144  H H    . ASP A 1 37  ? 1.817   2.241   7.731   1.00 0.00 ? 37  ASP A H    3  
ATOM 4145  H HA   . ASP A 1 37  ? -0.281  3.539   6.474   1.00 0.00 ? 37  ASP A HA   3  
ATOM 4146  H HB2  . ASP A 1 37  ? 2.267   4.437   7.736   1.00 0.00 ? 37  ASP A HB2  3  
ATOM 4147  H HB3  . ASP A 1 37  ? 1.355   5.611   6.792   1.00 0.00 ? 37  ASP A HB3  3  
ATOM 4148  N N    . ARG A 1 38  ? 0.260   3.979   4.109   1.00 0.00 ? 38  ARG A N    3  
ATOM 4149  C CA   . ARG A 1 38  ? 0.545   4.240   2.703   1.00 0.00 ? 38  ARG A CA   3  
ATOM 4150  C C    . ARG A 1 38  ? 1.829   3.540   2.269   1.00 0.00 ? 38  ARG A C    3  
ATOM 4151  O O    . ARG A 1 38  ? 2.640   4.108   1.536   1.00 0.00 ? 38  ARG A O    3  
ATOM 4152  C CB   . ARG A 1 38  ? 0.663   5.745   2.456   1.00 0.00 ? 38  ARG A CB   3  
ATOM 4153  C CG   . ARG A 1 38  ? -0.668  6.478   2.513   1.00 0.00 ? 38  ARG A CG   3  
ATOM 4154  C CD   . ARG A 1 38  ? -0.671  7.698   1.606   1.00 0.00 ? 38  ARG A CD   3  
ATOM 4155  N NE   . ARG A 1 38  ? -0.204  8.896   2.297   1.00 0.00 ? 38  ARG A NE   3  
ATOM 4156  C CZ   . ARG A 1 38  ? -0.904  9.524   3.235   1.00 0.00 ? 38  ARG A CZ   3  
ATOM 4157  N NH1  . ARG A 1 38  ? -2.097  9.069   3.593   1.00 0.00 ? 38  ARG A NH1  3  
ATOM 4158  N NH2  . ARG A 1 38  ? -0.411  10.609  3.819   1.00 0.00 ? 38  ARG A NH2  3  
ATOM 4159  H H    . ARG A 1 38  ? -0.672  3.897   4.401   1.00 0.00 ? 38  ARG A H    3  
ATOM 4160  H HA   . ARG A 1 38  ? -0.277  3.852   2.121   1.00 0.00 ? 38  ARG A HA   3  
ATOM 4161  H HB2  . ARG A 1 38  ? 1.315   6.171   3.204   1.00 0.00 ? 38  ARG A HB2  3  
ATOM 4162  H HB3  . ARG A 1 38  ? 1.095   5.905   1.480   1.00 0.00 ? 38  ARG A HB3  3  
ATOM 4163  H HG2  . ARG A 1 38  ? -1.452  5.806   2.198   1.00 0.00 ? 38  ARG A HG2  3  
ATOM 4164  H HG3  . ARG A 1 38  ? -0.850  6.795   3.529   1.00 0.00 ? 38  ARG A HG3  3  
ATOM 4165  H HD2  . ARG A 1 38  ? -0.025  7.505   0.763   1.00 0.00 ? 38  ARG A HD2  3  
ATOM 4166  H HD3  . ARG A 1 38  ? -1.679  7.866   1.255   1.00 0.00 ? 38  ARG A HD3  3  
ATOM 4167  H HE   . ARG A 1 38  ? 0.675   9.250   2.048   1.00 0.00 ? 38  ARG A HE   3  
ATOM 4168  H HH11 . ARG A 1 38  ? -2.470  8.251   3.156   1.00 0.00 ? 38  ARG A HH11 3  
ATOM 4169  H HH12 . ARG A 1 38  ? -2.621  9.542   4.301   1.00 0.00 ? 38  ARG A HH12 3  
ATOM 4170  H HH21 . ARG A 1 38  ? 0.489   10.954  3.552   1.00 0.00 ? 38  ARG A HH21 3  
ATOM 4171  H HH22 . ARG A 1 38  ? -0.938  11.080  4.525   1.00 0.00 ? 38  ARG A HH22 3  
ATOM 4172  N N    . CYS A 1 39  ? 2.008   2.306   2.726   1.00 0.00 ? 39  CYS A N    3  
ATOM 4173  C CA   . CYS A 1 39  ? 3.194   1.529   2.386   1.00 0.00 ? 39  CYS A CA   3  
ATOM 4174  C C    . CYS A 1 39  ? 3.057   0.088   2.868   1.00 0.00 ? 39  CYS A C    3  
ATOM 4175  O O    . CYS A 1 39  ? 2.201   -0.222  3.697   1.00 0.00 ? 39  CYS A O    3  
ATOM 4176  C CB   . CYS A 1 39  ? 4.441   2.168   3.000   1.00 0.00 ? 39  CYS A CB   3  
ATOM 4177  S SG   . CYS A 1 39  ? 5.948   1.926   2.030   1.00 0.00 ? 39  CYS A SG   3  
ATOM 4178  H H    . CYS A 1 39  ? 1.326   1.907   3.306   1.00 0.00 ? 39  CYS A H    3  
ATOM 4179  H HA   . CYS A 1 39  ? 3.292   1.528   1.311   1.00 0.00 ? 39  CYS A HA   3  
ATOM 4180  H HB2  . CYS A 1 39  ? 4.281   3.232   3.096   1.00 0.00 ? 39  CYS A HB2  3  
ATOM 4181  H HB3  . CYS A 1 39  ? 4.607   1.746   3.980   1.00 0.00 ? 39  CYS A HB3  3  
ATOM 4182  H HG   . CYS A 1 39  ? 6.535   0.818   2.458   1.00 0.00 ? 39  CYS A HG   3  
ATOM 4183  N N    . LEU A 1 40  ? 3.904   -0.789  2.341   1.00 0.00 ? 40  LEU A N    3  
ATOM 4184  C CA   . LEU A 1 40  ? 3.877   -2.199  2.716   1.00 0.00 ? 40  LEU A CA   3  
ATOM 4185  C C    . LEU A 1 40  ? 5.286   -2.719  2.979   1.00 0.00 ? 40  LEU A C    3  
ATOM 4186  O O    . LEU A 1 40  ? 6.226   -2.394  2.253   1.00 0.00 ? 40  LEU A O    3  
ATOM 4187  C CB   . LEU A 1 40  ? 3.212   -3.027  1.615   1.00 0.00 ? 40  LEU A CB   3  
ATOM 4188  C CG   . LEU A 1 40  ? 3.297   -4.545  1.773   1.00 0.00 ? 40  LEU A CG   3  
ATOM 4189  C CD1  . LEU A 1 40  ? 2.546   -4.994  3.017   1.00 0.00 ? 40  LEU A CD1  3  
ATOM 4190  C CD2  . LEU A 1 40  ? 2.748   -5.242  0.536   1.00 0.00 ? 40  LEU A CD2  3  
ATOM 4191  H H    . LEU A 1 40  ? 4.564   -0.483  1.685   1.00 0.00 ? 40  LEU A H    3  
ATOM 4192  H HA   . LEU A 1 40  ? 3.297   -2.289  3.623   1.00 0.00 ? 40  LEU A HA   3  
ATOM 4193  H HB2  . LEU A 1 40  ? 2.169   -2.755  1.581   1.00 0.00 ? 40  LEU A HB2  3  
ATOM 4194  H HB3  . LEU A 1 40  ? 3.681   -2.764  0.677   1.00 0.00 ? 40  LEU A HB3  3  
ATOM 4195  H HG   . LEU A 1 40  ? 4.333   -4.832  1.888   1.00 0.00 ? 40  LEU A HG   3  
ATOM 4196  H HD11 . LEU A 1 40  ? 2.789   -4.341  3.841   1.00 0.00 ? 40  LEU A HD11 3  
ATOM 4197  H HD12 . LEU A 1 40  ? 2.831   -6.006  3.264   1.00 0.00 ? 40  LEU A HD12 3  
ATOM 4198  H HD13 . LEU A 1 40  ? 1.482   -4.956  2.829   1.00 0.00 ? 40  LEU A HD13 3  
ATOM 4199  H HD21 . LEU A 1 40  ? 1.707   -5.482  0.691   1.00 0.00 ? 40  LEU A HD21 3  
ATOM 4200  H HD22 . LEU A 1 40  ? 3.305   -6.151  0.359   1.00 0.00 ? 40  LEU A HD22 3  
ATOM 4201  H HD23 . LEU A 1 40  ? 2.844   -4.588  -0.317  1.00 0.00 ? 40  LEU A HD23 3  
ATOM 4202  N N    . PHE A 1 41  ? 5.426   -3.532  4.021   1.00 0.00 ? 41  PHE A N    3  
ATOM 4203  C CA   . PHE A 1 41  ? 6.721   -4.100  4.380   1.00 0.00 ? 41  PHE A CA   3  
ATOM 4204  C C    . PHE A 1 41  ? 6.626   -5.615  4.537   1.00 0.00 ? 41  PHE A C    3  
ATOM 4205  O O    . PHE A 1 41  ? 5.567   -6.150  4.865   1.00 0.00 ? 41  PHE A O    3  
ATOM 4206  C CB   . PHE A 1 41  ? 7.234   -3.472  5.677   1.00 0.00 ? 41  PHE A CB   3  
ATOM 4207  C CG   . PHE A 1 41  ? 7.680   -2.047  5.518   1.00 0.00 ? 41  PHE A CG   3  
ATOM 4208  C CD1  . PHE A 1 41  ? 8.877   -1.748  4.888   1.00 0.00 ? 41  PHE A CD1  3  
ATOM 4209  C CD2  . PHE A 1 41  ? 6.903   -1.006  5.999   1.00 0.00 ? 41  PHE A CD2  3  
ATOM 4210  C CE1  . PHE A 1 41  ? 9.290   -0.437  4.741   1.00 0.00 ? 41  PHE A CE1  3  
ATOM 4211  C CE2  . PHE A 1 41  ? 7.310   0.307   5.855   1.00 0.00 ? 41  PHE A CE2  3  
ATOM 4212  C CZ   . PHE A 1 41  ? 8.506   0.591   5.224   1.00 0.00 ? 41  PHE A CZ   3  
ATOM 4213  H H    . PHE A 1 41  ? 4.639   -3.755  4.562   1.00 0.00 ? 41  PHE A H    3  
ATOM 4214  H HA   . PHE A 1 41  ? 7.412   -3.875  3.583   1.00 0.00 ? 41  PHE A HA   3  
ATOM 4215  H HB2  . PHE A 1 41  ? 6.446   -3.492  6.415   1.00 0.00 ? 41  PHE A HB2  3  
ATOM 4216  H HB3  . PHE A 1 41  ? 8.075   -4.046  6.038   1.00 0.00 ? 41  PHE A HB3  3  
ATOM 4217  H HD1  . PHE A 1 41  ? 9.492   -2.551  4.508   1.00 0.00 ? 41  PHE A HD1  3  
ATOM 4218  H HD2  . PHE A 1 41  ? 5.967   -1.228  6.493   1.00 0.00 ? 41  PHE A HD2  3  
ATOM 4219  H HE1  . PHE A 1 41  ? 10.225  -0.217  4.247   1.00 0.00 ? 41  PHE A HE1  3  
ATOM 4220  H HE2  . PHE A 1 41  ? 6.694   1.109   6.234   1.00 0.00 ? 41  PHE A HE2  3  
ATOM 4221  H HZ   . PHE A 1 41  ? 8.826   1.616   5.111   1.00 0.00 ? 41  PHE A HZ   3  
ATOM 4222  N N    . TYR A 1 42  ? 7.739   -6.299  4.300   1.00 0.00 ? 42  TYR A N    3  
ATOM 4223  C CA   . TYR A 1 42  ? 7.782   -7.752  4.411   1.00 0.00 ? 42  TYR A CA   3  
ATOM 4224  C C    . TYR A 1 42  ? 8.961   -8.198  5.270   1.00 0.00 ? 42  TYR A C    3  
ATOM 4225  O O    . TYR A 1 42  ? 10.032  -7.591  5.238   1.00 0.00 ? 42  TYR A O    3  
ATOM 4226  C CB   . TYR A 1 42  ? 7.878   -8.388  3.024   1.00 0.00 ? 42  TYR A CB   3  
ATOM 4227  C CG   . TYR A 1 42  ? 9.188   -8.114  2.321   1.00 0.00 ? 42  TYR A CG   3  
ATOM 4228  C CD1  . TYR A 1 42  ? 10.292  -8.933  2.522   1.00 0.00 ? 42  TYR A CD1  3  
ATOM 4229  C CD2  . TYR A 1 42  ? 9.321   -7.036  1.455   1.00 0.00 ? 42  TYR A CD2  3  
ATOM 4230  C CE1  . TYR A 1 42  ? 11.491  -8.685  1.882   1.00 0.00 ? 42  TYR A CE1  3  
ATOM 4231  C CE2  . TYR A 1 42  ? 10.516  -6.781  0.809   1.00 0.00 ? 42  TYR A CE2  3  
ATOM 4232  C CZ   . TYR A 1 42  ? 11.598  -7.609  1.027   1.00 0.00 ? 42  TYR A CZ   3  
ATOM 4233  O OH   . TYR A 1 42  ? 12.791  -7.360  0.387   1.00 0.00 ? 42  TYR A OH   3  
ATOM 4234  H H    . TYR A 1 42  ? 8.552   -5.815  4.041   1.00 0.00 ? 42  TYR A H    3  
ATOM 4235  H HA   . TYR A 1 42  ? 6.865   -8.075  4.883   1.00 0.00 ? 42  TYR A HA   3  
ATOM 4236  H HB2  . TYR A 1 42  ? 7.770   -9.458  3.118   1.00 0.00 ? 42  TYR A HB2  3  
ATOM 4237  H HB3  . TYR A 1 42  ? 7.081   -8.004  2.403   1.00 0.00 ? 42  TYR A HB3  3  
ATOM 4238  H HD1  . TYR A 1 42  ? 10.204  -9.776  3.192   1.00 0.00 ? 42  TYR A HD1  3  
ATOM 4239  H HD2  . TYR A 1 42  ? 8.472   -6.389  1.286   1.00 0.00 ? 42  TYR A HD2  3  
ATOM 4240  H HE1  . TYR A 1 42  ? 12.338  -9.334  2.052   1.00 0.00 ? 42  TYR A HE1  3  
ATOM 4241  H HE2  . TYR A 1 42  ? 10.601  -5.938  0.140   1.00 0.00 ? 42  TYR A HE2  3  
ATOM 4242  H HH   . TYR A 1 42  ? 12.983  -8.077  -0.222  1.00 0.00 ? 42  TYR A HH   3  
ATOM 4243  N N    . TYR A 1 43  ? 8.757   -9.262  6.037   1.00 0.00 ? 43  TYR A N    3  
ATOM 4244  C CA   . TYR A 1 43  ? 9.801   -9.790  6.907   1.00 0.00 ? 43  TYR A CA   3  
ATOM 4245  C C    . TYR A 1 43  ? 9.911   -11.305 6.769   1.00 0.00 ? 43  TYR A C    3  
ATOM 4246  O O    . TYR A 1 43  ? 8.951   -11.978 6.392   1.00 0.00 ? 43  TYR A O    3  
ATOM 4247  C CB   . TYR A 1 43  ? 9.518   -9.419  8.364   1.00 0.00 ? 43  TYR A CB   3  
ATOM 4248  C CG   . TYR A 1 43  ? 8.959   -8.024  8.535   1.00 0.00 ? 43  TYR A CG   3  
ATOM 4249  C CD1  . TYR A 1 43  ? 7.690   -7.700  8.069   1.00 0.00 ? 43  TYR A CD1  3  
ATOM 4250  C CD2  . TYR A 1 43  ? 9.699   -7.031  9.163   1.00 0.00 ? 43  TYR A CD2  3  
ATOM 4251  C CE1  . TYR A 1 43  ? 7.176   -6.427  8.223   1.00 0.00 ? 43  TYR A CE1  3  
ATOM 4252  C CE2  . TYR A 1 43  ? 9.193   -5.755  9.323   1.00 0.00 ? 43  TYR A CE2  3  
ATOM 4253  C CZ   . TYR A 1 43  ? 7.931   -5.458  8.851   1.00 0.00 ? 43  TYR A CZ   3  
ATOM 4254  O OH   . TYR A 1 43  ? 7.422   -4.190  9.007   1.00 0.00 ? 43  TYR A OH   3  
ATOM 4255  H H    . TYR A 1 43  ? 7.882   -9.704  6.020   1.00 0.00 ? 43  TYR A H    3  
ATOM 4256  H HA   . TYR A 1 43  ? 10.739  -9.344  6.608   1.00 0.00 ? 43  TYR A HA   3  
ATOM 4257  H HB2  . TYR A 1 43  ? 8.801   -10.115 8.772   1.00 0.00 ? 43  TYR A HB2  3  
ATOM 4258  H HB3  . TYR A 1 43  ? 10.436  -9.480  8.929   1.00 0.00 ? 43  TYR A HB3  3  
ATOM 4259  H HD1  . TYR A 1 43  ? 7.102   -8.462  7.579   1.00 0.00 ? 43  TYR A HD1  3  
ATOM 4260  H HD2  . TYR A 1 43  ? 10.687  -7.266  9.532   1.00 0.00 ? 43  TYR A HD2  3  
ATOM 4261  H HE1  . TYR A 1 43  ? 6.189   -6.195  7.854   1.00 0.00 ? 43  TYR A HE1  3  
ATOM 4262  H HE2  . TYR A 1 43  ? 9.784   -4.996  9.814   1.00 0.00 ? 43  TYR A HE2  3  
ATOM 4263  H HH   . TYR A 1 43  ? 6.527   -4.244  9.350   1.00 0.00 ? 43  TYR A HH   3  
ATOM 4264  N N    . LYS A 1 44  ? 11.089  -11.837 7.078   1.00 0.00 ? 44  LYS A N    3  
ATOM 4265  C CA   . LYS A 1 44  ? 11.327  -13.273 6.991   1.00 0.00 ? 44  LYS A CA   3  
ATOM 4266  C C    . LYS A 1 44  ? 10.112  -14.056 7.476   1.00 0.00 ? 44  LYS A C    3  
ATOM 4267  O O    . LYS A 1 44  ? 9.650   -14.981 6.807   1.00 0.00 ? 44  LYS A O    3  
ATOM 4268  C CB   . LYS A 1 44  ? 12.557  -13.657 7.817   1.00 0.00 ? 44  LYS A CB   3  
ATOM 4269  C CG   . LYS A 1 44  ? 13.758  -12.760 7.573   1.00 0.00 ? 44  LYS A CG   3  
ATOM 4270  C CD   . LYS A 1 44  ? 15.064  -13.512 7.762   1.00 0.00 ? 44  LYS A CD   3  
ATOM 4271  C CE   . LYS A 1 44  ? 16.223  -12.798 7.083   1.00 0.00 ? 44  LYS A CE   3  
ATOM 4272  N NZ   . LYS A 1 44  ? 16.513  -11.483 7.720   1.00 0.00 ? 44  LYS A NZ   3  
ATOM 4273  H H    . LYS A 1 44  ? 11.816  -11.249 7.372   1.00 0.00 ? 44  LYS A H    3  
ATOM 4274  H HA   . LYS A 1 44  ? 11.508  -13.517 5.956   1.00 0.00 ? 44  LYS A HA   3  
ATOM 4275  H HB2  . LYS A 1 44  ? 12.303  -13.607 8.865   1.00 0.00 ? 44  LYS A HB2  3  
ATOM 4276  H HB3  . LYS A 1 44  ? 12.837  -14.672 7.572   1.00 0.00 ? 44  LYS A HB3  3  
ATOM 4277  H HG2  . LYS A 1 44  ? 13.715  -12.383 6.562   1.00 0.00 ? 44  LYS A HG2  3  
ATOM 4278  H HG3  . LYS A 1 44  ? 13.725  -11.933 8.269   1.00 0.00 ? 44  LYS A HG3  3  
ATOM 4279  H HD2  . LYS A 1 44  ? 15.275  -13.592 8.818   1.00 0.00 ? 44  LYS A HD2  3  
ATOM 4280  H HD3  . LYS A 1 44  ? 14.965  -14.502 7.338   1.00 0.00 ? 44  LYS A HD3  3  
ATOM 4281  H HE2  . LYS A 1 44  ? 17.101  -13.421 7.148   1.00 0.00 ? 44  LYS A HE2  3  
ATOM 4282  H HE3  . LYS A 1 44  ? 15.971  -12.638 6.045   1.00 0.00 ? 44  LYS A HE3  3  
ATOM 4283  H HZ1  . LYS A 1 44  ? 15.650  -10.903 7.750   1.00 0.00 ? 44  LYS A HZ1  3  
ATOM 4284  H HZ2  . LYS A 1 44  ? 17.239  -10.975 7.176   1.00 0.00 ? 44  LYS A HZ2  3  
ATOM 4285  H HZ3  . LYS A 1 44  ? 16.858  -11.624 8.691   1.00 0.00 ? 44  LYS A HZ3  3  
ATOM 4286  N N    . ASP A 1 45  ? 9.597   -13.680 8.642   1.00 0.00 ? 45  ASP A N    3  
ATOM 4287  C CA   . ASP A 1 45  ? 8.433   -14.346 9.215   1.00 0.00 ? 45  ASP A CA   3  
ATOM 4288  C C    . ASP A 1 45  ? 7.738   -13.446 10.231  1.00 0.00 ? 45  ASP A C    3  
ATOM 4289  O O    . ASP A 1 45  ? 8.159   -12.313 10.460  1.00 0.00 ? 45  ASP A O    3  
ATOM 4290  C CB   . ASP A 1 45  ? 8.846   -15.661 9.877   1.00 0.00 ? 45  ASP A CB   3  
ATOM 4291  C CG   . ASP A 1 45  ? 9.851   -15.456 10.994  1.00 0.00 ? 45  ASP A CG   3  
ATOM 4292  O OD1  . ASP A 1 45  ? 10.852  -14.744 10.769  1.00 0.00 ? 45  ASP A OD1  3  
ATOM 4293  O OD2  . ASP A 1 45  ? 9.635   -16.007 12.094  1.00 0.00 ? 45  ASP A OD2  3  
ATOM 4294  H H    . ASP A 1 45  ? 10.010  -12.936 9.128   1.00 0.00 ? 45  ASP A H    3  
ATOM 4295  H HA   . ASP A 1 45  ? 7.745   -14.559 8.411   1.00 0.00 ? 45  ASP A HA   3  
ATOM 4296  H HB2  . ASP A 1 45  ? 7.970   -16.140 10.290  1.00 0.00 ? 45  ASP A HB2  3  
ATOM 4297  H HB3  . ASP A 1 45  ? 9.288   -16.308 9.134   1.00 0.00 ? 45  ASP A HB3  3  
ATOM 4298  N N    . GLU A 1 46  ? 6.672   -13.959 10.837  1.00 0.00 ? 46  GLU A N    3  
ATOM 4299  C CA   . GLU A 1 46  ? 5.917   -13.200 11.827  1.00 0.00 ? 46  GLU A CA   3  
ATOM 4300  C C    . GLU A 1 46  ? 6.856   -12.489 12.798  1.00 0.00 ? 46  GLU A C    3  
ATOM 4301  O O    . GLU A 1 46  ? 6.675   -11.310 13.103  1.00 0.00 ? 46  GLU A O    3  
ATOM 4302  C CB   . GLU A 1 46  ? 4.973   -14.124 12.599  1.00 0.00 ? 46  GLU A CB   3  
ATOM 4303  C CG   . GLU A 1 46  ? 3.878   -14.731 11.738  1.00 0.00 ? 46  GLU A CG   3  
ATOM 4304  C CD   . GLU A 1 46  ? 2.660   -15.140 12.545  1.00 0.00 ? 46  GLU A CD   3  
ATOM 4305  O OE1  . GLU A 1 46  ? 1.775   -14.285 12.757  1.00 0.00 ? 46  GLU A OE1  3  
ATOM 4306  O OE2  . GLU A 1 46  ? 2.594   -16.314 12.964  1.00 0.00 ? 46  GLU A OE2  3  
ATOM 4307  H H    . GLU A 1 46  ? 6.385   -14.869 10.612  1.00 0.00 ? 46  GLU A H    3  
ATOM 4308  H HA   . GLU A 1 46  ? 5.333   -12.460 11.303  1.00 0.00 ? 46  GLU A HA   3  
ATOM 4309  H HB2  . GLU A 1 46  ? 5.549   -14.927 13.033  1.00 0.00 ? 46  GLU A HB2  3  
ATOM 4310  H HB3  . GLU A 1 46  ? 4.506   -13.559 13.392  1.00 0.00 ? 46  GLU A HB3  3  
ATOM 4311  H HG2  . GLU A 1 46  ? 3.574   -14.005 10.999  1.00 0.00 ? 46  GLU A HG2  3  
ATOM 4312  H HG3  . GLU A 1 46  ? 4.272   -15.606 11.241  1.00 0.00 ? 46  GLU A HG3  3  
ATOM 4313  N N    . LYS A 1 47  ? 7.859   -13.214 13.280  1.00 0.00 ? 47  LYS A N    3  
ATOM 4314  C CA   . LYS A 1 47  ? 8.828   -12.655 14.216  1.00 0.00 ? 47  LYS A CA   3  
ATOM 4315  C C    . LYS A 1 47  ? 9.112   -11.191 13.894  1.00 0.00 ? 47  LYS A C    3  
ATOM 4316  O O    . LYS A 1 47  ? 9.313   -10.377 14.794  1.00 0.00 ? 47  LYS A O    3  
ATOM 4317  C CB   . LYS A 1 47  ? 10.129  -13.459 14.176  1.00 0.00 ? 47  LYS A CB   3  
ATOM 4318  C CG   . LYS A 1 47  ? 10.063  -14.762 14.954  1.00 0.00 ? 47  LYS A CG   3  
ATOM 4319  C CD   . LYS A 1 47  ? 11.451  -15.303 15.253  1.00 0.00 ? 47  LYS A CD   3  
ATOM 4320  C CE   . LYS A 1 47  ? 12.042  -14.665 16.501  1.00 0.00 ? 47  LYS A CE   3  
ATOM 4321  N NZ   . LYS A 1 47  ? 13.333  -15.296 16.889  1.00 0.00 ? 47  LYS A NZ   3  
ATOM 4322  H H    . LYS A 1 47  ? 7.951   -14.149 12.999  1.00 0.00 ? 47  LYS A H    3  
ATOM 4323  H HA   . LYS A 1 47  ? 8.406   -12.718 15.207  1.00 0.00 ? 47  LYS A HA   3  
ATOM 4324  H HB2  . LYS A 1 47  ? 10.364  -13.690 13.147  1.00 0.00 ? 47  LYS A HB2  3  
ATOM 4325  H HB3  . LYS A 1 47  ? 10.924  -12.856 14.591  1.00 0.00 ? 47  LYS A HB3  3  
ATOM 4326  H HG2  . LYS A 1 47  ? 9.548   -14.588 15.887  1.00 0.00 ? 47  LYS A HG2  3  
ATOM 4327  H HG3  . LYS A 1 47  ? 9.520   -15.492 14.371  1.00 0.00 ? 47  LYS A HG3  3  
ATOM 4328  H HD2  . LYS A 1 47  ? 11.387  -16.371 15.405  1.00 0.00 ? 47  LYS A HD2  3  
ATOM 4329  H HD3  . LYS A 1 47  ? 12.098  -15.096 14.412  1.00 0.00 ? 47  LYS A HD3  3  
ATOM 4330  H HE2  . LYS A 1 47  ? 12.207  -13.616 16.309  1.00 0.00 ? 47  LYS A HE2  3  
ATOM 4331  H HE3  . LYS A 1 47  ? 11.338  -14.775 17.313  1.00 0.00 ? 47  LYS A HE3  3  
ATOM 4332  H HZ1  . LYS A 1 47  ? 14.109  -14.903 16.319  1.00 0.00 ? 47  LYS A HZ1  3  
ATOM 4333  H HZ2  . LYS A 1 47  ? 13.290  -16.323 16.733  1.00 0.00 ? 47  LYS A HZ2  3  
ATOM 4334  H HZ3  . LYS A 1 47  ? 13.531  -15.117 17.894  1.00 0.00 ? 47  LYS A HZ3  3  
ATOM 4335  N N    . GLU A 1 48  ? 9.127   -10.865 12.605  1.00 0.00 ? 48  GLU A N    3  
ATOM 4336  C CA   . GLU A 1 48  ? 9.386   -9.499  12.166  1.00 0.00 ? 48  GLU A CA   3  
ATOM 4337  C C    . GLU A 1 48  ? 10.690  -8.975  12.760  1.00 0.00 ? 48  GLU A C    3  
ATOM 4338  O O    . GLU A 1 48  ? 10.740  -7.867  13.293  1.00 0.00 ? 48  GLU A O    3  
ATOM 4339  C CB   . GLU A 1 48  ? 8.227   -8.583  12.565  1.00 0.00 ? 48  GLU A CB   3  
ATOM 4340  C CG   . GLU A 1 48  ? 8.226   -7.250  11.836  1.00 0.00 ? 48  GLU A CG   3  
ATOM 4341  C CD   . GLU A 1 48  ? 7.538   -6.153  12.627  1.00 0.00 ? 48  GLU A CD   3  
ATOM 4342  O OE1  . GLU A 1 48  ? 7.805   -6.040  13.841  1.00 0.00 ? 48  GLU A OE1  3  
ATOM 4343  O OE2  . GLU A 1 48  ? 6.734   -5.408  12.029  1.00 0.00 ? 48  GLU A OE2  3  
ATOM 4344  H H    . GLU A 1 48  ? 8.959   -11.559 11.934  1.00 0.00 ? 48  GLU A H    3  
ATOM 4345  H HA   . GLU A 1 48  ? 9.472   -9.507  11.090  1.00 0.00 ? 48  GLU A HA   3  
ATOM 4346  H HB2  . GLU A 1 48  ? 7.296   -9.087  12.353  1.00 0.00 ? 48  GLU A HB2  3  
ATOM 4347  H HB3  . GLU A 1 48  ? 8.287   -8.389  13.626  1.00 0.00 ? 48  GLU A HB3  3  
ATOM 4348  H HG2  . GLU A 1 48  ? 9.248   -6.953  11.653  1.00 0.00 ? 48  GLU A HG2  3  
ATOM 4349  H HG3  . GLU A 1 48  ? 7.713   -7.370  10.893  1.00 0.00 ? 48  GLU A HG3  3  
ATOM 4350  N N    . GLU A 1 49  ? 11.743  -9.781  12.664  1.00 0.00 ? 49  GLU A N    3  
ATOM 4351  C CA   . GLU A 1 49  ? 13.047  -9.399  13.193  1.00 0.00 ? 49  GLU A CA   3  
ATOM 4352  C C    . GLU A 1 49  ? 13.472  -8.034  12.659  1.00 0.00 ? 49  GLU A C    3  
ATOM 4353  O O    . GLU A 1 49  ? 13.692  -7.097  13.426  1.00 0.00 ? 49  GLU A O    3  
ATOM 4354  C CB   . GLU A 1 49  ? 14.098  -10.451 12.829  1.00 0.00 ? 49  GLU A CB   3  
ATOM 4355  C CG   . GLU A 1 49  ? 13.951  -11.750 13.603  1.00 0.00 ? 49  GLU A CG   3  
ATOM 4356  C CD   . GLU A 1 49  ? 14.026  -11.547 15.104  1.00 0.00 ? 49  GLU A CD   3  
ATOM 4357  O OE1  . GLU A 1 49  ? 15.150  -11.558 15.648  1.00 0.00 ? 49  GLU A OE1  3  
ATOM 4358  O OE2  . GLU A 1 49  ? 12.961  -11.378 15.733  1.00 0.00 ? 49  GLU A OE2  3  
ATOM 4359  H H    . GLU A 1 49  ? 11.640  -10.652 12.228  1.00 0.00 ? 49  GLU A H    3  
ATOM 4360  H HA   . GLU A 1 49  ? 12.966  -9.342  14.268  1.00 0.00 ? 49  GLU A HA   3  
ATOM 4361  H HB2  . GLU A 1 49  ? 14.018  -10.672 11.775  1.00 0.00 ? 49  GLU A HB2  3  
ATOM 4362  H HB3  . GLU A 1 49  ? 15.079  -10.046 13.029  1.00 0.00 ? 49  GLU A HB3  3  
ATOM 4363  H HG2  . GLU A 1 49  ? 12.996  -12.192 13.362  1.00 0.00 ? 49  GLU A HG2  3  
ATOM 4364  H HG3  . GLU A 1 49  ? 14.743  -12.422 13.306  1.00 0.00 ? 49  GLU A HG3  3  
ATOM 4365  N N    . SER A 1 50  ? 13.587  -7.931  11.339  1.00 0.00 ? 50  SER A N    3  
ATOM 4366  C CA   . SER A 1 50  ? 13.990  -6.682  10.702  1.00 0.00 ? 50  SER A CA   3  
ATOM 4367  C C    . SER A 1 50  ? 13.402  -6.574  9.299   1.00 0.00 ? 50  SER A C    3  
ATOM 4368  O O    . SER A 1 50  ? 13.157  -7.583  8.637   1.00 0.00 ? 50  SER A O    3  
ATOM 4369  C CB   . SER A 1 50  ? 15.516  -6.588  10.637  1.00 0.00 ? 50  SER A CB   3  
ATOM 4370  O OG   . SER A 1 50  ? 15.928  -5.320  10.156  1.00 0.00 ? 50  SER A OG   3  
ATOM 4371  H H    . SER A 1 50  ? 13.399  -8.714  10.780  1.00 0.00 ? 50  SER A H    3  
ATOM 4372  H HA   . SER A 1 50  ? 13.613  -5.867  11.302  1.00 0.00 ? 50  SER A HA   3  
ATOM 4373  H HB2  . SER A 1 50  ? 15.926  -6.736  11.624  1.00 0.00 ? 50  SER A HB2  3  
ATOM 4374  H HB3  . SER A 1 50  ? 15.893  -7.352  9.972   1.00 0.00 ? 50  SER A HB3  3  
ATOM 4375  H HG   . SER A 1 50  ? 15.304  -4.650  10.445  1.00 0.00 ? 50  SER A HG   3  
ATOM 4376  N N    . ILE A 1 51  ? 13.178  -5.343  8.851   1.00 0.00 ? 51  ILE A N    3  
ATOM 4377  C CA   . ILE A 1 51  ? 12.619  -5.102  7.527   1.00 0.00 ? 51  ILE A CA   3  
ATOM 4378  C C    . ILE A 1 51  ? 13.595  -5.525  6.434   1.00 0.00 ? 51  ILE A C    3  
ATOM 4379  O O    . ILE A 1 51  ? 14.739  -5.068  6.396   1.00 0.00 ? 51  ILE A O    3  
ATOM 4380  C CB   . ILE A 1 51  ? 12.257  -3.618  7.330   1.00 0.00 ? 51  ILE A CB   3  
ATOM 4381  C CG1  . ILE A 1 51  ? 11.151  -3.207  8.305   1.00 0.00 ? 51  ILE A CG1  3  
ATOM 4382  C CG2  . ILE A 1 51  ? 11.825  -3.364  5.894   1.00 0.00 ? 51  ILE A CG2  3  
ATOM 4383  C CD1  . ILE A 1 51  ? 10.932  -1.712  8.374   1.00 0.00 ? 51  ILE A CD1  3  
ATOM 4384  H H    . ILE A 1 51  ? 13.393  -4.579  9.426   1.00 0.00 ? 51  ILE A H    3  
ATOM 4385  H HA   . ILE A 1 51  ? 11.716  -5.688  7.434   1.00 0.00 ? 51  ILE A HA   3  
ATOM 4386  H HB   . ILE A 1 51  ? 13.138  -3.026  7.526   1.00 0.00 ? 51  ILE A HB   3  
ATOM 4387  H HG12 . ILE A 1 51  ? 10.223  -3.664  8.000   1.00 0.00 ? 51  ILE A HG12 3  
ATOM 4388  H HG13 . ILE A 1 51  ? 11.409  -3.552  9.296   1.00 0.00 ? 51  ILE A HG13 3  
ATOM 4389  H HG21 . ILE A 1 51  ? 12.641  -3.599  5.226   1.00 0.00 ? 51  ILE A HG21 3  
ATOM 4390  H HG22 . ILE A 1 51  ? 10.977  -3.989  5.657   1.00 0.00 ? 51  ILE A HG22 3  
ATOM 4391  H HG23 . ILE A 1 51  ? 11.552  -2.326  5.777   1.00 0.00 ? 51  ILE A HG23 3  
ATOM 4392  H HD11 . ILE A 1 51  ? 9.873   -1.504  8.393   1.00 0.00 ? 51  ILE A HD11 3  
ATOM 4393  H HD12 . ILE A 1 51  ? 11.393  -1.321  9.268   1.00 0.00 ? 51  ILE A HD12 3  
ATOM 4394  H HD13 . ILE A 1 51  ? 11.374  -1.243  7.507   1.00 0.00 ? 51  ILE A HD13 3  
ATOM 4395  N N    . LEU A 1 52  ? 13.136  -6.398  5.544   1.00 0.00 ? 52  LEU A N    3  
ATOM 4396  C CA   . LEU A 1 52  ? 13.968  -6.881  4.447   1.00 0.00 ? 52  LEU A CA   3  
ATOM 4397  C C    . LEU A 1 52  ? 13.836  -5.979  3.225   1.00 0.00 ? 52  LEU A C    3  
ATOM 4398  O O    . LEU A 1 52  ? 14.800  -5.766  2.491   1.00 0.00 ? 52  LEU A O    3  
ATOM 4399  C CB   . LEU A 1 52  ? 13.580  -8.315  4.081   1.00 0.00 ? 52  LEU A CB   3  
ATOM 4400  C CG   . LEU A 1 52  ? 13.991  -9.398  5.080   1.00 0.00 ? 52  LEU A CG   3  
ATOM 4401  C CD1  . LEU A 1 52  ? 13.410  -10.744 4.677   1.00 0.00 ? 52  LEU A CD1  3  
ATOM 4402  C CD2  . LEU A 1 52  ? 15.507  -9.479  5.185   1.00 0.00 ? 52  LEU A CD2  3  
ATOM 4403  H H    . LEU A 1 52  ? 12.217  -6.726  5.626   1.00 0.00 ? 52  LEU A H    3  
ATOM 4404  H HA   . LEU A 1 52  ? 14.995  -6.869  4.780   1.00 0.00 ? 52  LEU A HA   3  
ATOM 4405  H HB2  . LEU A 1 52  ? 12.507  -8.351  3.978   1.00 0.00 ? 52  LEU A HB2  3  
ATOM 4406  H HB3  . LEU A 1 52  ? 14.039  -8.548  3.131   1.00 0.00 ? 52  LEU A HB3  3  
ATOM 4407  H HG   . LEU A 1 52  ? 13.600  -9.145  6.056   1.00 0.00 ? 52  LEU A HG   3  
ATOM 4408  H HD11 . LEU A 1 52  ? 14.203  -11.472 4.608   1.00 0.00 ? 52  LEU A HD11 3  
ATOM 4409  H HD12 . LEU A 1 52  ? 12.921  -10.652 3.718   1.00 0.00 ? 52  LEU A HD12 3  
ATOM 4410  H HD13 . LEU A 1 52  ? 12.691  -11.062 5.418   1.00 0.00 ? 52  LEU A HD13 3  
ATOM 4411  H HD21 . LEU A 1 52  ? 15.948  -9.197  4.240   1.00 0.00 ? 52  LEU A HD21 3  
ATOM 4412  H HD22 . LEU A 1 52  ? 15.797  -10.490 5.430   1.00 0.00 ? 52  LEU A HD22 3  
ATOM 4413  H HD23 . LEU A 1 52  ? 15.850  -8.807  5.957   1.00 0.00 ? 52  LEU A HD23 3  
ATOM 4414  N N    . GLY A 1 53  ? 12.635  -5.448  3.014   1.00 0.00 ? 53  GLY A N    3  
ATOM 4415  C CA   . GLY A 1 53  ? 12.400  -4.572  1.881   1.00 0.00 ? 53  GLY A CA   3  
ATOM 4416  C C    . GLY A 1 53  ? 11.196  -3.674  2.083   1.00 0.00 ? 53  GLY A C    3  
ATOM 4417  O O    . GLY A 1 53  ? 10.333  -3.958  2.914   1.00 0.00 ? 53  GLY A O    3  
ATOM 4418  H H    . GLY A 1 53  ? 11.903  -5.652  3.633   1.00 0.00 ? 53  GLY A H    3  
ATOM 4419  H HA2  . GLY A 1 53  ? 13.274  -3.957  1.728   1.00 0.00 ? 53  GLY A HA2  3  
ATOM 4420  H HA3  . GLY A 1 53  ? 12.239  -5.177  1.001   1.00 0.00 ? 53  GLY A HA3  3  
ATOM 4421  N N    . SER A 1 54  ? 11.137  -2.585  1.322   1.00 0.00 ? 54  SER A N    3  
ATOM 4422  C CA   . SER A 1 54  ? 10.033  -1.639  1.426   1.00 0.00 ? 54  SER A CA   3  
ATOM 4423  C C    . SER A 1 54  ? 9.283   -1.532  0.101   1.00 0.00 ? 54  SER A C    3  
ATOM 4424  O O    . SER A 1 54  ? 9.894   -1.411  -0.962  1.00 0.00 ? 54  SER A O    3  
ATOM 4425  C CB   . SER A 1 54  ? 10.551  -0.262  1.844   1.00 0.00 ? 54  SER A CB   3  
ATOM 4426  O OG   . SER A 1 54  ? 10.951  0.497   0.717   1.00 0.00 ? 54  SER A OG   3  
ATOM 4427  H H    . SER A 1 54  ? 11.856  -2.414  0.678   1.00 0.00 ? 54  SER A H    3  
ATOM 4428  H HA   . SER A 1 54  ? 9.353   -2.004  2.182   1.00 0.00 ? 54  SER A HA   3  
ATOM 4429  H HB2  . SER A 1 54  ? 9.769   0.272   2.363   1.00 0.00 ? 54  SER A HB2  3  
ATOM 4430  H HB3  . SER A 1 54  ? 11.400  -0.384  2.501   1.00 0.00 ? 54  SER A HB3  3  
ATOM 4431  H HG   . SER A 1 54  ? 10.673  1.409   0.829   1.00 0.00 ? 54  SER A HG   3  
ATOM 4432  N N    . ILE A 1 55  ? 7.957   -1.576  0.173   1.00 0.00 ? 55  ILE A N    3  
ATOM 4433  C CA   . ILE A 1 55  ? 7.124   -1.483  -1.019  1.00 0.00 ? 55  ILE A CA   3  
ATOM 4434  C C    . ILE A 1 55  ? 6.189   -0.282  -0.943  1.00 0.00 ? 55  ILE A C    3  
ATOM 4435  O O    . ILE A 1 55  ? 5.191   -0.285  -0.222  1.00 0.00 ? 55  ILE A O    3  
ATOM 4436  C CB   . ILE A 1 55  ? 6.287   -2.760  -1.221  1.00 0.00 ? 55  ILE A CB   3  
ATOM 4437  C CG1  . ILE A 1 55  ? 7.187   -3.997  -1.191  1.00 0.00 ? 55  ILE A CG1  3  
ATOM 4438  C CG2  . ILE A 1 55  ? 5.520   -2.688  -2.534  1.00 0.00 ? 55  ILE A CG2  3  
ATOM 4439  C CD1  . ILE A 1 55  ? 6.421   -5.300  -1.138  1.00 0.00 ? 55  ILE A CD1  3  
ATOM 4440  H H    . ILE A 1 55  ? 7.529   -1.673  1.049   1.00 0.00 ? 55  ILE A H    3  
ATOM 4441  H HA   . ILE A 1 55  ? 7.776   -1.366  -1.872  1.00 0.00 ? 55  ILE A HA   3  
ATOM 4442  H HB   . ILE A 1 55  ? 5.570   -2.825  -0.417  1.00 0.00 ? 55  ILE A HB   3  
ATOM 4443  H HG12 . ILE A 1 55  ? 7.801   -4.010  -2.077  1.00 0.00 ? 55  ILE A HG12 3  
ATOM 4444  H HG13 . ILE A 1 55  ? 7.822   -3.949  -0.318  1.00 0.00 ? 55  ILE A HG13 3  
ATOM 4445  H HG21 . ILE A 1 55  ? 4.870   -3.546  -2.618  1.00 0.00 ? 55  ILE A HG21 3  
ATOM 4446  H HG22 . ILE A 1 55  ? 4.928   -1.786  -2.556  1.00 0.00 ? 55  ILE A HG22 3  
ATOM 4447  H HG23 . ILE A 1 55  ? 6.218   -2.682  -3.358  1.00 0.00 ? 55  ILE A HG23 3  
ATOM 4448  H HD11 . ILE A 1 55  ? 5.546   -5.179  -0.515  1.00 0.00 ? 55  ILE A HD11 3  
ATOM 4449  H HD12 . ILE A 1 55  ? 6.118   -5.581  -2.135  1.00 0.00 ? 55  ILE A HD12 3  
ATOM 4450  H HD13 . ILE A 1 55  ? 7.053   -6.072  -0.722  1.00 0.00 ? 55  ILE A HD13 3  
ATOM 4451  N N    . PRO A 1 56  ? 6.516   0.772   -1.707  1.00 0.00 ? 56  PRO A N    3  
ATOM 4452  C CA   . PRO A 1 56  ? 5.716   2.000   -1.746  1.00 0.00 ? 56  PRO A CA   3  
ATOM 4453  C C    . PRO A 1 56  ? 4.371   1.794   -2.435  1.00 0.00 ? 56  PRO A C    3  
ATOM 4454  O O    . PRO A 1 56  ? 4.313   1.486   -3.626  1.00 0.00 ? 56  PRO A O    3  
ATOM 4455  C CB   . PRO A 1 56  ? 6.588   2.965   -2.553  1.00 0.00 ? 56  PRO A CB   3  
ATOM 4456  C CG   . PRO A 1 56  ? 7.441   2.086   -3.401  1.00 0.00 ? 56  PRO A CG   3  
ATOM 4457  C CD   . PRO A 1 56  ? 7.691   0.845   -2.591  1.00 0.00 ? 56  PRO A CD   3  
ATOM 4458  H HA   . PRO A 1 56  ? 5.555   2.400   -0.756  1.00 0.00 ? 56  PRO A HA   3  
ATOM 4459  H HB2  . PRO A 1 56  ? 5.958   3.606   -3.154  1.00 0.00 ? 56  PRO A HB2  3  
ATOM 4460  H HB3  . PRO A 1 56  ? 7.184   3.564   -1.881  1.00 0.00 ? 56  PRO A HB3  3  
ATOM 4461  H HG2  . PRO A 1 56  ? 6.920   1.840   -4.314  1.00 0.00 ? 56  PRO A HG2  3  
ATOM 4462  H HG3  . PRO A 1 56  ? 8.374   2.584   -3.622  1.00 0.00 ? 56  PRO A HG3  3  
ATOM 4463  H HD2  . PRO A 1 56  ? 7.745   -0.021  -3.234  1.00 0.00 ? 56  PRO A HD2  3  
ATOM 4464  H HD3  . PRO A 1 56  ? 8.600   0.946   -2.015  1.00 0.00 ? 56  PRO A HD3  3  
ATOM 4465  N N    . LEU A 1 57  ? 3.293   1.967   -1.679  1.00 0.00 ? 57  LEU A N    3  
ATOM 4466  C CA   . LEU A 1 57  ? 1.947   1.800   -2.217  1.00 0.00 ? 57  LEU A CA   3  
ATOM 4467  C C    . LEU A 1 57  ? 1.266   3.152   -2.408  1.00 0.00 ? 57  LEU A C    3  
ATOM 4468  O O    . LEU A 1 57  ? 0.076   3.304   -2.130  1.00 0.00 ? 57  LEU A O    3  
ATOM 4469  C CB   . LEU A 1 57  ? 1.109   0.922   -1.287  1.00 0.00 ? 57  LEU A CB   3  
ATOM 4470  C CG   . LEU A 1 57  ? 1.256   -0.588  -1.477  1.00 0.00 ? 57  LEU A CG   3  
ATOM 4471  C CD1  . LEU A 1 57  ? 0.389   -1.339  -0.479  1.00 0.00 ? 57  LEU A CD1  3  
ATOM 4472  C CD2  . LEU A 1 57  ? 0.896   -0.984  -2.902  1.00 0.00 ? 57  LEU A CD2  3  
ATOM 4473  H H    . LEU A 1 57  ? 3.402   2.212   -0.737  1.00 0.00 ? 57  LEU A H    3  
ATOM 4474  H HA   . LEU A 1 57  ? 2.032   1.315   -3.178  1.00 0.00 ? 57  LEU A HA   3  
ATOM 4475  H HB2  . LEU A 1 57  ? 1.389   1.155   -0.271  1.00 0.00 ? 57  LEU A HB2  3  
ATOM 4476  H HB3  . LEU A 1 57  ? 0.070   1.176   -1.440  1.00 0.00 ? 57  LEU A HB3  3  
ATOM 4477  H HG   . LEU A 1 57  ? 2.285   -0.869  -1.301  1.00 0.00 ? 57  LEU A HG   3  
ATOM 4478  H HD11 . LEU A 1 57  ? 0.402   -2.393  -0.712  1.00 0.00 ? 57  LEU A HD11 3  
ATOM 4479  H HD12 . LEU A 1 57  ? -0.625  -0.971  -0.534  1.00 0.00 ? 57  LEU A HD12 3  
ATOM 4480  H HD13 . LEU A 1 57  ? 0.773   -1.185  0.519   1.00 0.00 ? 57  LEU A HD13 3  
ATOM 4481  H HD21 . LEU A 1 57  ? 0.821   -2.059  -2.969  1.00 0.00 ? 57  LEU A HD21 3  
ATOM 4482  H HD22 . LEU A 1 57  ? 1.663   -0.634  -3.577  1.00 0.00 ? 57  LEU A HD22 3  
ATOM 4483  H HD23 . LEU A 1 57  ? -0.051  -0.539  -3.170  1.00 0.00 ? 57  LEU A HD23 3  
ATOM 4484  N N    . LEU A 1 58  ? 2.028   4.130   -2.886  1.00 0.00 ? 58  LEU A N    3  
ATOM 4485  C CA   . LEU A 1 58  ? 1.498   5.469   -3.117  1.00 0.00 ? 58  LEU A CA   3  
ATOM 4486  C C    . LEU A 1 58  ? 0.792   5.550   -4.467  1.00 0.00 ? 58  LEU A C    3  
ATOM 4487  O O    . LEU A 1 58  ? 1.438   5.592   -5.515  1.00 0.00 ? 58  LEU A O    3  
ATOM 4488  C CB   . LEU A 1 58  ? 2.624   6.502   -3.055  1.00 0.00 ? 58  LEU A CB   3  
ATOM 4489  C CG   . LEU A 1 58  ? 2.197   7.945   -2.781  1.00 0.00 ? 58  LEU A CG   3  
ATOM 4490  C CD1  . LEU A 1 58  ? 1.665   8.085   -1.363  1.00 0.00 ? 58  LEU A CD1  3  
ATOM 4491  C CD2  . LEU A 1 58  ? 3.360   8.899   -3.013  1.00 0.00 ? 58  LEU A CD2  3  
ATOM 4492  H H    . LEU A 1 58  ? 2.969   3.948   -3.089  1.00 0.00 ? 58  LEU A H    3  
ATOM 4493  H HA   . LEU A 1 58  ? 0.782   5.681   -2.337  1.00 0.00 ? 58  LEU A HA   3  
ATOM 4494  H HB2  . LEU A 1 58  ? 3.302   6.205   -2.270  1.00 0.00 ? 58  LEU A HB2  3  
ATOM 4495  H HB3  . LEU A 1 58  ? 3.142   6.483   -4.003  1.00 0.00 ? 58  LEU A HB3  3  
ATOM 4496  H HG   . LEU A 1 58  ? 1.401   8.213   -3.463  1.00 0.00 ? 58  LEU A HG   3  
ATOM 4497  H HD11 . LEU A 1 58  ? 0.703   7.601   -1.291  1.00 0.00 ? 58  LEU A HD11 3  
ATOM 4498  H HD12 . LEU A 1 58  ? 1.561   9.132   -1.120  1.00 0.00 ? 58  LEU A HD12 3  
ATOM 4499  H HD13 . LEU A 1 58  ? 2.355   7.622   -0.673  1.00 0.00 ? 58  LEU A HD13 3  
ATOM 4500  H HD21 . LEU A 1 58  ? 3.056   9.676   -3.699  1.00 0.00 ? 58  LEU A HD21 3  
ATOM 4501  H HD22 . LEU A 1 58  ? 4.193   8.354   -3.433  1.00 0.00 ? 58  LEU A HD22 3  
ATOM 4502  H HD23 . LEU A 1 58  ? 3.655   9.341   -2.074  1.00 0.00 ? 58  LEU A HD23 3  
ATOM 4503  N N    . SER A 1 59  ? -0.536  5.573   -4.435  1.00 0.00 ? 59  SER A N    3  
ATOM 4504  C CA   . SER A 1 59  ? -1.329  5.648   -5.656  1.00 0.00 ? 59  SER A CA   3  
ATOM 4505  C C    . SER A 1 59  ? -1.099  4.419   -6.530  1.00 0.00 ? 59  SER A C    3  
ATOM 4506  O O    . SER A 1 59  ? -1.169  4.493   -7.757  1.00 0.00 ? 59  SER A O    3  
ATOM 4507  C CB   . SER A 1 59  ? -0.982  6.916   -6.439  1.00 0.00 ? 59  SER A CB   3  
ATOM 4508  O OG   . SER A 1 59  ? -2.093  7.371   -7.192  1.00 0.00 ? 59  SER A OG   3  
ATOM 4509  H H    . SER A 1 59  ? -0.993  5.537   -3.569  1.00 0.00 ? 59  SER A H    3  
ATOM 4510  H HA   . SER A 1 59  ? -2.371  5.684   -5.373  1.00 0.00 ? 59  SER A HA   3  
ATOM 4511  H HB2  . SER A 1 59  ? -0.688  7.692   -5.749  1.00 0.00 ? 59  SER A HB2  3  
ATOM 4512  H HB3  . SER A 1 59  ? -0.165  6.706   -7.114  1.00 0.00 ? 59  SER A HB3  3  
ATOM 4513  H HG   . SER A 1 59  ? -2.481  8.136   -6.760  1.00 0.00 ? 59  SER A HG   3  
ATOM 4514  N N    . PHE A 1 60  ? -0.824  3.288   -5.888  1.00 0.00 ? 60  PHE A N    3  
ATOM 4515  C CA   . PHE A 1 60  ? -0.582  2.041   -6.605  1.00 0.00 ? 60  PHE A CA   3  
ATOM 4516  C C    . PHE A 1 60  ? -1.898  1.385   -7.014  1.00 0.00 ? 60  PHE A C    3  
ATOM 4517  O O    . PHE A 1 60  ? -2.858  1.363   -6.245  1.00 0.00 ? 60  PHE A O    3  
ATOM 4518  C CB   . PHE A 1 60  ? 0.232   1.079   -5.737  1.00 0.00 ? 60  PHE A CB   3  
ATOM 4519  C CG   . PHE A 1 60  ? 1.717   1.218   -5.920  1.00 0.00 ? 60  PHE A CG   3  
ATOM 4520  C CD1  . PHE A 1 60  ? 2.346   2.431   -5.691  1.00 0.00 ? 60  PHE A CD1  3  
ATOM 4521  C CD2  . PHE A 1 60  ? 2.483   0.136   -6.321  1.00 0.00 ? 60  PHE A CD2  3  
ATOM 4522  C CE1  . PHE A 1 60  ? 3.711   2.562   -5.859  1.00 0.00 ? 60  PHE A CE1  3  
ATOM 4523  C CE2  . PHE A 1 60  ? 3.849   0.260   -6.491  1.00 0.00 ? 60  PHE A CE2  3  
ATOM 4524  C CZ   . PHE A 1 60  ? 4.464   1.475   -6.258  1.00 0.00 ? 60  PHE A CZ   3  
ATOM 4525  H H    . PHE A 1 60  ? -0.782  3.292   -4.908  1.00 0.00 ? 60  PHE A H    3  
ATOM 4526  H HA   . PHE A 1 60  ? -0.019  2.276   -7.494  1.00 0.00 ? 60  PHE A HA   3  
ATOM 4527  H HB2  . PHE A 1 60  ? 0.008   1.265   -4.698  1.00 0.00 ? 60  PHE A HB2  3  
ATOM 4528  H HB3  . PHE A 1 60  ? -0.040  0.065   -5.985  1.00 0.00 ? 60  PHE A HB3  3  
ATOM 4529  H HD1  . PHE A 1 60  ? 1.759   3.282   -5.378  1.00 0.00 ? 60  PHE A HD1  3  
ATOM 4530  H HD2  . PHE A 1 60  ? 2.003   -0.816  -6.503  1.00 0.00 ? 60  PHE A HD2  3  
ATOM 4531  H HE1  . PHE A 1 60  ? 4.190   3.512   -5.677  1.00 0.00 ? 60  PHE A HE1  3  
ATOM 4532  H HE2  . PHE A 1 60  ? 4.435   -0.592  -6.803  1.00 0.00 ? 60  PHE A HE2  3  
ATOM 4533  H HZ   . PHE A 1 60  ? 5.531   1.574   -6.391  1.00 0.00 ? 60  PHE A HZ   3  
ATOM 4534  N N    . ARG A 1 61  ? -1.933  0.852   -8.231  1.00 0.00 ? 61  ARG A N    3  
ATOM 4535  C CA   . ARG A 1 61  ? -3.130  0.197   -8.744  1.00 0.00 ? 61  ARG A CA   3  
ATOM 4536  C C    . ARG A 1 61  ? -3.169  -1.270  -8.324  1.00 0.00 ? 61  ARG A C    3  
ATOM 4537  O O    . ARG A 1 61  ? -2.549  -2.124  -8.957  1.00 0.00 ? 61  ARG A O    3  
ATOM 4538  C CB   . ARG A 1 61  ? -3.181  0.304   -10.269 1.00 0.00 ? 61  ARG A CB   3  
ATOM 4539  C CG   . ARG A 1 61  ? -4.565  0.063   -10.850 1.00 0.00 ? 61  ARG A CG   3  
ATOM 4540  C CD   . ARG A 1 61  ? -4.671  0.588   -12.273 1.00 0.00 ? 61  ARG A CD   3  
ATOM 4541  N NE   . ARG A 1 61  ? -5.628  -0.176  -13.069 1.00 0.00 ? 61  ARG A NE   3  
ATOM 4542  C CZ   . ARG A 1 61  ? -5.840  0.033   -14.363 1.00 0.00 ? 61  ARG A CZ   3  
ATOM 4543  N NH1  . ARG A 1 61  ? -5.166  0.978   -15.005 1.00 0.00 ? 61  ARG A NH1  3  
ATOM 4544  N NH2  . ARG A 1 61  ? -6.727  -0.704  -15.019 1.00 0.00 ? 61  ARG A NH2  3  
ATOM 4545  H H    . ARG A 1 61  ? -1.134  0.901   -8.798  1.00 0.00 ? 61  ARG A H    3  
ATOM 4546  H HA   . ARG A 1 61  ? -3.988  0.701   -8.327  1.00 0.00 ? 61  ARG A HA   3  
ATOM 4547  H HB2  . ARG A 1 61  ? -2.860  1.293   -10.560 1.00 0.00 ? 61  ARG A HB2  3  
ATOM 4548  H HB3  . ARG A 1 61  ? -2.506  -0.425  -10.692 1.00 0.00 ? 61  ARG A HB3  3  
ATOM 4549  H HG2  . ARG A 1 61  ? -4.764  -0.999  -10.854 1.00 0.00 ? 61  ARG A HG2  3  
ATOM 4550  H HG3  . ARG A 1 61  ? -5.296  0.566   -10.234 1.00 0.00 ? 61  ARG A HG3  3  
ATOM 4551  H HD2  . ARG A 1 61  ? -4.989  1.620   -12.239 1.00 0.00 ? 61  ARG A HD2  3  
ATOM 4552  H HD3  . ARG A 1 61  ? -3.699  0.526   -12.738 1.00 0.00 ? 61  ARG A HD3  3  
ATOM 4553  H HE   . ARG A 1 61  ? -6.137  -0.880  -12.615 1.00 0.00 ? 61  ARG A HE   3  
ATOM 4554  H HH11 . ARG A 1 61  ? -4.496  1.534   -14.513 1.00 0.00 ? 61  ARG A HH11 3  
ATOM 4555  H HH12 . ARG A 1 61  ? -5.327  1.132   -15.980 1.00 0.00 ? 61  ARG A HH12 3  
ATOM 4556  H HH21 . ARG A 1 61  ? -7.237  -1.418  -14.539 1.00 0.00 ? 61  ARG A HH21 3  
ATOM 4557  H HH22 . ARG A 1 61  ? -6.886  -0.546  -15.993 1.00 0.00 ? 61  ARG A HH22 3  
ATOM 4558  N N    . VAL A 1 62  ? -3.902  -1.554  -7.252  1.00 0.00 ? 62  VAL A N    3  
ATOM 4559  C CA   . VAL A 1 62  ? -4.023  -2.917  -6.748  1.00 0.00 ? 62  VAL A CA   3  
ATOM 4560  C C    . VAL A 1 62  ? -5.355  -3.537  -7.155  1.00 0.00 ? 62  VAL A C    3  
ATOM 4561  O O    . VAL A 1 62  ? -6.411  -2.929  -6.988  1.00 0.00 ? 62  VAL A O    3  
ATOM 4562  C CB   . VAL A 1 62  ? -3.896  -2.961  -5.214  1.00 0.00 ? 62  VAL A CB   3  
ATOM 4563  C CG1  . VAL A 1 62  ? -3.767  -4.397  -4.730  1.00 0.00 ? 62  VAL A CG1  3  
ATOM 4564  C CG2  . VAL A 1 62  ? -2.710  -2.126  -4.754  1.00 0.00 ? 62  VAL A CG2  3  
ATOM 4565  H H    . VAL A 1 62  ? -4.373  -0.830  -6.790  1.00 0.00 ? 62  VAL A H    3  
ATOM 4566  H HA   . VAL A 1 62  ? -3.220  -3.502  -7.172  1.00 0.00 ? 62  VAL A HA   3  
ATOM 4567  H HB   . VAL A 1 62  ? -4.794  -2.540  -4.786  1.00 0.00 ? 62  VAL A HB   3  
ATOM 4568  H HG11 . VAL A 1 62  ? -2.729  -4.696  -4.762  1.00 0.00 ? 62  VAL A HG11 3  
ATOM 4569  H HG12 . VAL A 1 62  ? -4.133  -4.470  -3.716  1.00 0.00 ? 62  VAL A HG12 3  
ATOM 4570  H HG13 . VAL A 1 62  ? -4.347  -5.046  -5.370  1.00 0.00 ? 62  VAL A HG13 3  
ATOM 4571  H HG21 . VAL A 1 62  ? -2.064  -1.925  -5.595  1.00 0.00 ? 62  VAL A HG21 3  
ATOM 4572  H HG22 . VAL A 1 62  ? -3.065  -1.192  -4.342  1.00 0.00 ? 62  VAL A HG22 3  
ATOM 4573  H HG23 . VAL A 1 62  ? -2.160  -2.667  -3.998  1.00 0.00 ? 62  VAL A HG23 3  
ATOM 4574  N N    . ALA A 1 63  ? -5.297  -4.753  -7.689  1.00 0.00 ? 63  ALA A N    3  
ATOM 4575  C CA   . ALA A 1 63  ? -6.499  -5.457  -8.118  1.00 0.00 ? 63  ALA A CA   3  
ATOM 4576  C C    . ALA A 1 63  ? -6.183  -6.899  -8.500  1.00 0.00 ? 63  ALA A C    3  
ATOM 4577  O O    . ALA A 1 63  ? -5.021  -7.263  -8.682  1.00 0.00 ? 63  ALA A O    3  
ATOM 4578  C CB   . ALA A 1 63  ? -7.148  -4.730  -9.286  1.00 0.00 ? 63  ALA A CB   3  
ATOM 4579  H H    . ALA A 1 63  ? -4.424  -5.186  -7.797  1.00 0.00 ? 63  ALA A H    3  
ATOM 4580  H HA   . ALA A 1 63  ? -7.197  -5.458  -7.293  1.00 0.00 ? 63  ALA A HA   3  
ATOM 4581  H HB1  . ALA A 1 63  ? -7.097  -3.664  -9.118  1.00 0.00 ? 63  ALA A HB1  3  
ATOM 4582  H HB2  . ALA A 1 63  ? -6.626  -4.977  -10.198 1.00 0.00 ? 63  ALA A HB2  3  
ATOM 4583  H HB3  . ALA A 1 63  ? -8.181  -5.033  -9.368  1.00 0.00 ? 63  ALA A HB3  3  
ATOM 4584  N N    . ALA A 1 64  ? -7.224  -7.717  -8.618  1.00 0.00 ? 64  ALA A N    3  
ATOM 4585  C CA   . ALA A 1 64  ? -7.057  -9.119  -8.980  1.00 0.00 ? 64  ALA A CA   3  
ATOM 4586  C C    . ALA A 1 64  ? -6.344  -9.259  -10.320 1.00 0.00 ? 64  ALA A C    3  
ATOM 4587  O O    . ALA A 1 64  ? -6.713  -8.615  -11.302 1.00 0.00 ? 64  ALA A O    3  
ATOM 4588  C CB   . ALA A 1 64  ? -8.409  -9.817  -9.023  1.00 0.00 ? 64  ALA A CB   3  
ATOM 4589  H H    . ALA A 1 64  ? -8.126  -7.368  -8.461  1.00 0.00 ? 64  ALA A H    3  
ATOM 4590  H HA   . ALA A 1 64  ? -6.460  -9.592  -8.214  1.00 0.00 ? 64  ALA A HA   3  
ATOM 4591  H HB1  . ALA A 1 64  ? -8.777  -9.950  -8.016  1.00 0.00 ? 64  ALA A HB1  3  
ATOM 4592  H HB2  . ALA A 1 64  ? -9.107  -9.215  -9.586  1.00 0.00 ? 64  ALA A HB2  3  
ATOM 4593  H HB3  . ALA A 1 64  ? -8.300  -10.781 -9.498  1.00 0.00 ? 64  ALA A HB3  3  
ATOM 4594  N N    . VAL A 1 65  ? -5.319  -10.105 -10.354 1.00 0.00 ? 65  VAL A N    3  
ATOM 4595  C CA   . VAL A 1 65  ? -4.553  -10.330 -11.574 1.00 0.00 ? 65  VAL A CA   3  
ATOM 4596  C C    . VAL A 1 65  ? -5.466  -10.717 -12.732 1.00 0.00 ? 65  VAL A C    3  
ATOM 4597  O O    . VAL A 1 65  ? -6.670  -10.897 -12.552 1.00 0.00 ? 65  VAL A O    3  
ATOM 4598  C CB   . VAL A 1 65  ? -3.496  -11.433 -11.378 1.00 0.00 ? 65  VAL A CB   3  
ATOM 4599  C CG1  . VAL A 1 65  ? -2.357  -10.931 -10.502 1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4600  C CG2  . VAL A 1 65  ? -4.131  -12.679 -10.779 1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4601  H H    . VAL A 1 65  ? -5.072  -10.590 -9.538  1.00 0.00 ? 65  VAL A H    3  
ATOM 4602  H HA   . VAL A 1 65  ? -4.043  -9.411  -11.822 1.00 0.00 ? 65  VAL A HA   3  
ATOM 4603  H HB   . VAL A 1 65  ? -3.090  -11.690 -12.345 1.00 0.00 ? 65  VAL A HB   3  
ATOM 4604  H HG11 . VAL A 1 65  ? -2.453  -9.864  -10.364 1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4605  H HG12 . VAL A 1 65  ? -2.397  -11.425 -9.542  1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4606  H HG13 . VAL A 1 65  ? -1.413  -11.148 -10.980 1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4607  H HG21 . VAL A 1 65  ? -3.461  -13.108 -10.049 1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4608  H HG22 . VAL A 1 65  ? -5.063  -12.414 -10.301 1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4609  H HG23 . VAL A 1 65  ? -4.320  -13.398 -11.562 1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4610  N N    . GLN A 1 66  ? -4.884  -10.844 -13.920 1.00 0.00 ? 66  GLN A N    3  
ATOM 4611  C CA   . GLN A 1 66  ? -5.646  -11.210 -15.108 1.00 0.00 ? 66  GLN A CA   3  
ATOM 4612  C C    . GLN A 1 66  ? -5.127  -12.513 -15.708 1.00 0.00 ? 66  GLN A C    3  
ATOM 4613  O O    . GLN A 1 66  ? -4.002  -12.939 -15.448 1.00 0.00 ? 66  GLN A O    3  
ATOM 4614  C CB   . GLN A 1 66  ? -5.576  -10.091 -16.149 1.00 0.00 ? 66  GLN A CB   3  
ATOM 4615  C CG   . GLN A 1 66  ? -6.672  -9.049  -15.997 1.00 0.00 ? 66  GLN A CG   3  
ATOM 4616  C CD   . GLN A 1 66  ? -6.896  -8.248  -17.265 1.00 0.00 ? 66  GLN A CD   3  
ATOM 4617  O OE1  . GLN A 1 66  ? -6.198  -7.267  -17.524 1.00 0.00 ? 66  GLN A OE1  3  
ATOM 4618  N NE2  . GLN A 1 66  ? -7.872  -8.663  -18.064 1.00 0.00 ? 66  GLN A NE2  3  
ATOM 4619  H H    . GLN A 1 66  ? -3.921  -10.687 -14.000 1.00 0.00 ? 66  GLN A H    3  
ATOM 4620  H HA   . GLN A 1 66  ? -6.675  -11.349 -14.812 1.00 0.00 ? 66  GLN A HA   3  
ATOM 4621  H HB2  . GLN A 1 66  ? -4.622  -9.595  -16.063 1.00 0.00 ? 66  GLN A HB2  3  
ATOM 4622  H HB3  . GLN A 1 66  ? -5.658  -10.527 -17.134 1.00 0.00 ? 66  GLN A HB3  3  
ATOM 4623  H HG2  . GLN A 1 66  ? -7.594  -9.549  -15.739 1.00 0.00 ? 66  GLN A HG2  3  
ATOM 4624  H HG3  . GLN A 1 66  ? -6.398  -8.370  -15.203 1.00 0.00 ? 66  GLN A HG3  3  
ATOM 4625  H HE21 . GLN A 1 66  ? -8.387  -9.452  -17.792 1.00 0.00 ? 66  GLN A HE21 3  
ATOM 4626  H HE22 . GLN A 1 66  ? -8.039  -8.164  -18.889 1.00 0.00 ? 66  GLN A HE22 3  
ATOM 4627  N N    . PRO A 1 67  ? -5.965  -13.161 -16.530 1.00 0.00 ? 67  PRO A N    3  
ATOM 4628  C CA   . PRO A 1 67  ? -5.613  -14.425 -17.185 1.00 0.00 ? 67  PRO A CA   3  
ATOM 4629  C C    . PRO A 1 67  ? -4.544  -14.244 -18.257 1.00 0.00 ? 67  PRO A C    3  
ATOM 4630  O O    . PRO A 1 67  ? -3.916  -15.210 -18.691 1.00 0.00 ? 67  PRO A O    3  
ATOM 4631  C CB   . PRO A 1 67  ? -6.932  -14.878 -17.815 1.00 0.00 ? 67  PRO A CB   3  
ATOM 4632  C CG   . PRO A 1 67  ? -7.706  -13.621 -18.019 1.00 0.00 ? 67  PRO A CG   3  
ATOM 4633  C CD   . PRO A 1 67  ? -7.321  -12.710 -16.886 1.00 0.00 ? 67  PRO A CD   3  
ATOM 4634  H HA   . PRO A 1 67  ? -5.281  -15.163 -16.469 1.00 0.00 ? 67  PRO A HA   3  
ATOM 4635  H HB2  . PRO A 1 67  ? -6.732  -15.376 -18.754 1.00 0.00 ? 67  PRO A HB2  3  
ATOM 4636  H HB3  . PRO A 1 67  ? -7.443  -15.552 -17.145 1.00 0.00 ? 67  PRO A HB3  3  
ATOM 4637  H HG2  . PRO A 1 67  ? -7.440  -13.175 -18.965 1.00 0.00 ? 67  PRO A HG2  3  
ATOM 4638  H HG3  . PRO A 1 67  ? -8.764  -13.833 -17.986 1.00 0.00 ? 67  PRO A HG3  3  
ATOM 4639  H HD2  . PRO A 1 67  ? -7.312  -11.682 -17.215 1.00 0.00 ? 67  PRO A HD2  3  
ATOM 4640  H HD3  . PRO A 1 67  ? -7.999  -12.836 -16.054 1.00 0.00 ? 67  PRO A HD3  3  
ATOM 4641  N N    . SER A 1 68  ? -4.341  -13.000 -18.680 1.00 0.00 ? 68  SER A N    3  
ATOM 4642  C CA   . SER A 1 68  ? -3.350  -12.693 -19.705 1.00 0.00 ? 68  SER A CA   3  
ATOM 4643  C C    . SER A 1 68  ? -2.009  -12.332 -19.073 1.00 0.00 ? 68  SER A C    3  
ATOM 4644  O O    . SER A 1 68  ? -1.108  -11.832 -19.746 1.00 0.00 ? 68  SER A O    3  
ATOM 4645  C CB   . SER A 1 68  ? -3.837  -11.542 -20.587 1.00 0.00 ? 68  SER A CB   3  
ATOM 4646  O OG   . SER A 1 68  ? -4.916  -11.951 -21.410 1.00 0.00 ? 68  SER A OG   3  
ATOM 4647  H H    . SER A 1 68  ? -4.873  -12.272 -18.296 1.00 0.00 ? 68  SER A H    3  
ATOM 4648  H HA   . SER A 1 68  ? -3.221  -13.574 -20.316 1.00 0.00 ? 68  SER A HA   3  
ATOM 4649  H HB2  . SER A 1 68  ? -4.166  -10.727 -19.961 1.00 0.00 ? 68  SER A HB2  3  
ATOM 4650  H HB3  . SER A 1 68  ? -3.026  -11.207 -21.217 1.00 0.00 ? 68  SER A HB3  3  
ATOM 4651  H HG   . SER A 1 68  ? -5.646  -11.337 -21.309 1.00 0.00 ? 68  SER A HG   3  
ATOM 4652  N N    . ASP A 1 69  ? -1.886  -12.589 -17.775 1.00 0.00 ? 69  ASP A N    3  
ATOM 4653  C CA   . ASP A 1 69  ? -0.656  -12.292 -17.050 1.00 0.00 ? 69  ASP A CA   3  
ATOM 4654  C C    . ASP A 1 69  ? 0.133   -13.569 -16.774 1.00 0.00 ? 69  ASP A C    3  
ATOM 4655  O O    . ASP A 1 69  ? 1.214   -13.527 -16.188 1.00 0.00 ? 69  ASP A O    3  
ATOM 4656  C CB   . ASP A 1 69  ? -0.972  -11.579 -15.735 1.00 0.00 ? 69  ASP A CB   3  
ATOM 4657  C CG   . ASP A 1 69  ? -1.238  -10.099 -15.928 1.00 0.00 ? 69  ASP A CG   3  
ATOM 4658  O OD1  . ASP A 1 69  ? -0.262  -9.320  -15.961 1.00 0.00 ? 69  ASP A OD1  3  
ATOM 4659  O OD2  . ASP A 1 69  ? -2.422  -9.720  -16.048 1.00 0.00 ? 69  ASP A OD2  3  
ATOM 4660  H H    . ASP A 1 69  ? -2.641  -12.988 -17.293 1.00 0.00 ? 69  ASP A H    3  
ATOM 4661  H HA   . ASP A 1 69  ? -0.056  -11.640 -17.667 1.00 0.00 ? 69  ASP A HA   3  
ATOM 4662  H HB2  . ASP A 1 69  ? -1.849  -12.028 -15.292 1.00 0.00 ? 69  ASP A HB2  3  
ATOM 4663  H HB3  . ASP A 1 69  ? -0.136  -11.692 -15.061 1.00 0.00 ? 69  ASP A HB3  3  
ATOM 4664  N N    . ASN A 1 70  ? -0.416  -14.702 -17.201 1.00 0.00 ? 70  ASN A N    3  
ATOM 4665  C CA   . ASN A 1 70  ? 0.236   -15.990 -16.998 1.00 0.00 ? 70  ASN A CA   3  
ATOM 4666  C C    . ASN A 1 70  ? 0.338   -16.321 -15.512 1.00 0.00 ? 70  ASN A C    3  
ATOM 4667  O O    . ASN A 1 70  ? 1.294   -16.959 -15.072 1.00 0.00 ? 70  ASN A O    3  
ATOM 4668  C CB   . ASN A 1 70  ? 1.631   -15.985 -17.627 1.00 0.00 ? 70  ASN A CB   3  
ATOM 4669  C CG   . ASN A 1 70  ? 1.626   -15.427 -19.037 1.00 0.00 ? 70  ASN A CG   3  
ATOM 4670  O OD1  . ASN A 1 70  ? 0.774   -15.777 -19.853 1.00 0.00 ? 70  ASN A OD1  3  
ATOM 4671  N ND2  . ASN A 1 70  ? 2.583   -14.553 -19.331 1.00 0.00 ? 70  ASN A ND2  3  
ATOM 4672  H H    . ASN A 1 70  ? -1.280  -14.670 -17.662 1.00 0.00 ? 70  ASN A H    3  
ATOM 4673  H HA   . ASN A 1 70  ? -0.365  -16.745 -17.482 1.00 0.00 ? 70  ASN A HA   3  
ATOM 4674  H HB2  . ASN A 1 70  ? 2.289   -15.378 -17.023 1.00 0.00 ? 70  ASN A HB2  3  
ATOM 4675  H HB3  . ASN A 1 70  ? 2.009   -16.995 -17.660 1.00 0.00 ? 70  ASN A HB3  3  
ATOM 4676  H HD21 . ASN A 1 70  ? 3.228   -14.321 -18.631 1.00 0.00 ? 70  ASN A HD21 3  
ATOM 4677  H HD22 . ASN A 1 70  ? 2.603   -14.176 -20.235 1.00 0.00 ? 70  ASN A HD22 3  
ATOM 4678  N N    . ILE A 1 71  ? -0.654  -15.882 -14.745 1.00 0.00 ? 71  ILE A N    3  
ATOM 4679  C CA   . ILE A 1 71  ? -0.677  -16.132 -13.309 1.00 0.00 ? 71  ILE A CA   3  
ATOM 4680  C C    . ILE A 1 71  ? -1.628  -17.274 -12.965 1.00 0.00 ? 71  ILE A C    3  
ATOM 4681  O O    . ILE A 1 71  ? -2.781  -17.047 -12.601 1.00 0.00 ? 71  ILE A O    3  
ATOM 4682  C CB   . ILE A 1 71  ? -1.099  -14.875 -12.525 1.00 0.00 ? 71  ILE A CB   3  
ATOM 4683  C CG1  . ILE A 1 71  ? -0.164  -13.708 -12.849 1.00 0.00 ? 71  ILE A CG1  3  
ATOM 4684  C CG2  . ILE A 1 71  ? -1.101  -15.159 -11.030 1.00 0.00 ? 71  ILE A CG2  3  
ATOM 4685  C CD1  . ILE A 1 71  ? 1.245   -13.901 -12.335 1.00 0.00 ? 71  ILE A CD1  3  
ATOM 4686  H H    . ILE A 1 71  ? -1.389  -15.378 -15.154 1.00 0.00 ? 71  ILE A H    3  
ATOM 4687  H HA   . ILE A 1 71  ? 0.322   -16.405 -13.002 1.00 0.00 ? 71  ILE A HA   3  
ATOM 4688  H HB   . ILE A 1 71  ? -2.104  -14.615 -12.819 1.00 0.00 ? 71  ILE A HB   3  
ATOM 4689  H HG12 . ILE A 1 71  ? -0.112  -13.584 -13.919 1.00 0.00 ? 71  ILE A HG12 3  
ATOM 4690  H HG13 . ILE A 1 71  ? -0.560  -12.806 -12.405 1.00 0.00 ? 71  ILE A HG13 3  
ATOM 4691  H HG21 . ILE A 1 71  ? -0.202  -14.758 -10.586 1.00 0.00 ? 71  ILE A HG21 3  
ATOM 4692  H HG22 . ILE A 1 71  ? -1.963  -14.694 -10.577 1.00 0.00 ? 71  ILE A HG22 3  
ATOM 4693  H HG23 . ILE A 1 71  ? -1.139  -16.226 -10.866 1.00 0.00 ? 71  ILE A HG23 3  
ATOM 4694  H HD11 . ILE A 1 71  ? 1.374   -14.924 -12.012 1.00 0.00 ? 71  ILE A HD11 3  
ATOM 4695  H HD12 . ILE A 1 71  ? 1.950   -13.680 -13.122 1.00 0.00 ? 71  ILE A HD12 3  
ATOM 4696  H HD13 . ILE A 1 71  ? 1.418   -13.237 -11.500 1.00 0.00 ? 71  ILE A HD13 3  
ATOM 4697  N N    . SER A 1 72  ? -1.134  -18.503 -13.082 1.00 0.00 ? 72  SER A N    3  
ATOM 4698  C CA   . SER A 1 72  ? -1.940  -19.682 -12.786 1.00 0.00 ? 72  SER A CA   3  
ATOM 4699  C C    . SER A 1 72  ? -2.379  -19.686 -11.325 1.00 0.00 ? 72  SER A C    3  
ATOM 4700  O O    . SER A 1 72  ? -3.425  -20.238 -10.981 1.00 0.00 ? 72  SER A O    3  
ATOM 4701  C CB   . SER A 1 72  ? -1.152  -20.955 -13.097 1.00 0.00 ? 72  SER A CB   3  
ATOM 4702  O OG   . SER A 1 72  ? -2.022  -22.054 -13.310 1.00 0.00 ? 72  SER A OG   3  
ATOM 4703  H H    . SER A 1 72  ? -0.207  -18.619 -13.378 1.00 0.00 ? 72  SER A H    3  
ATOM 4704  H HA   . SER A 1 72  ? -2.818  -19.649 -13.414 1.00 0.00 ? 72  SER A HA   3  
ATOM 4705  H HB2  . SER A 1 72  ? -0.562  -20.802 -13.988 1.00 0.00 ? 72  SER A HB2  3  
ATOM 4706  H HB3  . SER A 1 72  ? -0.499  -21.184 -12.267 1.00 0.00 ? 72  SER A HB3  3  
ATOM 4707  H HG   . SER A 1 72  ? -2.608  -22.149 -12.556 1.00 0.00 ? 72  SER A HG   3  
ATOM 4708  N N    . ARG A 1 73  ? -1.572  -19.067 -10.469 1.00 0.00 ? 73  ARG A N    3  
ATOM 4709  C CA   . ARG A 1 73  ? -1.876  -19.000 -9.045  1.00 0.00 ? 73  ARG A CA   3  
ATOM 4710  C C    . ARG A 1 73  ? -3.239  -18.357 -8.809  1.00 0.00 ? 73  ARG A C    3  
ATOM 4711  O O    . ARG A 1 73  ? -3.523  -17.273 -9.319  1.00 0.00 ? 73  ARG A O    3  
ATOM 4712  C CB   . ARG A 1 73  ? -0.793  -18.210 -8.308  1.00 0.00 ? 73  ARG A CB   3  
ATOM 4713  C CG   . ARG A 1 73  ? 0.521   -18.961 -8.170  1.00 0.00 ? 73  ARG A CG   3  
ATOM 4714  C CD   . ARG A 1 73  ? 1.293   -18.511 -6.939  1.00 0.00 ? 73  ARG A CD   3  
ATOM 4715  N NE   . ARG A 1 73  ? 0.736   -19.068 -5.710  1.00 0.00 ? 73  ARG A NE   3  
ATOM 4716  C CZ   . ARG A 1 73  ? 0.936   -20.320 -5.313  1.00 0.00 ? 73  ARG A CZ   3  
ATOM 4717  N NH1  . ARG A 1 73  ? 1.677   -21.141 -6.045  1.00 0.00 ? 73  ARG A NH1  3  
ATOM 4718  N NH2  . ARG A 1 73  ? 0.395   -20.754 -4.182  1.00 0.00 ? 73  ARG A NH2  3  
ATOM 4719  H H    . ARG A 1 73  ? -0.753  -18.646 -10.804 1.00 0.00 ? 73  ARG A H    3  
ATOM 4720  H HA   . ARG A 1 73  ? -1.896  -20.009 -8.662  1.00 0.00 ? 73  ARG A HA   3  
ATOM 4721  H HB2  . ARG A 1 73  ? -0.604  -17.293 -8.846  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 4722  H HB3  . ARG A 1 73  ? -1.151  -17.970 -7.318  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 4723  H HG2  . ARG A 1 73  ? 0.315   -20.018 -8.085  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 4724  H HG3  . ARG A 1 73  ? 1.122   -18.779 -9.048  1.00 0.00 ? 73  ARG A HG3  3  
ATOM 4725  H HD2  . ARG A 1 73  ? 2.319   -18.834 -7.037  1.00 0.00 ? 73  ARG A HD2  3  
ATOM 4726  H HD3  . ARG A 1 73  ? 1.259   -17.434 -6.884  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 4727  H HE   . ARG A 1 73  ? 0.185   -18.480 -5.154  1.00 0.00 ? 73  ARG A HE   3  
ATOM 4728  H HH11 . ARG A 1 73  ? 2.087   -20.817 -6.898  1.00 0.00 ? 73  ARG A HH11 3  
ATOM 4729  H HH12 . ARG A 1 73  ? 1.827   -22.083 -5.744  1.00 0.00 ? 73  ARG A HH12 3  
ATOM 4730  H HH21 . ARG A 1 73  ? -0.164  -20.138 -3.627  1.00 0.00 ? 73  ARG A HH21 3  
ATOM 4731  H HH22 . ARG A 1 73  ? 0.546   -21.696 -3.884  1.00 0.00 ? 73  ARG A HH22 3  
ATOM 4732  N N    . LYS A 1 74  ? -4.081  -19.032 -8.034  1.00 0.00 ? 74  LYS A N    3  
ATOM 4733  C CA   . LYS A 1 74  ? -5.414  -18.528 -7.729  1.00 0.00 ? 74  LYS A CA   3  
ATOM 4734  C C    . LYS A 1 74  ? -5.361  -17.487 -6.616  1.00 0.00 ? 74  LYS A C    3  
ATOM 4735  O O    . LYS A 1 74  ? -4.346  -17.346 -5.932  1.00 0.00 ? 74  LYS A O    3  
ATOM 4736  C CB   . LYS A 1 74  ? -6.336  -19.679 -7.321  1.00 0.00 ? 74  LYS A CB   3  
ATOM 4737  C CG   . LYS A 1 74  ? -6.800  -20.530 -8.490  1.00 0.00 ? 74  LYS A CG   3  
ATOM 4738  C CD   . LYS A 1 74  ? -8.168  -21.138 -8.229  1.00 0.00 ? 74  LYS A CD   3  
ATOM 4739  C CE   . LYS A 1 74  ? -9.277  -20.112 -8.406  1.00 0.00 ? 74  LYS A CE   3  
ATOM 4740  N NZ   . LYS A 1 74  ? -10.510 -20.495 -7.665  1.00 0.00 ? 74  LYS A NZ   3  
ATOM 4741  H H    . LYS A 1 74  ? -3.797  -19.892 -7.656  1.00 0.00 ? 74  LYS A H    3  
ATOM 4742  H HA   . LYS A 1 74  ? -5.805  -18.063 -8.621  1.00 0.00 ? 74  LYS A HA   3  
ATOM 4743  H HB2  . LYS A 1 74  ? -5.811  -20.316 -6.625  1.00 0.00 ? 74  LYS A HB2  3  
ATOM 4744  H HB3  . LYS A 1 74  ? -7.209  -19.270 -6.833  1.00 0.00 ? 74  LYS A HB3  3  
ATOM 4745  H HG2  . LYS A 1 74  ? -6.856  -19.913 -9.374  1.00 0.00 ? 74  LYS A HG2  3  
ATOM 4746  H HG3  . LYS A 1 74  ? -6.087  -21.327 -8.649  1.00 0.00 ? 74  LYS A HG3  3  
ATOM 4747  H HD2  . LYS A 1 74  ? -8.330  -21.950 -8.923  1.00 0.00 ? 74  LYS A HD2  3  
ATOM 4748  H HD3  . LYS A 1 74  ? -8.197  -21.517 -7.217  1.00 0.00 ? 74  LYS A HD3  3  
ATOM 4749  H HE2  . LYS A 1 74  ? -8.929  -19.159 -8.040  1.00 0.00 ? 74  LYS A HE2  3  
ATOM 4750  H HE3  . LYS A 1 74  ? -9.510  -20.031 -9.457  1.00 0.00 ? 74  LYS A HE3  3  
ATOM 4751  H HZ1  . LYS A 1 74  ? -10.840 -19.698 -7.083  1.00 0.00 ? 74  LYS A HZ1  3  
ATOM 4752  H HZ2  . LYS A 1 74  ? -10.316 -21.306 -7.042  1.00 0.00 ? 74  LYS A HZ2  3  
ATOM 4753  H HZ3  . LYS A 1 74  ? -11.263 -20.757 -8.333  1.00 0.00 ? 74  LYS A HZ3  3  
ATOM 4754  N N    . HIS A 1 75  ? -6.459  -16.760 -6.438  1.00 0.00 ? 75  HIS A N    3  
ATOM 4755  C CA   . HIS A 1 75  ? -6.538  -15.732 -5.406  1.00 0.00 ? 75  HIS A CA   3  
ATOM 4756  C C    . HIS A 1 75  ? -5.259  -14.901 -5.368  1.00 0.00 ? 75  HIS A C    3  
ATOM 4757  O O    . HIS A 1 75  ? -4.655  -14.718 -4.310  1.00 0.00 ? 75  HIS A O    3  
ATOM 4758  C CB   . HIS A 1 75  ? -6.785  -16.371 -4.039  1.00 0.00 ? 75  HIS A CB   3  
ATOM 4759  C CG   . HIS A 1 75  ? -7.565  -17.648 -4.107  1.00 0.00 ? 75  HIS A CG   3  
ATOM 4760  N ND1  . HIS A 1 75  ? -8.760  -17.765 -4.786  1.00 0.00 ? 75  HIS A ND1  3  
ATOM 4761  C CD2  . HIS A 1 75  ? -7.315  -18.867 -3.577  1.00 0.00 ? 75  HIS A CD2  3  
ATOM 4762  C CE1  . HIS A 1 75  ? -9.211  -19.001 -4.669  1.00 0.00 ? 75  HIS A CE1  3  
ATOM 4763  N NE2  . HIS A 1 75  ? -8.352  -19.691 -3.940  1.00 0.00 ? 75  HIS A NE2  3  
ATOM 4764  H H    . HIS A 1 75  ? -7.235  -16.918 -7.015  1.00 0.00 ? 75  HIS A H    3  
ATOM 4765  H HA   . HIS A 1 75  ? -7.366  -15.083 -5.646  1.00 0.00 ? 75  HIS A HA   3  
ATOM 4766  H HB2  . HIS A 1 75  ? -5.836  -16.587 -3.573  1.00 0.00 ? 75  HIS A HB2  3  
ATOM 4767  H HB3  . HIS A 1 75  ? -7.335  -15.677 -3.419  1.00 0.00 ? 75  HIS A HB3  3  
ATOM 4768  H HD1  . HIS A 1 75  ? -9.210  -17.048 -5.278  1.00 0.00 ? 75  HIS A HD1  3  
ATOM 4769  H HD2  . HIS A 1 75  ? -6.458  -19.143 -2.978  1.00 0.00 ? 75  HIS A HD2  3  
ATOM 4770  H HE1  . HIS A 1 75  ? -10.125 -19.383 -5.097  1.00 0.00 ? 75  HIS A HE1  3  
ATOM 4771  H HE2  . HIS A 1 75  ? -8.486  -20.610 -3.630  1.00 0.00 ? 75  HIS A HE2  3  
ATOM 4772  N N    . THR A 1 76  ? -4.849  -14.401 -6.530  1.00 0.00 ? 76  THR A N    3  
ATOM 4773  C CA   . THR A 1 76  ? -3.641  -13.591 -6.630  1.00 0.00 ? 76  THR A CA   3  
ATOM 4774  C C    . THR A 1 76  ? -3.951  -12.208 -7.191  1.00 0.00 ? 76  THR A C    3  
ATOM 4775  O O    . THR A 1 76  ? -4.730  -12.070 -8.135  1.00 0.00 ? 76  THR A O    3  
ATOM 4776  C CB   . THR A 1 76  ? -2.583  -14.269 -7.520  1.00 0.00 ? 76  THR A CB   3  
ATOM 4777  O OG1  . THR A 1 76  ? -2.244  -15.554 -6.987  1.00 0.00 ? 76  THR A OG1  3  
ATOM 4778  C CG2  . THR A 1 76  ? -1.332  -13.410 -7.623  1.00 0.00 ? 76  THR A CG2  3  
ATOM 4779  H H    . THR A 1 76  ? -5.373  -14.581 -7.338  1.00 0.00 ? 76  THR A H    3  
ATOM 4780  H HA   . THR A 1 76  ? -3.230  -13.482 -5.637  1.00 0.00 ? 76  THR A HA   3  
ATOM 4781  H HB   . THR A 1 76  ? -2.996  -14.396 -8.511  1.00 0.00 ? 76  THR A HB   3  
ATOM 4782  H HG1  . THR A 1 76  ? -3.048  -16.036 -6.779  1.00 0.00 ? 76  THR A HG1  3  
ATOM 4783  H HG21 . THR A 1 76  ? -0.621  -13.719 -6.870  1.00 0.00 ? 76  THR A HG21 3  
ATOM 4784  H HG22 . THR A 1 76  ? -1.593  -12.374 -7.468  1.00 0.00 ? 76  THR A HG22 3  
ATOM 4785  H HG23 . THR A 1 76  ? -0.893  -13.529 -8.602  1.00 0.00 ? 76  THR A HG23 3  
ATOM 4786  N N    . PHE A 1 77  ? -3.336  -11.186 -6.606  1.00 0.00 ? 77  PHE A N    3  
ATOM 4787  C CA   . PHE A 1 77  ? -3.547  -9.812  -7.048  1.00 0.00 ? 77  PHE A CA   3  
ATOM 4788  C C    . PHE A 1 77  ? -2.229  -9.167  -7.464  1.00 0.00 ? 77  PHE A C    3  
ATOM 4789  O O    . PHE A 1 77  ? -1.151  -9.681  -7.167  1.00 0.00 ? 77  PHE A O    3  
ATOM 4790  C CB   . PHE A 1 77  ? -4.202  -8.990  -5.935  1.00 0.00 ? 77  PHE A CB   3  
ATOM 4791  C CG   . PHE A 1 77  ? -3.543  -9.162  -4.597  1.00 0.00 ? 77  PHE A CG   3  
ATOM 4792  C CD1  . PHE A 1 77  ? -3.773  -10.298 -3.837  1.00 0.00 ? 77  PHE A CD1  3  
ATOM 4793  C CD2  . PHE A 1 77  ? -2.694  -8.188  -4.097  1.00 0.00 ? 77  PHE A CD2  3  
ATOM 4794  C CE1  . PHE A 1 77  ? -3.168  -10.460 -2.605  1.00 0.00 ? 77  PHE A CE1  3  
ATOM 4795  C CE2  . PHE A 1 77  ? -2.086  -8.344  -2.866  1.00 0.00 ? 77  PHE A CE2  3  
ATOM 4796  C CZ   . PHE A 1 77  ? -2.324  -9.480  -2.118  1.00 0.00 ? 77  PHE A CZ   3  
ATOM 4797  H H    . PHE A 1 77  ? -2.727  -11.359 -5.858  1.00 0.00 ? 77  PHE A H    3  
ATOM 4798  H HA   . PHE A 1 77  ? -4.207  -9.837  -7.901  1.00 0.00 ? 77  PHE A HA   3  
ATOM 4799  H HB2  . PHE A 1 77  ? -4.155  -7.944  -6.196  1.00 0.00 ? 77  PHE A HB2  3  
ATOM 4800  H HB3  . PHE A 1 77  ? -5.235  -9.288  -5.839  1.00 0.00 ? 77  PHE A HB3  3  
ATOM 4801  H HD1  . PHE A 1 77  ? -4.433  -11.065 -4.217  1.00 0.00 ? 77  PHE A HD1  3  
ATOM 4802  H HD2  . PHE A 1 77  ? -2.508  -7.298  -4.680  1.00 0.00 ? 77  PHE A HD2  3  
ATOM 4803  H HE1  . PHE A 1 77  ? -3.356  -11.350 -2.023  1.00 0.00 ? 77  PHE A HE1  3  
ATOM 4804  H HE2  . PHE A 1 77  ? -1.427  -7.577  -2.488  1.00 0.00 ? 77  PHE A HE2  3  
ATOM 4805  H HZ   . PHE A 1 77  ? -1.850  -9.605  -1.156  1.00 0.00 ? 77  PHE A HZ   3  
ATOM 4806  N N    . LYS A 1 78  ? -2.323  -8.036  -8.156  1.00 0.00 ? 78  LYS A N    3  
ATOM 4807  C CA   . LYS A 1 78  ? -1.140  -7.318  -8.614  1.00 0.00 ? 78  LYS A CA   3  
ATOM 4808  C C    . LYS A 1 78  ? -1.212  -5.845  -8.223  1.00 0.00 ? 78  LYS A C    3  
ATOM 4809  O O    . LYS A 1 78  ? -2.298  -5.286  -8.072  1.00 0.00 ? 78  LYS A O    3  
ATOM 4810  C CB   . LYS A 1 78  ? -0.996  -7.446  -10.132 1.00 0.00 ? 78  LYS A CB   3  
ATOM 4811  C CG   . LYS A 1 78  ? -2.262  -7.097  -10.895 1.00 0.00 ? 78  LYS A CG   3  
ATOM 4812  C CD   . LYS A 1 78  ? -1.947  -6.538  -12.273 1.00 0.00 ? 78  LYS A CD   3  
ATOM 4813  C CE   . LYS A 1 78  ? -3.156  -5.846  -12.883 1.00 0.00 ? 78  LYS A CE   3  
ATOM 4814  N NZ   . LYS A 1 78  ? -4.046  -6.807  -13.593 1.00 0.00 ? 78  LYS A NZ   3  
ATOM 4815  H H    . LYS A 1 78  ? -3.211  -7.675  -8.363  1.00 0.00 ? 78  LYS A H    3  
ATOM 4816  H HA   . LYS A 1 78  ? -0.278  -7.762  -8.140  1.00 0.00 ? 78  LYS A HA   3  
ATOM 4817  H HB2  . LYS A 1 78  ? -0.207  -6.787  -10.464 1.00 0.00 ? 78  LYS A HB2  3  
ATOM 4818  H HB3  . LYS A 1 78  ? -0.726  -8.465  -10.371 1.00 0.00 ? 78  LYS A HB3  3  
ATOM 4819  H HG2  . LYS A 1 78  ? -2.861  -7.988  -11.009 1.00 0.00 ? 78  LYS A HG2  3  
ATOM 4820  H HG3  . LYS A 1 78  ? -2.817  -6.358  -10.335 1.00 0.00 ? 78  LYS A HG3  3  
ATOM 4821  H HD2  . LYS A 1 78  ? -1.143  -5.823  -12.186 1.00 0.00 ? 78  LYS A HD2  3  
ATOM 4822  H HD3  . LYS A 1 78  ? -1.643  -7.349  -12.919 1.00 0.00 ? 78  LYS A HD3  3  
ATOM 4823  H HE2  . LYS A 1 78  ? -3.716  -5.366  -12.095 1.00 0.00 ? 78  LYS A HE2  3  
ATOM 4824  H HE3  . LYS A 1 78  ? -2.812  -5.101  -13.585 1.00 0.00 ? 78  LYS A HE3  3  
ATOM 4825  H HZ1  . LYS A 1 78  ? -4.934  -6.338  -13.864 1.00 0.00 ? 78  LYS A HZ1  3  
ATOM 4826  H HZ2  . LYS A 1 78  ? -4.267  -7.612  -12.974 1.00 0.00 ? 78  LYS A HZ2  3  
ATOM 4827  H HZ3  . LYS A 1 78  ? -3.577  -7.161  -14.451 1.00 0.00 ? 78  LYS A HZ3  3  
ATOM 4828  N N    . ALA A 1 79  ? -0.049  -5.223  -8.061  1.00 0.00 ? 79  ALA A N    3  
ATOM 4829  C CA   . ALA A 1 79  ? 0.020   -3.815  -7.691  1.00 0.00 ? 79  ALA A CA   3  
ATOM 4830  C C    . ALA A 1 79  ? 1.137   -3.103  -8.445  1.00 0.00 ? 79  ALA A C    3  
ATOM 4831  O O    . ALA A 1 79  ? 2.316   -3.295  -8.152  1.00 0.00 ? 79  ALA A O    3  
ATOM 4832  C CB   . ALA A 1 79  ? 0.220   -3.673  -6.189  1.00 0.00 ? 79  ALA A CB   3  
ATOM 4833  H H    . ALA A 1 79  ? 0.783   -5.723  -8.195  1.00 0.00 ? 79  ALA A H    3  
ATOM 4834  H HA   . ALA A 1 79  ? -0.924  -3.356  -7.948  1.00 0.00 ? 79  ALA A HA   3  
ATOM 4835  H HB1  . ALA A 1 79  ? 1.276   -3.710  -5.963  1.00 0.00 ? 79  ALA A HB1  3  
ATOM 4836  H HB2  . ALA A 1 79  ? -0.186  -2.729  -5.859  1.00 0.00 ? 79  ALA A HB2  3  
ATOM 4837  H HB3  . ALA A 1 79  ? -0.286  -4.481  -5.681  1.00 0.00 ? 79  ALA A HB3  3  
ATOM 4838  N N    . GLU A 1 80  ? 0.757   -2.280  -9.418  1.00 0.00 ? 80  GLU A N    3  
ATOM 4839  C CA   . GLU A 1 80  ? 1.729   -1.541  -10.215 1.00 0.00 ? 80  GLU A CA   3  
ATOM 4840  C C    . GLU A 1 80  ? 1.365   -0.060  -10.279 1.00 0.00 ? 80  GLU A C    3  
ATOM 4841  O O    . GLU A 1 80  ? 0.189   0.304   -10.257 1.00 0.00 ? 80  GLU A O    3  
ATOM 4842  C CB   . GLU A 1 80  ? 1.808   -2.120  -11.629 1.00 0.00 ? 80  GLU A CB   3  
ATOM 4843  C CG   . GLU A 1 80  ? 0.565   -1.860  -12.464 1.00 0.00 ? 80  GLU A CG   3  
ATOM 4844  C CD   . GLU A 1 80  ? 0.488   -2.751  -13.688 1.00 0.00 ? 80  GLU A CD   3  
ATOM 4845  O OE1  . GLU A 1 80  ? 1.393   -2.666  -14.543 1.00 0.00 ? 80  GLU A OE1  3  
ATOM 4846  O OE2  . GLU A 1 80  ? -0.479  -3.536  -13.789 1.00 0.00 ? 80  GLU A OE2  3  
ATOM 4847  H H    . GLU A 1 80  ? -0.198  -2.169  -9.604  1.00 0.00 ? 80  GLU A H    3  
ATOM 4848  H HA   . GLU A 1 80  ? 2.693   -1.642  -9.740  1.00 0.00 ? 80  GLU A HA   3  
ATOM 4849  H HB2  . GLU A 1 80  ? 2.656   -1.683  -12.137 1.00 0.00 ? 80  GLU A HB2  3  
ATOM 4850  H HB3  . GLU A 1 80  ? 1.952   -3.188  -11.560 1.00 0.00 ? 80  GLU A HB3  3  
ATOM 4851  H HG2  . GLU A 1 80  ? -0.307  -2.037  -11.853 1.00 0.00 ? 80  GLU A HG2  3  
ATOM 4852  H HG3  . GLU A 1 80  ? 0.573   -0.829  -12.787 1.00 0.00 ? 80  GLU A HG3  3  
ATOM 4853  N N    . HIS A 1 81  ? 2.384   0.790   -10.359 1.00 0.00 ? 81  HIS A N    3  
ATOM 4854  C CA   . HIS A 1 81  ? 2.173   2.232   -10.426 1.00 0.00 ? 81  HIS A CA   3  
ATOM 4855  C C    . HIS A 1 81  ? 1.899   2.674   -11.861 1.00 0.00 ? 81  HIS A C    3  
ATOM 4856  O O    . HIS A 1 81  ? 1.820   3.868   -12.148 1.00 0.00 ? 81  HIS A O    3  
ATOM 4857  C CB   . HIS A 1 81  ? 3.391   2.974   -9.876  1.00 0.00 ? 81  HIS A CB   3  
ATOM 4858  C CG   . HIS A 1 81  ? 3.060   4.302   -9.268  1.00 0.00 ? 81  HIS A CG   3  
ATOM 4859  N ND1  . HIS A 1 81  ? 4.019   5.177   -8.803  1.00 0.00 ? 81  HIS A ND1  3  
ATOM 4860  C CD2  . HIS A 1 81  ? 1.867   4.904   -9.052  1.00 0.00 ? 81  HIS A CD2  3  
ATOM 4861  C CE1  . HIS A 1 81  ? 3.430   6.259   -8.325  1.00 0.00 ? 81  HIS A CE1  3  
ATOM 4862  N NE2  . HIS A 1 81  ? 2.124   6.118   -8.465  1.00 0.00 ? 81  HIS A NE2  3  
ATOM 4863  H H    . HIS A 1 81  ? 3.299   0.440   -10.372 1.00 0.00 ? 81  HIS A H    3  
ATOM 4864  H HA   . HIS A 1 81  ? 1.313   2.470   -9.819  1.00 0.00 ? 81  HIS A HA   3  
ATOM 4865  H HB2  . HIS A 1 81  ? 3.859   2.368   -9.114  1.00 0.00 ? 81  HIS A HB2  3  
ATOM 4866  H HB3  . HIS A 1 81  ? 4.096   3.141   -10.678 1.00 0.00 ? 81  HIS A HB3  3  
ATOM 4867  H HD1  . HIS A 1 81  ? 4.986   5.026   -8.819  1.00 0.00 ? 81  HIS A HD1  3  
ATOM 4868  H HD2  . HIS A 1 81  ? 0.893   4.503   -9.295  1.00 0.00 ? 81  HIS A HD2  3  
ATOM 4869  H HE1  . HIS A 1 81  ? 3.930   7.113   -7.894  1.00 0.00 ? 81  HIS A HE1  3  
ATOM 4870  H HE2  . HIS A 1 81  ? 1.449   6.737   -8.116  1.00 0.00 ? 81  HIS A HE2  3  
ATOM 4871  N N    . ALA A 1 82  ? 1.754   1.704   -12.757 1.00 0.00 ? 82  ALA A N    3  
ATOM 4872  C CA   . ALA A 1 82  ? 1.488   1.993   -14.160 1.00 0.00 ? 82  ALA A CA   3  
ATOM 4873  C C    . ALA A 1 82  ? 2.735   2.525   -14.857 1.00 0.00 ? 82  ALA A C    3  
ATOM 4874  O O    . ALA A 1 82  ? 2.662   3.461   -15.653 1.00 0.00 ? 82  ALA A O    3  
ATOM 4875  C CB   . ALA A 1 82  ? 0.345   2.989   -14.286 1.00 0.00 ? 82  ALA A CB   3  
ATOM 4876  H H    . ALA A 1 82  ? 1.828   0.770   -12.467 1.00 0.00 ? 82  ALA A H    3  
ATOM 4877  H HA   . ALA A 1 82  ? 1.186   1.073   -14.639 1.00 0.00 ? 82  ALA A HA   3  
ATOM 4878  H HB1  . ALA A 1 82  ? -0.045  3.214   -13.304 1.00 0.00 ? 82  ALA A HB1  3  
ATOM 4879  H HB2  . ALA A 1 82  ? 0.707   3.896   -14.747 1.00 0.00 ? 82  ALA A HB2  3  
ATOM 4880  H HB3  . ALA A 1 82  ? -0.438  2.562   -14.895 1.00 0.00 ? 82  ALA A HB3  3  
ATOM 4881  N N    . GLY A 1 83  ? 3.881   1.923   -14.553 1.00 0.00 ? 83  GLY A N    3  
ATOM 4882  C CA   . GLY A 1 83  ? 5.128   2.352   -15.158 1.00 0.00 ? 83  GLY A CA   3  
ATOM 4883  C C    . GLY A 1 83  ? 6.326   2.090   -14.266 1.00 0.00 ? 83  GLY A C    3  
ATOM 4884  O O    . GLY A 1 83  ? 7.295   1.459   -14.686 1.00 0.00 ? 83  GLY A O    3  
ATOM 4885  H H    . GLY A 1 83  ? 3.879   1.182   -13.911 1.00 0.00 ? 83  GLY A H    3  
ATOM 4886  H HA2  . GLY A 1 83  ? 5.264   1.823   -16.090 1.00 0.00 ? 83  GLY A HA2  3  
ATOM 4887  H HA3  . GLY A 1 83  ? 5.071   3.411   -15.363 1.00 0.00 ? 83  GLY A HA3  3  
ATOM 4888  N N    . VAL A 1 84  ? 6.260   2.579   -13.032 1.00 0.00 ? 84  VAL A N    3  
ATOM 4889  C CA   . VAL A 1 84  ? 7.347   2.395   -12.078 1.00 0.00 ? 84  VAL A CA   3  
ATOM 4890  C C    . VAL A 1 84  ? 7.728   0.924   -11.956 1.00 0.00 ? 84  VAL A C    3  
ATOM 4891  O O    . VAL A 1 84  ? 8.788   0.506   -12.422 1.00 0.00 ? 84  VAL A O    3  
ATOM 4892  C CB   . VAL A 1 84  ? 6.970   2.934   -10.686 1.00 0.00 ? 84  VAL A CB   3  
ATOM 4893  C CG1  . VAL A 1 84  ? 7.958   2.445   -9.638  1.00 0.00 ? 84  VAL A CG1  3  
ATOM 4894  C CG2  . VAL A 1 84  ? 6.906   4.454   -10.702 1.00 0.00 ? 84  VAL A CG2  3  
ATOM 4895  H H    . VAL A 1 84  ? 5.461   3.074   -12.756 1.00 0.00 ? 84  VAL A H    3  
ATOM 4896  H HA   . VAL A 1 84  ? 8.203   2.950   -12.436 1.00 0.00 ? 84  VAL A HA   3  
ATOM 4897  H HB   . VAL A 1 84  ? 5.991   2.557   -10.429 1.00 0.00 ? 84  VAL A HB   3  
ATOM 4898  H HG11 . VAL A 1 84  ? 7.873   1.373   -9.536  1.00 0.00 ? 84  VAL A HG11 3  
ATOM 4899  H HG12 . VAL A 1 84  ? 8.962   2.700   -9.942  1.00 0.00 ? 84  VAL A HG12 3  
ATOM 4900  H HG13 . VAL A 1 84  ? 7.738   2.914   -8.690  1.00 0.00 ? 84  VAL A HG13 3  
ATOM 4901  H HG21 . VAL A 1 84  ? 7.864   4.850   -11.006 1.00 0.00 ? 84  VAL A HG21 3  
ATOM 4902  H HG22 . VAL A 1 84  ? 6.146   4.775   -11.399 1.00 0.00 ? 84  VAL A HG22 3  
ATOM 4903  H HG23 . VAL A 1 84  ? 6.664   4.815   -9.714  1.00 0.00 ? 84  VAL A HG23 3  
ATOM 4904  N N    . ARG A 1 85  ? 6.857   0.143   -11.326 1.00 0.00 ? 85  ARG A N    3  
ATOM 4905  C CA   . ARG A 1 85  ? 7.102   -1.282  -11.141 1.00 0.00 ? 85  ARG A CA   3  
ATOM 4906  C C    . ARG A 1 85  ? 5.801   -2.025  -10.854 1.00 0.00 ? 85  ARG A C    3  
ATOM 4907  O O    . ARG A 1 85  ? 4.890   -1.484  -10.225 1.00 0.00 ? 85  ARG A O    3  
ATOM 4908  C CB   . ARG A 1 85  ? 8.093   -1.506  -9.997  1.00 0.00 ? 85  ARG A CB   3  
ATOM 4909  C CG   . ARG A 1 85  ? 8.579   -2.942  -9.886  1.00 0.00 ? 85  ARG A CG   3  
ATOM 4910  C CD   . ARG A 1 85  ? 9.827   -3.175  -10.722 1.00 0.00 ? 85  ARG A CD   3  
ATOM 4911  N NE   . ARG A 1 85  ? 10.392  -4.504  -10.504 1.00 0.00 ? 85  ARG A NE   3  
ATOM 4912  C CZ   . ARG A 1 85  ? 11.643  -4.830  -10.812 1.00 0.00 ? 85  ARG A CZ   3  
ATOM 4913  N NH1  . ARG A 1 85  ? 12.454  -3.928  -11.348 1.00 0.00 ? 85  ARG A NH1  3  
ATOM 4914  N NH2  . ARG A 1 85  ? 12.084  -6.060  -10.584 1.00 0.00 ? 85  ARG A NH2  3  
ATOM 4915  H H    . ARG A 1 85  ? 6.029   0.535   -10.976 1.00 0.00 ? 85  ARG A H    3  
ATOM 4916  H HA   . ARG A 1 85  ? 7.528   -1.667  -12.055 1.00 0.00 ? 85  ARG A HA   3  
ATOM 4917  H HB2  . ARG A 1 85  ? 8.952   -0.870  -10.151 1.00 0.00 ? 85  ARG A HB2  3  
ATOM 4918  H HB3  . ARG A 1 85  ? 7.617   -1.237  -9.067  1.00 0.00 ? 85  ARG A HB3  3  
ATOM 4919  H HG2  . ARG A 1 85  ? 8.807   -3.156  -8.852  1.00 0.00 ? 85  ARG A HG2  3  
ATOM 4920  H HG3  . ARG A 1 85  ? 7.798   -3.604  -10.228 1.00 0.00 ? 85  ARG A HG3  3  
ATOM 4921  H HD2  . ARG A 1 85  ? 9.569   -3.071  -11.766 1.00 0.00 ? 85  ARG A HD2  3  
ATOM 4922  H HD3  . ARG A 1 85  ? 10.565  -2.432  -10.458 1.00 0.00 ? 85  ARG A HD3  3  
ATOM 4923  H HE   . ARG A 1 85  ? 9.810   -5.185  -10.109 1.00 0.00 ? 85  ARG A HE   3  
ATOM 4924  H HH11 . ARG A 1 85  ? 12.124  -3.000  -11.521 1.00 0.00 ? 85  ARG A HH11 3  
ATOM 4925  H HH12 . ARG A 1 85  ? 13.395  -4.176  -11.578 1.00 0.00 ? 85  ARG A HH12 3  
ATOM 4926  H HH21 . ARG A 1 85  ? 11.476  -6.743  -10.180 1.00 0.00 ? 85  ARG A HH21 3  
ATOM 4927  H HH22 . ARG A 1 85  ? 13.025  -6.305  -10.816 1.00 0.00 ? 85  ARG A HH22 3  
ATOM 4928  N N    . THR A 1 86  ? 5.719   -3.267  -11.319 1.00 0.00 ? 86  THR A N    3  
ATOM 4929  C CA   . THR A 1 86  ? 4.530   -4.084  -11.114 1.00 0.00 ? 86  THR A CA   3  
ATOM 4930  C C    . THR A 1 86  ? 4.797   -5.205  -10.116 1.00 0.00 ? 86  THR A C    3  
ATOM 4931  O O    . THR A 1 86  ? 5.728   -5.993  -10.288 1.00 0.00 ? 86  THR A O    3  
ATOM 4932  C CB   . THR A 1 86  ? 4.035   -4.697  -12.437 1.00 0.00 ? 86  THR A CB   3  
ATOM 4933  O OG1  . THR A 1 86  ? 3.573   -3.664  -13.314 1.00 0.00 ? 86  THR A OG1  3  
ATOM 4934  C CG2  . THR A 1 86  ? 2.913   -5.694  -12.186 1.00 0.00 ? 86  THR A CG2  3  
ATOM 4935  H H    . THR A 1 86  ? 6.478   -3.643  -11.812 1.00 0.00 ? 86  THR A H    3  
ATOM 4936  H HA   . THR A 1 86  ? 3.750   -3.446  -10.723 1.00 0.00 ? 86  THR A HA   3  
ATOM 4937  H HB   . THR A 1 86  ? 4.858   -5.216  -12.907 1.00 0.00 ? 86  THR A HB   3  
ATOM 4938  H HG1  . THR A 1 86  ? 4.211   -2.946  -13.327 1.00 0.00 ? 86  THR A HG1  3  
ATOM 4939  H HG21 . THR A 1 86  ? 3.237   -6.425  -11.460 1.00 0.00 ? 86  THR A HG21 3  
ATOM 4940  H HG22 . THR A 1 86  ? 2.660   -6.192  -13.110 1.00 0.00 ? 86  THR A HG22 3  
ATOM 4941  H HG23 . THR A 1 86  ? 2.046   -5.172  -11.808 1.00 0.00 ? 86  THR A HG23 3  
ATOM 4942  N N    . TYR A 1 87  ? 3.976   -5.272  -9.074  1.00 0.00 ? 87  TYR A N    3  
ATOM 4943  C CA   . TYR A 1 87  ? 4.126   -6.296  -8.048  1.00 0.00 ? 87  TYR A CA   3  
ATOM 4944  C C    . TYR A 1 87  ? 3.031   -7.352  -8.168  1.00 0.00 ? 87  TYR A C    3  
ATOM 4945  O O    . TYR A 1 87  ? 1.994   -7.120  -8.790  1.00 0.00 ? 87  TYR A O    3  
ATOM 4946  C CB   . TYR A 1 87  ? 4.088   -5.663  -6.656  1.00 0.00 ? 87  TYR A CB   3  
ATOM 4947  C CG   . TYR A 1 87  ? 5.251   -4.736  -6.381  1.00 0.00 ? 87  TYR A CG   3  
ATOM 4948  C CD1  . TYR A 1 87  ? 5.421   -3.567  -7.113  1.00 0.00 ? 87  TYR A CD1  3  
ATOM 4949  C CD2  . TYR A 1 87  ? 6.179   -5.029  -5.390  1.00 0.00 ? 87  TYR A CD2  3  
ATOM 4950  C CE1  . TYR A 1 87  ? 6.482   -2.718  -6.866  1.00 0.00 ? 87  TYR A CE1  3  
ATOM 4951  C CE2  . TYR A 1 87  ? 7.242   -4.185  -5.135  1.00 0.00 ? 87  TYR A CE2  3  
ATOM 4952  C CZ   . TYR A 1 87  ? 7.390   -3.031  -5.875  1.00 0.00 ? 87  TYR A CZ   3  
ATOM 4953  O OH   . TYR A 1 87  ? 8.448   -2.188  -5.625  1.00 0.00 ? 87  TYR A OH   3  
ATOM 4954  H H    . TYR A 1 87  ? 3.253   -4.616  -8.992  1.00 0.00 ? 87  TYR A H    3  
ATOM 4955  H HA   . TYR A 1 87  ? 5.085   -6.771  -8.190  1.00 0.00 ? 87  TYR A HA   3  
ATOM 4956  H HB2  . TYR A 1 87  ? 3.178   -5.092  -6.552  1.00 0.00 ? 87  TYR A HB2  3  
ATOM 4957  H HB3  . TYR A 1 87  ? 4.104   -6.445  -5.911  1.00 0.00 ? 87  TYR A HB3  3  
ATOM 4958  H HD1  . TYR A 1 87  ? 4.709   -3.325  -7.888  1.00 0.00 ? 87  TYR A HD1  3  
ATOM 4959  H HD2  . TYR A 1 87  ? 6.061   -5.934  -4.812  1.00 0.00 ? 87  TYR A HD2  3  
ATOM 4960  H HE1  . TYR A 1 87  ? 6.598   -1.814  -7.445  1.00 0.00 ? 87  TYR A HE1  3  
ATOM 4961  H HE2  . TYR A 1 87  ? 7.953   -4.430  -4.359  1.00 0.00 ? 87  TYR A HE2  3  
ATOM 4962  H HH   . TYR A 1 87  ? 8.973   -2.540  -4.902  1.00 0.00 ? 87  TYR A HH   3  
ATOM 4963  N N    . PHE A 1 88  ? 3.270   -8.513  -7.567  1.00 0.00 ? 88  PHE A N    3  
ATOM 4964  C CA   . PHE A 1 88  ? 2.305   -9.606  -7.606  1.00 0.00 ? 88  PHE A CA   3  
ATOM 4965  C C    . PHE A 1 88  ? 2.302   -10.376 -6.289  1.00 0.00 ? 88  PHE A C    3  
ATOM 4966  O O    . PHE A 1 88  ? 3.358   -10.719 -5.755  1.00 0.00 ? 88  PHE A O    3  
ATOM 4967  C CB   . PHE A 1 88  ? 2.624   -10.555 -8.764  1.00 0.00 ? 88  PHE A CB   3  
ATOM 4968  C CG   . PHE A 1 88  ? 2.368   -9.956  -10.117 1.00 0.00 ? 88  PHE A CG   3  
ATOM 4969  C CD1  . PHE A 1 88  ? 1.089   -9.933  -10.649 1.00 0.00 ? 88  PHE A CD1  3  
ATOM 4970  C CD2  . PHE A 1 88  ? 3.407   -9.417  -10.858 1.00 0.00 ? 88  PHE A CD2  3  
ATOM 4971  C CE1  . PHE A 1 88  ? 0.849   -9.383  -11.894 1.00 0.00 ? 88  PHE A CE1  3  
ATOM 4972  C CE2  . PHE A 1 88  ? 3.174   -8.864  -12.104 1.00 0.00 ? 88  PHE A CE2  3  
ATOM 4973  C CZ   . PHE A 1 88  ? 1.894   -8.848  -12.622 1.00 0.00 ? 88  PHE A CZ   3  
ATOM 4974  H H    . PHE A 1 88  ? 4.115   -8.638  -7.087  1.00 0.00 ? 88  PHE A H    3  
ATOM 4975  H HA   . PHE A 1 88  ? 1.327   -9.179  -7.761  1.00 0.00 ? 88  PHE A HA   3  
ATOM 4976  H HB2  . PHE A 1 88  ? 3.666   -10.832 -8.716  1.00 0.00 ? 88  PHE A HB2  3  
ATOM 4977  H HB3  . PHE A 1 88  ? 2.015   -11.441 -8.671  1.00 0.00 ? 88  PHE A HB3  3  
ATOM 4978  H HD1  . PHE A 1 88  ? 0.270   -10.351 -10.079 1.00 0.00 ? 88  PHE A HD1  3  
ATOM 4979  H HD2  . PHE A 1 88  ? 4.409   -9.429  -10.455 1.00 0.00 ? 88  PHE A HD2  3  
ATOM 4980  H HE1  . PHE A 1 88  ? -0.153  -9.372  -12.296 1.00 0.00 ? 88  PHE A HE1  3  
ATOM 4981  H HE2  . PHE A 1 88  ? 3.992   -8.448  -12.672 1.00 0.00 ? 88  PHE A HE2  3  
ATOM 4982  H HZ   . PHE A 1 88  ? 1.709   -8.417  -13.595 1.00 0.00 ? 88  PHE A HZ   3  
ATOM 4983  N N    . PHE A 1 89  ? 1.109   -10.645 -5.770  1.00 0.00 ? 89  PHE A N    3  
ATOM 4984  C CA   . PHE A 1 89  ? 0.967   -11.373 -4.514  1.00 0.00 ? 89  PHE A CA   3  
ATOM 4985  C C    . PHE A 1 89  ? -0.085  -12.471 -4.638  1.00 0.00 ? 89  PHE A C    3  
ATOM 4986  O O    . PHE A 1 89  ? -1.120  -12.285 -5.277  1.00 0.00 ? 89  PHE A O    3  
ATOM 4987  C CB   . PHE A 1 89  ? 0.589   -10.413 -3.384  1.00 0.00 ? 89  PHE A CB   3  
ATOM 4988  C CG   . PHE A 1 89  ? 1.516   -9.238  -3.260  1.00 0.00 ? 89  PHE A CG   3  
ATOM 4989  C CD1  . PHE A 1 89  ? 2.780   -9.390  -2.713  1.00 0.00 ? 89  PHE A CD1  3  
ATOM 4990  C CD2  . PHE A 1 89  ? 1.124   -7.981  -3.690  1.00 0.00 ? 89  PHE A CD2  3  
ATOM 4991  C CE1  . PHE A 1 89  ? 3.634   -8.310  -2.597  1.00 0.00 ? 89  PHE A CE1  3  
ATOM 4992  C CE2  . PHE A 1 89  ? 1.974   -6.897  -3.577  1.00 0.00 ? 89  PHE A CE2  3  
ATOM 4993  C CZ   . PHE A 1 89  ? 3.231   -7.062  -3.031  1.00 0.00 ? 89  PHE A CZ   3  
ATOM 4994  H H    . PHE A 1 89  ? 0.304   -10.345 -6.242  1.00 0.00 ? 89  PHE A H    3  
ATOM 4995  H HA   . PHE A 1 89  ? 1.919   -11.827 -4.286  1.00 0.00 ? 89  PHE A HA   3  
ATOM 4996  H HB2  . PHE A 1 89  ? -0.406  -10.033 -3.561  1.00 0.00 ? 89  PHE A HB2  3  
ATOM 4997  H HB3  . PHE A 1 89  ? 0.604   -10.949 -2.447  1.00 0.00 ? 89  PHE A HB3  3  
ATOM 4998  H HD1  . PHE A 1 89  ? 3.097   -10.366 -2.374  1.00 0.00 ? 89  PHE A HD1  3  
ATOM 4999  H HD2  . PHE A 1 89  ? 0.139   -7.851  -4.119  1.00 0.00 ? 89  PHE A HD2  3  
ATOM 5000  H HE1  . PHE A 1 89  ? 4.617   -8.442  -2.170  1.00 0.00 ? 89  PHE A HE1  3  
ATOM 5001  H HE2  . PHE A 1 89  ? 1.655   -5.923  -3.918  1.00 0.00 ? 89  PHE A HE2  3  
ATOM 5002  H HZ   . PHE A 1 89  ? 3.897   -6.217  -2.941  1.00 0.00 ? 89  PHE A HZ   3  
ATOM 5003  N N    . SER A 1 90  ? 0.189   -13.616 -4.021  1.00 0.00 ? 90  SER A N    3  
ATOM 5004  C CA   . SER A 1 90  ? -0.731  -14.747 -4.065  1.00 0.00 ? 90  SER A CA   3  
ATOM 5005  C C    . SER A 1 90  ? -1.212  -15.111 -2.664  1.00 0.00 ? 90  SER A C    3  
ATOM 5006  O O    . SER A 1 90  ? -0.409  -15.382 -1.771  1.00 0.00 ? 90  SER A O    3  
ATOM 5007  C CB   . SER A 1 90  ? -0.056  -15.956 -4.715  1.00 0.00 ? 90  SER A CB   3  
ATOM 5008  O OG   . SER A 1 90  ? -0.862  -17.116 -4.595  1.00 0.00 ? 90  SER A OG   3  
ATOM 5009  H H    . SER A 1 90  ? 1.031   -13.704 -3.527  1.00 0.00 ? 90  SER A H    3  
ATOM 5010  H HA   . SER A 1 90  ? -1.584  -14.457 -4.662  1.00 0.00 ? 90  SER A HA   3  
ATOM 5011  H HB2  . SER A 1 90  ? 0.108   -15.753 -5.762  1.00 0.00 ? 90  SER A HB2  3  
ATOM 5012  H HB3  . SER A 1 90  ? 0.892   -16.139 -4.230  1.00 0.00 ? 90  SER A HB3  3  
ATOM 5013  H HG   . SER A 1 90  ? -1.345  -17.256 -5.412  1.00 0.00 ? 90  SER A HG   3  
ATOM 5014  N N    . ALA A 1 91  ? -2.528  -15.114 -2.479  1.00 0.00 ? 91  ALA A N    3  
ATOM 5015  C CA   . ALA A 1 91  ? -3.117  -15.446 -1.188  1.00 0.00 ? 91  ALA A CA   3  
ATOM 5016  C C    . ALA A 1 91  ? -3.450  -16.931 -1.102  1.00 0.00 ? 91  ALA A C    3  
ATOM 5017  O O    . ALA A 1 91  ? -3.847  -17.545 -2.092  1.00 0.00 ? 91  ALA A O    3  
ATOM 5018  C CB   . ALA A 1 91  ? -4.364  -14.608 -0.945  1.00 0.00 ? 91  ALA A CB   3  
ATOM 5019  H H    . ALA A 1 91  ? -3.117  -14.888 -3.229  1.00 0.00 ? 91  ALA A H    3  
ATOM 5020  H HA   . ALA A 1 91  ? -2.397  -15.204 -0.420  1.00 0.00 ? 91  ALA A HA   3  
ATOM 5021  H HB1  . ALA A 1 91  ? -4.080  -13.579 -0.782  1.00 0.00 ? 91  ALA A HB1  3  
ATOM 5022  H HB2  . ALA A 1 91  ? -5.012  -14.671 -1.807  1.00 0.00 ? 91  ALA A HB2  3  
ATOM 5023  H HB3  . ALA A 1 91  ? -4.884  -14.981 -0.076  1.00 0.00 ? 91  ALA A HB3  3  
ATOM 5024  N N    . GLU A 1 92  ? -3.286  -17.503 0.087   1.00 0.00 ? 92  GLU A N    3  
ATOM 5025  C CA   . GLU A 1 92  ? -3.568  -18.917 0.300   1.00 0.00 ? 92  GLU A CA   3  
ATOM 5026  C C    . GLU A 1 92  ? -5.069  -19.187 0.245   1.00 0.00 ? 92  GLU A C    3  
ATOM 5027  O O    . GLU A 1 92  ? -5.500  -20.297 -0.065  1.00 0.00 ? 92  GLU A O    3  
ATOM 5028  C CB   . GLU A 1 92  ? -3.005  -19.375 1.647   1.00 0.00 ? 92  GLU A CB   3  
ATOM 5029  C CG   . GLU A 1 92  ? -1.501  -19.202 1.769   1.00 0.00 ? 92  GLU A CG   3  
ATOM 5030  C CD   . GLU A 1 92  ? -0.869  -20.221 2.697   1.00 0.00 ? 92  GLU A CD   3  
ATOM 5031  O OE1  . GLU A 1 92  ? -1.153  -21.426 2.537   1.00 0.00 ? 92  GLU A OE1  3  
ATOM 5032  O OE2  . GLU A 1 92  ? -0.090  -19.813 3.584   1.00 0.00 ? 92  GLU A OE2  3  
ATOM 5033  H H    . GLU A 1 92  ? -2.967  -16.960 0.838   1.00 0.00 ? 92  GLU A H    3  
ATOM 5034  H HA   . GLU A 1 92  ? -3.086  -19.474 -0.489  1.00 0.00 ? 92  GLU A HA   3  
ATOM 5035  H HB2  . GLU A 1 92  ? -3.478  -18.806 2.434   1.00 0.00 ? 92  GLU A HB2  3  
ATOM 5036  H HB3  . GLU A 1 92  ? -3.238  -20.421 1.783   1.00 0.00 ? 92  GLU A HB3  3  
ATOM 5037  H HG2  . GLU A 1 92  ? -1.058  -19.307 0.790   1.00 0.00 ? 92  GLU A HG2  3  
ATOM 5038  H HG3  . GLU A 1 92  ? -1.295  -18.213 2.151   1.00 0.00 ? 92  GLU A HG3  3  
ATOM 5039  N N    . SER A 1 93  ? -5.860  -18.163 0.549   1.00 0.00 ? 93  SER A N    3  
ATOM 5040  C CA   . SER A 1 93  ? -7.312  -18.289 0.539   1.00 0.00 ? 93  SER A CA   3  
ATOM 5041  C C    . SER A 1 93  ? -7.951  -17.160 -0.264  1.00 0.00 ? 93  SER A C    3  
ATOM 5042  O O    . SER A 1 93  ? -7.425  -16.050 -0.348  1.00 0.00 ? 93  SER A O    3  
ATOM 5043  C CB   . SER A 1 93  ? -7.856  -18.283 1.969   1.00 0.00 ? 93  SER A CB   3  
ATOM 5044  O OG   . SER A 1 93  ? -9.199  -17.832 2.003   1.00 0.00 ? 93  SER A OG   3  
ATOM 5045  H H    . SER A 1 93  ? -5.456  -17.302 0.788   1.00 0.00 ? 93  SER A H    3  
ATOM 5046  H HA   . SER A 1 93  ? -7.560  -19.231 0.073   1.00 0.00 ? 93  SER A HA   3  
ATOM 5047  H HB2  . SER A 1 93  ? -7.815  -19.284 2.371   1.00 0.00 ? 93  SER A HB2  3  
ATOM 5048  H HB3  . SER A 1 93  ? -7.252  -17.626 2.578   1.00 0.00 ? 93  SER A HB3  3  
ATOM 5049  H HG   . SER A 1 93  ? -9.478  -17.726 2.915   1.00 0.00 ? 93  SER A HG   3  
ATOM 5050  N N    . PRO A 1 94  ? -9.112  -17.449 -0.869  1.00 0.00 ? 94  PRO A N    3  
ATOM 5051  C CA   . PRO A 1 94  ? -9.848  -16.471 -1.676  1.00 0.00 ? 94  PRO A CA   3  
ATOM 5052  C C    . PRO A 1 94  ? -10.454 -15.358 -0.829  1.00 0.00 ? 94  PRO A C    3  
ATOM 5053  O O    . PRO A 1 94  ? -10.944 -14.360 -1.357  1.00 0.00 ? 94  PRO A O    3  
ATOM 5054  C CB   . PRO A 1 94  ? -10.952 -17.309 -2.328  1.00 0.00 ? 94  PRO A CB   3  
ATOM 5055  C CG   . PRO A 1 94  ? -11.148 -18.461 -1.404  1.00 0.00 ? 94  PRO A CG   3  
ATOM 5056  C CD   . PRO A 1 94  ? -9.796  -18.751 -0.812  1.00 0.00 ? 94  PRO A CD   3  
ATOM 5057  H HA   . PRO A 1 94  ? -9.223  -16.038 -2.443  1.00 0.00 ? 94  PRO A HA   3  
ATOM 5058  H HB2  . PRO A 1 94  ? -11.852 -16.716 -2.417  1.00 0.00 ? 94  PRO A HB2  3  
ATOM 5059  H HB3  . PRO A 1 94  ? -10.632 -17.636 -3.305  1.00 0.00 ? 94  PRO A HB3  3  
ATOM 5060  H HG2  . PRO A 1 94  ? -11.848 -18.195 -0.628  1.00 0.00 ? 94  PRO A HG2  3  
ATOM 5061  H HG3  . PRO A 1 94  ? -11.506 -19.317 -1.957  1.00 0.00 ? 94  PRO A HG3  3  
ATOM 5062  H HD2  . PRO A 1 94  ? -9.896  -19.090 0.209   1.00 0.00 ? 94  PRO A HD2  3  
ATOM 5063  H HD3  . PRO A 1 94  ? -9.274  -19.487 -1.406  1.00 0.00 ? 94  PRO A HD3  3  
ATOM 5064  N N    . GLU A 1 95  ? -10.417 -15.536 0.488   1.00 0.00 ? 95  GLU A N    3  
ATOM 5065  C CA   . GLU A 1 95  ? -10.963 -14.545 1.408   1.00 0.00 ? 95  GLU A CA   3  
ATOM 5066  C C    . GLU A 1 95  ? -9.931  -13.466 1.721   1.00 0.00 ? 95  GLU A C    3  
ATOM 5067  O O    . GLU A 1 95  ? -10.283 -12.339 2.068   1.00 0.00 ? 95  GLU A O    3  
ATOM 5068  C CB   . GLU A 1 95  ? -11.422 -15.218 2.704   1.00 0.00 ? 95  GLU A CB   3  
ATOM 5069  C CG   . GLU A 1 95  ? -10.312 -15.390 3.727   1.00 0.00 ? 95  GLU A CG   3  
ATOM 5070  C CD   . GLU A 1 95  ? -10.612 -16.481 4.736   1.00 0.00 ? 95  GLU A CD   3  
ATOM 5071  O OE1  . GLU A 1 95  ? -11.493 -17.321 4.456   1.00 0.00 ? 95  GLU A OE1  3  
ATOM 5072  O OE2  . GLU A 1 95  ? -9.967  -16.495 5.805   1.00 0.00 ? 95  GLU A OE2  3  
ATOM 5073  H H    . GLU A 1 95  ? -10.013 -16.353 0.849   1.00 0.00 ? 95  GLU A H    3  
ATOM 5074  H HA   . GLU A 1 95  ? -11.815 -14.085 0.932   1.00 0.00 ? 95  GLU A HA   3  
ATOM 5075  H HB2  . GLU A 1 95  ? -12.204 -14.621 3.148   1.00 0.00 ? 95  GLU A HB2  3  
ATOM 5076  H HB3  . GLU A 1 95  ? -11.818 -16.195 2.467   1.00 0.00 ? 95  GLU A HB3  3  
ATOM 5077  H HG2  . GLU A 1 95  ? -9.398  -15.641 3.209   1.00 0.00 ? 95  GLU A HG2  3  
ATOM 5078  H HG3  . GLU A 1 95  ? -10.180 -14.457 4.255   1.00 0.00 ? 95  GLU A HG3  3  
ATOM 5079  N N    . GLU A 1 96  ? -8.656  -13.820 1.595   1.00 0.00 ? 96  GLU A N    3  
ATOM 5080  C CA   . GLU A 1 96  ? -7.573  -12.882 1.865   1.00 0.00 ? 96  GLU A CA   3  
ATOM 5081  C C    . GLU A 1 96  ? -7.300  -12.000 0.649   1.00 0.00 ? 96  GLU A C    3  
ATOM 5082  O O    . GLU A 1 96  ? -7.161  -10.784 0.772   1.00 0.00 ? 96  GLU A O    3  
ATOM 5083  C CB   . GLU A 1 96  ? -6.301  -13.636 2.257   1.00 0.00 ? 96  GLU A CB   3  
ATOM 5084  C CG   . GLU A 1 96  ? -6.256  -14.033 3.723   1.00 0.00 ? 96  GLU A CG   3  
ATOM 5085  C CD   . GLU A 1 96  ? -5.423  -15.277 3.965   1.00 0.00 ? 96  GLU A CD   3  
ATOM 5086  O OE1  . GLU A 1 96  ? -4.512  -15.547 3.155   1.00 0.00 ? 96  GLU A OE1  3  
ATOM 5087  O OE2  . GLU A 1 96  ? -5.682  -15.980 4.964   1.00 0.00 ? 96  GLU A OE2  3  
ATOM 5088  H H    . GLU A 1 96  ? -8.439  -14.733 1.314   1.00 0.00 ? 96  GLU A H    3  
ATOM 5089  H HA   . GLU A 1 96  ? -7.876  -12.254 2.689   1.00 0.00 ? 96  GLU A HA   3  
ATOM 5090  H HB2  . GLU A 1 96  ? -6.230  -14.533 1.660   1.00 0.00 ? 96  GLU A HB2  3  
ATOM 5091  H HB3  . GLU A 1 96  ? -5.447  -13.008 2.050   1.00 0.00 ? 96  GLU A HB3  3  
ATOM 5092  H HG2  . GLU A 1 96  ? -5.833  -13.219 4.291   1.00 0.00 ? 96  GLU A HG2  3  
ATOM 5093  H HG3  . GLU A 1 96  ? -7.264  -14.221 4.063   1.00 0.00 ? 96  GLU A HG3  3  
ATOM 5094  N N    . GLN A 1 97  ? -7.225  -12.624 -0.522  1.00 0.00 ? 97  GLN A N    3  
ATOM 5095  C CA   . GLN A 1 97  ? -6.968  -11.897 -1.759  1.00 0.00 ? 97  GLN A CA   3  
ATOM 5096  C C    . GLN A 1 97  ? -7.791  -10.615 -1.818  1.00 0.00 ? 97  GLN A C    3  
ATOM 5097  O O    . GLN A 1 97  ? -7.241  -9.515  -1.856  1.00 0.00 ? 97  GLN A O    3  
ATOM 5098  C CB   . GLN A 1 97  ? -7.287  -12.778 -2.969  1.00 0.00 ? 97  GLN A CB   3  
ATOM 5099  C CG   . GLN A 1 97  ? -7.212  -12.039 -4.295  1.00 0.00 ? 97  GLN A CG   3  
ATOM 5100  C CD   . GLN A 1 97  ? -8.006  -12.724 -5.390  1.00 0.00 ? 97  GLN A CD   3  
ATOM 5101  O OE1  . GLN A 1 97  ? -9.040  -13.342 -5.130  1.00 0.00 ? 97  GLN A OE1  3  
ATOM 5102  N NE2  . GLN A 1 97  ? -7.527  -12.619 -6.624  1.00 0.00 ? 97  GLN A NE2  3  
ATOM 5103  H H    . GLN A 1 97  ? -7.345  -13.596 -0.554  1.00 0.00 ? 97  GLN A H    3  
ATOM 5104  H HA   . GLN A 1 97  ? -5.920  -11.639 -1.780  1.00 0.00 ? 97  GLN A HA   3  
ATOM 5105  H HB2  . GLN A 1 97  ? -6.585  -13.598 -2.997  1.00 0.00 ? 97  GLN A HB2  3  
ATOM 5106  H HB3  . GLN A 1 97  ? -8.286  -13.173 -2.858  1.00 0.00 ? 97  GLN A HB3  3  
ATOM 5107  H HG2  . GLN A 1 97  ? -7.602  -11.041 -4.160  1.00 0.00 ? 97  GLN A HG2  3  
ATOM 5108  H HG3  . GLN A 1 97  ? -6.178  -11.982 -4.603  1.00 0.00 ? 97  GLN A HG3  3  
ATOM 5109  H HE21 . GLN A 1 97  ? -6.698  -12.112 -6.756  1.00 0.00 ? 97  GLN A HE21 3  
ATOM 5110  H HE22 . GLN A 1 97  ? -8.020  -13.052 -7.350  1.00 0.00 ? 97  GLN A HE22 3  
ATOM 5111  N N    . GLU A 1 98  ? -9.112  -10.765 -1.826  1.00 0.00 ? 98  GLU A N    3  
ATOM 5112  C CA   . GLU A 1 98  ? -10.010 -9.618  -1.881  1.00 0.00 ? 98  GLU A CA   3  
ATOM 5113  C C    . GLU A 1 98  ? -9.686  -8.619  -0.774  1.00 0.00 ? 98  GLU A C    3  
ATOM 5114  O O    . GLU A 1 98  ? -9.415  -7.448  -1.039  1.00 0.00 ? 98  GLU A O    3  
ATOM 5115  C CB   . GLU A 1 98  ? -11.466 -10.075 -1.761  1.00 0.00 ? 98  GLU A CB   3  
ATOM 5116  C CG   . GLU A 1 98  ? -11.873 -11.092 -2.814  1.00 0.00 ? 98  GLU A CG   3  
ATOM 5117  C CD   . GLU A 1 98  ? -13.264 -11.649 -2.579  1.00 0.00 ? 98  GLU A CD   3  
ATOM 5118  O OE1  . GLU A 1 98  ? -14.116 -10.911 -2.042  1.00 0.00 ? 98  GLU A OE1  3  
ATOM 5119  O OE2  . GLU A 1 98  ? -13.499 -12.823 -2.934  1.00 0.00 ? 98  GLU A OE2  3  
ATOM 5120  H H    . GLU A 1 98  ? -9.491  -11.668 -1.794  1.00 0.00 ? 98  GLU A H    3  
ATOM 5121  H HA   . GLU A 1 98  ? -9.872  -9.134  -2.837  1.00 0.00 ? 98  GLU A HA   3  
ATOM 5122  H HB2  . GLU A 1 98  ? -11.612 -10.517 -0.787  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 5123  H HB3  . GLU A 1 98  ? -12.110 -9.213  -1.855  1.00 0.00 ? 98  GLU A HB3  3  
ATOM 5124  H HG2  . GLU A 1 98  ? -11.852 -10.616 -3.783  1.00 0.00 ? 98  GLU A HG2  3  
ATOM 5125  H HG3  . GLU A 1 98  ? -11.167 -11.909 -2.799  1.00 0.00 ? 98  GLU A HG3  3  
ATOM 5126  N N    . ALA A 1 99  ? -9.718  -9.090  0.468   1.00 0.00 ? 99  ALA A N    3  
ATOM 5127  C CA   . ALA A 1 99  ? -9.426  -8.240  1.616   1.00 0.00 ? 99  ALA A CA   3  
ATOM 5128  C C    . ALA A 1 99  ? -8.194  -7.379  1.362   1.00 0.00 ? 99  ALA A C    3  
ATOM 5129  O O    . ALA A 1 99  ? -8.205  -6.174  1.616   1.00 0.00 ? 99  ALA A O    3  
ATOM 5130  C CB   . ALA A 1 99  ? -9.232  -9.088  2.864   1.00 0.00 ? 99  ALA A CB   3  
ATOM 5131  H H    . ALA A 1 99  ? -9.941  -10.033 0.616   1.00 0.00 ? 99  ALA A H    3  
ATOM 5132  H HA   . ALA A 1 99  ? -10.278 -7.595  1.778   1.00 0.00 ? 99  ALA A HA   3  
ATOM 5133  H HB1  . ALA A 1 99  ? -8.474  -9.835  2.677   1.00 0.00 ? 99  ALA A HB1  3  
ATOM 5134  H HB2  . ALA A 1 99  ? -8.921  -8.456  3.683   1.00 0.00 ? 99  ALA A HB2  3  
ATOM 5135  H HB3  . ALA A 1 99  ? -10.162 -9.574  3.117   1.00 0.00 ? 99  ALA A HB3  3  
ATOM 5136  N N    . TRP A 1 100 ? -7.135  -8.003  0.860   1.00 0.00 ? 100 TRP A N    3  
ATOM 5137  C CA   . TRP A 1 100 ? -5.894  -7.292  0.572   1.00 0.00 ? 100 TRP A CA   3  
ATOM 5138  C C    . TRP A 1 100 ? -6.115  -6.218  -0.487  1.00 0.00 ? 100 TRP A C    3  
ATOM 5139  O O    . TRP A 1 100 ? -5.815  -5.044  -0.265  1.00 0.00 ? 100 TRP A O    3  
ATOM 5140  C CB   . TRP A 1 100 ? -4.817  -8.272  0.105   1.00 0.00 ? 100 TRP A CB   3  
ATOM 5141  C CG   . TRP A 1 100 ? -4.082  -8.930  1.234   1.00 0.00 ? 100 TRP A CG   3  
ATOM 5142  C CD1  . TRP A 1 100 ? -4.264  -10.201 1.700   1.00 0.00 ? 100 TRP A CD1  3  
ATOM 5143  C CD2  . TRP A 1 100 ? -3.051  -8.349  2.039   1.00 0.00 ? 100 TRP A CD2  3  
ATOM 5144  N NE1  . TRP A 1 100 ? -3.408  -10.444 2.747   1.00 0.00 ? 100 TRP A NE1  3  
ATOM 5145  C CE2  . TRP A 1 100 ? -2.652  -9.324  2.974   1.00 0.00 ? 100 TRP A CE2  3  
ATOM 5146  C CE3  . TRP A 1 100 ? -2.424  -7.100  2.060   1.00 0.00 ? 100 TRP A CE3  3  
ATOM 5147  C CZ2  . TRP A 1 100 ? -1.657  -9.087  3.918   1.00 0.00 ? 100 TRP A CZ2  3  
ATOM 5148  C CZ3  . TRP A 1 100 ? -1.436  -6.867  2.998   1.00 0.00 ? 100 TRP A CZ3  3  
ATOM 5149  C CH2  . TRP A 1 100 ? -1.060  -7.856  3.916   1.00 0.00 ? 100 TRP A CH2  3  
ATOM 5150  H H    . TRP A 1 100 ? -7.188  -8.965  0.678   1.00 0.00 ? 100 TRP A H    3  
ATOM 5151  H HA   . TRP A 1 100 ? -5.565  -6.818  1.486   1.00 0.00 ? 100 TRP A HA   3  
ATOM 5152  H HB2  . TRP A 1 100 ? -5.278  -9.047  -0.489  1.00 0.00 ? 100 TRP A HB2  3  
ATOM 5153  H HB3  . TRP A 1 100 ? -4.095  -7.742  -0.499  1.00 0.00 ? 100 TRP A HB3  3  
ATOM 5154  H HD1  . TRP A 1 100 ? -4.981  -10.899 1.297   1.00 0.00 ? 100 TRP A HD1  3  
ATOM 5155  H HE1  . TRP A 1 100 ? -3.347  -11.285 3.248   1.00 0.00 ? 100 TRP A HE1  3  
ATOM 5156  H HE3  . TRP A 1 100 ? -2.700  -6.325  1.361   1.00 0.00 ? 100 TRP A HE3  3  
ATOM 5157  H HZ2  . TRP A 1 100 ? -1.355  -9.840  4.632   1.00 0.00 ? 100 TRP A HZ2  3  
ATOM 5158  H HZ3  . TRP A 1 100 ? -0.941  -5.907  3.030   1.00 0.00 ? 100 TRP A HZ3  3  
ATOM 5159  H HH2  . TRP A 1 100 ? -0.284  -7.630  4.631   1.00 0.00 ? 100 TRP A HH2  3  
ATOM 5160  N N    . ILE A 1 101 ? -6.642  -6.626  -1.636  1.00 0.00 ? 101 ILE A N    3  
ATOM 5161  C CA   . ILE A 1 101 ? -6.904  -5.697  -2.729  1.00 0.00 ? 101 ILE A CA   3  
ATOM 5162  C C    . ILE A 1 101 ? -7.578  -4.427  -2.220  1.00 0.00 ? 101 ILE A C    3  
ATOM 5163  O O    . ILE A 1 101 ? -7.342  -3.337  -2.740  1.00 0.00 ? 101 ILE A O    3  
ATOM 5164  C CB   . ILE A 1 101 ? -7.791  -6.338  -3.812  1.00 0.00 ? 101 ILE A CB   3  
ATOM 5165  C CG1  . ILE A 1 101 ? -7.086  -7.547  -4.430  1.00 0.00 ? 101 ILE A CG1  3  
ATOM 5166  C CG2  . ILE A 1 101 ? -8.138  -5.316  -4.885  1.00 0.00 ? 101 ILE A CG2  3  
ATOM 5167  C CD1  . ILE A 1 101 ? -7.956  -8.329  -5.389  1.00 0.00 ? 101 ILE A CD1  3  
ATOM 5168  H H    . ILE A 1 101 ? -6.860  -7.574  -1.753  1.00 0.00 ? 101 ILE A H    3  
ATOM 5169  H HA   . ILE A 1 101 ? -5.956  -5.434  -3.176  1.00 0.00 ? 101 ILE A HA   3  
ATOM 5170  H HB   . ILE A 1 101 ? -8.709  -6.663  -3.348  1.00 0.00 ? 101 ILE A HB   3  
ATOM 5171  H HG12 . ILE A 1 101 ? -6.215  -7.211  -4.971  1.00 0.00 ? 101 ILE A HG12 3  
ATOM 5172  H HG13 . ILE A 1 101 ? -6.777  -8.216  -3.639  1.00 0.00 ? 101 ILE A HG13 3  
ATOM 5173  H HG21 . ILE A 1 101 ? -8.887  -4.637  -4.505  1.00 0.00 ? 101 ILE A HG21 3  
ATOM 5174  H HG22 . ILE A 1 101 ? -7.252  -4.760  -5.152  1.00 0.00 ? 101 ILE A HG22 3  
ATOM 5175  H HG23 . ILE A 1 101 ? -8.521  -5.824  -5.756  1.00 0.00 ? 101 ILE A HG23 3  
ATOM 5176  H HD11 . ILE A 1 101 ? -7.604  -9.349  -5.445  1.00 0.00 ? 101 ILE A HD11 3  
ATOM 5177  H HD12 . ILE A 1 101 ? -8.977  -8.318  -5.040  1.00 0.00 ? 101 ILE A HD12 3  
ATOM 5178  H HD13 . ILE A 1 101 ? -7.906  -7.878  -6.369  1.00 0.00 ? 101 ILE A HD13 3  
ATOM 5179  N N    . GLN A 1 102 ? -8.418  -4.577  -1.201  1.00 0.00 ? 102 GLN A N    3  
ATOM 5180  C CA   . GLN A 1 102 ? -9.126  -3.442  -0.622  1.00 0.00 ? 102 GLN A CA   3  
ATOM 5181  C C    . GLN A 1 102 ? -8.283  -2.765  0.454   1.00 0.00 ? 102 GLN A C    3  
ATOM 5182  O O    . GLN A 1 102 ? -8.268  -1.540  0.566   1.00 0.00 ? 102 GLN A O    3  
ATOM 5183  C CB   . GLN A 1 102 ? -10.462 -3.895  -0.029  1.00 0.00 ? 102 GLN A CB   3  
ATOM 5184  C CG   . GLN A 1 102 ? -11.278 -4.769  -0.968  1.00 0.00 ? 102 GLN A CG   3  
ATOM 5185  C CD   . GLN A 1 102 ? -12.761 -4.734  -0.655  1.00 0.00 ? 102 GLN A CD   3  
ATOM 5186  O OE1  . GLN A 1 102 ? -13.341 -3.665  -0.460  1.00 0.00 ? 102 GLN A OE1  3  
ATOM 5187  N NE2  . GLN A 1 102 ? -13.384 -5.905  -0.607  1.00 0.00 ? 102 GLN A NE2  3  
ATOM 5188  H H    . GLN A 1 102 ? -8.565  -5.472  -0.831  1.00 0.00 ? 102 GLN A H    3  
ATOM 5189  H HA   . GLN A 1 102 ? -9.316  -2.732  -1.412  1.00 0.00 ? 102 GLN A HA   3  
ATOM 5190  H HB2  . GLN A 1 102 ? -10.270 -4.455  0.874   1.00 0.00 ? 102 GLN A HB2  3  
ATOM 5191  H HB3  . GLN A 1 102 ? -11.048 -3.022  0.215   1.00 0.00 ? 102 GLN A HB3  3  
ATOM 5192  H HG2  . GLN A 1 102 ? -11.132 -4.423  -1.980  1.00 0.00 ? 102 GLN A HG2  3  
ATOM 5193  H HG3  . GLN A 1 102 ? -10.931 -5.788  -0.883  1.00 0.00 ? 102 GLN A HG3  3  
ATOM 5194  H HE21 . GLN A 1 102 ? -12.858 -6.716  -0.772  1.00 0.00 ? 102 GLN A HE21 3  
ATOM 5195  H HE22 . GLN A 1 102 ? -14.342 -5.912  -0.406  1.00 0.00 ? 102 GLN A HE22 3  
ATOM 5196  N N    . ALA A 1 103 ? -7.581  -3.572  1.243   1.00 0.00 ? 103 ALA A N    3  
ATOM 5197  C CA   . ALA A 1 103 ? -6.734  -3.051  2.309   1.00 0.00 ? 103 ALA A CA   3  
ATOM 5198  C C    . ALA A 1 103 ? -5.592  -2.215  1.742   1.00 0.00 ? 103 ALA A C    3  
ATOM 5199  O O    . ALA A 1 103 ? -5.470  -1.028  2.045   1.00 0.00 ? 103 ALA A O    3  
ATOM 5200  C CB   . ALA A 1 103 ? -6.186  -4.192  3.153   1.00 0.00 ? 103 ALA A CB   3  
ATOM 5201  H H    . ALA A 1 103 ? -7.634  -4.541  1.104   1.00 0.00 ? 103 ALA A H    3  
ATOM 5202  H HA   . ALA A 1 103 ? -7.344  -2.426  2.945   1.00 0.00 ? 103 ALA A HA   3  
ATOM 5203  H HB1  . ALA A 1 103 ? -6.156  -3.890  4.190   1.00 0.00 ? 103 ALA A HB1  3  
ATOM 5204  H HB2  . ALA A 1 103 ? -6.826  -5.056  3.048   1.00 0.00 ? 103 ALA A HB2  3  
ATOM 5205  H HB3  . ALA A 1 103 ? -5.189  -4.439  2.821   1.00 0.00 ? 103 ALA A HB3  3  
ATOM 5206  N N    . MET A 1 104 ? -4.756  -2.841  0.920   1.00 0.00 ? 104 MET A N    3  
ATOM 5207  C CA   . MET A 1 104 ? -3.624  -2.153  0.312   1.00 0.00 ? 104 MET A CA   3  
ATOM 5208  C C    . MET A 1 104 ? -4.089  -1.219  -0.801  1.00 0.00 ? 104 MET A C    3  
ATOM 5209  O O    . MET A 1 104 ? -3.450  -0.206  -1.082  1.00 0.00 ? 104 MET A O    3  
ATOM 5210  C CB   . MET A 1 104 ? -2.622  -3.167  -0.244  1.00 0.00 ? 104 MET A CB   3  
ATOM 5211  C CG   . MET A 1 104 ? -3.068  -3.811  -1.547  1.00 0.00 ? 104 MET A CG   3  
ATOM 5212  S SD   . MET A 1 104 ? -1.766  -4.789  -2.320  1.00 0.00 ? 104 MET A SD   3  
ATOM 5213  C CE   . MET A 1 104 ? -1.168  -5.726  -0.916  1.00 0.00 ? 104 MET A CE   3  
ATOM 5214  H H    . MET A 1 104 ? -4.905  -3.789  0.717   1.00 0.00 ? 104 MET A H    3  
ATOM 5215  H HA   . MET A 1 104 ? -3.141  -1.567  1.079   1.00 0.00 ? 104 MET A HA   3  
ATOM 5216  H HB2  . MET A 1 104 ? -1.681  -2.667  -0.418  1.00 0.00 ? 104 MET A HB2  3  
ATOM 5217  H HB3  . MET A 1 104 ? -2.476  -3.949  0.486   1.00 0.00 ? 104 MET A HB3  3  
ATOM 5218  H HG2  . MET A 1 104 ? -3.911  -4.455  -1.345  1.00 0.00 ? 104 MET A HG2  3  
ATOM 5219  H HG3  . MET A 1 104 ? -3.370  -3.032  -2.232  1.00 0.00 ? 104 MET A HG3  3  
ATOM 5220  H HE1  . MET A 1 104 ? -0.319  -6.322  -1.216  1.00 0.00 ? 104 MET A HE1  3  
ATOM 5221  H HE2  . MET A 1 104 ? -0.871  -5.047  -0.130  1.00 0.00 ? 104 MET A HE2  3  
ATOM 5222  H HE3  . MET A 1 104 ? -1.953  -6.374  -0.555  1.00 0.00 ? 104 MET A HE3  3  
ATOM 5223  N N    . GLY A 1 105 ? -5.207  -1.567  -1.431  1.00 0.00 ? 105 GLY A N    3  
ATOM 5224  C CA   . GLY A 1 105 ? -5.738  -0.749  -2.505  1.00 0.00 ? 105 GLY A CA   3  
ATOM 5225  C C    . GLY A 1 105 ? -6.064  0.662   -2.054  1.00 0.00 ? 105 GLY A C    3  
ATOM 5226  O O    . GLY A 1 105 ? -5.672  1.632   -2.700  1.00 0.00 ? 105 GLY A O    3  
ATOM 5227  H H    . GLY A 1 105 ? -5.675  -2.386  -1.164  1.00 0.00 ? 105 GLY A H    3  
ATOM 5228  H HA2  . GLY A 1 105 ? -5.010  -0.702  -3.301  1.00 0.00 ? 105 GLY A HA2  3  
ATOM 5229  H HA3  . GLY A 1 105 ? -6.639  -1.210  -2.882  1.00 0.00 ? 105 GLY A HA3  3  
ATOM 5230  N N    . GLU A 1 106 ? -6.784  0.774   -0.942  1.00 0.00 ? 106 GLU A N    3  
ATOM 5231  C CA   . GLU A 1 106 ? -7.164  2.076   -0.408  1.00 0.00 ? 106 GLU A CA   3  
ATOM 5232  C C    . GLU A 1 106 ? -5.930  2.919   -0.098  1.00 0.00 ? 106 GLU A C    3  
ATOM 5233  O O    . GLU A 1 106 ? -5.853  4.088   -0.473  1.00 0.00 ? 106 GLU A O    3  
ATOM 5234  C CB   . GLU A 1 106 ? -8.009  1.907   0.857   1.00 0.00 ? 106 GLU A CB   3  
ATOM 5235  C CG   . GLU A 1 106 ? -7.189  1.858   2.135   1.00 0.00 ? 106 GLU A CG   3  
ATOM 5236  C CD   . GLU A 1 106 ? -8.051  1.742   3.377   1.00 0.00 ? 106 GLU A CD   3  
ATOM 5237  O OE1  . GLU A 1 106 ? -9.201  1.270   3.260   1.00 0.00 ? 106 GLU A OE1  3  
ATOM 5238  O OE2  . GLU A 1 106 ? -7.575  2.125   4.466   1.00 0.00 ? 106 GLU A OE2  3  
ATOM 5239  H H    . GLU A 1 106 ? -7.067  -0.037  -0.471  1.00 0.00 ? 106 GLU A H    3  
ATOM 5240  H HA   . GLU A 1 106 ? -7.752  2.584   -1.157  1.00 0.00 ? 106 GLU A HA   3  
ATOM 5241  H HB2  . GLU A 1 106 ? -8.700  2.734   0.927   1.00 0.00 ? 106 GLU A HB2  3  
ATOM 5242  H HB3  . GLU A 1 106 ? -8.570  0.987   0.779   1.00 0.00 ? 106 GLU A HB3  3  
ATOM 5243  H HG2  . GLU A 1 106 ? -6.530  1.004   2.092   1.00 0.00 ? 106 GLU A HG2  3  
ATOM 5244  H HG3  . GLU A 1 106 ? -6.601  2.761   2.205   1.00 0.00 ? 106 GLU A HG3  3  
ATOM 5245  N N    . ALA A 1 107 ? -4.966  2.315   0.589   1.00 0.00 ? 107 ALA A N    3  
ATOM 5246  C CA   . ALA A 1 107 ? -3.734  3.007   0.948   1.00 0.00 ? 107 ALA A CA   3  
ATOM 5247  C C    . ALA A 1 107 ? -3.179  3.789   -0.238  1.00 0.00 ? 107 ALA A C    3  
ATOM 5248  O O    . ALA A 1 107 ? -2.573  4.847   -0.067  1.00 0.00 ? 107 ALA A O    3  
ATOM 5249  C CB   . ALA A 1 107 ? -2.700  2.015   1.459   1.00 0.00 ? 107 ALA A CB   3  
ATOM 5250  H H    . ALA A 1 107 ? -5.085  1.380   0.859   1.00 0.00 ? 107 ALA A H    3  
ATOM 5251  H HA   . ALA A 1 107 ? -3.961  3.698   1.748   1.00 0.00 ? 107 ALA A HA   3  
ATOM 5252  H HB1  . ALA A 1 107 ? -2.166  1.590   0.622   1.00 0.00 ? 107 ALA A HB1  3  
ATOM 5253  H HB2  . ALA A 1 107 ? -2.005  2.523   2.110   1.00 0.00 ? 107 ALA A HB2  3  
ATOM 5254  H HB3  . ALA A 1 107 ? -3.197  1.228   2.006   1.00 0.00 ? 107 ALA A HB3  3  
ATOM 5255  N N    . ALA A 1 108 ? -3.388  3.262   -1.439  1.00 0.00 ? 108 ALA A N    3  
ATOM 5256  C CA   . ALA A 1 108 ? -2.910  3.912   -2.653  1.00 0.00 ? 108 ALA A CA   3  
ATOM 5257  C C    . ALA A 1 108 ? -3.767  5.124   -3.001  1.00 0.00 ? 108 ALA A C    3  
ATOM 5258  O O    . ALA A 1 108 ? -3.247  6.178   -3.367  1.00 0.00 ? 108 ALA A O    3  
ATOM 5259  C CB   . ALA A 1 108 ? -2.894  2.923   -3.810  1.00 0.00 ? 108 ALA A CB   3  
ATOM 5260  H H    . ALA A 1 108 ? -3.878  2.416   -1.511  1.00 0.00 ? 108 ALA A H    3  
ATOM 5261  H HA   . ALA A 1 108 ? -1.895  4.239   -2.478  1.00 0.00 ? 108 ALA A HA   3  
ATOM 5262  H HB1  . ALA A 1 108 ? -2.087  2.219   -3.670  1.00 0.00 ? 108 ALA A HB1  3  
ATOM 5263  H HB2  . ALA A 1 108 ? -3.834  2.393   -3.842  1.00 0.00 ? 108 ALA A HB2  3  
ATOM 5264  H HB3  . ALA A 1 108 ? -2.750  3.457   -4.737  1.00 0.00 ? 108 ALA A HB3  3  
ATOM 5265  N N    . ARG A 1 109 ? -5.081  4.966   -2.886  1.00 0.00 ? 109 ARG A N    3  
ATOM 5266  C CA   . ARG A 1 109 ? -6.010  6.048   -3.191  1.00 0.00 ? 109 ARG A CA   3  
ATOM 5267  C C    . ARG A 1 109 ? -5.716  7.275   -2.333  1.00 0.00 ? 109 ARG A C    3  
ATOM 5268  O O    . ARG A 1 109 ? -5.103  7.171   -1.271  1.00 0.00 ? 109 ARG A O    3  
ATOM 5269  C CB   . ARG A 1 109 ? -7.452  5.589   -2.965  1.00 0.00 ? 109 ARG A CB   3  
ATOM 5270  C CG   . ARG A 1 109 ? -8.090  4.961   -4.194  1.00 0.00 ? 109 ARG A CG   3  
ATOM 5271  C CD   . ARG A 1 109 ? -9.234  4.033   -3.815  1.00 0.00 ? 109 ARG A CD   3  
ATOM 5272  N NE   . ARG A 1 109 ? -10.485 4.760   -3.613  1.00 0.00 ? 109 ARG A NE   3  
ATOM 5273  C CZ   . ARG A 1 109 ? -11.209 5.266   -4.605  1.00 0.00 ? 109 ARG A CZ   3  
ATOM 5274  N NH1  . ARG A 1 109 ? -10.809 5.124   -5.861  1.00 0.00 ? 109 ARG A NH1  3  
ATOM 5275  N NH2  . ARG A 1 109 ? -12.336 5.914   -4.341  1.00 0.00 ? 109 ARG A NH2  3  
ATOM 5276  H H    . ARG A 1 109 ? -5.435  4.102   -2.589  1.00 0.00 ? 109 ARG A H    3  
ATOM 5277  H HA   . ARG A 1 109 ? -5.884  6.311   -4.230  1.00 0.00 ? 109 ARG A HA   3  
ATOM 5278  H HB2  . ARG A 1 109 ? -7.465  4.860   -2.168  1.00 0.00 ? 109 ARG A HB2  3  
ATOM 5279  H HB3  . ARG A 1 109 ? -8.047  6.441   -2.673  1.00 0.00 ? 109 ARG A HB3  3  
ATOM 5280  H HG2  . ARG A 1 109 ? -8.474  5.746   -4.829  1.00 0.00 ? 109 ARG A HG2  3  
ATOM 5281  H HG3  . ARG A 1 109 ? -7.341  4.396   -4.728  1.00 0.00 ? 109 ARG A HG3  3  
ATOM 5282  H HD2  . ARG A 1 109 ? -9.372  3.312   -4.606  1.00 0.00 ? 109 ARG A HD2  3  
ATOM 5283  H HD3  . ARG A 1 109 ? -8.975  3.520   -2.901  1.00 0.00 ? 109 ARG A HD3  3  
ATOM 5284  H HE   . ARG A 1 109 ? -10.799 4.876   -2.692  1.00 0.00 ? 109 ARG A HE   3  
ATOM 5285  H HH11 . ARG A 1 109 ? -9.961  4.635   -6.063  1.00 0.00 ? 109 ARG A HH11 3  
ATOM 5286  H HH12 . ARG A 1 109 ? -11.357 5.505   -6.606  1.00 0.00 ? 109 ARG A HH12 3  
ATOM 5287  H HH21 . ARG A 1 109 ? -12.641 6.023   -3.396  1.00 0.00 ? 109 ARG A HH21 3  
ATOM 5288  H HH22 . ARG A 1 109 ? -12.881 6.294   -5.088  1.00 0.00 ? 109 ARG A HH22 3  
ATOM 5289  N N    . VAL A 1 110 ? -6.156  8.438   -2.802  1.00 0.00 ? 110 VAL A N    3  
ATOM 5290  C CA   . VAL A 1 110 ? -5.941  9.685   -2.079  1.00 0.00 ? 110 VAL A CA   3  
ATOM 5291  C C    . VAL A 1 110 ? -7.259  10.409  -1.827  1.00 0.00 ? 110 VAL A C    3  
ATOM 5292  O O    . VAL A 1 110 ? -8.181  10.341  -2.640  1.00 0.00 ? 110 VAL A O    3  
ATOM 5293  C CB   . VAL A 1 110 ? -4.992  10.623  -2.848  1.00 0.00 ? 110 VAL A CB   3  
ATOM 5294  C CG1  . VAL A 1 110 ? -5.599  11.019  -4.185  1.00 0.00 ? 110 VAL A CG1  3  
ATOM 5295  C CG2  . VAL A 1 110 ? -4.669  11.854  -2.014  1.00 0.00 ? 110 VAL A CG2  3  
ATOM 5296  H H    . VAL A 1 110 ? -6.639  8.457   -3.655  1.00 0.00 ? 110 VAL A H    3  
ATOM 5297  H HA   . VAL A 1 110 ? -5.486  9.446   -1.129  1.00 0.00 ? 110 VAL A HA   3  
ATOM 5298  H HB   . VAL A 1 110 ? -4.071  10.092  -3.039  1.00 0.00 ? 110 VAL A HB   3  
ATOM 5299  H HG11 . VAL A 1 110 ? -6.578  11.445  -4.023  1.00 0.00 ? 110 VAL A HG11 3  
ATOM 5300  H HG12 . VAL A 1 110 ? -4.963  11.747  -4.668  1.00 0.00 ? 110 VAL A HG12 3  
ATOM 5301  H HG13 . VAL A 1 110 ? -5.687  10.144  -4.813  1.00 0.00 ? 110 VAL A HG13 3  
ATOM 5302  H HG21 . VAL A 1 110 ? -4.139  11.555  -1.123  1.00 0.00 ? 110 VAL A HG21 3  
ATOM 5303  H HG22 . VAL A 1 110 ? -4.052  12.529  -2.591  1.00 0.00 ? 110 VAL A HG22 3  
ATOM 5304  H HG23 . VAL A 1 110 ? -5.586  12.353  -1.738  1.00 0.00 ? 110 VAL A HG23 3  
ATOM 5305  N N    . GLN A 1 111 ? -7.340  11.103  -0.696  1.00 0.00 ? 111 GLN A N    3  
ATOM 5306  C CA   . GLN A 1 111 ? -8.546  11.840  -0.337  1.00 0.00 ? 111 GLN A CA   3  
ATOM 5307  C C    . GLN A 1 111 ? -9.726  10.892  -0.144  1.00 0.00 ? 111 GLN A C    3  
ATOM 5308  O O    . GLN A 1 111 ? -10.818 11.132  -0.658  1.00 0.00 ? 111 GLN A O    3  
ATOM 5309  C CB   . GLN A 1 111 ? -8.878  12.872  -1.416  1.00 0.00 ? 111 GLN A CB   3  
ATOM 5310  C CG   . GLN A 1 111 ? -9.793  13.985  -0.931  1.00 0.00 ? 111 GLN A CG   3  
ATOM 5311  C CD   . GLN A 1 111 ? -10.240 14.903  -2.052  1.00 0.00 ? 111 GLN A CD   3  
ATOM 5312  O OE1  . GLN A 1 111 ? -9.606  14.969  -3.106  1.00 0.00 ? 111 GLN A OE1  3  
ATOM 5313  N NE2  . GLN A 1 111 ? -11.337 15.618  -1.831  1.00 0.00 ? 111 GLN A NE2  3  
ATOM 5314  H H    . GLN A 1 111 ? -6.572  11.119  -0.089  1.00 0.00 ? 111 GLN A H    3  
ATOM 5315  H HA   . GLN A 1 111 ? -8.356  12.353  0.593   1.00 0.00 ? 111 GLN A HA   3  
ATOM 5316  H HB2  . GLN A 1 111 ? -7.959  13.318  -1.766  1.00 0.00 ? 111 GLN A HB2  3  
ATOM 5317  H HB3  . GLN A 1 111 ? -9.363  12.371  -2.241  1.00 0.00 ? 111 GLN A HB3  3  
ATOM 5318  H HG2  . GLN A 1 111 ? -10.669 13.543  -0.479  1.00 0.00 ? 111 GLN A HG2  3  
ATOM 5319  H HG3  . GLN A 1 111 ? -9.266  14.572  -0.194  1.00 0.00 ? 111 GLN A HG3  3  
ATOM 5320  H HE21 . GLN A 1 111 ? -11.789 15.515  -0.967  1.00 0.00 ? 111 GLN A HE21 3  
ATOM 5321  H HE22 . GLN A 1 111 ? -11.648 16.220  -2.538  1.00 0.00 ? 111 GLN A HE22 3  
ATOM 5322  N N    . SER A 1 112 ? -9.497  9.815   0.600   1.00 0.00 ? 112 SER A N    3  
ATOM 5323  C CA   . SER A 1 112 ? -10.540 8.829   0.858   1.00 0.00 ? 112 SER A CA   3  
ATOM 5324  C C    . SER A 1 112 ? -10.500 8.363   2.311   1.00 0.00 ? 112 SER A C    3  
ATOM 5325  O O    . SER A 1 112 ? -9.432  8.099   2.861   1.00 0.00 ? 112 SER A O    3  
ATOM 5326  C CB   . SER A 1 112 ? -10.380 7.629   -0.078  1.00 0.00 ? 112 SER A CB   3  
ATOM 5327  O OG   . SER A 1 112 ? -10.947 7.895   -1.349  1.00 0.00 ? 112 SER A OG   3  
ATOM 5328  H H    . SER A 1 112 ? -8.605  9.679   0.983   1.00 0.00 ? 112 SER A H    3  
ATOM 5329  H HA   . SER A 1 112 ? -11.494 9.298   0.669   1.00 0.00 ? 112 SER A HA   3  
ATOM 5330  H HB2  . SER A 1 112 ? -9.330  7.412   -0.204  1.00 0.00 ? 112 SER A HB2  3  
ATOM 5331  H HB3  . SER A 1 112 ? -10.876 6.772   0.352   1.00 0.00 ? 112 SER A HB3  3  
ATOM 5332  H HG   . SER A 1 112 ? -11.831 7.524   -1.390  1.00 0.00 ? 112 SER A HG   3  
ATOM 5333  N N    . GLY A 1 113 ? -11.674 8.266   2.927   1.00 0.00 ? 113 GLY A N    3  
ATOM 5334  C CA   . GLY A 1 113 ? -11.753 7.833   4.310   1.00 0.00 ? 113 GLY A CA   3  
ATOM 5335  C C    . GLY A 1 113 ? -12.102 8.966   5.253   1.00 0.00 ? 113 GLY A C    3  
ATOM 5336  O O    . GLY A 1 113 ? -12.703 9.967   4.861   1.00 0.00 ? 113 GLY A O    3  
ATOM 5337  H H    . GLY A 1 113 ? -12.494 8.490   2.438   1.00 0.00 ? 113 GLY A H    3  
ATOM 5338  H HA2  . GLY A 1 113 ? -12.507 7.064   4.393   1.00 0.00 ? 113 GLY A HA2  3  
ATOM 5339  H HA3  . GLY A 1 113 ? -10.798 7.419   4.600   1.00 0.00 ? 113 GLY A HA3  3  
ATOM 5340  N N    . PRO A 1 114 ? -11.721 8.816   6.531   1.00 0.00 ? 114 PRO A N    3  
ATOM 5341  C CA   . PRO A 1 114 ? -11.988 9.826   7.560   1.00 0.00 ? 114 PRO A CA   3  
ATOM 5342  C C    . PRO A 1 114 ? -11.161 11.091  7.360   1.00 0.00 ? 114 PRO A C    3  
ATOM 5343  O O    . PRO A 1 114 ? -11.485 12.148  7.899   1.00 0.00 ? 114 PRO A O    3  
ATOM 5344  C CB   . PRO A 1 114 ? -11.585 9.123   8.859   1.00 0.00 ? 114 PRO A CB   3  
ATOM 5345  C CG   . PRO A 1 114 ? -10.585 8.101   8.442   1.00 0.00 ? 114 PRO A CG   3  
ATOM 5346  C CD   . PRO A 1 114 ? -11.001 7.650   7.069   1.00 0.00 ? 114 PRO A CD   3  
ATOM 5347  H HA   . PRO A 1 114 ? -13.036 10.085  7.599   1.00 0.00 ? 114 PRO A HA   3  
ATOM 5348  H HB2  . PRO A 1 114 ? -11.155 9.842   9.542   1.00 0.00 ? 114 PRO A HB2  3  
ATOM 5349  H HB3  . PRO A 1 114 ? -12.453 8.665   9.309   1.00 0.00 ? 114 PRO A HB3  3  
ATOM 5350  H HG2  . PRO A 1 114 ? -9.601  8.542   8.410   1.00 0.00 ? 114 PRO A HG2  3  
ATOM 5351  H HG3  . PRO A 1 114 ? -10.603 7.269   9.130   1.00 0.00 ? 114 PRO A HG3  3  
ATOM 5352  H HD2  . PRO A 1 114 ? -10.134 7.421   6.468   1.00 0.00 ? 114 PRO A HD2  3  
ATOM 5353  H HD3  . PRO A 1 114 ? -11.654 6.792   7.135   1.00 0.00 ? 114 PRO A HD3  3  
ATOM 5354  N N    . SER A 1 115 ? -10.090 10.975  6.581   1.00 0.00 ? 115 SER A N    3  
ATOM 5355  C CA   . SER A 1 115 ? -9.213  12.109  6.312   1.00 0.00 ? 115 SER A CA   3  
ATOM 5356  C C    . SER A 1 115 ? -9.886  13.104  5.372   1.00 0.00 ? 115 SER A C    3  
ATOM 5357  O O    . SER A 1 115 ? -10.293 12.752  4.265   1.00 0.00 ? 115 SER A O    3  
ATOM 5358  C CB   . SER A 1 115 ? -7.894  11.628  5.705   1.00 0.00 ? 115 SER A CB   3  
ATOM 5359  O OG   . SER A 1 115 ? -7.285  10.644  6.523   1.00 0.00 ? 115 SER A OG   3  
ATOM 5360  H H    . SER A 1 115 ? -9.883  10.104  6.179   1.00 0.00 ? 115 SER A H    3  
ATOM 5361  H HA   . SER A 1 115 ? -9.010  12.600  7.252   1.00 0.00 ? 115 SER A HA   3  
ATOM 5362  H HB2  . SER A 1 115 ? -8.082  11.203  4.731   1.00 0.00 ? 115 SER A HB2  3  
ATOM 5363  H HB3  . SER A 1 115 ? -7.219  12.466  5.608   1.00 0.00 ? 115 SER A HB3  3  
ATOM 5364  H HG   . SER A 1 115 ? -6.843  11.069  7.261   1.00 0.00 ? 115 SER A HG   3  
ATOM 5365  N N    . SER A 1 116 ? -9.998  14.350  5.821   1.00 0.00 ? 116 SER A N    3  
ATOM 5366  C CA   . SER A 1 116 ? -10.625 15.397  5.023   1.00 0.00 ? 116 SER A CA   3  
ATOM 5367  C C    . SER A 1 116 ? -9.599  16.084  4.126   1.00 0.00 ? 116 SER A C    3  
ATOM 5368  O O    . SER A 1 116 ? -9.891  17.098  3.493   1.00 0.00 ? 116 SER A O    3  
ATOM 5369  C CB   . SER A 1 116 ? -11.296 16.428  5.932   1.00 0.00 ? 116 SER A CB   3  
ATOM 5370  O OG   . SER A 1 116 ? -10.373 16.964  6.864   1.00 0.00 ? 116 SER A OG   3  
ATOM 5371  H H    . SER A 1 116 ? -9.654  14.569  6.713   1.00 0.00 ? 116 SER A H    3  
ATOM 5372  H HA   . SER A 1 116 ? -11.377 14.935  4.401   1.00 0.00 ? 116 SER A HA   3  
ATOM 5373  H HB2  . SER A 1 116 ? -11.689 17.233  5.330   1.00 0.00 ? 116 SER A HB2  3  
ATOM 5374  H HB3  . SER A 1 116 ? -12.103 15.956  6.473   1.00 0.00 ? 116 SER A HB3  3  
ATOM 5375  H HG   . SER A 1 116 ? -10.409 17.923  6.835   1.00 0.00 ? 116 SER A HG   3  
ATOM 5376  N N    . GLY A 1 117 ? -8.394  15.523  4.079   1.00 0.00 ? 117 GLY A N    3  
ATOM 5377  C CA   . GLY A 1 117 ? -7.342  16.094  3.258   1.00 0.00 ? 117 GLY A CA   3  
ATOM 5378  C C    . GLY A 1 117 ? -6.315  15.063  2.833   1.00 0.00 ? 117 GLY A C    3  
ATOM 5379  O O    . GLY A 1 117 ? -6.309  13.940  3.335   1.00 0.00 ? 117 GLY A O    3  
ATOM 5380  H H    . GLY A 1 117 ? -8.219  14.715  4.605   1.00 0.00 ? 117 GLY A H    3  
ATOM 5381  H HA2  . GLY A 1 117 ? -7.786  16.530  2.375   1.00 0.00 ? 117 GLY A HA2  3  
ATOM 5382  H HA3  . GLY A 1 117 ? -6.845  16.870  3.820   1.00 0.00 ? 117 GLY A HA3  3  
ATOM 5383  N N    . GLY A 1 1   ? 7.858   16.390  -1.157  1.00 0.00 ? 1   GLY A N    4  
ATOM 5384  C CA   . GLY A 1 1   ? 7.387   16.716  0.176   1.00 0.00 ? 1   GLY A CA   4  
ATOM 5385  C C    . GLY A 1 1   ? 8.239   16.090  1.262   1.00 0.00 ? 1   GLY A C    4  
ATOM 5386  O O    . GLY A 1 1   ? 9.012   15.169  1.000   1.00 0.00 ? 1   GLY A O    4  
ATOM 5387  H H1   . GLY A 1 1   ? 8.175   17.103  -1.751  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5388  H HA2  . GLY A 1 1   ? 7.398   17.789  0.298   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5389  H HA3  . GLY A 1 1   ? 6.372   16.362  0.283   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5390  N N    . SER A 1 2   ? 8.099   16.592  2.485   1.00 0.00 ? 2   SER A N    4  
ATOM 5391  C CA   . SER A 1 2   ? 8.867   16.079  3.614   1.00 0.00 ? 2   SER A CA   4  
ATOM 5392  C C    . SER A 1 2   ? 8.012   16.035  4.877   1.00 0.00 ? 2   SER A C    4  
ATOM 5393  O O    . SER A 1 2   ? 6.911   16.584  4.914   1.00 0.00 ? 2   SER A O    4  
ATOM 5394  C CB   . SER A 1 2   ? 10.105  16.946  3.851   1.00 0.00 ? 2   SER A CB   4  
ATOM 5395  O OG   . SER A 1 2   ? 10.934  16.976  2.703   1.00 0.00 ? 2   SER A OG   4  
ATOM 5396  H H    . SER A 1 2   ? 7.466   17.326  2.631   1.00 0.00 ? 2   SER A H    4  
ATOM 5397  H HA   . SER A 1 2   ? 9.182   15.075  3.372   1.00 0.00 ? 2   SER A HA   4  
ATOM 5398  H HB2  . SER A 1 2   ? 9.796   17.954  4.085   1.00 0.00 ? 2   SER A HB2  4  
ATOM 5399  H HB3  . SER A 1 2   ? 10.670  16.542  4.679   1.00 0.00 ? 2   SER A HB3  4  
ATOM 5400  H HG   . SER A 1 2   ? 11.671  17.572  2.856   1.00 0.00 ? 2   SER A HG   4  
ATOM 5401  N N    . SER A 1 3   ? 8.529   15.379  5.911   1.00 0.00 ? 3   SER A N    4  
ATOM 5402  C CA   . SER A 1 3   ? 7.813   15.259  7.175   1.00 0.00 ? 3   SER A CA   4  
ATOM 5403  C C    . SER A 1 3   ? 8.770   14.908  8.311   1.00 0.00 ? 3   SER A C    4  
ATOM 5404  O O    . SER A 1 3   ? 9.870   14.411  8.078   1.00 0.00 ? 3   SER A O    4  
ATOM 5405  C CB   . SER A 1 3   ? 6.719   14.195  7.068   1.00 0.00 ? 3   SER A CB   4  
ATOM 5406  O OG   . SER A 1 3   ? 5.570   14.708  6.416   1.00 0.00 ? 3   SER A OG   4  
ATOM 5407  H H    . SER A 1 3   ? 9.412   14.962  5.820   1.00 0.00 ? 3   SER A H    4  
ATOM 5408  H HA   . SER A 1 3   ? 7.354   16.213  7.388   1.00 0.00 ? 3   SER A HA   4  
ATOM 5409  H HB2  . SER A 1 3   ? 7.093   13.354  6.503   1.00 0.00 ? 3   SER A HB2  4  
ATOM 5410  H HB3  . SER A 1 3   ? 6.440   13.867  8.059   1.00 0.00 ? 3   SER A HB3  4  
ATOM 5411  H HG   . SER A 1 3   ? 5.829   15.416  5.821   1.00 0.00 ? 3   SER A HG   4  
ATOM 5412  N N    . GLY A 1 4   ? 8.340   15.172  9.541   1.00 0.00 ? 4   GLY A N    4  
ATOM 5413  C CA   . GLY A 1 4   ? 9.170   14.879  10.695  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5414  C C    . GLY A 1 4   ? 9.251   13.394  10.988  1.00 0.00 ? 4   GLY A C    4  
ATOM 5415  O O    . GLY A 1 4   ? 8.822   12.570  10.180  1.00 0.00 ? 4   GLY A O    4  
ATOM 5416  H H    . GLY A 1 4   ? 7.453   15.569  9.666   1.00 0.00 ? 4   GLY A H    4  
ATOM 5417  H HA2  . GLY A 1 4   ? 10.166  15.254  10.514  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5418  H HA3  . GLY A 1 4   ? 8.758   15.382  11.557  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5419  N N    . SER A 1 5   ? 9.805   13.050  12.146  1.00 0.00 ? 5   SER A N    4  
ATOM 5420  C CA   . SER A 1 5   ? 9.947   11.654  12.542  1.00 0.00 ? 5   SER A CA   4  
ATOM 5421  C C    . SER A 1 5   ? 8.898   11.275  13.584  1.00 0.00 ? 5   SER A C    4  
ATOM 5422  O O    . SER A 1 5   ? 9.116   11.433  14.785  1.00 0.00 ? 5   SER A O    4  
ATOM 5423  C CB   . SER A 1 5   ? 11.349  11.398  13.097  1.00 0.00 ? 5   SER A CB   4  
ATOM 5424  O OG   . SER A 1 5   ? 11.606  10.010  13.214  1.00 0.00 ? 5   SER A OG   4  
ATOM 5425  H H    . SER A 1 5   ? 10.129  13.753  12.748  1.00 0.00 ? 5   SER A H    4  
ATOM 5426  H HA   . SER A 1 5   ? 9.800   11.044  11.663  1.00 0.00 ? 5   SER A HA   4  
ATOM 5427  H HB2  . SER A 1 5   ? 12.081  11.833  12.433  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5428  H HB3  . SER A 1 5   ? 11.435  11.852  14.074  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5429  H HG   . SER A 1 5   ? 11.516  9.594   12.353  1.00 0.00 ? 5   SER A HG   4  
ATOM 5430  N N    . SER A 1 6   ? 7.760   10.775  13.114  1.00 0.00 ? 6   SER A N    4  
ATOM 5431  C CA   . SER A 1 6   ? 6.675   10.377  14.004  1.00 0.00 ? 6   SER A CA   4  
ATOM 5432  C C    . SER A 1 6   ? 7.182   9.433   15.090  1.00 0.00 ? 6   SER A C    4  
ATOM 5433  O O    . SER A 1 6   ? 6.860   9.593   16.267  1.00 0.00 ? 6   SER A O    4  
ATOM 5434  C CB   . SER A 1 6   ? 5.556   9.703   13.208  1.00 0.00 ? 6   SER A CB   4  
ATOM 5435  O OG   . SER A 1 6   ? 4.620   10.656  12.736  1.00 0.00 ? 6   SER A OG   4  
ATOM 5436  H H    . SER A 1 6   ? 7.646   10.673  12.146  1.00 0.00 ? 6   SER A H    4  
ATOM 5437  H HA   . SER A 1 6   ? 6.286   11.269  14.471  1.00 0.00 ? 6   SER A HA   4  
ATOM 5438  H HB2  . SER A 1 6   ? 5.981   9.185   12.362  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5439  H HB3  . SER A 1 6   ? 5.042   8.995   13.843  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5440  H HG   . SER A 1 6   ? 4.080   10.964  13.468  1.00 0.00 ? 6   SER A HG   4  
ATOM 5441  N N    . GLY A 1 7   ? 7.978   8.448   14.685  1.00 0.00 ? 7   GLY A N    4  
ATOM 5442  C CA   . GLY A 1 7   ? 8.517   7.492   15.635  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5443  C C    . GLY A 1 7   ? 7.905   6.114   15.481  1.00 0.00 ? 7   GLY A C    4  
ATOM 5444  O O    . GLY A 1 7   ? 8.585   5.165   15.093  1.00 0.00 ? 7   GLY A O    4  
ATOM 5445  H H    . GLY A 1 7   ? 8.201   8.369   13.734  1.00 0.00 ? 7   GLY A H    4  
ATOM 5446  H HA2  . GLY A 1 7   ? 9.584   7.419   15.489  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5447  H HA3  . GLY A 1 7   ? 8.324   7.849   16.636  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5448  N N    . ASN A 1 8   ? 6.616   6.003   15.789  1.00 0.00 ? 8   ASN A N    4  
ATOM 5449  C CA   . ASN A 1 8   ? 5.913   4.730   15.685  1.00 0.00 ? 8   ASN A CA   4  
ATOM 5450  C C    . ASN A 1 8   ? 4.531   4.921   15.068  1.00 0.00 ? 8   ASN A C    4  
ATOM 5451  O O    . ASN A 1 8   ? 3.893   5.956   15.257  1.00 0.00 ? 8   ASN A O    4  
ATOM 5452  C CB   . ASN A 1 8   ? 5.783   4.081   17.064  1.00 0.00 ? 8   ASN A CB   4  
ATOM 5453  C CG   . ASN A 1 8   ? 7.106   4.024   17.803  1.00 0.00 ? 8   ASN A CG   4  
ATOM 5454  O OD1  . ASN A 1 8   ? 7.877   3.078   17.646  1.00 0.00 ? 8   ASN A OD1  4  
ATOM 5455  N ND2  . ASN A 1 8   ? 7.374   5.040   18.615  1.00 0.00 ? 8   ASN A ND2  4  
ATOM 5456  H H    . ASN A 1 8   ? 6.127   6.796   16.093  1.00 0.00 ? 8   ASN A H    4  
ATOM 5457  H HA   . ASN A 1 8   ? 6.493   4.082   15.045  1.00 0.00 ? 8   ASN A HA   4  
ATOM 5458  H HB2  . ASN A 1 8   ? 5.084   4.652   17.659  1.00 0.00 ? 8   ASN A HB2  4  
ATOM 5459  H HB3  . ASN A 1 8   ? 5.412   3.074   16.949  1.00 0.00 ? 8   ASN A HB3  4  
ATOM 5460  H HD21 . ASN A 1 8   ? 6.712   5.760   18.691  1.00 0.00 ? 8   ASN A HD21 4  
ATOM 5461  H HD22 . ASN A 1 8   ? 8.222   5.029   19.105  1.00 0.00 ? 8   ASN A HD22 4  
ATOM 5462  N N    . ALA A 1 9   ? 4.074   3.914   14.330  1.00 0.00 ? 9   ALA A N    4  
ATOM 5463  C CA   . ALA A 1 9   ? 2.766   3.970   13.688  1.00 0.00 ? 9   ALA A CA   4  
ATOM 5464  C C    . ALA A 1 9   ? 2.040   2.634   13.804  1.00 0.00 ? 9   ALA A C    4  
ATOM 5465  O O    . ALA A 1 9   ? 2.655   1.572   13.906  1.00 0.00 ? 9   ALA A O    4  
ATOM 5466  C CB   . ALA A 1 9   ? 2.913   4.367   12.226  1.00 0.00 ? 9   ALA A CB   4  
ATOM 5467  H H    . ALA A 1 9   ? 4.628   3.114   14.216  1.00 0.00 ? 9   ALA A H    4  
ATOM 5468  H HA   . ALA A 1 9   ? 2.182   4.730   14.185  1.00 0.00 ? 9   ALA A HA   4  
ATOM 5469  H HB1  . ALA A 1 9   ? 3.166   3.495   11.641  1.00 0.00 ? 9   ALA A HB1  4  
ATOM 5470  H HB2  . ALA A 1 9   ? 1.982   4.782   11.871  1.00 0.00 ? 9   ALA A HB2  4  
ATOM 5471  H HB3  . ALA A 1 9   ? 3.696   5.105   12.131  1.00 0.00 ? 9   ALA A HB3  4  
ATOM 5472  N N    . PRO A 1 10  ? 0.700   2.685   13.790  1.00 0.00 ? 10  PRO A N    4  
ATOM 5473  C CA   . PRO A 1 10  ? -0.139  1.487   13.893  1.00 0.00 ? 10  PRO A CA   4  
ATOM 5474  C C    . PRO A 1 10  ? -0.061  0.615   12.645  1.00 0.00 ? 10  PRO A C    4  
ATOM 5475  O O    . PRO A 1 10  ? 0.402   1.059   11.594  1.00 0.00 ? 10  PRO A O    4  
ATOM 5476  C CB   . PRO A 1 10  ? -1.550  2.056   14.062  1.00 0.00 ? 10  PRO A CB   4  
ATOM 5477  C CG   . PRO A 1 10  ? -1.493  3.404   13.430  1.00 0.00 ? 10  PRO A CG   4  
ATOM 5478  C CD   . PRO A 1 10  ? -0.100  3.916   13.672  1.00 0.00 ? 10  PRO A CD   4  
ATOM 5479  H HA   . PRO A 1 10  ? 0.119   0.896   14.760  1.00 0.00 ? 10  PRO A HA   4  
ATOM 5480  H HB2  . PRO A 1 10  ? -2.262  1.414   13.561  1.00 0.00 ? 10  PRO A HB2  4  
ATOM 5481  H HB3  . PRO A 1 10  ? -1.793  2.122   15.112  1.00 0.00 ? 10  PRO A HB3  4  
ATOM 5482  H HG2  . PRO A 1 10  ? -1.684  3.322   12.371  1.00 0.00 ? 10  PRO A HG2  4  
ATOM 5483  H HG3  . PRO A 1 10  ? -2.217  4.057   13.894  1.00 0.00 ? 10  PRO A HG3  4  
ATOM 5484  H HD2  . PRO A 1 10  ? 0.233   4.513   12.836  1.00 0.00 ? 10  PRO A HD2  4  
ATOM 5485  H HD3  . PRO A 1 10  ? -0.061  4.489   14.586  1.00 0.00 ? 10  PRO A HD3  4  
ATOM 5486  N N    . VAL A 1 11  ? -0.518  -0.627  12.766  1.00 0.00 ? 11  VAL A N    4  
ATOM 5487  C CA   . VAL A 1 11  ? -0.502  -1.561  11.646  1.00 0.00 ? 11  VAL A CA   4  
ATOM 5488  C C    . VAL A 1 11  ? -1.882  -1.679  11.010  1.00 0.00 ? 11  VAL A C    4  
ATOM 5489  O O    . VAL A 1 11  ? -2.895  -1.759  11.705  1.00 0.00 ? 11  VAL A O    4  
ATOM 5490  C CB   . VAL A 1 11  ? -0.031  -2.959  12.088  1.00 0.00 ? 11  VAL A CB   4  
ATOM 5491  C CG1  . VAL A 1 11  ? -0.120  -3.943  10.932  1.00 0.00 ? 11  VAL A CG1  4  
ATOM 5492  C CG2  . VAL A 1 11  ? 1.387   -2.894  12.636  1.00 0.00 ? 11  VAL A CG2  4  
ATOM 5493  H H    . VAL A 1 11  ? -0.875  -0.922  13.630  1.00 0.00 ? 11  VAL A H    4  
ATOM 5494  H HA   . VAL A 1 11  ? 0.193   -1.186  10.909  1.00 0.00 ? 11  VAL A HA   4  
ATOM 5495  H HB   . VAL A 1 11  ? -0.683  -3.304  12.876  1.00 0.00 ? 11  VAL A HB   4  
ATOM 5496  H HG11 . VAL A 1 11  ? -0.708  -4.798  11.231  1.00 0.00 ? 11  VAL A HG11 4  
ATOM 5497  H HG12 . VAL A 1 11  ? -0.587  -3.462  10.085  1.00 0.00 ? 11  VAL A HG12 4  
ATOM 5498  H HG13 . VAL A 1 11  ? 0.873   -4.268  10.659  1.00 0.00 ? 11  VAL A HG13 4  
ATOM 5499  H HG21 . VAL A 1 11  ? 1.880   -3.840  12.468  1.00 0.00 ? 11  VAL A HG21 4  
ATOM 5500  H HG22 . VAL A 1 11  ? 1.933   -2.110  12.132  1.00 0.00 ? 11  VAL A HG22 4  
ATOM 5501  H HG23 . VAL A 1 11  ? 1.355   -2.687  13.695  1.00 0.00 ? 11  VAL A HG23 4  
ATOM 5502  N N    . THR A 1 12  ? -1.916  -1.690  9.681   1.00 0.00 ? 12  THR A N    4  
ATOM 5503  C CA   . THR A 1 12  ? -3.171  -1.798  8.949   1.00 0.00 ? 12  THR A CA   4  
ATOM 5504  C C    . THR A 1 12  ? -3.559  -3.257  8.735   1.00 0.00 ? 12  THR A C    4  
ATOM 5505  O O    . THR A 1 12  ? -4.652  -3.681  9.113   1.00 0.00 ? 12  THR A O    4  
ATOM 5506  C CB   . THR A 1 12  ? -3.086  -1.096  7.580   1.00 0.00 ? 12  THR A CB   4  
ATOM 5507  O OG1  . THR A 1 12  ? -2.459  0.184   7.724   1.00 0.00 ? 12  THR A OG1  4  
ATOM 5508  C CG2  . THR A 1 12  ? -4.470  -0.922  6.974   1.00 0.00 ? 12  THR A CG2  4  
ATOM 5509  H H    . THR A 1 12  ? -1.075  -1.623  9.182   1.00 0.00 ? 12  THR A H    4  
ATOM 5510  H HA   . THR A 1 12  ? -3.940  -1.312  9.532   1.00 0.00 ? 12  THR A HA   4  
ATOM 5511  H HB   . THR A 1 12  ? -2.492  -1.707  6.916   1.00 0.00 ? 12  THR A HB   4  
ATOM 5512  H HG1  . THR A 1 12  ? -2.623  0.523   8.608   1.00 0.00 ? 12  THR A HG1  4  
ATOM 5513  H HG21 . THR A 1 12  ? -4.910  -0.005  7.336   1.00 0.00 ? 12  THR A HG21 4  
ATOM 5514  H HG22 . THR A 1 12  ? -5.094  -1.757  7.257   1.00 0.00 ? 12  THR A HG22 4  
ATOM 5515  H HG23 . THR A 1 12  ? -4.389  -0.882  5.898   1.00 0.00 ? 12  THR A HG23 4  
ATOM 5516  N N    . LYS A 1 13  ? -2.658  -4.021  8.128   1.00 0.00 ? 13  LYS A N    4  
ATOM 5517  C CA   . LYS A 1 13  ? -2.905  -5.434  7.866   1.00 0.00 ? 13  LYS A CA   4  
ATOM 5518  C C    . LYS A 1 13  ? -1.597  -6.217  7.826   1.00 0.00 ? 13  LYS A C    4  
ATOM 5519  O O    . LYS A 1 13  ? -0.551  -5.678  7.464   1.00 0.00 ? 13  LYS A O    4  
ATOM 5520  C CB   . LYS A 1 13  ? -3.654  -5.605  6.542   1.00 0.00 ? 13  LYS A CB   4  
ATOM 5521  C CG   . LYS A 1 13  ? -4.057  -7.040  6.252   1.00 0.00 ? 13  LYS A CG   4  
ATOM 5522  C CD   . LYS A 1 13  ? -5.069  -7.118  5.121   1.00 0.00 ? 13  LYS A CD   4  
ATOM 5523  C CE   . LYS A 1 13  ? -5.397  -8.560  4.765   1.00 0.00 ? 13  LYS A CE   4  
ATOM 5524  N NZ   . LYS A 1 13  ? -6.101  -9.259  5.876   1.00 0.00 ? 13  LYS A NZ   4  
ATOM 5525  H H    . LYS A 1 13  ? -1.805  -3.625  7.850   1.00 0.00 ? 13  LYS A H    4  
ATOM 5526  H HA   . LYS A 1 13  ? -3.517  -5.818  8.668   1.00 0.00 ? 13  LYS A HA   4  
ATOM 5527  H HB2  . LYS A 1 13  ? -4.548  -5.000  6.567   1.00 0.00 ? 13  LYS A HB2  4  
ATOM 5528  H HB3  . LYS A 1 13  ? -3.020  -5.262  5.737   1.00 0.00 ? 13  LYS A HB3  4  
ATOM 5529  H HG2  . LYS A 1 13  ? -3.178  -7.602  5.973   1.00 0.00 ? 13  LYS A HG2  4  
ATOM 5530  H HG3  . LYS A 1 13  ? -4.493  -7.469  7.143   1.00 0.00 ? 13  LYS A HG3  4  
ATOM 5531  H HD2  . LYS A 1 13  ? -5.976  -6.618  5.426   1.00 0.00 ? 13  LYS A HD2  4  
ATOM 5532  H HD3  . LYS A 1 13  ? -4.660  -6.625  4.250   1.00 0.00 ? 13  LYS A HD3  4  
ATOM 5533  H HE2  . LYS A 1 13  ? -6.030  -8.566  3.891   1.00 0.00 ? 13  LYS A HE2  4  
ATOM 5534  H HE3  . LYS A 1 13  ? -4.477  -9.082  4.548   1.00 0.00 ? 13  LYS A HE3  4  
ATOM 5535  H HZ1  . LYS A 1 13  ? -5.823  -8.846  6.790   1.00 0.00 ? 13  LYS A HZ1  4  
ATOM 5536  H HZ2  . LYS A 1 13  ? -5.854  -10.269 5.876   1.00 0.00 ? 13  LYS A HZ2  4  
ATOM 5537  H HZ3  . LYS A 1 13  ? -7.130  -9.164  5.764   1.00 0.00 ? 13  LYS A HZ3  4  
ATOM 5538  N N    . ALA A 1 14  ? -1.662  -7.490  8.201   1.00 0.00 ? 14  ALA A N    4  
ATOM 5539  C CA   . ALA A 1 14  ? -0.484  -8.347  8.205   1.00 0.00 ? 14  ALA A CA   4  
ATOM 5540  C C    . ALA A 1 14  ? -0.867  -9.809  8.004   1.00 0.00 ? 14  ALA A C    4  
ATOM 5541  O O    . ALA A 1 14  ? -1.771  -10.321 8.664   1.00 0.00 ? 14  ALA A O    4  
ATOM 5542  C CB   . ALA A 1 14  ? 0.289   -8.176  9.505   1.00 0.00 ? 14  ALA A CB   4  
ATOM 5543  H H    . ALA A 1 14  ? -2.525  -7.862  8.480   1.00 0.00 ? 14  ALA A H    4  
ATOM 5544  H HA   . ALA A 1 14  ? 0.157   -8.038  7.391   1.00 0.00 ? 14  ALA A HA   4  
ATOM 5545  H HB1  . ALA A 1 14  ? 1.304   -7.881  9.283   1.00 0.00 ? 14  ALA A HB1  4  
ATOM 5546  H HB2  . ALA A 1 14  ? -0.184  -7.415  10.107  1.00 0.00 ? 14  ALA A HB2  4  
ATOM 5547  H HB3  . ALA A 1 14  ? 0.295   -9.111  10.045  1.00 0.00 ? 14  ALA A HB3  4  
ATOM 5548  N N    . GLY A 1 15  ? -0.174  -10.478 7.087   1.00 0.00 ? 15  GLY A N    4  
ATOM 5549  C CA   . GLY A 1 15  ? -0.458  -11.875 6.815   1.00 0.00 ? 15  GLY A CA   4  
ATOM 5550  C C    . GLY A 1 15  ? 0.550   -12.498 5.870   1.00 0.00 ? 15  GLY A C    4  
ATOM 5551  O O    . GLY A 1 15  ? 1.310   -11.790 5.208   1.00 0.00 ? 15  GLY A O    4  
ATOM 5552  H H    . GLY A 1 15  ? 0.536   -10.018 6.592   1.00 0.00 ? 15  GLY A H    4  
ATOM 5553  H HA2  . GLY A 1 15  ? -0.448  -12.421 7.747   1.00 0.00 ? 15  GLY A HA2  4  
ATOM 5554  H HA3  . GLY A 1 15  ? -1.441  -11.951 6.375   1.00 0.00 ? 15  GLY A HA3  4  
ATOM 5555  N N    . TRP A 1 16  ? 0.559   -13.824 5.808   1.00 0.00 ? 16  TRP A N    4  
ATOM 5556  C CA   . TRP A 1 16  ? 1.483   -14.542 4.938   1.00 0.00 ? 16  TRP A CA   4  
ATOM 5557  C C    . TRP A 1 16  ? 1.071   -14.407 3.476   1.00 0.00 ? 16  TRP A C    4  
ATOM 5558  O O    . TRP A 1 16  ? 0.028   -14.917 3.065   1.00 0.00 ? 16  TRP A O    4  
ATOM 5559  C CB   . TRP A 1 16  ? 1.541   -16.020 5.329   1.00 0.00 ? 16  TRP A CB   4  
ATOM 5560  C CG   . TRP A 1 16  ? 2.313   -16.270 6.590   1.00 0.00 ? 16  TRP A CG   4  
ATOM 5561  C CD1  . TRP A 1 16  ? 1.798   -16.488 7.836   1.00 0.00 ? 16  TRP A CD1  4  
ATOM 5562  C CD2  . TRP A 1 16  ? 3.737   -16.326 6.726   1.00 0.00 ? 16  TRP A CD2  4  
ATOM 5563  N NE1  . TRP A 1 16  ? 2.817   -16.676 8.739   1.00 0.00 ? 16  TRP A NE1  4  
ATOM 5564  C CE2  . TRP A 1 16  ? 4.016   -16.583 8.083   1.00 0.00 ? 16  TRP A CE2  4  
ATOM 5565  C CE3  . TRP A 1 16  ? 4.803   -16.187 5.834   1.00 0.00 ? 16  TRP A CE3  4  
ATOM 5566  C CZ2  . TRP A 1 16  ? 5.316   -16.701 8.566   1.00 0.00 ? 16  TRP A CZ2  4  
ATOM 5567  C CZ3  . TRP A 1 16  ? 6.094   -16.304 6.315   1.00 0.00 ? 16  TRP A CZ3  4  
ATOM 5568  C CH2  . TRP A 1 16  ? 6.341   -16.560 7.671   1.00 0.00 ? 16  TRP A CH2  4  
ATOM 5569  H H    . TRP A 1 16  ? -0.071  -14.333 6.360   1.00 0.00 ? 16  TRP A H    4  
ATOM 5570  H HA   . TRP A 1 16  ? 2.463   -14.107 5.065   1.00 0.00 ? 16  TRP A HA   4  
ATOM 5571  H HB2  . TRP A 1 16  ? 0.537   -16.387 5.475   1.00 0.00 ? 16  TRP A HB2  4  
ATOM 5572  H HB3  . TRP A 1 16  ? 2.013   -16.577 4.533   1.00 0.00 ? 16  TRP A HB3  4  
ATOM 5573  H HD1  . TRP A 1 16  ? 0.743   -16.505 8.064   1.00 0.00 ? 16  TRP A HD1  4  
ATOM 5574  H HE1  . TRP A 1 16  ? 2.702   -16.851 9.697   1.00 0.00 ? 16  TRP A HE1  4  
ATOM 5575  H HE3  . TRP A 1 16  ? 4.633   -15.990 4.786   1.00 0.00 ? 16  TRP A HE3  4  
ATOM 5576  H HZ2  . TRP A 1 16  ? 5.523   -16.898 9.608   1.00 0.00 ? 16  TRP A HZ2  4  
ATOM 5577  H HZ3  . TRP A 1 16  ? 6.931   -16.199 5.641   1.00 0.00 ? 16  TRP A HZ3  4  
ATOM 5578  H HH2  . TRP A 1 16  ? 7.365   -16.643 8.002   1.00 0.00 ? 16  TRP A HH2  4  
ATOM 5579  N N    . LEU A 1 17  ? 1.895   -13.718 2.695   1.00 0.00 ? 17  LEU A N    4  
ATOM 5580  C CA   . LEU A 1 17  ? 1.616   -13.516 1.277   1.00 0.00 ? 17  LEU A CA   4  
ATOM 5581  C C    . LEU A 1 17  ? 2.800   -13.956 0.421   1.00 0.00 ? 17  LEU A C    4  
ATOM 5582  O O    . LEU A 1 17  ? 3.953   -13.677 0.748   1.00 0.00 ? 17  LEU A O    4  
ATOM 5583  C CB   . LEU A 1 17  ? 1.293   -12.046 1.005   1.00 0.00 ? 17  LEU A CB   4  
ATOM 5584  C CG   . LEU A 1 17  ? -0.133  -11.601 1.330   1.00 0.00 ? 17  LEU A CG   4  
ATOM 5585  C CD1  . LEU A 1 17  ? -0.276  -10.097 1.156   1.00 0.00 ? 17  LEU A CD1  4  
ATOM 5586  C CD2  . LEU A 1 17  ? -1.135  -12.338 0.453   1.00 0.00 ? 17  LEU A CD2  4  
ATOM 5587  H H    . LEU A 1 17  ? 2.711   -13.335 3.079   1.00 0.00 ? 17  LEU A H    4  
ATOM 5588  H HA   . LEU A 1 17  ? 0.758   -14.119 1.020   1.00 0.00 ? 17  LEU A HA   4  
ATOM 5589  H HB2  . LEU A 1 17  ? 1.969   -11.445 1.594   1.00 0.00 ? 17  LEU A HB2  4  
ATOM 5590  H HB3  . LEU A 1 17  ? 1.468   -11.859 -0.045  1.00 0.00 ? 17  LEU A HB3  4  
ATOM 5591  H HG   . LEU A 1 17  ? -0.352  -11.839 2.362   1.00 0.00 ? 17  LEU A HG   4  
ATOM 5592  H HD11 . LEU A 1 17  ? 0.027   -9.599  2.065   1.00 0.00 ? 17  LEU A HD11 4  
ATOM 5593  H HD12 . LEU A 1 17  ? -1.306  -9.855  0.940   1.00 0.00 ? 17  LEU A HD12 4  
ATOM 5594  H HD13 . LEU A 1 17  ? 0.350   -9.768  0.339   1.00 0.00 ? 17  LEU A HD13 4  
ATOM 5595  H HD21 . LEU A 1 17  ? -2.123  -11.935 0.619   1.00 0.00 ? 17  LEU A HD21 4  
ATOM 5596  H HD22 . LEU A 1 17  ? -1.128  -13.389 0.704   1.00 0.00 ? 17  LEU A HD22 4  
ATOM 5597  H HD23 . LEU A 1 17  ? -0.864  -12.213 -0.585  1.00 0.00 ? 17  LEU A HD23 4  
ATOM 5598  N N    . PHE A 1 18  ? 2.506   -14.642 -0.678  1.00 0.00 ? 18  PHE A N    4  
ATOM 5599  C CA   . PHE A 1 18  ? 3.545   -15.119 -1.582  1.00 0.00 ? 18  PHE A CA   4  
ATOM 5600  C C    . PHE A 1 18  ? 3.918   -14.043 -2.598  1.00 0.00 ? 18  PHE A C    4  
ATOM 5601  O O    . PHE A 1 18  ? 3.068   -13.556 -3.344  1.00 0.00 ? 18  PHE A O    4  
ATOM 5602  C CB   . PHE A 1 18  ? 3.079   -16.383 -2.309  1.00 0.00 ? 18  PHE A CB   4  
ATOM 5603  C CG   . PHE A 1 18  ? 2.971   -17.584 -1.413  1.00 0.00 ? 18  PHE A CG   4  
ATOM 5604  C CD1  . PHE A 1 18  ? 2.120   -17.574 -0.319  1.00 0.00 ? 18  PHE A CD1  4  
ATOM 5605  C CD2  . PHE A 1 18  ? 3.719   -18.722 -1.665  1.00 0.00 ? 18  PHE A CD2  4  
ATOM 5606  C CE1  . PHE A 1 18  ? 2.020   -18.678 0.507   1.00 0.00 ? 18  PHE A CE1  4  
ATOM 5607  C CE2  . PHE A 1 18  ? 3.622   -19.829 -0.843  1.00 0.00 ? 18  PHE A CE2  4  
ATOM 5608  C CZ   . PHE A 1 18  ? 2.771   -19.807 0.244   1.00 0.00 ? 18  PHE A CZ   4  
ATOM 5609  H H    . PHE A 1 18  ? 1.567   -14.834 -0.885  1.00 0.00 ? 18  PHE A H    4  
ATOM 5610  H HA   . PHE A 1 18  ? 4.416   -15.356 -0.990  1.00 0.00 ? 18  PHE A HA   4  
ATOM 5611  H HB2  . PHE A 1 18  ? 2.106   -16.203 -2.740  1.00 0.00 ? 18  PHE A HB2  4  
ATOM 5612  H HB3  . PHE A 1 18  ? 3.780   -16.616 -3.096  1.00 0.00 ? 18  PHE A HB3  4  
ATOM 5613  H HD1  . PHE A 1 18  ? 1.531   -16.693 -0.113  1.00 0.00 ? 18  PHE A HD1  4  
ATOM 5614  H HD2  . PHE A 1 18  ? 4.386   -18.740 -2.516  1.00 0.00 ? 18  PHE A HD2  4  
ATOM 5615  H HE1  . PHE A 1 18  ? 1.353   -18.658 1.356   1.00 0.00 ? 18  PHE A HE1  4  
ATOM 5616  H HE2  . PHE A 1 18  ? 4.211   -20.710 -1.052  1.00 0.00 ? 18  PHE A HE2  4  
ATOM 5617  H HZ   . PHE A 1 18  ? 2.694   -20.670 0.888   1.00 0.00 ? 18  PHE A HZ   4  
ATOM 5618  N N    . LYS A 1 19  ? 5.195   -13.677 -2.621  1.00 0.00 ? 19  LYS A N    4  
ATOM 5619  C CA   . LYS A 1 19  ? 5.683   -12.660 -3.545  1.00 0.00 ? 19  LYS A CA   4  
ATOM 5620  C C    . LYS A 1 19  ? 6.249   -13.299 -4.809  1.00 0.00 ? 19  LYS A C    4  
ATOM 5621  O O    . LYS A 1 19  ? 7.219   -14.054 -4.752  1.00 0.00 ? 19  LYS A O    4  
ATOM 5622  C CB   . LYS A 1 19  ? 6.756   -11.802 -2.870  1.00 0.00 ? 19  LYS A CB   4  
ATOM 5623  C CG   . LYS A 1 19  ? 6.880   -10.408 -3.460  1.00 0.00 ? 19  LYS A CG   4  
ATOM 5624  C CD   . LYS A 1 19  ? 8.137   -9.707  -2.975  1.00 0.00 ? 19  LYS A CD   4  
ATOM 5625  C CE   . LYS A 1 19  ? 8.200   -8.269  -3.469  1.00 0.00 ? 19  LYS A CE   4  
ATOM 5626  N NZ   . LYS A 1 19  ? 8.742   -8.181  -4.853  1.00 0.00 ? 19  LYS A NZ   4  
ATOM 5627  H H    . LYS A 1 19  ? 5.825   -14.103 -2.002  1.00 0.00 ? 19  LYS A H    4  
ATOM 5628  H HA   . LYS A 1 19  ? 4.849   -12.031 -3.816  1.00 0.00 ? 19  LYS A HA   4  
ATOM 5629  H HB2  . LYS A 1 19  ? 6.517   -11.707 -1.821  1.00 0.00 ? 19  LYS A HB2  4  
ATOM 5630  H HB3  . LYS A 1 19  ? 7.711   -12.298 -2.969  1.00 0.00 ? 19  LYS A HB3  4  
ATOM 5631  H HG2  . LYS A 1 19  ? 6.916   -10.484 -4.537  1.00 0.00 ? 19  LYS A HG2  4  
ATOM 5632  H HG3  . LYS A 1 19  ? 6.018   -9.825  -3.167  1.00 0.00 ? 19  LYS A HG3  4  
ATOM 5633  H HD2  . LYS A 1 19  ? 8.145   -9.705  -1.895  1.00 0.00 ? 19  LYS A HD2  4  
ATOM 5634  H HD3  . LYS A 1 19  ? 9.002   -10.242 -3.342  1.00 0.00 ? 19  LYS A HD3  4  
ATOM 5635  H HE2  . LYS A 1 19  ? 7.204   -7.854  -3.454  1.00 0.00 ? 19  LYS A HE2  4  
ATOM 5636  H HE3  . LYS A 1 19  ? 8.836   -7.702  -2.805  1.00 0.00 ? 19  LYS A HE3  4  
ATOM 5637  H HZ1  . LYS A 1 19  ? 9.330   -9.013  -5.059  1.00 0.00 ? 19  LYS A HZ1  4  
ATOM 5638  H HZ2  . LYS A 1 19  ? 9.323   -7.325  -4.955  1.00 0.00 ? 19  LYS A HZ2  4  
ATOM 5639  H HZ3  . LYS A 1 19  ? 7.962   -8.142  -5.540  1.00 0.00 ? 19  LYS A HZ3  4  
ATOM 5640  N N    . GLN A 1 20  ? 5.637   -12.990 -5.948  1.00 0.00 ? 20  GLN A N    4  
ATOM 5641  C CA   . GLN A 1 20  ? 6.081   -13.534 -7.225  1.00 0.00 ? 20  GLN A CA   4  
ATOM 5642  C C    . GLN A 1 20  ? 7.604   -13.604 -7.287  1.00 0.00 ? 20  GLN A C    4  
ATOM 5643  O O    . GLN A 1 20  ? 8.298   -12.829 -6.630  1.00 0.00 ? 20  GLN A O    4  
ATOM 5644  C CB   . GLN A 1 20  ? 5.551   -12.681 -8.379  1.00 0.00 ? 20  GLN A CB   4  
ATOM 5645  C CG   . GLN A 1 20  ? 5.825   -13.276 -9.751  1.00 0.00 ? 20  GLN A CG   4  
ATOM 5646  C CD   . GLN A 1 20  ? 5.116   -12.528 -10.863 1.00 0.00 ? 20  GLN A CD   4  
ATOM 5647  O OE1  . GLN A 1 20  ? 5.282   -11.318 -11.017 1.00 0.00 ? 20  GLN A OE1  4  
ATOM 5648  N NE2  . GLN A 1 20  ? 4.321   -13.246 -11.647 1.00 0.00 ? 20  GLN A NE2  4  
ATOM 5649  H H    . GLN A 1 20  ? 4.869   -12.382 -5.928  1.00 0.00 ? 20  GLN A H    4  
ATOM 5650  H HA   . GLN A 1 20  ? 5.684   -14.533 -7.316  1.00 0.00 ? 20  GLN A HA   4  
ATOM 5651  H HB2  . GLN A 1 20  ? 4.483   -12.567 -8.266  1.00 0.00 ? 20  GLN A HB2  4  
ATOM 5652  H HB3  . GLN A 1 20  ? 6.016   -11.707 -8.334  1.00 0.00 ? 20  GLN A HB3  4  
ATOM 5653  H HG2  . GLN A 1 20  ? 6.888   -13.244 -9.938  1.00 0.00 ? 20  GLN A HG2  4  
ATOM 5654  H HG3  . GLN A 1 20  ? 5.490   -14.303 -9.757  1.00 0.00 ? 20  GLN A HG3  4  
ATOM 5655  H HE21 . GLN A 1 20  ? 4.236   -14.206 -11.464 1.00 0.00 ? 20  GLN A HE21 4  
ATOM 5656  H HE22 . GLN A 1 20  ? 3.850   -12.789 -12.373 1.00 0.00 ? 20  GLN A HE22 4  
ATOM 5657  N N    . ALA A 1 21  ? 8.116   -14.539 -8.081  1.00 0.00 ? 21  ALA A N    4  
ATOM 5658  C CA   . ALA A 1 21  ? 9.556   -14.709 -8.230  1.00 0.00 ? 21  ALA A CA   4  
ATOM 5659  C C    . ALA A 1 21  ? 10.115  -13.762 -9.286  1.00 0.00 ? 21  ALA A C    4  
ATOM 5660  O O    . ALA A 1 21  ? 9.484   -13.524 -10.316 1.00 0.00 ? 21  ALA A O    4  
ATOM 5661  C CB   . ALA A 1 21  ? 9.883   -16.152 -8.586  1.00 0.00 ? 21  ALA A CB   4  
ATOM 5662  H H    . ALA A 1 21  ? 7.511   -15.127 -8.579  1.00 0.00 ? 21  ALA A H    4  
ATOM 5663  H HA   . ALA A 1 21  ? 10.019  -14.485 -7.279  1.00 0.00 ? 21  ALA A HA   4  
ATOM 5664  H HB1  . ALA A 1 21  ? 9.714   -16.782 -7.725  1.00 0.00 ? 21  ALA A HB1  4  
ATOM 5665  H HB2  . ALA A 1 21  ? 9.249   -16.474 -9.398  1.00 0.00 ? 21  ALA A HB2  4  
ATOM 5666  H HB3  . ALA A 1 21  ? 10.918  -16.223 -8.886  1.00 0.00 ? 21  ALA A HB3  4  
ATOM 5667  N N    . SER A 1 22  ? 11.301  -13.223 -9.023  1.00 0.00 ? 22  SER A N    4  
ATOM 5668  C CA   . SER A 1 22  ? 11.942  -12.297 -9.949  1.00 0.00 ? 22  SER A CA   4  
ATOM 5669  C C    . SER A 1 22  ? 12.440  -13.030 -11.192 1.00 0.00 ? 22  SER A C    4  
ATOM 5670  O O    . SER A 1 22  ? 12.244  -14.237 -11.334 1.00 0.00 ? 22  SER A O    4  
ATOM 5671  C CB   . SER A 1 22  ? 13.108  -11.582 -9.264  1.00 0.00 ? 22  SER A CB   4  
ATOM 5672  O OG   . SER A 1 22  ? 12.641  -10.646 -8.307  1.00 0.00 ? 22  SER A OG   4  
ATOM 5673  H H    . SER A 1 22  ? 11.754  -13.451 -8.184  1.00 0.00 ? 22  SER A H    4  
ATOM 5674  H HA   . SER A 1 22  ? 11.207  -11.565 -10.248 1.00 0.00 ? 22  SER A HA   4  
ATOM 5675  H HB2  . SER A 1 22  ? 13.729  -12.309 -8.764  1.00 0.00 ? 22  SER A HB2  4  
ATOM 5676  H HB3  . SER A 1 22  ? 13.693  -11.059 -10.007 1.00 0.00 ? 22  SER A HB3  4  
ATOM 5677  H HG   . SER A 1 22  ? 12.172  -9.938  -8.755  1.00 0.00 ? 22  SER A HG   4  
ATOM 5678  N N    . SER A 1 23  ? 13.085  -12.290 -12.088 1.00 0.00 ? 23  SER A N    4  
ATOM 5679  C CA   . SER A 1 23  ? 13.609  -12.868 -13.321 1.00 0.00 ? 23  SER A CA   4  
ATOM 5680  C C    . SER A 1 23  ? 14.158  -14.269 -13.074 1.00 0.00 ? 23  SER A C    4  
ATOM 5681  O O    . SER A 1 23  ? 15.273  -14.433 -12.580 1.00 0.00 ? 23  SER A O    4  
ATOM 5682  C CB   . SER A 1 23  ? 14.705  -11.973 -13.902 1.00 0.00 ? 23  SER A CB   4  
ATOM 5683  O OG   . SER A 1 23  ? 15.846  -11.952 -13.062 1.00 0.00 ? 23  SER A OG   4  
ATOM 5684  H H    . SER A 1 23  ? 13.210  -11.333 -11.917 1.00 0.00 ? 23  SER A H    4  
ATOM 5685  H HA   . SER A 1 23  ? 12.795  -12.932 -14.028 1.00 0.00 ? 23  SER A HA   4  
ATOM 5686  H HB2  . SER A 1 23  ? 14.995  -12.347 -14.872 1.00 0.00 ? 23  SER A HB2  4  
ATOM 5687  H HB3  . SER A 1 23  ? 14.328  -10.966 -14.003 1.00 0.00 ? 23  SER A HB3  4  
ATOM 5688  H HG   . SER A 1 23  ? 16.285  -12.805 -13.096 1.00 0.00 ? 23  SER A HG   4  
ATOM 5689  N N    . GLY A 1 24  ? 13.366  -15.279 -13.422 1.00 0.00 ? 24  GLY A N    4  
ATOM 5690  C CA   . GLY A 1 24  ? 13.788  -16.654 -13.231 1.00 0.00 ? 24  GLY A CA   4  
ATOM 5691  C C    . GLY A 1 24  ? 12.650  -17.640 -13.401 1.00 0.00 ? 24  GLY A C    4  
ATOM 5692  O O    . GLY A 1 24  ? 11.623  -17.316 -13.999 1.00 0.00 ? 24  GLY A O    4  
ATOM 5693  H H    . GLY A 1 24  ? 12.487  -15.088 -13.811 1.00 0.00 ? 24  GLY A H    4  
ATOM 5694  H HA2  . GLY A 1 24  ? 14.561  -16.885 -13.949 1.00 0.00 ? 24  GLY A HA2  4  
ATOM 5695  H HA3  . GLY A 1 24  ? 14.194  -16.759 -12.235 1.00 0.00 ? 24  GLY A HA3  4  
ATOM 5696  N N    . VAL A 1 25  ? 12.831  -18.847 -12.876 1.00 0.00 ? 25  VAL A N    4  
ATOM 5697  C CA   . VAL A 1 25  ? 11.810  -19.884 -12.973 1.00 0.00 ? 25  VAL A CA   4  
ATOM 5698  C C    . VAL A 1 25  ? 10.475  -19.394 -12.424 1.00 0.00 ? 25  VAL A C    4  
ATOM 5699  O O    . VAL A 1 25  ? 10.430  -18.625 -11.464 1.00 0.00 ? 25  VAL A O    4  
ATOM 5700  C CB   . VAL A 1 25  ? 12.229  -21.157 -12.213 1.00 0.00 ? 25  VAL A CB   4  
ATOM 5701  C CG1  . VAL A 1 25  ? 11.853  -21.049 -10.743 1.00 0.00 ? 25  VAL A CG1  4  
ATOM 5702  C CG2  . VAL A 1 25  ? 11.595  -22.387 -12.845 1.00 0.00 ? 25  VAL A CG2  4  
ATOM 5703  H H    . VAL A 1 25  ? 13.670  -19.045 -12.411 1.00 0.00 ? 25  VAL A H    4  
ATOM 5704  H HA   . VAL A 1 25  ? 11.689  -20.136 -14.017 1.00 0.00 ? 25  VAL A HA   4  
ATOM 5705  H HB   . VAL A 1 25  ? 13.302  -21.256 -12.281 1.00 0.00 ? 25  VAL A HB   4  
ATOM 5706  H HG11 . VAL A 1 25  ? 12.038  -20.042 -10.398 1.00 0.00 ? 25  VAL A HG11 4  
ATOM 5707  H HG12 . VAL A 1 25  ? 10.807  -21.287 -10.620 1.00 0.00 ? 25  VAL A HG12 4  
ATOM 5708  H HG13 . VAL A 1 25  ? 12.451  -21.741 -10.168 1.00 0.00 ? 25  VAL A HG13 4  
ATOM 5709  H HG21 . VAL A 1 25  ? 11.636  -22.300 -13.921 1.00 0.00 ? 25  VAL A HG21 4  
ATOM 5710  H HG22 . VAL A 1 25  ? 12.135  -23.270 -12.535 1.00 0.00 ? 25  VAL A HG22 4  
ATOM 5711  H HG23 . VAL A 1 25  ? 10.566  -22.465 -12.529 1.00 0.00 ? 25  VAL A HG23 4  
ATOM 5712  N N    . LYS A 1 26  ? 9.387   -19.845 -13.040 1.00 0.00 ? 26  LYS A N    4  
ATOM 5713  C CA   . LYS A 1 26  ? 8.049   -19.455 -12.614 1.00 0.00 ? 26  LYS A CA   4  
ATOM 5714  C C    . LYS A 1 26  ? 7.687   -20.113 -11.287 1.00 0.00 ? 26  LYS A C    4  
ATOM 5715  O O    . LYS A 1 26  ? 7.208   -21.246 -11.256 1.00 0.00 ? 26  LYS A O    4  
ATOM 5716  C CB   . LYS A 1 26  ? 7.020   -19.835 -13.681 1.00 0.00 ? 26  LYS A CB   4  
ATOM 5717  C CG   . LYS A 1 26  ? 7.322   -19.254 -15.052 1.00 0.00 ? 26  LYS A CG   4  
ATOM 5718  C CD   . LYS A 1 26  ? 6.628   -20.036 -16.154 1.00 0.00 ? 26  LYS A CD   4  
ATOM 5719  C CE   . LYS A 1 26  ? 5.150   -19.685 -16.242 1.00 0.00 ? 26  LYS A CE   4  
ATOM 5720  N NZ   . LYS A 1 26  ? 4.559   -20.094 -17.546 1.00 0.00 ? 26  LYS A NZ   4  
ATOM 5721  H H    . LYS A 1 26  ? 9.487   -20.456 -13.801 1.00 0.00 ? 26  LYS A H    4  
ATOM 5722  H HA   . LYS A 1 26  ? 8.041   -18.383 -12.484 1.00 0.00 ? 26  LYS A HA   4  
ATOM 5723  H HB2  . LYS A 1 26  ? 6.990   -20.911 -13.768 1.00 0.00 ? 26  LYS A HB2  4  
ATOM 5724  H HB3  . LYS A 1 26  ? 6.048   -19.481 -13.369 1.00 0.00 ? 26  LYS A HB3  4  
ATOM 5725  H HG2  . LYS A 1 26  ? 6.980   -18.230 -15.082 1.00 0.00 ? 26  LYS A HG2  4  
ATOM 5726  H HG3  . LYS A 1 26  ? 8.389   -19.285 -15.218 1.00 0.00 ? 26  LYS A HG3  4  
ATOM 5727  H HD2  . LYS A 1 26  ? 7.097   -19.805 -17.099 1.00 0.00 ? 26  LYS A HD2  4  
ATOM 5728  H HD3  . LYS A 1 26  ? 6.727   -21.093 -15.951 1.00 0.00 ? 26  LYS A HD3  4  
ATOM 5729  H HE2  . LYS A 1 26  ? 4.626   -20.190 -15.445 1.00 0.00 ? 26  LYS A HE2  4  
ATOM 5730  H HE3  . LYS A 1 26  ? 5.040   -18.617 -16.125 1.00 0.00 ? 26  LYS A HE3  4  
ATOM 5731  H HZ1  . LYS A 1 26  ? 5.076   -19.645 -18.328 1.00 0.00 ? 26  LYS A HZ1  4  
ATOM 5732  H HZ2  . LYS A 1 26  ? 3.562   -19.804 -17.592 1.00 0.00 ? 26  LYS A HZ2  4  
ATOM 5733  H HZ3  . LYS A 1 26  ? 4.615   -21.127 -17.656 1.00 0.00 ? 26  LYS A HZ3  4  
ATOM 5734  N N    . GLN A 1 27  ? 7.918   -19.395 -10.192 1.00 0.00 ? 27  GLN A N    4  
ATOM 5735  C CA   . GLN A 1 27  ? 7.616   -19.911 -8.863  1.00 0.00 ? 27  GLN A CA   4  
ATOM 5736  C C    . GLN A 1 27  ? 7.302   -18.773 -7.896  1.00 0.00 ? 27  GLN A C    4  
ATOM 5737  O O    . GLN A 1 27  ? 7.707   -17.631 -8.114  1.00 0.00 ? 27  GLN A O    4  
ATOM 5738  C CB   . GLN A 1 27  ? 8.789   -20.737 -8.333  1.00 0.00 ? 27  GLN A CB   4  
ATOM 5739  C CG   . GLN A 1 27  ? 9.967   -19.894 -7.870  1.00 0.00 ? 27  GLN A CG   4  
ATOM 5740  C CD   . GLN A 1 27  ? 10.990  -20.698 -7.093  1.00 0.00 ? 27  GLN A CD   4  
ATOM 5741  O OE1  . GLN A 1 27  ? 12.091  -20.959 -7.580  1.00 0.00 ? 27  GLN A OE1  4  
ATOM 5742  N NE2  . GLN A 1 27  ? 10.633  -21.094 -5.877  1.00 0.00 ? 27  GLN A NE2  4  
ATOM 5743  H H    . GLN A 1 27  ? 8.302   -18.498 -10.281 1.00 0.00 ? 27  GLN A H    4  
ATOM 5744  H HA   . GLN A 1 27  ? 6.747   -20.547 -8.944  1.00 0.00 ? 27  GLN A HA   4  
ATOM 5745  H HB2  . GLN A 1 27  ? 8.449   -21.331 -7.498  1.00 0.00 ? 27  GLN A HB2  4  
ATOM 5746  H HB3  . GLN A 1 27  ? 9.133   -21.395 -9.117  1.00 0.00 ? 27  GLN A HB3  4  
ATOM 5747  H HG2  . GLN A 1 27  ? 10.450  -19.466 -8.736  1.00 0.00 ? 27  GLN A HG2  4  
ATOM 5748  H HG3  . GLN A 1 27  ? 9.597   -19.100 -7.237  1.00 0.00 ? 27  GLN A HG3  4  
ATOM 5749  H HE21 . GLN A 1 27  ? 9.740   -20.850 -5.555  1.00 0.00 ? 27  GLN A HE21 4  
ATOM 5750  H HE22 . GLN A 1 27  ? 11.275  -21.616 -5.354  1.00 0.00 ? 27  GLN A HE22 4  
ATOM 5751  N N    . TRP A 1 28  ? 6.579   -19.093 -6.829  1.00 0.00 ? 28  TRP A N    4  
ATOM 5752  C CA   . TRP A 1 28  ? 6.211   -18.097 -5.829  1.00 0.00 ? 28  TRP A CA   4  
ATOM 5753  C C    . TRP A 1 28  ? 6.833   -18.428 -4.477  1.00 0.00 ? 28  TRP A C    4  
ATOM 5754  O O    . TRP A 1 28  ? 6.793   -19.572 -4.028  1.00 0.00 ? 28  TRP A O    4  
ATOM 5755  C CB   . TRP A 1 28  ? 4.689   -18.015 -5.697  1.00 0.00 ? 28  TRP A CB   4  
ATOM 5756  C CG   . TRP A 1 28  ? 4.027   -17.355 -6.869  1.00 0.00 ? 28  TRP A CG   4  
ATOM 5757  C CD1  . TRP A 1 28  ? 3.991   -17.812 -8.155  1.00 0.00 ? 28  TRP A CD1  4  
ATOM 5758  C CD2  . TRP A 1 28  ? 3.308   -16.117 -6.861  1.00 0.00 ? 28  TRP A CD2  4  
ATOM 5759  N NE1  . TRP A 1 28  ? 3.292   -16.933 -8.947  1.00 0.00 ? 28  TRP A NE1  4  
ATOM 5760  C CE2  . TRP A 1 28  ? 2.862   -15.885 -8.177  1.00 0.00 ? 28  TRP A CE2  4  
ATOM 5761  C CE3  . TRP A 1 28  ? 2.995   -15.183 -5.870  1.00 0.00 ? 28  TRP A CE3  4  
ATOM 5762  C CZ2  . TRP A 1 28  ? 2.122   -14.758 -8.524  1.00 0.00 ? 28  TRP A CZ2  4  
ATOM 5763  C CZ3  . TRP A 1 28  ? 2.260   -14.064 -6.216  1.00 0.00 ? 28  TRP A CZ3  4  
ATOM 5764  C CH2  . TRP A 1 28  ? 1.830   -13.860 -7.534  1.00 0.00 ? 28  TRP A CH2  4  
ATOM 5765  H H    . TRP A 1 28  ? 6.286   -20.021 -6.710  1.00 0.00 ? 28  TRP A H    4  
ATOM 5766  H HA   . TRP A 1 28  ? 6.587   -17.141 -6.161  1.00 0.00 ? 28  TRP A HA   4  
ATOM 5767  H HB2  . TRP A 1 28  ? 4.288   -19.013 -5.606  1.00 0.00 ? 28  TRP A HB2  4  
ATOM 5768  H HB3  . TRP A 1 28  ? 4.442   -17.449 -4.811  1.00 0.00 ? 28  TRP A HB3  4  
ATOM 5769  H HD1  . TRP A 1 28  ? 4.450   -18.731 -8.487  1.00 0.00 ? 28  TRP A HD1  4  
ATOM 5770  H HE1  . TRP A 1 28  ? 3.128   -17.040 -9.908  1.00 0.00 ? 28  TRP A HE1  4  
ATOM 5771  H HE3  . TRP A 1 28  ? 3.317   -15.322 -4.848  1.00 0.00 ? 28  TRP A HE3  4  
ATOM 5772  H HZ2  . TRP A 1 28  ? 1.783   -14.587 -9.536  1.00 0.00 ? 28  TRP A HZ2  4  
ATOM 5773  H HZ3  . TRP A 1 28  ? 2.010   -13.331 -5.464  1.00 0.00 ? 28  TRP A HZ3  4  
ATOM 5774  H HH2  . TRP A 1 28  ? 1.260   -12.973 -7.760  1.00 0.00 ? 28  TRP A HH2  4  
ATOM 5775  N N    . ASN A 1 29  ? 7.408   -17.418 -3.832  1.00 0.00 ? 29  ASN A N    4  
ATOM 5776  C CA   . ASN A 1 29  ? 8.040   -17.602 -2.530  1.00 0.00 ? 29  ASN A CA   4  
ATOM 5777  C C    . ASN A 1 29  ? 7.183   -17.002 -1.420  1.00 0.00 ? 29  ASN A C    4  
ATOM 5778  O O    . ASN A 1 29  ? 6.601   -15.929 -1.581  1.00 0.00 ? 29  ASN A O    4  
ATOM 5779  C CB   . ASN A 1 29  ? 9.430   -16.964 -2.519  1.00 0.00 ? 29  ASN A CB   4  
ATOM 5780  C CG   . ASN A 1 29  ? 10.393  -17.658 -3.463  1.00 0.00 ? 29  ASN A CG   4  
ATOM 5781  O OD1  . ASN A 1 29  ? 10.731  -18.826 -3.273  1.00 0.00 ? 29  ASN A OD1  4  
ATOM 5782  N ND2  . ASN A 1 29  ? 10.839  -16.939 -4.487  1.00 0.00 ? 29  ASN A ND2  4  
ATOM 5783  H H    . ASN A 1 29  ? 7.409   -16.527 -4.241  1.00 0.00 ? 29  ASN A H    4  
ATOM 5784  H HA   . ASN A 1 29  ? 8.139   -18.663 -2.358  1.00 0.00 ? 29  ASN A HA   4  
ATOM 5785  H HB2  . ASN A 1 29  ? 9.346   -15.929 -2.819  1.00 0.00 ? 29  ASN A HB2  4  
ATOM 5786  H HB3  . ASN A 1 29  ? 9.835   -17.013 -1.520  1.00 0.00 ? 29  ASN A HB3  4  
ATOM 5787  H HD21 . ASN A 1 29  ? 10.527  -16.014 -4.575  1.00 0.00 ? 29  ASN A HD21 4  
ATOM 5788  H HD22 . ASN A 1 29  ? 11.462  -17.364 -5.113  1.00 0.00 ? 29  ASN A HD22 4  
ATOM 5789  N N    . LYS A 1 30  ? 7.110   -17.701 -0.292  1.00 0.00 ? 30  LYS A N    4  
ATOM 5790  C CA   . LYS A 1 30  ? 6.327   -17.237 0.846   1.00 0.00 ? 30  LYS A CA   4  
ATOM 5791  C C    . LYS A 1 30  ? 7.124   -16.247 1.689   1.00 0.00 ? 30  LYS A C    4  
ATOM 5792  O O    . LYS A 1 30  ? 8.282   -16.496 2.026   1.00 0.00 ? 30  LYS A O    4  
ATOM 5793  C CB   . LYS A 1 30  ? 5.893   -18.424 1.710   1.00 0.00 ? 30  LYS A CB   4  
ATOM 5794  C CG   . LYS A 1 30  ? 4.958   -18.041 2.845   1.00 0.00 ? 30  LYS A CG   4  
ATOM 5795  C CD   . LYS A 1 30  ? 4.780   -19.183 3.830   1.00 0.00 ? 30  LYS A CD   4  
ATOM 5796  C CE   . LYS A 1 30  ? 3.515   -19.014 4.658   1.00 0.00 ? 30  LYS A CE   4  
ATOM 5797  N NZ   . LYS A 1 30  ? 2.301   -19.441 3.909   1.00 0.00 ? 30  LYS A NZ   4  
ATOM 5798  H H    . LYS A 1 30  ? 7.597   -18.549 -0.224  1.00 0.00 ? 30  LYS A H    4  
ATOM 5799  H HA   . LYS A 1 30  ? 5.448   -16.740 0.464   1.00 0.00 ? 30  LYS A HA   4  
ATOM 5800  H HB2  . LYS A 1 30  ? 5.388   -19.144 1.083   1.00 0.00 ? 30  LYS A HB2  4  
ATOM 5801  H HB3  . LYS A 1 30  ? 6.773   -18.884 2.136   1.00 0.00 ? 30  LYS A HB3  4  
ATOM 5802  H HG2  . LYS A 1 30  ? 5.370   -17.190 3.367   1.00 0.00 ? 30  LYS A HG2  4  
ATOM 5803  H HG3  . LYS A 1 30  ? 3.994   -17.779 2.432   1.00 0.00 ? 30  LYS A HG3  4  
ATOM 5804  H HD2  . LYS A 1 30  ? 4.717   -20.112 3.284   1.00 0.00 ? 30  LYS A HD2  4  
ATOM 5805  H HD3  . LYS A 1 30  ? 5.633   -19.211 4.494   1.00 0.00 ? 30  LYS A HD3  4  
ATOM 5806  H HE2  . LYS A 1 30  ? 3.604   -19.610 5.553   1.00 0.00 ? 30  LYS A HE2  4  
ATOM 5807  H HE3  . LYS A 1 30  ? 3.414   -17.973 4.927   1.00 0.00 ? 30  LYS A HE3  4  
ATOM 5808  H HZ1  . LYS A 1 30  ? 2.341   -19.087 2.932   1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 5809  H HZ2  . LYS A 1 30  ? 1.447   -19.063 4.367   1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 5810  H HZ3  . LYS A 1 30  ? 2.240   -20.479 3.888   1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 5811  N N    . ARG A 1 31  ? 6.498   -15.124 2.026   1.00 0.00 ? 31  ARG A N    4  
ATOM 5812  C CA   . ARG A 1 31  ? 7.150   -14.097 2.829   1.00 0.00 ? 31  ARG A CA   4  
ATOM 5813  C C    . ARG A 1 31  ? 6.128   -13.326 3.659   1.00 0.00 ? 31  ARG A C    4  
ATOM 5814  O O    . ARG A 1 31  ? 5.012   -13.070 3.207   1.00 0.00 ? 31  ARG A O    4  
ATOM 5815  C CB   . ARG A 1 31  ? 7.924   -13.131 1.930   1.00 0.00 ? 31  ARG A CB   4  
ATOM 5816  C CG   . ARG A 1 31  ? 9.158   -12.540 2.592   1.00 0.00 ? 31  ARG A CG   4  
ATOM 5817  C CD   . ARG A 1 31  ? 10.367  -13.447 2.428   1.00 0.00 ? 31  ARG A CD   4  
ATOM 5818  N NE   . ARG A 1 31  ? 11.113  -13.151 1.208   1.00 0.00 ? 31  ARG A NE   4  
ATOM 5819  C CZ   . ARG A 1 31  ? 12.045  -12.208 1.126   1.00 0.00 ? 31  ARG A CZ   4  
ATOM 5820  N NH1  . ARG A 1 31  ? 12.345  -11.475 2.189   1.00 0.00 ? 31  ARG A NH1  4  
ATOM 5821  N NH2  . ARG A 1 31  ? 12.680  -11.999 -0.020  1.00 0.00 ? 31  ARG A NH2  4  
ATOM 5822  H H    . ARG A 1 31  ? 5.575   -14.983 1.727   1.00 0.00 ? 31  ARG A H    4  
ATOM 5823  H HA   . ARG A 1 31  ? 7.842   -14.587 3.496   1.00 0.00 ? 31  ARG A HA   4  
ATOM 5824  H HB2  . ARG A 1 31  ? 8.238   -13.659 1.041   1.00 0.00 ? 31  ARG A HB2  4  
ATOM 5825  H HB3  . ARG A 1 31  ? 7.271   -12.321 1.646   1.00 0.00 ? 31  ARG A HB3  4  
ATOM 5826  H HG2  . ARG A 1 31  ? 9.375   -11.584 2.138   1.00 0.00 ? 31  ARG A HG2  4  
ATOM 5827  H HG3  . ARG A 1 31  ? 8.960   -12.404 3.644   1.00 0.00 ? 31  ARG A HG3  4  
ATOM 5828  H HD2  . ARG A 1 31  ? 11.019  -13.312 3.278   1.00 0.00 ? 31  ARG A HD2  4  
ATOM 5829  H HD3  . ARG A 1 31  ? 10.029  -14.472 2.393   1.00 0.00 ? 31  ARG A HD3  4  
ATOM 5830  H HE   . ARG A 1 31  ? 10.907  -13.681 0.410   1.00 0.00 ? 31  ARG A HE   4  
ATOM 5831  H HH11 . ARG A 1 31  ? 11.869  -11.631 3.054   1.00 0.00 ? 31  ARG A HH11 4  
ATOM 5832  H HH12 . ARG A 1 31  ? 13.049  -10.766 2.126   1.00 0.00 ? 31  ARG A HH12 4  
ATOM 5833  H HH21 . ARG A 1 31  ? 12.457  -12.550 -0.823  1.00 0.00 ? 31  ARG A HH21 4  
ATOM 5834  H HH22 . ARG A 1 31  ? 13.381  -11.289 -0.080  1.00 0.00 ? 31  ARG A HH22 4  
ATOM 5835  N N    . TRP A 1 32  ? 6.516   -12.960 4.875   1.00 0.00 ? 32  TRP A N    4  
ATOM 5836  C CA   . TRP A 1 32  ? 5.634   -12.219 5.769   1.00 0.00 ? 32  TRP A CA   4  
ATOM 5837  C C    . TRP A 1 32  ? 5.407   -10.801 5.258   1.00 0.00 ? 32  TRP A C    4  
ATOM 5838  O O    . TRP A 1 32  ? 6.356   -10.042 5.060   1.00 0.00 ? 32  TRP A O    4  
ATOM 5839  C CB   . TRP A 1 32  ? 6.222   -12.177 7.181   1.00 0.00 ? 32  TRP A CB   4  
ATOM 5840  C CG   . TRP A 1 32  ? 5.288   -11.591 8.196   1.00 0.00 ? 32  TRP A CG   4  
ATOM 5841  C CD1  . TRP A 1 32  ? 5.521   -10.509 8.996   1.00 0.00 ? 32  TRP A CD1  4  
ATOM 5842  C CD2  . TRP A 1 32  ? 3.974   -12.057 8.521   1.00 0.00 ? 32  TRP A CD2  4  
ATOM 5843  N NE1  . TRP A 1 32  ? 4.431   -10.274 9.799   1.00 0.00 ? 32  TRP A NE1  4  
ATOM 5844  C CE2  . TRP A 1 32  ? 3.468   -11.209 9.526   1.00 0.00 ? 32  TRP A CE2  4  
ATOM 5845  C CE3  . TRP A 1 32  ? 3.174   -13.106 8.060   1.00 0.00 ? 32  TRP A CE3  4  
ATOM 5846  C CZ2  . TRP A 1 32  ? 2.201   -11.380 10.076  1.00 0.00 ? 32  TRP A CZ2  4  
ATOM 5847  C CZ3  . TRP A 1 32  ? 1.916   -13.275 8.607   1.00 0.00 ? 32  TRP A CZ3  4  
ATOM 5848  C CH2  . TRP A 1 32  ? 1.439   -12.416 9.606   1.00 0.00 ? 32  TRP A CH2  4  
ATOM 5849  H H    . TRP A 1 32  ? 7.419   -13.193 5.180   1.00 0.00 ? 32  TRP A H    4  
ATOM 5850  H HA   . TRP A 1 32  ? 4.685   -12.735 5.799   1.00 0.00 ? 32  TRP A HA   4  
ATOM 5851  H HB2  . TRP A 1 32  ? 6.465   -13.182 7.493   1.00 0.00 ? 32  TRP A HB2  4  
ATOM 5852  H HB3  . TRP A 1 32  ? 7.122   -11.579 7.170   1.00 0.00 ? 32  TRP A HB3  4  
ATOM 5853  H HD1  . TRP A 1 32  ? 6.434   -9.933  8.989   1.00 0.00 ? 32  TRP A HD1  4  
ATOM 5854  H HE1  . TRP A 1 32  ? 4.356   -9.552  10.458  1.00 0.00 ? 32  TRP A HE1  4  
ATOM 5855  H HE3  . TRP A 1 32  ? 3.524   -13.778 7.291   1.00 0.00 ? 32  TRP A HE3  4  
ATOM 5856  H HZ2  . TRP A 1 32  ? 1.818   -10.726 10.846  1.00 0.00 ? 32  TRP A HZ2  4  
ATOM 5857  H HZ3  . TRP A 1 32  ? 1.284   -14.081 8.264   1.00 0.00 ? 32  TRP A HZ3  4  
ATOM 5858  H HH2  . TRP A 1 32  ? 0.451   -12.586 10.005  1.00 0.00 ? 32  TRP A HH2  4  
ATOM 5859  N N    . PHE A 1 33  ? 4.143   -10.448 5.044   1.00 0.00 ? 33  PHE A N    4  
ATOM 5860  C CA   . PHE A 1 33  ? 3.792   -9.120  4.555   1.00 0.00 ? 33  PHE A CA   4  
ATOM 5861  C C    . PHE A 1 33  ? 2.972   -8.358  5.591   1.00 0.00 ? 33  PHE A C    4  
ATOM 5862  O O    . PHE A 1 33  ? 2.120   -8.931  6.270   1.00 0.00 ? 33  PHE A O    4  
ATOM 5863  C CB   . PHE A 1 33  ? 3.007   -9.228  3.245   1.00 0.00 ? 33  PHE A CB   4  
ATOM 5864  C CG   . PHE A 1 33  ? 3.882   -9.351  2.031   1.00 0.00 ? 33  PHE A CG   4  
ATOM 5865  C CD1  . PHE A 1 33  ? 4.323   -8.221  1.361   1.00 0.00 ? 33  PHE A CD1  4  
ATOM 5866  C CD2  . PHE A 1 33  ? 4.264   -10.596 1.559   1.00 0.00 ? 33  PHE A CD2  4  
ATOM 5867  C CE1  . PHE A 1 33  ? 5.127   -8.331  0.242   1.00 0.00 ? 33  PHE A CE1  4  
ATOM 5868  C CE2  . PHE A 1 33  ? 5.068   -10.713 0.441   1.00 0.00 ? 33  PHE A CE2  4  
ATOM 5869  C CZ   . PHE A 1 33  ? 5.501   -9.579  -0.218  1.00 0.00 ? 33  PHE A CZ   4  
ATOM 5870  H H    . PHE A 1 33  ? 3.430   -11.098 5.220   1.00 0.00 ? 33  PHE A H    4  
ATOM 5871  H HA   . PHE A 1 33  ? 4.709   -8.582  4.372   1.00 0.00 ? 33  PHE A HA   4  
ATOM 5872  H HB2  . PHE A 1 33  ? 2.372   -10.099 3.285   1.00 0.00 ? 33  PHE A HB2  4  
ATOM 5873  H HB3  . PHE A 1 33  ? 2.396   -8.346  3.128   1.00 0.00 ? 33  PHE A HB3  4  
ATOM 5874  H HD1  . PHE A 1 33  ? 4.033   -7.244  1.720   1.00 0.00 ? 33  PHE A HD1  4  
ATOM 5875  H HD2  . PHE A 1 33  ? 3.925   -11.484 2.073   1.00 0.00 ? 33  PHE A HD2  4  
ATOM 5876  H HE1  . PHE A 1 33  ? 5.465   -7.443  -0.270  1.00 0.00 ? 33  PHE A HE1  4  
ATOM 5877  H HE2  . PHE A 1 33  ? 5.358   -11.690 0.084   1.00 0.00 ? 33  PHE A HE2  4  
ATOM 5878  H HZ   . PHE A 1 33  ? 6.129   -9.668  -1.091  1.00 0.00 ? 33  PHE A HZ   4  
ATOM 5879  N N    . VAL A 1 34  ? 3.237   -7.060  5.708   1.00 0.00 ? 34  VAL A N    4  
ATOM 5880  C CA   . VAL A 1 34  ? 2.525   -6.217  6.661   1.00 0.00 ? 34  VAL A CA   4  
ATOM 5881  C C    . VAL A 1 34  ? 2.219   -4.849  6.063   1.00 0.00 ? 34  VAL A C    4  
ATOM 5882  O O    . VAL A 1 34  ? 3.107   -4.008  5.921   1.00 0.00 ? 34  VAL A O    4  
ATOM 5883  C CB   . VAL A 1 34  ? 3.334   -6.029  7.958   1.00 0.00 ? 34  VAL A CB   4  
ATOM 5884  C CG1  . VAL A 1 34  ? 2.592   -5.116  8.922   1.00 0.00 ? 34  VAL A CG1  4  
ATOM 5885  C CG2  . VAL A 1 34  ? 3.625   -7.375  8.604   1.00 0.00 ? 34  VAL A CG2  4  
ATOM 5886  H H    . VAL A 1 34  ? 3.928   -6.660  5.139   1.00 0.00 ? 34  VAL A H    4  
ATOM 5887  H HA   . VAL A 1 34  ? 1.594   -6.707  6.909   1.00 0.00 ? 34  VAL A HA   4  
ATOM 5888  H HB   . VAL A 1 34  ? 4.275   -5.563  7.707   1.00 0.00 ? 34  VAL A HB   4  
ATOM 5889  H HG11 . VAL A 1 34  ? 1.741   -5.640  9.332   1.00 0.00 ? 34  VAL A HG11 4  
ATOM 5890  H HG12 . VAL A 1 34  ? 3.255   -4.822  9.722   1.00 0.00 ? 34  VAL A HG12 4  
ATOM 5891  H HG13 . VAL A 1 34  ? 2.252   -4.236  8.395   1.00 0.00 ? 34  VAL A HG13 4  
ATOM 5892  H HG21 . VAL A 1 34  ? 2.975   -8.126  8.179   1.00 0.00 ? 34  VAL A HG21 4  
ATOM 5893  H HG22 . VAL A 1 34  ? 4.655   -7.647  8.422   1.00 0.00 ? 34  VAL A HG22 4  
ATOM 5894  H HG23 . VAL A 1 34  ? 3.453   -7.310  9.668   1.00 0.00 ? 34  VAL A HG23 4  
ATOM 5895  N N    . LEU A 1 35  ? 0.956   -4.631  5.713   1.00 0.00 ? 35  LEU A N    4  
ATOM 5896  C CA   . LEU A 1 35  ? 0.531   -3.364  5.130   1.00 0.00 ? 35  LEU A CA   4  
ATOM 5897  C C    . LEU A 1 35  ? 0.612   -2.238  6.156   1.00 0.00 ? 35  LEU A C    4  
ATOM 5898  O O    . LEU A 1 35  ? 0.047   -2.335  7.245   1.00 0.00 ? 35  LEU A O    4  
ATOM 5899  C CB   . LEU A 1 35  ? -0.898  -3.479  4.595   1.00 0.00 ? 35  LEU A CB   4  
ATOM 5900  C CG   . LEU A 1 35  ? -1.589  -2.163  4.236   1.00 0.00 ? 35  LEU A CG   4  
ATOM 5901  C CD1  . LEU A 1 35  ? -0.852  -1.466  3.102   1.00 0.00 ? 35  LEU A CD1  4  
ATOM 5902  C CD2  . LEU A 1 35  ? -3.042  -2.409  3.858   1.00 0.00 ? 35  LEU A CD2  4  
ATOM 5903  H H    . LEU A 1 35  ? 0.292   -5.339  5.850   1.00 0.00 ? 35  LEU A H    4  
ATOM 5904  H HA   . LEU A 1 35  ? 1.196   -3.137  4.310   1.00 0.00 ? 35  LEU A HA   4  
ATOM 5905  H HB2  . LEU A 1 35  ? -0.869  -4.091  3.706   1.00 0.00 ? 35  LEU A HB2  4  
ATOM 5906  H HB3  . LEU A 1 35  ? -1.494  -3.972  5.349   1.00 0.00 ? 35  LEU A HB3  4  
ATOM 5907  H HG   . LEU A 1 35  ? -1.572  -1.509  5.096   1.00 0.00 ? 35  LEU A HG   4  
ATOM 5908  H HD11 . LEU A 1 35  ? 0.199   -1.701  3.158   1.00 0.00 ? 35  LEU A HD11 4  
ATOM 5909  H HD12 . LEU A 1 35  ? -0.988  -0.398  3.189   1.00 0.00 ? 35  LEU A HD12 4  
ATOM 5910  H HD13 . LEU A 1 35  ? -1.248  -1.802  2.155   1.00 0.00 ? 35  LEU A HD13 4  
ATOM 5911  H HD21 . LEU A 1 35  ? -3.441  -1.531  3.372   1.00 0.00 ? 35  LEU A HD21 4  
ATOM 5912  H HD22 . LEU A 1 35  ? -3.615  -2.618  4.750   1.00 0.00 ? 35  LEU A HD22 4  
ATOM 5913  H HD23 . LEU A 1 35  ? -3.101  -3.252  3.186   1.00 0.00 ? 35  LEU A HD23 4  
ATOM 5914  N N    . VAL A 1 36  ? 1.317   -1.169  5.799   1.00 0.00 ? 36  VAL A N    4  
ATOM 5915  C CA   . VAL A 1 36  ? 1.469   -0.022  6.687   1.00 0.00 ? 36  VAL A CA   4  
ATOM 5916  C C    . VAL A 1 36  ? 0.944   1.251   6.035   1.00 0.00 ? 36  VAL A C    4  
ATOM 5917  O O    . VAL A 1 36  ? 0.443   1.225   4.910   1.00 0.00 ? 36  VAL A O    4  
ATOM 5918  C CB   . VAL A 1 36  ? 2.943   0.188   7.084   1.00 0.00 ? 36  VAL A CB   4  
ATOM 5919  C CG1  . VAL A 1 36  ? 3.668   1.009   6.029   1.00 0.00 ? 36  VAL A CG1  4  
ATOM 5920  C CG2  . VAL A 1 36  ? 3.036   0.854   8.448   1.00 0.00 ? 36  VAL A CG2  4  
ATOM 5921  H H    . VAL A 1 36  ? 1.744   -1.150  4.917   1.00 0.00 ? 36  VAL A H    4  
ATOM 5922  H HA   . VAL A 1 36  ? 0.901   -0.217  7.584   1.00 0.00 ? 36  VAL A HA   4  
ATOM 5923  H HB   . VAL A 1 36  ? 3.419   -0.780  7.146   1.00 0.00 ? 36  VAL A HB   4  
ATOM 5924  H HG11 . VAL A 1 36  ? 3.498   2.060   6.212   1.00 0.00 ? 36  VAL A HG11 4  
ATOM 5925  H HG12 . VAL A 1 36  ? 4.727   0.801   6.076   1.00 0.00 ? 36  VAL A HG12 4  
ATOM 5926  H HG13 . VAL A 1 36  ? 3.293   0.750   5.050   1.00 0.00 ? 36  VAL A HG13 4  
ATOM 5927  H HG21 . VAL A 1 36  ? 2.115   0.696   8.989   1.00 0.00 ? 36  VAL A HG21 4  
ATOM 5928  H HG22 . VAL A 1 36  ? 3.858   0.424   9.004   1.00 0.00 ? 36  VAL A HG22 4  
ATOM 5929  H HG23 . VAL A 1 36  ? 3.203   1.913   8.322   1.00 0.00 ? 36  VAL A HG23 4  
ATOM 5930  N N    . ASP A 1 37  ? 1.060   2.366   6.748   1.00 0.00 ? 37  ASP A N    4  
ATOM 5931  C CA   . ASP A 1 37  ? 0.598   3.652   6.239   1.00 0.00 ? 37  ASP A CA   4  
ATOM 5932  C C    . ASP A 1 37  ? 1.185   3.932   4.859   1.00 0.00 ? 37  ASP A C    4  
ATOM 5933  O O    . ASP A 1 37  ? 2.398   4.085   4.709   1.00 0.00 ? 37  ASP A O    4  
ATOM 5934  C CB   . ASP A 1 37  ? 0.978   4.774   7.206   1.00 0.00 ? 37  ASP A CB   4  
ATOM 5935  C CG   . ASP A 1 37  ? -0.081  5.009   8.265   1.00 0.00 ? 37  ASP A CG   4  
ATOM 5936  O OD1  . ASP A 1 37  ? -1.247  5.258   7.893   1.00 0.00 ? 37  ASP A OD1  4  
ATOM 5937  O OD2  . ASP A 1 37  ? 0.256   4.944   9.466   1.00 0.00 ? 37  ASP A OD2  4  
ATOM 5938  H H    . ASP A 1 37  ? 1.468   2.323   7.639   1.00 0.00 ? 37  ASP A H    4  
ATOM 5939  H HA   . ASP A 1 37  ? -0.477  3.609   6.156   1.00 0.00 ? 37  ASP A HA   4  
ATOM 5940  H HB2  . ASP A 1 37  ? 1.904   4.517   7.700   1.00 0.00 ? 37  ASP A HB2  4  
ATOM 5941  H HB3  . ASP A 1 37  ? 1.114   5.689   6.650   1.00 0.00 ? 37  ASP A HB3  4  
ATOM 5942  N N    . ARG A 1 38  ? 0.318   3.998   3.855   1.00 0.00 ? 38  ARG A N    4  
ATOM 5943  C CA   . ARG A 1 38  ? 0.750   4.258   2.487   1.00 0.00 ? 38  ARG A CA   4  
ATOM 5944  C C    . ARG A 1 38  ? 2.046   3.514   2.176   1.00 0.00 ? 38  ARG A C    4  
ATOM 5945  O O    . ARG A 1 38  ? 2.925   4.038   1.491   1.00 0.00 ? 38  ARG A O    4  
ATOM 5946  C CB   . ARG A 1 38  ? 0.947   5.759   2.268   1.00 0.00 ? 38  ARG A CB   4  
ATOM 5947  C CG   . ARG A 1 38  ? -0.330  6.492   1.891   1.00 0.00 ? 38  ARG A CG   4  
ATOM 5948  C CD   . ARG A 1 38  ? -0.034  7.756   1.099   1.00 0.00 ? 38  ARG A CD   4  
ATOM 5949  N NE   . ARG A 1 38  ? 0.659   8.757   1.906   1.00 0.00 ? 38  ARG A NE   4  
ATOM 5950  C CZ   . ARG A 1 38  ? 0.759   10.036  1.563   1.00 0.00 ? 38  ARG A CZ   4  
ATOM 5951  N NH1  . ARG A 1 38  ? 0.213   10.468  0.435   1.00 0.00 ? 38  ARG A NH1  4  
ATOM 5952  N NH2  . ARG A 1 38  ? 1.407   10.887  2.349   1.00 0.00 ? 38  ARG A NH2  4  
ATOM 5953  H H    . ARG A 1 38  ? -0.636  3.868   4.037   1.00 0.00 ? 38  ARG A H    4  
ATOM 5954  H HA   . ARG A 1 38  ? -0.023  3.904   1.821   1.00 0.00 ? 38  ARG A HA   4  
ATOM 5955  H HB2  . ARG A 1 38  ? 1.331   6.197   3.178   1.00 0.00 ? 38  ARG A HB2  4  
ATOM 5956  H HB3  . ARG A 1 38  ? 1.666   5.904   1.476   1.00 0.00 ? 38  ARG A HB3  4  
ATOM 5957  H HG2  . ARG A 1 38  ? -0.945  5.839   1.288   1.00 0.00 ? 38  ARG A HG2  4  
ATOM 5958  H HG3  . ARG A 1 38  ? -0.861  6.758   2.793   1.00 0.00 ? 38  ARG A HG3  4  
ATOM 5959  H HD2  . ARG A 1 38  ? 0.585   7.498   0.253   1.00 0.00 ? 38  ARG A HD2  4  
ATOM 5960  H HD3  . ARG A 1 38  ? -0.967  8.172   0.749   1.00 0.00 ? 38  ARG A HD3  4  
ATOM 5961  H HE   . ARG A 1 38  ? 1.071   8.459   2.743   1.00 0.00 ? 38  ARG A HE   4  
ATOM 5962  H HH11 . ARG A 1 38  ? -0.277  9.830   -0.159  1.00 0.00 ? 38  ARG A HH11 4  
ATOM 5963  H HH12 . ARG A 1 38  ? 0.288   11.433  0.179   1.00 0.00 ? 38  ARG A HH12 4  
ATOM 5964  H HH21 . ARG A 1 38  ? 1.820   10.565  3.200   1.00 0.00 ? 38  ARG A HH21 4  
ATOM 5965  H HH22 . ARG A 1 38  ? 1.481   11.849  2.090   1.00 0.00 ? 38  ARG A HH22 4  
ATOM 5966  N N    . CYS A 1 39  ? 2.156   2.291   2.684   1.00 0.00 ? 39  CYS A N    4  
ATOM 5967  C CA   . CYS A 1 39  ? 3.345   1.476   2.462   1.00 0.00 ? 39  CYS A CA   4  
ATOM 5968  C C    . CYS A 1 39  ? 3.080   0.018   2.825   1.00 0.00 ? 39  CYS A C    4  
ATOM 5969  O O    . CYS A 1 39  ? 2.017   -0.319  3.348   1.00 0.00 ? 39  CYS A O    4  
ATOM 5970  C CB   . CYS A 1 39  ? 4.518   2.013   3.282   1.00 0.00 ? 39  CYS A CB   4  
ATOM 5971  S SG   . CYS A 1 39  ? 5.519   3.247   2.418   1.00 0.00 ? 39  CYS A SG   4  
ATOM 5972  H H    . CYS A 1 39  ? 1.422   1.928   3.222   1.00 0.00 ? 39  CYS A H    4  
ATOM 5973  H HA   . CYS A 1 39  ? 3.593   1.533   1.413   1.00 0.00 ? 39  CYS A HA   4  
ATOM 5974  H HB2  . CYS A 1 39  ? 4.138   2.472   4.183   1.00 0.00 ? 39  CYS A HB2  4  
ATOM 5975  H HB3  . CYS A 1 39  ? 5.166   1.192   3.550   1.00 0.00 ? 39  CYS A HB3  4  
ATOM 5976  H HG   . CYS A 1 39  ? 6.699   2.707   2.157   1.00 0.00 ? 39  CYS A HG   4  
ATOM 5977  N N    . LEU A 1 40  ? 4.052   -0.842  2.544   1.00 0.00 ? 40  LEU A N    4  
ATOM 5978  C CA   . LEU A 1 40  ? 3.923   -2.265  2.840   1.00 0.00 ? 40  LEU A CA   4  
ATOM 5979  C C    . LEU A 1 40  ? 5.290   -2.894  3.093   1.00 0.00 ? 40  LEU A C    4  
ATOM 5980  O O    . LEU A 1 40  ? 6.108   -3.014  2.182   1.00 0.00 ? 40  LEU A O    4  
ATOM 5981  C CB   . LEU A 1 40  ? 3.224   -2.985  1.686   1.00 0.00 ? 40  LEU A CB   4  
ATOM 5982  C CG   . LEU A 1 40  ? 3.283   -4.513  1.713   1.00 0.00 ? 40  LEU A CG   4  
ATOM 5983  C CD1  . LEU A 1 40  ? 2.567   -5.053  2.941   1.00 0.00 ? 40  LEU A CD1  4  
ATOM 5984  C CD2  . LEU A 1 40  ? 2.679   -5.093  0.443   1.00 0.00 ? 40  LEU A CD2  4  
ATOM 5985  H H    . LEU A 1 40  ? 4.875   -0.514  2.127   1.00 0.00 ? 40  LEU A H    4  
ATOM 5986  H HA   . LEU A 1 40  ? 3.323   -2.365  3.732   1.00 0.00 ? 40  LEU A HA   4  
ATOM 5987  H HB2  . LEU A 1 40  ? 2.185   -2.694  1.696   1.00 0.00 ? 40  LEU A HB2  4  
ATOM 5988  H HB3  . LEU A 1 40  ? 3.680   -2.652  0.764   1.00 0.00 ? 40  LEU A HB3  4  
ATOM 5989  H HG   . LEU A 1 40  ? 4.317   -4.826  1.766   1.00 0.00 ? 40  LEU A HG   4  
ATOM 5990  H HD11 . LEU A 1 40  ? 1.548   -4.697  2.949   1.00 0.00 ? 40  LEU A HD11 4  
ATOM 5991  H HD12 . LEU A 1 40  ? 3.074   -4.712  3.832   1.00 0.00 ? 40  LEU A HD12 4  
ATOM 5992  H HD13 . LEU A 1 40  ? 2.572   -6.132  2.915   1.00 0.00 ? 40  LEU A HD13 4  
ATOM 5993  H HD21 . LEU A 1 40  ? 2.318   -4.290  -0.183  1.00 0.00 ? 40  LEU A HD21 4  
ATOM 5994  H HD22 . LEU A 1 40  ? 1.857   -5.745  0.701   1.00 0.00 ? 40  LEU A HD22 4  
ATOM 5995  H HD23 . LEU A 1 40  ? 3.431   -5.655  -0.090  1.00 0.00 ? 40  LEU A HD23 4  
ATOM 5996  N N    . PHE A 1 41  ? 5.529   -3.296  4.337   1.00 0.00 ? 41  PHE A N    4  
ATOM 5997  C CA   . PHE A 1 41  ? 6.795   -3.914  4.711   1.00 0.00 ? 41  PHE A CA   4  
ATOM 5998  C C    . PHE A 1 41  ? 6.674   -5.435  4.728   1.00 0.00 ? 41  PHE A C    4  
ATOM 5999  O O    . PHE A 1 41  ? 5.586   -5.980  4.915   1.00 0.00 ? 41  PHE A O    4  
ATOM 6000  C CB   . PHE A 1 41  ? 7.247   -3.412  6.084   1.00 0.00 ? 41  PHE A CB   4  
ATOM 6001  C CG   . PHE A 1 41  ? 7.650   -1.965  6.090   1.00 0.00 ? 41  PHE A CG   4  
ATOM 6002  C CD1  . PHE A 1 41  ? 8.882   -1.573  5.591   1.00 0.00 ? 41  PHE A CD1  4  
ATOM 6003  C CD2  . PHE A 1 41  ? 6.796   -0.997  6.593   1.00 0.00 ? 41  PHE A CD2  4  
ATOM 6004  C CE1  . PHE A 1 41  ? 9.255   -0.242  5.597   1.00 0.00 ? 41  PHE A CE1  4  
ATOM 6005  C CE2  . PHE A 1 41  ? 7.164   0.336   6.601   1.00 0.00 ? 41  PHE A CE2  4  
ATOM 6006  C CZ   . PHE A 1 41  ? 8.395   0.713   6.101   1.00 0.00 ? 41  PHE A CZ   4  
ATOM 6007  H H    . PHE A 1 41  ? 4.836   -3.173  5.021   1.00 0.00 ? 41  PHE A H    4  
ATOM 6008  H HA   . PHE A 1 41  ? 7.531   -3.632  3.974   1.00 0.00 ? 41  PHE A HA   4  
ATOM 6009  H HB2  . PHE A 1 41  ? 6.438   -3.533  6.788   1.00 0.00 ? 41  PHE A HB2  4  
ATOM 6010  H HB3  . PHE A 1 41  ? 8.094   -3.995  6.411   1.00 0.00 ? 41  PHE A HB3  4  
ATOM 6011  H HD1  . PHE A 1 41  ? 9.556   -2.319  5.196   1.00 0.00 ? 41  PHE A HD1  4  
ATOM 6012  H HD2  . PHE A 1 41  ? 5.833   -1.291  6.985   1.00 0.00 ? 41  PHE A HD2  4  
ATOM 6013  H HE1  . PHE A 1 41  ? 10.218  0.050   5.205   1.00 0.00 ? 41  PHE A HE1  4  
ATOM 6014  H HE2  . PHE A 1 41  ? 6.489   1.080   6.996   1.00 0.00 ? 41  PHE A HE2  4  
ATOM 6015  H HZ   . PHE A 1 41  ? 8.684   1.754   6.106   1.00 0.00 ? 41  PHE A HZ   4  
ATOM 6016  N N    . TYR A 1 42  ? 7.799   -6.114  4.530   1.00 0.00 ? 42  TYR A N    4  
ATOM 6017  C CA   . TYR A 1 42  ? 7.819   -7.572  4.520   1.00 0.00 ? 42  TYR A CA   4  
ATOM 6018  C C    . TYR A 1 42  ? 9.069   -8.105  5.214   1.00 0.00 ? 42  TYR A C    4  
ATOM 6019  O O    . TYR A 1 42  ? 10.143  -7.509  5.127   1.00 0.00 ? 42  TYR A O    4  
ATOM 6020  C CB   . TYR A 1 42  ? 7.759   -8.094  3.083   1.00 0.00 ? 42  TYR A CB   4  
ATOM 6021  C CG   . TYR A 1 42  ? 9.023   -7.840  2.294   1.00 0.00 ? 42  TYR A CG   4  
ATOM 6022  C CD1  . TYR A 1 42  ? 10.097  -8.719  2.362   1.00 0.00 ? 42  TYR A CD1  4  
ATOM 6023  C CD2  . TYR A 1 42  ? 9.144   -6.721  1.479   1.00 0.00 ? 42  TYR A CD2  4  
ATOM 6024  C CE1  . TYR A 1 42  ? 11.254  -8.490  1.643   1.00 0.00 ? 42  TYR A CE1  4  
ATOM 6025  C CE2  . TYR A 1 42  ? 10.296  -6.485  0.755   1.00 0.00 ? 42  TYR A CE2  4  
ATOM 6026  C CZ   . TYR A 1 42  ? 11.349  -7.372  0.841   1.00 0.00 ? 42  TYR A CZ   4  
ATOM 6027  O OH   . TYR A 1 42  ? 12.499  -7.141  0.122   1.00 0.00 ? 42  TYR A OH   4  
ATOM 6028  H H    . TYR A 1 42  ? 8.635   -5.624  4.387   1.00 0.00 ? 42  TYR A H    4  
ATOM 6029  H HA   . TYR A 1 42  ? 6.948   -7.920  5.055   1.00 0.00 ? 42  TYR A HA   4  
ATOM 6030  H HB2  . TYR A 1 42  ? 7.588   -9.159  3.101   1.00 0.00 ? 42  TYR A HB2  4  
ATOM 6031  H HB3  . TYR A 1 42  ? 6.942   -7.612  2.566   1.00 0.00 ? 42  TYR A HB3  4  
ATOM 6032  H HD1  . TYR A 1 42  ? 10.019  -9.594  2.991   1.00 0.00 ? 42  TYR A HD1  4  
ATOM 6033  H HD2  . TYR A 1 42  ? 8.317   -6.027  1.414   1.00 0.00 ? 42  TYR A HD2  4  
ATOM 6034  H HE1  . TYR A 1 42  ? 12.078  -9.185  1.709   1.00 0.00 ? 42  TYR A HE1  4  
ATOM 6035  H HE2  . TYR A 1 42  ? 10.371  -5.609  0.127   1.00 0.00 ? 42  TYR A HE2  4  
ATOM 6036  H HH   . TYR A 1 42  ? 13.212  -7.678  0.477   1.00 0.00 ? 42  TYR A HH   4  
ATOM 6037  N N    . TYR A 1 43  ? 8.920   -9.231  5.903   1.00 0.00 ? 43  TYR A N    4  
ATOM 6038  C CA   . TYR A 1 43  ? 10.035  -9.844  6.615   1.00 0.00 ? 43  TYR A CA   4  
ATOM 6039  C C    . TYR A 1 43  ? 10.141  -11.330 6.285   1.00 0.00 ? 43  TYR A C    4  
ATOM 6040  O O    . TYR A 1 43  ? 9.186   -11.942 5.807   1.00 0.00 ? 43  TYR A O    4  
ATOM 6041  C CB   . TYR A 1 43  ? 9.870   -9.656  8.124   1.00 0.00 ? 43  TYR A CB   4  
ATOM 6042  C CG   . TYR A 1 43  ? 9.377   -8.280  8.512   1.00 0.00 ? 43  TYR A CG   4  
ATOM 6043  C CD1  . TYR A 1 43  ? 8.102   -7.853  8.162   1.00 0.00 ? 43  TYR A CD1  4  
ATOM 6044  C CD2  . TYR A 1 43  ? 10.187  -7.408  9.230   1.00 0.00 ? 43  TYR A CD2  4  
ATOM 6045  C CE1  . TYR A 1 43  ? 7.649   -6.596  8.514   1.00 0.00 ? 43  TYR A CE1  4  
ATOM 6046  C CE2  . TYR A 1 43  ? 9.741   -6.150  9.587   1.00 0.00 ? 43  TYR A CE2  4  
ATOM 6047  C CZ   . TYR A 1 43  ? 8.471   -5.749  9.227   1.00 0.00 ? 43  TYR A CZ   4  
ATOM 6048  O OH   . TYR A 1 43  ? 8.022   -4.497  9.581   1.00 0.00 ? 43  TYR A OH   4  
ATOM 6049  H H    . TYR A 1 43  ? 8.039   -9.659  5.936   1.00 0.00 ? 43  TYR A H    4  
ATOM 6050  H HA   . TYR A 1 43  ? 10.943  -9.351  6.298   1.00 0.00 ? 43  TYR A HA   4  
ATOM 6051  H HB2  . TYR A 1 43  ? 9.160   -10.378 8.494   1.00 0.00 ? 43  TYR A HB2  4  
ATOM 6052  H HB3  . TYR A 1 43  ? 10.823  -9.815  8.606   1.00 0.00 ? 43  TYR A HB3  4  
ATOM 6053  H HD1  . TYR A 1 43  ? 7.461   -8.519  7.604   1.00 0.00 ? 43  TYR A HD1  4  
ATOM 6054  H HD2  . TYR A 1 43  ? 11.181  -7.725  9.511   1.00 0.00 ? 43  TYR A HD2  4  
ATOM 6055  H HE1  . TYR A 1 43  ? 6.655   -6.282  8.233   1.00 0.00 ? 43  TYR A HE1  4  
ATOM 6056  H HE2  . TYR A 1 43  ? 10.384  -5.486  10.145  1.00 0.00 ? 43  TYR A HE2  4  
ATOM 6057  H HH   . TYR A 1 43  ? 7.340   -4.580  10.251  1.00 0.00 ? 43  TYR A HH   4  
ATOM 6058  N N    . LYS A 1 44  ? 11.310  -11.905 6.545   1.00 0.00 ? 44  LYS A N    4  
ATOM 6059  C CA   . LYS A 1 44  ? 11.544  -13.319 6.279   1.00 0.00 ? 44  LYS A CA   4  
ATOM 6060  C C    . LYS A 1 44  ? 10.467  -14.181 6.931   1.00 0.00 ? 44  LYS A C    4  
ATOM 6061  O O    . LYS A 1 44  ? 9.990   -15.149 6.338   1.00 0.00 ? 44  LYS A O    4  
ATOM 6062  C CB   . LYS A 1 44  ? 12.924  -13.735 6.792   1.00 0.00 ? 44  LYS A CB   4  
ATOM 6063  C CG   . LYS A 1 44  ? 13.524  -14.911 6.040   1.00 0.00 ? 44  LYS A CG   4  
ATOM 6064  C CD   . LYS A 1 44  ? 15.041  -14.903 6.111   1.00 0.00 ? 44  LYS A CD   4  
ATOM 6065  C CE   . LYS A 1 44  ? 15.643  -13.974 5.068   1.00 0.00 ? 44  LYS A CE   4  
ATOM 6066  N NZ   . LYS A 1 44  ? 17.094  -13.736 5.307   1.00 0.00 ? 44  LYS A NZ   4  
ATOM 6067  H H    . LYS A 1 44  ? 12.034  -11.365 6.926   1.00 0.00 ? 44  LYS A H    4  
ATOM 6068  H HA   . LYS A 1 44  ? 11.507  -13.466 5.210   1.00 0.00 ? 44  LYS A HA   4  
ATOM 6069  H HB2  . LYS A 1 44  ? 13.597  -12.895 6.700   1.00 0.00 ? 44  LYS A HB2  4  
ATOM 6070  H HB3  . LYS A 1 44  ? 12.841  -14.006 7.834   1.00 0.00 ? 44  LYS A HB3  4  
ATOM 6071  H HG2  . LYS A 1 44  ? 13.159  -15.829 6.476   1.00 0.00 ? 44  LYS A HG2  4  
ATOM 6072  H HG3  . LYS A 1 44  ? 13.220  -14.856 5.004   1.00 0.00 ? 44  LYS A HG3  4  
ATOM 6073  H HD2  . LYS A 1 44  ? 15.346  -14.569 7.092   1.00 0.00 ? 44  LYS A HD2  4  
ATOM 6074  H HD3  . LYS A 1 44  ? 15.406  -15.906 5.941   1.00 0.00 ? 44  LYS A HD3  4  
ATOM 6075  H HE2  . LYS A 1 44  ? 15.516  -14.419 4.093   1.00 0.00 ? 44  LYS A HE2  4  
ATOM 6076  H HE3  . LYS A 1 44  ? 15.122  -13.029 5.103   1.00 0.00 ? 44  LYS A HE3  4  
ATOM 6077  H HZ1  . LYS A 1 44  ? 17.650  -14.083 4.500   1.00 0.00 ? 44  LYS A HZ1  4  
ATOM 6078  H HZ2  . LYS A 1 44  ? 17.401  -14.237 6.165   1.00 0.00 ? 44  LYS A HZ2  4  
ATOM 6079  H HZ3  . LYS A 1 44  ? 17.274  -12.720 5.428   1.00 0.00 ? 44  LYS A HZ3  4  
ATOM 6080  N N    . ASP A 1 45  ? 10.087  -13.821 8.152   1.00 0.00 ? 45  ASP A N    4  
ATOM 6081  C CA   . ASP A 1 45  ? 9.064   -14.560 8.883   1.00 0.00 ? 45  ASP A CA   4  
ATOM 6082  C C    . ASP A 1 45  ? 8.399   -13.673 9.932   1.00 0.00 ? 45  ASP A C    4  
ATOM 6083  O O    . ASP A 1 45  ? 8.714   -12.490 10.047  1.00 0.00 ? 45  ASP A O    4  
ATOM 6084  C CB   . ASP A 1 45  ? 9.675   -15.792 9.552   1.00 0.00 ? 45  ASP A CB   4  
ATOM 6085  C CG   . ASP A 1 45  ? 10.720  -15.430 10.589  1.00 0.00 ? 45  ASP A CG   4  
ATOM 6086  O OD1  . ASP A 1 45  ? 11.746  -14.825 10.211  1.00 0.00 ? 45  ASP A OD1  4  
ATOM 6087  O OD2  . ASP A 1 45  ? 10.512  -15.750 11.777  1.00 0.00 ? 45  ASP A OD2  4  
ATOM 6088  H H    . ASP A 1 45  ? 10.504  -13.039 8.571   1.00 0.00 ? 45  ASP A H    4  
ATOM 6089  H HA   . ASP A 1 45  ? 8.316   -14.880 8.174   1.00 0.00 ? 45  ASP A HA   4  
ATOM 6090  H HB2  . ASP A 1 45  ? 8.892   -16.355 10.039  1.00 0.00 ? 45  ASP A HB2  4  
ATOM 6091  H HB3  . ASP A 1 45  ? 10.140  -16.409 8.798   1.00 0.00 ? 45  ASP A HB3  4  
ATOM 6092  N N    . GLU A 1 46  ? 7.477   -14.255 10.693  1.00 0.00 ? 46  GLU A N    4  
ATOM 6093  C CA   . GLU A 1 46  ? 6.767   -13.517 11.730  1.00 0.00 ? 46  GLU A CA   4  
ATOM 6094  C C    . GLU A 1 46  ? 7.747   -12.814 12.665  1.00 0.00 ? 46  GLU A C    4  
ATOM 6095  O O    . GLU A 1 46  ? 7.516   -11.681 13.089  1.00 0.00 ? 46  GLU A O    4  
ATOM 6096  C CB   . GLU A 1 46  ? 5.866   -14.459 12.532  1.00 0.00 ? 46  GLU A CB   4  
ATOM 6097  C CG   . GLU A 1 46  ? 6.587   -15.687 13.062  1.00 0.00 ? 46  GLU A CG   4  
ATOM 6098  C CD   . GLU A 1 46  ? 7.227   -15.448 14.416  1.00 0.00 ? 46  GLU A CD   4  
ATOM 6099  O OE1  . GLU A 1 46  ? 6.952   -14.394 15.025  1.00 0.00 ? 46  GLU A OE1  4  
ATOM 6100  O OE2  . GLU A 1 46  ? 8.003   -16.317 14.866  1.00 0.00 ? 46  GLU A OE2  4  
ATOM 6101  H H    . GLU A 1 46  ? 7.270   -15.203 10.553  1.00 0.00 ? 46  GLU A H    4  
ATOM 6102  H HA   . GLU A 1 46  ? 6.153   -12.772 11.246  1.00 0.00 ? 46  GLU A HA   4  
ATOM 6103  H HB2  . GLU A 1 46  ? 5.455   -13.917 13.371  1.00 0.00 ? 46  GLU A HB2  4  
ATOM 6104  H HB3  . GLU A 1 46  ? 5.057   -14.789 11.897  1.00 0.00 ? 46  GLU A HB3  4  
ATOM 6105  H HG2  . GLU A 1 46  ? 5.877   -16.494 13.154  1.00 0.00 ? 46  GLU A HG2  4  
ATOM 6106  H HG3  . GLU A 1 46  ? 7.359   -15.966 12.359  1.00 0.00 ? 46  GLU A HG3  4  
ATOM 6107  N N    . LYS A 1 47  ? 8.842   -13.495 12.985  1.00 0.00 ? 47  LYS A N    4  
ATOM 6108  C CA   . LYS A 1 47  ? 9.859   -12.938 13.869  1.00 0.00 ? 47  LYS A CA   4  
ATOM 6109  C C    . LYS A 1 47  ? 10.138  -11.478 13.527  1.00 0.00 ? 47  LYS A C    4  
ATOM 6110  O O    . LYS A 1 47  ? 10.528  -10.693 14.390  1.00 0.00 ? 47  LYS A O    4  
ATOM 6111  C CB   . LYS A 1 47  ? 11.151  -13.752 13.771  1.00 0.00 ? 47  LYS A CB   4  
ATOM 6112  C CG   . LYS A 1 47  ? 11.019  -15.170 14.299  1.00 0.00 ? 47  LYS A CG   4  
ATOM 6113  C CD   . LYS A 1 47  ? 11.200  -15.222 15.807  1.00 0.00 ? 47  LYS A CD   4  
ATOM 6114  C CE   . LYS A 1 47  ? 12.669  -15.155 16.194  1.00 0.00 ? 47  LYS A CE   4  
ATOM 6115  N NZ   . LYS A 1 47  ? 13.379  -16.431 15.900  1.00 0.00 ? 47  LYS A NZ   4  
ATOM 6116  H H    . LYS A 1 47  ? 8.970   -14.394 12.616  1.00 0.00 ? 47  LYS A H    4  
ATOM 6117  H HA   . LYS A 1 47  ? 9.485   -12.993 14.881  1.00 0.00 ? 47  LYS A HA   4  
ATOM 6118  H HB2  . LYS A 1 47  ? 11.452  -13.803 12.735  1.00 0.00 ? 47  LYS A HB2  4  
ATOM 6119  H HB3  . LYS A 1 47  ? 11.922  -13.250 14.337  1.00 0.00 ? 47  LYS A HB3  4  
ATOM 6120  H HG2  . LYS A 1 47  ? 10.037  -15.546 14.053  1.00 0.00 ? 47  LYS A HG2  4  
ATOM 6121  H HG3  . LYS A 1 47  ? 11.771  -15.790 13.833  1.00 0.00 ? 47  LYS A HG3  4  
ATOM 6122  H HD2  . LYS A 1 47  ? 10.683  -14.385 16.253  1.00 0.00 ? 47  LYS A HD2  4  
ATOM 6123  H HD3  . LYS A 1 47  ? 10.780  -16.146 16.179  1.00 0.00 ? 47  LYS A HD3  4  
ATOM 6124  H HE2  . LYS A 1 47  ? 13.138  -14.356 15.641  1.00 0.00 ? 47  LYS A HE2  4  
ATOM 6125  H HE3  . LYS A 1 47  ? 12.740  -14.949 17.252  1.00 0.00 ? 47  LYS A HE3  4  
ATOM 6126  H HZ1  . LYS A 1 47  ? 13.370  -16.617 14.877  1.00 0.00 ? 47  LYS A HZ1  4  
ATOM 6127  H HZ2  . LYS A 1 47  ? 12.912  -17.221 16.389  1.00 0.00 ? 47  LYS A HZ2  4  
ATOM 6128  H HZ3  . LYS A 1 47  ? 14.366  -16.373 16.222  1.00 0.00 ? 47  LYS A HZ3  4  
ATOM 6129  N N    . GLU A 1 48  ? 9.934   -11.122 12.262  1.00 0.00 ? 48  GLU A N    4  
ATOM 6130  C CA   . GLU A 1 48  ? 10.163  -9.756  11.807  1.00 0.00 ? 48  GLU A CA   4  
ATOM 6131  C C    . GLU A 1 48  ? 11.345  -9.130  12.541  1.00 0.00 ? 48  GLU A C    4  
ATOM 6132  O O    . GLU A 1 48  ? 11.259  -8.003  13.028  1.00 0.00 ? 48  GLU A O    4  
ATOM 6133  C CB   . GLU A 1 48  ? 8.908   -8.907  12.019  1.00 0.00 ? 48  GLU A CB   4  
ATOM 6134  C CG   . GLU A 1 48  ? 8.499   -8.779  13.477  1.00 0.00 ? 48  GLU A CG   4  
ATOM 6135  C CD   . GLU A 1 48  ? 7.107   -8.203  13.643  1.00 0.00 ? 48  GLU A CD   4  
ATOM 6136  O OE1  . GLU A 1 48  ? 6.208   -8.585  12.865  1.00 0.00 ? 48  GLU A OE1  4  
ATOM 6137  O OE2  . GLU A 1 48  ? 6.915   -7.369  14.553  1.00 0.00 ? 48  GLU A OE2  4  
ATOM 6138  H H    . GLU A 1 48  ? 9.622   -11.794 11.620  1.00 0.00 ? 48  GLU A H    4  
ATOM 6139  H HA   . GLU A 1 48  ? 10.388  -9.792  10.752  1.00 0.00 ? 48  GLU A HA   4  
ATOM 6140  H HB2  . GLU A 1 48  ? 9.089   -7.916  11.629  1.00 0.00 ? 48  GLU A HB2  4  
ATOM 6141  H HB3  . GLU A 1 48  ? 8.090   -9.355  11.475  1.00 0.00 ? 48  GLU A HB3  4  
ATOM 6142  H HG2  . GLU A 1 48  ? 8.523   -9.758  13.931  1.00 0.00 ? 48  GLU A HG2  4  
ATOM 6143  H HG3  . GLU A 1 48  ? 9.203   -8.133  13.980  1.00 0.00 ? 48  GLU A HG3  4  
ATOM 6144  N N    . GLU A 1 49  ? 12.447  -9.869  12.616  1.00 0.00 ? 49  GLU A N    4  
ATOM 6145  C CA   . GLU A 1 49  ? 13.646  -9.386  13.293  1.00 0.00 ? 49  GLU A CA   4  
ATOM 6146  C C    . GLU A 1 49  ? 14.102  -8.054  12.705  1.00 0.00 ? 49  GLU A C    4  
ATOM 6147  O O    . GLU A 1 49  ? 14.320  -7.085  13.433  1.00 0.00 ? 49  GLU A O    4  
ATOM 6148  C CB   . GLU A 1 49  ? 14.771  -10.417 13.181  1.00 0.00 ? 49  GLU A CB   4  
ATOM 6149  C CG   . GLU A 1 49  ? 14.414  -11.774 13.765  1.00 0.00 ? 49  GLU A CG   4  
ATOM 6150  C CD   . GLU A 1 49  ? 13.781  -12.700 12.745  1.00 0.00 ? 49  GLU A CD   4  
ATOM 6151  O OE1  . GLU A 1 49  ? 13.390  -12.212 11.664  1.00 0.00 ? 49  GLU A OE1  4  
ATOM 6152  O OE2  . GLU A 1 49  ? 13.678  -13.912 13.026  1.00 0.00 ? 49  GLU A OE2  4  
ATOM 6153  H H    . GLU A 1 49  ? 12.454  -10.760 12.208  1.00 0.00 ? 49  GLU A H    4  
ATOM 6154  H HA   . GLU A 1 49  ? 13.404  -9.243  14.335  1.00 0.00 ? 49  GLU A HA   4  
ATOM 6155  H HB2  . GLU A 1 49  ? 15.019  -10.550 12.139  1.00 0.00 ? 49  GLU A HB2  4  
ATOM 6156  H HB3  . GLU A 1 49  ? 15.639  -10.041 13.703  1.00 0.00 ? 49  GLU A HB3  4  
ATOM 6157  H HG2  . GLU A 1 49  ? 15.313  -12.238 14.141  1.00 0.00 ? 49  GLU A HG2  4  
ATOM 6158  H HG3  . GLU A 1 49  ? 13.718  -11.629 14.579  1.00 0.00 ? 49  GLU A HG3  4  
ATOM 6159  N N    . SER A 1 50  ? 14.244  -8.013  11.385  1.00 0.00 ? 50  SER A N    4  
ATOM 6160  C CA   . SER A 1 50  ? 14.679  -6.802  10.699  1.00 0.00 ? 50  SER A CA   4  
ATOM 6161  C C    . SER A 1 50  ? 14.059  -6.713  9.308   1.00 0.00 ? 50  SER A C    4  
ATOM 6162  O O    . SER A 1 50  ? 13.982  -7.707  8.586   1.00 0.00 ? 50  SER A O    4  
ATOM 6163  C CB   . SER A 1 50  ? 16.205  -6.770  10.593  1.00 0.00 ? 50  SER A CB   4  
ATOM 6164  O OG   . SER A 1 50  ? 16.667  -7.678  9.609   1.00 0.00 ? 50  SER A OG   4  
ATOM 6165  H H    . SER A 1 50  ? 14.055  -8.819  10.859  1.00 0.00 ? 50  SER A H    4  
ATOM 6166  H HA   . SER A 1 50  ? 14.349  -5.955  11.282  1.00 0.00 ? 50  SER A HA   4  
ATOM 6167  H HB2  . SER A 1 50  ? 16.524  -5.774  10.325  1.00 0.00 ? 50  SER A HB2  4  
ATOM 6168  H HB3  . SER A 1 50  ? 16.635  -7.041  11.547  1.00 0.00 ? 50  SER A HB3  4  
ATOM 6169  H HG   . SER A 1 50  ? 16.618  -7.265  8.743   1.00 0.00 ? 50  SER A HG   4  
ATOM 6170  N N    . ILE A 1 51  ? 13.619  -5.514  8.939   1.00 0.00 ? 51  ILE A N    4  
ATOM 6171  C CA   . ILE A 1 51  ? 13.007  -5.294  7.634   1.00 0.00 ? 51  ILE A CA   4  
ATOM 6172  C C    . ILE A 1 51  ? 14.019  -5.497  6.511   1.00 0.00 ? 51  ILE A C    4  
ATOM 6173  O O    . ILE A 1 51  ? 15.109  -4.924  6.532   1.00 0.00 ? 51  ILE A O    4  
ATOM 6174  C CB   . ILE A 1 51  ? 12.411  -3.879  7.524   1.00 0.00 ? 51  ILE A CB   4  
ATOM 6175  C CG1  . ILE A 1 51  ? 11.335  -3.670  8.591   1.00 0.00 ? 51  ILE A CG1  4  
ATOM 6176  C CG2  . ILE A 1 51  ? 11.836  -3.653  6.133   1.00 0.00 ? 51  ILE A CG2  4  
ATOM 6177  C CD1  . ILE A 1 51  ? 10.920  -2.225  8.757   1.00 0.00 ? 51  ILE A CD1  4  
ATOM 6178  H H    . ILE A 1 51  ? 13.709  -4.761  9.558   1.00 0.00 ? 51  ILE A H    4  
ATOM 6179  H HA   . ILE A 1 51  ? 12.207  -6.011  7.517   1.00 0.00 ? 51  ILE A HA   4  
ATOM 6180  H HB   . ILE A 1 51  ? 13.205  -3.165  7.679   1.00 0.00 ? 51  ILE A HB   4  
ATOM 6181  H HG12 . ILE A 1 51  ? 10.457  -4.238  8.325   1.00 0.00 ? 51  ILE A HG12 4  
ATOM 6182  H HG13 . ILE A 1 51  ? 11.709  -4.020  9.542   1.00 0.00 ? 51  ILE A HG13 4  
ATOM 6183  H HG21 . ILE A 1 51  ? 10.890  -4.166  6.047   1.00 0.00 ? 51  ILE A HG21 4  
ATOM 6184  H HG22 . ILE A 1 51  ? 11.687  -2.596  5.973   1.00 0.00 ? 51  ILE A HG22 4  
ATOM 6185  H HG23 . ILE A 1 51  ? 12.522  -4.037  5.393   1.00 0.00 ? 51  ILE A HG23 4  
ATOM 6186  H HD11 . ILE A 1 51  ? 9.884   -2.113  8.473   1.00 0.00 ? 51  ILE A HD11 4  
ATOM 6187  H HD12 . ILE A 1 51  ? 11.046  -1.930  9.787   1.00 0.00 ? 51  ILE A HD12 4  
ATOM 6188  H HD13 . ILE A 1 51  ? 11.534  -1.600  8.126   1.00 0.00 ? 51  ILE A HD13 4  
ATOM 6189  N N    . LEU A 1 52  ? 13.650  -6.314  5.531   1.00 0.00 ? 52  LEU A N    4  
ATOM 6190  C CA   . LEU A 1 52  ? 14.525  -6.591  4.397   1.00 0.00 ? 52  LEU A CA   4  
ATOM 6191  C C    . LEU A 1 52  ? 14.231  -5.643  3.238   1.00 0.00 ? 52  LEU A C    4  
ATOM 6192  O O    . LEU A 1 52  ? 15.145  -5.145  2.583   1.00 0.00 ? 52  LEU A O    4  
ATOM 6193  C CB   . LEU A 1 52  ? 14.356  -8.041  3.940   1.00 0.00 ? 52  LEU A CB   4  
ATOM 6194  C CG   . LEU A 1 52  ? 14.652  -9.114  4.988   1.00 0.00 ? 52  LEU A CG   4  
ATOM 6195  C CD1  . LEU A 1 52  ? 13.823  -10.361 4.724   1.00 0.00 ? 52  LEU A CD1  4  
ATOM 6196  C CD2  . LEU A 1 52  ? 16.136  -9.450  5.003   1.00 0.00 ? 52  LEU A CD2  4  
ATOM 6197  H H    . LEU A 1 52  ? 12.770  -6.741  5.569   1.00 0.00 ? 52  LEU A H    4  
ATOM 6198  H HA   . LEU A 1 52  ? 15.544  -6.440  4.719   1.00 0.00 ? 52  LEU A HA   4  
ATOM 6199  H HB2  . LEU A 1 52  ? 13.335  -8.168  3.615   1.00 0.00 ? 52  LEU A HB2  4  
ATOM 6200  H HB3  . LEU A 1 52  ? 15.021  -8.202  3.103   1.00 0.00 ? 52  LEU A HB3  4  
ATOM 6201  H HG   . LEU A 1 52  ? 14.384  -8.736  5.966   1.00 0.00 ? 52  LEU A HG   4  
ATOM 6202  H HD11 . LEU A 1 52  ? 12.774  -10.114 4.780   1.00 0.00 ? 52  LEU A HD11 4  
ATOM 6203  H HD12 . LEU A 1 52  ? 14.056  -11.112 5.465   1.00 0.00 ? 52  LEU A HD12 4  
ATOM 6204  H HD13 . LEU A 1 52  ? 14.052  -10.743 3.740   1.00 0.00 ? 52  LEU A HD13 4  
ATOM 6205  H HD21 . LEU A 1 52  ? 16.640  -8.823  5.723   1.00 0.00 ? 52  LEU A HD21 4  
ATOM 6206  H HD22 . LEU A 1 52  ? 16.554  -9.278  4.021   1.00 0.00 ? 52  LEU A HD22 4  
ATOM 6207  H HD23 . LEU A 1 52  ? 16.267  -10.488 5.273   1.00 0.00 ? 52  LEU A HD23 4  
ATOM 6208  N N    . GLY A 1 53  ? 12.947  -5.397  2.992   1.00 0.00 ? 53  GLY A N    4  
ATOM 6209  C CA   . GLY A 1 53  ? 12.556  -4.508  1.914   1.00 0.00 ? 53  GLY A CA   4  
ATOM 6210  C C    . GLY A 1 53  ? 11.192  -3.887  2.142   1.00 0.00 ? 53  GLY A C    4  
ATOM 6211  O O    . GLY A 1 53  ? 10.361  -4.442  2.861   1.00 0.00 ? 53  GLY A O    4  
ATOM 6212  H H    . GLY A 1 53  ? 12.261  -5.823  3.547   1.00 0.00 ? 53  GLY A H    4  
ATOM 6213  H HA2  . GLY A 1 53  ? 13.289  -3.720  1.827   1.00 0.00 ? 53  GLY A HA2  4  
ATOM 6214  H HA3  . GLY A 1 53  ? 12.533  -5.069  0.991   1.00 0.00 ? 53  GLY A HA3  4  
ATOM 6215  N N    . SER A 1 54  ? 10.960  -2.730  1.528   1.00 0.00 ? 54  SER A N    4  
ATOM 6216  C CA   . SER A 1 54  ? 9.690   -2.030  1.672   1.00 0.00 ? 54  SER A CA   4  
ATOM 6217  C C    . SER A 1 54  ? 9.046   -1.787  0.310   1.00 0.00 ? 54  SER A C    4  
ATOM 6218  O O    . SER A 1 54  ? 9.729   -1.756  -0.714  1.00 0.00 ? 54  SER A O    4  
ATOM 6219  C CB   . SER A 1 54  ? 9.896   -0.698  2.396   1.00 0.00 ? 54  SER A CB   4  
ATOM 6220  O OG   . SER A 1 54  ? 8.760   0.138   2.261   1.00 0.00 ? 54  SER A OG   4  
ATOM 6221  H H    . SER A 1 54  ? 11.663  -2.338  0.968   1.00 0.00 ? 54  SER A H    4  
ATOM 6222  H HA   . SER A 1 54  ? 9.033   -2.652  2.262   1.00 0.00 ? 54  SER A HA   4  
ATOM 6223  H HB2  . SER A 1 54  ? 10.069  -0.884  3.445   1.00 0.00 ? 54  SER A HB2  4  
ATOM 6224  H HB3  . SER A 1 54  ? 10.753  -0.191  1.974   1.00 0.00 ? 54  SER A HB3  4  
ATOM 6225  H HG   . SER A 1 54  ? 8.333   0.238   3.115   1.00 0.00 ? 54  SER A HG   4  
ATOM 6226  N N    . ILE A 1 55  ? 7.728   -1.617  0.308   1.00 0.00 ? 55  ILE A N    4  
ATOM 6227  C CA   . ILE A 1 55  ? 6.992   -1.376  -0.927  1.00 0.00 ? 55  ILE A CA   4  
ATOM 6228  C C    . ILE A 1 55  ? 6.114   -0.135  -0.810  1.00 0.00 ? 55  ILE A C    4  
ATOM 6229  O O    . ILE A 1 55  ? 5.067   -0.143  -0.163  1.00 0.00 ? 55  ILE A O    4  
ATOM 6230  C CB   . ILE A 1 55  ? 6.110   -2.582  -1.301  1.00 0.00 ? 55  ILE A CB   4  
ATOM 6231  C CG1  . ILE A 1 55  ? 6.957   -3.853  -1.389  1.00 0.00 ? 55  ILE A CG1  4  
ATOM 6232  C CG2  . ILE A 1 55  ? 5.392   -2.325  -2.617  1.00 0.00 ? 55  ILE A CG2  4  
ATOM 6233  C CD1  . ILE A 1 55  ? 6.163   -5.124  -1.179  1.00 0.00 ? 55  ILE A CD1  4  
ATOM 6234  H H    . ILE A 1 55  ? 7.240   -1.653  1.156   1.00 0.00 ? 55  ILE A H    4  
ATOM 6235  H HA   . ILE A 1 55  ? 7.711   -1.222  -1.719  1.00 0.00 ? 55  ILE A HA   4  
ATOM 6236  H HB   . ILE A 1 55  ? 5.365   -2.707  -0.530  1.00 0.00 ? 55  ILE A HB   4  
ATOM 6237  H HG12 . ILE A 1 55  ? 7.415   -3.906  -2.363  1.00 0.00 ? 55  ILE A HG12 4  
ATOM 6238  H HG13 . ILE A 1 55  ? 7.729   -3.815  -0.634  1.00 0.00 ? 55  ILE A HG13 4  
ATOM 6239  H HG21 . ILE A 1 55  ? 5.501   -1.286  -2.890  1.00 0.00 ? 55  ILE A HG21 4  
ATOM 6240  H HG22 . ILE A 1 55  ? 5.823   -2.945  -3.389  1.00 0.00 ? 55  ILE A HG22 4  
ATOM 6241  H HG23 . ILE A 1 55  ? 4.344   -2.561  -2.508  1.00 0.00 ? 55  ILE A HG23 4  
ATOM 6242  H HD11 . ILE A 1 55  ? 6.786   -5.863  -0.699  1.00 0.00 ? 55  ILE A HD11 4  
ATOM 6243  H HD12 . ILE A 1 55  ? 5.306   -4.915  -0.556  1.00 0.00 ? 55  ILE A HD12 4  
ATOM 6244  H HD13 . ILE A 1 55  ? 5.829   -5.501  -2.135  1.00 0.00 ? 55  ILE A HD13 4  
ATOM 6245  N N    . PRO A 1 56  ? 6.548   0.960   -1.453  1.00 0.00 ? 56  PRO A N    4  
ATOM 6246  C CA   . PRO A 1 56  ? 5.815   2.229   -1.439  1.00 0.00 ? 56  PRO A CA   4  
ATOM 6247  C C    . PRO A 1 56  ? 4.516   2.157   -2.234  1.00 0.00 ? 56  PRO A C    4  
ATOM 6248  O O    . PRO A 1 56  ? 4.531   2.119   -3.465  1.00 0.00 ? 56  PRO A O    4  
ATOM 6249  C CB   . PRO A 1 56  ? 6.790   3.209   -2.095  1.00 0.00 ? 56  PRO A CB   4  
ATOM 6250  C CG   . PRO A 1 56  ? 7.659   2.359   -2.957  1.00 0.00 ? 56  PRO A CG   4  
ATOM 6251  C CD   . PRO A 1 56  ? 7.787   1.042   -2.244  1.00 0.00 ? 56  PRO A CD   4  
ATOM 6252  H HA   . PRO A 1 56  ? 5.601   2.552   -0.431  1.00 0.00 ? 56  PRO A HA   4  
ATOM 6253  H HB2  . PRO A 1 56  ? 6.239   3.933   -2.679  1.00 0.00 ? 56  PRO A HB2  4  
ATOM 6254  H HB3  . PRO A 1 56  ? 7.365   3.716   -1.334  1.00 0.00 ? 56  PRO A HB3  4  
ATOM 6255  H HG2  . PRO A 1 56  ? 7.195   2.220   -3.922  1.00 0.00 ? 56  PRO A HG2  4  
ATOM 6256  H HG3  . PRO A 1 56  ? 8.629   2.821   -3.068  1.00 0.00 ? 56  PRO A HG3  4  
ATOM 6257  H HD2  . PRO A 1 56  ? 7.845   0.232   -2.956  1.00 0.00 ? 56  PRO A HD2  4  
ATOM 6258  H HD3  . PRO A 1 56  ? 8.655   1.044   -1.601  1.00 0.00 ? 56  PRO A HD3  4  
ATOM 6259  N N    . LEU A 1 57  ? 3.393   2.140   -1.524  1.00 0.00 ? 57  LEU A N    4  
ATOM 6260  C CA   . LEU A 1 57  ? 2.084   2.073   -2.164  1.00 0.00 ? 57  LEU A CA   4  
ATOM 6261  C C    . LEU A 1 57  ? 1.437   3.453   -2.224  1.00 0.00 ? 57  LEU A C    4  
ATOM 6262  O O    . LEU A 1 57  ? 0.329   3.653   -1.723  1.00 0.00 ? 57  LEU A O    4  
ATOM 6263  C CB   . LEU A 1 57  ? 1.174   1.102   -1.409  1.00 0.00 ? 57  LEU A CB   4  
ATOM 6264  C CG   . LEU A 1 57  ? 1.582   -0.371  -1.452  1.00 0.00 ? 57  LEU A CG   4  
ATOM 6265  C CD1  . LEU A 1 57  ? 0.660   -1.205  -0.577  1.00 0.00 ? 57  LEU A CD1  4  
ATOM 6266  C CD2  . LEU A 1 57  ? 1.572   -0.886  -2.884  1.00 0.00 ? 57  LEU A CD2  4  
ATOM 6267  H H    . LEU A 1 57  ? 3.445   2.172   -0.546  1.00 0.00 ? 57  LEU A H    4  
ATOM 6268  H HA   . LEU A 1 57  ? 2.226   1.711   -3.172  1.00 0.00 ? 57  LEU A HA   4  
ATOM 6269  H HB2  . LEU A 1 57  ? 1.150   1.409   -0.375  1.00 0.00 ? 57  LEU A HB2  4  
ATOM 6270  H HB3  . LEU A 1 57  ? 0.182   1.185   -1.831  1.00 0.00 ? 57  LEU A HB3  4  
ATOM 6271  H HG   . LEU A 1 57  ? 2.587   -0.470  -1.066  1.00 0.00 ? 57  LEU A HG   4  
ATOM 6272  H HD11 . LEU A 1 57  ? 0.071   -0.553  0.050   1.00 0.00 ? 57  LEU A HD11 4  
ATOM 6273  H HD12 . LEU A 1 57  ? 1.250   -1.864  0.043   1.00 0.00 ? 57  LEU A HD12 4  
ATOM 6274  H HD13 . LEU A 1 57  ? 0.004   -1.793  -1.203  1.00 0.00 ? 57  LEU A HD13 4  
ATOM 6275  H HD21 . LEU A 1 57  ? 2.586   -1.066  -3.208  1.00 0.00 ? 57  LEU A HD21 4  
ATOM 6276  H HD22 . LEU A 1 57  ? 1.114   -0.149  -3.528  1.00 0.00 ? 57  LEU A HD22 4  
ATOM 6277  H HD23 . LEU A 1 57  ? 1.010   -1.806  -2.931  1.00 0.00 ? 57  LEU A HD23 4  
ATOM 6278  N N    . LEU A 1 58  ? 2.132   4.401   -2.842  1.00 0.00 ? 58  LEU A N    4  
ATOM 6279  C CA   . LEU A 1 58  ? 1.624   5.762   -2.970  1.00 0.00 ? 58  LEU A CA   4  
ATOM 6280  C C    . LEU A 1 58  ? 0.339   5.789   -3.791  1.00 0.00 ? 58  LEU A C    4  
ATOM 6281  O O    . LEU A 1 58  ? -0.740  6.059   -3.264  1.00 0.00 ? 58  LEU A O    4  
ATOM 6282  C CB   . LEU A 1 58  ? 2.677   6.661   -3.621  1.00 0.00 ? 58  LEU A CB   4  
ATOM 6283  C CG   . LEU A 1 58  ? 2.210   8.061   -4.022  1.00 0.00 ? 58  LEU A CG   4  
ATOM 6284  C CD1  . LEU A 1 58  ? 1.294   8.643   -2.956  1.00 0.00 ? 58  LEU A CD1  4  
ATOM 6285  C CD2  . LEU A 1 58  ? 3.403   8.975   -4.258  1.00 0.00 ? 58  LEU A CD2  4  
ATOM 6286  H H    . LEU A 1 58  ? 3.008   4.181   -3.222  1.00 0.00 ? 58  LEU A H    4  
ATOM 6287  H HA   . LEU A 1 58  ? 1.412   6.131   -1.978  1.00 0.00 ? 58  LEU A HA   4  
ATOM 6288  H HB2  . LEU A 1 58  ? 3.494   6.772   -2.924  1.00 0.00 ? 58  LEU A HB2  4  
ATOM 6289  H HB3  . LEU A 1 58  ? 3.032   6.162   -4.512  1.00 0.00 ? 58  LEU A HB3  4  
ATOM 6290  H HG   . LEU A 1 58  ? 1.649   7.996   -4.944  1.00 0.00 ? 58  LEU A HG   4  
ATOM 6291  H HD11 . LEU A 1 58  ? 1.788   8.607   -1.998  1.00 0.00 ? 58  LEU A HD11 4  
ATOM 6292  H HD12 . LEU A 1 58  ? 0.381   8.066   -2.912  1.00 0.00 ? 58  LEU A HD12 4  
ATOM 6293  H HD13 . LEU A 1 58  ? 1.059   9.668   -3.204  1.00 0.00 ? 58  LEU A HD13 4  
ATOM 6294  H HD21 . LEU A 1 58  ? 4.199   8.413   -4.725  1.00 0.00 ? 58  LEU A HD21 4  
ATOM 6295  H HD22 . LEU A 1 58  ? 3.748   9.368   -3.313  1.00 0.00 ? 58  LEU A HD22 4  
ATOM 6296  H HD23 . LEU A 1 58  ? 3.111   9.790   -4.903  1.00 0.00 ? 58  LEU A HD23 4  
ATOM 6297  N N    . SER A 1 59  ? 0.462   5.505   -5.084  1.00 0.00 ? 59  SER A N    4  
ATOM 6298  C CA   . SER A 1 59  ? -0.690  5.498   -5.978  1.00 0.00 ? 59  SER A CA   4  
ATOM 6299  C C    . SER A 1 59  ? -0.712  4.229   -6.825  1.00 0.00 ? 59  SER A C    4  
ATOM 6300  O O    . SER A 1 59  ? -1.168  4.240   -7.969  1.00 0.00 ? 59  SER A O    4  
ATOM 6301  C CB   . SER A 1 59  ? -0.666  6.730   -6.884  1.00 0.00 ? 59  SER A CB   4  
ATOM 6302  O OG   . SER A 1 59  ? 0.335   6.611   -7.880  1.00 0.00 ? 59  SER A OG   4  
ATOM 6303  H H    . SER A 1 59  ? 1.349   5.298   -5.445  1.00 0.00 ? 59  SER A H    4  
ATOM 6304  H HA   . SER A 1 59  ? -1.582  5.526   -5.370  1.00 0.00 ? 59  SER A HA   4  
ATOM 6305  H HB2  . SER A 1 59  ? -1.625  6.837   -7.367  1.00 0.00 ? 59  SER A HB2  4  
ATOM 6306  H HB3  . SER A 1 59  ? -0.462  7.608   -6.288  1.00 0.00 ? 59  SER A HB3  4  
ATOM 6307  H HG   . SER A 1 59  ? 0.985   7.309   -7.766  1.00 0.00 ? 59  SER A HG   4  
ATOM 6308  N N    . PHE A 1 60  ? -0.216  3.136   -6.255  1.00 0.00 ? 60  PHE A N    4  
ATOM 6309  C CA   . PHE A 1 60  ? -0.177  1.858   -6.957  1.00 0.00 ? 60  PHE A CA   4  
ATOM 6310  C C    . PHE A 1 60  ? -1.588  1.337   -7.217  1.00 0.00 ? 60  PHE A C    4  
ATOM 6311  O O    . PHE A 1 60  ? -2.540  1.730   -6.542  1.00 0.00 ? 60  PHE A O    4  
ATOM 6312  C CB   . PHE A 1 60  ? 0.617   0.831   -6.147  1.00 0.00 ? 60  PHE A CB   4  
ATOM 6313  C CG   . PHE A 1 60  ? 2.094   0.871   -6.412  1.00 0.00 ? 60  PHE A CG   4  
ATOM 6314  C CD1  . PHE A 1 60  ? 2.833   2.008   -6.122  1.00 0.00 ? 60  PHE A CD1  4  
ATOM 6315  C CD2  . PHE A 1 60  ? 2.745   -0.227  -6.951  1.00 0.00 ? 60  PHE A CD2  4  
ATOM 6316  C CE1  . PHE A 1 60  ? 4.193   2.048   -6.366  1.00 0.00 ? 60  PHE A CE1  4  
ATOM 6317  C CE2  . PHE A 1 60  ? 4.105   -0.193  -7.196  1.00 0.00 ? 60  PHE A CE2  4  
ATOM 6318  C CZ   . PHE A 1 60  ? 4.830   0.946   -6.903  1.00 0.00 ? 60  PHE A CZ   4  
ATOM 6319  H H    . PHE A 1 60  ? 0.133   3.190   -5.340  1.00 0.00 ? 60  PHE A H    4  
ATOM 6320  H HA   . PHE A 1 60  ? 0.315   2.016   -7.904  1.00 0.00 ? 60  PHE A HA   4  
ATOM 6321  H HB2  . PHE A 1 60  ? 0.464   1.017   -5.095  1.00 0.00 ? 60  PHE A HB2  4  
ATOM 6322  H HB3  . PHE A 1 60  ? 0.261   -0.159  -6.389  1.00 0.00 ? 60  PHE A HB3  4  
ATOM 6323  H HD1  . PHE A 1 60  ? 2.336   2.870   -5.702  1.00 0.00 ? 60  PHE A HD1  4  
ATOM 6324  H HD2  . PHE A 1 60  ? 2.179   -1.118  -7.180  1.00 0.00 ? 60  PHE A HD2  4  
ATOM 6325  H HE1  . PHE A 1 60  ? 4.757   2.939   -6.135  1.00 0.00 ? 60  PHE A HE1  4  
ATOM 6326  H HE2  . PHE A 1 60  ? 4.600   -1.056  -7.616  1.00 0.00 ? 60  PHE A HE2  4  
ATOM 6327  H HZ   . PHE A 1 60  ? 5.892   0.974   -7.094  1.00 0.00 ? 60  PHE A HZ   4  
ATOM 6328  N N    . ARG A 1 61  ? -1.713  0.451   -8.199  1.00 0.00 ? 61  ARG A N    4  
ATOM 6329  C CA   . ARG A 1 61  ? -3.007  -0.123  -8.550  1.00 0.00 ? 61  ARG A CA   4  
ATOM 6330  C C    . ARG A 1 61  ? -3.061  -1.604  -8.189  1.00 0.00 ? 61  ARG A C    4  
ATOM 6331  O O    . ARG A 1 61  ? -2.558  -2.452  -8.926  1.00 0.00 ? 61  ARG A O    4  
ATOM 6332  C CB   . ARG A 1 61  ? -3.281  0.059   -10.044 1.00 0.00 ? 61  ARG A CB   4  
ATOM 6333  C CG   . ARG A 1 61  ? -4.729  -0.191  -10.432 1.00 0.00 ? 61  ARG A CG   4  
ATOM 6334  C CD   . ARG A 1 61  ? -5.032  0.337   -11.825 1.00 0.00 ? 61  ARG A CD   4  
ATOM 6335  N NE   . ARG A 1 61  ? -4.234  -0.332  -12.850 1.00 0.00 ? 61  ARG A NE   4  
ATOM 6336  C CZ   . ARG A 1 61  ? -4.472  -0.226  -14.152 1.00 0.00 ? 61  ARG A CZ   4  
ATOM 6337  N NH1  . ARG A 1 61  ? -5.479  0.518   -14.587 1.00 0.00 ? 61  ARG A NH1  4  
ATOM 6338  N NH2  . ARG A 1 61  ? -3.701  -0.865  -15.023 1.00 0.00 ? 61  ARG A NH2  4  
ATOM 6339  H H    . ARG A 1 61  ? -0.917  0.177   -8.700  1.00 0.00 ? 61  ARG A H    4  
ATOM 6340  H HA   . ARG A 1 61  ? -3.766  0.400   -7.987  1.00 0.00 ? 61  ARG A HA   4  
ATOM 6341  H HB2  . ARG A 1 61  ? -3.027  1.071   -10.324 1.00 0.00 ? 61  ARG A HB2  4  
ATOM 6342  H HB3  . ARG A 1 61  ? -2.659  -0.627  -10.598 1.00 0.00 ? 61  ARG A HB3  4  
ATOM 6343  H HG2  . ARG A 1 61  ? -4.918  -1.255  -10.414 1.00 0.00 ? 61  ARG A HG2  4  
ATOM 6344  H HG3  . ARG A 1 61  ? -5.374  0.303   -9.721  1.00 0.00 ? 61  ARG A HG3  4  
ATOM 6345  H HD2  . ARG A 1 61  ? -6.079  0.177   -12.037 1.00 0.00 ? 61  ARG A HD2  4  
ATOM 6346  H HD3  . ARG A 1 61  ? -4.818  1.395   -11.849 1.00 0.00 ? 61  ARG A HD3  4  
ATOM 6347  H HE   . ARG A 1 61  ? -3.484  -0.887  -12.550 1.00 0.00 ? 61  ARG A HE   4  
ATOM 6348  H HH11 . ARG A 1 61  ? -6.061  1.002   -13.933 1.00 0.00 ? 61  ARG A HH11 4  
ATOM 6349  H HH12 . ARG A 1 61  ? -5.656  0.597   -15.568 1.00 0.00 ? 61  ARG A HH12 4  
ATOM 6350  H HH21 . ARG A 1 61  ? -2.940  -1.427  -14.699 1.00 0.00 ? 61  ARG A HH21 4  
ATOM 6351  H HH22 . ARG A 1 61  ? -3.881  -0.785  -16.003 1.00 0.00 ? 61  ARG A HH22 4  
ATOM 6352  N N    . VAL A 1 62  ? -3.673  -1.909  -7.049  1.00 0.00 ? 62  VAL A N    4  
ATOM 6353  C CA   . VAL A 1 62  ? -3.793  -3.287  -6.590  1.00 0.00 ? 62  VAL A CA   4  
ATOM 6354  C C    . VAL A 1 62  ? -5.120  -3.898  -7.025  1.00 0.00 ? 62  VAL A C    4  
ATOM 6355  O O    . VAL A 1 62  ? -6.184  -3.328  -6.789  1.00 0.00 ? 62  VAL A O    4  
ATOM 6356  C CB   . VAL A 1 62  ? -3.675  -3.381  -5.057  1.00 0.00 ? 62  VAL A CB   4  
ATOM 6357  C CG1  . VAL A 1 62  ? -3.563  -4.832  -4.617  1.00 0.00 ? 62  VAL A CG1  4  
ATOM 6358  C CG2  . VAL A 1 62  ? -2.485  -2.571  -4.563  1.00 0.00 ? 62  VAL A CG2  4  
ATOM 6359  H H    . VAL A 1 62  ? -4.053  -1.189  -6.504  1.00 0.00 ? 62  VAL A H    4  
ATOM 6360  H HA   . VAL A 1 62  ? -2.985  -3.856  -7.027  1.00 0.00 ? 62  VAL A HA   4  
ATOM 6361  H HB   . VAL A 1 62  ? -4.572  -2.964  -4.621  1.00 0.00 ? 62  VAL A HB   4  
ATOM 6362  H HG11 . VAL A 1 62  ? -3.981  -4.942  -3.627  1.00 0.00 ? 62  VAL A HG11 4  
ATOM 6363  H HG12 . VAL A 1 62  ? -4.103  -5.462  -5.309  1.00 0.00 ? 62  VAL A HG12 4  
ATOM 6364  H HG13 . VAL A 1 62  ? -2.522  -5.124  -4.602  1.00 0.00 ? 62  VAL A HG13 4  
ATOM 6365  H HG21 . VAL A 1 62  ? -2.755  -2.053  -3.656  1.00 0.00 ? 62  VAL A HG21 4  
ATOM 6366  H HG22 . VAL A 1 62  ? -1.656  -3.235  -4.366  1.00 0.00 ? 62  VAL A HG22 4  
ATOM 6367  H HG23 . VAL A 1 62  ? -2.200  -1.854  -5.318  1.00 0.00 ? 62  VAL A HG23 4  
ATOM 6368  N N    . ALA A 1 63  ? -5.048  -5.062  -7.662  1.00 0.00 ? 63  ALA A N    4  
ATOM 6369  C CA   . ALA A 1 63  ? -6.245  -5.752  -8.129  1.00 0.00 ? 63  ALA A CA   4  
ATOM 6370  C C    . ALA A 1 63  ? -5.918  -7.171  -8.583  1.00 0.00 ? 63  ALA A C    4  
ATOM 6371  O O    . ALA A 1 63  ? -4.754  -7.566  -8.625  1.00 0.00 ? 63  ALA A O    4  
ATOM 6372  C CB   . ALA A 1 63  ? -6.897  -4.971  -9.260  1.00 0.00 ? 63  ALA A CB   4  
ATOM 6373  H H    . ALA A 1 63  ? -4.171  -5.467  -7.821  1.00 0.00 ? 63  ALA A H    4  
ATOM 6374  H HA   . ALA A 1 63  ? -6.944  -5.800  -7.307  1.00 0.00 ? 63  ALA A HA   4  
ATOM 6375  H HB1  . ALA A 1 63  ? -6.714  -3.915  -9.119  1.00 0.00 ? 63  ALA A HB1  4  
ATOM 6376  H HB2  . ALA A 1 63  ? -6.479  -5.287  -10.203 1.00 0.00 ? 63  ALA A HB2  4  
ATOM 6377  H HB3  . ALA A 1 63  ? -7.961  -5.156  -9.257  1.00 0.00 ? 63  ALA A HB3  4  
ATOM 6378  N N    . ALA A 1 64  ? -6.954  -7.932  -8.921  1.00 0.00 ? 64  ALA A N    4  
ATOM 6379  C CA   . ALA A 1 64  ? -6.776  -9.306  -9.374  1.00 0.00 ? 64  ALA A CA   4  
ATOM 6380  C C    . ALA A 1 64  ? -5.940  -9.361  -10.647 1.00 0.00 ? 64  ALA A C    4  
ATOM 6381  O O    . ALA A 1 64  ? -6.168  -8.597  -11.585 1.00 0.00 ? 64  ALA A O    4  
ATOM 6382  C CB   . ALA A 1 64  ? -8.128  -9.966  -9.599  1.00 0.00 ? 64  ALA A CB   4  
ATOM 6383  H H    . ALA A 1 64  ? -7.858  -7.560  -8.867  1.00 0.00 ? 64  ALA A H    4  
ATOM 6384  H HA   . ALA A 1 64  ? -6.263  -9.850  -8.594  1.00 0.00 ? 64  ALA A HA   4  
ATOM 6385  H HB1  . ALA A 1 64  ? -8.006  -11.040 -9.611  1.00 0.00 ? 64  ALA A HB1  4  
ATOM 6386  H HB2  . ALA A 1 64  ? -8.801  -9.690  -8.801  1.00 0.00 ? 64  ALA A HB2  4  
ATOM 6387  H HB3  . ALA A 1 64  ? -8.535  -9.639  -10.544 1.00 0.00 ? 64  ALA A HB3  4  
ATOM 6388  N N    . VAL A 1 65  ? -4.970  -10.270 -10.674 1.00 0.00 ? 65  VAL A N    4  
ATOM 6389  C CA   . VAL A 1 65  ? -4.099  -10.425 -11.833 1.00 0.00 ? 65  VAL A CA   4  
ATOM 6390  C C    . VAL A 1 65  ? -4.898  -10.812 -13.073 1.00 0.00 ? 65  VAL A C    4  
ATOM 6391  O O    . VAL A 1 65  ? -6.034  -11.275 -12.971 1.00 0.00 ? 65  VAL A O    4  
ATOM 6392  C CB   . VAL A 1 65  ? -3.014  -11.488 -11.582 1.00 0.00 ? 65  VAL A CB   4  
ATOM 6393  C CG1  . VAL A 1 65  ? -2.021  -11.003 -10.537 1.00 0.00 ? 65  VAL A CG1  4  
ATOM 6394  C CG2  . VAL A 1 65  ? -3.647  -12.805 -11.157 1.00 0.00 ? 65  VAL A CG2  4  
ATOM 6395  H H    . VAL A 1 65  ? -4.837  -10.850 -9.896  1.00 0.00 ? 65  VAL A H    4  
ATOM 6396  H HA   . VAL A 1 65  ? -3.611  -9.478  -12.013 1.00 0.00 ? 65  VAL A HA   4  
ATOM 6397  H HB   . VAL A 1 65  ? -2.479  -11.653 -12.506 1.00 0.00 ? 65  VAL A HB   4  
ATOM 6398  H HG11 . VAL A 1 65  ? -2.162  -11.559 -9.622  1.00 0.00 ? 65  VAL A HG11 4  
ATOM 6399  H HG12 . VAL A 1 65  ? -1.015  -11.152 -10.899 1.00 0.00 ? 65  VAL A HG12 4  
ATOM 6400  H HG13 . VAL A 1 65  ? -2.184  -9.952  -10.347 1.00 0.00 ? 65  VAL A HG13 4  
ATOM 6401  H HG21 . VAL A 1 65  ? -4.277  -13.174 -11.953 1.00 0.00 ? 65  VAL A HG21 4  
ATOM 6402  H HG22 . VAL A 1 65  ? -2.871  -13.527 -10.948 1.00 0.00 ? 65  VAL A HG22 4  
ATOM 6403  H HG23 . VAL A 1 65  ? -4.242  -12.649 -10.269 1.00 0.00 ? 65  VAL A HG23 4  
ATOM 6404  N N    . GLN A 1 66  ? -4.296  -10.620 -14.242 1.00 0.00 ? 66  GLN A N    4  
ATOM 6405  C CA   . GLN A 1 66  ? -4.952  -10.949 -15.502 1.00 0.00 ? 66  GLN A CA   4  
ATOM 6406  C C    . GLN A 1 66  ? -4.465  -12.292 -16.034 1.00 0.00 ? 66  GLN A C    4  
ATOM 6407  O O    . GLN A 1 66  ? -3.376  -12.762 -15.702 1.00 0.00 ? 66  GLN A O    4  
ATOM 6408  C CB   . GLN A 1 66  ? -4.695  -9.853  -16.537 1.00 0.00 ? 66  GLN A CB   4  
ATOM 6409  C CG   . GLN A 1 66  ? -5.730  -8.739  -16.514 1.00 0.00 ? 66  GLN A CG   4  
ATOM 6410  C CD   . GLN A 1 66  ? -5.609  -7.805  -17.702 1.00 0.00 ? 66  GLN A CD   4  
ATOM 6411  O OE1  . GLN A 1 66  ? -6.487  -7.763  -18.564 1.00 0.00 ? 66  GLN A OE1  4  
ATOM 6412  N NE2  . GLN A 1 66  ? -4.518  -7.050  -17.753 1.00 0.00 ? 66  GLN A NE2  4  
ATOM 6413  H H    . GLN A 1 66  ? -3.390  -10.247 -14.258 1.00 0.00 ? 66  GLN A H    4  
ATOM 6414  H HA   . GLN A 1 66  ? -6.014  -11.014 -15.316 1.00 0.00 ? 66  GLN A HA   4  
ATOM 6415  H HB2  . GLN A 1 66  ? -3.725  -9.418  -16.350 1.00 0.00 ? 66  GLN A HB2  4  
ATOM 6416  H HB3  . GLN A 1 66  ? -4.698  -10.296 -17.522 1.00 0.00 ? 66  GLN A HB3  4  
ATOM 6417  H HG2  . GLN A 1 66  ? -6.715  -9.180  -16.521 1.00 0.00 ? 66  GLN A HG2  4  
ATOM 6418  H HG3  . GLN A 1 66  ? -5.601  -8.165  -15.608 1.00 0.00 ? 66  GLN A HG3  4  
ATOM 6419  H HE21 . GLN A 1 66  ? -3.861  -7.138  -17.031 1.00 0.00 ? 66  GLN A HE21 4  
ATOM 6420  H HE22 . GLN A 1 66  ? -4.414  -6.438  -18.510 1.00 0.00 ? 66  GLN A HE22 4  
ATOM 6421  N N    . PRO A 1 67  ? -5.289  -12.928 -16.881 1.00 0.00 ? 67  PRO A N    4  
ATOM 6422  C CA   . PRO A 1 67  ? -4.962  -14.226 -17.478 1.00 0.00 ? 67  PRO A CA   4  
ATOM 6423  C C    . PRO A 1 67  ? -3.832  -14.128 -18.497 1.00 0.00 ? 67  PRO A C    4  
ATOM 6424  O O    . PRO A 1 67  ? -3.430  -15.129 -19.091 1.00 0.00 ? 67  PRO A O    4  
ATOM 6425  C CB   . PRO A 1 67  ? -6.266  -14.639 -18.165 1.00 0.00 ? 67  PRO A CB   4  
ATOM 6426  C CG   . PRO A 1 67  ? -6.969  -13.355 -18.446 1.00 0.00 ? 67  PRO A CG   4  
ATOM 6427  C CD   . PRO A 1 67  ? -6.601  -12.427 -17.322 1.00 0.00 ? 67  PRO A CD   4  
ATOM 6428  H HA   . PRO A 1 67  ? -4.704  -14.956 -16.724 1.00 0.00 ? 67  PRO A HA   4  
ATOM 6429  H HB2  . PRO A 1 67  ? -6.042  -15.175 -19.076 1.00 0.00 ? 67  PRO A HB2  4  
ATOM 6430  H HB3  . PRO A 1 67  ? -6.843  -15.267 -17.503 1.00 0.00 ? 67  PRO A HB3  4  
ATOM 6431  H HG2  . PRO A 1 67  ? -6.633  -12.952 -19.390 1.00 0.00 ? 67  PRO A HG2  4  
ATOM 6432  H HG3  . PRO A 1 67  ? -8.036  -13.518 -18.464 1.00 0.00 ? 67  PRO A HG3  4  
ATOM 6433  H HD2  . PRO A 1 67  ? -6.526  -11.411 -17.680 1.00 0.00 ? 67  PRO A HD2  4  
ATOM 6434  H HD3  . PRO A 1 67  ? -7.327  -12.495 -16.524 1.00 0.00 ? 67  PRO A HD3  4  
ATOM 6435  N N    . SER A 1 68  ? -3.321  -12.917 -18.693 1.00 0.00 ? 68  SER A N    4  
ATOM 6436  C CA   . SER A 1 68  ? -2.239  -12.688 -19.643 1.00 0.00 ? 68  SER A CA   4  
ATOM 6437  C C    . SER A 1 68  ? -1.019  -12.095 -18.944 1.00 0.00 ? 68  SER A C    4  
ATOM 6438  O O    . SER A 1 68  ? -0.259  -11.332 -19.539 1.00 0.00 ? 68  SER A O    4  
ATOM 6439  C CB   . SER A 1 68  ? -2.703  -11.755 -20.763 1.00 0.00 ? 68  SER A CB   4  
ATOM 6440  O OG   . SER A 1 68  ? -3.176  -10.526 -20.239 1.00 0.00 ? 68  SER A OG   4  
ATOM 6441  H H    . SER A 1 68  ? -3.684  -12.158 -18.189 1.00 0.00 ? 68  SER A H    4  
ATOM 6442  H HA   . SER A 1 68  ? -1.966  -13.642 -20.070 1.00 0.00 ? 68  SER A HA   4  
ATOM 6443  H HB2  . SER A 1 68  ? -1.876  -11.555 -21.427 1.00 0.00 ? 68  SER A HB2  4  
ATOM 6444  H HB3  . SER A 1 68  ? -3.501  -12.229 -21.315 1.00 0.00 ? 68  SER A HB3  4  
ATOM 6445  H HG   . SER A 1 68  ? -2.594  -9.814  -20.516 1.00 0.00 ? 68  SER A HG   4  
ATOM 6446  N N    . ASP A 1 69  ? -0.840  -12.452 -17.677 1.00 0.00 ? 69  ASP A N    4  
ATOM 6447  C CA   . ASP A 1 69  ? 0.287   -11.957 -16.895 1.00 0.00 ? 69  ASP A CA   4  
ATOM 6448  C C    . ASP A 1 69  ? 1.257   -13.087 -16.563 1.00 0.00 ? 69  ASP A C    4  
ATOM 6449  O O    . ASP A 1 69  ? 2.271   -12.873 -15.901 1.00 0.00 ? 69  ASP A O    4  
ATOM 6450  C CB   . ASP A 1 69  ? -0.208  -11.299 -15.606 1.00 0.00 ? 69  ASP A CB   4  
ATOM 6451  C CG   . ASP A 1 69  ? -0.742  -9.899  -15.839 1.00 0.00 ? 69  ASP A CG   4  
ATOM 6452  O OD1  . ASP A 1 69  ? -0.617  -9.397  -16.976 1.00 0.00 ? 69  ASP A OD1  4  
ATOM 6453  O OD2  . ASP A 1 69  ? -1.287  -9.306  -14.885 1.00 0.00 ? 69  ASP A OD2  4  
ATOM 6454  H H    . ASP A 1 69  ? -1.481  -13.064 -17.257 1.00 0.00 ? 69  ASP A H    4  
ATOM 6455  H HA   . ASP A 1 69  ? 0.804   -11.219 -17.489 1.00 0.00 ? 69  ASP A HA   4  
ATOM 6456  H HB2  . ASP A 1 69  ? -1.000  -11.900 -15.184 1.00 0.00 ? 69  ASP A HB2  4  
ATOM 6457  H HB3  . ASP A 1 69  ? 0.609   -11.241 -14.902 1.00 0.00 ? 69  ASP A HB3  4  
ATOM 6458  N N    . ASN A 1 70  ? 0.936   -14.290 -17.028 1.00 0.00 ? 70  ASN A N    4  
ATOM 6459  C CA   . ASN A 1 70  ? 1.778   -15.455 -16.779 1.00 0.00 ? 70  ASN A CA   4  
ATOM 6460  C C    . ASN A 1 70  ? 1.820   -15.788 -15.291 1.00 0.00 ? 70  ASN A C    4  
ATOM 6461  O O    . ASN A 1 70  ? 2.859   -16.182 -14.762 1.00 0.00 ? 70  ASN A O    4  
ATOM 6462  C CB   . ASN A 1 70  ? 3.196   -15.205 -17.297 1.00 0.00 ? 70  ASN A CB   4  
ATOM 6463  C CG   . ASN A 1 70  ? 3.922   -16.491 -17.640 1.00 0.00 ? 70  ASN A CG   4  
ATOM 6464  O OD1  . ASN A 1 70  ? 3.311   -17.459 -18.094 1.00 0.00 ? 70  ASN A OD1  4  
ATOM 6465  N ND2  . ASN A 1 70  ? 5.232   -16.507 -17.423 1.00 0.00 ? 70  ASN A ND2  4  
ATOM 6466  H H    . ASN A 1 70  ? 0.114   -14.398 -17.550 1.00 0.00 ? 70  ASN A H    4  
ATOM 6467  H HA   . ASN A 1 70  ? 1.352   -16.291 -17.312 1.00 0.00 ? 70  ASN A HA   4  
ATOM 6468  H HB2  . ASN A 1 70  ? 3.145   -14.595 -18.187 1.00 0.00 ? 70  ASN A HB2  4  
ATOM 6469  H HB3  . ASN A 1 70  ? 3.763   -14.683 -16.540 1.00 0.00 ? 70  ASN A HB3  4  
ATOM 6470  H HD21 . ASN A 1 70  ? 5.651   -15.700 -17.060 1.00 0.00 ? 70  ASN A HD21 4  
ATOM 6471  H HD22 . ASN A 1 70  ? 5.726   -17.326 -17.637 1.00 0.00 ? 70  ASN A HD22 4  
ATOM 6472  N N    . ILE A 1 71  ? 0.683   -15.628 -14.623 1.00 0.00 ? 71  ILE A N    4  
ATOM 6473  C CA   . ILE A 1 71  ? 0.589   -15.914 -13.196 1.00 0.00 ? 71  ILE A CA   4  
ATOM 6474  C C    . ILE A 1 71  ? 0.150   -17.354 -12.952 1.00 0.00 ? 71  ILE A C    4  
ATOM 6475  O O    . ILE A 1 71  ? 0.843   -18.119 -12.282 1.00 0.00 ? 71  ILE A O    4  
ATOM 6476  C CB   . ILE A 1 71  ? -0.399  -14.962 -12.495 1.00 0.00 ? 71  ILE A CB   4  
ATOM 6477  C CG1  . ILE A 1 71  ? 0.116   -13.522 -12.557 1.00 0.00 ? 71  ILE A CG1  4  
ATOM 6478  C CG2  . ILE A 1 71  ? -0.615  -15.392 -11.052 1.00 0.00 ? 71  ILE A CG2  4  
ATOM 6479  C CD1  . ILE A 1 71  ? 1.592   -13.395 -12.252 1.00 0.00 ? 71  ILE A CD1  4  
ATOM 6480  H H    . ILE A 1 71  ? -0.112  -15.311 -15.100 1.00 0.00 ? 71  ILE A H    4  
ATOM 6481  H HA   . ILE A 1 71  ? 1.567   -15.768 -12.762 1.00 0.00 ? 71  ILE A HA   4  
ATOM 6482  H HB   . ILE A 1 71  ? -1.346  -15.021 -13.009 1.00 0.00 ? 71  ILE A HB   4  
ATOM 6483  H HG12 . ILE A 1 71  ? -0.054  -13.128 -13.546 1.00 0.00 ? 71  ILE A HG12 4  
ATOM 6484  H HG13 . ILE A 1 71  ? -0.425  -12.924 -11.837 1.00 0.00 ? 71  ILE A HG13 4  
ATOM 6485  H HG21 . ILE A 1 71  ? 0.249   -15.941 -10.707 1.00 0.00 ? 71  ILE A HG21 4  
ATOM 6486  H HG22 . ILE A 1 71  ? -0.756  -14.519 -10.434 1.00 0.00 ? 71  ILE A HG22 4  
ATOM 6487  H HG23 . ILE A 1 71  ? -1.490  -16.022 -10.991 1.00 0.00 ? 71  ILE A HG23 4  
ATOM 6488  H HD11 . ILE A 1 71  ? 1.808   -12.386 -11.933 1.00 0.00 ? 71  ILE A HD11 4  
ATOM 6489  H HD12 . ILE A 1 71  ? 1.860   -14.087 -11.468 1.00 0.00 ? 71  ILE A HD12 4  
ATOM 6490  H HD13 . ILE A 1 71  ? 2.163   -13.621 -13.142 1.00 0.00 ? 71  ILE A HD13 4  
ATOM 6491  N N    . SER A 1 72  ? -1.004  -17.716 -13.502 1.00 0.00 ? 72  SER A N    4  
ATOM 6492  C CA   . SER A 1 72  ? -1.537  -19.064 -13.342 1.00 0.00 ? 72  SER A CA   4  
ATOM 6493  C C    . SER A 1 72  ? -1.678  -19.421 -11.865 1.00 0.00 ? 72  SER A C    4  
ATOM 6494  O O    . SER A 1 72  ? -1.324  -20.523 -11.445 1.00 0.00 ? 72  SER A O    4  
ATOM 6495  C CB   . SER A 1 72  ? -0.630  -20.080 -14.039 1.00 0.00 ? 72  SER A CB   4  
ATOM 6496  O OG   . SER A 1 72  ? -0.924  -20.161 -15.423 1.00 0.00 ? 72  SER A OG   4  
ATOM 6497  H H    . SER A 1 72  ? -1.511  -17.060 -14.025 1.00 0.00 ? 72  SER A H    4  
ATOM 6498  H HA   . SER A 1 72  ? -2.514  -19.092 -13.802 1.00 0.00 ? 72  SER A HA   4  
ATOM 6499  H HB2  . SER A 1 72  ? 0.400   -19.780 -13.920 1.00 0.00 ? 72  SER A HB2  4  
ATOM 6500  H HB3  . SER A 1 72  ? -0.776  -21.054 -13.594 1.00 0.00 ? 72  SER A HB3  4  
ATOM 6501  H HG   . SER A 1 72  ? -1.571  -20.854 -15.573 1.00 0.00 ? 72  SER A HG   4  
ATOM 6502  N N    . ARG A 1 73  ? -2.199  -18.481 -11.083 1.00 0.00 ? 73  ARG A N    4  
ATOM 6503  C CA   . ARG A 1 73  ? -2.386  -18.695 -9.653  1.00 0.00 ? 73  ARG A CA   4  
ATOM 6504  C C    . ARG A 1 73  ? -3.689  -18.060 -9.175  1.00 0.00 ? 73  ARG A C    4  
ATOM 6505  O O    . ARG A 1 73  ? -3.867  -16.845 -9.257  1.00 0.00 ? 73  ARG A O    4  
ATOM 6506  C CB   . ARG A 1 73  ? -1.207  -18.116 -8.870  1.00 0.00 ? 73  ARG A CB   4  
ATOM 6507  C CG   . ARG A 1 73  ? -0.014  -19.053 -8.784  1.00 0.00 ? 73  ARG A CG   4  
ATOM 6508  C CD   . ARG A 1 73  ? 0.783   -18.826 -7.509  1.00 0.00 ? 73  ARG A CD   4  
ATOM 6509  N NE   . ARG A 1 73  ? 0.244   -19.586 -6.384  1.00 0.00 ? 73  ARG A NE   4  
ATOM 6510  C CZ   . ARG A 1 73  ? 0.371   -20.903 -6.259  1.00 0.00 ? 73  ARG A CZ   4  
ATOM 6511  N NH1  . ARG A 1 73  ? 1.015   -21.600 -7.184  1.00 0.00 ? 73  ARG A NH1  4  
ATOM 6512  N NH2  . ARG A 1 73  ? -0.146  -21.523 -5.207  1.00 0.00 ? 73  ARG A NH2  4  
ATOM 6513  H H    . ARG A 1 73  ? -2.462  -17.623 -11.477 1.00 0.00 ? 73  ARG A H    4  
ATOM 6514  H HA   . ARG A 1 73  ? -2.434  -19.760 -9.480  1.00 0.00 ? 73  ARG A HA   4  
ATOM 6515  H HB2  . ARG A 1 73  ? -0.885  -17.203 -9.350  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 6516  H HB3  . ARG A 1 73  ? -1.533  -17.889 -7.866  1.00 0.00 ? 73  ARG A HB3  4  
ATOM 6517  H HG2  . ARG A 1 73  ? -0.368  -20.074 -8.796  1.00 0.00 ? 73  ARG A HG2  4  
ATOM 6518  H HG3  . ARG A 1 73  ? 0.629   -18.883 -9.635  1.00 0.00 ? 73  ARG A HG3  4  
ATOM 6519  H HD2  . ARG A 1 73  ? 1.805   -19.129 -7.679  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 6520  H HD3  . ARG A 1 73  ? 0.755   -17.774 -7.266  1.00 0.00 ? 73  ARG A HD3  4  
ATOM 6521  H HE   . ARG A 1 73  ? -0.235  -19.090 -5.689  1.00 0.00 ? 73  ARG A HE   4  
ATOM 6522  H HH11 . ARG A 1 73  ? 1.407   -21.135 -7.978  1.00 0.00 ? 73  ARG A HH11 4  
ATOM 6523  H HH12 . ARG A 1 73  ? 1.110   -22.592 -7.087  1.00 0.00 ? 73  ARG A HH12 4  
ATOM 6524  H HH21 . ARG A 1 73  ? -0.632  -21.001 -4.507  1.00 0.00 ? 73  ARG A HH21 4  
ATOM 6525  H HH22 . ARG A 1 73  ? -0.051  -22.514 -5.114  1.00 0.00 ? 73  ARG A HH22 4  
ATOM 6526  N N    . LYS A 1 74  ? -4.597  -18.891 -8.676  1.00 0.00 ? 74  LYS A N    4  
ATOM 6527  C CA   . LYS A 1 74  ? -5.884  -18.413 -8.183  1.00 0.00 ? 74  LYS A CA   4  
ATOM 6528  C C    . LYS A 1 74  ? -5.704  -17.557 -6.933  1.00 0.00 ? 74  LYS A C    4  
ATOM 6529  O O    . LYS A 1 74  ? -4.729  -17.713 -6.197  1.00 0.00 ? 74  LYS A O    4  
ATOM 6530  C CB   . LYS A 1 74  ? -6.807  -19.595 -7.877  1.00 0.00 ? 74  LYS A CB   4  
ATOM 6531  C CG   . LYS A 1 74  ? -7.490  -20.168 -9.106  1.00 0.00 ? 74  LYS A CG   4  
ATOM 6532  C CD   . LYS A 1 74  ? -8.832  -20.790 -8.759  1.00 0.00 ? 74  LYS A CD   4  
ATOM 6533  C CE   . LYS A 1 74  ? -9.726  -20.906 -9.984  1.00 0.00 ? 74  LYS A CE   4  
ATOM 6534  N NZ   . LYS A 1 74  ? -9.150  -21.824 -11.006 1.00 0.00 ? 74  LYS A NZ   4  
ATOM 6535  H H    . LYS A 1 74  ? -4.397  -19.851 -8.637  1.00 0.00 ? 74  LYS A H    4  
ATOM 6536  H HA   . LYS A 1 74  ? -6.332  -17.809 -8.957  1.00 0.00 ? 74  LYS A HA   4  
ATOM 6537  H HB2  . LYS A 1 74  ? -6.226  -20.379 -7.414  1.00 0.00 ? 74  LYS A HB2  4  
ATOM 6538  H HB3  . LYS A 1 74  ? -7.571  -19.269 -7.185  1.00 0.00 ? 74  LYS A HB3  4  
ATOM 6539  H HG2  . LYS A 1 74  ? -7.648  -19.375 -9.822  1.00 0.00 ? 74  LYS A HG2  4  
ATOM 6540  H HG3  . LYS A 1 74  ? -6.853  -20.926 -9.540  1.00 0.00 ? 74  LYS A HG3  4  
ATOM 6541  H HD2  . LYS A 1 74  ? -8.668  -21.777 -8.353  1.00 0.00 ? 74  LYS A HD2  4  
ATOM 6542  H HD3  . LYS A 1 74  ? -9.325  -20.173 -8.021  1.00 0.00 ? 74  LYS A HD3  4  
ATOM 6543  H HE2  . LYS A 1 74  ? -10.689 -21.283 -9.676  1.00 0.00 ? 74  LYS A HE2  4  
ATOM 6544  H HE3  . LYS A 1 74  ? -9.846  -19.926 -10.420 1.00 0.00 ? 74  LYS A HE3  4  
ATOM 6545  H HZ1  . LYS A 1 74  ? -8.245  -22.210 -10.669 1.00 0.00 ? 74  LYS A HZ1  4  
ATOM 6546  H HZ2  . LYS A 1 74  ? -8.986  -21.311 -11.895 1.00 0.00 ? 74  LYS A HZ2  4  
ATOM 6547  H HZ3  . LYS A 1 74  ? -9.804  -22.611 -11.189 1.00 0.00 ? 74  LYS A HZ3  4  
ATOM 6548  N N    . HIS A 1 75  ? -6.650  -16.654 -6.699  1.00 0.00 ? 75  HIS A N    4  
ATOM 6549  C CA   . HIS A 1 75  ? -6.597  -15.775 -5.536  1.00 0.00 ? 75  HIS A CA   4  
ATOM 6550  C C    . HIS A 1 75  ? -5.293  -14.983 -5.514  1.00 0.00 ? 75  HIS A C    4  
ATOM 6551  O O    . HIS A 1 75  ? -4.665  -14.828 -4.465  1.00 0.00 ? 75  HIS A O    4  
ATOM 6552  C CB   . HIS A 1 75  ? -6.736  -16.588 -4.249  1.00 0.00 ? 75  HIS A CB   4  
ATOM 6553  C CG   . HIS A 1 75  ? -7.657  -17.761 -4.378  1.00 0.00 ? 75  HIS A CG   4  
ATOM 6554  N ND1  . HIS A 1 75  ? -8.905  -17.678 -4.958  1.00 0.00 ? 75  HIS A ND1  4  
ATOM 6555  C CD2  . HIS A 1 75  ? -7.505  -19.052 -3.999  1.00 0.00 ? 75  HIS A CD2  4  
ATOM 6556  C CE1  . HIS A 1 75  ? -9.482  -18.866 -4.929  1.00 0.00 ? 75  HIS A CE1  4  
ATOM 6557  N NE2  . HIS A 1 75  ? -8.653  -19.718 -4.353  1.00 0.00 ? 75  HIS A NE2  4  
ATOM 6558  H H    . HIS A 1 75  ? -7.402  -16.577 -7.322  1.00 0.00 ? 75  HIS A H    4  
ATOM 6559  H HA   . HIS A 1 75  ? -7.423  -15.083 -5.605  1.00 0.00 ? 75  HIS A HA   4  
ATOM 6560  H HB2  . HIS A 1 75  ? -5.764  -16.960 -3.960  1.00 0.00 ? 75  HIS A HB2  4  
ATOM 6561  H HB3  . HIS A 1 75  ? -7.119  -15.948 -3.466  1.00 0.00 ? 75  HIS A HB3  4  
ATOM 6562  H HD1  . HIS A 1 75  ? -9.309  -16.868 -5.333  1.00 0.00 ? 75  HIS A HD1  4  
ATOM 6563  H HD2  . HIS A 1 75  ? -6.642  -19.480 -3.509  1.00 0.00 ? 75  HIS A HD2  4  
ATOM 6564  H HE1  . HIS A 1 75  ? -10.464 -19.102 -5.312  1.00 0.00 ? 75  HIS A HE1  4  
ATOM 6565  H HE2  . HIS A 1 75  ? -8.866  -20.647 -4.127  1.00 0.00 ? 75  HIS A HE2  4  
ATOM 6566  N N    . THR A 1 76  ? -4.890  -14.482 -6.678  1.00 0.00 ? 76  THR A N    4  
ATOM 6567  C CA   . THR A 1 76  ? -3.660  -13.708 -6.792  1.00 0.00 ? 76  THR A CA   4  
ATOM 6568  C C    . THR A 1 76  ? -3.942  -12.303 -7.313  1.00 0.00 ? 76  THR A C    4  
ATOM 6569  O O    . THR A 1 76  ? -4.772  -12.115 -8.203  1.00 0.00 ? 76  THR A O    4  
ATOM 6570  C CB   . THR A 1 76  ? -2.648  -14.397 -7.726  1.00 0.00 ? 76  THR A CB   4  
ATOM 6571  O OG1  . THR A 1 76  ? -2.518  -15.779 -7.374  1.00 0.00 ? 76  THR A OG1  4  
ATOM 6572  C CG2  . THR A 1 76  ? -1.289  -13.718 -7.646  1.00 0.00 ? 76  THR A CG2  4  
ATOM 6573  H H    . THR A 1 76  ? -5.433  -14.639 -7.478  1.00 0.00 ? 76  THR A H    4  
ATOM 6574  H HA   . THR A 1 76  ? -3.219  -13.635 -5.808  1.00 0.00 ? 76  THR A HA   4  
ATOM 6575  H HB   . THR A 1 76  ? -3.011  -14.324 -8.742  1.00 0.00 ? 76  THR A HB   4  
ATOM 6576  H HG1  . THR A 1 76  ? -3.338  -16.088 -6.983  1.00 0.00 ? 76  THR A HG1  4  
ATOM 6577  H HG21 . THR A 1 76  ? -0.643  -14.112 -8.417  1.00 0.00 ? 76  THR A HG21 4  
ATOM 6578  H HG22 . THR A 1 76  ? -0.850  -13.904 -6.678  1.00 0.00 ? 76  THR A HG22 4  
ATOM 6579  H HG23 . THR A 1 76  ? -1.410  -12.654 -7.788  1.00 0.00 ? 76  THR A HG23 4  
ATOM 6580  N N    . PHE A 1 77  ? -3.245  -11.319 -6.754  1.00 0.00 ? 77  PHE A N    4  
ATOM 6581  C CA   . PHE A 1 77  ? -3.420  -9.931  -7.162  1.00 0.00 ? 77  PHE A CA   4  
ATOM 6582  C C    . PHE A 1 77  ? -2.077  -9.288  -7.494  1.00 0.00 ? 77  PHE A C    4  
ATOM 6583  O O    . PHE A 1 77  ? -1.027  -9.749  -7.045  1.00 0.00 ? 77  PHE A O    4  
ATOM 6584  C CB   . PHE A 1 77  ? -4.120  -9.136  -6.057  1.00 0.00 ? 77  PHE A CB   4  
ATOM 6585  C CG   . PHE A 1 77  ? -3.598  -9.437  -4.681  1.00 0.00 ? 77  PHE A CG   4  
ATOM 6586  C CD1  . PHE A 1 77  ? -3.855  -10.659 -4.080  1.00 0.00 ? 77  PHE A CD1  4  
ATOM 6587  C CD2  . PHE A 1 77  ? -2.852  -8.497  -3.988  1.00 0.00 ? 77  PHE A CD2  4  
ATOM 6588  C CE1  . PHE A 1 77  ? -3.376  -10.939 -2.814  1.00 0.00 ? 77  PHE A CE1  4  
ATOM 6589  C CE2  . PHE A 1 77  ? -2.371  -8.771  -2.722  1.00 0.00 ? 77  PHE A CE2  4  
ATOM 6590  C CZ   . PHE A 1 77  ? -2.634  -9.993  -2.134  1.00 0.00 ? 77  PHE A CZ   4  
ATOM 6591  H H    . PHE A 1 77  ? -2.597  -11.533 -6.049  1.00 0.00 ? 77  PHE A H    4  
ATOM 6592  H HA   . PHE A 1 77  ? -4.038  -9.922  -8.047  1.00 0.00 ? 77  PHE A HA   4  
ATOM 6593  H HB2  . PHE A 1 77  ? -3.982  -8.081  -6.240  1.00 0.00 ? 77  PHE A HB2  4  
ATOM 6594  H HB3  . PHE A 1 77  ? -5.174  -9.366  -6.072  1.00 0.00 ? 77  PHE A HB3  4  
ATOM 6595  H HD1  . PHE A 1 77  ? -4.436  -11.399 -4.612  1.00 0.00 ? 77  PHE A HD1  4  
ATOM 6596  H HD2  . PHE A 1 77  ? -2.646  -7.541  -4.446  1.00 0.00 ? 77  PHE A HD2  4  
ATOM 6597  H HE1  . PHE A 1 77  ? -3.584  -11.895 -2.357  1.00 0.00 ? 77  PHE A HE1  4  
ATOM 6598  H HE2  . PHE A 1 77  ? -1.791  -8.031  -2.192  1.00 0.00 ? 77  PHE A HE2  4  
ATOM 6599  H HZ   . PHE A 1 77  ? -2.259  -10.210 -1.145  1.00 0.00 ? 77  PHE A HZ   4  
ATOM 6600  N N    . LYS A 1 78  ? -2.118  -8.219  -8.283  1.00 0.00 ? 78  LYS A N    4  
ATOM 6601  C CA   . LYS A 1 78  ? -0.905  -7.511  -8.676  1.00 0.00 ? 78  LYS A CA   4  
ATOM 6602  C C    . LYS A 1 78  ? -1.052  -6.011  -8.441  1.00 0.00 ? 78  LYS A C    4  
ATOM 6603  O O    . LYS A 1 78  ? -2.137  -5.452  -8.595  1.00 0.00 ? 78  LYS A O    4  
ATOM 6604  C CB   . LYS A 1 78  ? -0.588  -7.778  -10.149 1.00 0.00 ? 78  LYS A CB   4  
ATOM 6605  C CG   . LYS A 1 78  ? -1.671  -7.302  -11.101 1.00 0.00 ? 78  LYS A CG   4  
ATOM 6606  C CD   . LYS A 1 78  ? -1.118  -7.047  -12.493 1.00 0.00 ? 78  LYS A CD   4  
ATOM 6607  C CE   . LYS A 1 78  ? -1.999  -6.087  -13.276 1.00 0.00 ? 78  LYS A CE   4  
ATOM 6608  N NZ   . LYS A 1 78  ? -1.364  -5.671  -14.557 1.00 0.00 ? 78  LYS A NZ   4  
ATOM 6609  H H    . LYS A 1 78  ? -2.985  -7.899  -8.609  1.00 0.00 ? 78  LYS A H    4  
ATOM 6610  H HA   . LYS A 1 78  ? -0.093  -7.881  -8.068  1.00 0.00 ? 78  LYS A HA   4  
ATOM 6611  H HB2  . LYS A 1 78  ? 0.333   -7.275  -10.403 1.00 0.00 ? 78  LYS A HB2  4  
ATOM 6612  H HB3  . LYS A 1 78  ? -0.458  -8.842  -10.289 1.00 0.00 ? 78  LYS A HB3  4  
ATOM 6613  H HG2  . LYS A 1 78  ? -2.441  -8.056  -11.163 1.00 0.00 ? 78  LYS A HG2  4  
ATOM 6614  H HG3  . LYS A 1 78  ? -2.095  -6.384  -10.718 1.00 0.00 ? 78  LYS A HG3  4  
ATOM 6615  H HD2  . LYS A 1 78  ? -0.129  -6.621  -12.406 1.00 0.00 ? 78  LYS A HD2  4  
ATOM 6616  H HD3  . LYS A 1 78  ? -1.061  -7.987  -13.025 1.00 0.00 ? 78  LYS A HD3  4  
ATOM 6617  H HE2  . LYS A 1 78  ? -2.938  -6.575  -13.492 1.00 0.00 ? 78  LYS A HE2  4  
ATOM 6618  H HE3  . LYS A 1 78  ? -2.180  -5.211  -12.672 1.00 0.00 ? 78  LYS A HE3  4  
ATOM 6619  H HZ1  . LYS A 1 78  ? -0.942  -4.726  -14.456 1.00 0.00 ? 78  LYS A HZ1  4  
ATOM 6620  H HZ2  . LYS A 1 78  ? -2.075  -5.640  -15.316 1.00 0.00 ? 78  LYS A HZ2  4  
ATOM 6621  H HZ3  . LYS A 1 78  ? -0.619  -6.346  -14.823 1.00 0.00 ? 78  LYS A HZ3  4  
ATOM 6622  N N    . ALA A 1 79  ? 0.048   -5.365  -8.069  1.00 0.00 ? 79  ALA A N    4  
ATOM 6623  C CA   . ALA A 1 79  ? 0.043   -3.929  -7.816  1.00 0.00 ? 79  ALA A CA   4  
ATOM 6624  C C    . ALA A 1 79  ? 0.885   -3.187  -8.848  1.00 0.00 ? 79  ALA A C    4  
ATOM 6625  O O    . ALA A 1 79  ? 2.114   -3.186  -8.774  1.00 0.00 ? 79  ALA A O    4  
ATOM 6626  C CB   . ALA A 1 79  ? 0.548   -3.638  -6.411  1.00 0.00 ? 79  ALA A CB   4  
ATOM 6627  H H    . ALA A 1 79  ? 0.884   -5.865  -7.963  1.00 0.00 ? 79  ALA A H    4  
ATOM 6628  H HA   . ALA A 1 79  ? -0.979  -3.582  -7.884  1.00 0.00 ? 79  ALA A HA   4  
ATOM 6629  H HB1  . ALA A 1 79  ? 1.324   -4.345  -6.155  1.00 0.00 ? 79  ALA A HB1  4  
ATOM 6630  H HB2  . ALA A 1 79  ? 0.948   -2.636  -6.373  1.00 0.00 ? 79  ALA A HB2  4  
ATOM 6631  H HB3  . ALA A 1 79  ? -0.267  -3.729  -5.709  1.00 0.00 ? 79  ALA A HB3  4  
ATOM 6632  N N    . GLU A 1 80  ? 0.217   -2.557  -9.809  1.00 0.00 ? 80  GLU A N    4  
ATOM 6633  C CA   . GLU A 1 80  ? 0.906   -1.813  -10.856 1.00 0.00 ? 80  GLU A CA   4  
ATOM 6634  C C    . GLU A 1 80  ? 0.869   -0.314  -10.573 1.00 0.00 ? 80  GLU A C    4  
ATOM 6635  O O    . GLU A 1 80  ? -0.197  0.260   -10.345 1.00 0.00 ? 80  GLU A O    4  
ATOM 6636  C CB   . GLU A 1 80  ? 0.273   -2.101  -12.219 1.00 0.00 ? 80  GLU A CB   4  
ATOM 6637  C CG   . GLU A 1 80  ? 0.360   -0.936  -13.190 1.00 0.00 ? 80  GLU A CG   4  
ATOM 6638  C CD   . GLU A 1 80  ? 0.359   -1.382  -14.639 1.00 0.00 ? 80  GLU A CD   4  
ATOM 6639  O OE1  . GLU A 1 80  ? -0.663  -1.946  -15.084 1.00 0.00 ? 80  GLU A OE1  4  
ATOM 6640  O OE2  . GLU A 1 80  ? 1.378   -1.168  -15.327 1.00 0.00 ? 80  GLU A OE2  4  
ATOM 6641  H H    . GLU A 1 80  ? -0.763  -2.594  -9.814  1.00 0.00 ? 80  GLU A H    4  
ATOM 6642  H HA   . GLU A 1 80  ? 1.935   -2.138  -10.872 1.00 0.00 ? 80  GLU A HA   4  
ATOM 6643  H HB2  . GLU A 1 80  ? 0.771   -2.951  -12.662 1.00 0.00 ? 80  GLU A HB2  4  
ATOM 6644  H HB3  . GLU A 1 80  ? -0.770  -2.343  -12.073 1.00 0.00 ? 80  GLU A HB3  4  
ATOM 6645  H HG2  . GLU A 1 80  ? -0.486  -0.285  -13.029 1.00 0.00 ? 80  GLU A HG2  4  
ATOM 6646  H HG3  . GLU A 1 80  ? 1.273   -0.391  -12.997 1.00 0.00 ? 80  GLU A HG3  4  
ATOM 6647  N N    . HIS A 1 81  ? 2.040   0.315   -10.588 1.00 0.00 ? 81  HIS A N    4  
ATOM 6648  C CA   . HIS A 1 81  ? 2.142   1.748   -10.333 1.00 0.00 ? 81  HIS A CA   4  
ATOM 6649  C C    . HIS A 1 81  ? 2.254   2.526   -11.641 1.00 0.00 ? 81  HIS A C    4  
ATOM 6650  O O    . HIS A 1 81  ? 2.437   1.941   -12.708 1.00 0.00 ? 81  HIS A O    4  
ATOM 6651  C CB   . HIS A 1 81  ? 3.351   2.044   -9.445  1.00 0.00 ? 81  HIS A CB   4  
ATOM 6652  C CG   . HIS A 1 81  ? 3.560   3.504   -9.186  1.00 0.00 ? 81  HIS A CG   4  
ATOM 6653  N ND1  . HIS A 1 81  ? 4.393   4.292   -9.952  1.00 0.00 ? 81  HIS A ND1  4  
ATOM 6654  C CD2  . HIS A 1 81  ? 3.038   4.319   -8.240  1.00 0.00 ? 81  HIS A CD2  4  
ATOM 6655  C CE1  . HIS A 1 81  ? 4.375   5.529   -9.487  1.00 0.00 ? 81  HIS A CE1  4  
ATOM 6656  N NE2  . HIS A 1 81  ? 3.560   5.572   -8.449  1.00 0.00 ? 81  HIS A NE2  4  
ATOM 6657  H H    . HIS A 1 81  ? 2.854   -0.196  -10.776 1.00 0.00 ? 81  HIS A H    4  
ATOM 6658  H HA   . HIS A 1 81  ? 1.245   2.058   -9.820  1.00 0.00 ? 81  HIS A HA   4  
ATOM 6659  H HB2  . HIS A 1 81  ? 3.217   1.554   -8.492  1.00 0.00 ? 81  HIS A HB2  4  
ATOM 6660  H HB3  . HIS A 1 81  ? 4.242   1.659   -9.920  1.00 0.00 ? 81  HIS A HB3  4  
ATOM 6661  H HD1  . HIS A 1 81  ? 4.920   3.990   -10.720 1.00 0.00 ? 81  HIS A HD1  4  
ATOM 6662  H HD2  . HIS A 1 81  ? 2.340   4.037   -7.464  1.00 0.00 ? 81  HIS A HD2  4  
ATOM 6663  H HE1  . HIS A 1 81  ? 4.932   6.363   -9.888  1.00 0.00 ? 81  HIS A HE1  4  
ATOM 6664  H HE2  . HIS A 1 81  ? 3.430   6.348   -7.866  1.00 0.00 ? 81  HIS A HE2  4  
ATOM 6665  N N    . ALA A 1 82  ? 2.141   3.847   -11.549 1.00 0.00 ? 82  ALA A N    4  
ATOM 6666  C CA   . ALA A 1 82  ? 2.231   4.705   -12.724 1.00 0.00 ? 82  ALA A CA   4  
ATOM 6667  C C    . ALA A 1 82  ? 3.153   4.099   -13.777 1.00 0.00 ? 82  ALA A C    4  
ATOM 6668  O O    . ALA A 1 82  ? 2.731   3.819   -14.899 1.00 0.00 ? 82  ALA A O    4  
ATOM 6669  C CB   . ALA A 1 82  ? 2.717   6.091   -12.329 1.00 0.00 ? 82  ALA A CB   4  
ATOM 6670  H H    . ALA A 1 82  ? 1.996   4.254   -10.670 1.00 0.00 ? 82  ALA A H    4  
ATOM 6671  H HA   . ALA A 1 82  ? 1.239   4.803   -13.142 1.00 0.00 ? 82  ALA A HA   4  
ATOM 6672  H HB1  . ALA A 1 82  ? 2.814   6.145   -11.255 1.00 0.00 ? 82  ALA A HB1  4  
ATOM 6673  H HB2  . ALA A 1 82  ? 3.676   6.280   -12.788 1.00 0.00 ? 82  ALA A HB2  4  
ATOM 6674  H HB3  . ALA A 1 82  ? 2.005   6.831   -12.665 1.00 0.00 ? 82  ALA A HB3  4  
ATOM 6675  N N    . GLY A 1 83  ? 4.414   3.898   -13.408 1.00 0.00 ? 83  GLY A N    4  
ATOM 6676  C CA   . GLY A 1 83  ? 5.376   3.328   -14.333 1.00 0.00 ? 83  GLY A CA   4  
ATOM 6677  C C    . GLY A 1 83  ? 6.726   3.083   -13.689 1.00 0.00 ? 83  GLY A C    4  
ATOM 6678  O O    . GLY A 1 83  ? 7.751   3.054   -14.369 1.00 0.00 ? 83  GLY A O    4  
ATOM 6679  H H    . GLY A 1 83  ? 4.694   4.141   -12.501 1.00 0.00 ? 83  GLY A H    4  
ATOM 6680  H HA2  . GLY A 1 83  ? 4.990   2.390   -14.703 1.00 0.00 ? 83  GLY A HA2  4  
ATOM 6681  H HA3  . GLY A 1 83  ? 5.505   4.005   -15.164 1.00 0.00 ? 83  GLY A HA3  4  
ATOM 6682  N N    . VAL A 1 84  ? 6.728   2.909   -12.371 1.00 0.00 ? 84  VAL A N    4  
ATOM 6683  C CA   . VAL A 1 84  ? 7.962   2.666   -11.633 1.00 0.00 ? 84  VAL A CA   4  
ATOM 6684  C C    . VAL A 1 84  ? 8.218   1.173   -11.466 1.00 0.00 ? 84  VAL A C    4  
ATOM 6685  O O    . VAL A 1 84  ? 9.345   0.704   -11.628 1.00 0.00 ? 84  VAL A O    4  
ATOM 6686  C CB   . VAL A 1 84  ? 7.925   3.328   -10.243 1.00 0.00 ? 84  VAL A CB   4  
ATOM 6687  C CG1  . VAL A 1 84  ? 6.946   2.603   -9.332  1.00 0.00 ? 84  VAL A CG1  4  
ATOM 6688  C CG2  . VAL A 1 84  ? 9.316   3.356   -9.630  1.00 0.00 ? 84  VAL A CG2  4  
ATOM 6689  H H    . VAL A 1 84  ? 5.879   2.943   -11.883 1.00 0.00 ? 84  VAL A H    4  
ATOM 6690  H HA   . VAL A 1 84  ? 8.777   3.101   -12.194 1.00 0.00 ? 84  VAL A HA   4  
ATOM 6691  H HB   . VAL A 1 84  ? 7.585   4.347   -10.361 1.00 0.00 ? 84  VAL A HB   4  
ATOM 6692  H HG11 . VAL A 1 84  ? 7.259   1.576   -9.213  1.00 0.00 ? 84  VAL A HG11 4  
ATOM 6693  H HG12 . VAL A 1 84  ? 6.924   3.088   -8.368  1.00 0.00 ? 84  VAL A HG12 4  
ATOM 6694  H HG13 . VAL A 1 84  ? 5.959   2.629   -9.771  1.00 0.00 ? 84  VAL A HG13 4  
ATOM 6695  H HG21 . VAL A 1 84  ? 9.992   2.783   -10.246 1.00 0.00 ? 84  VAL A HG21 4  
ATOM 6696  H HG22 . VAL A 1 84  ? 9.663   4.378   -9.570  1.00 0.00 ? 84  VAL A HG22 4  
ATOM 6697  H HG23 . VAL A 1 84  ? 9.282   2.930   -8.638  1.00 0.00 ? 84  VAL A HG23 4  
ATOM 6698  N N    . ARG A 1 85  ? 7.164   0.430   -11.142 1.00 0.00 ? 85  ARG A N    4  
ATOM 6699  C CA   . ARG A 1 85  ? 7.275   -1.011  -10.952 1.00 0.00 ? 85  ARG A CA   4  
ATOM 6700  C C    . ARG A 1 85  ? 5.905   -1.633  -10.700 1.00 0.00 ? 85  ARG A C    4  
ATOM 6701  O O    . ARG A 1 85  ? 4.946   -0.936  -10.364 1.00 0.00 ? 85  ARG A O    4  
ATOM 6702  C CB   . ARG A 1 85  ? 8.212   -1.323  -9.784  1.00 0.00 ? 85  ARG A CB   4  
ATOM 6703  C CG   . ARG A 1 85  ? 8.850   -2.700  -9.865  1.00 0.00 ? 85  ARG A CG   4  
ATOM 6704  C CD   . ARG A 1 85  ? 10.174  -2.745  -9.119  1.00 0.00 ? 85  ARG A CD   4  
ATOM 6705  N NE   . ARG A 1 85  ? 10.998  -3.877  -9.535  1.00 0.00 ? 85  ARG A NE   4  
ATOM 6706  C CZ   . ARG A 1 85  ? 12.273  -4.023  -9.192  1.00 0.00 ? 85  ARG A CZ   4  
ATOM 6707  N NH1  . ARG A 1 85  ? 12.866  -3.114  -8.430  1.00 0.00 ? 85  ARG A NH1  4  
ATOM 6708  N NH2  . ARG A 1 85  ? 12.957  -5.080  -9.610  1.00 0.00 ? 85  ARG A NH2  4  
ATOM 6709  H H    . ARG A 1 85  ? 6.292   0.862   -11.027 1.00 0.00 ? 85  ARG A H    4  
ATOM 6710  H HA   . ARG A 1 85  ? 7.688   -1.434  -11.856 1.00 0.00 ? 85  ARG A HA   4  
ATOM 6711  H HB2  . ARG A 1 85  ? 9.001   -0.586  -9.763  1.00 0.00 ? 85  ARG A HB2  4  
ATOM 6712  H HB3  . ARG A 1 85  ? 7.651   -1.264  -8.863  1.00 0.00 ? 85  ARG A HB3  4  
ATOM 6713  H HG2  . ARG A 1 85  ? 8.178   -3.424  -9.428  1.00 0.00 ? 85  ARG A HG2  4  
ATOM 6714  H HG3  . ARG A 1 85  ? 9.022   -2.946  -10.902 1.00 0.00 ? 85  ARG A HG3  4  
ATOM 6715  H HD2  . ARG A 1 85  ? 10.712  -1.830  -9.313  1.00 0.00 ? 85  ARG A HD2  4  
ATOM 6716  H HD3  . ARG A 1 85  ? 9.973   -2.828  -8.061  1.00 0.00 ? 85  ARG A HD3  4  
ATOM 6717  H HE   . ARG A 1 85  ? 10.580  -4.560  -10.098 1.00 0.00 ? 85  ARG A HE   4  
ATOM 6718  H HH11 . ARG A 1 85  ? 12.353  -2.317  -8.113  1.00 0.00 ? 85  ARG A HH11 4  
ATOM 6719  H HH12 . ARG A 1 85  ? 13.826  -3.227  -8.172  1.00 0.00 ? 85  ARG A HH12 4  
ATOM 6720  H HH21 . ARG A 1 85  ? 12.513  -5.768  -10.184 1.00 0.00 ? 85  ARG A HH21 4  
ATOM 6721  H HH22 . ARG A 1 85  ? 13.916  -5.189  -9.351  1.00 0.00 ? 85  ARG A HH22 4  
ATOM 6722  N N    . THR A 1 86  ? 5.818   -2.950  -10.863 1.00 0.00 ? 86  THR A N    4  
ATOM 6723  C CA   . THR A 1 86  ? 4.566   -3.665  -10.655 1.00 0.00 ? 86  THR A CA   4  
ATOM 6724  C C    . THR A 1 86  ? 4.786   -4.932  -9.836  1.00 0.00 ? 86  THR A C    4  
ATOM 6725  O O    . THR A 1 86  ? 5.246   -5.948  -10.358 1.00 0.00 ? 86  THR A O    4  
ATOM 6726  C CB   . THR A 1 86  ? 3.904   -4.042  -11.994 1.00 0.00 ? 86  THR A CB   4  
ATOM 6727  O OG1  . THR A 1 86  ? 3.585   -2.857  -12.733 1.00 0.00 ? 86  THR A OG1  4  
ATOM 6728  C CG2  . THR A 1 86  ? 2.641   -4.857  -11.764 1.00 0.00 ? 86  THR A CG2  4  
ATOM 6729  H H    . THR A 1 86  ? 6.617   -3.450  -11.132 1.00 0.00 ? 86  THR A H    4  
ATOM 6730  H HA   . THR A 1 86  ? 3.894   -3.012  -10.117 1.00 0.00 ? 86  THR A HA   4  
ATOM 6731  H HB   . THR A 1 86  ? 4.600   -4.638  -12.567 1.00 0.00 ? 86  THR A HB   4  
ATOM 6732  H HG1  . THR A 1 86  ? 3.042   -3.089  -13.490 1.00 0.00 ? 86  THR A HG1  4  
ATOM 6733  H HG21 . THR A 1 86  ? 2.391   -5.397  -12.665 1.00 0.00 ? 86  THR A HG21 4  
ATOM 6734  H HG22 . THR A 1 86  ? 1.829   -4.196  -11.502 1.00 0.00 ? 86  THR A HG22 4  
ATOM 6735  H HG23 . THR A 1 86  ? 2.808   -5.558  -10.960 1.00 0.00 ? 86  THR A HG23 4  
ATOM 6736  N N    . TYR A 1 87  ? 4.455   -4.866  -8.552  1.00 0.00 ? 87  TYR A N    4  
ATOM 6737  C CA   . TYR A 1 87  ? 4.618   -6.008  -7.660  1.00 0.00 ? 87  TYR A CA   4  
ATOM 6738  C C    . TYR A 1 87  ? 3.458   -6.987  -7.811  1.00 0.00 ? 87  TYR A C    4  
ATOM 6739  O O    . TYR A 1 87  ? 2.430   -6.663  -8.406  1.00 0.00 ? 87  TYR A O    4  
ATOM 6740  C CB   . TYR A 1 87  ? 4.719   -5.538  -6.208  1.00 0.00 ? 87  TYR A CB   4  
ATOM 6741  C CG   . TYR A 1 87  ? 5.912   -4.648  -5.941  1.00 0.00 ? 87  TYR A CG   4  
ATOM 6742  C CD1  . TYR A 1 87  ? 5.940   -3.336  -6.396  1.00 0.00 ? 87  TYR A CD1  4  
ATOM 6743  C CD2  . TYR A 1 87  ? 7.011   -5.120  -5.234  1.00 0.00 ? 87  TYR A CD2  4  
ATOM 6744  C CE1  . TYR A 1 87  ? 7.028   -2.519  -6.154  1.00 0.00 ? 87  TYR A CE1  4  
ATOM 6745  C CE2  . TYR A 1 87  ? 8.102   -4.311  -4.987  1.00 0.00 ? 87  TYR A CE2  4  
ATOM 6746  C CZ   . TYR A 1 87  ? 8.106   -3.011  -5.449  1.00 0.00 ? 87  TYR A CZ   4  
ATOM 6747  O OH   . TYR A 1 87  ? 9.193   -2.202  -5.206  1.00 0.00 ? 87  TYR A OH   4  
ATOM 6748  H H    . TYR A 1 87  ? 4.093   -4.028  -8.194  1.00 0.00 ? 87  TYR A H    4  
ATOM 6749  H HA   . TYR A 1 87  ? 5.536   -6.510  -7.930  1.00 0.00 ? 87  TYR A HA   4  
ATOM 6750  H HB2  . TYR A 1 87  ? 3.829   -4.983  -5.954  1.00 0.00 ? 87  TYR A HB2  4  
ATOM 6751  H HB3  . TYR A 1 87  ? 4.796   -6.400  -5.562  1.00 0.00 ? 87  TYR A HB3  4  
ATOM 6752  H HD1  . TYR A 1 87  ? 5.094   -2.953  -6.948  1.00 0.00 ? 87  TYR A HD1  4  
ATOM 6753  H HD2  . TYR A 1 87  ? 7.004   -6.139  -4.874  1.00 0.00 ? 87  TYR A HD2  4  
ATOM 6754  H HE1  . TYR A 1 87  ? 7.032   -1.502  -6.516  1.00 0.00 ? 87  TYR A HE1  4  
ATOM 6755  H HE2  . TYR A 1 87  ? 8.947   -4.696  -4.435  1.00 0.00 ? 87  TYR A HE2  4  
ATOM 6756  H HH   . TYR A 1 87  ? 9.422   -1.725  -6.007  1.00 0.00 ? 87  TYR A HH   4  
ATOM 6757  N N    . PHE A 1 88  ? 3.631   -8.187  -7.266  1.00 0.00 ? 88  PHE A N    4  
ATOM 6758  C CA   . PHE A 1 88  ? 2.599   -9.215  -7.339  1.00 0.00 ? 88  PHE A CA   4  
ATOM 6759  C C    . PHE A 1 88  ? 2.463   -9.945  -6.006  1.00 0.00 ? 88  PHE A C    4  
ATOM 6760  O O    . PHE A 1 88  ? 3.423   -10.047 -5.241  1.00 0.00 ? 88  PHE A O    4  
ATOM 6761  C CB   . PHE A 1 88  ? 2.924   -10.216 -8.450  1.00 0.00 ? 88  PHE A CB   4  
ATOM 6762  C CG   . PHE A 1 88  ? 2.692   -9.674  -9.832  1.00 0.00 ? 88  PHE A CG   4  
ATOM 6763  C CD1  . PHE A 1 88  ? 3.610   -8.817  -10.418 1.00 0.00 ? 88  PHE A CD1  4  
ATOM 6764  C CD2  . PHE A 1 88  ? 1.556   -10.022 -10.545 1.00 0.00 ? 88  PHE A CD2  4  
ATOM 6765  C CE1  . PHE A 1 88  ? 3.398   -8.317  -11.688 1.00 0.00 ? 88  PHE A CE1  4  
ATOM 6766  C CE2  . PHE A 1 88  ? 1.339   -9.525  -11.816 1.00 0.00 ? 88  PHE A CE2  4  
ATOM 6767  C CZ   . PHE A 1 88  ? 2.262   -8.672  -12.389 1.00 0.00 ? 88  PHE A CZ   4  
ATOM 6768  H H    . PHE A 1 88  ? 4.473   -8.386  -6.805  1.00 0.00 ? 88  PHE A H    4  
ATOM 6769  H HA   . PHE A 1 88  ? 1.663   -8.729  -7.567  1.00 0.00 ? 88  PHE A HA   4  
ATOM 6770  H HB2  . PHE A 1 88  ? 3.963   -10.500 -8.376  1.00 0.00 ? 88  PHE A HB2  4  
ATOM 6771  H HB3  . PHE A 1 88  ? 2.306   -11.092 -8.328  1.00 0.00 ? 88  PHE A HB3  4  
ATOM 6772  H HD1  . PHE A 1 88  ? 4.500   -8.539  -9.872  1.00 0.00 ? 88  PHE A HD1  4  
ATOM 6773  H HD2  . PHE A 1 88  ? 0.833   -10.690 -10.097 1.00 0.00 ? 88  PHE A HD2  4  
ATOM 6774  H HE1  . PHE A 1 88  ? 4.121   -7.650  -12.134 1.00 0.00 ? 88  PHE A HE1  4  
ATOM 6775  H HE2  . PHE A 1 88  ? 0.450   -9.804  -12.361 1.00 0.00 ? 88  PHE A HE2  4  
ATOM 6776  H HZ   . PHE A 1 88  ? 2.094   -8.282  -13.382 1.00 0.00 ? 88  PHE A HZ   4  
ATOM 6777  N N    . PHE A 1 89  ? 1.264   -10.449 -5.734  1.00 0.00 ? 89  PHE A N    4  
ATOM 6778  C CA   . PHE A 1 89  ? 1.001   -11.168 -4.493  1.00 0.00 ? 89  PHE A CA   4  
ATOM 6779  C C    . PHE A 1 89  ? -0.021  -12.280 -4.715  1.00 0.00 ? 89  PHE A C    4  
ATOM 6780  O O    . PHE A 1 89  ? -1.005  -12.099 -5.432  1.00 0.00 ? 89  PHE A O    4  
ATOM 6781  C CB   . PHE A 1 89  ? 0.497   -10.204 -3.417  1.00 0.00 ? 89  PHE A CB   4  
ATOM 6782  C CG   . PHE A 1 89  ? 1.342   -8.970  -3.275  1.00 0.00 ? 89  PHE A CG   4  
ATOM 6783  C CD1  . PHE A 1 89  ? 2.657   -9.060  -2.848  1.00 0.00 ? 89  PHE A CD1  4  
ATOM 6784  C CD2  . PHE A 1 89  ? 0.822   -7.720  -3.569  1.00 0.00 ? 89  PHE A CD2  4  
ATOM 6785  C CE1  . PHE A 1 89  ? 3.436   -7.927  -2.716  1.00 0.00 ? 89  PHE A CE1  4  
ATOM 6786  C CE2  . PHE A 1 89  ? 1.596   -6.583  -3.439  1.00 0.00 ? 89  PHE A CE2  4  
ATOM 6787  C CZ   . PHE A 1 89  ? 2.906   -6.686  -3.013  1.00 0.00 ? 89  PHE A CZ   4  
ATOM 6788  H H    . PHE A 1 89  ? 0.539   -10.335 -6.384  1.00 0.00 ? 89  PHE A H    4  
ATOM 6789  H HA   . PHE A 1 89  ? 1.929   -11.609 -4.163  1.00 0.00 ? 89  PHE A HA   4  
ATOM 6790  H HB2  . PHE A 1 89  ? -0.506  -9.892  -3.665  1.00 0.00 ? 89  PHE A HB2  4  
ATOM 6791  H HB3  . PHE A 1 89  ? 0.487   -10.712 -2.465  1.00 0.00 ? 89  PHE A HB3  4  
ATOM 6792  H HD1  . PHE A 1 89  ? 3.074   -10.029 -2.617  1.00 0.00 ? 89  PHE A HD1  4  
ATOM 6793  H HD2  . PHE A 1 89  ? -0.203  -7.638  -3.903  1.00 0.00 ? 89  PHE A HD2  4  
ATOM 6794  H HE1  . PHE A 1 89  ? 4.460   -8.010  -2.383  1.00 0.00 ? 89  PHE A HE1  4  
ATOM 6795  H HE2  . PHE A 1 89  ? 1.178   -5.615  -3.673  1.00 0.00 ? 89  PHE A HE2  4  
ATOM 6796  H HZ   . PHE A 1 89  ? 3.512   -5.799  -2.910  1.00 0.00 ? 89  PHE A HZ   4  
ATOM 6797  N N    . SER A 1 90  ? 0.221   -13.430 -4.094  1.00 0.00 ? 90  SER A N    4  
ATOM 6798  C CA   . SER A 1 90  ? -0.675  -14.573 -4.226  1.00 0.00 ? 90  SER A CA   4  
ATOM 6799  C C    . SER A 1 90  ? -1.182  -15.026 -2.861  1.00 0.00 ? 90  SER A C    4  
ATOM 6800  O O    . SER A 1 90  ? -0.401  -15.425 -1.997  1.00 0.00 ? 90  SER A O    4  
ATOM 6801  C CB   . SER A 1 90  ? 0.040   -15.730 -4.927  1.00 0.00 ? 90  SER A CB   4  
ATOM 6802  O OG   . SER A 1 90  ? -0.739  -16.913 -4.882  1.00 0.00 ? 90  SER A OG   4  
ATOM 6803  H H    . SER A 1 90  ? 1.023   -13.512 -3.536  1.00 0.00 ? 90  SER A H    4  
ATOM 6804  H HA   . SER A 1 90  ? -1.518  -14.265 -4.826  1.00 0.00 ? 90  SER A HA   4  
ATOM 6805  H HB2  . SER A 1 90  ? 0.215   -15.468 -5.959  1.00 0.00 ? 90  SER A HB2  4  
ATOM 6806  H HB3  . SER A 1 90  ? 0.984   -15.915 -4.437  1.00 0.00 ? 90  SER A HB3  4  
ATOM 6807  H HG   . SER A 1 90  ? -1.562  -16.773 -5.355  1.00 0.00 ? 90  SER A HG   4  
ATOM 6808  N N    . ALA A 1 91  ? -2.497  -14.961 -2.673  1.00 0.00 ? 91  ALA A N    4  
ATOM 6809  C CA   . ALA A 1 91  ? -3.110  -15.367 -1.414  1.00 0.00 ? 91  ALA A CA   4  
ATOM 6810  C C    . ALA A 1 91  ? -3.479  -16.846 -1.435  1.00 0.00 ? 91  ALA A C    4  
ATOM 6811  O O    . ALA A 1 91  ? -3.948  -17.363 -2.448  1.00 0.00 ? 91  ALA A O    4  
ATOM 6812  C CB   . ALA A 1 91  ? -4.339  -14.517 -1.129  1.00 0.00 ? 91  ALA A CB   4  
ATOM 6813  H H    . ALA A 1 91  ? -3.067  -14.635 -3.400  1.00 0.00 ? 91  ALA A H    4  
ATOM 6814  H HA   . ALA A 1 91  ? -2.393  -15.196 -0.624  1.00 0.00 ? 91  ALA A HA   4  
ATOM 6815  H HB1  . ALA A 1 91  ? -4.061  -13.473 -1.123  1.00 0.00 ? 91  ALA A HB1  4  
ATOM 6816  H HB2  . ALA A 1 91  ? -5.081  -14.689 -1.895  1.00 0.00 ? 91  ALA A HB2  4  
ATOM 6817  H HB3  . ALA A 1 91  ? -4.747  -14.787 -0.166  1.00 0.00 ? 91  ALA A HB3  4  
ATOM 6818  N N    . GLU A 1 92  ? -3.263  -17.521 -0.310  1.00 0.00 ? 92  GLU A N    4  
ATOM 6819  C CA   . GLU A 1 92  ? -3.573  -18.941 -0.201  1.00 0.00 ? 92  GLU A CA   4  
ATOM 6820  C C    . GLU A 1 92  ? -5.074  -19.183 -0.336  1.00 0.00 ? 92  GLU A C    4  
ATOM 6821  O O    . GLU A 1 92  ? -5.503  -20.152 -0.962  1.00 0.00 ? 92  GLU A O    4  
ATOM 6822  C CB   . GLU A 1 92  ? -3.074  -19.493 1.136   1.00 0.00 ? 92  GLU A CB   4  
ATOM 6823  C CG   . GLU A 1 92  ? -1.569  -19.390 1.315   1.00 0.00 ? 92  GLU A CG   4  
ATOM 6824  C CD   . GLU A 1 92  ? -1.014  -20.469 2.224   1.00 0.00 ? 92  GLU A CD   4  
ATOM 6825  O OE1  . GLU A 1 92  ? -1.349  -20.460 3.427   1.00 0.00 ? 92  GLU A OE1  4  
ATOM 6826  O OE2  . GLU A 1 92  ? -0.244  -21.320 1.734   1.00 0.00 ? 92  GLU A OE2  4  
ATOM 6827  H H    . GLU A 1 92  ? -2.887  -17.052 0.464   1.00 0.00 ? 92  GLU A H    4  
ATOM 6828  H HA   . GLU A 1 92  ? -3.064  -19.454 -1.003  1.00 0.00 ? 92  GLU A HA   4  
ATOM 6829  H HB2  . GLU A 1 92  ? -3.550  -18.947 1.938   1.00 0.00 ? 92  GLU A HB2  4  
ATOM 6830  H HB3  . GLU A 1 92  ? -3.353  -20.534 1.208   1.00 0.00 ? 92  GLU A HB3  4  
ATOM 6831  H HG2  . GLU A 1 92  ? -1.098  -19.479 0.347   1.00 0.00 ? 92  GLU A HG2  4  
ATOM 6832  H HG3  . GLU A 1 92  ? -1.335  -18.425 1.740   1.00 0.00 ? 92  GLU A HG3  4  
ATOM 6833  N N    . SER A 1 93  ? -5.866  -18.296 0.257   1.00 0.00 ? 93  SER A N    4  
ATOM 6834  C CA   . SER A 1 93  ? -7.318  -18.414 0.207   1.00 0.00 ? 93  SER A CA   4  
ATOM 6835  C C    . SER A 1 93  ? -7.932  -17.254 -0.570  1.00 0.00 ? 93  SER A C    4  
ATOM 6836  O O    . SER A 1 93  ? -7.347  -16.178 -0.694  1.00 0.00 ? 93  SER A O    4  
ATOM 6837  C CB   . SER A 1 93  ? -7.896  -18.456 1.623   1.00 0.00 ? 93  SER A CB   4  
ATOM 6838  O OG   . SER A 1 93  ? -7.888  -19.776 2.139   1.00 0.00 ? 93  SER A OG   4  
ATOM 6839  H H    . SER A 1 93  ? -5.463  -17.545 0.742   1.00 0.00 ? 93  SER A H    4  
ATOM 6840  H HA   . SER A 1 93  ? -7.558  -19.338 -0.298  1.00 0.00 ? 93  SER A HA   4  
ATOM 6841  H HB2  . SER A 1 93  ? -7.305  -17.826 2.270   1.00 0.00 ? 93  SER A HB2  4  
ATOM 6842  H HB3  . SER A 1 93  ? -8.915  -18.096 1.604   1.00 0.00 ? 93  SER A HB3  4  
ATOM 6843  H HG   . SER A 1 93  ? -7.103  -19.905 2.676   1.00 0.00 ? 93  SER A HG   4  
ATOM 6844  N N    . PRO A 1 94  ? -9.140  -17.476 -1.108  1.00 0.00 ? 94  PRO A N    4  
ATOM 6845  C CA   . PRO A 1 94  ? -9.861  -16.462 -1.883  1.00 0.00 ? 94  PRO A CA   4  
ATOM 6846  C C    . PRO A 1 94  ? -10.352 -15.309 -1.014  1.00 0.00 ? 94  PRO A C    4  
ATOM 6847  O O    . PRO A 1 94  ? -10.458 -14.174 -1.476  1.00 0.00 ? 94  PRO A O    4  
ATOM 6848  C CB   . PRO A 1 94  ? -11.046 -17.236 -2.465  1.00 0.00 ? 94  PRO A CB   4  
ATOM 6849  C CG   . PRO A 1 94  ? -11.259 -18.369 -1.521  1.00 0.00 ? 94  PRO A CG   4  
ATOM 6850  C CD   . PRO A 1 94  ? -9.896  -18.735 -1.001  1.00 0.00 ? 94  PRO A CD   4  
ATOM 6851  H HA   . PRO A 1 94  ? -9.254  -16.072 -2.687  1.00 0.00 ? 94  PRO A HA   4  
ATOM 6852  H HB2  . PRO A 1 94  ? -11.913 -16.591 -2.510  1.00 0.00 ? 94  PRO A HB2  4  
ATOM 6853  H HB3  . PRO A 1 94  ? -10.800 -17.588 -3.455  1.00 0.00 ? 94  PRO A HB3  4  
ATOM 6854  H HG2  . PRO A 1 94  ? -11.898 -18.057 -0.710  1.00 0.00 ? 94  PRO A HG2  4  
ATOM 6855  H HG3  . PRO A 1 94  ? -11.697 -19.206 -2.045  1.00 0.00 ? 94  PRO A HG3  4  
ATOM 6856  H HD2  . PRO A 1 94  ? -9.960  -19.061 0.027   1.00 0.00 ? 94  PRO A HD2  4  
ATOM 6857  H HD3  . PRO A 1 94  ? -9.452  -19.505 -1.616  1.00 0.00 ? 94  PRO A HD3  4  
ATOM 6858  N N    . GLU A 1 95  ? -10.648 -15.609 0.247   1.00 0.00 ? 95  GLU A N    4  
ATOM 6859  C CA   . GLU A 1 95  ? -11.128 -14.596 1.179   1.00 0.00 ? 95  GLU A CA   4  
ATOM 6860  C C    . GLU A 1 95  ? -10.042 -13.564 1.468   1.00 0.00 ? 95  GLU A C    4  
ATOM 6861  O O    . GLU A 1 95  ? -10.327 -12.379 1.636   1.00 0.00 ? 95  GLU A O    4  
ATOM 6862  C CB   . GLU A 1 95  ? -11.587 -15.250 2.485   1.00 0.00 ? 95  GLU A CB   4  
ATOM 6863  C CG   . GLU A 1 95  ? -10.475 -15.973 3.226   1.00 0.00 ? 95  GLU A CG   4  
ATOM 6864  C CD   . GLU A 1 95  ? -10.994 -16.827 4.367   1.00 0.00 ? 95  GLU A CD   4  
ATOM 6865  O OE1  . GLU A 1 95  ? -11.922 -16.377 5.071   1.00 0.00 ? 95  GLU A OE1  4  
ATOM 6866  O OE2  . GLU A 1 95  ? -10.471 -17.945 4.556   1.00 0.00 ? 95  GLU A OE2  4  
ATOM 6867  H H    . GLU A 1 95  ? -10.542 -16.533 0.556   1.00 0.00 ? 95  GLU A H    4  
ATOM 6868  H HA   . GLU A 1 95  ? -11.970 -14.097 0.723   1.00 0.00 ? 95  GLU A HA   4  
ATOM 6869  H HB2  . GLU A 1 95  ? -11.987 -14.486 3.135   1.00 0.00 ? 95  GLU A HB2  4  
ATOM 6870  H HB3  . GLU A 1 95  ? -12.365 -15.964 2.261   1.00 0.00 ? 95  GLU A HB3  4  
ATOM 6871  H HG2  . GLU A 1 95  ? -9.951  -16.611 2.530   1.00 0.00 ? 95  GLU A HG2  4  
ATOM 6872  H HG3  . GLU A 1 95  ? -9.790  -15.240 3.627   1.00 0.00 ? 95  GLU A HG3  4  
ATOM 6873  N N    . GLU A 1 96  ? -8.796  -14.025 1.526   1.00 0.00 ? 96  GLU A N    4  
ATOM 6874  C CA   . GLU A 1 96  ? -7.668  -13.142 1.796   1.00 0.00 ? 96  GLU A CA   4  
ATOM 6875  C C    . GLU A 1 96  ? -7.364  -12.261 0.587   1.00 0.00 ? 96  GLU A C    4  
ATOM 6876  O O    . GLU A 1 96  ? -7.207  -11.048 0.715   1.00 0.00 ? 96  GLU A O    4  
ATOM 6877  C CB   . GLU A 1 96  ? -6.429  -13.960 2.168   1.00 0.00 ? 96  GLU A CB   4  
ATOM 6878  C CG   . GLU A 1 96  ? -6.383  -14.360 3.633   1.00 0.00 ? 96  GLU A CG   4  
ATOM 6879  C CD   . GLU A 1 96  ? -5.385  -15.470 3.903   1.00 0.00 ? 96  GLU A CD   4  
ATOM 6880  O OE1  . GLU A 1 96  ? -5.614  -16.603 3.431   1.00 0.00 ? 96  GLU A OE1  4  
ATOM 6881  O OE2  . GLU A 1 96  ? -4.374  -15.204 4.587   1.00 0.00 ? 96  GLU A OE2  4  
ATOM 6882  H H    . GLU A 1 96  ? -8.633  -14.981 1.384   1.00 0.00 ? 96  GLU A H    4  
ATOM 6883  H HA   . GLU A 1 96  ? -7.934  -12.509 2.629   1.00 0.00 ? 96  GLU A HA   4  
ATOM 6884  H HB2  . GLU A 1 96  ? -6.413  -14.859 1.570   1.00 0.00 ? 96  GLU A HB2  4  
ATOM 6885  H HB3  . GLU A 1 96  ? -5.548  -13.376 1.948   1.00 0.00 ? 96  GLU A HB3  4  
ATOM 6886  H HG2  . GLU A 1 96  ? -6.106  -13.498 4.220   1.00 0.00 ? 96  GLU A HG2  4  
ATOM 6887  H HG3  . GLU A 1 96  ? -7.364  -14.698 3.933   1.00 0.00 ? 96  GLU A HG3  4  
ATOM 6888  N N    . GLN A 1 97  ? -7.284  -12.883 -0.585  1.00 0.00 ? 97  GLN A N    4  
ATOM 6889  C CA   . GLN A 1 97  ? -6.998  -12.156 -1.817  1.00 0.00 ? 97  GLN A CA   4  
ATOM 6890  C C    . GLN A 1 97  ? -7.766  -10.839 -1.862  1.00 0.00 ? 97  GLN A C    4  
ATOM 6891  O O    . GLN A 1 97  ? -7.170  -9.763  -1.846  1.00 0.00 ? 97  GLN A O    4  
ATOM 6892  C CB   . GLN A 1 97  ? -7.356  -13.012 -3.033  1.00 0.00 ? 97  GLN A CB   4  
ATOM 6893  C CG   . GLN A 1 97  ? -7.096  -12.319 -4.361  1.00 0.00 ? 97  GLN A CG   4  
ATOM 6894  C CD   . GLN A 1 97  ? -8.045  -12.774 -5.452  1.00 0.00 ? 97  GLN A CD   4  
ATOM 6895  O OE1  . GLN A 1 97  ? -9.055  -13.424 -5.181  1.00 0.00 ? 97  GLN A OE1  4  
ATOM 6896  N NE2  . GLN A 1 97  ? -7.725  -12.434 -6.696  1.00 0.00 ? 97  GLN A NE2  4  
ATOM 6897  H H    . GLN A 1 97  ? -7.419  -13.852 -0.623  1.00 0.00 ? 97  GLN A H    4  
ATOM 6898  H HA   . GLN A 1 97  ? -5.940  -11.943 -1.837  1.00 0.00 ? 97  GLN A HA   4  
ATOM 6899  H HB2  . GLN A 1 97  ? -6.772  -13.920 -3.004  1.00 0.00 ? 97  GLN A HB2  4  
ATOM 6900  H HB3  . GLN A 1 97  ? -8.405  -13.265 -2.984  1.00 0.00 ? 97  GLN A HB3  4  
ATOM 6901  H HG2  . GLN A 1 97  ? -7.211  -11.254 -4.226  1.00 0.00 ? 97  GLN A HG2  4  
ATOM 6902  H HG3  . GLN A 1 97  ? -6.084  -12.534 -4.672  1.00 0.00 ? 97  GLN A HG3  4  
ATOM 6903  H HE21 . GLN A 1 97  ? -6.903  -11.917 -6.837  1.00 0.00 ? 97  GLN A HE21 4  
ATOM 6904  H HE22 . GLN A 1 97  ? -8.320  -12.716 -7.420  1.00 0.00 ? 97  GLN A HE22 4  
ATOM 6905  N N    . GLU A 1 98  ? -9.090  -10.934 -1.919  1.00 0.00 ? 98  GLU A N    4  
ATOM 6906  C CA   . GLU A 1 98  ? -9.939  -9.749  -1.968  1.00 0.00 ? 98  GLU A CA   4  
ATOM 6907  C C    . GLU A 1 98  ? -9.613  -8.799  -0.820  1.00 0.00 ? 98  GLU A C    4  
ATOM 6908  O O    . GLU A 1 98  ? -9.386  -7.608  -1.031  1.00 0.00 ? 98  GLU A O    4  
ATOM 6909  C CB   . GLU A 1 98  ? -11.415 -10.149 -1.912  1.00 0.00 ? 98  GLU A CB   4  
ATOM 6910  C CG   . GLU A 1 98  ? -11.891 -10.894 -3.147  1.00 0.00 ? 98  GLU A CG   4  
ATOM 6911  C CD   . GLU A 1 98  ? -13.387 -11.143 -3.137  1.00 0.00 ? 98  GLU A CD   4  
ATOM 6912  O OE1  . GLU A 1 98  ? -13.832 -12.050 -2.403  1.00 0.00 ? 98  GLU A OE1  4  
ATOM 6913  O OE2  . GLU A 1 98  ? -14.112 -10.431 -3.863  1.00 0.00 ? 98  GLU A OE2  4  
ATOM 6914  H H    . GLU A 1 98  ? -9.507  -11.821 -1.929  1.00 0.00 ? 98  GLU A H    4  
ATOM 6915  H HA   . GLU A 1 98  ? -9.748  -9.243  -2.903  1.00 0.00 ? 98  GLU A HA   4  
ATOM 6916  H HB2  . GLU A 1 98  ? -11.571 -10.782 -1.051  1.00 0.00 ? 98  GLU A HB2  4  
ATOM 6917  H HB3  . GLU A 1 98  ? -12.012 -9.256  -1.803  1.00 0.00 ? 98  GLU A HB3  4  
ATOM 6918  H HG2  . GLU A 1 98  ? -11.645 -10.311 -4.021  1.00 0.00 ? 98  GLU A HG2  4  
ATOM 6919  H HG3  . GLU A 1 98  ? -11.383 -11.846 -3.195  1.00 0.00 ? 98  GLU A HG3  4  
ATOM 6920  N N    . ALA A 1 99  ? -9.593  -9.335  0.396   1.00 0.00 ? 99  ALA A N    4  
ATOM 6921  C CA   . ALA A 1 99  ? -9.294  -8.536  1.578   1.00 0.00 ? 99  ALA A CA   4  
ATOM 6922  C C    . ALA A 1 99  ? -8.065  -7.662  1.354   1.00 0.00 ? 99  ALA A C    4  
ATOM 6923  O O    . ALA A 1 99  ? -8.066  -6.476  1.683   1.00 0.00 ? 99  ALA A O    4  
ATOM 6924  C CB   . ALA A 1 99  ? -9.090  -9.438  2.787   1.00 0.00 ? 99  ALA A CB   4  
ATOM 6925  H H    . ALA A 1 99  ? -9.782  -10.290 0.500   1.00 0.00 ? 99  ALA A H    4  
ATOM 6926  H HA   . ALA A 1 99  ? -10.145 -7.899  1.775   1.00 0.00 ? 99  ALA A HA   4  
ATOM 6927  H HB1  . ALA A 1 99  ? -9.562  -10.392 2.606   1.00 0.00 ? 99  ALA A HB1  4  
ATOM 6928  H HB2  . ALA A 1 99  ? -8.033  -9.584  2.952   1.00 0.00 ? 99  ALA A HB2  4  
ATOM 6929  H HB3  . ALA A 1 99  ? -9.530  -8.977  3.658   1.00 0.00 ? 99  ALA A HB3  4  
ATOM 6930  N N    . TRP A 1 100 ? -7.017  -8.256  0.794   1.00 0.00 ? 100 TRP A N    4  
ATOM 6931  C CA   . TRP A 1 100 ? -5.780  -7.531  0.526   1.00 0.00 ? 100 TRP A CA   4  
ATOM 6932  C C    . TRP A 1 100 ? -5.991  -6.473  -0.552  1.00 0.00 ? 100 TRP A C    4  
ATOM 6933  O O    . TRP A 1 100 ? -5.716  -5.292  -0.337  1.00 0.00 ? 100 TRP A O    4  
ATOM 6934  C CB   . TRP A 1 100 ? -4.678  -8.501  0.098   1.00 0.00 ? 100 TRP A CB   4  
ATOM 6935  C CG   . TRP A 1 100 ? -3.945  -9.114  1.252   1.00 0.00 ? 100 TRP A CG   4  
ATOM 6936  C CD1  . TRP A 1 100 ? -4.101  -10.379 1.744   1.00 0.00 ? 100 TRP A CD1  4  
ATOM 6937  C CD2  . TRP A 1 100 ? -2.942  -8.489  2.059   1.00 0.00 ? 100 TRP A CD2  4  
ATOM 6938  N NE1  . TRP A 1 100 ? -3.255  -10.577 2.808   1.00 0.00 ? 100 TRP A NE1  4  
ATOM 6939  C CE2  . TRP A 1 100 ? -2.533  -9.433  3.022   1.00 0.00 ? 100 TRP A CE2  4  
ATOM 6940  C CE3  . TRP A 1 100 ? -2.348  -7.224  2.062   1.00 0.00 ? 100 TRP A CE3  4  
ATOM 6941  C CZ2  . TRP A 1 100 ? -1.559  -9.149  3.975   1.00 0.00 ? 100 TRP A CZ2  4  
ATOM 6942  C CZ3  . TRP A 1 100 ? -1.382  -6.944  3.010   1.00 0.00 ? 100 TRP A CZ3  4  
ATOM 6943  C CH2  . TRP A 1 100 ? -0.994  -7.903  3.955   1.00 0.00 ? 100 TRP A CH2  4  
ATOM 6944  H H    . TRP A 1 100 ? -7.076  -9.205  0.554   1.00 0.00 ? 100 TRP A H    4  
ATOM 6945  H HA   . TRP A 1 100 ? -5.480  -7.041  1.441   1.00 0.00 ? 100 TRP A HA   4  
ATOM 6946  H HB2  . TRP A 1 100 ? -5.116  -9.300  -0.481  1.00 0.00 ? 100 TRP A HB2  4  
ATOM 6947  H HB3  . TRP A 1 100 ? -3.960  -7.972  -0.512  1.00 0.00 ? 100 TRP A HB3  4  
ATOM 6948  H HD1  . TRP A 1 100 ? -4.793  -11.105 1.345   1.00 0.00 ? 100 TRP A HD1  4  
ATOM 6949  H HE1  . TRP A 1 100 ? -3.180  -11.404 3.329   1.00 0.00 ? 100 TRP A HE1  4  
ATOM 6950  H HE3  . TRP A 1 100 ? -2.633  -6.471  1.342   1.00 0.00 ? 100 TRP A HE3  4  
ATOM 6951  H HZ2  . TRP A 1 100 ? -1.249  -9.878  4.710   1.00 0.00 ? 100 TRP A HZ2  4  
ATOM 6952  H HZ3  . TRP A 1 100 ? -0.912  -5.971  3.028   1.00 0.00 ? 100 TRP A HZ3  4  
ATOM 6953  H HH2  . TRP A 1 100 ? -0.236  -7.640  4.677   1.00 0.00 ? 100 TRP A HH2  4  
ATOM 6954  N N    . ILE A 1 101 ? -6.481  -6.904  -1.709  1.00 0.00 ? 101 ILE A N    4  
ATOM 6955  C CA   . ILE A 1 101 ? -6.730  -5.993  -2.819  1.00 0.00 ? 101 ILE A CA   4  
ATOM 6956  C C    . ILE A 1 101 ? -7.354  -4.690  -2.332  1.00 0.00 ? 101 ILE A C    4  
ATOM 6957  O O    . ILE A 1 101 ? -7.082  -3.620  -2.875  1.00 0.00 ? 101 ILE A O    4  
ATOM 6958  C CB   . ILE A 1 101 ? -7.655  -6.629  -3.873  1.00 0.00 ? 101 ILE A CB   4  
ATOM 6959  C CG1  . ILE A 1 101 ? -6.917  -7.735  -4.631  1.00 0.00 ? 101 ILE A CG1  4  
ATOM 6960  C CG2  . ILE A 1 101 ? -8.166  -5.570  -4.838  1.00 0.00 ? 101 ILE A CG2  4  
ATOM 6961  C CD1  . ILE A 1 101 ? -7.800  -8.506  -5.586  1.00 0.00 ? 101 ILE A CD1  4  
ATOM 6962  H H    . ILE A 1 101 ? -6.680  -7.857  -1.819  1.00 0.00 ? 101 ILE A H    4  
ATOM 6963  H HA   . ILE A 1 101 ? -5.781  -5.773  -3.288  1.00 0.00 ? 101 ILE A HA   4  
ATOM 6964  H HB   . ILE A 1 101 ? -8.504  -7.057  -3.363  1.00 0.00 ? 101 ILE A HB   4  
ATOM 6965  H HG12 . ILE A 1 101 ? -6.114  -7.297  -5.202  1.00 0.00 ? 101 ILE A HG12 4  
ATOM 6966  H HG13 . ILE A 1 101 ? -6.506  -8.436  -3.919  1.00 0.00 ? 101 ILE A HG13 4  
ATOM 6967  H HG21 . ILE A 1 101 ? -7.366  -4.885  -5.078  1.00 0.00 ? 101 ILE A HG21 4  
ATOM 6968  H HG22 . ILE A 1 101 ? -8.516  -6.045  -5.742  1.00 0.00 ? 101 ILE A HG22 4  
ATOM 6969  H HG23 . ILE A 1 101 ? -8.979  -5.027  -4.379  1.00 0.00 ? 101 ILE A HG23 4  
ATOM 6970  H HD11 . ILE A 1 101 ? -7.747  -9.560  -5.355  1.00 0.00 ? 101 ILE A HD11 4  
ATOM 6971  H HD12 . ILE A 1 101 ? -8.820  -8.166  -5.489  1.00 0.00 ? 101 ILE A HD12 4  
ATOM 6972  H HD13 . ILE A 1 101 ? -7.461  -8.344  -6.600  1.00 0.00 ? 101 ILE A HD13 4  
ATOM 6973  N N    . GLN A 1 102 ? -8.190  -4.789  -1.303  1.00 0.00 ? 102 GLN A N    4  
ATOM 6974  C CA   . GLN A 1 102 ? -8.852  -3.617  -0.742  1.00 0.00 ? 102 GLN A CA   4  
ATOM 6975  C C    . GLN A 1 102 ? -7.973  -2.948  0.310   1.00 0.00 ? 102 GLN A C    4  
ATOM 6976  O O    . GLN A 1 102 ? -7.731  -1.743  0.254   1.00 0.00 ? 102 GLN A O    4  
ATOM 6977  C CB   . GLN A 1 102 ? -10.195 -4.010  -0.126  1.00 0.00 ? 102 GLN A CB   4  
ATOM 6978  C CG   . GLN A 1 102 ? -11.102 -4.773  -1.079  1.00 0.00 ? 102 GLN A CG   4  
ATOM 6979  C CD   . GLN A 1 102 ? -12.573 -4.562  -0.780  1.00 0.00 ? 102 GLN A CD   4  
ATOM 6980  O OE1  . GLN A 1 102 ? -13.219 -3.694  -1.368  1.00 0.00 ? 102 GLN A OE1  4  
ATOM 6981  N NE2  . GLN A 1 102 ? -13.110 -5.355  0.139   1.00 0.00 ? 102 GLN A NE2  4  
ATOM 6982  H H    . GLN A 1 102 ? -8.366  -5.670  -0.914  1.00 0.00 ? 102 GLN A H    4  
ATOM 6983  H HA   . GLN A 1 102 ? -9.025  -2.918  -1.546  1.00 0.00 ? 102 GLN A HA   4  
ATOM 6984  H HB2  . GLN A 1 102 ? -10.013 -4.631  0.739   1.00 0.00 ? 102 GLN A HB2  4  
ATOM 6985  H HB3  . GLN A 1 102 ? -10.711 -3.114  0.186   1.00 0.00 ? 102 GLN A HB3  4  
ATOM 6986  H HG2  . GLN A 1 102 ? -10.904 -4.441  -2.087  1.00 0.00 ? 102 GLN A HG2  4  
ATOM 6987  H HG3  . GLN A 1 102 ? -10.880 -5.827  -0.999  1.00 0.00 ? 102 GLN A HG3  4  
ATOM 6988  H HE21 . GLN A 1 102 ? -12.534 -6.023  0.568   1.00 0.00 ? 102 GLN A HE21 4  
ATOM 6989  H HE22 . GLN A 1 102 ? -14.059 -5.240  0.353   1.00 0.00 ? 102 GLN A HE22 4  
ATOM 6990  N N    . ALA A 1 103 ? -7.499  -3.738  1.268   1.00 0.00 ? 103 ALA A N    4  
ATOM 6991  C CA   . ALA A 1 103 ? -6.646  -3.221  2.331   1.00 0.00 ? 103 ALA A CA   4  
ATOM 6992  C C    . ALA A 1 103 ? -5.513  -2.374  1.763   1.00 0.00 ? 103 ALA A C    4  
ATOM 6993  O O    . ALA A 1 103 ? -5.465  -1.163  1.976   1.00 0.00 ? 103 ALA A O    4  
ATOM 6994  C CB   . ALA A 1 103 ? -6.086  -4.367  3.161   1.00 0.00 ? 103 ALA A CB   4  
ATOM 6995  H H    . ALA A 1 103 ? -7.728  -4.690  1.258   1.00 0.00 ? 103 ALA A H    4  
ATOM 6996  H HA   . ALA A 1 103 ? -7.255  -2.605  2.977   1.00 0.00 ? 103 ALA A HA   4  
ATOM 6997  H HB1  . ALA A 1 103 ? -5.007  -4.324  3.150   1.00 0.00 ? 103 ALA A HB1  4  
ATOM 6998  H HB2  . ALA A 1 103 ? -6.440  -4.281  4.178   1.00 0.00 ? 103 ALA A HB2  4  
ATOM 6999  H HB3  . ALA A 1 103 ? -6.414  -5.307  2.744   1.00 0.00 ? 103 ALA A HB3  4  
ATOM 7000  N N    . MET A 1 104 ? -4.603  -3.019  1.041   1.00 0.00 ? 104 MET A N    4  
ATOM 7001  C CA   . MET A 1 104 ? -3.470  -2.323  0.442   1.00 0.00 ? 104 MET A CA   4  
ATOM 7002  C C    . MET A 1 104 ? -3.929  -1.408  -0.689  1.00 0.00 ? 104 MET A C    4  
ATOM 7003  O O    . MET A 1 104 ? -3.268  -0.422  -1.010  1.00 0.00 ? 104 MET A O    4  
ATOM 7004  C CB   . MET A 1 104 ? -2.446  -3.330  -0.085  1.00 0.00 ? 104 MET A CB   4  
ATOM 7005  C CG   . MET A 1 104 ? -2.847  -3.971  -1.404  1.00 0.00 ? 104 MET A CG   4  
ATOM 7006  S SD   . MET A 1 104 ? -1.458  -4.753  -2.246  1.00 0.00 ? 104 MET A SD   4  
ATOM 7007  C CE   . MET A 1 104 ? -0.642  -5.565  -0.874  1.00 0.00 ? 104 MET A CE   4  
ATOM 7008  H H    . MET A 1 104 ? -4.695  -3.985  0.906   1.00 0.00 ? 104 MET A H    4  
ATOM 7009  H HA   . MET A 1 104 ? -3.007  -1.721  1.210   1.00 0.00 ? 104 MET A HA   4  
ATOM 7010  H HB2  . MET A 1 104 ? -1.502  -2.825  -0.227  1.00 0.00 ? 104 MET A HB2  4  
ATOM 7011  H HB3  . MET A 1 104 ? -2.319  -4.113  0.647   1.00 0.00 ? 104 MET A HB3  4  
ATOM 7012  H HG2  . MET A 1 104 ? -3.600  -4.720  -1.210  1.00 0.00 ? 104 MET A HG2  4  
ATOM 7013  H HG3  . MET A 1 104 ? -3.258  -3.208  -2.048  1.00 0.00 ? 104 MET A HG3  4  
ATOM 7014  H HE1  . MET A 1 104 ? -1.374  -5.824  -0.123  1.00 0.00 ? 104 MET A HE1  4  
ATOM 7015  H HE2  . MET A 1 104 ? -0.154  -6.461  -1.225  1.00 0.00 ? 104 MET A HE2  4  
ATOM 7016  H HE3  . MET A 1 104 ? 0.092   -4.897  -0.446  1.00 0.00 ? 104 MET A HE3  4  
ATOM 7017  N N    . GLY A 1 105 ? -5.067  -1.743  -1.290  1.00 0.00 ? 105 GLY A N    4  
ATOM 7018  C CA   . GLY A 1 105 ? -5.595  -0.942  -2.379  1.00 0.00 ? 105 GLY A CA   4  
ATOM 7019  C C    . GLY A 1 105 ? -5.930  0.472   -1.948  1.00 0.00 ? 105 GLY A C    4  
ATOM 7020  O O    . GLY A 1 105 ? -5.665  1.428   -2.677  1.00 0.00 ? 105 GLY A O    4  
ATOM 7021  H H    . GLY A 1 105 ? -5.552  -2.541  -0.991  1.00 0.00 ? 105 GLY A H    4  
ATOM 7022  H HA2  . GLY A 1 105 ? -4.862  -0.902  -3.170  1.00 0.00 ? 105 GLY A HA2  4  
ATOM 7023  H HA3  . GLY A 1 105 ? -6.491  -1.413  -2.755  1.00 0.00 ? 105 GLY A HA3  4  
ATOM 7024  N N    . GLU A 1 106 ? -6.515  0.606   -0.762  1.00 0.00 ? 106 GLU A N    4  
ATOM 7025  C CA   . GLU A 1 106 ? -6.889  1.914   -0.238  1.00 0.00 ? 106 GLU A CA   4  
ATOM 7026  C C    . GLU A 1 106 ? -5.652  2.766   0.029   1.00 0.00 ? 106 GLU A C    4  
ATOM 7027  O O    . GLU A 1 106 ? -5.632  3.960   -0.267  1.00 0.00 ? 106 GLU A O    4  
ATOM 7028  C CB   . GLU A 1 106 ? -7.703  1.760   1.048   1.00 0.00 ? 106 GLU A CB   4  
ATOM 7029  C CG   . GLU A 1 106 ? -6.853  1.734   2.307   1.00 0.00 ? 106 GLU A CG   4  
ATOM 7030  C CD   . GLU A 1 106 ? -7.660  1.409   3.549   1.00 0.00 ? 106 GLU A CD   4  
ATOM 7031  O OE1  . GLU A 1 106 ? -8.745  2.002   3.722   1.00 0.00 ? 106 GLU A OE1  4  
ATOM 7032  O OE2  . GLU A 1 106 ? -7.207  0.563   4.348   1.00 0.00 ? 106 GLU A OE2  4  
ATOM 7033  H H    . GLU A 1 106 ? -6.701  -0.195  -0.228  1.00 0.00 ? 106 GLU A H    4  
ATOM 7034  H HA   . GLU A 1 106 ? -7.497  2.407   -0.981  1.00 0.00 ? 106 GLU A HA   4  
ATOM 7035  H HB2  . GLU A 1 106 ? -8.396  2.585   1.123   1.00 0.00 ? 106 GLU A HB2  4  
ATOM 7036  H HB3  . GLU A 1 106 ? -8.261  0.836   0.997   1.00 0.00 ? 106 GLU A HB3  4  
ATOM 7037  H HG2  . GLU A 1 106 ? -6.083  0.985   2.191   1.00 0.00 ? 106 GLU A HG2  4  
ATOM 7038  H HG3  . GLU A 1 106 ? -6.395  2.703   2.437   1.00 0.00 ? 106 GLU A HG3  4  
ATOM 7039  N N    . ALA A 1 107 ? -4.622  2.143   0.593   1.00 0.00 ? 107 ALA A N    4  
ATOM 7040  C CA   . ALA A 1 107 ? -3.381  2.843   0.900   1.00 0.00 ? 107 ALA A CA   4  
ATOM 7041  C C    . ALA A 1 107 ? -2.842  3.570   -0.328  1.00 0.00 ? 107 ALA A C    4  
ATOM 7042  O O    . ALA A 1 107 ? -2.118  4.558   -0.209  1.00 0.00 ? 107 ALA A O    4  
ATOM 7043  C CB   . ALA A 1 107 ? -2.343  1.868   1.435   1.00 0.00 ? 107 ALA A CB   4  
ATOM 7044  H H    . ALA A 1 107 ? -4.698  1.190   0.806   1.00 0.00 ? 107 ALA A H    4  
ATOM 7045  H HA   . ALA A 1 107 ? -3.589  3.569   1.672   1.00 0.00 ? 107 ALA A HA   4  
ATOM 7046  H HB1  . ALA A 1 107 ? -2.824  1.157   2.091   1.00 0.00 ? 107 ALA A HB1  4  
ATOM 7047  H HB2  . ALA A 1 107 ? -1.883  1.343   0.611   1.00 0.00 ? 107 ALA A HB2  4  
ATOM 7048  H HB3  . ALA A 1 107 ? -1.588  2.411   1.983   1.00 0.00 ? 107 ALA A HB3  4  
ATOM 7049  N N    . ALA A 1 108 ? -3.201  3.074   -1.508  1.00 0.00 ? 108 ALA A N    4  
ATOM 7050  C CA   . ALA A 1 108 ? -2.754  3.677   -2.758  1.00 0.00 ? 108 ALA A CA   4  
ATOM 7051  C C    . ALA A 1 108 ? -3.632  4.865   -3.138  1.00 0.00 ? 108 ALA A C    4  
ATOM 7052  O O    . ALA A 1 108 ? -3.198  5.764   -3.859  1.00 0.00 ? 108 ALA A O    4  
ATOM 7053  C CB   . ALA A 1 108 ? -2.752  2.642   -3.872  1.00 0.00 ? 108 ALA A CB   4  
ATOM 7054  H H    . ALA A 1 108 ? -3.780  2.284   -1.539  1.00 0.00 ? 108 ALA A H    4  
ATOM 7055  H HA   . ALA A 1 108 ? -1.740  4.022   -2.618  1.00 0.00 ? 108 ALA A HA   4  
ATOM 7056  H HB1  . ALA A 1 108 ? -3.682  2.091   -3.853  1.00 0.00 ? 108 ALA A HB1  4  
ATOM 7057  H HB2  . ALA A 1 108 ? -2.648  3.139   -4.825  1.00 0.00 ? 108 ALA A HB2  4  
ATOM 7058  H HB3  . ALA A 1 108 ? -1.927  1.960   -3.729  1.00 0.00 ? 108 ALA A HB3  4  
ATOM 7059  N N    . ARG A 1 109 ? -4.868  4.862   -2.650  1.00 0.00 ? 109 ARG A N    4  
ATOM 7060  C CA   . ARG A 1 109 ? -5.807  5.938   -2.941  1.00 0.00 ? 109 ARG A CA   4  
ATOM 7061  C C    . ARG A 1 109 ? -5.353  7.245   -2.295  1.00 0.00 ? 109 ARG A C    4  
ATOM 7062  O O    . ARG A 1 109 ? -4.699  7.240   -1.253  1.00 0.00 ? 109 ARG A O    4  
ATOM 7063  C CB   . ARG A 1 109 ? -7.207  5.571   -2.445  1.00 0.00 ? 109 ARG A CB   4  
ATOM 7064  C CG   . ARG A 1 109 ? -7.477  6.000   -1.012  1.00 0.00 ? 109 ARG A CG   4  
ATOM 7065  C CD   . ARG A 1 109 ? -8.484  5.082   -0.336  1.00 0.00 ? 109 ARG A CD   4  
ATOM 7066  N NE   . ARG A 1 109 ? -9.195  5.753   0.749   1.00 0.00 ? 109 ARG A NE   4  
ATOM 7067  C CZ   . ARG A 1 109 ? -8.710  5.877   1.979   1.00 0.00 ? 109 ARG A CZ   4  
ATOM 7068  N NH1  . ARG A 1 109 ? -7.519  5.377   2.279   1.00 0.00 ? 109 ARG A NH1  4  
ATOM 7069  N NH2  . ARG A 1 109 ? -9.417  6.501   2.912   1.00 0.00 ? 109 ARG A NH2  4  
ATOM 7070  H H    . ARG A 1 109 ? -5.156  4.117   -2.081  1.00 0.00 ? 109 ARG A H    4  
ATOM 7071  H HA   . ARG A 1 109 ? -5.838  6.072   -4.012  1.00 0.00 ? 109 ARG A HA   4  
ATOM 7072  H HB2  . ARG A 1 109 ? -7.938  6.045   -3.083  1.00 0.00 ? 109 ARG A HB2  4  
ATOM 7073  H HB3  . ARG A 1 109 ? -7.327  4.500   -2.506  1.00 0.00 ? 109 ARG A HB3  4  
ATOM 7074  H HG2  . ARG A 1 109 ? -6.551  5.971   -0.456  1.00 0.00 ? 109 ARG A HG2  4  
ATOM 7075  H HG3  . ARG A 1 109 ? -7.866  7.007   -1.015  1.00 0.00 ? 109 ARG A HG3  4  
ATOM 7076  H HD2  . ARG A 1 109 ? -9.200  4.751   -1.073  1.00 0.00 ? 109 ARG A HD2  4  
ATOM 7077  H HD3  . ARG A 1 109 ? -7.959  4.227   0.064   1.00 0.00 ? 109 ARG A HD3  4  
ATOM 7078  H HE   . ARG A 1 109 ? -10.076 6.130   0.549   1.00 0.00 ? 109 ARG A HE   4  
ATOM 7079  H HH11 . ARG A 1 109 ? -6.984  4.907   1.578   1.00 0.00 ? 109 ARG A HH11 4  
ATOM 7080  H HH12 . ARG A 1 109 ? -7.156  5.472   3.207   1.00 0.00 ? 109 ARG A HH12 4  
ATOM 7081  H HH21 . ARG A 1 109 ? -10.315 6.880   2.690   1.00 0.00 ? 109 ARG A HH21 4  
ATOM 7082  H HH22 . ARG A 1 109 ? -9.051  6.594   3.838   1.00 0.00 ? 109 ARG A HH22 4  
ATOM 7083  N N    . VAL A 1 110 ? -5.705  8.362   -2.923  1.00 0.00 ? 110 VAL A N    4  
ATOM 7084  C CA   . VAL A 1 110 ? -5.335  9.676   -2.410  1.00 0.00 ? 110 VAL A CA   4  
ATOM 7085  C C    . VAL A 1 110 ? -6.567  10.549  -2.195  1.00 0.00 ? 110 VAL A C    4  
ATOM 7086  O O    . VAL A 1 110 ? -7.397  10.698  -3.091  1.00 0.00 ? 110 VAL A O    4  
ATOM 7087  C CB   . VAL A 1 110 ? -4.367  10.399  -3.365  1.00 0.00 ? 110 VAL A CB   4  
ATOM 7088  C CG1  . VAL A 1 110 ? -5.034  10.657  -4.707  1.00 0.00 ? 110 VAL A CG1  4  
ATOM 7089  C CG2  . VAL A 1 110 ? -3.879  11.699  -2.744  1.00 0.00 ? 110 VAL A CG2  4  
ATOM 7090  H H    . VAL A 1 110 ? -6.227  8.302   -3.750  1.00 0.00 ? 110 VAL A H    4  
ATOM 7091  H HA   . VAL A 1 110 ? -4.836  9.536   -1.462  1.00 0.00 ? 110 VAL A HA   4  
ATOM 7092  H HB   . VAL A 1 110 ? -3.512  9.760   -3.530  1.00 0.00 ? 110 VAL A HB   4  
ATOM 7093  H HG11 . VAL A 1 110 ? -5.715  9.850   -4.931  1.00 0.00 ? 110 VAL A HG11 4  
ATOM 7094  H HG12 . VAL A 1 110 ? -5.579  11.589  -4.665  1.00 0.00 ? 110 VAL A HG12 4  
ATOM 7095  H HG13 . VAL A 1 110 ? -4.280  10.716  -5.478  1.00 0.00 ? 110 VAL A HG13 4  
ATOM 7096  H HG21 . VAL A 1 110 ? -2.811  11.646  -2.593  1.00 0.00 ? 110 VAL A HG21 4  
ATOM 7097  H HG22 . VAL A 1 110 ? -4.108  12.523  -3.404  1.00 0.00 ? 110 VAL A HG22 4  
ATOM 7098  H HG23 . VAL A 1 110 ? -4.370  11.852  -1.794  1.00 0.00 ? 110 VAL A HG23 4  
ATOM 7099  N N    . GLN A 1 111 ? -6.677  11.124  -1.002  1.00 0.00 ? 111 GLN A N    4  
ATOM 7100  C CA   . GLN A 1 111 ? -7.808  11.982  -0.670  1.00 0.00 ? 111 GLN A CA   4  
ATOM 7101  C C    . GLN A 1 111 ? -7.416  13.454  -0.748  1.00 0.00 ? 111 GLN A C    4  
ATOM 7102  O O    . GLN A 1 111 ? -6.367  13.854  -0.243  1.00 0.00 ? 111 GLN A O    4  
ATOM 7103  C CB   . GLN A 1 111 ? -8.330  11.655  0.730   1.00 0.00 ? 111 GLN A CB   4  
ATOM 7104  C CG   . GLN A 1 111 ? -9.705  12.236  1.018   1.00 0.00 ? 111 GLN A CG   4  
ATOM 7105  C CD   . GLN A 1 111 ? -9.993  12.347  2.502   1.00 0.00 ? 111 GLN A CD   4  
ATOM 7106  O OE1  . GLN A 1 111 ? -9.871  11.372  3.245   1.00 0.00 ? 111 GLN A OE1  4  
ATOM 7107  N NE2  . GLN A 1 111 ? -10.377 13.539  2.943   1.00 0.00 ? 111 GLN A NE2  4  
ATOM 7108  H H    . GLN A 1 111 ? -5.983  10.966  -0.329  1.00 0.00 ? 111 GLN A H    4  
ATOM 7109  H HA   . GLN A 1 111 ? -8.590  11.793  -1.389  1.00 0.00 ? 111 GLN A HA   4  
ATOM 7110  H HB2  . GLN A 1 111 ? -8.386  10.582  0.839   1.00 0.00 ? 111 GLN A HB2  4  
ATOM 7111  H HB3  . GLN A 1 111 ? -7.638  12.048  1.460   1.00 0.00 ? 111 GLN A HB3  4  
ATOM 7112  H HG2  . GLN A 1 111 ? -9.764  13.222  0.581   1.00 0.00 ? 111 GLN A HG2  4  
ATOM 7113  H HG3  . GLN A 1 111 ? -10.452 11.598  0.568   1.00 0.00 ? 111 GLN A HG3  4  
ATOM 7114  H HE21 . GLN A 1 111 ? -10.453 14.270  2.294   1.00 0.00 ? 111 GLN A HE21 4  
ATOM 7115  H HE22 . GLN A 1 111 ? -10.570 13.639  3.898   1.00 0.00 ? 111 GLN A HE22 4  
ATOM 7116  N N    . SER A 1 112 ? -8.265  14.255  -1.384  1.00 0.00 ? 112 SER A N    4  
ATOM 7117  C CA   . SER A 1 112 ? -8.004  15.682  -1.532  1.00 0.00 ? 112 SER A CA   4  
ATOM 7118  C C    . SER A 1 112 ? -8.794  16.488  -0.505  1.00 0.00 ? 112 SER A C    4  
ATOM 7119  O O    . SER A 1 112 ? -10.020 16.571  -0.574  1.00 0.00 ? 112 SER A O    4  
ATOM 7120  C CB   . SER A 1 112 ? -8.364  16.144  -2.945  1.00 0.00 ? 112 SER A CB   4  
ATOM 7121  O OG   . SER A 1 112 ? -7.289  15.924  -3.843  1.00 0.00 ? 112 SER A OG   4  
ATOM 7122  H H    . SER A 1 112 ? -9.085  13.876  -1.765  1.00 0.00 ? 112 SER A H    4  
ATOM 7123  H HA   . SER A 1 112 ? -6.950  15.845  -1.366  1.00 0.00 ? 112 SER A HA   4  
ATOM 7124  H HB2  . SER A 1 112 ? -9.225  15.594  -3.293  1.00 0.00 ? 112 SER A HB2  4  
ATOM 7125  H HB3  . SER A 1 112 ? -8.594  17.199  -2.928  1.00 0.00 ? 112 SER A HB3  4  
ATOM 7126  H HG   . SER A 1 112 ? -7.539  15.255  -4.484  1.00 0.00 ? 112 SER A HG   4  
ATOM 7127  N N    . GLY A 1 113 ? -8.082  17.080  0.449   1.00 0.00 ? 113 GLY A N    4  
ATOM 7128  C CA   . GLY A 1 113 ? -8.731  17.871  1.477   1.00 0.00 ? 113 GLY A CA   4  
ATOM 7129  C C    . GLY A 1 113 ? -7.740  18.526  2.418   1.00 0.00 ? 113 GLY A C    4  
ATOM 7130  O O    . GLY A 1 113 ? -7.492  18.048  3.525   1.00 0.00 ? 113 GLY A O    4  
ATOM 7131  H H    . GLY A 1 113 ? -7.107  16.978  0.454   1.00 0.00 ? 113 GLY A H    4  
ATOM 7132  H HA2  . GLY A 1 113 ? -9.325  18.639  1.004   1.00 0.00 ? 113 GLY A HA2  4  
ATOM 7133  H HA3  . GLY A 1 113 ? -9.383  17.229  2.051   1.00 0.00 ? 113 GLY A HA3  4  
ATOM 7134  N N    . PRO A 1 114 ? -7.152  19.648  1.976   1.00 0.00 ? 114 PRO A N    4  
ATOM 7135  C CA   . PRO A 1 114 ? -6.171  20.393  2.771   1.00 0.00 ? 114 PRO A CA   4  
ATOM 7136  C C    . PRO A 1 114 ? -6.804  21.083  3.975   1.00 0.00 ? 114 PRO A C    4  
ATOM 7137  O O    . PRO A 1 114 ? -7.318  22.195  3.866   1.00 0.00 ? 114 PRO A O    4  
ATOM 7138  C CB   . PRO A 1 114 ? -5.630  21.431  1.784   1.00 0.00 ? 114 PRO A CB   4  
ATOM 7139  C CG   . PRO A 1 114 ? -6.723  21.613  0.788   1.00 0.00 ? 114 PRO A CG   4  
ATOM 7140  C CD   . PRO A 1 114 ? -7.399  20.275  0.667   1.00 0.00 ? 114 PRO A CD   4  
ATOM 7141  H HA   . PRO A 1 114 ? -5.364  19.757  3.105   1.00 0.00 ? 114 PRO A HA   4  
ATOM 7142  H HB2  . PRO A 1 114 ? -5.414  22.352  2.308   1.00 0.00 ? 114 PRO A HB2  4  
ATOM 7143  H HB3  . PRO A 1 114 ? -4.731  21.056  1.319   1.00 0.00 ? 114 PRO A HB3  4  
ATOM 7144  H HG2  . PRO A 1 114 ? -7.421  22.356  1.141   1.00 0.00 ? 114 PRO A HG2  4  
ATOM 7145  H HG3  . PRO A 1 114 ? -6.307  21.909  -0.163  1.00 0.00 ? 114 PRO A HG3  4  
ATOM 7146  H HD2  . PRO A 1 114 ? -8.458  20.402  0.495   1.00 0.00 ? 114 PRO A HD2  4  
ATOM 7147  H HD3  . PRO A 1 114 ? -6.952  19.697  -0.128  1.00 0.00 ? 114 PRO A HD3  4  
ATOM 7148  N N    . SER A 1 115 ? -6.761  20.414  5.123   1.00 0.00 ? 115 SER A N    4  
ATOM 7149  C CA   . SER A 1 115 ? -7.334  20.962  6.348   1.00 0.00 ? 115 SER A CA   4  
ATOM 7150  C C    . SER A 1 115 ? -8.790  21.363  6.134   1.00 0.00 ? 115 SER A C    4  
ATOM 7151  O O    . SER A 1 115 ? -9.231  22.413  6.603   1.00 0.00 ? 115 SER A O    4  
ATOM 7152  C CB   . SER A 1 115 ? -6.523  22.171  6.819   1.00 0.00 ? 115 SER A CB   4  
ATOM 7153  O OG   . SER A 1 115 ? -5.373  21.764  7.539   1.00 0.00 ? 115 SER A OG   4  
ATOM 7154  H H    . SER A 1 115 ? -6.337  19.531  5.147   1.00 0.00 ? 115 SER A H    4  
ATOM 7155  H HA   . SER A 1 115 ? -7.292  20.194  7.105   1.00 0.00 ? 115 SER A HA   4  
ATOM 7156  H HB2  . SER A 1 115 ? -6.211  22.748  5.961   1.00 0.00 ? 115 SER A HB2  4  
ATOM 7157  H HB3  . SER A 1 115 ? -7.138  22.785  7.461   1.00 0.00 ? 115 SER A HB3  4  
ATOM 7158  H HG   . SER A 1 115 ? -5.097  22.471  8.127   1.00 0.00 ? 115 SER A HG   4  
ATOM 7159  N N    . SER A 1 116 ? -9.532  20.520  5.423   1.00 0.00 ? 116 SER A N    4  
ATOM 7160  C CA   . SER A 1 116 ? -10.937 20.787  5.144   1.00 0.00 ? 116 SER A CA   4  
ATOM 7161  C C    . SER A 1 116 ? -11.829 20.209  6.238   1.00 0.00 ? 116 SER A C    4  
ATOM 7162  O O    . SER A 1 116 ? -12.363 19.109  6.102   1.00 0.00 ? 116 SER A O    4  
ATOM 7163  C CB   . SER A 1 116 ? -11.330 20.200  3.786   1.00 0.00 ? 116 SER A CB   4  
ATOM 7164  O OG   . SER A 1 116 ? -12.517 20.798  3.296   1.00 0.00 ? 116 SER A OG   4  
ATOM 7165  H H    . SER A 1 116 ? -9.122  19.699  5.077   1.00 0.00 ? 116 SER A H    4  
ATOM 7166  H HA   . SER A 1 116 ? -11.072 21.858  5.115   1.00 0.00 ? 116 SER A HA   4  
ATOM 7167  H HB2  . SER A 1 116 ? -10.534 20.374  3.078   1.00 0.00 ? 116 SER A HB2  4  
ATOM 7168  H HB3  . SER A 1 116 ? -11.493 19.137  3.891   1.00 0.00 ? 116 SER A HB3  4  
ATOM 7169  H HG   . SER A 1 116 ? -13.275 20.272  3.562   1.00 0.00 ? 116 SER A HG   4  
ATOM 7170  N N    . GLY A 1 117 ? -11.984 20.959  7.325   1.00 0.00 ? 117 GLY A N    4  
ATOM 7171  C CA   . GLY A 1 117 ? -12.811 20.505  8.428   1.00 0.00 ? 117 GLY A CA   4  
ATOM 7172  C C    . GLY A 1 117 ? -13.569 21.639  9.089   1.00 0.00 ? 117 GLY A C    4  
ATOM 7173  O O    . GLY A 1 117 ? -13.589 21.750  10.314  1.00 0.00 ? 117 GLY A O    4  
ATOM 7174  H H    . GLY A 1 117 ? -11.534 21.828  7.378   1.00 0.00 ? 117 GLY A H    4  
ATOM 7175  H HA2  . GLY A 1 117 ? -13.520 19.780  8.057   1.00 0.00 ? 117 GLY A HA2  4  
ATOM 7176  H HA3  . GLY A 1 117 ? -12.179 20.032  9.165   1.00 0.00 ? 117 GLY A HA3  4  
ATOM 7177  N N    . GLY A 1 1   ? -15.822 9.974   11.372  1.00 0.00 ? 1   GLY A N    5  
ATOM 7178  C CA   . GLY A 1 1   ? -15.058 11.162  11.709  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7179  C C    . GLY A 1 1   ? -13.664 10.833  12.206  1.00 0.00 ? 1   GLY A C    5  
ATOM 7180  O O    . GLY A 1 1   ? -13.479 10.487  13.373  1.00 0.00 ? 1   GLY A O    5  
ATOM 7181  H H1   . GLY A 1 1   ? -16.501 10.015  10.667  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7182  H HA2  . GLY A 1 1   ? -14.978 11.786  10.832  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7183  H HA3  . GLY A 1 1   ? -15.583 11.707  12.480  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7184  N N    . SER A 1 2   ? -12.681 10.939  11.318  1.00 0.00 ? 2   SER A N    5  
ATOM 7185  C CA   . SER A 1 2   ? -11.297 10.645  11.672  1.00 0.00 ? 2   SER A CA   5  
ATOM 7186  C C    . SER A 1 2   ? -10.511 11.932  11.905  1.00 0.00 ? 2   SER A C    5  
ATOM 7187  O O    . SER A 1 2   ? -10.381 12.765  11.007  1.00 0.00 ? 2   SER A O    5  
ATOM 7188  C CB   . SER A 1 2   ? -10.631 9.820   10.569  1.00 0.00 ? 2   SER A CB   5  
ATOM 7189  O OG   . SER A 1 2   ? -9.410  9.259   11.019  1.00 0.00 ? 2   SER A OG   5  
ATOM 7190  H H    . SER A 1 2   ? -12.892 11.220  10.403  1.00 0.00 ? 2   SER A H    5  
ATOM 7191  H HA   . SER A 1 2   ? -11.303 10.071  12.586  1.00 0.00 ? 2   SER A HA   5  
ATOM 7192  H HB2  . SER A 1 2   ? -11.292 9.021   10.272  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7193  H HB3  . SER A 1 2   ? -10.430 10.456  9.719   1.00 0.00 ? 2   SER A HB3  5  
ATOM 7194  H HG   . SER A 1 2   ? -9.170  8.520   10.455  1.00 0.00 ? 2   SER A HG   5  
ATOM 7195  N N    . SER A 1 3   ? -9.988  12.087  13.117  1.00 0.00 ? 3   SER A N    5  
ATOM 7196  C CA   . SER A 1 3   ? -9.217  13.274  13.471  1.00 0.00 ? 3   SER A CA   5  
ATOM 7197  C C    . SER A 1 3   ? -8.258  13.654  12.347  1.00 0.00 ? 3   SER A C    5  
ATOM 7198  O O    . SER A 1 3   ? -8.258  14.789  11.872  1.00 0.00 ? 3   SER A O    5  
ATOM 7199  C CB   . SER A 1 3   ? -8.436  13.033  14.764  1.00 0.00 ? 3   SER A CB   5  
ATOM 7200  O OG   . SER A 1 3   ? -9.307  12.965  15.880  1.00 0.00 ? 3   SER A OG   5  
ATOM 7201  H H    . SER A 1 3   ? -10.126 11.388  13.790  1.00 0.00 ? 3   SER A H    5  
ATOM 7202  H HA   . SER A 1 3   ? -9.912  14.086  13.625  1.00 0.00 ? 3   SER A HA   5  
ATOM 7203  H HB2  . SER A 1 3   ? -7.895  12.102  14.687  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7204  H HB3  . SER A 1 3   ? -7.738  13.844  14.915  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7205  H HG   . SER A 1 3   ? -9.834  13.766  15.925  1.00 0.00 ? 3   SER A HG   5  
ATOM 7206  N N    . GLY A 1 4   ? -7.440  12.694  11.926  1.00 0.00 ? 4   GLY A N    5  
ATOM 7207  C CA   . GLY A 1 4   ? -6.486  12.946  10.861  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7208  C C    . GLY A 1 4   ? -5.247  13.668  11.352  1.00 0.00 ? 4   GLY A C    5  
ATOM 7209  O O    . GLY A 1 4   ? -5.066  14.856  11.086  1.00 0.00 ? 4   GLY A O    5  
ATOM 7210  H H    . GLY A 1 4   ? -7.484  11.807  12.341  1.00 0.00 ? 4   GLY A H    5  
ATOM 7211  H HA2  . GLY A 1 4   ? -6.192  12.003  10.425  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7212  H HA3  . GLY A 1 4   ? -6.963  13.549  10.102  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7213  N N    . SER A 1 5   ? -4.392  12.950  12.073  1.00 0.00 ? 5   SER A N    5  
ATOM 7214  C CA   . SER A 1 5   ? -3.166  13.531  12.607  1.00 0.00 ? 5   SER A CA   5  
ATOM 7215  C C    . SER A 1 5   ? -1.938  12.824  12.041  1.00 0.00 ? 5   SER A C    5  
ATOM 7216  O O    . SER A 1 5   ? -1.985  11.637  11.717  1.00 0.00 ? 5   SER A O    5  
ATOM 7217  C CB   . SER A 1 5   ? -3.159  13.445  14.134  1.00 0.00 ? 5   SER A CB   5  
ATOM 7218  O OG   . SER A 1 5   ? -2.382  14.486  14.700  1.00 0.00 ? 5   SER A OG   5  
ATOM 7219  H H    . SER A 1 5   ? -4.592  12.007  12.251  1.00 0.00 ? 5   SER A H    5  
ATOM 7220  H HA   . SER A 1 5   ? -3.136  14.569  12.313  1.00 0.00 ? 5   SER A HA   5  
ATOM 7221  H HB2  . SER A 1 5   ? -4.171  13.526  14.502  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7222  H HB3  . SER A 1 5   ? -2.742  12.495  14.437  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7223  H HG   . SER A 1 5   ? -1.756  14.115  15.326  1.00 0.00 ? 5   SER A HG   5  
ATOM 7224  N N    . SER A 1 6   ? -0.839  13.562  11.925  1.00 0.00 ? 6   SER A N    5  
ATOM 7225  C CA   . SER A 1 6   ? 0.402   13.008  11.395  1.00 0.00 ? 6   SER A CA   5  
ATOM 7226  C C    . SER A 1 6   ? 1.270   12.449  12.517  1.00 0.00 ? 6   SER A C    5  
ATOM 7227  O O    . SER A 1 6   ? 1.325   13.007  13.612  1.00 0.00 ? 6   SER A O    5  
ATOM 7228  C CB   . SER A 1 6   ? 1.174   14.079  10.622  1.00 0.00 ? 6   SER A CB   5  
ATOM 7229  O OG   . SER A 1 6   ? 2.474   13.627  10.284  1.00 0.00 ? 6   SER A OG   5  
ATOM 7230  H H    . SER A 1 6   ? -0.864  14.502  12.200  1.00 0.00 ? 6   SER A H    5  
ATOM 7231  H HA   . SER A 1 6   ? 0.144   12.205  10.720  1.00 0.00 ? 6   SER A HA   5  
ATOM 7232  H HB2  . SER A 1 6   ? 0.642   14.318  9.713   1.00 0.00 ? 6   SER A HB2  5  
ATOM 7233  H HB3  . SER A 1 6   ? 1.261   14.967  11.232  1.00 0.00 ? 6   SER A HB3  5  
ATOM 7234  H HG   . SER A 1 6   ? 2.967   13.442  11.087  1.00 0.00 ? 6   SER A HG   5  
ATOM 7235  N N    . GLY A 1 7   ? 1.950   11.341  12.236  1.00 0.00 ? 7   GLY A N    5  
ATOM 7236  C CA   . GLY A 1 7   ? 2.807   10.724  13.230  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7237  C C    . GLY A 1 7   ? 2.817   9.212   13.130  1.00 0.00 ? 7   GLY A C    5  
ATOM 7238  O O    . GLY A 1 7   ? 2.799   8.656   12.032  1.00 0.00 ? 7   GLY A O    5  
ATOM 7239  H H    . GLY A 1 7   ? 1.868   10.940  11.345  1.00 0.00 ? 7   GLY A H    5  
ATOM 7240  H HA2  . GLY A 1 7   ? 3.815   11.090  13.098  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7241  H HA3  . GLY A 1 7   ? 2.459   11.005  14.213  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7242  N N    . ASN A 1 8   ? 2.846   8.544   14.278  1.00 0.00 ? 8   ASN A N    5  
ATOM 7243  C CA   . ASN A 1 8   ? 2.860   7.086   14.315  1.00 0.00 ? 8   ASN A CA   5  
ATOM 7244  C C    . ASN A 1 8   ? 1.461   6.522   14.089  1.00 0.00 ? 8   ASN A C    5  
ATOM 7245  O O    . ASN A 1 8   ? 0.495   6.963   14.712  1.00 0.00 ? 8   ASN A O    5  
ATOM 7246  C CB   . ASN A 1 8   ? 3.410   6.594   15.655  1.00 0.00 ? 8   ASN A CB   5  
ATOM 7247  C CG   . ASN A 1 8   ? 2.330   6.466   16.711  1.00 0.00 ? 8   ASN A CG   5  
ATOM 7248  O OD1  . ASN A 1 8   ? 1.477   5.581   16.639  1.00 0.00 ? 8   ASN A OD1  5  
ATOM 7249  N ND2  . ASN A 1 8   ? 2.361   7.353   17.699  1.00 0.00 ? 8   ASN A ND2  5  
ATOM 7250  H H    . ASN A 1 8   ? 2.859   9.043   15.122  1.00 0.00 ? 8   ASN A H    5  
ATOM 7251  H HA   . ASN A 1 8   ? 3.507   6.741   13.522  1.00 0.00 ? 8   ASN A HA   5  
ATOM 7252  H HB2  . ASN A 1 8   ? 3.866   5.624   15.516  1.00 0.00 ? 8   ASN A HB2  5  
ATOM 7253  H HB3  . ASN A 1 8   ? 4.155   7.290   16.010  1.00 0.00 ? 8   ASN A HB3  5  
ATOM 7254  H HD21 . ASN A 1 8   ? 3.070   8.030   17.692  1.00 0.00 ? 8   ASN A HD21 5  
ATOM 7255  H HD22 . ASN A 1 8   ? 1.675   7.293   18.396  1.00 0.00 ? 8   ASN A HD22 5  
ATOM 7256  N N    . ALA A 1 9   ? 1.359   5.545   13.193  1.00 0.00 ? 9   ALA A N    5  
ATOM 7257  C CA   . ALA A 1 9   ? 0.079   4.920   12.887  1.00 0.00 ? 9   ALA A CA   5  
ATOM 7258  C C    . ALA A 1 9   ? 0.155   3.406   13.050  1.00 0.00 ? 9   ALA A C    5  
ATOM 7259  O O    . ALA A 1 9   ? 1.172   2.776   12.759  1.00 0.00 ? 9   ALA A O    5  
ATOM 7260  C CB   . ALA A 1 9   ? -0.359  5.279   11.475  1.00 0.00 ? 9   ALA A CB   5  
ATOM 7261  H H    . ALA A 1 9   ? 2.165   5.237   12.729  1.00 0.00 ? 9   ALA A H    5  
ATOM 7262  H HA   . ALA A 1 9   ? -0.656  5.310   13.576  1.00 0.00 ? 9   ALA A HA   5  
ATOM 7263  H HB1  . ALA A 1 9   ? 0.412   4.991   10.775  1.00 0.00 ? 9   ALA A HB1  5  
ATOM 7264  H HB2  . ALA A 1 9   ? -1.274  4.756   11.238  1.00 0.00 ? 9   ALA A HB2  5  
ATOM 7265  H HB3  . ALA A 1 9   ? -0.526  6.344   11.410  1.00 0.00 ? 9   ALA A HB3  5  
ATOM 7266  N N    . PRO A 1 10  ? -0.945  2.805   13.528  1.00 0.00 ? 10  PRO A N    5  
ATOM 7267  C CA   . PRO A 1 10  ? -1.028  1.357   13.741  1.00 0.00 ? 10  PRO A CA   5  
ATOM 7268  C C    . PRO A 1 10  ? -1.053  0.579   12.430  1.00 0.00 ? 10  PRO A C    5  
ATOM 7269  O O    . PRO A 1 10  ? -1.329  1.139   11.369  1.00 0.00 ? 10  PRO A O    5  
ATOM 7270  C CB   . PRO A 1 10  ? -2.350  1.184   14.492  1.00 0.00 ? 10  PRO A CB   5  
ATOM 7271  C CG   . PRO A 1 10  ? -3.167  2.366   14.098  1.00 0.00 ? 10  PRO A CG   5  
ATOM 7272  C CD   . PRO A 1 10  ? -2.194  3.494   13.897  1.00 0.00 ? 10  PRO A CD   5  
ATOM 7273  H HA   . PRO A 1 10  ? -0.214  1.000   14.355  1.00 0.00 ? 10  PRO A HA   5  
ATOM 7274  H HB2  . PRO A 1 10  ? -2.820  0.259   14.189  1.00 0.00 ? 10  PRO A HB2  5  
ATOM 7275  H HB3  . PRO A 1 10  ? -2.165  1.169   15.555  1.00 0.00 ? 10  PRO A HB3  5  
ATOM 7276  H HG2  . PRO A 1 10  ? -3.695  2.158   13.180  1.00 0.00 ? 10  PRO A HG2  5  
ATOM 7277  H HG3  . PRO A 1 10  ? -3.864  2.609   14.886  1.00 0.00 ? 10  PRO A HG3  5  
ATOM 7278  H HD2  . PRO A 1 10  ? -2.526  4.142   13.100  1.00 0.00 ? 10  PRO A HD2  5  
ATOM 7279  H HD3  . PRO A 1 10  ? -2.069  4.052   14.813  1.00 0.00 ? 10  PRO A HD3  5  
ATOM 7280  N N    . VAL A 1 11  ? -0.765  -0.716  12.510  1.00 0.00 ? 11  VAL A N    5  
ATOM 7281  C CA   . VAL A 1 11  ? -0.756  -1.572  11.330  1.00 0.00 ? 11  VAL A CA   5  
ATOM 7282  C C    . VAL A 1 11  ? -2.156  -1.709  10.740  1.00 0.00 ? 11  VAL A C    5  
ATOM 7283  O O    . VAL A 1 11  ? -3.142  -1.809  11.470  1.00 0.00 ? 11  VAL A O    5  
ATOM 7284  C CB   . VAL A 1 11  ? -0.210  -2.974  11.657  1.00 0.00 ? 11  VAL A CB   5  
ATOM 7285  C CG1  . VAL A 1 11  ? -0.299  -3.880  10.438  1.00 0.00 ? 11  VAL A CG1  5  
ATOM 7286  C CG2  . VAL A 1 11  ? 1.223   -2.883  12.161  1.00 0.00 ? 11  VAL A CG2  5  
ATOM 7287  H H    . VAL A 1 11  ? -0.553  -1.105  13.384  1.00 0.00 ? 11  VAL A H    5  
ATOM 7288  H HA   . VAL A 1 11  ? -0.108  -1.119  10.593  1.00 0.00 ? 11  VAL A HA   5  
ATOM 7289  H HB   . VAL A 1 11  ? -0.818  -3.402  12.441  1.00 0.00 ? 11  VAL A HB   5  
ATOM 7290  H HG11 . VAL A 1 11  ? 0.649   -4.377  10.290  1.00 0.00 ? 11  VAL A HG11 5  
ATOM 7291  H HG12 . VAL A 1 11  ? -1.073  -4.617  10.593  1.00 0.00 ? 11  VAL A HG12 5  
ATOM 7292  H HG13 . VAL A 1 11  ? -0.534  -3.288  9.566   1.00 0.00 ? 11  VAL A HG13 5  
ATOM 7293  H HG21 . VAL A 1 11  ? 1.511   -1.845  12.239  1.00 0.00 ? 11  VAL A HG21 5  
ATOM 7294  H HG22 . VAL A 1 11  ? 1.294   -3.350  13.132  1.00 0.00 ? 11  VAL A HG22 5  
ATOM 7295  H HG23 . VAL A 1 11  ? 1.881   -3.389  11.470  1.00 0.00 ? 11  VAL A HG23 5  
ATOM 7296  N N    . THR A 1 12  ? -2.235  -1.712  9.413   1.00 0.00 ? 12  THR A N    5  
ATOM 7297  C CA   . THR A 1 12  ? -3.513  -1.836  8.724   1.00 0.00 ? 12  THR A CA   5  
ATOM 7298  C C    . THR A 1 12  ? -3.873  -3.299  8.490   1.00 0.00 ? 12  THR A C    5  
ATOM 7299  O O    . THR A 1 12  ? -4.966  -3.744  8.840   1.00 0.00 ? 12  THR A O    5  
ATOM 7300  C CB   . THR A 1 12  ? -3.496  -1.101  7.371   1.00 0.00 ? 12  THR A CB   5  
ATOM 7301  O OG1  . THR A 1 12  ? -2.989  0.227   7.541   1.00 0.00 ? 12  THR A OG1  5  
ATOM 7302  C CG2  . THR A 1 12  ? -4.891  -1.043  6.768   1.00 0.00 ? 12  THR A CG2  5  
ATOM 7303  H H    . THR A 1 12  ? -1.413  -1.629  8.886   1.00 0.00 ? 12  THR A H    5  
ATOM 7304  H HA   . THR A 1 12  ? -4.272  -1.384  9.346   1.00 0.00 ? 12  THR A HA   5  
ATOM 7305  H HB   . THR A 1 12  ? -2.849  -1.641  6.694   1.00 0.00 ? 12  THR A HB   5  
ATOM 7306  H HG1  . THR A 1 12  ? -2.984  0.450   8.475   1.00 0.00 ? 12  THR A HG1  5  
ATOM 7307  H HG21 . THR A 1 12  ? -5.625  -1.013  7.560   1.00 0.00 ? 12  THR A HG21 5  
ATOM 7308  H HG22 . THR A 1 12  ? -5.056  -1.919  6.158   1.00 0.00 ? 12  THR A HG22 5  
ATOM 7309  H HG23 . THR A 1 12  ? -4.983  -0.157  6.159   1.00 0.00 ? 12  THR A HG23 5  
ATOM 7310  N N    . LYS A 1 13  ? -2.945  -4.044  7.898   1.00 0.00 ? 13  LYS A N    5  
ATOM 7311  C CA   . LYS A 1 13  ? -3.163  -5.458  7.618   1.00 0.00 ? 13  LYS A CA   5  
ATOM 7312  C C    . LYS A 1 13  ? -1.845  -6.226  7.640   1.00 0.00 ? 13  LYS A C    5  
ATOM 7313  O O    . LYS A 1 13  ? -0.777  -5.650  7.431   1.00 0.00 ? 13  LYS A O    5  
ATOM 7314  C CB   . LYS A 1 13  ? -3.844  -5.632  6.259   1.00 0.00 ? 13  LYS A CB   5  
ATOM 7315  C CG   . LYS A 1 13  ? -4.488  -6.995  6.071   1.00 0.00 ? 13  LYS A CG   5  
ATOM 7316  C CD   . LYS A 1 13  ? -5.557  -6.963  4.992   1.00 0.00 ? 13  LYS A CD   5  
ATOM 7317  C CE   . LYS A 1 13  ? -5.829  -8.352  4.436   1.00 0.00 ? 13  LYS A CE   5  
ATOM 7318  N NZ   . LYS A 1 13  ? -6.724  -9.141  5.327   1.00 0.00 ? 13  LYS A NZ   5  
ATOM 7319  H H    . LYS A 1 13  ? -2.093  -3.631  7.642   1.00 0.00 ? 13  LYS A H    5  
ATOM 7320  H HA   . LYS A 1 13  ? -3.808  -5.853  8.388   1.00 0.00 ? 13  LYS A HA   5  
ATOM 7321  H HB2  . LYS A 1 13  ? -4.610  -4.878  6.155   1.00 0.00 ? 13  LYS A HB2  5  
ATOM 7322  H HB3  . LYS A 1 13  ? -3.108  -5.495  5.481   1.00 0.00 ? 13  LYS A HB3  5  
ATOM 7323  H HG2  . LYS A 1 13  ? -3.727  -7.706  5.788   1.00 0.00 ? 13  LYS A HG2  5  
ATOM 7324  H HG3  . LYS A 1 13  ? -4.940  -7.301  7.004   1.00 0.00 ? 13  LYS A HG3  5  
ATOM 7325  H HD2  . LYS A 1 13  ? -6.470  -6.571  5.413   1.00 0.00 ? 13  LYS A HD2  5  
ATOM 7326  H HD3  . LYS A 1 13  ? -5.225  -6.321  4.188   1.00 0.00 ? 13  LYS A HD3  5  
ATOM 7327  H HE2  . LYS A 1 13  ? -6.295  -8.253  3.467   1.00 0.00 ? 13  LYS A HE2  5  
ATOM 7328  H HE3  . LYS A 1 13  ? -4.889  -8.874  4.331   1.00 0.00 ? 13  LYS A HE3  5  
ATOM 7329  H HZ1  . LYS A 1 13  ? -6.497  -10.153 5.255   1.00 0.00 ? 13  LYS A HZ1  5  
ATOM 7330  H HZ2  . LYS A 1 13  ? -7.717  -8.999  5.051   1.00 0.00 ? 13  LYS A HZ2  5  
ATOM 7331  H HZ3  . LYS A 1 13  ? -6.603  -8.838  6.314   1.00 0.00 ? 13  LYS A HZ3  5  
ATOM 7332  N N    . ALA A 1 14  ? -1.927  -7.528  7.892   1.00 0.00 ? 14  ALA A N    5  
ATOM 7333  C CA   . ALA A 1 14  ? -0.742  -8.374  7.937   1.00 0.00 ? 14  ALA A CA   5  
ATOM 7334  C C    . ALA A 1 14  ? -1.099  -9.835  7.683   1.00 0.00 ? 14  ALA A C    5  
ATOM 7335  O O    . ALA A 1 14  ? -2.101  -10.336 8.192   1.00 0.00 ? 14  ALA A O    5  
ATOM 7336  C CB   . ALA A 1 14  ? -0.038  -8.227  9.278   1.00 0.00 ? 14  ALA A CB   5  
ATOM 7337  H H    . ALA A 1 14  ? -2.807  -7.929  8.050   1.00 0.00 ? 14  ALA A H    5  
ATOM 7338  H HA   . ALA A 1 14  ? -0.064  -8.040  7.164   1.00 0.00 ? 14  ALA A HA   5  
ATOM 7339  H HB1  . ALA A 1 14  ? 0.869   -7.655  9.146   1.00 0.00 ? 14  ALA A HB1  5  
ATOM 7340  H HB2  . ALA A 1 14  ? -0.689  -7.716  9.971   1.00 0.00 ? 14  ALA A HB2  5  
ATOM 7341  H HB3  . ALA A 1 14  ? 0.206   -9.204  9.666   1.00 0.00 ? 14  ALA A HB3  5  
ATOM 7342  N N    . GLY A 1 15  ? -0.274  -10.513 6.891   1.00 0.00 ? 15  GLY A N    5  
ATOM 7343  C CA   . GLY A 1 15  ? -0.521  -11.909 6.583   1.00 0.00 ? 15  GLY A CA   5  
ATOM 7344  C C    . GLY A 1 15  ? 0.550   -12.505 5.692   1.00 0.00 ? 15  GLY A C    5  
ATOM 7345  O O    . GLY A 1 15  ? 1.296   -11.778 5.035   1.00 0.00 ? 15  GLY A O    5  
ATOM 7346  H H    . GLY A 1 15  ? 0.510   -10.061 6.513   1.00 0.00 ? 15  GLY A H    5  
ATOM 7347  H HA2  . GLY A 1 15  ? -0.560  -12.469 7.506   1.00 0.00 ? 15  GLY A HA2  5  
ATOM 7348  H HA3  . GLY A 1 15  ? -1.476  -11.992 6.083   1.00 0.00 ? 15  GLY A HA3  5  
ATOM 7349  N N    . TRP A 1 16  ? 0.629   -13.830 5.669   1.00 0.00 ? 16  TRP A N    5  
ATOM 7350  C CA   . TRP A 1 16  ? 1.619   -14.523 4.853   1.00 0.00 ? 16  TRP A CA   5  
ATOM 7351  C C    . TRP A 1 16  ? 1.253   -14.450 3.374   1.00 0.00 ? 16  TRP A C    5  
ATOM 7352  O O    . TRP A 1 16  ? 0.265   -15.044 2.939   1.00 0.00 ? 16  TRP A O    5  
ATOM 7353  C CB   . TRP A 1 16  ? 1.738   -15.984 5.290   1.00 0.00 ? 16  TRP A CB   5  
ATOM 7354  C CG   . TRP A 1 16  ? 2.443   -16.156 6.601   1.00 0.00 ? 16  TRP A CG   5  
ATOM 7355  C CD1  . TRP A 1 16  ? 1.868   -16.216 7.839   1.00 0.00 ? 16  TRP A CD1  5  
ATOM 7356  C CD2  . TRP A 1 16  ? 3.854   -16.289 6.805   1.00 0.00 ? 16  TRP A CD2  5  
ATOM 7357  N NE1  . TRP A 1 16  ? 2.837   -16.377 8.800   1.00 0.00 ? 16  TRP A NE1  5  
ATOM 7358  C CE2  . TRP A 1 16  ? 4.063   -16.426 8.191   1.00 0.00 ? 16  TRP A CE2  5  
ATOM 7359  C CE3  . TRP A 1 16  ? 4.960   -16.307 5.951   1.00 0.00 ? 16  TRP A CE3  5  
ATOM 7360  C CZ2  . TRP A 1 16  ? 5.334   -16.578 8.740   1.00 0.00 ? 16  TRP A CZ2  5  
ATOM 7361  C CZ3  . TRP A 1 16  ? 6.220   -16.458 6.498   1.00 0.00 ? 16  TRP A CZ3  5  
ATOM 7362  C CH2  . TRP A 1 16  ? 6.399   -16.592 7.881   1.00 0.00 ? 16  TRP A CH2  5  
ATOM 7363  H H    . TRP A 1 16  ? 0.006   -14.356 6.214   1.00 0.00 ? 16  TRP A H    5  
ATOM 7364  H HA   . TRP A 1 16  ? 2.570   -14.034 5.001   1.00 0.00 ? 16  TRP A HA   5  
ATOM 7365  H HB2  . TRP A 1 16  ? 0.749   -16.407 5.385   1.00 0.00 ? 16  TRP A HB2  5  
ATOM 7366  H HB3  . TRP A 1 16  ? 2.289   -16.533 4.540   1.00 0.00 ? 16  TRP A HB3  5  
ATOM 7367  H HD1  . TRP A 1 16  ? 0.807   -16.143 8.020   1.00 0.00 ? 16  TRP A HD1  5  
ATOM 7368  H HE1  . TRP A 1 16  ? 2.675   -16.448 9.764   1.00 0.00 ? 16  TRP A HE1  5  
ATOM 7369  H HE3  . TRP A 1 16  ? 4.843   -16.205 4.883   1.00 0.00 ? 16  TRP A HE3  5  
ATOM 7370  H HZ2  . TRP A 1 16  ? 5.488   -16.683 9.804   1.00 0.00 ? 16  TRP A HZ2  5  
ATOM 7371  H HZ3  . TRP A 1 16  ? 7.087   -16.474 5.854   1.00 0.00 ? 16  TRP A HZ3  5  
ATOM 7372  H HH2  . TRP A 1 16  ? 7.401   -16.707 8.264   1.00 0.00 ? 16  TRP A HH2  5  
ATOM 7373  N N    . LEU A 1 17  ? 2.053   -13.719 2.606   1.00 0.00 ? 17  LEU A N    5  
ATOM 7374  C CA   . LEU A 1 17  ? 1.813   -13.569 1.175   1.00 0.00 ? 17  LEU A CA   5  
ATOM 7375  C C    . LEU A 1 17  ? 2.994   -14.098 0.367   1.00 0.00 ? 17  LEU A C    5  
ATOM 7376  O O    . LEU A 1 17  ? 4.146   -13.988 0.786   1.00 0.00 ? 17  LEU A O    5  
ATOM 7377  C CB   . LEU A 1 17  ? 1.562   -12.100 0.832   1.00 0.00 ? 17  LEU A CB   5  
ATOM 7378  C CG   . LEU A 1 17  ? 0.129   -11.602 1.019   1.00 0.00 ? 17  LEU A CG   5  
ATOM 7379  C CD1  . LEU A 1 17  ? 0.067   -10.089 0.882   1.00 0.00 ? 17  LEU A CD1  5  
ATOM 7380  C CD2  . LEU A 1 17  ? -0.802  -12.269 0.016   1.00 0.00 ? 17  LEU A CD2  5  
ATOM 7381  H H    . LEU A 1 17  ? 2.824   -13.270 3.010   1.00 0.00 ? 17  LEU A H    5  
ATOM 7382  H HA   . LEU A 1 17  ? 0.934   -14.145 0.925   1.00 0.00 ? 17  LEU A HA   5  
ATOM 7383  H HB2  . LEU A 1 17  ? 2.205   -11.500 1.457   1.00 0.00 ? 17  LEU A HB2  5  
ATOM 7384  H HB3  . LEU A 1 17  ? 1.832   -11.953 -0.204  1.00 0.00 ? 17  LEU A HB3  5  
ATOM 7385  H HG   . LEU A 1 17  ? -0.209  -11.861 2.013   1.00 0.00 ? 17  LEU A HG   5  
ATOM 7386  H HD11 . LEU A 1 17  ? -0.038  -9.826  -0.159  1.00 0.00 ? 17  LEU A HD11 5  
ATOM 7387  H HD12 . LEU A 1 17  ? 0.975   -9.655  1.274   1.00 0.00 ? 17  LEU A HD12 5  
ATOM 7388  H HD13 . LEU A 1 17  ? -0.780  -9.712  1.437   1.00 0.00 ? 17  LEU A HD13 5  
ATOM 7389  H HD21 . LEU A 1 17  ? -0.871  -11.658 -0.872  1.00 0.00 ? 17  LEU A HD21 5  
ATOM 7390  H HD22 . LEU A 1 17  ? -1.784  -12.378 0.454   1.00 0.00 ? 17  LEU A HD22 5  
ATOM 7391  H HD23 . LEU A 1 17  ? -0.413  -13.242 -0.245  1.00 0.00 ? 17  LEU A HD23 5  
ATOM 7392  N N    . PHE A 1 18  ? 2.699   -14.671 -0.795  1.00 0.00 ? 18  PHE A N    5  
ATOM 7393  C CA   . PHE A 1 18  ? 3.736   -15.216 -1.664  1.00 0.00 ? 18  PHE A CA   5  
ATOM 7394  C C    . PHE A 1 18  ? 4.253   -14.152 -2.627  1.00 0.00 ? 18  PHE A C    5  
ATOM 7395  O O    . PHE A 1 18  ? 3.507   -13.633 -3.457  1.00 0.00 ? 18  PHE A O    5  
ATOM 7396  C CB   . PHE A 1 18  ? 3.195   -16.412 -2.451  1.00 0.00 ? 18  PHE A CB   5  
ATOM 7397  C CG   . PHE A 1 18  ? 3.118   -17.676 -1.642  1.00 0.00 ? 18  PHE A CG   5  
ATOM 7398  C CD1  . PHE A 1 18  ? 2.416   -17.708 -0.448  1.00 0.00 ? 18  PHE A CD1  5  
ATOM 7399  C CD2  . PHE A 1 18  ? 3.747   -18.831 -2.077  1.00 0.00 ? 18  PHE A CD2  5  
ATOM 7400  C CE1  . PHE A 1 18  ? 2.344   -18.870 0.298   1.00 0.00 ? 18  PHE A CE1  5  
ATOM 7401  C CE2  . PHE A 1 18  ? 3.679   -19.996 -1.335  1.00 0.00 ? 18  PHE A CE2  5  
ATOM 7402  C CZ   . PHE A 1 18  ? 2.975   -20.015 -0.147  1.00 0.00 ? 18  PHE A CZ   5  
ATOM 7403  H H    . PHE A 1 18  ? 1.761   -14.730 -1.075  1.00 0.00 ? 18  PHE A H    5  
ATOM 7404  H HA   . PHE A 1 18  ? 4.551   -15.546 -1.039  1.00 0.00 ? 18  PHE A HA   5  
ATOM 7405  H HB2  . PHE A 1 18  ? 2.201   -16.183 -2.802  1.00 0.00 ? 18  PHE A HB2  5  
ATOM 7406  H HB3  . PHE A 1 18  ? 3.838   -16.597 -3.297  1.00 0.00 ? 18  PHE A HB3  5  
ATOM 7407  H HD1  . PHE A 1 18  ? 1.920   -16.814 -0.100  1.00 0.00 ? 18  PHE A HD1  5  
ATOM 7408  H HD2  . PHE A 1 18  ? 4.298   -18.817 -3.007  1.00 0.00 ? 18  PHE A HD2  5  
ATOM 7409  H HE1  . PHE A 1 18  ? 1.793   -18.882 1.226   1.00 0.00 ? 18  PHE A HE1  5  
ATOM 7410  H HE2  . PHE A 1 18  ? 4.173   -20.889 -1.686  1.00 0.00 ? 18  PHE A HE2  5  
ATOM 7411  H HZ   . PHE A 1 18  ? 2.920   -20.923 0.434   1.00 0.00 ? 18  PHE A HZ   5  
ATOM 7412  N N    . LYS A 1 19  ? 5.537   -13.830 -2.509  1.00 0.00 ? 19  LYS A N    5  
ATOM 7413  C CA   . LYS A 1 19  ? 6.157   -12.829 -3.369  1.00 0.00 ? 19  LYS A CA   5  
ATOM 7414  C C    . LYS A 1 19  ? 6.829   -13.484 -4.571  1.00 0.00 ? 19  LYS A C    5  
ATOM 7415  O O    . LYS A 1 19  ? 7.779   -14.251 -4.420  1.00 0.00 ? 19  LYS A O    5  
ATOM 7416  C CB   . LYS A 1 19  ? 7.184   -12.015 -2.578  1.00 0.00 ? 19  LYS A CB   5  
ATOM 7417  C CG   . LYS A 1 19  ? 7.477   -10.653 -3.184  1.00 0.00 ? 19  LYS A CG   5  
ATOM 7418  C CD   . LYS A 1 19  ? 8.661   -9.984  -2.506  1.00 0.00 ? 19  LYS A CD   5  
ATOM 7419  C CE   . LYS A 1 19  ? 8.973   -8.634  -3.133  1.00 0.00 ? 19  LYS A CE   5  
ATOM 7420  N NZ   . LYS A 1 19  ? 10.095  -7.945  -2.437  1.00 0.00 ? 19  LYS A NZ   5  
ATOM 7421  H H    . LYS A 1 19  ? 6.082   -14.279 -1.828  1.00 0.00 ? 19  LYS A H    5  
ATOM 7422  H HA   . LYS A 1 19  ? 5.380   -12.167 -3.721  1.00 0.00 ? 19  LYS A HA   5  
ATOM 7423  H HB2  . LYS A 1 19  ? 6.814   -11.867 -1.575  1.00 0.00 ? 19  LYS A HB2  5  
ATOM 7424  H HB3  . LYS A 1 19  ? 8.109   -12.571 -2.533  1.00 0.00 ? 19  LYS A HB3  5  
ATOM 7425  H HG2  . LYS A 1 19  ? 7.700   -10.776 -4.233  1.00 0.00 ? 19  LYS A HG2  5  
ATOM 7426  H HG3  . LYS A 1 19  ? 6.606   -10.023 -3.070  1.00 0.00 ? 19  LYS A HG3  5  
ATOM 7427  H HD2  . LYS A 1 19  ? 8.431   -9.838  -1.461  1.00 0.00 ? 19  LYS A HD2  5  
ATOM 7428  H HD3  . LYS A 1 19  ? 9.527   -10.624 -2.600  1.00 0.00 ? 19  LYS A HD3  5  
ATOM 7429  H HE2  . LYS A 1 19  ? 9.241   -8.786  -4.167  1.00 0.00 ? 19  LYS A HE2  5  
ATOM 7430  H HE3  . LYS A 1 19  ? 8.091   -8.014  -3.077  1.00 0.00 ? 19  LYS A HE3  5  
ATOM 7431  H HZ1  . LYS A 1 19  ? 10.354  -8.466  -1.575  1.00 0.00 ? 19  LYS A HZ1  5  
ATOM 7432  H HZ2  . LYS A 1 19  ? 9.813   -6.979  -2.174  1.00 0.00 ? 19  LYS A HZ2  5  
ATOM 7433  H HZ3  . LYS A 1 19  ? 10.925  -7.895  -3.061  1.00 0.00 ? 19  LYS A HZ3  5  
ATOM 7434  N N    . GLN A 1 20  ? 6.329   -13.175 -5.763  1.00 0.00 ? 20  GLN A N    5  
ATOM 7435  C CA   . GLN A 1 20  ? 6.882   -13.734 -6.991  1.00 0.00 ? 20  GLN A CA   5  
ATOM 7436  C C    . GLN A 1 20  ? 8.396   -13.552 -7.039  1.00 0.00 ? 20  GLN A C    5  
ATOM 7437  O O    . GLN A 1 20  ? 8.931   -12.584 -6.499  1.00 0.00 ? 20  GLN A O    5  
ATOM 7438  C CB   . GLN A 1 20  ? 6.238   -13.075 -8.212  1.00 0.00 ? 20  GLN A CB   5  
ATOM 7439  C CG   . GLN A 1 20  ? 6.267   -13.945 -9.459  1.00 0.00 ? 20  GLN A CG   5  
ATOM 7440  C CD   . GLN A 1 20  ? 5.613   -13.275 -10.652 1.00 0.00 ? 20  GLN A CD   5  
ATOM 7441  O OE1  . GLN A 1 20  ? 6.115   -12.278 -11.170 1.00 0.00 ? 20  GLN A OE1  5  
ATOM 7442  N NE2  . GLN A 1 20  ? 4.487   -13.823 -11.095 1.00 0.00 ? 20  GLN A NE2  5  
ATOM 7443  H H    . GLN A 1 20  ? 5.571   -12.558 -5.818  1.00 0.00 ? 20  GLN A H    5  
ATOM 7444  H HA   . GLN A 1 20  ? 6.659   -14.790 -7.004  1.00 0.00 ? 20  GLN A HA   5  
ATOM 7445  H HB2  . GLN A 1 20  ? 5.209   -12.846 -7.982  1.00 0.00 ? 20  GLN A HB2  5  
ATOM 7446  H HB3  . GLN A 1 20  ? 6.763   -12.156 -8.429  1.00 0.00 ? 20  GLN A HB3  5  
ATOM 7447  H HG2  . GLN A 1 20  ? 7.295   -14.163 -9.707  1.00 0.00 ? 20  GLN A HG2  5  
ATOM 7448  H HG3  . GLN A 1 20  ? 5.744   -14.866 -9.250  1.00 0.00 ? 20  GLN A HG3  5  
ATOM 7449  H HE21 . GLN A 1 20  ? 4.146   -14.616 -10.631 1.00 0.00 ? 20  GLN A HE21 5  
ATOM 7450  H HE22 . GLN A 1 20  ? 4.044   -13.410 -11.864 1.00 0.00 ? 20  GLN A HE22 5  
ATOM 7451  N N    . ALA A 1 21  ? 9.079   -14.488 -7.688  1.00 0.00 ? 21  ALA A N    5  
ATOM 7452  C CA   . ALA A 1 21  ? 10.531  -14.429 -7.808  1.00 0.00 ? 21  ALA A CA   5  
ATOM 7453  C C    . ALA A 1 21  ? 10.957  -13.353 -8.800  1.00 0.00 ? 21  ALA A C    5  
ATOM 7454  O O    . ALA A 1 21  ? 10.118  -12.710 -9.432  1.00 0.00 ? 21  ALA A O    5  
ATOM 7455  C CB   . ALA A 1 21  ? 11.081  -15.784 -8.227  1.00 0.00 ? 21  ALA A CB   5  
ATOM 7456  H H    . ALA A 1 21  ? 8.596   -15.235 -8.098  1.00 0.00 ? 21  ALA A H    5  
ATOM 7457  H HA   . ALA A 1 21  ? 10.937  -14.189 -6.835  1.00 0.00 ? 21  ALA A HA   5  
ATOM 7458  H HB1  . ALA A 1 21  ? 10.612  -16.560 -7.640  1.00 0.00 ? 21  ALA A HB1  5  
ATOM 7459  H HB2  . ALA A 1 21  ? 10.873  -15.949 -9.274  1.00 0.00 ? 21  ALA A HB2  5  
ATOM 7460  H HB3  . ALA A 1 21  ? 12.148  -15.805 -8.065  1.00 0.00 ? 21  ALA A HB3  5  
ATOM 7461  N N    . SER A 1 22  ? 12.266  -13.160 -8.932  1.00 0.00 ? 22  SER A N    5  
ATOM 7462  C CA   . SER A 1 22  ? 12.803  -12.158 -9.845  1.00 0.00 ? 22  SER A CA   5  
ATOM 7463  C C    . SER A 1 22  ? 14.187  -12.562 -10.342 1.00 0.00 ? 22  SER A C    5  
ATOM 7464  O O    . SER A 1 22  ? 15.035  -12.999 -9.564  1.00 0.00 ? 22  SER A O    5  
ATOM 7465  C CB   . SER A 1 22  ? 12.875  -10.794 -9.154  1.00 0.00 ? 22  SER A CB   5  
ATOM 7466  O OG   . SER A 1 22  ? 13.819  -10.807 -8.097  1.00 0.00 ? 22  SER A OG   5  
ATOM 7467  H H    . SER A 1 22  ? 12.884  -13.704 -8.401  1.00 0.00 ? 22  SER A H    5  
ATOM 7468  H HA   . SER A 1 22  ? 12.135  -12.088 -10.691 1.00 0.00 ? 22  SER A HA   5  
ATOM 7469  H HB2  . SER A 1 22  ? 13.167  -10.044 -9.873  1.00 0.00 ? 22  SER A HB2  5  
ATOM 7470  H HB3  . SER A 1 22  ? 11.903  -10.547 -8.750  1.00 0.00 ? 22  SER A HB3  5  
ATOM 7471  H HG   . SER A 1 22  ? 13.695  -11.597 -7.566  1.00 0.00 ? 22  SER A HG   5  
ATOM 7472  N N    . SER A 1 23  ? 14.408  -12.413 -11.644 1.00 0.00 ? 23  SER A N    5  
ATOM 7473  C CA   . SER A 1 23  ? 15.688  -12.765 -12.248 1.00 0.00 ? 23  SER A CA   5  
ATOM 7474  C C    . SER A 1 23  ? 15.995  -14.246 -12.045 1.00 0.00 ? 23  SER A C    5  
ATOM 7475  O O    . SER A 1 23  ? 17.117  -14.618 -11.704 1.00 0.00 ? 23  SER A O    5  
ATOM 7476  C CB   . SER A 1 23  ? 16.810  -11.914 -11.650 1.00 0.00 ? 23  SER A CB   5  
ATOM 7477  O OG   . SER A 1 23  ? 16.766  -10.589 -12.149 1.00 0.00 ? 23  SER A OG   5  
ATOM 7478  H H    . SER A 1 23  ? 13.692  -12.059 -12.213 1.00 0.00 ? 23  SER A H    5  
ATOM 7479  H HA   . SER A 1 23  ? 15.622  -12.565 -13.307 1.00 0.00 ? 23  SER A HA   5  
ATOM 7480  H HB2  . SER A 1 23  ? 16.703  -11.885 -10.576 1.00 0.00 ? 23  SER A HB2  5  
ATOM 7481  H HB3  . SER A 1 23  ? 17.765  -12.351 -11.905 1.00 0.00 ? 23  SER A HB3  5  
ATOM 7482  H HG   . SER A 1 23  ? 16.057  -10.107 -11.717 1.00 0.00 ? 23  SER A HG   5  
ATOM 7483  N N    . GLY A 1 24  ? 14.987  -15.087 -12.257 1.00 0.00 ? 24  GLY A N    5  
ATOM 7484  C CA   . GLY A 1 24  ? 15.167  -16.518 -12.093 1.00 0.00 ? 24  GLY A CA   5  
ATOM 7485  C C    . GLY A 1 24  ? 13.946  -17.309 -12.515 1.00 0.00 ? 24  GLY A C    5  
ATOM 7486  O O    . GLY A 1 24  ? 13.087  -16.800 -13.236 1.00 0.00 ? 24  GLY A O    5  
ATOM 7487  H H    . GLY A 1 24  ? 14.114  -14.733 -12.527 1.00 0.00 ? 24  GLY A H    5  
ATOM 7488  H HA2  . GLY A 1 24  ? 16.012  -16.834 -12.687 1.00 0.00 ? 24  GLY A HA2  5  
ATOM 7489  H HA3  . GLY A 1 24  ? 15.374  -16.726 -11.053 1.00 0.00 ? 24  GLY A HA3  5  
ATOM 7490  N N    . VAL A 1 25  ? 13.867  -18.558 -12.068 1.00 0.00 ? 25  VAL A N    5  
ATOM 7491  C CA   . VAL A 1 25  ? 12.742  -19.422 -12.405 1.00 0.00 ? 25  VAL A CA   5  
ATOM 7492  C C    . VAL A 1 25  ? 11.420  -18.794 -11.977 1.00 0.00 ? 25  VAL A C    5  
ATOM 7493  O O    . VAL A 1 25  ? 11.382  -17.948 -11.083 1.00 0.00 ? 25  VAL A O    5  
ATOM 7494  C CB   . VAL A 1 25  ? 12.878  -20.806 -11.743 1.00 0.00 ? 25  VAL A CB   5  
ATOM 7495  C CG1  . VAL A 1 25  ? 12.327  -20.776 -10.325 1.00 0.00 ? 25  VAL A CG1  5  
ATOM 7496  C CG2  . VAL A 1 25  ? 12.174  -21.866 -12.576 1.00 0.00 ? 25  VAL A CG2  5  
ATOM 7497  H H    . VAL A 1 25  ? 14.583  -18.907 -11.497 1.00 0.00 ? 25  VAL A H    5  
ATOM 7498  H HA   . VAL A 1 25  ? 12.734  -19.558 -13.477 1.00 0.00 ? 25  VAL A HA   5  
ATOM 7499  H HB   . VAL A 1 25  ? 13.928  -21.056 -11.692 1.00 0.00 ? 25  VAL A HB   5  
ATOM 7500  H HG11 . VAL A 1 25  ? 12.868  -20.044 -9.744  1.00 0.00 ? 25  VAL A HG11 5  
ATOM 7501  H HG12 . VAL A 1 25  ? 11.280  -20.515 -10.351 1.00 0.00 ? 25  VAL A HG12 5  
ATOM 7502  H HG13 . VAL A 1 25  ? 12.444  -21.750 -9.874  1.00 0.00 ? 25  VAL A HG13 5  
ATOM 7503  H HG21 . VAL A 1 25  ? 12.381  -21.697 -13.622 1.00 0.00 ? 25  VAL A HG21 5  
ATOM 7504  H HG22 . VAL A 1 25  ? 12.532  -22.845 -12.291 1.00 0.00 ? 25  VAL A HG22 5  
ATOM 7505  H HG23 . VAL A 1 25  ? 11.109  -21.809 -12.405 1.00 0.00 ? 25  VAL A HG23 5  
ATOM 7506  N N    . LYS A 1 26  ? 10.336  -19.213 -12.621 1.00 0.00 ? 26  LYS A N    5  
ATOM 7507  C CA   . LYS A 1 26  ? 9.010   -18.694 -12.307 1.00 0.00 ? 26  LYS A CA   5  
ATOM 7508  C C    . LYS A 1 26  ? 8.404   -19.433 -11.119 1.00 0.00 ? 26  LYS A C    5  
ATOM 7509  O O    . LYS A 1 26  ? 7.602   -20.351 -11.291 1.00 0.00 ? 26  LYS A O    5  
ATOM 7510  C CB   . LYS A 1 26  ? 8.090   -18.820 -13.523 1.00 0.00 ? 26  LYS A CB   5  
ATOM 7511  C CG   . LYS A 1 26  ? 8.263   -17.702 -14.536 1.00 0.00 ? 26  LYS A CG   5  
ATOM 7512  C CD   . LYS A 1 26  ? 7.333   -16.536 -14.245 1.00 0.00 ? 26  LYS A CD   5  
ATOM 7513  C CE   . LYS A 1 26  ? 7.963   -15.548 -13.277 1.00 0.00 ? 26  LYS A CE   5  
ATOM 7514  N NZ   . LYS A 1 26  ? 7.654   -15.886 -11.860 1.00 0.00 ? 26  LYS A NZ   5  
ATOM 7515  H H    . LYS A 1 26  ? 10.430  -19.889 -13.325 1.00 0.00 ? 26  LYS A H    5  
ATOM 7516  H HA   . LYS A 1 26  ? 9.114   -17.651 -12.052 1.00 0.00 ? 26  LYS A HA   5  
ATOM 7517  H HB2  . LYS A 1 26  ? 8.292   -19.759 -14.017 1.00 0.00 ? 26  LYS A HB2  5  
ATOM 7518  H HB3  . LYS A 1 26  ? 7.063   -18.815 -13.185 1.00 0.00 ? 26  LYS A HB3  5  
ATOM 7519  H HG2  . LYS A 1 26  ? 9.284   -17.351 -14.500 1.00 0.00 ? 26  LYS A HG2  5  
ATOM 7520  H HG3  . LYS A 1 26  ? 8.047   -18.086 -15.523 1.00 0.00 ? 26  LYS A HG3  5  
ATOM 7521  H HD2  . LYS A 1 26  ? 7.111   -16.025 -15.170 1.00 0.00 ? 26  LYS A HD2  5  
ATOM 7522  H HD3  . LYS A 1 26  ? 6.418   -16.917 -13.813 1.00 0.00 ? 26  LYS A HD3  5  
ATOM 7523  H HE2  . LYS A 1 26  ? 9.034   -15.561 -13.415 1.00 0.00 ? 26  LYS A HE2  5  
ATOM 7524  H HE3  . LYS A 1 26  ? 7.585   -14.560 -13.493 1.00 0.00 ? 26  LYS A HE3  5  
ATOM 7525  H HZ1  . LYS A 1 26  ? 6.903   -15.262 -11.500 1.00 0.00 ? 26  LYS A HZ1  5  
ATOM 7526  H HZ2  . LYS A 1 26  ? 8.502   -15.765 -11.270 1.00 0.00 ? 26  LYS A HZ2  5  
ATOM 7527  H HZ3  . LYS A 1 26  ? 7.334   -16.872 -11.789 1.00 0.00 ? 26  LYS A HZ3  5  
ATOM 7528  N N    . GLN A 1 27  ? 8.792   -19.026 -9.914  1.00 0.00 ? 27  GLN A N    5  
ATOM 7529  C CA   . GLN A 1 27  ? 8.285   -19.651 -8.698  1.00 0.00 ? 27  GLN A CA   5  
ATOM 7530  C C    . GLN A 1 27  ? 7.806   -18.597 -7.704  1.00 0.00 ? 27  GLN A C    5  
ATOM 7531  O O    . GLN A 1 27  ? 7.906   -17.398 -7.961  1.00 0.00 ? 27  GLN A O    5  
ATOM 7532  C CB   . GLN A 1 27  ? 9.368   -20.519 -8.056  1.00 0.00 ? 27  GLN A CB   5  
ATOM 7533  C CG   . GLN A 1 27  ? 10.555  -19.726 -7.535  1.00 0.00 ? 27  GLN A CG   5  
ATOM 7534  C CD   . GLN A 1 27  ? 11.603  -20.605 -6.882  1.00 0.00 ? 27  GLN A CD   5  
ATOM 7535  O OE1  . GLN A 1 27  ? 11.385  -21.798 -6.669  1.00 0.00 ? 27  GLN A OE1  5  
ATOM 7536  N NE2  . GLN A 1 27  ? 12.751  -20.019 -6.560  1.00 0.00 ? 27  GLN A NE2  5  
ATOM 7537  H H    . GLN A 1 27  ? 9.433   -18.290 -9.842  1.00 0.00 ? 27  GLN A H    5  
ATOM 7538  H HA   . GLN A 1 27  ? 7.449   -20.277 -8.970  1.00 0.00 ? 27  GLN A HA   5  
ATOM 7539  H HB2  . GLN A 1 27  ? 8.934   -21.063 -7.229  1.00 0.00 ? 27  GLN A HB2  5  
ATOM 7540  H HB3  . GLN A 1 27  ? 9.729   -21.225 -8.790  1.00 0.00 ? 27  GLN A HB3  5  
ATOM 7541  H HG2  . GLN A 1 27  ? 11.012  -19.201 -8.361  1.00 0.00 ? 27  GLN A HG2  5  
ATOM 7542  H HG3  . GLN A 1 27  ? 10.201  -19.011 -6.807  1.00 0.00 ? 27  GLN A HG3  5  
ATOM 7543  H HE21 . GLN A 1 27  ? 12.854  -19.064 -6.758  1.00 0.00 ? 27  GLN A HE21 5  
ATOM 7544  H HE22 . GLN A 1 27  ? 13.446  -20.563 -6.136  1.00 0.00 ? 27  GLN A HE22 5  
ATOM 7545  N N    . TRP A 1 28  ? 7.287   -19.054 -6.570  1.00 0.00 ? 28  TRP A N    5  
ATOM 7546  C CA   . TRP A 1 28  ? 6.792   -18.150 -5.538  1.00 0.00 ? 28  TRP A CA   5  
ATOM 7547  C C    . TRP A 1 28  ? 7.390   -18.496 -4.179  1.00 0.00 ? 28  TRP A C    5  
ATOM 7548  O O    . TRP A 1 28  ? 7.368   -19.652 -3.758  1.00 0.00 ? 28  TRP A O    5  
ATOM 7549  C CB   . TRP A 1 28  ? 5.265   -18.210 -5.467  1.00 0.00 ? 28  TRP A CB   5  
ATOM 7550  C CG   . TRP A 1 28  ? 4.594   -17.739 -6.722  1.00 0.00 ? 28  TRP A CG   5  
ATOM 7551  C CD1  . TRP A 1 28  ? 4.534   -18.397 -7.917  1.00 0.00 ? 28  TRP A CD1  5  
ATOM 7552  C CD2  . TRP A 1 28  ? 3.888   -16.507 -6.904  1.00 0.00 ? 28  TRP A CD2  5  
ATOM 7553  N NE1  . TRP A 1 28  ? 3.834   -17.648 -8.831  1.00 0.00 ? 28  TRP A NE1  5  
ATOM 7554  C CE2  . TRP A 1 28  ? 3.426   -16.484 -8.235  1.00 0.00 ? 28  TRP A CE2  5  
ATOM 7555  C CE3  . TRP A 1 28  ? 3.600   -15.421 -6.073  1.00 0.00 ? 28  TRP A CE3  5  
ATOM 7556  C CZ2  . TRP A 1 28  ? 2.694   -15.418 -8.751  1.00 0.00 ? 28  TRP A CZ2  5  
ATOM 7557  C CZ3  . TRP A 1 28  ? 2.873   -14.363 -6.587  1.00 0.00 ? 28  TRP A CZ3  5  
ATOM 7558  C CH2  . TRP A 1 28  ? 2.426   -14.369 -7.915  1.00 0.00 ? 28  TRP A CH2  5  
ATOM 7559  H H    . TRP A 1 28  ? 7.235   -20.022 -6.424  1.00 0.00 ? 28  TRP A H    5  
ATOM 7560  H HA   . TRP A 1 28  ? 7.092   -17.147 -5.805  1.00 0.00 ? 28  TRP A HA   5  
ATOM 7561  H HB2  . TRP A 1 28  ? 4.959   -19.230 -5.289  1.00 0.00 ? 28  TRP A HB2  5  
ATOM 7562  H HB3  . TRP A 1 28  ? 4.926   -17.588 -4.652  1.00 0.00 ? 28  TRP A HB3  5  
ATOM 7563  H HD1  . TRP A 1 28  ? 4.978   -19.363 -8.101  1.00 0.00 ? 28  TRP A HD1  5  
ATOM 7564  H HE1  . TRP A 1 28  ? 3.654   -17.907 -9.760  1.00 0.00 ? 28  TRP A HE1  5  
ATOM 7565  H HE3  . TRP A 1 28  ? 3.935   -15.398 -5.047  1.00 0.00 ? 28  TRP A HE3  5  
ATOM 7566  H HZ2  . TRP A 1 28  ? 2.342   -15.408 -9.772  1.00 0.00 ? 28  TRP A HZ2  5  
ATOM 7567  H HZ3  . TRP A 1 28  ? 2.641   -13.515 -5.960  1.00 0.00 ? 28  TRP A HZ3  5  
ATOM 7568  H HH2  . TRP A 1 28  ? 1.862   -13.521 -8.274  1.00 0.00 ? 28  TRP A HH2  5  
ATOM 7569  N N    . ASN A 1 29  ? 7.924   -17.487 -3.498  1.00 0.00 ? 29  ASN A N    5  
ATOM 7570  C CA   . ASN A 1 29  ? 8.529   -17.686 -2.186  1.00 0.00 ? 29  ASN A CA   5  
ATOM 7571  C C    . ASN A 1 29  ? 7.669   -17.063 -1.090  1.00 0.00 ? 29  ASN A C    5  
ATOM 7572  O O    . ASN A 1 29  ? 7.533   -15.842 -1.012  1.00 0.00 ? 29  ASN A O    5  
ATOM 7573  C CB   . ASN A 1 29  ? 9.934   -17.083 -2.152  1.00 0.00 ? 29  ASN A CB   5  
ATOM 7574  C CG   . ASN A 1 29  ? 10.864  -17.727 -3.163  1.00 0.00 ? 29  ASN A CG   5  
ATOM 7575  O OD1  . ASN A 1 29  ? 11.449  -18.778 -2.904  1.00 0.00 ? 29  ASN A OD1  5  
ATOM 7576  N ND2  . ASN A 1 29  ? 11.004  -17.096 -4.323  1.00 0.00 ? 29  ASN A ND2  5  
ATOM 7577  H H    . ASN A 1 29  ? 7.911   -16.588 -3.887  1.00 0.00 ? 29  ASN A H    5  
ATOM 7578  H HA   . ASN A 1 29  ? 8.599   -18.749 -2.011  1.00 0.00 ? 29  ASN A HA   5  
ATOM 7579  H HB2  . ASN A 1 29  ? 9.872   -16.027 -2.371  1.00 0.00 ? 29  ASN A HB2  5  
ATOM 7580  H HB3  . ASN A 1 29  ? 10.355  -17.218 -1.167  1.00 0.00 ? 29  ASN A HB3  5  
ATOM 7581  H HD21 . ASN A 1 29  ? 10.507  -16.262 -4.460  1.00 0.00 ? 29  ASN A HD21 5  
ATOM 7582  H HD22 . ASN A 1 29  ? 11.598  -17.490 -4.995  1.00 0.00 ? 29  ASN A HD22 5  
ATOM 7583  N N    . LYS A 1 30  ? 7.092   -17.909 -0.245  1.00 0.00 ? 30  LYS A N    5  
ATOM 7584  C CA   . LYS A 1 30  ? 6.247   -17.443 0.848   1.00 0.00 ? 30  LYS A CA   5  
ATOM 7585  C C    . LYS A 1 30  ? 6.998   -16.455 1.733   1.00 0.00 ? 30  LYS A C    5  
ATOM 7586  O O    . LYS A 1 30  ? 8.123   -16.719 2.159   1.00 0.00 ? 30  LYS A O    5  
ATOM 7587  C CB   . LYS A 1 30  ? 5.762   -18.628 1.686   1.00 0.00 ? 30  LYS A CB   5  
ATOM 7588  C CG   . LYS A 1 30  ? 4.865   -18.227 2.845   1.00 0.00 ? 30  LYS A CG   5  
ATOM 7589  C CD   . LYS A 1 30  ? 4.354   -19.442 3.601   1.00 0.00 ? 30  LYS A CD   5  
ATOM 7590  C CE   . LYS A 1 30  ? 3.235   -19.070 4.561   1.00 0.00 ? 30  LYS A CE   5  
ATOM 7591  N NZ   . LYS A 1 30  ? 2.543   -20.274 5.099   1.00 0.00 ? 30  LYS A NZ   5  
ATOM 7592  H H    . LYS A 1 30  ? 7.238   -18.872 -0.359  1.00 0.00 ? 30  LYS A H    5  
ATOM 7593  H HA   . LYS A 1 30  ? 5.392   -16.944 0.417   1.00 0.00 ? 30  LYS A HA   5  
ATOM 7594  H HB2  . LYS A 1 30  ? 5.210   -19.303 1.048   1.00 0.00 ? 30  LYS A HB2  5  
ATOM 7595  H HB3  . LYS A 1 30  ? 6.621   -19.147 2.086   1.00 0.00 ? 30  LYS A HB3  5  
ATOM 7596  H HG2  . LYS A 1 30  ? 5.428   -17.604 3.525   1.00 0.00 ? 30  LYS A HG2  5  
ATOM 7597  H HG3  . LYS A 1 30  ? 4.022   -17.672 2.460   1.00 0.00 ? 30  LYS A HG3  5  
ATOM 7598  H HD2  . LYS A 1 30  ? 3.979   -20.165 2.892   1.00 0.00 ? 30  LYS A HD2  5  
ATOM 7599  H HD3  . LYS A 1 30  ? 5.170   -19.875 4.162   1.00 0.00 ? 30  LYS A HD3  5  
ATOM 7600  H HE2  . LYS A 1 30  ? 3.654   -18.510 5.383   1.00 0.00 ? 30  LYS A HE2  5  
ATOM 7601  H HE3  . LYS A 1 30  ? 2.517   -18.457 4.037   1.00 0.00 ? 30  LYS A HE3  5  
ATOM 7602  H HZ1  . LYS A 1 30  ? 1.912   -20.676 4.376   1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 7603  H HZ2  . LYS A 1 30  ? 1.977   -20.019 5.933   1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 7604  H HZ3  . LYS A 1 30  ? 3.241   -20.995 5.375   1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 7605  N N    . ARG A 1 31  ? 6.370   -15.316 2.007   1.00 0.00 ? 31  ARG A N    5  
ATOM 7606  C CA   . ARG A 1 31  ? 6.980   -14.288 2.842   1.00 0.00 ? 31  ARG A CA   5  
ATOM 7607  C C    . ARG A 1 31  ? 5.918   -13.531 3.634   1.00 0.00 ? 31  ARG A C    5  
ATOM 7608  O O    . ARG A 1 31  ? 4.790   -13.359 3.172   1.00 0.00 ? 31  ARG A O    5  
ATOM 7609  C CB   . ARG A 1 31  ? 7.783   -13.312 1.981   1.00 0.00 ? 31  ARG A CB   5  
ATOM 7610  C CG   . ARG A 1 31  ? 8.906   -12.618 2.734   1.00 0.00 ? 31  ARG A CG   5  
ATOM 7611  C CD   . ARG A 1 31  ? 10.128  -13.515 2.862   1.00 0.00 ? 31  ARG A CD   5  
ATOM 7612  N NE   . ARG A 1 31  ? 9.925   -14.577 3.843   1.00 0.00 ? 31  ARG A NE   5  
ATOM 7613  C CZ   . ARG A 1 31  ? 10.623  -15.708 3.857   1.00 0.00 ? 31  ARG A CZ   5  
ATOM 7614  N NH1  . ARG A 1 31  ? 11.563  -15.921 2.947   1.00 0.00 ? 31  ARG A NH1  5  
ATOM 7615  N NH2  . ARG A 1 31  ? 10.380  -16.628 4.782   1.00 0.00 ? 31  ARG A NH2  5  
ATOM 7616  H H    . ARG A 1 31  ? 5.475   -15.163 1.638   1.00 0.00 ? 31  ARG A H    5  
ATOM 7617  H HA   . ARG A 1 31  ? 7.649   -14.777 3.535   1.00 0.00 ? 31  ARG A HA   5  
ATOM 7618  H HB2  . ARG A 1 31  ? 8.215   -13.852 1.152   1.00 0.00 ? 31  ARG A HB2  5  
ATOM 7619  H HB3  . ARG A 1 31  ? 7.114   -12.555 1.598   1.00 0.00 ? 31  ARG A HB3  5  
ATOM 7620  H HG2  . ARG A 1 31  ? 9.186   -11.722 2.199   1.00 0.00 ? 31  ARG A HG2  5  
ATOM 7621  H HG3  . ARG A 1 31  ? 8.557   -12.355 3.721   1.00 0.00 ? 31  ARG A HG3  5  
ATOM 7622  H HD2  . ARG A 1 31  ? 10.334  -13.960 1.901   1.00 0.00 ? 31  ARG A HD2  5  
ATOM 7623  H HD3  . ARG A 1 31  ? 10.970  -12.911 3.167   1.00 0.00 ? 31  ARG A HD3  5  
ATOM 7624  H HE   . ARG A 1 31  ? 9.235   -14.441 4.525   1.00 0.00 ? 31  ARG A HE   5  
ATOM 7625  H HH11 . ARG A 1 31  ? 11.749  -15.229 2.249   1.00 0.00 ? 31  ARG A HH11 5  
ATOM 7626  H HH12 . ARG A 1 31  ? 12.088  -16.773 2.960   1.00 0.00 ? 31  ARG A HH12 5  
ATOM 7627  H HH21 . ARG A 1 31  ? 9.672   -16.470 5.469   1.00 0.00 ? 31  ARG A HH21 5  
ATOM 7628  H HH22 . ARG A 1 31  ? 10.905  -17.478 4.791   1.00 0.00 ? 31  ARG A HH22 5  
ATOM 7629  N N    . TRP A 1 32  ? 6.288   -13.081 4.828   1.00 0.00 ? 32  TRP A N    5  
ATOM 7630  C CA   . TRP A 1 32  ? 5.367   -12.343 5.685   1.00 0.00 ? 32  TRP A CA   5  
ATOM 7631  C C    . TRP A 1 32  ? 5.252   -10.890 5.236   1.00 0.00 ? 32  TRP A C    5  
ATOM 7632  O O    . TRP A 1 32  ? 6.248   -10.170 5.171   1.00 0.00 ? 32  TRP A O    5  
ATOM 7633  C CB   . TRP A 1 32  ? 5.832   -12.404 7.141   1.00 0.00 ? 32  TRP A CB   5  
ATOM 7634  C CG   . TRP A 1 32  ? 4.884   -11.744 8.095   1.00 0.00 ? 32  TRP A CG   5  
ATOM 7635  C CD1  . TRP A 1 32  ? 5.126   -10.637 8.858   1.00 0.00 ? 32  TRP A CD1  5  
ATOM 7636  C CD2  . TRP A 1 32  ? 3.543   -12.151 8.390   1.00 0.00 ? 32  TRP A CD2  5  
ATOM 7637  N NE1  . TRP A 1 32  ? 4.017   -10.331 9.609   1.00 0.00 ? 32  TRP A NE1  5  
ATOM 7638  C CE2  . TRP A 1 32  ? 3.032   -11.244 9.340   1.00 0.00 ? 32  TRP A CE2  5  
ATOM 7639  C CE3  . TRP A 1 32  ? 2.724   -13.191 7.943   1.00 0.00 ? 32  TRP A CE3  5  
ATOM 7640  C CZ2  . TRP A 1 32  ? 1.741   -11.349 9.849   1.00 0.00 ? 32  TRP A CZ2  5  
ATOM 7641  C CZ3  . TRP A 1 32  ? 1.442   -13.294 8.450   1.00 0.00 ? 32  TRP A CZ3  5  
ATOM 7642  C CH2  . TRP A 1 32  ? 0.960   -12.377 9.394   1.00 0.00 ? 32  TRP A CH2  5  
ATOM 7643  H H    . TRP A 1 32  ? 7.201   -13.250 5.142   1.00 0.00 ? 32  TRP A H    5  
ATOM 7644  H HA   . TRP A 1 32  ? 4.396   -12.810 5.607   1.00 0.00 ? 32  TRP A HA   5  
ATOM 7645  H HB2  . TRP A 1 32  ? 5.937   -13.437 7.436   1.00 0.00 ? 32  TRP A HB2  5  
ATOM 7646  H HB3  . TRP A 1 32  ? 6.789   -11.910 7.226   1.00 0.00 ? 32  TRP A HB3  5  
ATOM 7647  H HD1  . TRP A 1 32  ? 6.059   -10.094 8.861   1.00 0.00 ? 32  TRP A HD1  5  
ATOM 7648  H HE1  . TRP A 1 32  ? 3.944   -9.580  10.235  1.00 0.00 ? 32  TRP A HE1  5  
ATOM 7649  H HE3  . TRP A 1 32  ? 3.077   -13.907 7.216   1.00 0.00 ? 32  TRP A HE3  5  
ATOM 7650  H HZ2  . TRP A 1 32  ? 1.354   -10.651 10.577  1.00 0.00 ? 32  TRP A HZ2  5  
ATOM 7651  H HZ3  . TRP A 1 32  ? 0.795   -14.092 8.117   1.00 0.00 ? 32  TRP A HZ3  5  
ATOM 7652  H HH2  . TRP A 1 32  ? -0.047  -12.497 9.762   1.00 0.00 ? 32  TRP A HH2  5  
ATOM 7653  N N    . PHE A 1 33  ? 4.031   -10.466 4.926   1.00 0.00 ? 33  PHE A N    5  
ATOM 7654  C CA   . PHE A 1 33  ? 3.786   -9.099  4.482   1.00 0.00 ? 33  PHE A CA   5  
ATOM 7655  C C    . PHE A 1 33  ? 2.964   -8.331  5.513   1.00 0.00 ? 33  PHE A C    5  
ATOM 7656  O O    . PHE A 1 33  ? 2.034   -8.873  6.111   1.00 0.00 ? 33  PHE A O    5  
ATOM 7657  C CB   . PHE A 1 33  ? 3.062   -9.100  3.134   1.00 0.00 ? 33  PHE A CB   5  
ATOM 7658  C CG   . PHE A 1 33  ? 3.984   -9.263  1.959   1.00 0.00 ? 33  PHE A CG   5  
ATOM 7659  C CD1  . PHE A 1 33  ? 4.424   -10.520 1.576   1.00 0.00 ? 33  PHE A CD1  5  
ATOM 7660  C CD2  . PHE A 1 33  ? 4.410   -8.159  1.238   1.00 0.00 ? 33  PHE A CD2  5  
ATOM 7661  C CE1  . PHE A 1 33  ? 5.272   -10.673 0.495   1.00 0.00 ? 33  PHE A CE1  5  
ATOM 7662  C CE2  . PHE A 1 33  ? 5.258   -8.307  0.156   1.00 0.00 ? 33  PHE A CE2  5  
ATOM 7663  C CZ   . PHE A 1 33  ? 5.690   -9.565  -0.215  1.00 0.00 ? 33  PHE A CZ   5  
ATOM 7664  H H    . PHE A 1 33  ? 3.276   -11.088 4.998   1.00 0.00 ? 33  PHE A H    5  
ATOM 7665  H HA   . PHE A 1 33  ? 4.743   -8.613  4.367   1.00 0.00 ? 33  PHE A HA   5  
ATOM 7666  H HB2  . PHE A 1 33  ? 2.354   -9.914  3.114   1.00 0.00 ? 33  PHE A HB2  5  
ATOM 7667  H HB3  . PHE A 1 33  ? 2.535   -8.166  3.016   1.00 0.00 ? 33  PHE A HB3  5  
ATOM 7668  H HD1  . PHE A 1 33  ? 4.098   -11.388 2.131   1.00 0.00 ? 33  PHE A HD1  5  
ATOM 7669  H HD2  . PHE A 1 33  ? 4.074   -7.175  1.527   1.00 0.00 ? 33  PHE A HD2  5  
ATOM 7670  H HE1  . PHE A 1 33  ? 5.608   -11.659 0.208   1.00 0.00 ? 33  PHE A HE1  5  
ATOM 7671  H HE2  . PHE A 1 33  ? 5.583   -7.439  -0.398  1.00 0.00 ? 33  PHE A HE2  5  
ATOM 7672  H HZ   . PHE A 1 33  ? 6.351   -9.683  -1.061  1.00 0.00 ? 33  PHE A HZ   5  
ATOM 7673  N N    . VAL A 1 34  ? 3.314   -7.065  5.716   1.00 0.00 ? 34  VAL A N    5  
ATOM 7674  C CA   . VAL A 1 34  ? 2.609   -6.221  6.673   1.00 0.00 ? 34  VAL A CA   5  
ATOM 7675  C C    . VAL A 1 34  ? 2.272   -4.864  6.066   1.00 0.00 ? 34  VAL A C    5  
ATOM 7676  O O    . VAL A 1 34  ? 3.159   -4.045  5.818   1.00 0.00 ? 34  VAL A O    5  
ATOM 7677  C CB   . VAL A 1 34  ? 3.441   -6.007  7.952   1.00 0.00 ? 34  VAL A CB   5  
ATOM 7678  C CG1  . VAL A 1 34  ? 2.668   -5.169  8.958   1.00 0.00 ? 34  VAL A CG1  5  
ATOM 7679  C CG2  . VAL A 1 34  ? 3.843   -7.344  8.555   1.00 0.00 ? 34  VAL A CG2  5  
ATOM 7680  H H    . VAL A 1 34  ? 4.064   -6.689  5.209   1.00 0.00 ? 34  VAL A H    5  
ATOM 7681  H HA   . VAL A 1 34  ? 1.691   -6.721  6.946   1.00 0.00 ? 34  VAL A HA   5  
ATOM 7682  H HB   . VAL A 1 34  ? 4.341   -5.471  7.686   1.00 0.00 ? 34  VAL A HB   5  
ATOM 7683  H HG11 . VAL A 1 34  ? 2.371   -4.238  8.498   1.00 0.00 ? 34  VAL A HG11 5  
ATOM 7684  H HG12 . VAL A 1 34  ? 1.790   -5.710  9.279   1.00 0.00 ? 34  VAL A HG12 5  
ATOM 7685  H HG13 . VAL A 1 34  ? 3.296   -4.963  9.813   1.00 0.00 ? 34  VAL A HG13 5  
ATOM 7686  H HG21 . VAL A 1 34  ? 4.157   -8.014  7.769   1.00 0.00 ? 34  VAL A HG21 5  
ATOM 7687  H HG22 . VAL A 1 34  ? 4.659   -7.197  9.249   1.00 0.00 ? 34  VAL A HG22 5  
ATOM 7688  H HG23 . VAL A 1 34  ? 3.000   -7.772  9.078   1.00 0.00 ? 34  VAL A HG23 5  
ATOM 7689  N N    . LEU A 1 35  ? 0.986   -4.631  5.829   1.00 0.00 ? 35  LEU A N    5  
ATOM 7690  C CA   . LEU A 1 35  ? 0.531   -3.371  5.251   1.00 0.00 ? 35  LEU A CA   5  
ATOM 7691  C C    . LEU A 1 35  ? 0.640   -2.236  6.264   1.00 0.00 ? 35  LEU A C    5  
ATOM 7692  O O    . LEU A 1 35  ? 0.049   -2.293  7.343   1.00 0.00 ? 35  LEU A O    5  
ATOM 7693  C CB   . LEU A 1 35  ? -0.915  -3.502  4.769   1.00 0.00 ? 35  LEU A CB   5  
ATOM 7694  C CG   . LEU A 1 35  ? -1.598  -2.205  4.336   1.00 0.00 ? 35  LEU A CG   5  
ATOM 7695  C CD1  . LEU A 1 35  ? -0.868  -1.585  3.154   1.00 0.00 ? 35  LEU A CD1  5  
ATOM 7696  C CD2  . LEU A 1 35  ? -3.058  -2.460  3.989   1.00 0.00 ? 35  LEU A CD2  5  
ATOM 7697  H H    . LEU A 1 35  ? 0.327   -5.321  6.048   1.00 0.00 ? 35  LEU A H    5  
ATOM 7698  H HA   . LEU A 1 35  ? 1.164   -3.146  4.406   1.00 0.00 ? 35  LEU A HA   5  
ATOM 7699  H HB2  . LEU A 1 35  ? -0.923  -4.177  3.926   1.00 0.00 ? 35  LEU A HB2  5  
ATOM 7700  H HB3  . LEU A 1 35  ? -1.494  -3.930  5.575   1.00 0.00 ? 35  LEU A HB3  5  
ATOM 7701  H HG   . LEU A 1 35  ? -1.567  -1.498  5.154   1.00 0.00 ? 35  LEU A HG   5  
ATOM 7702  H HD11 . LEU A 1 35  ? -1.398  -1.816  2.243   1.00 0.00 ? 35  LEU A HD11 5  
ATOM 7703  H HD12 . LEU A 1 35  ? 0.133   -1.985  3.100   1.00 0.00 ? 35  LEU A HD12 5  
ATOM 7704  H HD13 . LEU A 1 35  ? -0.821  -0.514  3.282   1.00 0.00 ? 35  LEU A HD13 5  
ATOM 7705  H HD21 . LEU A 1 35  ? -3.620  -2.622  4.897   1.00 0.00 ? 35  LEU A HD21 5  
ATOM 7706  H HD22 . LEU A 1 35  ? -3.130  -3.336  3.361   1.00 0.00 ? 35  LEU A HD22 5  
ATOM 7707  H HD23 . LEU A 1 35  ? -3.458  -1.606  3.464   1.00 0.00 ? 35  LEU A HD23 5  
ATOM 7708  N N    . VAL A 1 36  ? 1.398   -1.204  5.908   1.00 0.00 ? 36  VAL A N    5  
ATOM 7709  C CA   . VAL A 1 36  ? 1.582   -0.053  6.785   1.00 0.00 ? 36  VAL A CA   5  
ATOM 7710  C C    . VAL A 1 36  ? 1.016   1.214   6.154   1.00 0.00 ? 36  VAL A C    5  
ATOM 7711  O O    . VAL A 1 36  ? 0.429   1.173   5.072   1.00 0.00 ? 36  VAL A O    5  
ATOM 7712  C CB   . VAL A 1 36  ? 3.071   0.170   7.112   1.00 0.00 ? 36  VAL A CB   5  
ATOM 7713  C CG1  . VAL A 1 36  ? 3.732   1.020   6.038   1.00 0.00 ? 36  VAL A CG1  5  
ATOM 7714  C CG2  . VAL A 1 36  ? 3.224   0.814   8.482   1.00 0.00 ? 36  VAL A CG2  5  
ATOM 7715  H H    . VAL A 1 36  ? 1.843   -1.216  5.036   1.00 0.00 ? 36  VAL A H    5  
ATOM 7716  H HA   . VAL A 1 36  ? 1.058   -0.249  7.708   1.00 0.00 ? 36  VAL A HA   5  
ATOM 7717  H HB   . VAL A 1 36  ? 3.562   -0.791  7.132   1.00 0.00 ? 36  VAL A HB   5  
ATOM 7718  H HG11 . VAL A 1 36  ? 3.666   0.513   5.086   1.00 0.00 ? 36  VAL A HG11 5  
ATOM 7719  H HG12 . VAL A 1 36  ? 3.231   1.975   5.974   1.00 0.00 ? 36  VAL A HG12 5  
ATOM 7720  H HG13 . VAL A 1 36  ? 4.771   1.175   6.290   1.00 0.00 ? 36  VAL A HG13 5  
ATOM 7721  H HG21 . VAL A 1 36  ? 3.676   1.788   8.373   1.00 0.00 ? 36  VAL A HG21 5  
ATOM 7722  H HG22 . VAL A 1 36  ? 2.251   0.918   8.942   1.00 0.00 ? 36  VAL A HG22 5  
ATOM 7723  H HG23 . VAL A 1 36  ? 3.851   0.193   9.104   1.00 0.00 ? 36  VAL A HG23 5  
ATOM 7724  N N    . ASP A 1 37  ? 1.196   2.339   6.837   1.00 0.00 ? 37  ASP A N    5  
ATOM 7725  C CA   . ASP A 1 37  ? 0.705   3.620   6.343   1.00 0.00 ? 37  ASP A CA   5  
ATOM 7726  C C    . ASP A 1 37  ? 1.148   3.854   4.902   1.00 0.00 ? 37  ASP A C    5  
ATOM 7727  O O    . ASP A 1 37  ? 2.343   3.937   4.616   1.00 0.00 ? 37  ASP A O    5  
ATOM 7728  C CB   . ASP A 1 37  ? 1.202   4.760   7.234   1.00 0.00 ? 37  ASP A CB   5  
ATOM 7729  C CG   . ASP A 1 37  ? 2.715   4.849   7.269   1.00 0.00 ? 37  ASP A CG   5  
ATOM 7730  O OD1  . ASP A 1 37  ? 3.371   3.786   7.283   1.00 0.00 ? 37  ASP A OD1  5  
ATOM 7731  O OD2  . ASP A 1 37  ? 3.243   5.980   7.283   1.00 0.00 ? 37  ASP A OD2  5  
ATOM 7732  H H    . ASP A 1 37  ? 1.672   2.308   7.693   1.00 0.00 ? 37  ASP A H    5  
ATOM 7733  H HA   . ASP A 1 37  ? -0.374  3.596   6.374   1.00 0.00 ? 37  ASP A HA   5  
ATOM 7734  H HB2  . ASP A 1 37  ? 0.814   5.696   6.860   1.00 0.00 ? 37  ASP A HB2  5  
ATOM 7735  H HB3  . ASP A 1 37  ? 0.845   4.603   8.241   1.00 0.00 ? 37  ASP A HB3  5  
ATOM 7736  N N    . ARG A 1 38  ? 0.179   3.958   3.999   1.00 0.00 ? 38  ARG A N    5  
ATOM 7737  C CA   . ARG A 1 38  ? 0.470   4.179   2.588   1.00 0.00 ? 38  ARG A CA   5  
ATOM 7738  C C    . ARG A 1 38  ? 1.753   3.463   2.178   1.00 0.00 ? 38  ARG A C    5  
ATOM 7739  O O    . ARG A 1 38  ? 2.488   3.933   1.309   1.00 0.00 ? 38  ARG A O    5  
ATOM 7740  C CB   . ARG A 1 38  ? 0.595   5.676   2.299   1.00 0.00 ? 38  ARG A CB   5  
ATOM 7741  C CG   . ARG A 1 38  ? -0.735  6.413   2.317   1.00 0.00 ? 38  ARG A CG   5  
ATOM 7742  C CD   . ARG A 1 38  ? -0.656  7.724   1.550   1.00 0.00 ? 38  ARG A CD   5  
ATOM 7743  N NE   . ARG A 1 38  ? -1.872  8.518   1.696   1.00 0.00 ? 38  ARG A NE   5  
ATOM 7744  C CZ   . ARG A 1 38  ? -2.040  9.714   1.144   1.00 0.00 ? 38  ARG A CZ   5  
ATOM 7745  N NH1  . ARG A 1 38  ? -1.073  10.252  0.413   1.00 0.00 ? 38  ARG A NH1  5  
ATOM 7746  N NH2  . ARG A 1 38  ? -3.176  10.376  1.323   1.00 0.00 ? 38  ARG A NH2  5  
ATOM 7747  H H    . ARG A 1 38  ? -0.755  3.883   4.289   1.00 0.00 ? 38  ARG A H    5  
ATOM 7748  H HA   . ARG A 1 38  ? -0.351  3.778   2.013   1.00 0.00 ? 38  ARG A HA   5  
ATOM 7749  H HB2  . ARG A 1 38  ? 1.238   6.122   3.044   1.00 0.00 ? 38  ARG A HB2  5  
ATOM 7750  H HB3  . ARG A 1 38  ? 1.041   5.807   1.325   1.00 0.00 ? 38  ARG A HB3  5  
ATOM 7751  H HG2  . ARG A 1 38  ? -1.488  5.787   1.862   1.00 0.00 ? 38  ARG A HG2  5  
ATOM 7752  H HG3  . ARG A 1 38  ? -1.007  6.621   3.341   1.00 0.00 ? 38  ARG A HG3  5  
ATOM 7753  H HD2  . ARG A 1 38  ? 0.182   8.294   1.923   1.00 0.00 ? 38  ARG A HD2  5  
ATOM 7754  H HD3  . ARG A 1 38  ? -0.504  7.504   0.504   1.00 0.00 ? 38  ARG A HD3  5  
ATOM 7755  H HE   . ARG A 1 38  ? -2.599  8.140   2.233   1.00 0.00 ? 38  ARG A HE   5  
ATOM 7756  H HH11 . ARG A 1 38  ? -0.217  9.755   0.275   1.00 0.00 ? 38  ARG A HH11 5  
ATOM 7757  H HH12 . ARG A 1 38  ? -1.202  11.152  -0.003  1.00 0.00 ? 38  ARG A HH12 5  
ATOM 7758  H HH21 . ARG A 1 38  ? -3.907  9.974   1.874   1.00 0.00 ? 38  ARG A HH21 5  
ATOM 7759  H HH22 . ARG A 1 38  ? -3.301  11.276  0.908   1.00 0.00 ? 38  ARG A HH22 5  
ATOM 7760  N N    . CYS A 1 39  ? 2.016   2.324   2.810   1.00 0.00 ? 39  CYS A N    5  
ATOM 7761  C CA   . CYS A 1 39  ? 3.212   1.543   2.513   1.00 0.00 ? 39  CYS A CA   5  
ATOM 7762  C C    . CYS A 1 39  ? 2.998   0.072   2.853   1.00 0.00 ? 39  CYS A C    5  
ATOM 7763  O O    . CYS A 1 39  ? 2.021   -0.289  3.509   1.00 0.00 ? 39  CYS A O    5  
ATOM 7764  C CB   . CYS A 1 39  ? 4.410   2.090   3.289   1.00 0.00 ? 39  CYS A CB   5  
ATOM 7765  S SG   . CYS A 1 39  ? 5.352   3.352   2.401   1.00 0.00 ? 39  CYS A SG   5  
ATOM 7766  H H    . CYS A 1 39  ? 1.392   2.001   3.493   1.00 0.00 ? 39  CYS A H    5  
ATOM 7767  H HA   . CYS A 1 39  ? 3.409   1.630   1.455   1.00 0.00 ? 39  CYS A HA   5  
ATOM 7768  H HB2  . CYS A 1 39  ? 4.061   2.531   4.212   1.00 0.00 ? 39  CYS A HB2  5  
ATOM 7769  H HB3  . CYS A 1 39  ? 5.082   1.277   3.519   1.00 0.00 ? 39  CYS A HB3  5  
ATOM 7770  H HG   . CYS A 1 39  ? 5.444   2.977   1.134   1.00 0.00 ? 39  CYS A HG   5  
ATOM 7771  N N    . LEU A 1 40  ? 3.918   -0.774  2.401   1.00 0.00 ? 40  LEU A N    5  
ATOM 7772  C CA   . LEU A 1 40  ? 3.831   -2.207  2.657   1.00 0.00 ? 40  LEU A CA   5  
ATOM 7773  C C    . LEU A 1 40  ? 5.217   -2.809  2.862   1.00 0.00 ? 40  LEU A C    5  
ATOM 7774  O O    . LEU A 1 40  ? 6.090   -2.693  2.002   1.00 0.00 ? 40  LEU A O    5  
ATOM 7775  C CB   . LEU A 1 40  ? 3.124   -2.910  1.496   1.00 0.00 ? 40  LEU A CB   5  
ATOM 7776  C CG   . LEU A 1 40  ? 3.148   -4.438  1.522   1.00 0.00 ? 40  LEU A CG   5  
ATOM 7777  C CD1  . LEU A 1 40  ? 2.596   -4.958  2.841   1.00 0.00 ? 40  LEU A CD1  5  
ATOM 7778  C CD2  . LEU A 1 40  ? 2.357   -5.004  0.351   1.00 0.00 ? 40  LEU A CD2  5  
ATOM 7779  H H    . LEU A 1 40  ? 4.675   -0.427  1.885   1.00 0.00 ? 40  LEU A H    5  
ATOM 7780  H HA   . LEU A 1 40  ? 3.253   -2.349  3.558   1.00 0.00 ? 40  LEU A HA   5  
ATOM 7781  H HB2  . LEU A 1 40  ? 2.092   -2.595  1.498   1.00 0.00 ? 40  LEU A HB2  5  
ATOM 7782  H HB3  . LEU A 1 40  ? 3.596   -2.586  0.578   1.00 0.00 ? 40  LEU A HB3  5  
ATOM 7783  H HG   . LEU A 1 40  ? 4.170   -4.778  1.431   1.00 0.00 ? 40  LEU A HG   5  
ATOM 7784  H HD11 . LEU A 1 40  ? 3.263   -4.682  3.643   1.00 0.00 ? 40  LEU A HD11 5  
ATOM 7785  H HD12 . LEU A 1 40  ? 2.511   -6.034  2.796   1.00 0.00 ? 40  LEU A HD12 5  
ATOM 7786  H HD13 . LEU A 1 40  ? 1.622   -4.527  3.018   1.00 0.00 ? 40  LEU A HD13 5  
ATOM 7787  H HD21 . LEU A 1 40  ? 1.303   -4.985  0.587   1.00 0.00 ? 40  LEU A HD21 5  
ATOM 7788  H HD22 . LEU A 1 40  ? 2.666   -6.023  0.167   1.00 0.00 ? 40  LEU A HD22 5  
ATOM 7789  H HD23 . LEU A 1 40  ? 2.540   -4.406  -0.529  1.00 0.00 ? 40  LEU A HD23 5  
ATOM 7790  N N    . PHE A 1 41  ? 5.412   -3.456  4.007   1.00 0.00 ? 41  PHE A N    5  
ATOM 7791  C CA   . PHE A 1 41  ? 6.692   -4.078  4.325   1.00 0.00 ? 41  PHE A CA   5  
ATOM 7792  C C    . PHE A 1 41  ? 6.577   -5.599  4.304   1.00 0.00 ? 41  PHE A C    5  
ATOM 7793  O O    . PHE A 1 41  ? 5.478   -6.149  4.226   1.00 0.00 ? 41  PHE A O    5  
ATOM 7794  C CB   . PHE A 1 41  ? 7.183   -3.611  5.697   1.00 0.00 ? 41  PHE A CB   5  
ATOM 7795  C CG   . PHE A 1 41  ? 7.704   -2.202  5.700   1.00 0.00 ? 41  PHE A CG   5  
ATOM 7796  C CD1  . PHE A 1 41  ? 8.995   -1.926  5.281   1.00 0.00 ? 41  PHE A CD1  5  
ATOM 7797  C CD2  . PHE A 1 41  ? 6.902   -1.154  6.121   1.00 0.00 ? 41  PHE A CD2  5  
ATOM 7798  C CE1  . PHE A 1 41  ? 9.477   -0.631  5.283   1.00 0.00 ? 41  PHE A CE1  5  
ATOM 7799  C CE2  . PHE A 1 41  ? 7.378   0.144   6.125   1.00 0.00 ? 41  PHE A CE2  5  
ATOM 7800  C CZ   . PHE A 1 41  ? 8.667   0.406   5.704   1.00 0.00 ? 41  PHE A CZ   5  
ATOM 7801  H H    . PHE A 1 41  ? 4.677   -3.515  4.653   1.00 0.00 ? 41  PHE A H    5  
ATOM 7802  H HA   . PHE A 1 41  ? 7.404   -3.772  3.574   1.00 0.00 ? 41  PHE A HA   5  
ATOM 7803  H HB2  . PHE A 1 41  ? 6.366   -3.663  6.401   1.00 0.00 ? 41  PHE A HB2  5  
ATOM 7804  H HB3  . PHE A 1 41  ? 7.979   -4.261  6.027   1.00 0.00 ? 41  PHE A HB3  5  
ATOM 7805  H HD1  . PHE A 1 41  ? 9.630   -2.736  4.950   1.00 0.00 ? 41  PHE A HD1  5  
ATOM 7806  H HD2  . PHE A 1 41  ? 5.892   -1.357  6.450   1.00 0.00 ? 41  PHE A HD2  5  
ATOM 7807  H HE1  . PHE A 1 41  ? 10.486  -0.429  4.954   1.00 0.00 ? 41  PHE A HE1  5  
ATOM 7808  H HE2  . PHE A 1 41  ? 6.742   0.952   6.455   1.00 0.00 ? 41  PHE A HE2  5  
ATOM 7809  H HZ   . PHE A 1 41  ? 9.042   1.418   5.707   1.00 0.00 ? 41  PHE A HZ   5  
ATOM 7810  N N    . TYR A 1 42  ? 7.719   -6.273  4.374   1.00 0.00 ? 42  TYR A N    5  
ATOM 7811  C CA   . TYR A 1 42  ? 7.749   -7.731  4.361   1.00 0.00 ? 42  TYR A CA   5  
ATOM 7812  C C    . TYR A 1 42  ? 8.961   -8.259  5.122   1.00 0.00 ? 42  TYR A C    5  
ATOM 7813  O O    . TYR A 1 42  ? 10.046  -7.681  5.061   1.00 0.00 ? 42  TYR A O    5  
ATOM 7814  C CB   . TYR A 1 42  ? 7.772   -8.248  2.921   1.00 0.00 ? 42  TYR A CB   5  
ATOM 7815  C CG   . TYR A 1 42  ? 9.102   -8.051  2.228   1.00 0.00 ? 42  TYR A CG   5  
ATOM 7816  C CD1  . TYR A 1 42  ? 10.153  -8.935  2.434   1.00 0.00 ? 42  TYR A CD1  5  
ATOM 7817  C CD2  . TYR A 1 42  ? 9.306   -6.979  1.367   1.00 0.00 ? 42  TYR A CD2  5  
ATOM 7818  C CE1  . TYR A 1 42  ? 11.369  -8.758  1.804   1.00 0.00 ? 42  TYR A CE1  5  
ATOM 7819  C CE2  . TYR A 1 42  ? 10.518  -6.795  0.731   1.00 0.00 ? 42  TYR A CE2  5  
ATOM 7820  C CZ   . TYR A 1 42  ? 11.547  -7.687  0.953   1.00 0.00 ? 42  TYR A CZ   5  
ATOM 7821  O OH   . TYR A 1 42  ? 12.757  -7.508  0.322   1.00 0.00 ? 42  TYR A OH   5  
ATOM 7822  H H    . TYR A 1 42  ? 8.564   -5.779  4.435   1.00 0.00 ? 42  TYR A H    5  
ATOM 7823  H HA   . TYR A 1 42  ? 6.851   -8.086  4.845   1.00 0.00 ? 42  TYR A HA   5  
ATOM 7824  H HB2  . TYR A 1 42  ? 7.553   -9.305  2.922   1.00 0.00 ? 42  TYR A HB2  5  
ATOM 7825  H HB3  . TYR A 1 42  ? 7.018   -7.729  2.347   1.00 0.00 ? 42  TYR A HB3  5  
ATOM 7826  H HD1  . TYR A 1 42  ? 10.010  -9.774  3.100   1.00 0.00 ? 42  TYR A HD1  5  
ATOM 7827  H HD2  . TYR A 1 42  ? 8.498   -6.283  1.195   1.00 0.00 ? 42  TYR A HD2  5  
ATOM 7828  H HE1  . TYR A 1 42  ? 12.175  -9.457  1.977   1.00 0.00 ? 42  TYR A HE1  5  
ATOM 7829  H HE2  . TYR A 1 42  ? 10.658  -5.956  0.066   1.00 0.00 ? 42  TYR A HE2  5  
ATOM 7830  H HH   . TYR A 1 42  ? 12.744  -6.681  -0.166  1.00 0.00 ? 42  TYR A HH   5  
ATOM 7831  N N    . TYR A 1 43  ? 8.767   -9.361  5.839   1.00 0.00 ? 43  TYR A N    5  
ATOM 7832  C CA   . TYR A 1 43  ? 9.842   -9.967  6.614   1.00 0.00 ? 43  TYR A CA   5  
ATOM 7833  C C    . TYR A 1 43  ? 9.901   -11.473 6.379   1.00 0.00 ? 43  TYR A C    5  
ATOM 7834  O O    . TYR A 1 43  ? 8.957   -12.071 5.863   1.00 0.00 ? 43  TYR A O    5  
ATOM 7835  C CB   . TYR A 1 43  ? 9.650   -9.679  8.104   1.00 0.00 ? 43  TYR A CB   5  
ATOM 7836  C CG   . TYR A 1 43  ? 9.138   -8.285  8.390   1.00 0.00 ? 43  TYR A CG   5  
ATOM 7837  C CD1  . TYR A 1 43  ? 7.827   -7.931  8.097   1.00 0.00 ? 43  TYR A CD1  5  
ATOM 7838  C CD2  . TYR A 1 43  ? 9.966   -7.323  8.955   1.00 0.00 ? 43  TYR A CD2  5  
ATOM 7839  C CE1  . TYR A 1 43  ? 7.356   -6.659  8.356   1.00 0.00 ? 43  TYR A CE1  5  
ATOM 7840  C CE2  . TYR A 1 43  ? 9.502   -6.048  9.219   1.00 0.00 ? 43  TYR A CE2  5  
ATOM 7841  C CZ   . TYR A 1 43  ? 8.197   -5.721  8.917   1.00 0.00 ? 43  TYR A CZ   5  
ATOM 7842  O OH   . TYR A 1 43  ? 7.731   -4.453  9.178   1.00 0.00 ? 43  TYR A OH   5  
ATOM 7843  H H    . TYR A 1 43  ? 7.879   -9.775  5.848   1.00 0.00 ? 43  TYR A H    5  
ATOM 7844  H HA   . TYR A 1 43  ? 10.774  -9.527  6.290   1.00 0.00 ? 43  TYR A HA   5  
ATOM 7845  H HB2  . TYR A 1 43  ? 8.940   -10.382 8.511   1.00 0.00 ? 43  TYR A HB2  5  
ATOM 7846  H HB3  . TYR A 1 43  ? 10.597  -9.796  8.611   1.00 0.00 ? 43  TYR A HB3  5  
ATOM 7847  H HD1  . TYR A 1 43  ? 7.171   -8.669  7.658   1.00 0.00 ? 43  TYR A HD1  5  
ATOM 7848  H HD2  . TYR A 1 43  ? 10.988  -7.582  9.191   1.00 0.00 ? 43  TYR A HD2  5  
ATOM 7849  H HE1  . TYR A 1 43  ? 6.333   -6.403  8.120   1.00 0.00 ? 43  TYR A HE1  5  
ATOM 7850  H HE2  . TYR A 1 43  ? 10.161  -5.313  9.659   1.00 0.00 ? 43  TYR A HE2  5  
ATOM 7851  H HH   . TYR A 1 43  ? 8.382   -3.973  9.696   1.00 0.00 ? 43  TYR A HH   5  
ATOM 7852  N N    . LYS A 1 44  ? 11.018  -12.082 6.763   1.00 0.00 ? 44  LYS A N    5  
ATOM 7853  C CA   . LYS A 1 44  ? 11.202  -13.519 6.598   1.00 0.00 ? 44  LYS A CA   5  
ATOM 7854  C C    . LYS A 1 44  ? 10.114  -14.295 7.332   1.00 0.00 ? 44  LYS A C    5  
ATOM 7855  O O    . LYS A 1 44  ? 9.596   -15.289 6.822   1.00 0.00 ? 44  LYS A O    5  
ATOM 7856  C CB   . LYS A 1 44  ? 12.580  -13.940 7.114   1.00 0.00 ? 44  LYS A CB   5  
ATOM 7857  C CG   . LYS A 1 44  ? 13.712  -13.629 6.150   1.00 0.00 ? 44  LYS A CG   5  
ATOM 7858  C CD   . LYS A 1 44  ? 13.894  -14.738 5.127   1.00 0.00 ? 44  LYS A CD   5  
ATOM 7859  C CE   . LYS A 1 44  ? 14.756  -14.283 3.960   1.00 0.00 ? 44  LYS A CE   5  
ATOM 7860  N NZ   . LYS A 1 44  ? 14.689  -15.235 2.817   1.00 0.00 ? 44  LYS A NZ   5  
ATOM 7861  H H    . LYS A 1 44  ? 11.736  -11.552 7.169   1.00 0.00 ? 44  LYS A H    5  
ATOM 7862  H HA   . LYS A 1 44  ? 11.139  -13.742 5.544   1.00 0.00 ? 44  LYS A HA   5  
ATOM 7863  H HB2  . LYS A 1 44  ? 12.775  -13.426 8.044   1.00 0.00 ? 44  LYS A HB2  5  
ATOM 7864  H HB3  . LYS A 1 44  ? 12.573  -15.005 7.296   1.00 0.00 ? 44  LYS A HB3  5  
ATOM 7865  H HG2  . LYS A 1 44  ? 13.488  -12.708 5.631   1.00 0.00 ? 44  LYS A HG2  5  
ATOM 7866  H HG3  . LYS A 1 44  ? 14.629  -13.514 6.711   1.00 0.00 ? 44  LYS A HG3  5  
ATOM 7867  H HD2  . LYS A 1 44  ? 14.371  -15.581 5.605   1.00 0.00 ? 44  LYS A HD2  5  
ATOM 7868  H HD3  . LYS A 1 44  ? 12.925  -15.034 4.754   1.00 0.00 ? 44  LYS A HD3  5  
ATOM 7869  H HE2  . LYS A 1 44  ? 14.412  -13.314 3.631   1.00 0.00 ? 44  LYS A HE2  5  
ATOM 7870  H HE3  . LYS A 1 44  ? 15.780  -14.206 4.293   1.00 0.00 ? 44  LYS A HE3  5  
ATOM 7871  H HZ1  . LYS A 1 44  ? 15.595  -15.735 2.715   1.00 0.00 ? 44  LYS A HZ1  5  
ATOM 7872  H HZ2  . LYS A 1 44  ? 14.488  -14.721 1.935   1.00 0.00 ? 44  LYS A HZ2  5  
ATOM 7873  H HZ3  . LYS A 1 44  ? 13.936  -15.933 2.977   1.00 0.00 ? 44  LYS A HZ3  5  
ATOM 7874  N N    . ASP A 1 45  ? 9.771   -13.835 8.530   1.00 0.00 ? 45  ASP A N    5  
ATOM 7875  C CA   . ASP A 1 45  ? 8.742   -14.485 9.333   1.00 0.00 ? 45  ASP A CA   5  
ATOM 7876  C C    . ASP A 1 45  ? 8.126   -13.503 10.325  1.00 0.00 ? 45  ASP A C    5  
ATOM 7877  O O    . ASP A 1 45  ? 8.598   -12.377 10.471  1.00 0.00 ? 45  ASP A O    5  
ATOM 7878  C CB   . ASP A 1 45  ? 9.329   -15.684 10.080  1.00 0.00 ? 45  ASP A CB   5  
ATOM 7879  C CG   . ASP A 1 45  ? 8.267   -16.499 10.792  1.00 0.00 ? 45  ASP A CG   5  
ATOM 7880  O OD1  . ASP A 1 45  ? 7.842   -16.088 11.892  1.00 0.00 ? 45  ASP A OD1  5  
ATOM 7881  O OD2  . ASP A 1 45  ? 7.861   -17.547 10.248  1.00 0.00 ? 45  ASP A OD2  5  
ATOM 7882  H H    . ASP A 1 45  ? 10.220  -13.038 8.882   1.00 0.00 ? 45  ASP A H    5  
ATOM 7883  H HA   . ASP A 1 45  ? 7.969   -14.833 8.664   1.00 0.00 ? 45  ASP A HA   5  
ATOM 7884  H HB2  . ASP A 1 45  ? 9.837   -16.326 9.375   1.00 0.00 ? 45  ASP A HB2  5  
ATOM 7885  H HB3  . ASP A 1 45  ? 10.038  -15.330 10.814  1.00 0.00 ? 45  ASP A HB3  5  
ATOM 7886  N N    . GLU A 1 46  ? 7.069   -13.940 11.003  1.00 0.00 ? 46  GLU A N    5  
ATOM 7887  C CA   . GLU A 1 46  ? 6.388   -13.098 11.980  1.00 0.00 ? 46  GLU A CA   5  
ATOM 7888  C C    . GLU A 1 46  ? 7.386   -12.227 12.737  1.00 0.00 ? 46  GLU A C    5  
ATOM 7889  O O    . GLU A 1 46  ? 7.137   -11.046 12.980  1.00 0.00 ? 46  GLU A O    5  
ATOM 7890  C CB   . GLU A 1 46  ? 5.597   -13.960 12.966  1.00 0.00 ? 46  GLU A CB   5  
ATOM 7891  C CG   . GLU A 1 46  ? 4.556   -14.845 12.301  1.00 0.00 ? 46  GLU A CG   5  
ATOM 7892  C CD   . GLU A 1 46  ? 3.347   -14.065 11.823  1.00 0.00 ? 46  GLU A CD   5  
ATOM 7893  O OE1  . GLU A 1 46  ? 3.469   -13.339 10.815  1.00 0.00 ? 46  GLU A OE1  5  
ATOM 7894  O OE2  . GLU A 1 46  ? 2.278   -14.182 12.458  1.00 0.00 ? 46  GLU A OE2  5  
ATOM 7895  H H    . GLU A 1 46  ? 6.740   -14.849 10.843  1.00 0.00 ? 46  GLU A H    5  
ATOM 7896  H HA   . GLU A 1 46  ? 5.703   -12.458 11.445  1.00 0.00 ? 46  GLU A HA   5  
ATOM 7897  H HB2  . GLU A 1 46  ? 6.286   -14.593 13.506  1.00 0.00 ? 46  GLU A HB2  5  
ATOM 7898  H HB3  . GLU A 1 46  ? 5.093   -13.312 13.667  1.00 0.00 ? 46  GLU A HB3  5  
ATOM 7899  H HG2  . GLU A 1 46  ? 5.008   -15.335 11.452  1.00 0.00 ? 46  GLU A HG2  5  
ATOM 7900  H HG3  . GLU A 1 46  ? 4.228   -15.590 13.012  1.00 0.00 ? 46  GLU A HG3  5  
ATOM 7901  N N    . LYS A 1 47  ? 8.517   -12.818 13.107  1.00 0.00 ? 47  LYS A N    5  
ATOM 7902  C CA   . LYS A 1 47  ? 9.555   -12.097 13.836  1.00 0.00 ? 47  LYS A CA   5  
ATOM 7903  C C    . LYS A 1 47  ? 9.642   -10.648 13.368  1.00 0.00 ? 47  LYS A C    5  
ATOM 7904  O O    . LYS A 1 47  ? 9.702   -9.727  14.181  1.00 0.00 ? 47  LYS A O    5  
ATOM 7905  C CB   . LYS A 1 47  ? 10.908  -12.787 13.651  1.00 0.00 ? 47  LYS A CB   5  
ATOM 7906  C CG   . LYS A 1 47  ? 10.984  -14.160 14.295  1.00 0.00 ? 47  LYS A CG   5  
ATOM 7907  C CD   . LYS A 1 47  ? 12.275  -14.875 13.934  1.00 0.00 ? 47  LYS A CD   5  
ATOM 7908  C CE   . LYS A 1 47  ? 12.646  -15.918 14.977  1.00 0.00 ? 47  LYS A CE   5  
ATOM 7909  N NZ   . LYS A 1 47  ? 13.647  -16.890 14.458  1.00 0.00 ? 47  LYS A NZ   5  
ATOM 7910  H H    . LYS A 1 47  ? 8.658   -13.762 12.884  1.00 0.00 ? 47  LYS A H    5  
ATOM 7911  H HA   . LYS A 1 47  ? 9.294   -12.109 14.883  1.00 0.00 ? 47  LYS A HA   5  
ATOM 7912  H HB2  . LYS A 1 47  ? 11.102  -12.896 12.595  1.00 0.00 ? 47  LYS A HB2  5  
ATOM 7913  H HB3  . LYS A 1 47  ? 11.677  -12.165 14.088  1.00 0.00 ? 47  LYS A HB3  5  
ATOM 7914  H HG2  . LYS A 1 47  ? 10.935  -14.049 15.368  1.00 0.00 ? 47  LYS A HG2  5  
ATOM 7915  H HG3  . LYS A 1 47  ? 10.147  -14.754 13.954  1.00 0.00 ? 47  LYS A HG3  5  
ATOM 7916  H HD2  . LYS A 1 47  ? 12.151  -15.365 12.980  1.00 0.00 ? 47  LYS A HD2  5  
ATOM 7917  H HD3  . LYS A 1 47  ? 13.072  -14.148 13.865  1.00 0.00 ? 47  LYS A HD3  5  
ATOM 7918  H HE2  . LYS A 1 47  ? 13.058  -15.415 15.839  1.00 0.00 ? 47  LYS A HE2  5  
ATOM 7919  H HE3  . LYS A 1 47  ? 11.753  -16.453 15.265  1.00 0.00 ? 47  LYS A HE3  5  
ATOM 7920  H HZ1  . LYS A 1 47  ? 13.186  -17.797 14.243  1.00 0.00 ? 47  LYS A HZ1  5  
ATOM 7921  H HZ2  . LYS A 1 47  ? 14.390  -17.052 15.168  1.00 0.00 ? 47  LYS A HZ2  5  
ATOM 7922  H HZ3  . LYS A 1 47  ? 14.086  -16.523 13.590  1.00 0.00 ? 47  LYS A HZ3  5  
ATOM 7923  N N    . GLU A 1 48  ? 9.647   -10.455 12.052  1.00 0.00 ? 48  GLU A N    5  
ATOM 7924  C CA   . GLU A 1 48  ? 9.727   -9.118  11.477  1.00 0.00 ? 48  GLU A CA   5  
ATOM 7925  C C    . GLU A 1 48  ? 10.759  -8.269  12.214  1.00 0.00 ? 48  GLU A C    5  
ATOM 7926  O O    . GLU A 1 48  ? 10.662  -7.043  12.244  1.00 0.00 ? 48  GLU A O    5  
ATOM 7927  C CB   . GLU A 1 48  ? 8.358   -8.434  11.529  1.00 0.00 ? 48  GLU A CB   5  
ATOM 7928  C CG   . GLU A 1 48  ? 7.929   -8.037  12.931  1.00 0.00 ? 48  GLU A CG   5  
ATOM 7929  C CD   . GLU A 1 48  ? 6.844   -6.977  12.930  1.00 0.00 ? 48  GLU A CD   5  
ATOM 7930  O OE1  . GLU A 1 48  ? 5.653   -7.346  12.882  1.00 0.00 ? 48  GLU A OE1  5  
ATOM 7931  O OE2  . GLU A 1 48  ? 7.189   -5.778  12.978  1.00 0.00 ? 48  GLU A OE2  5  
ATOM 7932  H H    . GLU A 1 48  ? 9.597   -11.230 11.455  1.00 0.00 ? 48  GLU A H    5  
ATOM 7933  H HA   . GLU A 1 48  ? 10.030  -9.217  10.446  1.00 0.00 ? 48  GLU A HA   5  
ATOM 7934  H HB2  . GLU A 1 48  ? 8.391   -7.544  10.918  1.00 0.00 ? 48  GLU A HB2  5  
ATOM 7935  H HB3  . GLU A 1 48  ? 7.618   -9.109  11.126  1.00 0.00 ? 48  GLU A HB3  5  
ATOM 7936  H HG2  . GLU A 1 48  ? 7.554   -8.912  13.440  1.00 0.00 ? 48  GLU A HG2  5  
ATOM 7937  H HG3  . GLU A 1 48  ? 8.787   -7.653  13.462  1.00 0.00 ? 48  GLU A HG3  5  
ATOM 7938  N N    . GLU A 1 49  ? 11.746  -8.932  12.808  1.00 0.00 ? 49  GLU A N    5  
ATOM 7939  C CA   . GLU A 1 49  ? 12.796  -8.239  13.546  1.00 0.00 ? 49  GLU A CA   5  
ATOM 7940  C C    . GLU A 1 49  ? 13.386  -7.103  12.715  1.00 0.00 ? 49  GLU A C    5  
ATOM 7941  O O    . GLU A 1 49  ? 13.301  -5.935  13.093  1.00 0.00 ? 49  GLU A O    5  
ATOM 7942  C CB   . GLU A 1 49  ? 13.900  -9.219  13.948  1.00 0.00 ? 49  GLU A CB   5  
ATOM 7943  C CG   . GLU A 1 49  ? 13.641  -9.919  15.271  1.00 0.00 ? 49  GLU A CG   5  
ATOM 7944  C CD   . GLU A 1 49  ? 13.565  -8.952  16.437  1.00 0.00 ? 49  GLU A CD   5  
ATOM 7945  O OE1  . GLU A 1 49  ? 14.632  -8.497  16.900  1.00 0.00 ? 49  GLU A OE1  5  
ATOM 7946  O OE2  . GLU A 1 49  ? 12.440  -8.650  16.886  1.00 0.00 ? 49  GLU A OE2  5  
ATOM 7947  H H    . GLU A 1 49  ? 11.769  -9.910  12.749  1.00 0.00 ? 49  GLU A H    5  
ATOM 7948  H HA   . GLU A 1 49  ? 12.354  -7.824  14.439  1.00 0.00 ? 49  GLU A HA   5  
ATOM 7949  H HB2  . GLU A 1 49  ? 13.995  -9.971  13.178  1.00 0.00 ? 49  GLU A HB2  5  
ATOM 7950  H HB3  . GLU A 1 49  ? 14.832  -8.679  14.026  1.00 0.00 ? 49  GLU A HB3  5  
ATOM 7951  H HG2  . GLU A 1 49  ? 12.705  -10.452 15.205  1.00 0.00 ? 49  GLU A HG2  5  
ATOM 7952  H HG3  . GLU A 1 49  ? 14.442  -10.620 15.456  1.00 0.00 ? 49  GLU A HG3  5  
ATOM 7953  N N    . SER A 1 50  ? 13.984  -7.456  11.582  1.00 0.00 ? 50  SER A N    5  
ATOM 7954  C CA   . SER A 1 50  ? 14.593  -6.468  10.699  1.00 0.00 ? 50  SER A CA   5  
ATOM 7955  C C    . SER A 1 50  ? 13.950  -6.506  9.316   1.00 0.00 ? 50  SER A C    5  
ATOM 7956  O O    . SER A 1 50  ? 13.827  -7.568  8.706   1.00 0.00 ? 50  SER A O    5  
ATOM 7957  C CB   . SER A 1 50  ? 16.098  -6.716  10.582  1.00 0.00 ? 50  SER A CB   5  
ATOM 7958  O OG   . SER A 1 50  ? 16.365  -7.867  9.800   1.00 0.00 ? 50  SER A OG   5  
ATOM 7959  H H    . SER A 1 50  ? 14.020  -8.404  11.335  1.00 0.00 ? 50  SER A H    5  
ATOM 7960  H HA   . SER A 1 50  ? 14.430  -5.492  11.132  1.00 0.00 ? 50  SER A HA   5  
ATOM 7961  H HB2  . SER A 1 50  ? 16.566  -5.862  10.115  1.00 0.00 ? 50  SER A HB2  5  
ATOM 7962  H HB3  . SER A 1 50  ? 16.514  -6.860  11.568  1.00 0.00 ? 50  SER A HB3  5  
ATOM 7963  H HG   . SER A 1 50  ? 17.305  -8.061  9.826   1.00 0.00 ? 50  SER A HG   5  
ATOM 7964  N N    . ILE A 1 51  ? 13.542  -5.339  8.828   1.00 0.00 ? 51  ILE A N    5  
ATOM 7965  C CA   . ILE A 1 51  ? 12.912  -5.238  7.517   1.00 0.00 ? 51  ILE A CA   5  
ATOM 7966  C C    . ILE A 1 51  ? 13.900  -5.578  6.406   1.00 0.00 ? 51  ILE A C    5  
ATOM 7967  O O    . ILE A 1 51  ? 15.075  -5.214  6.472   1.00 0.00 ? 51  ILE A O    5  
ATOM 7968  C CB   . ILE A 1 51  ? 12.346  -3.828  7.272   1.00 0.00 ? 51  ILE A CB   5  
ATOM 7969  C CG1  . ILE A 1 51  ? 11.280  -3.494  8.318   1.00 0.00 ? 51  ILE A CG1  5  
ATOM 7970  C CG2  . ILE A 1 51  ? 11.768  -3.725  5.868   1.00 0.00 ? 51  ILE A CG2  5  
ATOM 7971  C CD1  . ILE A 1 51  ? 10.964  -2.017  8.409   1.00 0.00 ? 51  ILE A CD1  5  
ATOM 7972  H H    . ILE A 1 51  ? 13.667  -4.527  9.362   1.00 0.00 ? 51  ILE A H    5  
ATOM 7973  H HA   . ILE A 1 51  ? 12.095  -5.944  7.485   1.00 0.00 ? 51  ILE A HA   5  
ATOM 7974  H HB   . ILE A 1 51  ? 13.156  -3.119  7.355   1.00 0.00 ? 51  ILE A HB   5  
ATOM 7975  H HG12 . ILE A 1 51  ? 10.367  -4.013  8.071   1.00 0.00 ? 51  ILE A HG12 5  
ATOM 7976  H HG13 . ILE A 1 51  ? 11.624  -3.820  9.288   1.00 0.00 ? 51  ILE A HG13 5  
ATOM 7977  H HG21 . ILE A 1 51  ? 11.571  -2.689  5.635   1.00 0.00 ? 51  ILE A HG21 5  
ATOM 7978  H HG22 . ILE A 1 51  ? 12.477  -4.124  5.158   1.00 0.00 ? 51  ILE A HG22 5  
ATOM 7979  H HG23 . ILE A 1 51  ? 10.849  -4.288  5.815   1.00 0.00 ? 51  ILE A HG23 5  
ATOM 7980  H HD11 . ILE A 1 51  ? 10.882  -1.604  7.414   1.00 0.00 ? 51  ILE A HD11 5  
ATOM 7981  H HD12 . ILE A 1 51  ? 10.032  -1.879  8.935   1.00 0.00 ? 51  ILE A HD12 5  
ATOM 7982  H HD13 . ILE A 1 51  ? 11.757  -1.512  8.942   1.00 0.00 ? 51  ILE A HD13 5  
ATOM 7983  N N    . LEU A 1 52  ? 13.415  -6.274  5.384   1.00 0.00 ? 52  LEU A N    5  
ATOM 7984  C CA   . LEU A 1 52  ? 14.255  -6.661  4.255   1.00 0.00 ? 52  LEU A CA   5  
ATOM 7985  C C    . LEU A 1 52  ? 14.046  -5.721  3.073   1.00 0.00 ? 52  LEU A C    5  
ATOM 7986  O O    . LEU A 1 52  ? 14.994  -5.364  2.375   1.00 0.00 ? 52  LEU A O    5  
ATOM 7987  C CB   . LEU A 1 52  ? 13.949  -8.101  3.837   1.00 0.00 ? 52  LEU A CB   5  
ATOM 7988  C CG   . LEU A 1 52  ? 14.072  -9.159  4.933   1.00 0.00 ? 52  LEU A CG   5  
ATOM 7989  C CD1  . LEU A 1 52  ? 13.269  -10.399 4.571   1.00 0.00 ? 52  LEU A CD1  5  
ATOM 7990  C CD2  . LEU A 1 52  ? 15.532  -9.516  5.168   1.00 0.00 ? 52  LEU A CD2  5  
ATOM 7991  H H    . LEU A 1 52  ? 12.471  -6.535  5.387   1.00 0.00 ? 52  LEU A H    5  
ATOM 7992  H HA   . LEU A 1 52  ? 15.285  -6.599  4.572   1.00 0.00 ? 52  LEU A HA   5  
ATOM 7993  H HB2  . LEU A 1 52  ? 12.937  -8.128  3.463   1.00 0.00 ? 52  LEU A HB2  5  
ATOM 7994  H HB3  . LEU A 1 52  ? 14.631  -8.365  3.042   1.00 0.00 ? 52  LEU A HB3  5  
ATOM 7995  H HG   . LEU A 1 52  ? 13.671  -8.761  5.856   1.00 0.00 ? 52  LEU A HG   5  
ATOM 7996  H HD11 . LEU A 1 52  ? 12.772  -10.776 5.451   1.00 0.00 ? 52  LEU A HD11 5  
ATOM 7997  H HD12 . LEU A 1 52  ? 13.934  -11.156 4.181   1.00 0.00 ? 52  LEU A HD12 5  
ATOM 7998  H HD13 . LEU A 1 52  ? 12.534  -10.145 3.821   1.00 0.00 ? 52  LEU A HD13 5  
ATOM 7999  H HD21 . LEU A 1 52  ? 16.045  -8.668  5.597   1.00 0.00 ? 52  LEU A HD21 5  
ATOM 8000  H HD22 . LEU A 1 52  ? 15.994  -9.778  4.227   1.00 0.00 ? 52  LEU A HD22 5  
ATOM 8001  H HD23 . LEU A 1 52  ? 15.593  -10.355 5.846   1.00 0.00 ? 52  LEU A HD23 5  
ATOM 8002  N N    . GLY A 1 53  ? 12.797  -5.320  2.856   1.00 0.00 ? 53  GLY A N    5  
ATOM 8003  C CA   . GLY A 1 53  ? 12.486  -4.422  1.759   1.00 0.00 ? 53  GLY A CA   5  
ATOM 8004  C C    . GLY A 1 53  ? 11.208  -3.641  1.993   1.00 0.00 ? 53  GLY A C    5  
ATOM 8005  O O    . GLY A 1 53  ? 10.342  -4.069  2.757   1.00 0.00 ? 53  GLY A O    5  
ATOM 8006  H H    . GLY A 1 53  ? 12.080  -5.636  3.445   1.00 0.00 ? 53  GLY A H    5  
ATOM 8007  H HA2  . GLY A 1 53  ? 13.303  -3.726  1.635   1.00 0.00 ? 53  GLY A HA2  5  
ATOM 8008  H HA3  . GLY A 1 53  ? 12.379  -5.001  0.854   1.00 0.00 ? 53  GLY A HA3  5  
ATOM 8009  N N    . SER A 1 54  ? 11.089  -2.492  1.335   1.00 0.00 ? 54  SER A N    5  
ATOM 8010  C CA   . SER A 1 54  ? 9.910   -1.647  1.480   1.00 0.00 ? 54  SER A CA   5  
ATOM 8011  C C    . SER A 1 54  ? 9.247   -1.404  0.127   1.00 0.00 ? 54  SER A C    5  
ATOM 8012  O O    . SER A 1 54  ? 9.904   -1.013  -0.837  1.00 0.00 ? 54  SER A O    5  
ATOM 8013  C CB   . SER A 1 54  ? 10.289  -0.311  2.122   1.00 0.00 ? 54  SER A CB   5  
ATOM 8014  O OG   . SER A 1 54  ? 11.027  0.496   1.221   1.00 0.00 ? 54  SER A OG   5  
ATOM 8015  H H    . SER A 1 54  ? 11.814  -2.205  0.741   1.00 0.00 ? 54  SER A H    5  
ATOM 8016  H HA   . SER A 1 54  ? 9.211   -2.160  2.123   1.00 0.00 ? 54  SER A HA   5  
ATOM 8017  H HB2  . SER A 1 54  ? 9.391   0.216   2.406   1.00 0.00 ? 54  SER A HB2  5  
ATOM 8018  H HB3  . SER A 1 54  ? 10.892  -0.495  2.999   1.00 0.00 ? 54  SER A HB3  5  
ATOM 8019  H HG   . SER A 1 54  ? 11.943  0.541   1.507   1.00 0.00 ? 54  SER A HG   5  
ATOM 8020  N N    . ILE A 1 55  ? 7.940   -1.639  0.066   1.00 0.00 ? 55  ILE A N    5  
ATOM 8021  C CA   . ILE A 1 55  ? 7.187   -1.445  -1.167  1.00 0.00 ? 55  ILE A CA   5  
ATOM 8022  C C    . ILE A 1 55  ? 6.245   -0.251  -1.054  1.00 0.00 ? 55  ILE A C    5  
ATOM 8023  O O    . ILE A 1 55  ? 5.346   -0.215  -0.214  1.00 0.00 ? 55  ILE A O    5  
ATOM 8024  C CB   . ILE A 1 55  ? 6.368   -2.698  -1.530  1.00 0.00 ? 55  ILE A CB   5  
ATOM 8025  C CG1  . ILE A 1 55  ? 7.274   -3.930  -1.576  1.00 0.00 ? 55  ILE A CG1  5  
ATOM 8026  C CG2  . ILE A 1 55  ? 5.663   -2.502  -2.864  1.00 0.00 ? 55  ILE A CG2  5  
ATOM 8027  C CD1  . ILE A 1 55  ? 6.525   -5.236  -1.439  1.00 0.00 ? 55  ILE A CD1  5  
ATOM 8028  H H    . ILE A 1 55  ? 7.472   -1.949  0.868   1.00 0.00 ? 55  ILE A H    5  
ATOM 8029  H HA   . ILE A 1 55  ? 7.894   -1.258  -1.963  1.00 0.00 ? 55  ILE A HA   5  
ATOM 8030  H HB   . ILE A 1 55  ? 5.616   -2.841  -0.770  1.00 0.00 ? 55  ILE A HB   5  
ATOM 8031  H HG12 . ILE A 1 55  ? 7.800   -3.947  -2.518  1.00 0.00 ? 55  ILE A HG12 5  
ATOM 8032  H HG13 . ILE A 1 55  ? 7.991   -3.871  -0.770  1.00 0.00 ? 55  ILE A HG13 5  
ATOM 8033  H HG21 . ILE A 1 55  ? 5.570   -3.454  -3.365  1.00 0.00 ? 55  ILE A HG21 5  
ATOM 8034  H HG22 . ILE A 1 55  ? 4.680   -2.088  -2.693  1.00 0.00 ? 55  ILE A HG22 5  
ATOM 8035  H HG23 . ILE A 1 55  ? 6.237   -1.825  -3.479  1.00 0.00 ? 55  ILE A HG23 5  
ATOM 8036  H HD11 . ILE A 1 55  ? 5.886   -5.196  -0.569  1.00 0.00 ? 55  ILE A HD11 5  
ATOM 8037  H HD12 . ILE A 1 55  ? 5.924   -5.402  -2.321  1.00 0.00 ? 55  ILE A HD12 5  
ATOM 8038  H HD13 . ILE A 1 55  ? 7.231   -6.047  -1.328  1.00 0.00 ? 55  ILE A HD13 5  
ATOM 8039  N N    . PRO A 1 56  ? 6.454   0.752   -1.921  1.00 0.00 ? 56  PRO A N    5  
ATOM 8040  C CA   . PRO A 1 56  ? 5.632   1.965   -1.940  1.00 0.00 ? 56  PRO A CA   5  
ATOM 8041  C C    . PRO A 1 56  ? 4.216   1.699   -2.438  1.00 0.00 ? 56  PRO A C    5  
ATOM 8042  O O    . PRO A 1 56  ? 4.017   0.979   -3.418  1.00 0.00 ? 56  PRO A O    5  
ATOM 8043  C CB   . PRO A 1 56  ? 6.377   2.883   -2.913  1.00 0.00 ? 56  PRO A CB   5  
ATOM 8044  C CG   . PRO A 1 56  ? 7.134   1.958   -3.802  1.00 0.00 ? 56  PRO A CG   5  
ATOM 8045  C CD   . PRO A 1 56  ? 7.508   0.777   -2.949  1.00 0.00 ? 56  PRO A CD   5  
ATOM 8046  H HA   . PRO A 1 56  ? 5.588   2.430   -0.966  1.00 0.00 ? 56  PRO A HA   5  
ATOM 8047  H HB2  . PRO A 1 56  ? 5.665   3.474   -3.471  1.00 0.00 ? 56  PRO A HB2  5  
ATOM 8048  H HB3  . PRO A 1 56  ? 7.041   3.533   -2.363  1.00 0.00 ? 56  PRO A HB3  5  
ATOM 8049  H HG2  . PRO A 1 56  ? 6.508   1.644   -4.623  1.00 0.00 ? 56  PRO A HG2  5  
ATOM 8050  H HG3  . PRO A 1 56  ? 8.022   2.449   -4.171  1.00 0.00 ? 56  PRO A HG3  5  
ATOM 8051  H HD2  . PRO A 1 56  ? 7.497   -0.130  -3.535  1.00 0.00 ? 56  PRO A HD2  5  
ATOM 8052  H HD3  . PRO A 1 56  ? 8.479   0.927   -2.501  1.00 0.00 ? 56  PRO A HD3  5  
ATOM 8053  N N    . LEU A 1 57  ? 3.235   2.283   -1.759  1.00 0.00 ? 57  LEU A N    5  
ATOM 8054  C CA   . LEU A 1 57  ? 1.836   2.109   -2.134  1.00 0.00 ? 57  LEU A CA   5  
ATOM 8055  C C    . LEU A 1 57  ? 1.160   3.458   -2.356  1.00 0.00 ? 57  LEU A C    5  
ATOM 8056  O O    . LEU A 1 57  ? 0.009   3.660   -1.965  1.00 0.00 ? 57  LEU A O    5  
ATOM 8057  C CB   . LEU A 1 57  ? 1.092   1.325   -1.051  1.00 0.00 ? 57  LEU A CB   5  
ATOM 8058  C CG   . LEU A 1 57  ? 1.196   -0.198  -1.134  1.00 0.00 ? 57  LEU A CG   5  
ATOM 8059  C CD1  . LEU A 1 57  ? 0.564   -0.844  0.088   1.00 0.00 ? 57  LEU A CD1  5  
ATOM 8060  C CD2  . LEU A 1 57  ? 0.541   -0.709  -2.409  1.00 0.00 ? 57  LEU A CD2  5  
ATOM 8061  H H    . LEU A 1 57  ? 3.456   2.845   -0.988  1.00 0.00 ? 57  LEU A H    5  
ATOM 8062  H HA   . LEU A 1 57  ? 1.807   1.549   -3.057  1.00 0.00 ? 57  LEU A HA   5  
ATOM 8063  H HB2  . LEU A 1 57  ? 1.483   1.631   -0.093  1.00 0.00 ? 57  LEU A HB2  5  
ATOM 8064  H HB3  . LEU A 1 57  ? 0.046   1.590   -1.113  1.00 0.00 ? 57  LEU A HB3  5  
ATOM 8065  H HG   . LEU A 1 57  ? 2.240   -0.480  -1.158  1.00 0.00 ? 57  LEU A HG   5  
ATOM 8066  H HD11 . LEU A 1 57  ? -0.304  -0.275  0.388   1.00 0.00 ? 57  LEU A HD11 5  
ATOM 8067  H HD12 . LEU A 1 57  ? 1.279   -0.862  0.897   1.00 0.00 ? 57  LEU A HD12 5  
ATOM 8068  H HD13 . LEU A 1 57  ? 0.267   -1.855  -0.151  1.00 0.00 ? 57  LEU A HD13 5  
ATOM 8069  H HD21 . LEU A 1 57  ? -0.427  -1.127  -2.173  1.00 0.00 ? 57  LEU A HD21 5  
ATOM 8070  H HD22 . LEU A 1 57  ? 1.164   -1.473  -2.853  1.00 0.00 ? 57  LEU A HD22 5  
ATOM 8071  H HD23 . LEU A 1 57  ? 0.421   0.108   -3.105  1.00 0.00 ? 57  LEU A HD23 5  
ATOM 8072  N N    . LEU A 1 58  ? 1.880   4.378   -2.988  1.00 0.00 ? 58  LEU A N    5  
ATOM 8073  C CA   . LEU A 1 58  ? 1.349   5.708   -3.266  1.00 0.00 ? 58  LEU A CA   5  
ATOM 8074  C C    . LEU A 1 58  ? 0.657   5.746   -4.624  1.00 0.00 ? 58  LEU A C    5  
ATOM 8075  O O    . LEU A 1 58  ? 1.291   5.545   -5.661  1.00 0.00 ? 58  LEU A O    5  
ATOM 8076  C CB   . LEU A 1 58  ? 2.472   6.746   -3.224  1.00 0.00 ? 58  LEU A CB   5  
ATOM 8077  C CG   . LEU A 1 58  ? 2.062   8.191   -3.507  1.00 0.00 ? 58  LEU A CG   5  
ATOM 8078  C CD1  . LEU A 1 58  ? 1.154   8.714   -2.404  1.00 0.00 ? 58  LEU A CD1  5  
ATOM 8079  C CD2  . LEU A 1 58  ? 3.291   9.076   -3.653  1.00 0.00 ? 58  LEU A CD2  5  
ATOM 8080  H H    . LEU A 1 58  ? 2.791   4.158   -3.276  1.00 0.00 ? 58  LEU A H    5  
ATOM 8081  H HA   . LEU A 1 58  ? 0.625   5.942   -2.500  1.00 0.00 ? 58  LEU A HA   5  
ATOM 8082  H HB2  . LEU A 1 58  ? 2.915   6.714   -2.240  1.00 0.00 ? 58  LEU A HB2  5  
ATOM 8083  H HB3  . LEU A 1 58  ? 3.212   6.461   -3.959  1.00 0.00 ? 58  LEU A HB3  5  
ATOM 8084  H HG   . LEU A 1 58  ? 1.510   8.227   -4.436  1.00 0.00 ? 58  LEU A HG   5  
ATOM 8085  H HD11 . LEU A 1 58  ? 0.719   9.653   -2.710  1.00 0.00 ? 58  LEU A HD11 5  
ATOM 8086  H HD12 . LEU A 1 58  ? 1.732   8.862   -1.503  1.00 0.00 ? 58  LEU A HD12 5  
ATOM 8087  H HD13 . LEU A 1 58  ? 0.369   7.997   -2.213  1.00 0.00 ? 58  LEU A HD13 5  
ATOM 8088  H HD21 . LEU A 1 58  ? 4.171   8.457   -3.743  1.00 0.00 ? 58  LEU A HD21 5  
ATOM 8089  H HD22 . LEU A 1 58  ? 3.384   9.709   -2.782  1.00 0.00 ? 58  LEU A HD22 5  
ATOM 8090  H HD23 . LEU A 1 58  ? 3.190   9.690   -4.535  1.00 0.00 ? 58  LEU A HD23 5  
ATOM 8091  N N    . SER A 1 59  ? -0.646  6.006   -4.612  1.00 0.00 ? 59  SER A N    5  
ATOM 8092  C CA   . SER A 1 59  ? -1.425  6.069   -5.843  1.00 0.00 ? 59  SER A CA   5  
ATOM 8093  C C    . SER A 1 59  ? -1.220  4.810   -6.680  1.00 0.00 ? 59  SER A C    5  
ATOM 8094  O O    . SER A 1 59  ? -1.097  4.877   -7.903  1.00 0.00 ? 59  SER A O    5  
ATOM 8095  C CB   . SER A 1 59  ? -1.035  7.305   -6.656  1.00 0.00 ? 59  SER A CB   5  
ATOM 8096  O OG   . SER A 1 59  ? -1.504  8.491   -6.037  1.00 0.00 ? 59  SER A OG   5  
ATOM 8097  H H    . SER A 1 59  ? -1.095  6.157   -3.753  1.00 0.00 ? 59  SER A H    5  
ATOM 8098  H HA   . SER A 1 59  ? -2.468  6.141   -5.572  1.00 0.00 ? 59  SER A HA   5  
ATOM 8099  H HB2  . SER A 1 59  ? 0.040   7.356   -6.735  1.00 0.00 ? 59  SER A HB2  5  
ATOM 8100  H HB3  . SER A 1 59  ? -1.467  7.233   -7.644  1.00 0.00 ? 59  SER A HB3  5  
ATOM 8101  H HG   . SER A 1 59  ? -2.443  8.406   -5.853  1.00 0.00 ? 59  SER A HG   5  
ATOM 8102  N N    . PHE A 1 60  ? -1.184  3.662   -6.012  1.00 0.00 ? 60  PHE A N    5  
ATOM 8103  C CA   . PHE A 1 60  ? -0.993  2.387   -6.693  1.00 0.00 ? 60  PHE A CA   5  
ATOM 8104  C C    . PHE A 1 60  ? -2.333  1.788   -7.112  1.00 0.00 ? 60  PHE A C    5  
ATOM 8105  O O    . PHE A 1 60  ? -3.377  2.125   -6.555  1.00 0.00 ? 60  PHE A O    5  
ATOM 8106  C CB   . PHE A 1 60  ? -0.245  1.407   -5.786  1.00 0.00 ? 60  PHE A CB   5  
ATOM 8107  C CG   . PHE A 1 60  ? 1.249   1.488   -5.919  1.00 0.00 ? 60  PHE A CG   5  
ATOM 8108  C CD1  . PHE A 1 60  ? 1.936   2.612   -5.488  1.00 0.00 ? 60  PHE A CD1  5  
ATOM 8109  C CD2  . PHE A 1 60  ? 1.966   0.441   -6.474  1.00 0.00 ? 60  PHE A CD2  5  
ATOM 8110  C CE1  . PHE A 1 60  ? 3.310   2.689   -5.610  1.00 0.00 ? 60  PHE A CE1  5  
ATOM 8111  C CE2  . PHE A 1 60  ? 3.341   0.512   -6.598  1.00 0.00 ? 60  PHE A CE2  5  
ATOM 8112  C CZ   . PHE A 1 60  ? 4.014   1.638   -6.164  1.00 0.00 ? 60  PHE A CZ   5  
ATOM 8113  H H    . PHE A 1 60  ? -1.288  3.673   -5.037  1.00 0.00 ? 60  PHE A H    5  
ATOM 8114  H HA   . PHE A 1 60  ? -0.401  2.569   -7.577  1.00 0.00 ? 60  PHE A HA   5  
ATOM 8115  H HB2  . PHE A 1 60  ? -0.498  1.615   -4.757  1.00 0.00 ? 60  PHE A HB2  5  
ATOM 8116  H HB3  . PHE A 1 60  ? -0.547  0.400   -6.030  1.00 0.00 ? 60  PHE A HB3  5  
ATOM 8117  H HD1  . PHE A 1 60  ? 1.387   3.434   -5.053  1.00 0.00 ? 60  PHE A HD1  5  
ATOM 8118  H HD2  . PHE A 1 60  ? 1.440   -0.441  -6.814  1.00 0.00 ? 60  PHE A HD2  5  
ATOM 8119  H HE1  . PHE A 1 60  ? 3.834   3.570   -5.270  1.00 0.00 ? 60  PHE A HE1  5  
ATOM 8120  H HE2  . PHE A 1 60  ? 3.887   -0.311  -7.032  1.00 0.00 ? 60  PHE A HE2  5  
ATOM 8121  H HZ   . PHE A 1 60  ? 5.088   1.696   -6.261  1.00 0.00 ? 60  PHE A HZ   5  
ATOM 8122  N N    . ARG A 1 61  ? -2.293  0.898   -8.099  1.00 0.00 ? 61  ARG A N    5  
ATOM 8123  C CA   . ARG A 1 61  ? -3.503  0.254   -8.595  1.00 0.00 ? 61  ARG A CA   5  
ATOM 8124  C C    . ARG A 1 61  ? -3.532  -1.221  -8.206  1.00 0.00 ? 61  ARG A C    5  
ATOM 8125  O O    . ARG A 1 61  ? -2.960  -2.067  -8.894  1.00 0.00 ? 61  ARG A O    5  
ATOM 8126  C CB   . ARG A 1 61  ? -3.594  0.392   -10.116 1.00 0.00 ? 61  ARG A CB   5  
ATOM 8127  C CG   . ARG A 1 61  ? -4.768  -0.355  -10.727 1.00 0.00 ? 61  ARG A CG   5  
ATOM 8128  C CD   . ARG A 1 61  ? -4.690  -0.370  -12.245 1.00 0.00 ? 61  ARG A CD   5  
ATOM 8129  N NE   . ARG A 1 61  ? -6.012  -0.449  -12.861 1.00 0.00 ? 61  ARG A NE   5  
ATOM 8130  C CZ   . ARG A 1 61  ? -6.211  -0.765  -14.136 1.00 0.00 ? 61  ARG A CZ   5  
ATOM 8131  N NH1  . ARG A 1 61  ? -5.180  -1.030  -14.925 1.00 0.00 ? 61  ARG A NH1  5  
ATOM 8132  N NH2  . ARG A 1 61  ? -7.444  -0.816  -14.623 1.00 0.00 ? 61  ARG A NH2  5  
ATOM 8133  H H    . ARG A 1 61  ? -1.430  0.671   -8.504  1.00 0.00 ? 61  ARG A H    5  
ATOM 8134  H HA   . ARG A 1 61  ? -4.351  0.749   -8.146  1.00 0.00 ? 61  ARG A HA   5  
ATOM 8135  H HB2  . ARG A 1 61  ? -3.692  1.439   -10.365 1.00 0.00 ? 61  ARG A HB2  5  
ATOM 8136  H HB3  . ARG A 1 61  ? -2.684  0.010   -10.555 1.00 0.00 ? 61  ARG A HB3  5  
ATOM 8137  H HG2  . ARG A 1 61  ? -4.761  -1.373  -10.367 1.00 0.00 ? 61  ARG A HG2  5  
ATOM 8138  H HG3  . ARG A 1 61  ? -5.685  0.129   -10.427 1.00 0.00 ? 61  ARG A HG3  5  
ATOM 8139  H HD2  . ARG A 1 61  ? -4.203  0.536   -12.576 1.00 0.00 ? 61  ARG A HD2  5  
ATOM 8140  H HD3  . ARG A 1 61  ? -4.107  -1.225  -12.554 1.00 0.00 ? 61  ARG A HD3  5  
ATOM 8141  H HE   . ARG A 1 61  ? -6.788  -0.256  -12.295 1.00 0.00 ? 61  ARG A HE   5  
ATOM 8142  H HH11 . ARG A 1 61  ? -4.249  -0.993  -14.561 1.00 0.00 ? 61  ARG A HH11 5  
ATOM 8143  H HH12 . ARG A 1 61  ? -5.332  -1.269  -15.885 1.00 0.00 ? 61  ARG A HH12 5  
ATOM 8144  H HH21 . ARG A 1 61  ? -8.224  -0.617  -14.030 1.00 0.00 ? 61  ARG A HH21 5  
ATOM 8145  H HH22 . ARG A 1 61  ? -7.593  -1.054  -15.582 1.00 0.00 ? 61  ARG A HH22 5  
ATOM 8146  N N    . VAL A 1 62  ? -4.200  -1.523  -7.097  1.00 0.00 ? 62  VAL A N    5  
ATOM 8147  C CA   . VAL A 1 62  ? -4.304  -2.895  -6.616  1.00 0.00 ? 62  VAL A CA   5  
ATOM 8148  C C    . VAL A 1 62  ? -5.617  -3.534  -7.056  1.00 0.00 ? 62  VAL A C    5  
ATOM 8149  O O    . VAL A 1 62  ? -6.692  -2.973  -6.849  1.00 0.00 ? 62  VAL A O    5  
ATOM 8150  C CB   . VAL A 1 62  ? -4.204  -2.960  -5.080  1.00 0.00 ? 62  VAL A CB   5  
ATOM 8151  C CG1  . VAL A 1 62  ? -4.245  -4.404  -4.603  1.00 0.00 ? 62  VAL A CG1  5  
ATOM 8152  C CG2  . VAL A 1 62  ? -2.938  -2.267  -4.599  1.00 0.00 ? 62  VAL A CG2  5  
ATOM 8153  H H    . VAL A 1 62  ? -4.635  -0.805  -6.591  1.00 0.00 ? 62  VAL A H    5  
ATOM 8154  H HA   . VAL A 1 62  ? -3.483  -3.458  -7.034  1.00 0.00 ? 62  VAL A HA   5  
ATOM 8155  H HB   . VAL A 1 62  ? -5.055  -2.443  -4.662  1.00 0.00 ? 62  VAL A HB   5  
ATOM 8156  H HG11 . VAL A 1 62  ? -3.417  -4.949  -5.035  1.00 0.00 ? 62  VAL A HG11 5  
ATOM 8157  H HG12 . VAL A 1 62  ? -4.172  -4.430  -3.526  1.00 0.00 ? 62  VAL A HG12 5  
ATOM 8158  H HG13 . VAL A 1 62  ? -5.174  -4.859  -4.913  1.00 0.00 ? 62  VAL A HG13 5  
ATOM 8159  H HG21 . VAL A 1 62  ? -3.057  -1.198  -4.693  1.00 0.00 ? 62  VAL A HG21 5  
ATOM 8160  H HG22 . VAL A 1 62  ? -2.760  -2.520  -3.564  1.00 0.00 ? 62  VAL A HG22 5  
ATOM 8161  H HG23 . VAL A 1 62  ? -2.100  -2.591  -5.198  1.00 0.00 ? 62  VAL A HG23 5  
ATOM 8162  N N    . ALA A 1 63  ? -5.520  -4.712  -7.664  1.00 0.00 ? 63  ALA A N    5  
ATOM 8163  C CA   . ALA A 1 63  ? -6.700  -5.429  -8.132  1.00 0.00 ? 63  ALA A CA   5  
ATOM 8164  C C    . ALA A 1 63  ? -6.333  -6.821  -8.635  1.00 0.00 ? 63  ALA A C    5  
ATOM 8165  O O    . ALA A 1 63  ? -5.197  -7.064  -9.042  1.00 0.00 ? 63  ALA A O    5  
ATOM 8166  C CB   . ALA A 1 63  ? -7.399  -4.637  -9.227  1.00 0.00 ? 63  ALA A CB   5  
ATOM 8167  H H    . ALA A 1 63  ? -4.635  -5.108  -7.801  1.00 0.00 ? 63  ALA A H    5  
ATOM 8168  H HA   . ALA A 1 63  ? -7.383  -5.526  -7.300  1.00 0.00 ? 63  ALA A HA   5  
ATOM 8169  H HB1  . ALA A 1 63  ? -7.160  -3.589  -9.121  1.00 0.00 ? 63  ALA A HB1  5  
ATOM 8170  H HB2  . ALA A 1 63  ? -7.065  -4.987  -10.193 1.00 0.00 ? 63  ALA A HB2  5  
ATOM 8171  H HB3  . ALA A 1 63  ? -8.467  -4.773  -9.144  1.00 0.00 ? 63  ALA A HB3  5  
ATOM 8172  N N    . ALA A 1 64  ? -7.301  -7.731  -8.603  1.00 0.00 ? 64  ALA A N    5  
ATOM 8173  C CA   . ALA A 1 64  ? -7.079  -9.098  -9.056  1.00 0.00 ? 64  ALA A CA   5  
ATOM 8174  C C    . ALA A 1 64  ? -6.249  -9.124  -10.335 1.00 0.00 ? 64  ALA A C    5  
ATOM 8175  O O    . ALA A 1 64  ? -6.511  -8.371  -11.273 1.00 0.00 ? 64  ALA A O    5  
ATOM 8176  C CB   . ALA A 1 64  ? -8.409  -9.804  -9.273  1.00 0.00 ? 64  ALA A CB   5  
ATOM 8177  H H    . ALA A 1 64  ? -8.185  -7.476  -8.267  1.00 0.00 ? 64  ALA A H    5  
ATOM 8178  H HA   . ALA A 1 64  ? -6.542  -9.625  -8.280  1.00 0.00 ? 64  ALA A HA   5  
ATOM 8179  H HB1  . ALA A 1 64  ? -8.838  -9.483  -10.211 1.00 0.00 ? 64  ALA A HB1  5  
ATOM 8180  H HB2  . ALA A 1 64  ? -8.250  -10.872 -9.297  1.00 0.00 ? 64  ALA A HB2  5  
ATOM 8181  H HB3  . ALA A 1 64  ? -9.083  -9.558  -8.466  1.00 0.00 ? 64  ALA A HB3  5  
ATOM 8182  N N    . VAL A 1 65  ? -5.246  -9.996  -10.367 1.00 0.00 ? 65  VAL A N    5  
ATOM 8183  C CA   . VAL A 1 65  ? -4.378  -10.121 -11.532 1.00 0.00 ? 65  VAL A CA   5  
ATOM 8184  C C    . VAL A 1 65  ? -5.191  -10.327 -12.804 1.00 0.00 ? 65  VAL A C    5  
ATOM 8185  O O    . VAL A 1 65  ? -6.416  -10.437 -12.758 1.00 0.00 ? 65  VAL A O    5  
ATOM 8186  C CB   . VAL A 1 65  ? -3.389  -11.291 -11.372 1.00 0.00 ? 65  VAL A CB   5  
ATOM 8187  C CG1  . VAL A 1 65  ? -2.386  -10.997 -10.267 1.00 0.00 ? 65  VAL A CG1  5  
ATOM 8188  C CG2  . VAL A 1 65  ? -4.138  -12.586 -11.093 1.00 0.00 ? 65  VAL A CG2  5  
ATOM 8189  H H    . VAL A 1 65  ? -5.087  -10.570 -9.589  1.00 0.00 ? 65  VAL A H    5  
ATOM 8190  H HA   . VAL A 1 65  ? -3.809  -9.207  -11.623 1.00 0.00 ? 65  VAL A HA   5  
ATOM 8191  H HB   . VAL A 1 65  ? -2.847  -11.407 -12.299 1.00 0.00 ? 65  VAL A HB   5  
ATOM 8192  H HG11 . VAL A 1 65  ? -2.709  -11.472 -9.353  1.00 0.00 ? 65  VAL A HG11 5  
ATOM 8193  H HG12 . VAL A 1 65  ? -1.416  -11.379 -10.550 1.00 0.00 ? 65  VAL A HG12 5  
ATOM 8194  H HG13 . VAL A 1 65  ? -2.323  -9.929  -10.114 1.00 0.00 ? 65  VAL A HG13 5  
ATOM 8195  H HG21 . VAL A 1 65  ? -4.743  -12.843 -11.949 1.00 0.00 ? 65  VAL A HG21 5  
ATOM 8196  H HG22 . VAL A 1 65  ? -3.429  -13.378 -10.902 1.00 0.00 ? 65  VAL A HG22 5  
ATOM 8197  H HG23 . VAL A 1 65  ? -4.773  -12.456 -10.229 1.00 0.00 ? 65  VAL A HG23 5  
ATOM 8198  N N    . GLN A 1 66  ? -4.502  -10.378 -13.939 1.00 0.00 ? 66  GLN A N    5  
ATOM 8199  C CA   . GLN A 1 66  ? -5.161  -10.571 -15.225 1.00 0.00 ? 66  GLN A CA   5  
ATOM 8200  C C    . GLN A 1 66  ? -4.722  -11.881 -15.871 1.00 0.00 ? 66  GLN A C    5  
ATOM 8201  O O    . GLN A 1 66  ? -3.676  -12.442 -15.546 1.00 0.00 ? 66  GLN A O    5  
ATOM 8202  C CB   . GLN A 1 66  ? -4.854  -9.400  -16.160 1.00 0.00 ? 66  GLN A CB   5  
ATOM 8203  C CG   . GLN A 1 66  ? -5.777  -8.207  -15.965 1.00 0.00 ? 66  GLN A CG   5  
ATOM 8204  C CD   . GLN A 1 66  ? -5.810  -7.291  -17.173 1.00 0.00 ? 66  GLN A CD   5  
ATOM 8205  O OE1  . GLN A 1 66  ? -6.583  -7.504  -18.107 1.00 0.00 ? 66  GLN A OE1  5  
ATOM 8206  N NE2  . GLN A 1 66  ? -4.969  -6.263  -17.159 1.00 0.00 ? 66  GLN A NE2  5  
ATOM 8207  H H    . GLN A 1 66  ? -3.527  -10.283 -13.911 1.00 0.00 ? 66  GLN A H    5  
ATOM 8208  H HA   . GLN A 1 66  ? -6.225  -10.609 -15.049 1.00 0.00 ? 66  GLN A HA   5  
ATOM 8209  H HB2  . GLN A 1 66  ? -3.839  -9.074  -15.989 1.00 0.00 ? 66  GLN A HB2  5  
ATOM 8210  H HB3  . GLN A 1 66  ? -4.948  -9.736  -17.182 1.00 0.00 ? 66  GLN A HB3  5  
ATOM 8211  H HG2  . GLN A 1 66  ? -6.777  -8.569  -15.780 1.00 0.00 ? 66  GLN A HG2  5  
ATOM 8212  H HG3  . GLN A 1 66  ? -5.436  -7.641  -15.111 1.00 0.00 ? 66  GLN A HG3  5  
ATOM 8213  H HE21 . GLN A 1 66  ? -4.382  -6.157  -16.382 1.00 0.00 ? 66  GLN A HE21 5  
ATOM 8214  H HE22 . GLN A 1 66  ? -4.969  -5.656  -17.927 1.00 0.00 ? 66  GLN A HE22 5  
ATOM 8215  N N    . PRO A 1 67  ? -5.540  -12.382 -16.809 1.00 0.00 ? 67  PRO A N    5  
ATOM 8216  C CA   . PRO A 1 67  ? -5.257  -13.632 -17.520 1.00 0.00 ? 67  PRO A CA   5  
ATOM 8217  C C    . PRO A 1 67  ? -4.079  -13.499 -18.479 1.00 0.00 ? 67  PRO A C    5  
ATOM 8218  O O    . PRO A 1 67  ? -3.702  -14.459 -19.150 1.00 0.00 ? 67  PRO A O    5  
ATOM 8219  C CB   . PRO A 1 67  ? -6.550  -13.900 -18.295 1.00 0.00 ? 67  PRO A CB   5  
ATOM 8220  C CG   . PRO A 1 67  ? -7.170  -12.557 -18.473 1.00 0.00 ? 67  PRO A CG   5  
ATOM 8221  C CD   . PRO A 1 67  ? -6.804  -11.766 -17.247 1.00 0.00 ? 67  PRO A CD   5  
ATOM 8222  H HA   . PRO A 1 67  ? -5.072  -14.445 -16.834 1.00 0.00 ? 67  PRO A HA   5  
ATOM 8223  H HB2  . PRO A 1 67  ? -6.314  -14.356 -19.246 1.00 0.00 ? 67  PRO A HB2  5  
ATOM 8224  H HB3  . PRO A 1 67  ? -7.187  -14.556 -17.723 1.00 0.00 ? 67  PRO A HB3  5  
ATOM 8225  H HG2  . PRO A 1 67  ? -6.772  -12.083 -19.357 1.00 0.00 ? 67  PRO A HG2  5  
ATOM 8226  H HG3  . PRO A 1 67  ? -8.243  -12.655 -18.548 1.00 0.00 ? 67  PRO A HG3  5  
ATOM 8227  H HD2  . PRO A 1 67  ? -6.660  -10.726 -17.499 1.00 0.00 ? 67  PRO A HD2  5  
ATOM 8228  H HD3  . PRO A 1 67  ? -7.566  -11.871 -16.489 1.00 0.00 ? 67  PRO A HD3  5  
ATOM 8229  N N    . SER A 1 68  ? -3.501  -12.303 -18.538 1.00 0.00 ? 68  SER A N    5  
ATOM 8230  C CA   . SER A 1 68  ? -2.367  -12.045 -19.417 1.00 0.00 ? 68  SER A CA   5  
ATOM 8231  C C    . SER A 1 68  ? -1.144  -11.613 -18.614 1.00 0.00 ? 68  SER A C    5  
ATOM 8232  O O    . SER A 1 68  ? -0.360  -10.775 -19.059 1.00 0.00 ? 68  SER A O    5  
ATOM 8233  C CB   . SER A 1 68  ? -2.725  -10.966 -20.442 1.00 0.00 ? 68  SER A CB   5  
ATOM 8234  O OG   . SER A 1 68  ? -3.635  -11.462 -21.408 1.00 0.00 ? 68  SER A OG   5  
ATOM 8235  H H    . SER A 1 68  ? -3.848  -11.577 -17.978 1.00 0.00 ? 68  SER A H    5  
ATOM 8236  H HA   . SER A 1 68  ? -2.136  -12.962 -19.939 1.00 0.00 ? 68  SER A HA   5  
ATOM 8237  H HB2  . SER A 1 68  ? -3.179  -10.128 -19.935 1.00 0.00 ? 68  SER A HB2  5  
ATOM 8238  H HB3  . SER A 1 68  ? -1.827  -10.639 -20.945 1.00 0.00 ? 68  SER A HB3  5  
ATOM 8239  H HG   . SER A 1 68  ? -3.424  -12.377 -21.607 1.00 0.00 ? 68  SER A HG   5  
ATOM 8240  N N    . ASP A 1 69  ? -0.989  -12.191 -17.428 1.00 0.00 ? 69  ASP A N    5  
ATOM 8241  C CA   . ASP A 1 69  ? 0.139   -11.869 -16.562 1.00 0.00 ? 69  ASP A CA   5  
ATOM 8242  C C    . ASP A 1 69  ? 0.919   -13.127 -16.194 1.00 0.00 ? 69  ASP A C    5  
ATOM 8243  O O    . ASP A 1 69  ? 1.809   -13.091 -15.346 1.00 0.00 ? 69  ASP A O    5  
ATOM 8244  C CB   . ASP A 1 69  ? -0.350  -11.168 -15.293 1.00 0.00 ? 69  ASP A CB   5  
ATOM 8245  C CG   . ASP A 1 69  ? -0.704  -9.714  -15.535 1.00 0.00 ? 69  ASP A CG   5  
ATOM 8246  O OD1  . ASP A 1 69  ? -1.519  -9.445  -16.442 1.00 0.00 ? 69  ASP A OD1  5  
ATOM 8247  O OD2  . ASP A 1 69  ? -0.166  -8.844  -14.818 1.00 0.00 ? 69  ASP A OD2  5  
ATOM 8248  H H    . ASP A 1 69  ? -1.648  -12.852 -17.129 1.00 0.00 ? 69  ASP A H    5  
ATOM 8249  H HA   . ASP A 1 69  ? 0.792   -11.200 -17.103 1.00 0.00 ? 69  ASP A HA   5  
ATOM 8250  H HB2  . ASP A 1 69  ? -1.228  -11.676 -14.924 1.00 0.00 ? 69  ASP A HB2  5  
ATOM 8251  H HB3  . ASP A 1 69  ? 0.427   -11.210 -14.544 1.00 0.00 ? 69  ASP A HB3  5  
ATOM 8252  N N    . ASN A 1 70  ? 0.578   -14.238 -16.839 1.00 0.00 ? 70  ASN A N    5  
ATOM 8253  C CA   . ASN A 1 70  ? 1.246   -15.508 -16.579 1.00 0.00 ? 70  ASN A CA   5  
ATOM 8254  C C    . ASN A 1 70  ? 1.177   -15.865 -15.097 1.00 0.00 ? 70  ASN A C    5  
ATOM 8255  O O    . ASN A 1 70  ? 2.106   -16.457 -14.547 1.00 0.00 ? 70  ASN A O    5  
ATOM 8256  C CB   . ASN A 1 70  ? 2.706   -15.443 -17.031 1.00 0.00 ? 70  ASN A CB   5  
ATOM 8257  C CG   . ASN A 1 70  ? 2.853   -15.594 -18.533 1.00 0.00 ? 70  ASN A CG   5  
ATOM 8258  O OD1  . ASN A 1 70  ? 3.438   -16.564 -19.016 1.00 0.00 ? 70  ASN A OD1  5  
ATOM 8259  N ND2  . ASN A 1 70  ? 2.321   -14.633 -19.279 1.00 0.00 ? 70  ASN A ND2  5  
ATOM 8260  H H    . ASN A 1 70  ? -0.140  -14.203 -17.505 1.00 0.00 ? 70  ASN A H    5  
ATOM 8261  H HA   . ASN A 1 70  ? 0.736   -16.272 -17.145 1.00 0.00 ? 70  ASN A HA   5  
ATOM 8262  H HB2  . ASN A 1 70  ? 3.124   -14.489 -16.743 1.00 0.00 ? 70  ASN A HB2  5  
ATOM 8263  H HB3  . ASN A 1 70  ? 3.262   -16.234 -16.552 1.00 0.00 ? 70  ASN A HB3  5  
ATOM 8264  H HD21 . ASN A 1 70  ? 1.871   -13.890 -18.826 1.00 0.00 ? 70  ASN A HD21 5  
ATOM 8265  H HD22 . ASN A 1 70  ? 2.401   -14.706 -20.253 1.00 0.00 ? 70  ASN A HD22 5  
ATOM 8266  N N    . ILE A 1 71  ? 0.070   -15.502 -14.457 1.00 0.00 ? 71  ILE A N    5  
ATOM 8267  C CA   . ILE A 1 71  ? -0.121  -15.786 -13.041 1.00 0.00 ? 71  ILE A CA   5  
ATOM 8268  C C    . ILE A 1 71  ? -0.977  -17.032 -12.840 1.00 0.00 ? 71  ILE A C    5  
ATOM 8269  O O    . ILE A 1 71  ? -2.199  -16.945 -12.722 1.00 0.00 ? 71  ILE A O    5  
ATOM 8270  C CB   . ILE A 1 71  ? -0.781  -14.600 -12.313 1.00 0.00 ? 71  ILE A CB   5  
ATOM 8271  C CG1  . ILE A 1 71  ? -0.017  -13.307 -12.602 1.00 0.00 ? 71  ILE A CG1  5  
ATOM 8272  C CG2  . ILE A 1 71  ? -0.840  -14.864 -10.816 1.00 0.00 ? 71  ILE A CG2  5  
ATOM 8273  C CD1  . ILE A 1 71  ? 1.367   -13.274 -11.993 1.00 0.00 ? 71  ILE A CD1  5  
ATOM 8274  H H    . ILE A 1 71  ? -0.635  -15.033 -14.950 1.00 0.00 ? 71  ILE A H    5  
ATOM 8275  H HA   . ILE A 1 71  ? 0.852   -15.956 -12.601 1.00 0.00 ? 71  ILE A HA   5  
ATOM 8276  H HB   . ILE A 1 71  ? -1.792  -14.501 -12.677 1.00 0.00 ? 71  ILE A HB   5  
ATOM 8277  H HG12 . ILE A 1 71  ? 0.088   -13.188 -13.669 1.00 0.00 ? 71  ILE A HG12 5  
ATOM 8278  H HG13 . ILE A 1 71  ? -0.575  -12.471 -12.205 1.00 0.00 ? 71  ILE A HG13 5  
ATOM 8279  H HG21 . ILE A 1 71  ? 0.146   -15.119 -10.456 1.00 0.00 ? 71  ILE A HG21 5  
ATOM 8280  H HG22 . ILE A 1 71  ? -1.189  -13.977 -10.308 1.00 0.00 ? 71  ILE A HG22 5  
ATOM 8281  H HG23 . ILE A 1 71  ? -1.517  -15.681 -10.620 1.00 0.00 ? 71  ILE A HG23 5  
ATOM 8282  H HD11 . ILE A 1 71  ? 1.702   -14.283 -11.803 1.00 0.00 ? 71  ILE A HD11 5  
ATOM 8283  H HD12 . ILE A 1 71  ? 2.050   -12.789 -12.674 1.00 0.00 ? 71  ILE A HD12 5  
ATOM 8284  H HD13 . ILE A 1 71  ? 1.338   -12.724 -11.062 1.00 0.00 ? 71  ILE A HD13 5  
ATOM 8285  N N    . SER A 1 72  ? -0.326  -18.190 -12.800 1.00 0.00 ? 72  SER A N    5  
ATOM 8286  C CA   . SER A 1 72  ? -1.028  -19.455 -12.615 1.00 0.00 ? 72  SER A CA   5  
ATOM 8287  C C    . SER A 1 72  ? -1.291  -19.719 -11.136 1.00 0.00 ? 72  SER A C    5  
ATOM 8288  O O    . SER A 1 72  ? -1.066  -20.825 -10.642 1.00 0.00 ? 72  SER A O    5  
ATOM 8289  C CB   . SER A 1 72  ? -0.217  -20.605 -13.214 1.00 0.00 ? 72  SER A CB   5  
ATOM 8290  O OG   . SER A 1 72  ? -0.212  -20.543 -14.630 1.00 0.00 ? 72  SER A OG   5  
ATOM 8291  H H    . SER A 1 72  ? 0.649   -18.194 -12.900 1.00 0.00 ? 72  SER A H    5  
ATOM 8292  H HA   . SER A 1 72  ? -1.975  -19.387 -13.130 1.00 0.00 ? 72  SER A HA   5  
ATOM 8293  H HB2  . SER A 1 72  ? 0.801   -20.547 -12.860 1.00 0.00 ? 72  SER A HB2  5  
ATOM 8294  H HB3  . SER A 1 72  ? -0.651  -21.546 -12.908 1.00 0.00 ? 72  SER A HB3  5  
ATOM 8295  H HG   . SER A 1 72  ? -0.259  -19.626 -14.911 1.00 0.00 ? 72  SER A HG   5  
ATOM 8296  N N    . ARG A 1 73  ? -1.768  -18.697 -10.434 1.00 0.00 ? 73  ARG A N    5  
ATOM 8297  C CA   . ARG A 1 73  ? -2.061  -18.817 -9.011  1.00 0.00 ? 73  ARG A CA   5  
ATOM 8298  C C    . ARG A 1 73  ? -3.424  -18.214 -8.683  1.00 0.00 ? 73  ARG A C    5  
ATOM 8299  O O    . ARG A 1 73  ? -3.680  -17.042 -8.960  1.00 0.00 ? 73  ARG A O    5  
ATOM 8300  C CB   . ARG A 1 73  ? -0.974  -18.126 -8.185  1.00 0.00 ? 73  ARG A CB   5  
ATOM 8301  C CG   . ARG A 1 73  ? 0.280   -18.965 -8.005  1.00 0.00 ? 73  ARG A CG   5  
ATOM 8302  C CD   . ARG A 1 73  ? 1.068   -18.533 -6.778  1.00 0.00 ? 73  ARG A CD   5  
ATOM 8303  N NE   . ARG A 1 73  ? 0.653   -19.255 -5.579  1.00 0.00 ? 73  ARG A NE   5  
ATOM 8304  C CZ   . ARG A 1 73  ? 1.086   -20.472 -5.267  1.00 0.00 ? 73  ARG A CZ   5  
ATOM 8305  N NH1  . ARG A 1 73  ? 1.943   -21.098 -6.062  1.00 0.00 ? 73  ARG A NH1  5  
ATOM 8306  N NH2  . ARG A 1 73  ? 0.663   -21.064 -4.157  1.00 0.00 ? 73  ARG A NH2  5  
ATOM 8307  H H    . ARG A 1 73  ? -1.927  -17.840 -10.884 1.00 0.00 ? 73  ARG A H    5  
ATOM 8308  H HA   . ARG A 1 73  ? -2.076  -19.867 -8.763  1.00 0.00 ? 73  ARG A HA   5  
ATOM 8309  H HB2  . ARG A 1 73  ? -0.697  -17.204 -8.676  1.00 0.00 ? 73  ARG A HB2  5  
ATOM 8310  H HB3  . ARG A 1 73  ? -1.372  -17.898 -7.208  1.00 0.00 ? 73  ARG A HB3  5  
ATOM 8311  H HG2  . ARG A 1 73  ? -0.004  -20.001 -7.890  1.00 0.00 ? 73  ARG A HG2  5  
ATOM 8312  H HG3  . ARG A 1 73  ? 0.904   -18.856 -8.880  1.00 0.00 ? 73  ARG A HG3  5  
ATOM 8313  H HD2  . ARG A 1 73  ? 2.117   -18.721 -6.956  1.00 0.00 ? 73  ARG A HD2  5  
ATOM 8314  H HD3  . ARG A 1 73  ? 0.914   -17.475 -6.622  1.00 0.00 ? 73  ARG A HD3  5  
ATOM 8315  H HE   . ARG A 1 73  ? 0.021   -18.810 -4.977  1.00 0.00 ? 73  ARG A HE   5  
ATOM 8316  H HH11 . ARG A 1 73  ? 2.264   -20.654 -6.898  1.00 0.00 ? 73  ARG A HH11 5  
ATOM 8317  H HH12 . ARG A 1 73  ? 2.268   -22.014 -5.824  1.00 0.00 ? 73  ARG A HH12 5  
ATOM 8318  H HH21 . ARG A 1 73  ? 0.017   -20.594 -3.556  1.00 0.00 ? 73  ARG A HH21 5  
ATOM 8319  H HH22 . ARG A 1 73  ? 0.989   -21.979 -3.924  1.00 0.00 ? 73  ARG A HH22 5  
ATOM 8320  N N    . LYS A 1 74  ? -4.296  -19.024 -8.092  1.00 0.00 ? 74  LYS A N    5  
ATOM 8321  C CA   . LYS A 1 74  ? -5.633  -18.572 -7.726  1.00 0.00 ? 74  LYS A CA   5  
ATOM 8322  C C    . LYS A 1 74  ? -5.581  -17.638 -6.521  1.00 0.00 ? 74  LYS A C    5  
ATOM 8323  O O    . LYS A 1 74  ? -4.775  -17.829 -5.610  1.00 0.00 ? 74  LYS A O    5  
ATOM 8324  C CB   . LYS A 1 74  ? -6.532  -19.772 -7.416  1.00 0.00 ? 74  LYS A CB   5  
ATOM 8325  C CG   . LYS A 1 74  ? -7.214  -20.353 -8.642  1.00 0.00 ? 74  LYS A CG   5  
ATOM 8326  C CD   . LYS A 1 74  ? -8.487  -19.596 -8.983  1.00 0.00 ? 74  LYS A CD   5  
ATOM 8327  C CE   . LYS A 1 74  ? -9.642  -20.014 -8.087  1.00 0.00 ? 74  LYS A CE   5  
ATOM 8328  N NZ   . LYS A 1 74  ? -10.115 -21.391 -8.398  1.00 0.00 ? 74  LYS A NZ   5  
ATOM 8329  H H    . LYS A 1 74  ? -4.034  -19.948 -7.897  1.00 0.00 ? 74  LYS A H    5  
ATOM 8330  H HA   . LYS A 1 74  ? -6.043  -18.034 -8.566  1.00 0.00 ? 74  LYS A HA   5  
ATOM 8331  H HB2  . LYS A 1 74  ? -5.933  -20.547 -6.961  1.00 0.00 ? 74  LYS A HB2  5  
ATOM 8332  H HB3  . LYS A 1 74  ? -7.296  -19.463 -6.717  1.00 0.00 ? 74  LYS A HB3  5  
ATOM 8333  H HG2  . LYS A 1 74  ? -6.538  -20.295 -9.481  1.00 0.00 ? 74  LYS A HG2  5  
ATOM 8334  H HG3  . LYS A 1 74  ? -7.463  -21.387 -8.448  1.00 0.00 ? 74  LYS A HG3  5  
ATOM 8335  H HD2  . LYS A 1 74  ? -8.311  -18.538 -8.855  1.00 0.00 ? 74  LYS A HD2  5  
ATOM 8336  H HD3  . LYS A 1 74  ? -8.750  -19.797 -10.012 1.00 0.00 ? 74  LYS A HD3  5  
ATOM 8337  H HE2  . LYS A 1 74  ? -9.314  -19.979 -7.059  1.00 0.00 ? 74  LYS A HE2  5  
ATOM 8338  H HE3  . LYS A 1 74  ? -10.458 -19.321 -8.228  1.00 0.00 ? 74  LYS A HE3  5  
ATOM 8339  H HZ1  . LYS A 1 74  ? -11.044 -21.352 -8.865  1.00 0.00 ? 74  LYS A HZ1  5  
ATOM 8340  H HZ2  . LYS A 1 74  ? -10.204 -21.945 -7.522  1.00 0.00 ? 74  LYS A HZ2  5  
ATOM 8341  H HZ3  . LYS A 1 74  ? -9.440  -21.867 -9.030  1.00 0.00 ? 74  LYS A HZ3  5  
ATOM 8342  N N    . HIS A 1 75  ? -6.446  -16.629 -6.523  1.00 0.00 ? 75  HIS A N    5  
ATOM 8343  C CA   . HIS A 1 75  ? -6.499  -15.666 -5.428  1.00 0.00 ? 75  HIS A CA   5  
ATOM 8344  C C    . HIS A 1 75  ? -5.244  -14.798 -5.406  1.00 0.00 ? 75  HIS A C    5  
ATOM 8345  O O    . HIS A 1 75  ? -4.649  -14.574 -4.352  1.00 0.00 ? 75  HIS A O    5  
ATOM 8346  C CB   . HIS A 1 75  ? -6.655  -16.391 -4.091  1.00 0.00 ? 75  HIS A CB   5  
ATOM 8347  C CG   . HIS A 1 75  ? -7.470  -17.644 -4.180  1.00 0.00 ? 75  HIS A CG   5  
ATOM 8348  N ND1  . HIS A 1 75  ? -8.629  -17.737 -4.921  1.00 0.00 ? 75  HIS A ND1  5  
ATOM 8349  C CD2  . HIS A 1 75  ? -7.287  -18.861 -3.617  1.00 0.00 ? 75  HIS A CD2  5  
ATOM 8350  C CE1  . HIS A 1 75  ? -9.124  -18.956 -4.809  1.00 0.00 ? 75  HIS A CE1  5  
ATOM 8351  N NE2  . HIS A 1 75  ? -8.328  -19.659 -4.024  1.00 0.00 ? 75  HIS A NE2  5  
ATOM 8352  H H    . HIS A 1 75  ? -7.063  -16.530 -7.277  1.00 0.00 ? 75  HIS A H    5  
ATOM 8353  H HA   . HIS A 1 75  ? -7.358  -15.032 -5.586  1.00 0.00 ? 75  HIS A HA   5  
ATOM 8354  H HB2  . HIS A 1 75  ? -5.677  -16.657 -3.717  1.00 0.00 ? 75  HIS A HB2  5  
ATOM 8355  H HB3  . HIS A 1 75  ? -7.137  -15.730 -3.385  1.00 0.00 ? 75  HIS A HB3  5  
ATOM 8356  H HD1  . HIS A 1 75  ? -9.030  -17.016 -5.449  1.00 0.00 ? 75  HIS A HD1  5  
ATOM 8357  H HD2  . HIS A 1 75  ? -6.472  -19.152 -2.969  1.00 0.00 ? 75  HIS A HD2  5  
ATOM 8358  H HE1  . HIS A 1 75  ? -10.026 -19.318 -5.280  1.00 0.00 ? 75  HIS A HE1  5  
ATOM 8359  H HE2  . HIS A 1 75  ? -8.508  -20.568 -3.706  1.00 0.00 ? 75  HIS A HE2  5  
ATOM 8360  N N    . THR A 1 76  ? -4.847  -14.312 -6.578  1.00 0.00 ? 76  THR A N    5  
ATOM 8361  C CA   . THR A 1 76  ? -3.662  -13.471 -6.694  1.00 0.00 ? 76  THR A CA   5  
ATOM 8362  C C    . THR A 1 76  ? -4.017  -12.095 -7.247  1.00 0.00 ? 76  THR A C    5  
ATOM 8363  O O    . THR A 1 76  ? -4.930  -11.959 -8.061  1.00 0.00 ? 76  THR A O    5  
ATOM 8364  C CB   . THR A 1 76  ? -2.600  -14.118 -7.602  1.00 0.00 ? 76  THR A CB   5  
ATOM 8365  O OG1  . THR A 1 76  ? -2.389  -15.481 -7.215  1.00 0.00 ? 76  THR A OG1  5  
ATOM 8366  C CG2  . THR A 1 76  ? -1.286  -13.356 -7.527  1.00 0.00 ? 76  THR A CG2  5  
ATOM 8367  H H    . THR A 1 76  ? -5.363  -14.526 -7.383  1.00 0.00 ? 76  THR A H    5  
ATOM 8368  H HA   . THR A 1 76  ? -3.239  -13.353 -5.707  1.00 0.00 ? 76  THR A HA   5  
ATOM 8369  H HB   . THR A 1 76  ? -2.956  -14.093 -8.622  1.00 0.00 ? 76  THR A HB   5  
ATOM 8370  H HG1  . THR A 1 76  ? -3.218  -15.859 -6.912  1.00 0.00 ? 76  THR A HG1  5  
ATOM 8371  H HG21 . THR A 1 76  ? -0.838  -13.504 -6.555  1.00 0.00 ? 76  THR A HG21 5  
ATOM 8372  H HG22 . THR A 1 76  ? -1.471  -12.303 -7.681  1.00 0.00 ? 76  THR A HG22 5  
ATOM 8373  H HG23 . THR A 1 76  ? -0.615  -13.719 -8.291  1.00 0.00 ? 76  THR A HG23 5  
ATOM 8374  N N    . PHE A 1 77  ? -3.288  -11.077 -6.801  1.00 0.00 ? 77  PHE A N    5  
ATOM 8375  C CA   . PHE A 1 77  ? -3.527  -9.711  -7.252  1.00 0.00 ? 77  PHE A CA   5  
ATOM 8376  C C    . PHE A 1 77  ? -2.219  -9.034  -7.651  1.00 0.00 ? 77  PHE A C    5  
ATOM 8377  O O    . PHE A 1 77  ? -1.135  -9.479  -7.272  1.00 0.00 ? 77  PHE A O    5  
ATOM 8378  C CB   . PHE A 1 77  ? -4.217  -8.902  -6.152  1.00 0.00 ? 77  PHE A CB   5  
ATOM 8379  C CG   . PHE A 1 77  ? -3.596  -9.080  -4.796  1.00 0.00 ? 77  PHE A CG   5  
ATOM 8380  C CD1  . PHE A 1 77  ? -3.772  -10.258 -4.088  1.00 0.00 ? 77  PHE A CD1  5  
ATOM 8381  C CD2  . PHE A 1 77  ? -2.836  -8.070  -4.230  1.00 0.00 ? 77  PHE A CD2  5  
ATOM 8382  C CE1  . PHE A 1 77  ? -3.201  -10.426 -2.841  1.00 0.00 ? 77  PHE A CE1  5  
ATOM 8383  C CE2  . PHE A 1 77  ? -2.262  -8.232  -2.983  1.00 0.00 ? 77  PHE A CE2  5  
ATOM 8384  C CZ   . PHE A 1 77  ? -2.446  -9.411  -2.287  1.00 0.00 ? 77  PHE A CZ   5  
ATOM 8385  H H    . PHE A 1 77  ? -2.573  -11.249 -6.152  1.00 0.00 ? 77  PHE A H    5  
ATOM 8386  H HA   . PHE A 1 77  ? -4.173  -9.756  -8.114  1.00 0.00 ? 77  PHE A HA   5  
ATOM 8387  H HB2  . PHE A 1 77  ? -4.170  -7.853  -6.403  1.00 0.00 ? 77  PHE A HB2  5  
ATOM 8388  H HB3  . PHE A 1 77  ? -5.251  -9.206  -6.087  1.00 0.00 ? 77  PHE A HB3  5  
ATOM 8389  H HD1  . PHE A 1 77  ? -4.363  -11.053 -4.521  1.00 0.00 ? 77  PHE A HD1  5  
ATOM 8390  H HD2  . PHE A 1 77  ? -2.692  -7.147  -4.772  1.00 0.00 ? 77  PHE A HD2  5  
ATOM 8391  H HE1  . PHE A 1 77  ? -3.347  -11.349 -2.299  1.00 0.00 ? 77  PHE A HE1  5  
ATOM 8392  H HE2  . PHE A 1 77  ? -1.673  -7.436  -2.552  1.00 0.00 ? 77  PHE A HE2  5  
ATOM 8393  H HZ   . PHE A 1 77  ? -1.999  -9.540  -1.313  1.00 0.00 ? 77  PHE A HZ   5  
ATOM 8394  N N    . LYS A 1 78  ? -2.328  -7.956  -8.420  1.00 0.00 ? 78  LYS A N    5  
ATOM 8395  C CA   . LYS A 1 78  ? -1.156  -7.216  -8.872  1.00 0.00 ? 78  LYS A CA   5  
ATOM 8396  C C    . LYS A 1 78  ? -1.238  -5.754  -8.445  1.00 0.00 ? 78  LYS A C    5  
ATOM 8397  O O    . LYS A 1 78  ? -2.323  -5.177  -8.379  1.00 0.00 ? 78  LYS A O    5  
ATOM 8398  C CB   . LYS A 1 78  ? -1.026  -7.307  -10.394 1.00 0.00 ? 78  LYS A CB   5  
ATOM 8399  C CG   . LYS A 1 78  ? -2.185  -6.672  -11.143 1.00 0.00 ? 78  LYS A CG   5  
ATOM 8400  C CD   . LYS A 1 78  ? -1.786  -6.270  -12.553 1.00 0.00 ? 78  LYS A CD   5  
ATOM 8401  C CE   . LYS A 1 78  ? -2.927  -5.575  -13.279 1.00 0.00 ? 78  LYS A CE   5  
ATOM 8402  N NZ   . LYS A 1 78  ? -2.592  -5.300  -14.704 1.00 0.00 ? 78  LYS A NZ   5  
ATOM 8403  H H    . LYS A 1 78  ? -3.220  -7.651  -8.690  1.00 0.00 ? 78  LYS A H    5  
ATOM 8404  H HA   . LYS A 1 78  ? -0.285  -7.663  -8.418  1.00 0.00 ? 78  LYS A HA   5  
ATOM 8405  H HB2  . LYS A 1 78  ? -0.115  -6.811  -10.696 1.00 0.00 ? 78  LYS A HB2  5  
ATOM 8406  H HB3  . LYS A 1 78  ? -0.969  -8.348  -10.677 1.00 0.00 ? 78  LYS A HB3  5  
ATOM 8407  H HG2  . LYS A 1 78  ? -2.998  -7.381  -11.199 1.00 0.00 ? 78  LYS A HG2  5  
ATOM 8408  H HG3  . LYS A 1 78  ? -2.510  -5.792  -10.606 1.00 0.00 ? 78  LYS A HG3  5  
ATOM 8409  H HD2  . LYS A 1 78  ? -0.944  -5.596  -12.501 1.00 0.00 ? 78  LYS A HD2  5  
ATOM 8410  H HD3  . LYS A 1 78  ? -1.506  -7.157  -13.105 1.00 0.00 ? 78  LYS A HD3  5  
ATOM 8411  H HE2  . LYS A 1 78  ? -3.800  -6.209  -13.240 1.00 0.00 ? 78  LYS A HE2  5  
ATOM 8412  H HE3  . LYS A 1 78  ? -3.137  -4.641  -12.780 1.00 0.00 ? 78  LYS A HE3  5  
ATOM 8413  H HZ1  . LYS A 1 78  ? -3.300  -4.662  -15.120 1.00 0.00 ? 78  LYS A HZ1  5  
ATOM 8414  H HZ2  . LYS A 1 78  ? -2.580  -6.187  -15.246 1.00 0.00 ? 78  LYS A HZ2  5  
ATOM 8415  H HZ3  . LYS A 1 78  ? -1.656  -4.853  -14.771 1.00 0.00 ? 78  LYS A HZ3  5  
ATOM 8416  N N    . ALA A 1 79  ? -0.084  -5.161  -8.156  1.00 0.00 ? 79  ALA A N    5  
ATOM 8417  C CA   . ALA A 1 79  ? -0.026  -3.766  -7.738  1.00 0.00 ? 79  ALA A CA   5  
ATOM 8418  C C    . ALA A 1 79  ? 0.903   -2.961  -8.641  1.00 0.00 ? 79  ALA A C    5  
ATOM 8419  O O    . ALA A 1 79  ? 2.125   -3.069  -8.544  1.00 0.00 ? 79  ALA A O    5  
ATOM 8420  C CB   . ALA A 1 79  ? 0.428   -3.667  -6.290  1.00 0.00 ? 79  ALA A CB   5  
ATOM 8421  H H    . ALA A 1 79  ? 0.748   -5.674  -8.227  1.00 0.00 ? 79  ALA A H    5  
ATOM 8422  H HA   . ALA A 1 79  ? -1.023  -3.355  -7.806  1.00 0.00 ? 79  ALA A HA   5  
ATOM 8423  H HB1  . ALA A 1 79  ? 0.671   -2.640  -6.059  1.00 0.00 ? 79  ALA A HB1  5  
ATOM 8424  H HB2  . ALA A 1 79  ? -0.366  -4.005  -5.640  1.00 0.00 ? 79  ALA A HB2  5  
ATOM 8425  H HB3  . ALA A 1 79  ? 1.301   -4.286  -6.143  1.00 0.00 ? 79  ALA A HB3  5  
ATOM 8426  N N    . GLU A 1 80  ? 0.315   -2.155  -9.520  1.00 0.00 ? 80  GLU A N    5  
ATOM 8427  C CA   . GLU A 1 80  ? 1.091   -1.334  -10.441 1.00 0.00 ? 80  GLU A CA   5  
ATOM 8428  C C    . GLU A 1 80  ? 0.897   0.150   -10.143 1.00 0.00 ? 80  GLU A C    5  
ATOM 8429  O O    . GLU A 1 80  ? -0.224  0.609   -9.920  1.00 0.00 ? 80  GLU A O    5  
ATOM 8430  C CB   . GLU A 1 80  ? 0.689   -1.631  -11.887 1.00 0.00 ? 80  GLU A CB   5  
ATOM 8431  C CG   . GLU A 1 80  ? 1.396   -0.755  -12.908 1.00 0.00 ? 80  GLU A CG   5  
ATOM 8432  C CD   . GLU A 1 80  ? 2.878   -1.061  -13.012 1.00 0.00 ? 80  GLU A CD   5  
ATOM 8433  O OE1  . GLU A 1 80  ? 3.609   -0.797  -12.034 1.00 0.00 ? 80  GLU A OE1  5  
ATOM 8434  O OE2  . GLU A 1 80  ? 3.306   -1.565  -14.071 1.00 0.00 ? 80  GLU A OE2  5  
ATOM 8435  H H    . GLU A 1 80  ? -0.664  -2.112  -9.549  1.00 0.00 ? 80  GLU A H    5  
ATOM 8436  H HA   . GLU A 1 80  ? 2.133   -1.581  -10.309 1.00 0.00 ? 80  GLU A HA   5  
ATOM 8437  H HB2  . GLU A 1 80  ? 0.919   -2.663  -12.107 1.00 0.00 ? 80  GLU A HB2  5  
ATOM 8438  H HB3  . GLU A 1 80  ? -0.375  -1.479  -11.990 1.00 0.00 ? 80  GLU A HB3  5  
ATOM 8439  H HG2  . GLU A 1 80  ? 0.943   -0.914  -13.875 1.00 0.00 ? 80  GLU A HG2  5  
ATOM 8440  H HG3  . GLU A 1 80  ? 1.276   0.279   -12.621 1.00 0.00 ? 80  GLU A HG3  5  
ATOM 8441  N N    . HIS A 1 81  ? 1.997   0.896   -10.139 1.00 0.00 ? 81  HIS A N    5  
ATOM 8442  C CA   . HIS A 1 81  ? 1.949   2.329   -9.868  1.00 0.00 ? 81  HIS A CA   5  
ATOM 8443  C C    . HIS A 1 81  ? 2.309   3.130   -11.115 1.00 0.00 ? 81  HIS A C    5  
ATOM 8444  O O    . HIS A 1 81  ? 3.352   3.781   -11.166 1.00 0.00 ? 81  HIS A O    5  
ATOM 8445  C CB   . HIS A 1 81  ? 2.900   2.685   -8.726  1.00 0.00 ? 81  HIS A CB   5  
ATOM 8446  C CG   . HIS A 1 81  ? 3.164   4.154   -8.602  1.00 0.00 ? 81  HIS A CG   5  
ATOM 8447  N ND1  . HIS A 1 81  ? 4.237   4.670   -7.906  1.00 0.00 ? 81  HIS A ND1  5  
ATOM 8448  C CD2  . HIS A 1 81  ? 2.489   5.219   -9.094  1.00 0.00 ? 81  HIS A CD2  5  
ATOM 8449  C CE1  . HIS A 1 81  ? 4.208   5.990   -7.972  1.00 0.00 ? 81  HIS A CE1  5  
ATOM 8450  N NE2  . HIS A 1 81  ? 3.158   6.348   -8.688  1.00 0.00 ? 81  HIS A NE2  5  
ATOM 8451  H H    . HIS A 1 81  ? 2.861   0.473   -10.323 1.00 0.00 ? 81  HIS A H    5  
ATOM 8452  H HA   . HIS A 1 81  ? 0.940   2.577   -9.575  1.00 0.00 ? 81  HIS A HA   5  
ATOM 8453  H HB2  . HIS A 1 81  ? 2.475   2.346   -7.793  1.00 0.00 ? 81  HIS A HB2  5  
ATOM 8454  H HB3  . HIS A 1 81  ? 3.847   2.189   -8.886  1.00 0.00 ? 81  HIS A HB3  5  
ATOM 8455  H HD1  . HIS A 1 81  ? 4.916   4.148   -7.431  1.00 0.00 ? 81  HIS A HD1  5  
ATOM 8456  H HD2  . HIS A 1 81  ? 1.590   5.188   -9.694  1.00 0.00 ? 81  HIS A HD2  5  
ATOM 8457  H HE1  . HIS A 1 81  ? 4.922   6.661   -7.519  1.00 0.00 ? 81  HIS A HE1  5  
ATOM 8458  H HE2  . HIS A 1 81  ? 2.854   7.270   -8.821  1.00 0.00 ? 81  HIS A HE2  5  
ATOM 8459  N N    . ALA A 1 82  ? 1.440   3.077   -12.119 1.00 0.00 ? 82  ALA A N    5  
ATOM 8460  C CA   . ALA A 1 82  ? 1.666   3.798   -13.365 1.00 0.00 ? 82  ALA A CA   5  
ATOM 8461  C C    . ALA A 1 82  ? 2.927   3.302   -14.065 1.00 0.00 ? 82  ALA A C    5  
ATOM 8462  O O    . ALA A 1 82  ? 3.544   4.030   -14.842 1.00 0.00 ? 82  ALA A O    5  
ATOM 8463  C CB   . ALA A 1 82  ? 1.762   5.293   -13.099 1.00 0.00 ? 82  ALA A CB   5  
ATOM 8464  H H    . ALA A 1 82  ? 0.626   2.540   -12.018 1.00 0.00 ? 82  ALA A H    5  
ATOM 8465  H HA   . ALA A 1 82  ? 0.816   3.626   -14.010 1.00 0.00 ? 82  ALA A HA   5  
ATOM 8466  H HB1  . ALA A 1 82  ? 1.716   5.828   -14.036 1.00 0.00 ? 82  ALA A HB1  5  
ATOM 8467  H HB2  . ALA A 1 82  ? 0.940   5.600   -12.469 1.00 0.00 ? 82  ALA A HB2  5  
ATOM 8468  H HB3  . ALA A 1 82  ? 2.696   5.512   -12.604 1.00 0.00 ? 82  ALA A HB3  5  
ATOM 8469  N N    . GLY A 1 83  ? 3.304   2.058   -13.785 1.00 0.00 ? 83  GLY A N    5  
ATOM 8470  C CA   . GLY A 1 83  ? 4.490   1.487   -14.396 1.00 0.00 ? 83  GLY A CA   5  
ATOM 8471  C C    . GLY A 1 83  ? 5.664   1.428   -13.439 1.00 0.00 ? 83  GLY A C    5  
ATOM 8472  O O    . GLY A 1 83  ? 6.496   0.524   -13.520 1.00 0.00 ? 83  GLY A O    5  
ATOM 8473  H H    . GLY A 1 83  ? 2.772   1.525   -13.157 1.00 0.00 ? 83  GLY A H    5  
ATOM 8474  H HA2  . GLY A 1 83  ? 4.262   0.487   -14.732 1.00 0.00 ? 83  GLY A HA2  5  
ATOM 8475  H HA3  . GLY A 1 83  ? 4.766   2.089   -15.249 1.00 0.00 ? 83  GLY A HA3  5  
ATOM 8476  N N    . VAL A 1 84  ? 5.733   2.394   -12.529 1.00 0.00 ? 84  VAL A N    5  
ATOM 8477  C CA   . VAL A 1 84  ? 6.814   2.449   -11.552 1.00 0.00 ? 84  VAL A CA   5  
ATOM 8478  C C    . VAL A 1 84  ? 7.286   1.049   -11.176 1.00 0.00 ? 84  VAL A C    5  
ATOM 8479  O O    . VAL A 1 84  ? 8.484   0.765   -11.179 1.00 0.00 ? 84  VAL A O    5  
ATOM 8480  C CB   . VAL A 1 84  ? 6.380   3.193   -10.275 1.00 0.00 ? 84  VAL A CB   5  
ATOM 8481  C CG1  . VAL A 1 84  ? 7.463   3.103   -9.211  1.00 0.00 ? 84  VAL A CG1  5  
ATOM 8482  C CG2  . VAL A 1 84  ? 6.050   4.644   -10.591 1.00 0.00 ? 84  VAL A CG2  5  
ATOM 8483  H H    . VAL A 1 84  ? 5.040   3.087   -12.513 1.00 0.00 ? 84  VAL A H    5  
ATOM 8484  H HA   . VAL A 1 84  ? 7.638   2.989   -11.996 1.00 0.00 ? 84  VAL A HA   5  
ATOM 8485  H HB   . VAL A 1 84  ? 5.489   2.718   -9.892  1.00 0.00 ? 84  VAL A HB   5  
ATOM 8486  H HG11 . VAL A 1 84  ? 7.419   3.977   -8.578  1.00 0.00 ? 84  VAL A HG11 5  
ATOM 8487  H HG12 . VAL A 1 84  ? 7.309   2.217   -8.613  1.00 0.00 ? 84  VAL A HG12 5  
ATOM 8488  H HG13 . VAL A 1 84  ? 8.432   3.053   -9.686  1.00 0.00 ? 84  VAL A HG13 5  
ATOM 8489  H HG21 . VAL A 1 84  ? 5.936   4.762   -11.658 1.00 0.00 ? 84  VAL A HG21 5  
ATOM 8490  H HG22 . VAL A 1 84  ? 5.129   4.920   -10.097 1.00 0.00 ? 84  VAL A HG22 5  
ATOM 8491  H HG23 . VAL A 1 84  ? 6.850   5.280   -10.241 1.00 0.00 ? 84  VAL A HG23 5  
ATOM 8492  N N    . ARG A 1 85  ? 6.337   0.177   -10.852 1.00 0.00 ? 85  ARG A N    5  
ATOM 8493  C CA   . ARG A 1 85  ? 6.655   -1.194  -10.473 1.00 0.00 ? 85  ARG A CA   5  
ATOM 8494  C C    . ARG A 1 85  ? 5.383   -2.016  -10.288 1.00 0.00 ? 85  ARG A C    5  
ATOM 8495  O O    . ARG A 1 85  ? 4.383   -1.525  -9.763  1.00 0.00 ? 85  ARG A O    5  
ATOM 8496  C CB   . ARG A 1 85  ? 7.478   -1.210  -9.183  1.00 0.00 ? 85  ARG A CB   5  
ATOM 8497  C CG   . ARG A 1 85  ? 8.354   -2.444  -9.036  1.00 0.00 ? 85  ARG A CG   5  
ATOM 8498  C CD   . ARG A 1 85  ? 9.634   -2.319  -9.846  1.00 0.00 ? 85  ARG A CD   5  
ATOM 8499  N NE   . ARG A 1 85  ? 10.182  -3.623  -10.210 1.00 0.00 ? 85  ARG A NE   5  
ATOM 8500  C CZ   . ARG A 1 85  ? 10.983  -3.819  -11.251 1.00 0.00 ? 85  ARG A CZ   5  
ATOM 8501  N NH1  . ARG A 1 85  ? 11.328  -2.801  -12.027 1.00 0.00 ? 85  ARG A NH1  5  
ATOM 8502  N NH2  . ARG A 1 85  ? 11.441  -5.035  -11.517 1.00 0.00 ? 85  ARG A NH2  5  
ATOM 8503  H H    . ARG A 1 85  ? 5.399   0.463   -10.868 1.00 0.00 ? 85  ARG A H    5  
ATOM 8504  H HA   . ARG A 1 85  ? 7.240   -1.631  -11.268 1.00 0.00 ? 85  ARG A HA   5  
ATOM 8505  H HB2  . ARG A 1 85  ? 8.116   -0.339  -9.166  1.00 0.00 ? 85  ARG A HB2  5  
ATOM 8506  H HB3  . ARG A 1 85  ? 6.805   -1.171  -8.341  1.00 0.00 ? 85  ARG A HB3  5  
ATOM 8507  H HG2  . ARG A 1 85  ? 8.611   -2.569  -7.994  1.00 0.00 ? 85  ARG A HG2  5  
ATOM 8508  H HG3  . ARG A 1 85  ? 7.804   -3.307  -9.379  1.00 0.00 ? 85  ARG A HG3  5  
ATOM 8509  H HD2  . ARG A 1 85  ? 9.421   -1.764  -10.748 1.00 0.00 ? 85  ARG A HD2  5  
ATOM 8510  H HD3  . ARG A 1 85  ? 10.365  -1.783  -9.258  1.00 0.00 ? 85  ARG A HD3  5  
ATOM 8511  H HE   . ARG A 1 85  ? 9.940   -4.389  -9.650  1.00 0.00 ? 85  ARG A HE   5  
ATOM 8512  H HH11 . ARG A 1 85  ? 10.986  -1.883  -11.828 1.00 0.00 ? 85  ARG A HH11 5  
ATOM 8513  H HH12 . ARG A 1 85  ? 11.933  -2.951  -12.810 1.00 0.00 ? 85  ARG A HH12 5  
ATOM 8514  H HH21 . ARG A 1 85  ? 11.183  -5.805  -10.934 1.00 0.00 ? 85  ARG A HH21 5  
ATOM 8515  H HH22 . ARG A 1 85  ? 12.044  -5.182  -12.301 1.00 0.00 ? 85  ARG A HH22 5  
ATOM 8516  N N    . THR A 1 86  ? 5.428   -3.272  -10.723 1.00 0.00 ? 86  THR A N    5  
ATOM 8517  C CA   . THR A 1 86  ? 4.279   -4.162  -10.607 1.00 0.00 ? 86  THR A CA   5  
ATOM 8518  C C    . THR A 1 86  ? 4.572   -5.315  -9.654  1.00 0.00 ? 86  THR A C    5  
ATOM 8519  O O    . THR A 1 86  ? 5.293   -6.251  -10.000 1.00 0.00 ? 86  THR A O    5  
ATOM 8520  C CB   . THR A 1 86  ? 3.872   -4.734  -11.978 1.00 0.00 ? 86  THR A CB   5  
ATOM 8521  O OG1  . THR A 1 86  ? 3.950   -3.712  -12.978 1.00 0.00 ? 86  THR A OG1  5  
ATOM 8522  C CG2  . THR A 1 86  ? 2.459   -5.297  -11.931 1.00 0.00 ? 86  THR A CG2  5  
ATOM 8523  H H    . THR A 1 86  ? 6.253   -3.605  -11.132 1.00 0.00 ? 86  THR A H    5  
ATOM 8524  H HA   . THR A 1 86  ? 3.450   -3.588  -10.219 1.00 0.00 ? 86  THR A HA   5  
ATOM 8525  H HB   . THR A 1 86  ? 4.553   -5.532  -12.235 1.00 0.00 ? 86  THR A HB   5  
ATOM 8526  H HG1  . THR A 1 86  ? 4.849   -3.660  -13.313 1.00 0.00 ? 86  THR A HG1  5  
ATOM 8527  H HG21 . THR A 1 86  ? 2.297   -5.784  -10.981 1.00 0.00 ? 86  THR A HG21 5  
ATOM 8528  H HG22 . THR A 1 86  ? 2.330   -6.012  -12.730 1.00 0.00 ? 86  THR A HG22 5  
ATOM 8529  H HG23 . THR A 1 86  ? 1.748   -4.493  -12.048 1.00 0.00 ? 86  THR A HG23 5  
ATOM 8530  N N    . TYR A 1 87  ? 4.008   -5.242  -8.454  1.00 0.00 ? 87  TYR A N    5  
ATOM 8531  C CA   . TYR A 1 87  ? 4.210   -6.280  -7.450  1.00 0.00 ? 87  TYR A CA   5  
ATOM 8532  C C    . TYR A 1 87  ? 3.090   -7.315  -7.503  1.00 0.00 ? 87  TYR A C    5  
ATOM 8533  O O    . TYR A 1 87  ? 1.914   -6.968  -7.618  1.00 0.00 ? 87  TYR A O    5  
ATOM 8534  C CB   . TYR A 1 87  ? 4.281   -5.661  -6.053  1.00 0.00 ? 87  TYR A CB   5  
ATOM 8535  C CG   . TYR A 1 87  ? 5.430   -4.693  -5.878  1.00 0.00 ? 87  TYR A CG   5  
ATOM 8536  C CD1  . TYR A 1 87  ? 5.314   -3.368  -6.279  1.00 0.00 ? 87  TYR A CD1  5  
ATOM 8537  C CD2  . TYR A 1 87  ? 6.631   -5.104  -5.313  1.00 0.00 ? 87  TYR A CD2  5  
ATOM 8538  C CE1  . TYR A 1 87  ? 6.361   -2.480  -6.121  1.00 0.00 ? 87  TYR A CE1  5  
ATOM 8539  C CE2  . TYR A 1 87  ? 7.682   -4.223  -5.150  1.00 0.00 ? 87  TYR A CE2  5  
ATOM 8540  C CZ   . TYR A 1 87  ? 7.542   -2.912  -5.556  1.00 0.00 ? 87  TYR A CZ   5  
ATOM 8541  O OH   . TYR A 1 87  ? 8.588   -2.032  -5.397  1.00 0.00 ? 87  TYR A OH   5  
ATOM 8542  H H    . TYR A 1 87  ? 3.443   -4.471  -8.237  1.00 0.00 ? 87  TYR A H    5  
ATOM 8543  H HA   . TYR A 1 87  ? 5.148   -6.770  -7.664  1.00 0.00 ? 87  TYR A HA   5  
ATOM 8544  H HB2  . TYR A 1 87  ? 3.365   -5.126  -5.856  1.00 0.00 ? 87  TYR A HB2  5  
ATOM 8545  H HB3  . TYR A 1 87  ? 4.397   -6.449  -5.323  1.00 0.00 ? 87  TYR A HB3  5  
ATOM 8546  H HD1  . TYR A 1 87  ? 4.387   -3.032  -6.721  1.00 0.00 ? 87  TYR A HD1  5  
ATOM 8547  H HD2  . TYR A 1 87  ? 6.737   -6.132  -4.997  1.00 0.00 ? 87  TYR A HD2  5  
ATOM 8548  H HE1  . TYR A 1 87  ? 6.252   -1.453  -6.438  1.00 0.00 ? 87  TYR A HE1  5  
ATOM 8549  H HE2  . TYR A 1 87  ? 8.608   -4.561  -4.708  1.00 0.00 ? 87  TYR A HE2  5  
ATOM 8550  H HH   . TYR A 1 87  ? 9.408   -2.522  -5.306  1.00 0.00 ? 87  TYR A HH   5  
ATOM 8551  N N    . PHE A 1 88  ? 3.464   -8.587  -7.418  1.00 0.00 ? 88  PHE A N    5  
ATOM 8552  C CA   . PHE A 1 88  ? 2.493   -9.674  -7.457  1.00 0.00 ? 88  PHE A CA   5  
ATOM 8553  C C    . PHE A 1 88  ? 2.428   -10.394 -6.113  1.00 0.00 ? 88  PHE A C    5  
ATOM 8554  O O    . PHE A 1 88  ? 3.457   -10.697 -5.509  1.00 0.00 ? 88  PHE A O    5  
ATOM 8555  C CB   . PHE A 1 88  ? 2.851   -10.667 -8.564  1.00 0.00 ? 88  PHE A CB   5  
ATOM 8556  C CG   . PHE A 1 88  ? 2.570   -10.151 -9.946  1.00 0.00 ? 88  PHE A CG   5  
ATOM 8557  C CD1  . PHE A 1 88  ? 1.273   -10.102 -10.432 1.00 0.00 ? 88  PHE A CD1  5  
ATOM 8558  C CD2  . PHE A 1 88  ? 3.603   -9.716  -10.760 1.00 0.00 ? 88  PHE A CD2  5  
ATOM 8559  C CE1  . PHE A 1 88  ? 1.011   -9.627  -11.703 1.00 0.00 ? 88  PHE A CE1  5  
ATOM 8560  C CE2  . PHE A 1 88  ? 3.347   -9.239  -12.032 1.00 0.00 ? 88  PHE A CE2  5  
ATOM 8561  C CZ   . PHE A 1 88  ? 2.050   -9.197  -12.505 1.00 0.00 ? 88  PHE A CZ   5  
ATOM 8562  H H    . PHE A 1 88  ? 4.417   -8.800  -7.328  1.00 0.00 ? 88  PHE A H    5  
ATOM 8563  H HA   . PHE A 1 88  ? 1.525   -9.245  -7.669  1.00 0.00 ? 88  PHE A HA   5  
ATOM 8564  H HB2  . PHE A 1 88  ? 3.904   -10.898 -8.504  1.00 0.00 ? 88  PHE A HB2  5  
ATOM 8565  H HB3  . PHE A 1 88  ? 2.279   -11.572 -8.424  1.00 0.00 ? 88  PHE A HB3  5  
ATOM 8566  H HD1  . PHE A 1 88  ? 0.459   -10.440 -9.805  1.00 0.00 ? 88  PHE A HD1  5  
ATOM 8567  H HD2  . PHE A 1 88  ? 4.618   -9.749  -10.393 1.00 0.00 ? 88  PHE A HD2  5  
ATOM 8568  H HE1  . PHE A 1 88  ? -0.004  -9.595  -12.069 1.00 0.00 ? 88  PHE A HE1  5  
ATOM 8569  H HE2  . PHE A 1 88  ? 4.161   -8.903  -12.658 1.00 0.00 ? 88  PHE A HE2  5  
ATOM 8570  H HZ   . PHE A 1 88  ? 1.847   -8.825  -13.498 1.00 0.00 ? 88  PHE A HZ   5  
ATOM 8571  N N    . PHE A 1 89  ? 1.212   -10.664 -5.651  1.00 0.00 ? 89  PHE A N    5  
ATOM 8572  C CA   . PHE A 1 89  ? 1.012   -11.347 -4.378  1.00 0.00 ? 89  PHE A CA   5  
ATOM 8573  C C    . PHE A 1 89  ? -0.113  -12.372 -4.482  1.00 0.00 ? 89  PHE A C    5  
ATOM 8574  O O    . PHE A 1 89  ? -1.240  -12.038 -4.846  1.00 0.00 ? 89  PHE A O    5  
ATOM 8575  C CB   . PHE A 1 89  ? 0.694   -10.334 -3.276  1.00 0.00 ? 89  PHE A CB   5  
ATOM 8576  C CG   . PHE A 1 89  ? 1.657   -9.182  -3.225  1.00 0.00 ? 89  PHE A CG   5  
ATOM 8577  C CD1  . PHE A 1 89  ? 2.960   -9.370  -2.792  1.00 0.00 ? 89  PHE A CD1  5  
ATOM 8578  C CD2  . PHE A 1 89  ? 1.260   -7.912  -3.609  1.00 0.00 ? 89  PHE A CD2  5  
ATOM 8579  C CE1  . PHE A 1 89  ? 3.848   -8.312  -2.743  1.00 0.00 ? 89  PHE A CE1  5  
ATOM 8580  C CE2  . PHE A 1 89  ? 2.143   -6.850  -3.563  1.00 0.00 ? 89  PHE A CE2  5  
ATOM 8581  C CZ   . PHE A 1 89  ? 3.439   -7.051  -3.130  1.00 0.00 ? 89  PHE A CZ   5  
ATOM 8582  H H    . PHE A 1 89  ? 0.430   -10.397 -6.178  1.00 0.00 ? 89  PHE A H    5  
ATOM 8583  H HA   . PHE A 1 89  ? 1.929   -11.860 -4.130  1.00 0.00 ? 89  PHE A HA   5  
ATOM 8584  H HB2  . PHE A 1 89  ? -0.294  -9.932  -3.440  1.00 0.00 ? 89  PHE A HB2  5  
ATOM 8585  H HB3  . PHE A 1 89  ? 0.721   -10.834 -2.319  1.00 0.00 ? 89  PHE A HB3  5  
ATOM 8586  H HD1  . PHE A 1 89  ? 3.282   -10.356 -2.490  1.00 0.00 ? 89  PHE A HD1  5  
ATOM 8587  H HD2  . PHE A 1 89  ? 0.245   -7.754  -3.948  1.00 0.00 ? 89  PHE A HD2  5  
ATOM 8588  H HE1  . PHE A 1 89  ? 4.861   -8.472  -2.405  1.00 0.00 ? 89  PHE A HE1  5  
ATOM 8589  H HE2  . PHE A 1 89  ? 1.820   -5.865  -3.866  1.00 0.00 ? 89  PHE A HE2  5  
ATOM 8590  H HZ   . PHE A 1 89  ? 4.131   -6.222  -3.092  1.00 0.00 ? 89  PHE A HZ   5  
ATOM 8591  N N    . SER A 1 90  ? 0.202   -13.622 -4.159  1.00 0.00 ? 90  SER A N    5  
ATOM 8592  C CA   . SER A 1 90  ? -0.780  -14.698 -4.219  1.00 0.00 ? 90  SER A CA   5  
ATOM 8593  C C    . SER A 1 90  ? -1.240  -15.094 -2.819  1.00 0.00 ? 90  SER A C    5  
ATOM 8594  O O    . SER A 1 90  ? -0.431  -15.471 -1.972  1.00 0.00 ? 90  SER A O    5  
ATOM 8595  C CB   . SER A 1 90  ? -0.192  -15.914 -4.938  1.00 0.00 ? 90  SER A CB   5  
ATOM 8596  O OG   . SER A 1 90  ? -1.130  -16.975 -4.996  1.00 0.00 ? 90  SER A OG   5  
ATOM 8597  H H    . SER A 1 90  ? 1.118   -13.826 -3.875  1.00 0.00 ? 90  SER A H    5  
ATOM 8598  H HA   . SER A 1 90  ? -1.632  -14.339 -4.777  1.00 0.00 ? 90  SER A HA   5  
ATOM 8599  H HB2  . SER A 1 90  ? 0.082   -15.637 -5.944  1.00 0.00 ? 90  SER A HB2  5  
ATOM 8600  H HB3  . SER A 1 90  ? 0.685   -16.254 -4.406  1.00 0.00 ? 90  SER A HB3  5  
ATOM 8601  H HG   . SER A 1 90  ? -1.954  -16.697 -4.589  1.00 0.00 ? 90  SER A HG   5  
ATOM 8602  N N    . ALA A 1 91  ? -2.545  -15.004 -2.585  1.00 0.00 ? 91  ALA A N    5  
ATOM 8603  C CA   . ALA A 1 91  ? -3.114  -15.354 -1.289  1.00 0.00 ? 91  ALA A CA   5  
ATOM 8604  C C    . ALA A 1 91  ? -3.563  -16.811 -1.262  1.00 0.00 ? 91  ALA A C    5  
ATOM 8605  O O    . ALA A 1 91  ? -4.224  -17.283 -2.187  1.00 0.00 ? 91  ALA A O    5  
ATOM 8606  C CB   . ALA A 1 91  ? -4.280  -14.434 -0.959  1.00 0.00 ? 91  ALA A CB   5  
ATOM 8607  H H    . ALA A 1 91  ? -3.139  -14.697 -3.301  1.00 0.00 ? 91  ALA A H    5  
ATOM 8608  H HA   . ALA A 1 91  ? -2.350  -15.210 -0.539  1.00 0.00 ? 91  ALA A HA   5  
ATOM 8609  H HB1  . ALA A 1 91  ? -3.903  -13.454 -0.706  1.00 0.00 ? 91  ALA A HB1  5  
ATOM 8610  H HB2  . ALA A 1 91  ? -4.933  -14.360 -1.816  1.00 0.00 ? 91  ALA A HB2  5  
ATOM 8611  H HB3  . ALA A 1 91  ? -4.829  -14.836 -0.121  1.00 0.00 ? 91  ALA A HB3  5  
ATOM 8612  N N    . GLU A 1 92  ? -3.199  -17.518 -0.197  1.00 0.00 ? 92  GLU A N    5  
ATOM 8613  C CA   . GLU A 1 92  ? -3.565  -18.923 -0.052  1.00 0.00 ? 92  GLU A CA   5  
ATOM 8614  C C    . GLU A 1 92  ? -5.072  -19.110 -0.194  1.00 0.00 ? 92  GLU A C    5  
ATOM 8615  O O    . GLU A 1 92  ? -5.533  -20.030 -0.870  1.00 0.00 ? 92  GLU A O    5  
ATOM 8616  C CB   . GLU A 1 92  ? -3.099  -19.456 1.304   1.00 0.00 ? 92  GLU A CB   5  
ATOM 8617  C CG   . GLU A 1 92  ? -1.604  -19.311 1.535   1.00 0.00 ? 92  GLU A CG   5  
ATOM 8618  C CD   . GLU A 1 92  ? -1.086  -20.246 2.611   1.00 0.00 ? 92  GLU A CD   5  
ATOM 8619  O OE1  . GLU A 1 92  ? -1.647  -21.352 2.757   1.00 0.00 ? 92  GLU A OE1  5  
ATOM 8620  O OE2  . GLU A 1 92  ? -0.120  -19.871 3.307   1.00 0.00 ? 92  GLU A OE2  5  
ATOM 8621  H H    . GLU A 1 92  ? -2.673  -17.086 0.507   1.00 0.00 ? 92  GLU A H    5  
ATOM 8622  H HA   . GLU A 1 92  ? -3.070  -19.477 -0.835  1.00 0.00 ? 92  GLU A HA   5  
ATOM 8623  H HB2  . GLU A 1 92  ? -3.617  -18.920 2.086   1.00 0.00 ? 92  GLU A HB2  5  
ATOM 8624  H HB3  . GLU A 1 92  ? -3.352  -20.504 1.371   1.00 0.00 ? 92  GLU A HB3  5  
ATOM 8625  H HG2  . GLU A 1 92  ? -1.088  -19.529 0.612   1.00 0.00 ? 92  GLU A HG2  5  
ATOM 8626  H HG3  . GLU A 1 92  ? -1.396  -18.294 1.832   1.00 0.00 ? 92  GLU A HG3  5  
ATOM 8627  N N    . SER A 1 93  ? -5.835  -18.232 0.448   1.00 0.00 ? 93  SER A N    5  
ATOM 8628  C CA   . SER A 1 93  ? -7.291  -18.303 0.398   1.00 0.00 ? 93  SER A CA   5  
ATOM 8629  C C    . SER A 1 93  ? -7.862  -17.154 -0.429  1.00 0.00 ? 93  SER A C    5  
ATOM 8630  O O    . SER A 1 93  ? -7.285  -16.070 -0.515  1.00 0.00 ? 93  SER A O    5  
ATOM 8631  C CB   . SER A 1 93  ? -7.874  -18.267 1.812   1.00 0.00 ? 93  SER A CB   5  
ATOM 8632  O OG   . SER A 1 93  ? -7.467  -19.400 2.559   1.00 0.00 ? 93  SER A OG   5  
ATOM 8633  H H    . SER A 1 93  ? -5.409  -17.521 0.971   1.00 0.00 ? 93  SER A H    5  
ATOM 8634  H HA   . SER A 1 93  ? -7.561  -19.237 -0.071  1.00 0.00 ? 93  SER A HA   5  
ATOM 8635  H HB2  . SER A 1 93  ? -7.533  -17.376 2.317   1.00 0.00 ? 93  SER A HB2  5  
ATOM 8636  H HB3  . SER A 1 93  ? -8.953  -18.258 1.753   1.00 0.00 ? 93  SER A HB3  5  
ATOM 8637  H HG   . SER A 1 93  ? -6.560  -19.283 2.851   1.00 0.00 ? 93  SER A HG   5  
ATOM 8638  N N    . PRO A 1 94  ? -9.025  -17.397 -1.053  1.00 0.00 ? 94  PRO A N    5  
ATOM 8639  C CA   . PRO A 1 94  ? -9.701  -16.396 -1.883  1.00 0.00 ? 94  PRO A CA   5  
ATOM 8640  C C    . PRO A 1 94  ? -10.270 -15.247 -1.059  1.00 0.00 ? 94  PRO A C    5  
ATOM 8641  O O    . PRO A 1 94  ? -10.433 -14.134 -1.558  1.00 0.00 ? 94  PRO A O    5  
ATOM 8642  C CB   . PRO A 1 94  ? -10.830 -17.189 -2.546  1.00 0.00 ? 94  PRO A CB   5  
ATOM 8643  C CG   . PRO A 1 94  ? -11.095 -18.321 -1.614  1.00 0.00 ? 94  PRO A CG   5  
ATOM 8644  C CD   . PRO A 1 94  ? -9.769  -18.666 -0.994  1.00 0.00 ? 94  PRO A CD   5  
ATOM 8645  H HA   . PRO A 1 94  ? -9.042  -16.001 -2.643  1.00 0.00 ? 94  PRO A HA   5  
ATOM 8646  H HB2  . PRO A 1 94  ? -11.700 -16.557 -2.658  1.00 0.00 ? 94  PRO A HB2  5  
ATOM 8647  H HB3  . PRO A 1 94  ? -10.507 -17.542 -3.514  1.00 0.00 ? 94  PRO A HB3  5  
ATOM 8648  H HG2  . PRO A 1 94  ? -11.796 -18.014 -0.854  1.00 0.00 ? 94  PRO A HG2  5  
ATOM 8649  H HG3  . PRO A 1 94  ? -11.481 -19.166 -2.165  1.00 0.00 ? 94  PRO A HG3  5  
ATOM 8650  H HD2  . PRO A 1 94  ? -9.903  -18.988 0.028   1.00 0.00 ? 94  PRO A HD2  5  
ATOM 8651  H HD3  . PRO A 1 94  ? -9.270  -19.431 -1.571  1.00 0.00 ? 94  PRO A HD3  5  
ATOM 8652  N N    . GLU A 1 95  ? -10.569 -15.524 0.207   1.00 0.00 ? 95  GLU A N    5  
ATOM 8653  C CA   . GLU A 1 95  ? -11.121 -14.511 1.100   1.00 0.00 ? 95  GLU A CA   5  
ATOM 8654  C C    . GLU A 1 95  ? -10.075 -13.450 1.431   1.00 0.00 ? 95  GLU A C    5  
ATOM 8655  O O    . GLU A 1 95  ? -10.406 -12.286 1.652   1.00 0.00 ? 95  GLU A O    5  
ATOM 8656  C CB   . GLU A 1 95  ? -11.631 -15.160 2.388   1.00 0.00 ? 95  GLU A CB   5  
ATOM 8657  C CG   . GLU A 1 95  ? -10.571 -15.956 3.131   1.00 0.00 ? 95  GLU A CG   5  
ATOM 8658  C CD   . GLU A 1 95  ? -11.017 -16.366 4.521   1.00 0.00 ? 95  GLU A CD   5  
ATOM 8659  O OE1  . GLU A 1 95  ? -11.519 -15.497 5.264   1.00 0.00 ? 95  GLU A OE1  5  
ATOM 8660  O OE2  . GLU A 1 95  ? -10.864 -17.557 4.865   1.00 0.00 ? 95  GLU A OE2  5  
ATOM 8661  H H    . GLU A 1 95  ? -10.416 -16.430 0.547   1.00 0.00 ? 95  GLU A H    5  
ATOM 8662  H HA   . GLU A 1 95  ? -11.948 -14.038 0.594   1.00 0.00 ? 95  GLU A HA   5  
ATOM 8663  H HB2  . GLU A 1 95  ? -11.998 -14.385 3.046   1.00 0.00 ? 95  GLU A HB2  5  
ATOM 8664  H HB3  . GLU A 1 95  ? -12.446 -15.826 2.143   1.00 0.00 ? 95  GLU A HB3  5  
ATOM 8665  H HG2  . GLU A 1 95  ? -10.346 -16.847 2.564   1.00 0.00 ? 95  GLU A HG2  5  
ATOM 8666  H HG3  . GLU A 1 95  ? -9.681  -15.351 3.218   1.00 0.00 ? 95  GLU A HG3  5  
ATOM 8667  N N    . GLU A 1 96  ? -8.812  -13.863 1.464   1.00 0.00 ? 96  GLU A N    5  
ATOM 8668  C CA   . GLU A 1 96  ? -7.718  -12.948 1.770   1.00 0.00 ? 96  GLU A CA   5  
ATOM 8669  C C    . GLU A 1 96  ? -7.399  -12.061 0.570   1.00 0.00 ? 96  GLU A C    5  
ATOM 8670  O O    . GLU A 1 96  ? -7.277  -10.844 0.702   1.00 0.00 ? 96  GLU A O    5  
ATOM 8671  C CB   . GLU A 1 96  ? -6.471  -13.731 2.186   1.00 0.00 ? 96  GLU A CB   5  
ATOM 8672  C CG   . GLU A 1 96  ? -6.422  -14.055 3.669   1.00 0.00 ? 96  GLU A CG   5  
ATOM 8673  C CD   . GLU A 1 96  ? -5.440  -15.165 3.992   1.00 0.00 ? 96  GLU A CD   5  
ATOM 8674  O OE1  . GLU A 1 96  ? -5.639  -16.296 3.500   1.00 0.00 ? 96  GLU A OE1  5  
ATOM 8675  O OE2  . GLU A 1 96  ? -4.473  -14.903 4.737   1.00 0.00 ? 96  GLU A OE2  5  
ATOM 8676  H H    . GLU A 1 96  ? -8.611  -14.804 1.279   1.00 0.00 ? 96  GLU A H    5  
ATOM 8677  H HA   . GLU A 1 96  ? -8.029  -12.322 2.593   1.00 0.00 ? 96  GLU A HA   5  
ATOM 8678  H HB2  . GLU A 1 96  ? -6.442  -14.659 1.634   1.00 0.00 ? 96  GLU A HB2  5  
ATOM 8679  H HB3  . GLU A 1 96  ? -5.596  -13.148 1.938   1.00 0.00 ? 96  GLU A HB3  5  
ATOM 8680  H HG2  . GLU A 1 96  ? -6.128  -13.168 4.210   1.00 0.00 ? 96  GLU A HG2  5  
ATOM 8681  H HG3  . GLU A 1 96  ? -7.407  -14.361 3.991   1.00 0.00 ? 96  GLU A HG3  5  
ATOM 8682  N N    . GLN A 1 97  ? -7.265  -12.681 -0.598  1.00 0.00 ? 97  GLN A N    5  
ATOM 8683  C CA   . GLN A 1 97  ? -6.959  -11.948 -1.820  1.00 0.00 ? 97  GLN A CA   5  
ATOM 8684  C C    . GLN A 1 97  ? -7.803  -10.682 -1.922  1.00 0.00 ? 97  GLN A C    5  
ATOM 8685  O O    . GLN A 1 97  ? -7.270  -9.577  -2.023  1.00 0.00 ? 97  GLN A O    5  
ATOM 8686  C CB   . GLN A 1 97  ? -7.198  -12.834 -3.044  1.00 0.00 ? 97  GLN A CB   5  
ATOM 8687  C CG   . GLN A 1 97  ? -7.104  -12.086 -4.364  1.00 0.00 ? 97  GLN A CG   5  
ATOM 8688  C CD   . GLN A 1 97  ? -7.975  -12.697 -5.445  1.00 0.00 ? 97  GLN A CD   5  
ATOM 8689  O OE1  . GLN A 1 97  ? -8.907  -13.448 -5.156  1.00 0.00 ? 97  GLN A OE1  5  
ATOM 8690  N NE2  . GLN A 1 97  ? -7.674  -12.378 -6.698  1.00 0.00 ? 97  GLN A NE2  5  
ATOM 8691  H H    . GLN A 1 97  ? -7.374  -13.654 -0.638  1.00 0.00 ? 97  GLN A H    5  
ATOM 8692  H HA   . GLN A 1 97  ? -5.916  -11.670 -1.787  1.00 0.00 ? 97  GLN A HA   5  
ATOM 8693  H HB2  . GLN A 1 97  ? -6.463  -13.625 -3.050  1.00 0.00 ? 97  GLN A HB2  5  
ATOM 8694  H HB3  . GLN A 1 97  ? -8.184  -13.269 -2.972  1.00 0.00 ? 97  GLN A HB3  5  
ATOM 8695  H HG2  . GLN A 1 97  ? -7.417  -11.064 -4.207  1.00 0.00 ? 97  GLN A HG2  5  
ATOM 8696  H HG3  . GLN A 1 97  ? -6.077  -12.100 -4.699  1.00 0.00 ? 97  GLN A HG3  5  
ATOM 8697  H HE21 . GLN A 1 97  ? -6.917  -11.775 -6.853  1.00 0.00 ? 97  GLN A HE21 5  
ATOM 8698  H HE22 . GLN A 1 97  ? -8.220  -12.759 -7.416  1.00 0.00 ? 97  GLN A HE22 5  
ATOM 8699  N N    . GLU A 1 98  ? -9.121  -10.851 -1.894  1.00 0.00 ? 98  GLU A N    5  
ATOM 8700  C CA   . GLU A 1 98  ? -10.038 -9.721  -1.984  1.00 0.00 ? 98  GLU A CA   5  
ATOM 8701  C C    . GLU A 1 98  ? -9.783  -8.723  -0.858  1.00 0.00 ? 98  GLU A C    5  
ATOM 8702  O O    . GLU A 1 98  ? -9.606  -7.529  -1.100  1.00 0.00 ? 98  GLU A O    5  
ATOM 8703  C CB   . GLU A 1 98  ? -11.488 -10.206 -1.932  1.00 0.00 ? 98  GLU A CB   5  
ATOM 8704  C CG   . GLU A 1 98  ? -11.863 -11.126 -3.081  1.00 0.00 ? 98  GLU A CG   5  
ATOM 8705  C CD   . GLU A 1 98  ? -13.055 -12.007 -2.759  1.00 0.00 ? 98  GLU A CD   5  
ATOM 8706  O OE1  . GLU A 1 98  ? -12.945 -12.835 -1.830  1.00 0.00 ? 98  GLU A OE1  5  
ATOM 8707  O OE2  . GLU A 1 98  ? -14.096 -11.869 -3.434  1.00 0.00 ? 98  GLU A OE2  5  
ATOM 8708  H H    . GLU A 1 98  ? -9.485  -11.757 -1.812  1.00 0.00 ? 98  GLU A H    5  
ATOM 8709  H HA   . GLU A 1 98  ? -9.866  -9.229  -2.930  1.00 0.00 ? 98  GLU A HA   5  
ATOM 8710  H HB2  . GLU A 1 98  ? -11.644 -10.739 -1.006  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 8711  H HB3  . GLU A 1 98  ? -12.143 -9.348  -1.958  1.00 0.00 ? 98  GLU A HB3  5  
ATOM 8712  H HG2  . GLU A 1 98  ? -12.104 -10.524 -3.945  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 8713  H HG3  . GLU A 1 98  ? -11.018 -11.759 -3.310  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 8714  N N    . ALA A 1 99  ? -9.767  -9.221  0.374   1.00 0.00 ? 99  ALA A N    5  
ATOM 8715  C CA   . ALA A 1 99  ? -9.533  -8.375  1.537   1.00 0.00 ? 99  ALA A CA   5  
ATOM 8716  C C    . ALA A 1 99  ? -8.333  -7.460  1.318   1.00 0.00 ? 99  ALA A C    5  
ATOM 8717  O O    . ALA A 1 99  ? -8.410  -6.254  1.552   1.00 0.00 ? 99  ALA A O    5  
ATOM 8718  C CB   . ALA A 1 99  ? -9.327  -9.230  2.779   1.00 0.00 ? 99  ALA A CB   5  
ATOM 8719  H H    . ALA A 1 99  ? -9.914  -10.181 0.503   1.00 0.00 ? 99  ALA A H    5  
ATOM 8720  H HA   . ALA A 1 99  ? -10.413 -7.767  1.691   1.00 0.00 ? 99  ALA A HA   5  
ATOM 8721  H HB1  . ALA A 1 99  ? -10.175 -9.115  3.439   1.00 0.00 ? 99  ALA A HB1  5  
ATOM 8722  H HB2  . ALA A 1 99  ? -9.233  -10.266 2.491   1.00 0.00 ? 99  ALA A HB2  5  
ATOM 8723  H HB3  . ALA A 1 99  ? -8.429  -8.914  3.288   1.00 0.00 ? 99  ALA A HB3  5  
ATOM 8724  N N    . TRP A 1 100 ? -7.226  -8.041  0.870   1.00 0.00 ? 100 TRP A N    5  
ATOM 8725  C CA   . TRP A 1 100 ? -6.009  -7.276  0.620   1.00 0.00 ? 100 TRP A CA   5  
ATOM 8726  C C    . TRP A 1 100 ? -6.258  -6.176  -0.405  1.00 0.00 ? 100 TRP A C    5  
ATOM 8727  O O    . TRP A 1 100 ? -6.079  -4.993  -0.116  1.00 0.00 ? 100 TRP A O    5  
ATOM 8728  C CB   . TRP A 1 100 ? -4.892  -8.201  0.134   1.00 0.00 ? 100 TRP A CB   5  
ATOM 8729  C CG   . TRP A 1 100 ? -4.160  -8.885  1.248   1.00 0.00 ? 100 TRP A CG   5  
ATOM 8730  C CD1  . TRP A 1 100 ? -4.367  -10.155 1.707   1.00 0.00 ? 100 TRP A CD1  5  
ATOM 8731  C CD2  . TRP A 1 100 ? -3.105  -8.336  2.045   1.00 0.00 ? 100 TRP A CD2  5  
ATOM 8732  N NE1  . TRP A 1 100 ? -3.504  -10.428 2.741   1.00 0.00 ? 100 TRP A NE1  5  
ATOM 8733  C CE2  . TRP A 1 100 ? -2.719  -9.328  2.967   1.00 0.00 ? 100 TRP A CE2  5  
ATOM 8734  C CE3  . TRP A 1 100 ? -2.448  -7.103  2.068   1.00 0.00 ? 100 TRP A CE3  5  
ATOM 8735  C CZ2  . TRP A 1 100 ? -1.706  -9.123  3.900   1.00 0.00 ? 100 TRP A CZ2  5  
ATOM 8736  C CZ3  . TRP A 1 100 ? -1.443  -6.900  2.995   1.00 0.00 ? 100 TRP A CZ3  5  
ATOM 8737  C CH2  . TRP A 1 100 ? -1.080  -7.906  3.900   1.00 0.00 ? 100 TRP A CH2  5  
ATOM 8738  H H    . TRP A 1 100 ? -7.227  -9.007  0.703   1.00 0.00 ? 100 TRP A H    5  
ATOM 8739  H HA   . TRP A 1 100 ? -5.708  -6.822  1.552   1.00 0.00 ? 100 TRP A HA   5  
ATOM 8740  H HB2  . TRP A 1 100 ? -5.316  -8.963  -0.504  1.00 0.00 ? 100 TRP A HB2  5  
ATOM 8741  H HB3  . TRP A 1 100 ? -4.176  -7.622  -0.431  1.00 0.00 ? 100 TRP A HB3  5  
ATOM 8742  H HD1  . TRP A 1 100 ? -5.105  -10.833 1.307   1.00 0.00 ? 100 TRP A HD1  5  
ATOM 8743  H HE1  . TRP A 1 100 ? -3.457  -11.273 3.235   1.00 0.00 ? 100 TRP A HE1  5  
ATOM 8744  H HE3  . TRP A 1 100 ? -2.713  -6.315  1.378   1.00 0.00 ? 100 TRP A HE3  5  
ATOM 8745  H HZ2  . TRP A 1 100 ? -1.414  -9.888  4.604   1.00 0.00 ? 100 TRP A HZ2  5  
ATOM 8746  H HZ3  . TRP A 1 100 ? -0.924  -5.954  3.028   1.00 0.00 ? 100 TRP A HZ3  5  
ATOM 8747  H HH2  . TRP A 1 100 ? -0.290  -7.704  4.607   1.00 0.00 ? 100 TRP A HH2  5  
ATOM 8748  N N    . ILE A 1 101 ? -6.672  -6.574  -1.604  1.00 0.00 ? 101 ILE A N    5  
ATOM 8749  C CA   . ILE A 1 101 ? -6.947  -5.620  -2.672  1.00 0.00 ? 101 ILE A CA   5  
ATOM 8750  C C    . ILE A 1 101 ? -7.579  -4.346  -2.121  1.00 0.00 ? 101 ILE A C    5  
ATOM 8751  O O    . ILE A 1 101 ? -7.316  -3.249  -2.614  1.00 0.00 ? 101 ILE A O    5  
ATOM 8752  C CB   . ILE A 1 101 ? -7.879  -6.223  -3.739  1.00 0.00 ? 101 ILE A CB   5  
ATOM 8753  C CG1  . ILE A 1 101 ? -7.169  -7.352  -4.489  1.00 0.00 ? 101 ILE A CG1  5  
ATOM 8754  C CG2  . ILE A 1 101 ? -8.342  -5.145  -4.708  1.00 0.00 ? 101 ILE A CG2  5  
ATOM 8755  C CD1  . ILE A 1 101 ? -8.085  -8.146  -5.393  1.00 0.00 ? 101 ILE A CD1  5  
ATOM 8756  H H    . ILE A 1 101 ? -6.797  -7.530  -1.774  1.00 0.00 ? 101 ILE A H    5  
ATOM 8757  H HA   . ILE A 1 101 ? -6.008  -5.369  -3.143  1.00 0.00 ? 101 ILE A HA   5  
ATOM 8758  H HB   . ILE A 1 101 ? -8.749  -6.623  -3.241  1.00 0.00 ? 101 ILE A HB   5  
ATOM 8759  H HG12 . ILE A 1 101 ? -6.384  -6.932  -5.099  1.00 0.00 ? 101 ILE A HG12 5  
ATOM 8760  H HG13 . ILE A 1 101 ? -6.736  -8.034  -3.771  1.00 0.00 ? 101 ILE A HG13 5  
ATOM 8761  H HG21 . ILE A 1 101 ? -7.550  -4.424  -4.849  1.00 0.00 ? 101 ILE A HG21 5  
ATOM 8762  H HG22 . ILE A 1 101 ? -8.590  -5.597  -5.656  1.00 0.00 ? 101 ILE A HG22 5  
ATOM 8763  H HG23 . ILE A 1 101 ? -9.213  -4.649  -4.306  1.00 0.00 ? 101 ILE A HG23 5  
ATOM 8764  H HD11 . ILE A 1 101 ? -9.111  -7.987  -5.097  1.00 0.00 ? 101 ILE A HD11 5  
ATOM 8765  H HD12 . ILE A 1 101 ? -7.950  -7.825  -6.415  1.00 0.00 ? 101 ILE A HD12 5  
ATOM 8766  H HD13 . ILE A 1 101 ? -7.847  -9.197  -5.312  1.00 0.00 ? 101 ILE A HD13 5  
ATOM 8767  N N    . GLN A 1 102 ? -8.412  -4.500  -1.097  1.00 0.00 ? 102 GLN A N    5  
ATOM 8768  C CA   . GLN A 1 102 ? -9.081  -3.361  -0.479  1.00 0.00 ? 102 GLN A CA   5  
ATOM 8769  C C    . GLN A 1 102 ? -8.208  -2.741  0.607   1.00 0.00 ? 102 GLN A C    5  
ATOM 8770  O O    . GLN A 1 102 ? -8.012  -1.527  0.641   1.00 0.00 ? 102 GLN A O    5  
ATOM 8771  C CB   . GLN A 1 102 ? -10.424 -3.791  0.113   1.00 0.00 ? 102 GLN A CB   5  
ATOM 8772  C CG   . GLN A 1 102 ? -11.421 -4.272  -0.929  1.00 0.00 ? 102 GLN A CG   5  
ATOM 8773  C CD   . GLN A 1 102 ? -12.284 -3.151  -1.473  1.00 0.00 ? 102 GLN A CD   5  
ATOM 8774  O OE1  . GLN A 1 102 ? -11.972 -1.972  -1.301  1.00 0.00 ? 102 GLN A OE1  5  
ATOM 8775  N NE2  . GLN A 1 102 ? -13.377 -3.513  -2.135  1.00 0.00 ? 102 GLN A NE2  5  
ATOM 8776  H H    . GLN A 1 102 ? -8.581  -5.400  -0.749  1.00 0.00 ? 102 GLN A H    5  
ATOM 8777  H HA   . GLN A 1 102 ? -9.256  -2.623  -1.247  1.00 0.00 ? 102 GLN A HA   5  
ATOM 8778  H HB2  . GLN A 1 102 ? -10.254 -4.593  0.815   1.00 0.00 ? 102 GLN A HB2  5  
ATOM 8779  H HB3  . GLN A 1 102 ? -10.859 -2.951  0.635   1.00 0.00 ? 102 GLN A HB3  5  
ATOM 8780  H HG2  . GLN A 1 102 ? -10.879 -4.718  -1.749  1.00 0.00 ? 102 GLN A HG2  5  
ATOM 8781  H HG3  . GLN A 1 102 ? -12.063 -5.015  -0.477  1.00 0.00 ? 102 GLN A HG3  5  
ATOM 8782  H HE21 . GLN A 1 102 ? -13.563 -4.470  -2.232  1.00 0.00 ? 102 GLN A HE21 5  
ATOM 8783  H HE22 . GLN A 1 102 ? -13.954 -2.809  -2.496  1.00 0.00 ? 102 GLN A HE22 5  
ATOM 8784  N N    . ALA A 1 103 ? -7.687  -3.583  1.493   1.00 0.00 ? 103 ALA A N    5  
ATOM 8785  C CA   . ALA A 1 103 ? -6.835  -3.118  2.580   1.00 0.00 ? 103 ALA A CA   5  
ATOM 8786  C C    . ALA A 1 103 ? -5.668  -2.293  2.048   1.00 0.00 ? 103 ALA A C    5  
ATOM 8787  O O    . ALA A 1 103 ? -5.480  -1.142  2.441   1.00 0.00 ? 103 ALA A O    5  
ATOM 8788  C CB   . ALA A 1 103 ? -6.321  -4.299  3.391   1.00 0.00 ? 103 ALA A CB   5  
ATOM 8789  H H    . ALA A 1 103 ? -7.880  -4.541  1.414   1.00 0.00 ? 103 ALA A H    5  
ATOM 8790  H HA   . ALA A 1 103 ? -7.433  -2.499  3.233   1.00 0.00 ? 103 ALA A HA   5  
ATOM 8791  H HB1  . ALA A 1 103 ? -5.290  -4.490  3.132   1.00 0.00 ? 103 ALA A HB1  5  
ATOM 8792  H HB2  . ALA A 1 103 ? -6.393  -4.071  4.444   1.00 0.00 ? 103 ALA A HB2  5  
ATOM 8793  H HB3  . ALA A 1 103 ? -6.916  -5.173  3.169   1.00 0.00 ? 103 ALA A HB3  5  
ATOM 8794  N N    . MET A 1 104 ? -4.888  -2.888  1.152   1.00 0.00 ? 104 MET A N    5  
ATOM 8795  C CA   . MET A 1 104 ? -3.740  -2.206  0.565   1.00 0.00 ? 104 MET A CA   5  
ATOM 8796  C C    . MET A 1 104 ? -4.182  -1.239  -0.528  1.00 0.00 ? 104 MET A C    5  
ATOM 8797  O O    . MET A 1 104 ? -3.491  -0.266  -0.826  1.00 0.00 ? 104 MET A O    5  
ATOM 8798  C CB   . MET A 1 104 ? -2.753  -3.225  -0.007  1.00 0.00 ? 104 MET A CB   5  
ATOM 8799  C CG   . MET A 1 104 ? -3.259  -3.926  -1.257  1.00 0.00 ? 104 MET A CG   5  
ATOM 8800  S SD   . MET A 1 104 ? -1.933  -4.688  -2.211  1.00 0.00 ? 104 MET A SD   5  
ATOM 8801  C CE   . MET A 1 104 ? -1.162  -5.713  -0.961  1.00 0.00 ? 104 MET A CE   5  
ATOM 8802  H H    . MET A 1 104 ? -5.089  -3.807  0.877   1.00 0.00 ? 104 MET A H    5  
ATOM 8803  H HA   . MET A 1 104 ? -3.252  -1.646  1.349   1.00 0.00 ? 104 MET A HA   5  
ATOM 8804  H HB2  . MET A 1 104 ? -1.832  -2.717  -0.253  1.00 0.00 ? 104 MET A HB2  5  
ATOM 8805  H HB3  . MET A 1 104 ? -2.551  -3.975  0.743   1.00 0.00 ? 104 MET A HB3  5  
ATOM 8806  H HG2  . MET A 1 104 ? -3.959  -4.694  -0.964  1.00 0.00 ? 104 MET A HG2  5  
ATOM 8807  H HG3  . MET A 1 104 ? -3.762  -3.201  -1.880  1.00 0.00 ? 104 MET A HG3  5  
ATOM 8808  H HE1  . MET A 1 104 ? -1.859  -6.472  -0.637  1.00 0.00 ? 104 MET A HE1  5  
ATOM 8809  H HE2  . MET A 1 104 ? -0.282  -6.184  -1.374  1.00 0.00 ? 104 MET A HE2  5  
ATOM 8810  H HE3  . MET A 1 104 ? -0.879  -5.100  -0.117  1.00 0.00 ? 104 MET A HE3  5  
ATOM 8811  N N    . GLY A 1 105 ? -5.339  -1.514  -1.123  1.00 0.00 ? 105 GLY A N    5  
ATOM 8812  C CA   . GLY A 1 105 ? -5.853  -0.659  -2.177  1.00 0.00 ? 105 GLY A CA   5  
ATOM 8813  C C    . GLY A 1 105 ? -6.262  0.708   -1.667  1.00 0.00 ? 105 GLY A C    5  
ATOM 8814  O O    . GLY A 1 105 ? -5.986  1.723   -2.306  1.00 0.00 ? 105 GLY A O    5  
ATOM 8815  H H    . GLY A 1 105 ? -5.848  -2.304  -0.844  1.00 0.00 ? 105 GLY A H    5  
ATOM 8816  H HA2  . GLY A 1 105 ? -5.090  -0.538  -2.931  1.00 0.00 ? 105 GLY A HA2  5  
ATOM 8817  H HA3  . GLY A 1 105 ? -6.713  -1.136  -2.624  1.00 0.00 ? 105 GLY A HA3  5  
ATOM 8818  N N    . GLU A 1 106 ? -6.921  0.735   -0.513  1.00 0.00 ? 106 GLU A N    5  
ATOM 8819  C CA   . GLU A 1 106 ? -7.371  1.989   0.080   1.00 0.00 ? 106 GLU A CA   5  
ATOM 8820  C C    . GLU A 1 106 ? -6.190  2.918   0.347   1.00 0.00 ? 106 GLU A C    5  
ATOM 8821  O O    . GLU A 1 106 ? -6.259  4.119   0.085   1.00 0.00 ? 106 GLU A O    5  
ATOM 8822  C CB   . GLU A 1 106 ? -8.127  1.721   1.383   1.00 0.00 ? 106 GLU A CB   5  
ATOM 8823  C CG   . GLU A 1 106 ? -7.234  1.694   2.611   1.00 0.00 ? 106 GLU A CG   5  
ATOM 8824  C CD   . GLU A 1 106 ? -8.019  1.551   3.901   1.00 0.00 ? 106 GLU A CD   5  
ATOM 8825  O OE1  . GLU A 1 106 ? -9.050  2.240   4.046   1.00 0.00 ? 106 GLU A OE1  5  
ATOM 8826  O OE2  . GLU A 1 106 ? -7.602  0.752   4.764   1.00 0.00 ? 106 GLU A OE2  5  
ATOM 8827  H H    . GLU A 1 106 ? -7.111  -0.108  -0.051  1.00 0.00 ? 106 GLU A H    5  
ATOM 8828  H HA   . GLU A 1 106 ? -8.038  2.467   -0.621  1.00 0.00 ? 106 GLU A HA   5  
ATOM 8829  H HB2  . GLU A 1 106 ? -8.870  2.493   1.519   1.00 0.00 ? 106 GLU A HB2  5  
ATOM 8830  H HB3  . GLU A 1 106 ? -8.624  0.765   1.305   1.00 0.00 ? 106 GLU A HB3  5  
ATOM 8831  H HG2  . GLU A 1 106 ? -6.553  0.860   2.528   1.00 0.00 ? 106 GLU A HG2  5  
ATOM 8832  H HG3  . GLU A 1 106 ? -6.670  2.615   2.650   1.00 0.00 ? 106 GLU A HG3  5  
ATOM 8833  N N    . ALA A 1 107 ? -5.107  2.354   0.871   1.00 0.00 ? 107 ALA A N    5  
ATOM 8834  C CA   . ALA A 1 107 ? -3.911  3.130   1.173   1.00 0.00 ? 107 ALA A CA   5  
ATOM 8835  C C    . ALA A 1 107 ? -3.346  3.779   -0.086  1.00 0.00 ? 107 ALA A C    5  
ATOM 8836  O O    . ALA A 1 107 ? -2.729  4.842   -0.024  1.00 0.00 ? 107 ALA A O    5  
ATOM 8837  C CB   . ALA A 1 107 ? -2.860  2.247   1.830   1.00 0.00 ? 107 ALA A CB   5  
ATOM 8838  H H    . ALA A 1 107 ? -5.112  1.392   1.058   1.00 0.00 ? 107 ALA A H    5  
ATOM 8839  H HA   . ALA A 1 107 ? -4.184  3.906   1.874   1.00 0.00 ? 107 ALA A HA   5  
ATOM 8840  H HB1  . ALA A 1 107 ? -3.334  1.614   2.566   1.00 0.00 ? 107 ALA A HB1  5  
ATOM 8841  H HB2  . ALA A 1 107 ? -2.384  1.634   1.080   1.00 0.00 ? 107 ALA A HB2  5  
ATOM 8842  H HB3  . ALA A 1 107 ? -2.120  2.868   2.312   1.00 0.00 ? 107 ALA A HB3  5  
ATOM 8843  N N    . ALA A 1 108 ? -3.560  3.132   -1.227  1.00 0.00 ? 108 ALA A N    5  
ATOM 8844  C CA   . ALA A 1 108 ? -3.073  3.647   -2.501  1.00 0.00 ? 108 ALA A CA   5  
ATOM 8845  C C    . ALA A 1 108 ? -4.028  4.690   -3.072  1.00 0.00 ? 108 ALA A C    5  
ATOM 8846  O O    . ALA A 1 108 ? -3.598  5.688   -3.650  1.00 0.00 ? 108 ALA A O    5  
ATOM 8847  C CB   . ALA A 1 108 ? -2.877  2.509   -3.491  1.00 0.00 ? 108 ALA A CB   5  
ATOM 8848  H H    . ALA A 1 108 ? -4.058  2.289   -1.212  1.00 0.00 ? 108 ALA A H    5  
ATOM 8849  H HA   . ALA A 1 108 ? -2.112  4.111   -2.328  1.00 0.00 ? 108 ALA A HA   5  
ATOM 8850  H HB1  . ALA A 1 108 ? -3.590  1.724   -3.281  1.00 0.00 ? 108 ALA A HB1  5  
ATOM 8851  H HB2  . ALA A 1 108 ? -3.029  2.875   -4.495  1.00 0.00 ? 108 ALA A HB2  5  
ATOM 8852  H HB3  . ALA A 1 108 ? -1.875  2.119   -3.397  1.00 0.00 ? 108 ALA A HB3  5  
ATOM 8853  N N    . ARG A 1 109 ? -5.325  4.451   -2.908  1.00 0.00 ? 109 ARG A N    5  
ATOM 8854  C CA   . ARG A 1 109 ? -6.340  5.369   -3.409  1.00 0.00 ? 109 ARG A CA   5  
ATOM 8855  C C    . ARG A 1 109 ? -6.463  6.591   -2.505  1.00 0.00 ? 109 ARG A C    5  
ATOM 8856  O O    . ARG A 1 109 ? -5.847  6.653   -1.440  1.00 0.00 ? 109 ARG A O    5  
ATOM 8857  C CB   . ARG A 1 109 ? -7.692  4.660   -3.513  1.00 0.00 ? 109 ARG A CB   5  
ATOM 8858  C CG   . ARG A 1 109 ? -8.521  4.741   -2.241  1.00 0.00 ? 109 ARG A CG   5  
ATOM 8859  C CD   . ARG A 1 109 ? -9.779  3.894   -2.342  1.00 0.00 ? 109 ARG A CD   5  
ATOM 8860  N NE   . ARG A 1 109 ? -10.899 4.642   -2.906  1.00 0.00 ? 109 ARG A NE   5  
ATOM 8861  C CZ   . ARG A 1 109 ? -11.109 4.778   -4.211  1.00 0.00 ? 109 ARG A CZ   5  
ATOM 8862  N NH1  . ARG A 1 109 ? -10.279 4.219   -5.081  1.00 0.00 ? 109 ARG A NH1  5  
ATOM 8863  N NH2  . ARG A 1 109 ? -12.151 5.474   -4.648  1.00 0.00 ? 109 ARG A NH2  5  
ATOM 8864  H H    . ARG A 1 109 ? -5.605  3.638   -2.439  1.00 0.00 ? 109 ARG A H    5  
ATOM 8865  H HA   . ARG A 1 109 ? -6.037  5.693   -4.394  1.00 0.00 ? 109 ARG A HA   5  
ATOM 8866  H HB2  . ARG A 1 109 ? -8.260  5.108   -4.315  1.00 0.00 ? 109 ARG A HB2  5  
ATOM 8867  H HB3  . ARG A 1 109 ? -7.522  3.619   -3.740  1.00 0.00 ? 109 ARG A HB3  5  
ATOM 8868  H HG2  . ARG A 1 109 ? -7.927  4.386   -1.412  1.00 0.00 ? 109 ARG A HG2  5  
ATOM 8869  H HG3  . ARG A 1 109 ? -8.802  5.770   -2.071  1.00 0.00 ? 109 ARG A HG3  5  
ATOM 8870  H HD2  . ARG A 1 109 ? -9.574  3.041   -2.972  1.00 0.00 ? 109 ARG A HD2  5  
ATOM 8871  H HD3  . ARG A 1 109 ? -10.048 3.553   -1.353  1.00 0.00 ? 109 ARG A HD3  5  
ATOM 8872  H HE   . ARG A 1 109 ? -11.525 5.063   -2.281  1.00 0.00 ? 109 ARG A HE   5  
ATOM 8873  H HH11 . ARG A 1 109 ? -9.494  3.693   -4.755  1.00 0.00 ? 109 ARG A HH11 5  
ATOM 8874  H HH12 . ARG A 1 109 ? -10.440 4.323   -6.063  1.00 0.00 ? 109 ARG A HH12 5  
ATOM 8875  H HH21 . ARG A 1 109 ? -12.779 5.897   -3.995  1.00 0.00 ? 109 ARG A HH21 5  
ATOM 8876  H HH22 . ARG A 1 109 ? -12.308 5.576   -5.629  1.00 0.00 ? 109 ARG A HH22 5  
ATOM 8877  N N    . VAL A 1 110 ? -7.261  7.563   -2.936  1.00 0.00 ? 110 VAL A N    5  
ATOM 8878  C CA   . VAL A 1 110 ? -7.465  8.784   -2.165  1.00 0.00 ? 110 VAL A CA   5  
ATOM 8879  C C    . VAL A 1 110 ? -8.950  9.082   -1.991  1.00 0.00 ? 110 VAL A C    5  
ATOM 8880  O O    . VAL A 1 110 ? -9.720  9.028   -2.949  1.00 0.00 ? 110 VAL A O    5  
ATOM 8881  C CB   . VAL A 1 110 ? -6.785  9.992   -2.838  1.00 0.00 ? 110 VAL A CB   5  
ATOM 8882  C CG1  . VAL A 1 110 ? -7.388  10.248  -4.210  1.00 0.00 ? 110 VAL A CG1  5  
ATOM 8883  C CG2  . VAL A 1 110 ? -6.901  11.226  -1.956  1.00 0.00 ? 110 VAL A CG2  5  
ATOM 8884  H H    . VAL A 1 110 ? -7.725  7.455   -3.793  1.00 0.00 ? 110 VAL A H    5  
ATOM 8885  H HA   . VAL A 1 110 ? -7.019  8.642   -1.192  1.00 0.00 ? 110 VAL A HA   5  
ATOM 8886  H HB   . VAL A 1 110 ? -5.737  9.764   -2.966  1.00 0.00 ? 110 VAL A HB   5  
ATOM 8887  H HG11 . VAL A 1 110 ? -6.770  10.951  -4.749  1.00 0.00 ? 110 VAL A HG11 5  
ATOM 8888  H HG12 . VAL A 1 110 ? -7.442  9.319   -4.759  1.00 0.00 ? 110 VAL A HG12 5  
ATOM 8889  H HG13 . VAL A 1 110 ? -8.382  10.657  -4.096  1.00 0.00 ? 110 VAL A HG13 5  
ATOM 8890  H HG21 . VAL A 1 110 ? -7.401  12.012  -2.503  1.00 0.00 ? 110 VAL A HG21 5  
ATOM 8891  H HG22 . VAL A 1 110 ? -7.472  10.985  -1.071  1.00 0.00 ? 110 VAL A HG22 5  
ATOM 8892  H HG23 . VAL A 1 110 ? -5.915  11.558  -1.668  1.00 0.00 ? 110 VAL A HG23 5  
ATOM 8893  N N    . GLN A 1 111 ? -9.344  9.396   -0.761  1.00 0.00 ? 111 GLN A N    5  
ATOM 8894  C CA   . GLN A 1 111 ? -10.737 9.703   -0.461  1.00 0.00 ? 111 GLN A CA   5  
ATOM 8895  C C    . GLN A 1 111 ? -11.250 10.831  -1.350  1.00 0.00 ? 111 GLN A C    5  
ATOM 8896  O O    . GLN A 1 111 ? -10.475 11.659  -1.827  1.00 0.00 ? 111 GLN A O    5  
ATOM 8897  C CB   . GLN A 1 111 ? -10.891 10.088  1.012   1.00 0.00 ? 111 GLN A CB   5  
ATOM 8898  C CG   . GLN A 1 111 ? -10.170 11.374  1.383   1.00 0.00 ? 111 GLN A CG   5  
ATOM 8899  C CD   . GLN A 1 111 ? -8.714  11.146  1.737   1.00 0.00 ? 111 GLN A CD   5  
ATOM 8900  O OE1  . GLN A 1 111 ? -7.814  11.673  1.082   1.00 0.00 ? 111 GLN A OE1  5  
ATOM 8901  N NE2  . GLN A 1 111 ? -8.474  10.356  2.777   1.00 0.00 ? 111 GLN A NE2  5  
ATOM 8902  H H    . GLN A 1 111 ? -8.682  9.422   -0.039  1.00 0.00 ? 111 GLN A H    5  
ATOM 8903  H HA   . GLN A 1 111 ? -11.321 8.815   -0.654  1.00 0.00 ? 111 GLN A HA   5  
ATOM 8904  H HB2  . GLN A 1 111 ? -11.941 10.212  1.231   1.00 0.00 ? 111 GLN A HB2  5  
ATOM 8905  H HB3  . GLN A 1 111 ? -10.496 9.290   1.623   1.00 0.00 ? 111 GLN A HB3  5  
ATOM 8906  H HG2  . GLN A 1 111 ? -10.219 12.053  0.545   1.00 0.00 ? 111 GLN A HG2  5  
ATOM 8907  H HG3  . GLN A 1 111 ? -10.668 11.817  2.233   1.00 0.00 ? 111 GLN A HG3  5  
ATOM 8908  H HE21 . GLN A 1 111 ? -9.241  9.970   3.251   1.00 0.00 ? 111 GLN A HE21 5  
ATOM 8909  H HE22 . GLN A 1 111 ? -7.542  10.191  3.028   1.00 0.00 ? 111 GLN A HE22 5  
ATOM 8910  N N    . SER A 1 112 ? -12.561 10.856  -1.568  1.00 0.00 ? 112 SER A N    5  
ATOM 8911  C CA   . SER A 1 112 ? -13.177 11.880  -2.404  1.00 0.00 ? 112 SER A CA   5  
ATOM 8912  C C    . SER A 1 112 ? -13.196 13.227  -1.687  1.00 0.00 ? 112 SER A C    5  
ATOM 8913  O O    . SER A 1 112 ? -12.824 13.327  -0.519  1.00 0.00 ? 112 SER A O    5  
ATOM 8914  C CB   . SER A 1 112 ? -14.602 11.471  -2.782  1.00 0.00 ? 112 SER A CB   5  
ATOM 8915  O OG   . SER A 1 112 ? -15.379 11.205  -1.627  1.00 0.00 ? 112 SER A OG   5  
ATOM 8916  H H    . SER A 1 112 ? -13.127 10.168  -1.160  1.00 0.00 ? 112 SER A H    5  
ATOM 8917  H HA   . SER A 1 112 ? -12.587 11.973  -3.304  1.00 0.00 ? 112 SER A HA   5  
ATOM 8918  H HB2  . SER A 1 112 ? -15.067 12.270  -3.339  1.00 0.00 ? 112 SER A HB2  5  
ATOM 8919  H HB3  . SER A 1 112 ? -14.567 10.580  -3.392  1.00 0.00 ? 112 SER A HB3  5  
ATOM 8920  H HG   . SER A 1 112 ? -16.259 11.573  -1.742  1.00 0.00 ? 112 SER A HG   5  
ATOM 8921  N N    . GLY A 1 113 ? -13.632 14.263  -2.398  1.00 0.00 ? 113 GLY A N    5  
ATOM 8922  C CA   . GLY A 1 113 ? -13.692 15.590  -1.815  1.00 0.00 ? 113 GLY A CA   5  
ATOM 8923  C C    . GLY A 1 113 ? -12.321 16.223  -1.672  1.00 0.00 ? 113 GLY A C    5  
ATOM 8924  O O    . GLY A 1 113 ? -11.294 15.592  -1.921  1.00 0.00 ? 113 GLY A O    5  
ATOM 8925  H H    . GLY A 1 113 ? -13.916 14.124  -3.326  1.00 0.00 ? 113 GLY A H    5  
ATOM 8926  H HA2  . GLY A 1 113 ? -14.304 16.220  -2.443  1.00 0.00 ? 113 GLY A HA2  5  
ATOM 8927  H HA3  . GLY A 1 113 ? -14.147 15.522  -0.838  1.00 0.00 ? 113 GLY A HA3  5  
ATOM 8928  N N    . PRO A 1 114 ? -12.295 17.500  -1.263  1.00 0.00 ? 114 PRO A N    5  
ATOM 8929  C CA   . PRO A 1 114 ? -11.046 18.246  -1.079  1.00 0.00 ? 114 PRO A CA   5  
ATOM 8930  C C    . PRO A 1 114 ? -10.241 17.744  0.115   1.00 0.00 ? 114 PRO A C    5  
ATOM 8931  O O    . PRO A 1 114 ? -10.347 18.282  1.217   1.00 0.00 ? 114 PRO A O    5  
ATOM 8932  C CB   . PRO A 1 114 ? -11.523 19.681  -0.837  1.00 0.00 ? 114 PRO A CB   5  
ATOM 8933  C CG   . PRO A 1 114 ? -12.901 19.535  -0.289  1.00 0.00 ? 114 PRO A CG   5  
ATOM 8934  C CD   . PRO A 1 114 ? -13.481 18.313  -0.947  1.00 0.00 ? 114 PRO A CD   5  
ATOM 8935  H HA   . PRO A 1 114 ? -10.431 18.214  -1.966  1.00 0.00 ? 114 PRO A HA   5  
ATOM 8936  H HB2  . PRO A 1 114 ? -10.865 20.167  -0.131  1.00 0.00 ? 114 PRO A HB2  5  
ATOM 8937  H HB3  . PRO A 1 114 ? -11.525 20.225  -1.770  1.00 0.00 ? 114 PRO A HB3  5  
ATOM 8938  H HG2  . PRO A 1 114 ? -12.858 19.400  0.781   1.00 0.00 ? 114 PRO A HG2  5  
ATOM 8939  H HG3  . PRO A 1 114 ? -13.488 20.407  -0.536  1.00 0.00 ? 114 PRO A HG3  5  
ATOM 8940  H HD2  . PRO A 1 114 ? -14.136 17.792  -0.265  1.00 0.00 ? 114 PRO A HD2  5  
ATOM 8941  H HD3  . PRO A 1 114 ? -14.011 18.586  -1.848  1.00 0.00 ? 114 PRO A HD3  5  
ATOM 8942  N N    . SER A 1 115 ? -9.436  16.711  -0.112  1.00 0.00 ? 115 SER A N    5  
ATOM 8943  C CA   . SER A 1 115 ? -8.615  16.135  0.946   1.00 0.00 ? 115 SER A CA   5  
ATOM 8944  C C    . SER A 1 115 ? -8.031  17.227  1.837   1.00 0.00 ? 115 SER A C    5  
ATOM 8945  O O    . SER A 1 115 ? -7.778  18.343  1.384   1.00 0.00 ? 115 SER A O    5  
ATOM 8946  C CB   . SER A 1 115 ? -7.488  15.294  0.345   1.00 0.00 ? 115 SER A CB   5  
ATOM 8947  O OG   . SER A 1 115 ? -7.040  14.311  1.262   1.00 0.00 ? 115 SER A OG   5  
ATOM 8948  H H    . SER A 1 115 ? -9.396  16.326  -1.013  1.00 0.00 ? 115 SER A H    5  
ATOM 8949  H HA   . SER A 1 115 ? -9.248  15.497  1.546   1.00 0.00 ? 115 SER A HA   5  
ATOM 8950  H HB2  . SER A 1 115 ? -7.845  14.801  -0.546  1.00 0.00 ? 115 SER A HB2  5  
ATOM 8951  H HB3  . SER A 1 115 ? -6.658  15.938  0.092   1.00 0.00 ? 115 SER A HB3  5  
ATOM 8952  H HG   . SER A 1 115 ? -7.361  14.523  2.142   1.00 0.00 ? 115 SER A HG   5  
ATOM 8953  N N    . SER A 1 116 ? -7.819  16.896  3.107   1.00 0.00 ? 116 SER A N    5  
ATOM 8954  C CA   . SER A 1 116 ? -7.269  17.850  4.063   1.00 0.00 ? 116 SER A CA   5  
ATOM 8955  C C    . SER A 1 116 ? -5.744  17.813  4.050   1.00 0.00 ? 116 SER A C    5  
ATOM 8956  O O    . SER A 1 116 ? -5.087  18.848  3.946   1.00 0.00 ? 116 SER A O    5  
ATOM 8957  C CB   . SER A 1 116 ? -7.785  17.548  5.471   1.00 0.00 ? 116 SER A CB   5  
ATOM 8958  O OG   . SER A 1 116 ? -7.379  18.548  6.389   1.00 0.00 ? 116 SER A OG   5  
ATOM 8959  H H    . SER A 1 116 ? -8.041  15.990  3.408   1.00 0.00 ? 116 SER A H    5  
ATOM 8960  H HA   . SER A 1 116 ? -7.596  18.837  3.773   1.00 0.00 ? 116 SER A HA   5  
ATOM 8961  H HB2  . SER A 1 116 ? -8.864  17.508  5.455   1.00 0.00 ? 116 SER A HB2  5  
ATOM 8962  H HB3  . SER A 1 116 ? -7.395  16.595  5.798   1.00 0.00 ? 116 SER A HB3  5  
ATOM 8963  H HG   . SER A 1 116 ? -7.885  18.463  7.200   1.00 0.00 ? 116 SER A HG   5  
ATOM 8964  N N    . GLY A 1 117 ? -5.186  16.610  4.156   1.00 0.00 ? 117 GLY A N    5  
ATOM 8965  C CA   . GLY A 1 117 ? -3.743  16.459  4.154   1.00 0.00 ? 117 GLY A CA   5  
ATOM 8966  C C    . GLY A 1 117 ? -3.230  15.802  2.888   1.00 0.00 ? 117 GLY A C    5  
ATOM 8967  O O    . GLY A 1 117 ? -4.012  15.424  2.016   1.00 0.00 ? 117 GLY A O    5  
ATOM 8968  H H    . GLY A 1 117 ? -5.759  15.819  4.236   1.00 0.00 ? 117 GLY A H    5  
ATOM 8969  H HA2  . GLY A 1 117 ? -3.289  17.435  4.250   1.00 0.00 ? 117 GLY A HA2  5  
ATOM 8970  H HA3  . GLY A 1 117 ? -3.454  15.855  5.002   1.00 0.00 ? 117 GLY A HA3  5  
ATOM 8971  N N    . GLY A 1 1   ? 13.626  17.025  6.095   1.00 0.00 ? 1   GLY A N    6  
ATOM 8972  C CA   . GLY A 1 1   ? 12.917  17.252  7.340   1.00 0.00 ? 1   GLY A CA   6  
ATOM 8973  C C    . GLY A 1 1   ? 11.547  16.603  7.354   1.00 0.00 ? 1   GLY A C    6  
ATOM 8974  O O    . GLY A 1 1   ? 10.527  17.287  7.277   1.00 0.00 ? 1   GLY A O    6  
ATOM 8975  H H1   . GLY A 1 1   ? 14.457  16.505  6.094   1.00 0.00 ? 1   GLY A H1   6  
ATOM 8976  H HA2  . GLY A 1 1   ? 13.502  16.852  8.154   1.00 0.00 ? 1   GLY A HA2  6  
ATOM 8977  H HA3  . GLY A 1 1   ? 12.799  18.316  7.485   1.00 0.00 ? 1   GLY A HA3  6  
ATOM 8978  N N    . SER A 1 2   ? 11.524  15.277  7.451   1.00 0.00 ? 2   SER A N    6  
ATOM 8979  C CA   . SER A 1 2   ? 10.269  14.534  7.469   1.00 0.00 ? 2   SER A CA   6  
ATOM 8980  C C    . SER A 1 2   ? 9.805   14.287  8.901   1.00 0.00 ? 2   SER A C    6  
ATOM 8981  O O    . SER A 1 2   ? 10.191  13.301  9.529   1.00 0.00 ? 2   SER A O    6  
ATOM 8982  C CB   . SER A 1 2   ? 10.431  13.201  6.736   1.00 0.00 ? 2   SER A CB   6  
ATOM 8983  O OG   . SER A 1 2   ? 9.171   12.612  6.464   1.00 0.00 ? 2   SER A OG   6  
ATOM 8984  H H    . SER A 1 2   ? 12.371  14.787  7.509   1.00 0.00 ? 2   SER A H    6  
ATOM 8985  H HA   . SER A 1 2   ? 9.525   15.128  6.959   1.00 0.00 ? 2   SER A HA   6  
ATOM 8986  H HB2  . SER A 1 2   ? 10.946  13.367  5.802   1.00 0.00 ? 2   SER A HB2  6  
ATOM 8987  H HB3  . SER A 1 2   ? 11.007  12.523  7.349   1.00 0.00 ? 2   SER A HB3  6  
ATOM 8988  H HG   . SER A 1 2   ? 8.955   12.732  5.536   1.00 0.00 ? 2   SER A HG   6  
ATOM 8989  N N    . SER A 1 3   ? 8.973   15.190  9.411   1.00 0.00 ? 3   SER A N    6  
ATOM 8990  C CA   . SER A 1 3   ? 8.458   15.073  10.770  1.00 0.00 ? 3   SER A CA   6  
ATOM 8991  C C    . SER A 1 3   ? 7.457   13.926  10.875  1.00 0.00 ? 3   SER A C    6  
ATOM 8992  O O    . SER A 1 3   ? 6.290   14.072  10.515  1.00 0.00 ? 3   SER A O    6  
ATOM 8993  C CB   . SER A 1 3   ? 7.797   16.383  11.202  1.00 0.00 ? 3   SER A CB   6  
ATOM 8994  O OG   . SER A 1 3   ? 7.236   16.269  12.498  1.00 0.00 ? 3   SER A OG   6  
ATOM 8995  H H    . SER A 1 3   ? 8.702   15.954  8.860   1.00 0.00 ? 3   SER A H    6  
ATOM 8996  H HA   . SER A 1 3   ? 9.293   14.868  11.424  1.00 0.00 ? 3   SER A HA   6  
ATOM 8997  H HB2  . SER A 1 3   ? 8.536   17.170  11.211  1.00 0.00 ? 3   SER A HB2  6  
ATOM 8998  H HB3  . SER A 1 3   ? 7.012   16.634  10.503  1.00 0.00 ? 3   SER A HB3  6  
ATOM 8999  H HG   . SER A 1 3   ? 7.051   17.144  12.845  1.00 0.00 ? 3   SER A HG   6  
ATOM 9000  N N    . GLY A 1 4   ? 7.925   12.785  11.371  1.00 0.00 ? 4   GLY A N    6  
ATOM 9001  C CA   . GLY A 1 4   ? 7.059   11.629  11.515  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9002  C C    . GLY A 1 4   ? 7.660   10.562  12.409  1.00 0.00 ? 4   GLY A C    6  
ATOM 9003  O O    . GLY A 1 4   ? 8.612   10.823  13.144  1.00 0.00 ? 4   GLY A O    6  
ATOM 9004  H H    . GLY A 1 4   ? 8.865   12.727  11.642  1.00 0.00 ? 4   GLY A H    6  
ATOM 9005  H HA2  . GLY A 1 4   ? 6.117   11.948  11.936  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9006  H HA3  . GLY A 1 4   ? 6.879   11.204  10.538  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9007  N N    . SER A 1 5   ? 7.101   9.358   12.348  1.00 0.00 ? 5   SER A N    6  
ATOM 9008  C CA   . SER A 1 5   ? 7.584   8.249   13.162  1.00 0.00 ? 5   SER A CA   6  
ATOM 9009  C C    . SER A 1 5   ? 7.652   6.963   12.344  1.00 0.00 ? 5   SER A C    6  
ATOM 9010  O O    . SER A 1 5   ? 6.977   6.827   11.323  1.00 0.00 ? 5   SER A O    6  
ATOM 9011  C CB   . SER A 1 5   ? 6.676   8.046   14.376  1.00 0.00 ? 5   SER A CB   6  
ATOM 9012  O OG   . SER A 1 5   ? 6.920   9.031   15.366  1.00 0.00 ? 5   SER A OG   6  
ATOM 9013  H H    . SER A 1 5   ? 6.344   9.212   11.742  1.00 0.00 ? 5   SER A H    6  
ATOM 9014  H HA   . SER A 1 5   ? 8.578   8.497   13.504  1.00 0.00 ? 5   SER A HA   6  
ATOM 9015  H HB2  . SER A 1 5   ? 5.644   8.114   14.066  1.00 0.00 ? 5   SER A HB2  6  
ATOM 9016  H HB3  . SER A 1 5   ? 6.861   7.071   14.802  1.00 0.00 ? 5   SER A HB3  6  
ATOM 9017  H HG   . SER A 1 5   ? 6.085   9.340   15.723  1.00 0.00 ? 5   SER A HG   6  
ATOM 9018  N N    . SER A 1 6   ? 8.472   6.021   12.800  1.00 0.00 ? 6   SER A N    6  
ATOM 9019  C CA   . SER A 1 6   ? 8.632   4.747   12.109  1.00 0.00 ? 6   SER A CA   6  
ATOM 9020  C C    . SER A 1 6   ? 7.281   4.070   11.897  1.00 0.00 ? 6   SER A C    6  
ATOM 9021  O O    . SER A 1 6   ? 6.999   3.545   10.821  1.00 0.00 ? 6   SER A O    6  
ATOM 9022  C CB   . SER A 1 6   ? 9.558   3.825   12.904  1.00 0.00 ? 6   SER A CB   6  
ATOM 9023  O OG   . SER A 1 6   ? 10.916  4.054   12.570  1.00 0.00 ? 6   SER A OG   6  
ATOM 9024  H H    . SER A 1 6   ? 8.983   6.189   13.619  1.00 0.00 ? 6   SER A H    6  
ATOM 9025  H HA   . SER A 1 6   ? 9.076   4.946   11.145  1.00 0.00 ? 6   SER A HA   6  
ATOM 9026  H HB2  . SER A 1 6   ? 9.424   4.007   13.959  1.00 0.00 ? 6   SER A HB2  6  
ATOM 9027  H HB3  . SER A 1 6   ? 9.314   2.796   12.682  1.00 0.00 ? 6   SER A HB3  6  
ATOM 9028  H HG   . SER A 1 6   ? 11.291  4.698   13.176  1.00 0.00 ? 6   SER A HG   6  
ATOM 9029  N N    . GLY A 1 7   ? 6.448   4.088   12.934  1.00 0.00 ? 7   GLY A N    6  
ATOM 9030  C CA   . GLY A 1 7   ? 5.137   3.473   12.842  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9031  C C    . GLY A 1 7   ? 4.291   3.726   14.074  1.00 0.00 ? 7   GLY A C    6  
ATOM 9032  O O    . GLY A 1 7   ? 4.010   2.806   14.842  1.00 0.00 ? 7   GLY A O    6  
ATOM 9033  H H    . GLY A 1 7   ? 6.727   4.522   13.767  1.00 0.00 ? 7   GLY A H    6  
ATOM 9034  H HA2  . GLY A 1 7   ? 4.624   3.871   11.979  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9035  H HA3  . GLY A 1 7   ? 5.259   2.408   12.716  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9036  N N    . ASN A 1 8   ? 3.884   4.977   14.265  1.00 0.00 ? 8   ASN A N    6  
ATOM 9037  C CA   . ASN A 1 8   ? 3.067   5.348   15.415  1.00 0.00 ? 8   ASN A CA   6  
ATOM 9038  C C    . ASN A 1 8   ? 1.692   4.692   15.339  1.00 0.00 ? 8   ASN A C    6  
ATOM 9039  O O    . ASN A 1 8   ? 1.214   4.114   16.314  1.00 0.00 ? 8   ASN A O    6  
ATOM 9040  C CB   . ASN A 1 8   ? 2.916   6.869   15.489  1.00 0.00 ? 8   ASN A CB   6  
ATOM 9041  C CG   . ASN A 1 8   ? 2.489   7.473   14.166  1.00 0.00 ? 8   ASN A CG   6  
ATOM 9042  O OD1  . ASN A 1 8   ? 3.111   7.232   13.131  1.00 0.00 ? 8   ASN A OD1  6  
ATOM 9043  N ND2  . ASN A 1 8   ? 1.423   8.264   14.193  1.00 0.00 ? 8   ASN A ND2  6  
ATOM 9044  H H    . ASN A 1 8   ? 4.140   5.667   13.618  1.00 0.00 ? 8   ASN A H    6  
ATOM 9045  H HA   . ASN A 1 8   ? 3.570   5.001   16.305  1.00 0.00 ? 8   ASN A HA   6  
ATOM 9046  H HB2  . ASN A 1 8   ? 2.171   7.114   16.232  1.00 0.00 ? 8   ASN A HB2  6  
ATOM 9047  H HB3  . ASN A 1 8   ? 3.861   7.305   15.776  1.00 0.00 ? 8   ASN A HB3  6  
ATOM 9048  H HD21 . ASN A 1 8   ? 0.978   8.412   15.054  1.00 0.00 ? 8   ASN A HD21 6  
ATOM 9049  H HD22 . ASN A 1 8   ? 1.125   8.668   13.352  1.00 0.00 ? 8   ASN A HD22 6  
ATOM 9050  N N    . ALA A 1 9   ? 1.061   4.787   14.173  1.00 0.00 ? 9   ALA A N    6  
ATOM 9051  C CA   . ALA A 1 9   ? -0.258  4.202   13.968  1.00 0.00 ? 9   ALA A CA   6  
ATOM 9052  C C    . ALA A 1 9   ? -0.201  2.680   14.046  1.00 0.00 ? 9   ALA A C    6  
ATOM 9053  O O    . ALA A 1 9   ? 0.833   2.060   13.798  1.00 0.00 ? 9   ALA A O    6  
ATOM 9054  C CB   . ALA A 1 9   ? -0.830  4.643   12.629  1.00 0.00 ? 9   ALA A CB   6  
ATOM 9055  H H    . ALA A 1 9   ? 1.493   5.261   13.433  1.00 0.00 ? 9   ALA A H    6  
ATOM 9056  H HA   . ALA A 1 9   ? -0.911  4.567   14.749  1.00 0.00 ? 9   ALA A HA   6  
ATOM 9057  H HB1  . ALA A 1 9   ? -1.863  4.933   12.758  1.00 0.00 ? 9   ALA A HB1  6  
ATOM 9058  H HB2  . ALA A 1 9   ? -0.264  5.483   12.255  1.00 0.00 ? 9   ALA A HB2  6  
ATOM 9059  H HB3  . ALA A 1 9   ? -0.770  3.826   11.926  1.00 0.00 ? 9   ALA A HB3  6  
ATOM 9060  N N    . PRO A 1 10  ? -1.338  2.061   14.398  1.00 0.00 ? 10  PRO A N    6  
ATOM 9061  C CA   . PRO A 1 10  ? -1.442  0.604   14.516  1.00 0.00 ? 10  PRO A CA   6  
ATOM 9062  C C    . PRO A 1 10  ? -1.367  -0.095  13.163  1.00 0.00 ? 10  PRO A C    6  
ATOM 9063  O O    . PRO A 1 10  ? -1.635  0.511   12.125  1.00 0.00 ? 10  PRO A O    6  
ATOM 9064  C CB   . PRO A 1 10  ? -2.820  0.397   15.149  1.00 0.00 ? 10  PRO A CB   6  
ATOM 9065  C CG   . PRO A 1 10  ? -3.599  1.607   14.764  1.00 0.00 ? 10  PRO A CG   6  
ATOM 9066  C CD   . PRO A 1 10  ? -2.609  2.737   14.708  1.00 0.00 ? 10  PRO A CD   6  
ATOM 9067  H HA   . PRO A 1 10  ? -0.681  0.203   15.170  1.00 0.00 ? 10  PRO A HA   6  
ATOM 9068  H HB2  . PRO A 1 10  ? -3.268  -0.505  14.755  1.00 0.00 ? 10  PRO A HB2  6  
ATOM 9069  H HB3  . PRO A 1 10  ? -2.720  0.317   16.221  1.00 0.00 ? 10  PRO A HB3  6  
ATOM 9070  H HG2  . PRO A 1 10  ? -4.054  1.458   13.796  1.00 0.00 ? 10  PRO A HG2  6  
ATOM 9071  H HG3  . PRO A 1 10  ? -4.356  1.808   15.508  1.00 0.00 ? 10  PRO A HG3  6  
ATOM 9072  H HD2  . PRO A 1 10  ? -2.875  3.434   13.928  1.00 0.00 ? 10  PRO A HD2  6  
ATOM 9073  H HD3  . PRO A 1 10  ? -2.555  3.238   15.663  1.00 0.00 ? 10  PRO A HD3  6  
ATOM 9074  N N    . VAL A 1 11  ? -1.001  -1.372  13.181  1.00 0.00 ? 11  VAL A N    6  
ATOM 9075  C CA   . VAL A 1 11  ? -0.892  -2.154  11.954  1.00 0.00 ? 11  VAL A CA   6  
ATOM 9076  C C    . VAL A 1 11  ? -2.234  -2.242  11.238  1.00 0.00 ? 11  VAL A C    6  
ATOM 9077  O O    . VAL A 1 11  ? -3.269  -2.483  11.861  1.00 0.00 ? 11  VAL A O    6  
ATOM 9078  C CB   . VAL A 1 11  ? -0.380  -3.578  12.240  1.00 0.00 ? 11  VAL A CB   6  
ATOM 9079  C CG1  . VAL A 1 11  ? -0.291  -4.382  10.952  1.00 0.00 ? 11  VAL A CG1  6  
ATOM 9080  C CG2  . VAL A 1 11  ? 0.969   -3.529  12.942  1.00 0.00 ? 11  VAL A CG2  6  
ATOM 9081  H H    . VAL A 1 11  ? -0.800  -1.800  14.039  1.00 0.00 ? 11  VAL A H    6  
ATOM 9082  H HA   . VAL A 1 11  ? -0.181  -1.661  11.307  1.00 0.00 ? 11  VAL A HA   6  
ATOM 9083  H HB   . VAL A 1 11  ? -1.086  -4.067  12.895  1.00 0.00 ? 11  VAL A HB   6  
ATOM 9084  H HG11 . VAL A 1 11  ? -0.593  -5.401  11.142  1.00 0.00 ? 11  VAL A HG11 6  
ATOM 9085  H HG12 . VAL A 1 11  ? -0.941  -3.945  10.208  1.00 0.00 ? 11  VAL A HG12 6  
ATOM 9086  H HG13 . VAL A 1 11  ? 0.727   -4.371  10.591  1.00 0.00 ? 11  VAL A HG13 6  
ATOM 9087  H HG21 . VAL A 1 11  ? 1.559   -2.724  12.529  1.00 0.00 ? 11  VAL A HG21 6  
ATOM 9088  H HG22 . VAL A 1 11  ? 0.819   -3.360  13.999  1.00 0.00 ? 11  VAL A HG22 6  
ATOM 9089  H HG23 . VAL A 1 11  ? 1.485   -4.466  12.797  1.00 0.00 ? 11  VAL A HG23 6  
ATOM 9090  N N    . THR A 1 12  ? -2.212  -2.046  9.923   1.00 0.00 ? 12  THR A N    6  
ATOM 9091  C CA   . THR A 1 12  ? -3.427  -2.102  9.121   1.00 0.00 ? 12  THR A CA   6  
ATOM 9092  C C    . THR A 1 12  ? -3.787  -3.541  8.769   1.00 0.00 ? 12  THR A C    6  
ATOM 9093  O O    . THR A 1 12  ? -4.936  -3.958  8.915   1.00 0.00 ? 12  THR A O    6  
ATOM 9094  C CB   . THR A 1 12  ? -3.280  -1.289  7.821   1.00 0.00 ? 12  THR A CB   6  
ATOM 9095  O OG1  . THR A 1 12  ? -2.746  0.007   8.111   1.00 0.00 ? 12  THR A OG1  6  
ATOM 9096  C CG2  . THR A 1 12  ? -4.622  -1.145  7.118   1.00 0.00 ? 12  THR A CG2  6  
ATOM 9097  H H    . THR A 1 12  ? -1.356  -1.858  9.484   1.00 0.00 ? 12  THR A H    6  
ATOM 9098  H HA   . THR A 1 12  ? -4.230  -1.672  9.701   1.00 0.00 ? 12  THR A HA   6  
ATOM 9099  H HB   . THR A 1 12  ? -2.600  -1.811  7.162   1.00 0.00 ? 12  THR A HB   6  
ATOM 9100  H HG1  . THR A 1 12  ? -1.870  -0.086  8.495   1.00 0.00 ? 12  THR A HG1  6  
ATOM 9101  H HG21 . THR A 1 12  ? -4.868  -2.070  6.618   1.00 0.00 ? 12  THR A HG21 6  
ATOM 9102  H HG22 . THR A 1 12  ? -4.564  -0.347  6.393   1.00 0.00 ? 12  THR A HG22 6  
ATOM 9103  H HG23 . THR A 1 12  ? -5.385  -0.915  7.846   1.00 0.00 ? 12  THR A HG23 6  
ATOM 9104  N N    . LYS A 1 13  ? -2.798  -4.297  8.304   1.00 0.00 ? 13  LYS A N    6  
ATOM 9105  C CA   . LYS A 1 13  ? -3.009  -5.691  7.933   1.00 0.00 ? 13  LYS A CA   6  
ATOM 9106  C C    . LYS A 1 13  ? -1.699  -6.471  7.982   1.00 0.00 ? 13  LYS A C    6  
ATOM 9107  O O    . LYS A 1 13  ? -0.620  -5.903  7.817   1.00 0.00 ? 13  LYS A O    6  
ATOM 9108  C CB   . LYS A 1 13  ? -3.616  -5.780  6.531   1.00 0.00 ? 13  LYS A CB   6  
ATOM 9109  C CG   . LYS A 1 13  ? -4.213  -7.140  6.212   1.00 0.00 ? 13  LYS A CG   6  
ATOM 9110  C CD   . LYS A 1 13  ? -4.866  -7.155  4.841   1.00 0.00 ? 13  LYS A CD   6  
ATOM 9111  C CE   . LYS A 1 13  ? -5.835  -8.319  4.697   1.00 0.00 ? 13  LYS A CE   6  
ATOM 9112  N NZ   . LYS A 1 13  ? -6.996  -8.191  5.620   1.00 0.00 ? 13  LYS A NZ   6  
ATOM 9113  H H    . LYS A 1 13  ? -1.903  -3.907  8.210   1.00 0.00 ? 13  LYS A H    6  
ATOM 9114  H HA   . LYS A 1 13  ? -3.698  -6.123  8.643   1.00 0.00 ? 13  LYS A HA   6  
ATOM 9115  H HB2  . LYS A 1 13  ? -4.396  -5.038  6.442   1.00 0.00 ? 13  LYS A HB2  6  
ATOM 9116  H HB3  . LYS A 1 13  ? -2.845  -5.570  5.804   1.00 0.00 ? 13  LYS A HB3  6  
ATOM 9117  H HG2  . LYS A 1 13  ? -3.428  -7.882  6.233   1.00 0.00 ? 13  LYS A HG2  6  
ATOM 9118  H HG3  . LYS A 1 13  ? -4.957  -7.381  6.959   1.00 0.00 ? 13  LYS A HG3  6  
ATOM 9119  H HD2  . LYS A 1 13  ? -5.408  -6.232  4.700   1.00 0.00 ? 13  LYS A HD2  6  
ATOM 9120  H HD3  . LYS A 1 13  ? -4.098  -7.242  4.086   1.00 0.00 ? 13  LYS A HD3  6  
ATOM 9121  H HE2  . LYS A 1 13  ? -6.195  -8.347  3.680   1.00 0.00 ? 13  LYS A HE2  6  
ATOM 9122  H HE3  . LYS A 1 13  ? -5.309  -9.236  4.918   1.00 0.00 ? 13  LYS A HE3  6  
ATOM 9123  H HZ1  . LYS A 1 13  ? -7.869  -8.035  5.076   1.00 0.00 ? 13  LYS A HZ1  6  
ATOM 9124  H HZ2  . LYS A 1 13  ? -6.854  -7.387  6.264   1.00 0.00 ? 13  LYS A HZ2  6  
ATOM 9125  H HZ3  . LYS A 1 13  ? -7.103  -9.059  6.184   1.00 0.00 ? 13  LYS A HZ3  6  
ATOM 9126  N N    . ALA A 1 14  ? -1.801  -7.777  8.208   1.00 0.00 ? 14  ALA A N    6  
ATOM 9127  C CA   . ALA A 1 14  ? -0.625  -8.635  8.275   1.00 0.00 ? 14  ALA A CA   6  
ATOM 9128  C C    . ALA A 1 14  ? -0.986  -10.086 7.974   1.00 0.00 ? 14  ALA A C    6  
ATOM 9129  O O    . ALA A 1 14  ? -1.939  -10.628 8.533   1.00 0.00 ? 14  ALA A O    6  
ATOM 9130  C CB   . ALA A 1 14  ? 0.031   -8.526  9.643   1.00 0.00 ? 14  ALA A CB   6  
ATOM 9131  H H    . ALA A 1 14  ? -2.689  -8.172  8.332   1.00 0.00 ? 14  ALA A H    6  
ATOM 9132  H HA   . ALA A 1 14  ? 0.082   -8.290  7.535   1.00 0.00 ? 14  ALA A HA   6  
ATOM 9133  H HB1  . ALA A 1 14  ? 0.230   -9.516  10.027  1.00 0.00 ? 14  ALA A HB1  6  
ATOM 9134  H HB2  . ALA A 1 14  ? 0.959   -7.981  9.555   1.00 0.00 ? 14  ALA A HB2  6  
ATOM 9135  H HB3  . ALA A 1 14  ? -0.630  -8.004  10.319  1.00 0.00 ? 14  ALA A HB3  6  
ATOM 9136  N N    . GLY A 1 15  ? -0.219  -10.710 7.086   1.00 0.00 ? 15  GLY A N    6  
ATOM 9137  C CA   . GLY A 1 15  ? -0.475  -12.092 6.725   1.00 0.00 ? 15  GLY A CA   6  
ATOM 9138  C C    . GLY A 1 15  ? 0.578   -12.652 5.790   1.00 0.00 ? 15  GLY A C    6  
ATOM 9139  O O    . GLY A 1 15  ? 1.315   -11.900 5.153   1.00 0.00 ? 15  GLY A O    6  
ATOM 9140  H H    . GLY A 1 15  ? 0.527   -10.228 6.672   1.00 0.00 ? 15  GLY A H    6  
ATOM 9141  H HA2  . GLY A 1 15  ? -0.497  -12.689 7.625   1.00 0.00 ? 15  GLY A HA2  6  
ATOM 9142  H HA3  . GLY A 1 15  ? -1.439  -12.153 6.242   1.00 0.00 ? 15  GLY A HA3  6  
ATOM 9143  N N    . TRP A 1 16  ? 0.650   -13.976 5.707   1.00 0.00 ? 16  TRP A N    6  
ATOM 9144  C CA   . TRP A 1 16  ? 1.622   -14.636 4.843   1.00 0.00 ? 16  TRP A CA   6  
ATOM 9145  C C    . TRP A 1 16  ? 1.208   -14.532 3.379   1.00 0.00 ? 16  TRP A C    6  
ATOM 9146  O O    . TRP A 1 16  ? 0.194   -15.098 2.968   1.00 0.00 ? 16  TRP A O    6  
ATOM 9147  C CB   . TRP A 1 16  ? 1.773   -16.105 5.240   1.00 0.00 ? 16  TRP A CB   6  
ATOM 9148  C CG   . TRP A 1 16  ? 2.512   -16.299 6.529   1.00 0.00 ? 16  TRP A CG   6  
ATOM 9149  C CD1  . TRP A 1 16  ? 1.966   -16.469 7.769   1.00 0.00 ? 16  TRP A CD1  6  
ATOM 9150  C CD2  . TRP A 1 16  ? 3.932   -16.340 6.705   1.00 0.00 ? 16  TRP A CD2  6  
ATOM 9151  N NE1  . TRP A 1 16  ? 2.961   -16.614 8.706   1.00 0.00 ? 16  TRP A NE1  6  
ATOM 9152  C CE2  . TRP A 1 16  ? 4.176   -16.540 8.078   1.00 0.00 ? 16  TRP A CE2  6  
ATOM 9153  C CE3  . TRP A 1 16  ? 5.021   -16.231 5.837   1.00 0.00 ? 16  TRP A CE3  6  
ATOM 9154  C CZ2  . TRP A 1 16  ? 5.464   -16.630 8.600   1.00 0.00 ? 16  TRP A CZ2  6  
ATOM 9155  C CZ3  . TRP A 1 16  ? 6.299   -16.320 6.356   1.00 0.00 ? 16  TRP A CZ3  6  
ATOM 9156  C CH2  . TRP A 1 16  ? 6.512   -16.519 7.727   1.00 0.00 ? 16  TRP A CH2  6  
ATOM 9157  H H    . TRP A 1 16  ? 0.034   -14.523 6.239   1.00 0.00 ? 16  TRP A H    6  
ATOM 9158  H HA   . TRP A 1 16  ? 2.571   -14.138 4.973   1.00 0.00 ? 16  TRP A HA   6  
ATOM 9159  H HB2  . TRP A 1 16  ? 0.793   -16.545 5.348   1.00 0.00 ? 16  TRP A HB2  6  
ATOM 9160  H HB3  . TRP A 1 16  ? 2.314   -16.626 4.463   1.00 0.00 ? 16  TRP A HB3  6  
ATOM 9161  H HD1  . TRP A 1 16  ? 0.905   -16.484 7.970   1.00 0.00 ? 16  TRP A HD1  6  
ATOM 9162  H HE1  . TRP A 1 16  ? 2.822   -16.750 9.667   1.00 0.00 ? 16  TRP A HE1  6  
ATOM 9163  H HE3  . TRP A 1 16  ? 4.878   -16.078 4.777   1.00 0.00 ? 16  TRP A HE3  6  
ATOM 9164  H HZ2  . TRP A 1 16  ? 5.644   -16.783 9.654   1.00 0.00 ? 16  TRP A HZ2  6  
ATOM 9165  H HZ3  . TRP A 1 16  ? 7.153   -16.237 5.700   1.00 0.00 ? 16  TRP A HZ3  6  
ATOM 9166  H HH2  . TRP A 1 16  ? 7.526   -16.582 8.088   1.00 0.00 ? 16  TRP A HH2  6  
ATOM 9167  N N    . LEU A 1 17  ? 1.999   -13.807 2.595   1.00 0.00 ? 17  LEU A N    6  
ATOM 9168  C CA   . LEU A 1 17  ? 1.714   -13.629 1.176   1.00 0.00 ? 17  LEU A CA   6  
ATOM 9169  C C    . LEU A 1 17  ? 2.885   -14.105 0.322   1.00 0.00 ? 17  LEU A C    6  
ATOM 9170  O O    . LEU A 1 17  ? 4.046   -13.946 0.698   1.00 0.00 ? 17  LEU A O    6  
ATOM 9171  C CB   . LEU A 1 17  ? 1.414   -12.159 0.875   1.00 0.00 ? 17  LEU A CB   6  
ATOM 9172  C CG   . LEU A 1 17  ? -0.014  -11.694 1.162   1.00 0.00 ? 17  LEU A CG   6  
ATOM 9173  C CD1  . LEU A 1 17  ? -0.127  -10.186 0.999   1.00 0.00 ? 17  LEU A CD1  6  
ATOM 9174  C CD2  . LEU A 1 17  ? -1.000  -12.406 0.247   1.00 0.00 ? 17  LEU A CD2  6  
ATOM 9175  H H    . LEU A 1 17  ? 2.792   -13.380 2.980   1.00 0.00 ? 17  LEU A H    6  
ATOM 9176  H HA   . LEU A 1 17  ? 0.844   -14.222 0.936   1.00 0.00 ? 17  LEU A HA   6  
ATOM 9177  H HB2  . LEU A 1 17  ? 2.083   -11.557 1.470   1.00 0.00 ? 17  LEU A HB2  6  
ATOM 9178  H HB3  . LEU A 1 17  ? 1.615   -11.989 -0.173  1.00 0.00 ? 17  LEU A HB3  6  
ATOM 9179  H HG   . LEU A 1 17  ? -0.268  -11.939 2.184   1.00 0.00 ? 17  LEU A HG   6  
ATOM 9180  H HD11 . LEU A 1 17  ? -1.144  -9.879  1.187   1.00 0.00 ? 17  LEU A HD11 6  
ATOM 9181  H HD12 . LEU A 1 17  ? 0.153   -9.911  -0.007  1.00 0.00 ? 17  LEU A HD12 6  
ATOM 9182  H HD13 . LEU A 1 17  ? 0.533   -9.698  1.702   1.00 0.00 ? 17  LEU A HD13 6  
ATOM 9183  H HD21 . LEU A 1 17  ? -1.595  -13.095 0.827   1.00 0.00 ? 17  LEU A HD21 6  
ATOM 9184  H HD22 . LEU A 1 17  ? -0.458  -12.950 -0.513  1.00 0.00 ? 17  LEU A HD22 6  
ATOM 9185  H HD23 . LEU A 1 17  ? -1.646  -11.678 -0.221  1.00 0.00 ? 17  LEU A HD23 6  
ATOM 9186  N N    . PHE A 1 18  ? 2.572   -14.689 -0.830  1.00 0.00 ? 18  PHE A N    6  
ATOM 9187  C CA   . PHE A 1 18  ? 3.598   -15.188 -1.738  1.00 0.00 ? 18  PHE A CA   6  
ATOM 9188  C C    . PHE A 1 18  ? 3.971   -14.129 -2.771  1.00 0.00 ? 18  PHE A C    6  
ATOM 9189  O O    . PHE A 1 18  ? 3.108   -13.590 -3.465  1.00 0.00 ? 18  PHE A O    6  
ATOM 9190  C CB   . PHE A 1 18  ? 3.112   -16.456 -2.444  1.00 0.00 ? 18  PHE A CB   6  
ATOM 9191  C CG   . PHE A 1 18  ? 3.126   -17.674 -1.565  1.00 0.00 ? 18  PHE A CG   6  
ATOM 9192  C CD1  . PHE A 1 18  ? 2.434   -17.687 -0.365  1.00 0.00 ? 18  PHE A CD1  6  
ATOM 9193  C CD2  . PHE A 1 18  ? 3.832   -18.806 -1.939  1.00 0.00 ? 18  PHE A CD2  6  
ATOM 9194  C CE1  . PHE A 1 18  ? 2.446   -18.806 0.446   1.00 0.00 ? 18  PHE A CE1  6  
ATOM 9195  C CE2  . PHE A 1 18  ? 3.848   -19.928 -1.132  1.00 0.00 ? 18  PHE A CE2  6  
ATOM 9196  C CZ   . PHE A 1 18  ? 3.153   -19.929 0.061   1.00 0.00 ? 18  PHE A CZ   6  
ATOM 9197  H H    . PHE A 1 18  ? 1.627   -14.788 -1.075  1.00 0.00 ? 18  PHE A H    6  
ATOM 9198  H HA   . PHE A 1 18  ? 4.472   -15.425 -1.152  1.00 0.00 ? 18  PHE A HA   6  
ATOM 9199  H HB2  . PHE A 1 18  ? 2.098   -16.305 -2.783  1.00 0.00 ? 18  PHE A HB2  6  
ATOM 9200  H HB3  . PHE A 1 18  ? 3.747   -16.651 -3.295  1.00 0.00 ? 18  PHE A HB3  6  
ATOM 9201  H HD1  . PHE A 1 18  ? 1.879   -16.810 -0.063  1.00 0.00 ? 18  PHE A HD1  6  
ATOM 9202  H HD2  . PHE A 1 18  ? 4.376   -18.807 -2.873  1.00 0.00 ? 18  PHE A HD2  6  
ATOM 9203  H HE1  . PHE A 1 18  ? 1.902   -18.804 1.379   1.00 0.00 ? 18  PHE A HE1  6  
ATOM 9204  H HE2  . PHE A 1 18  ? 4.402   -20.804 -1.436  1.00 0.00 ? 18  PHE A HE2  6  
ATOM 9205  H HZ   . PHE A 1 18  ? 3.165   -20.804 0.693   1.00 0.00 ? 18  PHE A HZ   6  
ATOM 9206  N N    . LYS A 1 19  ? 5.263   -13.835 -2.868  1.00 0.00 ? 19  LYS A N    6  
ATOM 9207  C CA   . LYS A 1 19  ? 5.753   -12.841 -3.816  1.00 0.00 ? 19  LYS A CA   6  
ATOM 9208  C C    . LYS A 1 19  ? 6.433   -13.513 -5.005  1.00 0.00 ? 19  LYS A C    6  
ATOM 9209  O O    . LYS A 1 19  ? 7.251   -14.416 -4.834  1.00 0.00 ? 19  LYS A O    6  
ATOM 9210  C CB   . LYS A 1 19  ? 6.732   -11.888 -3.127  1.00 0.00 ? 19  LYS A CB   6  
ATOM 9211  C CG   . LYS A 1 19  ? 6.906   -10.565 -3.853  1.00 0.00 ? 19  LYS A CG   6  
ATOM 9212  C CD   . LYS A 1 19  ? 8.134   -9.817  -3.362  1.00 0.00 ? 19  LYS A CD   6  
ATOM 9213  C CE   . LYS A 1 19  ? 8.097   -8.354  -3.775  1.00 0.00 ? 19  LYS A CE   6  
ATOM 9214  N NZ   . LYS A 1 19  ? 8.628   -8.152  -5.151  1.00 0.00 ? 19  LYS A NZ   6  
ATOM 9215  H H    . LYS A 1 19  ? 5.903   -14.299 -2.288  1.00 0.00 ? 19  LYS A H    6  
ATOM 9216  H HA   . LYS A 1 19  ? 4.905   -12.277 -4.173  1.00 0.00 ? 19  LYS A HA   6  
ATOM 9217  H HB2  . LYS A 1 19  ? 6.373   -11.683 -2.129  1.00 0.00 ? 19  LYS A HB2  6  
ATOM 9218  H HB3  . LYS A 1 19  ? 7.697   -12.368 -3.061  1.00 0.00 ? 19  LYS A HB3  6  
ATOM 9219  H HG2  . LYS A 1 19  ? 7.013   -10.757 -4.910  1.00 0.00 ? 19  LYS A HG2  6  
ATOM 9220  H HG3  . LYS A 1 19  ? 6.031   -9.954  -3.683  1.00 0.00 ? 19  LYS A HG3  6  
ATOM 9221  H HD2  . LYS A 1 19  ? 8.173   -9.874  -2.284  1.00 0.00 ? 19  LYS A HD2  6  
ATOM 9222  H HD3  . LYS A 1 19  ? 9.017   -10.278 -3.781  1.00 0.00 ? 19  LYS A HD3  6  
ATOM 9223  H HE2  . LYS A 1 19  ? 7.075   -8.009  -3.739  1.00 0.00 ? 19  LYS A HE2  6  
ATOM 9224  H HE3  . LYS A 1 19  ? 8.695   -7.782  -3.080  1.00 0.00 ? 19  LYS A HE3  6  
ATOM 9225  H HZ1  . LYS A 1 19  ? 9.038   -7.200  -5.240  1.00 0.00 ? 19  LYS A HZ1  6  
ATOM 9226  H HZ2  . LYS A 1 19  ? 7.863   -8.254  -5.848  1.00 0.00 ? 19  LYS A HZ2  6  
ATOM 9227  H HZ3  . LYS A 1 19  ? 9.366   -8.856  -5.357  1.00 0.00 ? 19  LYS A HZ3  6  
ATOM 9228  N N    . GLN A 1 20  ? 6.091   -13.064 -6.208  1.00 0.00 ? 20  GLN A N    6  
ATOM 9229  C CA   . GLN A 1 20  ? 6.670   -13.621 -7.424  1.00 0.00 ? 20  GLN A CA   6  
ATOM 9230  C C    . GLN A 1 20  ? 8.170   -13.353 -7.486  1.00 0.00 ? 20  GLN A C    6  
ATOM 9231  O O    . GLN A 1 20  ? 8.633   -12.276 -7.112  1.00 0.00 ? 20  GLN A O    6  
ATOM 9232  C CB   . GLN A 1 20  ? 5.983   -13.033 -8.658  1.00 0.00 ? 20  GLN A CB   6  
ATOM 9233  C CG   . GLN A 1 20  ? 6.053   -13.933 -9.881  1.00 0.00 ? 20  GLN A CG   6  
ATOM 9234  C CD   . GLN A 1 20  ? 5.147   -13.464 -11.003 1.00 0.00 ? 20  GLN A CD   6  
ATOM 9235  O OE1  . GLN A 1 20  ? 4.890   -12.269 -11.151 1.00 0.00 ? 20  GLN A OE1  6  
ATOM 9236  N NE2  . GLN A 1 20  ? 4.657   -14.406 -11.801 1.00 0.00 ? 20  GLN A NE2  6  
ATOM 9237  H H    . GLN A 1 20  ? 5.433   -12.341 -6.279  1.00 0.00 ? 20  GLN A H    6  
ATOM 9238  H HA   . GLN A 1 20  ? 6.508   -14.689 -7.409  1.00 0.00 ? 20  GLN A HA   6  
ATOM 9239  H HB2  . GLN A 1 20  ? 4.943   -12.856 -8.426  1.00 0.00 ? 20  GLN A HB2  6  
ATOM 9240  H HB3  . GLN A 1 20  ? 6.454   -12.092 -8.903  1.00 0.00 ? 20  GLN A HB3  6  
ATOM 9241  H HG2  . GLN A 1 20  ? 7.070   -13.948 -10.243 1.00 0.00 ? 20  GLN A HG2  6  
ATOM 9242  H HG3  . GLN A 1 20  ? 5.759   -14.932 -9.594  1.00 0.00 ? 20  GLN A HG3  6  
ATOM 9243  H HE21 . GLN A 1 20  ? 4.903   -15.338 -11.622 1.00 0.00 ? 20  GLN A HE21 6  
ATOM 9244  H HE22 . GLN A 1 20  ? 4.068   -14.132 -12.533 1.00 0.00 ? 20  GLN A HE22 6  
ATOM 9245  N N    . ALA A 1 21  ? 8.924   -14.339 -7.960  1.00 0.00 ? 21  ALA A N    6  
ATOM 9246  C CA   . ALA A 1 21  ? 10.371  -14.208 -8.072  1.00 0.00 ? 21  ALA A CA   6  
ATOM 9247  C C    . ALA A 1 21  ? 10.748  -13.061 -9.003  1.00 0.00 ? 21  ALA A C    6  
ATOM 9248  O O    . ALA A 1 21  ? 9.987   -12.702 -9.901  1.00 0.00 ? 21  ALA A O    6  
ATOM 9249  C CB   . ALA A 1 21  ? 10.983  -15.512 -8.563  1.00 0.00 ? 21  ALA A CB   6  
ATOM 9250  H H    . ALA A 1 21  ? 8.496   -15.174 -8.242  1.00 0.00 ? 21  ALA A H    6  
ATOM 9251  H HA   . ALA A 1 21  ? 10.765  -14.003 -7.087  1.00 0.00 ? 21  ALA A HA   6  
ATOM 9252  H HB1  . ALA A 1 21  ? 10.493  -15.816 -9.477  1.00 0.00 ? 21  ALA A HB1  6  
ATOM 9253  H HB2  . ALA A 1 21  ? 12.036  -15.367 -8.750  1.00 0.00 ? 21  ALA A HB2  6  
ATOM 9254  H HB3  . ALA A 1 21  ? 10.851  -16.276 -7.812  1.00 0.00 ? 21  ALA A HB3  6  
ATOM 9255  N N    . SER A 1 22  ? 11.927  -12.489 -8.782  1.00 0.00 ? 22  SER A N    6  
ATOM 9256  C CA   . SER A 1 22  ? 12.403  -11.378 -9.599  1.00 0.00 ? 22  SER A CA   6  
ATOM 9257  C C    . SER A 1 22  ? 13.746  -11.713 -10.241 1.00 0.00 ? 22  SER A C    6  
ATOM 9258  O O    . SER A 1 22  ? 14.719  -12.015 -9.550  1.00 0.00 ? 22  SER A O    6  
ATOM 9259  C CB   . SER A 1 22  ? 12.532  -10.112 -8.750  1.00 0.00 ? 22  SER A CB   6  
ATOM 9260  O OG   . SER A 1 22  ? 11.311  -9.394  -8.716  1.00 0.00 ? 22  SER A OG   6  
ATOM 9261  H H    . SER A 1 22  ? 12.489  -12.820 -8.050  1.00 0.00 ? 22  SER A H    6  
ATOM 9262  H HA   . SER A 1 22  ? 11.677  -11.206 -10.379 1.00 0.00 ? 22  SER A HA   6  
ATOM 9263  H HB2  . SER A 1 22  ? 12.805  -10.384 -7.742  1.00 0.00 ? 22  SER A HB2  6  
ATOM 9264  H HB3  . SER A 1 22  ? 13.298  -9.477  -9.171  1.00 0.00 ? 22  SER A HB3  6  
ATOM 9265  H HG   . SER A 1 22  ? 11.153  -9.073  -7.826  1.00 0.00 ? 22  SER A HG   6  
ATOM 9266  N N    . SER A 1 23  ? 13.790  -11.657 -11.569 1.00 0.00 ? 23  SER A N    6  
ATOM 9267  C CA   . SER A 1 23  ? 15.012  -11.958 -12.306 1.00 0.00 ? 23  SER A CA   6  
ATOM 9268  C C    . SER A 1 23  ? 15.320  -13.452 -12.260 1.00 0.00 ? 23  SER A C    6  
ATOM 9269  O O    . SER A 1 23  ? 16.441  -13.856 -11.955 1.00 0.00 ? 23  SER A O    6  
ATOM 9270  C CB   . SER A 1 23  ? 16.187  -11.165 -11.732 1.00 0.00 ? 23  SER A CB   6  
ATOM 9271  O OG   . SER A 1 23  ? 17.255  -11.091 -12.661 1.00 0.00 ? 23  SER A OG   6  
ATOM 9272  H H    . SER A 1 23  ? 12.981  -11.411 -12.064 1.00 0.00 ? 23  SER A H    6  
ATOM 9273  H HA   . SER A 1 23  ? 14.859  -11.665 -13.334 1.00 0.00 ? 23  SER A HA   6  
ATOM 9274  H HB2  . SER A 1 23  ? 15.862  -10.164 -11.496 1.00 0.00 ? 23  SER A HB2  6  
ATOM 9275  H HB3  . SER A 1 23  ? 16.541  -11.650 -10.834 1.00 0.00 ? 23  SER A HB3  6  
ATOM 9276  H HG   . SER A 1 23  ? 18.091  -11.115 -12.191 1.00 0.00 ? 23  SER A HG   6  
ATOM 9277  N N    . GLY A 1 24  ? 14.316  -14.267 -12.567 1.00 0.00 ? 24  GLY A N    6  
ATOM 9278  C CA   . GLY A 1 24  ? 14.498  -15.707 -12.555 1.00 0.00 ? 24  GLY A CA   6  
ATOM 9279  C C    . GLY A 1 24  ? 13.248  -16.453 -12.977 1.00 0.00 ? 24  GLY A C    6  
ATOM 9280  O O    . GLY A 1 24  ? 12.316  -15.860 -13.519 1.00 0.00 ? 24  GLY A O    6  
ATOM 9281  H H    . GLY A 1 24  ? 13.443  -13.888 -12.803 1.00 0.00 ? 24  GLY A H    6  
ATOM 9282  H HA2  . GLY A 1 24  ? 15.302  -15.962 -13.229 1.00 0.00 ? 24  GLY A HA2  6  
ATOM 9283  H HA3  . GLY A 1 24  ? 14.768  -16.015 -11.555 1.00 0.00 ? 24  GLY A HA3  6  
ATOM 9284  N N    . VAL A 1 25  ? 13.229  -17.759 -12.729 1.00 0.00 ? 25  VAL A N    6  
ATOM 9285  C CA   . VAL A 1 25  ? 12.085  -18.588 -13.088 1.00 0.00 ? 25  VAL A CA   6  
ATOM 9286  C C    . VAL A 1 25  ? 10.782  -17.973 -12.588 1.00 0.00 ? 25  VAL A C    6  
ATOM 9287  O O    . VAL A 1 25  ? 10.788  -17.095 -11.726 1.00 0.00 ? 25  VAL A O    6  
ATOM 9288  C CB   . VAL A 1 25  ? 12.221  -20.011 -12.514 1.00 0.00 ? 25  VAL A CB   6  
ATOM 9289  C CG1  . VAL A 1 25  ? 13.264  -20.802 -13.289 1.00 0.00 ? 25  VAL A CG1  6  
ATOM 9290  C CG2  . VAL A 1 25  ? 12.571  -19.957 -11.035 1.00 0.00 ? 25  VAL A CG2  6  
ATOM 9291  H H    . VAL A 1 25  ? 14.003  -18.175 -12.295 1.00 0.00 ? 25  VAL A H    6  
ATOM 9292  H HA   . VAL A 1 25  ? 12.048  -18.659 -14.165 1.00 0.00 ? 25  VAL A HA   6  
ATOM 9293  H HB   . VAL A 1 25  ? 11.270  -20.512 -12.619 1.00 0.00 ? 25  VAL A HB   6  
ATOM 9294  H HG11 . VAL A 1 25  ? 13.183  -21.849 -13.035 1.00 0.00 ? 25  VAL A HG11 6  
ATOM 9295  H HG12 . VAL A 1 25  ? 13.100  -20.673 -14.349 1.00 0.00 ? 25  VAL A HG12 6  
ATOM 9296  H HG13 . VAL A 1 25  ? 14.250  -20.445 -13.031 1.00 0.00 ? 25  VAL A HG13 6  
ATOM 9297  H HG21 . VAL A 1 25  ? 13.170  -19.080 -10.839 1.00 0.00 ? 25  VAL A HG21 6  
ATOM 9298  H HG22 . VAL A 1 25  ? 11.663  -19.910 -10.451 1.00 0.00 ? 25  VAL A HG22 6  
ATOM 9299  H HG23 . VAL A 1 25  ? 13.128  -20.842 -10.764 1.00 0.00 ? 25  VAL A HG23 6  
ATOM 9300  N N    . LYS A 1 26  ? 9.666   -18.440 -13.136 1.00 0.00 ? 26  LYS A N    6  
ATOM 9301  C CA   . LYS A 1 26  ? 8.353   -17.939 -12.746 1.00 0.00 ? 26  LYS A CA   6  
ATOM 9302  C C    . LYS A 1 26  ? 7.825   -18.687 -11.526 1.00 0.00 ? 26  LYS A C    6  
ATOM 9303  O O    . LYS A 1 26  ? 6.767   -19.314 -11.583 1.00 0.00 ? 26  LYS A O    6  
ATOM 9304  C CB   . LYS A 1 26  ? 7.367   -18.074 -13.908 1.00 0.00 ? 26  LYS A CB   6  
ATOM 9305  C CG   . LYS A 1 26  ? 7.519   -16.993 -14.964 1.00 0.00 ? 26  LYS A CG   6  
ATOM 9306  C CD   . LYS A 1 26  ? 7.157   -15.623 -14.416 1.00 0.00 ? 26  LYS A CD   6  
ATOM 9307  C CE   . LYS A 1 26  ? 7.111   -14.575 -15.518 1.00 0.00 ? 26  LYS A CE   6  
ATOM 9308  N NZ   . LYS A 1 26  ? 5.817   -14.601 -16.254 1.00 0.00 ? 26  LYS A NZ   6  
ATOM 9309  H H    . LYS A 1 26  ? 9.725   -19.142 -13.819 1.00 0.00 ? 26  LYS A H    6  
ATOM 9310  H HA   . LYS A 1 26  ? 8.459   -16.894 -12.494 1.00 0.00 ? 26  LYS A HA   6  
ATOM 9311  H HB2  . LYS A 1 26  ? 7.515   -19.033 -14.380 1.00 0.00 ? 26  LYS A HB2  6  
ATOM 9312  H HB3  . LYS A 1 26  ? 6.360   -18.027 -13.517 1.00 0.00 ? 26  LYS A HB3  6  
ATOM 9313  H HG2  . LYS A 1 26  ? 8.544   -16.974 -15.301 1.00 0.00 ? 26  LYS A HG2  6  
ATOM 9314  H HG3  . LYS A 1 26  ? 6.868   -17.221 -15.796 1.00 0.00 ? 26  LYS A HG3  6  
ATOM 9315  H HD2  . LYS A 1 26  ? 6.186   -15.677 -13.946 1.00 0.00 ? 26  LYS A HD2  6  
ATOM 9316  H HD3  . LYS A 1 26  ? 7.896   -15.331 -13.683 1.00 0.00 ? 26  LYS A HD3  6  
ATOM 9317  H HE2  . LYS A 1 26  ? 7.245   -13.600 -15.075 1.00 0.00 ? 26  LYS A HE2  6  
ATOM 9318  H HE3  . LYS A 1 26  ? 7.915   -14.769 -16.213 1.00 0.00 ? 26  LYS A HE3  6  
ATOM 9319  H HZ1  . LYS A 1 26  ? 5.442   -13.635 -16.349 1.00 0.00 ? 26  LYS A HZ1  6  
ATOM 9320  H HZ2  . LYS A 1 26  ? 5.124   -15.180 -15.739 1.00 0.00 ? 26  LYS A HZ2  6  
ATOM 9321  H HZ3  . LYS A 1 26  ? 5.953   -15.003 -17.203 1.00 0.00 ? 26  LYS A HZ3  6  
ATOM 9322  N N    . GLN A 1 27  ? 8.568   -18.617 -10.426 1.00 0.00 ? 27  GLN A N    6  
ATOM 9323  C CA   . GLN A 1 27  ? 8.172   -19.288 -9.194  1.00 0.00 ? 27  GLN A CA   6  
ATOM 9324  C C    . GLN A 1 27  ? 7.650   -18.285 -8.171  1.00 0.00 ? 27  GLN A C    6  
ATOM 9325  O O    . GLN A 1 27  ? 7.695   -17.075 -8.395  1.00 0.00 ? 27  GLN A O    6  
ATOM 9326  C CB   . GLN A 1 27  ? 9.354   -20.063 -8.609  1.00 0.00 ? 27  GLN A CB   6  
ATOM 9327  C CG   . GLN A 1 27  ? 10.434  -19.171 -8.019  1.00 0.00 ? 27  GLN A CG   6  
ATOM 9328  C CD   . GLN A 1 27  ? 11.452  -19.947 -7.206  1.00 0.00 ? 27  GLN A CD   6  
ATOM 9329  O OE1  . GLN A 1 27  ? 12.058  -20.901 -7.696  1.00 0.00 ? 27  GLN A OE1  6  
ATOM 9330  N NE2  . GLN A 1 27  ? 11.646  -19.541 -5.957  1.00 0.00 ? 27  GLN A NE2  6  
ATOM 9331  H H    . GLN A 1 27  ? 9.401   -18.102 -10.444 1.00 0.00 ? 27  GLN A H    6  
ATOM 9332  H HA   . GLN A 1 27  ? 7.381   -19.983 -9.434  1.00 0.00 ? 27  GLN A HA   6  
ATOM 9333  H HB2  . GLN A 1 27  ? 8.990   -20.716 -7.829  1.00 0.00 ? 27  GLN A HB2  6  
ATOM 9334  H HB3  . GLN A 1 27  ? 9.799   -20.662 -9.390  1.00 0.00 ? 27  GLN A HB3  6  
ATOM 9335  H HG2  . GLN A 1 27  ? 10.948  -18.669 -8.825  1.00 0.00 ? 27  GLN A HG2  6  
ATOM 9336  H HG3  . GLN A 1 27  ? 9.967   -18.438 -7.379  1.00 0.00 ? 27  GLN A HG3  6  
ATOM 9337  H HE21 . GLN A 1 27  ? 11.126  -18.775 -5.634  1.00 0.00 ? 27  GLN A HE21 6  
ATOM 9338  H HE22 . GLN A 1 27  ? 12.297  -20.025 -5.409  1.00 0.00 ? 27  GLN A HE22 6  
ATOM 9339  N N    . TRP A 1 28  ? 7.156   -18.795 -7.049  1.00 0.00 ? 28  TRP A N    6  
ATOM 9340  C CA   . TRP A 1 28  ? 6.624   -17.942 -5.991  1.00 0.00 ? 28  TRP A CA   6  
ATOM 9341  C C    . TRP A 1 28  ? 7.250   -18.291 -4.645  1.00 0.00 ? 28  TRP A C    6  
ATOM 9342  O O    . TRP A 1 28  ? 7.346   -19.462 -4.280  1.00 0.00 ? 28  TRP A O    6  
ATOM 9343  C CB   . TRP A 1 28  ? 5.103   -18.081 -5.912  1.00 0.00 ? 28  TRP A CB   6  
ATOM 9344  C CG   . TRP A 1 28  ? 4.399   -17.609 -7.148  1.00 0.00 ? 28  TRP A CG   6  
ATOM 9345  C CD1  . TRP A 1 28  ? 4.425   -18.195 -8.381  1.00 0.00 ? 28  TRP A CD1  6  
ATOM 9346  C CD2  . TRP A 1 28  ? 3.564   -16.452 -7.269  1.00 0.00 ? 28  TRP A CD2  6  
ATOM 9347  N NE1  . TRP A 1 28  ? 3.658   -17.472 -9.262  1.00 0.00 ? 28  TRP A NE1  6  
ATOM 9348  C CE2  . TRP A 1 28  ? 3.118   -16.398 -8.604  1.00 0.00 ? 28  TRP A CE2  6  
ATOM 9349  C CE3  . TRP A 1 28  ? 3.149   -15.457 -6.380  1.00 0.00 ? 28  TRP A CE3  6  
ATOM 9350  C CZ2  . TRP A 1 28  ? 2.280   -15.389 -9.069  1.00 0.00 ? 28  TRP A CZ2  6  
ATOM 9351  C CZ3  . TRP A 1 28  ? 2.317   -14.455 -6.843  1.00 0.00 ? 28  TRP A CZ3  6  
ATOM 9352  C CH2  . TRP A 1 28  ? 1.889   -14.427 -8.177  1.00 0.00 ? 28  TRP A CH2  6  
ATOM 9353  H H    . TRP A 1 28  ? 7.147   -19.767 -6.928  1.00 0.00 ? 28  TRP A H    6  
ATOM 9354  H HA   . TRP A 1 28  ? 6.871   -16.919 -6.236  1.00 0.00 ? 28  TRP A HA   6  
ATOM 9355  H HB2  . TRP A 1 28  ? 4.850   -19.119 -5.760  1.00 0.00 ? 28  TRP A HB2  6  
ATOM 9356  H HB3  . TRP A 1 28  ? 4.740   -17.499 -5.077  1.00 0.00 ? 28  TRP A HB3  6  
ATOM 9357  H HD1  . TRP A 1 28  ? 4.975   -19.094 -8.615  1.00 0.00 ? 28  TRP A HD1  6  
ATOM 9358  H HE1  . TRP A 1 28  ? 3.519   -17.691 -10.207 1.00 0.00 ? 28  TRP A HE1  6  
ATOM 9359  H HE3  . TRP A 1 28  ? 3.468   -15.461 -5.349  1.00 0.00 ? 28  TRP A HE3  6  
ATOM 9360  H HZ2  . TRP A 1 28  ? 1.941   -15.354 -10.094 1.00 0.00 ? 28  TRP A HZ2  6  
ATOM 9361  H HZ3  . TRP A 1 28  ? 1.986   -13.677 -6.171  1.00 0.00 ? 28  TRP A HZ3  6  
ATOM 9362  H HH2  . TRP A 1 28  ? 1.240   -13.626 -8.495  1.00 0.00 ? 28  TRP A HH2  6  
ATOM 9363  N N    . ASN A 1 29  ? 7.675   -17.267 -3.912  1.00 0.00 ? 29  ASN A N    6  
ATOM 9364  C CA   . ASN A 1 29  ? 8.292   -17.467 -2.606  1.00 0.00 ? 29  ASN A CA   6  
ATOM 9365  C C    . ASN A 1 29  ? 7.433   -16.861 -1.500  1.00 0.00 ? 29  ASN A C    6  
ATOM 9366  O O    . ASN A 1 29  ? 7.015   -15.706 -1.584  1.00 0.00 ? 29  ASN A O    6  
ATOM 9367  C CB   . ASN A 1 29  ? 9.690   -16.845 -2.578  1.00 0.00 ? 29  ASN A CB   6  
ATOM 9368  C CG   . ASN A 1 29  ? 9.714   -15.450 -3.172  1.00 0.00 ? 29  ASN A CG   6  
ATOM 9369  O OD1  . ASN A 1 29  ? 9.586   -14.456 -2.456  1.00 0.00 ? 29  ASN A OD1  6  
ATOM 9370  N ND2  . ASN A 1 29  ? 9.878   -15.369 -4.487  1.00 0.00 ? 29  ASN A ND2  6  
ATOM 9371  H H    . ASN A 1 29  ? 7.571   -16.356 -4.257  1.00 0.00 ? 29  ASN A H    6  
ATOM 9372  H HA   . ASN A 1 29  ? 8.377   -18.530 -2.438  1.00 0.00 ? 29  ASN A HA   6  
ATOM 9373  H HB2  . ASN A 1 29  ? 10.031  -16.786 -1.555  1.00 0.00 ? 29  ASN A HB2  6  
ATOM 9374  H HB3  . ASN A 1 29  ? 10.366  -17.469 -3.143  1.00 0.00 ? 29  ASN A HB3  6  
ATOM 9375  H HD21 . ASN A 1 29  ? 9.974   -16.202 -4.994  1.00 0.00 ? 29  ASN A HD21 6  
ATOM 9376  H HD22 . ASN A 1 29  ? 9.898   -14.479 -4.897  1.00 0.00 ? 29  ASN A HD22 6  
ATOM 9377  N N    . LYS A 1 30  ? 7.172   -17.650 -0.462  1.00 0.00 ? 30  LYS A N    6  
ATOM 9378  C CA   . LYS A 1 30  ? 6.364   -17.193 0.662   1.00 0.00 ? 30  LYS A CA   6  
ATOM 9379  C C    . LYS A 1 30  ? 7.123   -16.165 1.496   1.00 0.00 ? 30  LYS A C    6  
ATOM 9380  O O    . LYS A 1 30  ? 8.324   -16.306 1.728   1.00 0.00 ? 30  LYS A O    6  
ATOM 9381  C CB   . LYS A 1 30  ? 5.959   -18.379 1.541   1.00 0.00 ? 30  LYS A CB   6  
ATOM 9382  C CG   . LYS A 1 30  ? 5.171   -17.979 2.776   1.00 0.00 ? 30  LYS A CG   6  
ATOM 9383  C CD   . LYS A 1 30  ? 4.883   -19.177 3.665   1.00 0.00 ? 30  LYS A CD   6  
ATOM 9384  C CE   . LYS A 1 30  ? 3.591   -18.993 4.447   1.00 0.00 ? 30  LYS A CE   6  
ATOM 9385  N NZ   . LYS A 1 30  ? 3.110   -20.275 5.033   1.00 0.00 ? 30  LYS A NZ   6  
ATOM 9386  H H    . LYS A 1 30  ? 7.532   -18.562 -0.453  1.00 0.00 ? 30  LYS A H    6  
ATOM 9387  H HA   . LYS A 1 30  ? 5.474   -16.729 0.265   1.00 0.00 ? 30  LYS A HA   6  
ATOM 9388  H HB2  . LYS A 1 30  ? 5.352   -19.054 0.955   1.00 0.00 ? 30  LYS A HB2  6  
ATOM 9389  H HB3  . LYS A 1 30  ? 6.852   -18.896 1.861   1.00 0.00 ? 30  LYS A HB3  6  
ATOM 9390  H HG2  . LYS A 1 30  ? 5.743   -17.257 3.339   1.00 0.00 ? 30  LYS A HG2  6  
ATOM 9391  H HG3  . LYS A 1 30  ? 4.234   -17.537 2.468   1.00 0.00 ? 30  LYS A HG3  6  
ATOM 9392  H HD2  . LYS A 1 30  ? 4.794   -20.059 3.049   1.00 0.00 ? 30  LYS A HD2  6  
ATOM 9393  H HD3  . LYS A 1 30  ? 5.700   -19.303 4.362   1.00 0.00 ? 30  LYS A HD3  6  
ATOM 9394  H HE2  . LYS A 1 30  ? 3.764   -18.286 5.243   1.00 0.00 ? 30  LYS A HE2  6  
ATOM 9395  H HE3  . LYS A 1 30  ? 2.834   -18.606 3.780   1.00 0.00 ? 30  LYS A HE3  6  
ATOM 9396  H HZ1  . LYS A 1 30  ? 2.070   -20.311 5.008   1.00 0.00 ? 30  LYS A HZ1  6  
ATOM 9397  H HZ2  . LYS A 1 30  ? 3.424   -20.356 6.021   1.00 0.00 ? 30  LYS A HZ2  6  
ATOM 9398  H HZ3  . LYS A 1 30  ? 3.487   -21.079 4.492   1.00 0.00 ? 30  LYS A HZ3  6  
ATOM 9399  N N    . ARG A 1 31  ? 6.415   -15.134 1.944   1.00 0.00 ? 31  ARG A N    6  
ATOM 9400  C CA   . ARG A 1 31  ? 7.023   -14.083 2.751   1.00 0.00 ? 31  ARG A CA   6  
ATOM 9401  C C    . ARG A 1 31  ? 5.969   -13.363 3.588   1.00 0.00 ? 31  ARG A C    6  
ATOM 9402  O O    . ARG A 1 31  ? 4.841   -13.158 3.140   1.00 0.00 ? 31  ARG A O    6  
ATOM 9403  C CB   . ARG A 1 31  ? 7.753   -13.080 1.856   1.00 0.00 ? 31  ARG A CB   6  
ATOM 9404  C CG   . ARG A 1 31  ? 8.953   -12.429 2.524   1.00 0.00 ? 31  ARG A CG   6  
ATOM 9405  C CD   . ARG A 1 31  ? 10.190  -13.309 2.425   1.00 0.00 ? 31  ARG A CD   6  
ATOM 9406  N NE   . ARG A 1 31  ? 10.660  -13.440 1.049   1.00 0.00 ? 31  ARG A NE   6  
ATOM 9407  C CZ   . ARG A 1 31  ? 11.352  -12.499 0.416   1.00 0.00 ? 31  ARG A CZ   6  
ATOM 9408  N NH1  . ARG A 1 31  ? 11.652  -11.364 1.033   1.00 0.00 ? 31  ARG A NH1  6  
ATOM 9409  N NH2  . ARG A 1 31  ? 11.745  -12.692 -0.836  1.00 0.00 ? 31  ARG A NH2  6  
ATOM 9410  H H    . ARG A 1 31  ? 5.461   -15.077 1.725   1.00 0.00 ? 31  ARG A H    6  
ATOM 9411  H HA   . ARG A 1 31  ? 7.737   -14.546 3.415   1.00 0.00 ? 31  ARG A HA   6  
ATOM 9412  H HB2  . ARG A 1 31  ? 8.095   -13.590 0.968   1.00 0.00 ? 31  ARG A HB2  6  
ATOM 9413  H HB3  . ARG A 1 31  ? 7.061   -12.302 1.571   1.00 0.00 ? 31  ARG A HB3  6  
ATOM 9414  H HG2  . ARG A 1 31  ? 9.157   -11.487 2.038   1.00 0.00 ? 31  ARG A HG2  6  
ATOM 9415  H HG3  . ARG A 1 31  ? 8.725   -12.258 3.565   1.00 0.00 ? 31  ARG A HG3  6  
ATOM 9416  H HD2  . ARG A 1 31  ? 10.975  -12.872 3.024   1.00 0.00 ? 31  ARG A HD2  6  
ATOM 9417  H HD3  . ARG A 1 31  ? 9.949   -14.289 2.809   1.00 0.00 ? 31  ARG A HD3  6  
ATOM 9418  H HE   . ARG A 1 31  ? 10.449  -14.271 0.574   1.00 0.00 ? 31  ARG A HE   6  
ATOM 9419  H HH11 . ARG A 1 31  ? 11.358  -11.217 1.977   1.00 0.00 ? 31  ARG A HH11 6  
ATOM 9420  H HH12 . ARG A 1 31  ? 12.174  -10.658 0.554   1.00 0.00 ? 31  ARG A HH12 6  
ATOM 9421  H HH21 . ARG A 1 31  ? 11.521  -13.546 -1.305  1.00 0.00 ? 31  ARG A HH21 6  
ATOM 9422  H HH22 . ARG A 1 31  ? 12.265  -11.983 -1.312  1.00 0.00 ? 31  ARG A HH22 6  
ATOM 9423  N N    . TRP A 1 32  ? 6.346   -12.982 4.803   1.00 0.00 ? 32  TRP A N    6  
ATOM 9424  C CA   . TRP A 1 32  ? 5.433   -12.284 5.702   1.00 0.00 ? 32  TRP A CA   6  
ATOM 9425  C C    . TRP A 1 32  ? 5.245   -10.834 5.270   1.00 0.00 ? 32  TRP A C    6  
ATOM 9426  O O    . TRP A 1 32  ? 6.199   -10.057 5.238   1.00 0.00 ? 32  TRP A O    6  
ATOM 9427  C CB   . TRP A 1 32  ? 5.959   -12.337 7.138   1.00 0.00 ? 32  TRP A CB   6  
ATOM 9428  C CG   . TRP A 1 32  ? 5.037   -11.699 8.132   1.00 0.00 ? 32  TRP A CG   6  
ATOM 9429  C CD1  . TRP A 1 32  ? 5.254   -10.545 8.828   1.00 0.00 ? 32  TRP A CD1  6  
ATOM 9430  C CD2  . TRP A 1 32  ? 3.753   -12.182 8.542   1.00 0.00 ? 32  TRP A CD2  6  
ATOM 9431  N NE1  . TRP A 1 32  ? 4.183   -10.280 9.646   1.00 0.00 ? 32  TRP A NE1  6  
ATOM 9432  C CE2  . TRP A 1 32  ? 3.248   -11.269 9.489   1.00 0.00 ? 32  TRP A CE2  6  
ATOM 9433  C CE3  . TRP A 1 32  ? 2.979   -13.294 8.200   1.00 0.00 ? 32  TRP A CE3  6  
ATOM 9434  C CZ2  . TRP A 1 32  ? 2.006   -11.438 10.096  1.00 0.00 ? 32  TRP A CZ2  6  
ATOM 9435  C CZ3  . TRP A 1 32  ? 1.748   -13.460 8.804   1.00 0.00 ? 32  TRP A CZ3  6  
ATOM 9436  C CH2  . TRP A 1 32  ? 1.270   -12.536 9.743   1.00 0.00 ? 32  TRP A CH2  6  
ATOM 9437  H H    . TRP A 1 32  ? 7.259   -13.173 5.103   1.00 0.00 ? 32  TRP A H    6  
ATOM 9438  H HA   . TRP A 1 32  ? 4.478   -12.788 5.659   1.00 0.00 ? 32  TRP A HA   6  
ATOM 9439  H HB2  . TRP A 1 32  ? 6.098   -13.368 7.426   1.00 0.00 ? 32  TRP A HB2  6  
ATOM 9440  H HB3  . TRP A 1 32  ? 6.908   -11.823 7.184   1.00 0.00 ? 32  TRP A HB3  6  
ATOM 9441  H HD1  . TRP A 1 32  ? 6.144   -9.940  8.740   1.00 0.00 ? 32  TRP A HD1  6  
ATOM 9442  H HE1  . TRP A 1 32  ? 4.101   -9.508  10.245  1.00 0.00 ? 32  TRP A HE1  6  
ATOM 9443  H HE3  . TRP A 1 32  ? 3.330   -14.018 7.479   1.00 0.00 ? 32  TRP A HE3  6  
ATOM 9444  H HZ2  . TRP A 1 32  ? 1.624   -10.734 10.821  1.00 0.00 ? 32  TRP A HZ2  6  
ATOM 9445  H HZ3  . TRP A 1 32  ? 1.136   -14.315 8.553   1.00 0.00 ? 32  TRP A HZ3  6  
ATOM 9446  H HH2  . TRP A 1 32  ? 0.303   -12.706 10.189  1.00 0.00 ? 32  TRP A HH2  6  
ATOM 9447  N N    . PHE A 1 33  ? 4.009   -10.476 4.938   1.00 0.00 ? 33  PHE A N    6  
ATOM 9448  C CA   . PHE A 1 33  ? 3.696   -9.119  4.507   1.00 0.00 ? 33  PHE A CA   6  
ATOM 9449  C C    . PHE A 1 33  ? 2.815   -8.412  5.532   1.00 0.00 ? 33  PHE A C    6  
ATOM 9450  O O    . PHE A 1 33  ? 1.866   -8.994  6.059   1.00 0.00 ? 33  PHE A O    6  
ATOM 9451  C CB   . PHE A 1 33  ? 2.997   -9.142  3.146   1.00 0.00 ? 33  PHE A CB   6  
ATOM 9452  C CG   . PHE A 1 33  ? 3.945   -9.276  1.988   1.00 0.00 ? 33  PHE A CG   6  
ATOM 9453  C CD1  . PHE A 1 33  ? 4.357   -10.526 1.555   1.00 0.00 ? 33  PHE A CD1  6  
ATOM 9454  C CD2  . PHE A 1 33  ? 4.422   -8.153  1.333   1.00 0.00 ? 33  PHE A CD2  6  
ATOM 9455  C CE1  . PHE A 1 33  ? 5.229   -10.653 0.490   1.00 0.00 ? 33  PHE A CE1  6  
ATOM 9456  C CE2  . PHE A 1 33  ? 5.293   -8.274  0.266   1.00 0.00 ? 33  PHE A CE2  6  
ATOM 9457  C CZ   . PHE A 1 33  ? 5.698   -9.525  -0.155  1.00 0.00 ? 33  PHE A CZ   6  
ATOM 9458  H H    . PHE A 1 33  ? 3.290   -11.141 4.984   1.00 0.00 ? 33  PHE A H    6  
ATOM 9459  H HA   . PHE A 1 33  ? 4.626   -8.578  4.416   1.00 0.00 ? 33  PHE A HA   6  
ATOM 9460  H HB2  . PHE A 1 33  ? 2.314   -9.977  3.114   1.00 0.00 ? 33  PHE A HB2  6  
ATOM 9461  H HB3  . PHE A 1 33  ? 2.444   -8.224  3.018   1.00 0.00 ? 33  PHE A HB3  6  
ATOM 9462  H HD1  . PHE A 1 33  ? 3.991   -11.409 2.059   1.00 0.00 ? 33  PHE A HD1  6  
ATOM 9463  H HD2  . PHE A 1 33  ? 4.108   -7.173  1.661   1.00 0.00 ? 33  PHE A HD2  6  
ATOM 9464  H HE1  . PHE A 1 33  ? 5.543   -11.633 0.163   1.00 0.00 ? 33  PHE A HE1  6  
ATOM 9465  H HE2  . PHE A 1 33  ? 5.659   -7.390  -0.236  1.00 0.00 ? 33  PHE A HE2  6  
ATOM 9466  H HZ   . PHE A 1 33  ? 6.378   -9.623  -0.988  1.00 0.00 ? 33  PHE A HZ   6  
ATOM 9467  N N    . VAL A 1 34  ? 3.135   -7.152  5.811   1.00 0.00 ? 34  VAL A N    6  
ATOM 9468  C CA   . VAL A 1 34  ? 2.372   -6.364  6.772   1.00 0.00 ? 34  VAL A CA   6  
ATOM 9469  C C    . VAL A 1 34  ? 2.088   -4.966  6.235   1.00 0.00 ? 34  VAL A C    6  
ATOM 9470  O O    . VAL A 1 34  ? 2.951   -4.087  6.272   1.00 0.00 ? 34  VAL A O    6  
ATOM 9471  C CB   . VAL A 1 34  ? 3.117   -6.245  8.115   1.00 0.00 ? 34  VAL A CB   6  
ATOM 9472  C CG1  . VAL A 1 34  ? 2.340   -5.362  9.080   1.00 0.00 ? 34  VAL A CG1  6  
ATOM 9473  C CG2  . VAL A 1 34  ? 3.356   -7.622  8.715   1.00 0.00 ? 34  VAL A CG2  6  
ATOM 9474  H H    . VAL A 1 34  ? 3.901   -6.742  5.358   1.00 0.00 ? 34  VAL A H    6  
ATOM 9475  H HA   . VAL A 1 34  ? 1.434   -6.869  6.948   1.00 0.00 ? 34  VAL A HA   6  
ATOM 9476  H HB   . VAL A 1 34  ? 4.076   -5.783  7.933   1.00 0.00 ? 34  VAL A HB   6  
ATOM 9477  H HG11 . VAL A 1 34  ? 1.455   -5.885  9.413   1.00 0.00 ? 34  VAL A HG11 6  
ATOM 9478  H HG12 . VAL A 1 34  ? 2.961   -5.124  9.931   1.00 0.00 ? 34  VAL A HG12 6  
ATOM 9479  H HG13 . VAL A 1 34  ? 2.050   -4.450  8.579   1.00 0.00 ? 34  VAL A HG13 6  
ATOM 9480  H HG21 . VAL A 1 34  ? 3.365   -7.548  9.793   1.00 0.00 ? 34  VAL A HG21 6  
ATOM 9481  H HG22 . VAL A 1 34  ? 2.567   -8.292  8.407   1.00 0.00 ? 34  VAL A HG22 6  
ATOM 9482  H HG23 . VAL A 1 34  ? 4.306   -8.004  8.373   1.00 0.00 ? 34  VAL A HG23 6  
ATOM 9483  N N    . LEU A 1 35  ? 0.874   -4.766  5.735   1.00 0.00 ? 35  LEU A N    6  
ATOM 9484  C CA   . LEU A 1 35  ? 0.475   -3.473  5.190   1.00 0.00 ? 35  LEU A CA   6  
ATOM 9485  C C    . LEU A 1 35  ? 0.486   -2.398  6.272   1.00 0.00 ? 35  LEU A C    6  
ATOM 9486  O O    . LEU A 1 35  ? -0.154  -2.544  7.314   1.00 0.00 ? 35  LEU A O    6  
ATOM 9487  C CB   . LEU A 1 35  ? -0.919  -3.569  4.566   1.00 0.00 ? 35  LEU A CB   6  
ATOM 9488  C CG   . LEU A 1 35  ? -1.657  -2.245  4.366   1.00 0.00 ? 35  LEU A CG   6  
ATOM 9489  C CD1  . LEU A 1 35  ? -0.955  -1.395  3.319   1.00 0.00 ? 35  LEU A CD1  6  
ATOM 9490  C CD2  . LEU A 1 35  ? -3.105  -2.497  3.968   1.00 0.00 ? 35  LEU A CD2  6  
ATOM 9491  H H    . LEU A 1 35  ? 0.230   -5.504  5.733   1.00 0.00 ? 35  LEU A H    6  
ATOM 9492  H HA   . LEU A 1 35  ? 1.186   -3.203  4.423   1.00 0.00 ? 35  LEU A HA   6  
ATOM 9493  H HB2  . LEU A 1 35  ? -0.816  -4.040  3.600   1.00 0.00 ? 35  LEU A HB2  6  
ATOM 9494  H HB3  . LEU A 1 35  ? -1.525  -4.194  5.206   1.00 0.00 ? 35  LEU A HB3  6  
ATOM 9495  H HG   . LEU A 1 35  ? -1.656  -1.696  5.297   1.00 0.00 ? 35  LEU A HG   6  
ATOM 9496  H HD11 . LEU A 1 35  ? -0.547  -0.512  3.787   1.00 0.00 ? 35  LEU A HD11 6  
ATOM 9497  H HD12 . LEU A 1 35  ? -1.663  -1.104  2.557   1.00 0.00 ? 35  LEU A HD12 6  
ATOM 9498  H HD13 . LEU A 1 35  ? -0.157  -1.966  2.868   1.00 0.00 ? 35  LEU A HD13 6  
ATOM 9499  H HD21 . LEU A 1 35  ? -3.188  -3.474  3.515   1.00 0.00 ? 35  LEU A HD21 6  
ATOM 9500  H HD22 . LEU A 1 35  ? -3.419  -1.744  3.260   1.00 0.00 ? 35  LEU A HD22 6  
ATOM 9501  H HD23 . LEU A 1 35  ? -3.732  -2.452  4.846   1.00 0.00 ? 35  LEU A HD23 6  
ATOM 9502  N N    . VAL A 1 36  ? 1.217   -1.317  6.018   1.00 0.00 ? 36  VAL A N    6  
ATOM 9503  C CA   . VAL A 1 36  ? 1.310   -0.216  6.969   1.00 0.00 ? 36  VAL A CA   6  
ATOM 9504  C C    . VAL A 1 36  ? 0.673   1.050   6.407   1.00 0.00 ? 36  VAL A C    6  
ATOM 9505  O O    . VAL A 1 36  ? 0.064   1.029   5.337   1.00 0.00 ? 36  VAL A O    6  
ATOM 9506  C CB   . VAL A 1 36  ? 2.774   0.081   7.342   1.00 0.00 ? 36  VAL A CB   6  
ATOM 9507  C CG1  . VAL A 1 36  ? 3.374   1.099   6.383   1.00 0.00 ? 36  VAL A CG1  6  
ATOM 9508  C CG2  . VAL A 1 36  ? 2.868   0.571   8.779   1.00 0.00 ? 36  VAL A CG2  6  
ATOM 9509  H H    . VAL A 1 36  ? 1.705   -1.259  5.170   1.00 0.00 ? 36  VAL A H    6  
ATOM 9510  H HA   . VAL A 1 36  ? 0.783   -0.505  7.866   1.00 0.00 ? 36  VAL A HA   6  
ATOM 9511  H HB   . VAL A 1 36  ? 3.339   -0.835  7.258   1.00 0.00 ? 36  VAL A HB   6  
ATOM 9512  H HG11 . VAL A 1 36  ? 2.807   1.104   5.464   1.00 0.00 ? 36  VAL A HG11 6  
ATOM 9513  H HG12 . VAL A 1 36  ? 3.341   2.080   6.833   1.00 0.00 ? 36  VAL A HG12 6  
ATOM 9514  H HG13 . VAL A 1 36  ? 4.399   0.833   6.172   1.00 0.00 ? 36  VAL A HG13 6  
ATOM 9515  H HG21 . VAL A 1 36  ? 3.174   1.607   8.787   1.00 0.00 ? 36  VAL A HG21 6  
ATOM 9516  H HG22 . VAL A 1 36  ? 1.903   0.477   9.256   1.00 0.00 ? 36  VAL A HG22 6  
ATOM 9517  H HG23 . VAL A 1 36  ? 3.593   -0.023  9.316   1.00 0.00 ? 36  VAL A HG23 6  
ATOM 9518  N N    . ASP A 1 37  ? 0.818   2.152   7.135   1.00 0.00 ? 37  ASP A N    6  
ATOM 9519  C CA   . ASP A 1 37  ? 0.258   3.429   6.708   1.00 0.00 ? 37  ASP A CA   6  
ATOM 9520  C C    . ASP A 1 37  ? 0.778   3.817   5.328   1.00 0.00 ? 37  ASP A C    6  
ATOM 9521  O O    . ASP A 1 37  ? 1.987   3.890   5.107   1.00 0.00 ? 37  ASP A O    6  
ATOM 9522  C CB   . ASP A 1 37  ? 0.599   4.523   7.721   1.00 0.00 ? 37  ASP A CB   6  
ATOM 9523  C CG   . ASP A 1 37  ? -0.466  5.600   7.791   1.00 0.00 ? 37  ASP A CG   6  
ATOM 9524  O OD1  . ASP A 1 37  ? -1.594  5.291   8.228   1.00 0.00 ? 37  ASP A OD1  6  
ATOM 9525  O OD2  . ASP A 1 37  ? -0.170  6.752   7.410   1.00 0.00 ? 37  ASP A OD2  6  
ATOM 9526  H H    . ASP A 1 37  ? 1.314   2.105   7.979   1.00 0.00 ? 37  ASP A H    6  
ATOM 9527  H HA   . ASP A 1 37  ? -0.815  3.320   6.658   1.00 0.00 ? 37  ASP A HA   6  
ATOM 9528  H HB2  . ASP A 1 37  ? 0.700   4.079   8.701   1.00 0.00 ? 37  ASP A HB2  6  
ATOM 9529  H HB3  . ASP A 1 37  ? 1.535   4.984   7.441   1.00 0.00 ? 37  ASP A HB3  6  
ATOM 9530  N N    . ARG A 1 38  ? -0.143  4.062   4.402   1.00 0.00 ? 38  ARG A N    6  
ATOM 9531  C CA   . ARG A 1 38  ? 0.223   4.440   3.042   1.00 0.00 ? 38  ARG A CA   6  
ATOM 9532  C C    . ARG A 1 38  ? 1.529   3.771   2.625   1.00 0.00 ? 38  ARG A C    6  
ATOM 9533  O O    . ARG A 1 38  ? 2.341   4.363   1.912   1.00 0.00 ? 38  ARG A O    6  
ATOM 9534  C CB   . ARG A 1 38  ? 0.357   5.960   2.930   1.00 0.00 ? 38  ARG A CB   6  
ATOM 9535  C CG   . ARG A 1 38  ? -0.960  6.701   3.095   1.00 0.00 ? 38  ARG A CG   6  
ATOM 9536  C CD   . ARG A 1 38  ? -0.973  7.996   2.298   1.00 0.00 ? 38  ARG A CD   6  
ATOM 9537  N NE   . ARG A 1 38  ? -1.855  8.996   2.894   1.00 0.00 ? 38  ARG A NE   6  
ATOM 9538  C CZ   . ARG A 1 38  ? -1.737  10.302  2.680   1.00 0.00 ? 38  ARG A CZ   6  
ATOM 9539  N NH1  . ARG A 1 38  ? -0.779  10.763  1.888   1.00 0.00 ? 38  ARG A NH1  6  
ATOM 9540  N NH2  . ARG A 1 38  ? -2.579  11.149  3.258   1.00 0.00 ? 38  ARG A NH2  6  
ATOM 9541  H H    . ARG A 1 38  ? -1.091  3.987   4.638   1.00 0.00 ? 38  ARG A H    6  
ATOM 9542  H HA   . ARG A 1 38  ? -0.565  4.108   2.382   1.00 0.00 ? 38  ARG A HA   6  
ATOM 9543  H HB2  . ARG A 1 38  ? 1.037   6.306   3.694   1.00 0.00 ? 38  ARG A HB2  6  
ATOM 9544  H HB3  . ARG A 1 38  ? 0.763   6.203   1.960   1.00 0.00 ? 38  ARG A HB3  6  
ATOM 9545  H HG2  . ARG A 1 38  ? -1.764  6.069   2.747   1.00 0.00 ? 38  ARG A HG2  6  
ATOM 9546  H HG3  . ARG A 1 38  ? -1.105  6.930   4.140   1.00 0.00 ? 38  ARG A HG3  6  
ATOM 9547  H HD2  . ARG A 1 38  ? 0.031   8.392   2.263   1.00 0.00 ? 38  ARG A HD2  6  
ATOM 9548  H HD3  . ARG A 1 38  ? -1.312  7.783   1.295   1.00 0.00 ? 38  ARG A HD3  6  
ATOM 9549  H HE   . ARG A 1 38  ? -2.571  8.677   3.483   1.00 0.00 ? 38  ARG A HE   6  
ATOM 9550  H HH11 . ARG A 1 38  ? -0.144  10.126  1.450   1.00 0.00 ? 38  ARG A HH11 6  
ATOM 9551  H HH12 . ARG A 1 38  ? -0.693  11.746  1.727   1.00 0.00 ? 38  ARG A HH12 6  
ATOM 9552  H HH21 . ARG A 1 38  ? -3.302  10.805  3.856   1.00 0.00 ? 38  ARG A HH21 6  
ATOM 9553  H HH22 . ARG A 1 38  ? -2.489  12.131  3.096   1.00 0.00 ? 38  ARG A HH22 6  
ATOM 9554  N N    . CYS A 1 39  ? 1.725   2.536   3.073   1.00 0.00 ? 39  CYS A N    6  
ATOM 9555  C CA   . CYS A 1 39  ? 2.934   1.788   2.748   1.00 0.00 ? 39  CYS A CA   6  
ATOM 9556  C C    . CYS A 1 39  ? 2.806   0.332   3.184   1.00 0.00 ? 39  CYS A C    6  
ATOM 9557  O O    . CYS A 1 39  ? 1.845   -0.043  3.858   1.00 0.00 ? 39  CYS A O    6  
ATOM 9558  C CB   . CYS A 1 39  ? 4.151   2.428   3.416   1.00 0.00 ? 39  CYS A CB   6  
ATOM 9559  S SG   . CYS A 1 39  ? 5.689   2.240   2.485   1.00 0.00 ? 39  CYS A SG   6  
ATOM 9560  H H    . CYS A 1 39  ? 1.042   2.118   3.637   1.00 0.00 ? 39  CYS A H    6  
ATOM 9561  H HA   . CYS A 1 39  ? 3.064   1.819   1.677   1.00 0.00 ? 39  CYS A HA   6  
ATOM 9562  H HB2  . CYS A 1 39  ? 3.970   3.485   3.540   1.00 0.00 ? 39  CYS A HB2  6  
ATOM 9563  H HB3  . CYS A 1 39  ? 4.296   1.979   4.388   1.00 0.00 ? 39  CYS A HB3  6  
ATOM 9564  H HG   . CYS A 1 39  ? 6.639   1.877   3.333   1.00 0.00 ? 39  CYS A HG   6  
ATOM 9565  N N    . LEU A 1 40  ? 3.778   -0.485  2.795   1.00 0.00 ? 40  LEU A N    6  
ATOM 9566  C CA   . LEU A 1 40  ? 3.774   -1.901  3.144   1.00 0.00 ? 40  LEU A CA   6  
ATOM 9567  C C    . LEU A 1 40  ? 5.195   -2.415  3.351   1.00 0.00 ? 40  LEU A C    6  
ATOM 9568  O O    . LEU A 1 40  ? 6.121   -2.014  2.645   1.00 0.00 ? 40  LEU A O    6  
ATOM 9569  C CB   . LEU A 1 40  ? 3.079   -2.714  2.051   1.00 0.00 ? 40  LEU A CB   6  
ATOM 9570  C CG   . LEU A 1 40  ? 3.401   -4.209  2.019   1.00 0.00 ? 40  LEU A CG   6  
ATOM 9571  C CD1  . LEU A 1 40  ? 2.601   -4.950  3.078   1.00 0.00 ? 40  LEU A CD1  6  
ATOM 9572  C CD2  . LEU A 1 40  ? 3.123   -4.785  0.638   1.00 0.00 ? 40  LEU A CD2  6  
ATOM 9573  H H    . LEU A 1 40  ? 4.517   -0.128  2.260   1.00 0.00 ? 40  LEU A H    6  
ATOM 9574  H HA   . LEU A 1 40  ? 3.226   -2.013  4.068   1.00 0.00 ? 40  LEU A HA   6  
ATOM 9575  H HB2  . LEU A 1 40  ? 2.014   -2.609  2.187   1.00 0.00 ? 40  LEU A HB2  6  
ATOM 9576  H HB3  . LEU A 1 40  ? 3.362   -2.293  1.096   1.00 0.00 ? 40  LEU A HB3  6  
ATOM 9577  H HG   . LEU A 1 40  ? 4.451   -4.349  2.235   1.00 0.00 ? 40  LEU A HG   6  
ATOM 9578  H HD11 . LEU A 1 40  ? 2.784   -6.011  2.991   1.00 0.00 ? 40  LEU A HD11 6  
ATOM 9579  H HD12 . LEU A 1 40  ? 1.549   -4.753  2.939   1.00 0.00 ? 40  LEU A HD12 6  
ATOM 9580  H HD13 . LEU A 1 40  ? 2.903   -4.612  4.059   1.00 0.00 ? 40  LEU A HD13 6  
ATOM 9581  H HD21 . LEU A 1 40  ? 3.788   -5.616  0.454   1.00 0.00 ? 40  LEU A HD21 6  
ATOM 9582  H HD22 . LEU A 1 40  ? 3.286   -4.022  -0.110  1.00 0.00 ? 40  LEU A HD22 6  
ATOM 9583  H HD23 . LEU A 1 40  ? 2.099   -5.124  0.589   1.00 0.00 ? 40  LEU A HD23 6  
ATOM 9584  N N    . PHE A 1 41  ? 5.361   -3.308  4.321   1.00 0.00 ? 41  PHE A N    6  
ATOM 9585  C CA   . PHE A 1 41  ? 6.669   -3.879  4.620   1.00 0.00 ? 41  PHE A CA   6  
ATOM 9586  C C    . PHE A 1 41  ? 6.597   -5.402  4.682   1.00 0.00 ? 41  PHE A C    6  
ATOM 9587  O O    . PHE A 1 41  ? 5.563   -5.971  5.031   1.00 0.00 ? 41  PHE A O    6  
ATOM 9588  C CB   . PHE A 1 41  ? 7.199   -3.328  5.946   1.00 0.00 ? 41  PHE A CB   6  
ATOM 9589  C CG   . PHE A 1 41  ? 7.576   -1.875  5.883   1.00 0.00 ? 41  PHE A CG   6  
ATOM 9590  C CD1  . PHE A 1 41  ? 8.823   -1.490  5.418   1.00 0.00 ? 41  PHE A CD1  6  
ATOM 9591  C CD2  . PHE A 1 41  ? 6.684   -0.896  6.289   1.00 0.00 ? 41  PHE A CD2  6  
ATOM 9592  C CE1  . PHE A 1 41  ? 9.173   -0.154  5.360   1.00 0.00 ? 41  PHE A CE1  6  
ATOM 9593  C CE2  . PHE A 1 41  ? 7.029   0.441   6.234   1.00 0.00 ? 41  PHE A CE2  6  
ATOM 9594  C CZ   . PHE A 1 41  ? 8.275   0.813   5.767   1.00 0.00 ? 41  PHE A CZ   6  
ATOM 9595  H H    . PHE A 1 41  ? 4.584   -3.589  4.850   1.00 0.00 ? 41  PHE A H    6  
ATOM 9596  H HA   . PHE A 1 41  ? 7.343   -3.594  3.827   1.00 0.00 ? 41  PHE A HA   6  
ATOM 9597  H HB2  . PHE A 1 41  ? 6.438   -3.440  6.703   1.00 0.00 ? 41  PHE A HB2  6  
ATOM 9598  H HB3  . PHE A 1 41  ? 8.075   -3.888  6.235   1.00 0.00 ? 41  PHE A HB3  6  
ATOM 9599  H HD1  . PHE A 1 41  ? 9.526   -2.244  5.098   1.00 0.00 ? 41  PHE A HD1  6  
ATOM 9600  H HD2  . PHE A 1 41  ? 5.709   -1.186  6.654   1.00 0.00 ? 41  PHE A HD2  6  
ATOM 9601  H HE1  . PHE A 1 41  ? 10.148  0.134   4.995   1.00 0.00 ? 41  PHE A HE1  6  
ATOM 9602  H HE2  . PHE A 1 41  ? 6.324   1.195   6.553   1.00 0.00 ? 41  PHE A HE2  6  
ATOM 9603  H HZ   . PHE A 1 41  ? 8.546   1.857   5.723   1.00 0.00 ? 41  PHE A HZ   6  
ATOM 9604  N N    . TYR A 1 42  ? 7.702   -6.054  4.339   1.00 0.00 ? 42  TYR A N    6  
ATOM 9605  C CA   . TYR A 1 42  ? 7.764   -7.511  4.352   1.00 0.00 ? 42  TYR A CA   6  
ATOM 9606  C C    . TYR A 1 42  ? 9.008   -7.997  5.090   1.00 0.00 ? 42  TYR A C    6  
ATOM 9607  O O    . TYR A 1 42  ? 10.062  -7.362  5.038   1.00 0.00 ? 42  TYR A O    6  
ATOM 9608  C CB   . TYR A 1 42  ? 7.760   -8.055  2.922   1.00 0.00 ? 42  TYR A CB   6  
ATOM 9609  C CG   . TYR A 1 42  ? 9.023   -7.743  2.152   1.00 0.00 ? 42  TYR A CG   6  
ATOM 9610  C CD1  . TYR A 1 42  ? 10.108  -8.611  2.177   1.00 0.00 ? 42  TYR A CD1  6  
ATOM 9611  C CD2  . TYR A 1 42  ? 9.132   -6.581  1.399   1.00 0.00 ? 42  TYR A CD2  6  
ATOM 9612  C CE1  . TYR A 1 42  ? 11.264  -8.329  1.476   1.00 0.00 ? 42  TYR A CE1  6  
ATOM 9613  C CE2  . TYR A 1 42  ? 10.284  -6.291  0.693   1.00 0.00 ? 42  TYR A CE2  6  
ATOM 9614  C CZ   . TYR A 1 42  ? 11.347  -7.169  0.735   1.00 0.00 ? 42  TYR A CZ   6  
ATOM 9615  O OH   . TYR A 1 42  ? 12.497  -6.885  0.034   1.00 0.00 ? 42  TYR A OH   6  
ATOM 9616  H H    . TYR A 1 42  ? 8.494   -5.545  4.069   1.00 0.00 ? 42  TYR A H    6  
ATOM 9617  H HA   . TYR A 1 42  ? 6.888   -7.876  4.868   1.00 0.00 ? 42  TYR A HA   6  
ATOM 9618  H HB2  . TYR A 1 42  ? 7.648   -9.128  2.953   1.00 0.00 ? 42  TYR A HB2  6  
ATOM 9619  H HB3  . TYR A 1 42  ? 6.928   -7.627  2.383   1.00 0.00 ? 42  TYR A HB3  6  
ATOM 9620  H HD1  . TYR A 1 42  ? 10.040  -9.520  2.758   1.00 0.00 ? 42  TYR A HD1  6  
ATOM 9621  H HD2  . TYR A 1 42  ? 8.297   -5.895  1.368   1.00 0.00 ? 42  TYR A HD2  6  
ATOM 9622  H HE1  . TYR A 1 42  ? 12.097  -9.016  1.508   1.00 0.00 ? 42  TYR A HE1  6  
ATOM 9623  H HE2  . TYR A 1 42  ? 10.349  -5.383  0.114   1.00 0.00 ? 42  TYR A HE2  6  
ATOM 9624  H HH   . TYR A 1 42  ? 12.955  -7.703  -0.174  1.00 0.00 ? 42  TYR A HH   6  
ATOM 9625  N N    . TYR A 1 43  ? 8.877   -9.127  5.776   1.00 0.00 ? 43  TYR A N    6  
ATOM 9626  C CA   . TYR A 1 43  ? 9.989   -9.698  6.527   1.00 0.00 ? 43  TYR A CA   6  
ATOM 9627  C C    . TYR A 1 43  ? 10.167  -11.176 6.195   1.00 0.00 ? 43  TYR A C    6  
ATOM 9628  O O    . TYR A 1 43  ? 9.237   -11.838 5.733   1.00 0.00 ? 43  TYR A O    6  
ATOM 9629  C CB   . TYR A 1 43  ? 9.760   -9.524  8.029   1.00 0.00 ? 43  TYR A CB   6  
ATOM 9630  C CG   . TYR A 1 43  ? 9.215   -8.165  8.405   1.00 0.00 ? 43  TYR A CG   6  
ATOM 9631  C CD1  . TYR A 1 43  ? 7.897   -7.822  8.133   1.00 0.00 ? 43  TYR A CD1  6  
ATOM 9632  C CD2  . TYR A 1 43  ? 10.020  -7.223  9.035   1.00 0.00 ? 43  TYR A CD2  6  
ATOM 9633  C CE1  . TYR A 1 43  ? 7.396   -6.581  8.474   1.00 0.00 ? 43  TYR A CE1  6  
ATOM 9634  C CE2  . TYR A 1 43  ? 9.527   -5.980  9.382   1.00 0.00 ? 43  TYR A CE2  6  
ATOM 9635  C CZ   . TYR A 1 43  ? 8.215   -5.663  9.099   1.00 0.00 ? 43  TYR A CZ   6  
ATOM 9636  O OH   . TYR A 1 43  ? 7.719   -4.426  9.442   1.00 0.00 ? 43  TYR A OH   6  
ATOM 9637  H H    . TYR A 1 43  ? 8.012   -9.587  5.779   1.00 0.00 ? 43  TYR A H    6  
ATOM 9638  H HA   . TYR A 1 43  ? 10.886  -9.167  6.245   1.00 0.00 ? 43  TYR A HA   6  
ATOM 9639  H HB2  . TYR A 1 43  ? 9.055   -10.268 8.367   1.00 0.00 ? 43  TYR A HB2  6  
ATOM 9640  H HB3  . TYR A 1 43  ? 10.697  -9.662  8.547   1.00 0.00 ? 43  TYR A HB3  6  
ATOM 9641  H HD1  . TYR A 1 43  ? 7.258   -8.544  7.644   1.00 0.00 ? 43  TYR A HD1  6  
ATOM 9642  H HD2  . TYR A 1 43  ? 11.048  -7.474  9.255   1.00 0.00 ? 43  TYR A HD2  6  
ATOM 9643  H HE1  . TYR A 1 43  ? 6.368   -6.333  8.253   1.00 0.00 ? 43  TYR A HE1  6  
ATOM 9644  H HE2  . TYR A 1 43  ? 10.168  -5.261  9.870   1.00 0.00 ? 43  TYR A HE2  6  
ATOM 9645  H HH   . TYR A 1 43  ? 8.448   -3.822  9.600   1.00 0.00 ? 43  TYR A HH   6  
ATOM 9646  N N    . LYS A 1 44  ? 11.369  -11.689 6.436   1.00 0.00 ? 44  LYS A N    6  
ATOM 9647  C CA   . LYS A 1 44  ? 11.672  -13.090 6.166   1.00 0.00 ? 44  LYS A CA   6  
ATOM 9648  C C    . LYS A 1 44  ? 10.616  -14.003 6.781   1.00 0.00 ? 44  LYS A C    6  
ATOM 9649  O O    . LYS A 1 44  ? 10.211  -14.995 6.175   1.00 0.00 ? 44  LYS A O    6  
ATOM 9650  C CB   . LYS A 1 44  ? 13.054  -13.449 6.716   1.00 0.00 ? 44  LYS A CB   6  
ATOM 9651  C CG   . LYS A 1 44  ? 13.756  -14.542 5.929   1.00 0.00 ? 44  LYS A CG   6  
ATOM 9652  C CD   . LYS A 1 44  ? 14.242  -14.035 4.581   1.00 0.00 ? 44  LYS A CD   6  
ATOM 9653  C CE   . LYS A 1 44  ? 15.475  -14.792 4.113   1.00 0.00 ? 44  LYS A CE   6  
ATOM 9654  N NZ   . LYS A 1 44  ? 16.692  -14.395 4.874   1.00 0.00 ? 44  LYS A NZ   6  
ATOM 9655  H H    . LYS A 1 44  ? 12.069  -11.111 6.805   1.00 0.00 ? 44  LYS A H    6  
ATOM 9656  H HA   . LYS A 1 44  ? 11.672  -13.229 5.096   1.00 0.00 ? 44  LYS A HA   6  
ATOM 9657  H HB2  . LYS A 1 44  ? 13.676  -12.566 6.698   1.00 0.00 ? 44  LYS A HB2  6  
ATOM 9658  H HB3  . LYS A 1 44  ? 12.946  -13.783 7.738   1.00 0.00 ? 44  LYS A HB3  6  
ATOM 9659  H HG2  . LYS A 1 44  ? 14.605  -14.893 6.497   1.00 0.00 ? 44  LYS A HG2  6  
ATOM 9660  H HG3  . LYS A 1 44  ? 13.065  -15.358 5.769   1.00 0.00 ? 44  LYS A HG3  6  
ATOM 9661  H HD2  . LYS A 1 44  ? 13.455  -14.165 3.853   1.00 0.00 ? 44  LYS A HD2  6  
ATOM 9662  H HD3  . LYS A 1 44  ? 14.485  -12.986 4.668   1.00 0.00 ? 44  LYS A HD3  6  
ATOM 9663  H HE2  . LYS A 1 44  ? 15.305  -15.849 4.247   1.00 0.00 ? 44  LYS A HE2  6  
ATOM 9664  H HE3  . LYS A 1 44  ? 15.632  -14.583 3.065   1.00 0.00 ? 44  LYS A HE3  6  
ATOM 9665  H HZ1  . LYS A 1 44  ? 17.427  -15.125 4.778   1.00 0.00 ? 44  LYS A HZ1  6  
ATOM 9666  H HZ2  . LYS A 1 44  ? 16.461  -14.283 5.882   1.00 0.00 ? 44  LYS A HZ2  6  
ATOM 9667  H HZ3  . LYS A 1 44  ? 17.062  -13.494 4.512   1.00 0.00 ? 44  LYS A HZ3  6  
ATOM 9668  N N    . ASP A 1 45  ? 10.173  -13.661 7.986   1.00 0.00 ? 45  ASP A N    6  
ATOM 9669  C CA   . ASP A 1 45  ? 9.162   -14.448 8.681   1.00 0.00 ? 45  ASP A CA   6  
ATOM 9670  C C    . ASP A 1 45  ? 8.394   -13.588 9.679   1.00 0.00 ? 45  ASP A C    6  
ATOM 9671  O O    . ASP A 1 45  ? 8.621   -12.382 9.777   1.00 0.00 ? 45  ASP A O    6  
ATOM 9672  C CB   . ASP A 1 45  ? 9.812   -15.630 9.403   1.00 0.00 ? 45  ASP A CB   6  
ATOM 9673  C CG   . ASP A 1 45  ? 11.219  -15.317 9.874   1.00 0.00 ? 45  ASP A CG   6  
ATOM 9674  O OD1  . ASP A 1 45  ? 11.455  -14.175 10.319  1.00 0.00 ? 45  ASP A OD1  6  
ATOM 9675  O OD2  . ASP A 1 45  ? 12.084  -16.215 9.796   1.00 0.00 ? 45  ASP A OD2  6  
ATOM 9676  H H    . ASP A 1 45  ? 10.535  -12.858 8.418   1.00 0.00 ? 45  ASP A H    6  
ATOM 9677  H HA   . ASP A 1 45  ? 8.470   -14.826 7.943   1.00 0.00 ? 45  ASP A HA   6  
ATOM 9678  H HB2  . ASP A 1 45  ? 9.214   -15.891 10.264  1.00 0.00 ? 45  ASP A HB2  6  
ATOM 9679  H HB3  . ASP A 1 45  ? 9.856   -16.474 8.730   1.00 0.00 ? 45  ASP A HB3  6  
ATOM 9680  N N    . GLU A 1 46  ? 7.483   -14.215 10.417  1.00 0.00 ? 46  GLU A N    6  
ATOM 9681  C CA   . GLU A 1 46  ? 6.681   -13.505 11.406  1.00 0.00 ? 46  GLU A CA   6  
ATOM 9682  C C    . GLU A 1 46  ? 7.563   -12.646 12.307  1.00 0.00 ? 46  GLU A C    6  
ATOM 9683  O O    . GLU A 1 46  ? 7.215   -11.512 12.637  1.00 0.00 ? 46  GLU A O    6  
ATOM 9684  C CB   . GLU A 1 46  ? 5.881   -14.497 12.253  1.00 0.00 ? 46  GLU A CB   6  
ATOM 9685  C CG   . GLU A 1 46  ? 6.732   -15.589 12.879  1.00 0.00 ? 46  GLU A CG   6  
ATOM 9686  C CD   . GLU A 1 46  ? 7.263   -15.203 14.246  1.00 0.00 ? 46  GLU A CD   6  
ATOM 9687  O OE1  . GLU A 1 46  ? 6.585   -14.425 14.948  1.00 0.00 ? 46  GLU A OE1  6  
ATOM 9688  O OE2  . GLU A 1 46  ? 8.356   -15.681 14.613  1.00 0.00 ? 46  GLU A OE2  6  
ATOM 9689  H H    . GLU A 1 46  ? 7.348   -15.178 10.293  1.00 0.00 ? 46  GLU A H    6  
ATOM 9690  H HA   . GLU A 1 46  ? 5.994   -12.863 10.876  1.00 0.00 ? 46  GLU A HA   6  
ATOM 9691  H HB2  . GLU A 1 46  ? 5.384   -13.956 13.046  1.00 0.00 ? 46  GLU A HB2  6  
ATOM 9692  H HB3  . GLU A 1 46  ? 5.135   -14.965 11.628  1.00 0.00 ? 46  GLU A HB3  6  
ATOM 9693  H HG2  . GLU A 1 46  ? 6.133   -16.481 12.981  1.00 0.00 ? 46  GLU A HG2  6  
ATOM 9694  H HG3  . GLU A 1 46  ? 7.570   -15.792 12.228  1.00 0.00 ? 46  GLU A HG3  6  
ATOM 9695  N N    . LYS A 1 47  ? 8.707   -13.194 12.702  1.00 0.00 ? 47  LYS A N    6  
ATOM 9696  C CA   . LYS A 1 47  ? 9.640   -12.479 13.565  1.00 0.00 ? 47  LYS A CA   6  
ATOM 9697  C C    . LYS A 1 47  ? 9.676   -10.995 13.216  1.00 0.00 ? 47  LYS A C    6  
ATOM 9698  O O    . LYS A 1 47  ? 9.908   -10.151 14.081  1.00 0.00 ? 47  LYS A O    6  
ATOM 9699  C CB   . LYS A 1 47  ? 11.043  -13.078 13.438  1.00 0.00 ? 47  LYS A CB   6  
ATOM 9700  C CG   . LYS A 1 47  ? 11.141  -14.510 13.935  1.00 0.00 ? 47  LYS A CG   6  
ATOM 9701  C CD   . LYS A 1 47  ? 12.561  -14.864 14.341  1.00 0.00 ? 47  LYS A CD   6  
ATOM 9702  C CE   . LYS A 1 47  ? 12.660  -16.302 14.828  1.00 0.00 ? 47  LYS A CE   6  
ATOM 9703  N NZ   . LYS A 1 47  ? 12.326  -17.276 13.752  1.00 0.00 ? 47  LYS A NZ   6  
ATOM 9704  H H    . LYS A 1 47  ? 8.929   -14.102 12.406  1.00 0.00 ? 47  LYS A H    6  
ATOM 9705  H HA   . LYS A 1 47  ? 9.302   -12.589 14.584  1.00 0.00 ? 47  LYS A HA   6  
ATOM 9706  H HB2  . LYS A 1 47  ? 11.338  -13.058 12.399  1.00 0.00 ? 47  LYS A HB2  6  
ATOM 9707  H HB3  . LYS A 1 47  ? 11.732  -12.473 14.010  1.00 0.00 ? 47  LYS A HB3  6  
ATOM 9708  H HG2  . LYS A 1 47  ? 10.493  -14.630 14.791  1.00 0.00 ? 47  LYS A HG2  6  
ATOM 9709  H HG3  . LYS A 1 47  ? 10.824  -15.177 13.145  1.00 0.00 ? 47  LYS A HG3  6  
ATOM 9710  H HD2  . LYS A 1 47  ? 13.212  -14.739 13.488  1.00 0.00 ? 47  LYS A HD2  6  
ATOM 9711  H HD3  . LYS A 1 47  ? 12.875  -14.202 15.135  1.00 0.00 ? 47  LYS A HD3  6  
ATOM 9712  H HE2  . LYS A 1 47  ? 13.668  -16.485 15.167  1.00 0.00 ? 47  LYS A HE2  6  
ATOM 9713  H HE3  . LYS A 1 47  ? 11.973  -16.437 15.650  1.00 0.00 ? 47  LYS A HE3  6  
ATOM 9714  H HZ1  . LYS A 1 47  ? 12.571  -18.240 14.055  1.00 0.00 ? 47  LYS A HZ1  6  
ATOM 9715  H HZ2  . LYS A 1 47  ? 12.859  -17.051 12.888  1.00 0.00 ? 47  LYS A HZ2  6  
ATOM 9716  H HZ3  . LYS A 1 47  ? 11.309  -17.238 13.539  1.00 0.00 ? 47  LYS A HZ3  6  
ATOM 9717  N N    . GLU A 1 48  ? 9.444   -10.685 11.944  1.00 0.00 ? 48  GLU A N    6  
ATOM 9718  C CA   . GLU A 1 48  ? 9.449   -9.301  11.483  1.00 0.00 ? 48  GLU A CA   6  
ATOM 9719  C C    . GLU A 1 48  ? 10.423  -8.459  12.302  1.00 0.00 ? 48  GLU A C    6  
ATOM 9720  O O    . GLU A 1 48  ? 10.089  -7.359  12.741  1.00 0.00 ? 48  GLU A O    6  
ATOM 9721  C CB   . GLU A 1 48  ? 8.042   -8.706  11.571  1.00 0.00 ? 48  GLU A CB   6  
ATOM 9722  C CG   . GLU A 1 48  ? 7.559   -8.496  12.996  1.00 0.00 ? 48  GLU A CG   6  
ATOM 9723  C CD   . GLU A 1 48  ? 6.046   -8.501  13.106  1.00 0.00 ? 48  GLU A CD   6  
ATOM 9724  O OE1  . GLU A 1 48  ? 5.459   -9.601  13.158  1.00 0.00 ? 48  GLU A OE1  6  
ATOM 9725  O OE2  . GLU A 1 48  ? 5.451   -7.404  13.140  1.00 0.00 ? 48  GLU A OE2  6  
ATOM 9726  H H    . GLU A 1 48  ? 9.265   -11.403 11.302  1.00 0.00 ? 48  GLU A H    6  
ATOM 9727  H HA   . GLU A 1 48  ? 9.767   -9.297  10.452  1.00 0.00 ? 48  GLU A HA   6  
ATOM 9728  H HB2  . GLU A 1 48  ? 8.036   -7.751  11.066  1.00 0.00 ? 48  GLU A HB2  6  
ATOM 9729  H HB3  . GLU A 1 48  ? 7.352   -9.370  11.073  1.00 0.00 ? 48  GLU A HB3  6  
ATOM 9730  H HG2  . GLU A 1 48  ? 7.952   -9.287  13.617  1.00 0.00 ? 48  GLU A HG2  6  
ATOM 9731  H HG3  . GLU A 1 48  ? 7.927   -7.545  13.352  1.00 0.00 ? 48  GLU A HG3  6  
ATOM 9732  N N    . GLU A 1 49  ? 11.627  -8.984  12.503  1.00 0.00 ? 49  GLU A N    6  
ATOM 9733  C CA   . GLU A 1 49  ? 12.648  -8.281  13.270  1.00 0.00 ? 49  GLU A CA   6  
ATOM 9734  C C    . GLU A 1 49  ? 13.345  -7.228  12.412  1.00 0.00 ? 49  GLU A C    6  
ATOM 9735  O O    . GLU A 1 49  ? 13.412  -6.056  12.781  1.00 0.00 ? 49  GLU A O    6  
ATOM 9736  C CB   . GLU A 1 49  ? 13.679  -9.271  13.817  1.00 0.00 ? 49  GLU A CB   6  
ATOM 9737  C CG   . GLU A 1 49  ? 13.197  -10.038 15.037  1.00 0.00 ? 49  GLU A CG   6  
ATOM 9738  C CD   . GLU A 1 49  ? 13.021  -9.149  16.253  1.00 0.00 ? 49  GLU A CD   6  
ATOM 9739  O OE1  . GLU A 1 49  ? 13.917  -8.320  16.516  1.00 0.00 ? 49  GLU A OE1  6  
ATOM 9740  O OE2  . GLU A 1 49  ? 11.988  -9.282  16.942  1.00 0.00 ? 49  GLU A OE2  6  
ATOM 9741  H H    . GLU A 1 49  ? 11.833  -9.865  12.127  1.00 0.00 ? 49  GLU A H    6  
ATOM 9742  H HA   . GLU A 1 49  ? 12.161  -7.788  14.097  1.00 0.00 ? 49  GLU A HA   6  
ATOM 9743  H HB2  . GLU A 1 49  ? 13.923  -9.983  13.043  1.00 0.00 ? 49  GLU A HB2  6  
ATOM 9744  H HB3  . GLU A 1 49  ? 14.572  -8.728  14.089  1.00 0.00 ? 49  GLU A HB3  6  
ATOM 9745  H HG2  . GLU A 1 49  ? 12.248  -10.497 14.807  1.00 0.00 ? 49  GLU A HG2  6  
ATOM 9746  H HG3  . GLU A 1 49  ? 13.919  -10.805 15.273  1.00 0.00 ? 49  GLU A HG3  6  
ATOM 9747  N N    . SER A 1 50  ? 13.862  -7.656  11.264  1.00 0.00 ? 50  SER A N    6  
ATOM 9748  C CA   . SER A 1 50  ? 14.557  -6.752  10.355  1.00 0.00 ? 50  SER A CA   6  
ATOM 9749  C C    . SER A 1 50  ? 13.834  -6.669  9.014   1.00 0.00 ? 50  SER A C    6  
ATOM 9750  O O    . SER A 1 50  ? 13.481  -7.690  8.423   1.00 0.00 ? 50  SER A O    6  
ATOM 9751  C CB   . SER A 1 50  ? 15.998  -7.218  10.143  1.00 0.00 ? 50  SER A CB   6  
ATOM 9752  O OG   . SER A 1 50  ? 16.038  -8.468  9.476   1.00 0.00 ? 50  SER A OG   6  
ATOM 9753  H H    . SER A 1 50  ? 13.776  -8.603  11.025  1.00 0.00 ? 50  SER A H    6  
ATOM 9754  H HA   . SER A 1 50  ? 14.567  -5.771  10.807  1.00 0.00 ? 50  SER A HA   6  
ATOM 9755  H HB2  . SER A 1 50  ? 16.525  -6.489  9.546   1.00 0.00 ? 50  SER A HB2  6  
ATOM 9756  H HB3  . SER A 1 50  ? 16.486  -7.319  11.102  1.00 0.00 ? 50  SER A HB3  6  
ATOM 9757  H HG   . SER A 1 50  ? 15.489  -8.429  8.689   1.00 0.00 ? 50  SER A HG   6  
ATOM 9758  N N    . ILE A 1 51  ? 13.619  -5.447  8.540   1.00 0.00 ? 51  ILE A N    6  
ATOM 9759  C CA   . ILE A 1 51  ? 12.940  -5.229  7.269   1.00 0.00 ? 51  ILE A CA   6  
ATOM 9760  C C    . ILE A 1 51  ? 13.894  -5.426  6.095   1.00 0.00 ? 51  ILE A C    6  
ATOM 9761  O O    . ILE A 1 51  ? 15.009  -4.904  6.094   1.00 0.00 ? 51  ILE A O    6  
ATOM 9762  C CB   . ILE A 1 51  ? 12.331  -3.817  7.190   1.00 0.00 ? 51  ILE A CB   6  
ATOM 9763  C CG1  . ILE A 1 51  ? 11.331  -3.605  8.328   1.00 0.00 ? 51  ILE A CG1  6  
ATOM 9764  C CG2  . ILE A 1 51  ? 11.660  -3.604  5.841   1.00 0.00 ? 51  ILE A CG2  6  
ATOM 9765  C CD1  . ILE A 1 51  ? 11.027  -2.148  8.602   1.00 0.00 ? 51  ILE A CD1  6  
ATOM 9766  H H    . ILE A 1 51  ? 13.924  -4.673  9.057   1.00 0.00 ? 51  ILE A H    6  
ATOM 9767  H HA   . ILE A 1 51  ? 12.138  -5.950  7.192   1.00 0.00 ? 51  ILE A HA   6  
ATOM 9768  H HB   . ILE A 1 51  ? 13.131  -3.099  7.284   1.00 0.00 ? 51  ILE A HB   6  
ATOM 9769  H HG12 . ILE A 1 51  ? 10.403  -4.095  8.079   1.00 0.00 ? 51  ILE A HG12 6  
ATOM 9770  H HG13 . ILE A 1 51  ? 11.730  -4.037  9.234   1.00 0.00 ? 51  ILE A HG13 6  
ATOM 9771  H HG21 . ILE A 1 51  ? 12.135  -4.230  5.100   1.00 0.00 ? 51  ILE A HG21 6  
ATOM 9772  H HG22 . ILE A 1 51  ? 10.615  -3.864  5.914   1.00 0.00 ? 51  ILE A HG22 6  
ATOM 9773  H HG23 . ILE A 1 51  ? 11.755  -2.568  5.551   1.00 0.00 ? 51  ILE A HG23 6  
ATOM 9774  H HD11 . ILE A 1 51  ? 10.591  -2.050  9.584   1.00 0.00 ? 51  ILE A HD11 6  
ATOM 9775  H HD12 . ILE A 1 51  ? 11.940  -1.574  8.553   1.00 0.00 ? 51  ILE A HD12 6  
ATOM 9776  H HD13 . ILE A 1 51  ? 10.331  -1.780  7.861   1.00 0.00 ? 51  ILE A HD13 6  
ATOM 9777  N N    . LEU A 1 52  ? 13.447  -6.181  5.098   1.00 0.00 ? 52  LEU A N    6  
ATOM 9778  C CA   . LEU A 1 52  ? 14.260  -6.446  3.916   1.00 0.00 ? 52  LEU A CA   6  
ATOM 9779  C C    . LEU A 1 52  ? 13.980  -5.421  2.821   1.00 0.00 ? 52  LEU A C    6  
ATOM 9780  O O    . LEU A 1 52  ? 14.902  -4.869  2.223   1.00 0.00 ? 52  LEU A O    6  
ATOM 9781  C CB   . LEU A 1 52  ? 13.988  -7.857  3.391   1.00 0.00 ? 52  LEU A CB   6  
ATOM 9782  C CG   . LEU A 1 52  ? 14.164  -8.993  4.398   1.00 0.00 ? 52  LEU A CG   6  
ATOM 9783  C CD1  . LEU A 1 52  ? 13.308  -10.188 4.010   1.00 0.00 ? 52  LEU A CD1  6  
ATOM 9784  C CD2  . LEU A 1 52  ? 15.629  -9.394  4.498   1.00 0.00 ? 52  LEU A CD2  6  
ATOM 9785  H H    . LEU A 1 52  ? 12.550  -6.570  5.156   1.00 0.00 ? 52  LEU A H    6  
ATOM 9786  H HA   . LEU A 1 52  ? 15.298  -6.372  4.204   1.00 0.00 ? 52  LEU A HA   6  
ATOM 9787  H HB2  . LEU A 1 52  ? 12.970  -7.886  3.035   1.00 0.00 ? 52  LEU A HB2  6  
ATOM 9788  H HB3  . LEU A 1 52  ? 14.662  -8.037  2.565   1.00 0.00 ? 52  LEU A HB3  6  
ATOM 9789  H HG   . LEU A 1 52  ? 13.842  -8.655  5.373   1.00 0.00 ? 52  LEU A HG   6  
ATOM 9790  H HD11 . LEU A 1 52  ? 13.910  -11.084 4.031   1.00 0.00 ? 52  LEU A HD11 6  
ATOM 9791  H HD12 . LEU A 1 52  ? 12.915  -10.042 3.015   1.00 0.00 ? 52  LEU A HD12 6  
ATOM 9792  H HD13 . LEU A 1 52  ? 12.490  -10.287 4.709   1.00 0.00 ? 52  LEU A HD13 6  
ATOM 9793  H HD21 . LEU A 1 52  ? 16.099  -8.842  5.298   1.00 0.00 ? 52  LEU A HD21 6  
ATOM 9794  H HD22 . LEU A 1 52  ? 16.128  -9.172  3.566   1.00 0.00 ? 52  LEU A HD22 6  
ATOM 9795  H HD23 . LEU A 1 52  ? 15.699  -10.453 4.702   1.00 0.00 ? 52  LEU A HD23 6  
ATOM 9796  N N    . GLY A 1 53  ? 12.699  -5.170  2.566   1.00 0.00 ? 53  GLY A N    6  
ATOM 9797  C CA   . GLY A 1 53  ? 12.320  -4.210  1.545   1.00 0.00 ? 53  GLY A CA   6  
ATOM 9798  C C    . GLY A 1 53  ? 11.025  -3.496  1.874   1.00 0.00 ? 53  GLY A C    6  
ATOM 9799  O O    . GLY A 1 53  ? 10.185  -4.022  2.604   1.00 0.00 ? 53  GLY A O    6  
ATOM 9800  H H    . GLY A 1 53  ? 12.006  -5.641  3.075   1.00 0.00 ? 53  GLY A H    6  
ATOM 9801  H HA2  . GLY A 1 53  ? 13.108  -3.479  1.445   1.00 0.00 ? 53  GLY A HA2  6  
ATOM 9802  H HA3  . GLY A 1 53  ? 12.203  -4.729  0.605   1.00 0.00 ? 53  GLY A HA3  6  
ATOM 9803  N N    . SER A 1 54  ? 10.862  -2.292  1.335   1.00 0.00 ? 54  SER A N    6  
ATOM 9804  C CA   . SER A 1 54  ? 9.661   -1.501  1.580   1.00 0.00 ? 54  SER A CA   6  
ATOM 9805  C C    . SER A 1 54  ? 8.948   -1.177  0.271   1.00 0.00 ? 54  SER A C    6  
ATOM 9806  O O    . SER A 1 54  ? 9.578   -0.786  -0.712  1.00 0.00 ? 54  SER A O    6  
ATOM 9807  C CB   . SER A 1 54  ? 10.018  -0.206  2.313   1.00 0.00 ? 54  SER A CB   6  
ATOM 9808  O OG   . SER A 1 54  ? 10.692  0.697   1.454   1.00 0.00 ? 54  SER A OG   6  
ATOM 9809  H H    . SER A 1 54  ? 11.567  -1.926  0.762   1.00 0.00 ? 54  SER A H    6  
ATOM 9810  H HA   . SER A 1 54  ? 9.000   -2.086  2.202   1.00 0.00 ? 54  SER A HA   6  
ATOM 9811  H HB2  . SER A 1 54  ? 9.115   0.263   2.672   1.00 0.00 ? 54  SER A HB2  6  
ATOM 9812  H HB3  . SER A 1 54  ? 10.662  -0.436  3.151   1.00 0.00 ? 54  SER A HB3  6  
ATOM 9813  H HG   . SER A 1 54  ? 11.583  0.846   1.780   1.00 0.00 ? 54  SER A HG   6  
ATOM 9814  N N    . ILE A 1 55  ? 7.630   -1.343  0.266   1.00 0.00 ? 55  ILE A N    6  
ATOM 9815  C CA   . ILE A 1 55  ? 6.830   -1.067  -0.921  1.00 0.00 ? 55  ILE A CA   6  
ATOM 9816  C C    . ILE A 1 55  ? 5.900   0.120   -0.694  1.00 0.00 ? 55  ILE A C    6  
ATOM 9817  O O    . ILE A 1 55  ? 4.883   0.022   -0.009  1.00 0.00 ? 55  ILE A O    6  
ATOM 9818  C CB   . ILE A 1 55  ? 5.989   -2.291  -1.330  1.00 0.00 ? 55  ILE A CB   6  
ATOM 9819  C CG1  . ILE A 1 55  ? 6.880   -3.529  -1.459  1.00 0.00 ? 55  ILE A CG1  6  
ATOM 9820  C CG2  . ILE A 1 55  ? 5.259   -2.020  -2.636  1.00 0.00 ? 55  ILE A CG2  6  
ATOM 9821  C CD1  . ILE A 1 55  ? 6.126   -4.833  -1.327  1.00 0.00 ? 55  ILE A CD1  6  
ATOM 9822  H H    . ILE A 1 55  ? 7.184   -1.657  1.080   1.00 0.00 ? 55  ILE A H    6  
ATOM 9823  H HA   . ILE A 1 55  ? 7.506   -0.833  -1.731  1.00 0.00 ? 55  ILE A HA   6  
ATOM 9824  H HB   . ILE A 1 55  ? 5.251   -2.466  -0.562  1.00 0.00 ? 55  ILE A HB   6  
ATOM 9825  H HG12 . ILE A 1 55  ? 7.360   -3.520  -2.425  1.00 0.00 ? 55  ILE A HG12 6  
ATOM 9826  H HG13 . ILE A 1 55  ? 7.635   -3.502  -0.686  1.00 0.00 ? 55  ILE A HG13 6  
ATOM 9827  H HG21 . ILE A 1 55  ? 4.734   -2.911  -2.947  1.00 0.00 ? 55  ILE A HG21 6  
ATOM 9828  H HG22 . ILE A 1 55  ? 4.550   -1.218  -2.492  1.00 0.00 ? 55  ILE A HG22 6  
ATOM 9829  H HG23 . ILE A 1 55  ? 5.972   -1.738  -3.396  1.00 0.00 ? 55  ILE A HG23 6  
ATOM 9830  H HD11 . ILE A 1 55  ? 5.264   -4.688  -0.692  1.00 0.00 ? 55  ILE A HD11 6  
ATOM 9831  H HD12 . ILE A 1 55  ? 5.804   -5.164  -2.303  1.00 0.00 ? 55  ILE A HD12 6  
ATOM 9832  H HD13 . ILE A 1 55  ? 6.772   -5.580  -0.889  1.00 0.00 ? 55  ILE A HD13 6  
ATOM 9833  N N    . PRO A 1 56  ? 6.256   1.271   -1.284  1.00 0.00 ? 56  PRO A N    6  
ATOM 9834  C CA   . PRO A 1 56  ? 5.466   2.500   -1.164  1.00 0.00 ? 56  PRO A CA   6  
ATOM 9835  C C    . PRO A 1 56  ? 4.140   2.413   -1.911  1.00 0.00 ? 56  PRO A C    6  
ATOM 9836  O O    . PRO A 1 56  ? 4.095   2.551   -3.135  1.00 0.00 ? 56  PRO A O    6  
ATOM 9837  C CB   . PRO A 1 56  ? 6.367   3.564   -1.795  1.00 0.00 ? 56  PRO A CB   6  
ATOM 9838  C CG   . PRO A 1 56  ? 7.238   2.811   -2.741  1.00 0.00 ? 56  PRO A CG   6  
ATOM 9839  C CD   . PRO A 1 56  ? 7.457   1.461   -2.116  1.00 0.00 ? 56  PRO A CD   6  
ATOM 9840  H HA   . PRO A 1 56  ? 5.279   2.751   -0.130  1.00 0.00 ? 56  PRO A HA   6  
ATOM 9841  H HB2  . PRO A 1 56  ? 5.759   4.293   -2.312  1.00 0.00 ? 56  PRO A HB2  6  
ATOM 9842  H HB3  . PRO A 1 56  ? 6.948   4.051   -1.027  1.00 0.00 ? 56  PRO A HB3  6  
ATOM 9843  H HG2  . PRO A 1 56  ? 6.742   2.707   -3.694  1.00 0.00 ? 56  PRO A HG2  6  
ATOM 9844  H HG3  . PRO A 1 56  ? 8.180   3.325   -2.860  1.00 0.00 ? 56  PRO A HG3  6  
ATOM 9845  H HD2  . PRO A 1 56  ? 7.523   0.699   -2.878  1.00 0.00 ? 56  PRO A HD2  6  
ATOM 9846  H HD3  . PRO A 1 56  ? 8.349   1.467   -1.507  1.00 0.00 ? 56  PRO A HD3  6  
ATOM 9847  N N    . LEU A 1 57  ? 3.062   2.183   -1.170  1.00 0.00 ? 57  LEU A N    6  
ATOM 9848  C CA   . LEU A 1 57  ? 1.734   2.078   -1.763  1.00 0.00 ? 57  LEU A CA   6  
ATOM 9849  C C    . LEU A 1 57  ? 1.036   3.434   -1.780  1.00 0.00 ? 57  LEU A C    6  
ATOM 9850  O O    . LEU A 1 57  ? -0.136  3.546   -1.419  1.00 0.00 ? 57  LEU A O    6  
ATOM 9851  C CB   . LEU A 1 57  ? 0.887   1.066   -0.990  1.00 0.00 ? 57  LEU A CB   6  
ATOM 9852  C CG   . LEU A 1 57  ? 1.295   -0.401  -1.135  1.00 0.00 ? 57  LEU A CG   6  
ATOM 9853  C CD1  . LEU A 1 57  ? 0.359   -1.297  -0.338  1.00 0.00 ? 57  LEU A CD1  6  
ATOM 9854  C CD2  . LEU A 1 57  ? 1.307   -0.809  -2.601  1.00 0.00 ? 57  LEU A CD2  6  
ATOM 9855  H H    . LEU A 1 57  ? 3.161   2.082   -0.200  1.00 0.00 ? 57  LEU A H    6  
ATOM 9856  H HA   . LEU A 1 57  ? 1.851   1.734   -2.780  1.00 0.00 ? 57  LEU A HA   6  
ATOM 9857  H HB2  . LEU A 1 57  ? 0.941   1.321   0.057   1.00 0.00 ? 57  LEU A HB2  6  
ATOM 9858  H HB3  . LEU A 1 57  ? -0.134  1.161   -1.330  1.00 0.00 ? 57  LEU A HB3  6  
ATOM 9859  H HG   . LEU A 1 57  ? 2.294   -0.531  -0.742  1.00 0.00 ? 57  LEU A HG   6  
ATOM 9860  H HD11 . LEU A 1 57  ? 0.277   -2.256  -0.827  1.00 0.00 ? 57  LEU A HD11 6  
ATOM 9861  H HD12 . LEU A 1 57  ? -0.616  -0.837  -0.280  1.00 0.00 ? 57  LEU A HD12 6  
ATOM 9862  H HD13 . LEU A 1 57  ? 0.753   -1.432  0.659   1.00 0.00 ? 57  LEU A HD13 6  
ATOM 9863  H HD21 . LEU A 1 57  ? 0.711   -1.700  -2.731  1.00 0.00 ? 57  LEU A HD21 6  
ATOM 9864  H HD22 . LEU A 1 57  ? 2.323   -1.007  -2.911  1.00 0.00 ? 57  LEU A HD22 6  
ATOM 9865  H HD23 . LEU A 1 57  ? 0.897   -0.010  -3.200  1.00 0.00 ? 57  LEU A HD23 6  
ATOM 9866  N N    . LEU A 1 58  ? 1.763   4.462   -2.204  1.00 0.00 ? 58  LEU A N    6  
ATOM 9867  C CA   . LEU A 1 58  ? 1.213   5.812   -2.271  1.00 0.00 ? 58  LEU A CA   6  
ATOM 9868  C C    . LEU A 1 58  ? 0.157   5.916   -3.366  1.00 0.00 ? 58  LEU A C    6  
ATOM 9869  O O    . LEU A 1 58  ? -1.007  6.212   -3.094  1.00 0.00 ? 58  LEU A O    6  
ATOM 9870  C CB   . LEU A 1 58  ? 2.330   6.826   -2.525  1.00 0.00 ? 58  LEU A CB   6  
ATOM 9871  C CG   . LEU A 1 58  ? 1.894   8.172   -3.107  1.00 0.00 ? 58  LEU A CG   6  
ATOM 9872  C CD1  . LEU A 1 58  ? 0.728   8.743   -2.316  1.00 0.00 ? 58  LEU A CD1  6  
ATOM 9873  C CD2  . LEU A 1 58  ? 3.061   9.149   -3.121  1.00 0.00 ? 58  LEU A CD2  6  
ATOM 9874  H H    . LEU A 1 58  ? 2.691   4.311   -2.479  1.00 0.00 ? 58  LEU A H    6  
ATOM 9875  H HA   . LEU A 1 58  ? 0.751   6.028   -1.319  1.00 0.00 ? 58  LEU A HA   6  
ATOM 9876  H HB2  . LEU A 1 58  ? 2.823   7.017   -1.584  1.00 0.00 ? 58  LEU A HB2  6  
ATOM 9877  H HB3  . LEU A 1 58  ? 3.032   6.378   -3.213  1.00 0.00 ? 58  LEU A HB3  6  
ATOM 9878  H HG   . LEU A 1 58  ? 1.566   8.026   -4.127  1.00 0.00 ? 58  LEU A HG   6  
ATOM 9879  H HD11 . LEU A 1 58  ? 0.564   9.769   -2.607  1.00 0.00 ? 58  LEU A HD11 6  
ATOM 9880  H HD12 . LEU A 1 58  ? 0.953   8.700   -1.261  1.00 0.00 ? 58  LEU A HD12 6  
ATOM 9881  H HD13 . LEU A 1 58  ? -0.162  8.164   -2.518  1.00 0.00 ? 58  LEU A HD13 6  
ATOM 9882  H HD21 . LEU A 1 58  ? 3.122   9.649   -2.166  1.00 0.00 ? 58  LEU A HD21 6  
ATOM 9883  H HD22 . LEU A 1 58  ? 2.907   9.881   -3.901  1.00 0.00 ? 58  LEU A HD22 6  
ATOM 9884  H HD23 . LEU A 1 58  ? 3.979   8.611   -3.306  1.00 0.00 ? 58  LEU A HD23 6  
ATOM 9885  N N    . SER A 1 59  ? 0.570   5.669   -4.605  1.00 0.00 ? 59  SER A N    6  
ATOM 9886  C CA   . SER A 1 59  ? -0.340  5.736   -5.742  1.00 0.00 ? 59  SER A CA   6  
ATOM 9887  C C    . SER A 1 59  ? -0.217  4.488   -6.611  1.00 0.00 ? 59  SER A C    6  
ATOM 9888  O O    . SER A 1 59  ? -0.199  4.573   -7.839  1.00 0.00 ? 59  SER A O    6  
ATOM 9889  C CB   . SER A 1 59  ? -0.053  6.985   -6.578  1.00 0.00 ? 59  SER A CB   6  
ATOM 9890  O OG   . SER A 1 59  ? -1.219  7.424   -7.254  1.00 0.00 ? 59  SER A OG   6  
ATOM 9891  H H    . SER A 1 59  ? 1.510   5.438   -4.758  1.00 0.00 ? 59  SER A H    6  
ATOM 9892  H HA   . SER A 1 59  ? -1.347  5.795   -5.357  1.00 0.00 ? 59  SER A HA   6  
ATOM 9893  H HB2  . SER A 1 59  ? 0.293   7.776   -5.932  1.00 0.00 ? 59  SER A HB2  6  
ATOM 9894  H HB3  . SER A 1 59  ? 0.709   6.757   -7.310  1.00 0.00 ? 59  SER A HB3  6  
ATOM 9895  H HG   . SER A 1 59  ? -1.421  8.325   -6.991  1.00 0.00 ? 59  SER A HG   6  
ATOM 9896  N N    . PHE A 1 60  ? -0.132  3.331   -5.965  1.00 0.00 ? 60  PHE A N    6  
ATOM 9897  C CA   . PHE A 1 60  ? -0.010  2.064   -6.677  1.00 0.00 ? 60  PHE A CA   6  
ATOM 9898  C C    . PHE A 1 60  ? -1.370  1.589   -7.180  1.00 0.00 ? 60  PHE A C    6  
ATOM 9899  O O    . PHE A 1 60  ? -2.406  2.150   -6.823  1.00 0.00 ? 60  PHE A O    6  
ATOM 9900  C CB   . PHE A 1 60  ? 0.611   1.001   -5.768  1.00 0.00 ? 60  PHE A CB   6  
ATOM 9901  C CG   . PHE A 1 60  ? 2.109   0.940   -5.854  1.00 0.00 ? 60  PHE A CG   6  
ATOM 9902  C CD1  . PHE A 1 60  ? 2.880   2.048   -5.538  1.00 0.00 ? 60  PHE A CD1  6  
ATOM 9903  C CD2  . PHE A 1 60  ? 2.747   -0.225  -6.248  1.00 0.00 ? 60  PHE A CD2  6  
ATOM 9904  C CE1  . PHE A 1 60  ? 4.259   1.994   -5.617  1.00 0.00 ? 60  PHE A CE1  6  
ATOM 9905  C CE2  . PHE A 1 60  ? 4.125   -0.284  -6.328  1.00 0.00 ? 60  PHE A CE2  6  
ATOM 9906  C CZ   . PHE A 1 60  ? 4.882   0.827   -6.011  1.00 0.00 ? 60  PHE A CZ   6  
ATOM 9907  H H    . PHE A 1 60  ? -0.153  3.328   -4.985  1.00 0.00 ? 60  PHE A H    6  
ATOM 9908  H HA   . PHE A 1 60  ? 0.638   2.223   -7.525  1.00 0.00 ? 60  PHE A HA   6  
ATOM 9909  H HB2  . PHE A 1 60  ? 0.346   1.215   -4.744  1.00 0.00 ? 60  PHE A HB2  6  
ATOM 9910  H HB3  . PHE A 1 60  ? 0.222   0.032   -6.042  1.00 0.00 ? 60  PHE A HB3  6  
ATOM 9911  H HD1  . PHE A 1 60  ? 2.394   2.961   -5.229  1.00 0.00 ? 60  PHE A HD1  6  
ATOM 9912  H HD2  . PHE A 1 60  ? 2.155   -1.095  -6.497  1.00 0.00 ? 60  PHE A HD2  6  
ATOM 9913  H HE1  . PHE A 1 60  ? 4.848   2.864   -5.368  1.00 0.00 ? 60  PHE A HE1  6  
ATOM 9914  H HE2  . PHE A 1 60  ? 4.610   -1.199  -6.637  1.00 0.00 ? 60  PHE A HE2  6  
ATOM 9915  H HZ   . PHE A 1 60  ? 5.959   0.782   -6.073  1.00 0.00 ? 60  PHE A HZ   6  
ATOM 9916  N N    . ARG A 1 61  ? -1.357  0.552   -8.011  1.00 0.00 ? 61  ARG A N    6  
ATOM 9917  C CA   . ARG A 1 61  ? -2.589  0.002   -8.564  1.00 0.00 ? 61  ARG A CA   6  
ATOM 9918  C C    . ARG A 1 61  ? -2.744  -1.469  -8.189  1.00 0.00 ? 61  ARG A C    6  
ATOM 9919  O O    . ARG A 1 61  ? -2.191  -2.351  -8.847  1.00 0.00 ? 61  ARG A O    6  
ATOM 9920  C CB   . ARG A 1 61  ? -2.602  0.155   -10.086 1.00 0.00 ? 61  ARG A CB   6  
ATOM 9921  C CG   . ARG A 1 61  ? -3.987  0.028   -10.699 1.00 0.00 ? 61  ARG A CG   6  
ATOM 9922  C CD   . ARG A 1 61  ? -3.992  0.457   -12.158 1.00 0.00 ? 61  ARG A CD   6  
ATOM 9923  N NE   . ARG A 1 61  ? -5.318  0.336   -12.760 1.00 0.00 ? 61  ARG A NE   6  
ATOM 9924  C CZ   . ARG A 1 61  ? -5.661  0.916   -13.905 1.00 0.00 ? 61  ARG A CZ   6  
ATOM 9925  N NH1  . ARG A 1 61  ? -4.780  1.652   -14.568 1.00 0.00 ? 61  ARG A NH1  6  
ATOM 9926  N NH2  . ARG A 1 61  ? -6.886  0.759   -14.388 1.00 0.00 ? 61  ARG A NH2  6  
ATOM 9927  H H    . ARG A 1 61  ? -0.500  0.147   -8.258  1.00 0.00 ? 61  ARG A H    6  
ATOM 9928  H HA   . ARG A 1 61  ? -3.417  0.556   -8.148  1.00 0.00 ? 61  ARG A HA   6  
ATOM 9929  H HB2  . ARG A 1 61  ? -2.207  1.127   -10.342 1.00 0.00 ? 61  ARG A HB2  6  
ATOM 9930  H HB3  . ARG A 1 61  ? -1.970  -0.607  -10.518 1.00 0.00 ? 61  ARG A HB3  6  
ATOM 9931  H HG2  . ARG A 1 61  ? -4.305  -1.003  -10.638 1.00 0.00 ? 61  ARG A HG2  6  
ATOM 9932  H HG3  . ARG A 1 61  ? -4.674  0.652   -10.147 1.00 0.00 ? 61  ARG A HG3  6  
ATOM 9933  H HD2  . ARG A 1 61  ? -3.673  1.487   -12.218 1.00 0.00 ? 61  ARG A HD2  6  
ATOM 9934  H HD3  . ARG A 1 61  ? -3.301  -0.166  -12.705 1.00 0.00 ? 61  ARG A HD3  6  
ATOM 9935  H HE   . ARG A 1 61  ? -5.984  -0.204  -12.286 1.00 0.00 ? 61  ARG A HE   6  
ATOM 9936  H HH11 . ARG A 1 61  ? -3.856  1.772   -14.207 1.00 0.00 ? 61  ARG A HH11 6  
ATOM 9937  H HH12 . ARG A 1 61  ? -5.041  2.087   -15.431 1.00 0.00 ? 61  ARG A HH12 6  
ATOM 9938  H HH21 . ARG A 1 61  ? -7.553  0.204   -13.890 1.00 0.00 ? 61  ARG A HH21 6  
ATOM 9939  H HH22 . ARG A 1 61  ? -7.144  1.196   -15.249 1.00 0.00 ? 61  ARG A HH22 6  
ATOM 9940  N N    . VAL A 1 62  ? -3.500  -1.727  -7.126  1.00 0.00 ? 62  VAL A N    6  
ATOM 9941  C CA   . VAL A 1 62  ? -3.729  -3.090  -6.663  1.00 0.00 ? 62  VAL A CA   6  
ATOM 9942  C C    . VAL A 1 62  ? -5.084  -3.609  -7.130  1.00 0.00 ? 62  VAL A C    6  
ATOM 9943  O O    . VAL A 1 62  ? -6.109  -2.955  -6.943  1.00 0.00 ? 62  VAL A O    6  
ATOM 9944  C CB   . VAL A 1 62  ? -3.658  -3.181  -5.127  1.00 0.00 ? 62  VAL A CB   6  
ATOM 9945  C CG1  . VAL A 1 62  ? -3.779  -4.627  -4.671  1.00 0.00 ? 62  VAL A CG1  6  
ATOM 9946  C CG2  . VAL A 1 62  ? -2.368  -2.558  -4.616  1.00 0.00 ? 62  VAL A CG2  6  
ATOM 9947  H H    . VAL A 1 62  ? -3.914  -0.982  -6.642  1.00 0.00 ? 62  VAL A H    6  
ATOM 9948  H HA   . VAL A 1 62  ? -2.952  -3.718  -7.076  1.00 0.00 ? 62  VAL A HA   6  
ATOM 9949  H HB   . VAL A 1 62  ? -4.489  -2.626  -4.716  1.00 0.00 ? 62  VAL A HB   6  
ATOM 9950  H HG11 . VAL A 1 62  ? -4.787  -4.976  -4.845  1.00 0.00 ? 62  VAL A HG11 6  
ATOM 9951  H HG12 . VAL A 1 62  ? -3.084  -5.239  -5.226  1.00 0.00 ? 62  VAL A HG12 6  
ATOM 9952  H HG13 . VAL A 1 62  ? -3.554  -4.691  -3.617  1.00 0.00 ? 62  VAL A HG13 6  
ATOM 9953  H HG21 . VAL A 1 62  ? -1.629  -3.331  -4.470  1.00 0.00 ? 62  VAL A HG21 6  
ATOM 9954  H HG22 . VAL A 1 62  ? -2.002  -1.842  -5.338  1.00 0.00 ? 62  VAL A HG22 6  
ATOM 9955  H HG23 . VAL A 1 62  ? -2.556  -2.058  -3.678  1.00 0.00 ? 62  VAL A HG23 6  
ATOM 9956  N N    . ALA A 1 63  ? -5.081  -4.791  -7.739  1.00 0.00 ? 63  ALA A N    6  
ATOM 9957  C CA   . ALA A 1 63  ? -6.311  -5.400  -8.231  1.00 0.00 ? 63  ALA A CA   6  
ATOM 9958  C C    . ALA A 1 63  ? -6.055  -6.810  -8.752  1.00 0.00 ? 63  ALA A C    6  
ATOM 9959  O O    . ALA A 1 63  ? -5.017  -7.080  -9.356  1.00 0.00 ? 63  ALA A O    6  
ATOM 9960  C CB   . ALA A 1 63  ? -6.928  -4.536  -9.321  1.00 0.00 ? 63  ALA A CB   6  
ATOM 9961  H H    . ALA A 1 63  ? -4.232  -5.265  -7.858  1.00 0.00 ? 63  ALA A H    6  
ATOM 9962  H HA   . ALA A 1 63  ? -7.010  -5.452  -7.408  1.00 0.00 ? 63  ALA A HA   6  
ATOM 9963  H HB1  . ALA A 1 63  ? -7.035  -3.524  -8.959  1.00 0.00 ? 63  ALA A HB1  6  
ATOM 9964  H HB2  . ALA A 1 63  ? -6.288  -4.542  -10.191 1.00 0.00 ? 63  ALA A HB2  6  
ATOM 9965  H HB3  . ALA A 1 63  ? -7.898  -4.929  -9.585  1.00 0.00 ? 63  ALA A HB3  6  
ATOM 9966  N N    . ALA A 1 64  ? -7.007  -7.706  -8.513  1.00 0.00 ? 64  ALA A N    6  
ATOM 9967  C CA   . ALA A 1 64  ? -6.885  -9.088  -8.960  1.00 0.00 ? 64  ALA A CA   6  
ATOM 9968  C C    . ALA A 1 64  ? -6.167  -9.169  -10.303 1.00 0.00 ? 64  ALA A C    6  
ATOM 9969  O O    . ALA A 1 64  ? -6.493  -8.438  -11.238 1.00 0.00 ? 64  ALA A O    6  
ATOM 9970  C CB   . ALA A 1 64  ? -8.258  -9.735  -9.054  1.00 0.00 ? 64  ALA A CB   6  
ATOM 9971  H H    . ALA A 1 64  ? -7.811  -7.430  -8.027  1.00 0.00 ? 64  ALA A H    6  
ATOM 9972  H HA   . ALA A 1 64  ? -6.309  -9.627  -8.222  1.00 0.00 ? 64  ALA A HA   6  
ATOM 9973  H HB1  . ALA A 1 64  ? -8.146  -10.808 -9.119  1.00 0.00 ? 64  ALA A HB1  6  
ATOM 9974  H HB2  . ALA A 1 64  ? -8.835  -9.486  -8.175  1.00 0.00 ? 64  ALA A HB2  6  
ATOM 9975  H HB3  . ALA A 1 64  ? -8.768  -9.373  -9.934  1.00 0.00 ? 64  ALA A HB3  6  
ATOM 9976  N N    . VAL A 1 65  ? -5.187  -10.063 -10.391 1.00 0.00 ? 65  VAL A N    6  
ATOM 9977  C CA   . VAL A 1 65  ? -4.422  -10.240 -11.620 1.00 0.00 ? 65  VAL A CA   6  
ATOM 9978  C C    . VAL A 1 65  ? -5.343  -10.502 -12.807 1.00 0.00 ? 65  VAL A C    6  
ATOM 9979  O O    . VAL A 1 65  ? -6.566  -10.489 -12.670 1.00 0.00 ? 65  VAL A O    6  
ATOM 9980  C CB   . VAL A 1 65  ? -3.421  -11.404 -11.495 1.00 0.00 ? 65  VAL A CB   6  
ATOM 9981  C CG1  . VAL A 1 65  ? -2.337  -11.069 -10.481 1.00 0.00 ? 65  VAL A CG1  6  
ATOM 9982  C CG2  . VAL A 1 65  ? -4.141  -12.688 -11.113 1.00 0.00 ? 65  VAL A CG2  6  
ATOM 9983  H H    . VAL A 1 65  ? -4.973  -10.617 -9.611  1.00 0.00 ? 65  VAL A H    6  
ATOM 9984  H HA   . VAL A 1 65  ? -3.866  -9.332  -11.801 1.00 0.00 ? 65  VAL A HA   6  
ATOM 9985  H HB   . VAL A 1 65  ? -2.950  -11.552 -12.456 1.00 0.00 ? 65  VAL A HB   6  
ATOM 9986  H HG11 . VAL A 1 65  ? -1.373  -11.350 -10.879 1.00 0.00 ? 65  VAL A HG11 6  
ATOM 9987  H HG12 . VAL A 1 65  ? -2.349  -10.009 -10.277 1.00 0.00 ? 65  VAL A HG12 6  
ATOM 9988  H HG13 . VAL A 1 65  ? -2.520  -11.614 -9.566  1.00 0.00 ? 65  VAL A HG13 6  
ATOM 9989  H HG21 . VAL A 1 65  ? -4.021  -13.415 -11.902 1.00 0.00 ? 65  VAL A HG21 6  
ATOM 9990  H HG22 . VAL A 1 65  ? -3.722  -13.078 -10.197 1.00 0.00 ? 65  VAL A HG22 6  
ATOM 9991  H HG23 . VAL A 1 65  ? -5.191  -12.483 -10.969 1.00 0.00 ? 65  VAL A HG23 6  
ATOM 9992  N N    . GLN A 1 66  ? -4.746  -10.740 -13.970 1.00 0.00 ? 66  GLN A N    6  
ATOM 9993  C CA   . GLN A 1 66  ? -5.513  -11.004 -15.182 1.00 0.00 ? 66  GLN A CA   6  
ATOM 9994  C C    . GLN A 1 66  ? -4.998  -12.253 -15.890 1.00 0.00 ? 66  GLN A C    6  
ATOM 9995  O O    . GLN A 1 66  ? -3.874  -12.704 -15.668 1.00 0.00 ? 66  GLN A O    6  
ATOM 9996  C CB   . GLN A 1 66  ? -5.444  -9.803  -16.126 1.00 0.00 ? 66  GLN A CB   6  
ATOM 9997  C CG   . GLN A 1 66  ? -6.553  -8.788  -15.901 1.00 0.00 ? 66  GLN A CG   6  
ATOM 9998  C CD   . GLN A 1 66  ? -6.508  -7.645  -16.895 1.00 0.00 ? 66  GLN A CD   6  
ATOM 9999  O OE1  . GLN A 1 66  ? -5.442  -7.276  -17.388 1.00 0.00 ? 66  GLN A OE1  6  
ATOM 10000 N NE2  . GLN A 1 66  ? -7.670  -7.076  -17.197 1.00 0.00 ? 66  GLN A NE2  6  
ATOM 10001 H H    . GLN A 1 66  ? -3.767  -10.737 -14.015 1.00 0.00 ? 66  GLN A H    6  
ATOM 10002 H HA   . GLN A 1 66  ? -6.541  -11.166 -14.894 1.00 0.00 ? 66  GLN A HA   6  
ATOM 10003 H HB2  . GLN A 1 66  ? -4.496  -9.306  -15.989 1.00 0.00 ? 66  GLN A HB2  6  
ATOM 10004 H HB3  . GLN A 1 66  ? -5.512  -10.157 -17.145 1.00 0.00 ? 66  GLN A HB3  6  
ATOM 10005 H HG2  . GLN A 1 66  ? -7.506  -9.287  -15.993 1.00 0.00 ? 66  GLN A HG2  6  
ATOM 10006 H HG3  . GLN A 1 66  ? -6.455  -8.383  -14.904 1.00 0.00 ? 66  GLN A HG3  6  
ATOM 10007 H HE21 . GLN A 1 66  ? -8.480  -7.422  -16.765 1.00 0.00 ? 66  GLN A HE21 6  
ATOM 10008 H HE22 . GLN A 1 66  ? -7.671  -6.335  -17.836 1.00 0.00 ? 66  GLN A HE22 6  
ATOM 10009 N N    . PRO A 1 67  ? -5.839  -12.828 -16.763 1.00 0.00 ? 67  PRO A N    6  
ATOM 10010 C CA   . PRO A 1 67  ? -5.491  -14.033 -17.522 1.00 0.00 ? 67  PRO A CA   6  
ATOM 10011 C C    . PRO A 1 67  ? -4.422  -13.765 -18.576 1.00 0.00 ? 67  PRO A C    6  
ATOM 10012 O O    . PRO A 1 67  ? -3.967  -14.683 -19.259 1.00 0.00 ? 67  PRO A O    6  
ATOM 10013 C CB   . PRO A 1 67  ? -6.812  -14.427 -18.187 1.00 0.00 ? 67  PRO A CB   6  
ATOM 10014 C CG   . PRO A 1 67  ? -7.582  -13.156 -18.283 1.00 0.00 ? 67  PRO A CG   6  
ATOM 10015 C CD   . PRO A 1 67  ? -7.194  -12.345 -17.077 1.00 0.00 ? 67  PRO A CD   6  
ATOM 10016 H HA   . PRO A 1 67  ? -5.161  -14.830 -16.871 1.00 0.00 ? 67  PRO A HA   6  
ATOM 10017 H HB2  . PRO A 1 67  ? -6.615  -14.845 -19.164 1.00 0.00 ? 67  PRO A HB2  6  
ATOM 10018 H HB3  . PRO A 1 67  ? -7.324  -15.154 -17.575 1.00 0.00 ? 67  PRO A HB3  6  
ATOM 10019 H HG2  . PRO A 1 67  ? -7.316  -12.633 -19.188 1.00 0.00 ? 67  PRO A HG2  6  
ATOM 10020 H HG3  . PRO A 1 67  ? -8.641  -13.367 -18.267 1.00 0.00 ? 67  PRO A HG3  6  
ATOM 10021 H HD2  . PRO A 1 67  ? -7.182  -11.292 -17.319 1.00 0.00 ? 67  PRO A HD2  6  
ATOM 10022 H HD3  . PRO A 1 67  ? -7.871  -12.538 -16.258 1.00 0.00 ? 67  PRO A HD3  6  
ATOM 10023 N N    . SER A 1 68  ? -4.026  -12.503 -18.704 1.00 0.00 ? 68  SER A N    6  
ATOM 10024 C CA   . SER A 1 68  ? -3.013  -12.114 -19.678 1.00 0.00 ? 68  SER A CA   6  
ATOM 10025 C C    . SER A 1 68  ? -1.654  -11.938 -19.008 1.00 0.00 ? 68  SER A C    6  
ATOM 10026 O O    . SER A 1 68  ? -0.632  -11.797 -19.680 1.00 0.00 ? 68  SER A O    6  
ATOM 10027 C CB   . SER A 1 68  ? -3.421  -10.817 -20.379 1.00 0.00 ? 68  SER A CB   6  
ATOM 10028 O OG   . SER A 1 68  ? -4.241  -11.081 -21.505 1.00 0.00 ? 68  SER A OG   6  
ATOM 10029 H H    . SER A 1 68  ? -4.427  -11.816 -18.131 1.00 0.00 ? 68  SER A H    6  
ATOM 10030 H HA   . SER A 1 68  ? -2.940  -12.902 -20.413 1.00 0.00 ? 68  SER A HA   6  
ATOM 10031 H HB2  . SER A 1 68  ? -3.968  -10.194 -19.689 1.00 0.00 ? 68  SER A HB2  6  
ATOM 10032 H HB3  . SER A 1 68  ? -2.534  -10.295 -20.710 1.00 0.00 ? 68  SER A HB3  6  
ATOM 10033 H HG   . SER A 1 68  ? -4.019  -10.472 -22.213 1.00 0.00 ? 68  SER A HG   6  
ATOM 10034 N N    . ASP A 1 69  ? -1.651  -11.946 -17.680 1.00 0.00 ? 69  ASP A N    6  
ATOM 10035 C CA   . ASP A 1 69  ? -0.419  -11.789 -16.917 1.00 0.00 ? 69  ASP A CA   6  
ATOM 10036 C C    . ASP A 1 69  ? 0.251   -13.139 -16.680 1.00 0.00 ? 69  ASP A C    6  
ATOM 10037 O O    . ASP A 1 69  ? 1.266   -13.227 -15.991 1.00 0.00 ? 69  ASP A O    6  
ATOM 10038 C CB   . ASP A 1 69  ? -0.706  -11.106 -15.578 1.00 0.00 ? 69  ASP A CB   6  
ATOM 10039 C CG   . ASP A 1 69  ? -0.698  -9.594  -15.686 1.00 0.00 ? 69  ASP A CG   6  
ATOM 10040 O OD1  . ASP A 1 69  ? 0.365   -9.028  -16.015 1.00 0.00 ? 69  ASP A OD1  6  
ATOM 10041 O OD2  . ASP A 1 69  ? -1.756  -8.977  -15.441 1.00 0.00 ? 69  ASP A OD2  6  
ATOM 10042 H H    . ASP A 1 69  ? -2.499  -12.062 -17.201 1.00 0.00 ? 69  ASP A H    6  
ATOM 10043 H HA   . ASP A 1 69  ? 0.250   -11.166 -17.491 1.00 0.00 ? 69  ASP A HA   6  
ATOM 10044 H HB2  . ASP A 1 69  ? -1.678  -11.418 -15.224 1.00 0.00 ? 69  ASP A HB2  6  
ATOM 10045 H HB3  . ASP A 1 69  ? 0.046   -11.403 -14.862 1.00 0.00 ? 69  ASP A HB3  6  
ATOM 10046 N N    . ASN A 1 70  ? -0.327  -14.189 -17.256 1.00 0.00 ? 70  ASN A N    6  
ATOM 10047 C CA   . ASN A 1 70  ? 0.213   -15.535 -17.106 1.00 0.00 ? 70  ASN A CA   6  
ATOM 10048 C C    . ASN A 1 70  ? 0.251   -15.946 -15.637 1.00 0.00 ? 70  ASN A C    6  
ATOM 10049 O O    . ASN A 1 70  ? 1.119   -16.713 -15.219 1.00 0.00 ? 70  ASN A O    6  
ATOM 10050 C CB   . ASN A 1 70  ? 1.618   -15.613 -17.706 1.00 0.00 ? 70  ASN A CB   6  
ATOM 10051 C CG   . ASN A 1 70  ? 1.601   -16.001 -19.172 1.00 0.00 ? 70  ASN A CG   6  
ATOM 10052 O OD1  . ASN A 1 70  ? 0.692   -16.692 -19.632 1.00 0.00 ? 70  ASN A OD1  6  
ATOM 10053 N ND2  . ASN A 1 70  ? 2.608   -15.556 -19.913 1.00 0.00 ? 70  ASN A ND2  6  
ATOM 10054 H H    . ASN A 1 70  ? -1.135  -14.055 -17.794 1.00 0.00 ? 70  ASN A H    6  
ATOM 10055 H HA   . ASN A 1 70  ? -0.435  -16.213 -17.641 1.00 0.00 ? 70  ASN A HA   6  
ATOM 10056 H HB2  . ASN A 1 70  ? 2.096   -14.649 -17.614 1.00 0.00 ? 70  ASN A HB2  6  
ATOM 10057 H HB3  . ASN A 1 70  ? 2.194   -16.349 -17.165 1.00 0.00 ? 70  ASN A HB3  6  
ATOM 10058 H HD21 . ASN A 1 70  ? 3.297   -15.010 -19.479 1.00 0.00 ? 70  ASN A HD21 6  
ATOM 10059 H HD22 . ASN A 1 70  ? 2.621   -15.791 -20.865 1.00 0.00 ? 70  ASN A HD22 6  
ATOM 10060 N N    . ILE A 1 71  ? -0.694  -15.430 -14.859 1.00 0.00 ? 71  ILE A N    6  
ATOM 10061 C CA   . ILE A 1 71  ? -0.770  -15.744 -13.438 1.00 0.00 ? 71  ILE A CA   6  
ATOM 10062 C C    . ILE A 1 71  ? -1.734  -16.896 -13.180 1.00 0.00 ? 71  ILE A C    6  
ATOM 10063 O O    . ILE A 1 71  ? -2.906  -16.681 -12.869 1.00 0.00 ? 71  ILE A O    6  
ATOM 10064 C CB   . ILE A 1 71  ? -1.216  -14.522 -12.614 1.00 0.00 ? 71  ILE A CB   6  
ATOM 10065 C CG1  . ILE A 1 71  ? -0.298  -13.330 -12.891 1.00 0.00 ? 71  ILE A CG1  6  
ATOM 10066 C CG2  . ILE A 1 71  ? -1.224  -14.858 -11.130 1.00 0.00 ? 71  ILE A CG2  6  
ATOM 10067 C CD1  . ILE A 1 71  ? 1.088   -13.485 -12.305 1.00 0.00 ? 71  ILE A CD1  6  
ATOM 10068 H H    . ILE A 1 71  ? -1.358  -14.824 -15.251 1.00 0.00 ? 71  ILE A H    6  
ATOM 10069 H HA   . ILE A 1 71  ? 0.218   -16.034 -13.109 1.00 0.00 ? 71  ILE A HA   6  
ATOM 10070 H HB   . ILE A 1 71  ? -2.223  -14.267 -12.906 1.00 0.00 ? 71  ILE A HB   6  
ATOM 10071 H HG12 . ILE A 1 71  ? -0.194  -13.203 -13.957 1.00 0.00 ? 71  ILE A HG12 6  
ATOM 10072 H HG13 . ILE A 1 71  ? -0.740  -12.439 -12.469 1.00 0.00 ? 71  ILE A HG13 6  
ATOM 10073 H HG21 . ILE A 1 71  ? -0.485  -14.257 -10.621 1.00 0.00 ? 71  ILE A HG21 6  
ATOM 10074 H HG22 . ILE A 1 71  ? -2.201  -14.649 -10.720 1.00 0.00 ? 71  ILE A HG22 6  
ATOM 10075 H HG23 . ILE A 1 71  ? -0.992  -15.903 -10.996 1.00 0.00 ? 71  ILE A HG23 6  
ATOM 10076 H HD11 . ILE A 1 71  ? 1.352   -14.532 -12.276 1.00 0.00 ? 71  ILE A HD11 6  
ATOM 10077 H HD12 . ILE A 1 71  ? 1.800   -12.950 -12.914 1.00 0.00 ? 71  ILE A HD12 6  
ATOM 10078 H HD13 . ILE A 1 71  ? 1.101   -13.084 -11.301 1.00 0.00 ? 71  ILE A HD13 6  
ATOM 10079 N N    . SER A 1 72  ? -1.233  -18.121 -13.311 1.00 0.00 ? 72  SER A N    6  
ATOM 10080 C CA   . SER A 1 72  ? -2.051  -19.308 -13.094 1.00 0.00 ? 72  SER A CA   6  
ATOM 10081 C C    . SER A 1 72  ? -2.173  -19.620 -11.605 1.00 0.00 ? 72  SER A C    6  
ATOM 10082 O O    . SER A 1 72  ? -2.061  -20.773 -11.190 1.00 0.00 ? 72  SER A O    6  
ATOM 10083 C CB   . SER A 1 72  ? -1.451  -20.508 -13.829 1.00 0.00 ? 72  SER A CB   6  
ATOM 10084 O OG   . SER A 1 72  ? -2.423  -21.517 -14.038 1.00 0.00 ? 72  SER A OG   6  
ATOM 10085 H H    . SER A 1 72  ? -0.292  -18.227 -13.561 1.00 0.00 ? 72  SER A H    6  
ATOM 10086 H HA   . SER A 1 72  ? -3.036  -19.110 -13.490 1.00 0.00 ? 72  SER A HA   6  
ATOM 10087 H HB2  . SER A 1 72  ? -1.072  -20.187 -14.788 1.00 0.00 ? 72  SER A HB2  6  
ATOM 10088 H HB3  . SER A 1 72  ? -0.642  -20.919 -13.242 1.00 0.00 ? 72  SER A HB3  6  
ATOM 10089 H HG   . SER A 1 72  ? -3.301  -21.141 -13.940 1.00 0.00 ? 72  SER A HG   6  
ATOM 10090 N N    . ARG A 1 73  ? -2.403  -18.582 -10.807 1.00 0.00 ? 73  ARG A N    6  
ATOM 10091 C CA   . ARG A 1 73  ? -2.539  -18.743 -9.364  1.00 0.00 ? 73  ARG A CA   6  
ATOM 10092 C C    . ARG A 1 73  ? -3.825  -18.091 -8.864  1.00 0.00 ? 73  ARG A C    6  
ATOM 10093 O O    . ARG A 1 73  ? -3.976  -16.871 -8.915  1.00 0.00 ? 73  ARG A O    6  
ATOM 10094 C CB   . ARG A 1 73  ? -1.333  -18.135 -8.646  1.00 0.00 ? 73  ARG A CB   6  
ATOM 10095 C CG   . ARG A 1 73  ? -0.092  -19.011 -8.690  1.00 0.00 ? 73  ARG A CG   6  
ATOM 10096 C CD   . ARG A 1 73  ? 0.964   -18.531 -7.707  1.00 0.00 ? 73  ARG A CD   6  
ATOM 10097 N NE   . ARG A 1 73  ? 0.769   -19.097 -6.375  1.00 0.00 ? 73  ARG A NE   6  
ATOM 10098 C CZ   . ARG A 1 73  ? 0.928   -20.385 -6.093  1.00 0.00 ? 73  ARG A CZ   6  
ATOM 10099 N NH1  . ARG A 1 73  ? 1.282   -21.237 -7.046  1.00 0.00 ? 73  ARG A NH1  6  
ATOM 10100 N NH2  . ARG A 1 73  ? 0.732   -20.824 -4.856  1.00 0.00 ? 73  ARG A NH2  6  
ATOM 10101 H H    . ARG A 1 73  ? -2.482  -17.686 -11.198 1.00 0.00 ? 73  ARG A H    6  
ATOM 10102 H HA   . ARG A 1 73  ? -2.578  -19.800 -9.151  1.00 0.00 ? 73  ARG A HA   6  
ATOM 10103 H HB2  . ARG A 1 73  ? -1.094  -17.187 -9.107  1.00 0.00 ? 73  ARG A HB2  6  
ATOM 10104 H HB3  . ARG A 1 73  ? -1.592  -17.967 -7.612  1.00 0.00 ? 73  ARG A HB3  6  
ATOM 10105 H HG2  . ARG A 1 73  ? -0.368  -20.024 -8.438  1.00 0.00 ? 73  ARG A HG2  6  
ATOM 10106 H HG3  . ARG A 1 73  ? 0.320   -18.986 -9.688  1.00 0.00 ? 73  ARG A HG3  6  
ATOM 10107 H HD2  . ARG A 1 73  ? 1.937   -18.824 -8.073  1.00 0.00 ? 73  ARG A HD2  6  
ATOM 10108 H HD3  . ARG A 1 73  ? 0.913   -17.454 -7.642  1.00 0.00 ? 73  ARG A HD3  6  
ATOM 10109 H HE   . ARG A 1 73  ? 0.507   -18.485 -5.656  1.00 0.00 ? 73  ARG A HE   6  
ATOM 10110 H HH11 . ARG A 1 73  ? 1.431   -20.909 -7.978  1.00 0.00 ? 73  ARG A HH11 6  
ATOM 10111 H HH12 . ARG A 1 73  ? 1.402   -22.206 -6.831  1.00 0.00 ? 73  ARG A HH12 6  
ATOM 10112 H HH21 . ARG A 1 73  ? 0.465   -20.185 -4.136  1.00 0.00 ? 73  ARG A HH21 6  
ATOM 10113 H HH22 . ARG A 1 73  ? 0.851   -21.794 -4.645  1.00 0.00 ? 73  ARG A HH22 6  
ATOM 10114 N N    . LYS A 1 74  ? -4.748  -18.914 -8.379  1.00 0.00 ? 74  LYS A N    6  
ATOM 10115 C CA   . LYS A 1 74  ? -6.021  -18.420 -7.868  1.00 0.00 ? 74  LYS A CA   6  
ATOM 10116 C C    . LYS A 1 74  ? -5.807  -17.508 -6.664  1.00 0.00 ? 74  LYS A C    6  
ATOM 10117 O O    . LYS A 1 74  ? -4.826  -17.649 -5.933  1.00 0.00 ? 74  LYS A O    6  
ATOM 10118 C CB   . LYS A 1 74  ? -6.928  -19.591 -7.480  1.00 0.00 ? 74  LYS A CB   6  
ATOM 10119 C CG   . LYS A 1 74  ? -7.606  -20.254 -8.666  1.00 0.00 ? 74  LYS A CG   6  
ATOM 10120 C CD   . LYS A 1 74  ? -8.901  -19.549 -9.035  1.00 0.00 ? 74  LYS A CD   6  
ATOM 10121 C CE   . LYS A 1 74  ? -10.048 -19.986 -8.137  1.00 0.00 ? 74  LYS A CE   6  
ATOM 10122 N NZ   . LYS A 1 74  ? -11.251 -19.127 -8.316  1.00 0.00 ? 74  LYS A NZ   6  
ATOM 10123 H H    . LYS A 1 74  ? -4.569  -19.878 -8.364  1.00 0.00 ? 74  LYS A H    6  
ATOM 10124 H HA   . LYS A 1 74  ? -6.497  -17.853 -8.654  1.00 0.00 ? 74  LYS A HA   6  
ATOM 10125 H HB2  . LYS A 1 74  ? -6.335  -20.335 -6.968  1.00 0.00 ? 74  LYS A HB2  6  
ATOM 10126 H HB3  . LYS A 1 74  ? -7.695  -19.230 -6.810  1.00 0.00 ? 74  LYS A HB3  6  
ATOM 10127 H HG2  . LYS A 1 74  ? -6.938  -20.223 -9.515  1.00 0.00 ? 74  LYS A HG2  6  
ATOM 10128 H HG3  . LYS A 1 74  ? -7.825  -21.282 -8.415  1.00 0.00 ? 74  LYS A HG3  6  
ATOM 10129 H HD2  . LYS A 1 74  ? -8.763  -18.483 -8.929  1.00 0.00 ? 74  LYS A HD2  6  
ATOM 10130 H HD3  . LYS A 1 74  ? -9.148  -19.782 -10.061 1.00 0.00 ? 74  LYS A HD3  6  
ATOM 10131 H HE2  . LYS A 1 74  ? -10.306 -21.007 -8.377  1.00 0.00 ? 74  LYS A HE2  6  
ATOM 10132 H HE3  . LYS A 1 74  ? -9.725  -19.929 -7.108  1.00 0.00 ? 74  LYS A HE3  6  
ATOM 10133 H HZ1  . LYS A 1 74  ? -11.982 -19.388 -7.624  1.00 0.00 ? 74  LYS A HZ1  6  
ATOM 10134 H HZ2  . LYS A 1 74  ? -11.638 -19.248 -9.274  1.00 0.00 ? 74  LYS A HZ2  6  
ATOM 10135 H HZ3  . LYS A 1 74  ? -11.000 -18.127 -8.179  1.00 0.00 ? 74  LYS A HZ3  6  
ATOM 10136 N N    . HIS A 1 75  ? -6.732  -16.575 -6.462  1.00 0.00 ? 75  HIS A N    6  
ATOM 10137 C CA   . HIS A 1 75  ? -6.645  -15.642 -5.344  1.00 0.00 ? 75  HIS A CA   6  
ATOM 10138 C C    . HIS A 1 75  ? -5.333  -14.864 -5.387  1.00 0.00 ? 75  HIS A C    6  
ATOM 10139 O O    . HIS A 1 75  ? -4.657  -14.708 -4.369  1.00 0.00 ? 75  HIS A O    6  
ATOM 10140 C CB   . HIS A 1 75  ? -6.764  -16.390 -4.017  1.00 0.00 ? 75  HIS A CB   6  
ATOM 10141 C CG   . HIS A 1 75  ? -7.630  -17.610 -4.092  1.00 0.00 ? 75  HIS A CG   6  
ATOM 10142 N ND1  . HIS A 1 75  ? -8.867  -17.617 -4.701  1.00 0.00 ? 75  HIS A ND1  6  
ATOM 10143 C CD2  . HIS A 1 75  ? -7.431  -18.867 -3.633  1.00 0.00 ? 75  HIS A CD2  6  
ATOM 10144 C CE1  . HIS A 1 75  ? -9.393  -18.826 -4.612  1.00 0.00 ? 75  HIS A CE1  6  
ATOM 10145 N NE2  . HIS A 1 75  ? -8.540  -19.604 -3.968  1.00 0.00 ? 75  HIS A NE2  6  
ATOM 10146 H H    . HIS A 1 75  ? -7.490  -16.513 -7.079  1.00 0.00 ? 75  HIS A H    6  
ATOM 10147 H HA   . HIS A 1 75  ? -7.464  -14.945 -5.430  1.00 0.00 ? 75  HIS A HA   6  
ATOM 10148 H HB2  . HIS A 1 75  ? -5.781  -16.702 -3.697  1.00 0.00 ? 75  HIS A HB2  6  
ATOM 10149 H HB3  . HIS A 1 75  ? -7.186  -15.728 -3.274  1.00 0.00 ? 75  HIS A HB3  6  
ATOM 10150 H HD1  . HIS A 1 75  ? -9.297  -16.850 -5.133  1.00 0.00 ? 75  HIS A HD1  6  
ATOM 10151 H HD2  . HIS A 1 75  ? -6.561  -19.226 -3.101  1.00 0.00 ? 75  HIS A HD2  6  
ATOM 10152 H HE1  . HIS A 1 75  ? -10.354 -19.128 -4.999  1.00 0.00 ? 75  HIS A HE1  6  
ATOM 10153 H HE2  . HIS A 1 75  ? -8.718  -20.527 -3.691  1.00 0.00 ? 75  HIS A HE2  6  
ATOM 10154 N N    . THR A 1 76  ? -4.977  -14.378 -6.572  1.00 0.00 ? 76  THR A N    6  
ATOM 10155 C CA   . THR A 1 76  ? -3.745  -13.618 -6.748  1.00 0.00 ? 76  THR A CA   6  
ATOM 10156 C C    . THR A 1 76  ? -4.032  -12.224 -7.295  1.00 0.00 ? 76  THR A C    6  
ATOM 10157 O O    . THR A 1 76  ? -4.890  -12.051 -8.160  1.00 0.00 ? 76  THR A O    6  
ATOM 10158 C CB   . THR A 1 76  ? -2.772  -14.340 -7.699  1.00 0.00 ? 76  THR A CB   6  
ATOM 10159 O OG1  . THR A 1 76  ? -2.561  -15.685 -7.257  1.00 0.00 ? 76  THR A OG1  6  
ATOM 10160 C CG2  . THR A 1 76  ? -1.440  -13.608 -7.767  1.00 0.00 ? 76  THR A CG2  6  
ATOM 10161 H H    . THR A 1 76  ? -5.557  -14.535 -7.346  1.00 0.00 ? 76  THR A H    6  
ATOM 10162 H HA   . THR A 1 76  ? -3.270  -13.525 -5.783  1.00 0.00 ? 76  THR A HA   6  
ATOM 10163 H HB   . THR A 1 76  ? -3.206  -14.358 -8.689  1.00 0.00 ? 76  THR A HB   6  
ATOM 10164 H HG1  . THR A 1 76  ? -3.401  -16.073 -7.000  1.00 0.00 ? 76  THR A HG1  6  
ATOM 10165 H HG21 . THR A 1 76  ? -1.490  -12.712 -7.166  1.00 0.00 ? 76  THR A HG21 6  
ATOM 10166 H HG22 . THR A 1 76  ? -1.226  -13.343 -8.792  1.00 0.00 ? 76  THR A HG22 6  
ATOM 10167 H HG23 . THR A 1 76  ? -0.657  -14.249 -7.390  1.00 0.00 ? 76  THR A HG23 6  
ATOM 10168 N N    . PHE A 1 77  ? -3.309  -11.233 -6.784  1.00 0.00 ? 77  PHE A N    6  
ATOM 10169 C CA   . PHE A 1 77  ? -3.487  -9.854  -7.221  1.00 0.00 ? 77  PHE A CA   6  
ATOM 10170 C C    . PHE A 1 77  ? -2.150  -9.231  -7.612  1.00 0.00 ? 77  PHE A C    6  
ATOM 10171 O O    . PHE A 1 77  ? -1.087  -9.719  -7.227  1.00 0.00 ? 77  PHE A O    6  
ATOM 10172 C CB   . PHE A 1 77  ? -4.143  -9.026  -6.114  1.00 0.00 ? 77  PHE A CB   6  
ATOM 10173 C CG   . PHE A 1 77  ? -3.576  -9.294  -4.749  1.00 0.00 ? 77  PHE A CG   6  
ATOM 10174 C CD1  . PHE A 1 77  ? -3.907  -10.450 -4.061  1.00 0.00 ? 77  PHE A CD1  6  
ATOM 10175 C CD2  . PHE A 1 77  ? -2.712  -8.389  -4.154  1.00 0.00 ? 77  PHE A CD2  6  
ATOM 10176 C CE1  . PHE A 1 77  ? -3.386  -10.699 -2.805  1.00 0.00 ? 77  PHE A CE1  6  
ATOM 10177 C CE2  . PHE A 1 77  ? -2.188  -8.633  -2.899  1.00 0.00 ? 77  PHE A CE2  6  
ATOM 10178 C CZ   . PHE A 1 77  ? -2.526  -9.789  -2.223  1.00 0.00 ? 77  PHE A CZ   6  
ATOM 10179 H H    . PHE A 1 77  ? -2.640  -11.435 -6.096  1.00 0.00 ? 77  PHE A H    6  
ATOM 10180 H HA   . PHE A 1 77  ? -4.133  -9.861  -8.085  1.00 0.00 ? 77  PHE A HA   6  
ATOM 10181 H HB2  . PHE A 1 77  ? -4.006  -7.977  -6.329  1.00 0.00 ? 77  PHE A HB2  6  
ATOM 10182 H HB3  . PHE A 1 77  ? -5.199  -9.249  -6.086  1.00 0.00 ? 77  PHE A HB3  6  
ATOM 10183 H HD1  . PHE A 1 77  ? -4.580  -11.163 -4.516  1.00 0.00 ? 77  PHE A HD1  6  
ATOM 10184 H HD2  . PHE A 1 77  ? -2.447  -7.483  -4.680  1.00 0.00 ? 77  PHE A HD2  6  
ATOM 10185 H HE1  . PHE A 1 77  ? -3.653  -11.604 -2.280  1.00 0.00 ? 77  PHE A HE1  6  
ATOM 10186 H HE2  . PHE A 1 77  ? -1.516  -7.919  -2.445  1.00 0.00 ? 77  PHE A HE2  6  
ATOM 10187 H HZ   . PHE A 1 77  ? -2.118  -9.982  -1.242  1.00 0.00 ? 77  PHE A HZ   6  
ATOM 10188 N N    . LYS A 1 78  ? -2.211  -8.149  -8.381  1.00 0.00 ? 78  LYS A N    6  
ATOM 10189 C CA   . LYS A 1 78  ? -1.007  -7.457  -8.826  1.00 0.00 ? 78  LYS A CA   6  
ATOM 10190 C C    . LYS A 1 78  ? -0.985  -6.020  -8.316  1.00 0.00 ? 78  LYS A C    6  
ATOM 10191 O O    . LYS A 1 78  ? -2.029  -5.381  -8.186  1.00 0.00 ? 78  LYS A O    6  
ATOM 10192 C CB   . LYS A 1 78  ? -0.922  -7.468  -10.354 1.00 0.00 ? 78  LYS A CB   6  
ATOM 10193 C CG   . LYS A 1 78  ? -2.150  -6.891  -11.035 1.00 0.00 ? 78  LYS A CG   6  
ATOM 10194 C CD   . LYS A 1 78  ? -1.799  -6.249  -12.367 1.00 0.00 ? 78  LYS A CD   6  
ATOM 10195 C CE   . LYS A 1 78  ? -2.849  -5.234  -12.791 1.00 0.00 ? 78  LYS A CE   6  
ATOM 10196 N NZ   . LYS A 1 78  ? -2.586  -3.888  -12.209 1.00 0.00 ? 78  LYS A NZ   6  
ATOM 10197 H H    . LYS A 1 78  ? -3.088  -7.806  -8.656  1.00 0.00 ? 78  LYS A H    6  
ATOM 10198 H HA   . LYS A 1 78  ? -0.154  -7.982  -8.423  1.00 0.00 ? 78  LYS A HA   6  
ATOM 10199 H HB2  . LYS A 1 78  ? -0.062  -6.890  -10.659 1.00 0.00 ? 78  LYS A HB2  6  
ATOM 10200 H HB3  . LYS A 1 78  ? -0.797  -8.488  -10.688 1.00 0.00 ? 78  LYS A HB3  6  
ATOM 10201 H HG2  . LYS A 1 78  ? -2.862  -7.685  -11.207 1.00 0.00 ? 78  LYS A HG2  6  
ATOM 10202 H HG3  . LYS A 1 78  ? -2.590  -6.143  -10.391 1.00 0.00 ? 78  LYS A HG3  6  
ATOM 10203 H HD2  . LYS A 1 78  ? -0.847  -5.748  -12.276 1.00 0.00 ? 78  LYS A HD2  6  
ATOM 10204 H HD3  . LYS A 1 78  ? -1.732  -7.020  -13.122 1.00 0.00 ? 78  LYS A HD3  6  
ATOM 10205 H HE2  . LYS A 1 78  ? -2.845  -5.158  -13.867 1.00 0.00 ? 78  LYS A HE2  6  
ATOM 10206 H HE3  . LYS A 1 78  ? -3.818  -5.577  -12.458 1.00 0.00 ? 78  LYS A HE3  6  
ATOM 10207 H HZ1  . LYS A 1 78  ? -2.078  -3.983  -11.306 1.00 0.00 ? 78  LYS A HZ1  6  
ATOM 10208 H HZ2  . LYS A 1 78  ? -3.484  -3.391  -12.037 1.00 0.00 ? 78  LYS A HZ2  6  
ATOM 10209 H HZ3  . LYS A 1 78  ? -2.008  -3.323  -12.862 1.00 0.00 ? 78  LYS A HZ3  6  
ATOM 10210 N N    . ALA A 1 79  ? 0.211   -5.516  -8.028  1.00 0.00 ? 79  ALA A N    6  
ATOM 10211 C CA   . ALA A 1 79  ? 0.367   -4.153  -7.536  1.00 0.00 ? 79  ALA A CA   6  
ATOM 10212 C C    . ALA A 1 79  ? 1.497   -3.433  -8.264  1.00 0.00 ? 79  ALA A C    6  
ATOM 10213 O O    . ALA A 1 79  ? 2.673   -3.673  -7.996  1.00 0.00 ? 79  ALA A O    6  
ATOM 10214 C CB   . ALA A 1 79  ? 0.624   -4.160  -6.036  1.00 0.00 ? 79  ALA A CB   6  
ATOM 10215 H H    . ALA A 1 79  ? 1.006   -6.074  -8.152  1.00 0.00 ? 79  ALA A H    6  
ATOM 10216 H HA   . ALA A 1 79  ? -0.558  -3.625  -7.715  1.00 0.00 ? 79  ALA A HA   6  
ATOM 10217 H HB1  . ALA A 1 79  ? -0.015  -4.893  -5.566  1.00 0.00 ? 79  ALA A HB1  6  
ATOM 10218 H HB2  . ALA A 1 79  ? 1.658   -4.410  -5.849  1.00 0.00 ? 79  ALA A HB2  6  
ATOM 10219 H HB3  . ALA A 1 79  ? 0.411   -3.183  -5.630  1.00 0.00 ? 79  ALA A HB3  6  
ATOM 10220 N N    . GLU A 1 80  ? 1.130   -2.549  -9.188  1.00 0.00 ? 80  GLU A N    6  
ATOM 10221 C CA   . GLU A 1 80  ? 2.114   -1.795  -9.956  1.00 0.00 ? 80  GLU A CA   6  
ATOM 10222 C C    . GLU A 1 80  ? 1.858   -0.295  -9.844  1.00 0.00 ? 80  GLU A C    6  
ATOM 10223 O O    . GLU A 1 80  ? 0.720   0.141   -9.671  1.00 0.00 ? 80  GLU A O    6  
ATOM 10224 C CB   . GLU A 1 80  ? 2.083   -2.221  -11.425 1.00 0.00 ? 80  GLU A CB   6  
ATOM 10225 C CG   . GLU A 1 80  ? 0.839   -1.760  -12.166 1.00 0.00 ? 80  GLU A CG   6  
ATOM 10226 C CD   . GLU A 1 80  ? 0.837   -2.182  -13.622 1.00 0.00 ? 80  GLU A CD   6  
ATOM 10227 O OE1  . GLU A 1 80  ? 1.871   -1.994  -14.296 1.00 0.00 ? 80  GLU A OE1  6  
ATOM 10228 O OE2  . GLU A 1 80  ? -0.200  -2.701  -14.087 1.00 0.00 ? 80  GLU A OE2  6  
ATOM 10229 H H    . GLU A 1 80  ? 0.176   -2.401  -9.356  1.00 0.00 ? 80  GLU A H    6  
ATOM 10230 H HA   . GLU A 1 80  ? 3.090   -2.013  -9.549  1.00 0.00 ? 80  GLU A HA   6  
ATOM 10231 H HB2  . GLU A 1 80  ? 2.948   -1.811  -11.925 1.00 0.00 ? 80  GLU A HB2  6  
ATOM 10232 H HB3  . GLU A 1 80  ? 2.126   -3.299  -11.475 1.00 0.00 ? 80  GLU A HB3  6  
ATOM 10233 H HG2  . GLU A 1 80  ? -0.030  -2.183  -11.683 1.00 0.00 ? 80  GLU A HG2  6  
ATOM 10234 H HG3  . GLU A 1 80  ? 0.786   -0.682  -12.118 1.00 0.00 ? 80  GLU A HG3  6  
ATOM 10235 N N    . HIS A 1 81  ? 2.926   0.491   -9.944  1.00 0.00 ? 81  HIS A N    6  
ATOM 10236 C CA   . HIS A 1 81  ? 2.818   1.942   -9.855  1.00 0.00 ? 81  HIS A CA   6  
ATOM 10237 C C    . HIS A 1 81  ? 2.754   2.569   -11.244 1.00 0.00 ? 81  HIS A C    6  
ATOM 10238 O O    . HIS A 1 81  ? 2.956   3.773   -11.403 1.00 0.00 ? 81  HIS A O    6  
ATOM 10239 C CB   . HIS A 1 81  ? 4.003   2.516   -9.078  1.00 0.00 ? 81  HIS A CB   6  
ATOM 10240 C CG   . HIS A 1 81  ? 3.873   3.978   -8.780  1.00 0.00 ? 81  HIS A CG   6  
ATOM 10241 N ND1  . HIS A 1 81  ? 4.898   4.733   -8.251  1.00 0.00 ? 81  HIS A ND1  6  
ATOM 10242 C CD2  . HIS A 1 81  ? 2.830   4.825   -8.942  1.00 0.00 ? 81  HIS A CD2  6  
ATOM 10243 C CE1  . HIS A 1 81  ? 4.491   5.980   -8.098  1.00 0.00 ? 81  HIS A CE1  6  
ATOM 10244 N NE2  . HIS A 1 81  ? 3.239   6.063   -8.511  1.00 0.00 ? 81  HIS A NE2  6  
ATOM 10245 H H    . HIS A 1 81  ? 3.807   0.084   -10.082 1.00 0.00 ? 81  HIS A H    6  
ATOM 10246 H HA   . HIS A 1 81  ? 1.906   2.175   -9.326  1.00 0.00 ? 81  HIS A HA   6  
ATOM 10247 H HB2  . HIS A 1 81  ? 4.096   1.993   -8.138  1.00 0.00 ? 81  HIS A HB2  6  
ATOM 10248 H HB3  . HIS A 1 81  ? 4.906   2.374   -9.655  1.00 0.00 ? 81  HIS A HB3  6  
ATOM 10249 H HD1  . HIS A 1 81  ? 5.791   4.403   -8.019  1.00 0.00 ? 81  HIS A HD1  6  
ATOM 10250 H HD2  . HIS A 1 81  ? 1.855   4.575   -9.337  1.00 0.00 ? 81  HIS A HD2  6  
ATOM 10251 H HE1  . HIS A 1 81  ? 5.080   6.794   -7.704  1.00 0.00 ? 81  HIS A HE1  6  
ATOM 10252 H HE2  . HIS A 1 81  ? 2.669   6.855   -8.428  1.00 0.00 ? 81  HIS A HE2  6  
ATOM 10253 N N    . ALA A 1 82  ? 2.471   1.744   -12.248 1.00 0.00 ? 82  ALA A N    6  
ATOM 10254 C CA   . ALA A 1 82  ? 2.379   2.218   -13.623 1.00 0.00 ? 82  ALA A CA   6  
ATOM 10255 C C    . ALA A 1 82  ? 3.670   2.906   -14.054 1.00 0.00 ? 82  ALA A C    6  
ATOM 10256 O O    . ALA A 1 82  ? 3.644   4.000   -14.616 1.00 0.00 ? 82  ALA A O    6  
ATOM 10257 C CB   . ALA A 1 82  ? 1.198   3.164   -13.777 1.00 0.00 ? 82  ALA A CB   6  
ATOM 10258 H H    . ALA A 1 82  ? 2.320   0.795   -12.058 1.00 0.00 ? 82  ALA A H    6  
ATOM 10259 H HA   . ALA A 1 82  ? 2.209   1.362   -14.260 1.00 0.00 ? 82  ALA A HA   6  
ATOM 10260 H HB1  . ALA A 1 82  ? 1.391   4.073   -13.227 1.00 0.00 ? 82  ALA A HB1  6  
ATOM 10261 H HB2  . ALA A 1 82  ? 1.058   3.398   -14.822 1.00 0.00 ? 82  ALA A HB2  6  
ATOM 10262 H HB3  . ALA A 1 82  ? 0.306   2.692   -13.392 1.00 0.00 ? 82  ALA A HB3  6  
ATOM 10263 N N    . GLY A 1 83  ? 4.799   2.257   -13.787 1.00 0.00 ? 83  GLY A N    6  
ATOM 10264 C CA   . GLY A 1 83  ? 6.085   2.822   -14.154 1.00 0.00 ? 83  GLY A CA   6  
ATOM 10265 C C    . GLY A 1 83  ? 7.221   2.269   -13.318 1.00 0.00 ? 83  GLY A C    6  
ATOM 10266 O O    . GLY A 1 83  ? 8.229   1.808   -13.854 1.00 0.00 ? 83  GLY A O    6  
ATOM 10267 H H    . GLY A 1 83  ? 4.759   1.387   -13.337 1.00 0.00 ? 83  GLY A H    6  
ATOM 10268 H HA2  . GLY A 1 83  ? 6.277   2.606   -15.194 1.00 0.00 ? 83  GLY A HA2  6  
ATOM 10269 H HA3  . GLY A 1 83  ? 6.045   3.894   -14.021 1.00 0.00 ? 83  GLY A HA3  6  
ATOM 10270 N N    . VAL A 1 84  ? 7.061   2.315   -11.999 1.00 0.00 ? 84  VAL A N    6  
ATOM 10271 C CA   . VAL A 1 84  ? 8.082   1.814   -11.087 1.00 0.00 ? 84  VAL A CA   6  
ATOM 10272 C C    . VAL A 1 84  ? 8.338   0.328   -11.310 1.00 0.00 ? 84  VAL A C    6  
ATOM 10273 O O    . VAL A 1 84  ? 9.381   -0.061  -11.836 1.00 0.00 ? 84  VAL A O    6  
ATOM 10274 C CB   . VAL A 1 84  ? 7.681   2.040   -9.617  1.00 0.00 ? 84  VAL A CB   6  
ATOM 10275 C CG1  . VAL A 1 84  ? 8.698   1.402   -8.682  1.00 0.00 ? 84  VAL A CG1  6  
ATOM 10276 C CG2  . VAL A 1 84  ? 7.537   3.526   -9.327  1.00 0.00 ? 84  VAL A CG2  6  
ATOM 10277 H H    . VAL A 1 84  ? 6.236   2.694   -11.631 1.00 0.00 ? 84  VAL A H    6  
ATOM 10278 H HA   . VAL A 1 84  ? 8.996   2.359   -11.277 1.00 0.00 ? 84  VAL A HA   6  
ATOM 10279 H HB   . VAL A 1 84  ? 6.725   1.567   -9.449  1.00 0.00 ? 84  VAL A HB   6  
ATOM 10280 H HG11 . VAL A 1 84  ? 8.488   1.701   -7.665  1.00 0.00 ? 84  VAL A HG11 6  
ATOM 10281 H HG12 . VAL A 1 84  ? 8.636   0.327   -8.763  1.00 0.00 ? 84  VAL A HG12 6  
ATOM 10282 H HG13 . VAL A 1 84  ? 9.691   1.728   -8.954  1.00 0.00 ? 84  VAL A HG13 6  
ATOM 10283 H HG21 . VAL A 1 84  ? 7.551   3.687   -8.259  1.00 0.00 ? 84  VAL A HG21 6  
ATOM 10284 H HG22 . VAL A 1 84  ? 8.356   4.064   -9.782  1.00 0.00 ? 84  VAL A HG22 6  
ATOM 10285 H HG23 . VAL A 1 84  ? 6.603   3.884   -9.733  1.00 0.00 ? 84  VAL A HG23 6  
ATOM 10286 N N    . ARG A 1 85  ? 7.378   -0.499  -10.907 1.00 0.00 ? 85  ARG A N    6  
ATOM 10287 C CA   . ARG A 1 85  ? 7.500   -1.943  -11.063 1.00 0.00 ? 85  ARG A CA   6  
ATOM 10288 C C    . ARG A 1 85  ? 6.157   -2.630  -10.829 1.00 0.00 ? 85  ARG A C    6  
ATOM 10289 O O    . ARG A 1 85  ? 5.264   -2.071  -10.192 1.00 0.00 ? 85  ARG A O    6  
ATOM 10290 C CB   . ARG A 1 85  ? 8.543   -2.496  -10.091 1.00 0.00 ? 85  ARG A CB   6  
ATOM 10291 C CG   . ARG A 1 85  ? 9.051   -3.880  -10.464 1.00 0.00 ? 85  ARG A CG   6  
ATOM 10292 C CD   . ARG A 1 85  ? 10.453  -4.122  -9.928  1.00 0.00 ? 85  ARG A CD   6  
ATOM 10293 N NE   . ARG A 1 85  ? 11.482  -3.708  -10.879 1.00 0.00 ? 85  ARG A NE   6  
ATOM 10294 C CZ   . ARG A 1 85  ? 12.738  -3.447  -10.536 1.00 0.00 ? 85  ARG A CZ   6  
ATOM 10295 N NH1  . ARG A 1 85  ? 13.119  -3.557  -9.270  1.00 0.00 ? 85  ARG A NH1  6  
ATOM 10296 N NH2  . ARG A 1 85  ? 13.616  -3.076  -11.458 1.00 0.00 ? 85  ARG A NH2  6  
ATOM 10297 H H    . ARG A 1 85  ? 6.570   -0.129  -10.495 1.00 0.00 ? 85  ARG A H    6  
ATOM 10298 H HA   . ARG A 1 85  ? 7.821   -2.143  -12.074 1.00 0.00 ? 85  ARG A HA   6  
ATOM 10299 H HB2  . ARG A 1 85  ? 9.387   -1.823  -10.065 1.00 0.00 ? 85  ARG A HB2  6  
ATOM 10300 H HB3  . ARG A 1 85  ? 8.106   -2.551  -9.105  1.00 0.00 ? 85  ARG A HB3  6  
ATOM 10301 H HG2  . ARG A 1 85  ? 8.386   -4.622  -10.048 1.00 0.00 ? 85  ARG A HG2  6  
ATOM 10302 H HG3  . ARG A 1 85  ? 9.066   -3.969  -11.540 1.00 0.00 ? 85  ARG A HG3  6  
ATOM 10303 H HD2  . ARG A 1 85  ? 10.576  -3.562  -9.013  1.00 0.00 ? 85  ARG A HD2  6  
ATOM 10304 H HD3  . ARG A 1 85  ? 10.569  -5.176  -9.723  1.00 0.00 ? 85  ARG A HD3  6  
ATOM 10305 H HE   . ARG A 1 85  ? 11.222  -3.620  -11.819 1.00 0.00 ? 85  ARG A HE   6  
ATOM 10306 H HH11 . ARG A 1 85  ? 12.460  -3.838  -8.573  1.00 0.00 ? 85  ARG A HH11 6  
ATOM 10307 H HH12 . ARG A 1 85  ? 14.066  -3.362  -9.015  1.00 0.00 ? 85  ARG A HH12 6  
ATOM 10308 H HH21 . ARG A 1 85  ? 13.332  -2.992  -12.413 1.00 0.00 ? 85  ARG A HH21 6  
ATOM 10309 H HH22 . ARG A 1 85  ? 14.561  -2.880  -11.199 1.00 0.00 ? 85  ARG A HH22 6  
ATOM 10310 N N    . THR A 1 86  ? 6.021   -3.845  -11.350 1.00 0.00 ? 86  THR A N    6  
ATOM 10311 C CA   . THR A 1 86  ? 4.788   -4.608  -11.200 1.00 0.00 ? 86  THR A CA   6  
ATOM 10312 C C    . THR A 1 86  ? 4.987   -5.798  -10.269 1.00 0.00 ? 86  THR A C    6  
ATOM 10313 O O    . THR A 1 86  ? 5.655   -6.771  -10.623 1.00 0.00 ? 86  THR A O    6  
ATOM 10314 C CB   . THR A 1 86  ? 4.272   -5.115  -12.560 1.00 0.00 ? 86  THR A CB   6  
ATOM 10315 O OG1  . THR A 1 86  ? 4.318   -4.059  -13.526 1.00 0.00 ? 86  THR A OG1  6  
ATOM 10316 C CG2  . THR A 1 86  ? 2.848   -5.636  -12.438 1.00 0.00 ? 86  THR A CG2  6  
ATOM 10317 H H    . THR A 1 86  ? 6.769   -4.237  -11.848 1.00 0.00 ? 86  THR A H    6  
ATOM 10318 H HA   . THR A 1 86  ? 4.040   -3.953  -10.776 1.00 0.00 ? 86  THR A HA   6  
ATOM 10319 H HB   . THR A 1 86  ? 4.908   -5.923  -12.891 1.00 0.00 ? 86  THR A HB   6  
ATOM 10320 H HG1  . THR A 1 86  ? 4.272   -4.431  -14.410 1.00 0.00 ? 86  THR A HG1  6  
ATOM 10321 H HG21 . THR A 1 86  ? 2.484   -5.458  -11.437 1.00 0.00 ? 86  THR A HG21 6  
ATOM 10322 H HG22 . THR A 1 86  ? 2.834   -6.696  -12.645 1.00 0.00 ? 86  THR A HG22 6  
ATOM 10323 H HG23 . THR A 1 86  ? 2.216   -5.123  -13.147 1.00 0.00 ? 86  THR A HG23 6  
ATOM 10324 N N    . TYR A 1 87  ? 4.404   -5.716  -9.078  1.00 0.00 ? 87  TYR A N    6  
ATOM 10325 C CA   . TYR A 1 87  ? 4.520   -6.787  -8.095  1.00 0.00 ? 87  TYR A CA   6  
ATOM 10326 C C    . TYR A 1 87  ? 3.371   -7.781  -8.236  1.00 0.00 ? 87  TYR A C    6  
ATOM 10327 O O    . TYR A 1 87  ? 2.404   -7.533  -8.957  1.00 0.00 ? 87  TYR A O    6  
ATOM 10328 C CB   . TYR A 1 87  ? 4.538   -6.208  -6.680  1.00 0.00 ? 87  TYR A CB   6  
ATOM 10329 C CG   . TYR A 1 87  ? 5.685   -5.254  -6.431  1.00 0.00 ? 87  TYR A CG   6  
ATOM 10330 C CD1  . TYR A 1 87  ? 5.752   -4.032  -7.087  1.00 0.00 ? 87  TYR A CD1  6  
ATOM 10331 C CD2  . TYR A 1 87  ? 6.701   -5.576  -5.540  1.00 0.00 ? 87  TYR A CD2  6  
ATOM 10332 C CE1  . TYR A 1 87  ? 6.798   -3.157  -6.863  1.00 0.00 ? 87  TYR A CE1  6  
ATOM 10333 C CE2  . TYR A 1 87  ? 7.750   -4.708  -5.309  1.00 0.00 ? 87  TYR A CE2  6  
ATOM 10334 C CZ   . TYR A 1 87  ? 7.794   -3.500  -5.973  1.00 0.00 ? 87  TYR A CZ   6  
ATOM 10335 O OH   . TYR A 1 87  ? 8.838   -2.632  -5.746  1.00 0.00 ? 87  TYR A OH   6  
ATOM 10336 H H    . TYR A 1 87  ? 3.885   -4.916  -8.854  1.00 0.00 ? 87  TYR A H    6  
ATOM 10337 H HA   . TYR A 1 87  ? 5.451   -7.303  -8.275  1.00 0.00 ? 87  TYR A HA   6  
ATOM 10338 H HB2  . TYR A 1 87  ? 3.618   -5.672  -6.505  1.00 0.00 ? 87  TYR A HB2  6  
ATOM 10339 H HB3  . TYR A 1 87  ? 4.619   -7.017  -5.968  1.00 0.00 ? 87  TYR A HB3  6  
ATOM 10340 H HD1  . TYR A 1 87  ? 4.970   -3.766  -7.784  1.00 0.00 ? 87  TYR A HD1  6  
ATOM 10341 H HD2  . TYR A 1 87  ? 6.664   -6.524  -5.022  1.00 0.00 ? 87  TYR A HD2  6  
ATOM 10342 H HE1  . TYR A 1 87  ? 6.833   -2.211  -7.383  1.00 0.00 ? 87  TYR A HE1  6  
ATOM 10343 H HE2  . TYR A 1 87  ? 8.531   -4.976  -4.612  1.00 0.00 ? 87  TYR A HE2  6  
ATOM 10344 H HH   . TYR A 1 87  ? 8.588   -1.750  -6.031  1.00 0.00 ? 87  TYR A HH   6  
ATOM 10345 N N    . PHE A 1 88  ? 3.483   -8.907  -7.539  1.00 0.00 ? 88  PHE A N    6  
ATOM 10346 C CA   . PHE A 1 88  ? 2.455   -9.940  -7.585  1.00 0.00 ? 88  PHE A CA   6  
ATOM 10347 C C    . PHE A 1 88  ? 2.382   -10.693 -6.259  1.00 0.00 ? 88  PHE A C    6  
ATOM 10348 O O    . PHE A 1 88  ? 3.357   -11.307 -5.826  1.00 0.00 ? 88  PHE A O    6  
ATOM 10349 C CB   . PHE A 1 88  ? 2.737   -10.920 -8.726  1.00 0.00 ? 88  PHE A CB   6  
ATOM 10350 C CG   . PHE A 1 88  ? 2.501   -10.335 -10.089 1.00 0.00 ? 88  PHE A CG   6  
ATOM 10351 C CD1  . PHE A 1 88  ? 3.517   -9.671  -10.757 1.00 0.00 ? 88  PHE A CD1  6  
ATOM 10352 C CD2  . PHE A 1 88  ? 1.265   -10.451 -10.703 1.00 0.00 ? 88  PHE A CD2  6  
ATOM 10353 C CE1  . PHE A 1 88  ? 3.303   -9.131  -12.012 1.00 0.00 ? 88  PHE A CE1  6  
ATOM 10354 C CE2  . PHE A 1 88  ? 1.045   -9.914  -11.958 1.00 0.00 ? 88  PHE A CE2  6  
ATOM 10355 C CZ   . PHE A 1 88  ? 2.066   -9.254  -12.613 1.00 0.00 ? 88  PHE A CZ   6  
ATOM 10356 H H    . PHE A 1 88  ? 4.277   -9.047  -6.981  1.00 0.00 ? 88  PHE A H    6  
ATOM 10357 H HA   . PHE A 1 88  ? 1.507   -9.456  -7.763  1.00 0.00 ? 88  PHE A HA   6  
ATOM 10358 H HB2  . PHE A 1 88  ? 3.768   -11.235 -8.674  1.00 0.00 ? 88  PHE A HB2  6  
ATOM 10359 H HB3  . PHE A 1 88  ? 2.095   -11.781 -8.617  1.00 0.00 ? 88  PHE A HB3  6  
ATOM 10360 H HD1  . PHE A 1 88  ? 4.486   -9.575  -10.289 1.00 0.00 ? 88  PHE A HD1  6  
ATOM 10361 H HD2  . PHE A 1 88  ? 0.465   -10.968 -10.191 1.00 0.00 ? 88  PHE A HD2  6  
ATOM 10362 H HE1  . PHE A 1 88  ? 4.103   -8.616  -12.522 1.00 0.00 ? 88  PHE A HE1  6  
ATOM 10363 H HE2  . PHE A 1 88  ? 0.076   -10.012 -12.425 1.00 0.00 ? 88  PHE A HE2  6  
ATOM 10364 H HZ   . PHE A 1 88  ? 1.896   -8.833  -13.593 1.00 0.00 ? 88  PHE A HZ   6  
ATOM 10365 N N    . PHE A 1 89  ? 1.218   -10.641 -5.620  1.00 0.00 ? 89  PHE A N    6  
ATOM 10366 C CA   . PHE A 1 89  ? 1.016   -11.316 -4.343  1.00 0.00 ? 89  PHE A CA   6  
ATOM 10367 C C    . PHE A 1 89  ? -0.120  -12.330 -4.438  1.00 0.00 ? 89  PHE A C    6  
ATOM 10368 O O    . PHE A 1 89  ? -1.220  -12.006 -4.886  1.00 0.00 ? 89  PHE A O    6  
ATOM 10369 C CB   . PHE A 1 89  ? 0.713   -10.295 -3.244  1.00 0.00 ? 89  PHE A CB   6  
ATOM 10370 C CG   . PHE A 1 89  ? 1.723   -9.187  -3.162  1.00 0.00 ? 89  PHE A CG   6  
ATOM 10371 C CD1  . PHE A 1 89  ? 2.987   -9.420  -2.642  1.00 0.00 ? 89  PHE A CD1  6  
ATOM 10372 C CD2  . PHE A 1 89  ? 1.410   -7.912  -3.604  1.00 0.00 ? 89  PHE A CD2  6  
ATOM 10373 C CE1  . PHE A 1 89  ? 3.918   -8.401  -2.564  1.00 0.00 ? 89  PHE A CE1  6  
ATOM 10374 C CE2  . PHE A 1 89  ? 2.337   -6.889  -3.529  1.00 0.00 ? 89  PHE A CE2  6  
ATOM 10375 C CZ   . PHE A 1 89  ? 3.593   -7.135  -3.009  1.00 0.00 ? 89  PHE A CZ   6  
ATOM 10376 H H    . PHE A 1 89  ? 0.477   -10.136 -6.016  1.00 0.00 ? 89  PHE A H    6  
ATOM 10377 H HA   . PHE A 1 89  ? 1.928   -11.837 -4.097  1.00 0.00 ? 89  PHE A HA   6  
ATOM 10378 H HB2  . PHE A 1 89  ? -0.252  -9.850  -3.432  1.00 0.00 ? 89  PHE A HB2  6  
ATOM 10379 H HB3  . PHE A 1 89  ? 0.693   -10.800 -2.290  1.00 0.00 ? 89  PHE A HB3  6  
ATOM 10380 H HD1  . PHE A 1 89  ? 3.242   -10.410 -2.294  1.00 0.00 ? 89  PHE A HD1  6  
ATOM 10381 H HD2  . PHE A 1 89  ? 0.428   -7.718  -4.011  1.00 0.00 ? 89  PHE A HD2  6  
ATOM 10382 H HE1  . PHE A 1 89  ? 4.899   -8.596  -2.157  1.00 0.00 ? 89  PHE A HE1  6  
ATOM 10383 H HE2  . PHE A 1 89  ? 2.080   -5.900  -3.878  1.00 0.00 ? 89  PHE A HE2  6  
ATOM 10384 H HZ   . PHE A 1 89  ? 4.318   -6.337  -2.949  1.00 0.00 ? 89  PHE A HZ   6  
ATOM 10385 N N    . SER A 1 90  ? 0.154   -13.559 -4.013  1.00 0.00 ? 90  SER A N    6  
ATOM 10386 C CA   . SER A 1 90  ? -0.843  -14.623 -4.054  1.00 0.00 ? 90  SER A CA   6  
ATOM 10387 C C    . SER A 1 90  ? -1.357  -14.939 -2.652  1.00 0.00 ? 90  SER A C    6  
ATOM 10388 O O    . SER A 1 90  ? -0.586  -14.995 -1.695  1.00 0.00 ? 90  SER A O    6  
ATOM 10389 C CB   . SER A 1 90  ? -0.250  -15.882 -4.688  1.00 0.00 ? 90  SER A CB   6  
ATOM 10390 O OG   . SER A 1 90  ? -1.197  -16.936 -4.710  1.00 0.00 ? 90  SER A OG   6  
ATOM 10391 H H    . SER A 1 90  ? 1.050   -13.756 -3.667  1.00 0.00 ? 90  SER A H    6  
ATOM 10392 H HA   . SER A 1 90  ? -1.669  -14.280 -4.658  1.00 0.00 ? 90  SER A HA   6  
ATOM 10393 H HB2  . SER A 1 90  ? 0.051   -15.664 -5.702  1.00 0.00 ? 90  SER A HB2  6  
ATOM 10394 H HB3  . SER A 1 90  ? 0.611   -16.199 -4.117  1.00 0.00 ? 90  SER A HB3  6  
ATOM 10395 H HG   . SER A 1 90  ? -1.771  -16.867 -3.943  1.00 0.00 ? 90  SER A HG   6  
ATOM 10396 N N    . ALA A 1 91  ? -2.665  -15.145 -2.541  1.00 0.00 ? 91  ALA A N    6  
ATOM 10397 C CA   . ALA A 1 91  ? -3.283  -15.458 -1.259  1.00 0.00 ? 91  ALA A CA   6  
ATOM 10398 C C    . ALA A 1 91  ? -3.753  -16.908 -1.215  1.00 0.00 ? 91  ALA A C    6  
ATOM 10399 O O    . ALA A 1 91  ? -4.345  -17.407 -2.171  1.00 0.00 ? 91  ALA A O    6  
ATOM 10400 C CB   . ALA A 1 91  ? -4.447  -14.516 -0.990  1.00 0.00 ? 91  ALA A CB   6  
ATOM 10401 H H    . ALA A 1 91  ? -3.227  -15.087 -3.342  1.00 0.00 ? 91  ALA A H    6  
ATOM 10402 H HA   . ALA A 1 91  ? -2.543  -15.306 -0.486  1.00 0.00 ? 91  ALA A HA   6  
ATOM 10403 H HB1  . ALA A 1 91  ? -5.227  -14.693 -1.716  1.00 0.00 ? 91  ALA A HB1  6  
ATOM 10404 H HB2  . ALA A 1 91  ? -4.831  -14.693 0.003   1.00 0.00 ? 91  ALA A HB2  6  
ATOM 10405 H HB3  . ALA A 1 91  ? -4.108  -13.494 -1.068  1.00 0.00 ? 91  ALA A HB3  6  
ATOM 10406 N N    . GLU A 1 92  ? -3.483  -17.579 -0.099  1.00 0.00 ? 92  GLU A N    6  
ATOM 10407 C CA   . GLU A 1 92  ? -3.878  -18.973 0.067   1.00 0.00 ? 92  GLU A CA   6  
ATOM 10408 C C    . GLU A 1 92  ? -5.392  -19.127 -0.047  1.00 0.00 ? 92  GLU A C    6  
ATOM 10409 O O    . GLU A 1 92  ? -5.886  -20.036 -0.714  1.00 0.00 ? 92  GLU A O    6  
ATOM 10410 C CB   . GLU A 1 92  ? -3.400  -19.504 1.420   1.00 0.00 ? 92  GLU A CB   6  
ATOM 10411 C CG   . GLU A 1 92  ? -1.898  -19.397 1.620   1.00 0.00 ? 92  GLU A CG   6  
ATOM 10412 C CD   . GLU A 1 92  ? -1.375  -20.377 2.652   1.00 0.00 ? 92  GLU A CD   6  
ATOM 10413 O OE1  . GLU A 1 92  ? -2.071  -20.599 3.664   1.00 0.00 ? 92  GLU A OE1  6  
ATOM 10414 O OE2  . GLU A 1 92  ? -0.270  -20.922 2.447   1.00 0.00 ? 92  GLU A OE2  6  
ATOM 10415 H H    . GLU A 1 92  ? -3.008  -17.127 0.628   1.00 0.00 ? 92  GLU A H    6  
ATOM 10416 H HA   . GLU A 1 92  ? -3.410  -19.546 -0.719  1.00 0.00 ? 92  GLU A HA   6  
ATOM 10417 H HB2  . GLU A 1 92  ? -3.888  -18.945 2.205   1.00 0.00 ? 92  GLU A HB2  6  
ATOM 10418 H HB3  . GLU A 1 92  ? -3.680  -20.543 1.504   1.00 0.00 ? 92  GLU A HB3  6  
ATOM 10419 H HG2  . GLU A 1 92  ? -1.407  -19.593 0.678   1.00 0.00 ? 92  GLU A HG2  6  
ATOM 10420 H HG3  . GLU A 1 92  ? -1.661  -18.394 1.945   1.00 0.00 ? 92  GLU A HG3  6  
ATOM 10421 N N    . SER A 1 93  ? -6.123  -18.232 0.611   1.00 0.00 ? 93  SER A N    6  
ATOM 10422 C CA   . SER A 1 93  ? -7.580  -18.271 0.588   1.00 0.00 ? 93  SER A CA   6  
ATOM 10423 C C    . SER A 1 93  ? -8.141  -17.126 -0.250  1.00 0.00 ? 93  SER A C    6  
ATOM 10424 O O    . SER A 1 93  ? -7.534  -16.062 -0.379  1.00 0.00 ? 93  SER A O    6  
ATOM 10425 C CB   . SER A 1 93  ? -8.136  -18.195 2.012   1.00 0.00 ? 93  SER A CB   6  
ATOM 10426 O OG   . SER A 1 93  ? -7.546  -17.127 2.733   1.00 0.00 ? 93  SER A OG   6  
ATOM 10427 H H    . SER A 1 93  ? -5.670  -17.531 1.125   1.00 0.00 ? 93  SER A H    6  
ATOM 10428 H HA   . SER A 1 93  ? -7.880  -19.208 0.143   1.00 0.00 ? 93  SER A HA   6  
ATOM 10429 H HB2  . SER A 1 93  ? -9.203  -18.040 1.971   1.00 0.00 ? 93  SER A HB2  6  
ATOM 10430 H HB3  . SER A 1 93  ? -7.926  -19.121 2.527   1.00 0.00 ? 93  SER A HB3  6  
ATOM 10431 H HG   . SER A 1 93  ? -7.214  -16.469 2.117   1.00 0.00 ? 93  SER A HG   6  
ATOM 10432 N N    . PRO A 1 94  ? -9.327  -17.348 -0.835  1.00 0.00 ? 94  PRO A N    6  
ATOM 10433 C CA   . PRO A 1 94  ? -9.997  -16.348 -1.671  1.00 0.00 ? 94  PRO A CA   6  
ATOM 10434 C C    . PRO A 1 94  ? -10.509 -15.163 -0.860  1.00 0.00 ? 94  PRO A C    6  
ATOM 10435 O O    . PRO A 1 94  ? -10.734 -14.080 -1.400  1.00 0.00 ? 94  PRO A O    6  
ATOM 10436 C CB   . PRO A 1 94  ? -11.167 -17.122 -2.283  1.00 0.00 ? 94  PRO A CB   6  
ATOM 10437 C CG   . PRO A 1 94  ? -11.439 -18.223 -1.316  1.00 0.00 ? 94  PRO A CG   6  
ATOM 10438 C CD   . PRO A 1 94  ? -10.106 -18.593 -0.725  1.00 0.00 ? 94  PRO A CD   6  
ATOM 10439 H HA   . PRO A 1 94  ? -9.349  -15.991 -2.459  1.00 0.00 ? 94  PRO A HA   6  
ATOM 10440 H HB2  . PRO A 1 94  ? -12.021 -16.467 -2.386  1.00 0.00 ? 94  PRO A HB2  6  
ATOM 10441 H HB3  . PRO A 1 94  ? -10.883 -17.508 -3.250  1.00 0.00 ? 94  PRO A HB3  6  
ATOM 10442 H HG2  . PRO A 1 94  ? -12.109 -17.878 -0.544  1.00 0.00 ? 94  PRO A HG2  6  
ATOM 10443 H HG3  . PRO A 1 94  ? -11.866 -19.069 -1.835  1.00 0.00 ? 94  PRO A HG3  6  
ATOM 10444 H HD2  . PRO A 1 94  ? -10.220 -18.886 0.308   1.00 0.00 ? 94  PRO A HD2  6  
ATOM 10445 H HD3  . PRO A 1 94  ? -9.647  -19.386 -1.296  1.00 0.00 ? 94  PRO A HD3  6  
ATOM 10446 N N    . GLU A 1 95  ? -10.689 -15.375 0.440   1.00 0.00 ? 95  GLU A N    6  
ATOM 10447 C CA   . GLU A 1 95  ? -11.175 -14.323 1.325   1.00 0.00 ? 95  GLU A CA   6  
ATOM 10448 C C    . GLU A 1 95  ? -10.086 -13.286 1.585   1.00 0.00 ? 95  GLU A C    6  
ATOM 10449 O O    . GLU A 1 95  ? -10.367 -12.094 1.706   1.00 0.00 ? 95  GLU A O    6  
ATOM 10450 C CB   . GLU A 1 95  ? -11.653 -14.920 2.650   1.00 0.00 ? 95  GLU A CB   6  
ATOM 10451 C CG   . GLU A 1 95  ? -10.577 -15.698 3.390   1.00 0.00 ? 95  GLU A CG   6  
ATOM 10452 C CD   . GLU A 1 95  ? -11.139 -16.541 4.519   1.00 0.00 ? 95  GLU A CD   6  
ATOM 10453 O OE1  . GLU A 1 95  ? -12.150 -17.237 4.291   1.00 0.00 ? 95  GLU A OE1  6  
ATOM 10454 O OE2  . GLU A 1 95  ? -10.567 -16.504 5.628   1.00 0.00 ? 95  GLU A OE2  6  
ATOM 10455 H H    . GLU A 1 95  ? -10.492 -16.260 0.812   1.00 0.00 ? 95  GLU A H    6  
ATOM 10456 H HA   . GLU A 1 95  ? -12.008 -13.838 0.839   1.00 0.00 ? 95  GLU A HA   6  
ATOM 10457 H HB2  . GLU A 1 95  ? -11.994 -14.120 3.290   1.00 0.00 ? 95  GLU A HB2  6  
ATOM 10458 H HB3  . GLU A 1 95  ? -12.478 -15.588 2.453   1.00 0.00 ? 95  GLU A HB3  6  
ATOM 10459 H HG2  . GLU A 1 95  ? -10.076 -16.349 2.690   1.00 0.00 ? 95  GLU A HG2  6  
ATOM 10460 H HG3  . GLU A 1 95  ? -9.865  -14.999 3.803   1.00 0.00 ? 95  GLU A HG3  6  
ATOM 10461 N N    . GLU A 1 96  ? -8.843  -13.749 1.671   1.00 0.00 ? 96  GLU A N    6  
ATOM 10462 C CA   . GLU A 1 96  ? -7.713  -12.862 1.919   1.00 0.00 ? 96  GLU A CA   6  
ATOM 10463 C C    . GLU A 1 96  ? -7.413  -12.008 0.691   1.00 0.00 ? 96  GLU A C    6  
ATOM 10464 O O    . GLU A 1 96  ? -7.268  -10.790 0.790   1.00 0.00 ? 96  GLU A O    6  
ATOM 10465 C CB   . GLU A 1 96  ? -6.474  -13.673 2.305   1.00 0.00 ? 96  GLU A CB   6  
ATOM 10466 C CG   . GLU A 1 96  ? -6.424  -14.043 3.778   1.00 0.00 ? 96  GLU A CG   6  
ATOM 10467 C CD   . GLU A 1 96  ? -5.362  -15.082 4.082   1.00 0.00 ? 96  GLU A CD   6  
ATOM 10468 O OE1  . GLU A 1 96  ? -4.996  -15.844 3.163   1.00 0.00 ? 96  GLU A OE1  6  
ATOM 10469 O OE2  . GLU A 1 96  ? -4.897  -15.132 5.240   1.00 0.00 ? 96  GLU A OE2  6  
ATOM 10470 H H    . GLU A 1 96  ? -8.683  -14.710 1.567   1.00 0.00 ? 96  GLU A H    6  
ATOM 10471 H HA   . GLU A 1 96  ? -7.976  -12.211 2.739   1.00 0.00 ? 96  GLU A HA   6  
ATOM 10472 H HB2  . GLU A 1 96  ? -6.460  -14.584 1.725   1.00 0.00 ? 96  GLU A HB2  6  
ATOM 10473 H HB3  . GLU A 1 96  ? -5.593  -13.094 2.071   1.00 0.00 ? 96  GLU A HB3  6  
ATOM 10474 H HG2  . GLU A 1 96  ? -6.211  -13.154 4.352   1.00 0.00 ? 96  GLU A HG2  6  
ATOM 10475 H HG3  . GLU A 1 96  ? -7.386  -14.437 4.070   1.00 0.00 ? 96  GLU A HG3  6  
ATOM 10476 N N    . GLN A 1 97  ? -7.320  -12.657 -0.466  1.00 0.00 ? 97  GLN A N    6  
ATOM 10477 C CA   . GLN A 1 97  ? -7.036  -11.957 -1.713  1.00 0.00 ? 97  GLN A CA   6  
ATOM 10478 C C    . GLN A 1 97  ? -7.802  -10.640 -1.785  1.00 0.00 ? 97  GLN A C    6  
ATOM 10479 O O    . GLN A 1 97  ? -7.204  -9.568  -1.872  1.00 0.00 ? 97  GLN A O    6  
ATOM 10480 C CB   . GLN A 1 97  ? -7.398  -12.838 -2.910  1.00 0.00 ? 97  GLN A CB   6  
ATOM 10481 C CG   . GLN A 1 97  ? -7.245  -12.136 -4.250  1.00 0.00 ? 97  GLN A CG   6  
ATOM 10482 C CD   . GLN A 1 97  ? -8.208  -12.661 -5.297  1.00 0.00 ? 97  GLN A CD   6  
ATOM 10483 O OE1  . GLN A 1 97  ? -9.100  -13.455 -4.994  1.00 0.00 ? 97  GLN A OE1  6  
ATOM 10484 N NE2  . GLN A 1 97  ? -8.032  -12.220 -6.537  1.00 0.00 ? 97  GLN A NE2  6  
ATOM 10485 H H    . GLN A 1 97  ? -7.446  -13.628 -0.480  1.00 0.00 ? 97  GLN A H    6  
ATOM 10486 H HA   . GLN A 1 97  ? -5.978  -11.746 -1.740  1.00 0.00 ? 97  GLN A HA   6  
ATOM 10487 H HB2  . GLN A 1 97  ? -6.758  -13.707 -2.909  1.00 0.00 ? 97  GLN A HB2  6  
ATOM 10488 H HB3  . GLN A 1 97  ? -8.425  -13.156 -2.810  1.00 0.00 ? 97  GLN A HB3  6  
ATOM 10489 H HG2  . GLN A 1 97  ? -7.429  -11.081 -4.112  1.00 0.00 ? 97  GLN A HG2  6  
ATOM 10490 H HG3  . GLN A 1 97  ? -6.236  -12.281 -4.605  1.00 0.00 ? 97  GLN A HG3  6  
ATOM 10491 H HE21 . GLN A 1 97  ? -7.300  -11.590 -6.704  1.00 0.00 ? 97  GLN A HE21 6  
ATOM 10492 H HE22 . GLN A 1 97  ? -8.639  -12.544 -7.234  1.00 0.00 ? 97  GLN A HE22 6  
ATOM 10493 N N    . GLU A 1 98  ? -9.128  -10.730 -1.749  1.00 0.00 ? 98  GLU A N    6  
ATOM 10494 C CA   . GLU A 1 98  ? -9.974  -9.544  -1.812  1.00 0.00 ? 98  GLU A CA   6  
ATOM 10495 C C    . GLU A 1 98  ? -9.635  -8.573  -0.685  1.00 0.00 ? 98  GLU A C    6  
ATOM 10496 O O    . GLU A 1 98  ? -9.399  -7.389  -0.922  1.00 0.00 ? 98  GLU A O    6  
ATOM 10497 C CB   . GLU A 1 98  ? -11.450 -9.940  -1.732  1.00 0.00 ? 98  GLU A CB   6  
ATOM 10498 C CG   . GLU A 1 98  ? -11.900 -10.847 -2.866  1.00 0.00 ? 98  GLU A CG   6  
ATOM 10499 C CD   . GLU A 1 98  ? -13.354 -11.258 -2.742  1.00 0.00 ? 98  GLU A CD   6  
ATOM 10500 O OE1  . GLU A 1 98  ? -14.227 -10.502 -3.216  1.00 0.00 ? 98  GLU A OE1  6  
ATOM 10501 O OE2  . GLU A 1 98  ? -13.618 -12.337 -2.171  1.00 0.00 ? 98  GLU A OE2  6  
ATOM 10502 H H    . GLU A 1 98  ? -9.546  -11.613 -1.679  1.00 0.00 ? 98  GLU A H    6  
ATOM 10503 H HA   . GLU A 1 98  ? -9.793  -9.057  -2.758  1.00 0.00 ? 98  GLU A HA   6  
ATOM 10504 H HB2  . GLU A 1 98  ? -11.623 -10.453 -0.798  1.00 0.00 ? 98  GLU A HB2  6  
ATOM 10505 H HB3  . GLU A 1 98  ? -12.052 -9.043  -1.757  1.00 0.00 ? 98  GLU A HB3  6  
ATOM 10506 H HG2  . GLU A 1 98  ? -11.768 -10.325 -3.801  1.00 0.00 ? 98  GLU A HG2  6  
ATOM 10507 H HG3  . GLU A 1 98  ? -11.288 -11.737 -2.862  1.00 0.00 ? 98  GLU A HG3  6  
ATOM 10508 N N    . ALA A 1 99  ? -9.613  -9.083  0.542   1.00 0.00 ? 99  ALA A N    6  
ATOM 10509 C CA   . ALA A 1 99  ? -9.302  -8.263  1.705   1.00 0.00 ? 99  ALA A CA   6  
ATOM 10510 C C    . ALA A 1 99  ? -8.103  -7.360  1.435   1.00 0.00 ? 99  ALA A C    6  
ATOM 10511 O O    . ALA A 1 99  ? -8.163  -6.150  1.655   1.00 0.00 ? 99  ALA A O    6  
ATOM 10512 C CB   . ALA A 1 99  ? -9.040  -9.144  2.918   1.00 0.00 ? 99  ALA A CB   6  
ATOM 10513 H H    . ALA A 1 99  ? -9.810  -10.035 0.667   1.00 0.00 ? 99  ALA A H    6  
ATOM 10514 H HA   . ALA A 1 99  ? -10.163 -7.646  1.919   1.00 0.00 ? 99  ALA A HA   6  
ATOM 10515 H HB1  . ALA A 1 99  ? -9.837  -9.013  3.635   1.00 0.00 ? 99  ALA A HB1  6  
ATOM 10516 H HB2  . ALA A 1 99  ? -8.999  -10.177 2.609   1.00 0.00 ? 99  ALA A HB2  6  
ATOM 10517 H HB3  . ALA A 1 99  ? -8.100  -8.864  3.369   1.00 0.00 ? 99  ALA A HB3  6  
ATOM 10518 N N    . TRP A 1 100 ? -7.015  -7.956  0.960   1.00 0.00 ? 100 TRP A N    6  
ATOM 10519 C CA   . TRP A 1 100 ? -5.801  -7.205  0.661   1.00 0.00 ? 100 TRP A CA   6  
ATOM 10520 C C    . TRP A 1 100 ? -6.057  -6.167  -0.425  1.00 0.00 ? 100 TRP A C    6  
ATOM 10521 O O    . TRP A 1 100 ? -5.876  -4.968  -0.206  1.00 0.00 ? 100 TRP A O    6  
ATOM 10522 C CB   . TRP A 1 100 ? -4.685  -8.155  0.223   1.00 0.00 ? 100 TRP A CB   6  
ATOM 10523 C CG   . TRP A 1 100 ? -4.006  -8.842  1.369   1.00 0.00 ? 100 TRP A CG   6  
ATOM 10524 C CD1  . TRP A 1 100 ? -4.270  -10.095 1.845   1.00 0.00 ? 100 TRP A CD1  6  
ATOM 10525 C CD2  . TRP A 1 100 ? -2.953  -8.315  2.183   1.00 0.00 ? 100 TRP A CD2  6  
ATOM 10526 N NE1  . TRP A 1 100 ? -3.445  -10.378 2.907   1.00 0.00 ? 100 TRP A NE1  6  
ATOM 10527 C CE2  . TRP A 1 100 ? -2.627  -9.302  3.133   1.00 0.00 ? 100 TRP A CE2  6  
ATOM 10528 C CE3  . TRP A 1 100 ? -2.253  -7.106  2.201   1.00 0.00 ? 100 TRP A CE3  6  
ATOM 10529 C CZ2  . TRP A 1 100 ? -1.633  -9.115  4.090   1.00 0.00 ? 100 TRP A CZ2  6  
ATOM 10530 C CZ3  . TRP A 1 100 ? -1.267  -6.921  3.151   1.00 0.00 ? 100 TRP A CZ3  6  
ATOM 10531 C CH2  . TRP A 1 100 ? -0.963  -7.921  4.084   1.00 0.00 ? 100 TRP A CH2  6  
ATOM 10532 H H    . TRP A 1 100 ? -7.029  -8.924  0.806   1.00 0.00 ? 100 TRP A H    6  
ATOM 10533 H HA   . TRP A 1 100 ? -5.496  -6.697  1.564   1.00 0.00 ? 100 TRP A HA   6  
ATOM 10534 H HB2  . TRP A 1 100 ? -5.099  -8.914  -0.423  1.00 0.00 ? 100 TRP A HB2  6  
ATOM 10535 H HB3  . TRP A 1 100 ? -3.937  -7.593  -0.319  1.00 0.00 ? 100 TRP A HB3  6  
ATOM 10536 H HD1  . TRP A 1 100 ? -5.022  -10.754 1.439   1.00 0.00 ? 100 TRP A HD1  6  
ATOM 10537 H HE1  . TRP A 1 100 ? -3.441  -11.215 3.417   1.00 0.00 ? 100 TRP A HE1  6  
ATOM 10538 H HE3  . TRP A 1 100 ? -2.473  -6.323  1.490   1.00 0.00 ? 100 TRP A HE3  6  
ATOM 10539 H HZ2  . TRP A 1 100 ? -1.386  -9.876  4.815   1.00 0.00 ? 100 TRP A HZ2  6  
ATOM 10540 H HZ3  . TRP A 1 100 ? -0.715  -5.993  3.180   1.00 0.00 ? 100 TRP A HZ3  6  
ATOM 10541 H HH2  . TRP A 1 100 ? -0.185  -7.734  4.808   1.00 0.00 ? 100 TRP A HH2  6  
ATOM 10542 N N    . ILE A 1 101 ? -6.479  -6.632  -1.596  1.00 0.00 ? 101 ILE A N    6  
ATOM 10543 C CA   . ILE A 1 101 ? -6.761  -5.742  -2.715  1.00 0.00 ? 101 ILE A CA   6  
ATOM 10544 C C    . ILE A 1 101 ? -7.384  -4.436  -2.235  1.00 0.00 ? 101 ILE A C    6  
ATOM 10545 O O    . ILE A 1 101 ? -7.086  -3.364  -2.761  1.00 0.00 ? 101 ILE A O    6  
ATOM 10546 C CB   . ILE A 1 101 ? -7.705  -6.403  -3.737  1.00 0.00 ? 101 ILE A CB   6  
ATOM 10547 C CG1  . ILE A 1 101 ? -7.025  -7.612  -4.383  1.00 0.00 ? 101 ILE A CG1  6  
ATOM 10548 C CG2  . ILE A 1 101 ? -8.128  -5.397  -4.796  1.00 0.00 ? 101 ILE A CG2  6  
ATOM 10549 C CD1  . ILE A 1 101 ? -7.960  -8.452  -5.226  1.00 0.00 ? 101 ILE A CD1  6  
ATOM 10550 H H    . ILE A 1 101 ? -6.605  -7.597  -1.709  1.00 0.00 ? 101 ILE A H    6  
ATOM 10551 H HA   . ILE A 1 101 ? -5.826  -5.522  -3.209  1.00 0.00 ? 101 ILE A HA   6  
ATOM 10552 H HB   . ILE A 1 101 ? -8.590  -6.733  -3.215  1.00 0.00 ? 101 ILE A HB   6  
ATOM 10553 H HG12 . ILE A 1 101 ? -6.225  -7.270  -5.019  1.00 0.00 ? 101 ILE A HG12 6  
ATOM 10554 H HG13 . ILE A 1 101 ? -6.618  -8.244  -3.608  1.00 0.00 ? 101 ILE A HG13 6  
ATOM 10555 H HG21 . ILE A 1 101 ? -7.459  -4.548  -4.774  1.00 0.00 ? 101 ILE A HG21 6  
ATOM 10556 H HG22 . ILE A 1 101 ? -8.086  -5.861  -5.770  1.00 0.00 ? 101 ILE A HG22 6  
ATOM 10557 H HG23 . ILE A 1 101 ? -9.136  -5.066  -4.597  1.00 0.00 ? 101 ILE A HG23 6  
ATOM 10558 H HD11 . ILE A 1 101 ? -7.580  -9.460  -5.291  1.00 0.00 ? 101 ILE A HD11 6  
ATOM 10559 H HD12 . ILE A 1 101 ? -8.940  -8.464  -4.773  1.00 0.00 ? 101 ILE A HD12 6  
ATOM 10560 H HD13 . ILE A 1 101 ? -8.028  -8.029  -6.218  1.00 0.00 ? 101 ILE A HD13 6  
ATOM 10561 N N    . GLN A 1 102 ? -8.251  -4.534  -1.232  1.00 0.00 ? 102 GLN A N    6  
ATOM 10562 C CA   . GLN A 1 102 ? -8.915  -3.359  -0.680  1.00 0.00 ? 102 GLN A CA   6  
ATOM 10563 C C    . GLN A 1 102 ? -8.049  -2.693  0.384   1.00 0.00 ? 102 GLN A C    6  
ATOM 10564 O O    . GLN A 1 102 ? -7.863  -1.476  0.374   1.00 0.00 ? 102 GLN A O    6  
ATOM 10565 C CB   . GLN A 1 102 ? -10.269 -3.747  -0.082  1.00 0.00 ? 102 GLN A CB   6  
ATOM 10566 C CG   . GLN A 1 102 ? -11.189 -4.451  -1.066  1.00 0.00 ? 102 GLN A CG   6  
ATOM 10567 C CD   . GLN A 1 102 ? -12.656 -4.206  -0.771  1.00 0.00 ? 102 GLN A CD   6  
ATOM 10568 O OE1  . GLN A 1 102 ? -13.134 -3.073  -0.840  1.00 0.00 ? 102 GLN A OE1  6  
ATOM 10569 N NE2  . GLN A 1 102 ? -13.379 -5.269  -0.441  1.00 0.00 ? 102 GLN A NE2  6  
ATOM 10570 H H    . GLN A 1 102 ? -8.447  -5.416  -0.854  1.00 0.00 ? 102 GLN A H    6  
ATOM 10571 H HA   . GLN A 1 102 ? -9.075  -2.659  -1.486  1.00 0.00 ? 102 GLN A HA   6  
ATOM 10572 H HB2  . GLN A 1 102 ? -10.103 -4.405  0.758   1.00 0.00 ? 102 GLN A HB2  6  
ATOM 10573 H HB3  . GLN A 1 102 ? -10.765 -2.852  0.264   1.00 0.00 ? 102 GLN A HB3  6  
ATOM 10574 H HG2  . GLN A 1 102 ? -10.973 -4.092  -2.061  1.00 0.00 ? 102 GLN A HG2  6  
ATOM 10575 H HG3  . GLN A 1 102 ? -11.000 -5.513  -1.018  1.00 0.00 ? 102 GLN A HG3  6  
ATOM 10576 H HE21 . GLN A 1 102 ? -12.931 -6.141  -0.405  1.00 0.00 ? 102 GLN A HE21 6  
ATOM 10577 H HE22 . GLN A 1 102 ? -14.330 -5.140  -0.244  1.00 0.00 ? 102 GLN A HE22 6  
ATOM 10578 N N    . ALA A 1 103 ? -7.520  -3.498  1.300   1.00 0.00 ? 103 ALA A N    6  
ATOM 10579 C CA   . ALA A 1 103 ? -6.672  -2.986  2.369   1.00 0.00 ? 103 ALA A CA   6  
ATOM 10580 C C    . ALA A 1 103 ? -5.497  -2.194  1.806   1.00 0.00 ? 103 ALA A C    6  
ATOM 10581 O O    . ALA A 1 103 ? -5.342  -1.007  2.091   1.00 0.00 ? 103 ALA A O    6  
ATOM 10582 C CB   . ALA A 1 103 ? -6.172  -4.130  3.239   1.00 0.00 ? 103 ALA A CB   6  
ATOM 10583 H H    . ALA A 1 103 ? -7.705  -4.459  1.254   1.00 0.00 ? 103 ALA A H    6  
ATOM 10584 H HA   . ALA A 1 103 ? -7.271  -2.332  2.986   1.00 0.00 ? 103 ALA A HA   6  
ATOM 10585 H HB1  . ALA A 1 103 ? -5.113  -4.269  3.075   1.00 0.00 ? 103 ALA A HB1  6  
ATOM 10586 H HB2  . ALA A 1 103 ? -6.348  -3.895  4.278   1.00 0.00 ? 103 ALA A HB2  6  
ATOM 10587 H HB3  . ALA A 1 103 ? -6.699  -5.036  2.980   1.00 0.00 ? 103 ALA A HB3  6  
ATOM 10588 N N    . MET A 1 104 ? -4.670  -2.860  1.005   1.00 0.00 ? 104 MET A N    6  
ATOM 10589 C CA   . MET A 1 104 ? -3.509  -2.217  0.402   1.00 0.00 ? 104 MET A CA   6  
ATOM 10590 C C    . MET A 1 104 ? -3.931  -1.275  -0.722  1.00 0.00 ? 104 MET A C    6  
ATOM 10591 O O    . MET A 1 104 ? -3.307  -0.238  -0.942  1.00 0.00 ? 104 MET A O    6  
ATOM 10592 C CB   . MET A 1 104 ? -2.539  -3.270  -0.137  1.00 0.00 ? 104 MET A CB   6  
ATOM 10593 C CG   . MET A 1 104 ? -3.054  -3.996  -1.369  1.00 0.00 ? 104 MET A CG   6  
ATOM 10594 S SD   . MET A 1 104 ? -2.439  -5.688  -1.486  1.00 0.00 ? 104 MET A SD   6  
ATOM 10595 C CE   . MET A 1 104 ? -0.678  -5.421  -1.301  1.00 0.00 ? 104 MET A CE   6  
ATOM 10596 H H    . MET A 1 104 ? -4.846  -3.805  0.814   1.00 0.00 ? 104 MET A H    6  
ATOM 10597 H HA   . MET A 1 104 ? -3.012  -1.642  1.170   1.00 0.00 ? 104 MET A HA   6  
ATOM 10598 H HB2  . MET A 1 104 ? -1.608  -2.787  -0.393  1.00 0.00 ? 104 MET A HB2  6  
ATOM 10599 H HB3  . MET A 1 104 ? -2.355  -4.002  0.635   1.00 0.00 ? 104 MET A HB3  6  
ATOM 10600 H HG2  . MET A 1 104 ? -4.132  -4.023  -1.331  1.00 0.00 ? 104 MET A HG2  6  
ATOM 10601 H HG3  . MET A 1 104 ? -2.740  -3.452  -2.248  1.00 0.00 ? 104 MET A HG3  6  
ATOM 10602 H HE1  . MET A 1 104 ? -0.216  -6.318  -0.915  1.00 0.00 ? 104 MET A HE1  6  
ATOM 10603 H HE2  . MET A 1 104 ? -0.248  -5.180  -2.261  1.00 0.00 ? 104 MET A HE2  6  
ATOM 10604 H HE3  . MET A 1 104 ? -0.508  -4.605  -0.614  1.00 0.00 ? 104 MET A HE3  6  
ATOM 10605 N N    . GLY A 1 105 ? -4.994  -1.644  -1.429  1.00 0.00 ? 105 GLY A N    6  
ATOM 10606 C CA   . GLY A 1 105 ? -5.481  -0.822  -2.521  1.00 0.00 ? 105 GLY A CA   6  
ATOM 10607 C C    . GLY A 1 105 ? -5.900  0.561   -2.063  1.00 0.00 ? 105 GLY A C    6  
ATOM 10608 O O    . GLY A 1 105 ? -5.449  1.566   -2.611  1.00 0.00 ? 105 GLY A O    6  
ATOM 10609 H H    . GLY A 1 105 ? -5.452  -2.482  -1.208  1.00 0.00 ? 105 GLY A H    6  
ATOM 10610 H HA2  . GLY A 1 105 ? -4.699  -0.723  -3.259  1.00 0.00 ? 105 GLY A HA2  6  
ATOM 10611 H HA3  . GLY A 1 105 ? -6.330  -1.311  -2.975  1.00 0.00 ? 105 GLY A HA3  6  
ATOM 10612 N N    . GLU A 1 106 ? -6.768  0.612   -1.057  1.00 0.00 ? 106 GLU A N    6  
ATOM 10613 C CA   . GLU A 1 106 ? -7.250  1.882   -0.529  1.00 0.00 ? 106 GLU A CA   6  
ATOM 10614 C C    . GLU A 1 106 ? -6.089  2.836   -0.260  1.00 0.00 ? 106 GLU A C    6  
ATOM 10615 O O    . GLU A 1 106 ? -6.136  4.008   -0.631  1.00 0.00 ? 106 GLU A O    6  
ATOM 10616 C CB   . GLU A 1 106 ? -8.046  1.656   0.758   1.00 0.00 ? 106 GLU A CB   6  
ATOM 10617 C CG   . GLU A 1 106 ? -7.191  1.678   2.014   1.00 0.00 ? 106 GLU A CG   6  
ATOM 10618 C CD   . GLU A 1 106 ? -8.007  1.496   3.279   1.00 0.00 ? 106 GLU A CD   6  
ATOM 10619 O OE1  . GLU A 1 106 ? -8.863  2.361   3.561   1.00 0.00 ? 106 GLU A OE1  6  
ATOM 10620 O OE2  . GLU A 1 106 ? -7.790  0.491   3.987   1.00 0.00 ? 106 GLU A OE2  6  
ATOM 10621 H H    . GLU A 1 106 ? -7.092  -0.224  -0.662  1.00 0.00 ? 106 GLU A H    6  
ATOM 10622 H HA   . GLU A 1 106 ? -7.899  2.325   -1.269  1.00 0.00 ? 106 GLU A HA   6  
ATOM 10623 H HB2  . GLU A 1 106 ? -8.796  2.428   0.844   1.00 0.00 ? 106 GLU A HB2  6  
ATOM 10624 H HB3  . GLU A 1 106 ? -8.536  0.695   0.699   1.00 0.00 ? 106 GLU A HB3  6  
ATOM 10625 H HG2  . GLU A 1 106 ? -6.466  0.880   1.955   1.00 0.00 ? 106 GLU A HG2  6  
ATOM 10626 H HG3  . GLU A 1 106 ? -6.677  2.626   2.068   1.00 0.00 ? 106 GLU A HG3  6  
ATOM 10627 N N    . ALA A 1 107 ? -5.047  2.323   0.387   1.00 0.00 ? 107 ALA A N    6  
ATOM 10628 C CA   . ALA A 1 107 ? -3.873  3.127   0.703   1.00 0.00 ? 107 ALA A CA   6  
ATOM 10629 C C    . ALA A 1 107 ? -3.321  3.808   -0.544  1.00 0.00 ? 107 ALA A C    6  
ATOM 10630 O O    . ALA A 1 107 ? -2.798  4.919   -0.476  1.00 0.00 ? 107 ALA A O    6  
ATOM 10631 C CB   . ALA A 1 107 ? -2.802  2.264   1.354   1.00 0.00 ? 107 ALA A CB   6  
ATOM 10632 H H    . ALA A 1 107 ? -5.068  1.381   0.656   1.00 0.00 ? 107 ALA A H    6  
ATOM 10633 H HA   . ALA A 1 107 ? -4.170  3.885   1.414   1.00 0.00 ? 107 ALA A HA   6  
ATOM 10634 H HB1  . ALA A 1 107 ? -2.026  2.898   1.757   1.00 0.00 ? 107 ALA A HB1  6  
ATOM 10635 H HB2  . ALA A 1 107 ? -3.243  1.682   2.150   1.00 0.00 ? 107 ALA A HB2  6  
ATOM 10636 H HB3  . ALA A 1 107 ? -2.378  1.600   0.615   1.00 0.00 ? 107 ALA A HB3  6  
ATOM 10637 N N    . ALA A 1 108 ? -3.441  3.133   -1.683  1.00 0.00 ? 108 ALA A N    6  
ATOM 10638 C CA   . ALA A 1 108 ? -2.955  3.674   -2.946  1.00 0.00 ? 108 ALA A CA   6  
ATOM 10639 C C    . ALA A 1 108 ? -3.848  4.810   -3.437  1.00 0.00 ? 108 ALA A C    6  
ATOM 10640 O O    . ALA A 1 108 ? -3.364  5.796   -3.992  1.00 0.00 ? 108 ALA A O    6  
ATOM 10641 C CB   . ALA A 1 108 ? -2.872  2.575   -3.994  1.00 0.00 ? 108 ALA A CB   6  
ATOM 10642 H H    . ALA A 1 108 ? -3.868  2.251   -1.673  1.00 0.00 ? 108 ALA A H    6  
ATOM 10643 H HA   . ALA A 1 108 ? -1.958  4.058   -2.783  1.00 0.00 ? 108 ALA A HA   6  
ATOM 10644 H HB1  . ALA A 1 108 ? -1.848  2.246   -4.089  1.00 0.00 ? 108 ALA A HB1  6  
ATOM 10645 H HB2  . ALA A 1 108 ? -3.492  1.743   -3.693  1.00 0.00 ? 108 ALA A HB2  6  
ATOM 10646 H HB3  . ALA A 1 108 ? -3.218  2.956   -4.944  1.00 0.00 ? 108 ALA A HB3  6  
ATOM 10647 N N    . ARG A 1 109 ? -5.152  4.662   -3.229  1.00 0.00 ? 109 ARG A N    6  
ATOM 10648 C CA   . ARG A 1 109 ? -6.112  5.675   -3.653  1.00 0.00 ? 109 ARG A CA   6  
ATOM 10649 C C    . ARG A 1 109 ? -5.732  7.047   -3.104  1.00 0.00 ? 109 ARG A C    6  
ATOM 10650 O O    . ARG A 1 109 ? -4.955  7.155   -2.155  1.00 0.00 ? 109 ARG A O    6  
ATOM 10651 C CB   . ARG A 1 109 ? -7.520  5.300   -3.187  1.00 0.00 ? 109 ARG A CB   6  
ATOM 10652 C CG   . ARG A 1 109 ? -8.283  4.443   -4.184  1.00 0.00 ? 109 ARG A CG   6  
ATOM 10653 C CD   . ARG A 1 109 ? -9.471  3.753   -3.531  1.00 0.00 ? 109 ARG A CD   6  
ATOM 10654 N NE   . ARG A 1 109 ? -10.620 4.645   -3.403  1.00 0.00 ? 109 ARG A NE   6  
ATOM 10655 C CZ   . ARG A 1 109 ? -11.589 4.471   -2.511  1.00 0.00 ? 109 ARG A CZ   6  
ATOM 10656 N NH1  . ARG A 1 109 ? -11.547 3.444   -1.673  1.00 0.00 ? 109 ARG A NH1  6  
ATOM 10657 N NH2  . ARG A 1 109 ? -12.603 5.326   -2.456  1.00 0.00 ? 109 ARG A NH2  6  
ATOM 10658 H H    . ARG A 1 109 ? -5.477  3.853   -2.781  1.00 0.00 ? 109 ARG A H    6  
ATOM 10659 H HA   . ARG A 1 109 ? -6.098  5.715   -4.731  1.00 0.00 ? 109 ARG A HA   6  
ATOM 10660 H HB2  . ARG A 1 109 ? -7.446  4.752   -2.258  1.00 0.00 ? 109 ARG A HB2  6  
ATOM 10661 H HB3  . ARG A 1 109 ? -8.083  6.205   -3.017  1.00 0.00 ? 109 ARG A HB3  6  
ATOM 10662 H HG2  . ARG A 1 109 ? -8.643  5.073   -4.984  1.00 0.00 ? 109 ARG A HG2  6  
ATOM 10663 H HG3  . ARG A 1 109 ? -7.617  3.694   -4.584  1.00 0.00 ? 109 ARG A HG3  6  
ATOM 10664 H HD2  . ARG A 1 109 ? -9.752  2.903   -4.134  1.00 0.00 ? 109 ARG A HD2  6  
ATOM 10665 H HD3  . ARG A 1 109 ? -9.177  3.415   -2.548  1.00 0.00 ? 109 ARG A HD3  6  
ATOM 10666 H HE   . ARG A 1 109 ? -10.671 5.410   -4.012  1.00 0.00 ? 109 ARG A HE   6  
ATOM 10667 H HH11 . ARG A 1 109 ? -10.784 2.799   -1.712  1.00 0.00 ? 109 ARG A HH11 6  
ATOM 10668 H HH12 . ARG A 1 109 ? -12.278 3.316   -1.002  1.00 0.00 ? 109 ARG A HH12 6  
ATOM 10669 H HH21 . ARG A 1 109 ? -12.637 6.101   -3.086  1.00 0.00 ? 109 ARG A HH21 6  
ATOM 10670 H HH22 . ARG A 1 109 ? -13.331 5.194   -1.785  1.00 0.00 ? 109 ARG A HH22 6  
ATOM 10671 N N    . VAL A 1 110 ? -6.285  8.094   -3.709  1.00 0.00 ? 110 VAL A N    6  
ATOM 10672 C CA   . VAL A 1 110 ? -6.005  9.460   -3.281  1.00 0.00 ? 110 VAL A CA   6  
ATOM 10673 C C    . VAL A 1 110 ? -7.294  10.242  -3.062  1.00 0.00 ? 110 VAL A C    6  
ATOM 10674 O O    . VAL A 1 110 ? -8.184  10.241  -3.912  1.00 0.00 ? 110 VAL A O    6  
ATOM 10675 C CB   . VAL A 1 110 ? -5.135  10.203  -4.312  1.00 0.00 ? 110 VAL A CB   6  
ATOM 10676 C CG1  . VAL A 1 110 ? -4.878  11.633  -3.862  1.00 0.00 ? 110 VAL A CG1  6  
ATOM 10677 C CG2  . VAL A 1 110 ? -3.825  9.463   -4.537  1.00 0.00 ? 110 VAL A CG2  6  
ATOM 10678 H H    . VAL A 1 110 ? -6.896  7.944   -4.460  1.00 0.00 ? 110 VAL A H    6  
ATOM 10679 H HA   . VAL A 1 110 ? -5.460  9.413   -2.349  1.00 0.00 ? 110 VAL A HA   6  
ATOM 10680 H HB   . VAL A 1 110 ? -5.671  10.235  -5.249  1.00 0.00 ? 110 VAL A HB   6  
ATOM 10681 H HG11 . VAL A 1 110 ? -5.772  12.033  -3.407  1.00 0.00 ? 110 VAL A HG11 6  
ATOM 10682 H HG12 . VAL A 1 110 ? -4.071  11.646  -3.145  1.00 0.00 ? 110 VAL A HG12 6  
ATOM 10683 H HG13 . VAL A 1 110 ? -4.610  12.237  -4.717  1.00 0.00 ? 110 VAL A HG13 6  
ATOM 10684 H HG21 . VAL A 1 110 ? -3.126  10.115  -5.038  1.00 0.00 ? 110 VAL A HG21 6  
ATOM 10685 H HG22 . VAL A 1 110 ? -3.415  9.159   -3.585  1.00 0.00 ? 110 VAL A HG22 6  
ATOM 10686 H HG23 . VAL A 1 110 ? -4.005  8.589   -5.146  1.00 0.00 ? 110 VAL A HG23 6  
ATOM 10687 N N    . GLN A 1 111 ? -7.387  10.910  -1.916  1.00 0.00 ? 111 GLN A N    6  
ATOM 10688 C CA   . GLN A 1 111 ? -8.569  11.697  -1.585  1.00 0.00 ? 111 GLN A CA   6  
ATOM 10689 C C    . GLN A 1 111 ? -9.167  12.333  -2.836  1.00 0.00 ? 111 GLN A C    6  
ATOM 10690 O O    . GLN A 1 111 ? -8.443  12.830  -3.698  1.00 0.00 ? 111 GLN A O    6  
ATOM 10691 C CB   . GLN A 1 111 ? -8.216  12.782  -0.566  1.00 0.00 ? 111 GLN A CB   6  
ATOM 10692 C CG   . GLN A 1 111 ? -7.072  13.680  -1.005  1.00 0.00 ? 111 GLN A CG   6  
ATOM 10693 C CD   . GLN A 1 111 ? -5.714  13.033  -0.811  1.00 0.00 ? 111 GLN A CD   6  
ATOM 10694 O OE1  . GLN A 1 111 ? -5.539  12.180  0.060   1.00 0.00 ? 111 GLN A OE1  6  
ATOM 10695 N NE2  . GLN A 1 111 ? -4.745  13.435  -1.625  1.00 0.00 ? 111 GLN A NE2  6  
ATOM 10696 H H    . GLN A 1 111 ? -6.644  10.872  -1.279  1.00 0.00 ? 111 GLN A H    6  
ATOM 10697 H HA   . GLN A 1 111 ? -9.300  11.032  -1.151  1.00 0.00 ? 111 GLN A HA   6  
ATOM 10698 H HB2  . GLN A 1 111 ? -9.087  13.399  -0.399  1.00 0.00 ? 111 GLN A HB2  6  
ATOM 10699 H HB3  . GLN A 1 111 ? -7.937  12.308  0.364   1.00 0.00 ? 111 GLN A HB3  6  
ATOM 10700 H HG2  . GLN A 1 111 ? -7.195  13.914  -2.052  1.00 0.00 ? 111 GLN A HG2  6  
ATOM 10701 H HG3  . GLN A 1 111 ? -7.105  14.592  -0.427  1.00 0.00 ? 111 GLN A HG3  6  
ATOM 10702 H HE21 . GLN A 1 111 ? -4.957  14.120  -2.294  1.00 0.00 ? 111 GLN A HE21 6  
ATOM 10703 H HE22 . GLN A 1 111 ? -3.858  13.034  -1.521  1.00 0.00 ? 111 GLN A HE22 6  
ATOM 10704 N N    . SER A 1 112 ? -10.493 12.314  -2.927  1.00 0.00 ? 112 SER A N    6  
ATOM 10705 C CA   . SER A 1 112 ? -11.189 12.885  -4.074  1.00 0.00 ? 112 SER A CA   6  
ATOM 10706 C C    . SER A 1 112 ? -10.417 12.623  -5.364  1.00 0.00 ? 112 SER A C    6  
ATOM 10707 O O    . SER A 1 112 ? -10.142 13.542  -6.134  1.00 0.00 ? 112 SER A O    6  
ATOM 10708 C CB   . SER A 1 112 ? -11.384 14.390  -3.881  1.00 0.00 ? 112 SER A CB   6  
ATOM 10709 O OG   . SER A 1 112 ? -12.237 14.657  -2.781  1.00 0.00 ? 112 SER A OG   6  
ATOM 10710 H H    . SER A 1 112 ? -11.016 11.904  -2.206  1.00 0.00 ? 112 SER A H    6  
ATOM 10711 H HA   . SER A 1 112 ? -12.156 12.412  -4.145  1.00 0.00 ? 112 SER A HA   6  
ATOM 10712 H HB2  . SER A 1 112 ? -10.427 14.855  -3.700  1.00 0.00 ? 112 SER A HB2  6  
ATOM 10713 H HB3  . SER A 1 112 ? -11.826 14.811  -4.773  1.00 0.00 ? 112 SER A HB3  6  
ATOM 10714 H HG   . SER A 1 112 ? -11.817 15.294  -2.198  1.00 0.00 ? 112 SER A HG   6  
ATOM 10715 N N    . GLY A 1 113 ? -10.069 11.360  -5.591  1.00 0.00 ? 113 GLY A N    6  
ATOM 10716 C CA   . GLY A 1 113 ? -9.332  10.997  -6.787  1.00 0.00 ? 113 GLY A CA   6  
ATOM 10717 C C    . GLY A 1 113 ? -10.034 11.436  -8.057  1.00 0.00 ? 113 GLY A C    6  
ATOM 10718 O O    . GLY A 1 113 ? -11.260 11.539  -8.109  1.00 0.00 ? 113 GLY A O    6  
ATOM 10719 H H    . GLY A 1 113 ? -10.315 10.668  -4.941  1.00 0.00 ? 113 GLY A H    6  
ATOM 10720 H HA2  . GLY A 1 113 ? -8.357  11.459  -6.750  1.00 0.00 ? 113 GLY A HA2  6  
ATOM 10721 H HA3  . GLY A 1 113 ? -9.210  9.924   -6.810  1.00 0.00 ? 113 GLY A HA3  6  
ATOM 10722 N N    . PRO A 1 114 ? -9.249  11.705  -9.110  1.00 0.00 ? 114 PRO A N    6  
ATOM 10723 C CA   . PRO A 1 114 ? -9.782  12.141  -10.404 1.00 0.00 ? 114 PRO A CA   6  
ATOM 10724 C C    . PRO A 1 114 ? -10.535 11.028  -11.126 1.00 0.00 ? 114 PRO A C    6  
ATOM 10725 O O    . PRO A 1 114 ? -11.003 11.210  -12.249 1.00 0.00 ? 114 PRO A O    6  
ATOM 10726 C CB   . PRO A 1 114 ? -8.528  12.534  -11.190 1.00 0.00 ? 114 PRO A CB   6  
ATOM 10727 C CG   . PRO A 1 114 ? -7.430  11.736  -10.575 1.00 0.00 ? 114 PRO A CG   6  
ATOM 10728 C CD   . PRO A 1 114 ? -7.780  11.603  -9.119  1.00 0.00 ? 114 PRO A CD   6  
ATOM 10729 H HA   . PRO A 1 114 ? -10.427 13.000  -10.298 1.00 0.00 ? 114 PRO A HA   6  
ATOM 10730 H HB2  . PRO A 1 114 ? -8.661  12.286  -12.233 1.00 0.00 ? 114 PRO A HB2  6  
ATOM 10731 H HB3  . PRO A 1 114 ? -8.351  13.594  -11.085 1.00 0.00 ? 114 PRO A HB3  6  
ATOM 10732 H HG2  . PRO A 1 114 ? -7.380  10.763  -11.039 1.00 0.00 ? 114 PRO A HG2  6  
ATOM 10733 H HG3  . PRO A 1 114 ? -6.491  12.256  -10.689 1.00 0.00 ? 114 PRO A HG3  6  
ATOM 10734 H HD2  . PRO A 1 114 ? -7.457  10.645  -8.739  1.00 0.00 ? 114 PRO A HD2  6  
ATOM 10735 H HD3  . PRO A 1 114 ? -7.335  12.406  -8.549  1.00 0.00 ? 114 PRO A HD3  6  
ATOM 10736 N N    . SER A 1 115 ? -10.648 9.876   -10.472 1.00 0.00 ? 115 SER A N    6  
ATOM 10737 C CA   . SER A 1 115 ? -11.342 8.733   -11.053 1.00 0.00 ? 115 SER A CA   6  
ATOM 10738 C C    . SER A 1 115 ? -12.521 9.189   -11.907 1.00 0.00 ? 115 SER A C    6  
ATOM 10739 O O    . SER A 1 115 ? -12.696 8.734   -13.037 1.00 0.00 ? 115 SER A O    6  
ATOM 10740 C CB   . SER A 1 115 ? -11.831 7.792   -9.950  1.00 0.00 ? 115 SER A CB   6  
ATOM 10741 O OG   . SER A 1 115 ? -10.772 6.989   -9.458  1.00 0.00 ? 115 SER A OG   6  
ATOM 10742 H H    . SER A 1 115 ? -10.253 9.793   -9.579  1.00 0.00 ? 115 SER A H    6  
ATOM 10743 H HA   . SER A 1 115 ? -10.641 8.204   -11.681 1.00 0.00 ? 115 SER A HA   6  
ATOM 10744 H HB2  . SER A 1 115 ? -12.233 8.374   -9.135  1.00 0.00 ? 115 SER A HB2  6  
ATOM 10745 H HB3  . SER A 1 115 ? -12.602 7.147   -10.346 1.00 0.00 ? 115 SER A HB3  6  
ATOM 10746 H HG   . SER A 1 115 ? -9.947  7.478   -9.511  1.00 0.00 ? 115 SER A HG   6  
ATOM 10747 N N    . SER A 1 116 ? -13.327 10.092  -11.358 1.00 0.00 ? 116 SER A N    6  
ATOM 10748 C CA   . SER A 1 116 ? -14.492 10.609  -12.066 1.00 0.00 ? 116 SER A CA   6  
ATOM 10749 C C    . SER A 1 116 ? -14.154 11.906  -12.794 1.00 0.00 ? 116 SER A C    6  
ATOM 10750 O O    . SER A 1 116 ? -14.150 12.982  -12.198 1.00 0.00 ? 116 SER A O    6  
ATOM 10751 C CB   . SER A 1 116 ? -15.646 10.844  -11.090 1.00 0.00 ? 116 SER A CB   6  
ATOM 10752 O OG   . SER A 1 116 ? -15.929 9.673   -10.344 1.00 0.00 ? 116 SER A OG   6  
ATOM 10753 H H    . SER A 1 116 ? -13.134 10.417  -10.453 1.00 0.00 ? 116 SER A H    6  
ATOM 10754 H HA   . SER A 1 116 ? -14.792 9.869   -12.794 1.00 0.00 ? 116 SER A HA   6  
ATOM 10755 H HB2  . SER A 1 116 ? -15.381 11.636  -10.407 1.00 0.00 ? 116 SER A HB2  6  
ATOM 10756 H HB3  . SER A 1 116 ? -16.530 11.126  -11.644 1.00 0.00 ? 116 SER A HB3  6  
ATOM 10757 H HG   . SER A 1 116 ? -16.868 9.479   -10.396 1.00 0.00 ? 116 SER A HG   6  
ATOM 10758 N N    . GLY A 1 117 ? -13.871 11.795  -14.089 1.00 0.00 ? 117 GLY A N    6  
ATOM 10759 C CA   . GLY A 1 117 ? -13.535 12.966  -14.878 1.00 0.00 ? 117 GLY A CA   6  
ATOM 10760 C C    . GLY A 1 117 ? -14.711 13.908  -15.046 1.00 0.00 ? 117 GLY A C    6  
ATOM 10761 O O    . GLY A 1 117 ? -15.318 13.968  -16.115 1.00 0.00 ? 117 GLY A O    6  
ATOM 10762 H H    . GLY A 1 117 ? -13.890 10.911  -14.511 1.00 0.00 ? 117 GLY A H    6  
ATOM 10763 H HA2  . GLY A 1 117 ? -12.730 13.496  -14.391 1.00 0.00 ? 117 GLY A HA2  6  
ATOM 10764 H HA3  . GLY A 1 117 ? -13.203 12.645  -15.854 1.00 0.00 ? 117 GLY A HA3  6  
ATOM 10765 N N    . GLY A 1 1   ? 14.715  15.194  1.790   1.00 0.00 ? 1   GLY A N    7  
ATOM 10766 C CA   . GLY A 1 1   ? 13.318  15.502  1.545   1.00 0.00 ? 1   GLY A CA   7  
ATOM 10767 C C    . GLY A 1 1   ? 12.428  15.127  2.713   1.00 0.00 ? 1   GLY A C    7  
ATOM 10768 O O    . GLY A 1 1   ? 11.647  15.946  3.196   1.00 0.00 ? 1   GLY A O    7  
ATOM 10769 H H1   . GLY A 1 1   ? 15.415  15.744  1.380   1.00 0.00 ? 1   GLY A H1   7  
ATOM 10770 H HA2  . GLY A 1 1   ? 13.222  16.561  1.358   1.00 0.00 ? 1   GLY A HA2  7  
ATOM 10771 H HA3  . GLY A 1 1   ? 12.990  14.961  0.670   1.00 0.00 ? 1   GLY A HA3  7  
ATOM 10772 N N    . SER A 1 2   ? 12.545  13.883  3.168   1.00 0.00 ? 2   SER A N    7  
ATOM 10773 C CA   . SER A 1 2   ? 11.741  13.398  4.284   1.00 0.00 ? 2   SER A CA   7  
ATOM 10774 C C    . SER A 1 2   ? 12.592  13.246  5.541   1.00 0.00 ? 2   SER A C    7  
ATOM 10775 O O    . SER A 1 2   ? 13.735  12.794  5.479   1.00 0.00 ? 2   SER A O    7  
ATOM 10776 C CB   . SER A 1 2   ? 11.091  12.060  3.928   1.00 0.00 ? 2   SER A CB   7  
ATOM 10777 O OG   . SER A 1 2   ? 10.170  11.659  4.927   1.00 0.00 ? 2   SER A OG   7  
ATOM 10778 H H    . SER A 1 2   ? 13.186  13.276  2.741   1.00 0.00 ? 2   SER A H    7  
ATOM 10779 H HA   . SER A 1 2   ? 10.966  14.126  4.474   1.00 0.00 ? 2   SER A HA   7  
ATOM 10780 H HB2  . SER A 1 2   ? 10.567  12.155  2.989   1.00 0.00 ? 2   SER A HB2  7  
ATOM 10781 H HB3  . SER A 1 2   ? 11.858  11.304  3.838   1.00 0.00 ? 2   SER A HB3  7  
ATOM 10782 H HG   . SER A 1 2   ? 10.310  10.733  5.140   1.00 0.00 ? 2   SER A HG   7  
ATOM 10783 N N    . SER A 1 3   ? 12.024  13.626  6.681   1.00 0.00 ? 3   SER A N    7  
ATOM 10784 C CA   . SER A 1 3   ? 12.731  13.535  7.954   1.00 0.00 ? 3   SER A CA   7  
ATOM 10785 C C    . SER A 1 3   ? 12.571  12.147  8.567   1.00 0.00 ? 3   SER A C    7  
ATOM 10786 O O    . SER A 1 3   ? 11.603  11.878  9.277   1.00 0.00 ? 3   SER A O    7  
ATOM 10787 C CB   . SER A 1 3   ? 12.213  14.597  8.926   1.00 0.00 ? 3   SER A CB   7  
ATOM 10788 O OG   . SER A 1 3   ? 13.043  14.690  10.070  1.00 0.00 ? 3   SER A OG   7  
ATOM 10789 H H    . SER A 1 3   ? 11.110  13.978  6.666   1.00 0.00 ? 3   SER A H    7  
ATOM 10790 H HA   . SER A 1 3   ? 13.779  13.714  7.764   1.00 0.00 ? 3   SER A HA   7  
ATOM 10791 H HB2  . SER A 1 3   ? 12.194  15.556  8.431   1.00 0.00 ? 3   SER A HB2  7  
ATOM 10792 H HB3  . SER A 1 3   ? 11.213  14.335  9.241   1.00 0.00 ? 3   SER A HB3  7  
ATOM 10793 H HG   . SER A 1 3   ? 13.056  15.597  10.384  1.00 0.00 ? 3   SER A HG   7  
ATOM 10794 N N    . GLY A 1 4   ? 13.529  11.269  8.285   1.00 0.00 ? 4   GLY A N    7  
ATOM 10795 C CA   . GLY A 1 4   ? 13.477  9.919   8.816   1.00 0.00 ? 4   GLY A CA   7  
ATOM 10796 C C    . GLY A 1 4   ? 12.106  9.290   8.667   1.00 0.00 ? 4   GLY A C    7  
ATOM 10797 O O    . GLY A 1 4   ? 11.710  8.902   7.568   1.00 0.00 ? 4   GLY A O    7  
ATOM 10798 H H    . GLY A 1 4   ? 14.277  11.540  7.713   1.00 0.00 ? 4   GLY A H    7  
ATOM 10799 H HA2  . GLY A 1 4   ? 14.199  9.311   8.293   1.00 0.00 ? 4   GLY A HA2  7  
ATOM 10800 H HA3  . GLY A 1 4   ? 13.735  9.947   9.864   1.00 0.00 ? 4   GLY A HA3  7  
ATOM 10801 N N    . SER A 1 5   ? 11.379  9.189   9.775   1.00 0.00 ? 5   SER A N    7  
ATOM 10802 C CA   . SER A 1 5   ? 10.046  8.597   9.764   1.00 0.00 ? 5   SER A CA   7  
ATOM 10803 C C    . SER A 1 5   ? 9.083   9.412   10.622  1.00 0.00 ? 5   SER A C    7  
ATOM 10804 O O    . SER A 1 5   ? 9.288   9.569   11.826  1.00 0.00 ? 5   SER A O    7  
ATOM 10805 C CB   . SER A 1 5   ? 10.101  7.154   10.269  1.00 0.00 ? 5   SER A CB   7  
ATOM 10806 O OG   . SER A 1 5   ? 8.812   6.566   10.274  1.00 0.00 ? 5   SER A OG   7  
ATOM 10807 H H    . SER A 1 5   ? 11.750  9.517   10.621  1.00 0.00 ? 5   SER A H    7  
ATOM 10808 H HA   . SER A 1 5   ? 9.691   8.599   8.745   1.00 0.00 ? 5   SER A HA   7  
ATOM 10809 H HB2  . SER A 1 5   ? 10.746  6.575   9.626   1.00 0.00 ? 5   SER A HB2  7  
ATOM 10810 H HB3  . SER A 1 5   ? 10.493  7.143   11.276  1.00 0.00 ? 5   SER A HB3  7  
ATOM 10811 H HG   . SER A 1 5   ? 8.241   7.051   10.874  1.00 0.00 ? 5   SER A HG   7  
ATOM 10812 N N    . SER A 1 6   ? 8.033   9.929   9.994   1.00 0.00 ? 6   SER A N    7  
ATOM 10813 C CA   . SER A 1 6   ? 7.039   10.731  10.697  1.00 0.00 ? 6   SER A CA   7  
ATOM 10814 C C    . SER A 1 6   ? 5.659   10.088  10.608  1.00 0.00 ? 6   SER A C    7  
ATOM 10815 O O    . SER A 1 6   ? 5.414   9.232   9.759   1.00 0.00 ? 6   SER A O    7  
ATOM 10816 C CB   . SER A 1 6   ? 6.993   12.147  10.119  1.00 0.00 ? 6   SER A CB   7  
ATOM 10817 O OG   . SER A 1 6   ? 6.554   12.133  8.771   1.00 0.00 ? 6   SER A OG   7  
ATOM 10818 H H    . SER A 1 6   ? 7.925   9.769   9.033   1.00 0.00 ? 6   SER A H    7  
ATOM 10819 H HA   . SER A 1 6   ? 7.331   10.785  11.735  1.00 0.00 ? 6   SER A HA   7  
ATOM 10820 H HB2  . SER A 1 6   ? 6.311   12.748  10.700  1.00 0.00 ? 6   SER A HB2  7  
ATOM 10821 H HB3  . SER A 1 6   ? 7.981   12.581  10.159  1.00 0.00 ? 6   SER A HB3  7  
ATOM 10822 H HG   . SER A 1 6   ? 7.102   11.532  8.262   1.00 0.00 ? 6   SER A HG   7  
ATOM 10823 N N    . GLY A 1 7   ? 4.758   10.507  11.492  1.00 0.00 ? 7   GLY A N    7  
ATOM 10824 C CA   . GLY A 1 7   ? 3.413   9.962   11.497  1.00 0.00 ? 7   GLY A CA   7  
ATOM 10825 C C    . GLY A 1 7   ? 3.382   8.501   11.901  1.00 0.00 ? 7   GLY A C    7  
ATOM 10826 O O    . GLY A 1 7   ? 3.633   7.618   11.081  1.00 0.00 ? 7   GLY A O    7  
ATOM 10827 H H    . GLY A 1 7   ? 5.010   11.192  12.146  1.00 0.00 ? 7   GLY A H    7  
ATOM 10828 H HA2  . GLY A 1 7   ? 2.809   10.529  12.189  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 10829 H HA3  . GLY A 1 7   ? 2.995   10.058  10.506  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 10830 N N    . ASN A 1 8   ? 3.074   8.245   13.168  1.00 0.00 ? 8   ASN A N    7  
ATOM 10831 C CA   . ASN A 1 8   ? 3.012   6.881   13.679  1.00 0.00 ? 8   ASN A CA   7  
ATOM 10832 C C    . ASN A 1 8   ? 1.567   6.401   13.778  1.00 0.00 ? 8   ASN A C    7  
ATOM 10833 O O    . ASN A 1 8   ? 0.677   7.157   14.166  1.00 0.00 ? 8   ASN A O    7  
ATOM 10834 C CB   . ASN A 1 8   ? 3.684   6.798   15.051  1.00 0.00 ? 8   ASN A CB   7  
ATOM 10835 C CG   . ASN A 1 8   ? 3.297   7.951   15.956  1.00 0.00 ? 8   ASN A CG   7  
ATOM 10836 O OD1  . ASN A 1 8   ? 2.116   8.266   16.109  1.00 0.00 ? 8   ASN A OD1  7  
ATOM 10837 N ND2  . ASN A 1 8   ? 4.292   8.589   16.561  1.00 0.00 ? 8   ASN A ND2  7  
ATOM 10838 H H    . ASN A 1 8   ? 2.883   8.991   13.774  1.00 0.00 ? 8   ASN A H    7  
ATOM 10839 H HA   . ASN A 1 8   ? 3.544   6.244   12.989  1.00 0.00 ? 8   ASN A HA   7  
ATOM 10840 H HB2  . ASN A 1 8   ? 3.393   5.875   15.533  1.00 0.00 ? 8   ASN A HB2  7  
ATOM 10841 H HB3  . ASN A 1 8   ? 4.756   6.809   14.923  1.00 0.00 ? 8   ASN A HB3  7  
ATOM 10842 H HD21 . ASN A 1 8   ? 5.208   8.284   16.392  1.00 0.00 ? 8   ASN A HD21 7  
ATOM 10843 H HD22 . ASN A 1 8   ? 4.070   9.339   17.151  1.00 0.00 ? 8   ASN A HD22 7  
ATOM 10844 N N    . ALA A 1 9   ? 1.343   5.140   13.425  1.00 0.00 ? 9   ALA A N    7  
ATOM 10845 C CA   . ALA A 1 9   ? 0.007   4.559   13.477  1.00 0.00 ? 9   ALA A CA   7  
ATOM 10846 C C    . ALA A 1 9   ? 0.073   3.038   13.564  1.00 0.00 ? 9   ALA A C    7  
ATOM 10847 O O    . ALA A 1 9   ? 1.090   2.418   13.251  1.00 0.00 ? 9   ALA A O    7  
ATOM 10848 C CB   . ALA A 1 9   ? -0.801  4.985   12.260  1.00 0.00 ? 9   ALA A CB   7  
ATOM 10849 H H    . ALA A 1 9   ? 2.093   4.587   13.124  1.00 0.00 ? 9   ALA A H    7  
ATOM 10850 H HA   . ALA A 1 9   ? -0.489  4.939   14.358  1.00 0.00 ? 9   ALA A HA   7  
ATOM 10851 H HB1  . ALA A 1 9   ? -1.702  5.486   12.585  1.00 0.00 ? 9   ALA A HB1  7  
ATOM 10852 H HB2  . ALA A 1 9   ? -0.213  5.658   11.655  1.00 0.00 ? 9   ALA A HB2  7  
ATOM 10853 H HB3  . ALA A 1 9   ? -1.063  4.113   11.679  1.00 0.00 ? 9   ALA A HB3  7  
ATOM 10854 N N    . PRO A 1 10  ? -1.035  2.420   14.000  1.00 0.00 ? 10  PRO A N    7  
ATOM 10855 C CA   . PRO A 1 10  ? -1.127  0.964   14.139  1.00 0.00 ? 10  PRO A CA   7  
ATOM 10856 C C    . PRO A 1 10  ? -1.144  0.253   12.790  1.00 0.00 ? 10  PRO A C    7  
ATOM 10857 O O    . PRO A 1 10  ? -1.530  0.834   11.776  1.00 0.00 ? 10  PRO A O    7  
ATOM 10858 C CB   . PRO A 1 10  ? -2.458  0.761   14.867  1.00 0.00 ? 10  PRO A CB   7  
ATOM 10859 C CG   . PRO A 1 10  ? -3.265  1.966   14.526  1.00 0.00 ? 10  PRO A CG   7  
ATOM 10860 C CD   . PRO A 1 10  ? -2.283  3.097   14.391  1.00 0.00 ? 10  PRO A CD   7  
ATOM 10861 H HA   . PRO A 1 10  ? -0.321  0.571   14.742  1.00 0.00 ? 10  PRO A HA   7  
ATOM 10862 H HB2  . PRO A 1 10  ? -2.930  -0.145  14.514  1.00 0.00 ? 10  PRO A HB2  7  
ATOM 10863 H HB3  . PRO A 1 10  ? -2.284  0.691   15.930  1.00 0.00 ? 10  PRO A HB3  7  
ATOM 10864 H HG2  . PRO A 1 10  ? -3.784  1.807   13.593  1.00 0.00 ? 10  PRO A HG2  7  
ATOM 10865 H HG3  . PRO A 1 10  ? -3.968  2.173   15.318  1.00 0.00 ? 10  PRO A HG3  7  
ATOM 10866 H HD2  . PRO A 1 10  ? -2.604  3.786   13.624  1.00 0.00 ? 10  PRO A HD2  7  
ATOM 10867 H HD3  . PRO A 1 10  ? -2.165  3.608   15.335  1.00 0.00 ? 10  PRO A HD3  7  
ATOM 10868 N N    . VAL A 1 11  ? -0.723  -1.008  12.786  1.00 0.00 ? 11  VAL A N    7  
ATOM 10869 C CA   . VAL A 1 11  ? -0.692  -1.799  11.561  1.00 0.00 ? 11  VAL A CA   7  
ATOM 10870 C C    . VAL A 1 11  ? -2.083  -1.920  10.949  1.00 0.00 ? 11  VAL A C    7  
ATOM 10871 O O    . VAL A 1 11  ? -3.081  -2.027  11.663  1.00 0.00 ? 11  VAL A O    7  
ATOM 10872 C CB   . VAL A 1 11  ? -0.132  -3.211  11.819  1.00 0.00 ? 11  VAL A CB   7  
ATOM 10873 C CG1  . VAL A 1 11  ? -0.229  -4.062  10.562  1.00 0.00 ? 11  VAL A CG1  7  
ATOM 10874 C CG2  . VAL A 1 11  ? 1.306   -3.132  12.309  1.00 0.00 ? 11  VAL A CG2  7  
ATOM 10875 H H    . VAL A 1 11  ? -0.428  -1.416  13.626  1.00 0.00 ? 11  VAL A H    7  
ATOM 10876 H HA   . VAL A 1 11  ? -0.041  -1.300  10.858  1.00 0.00 ? 11  VAL A HA   7  
ATOM 10877 H HB   . VAL A 1 11  ? -0.728  -3.677  12.590  1.00 0.00 ? 11  VAL A HB   7  
ATOM 10878 H HG11 . VAL A 1 11  ? 0.599   -4.754  10.532  1.00 0.00 ? 11  VAL A HG11 7  
ATOM 10879 H HG12 . VAL A 1 11  ? -1.159  -4.611  10.571  1.00 0.00 ? 11  VAL A HG12 7  
ATOM 10880 H HG13 . VAL A 1 11  ? -0.196  -3.423  9.692   1.00 0.00 ? 11  VAL A HG13 7  
ATOM 10881 H HG21 . VAL A 1 11  ? 1.325   -2.699  13.299  1.00 0.00 ? 11  VAL A HG21 7  
ATOM 10882 H HG22 . VAL A 1 11  ? 1.731   -4.125  12.343  1.00 0.00 ? 11  VAL A HG22 7  
ATOM 10883 H HG23 . VAL A 1 11  ? 1.883   -2.516  11.636  1.00 0.00 ? 11  VAL A HG23 7  
ATOM 10884 N N    . THR A 1 12  ? -2.142  -1.903  9.621   1.00 0.00 ? 12  THR A N    7  
ATOM 10885 C CA   . THR A 1 12  ? -3.411  -2.009  8.911   1.00 0.00 ? 12  THR A CA   7  
ATOM 10886 C C    . THR A 1 12  ? -3.768  -3.466  8.640   1.00 0.00 ? 12  THR A C    7  
ATOM 10887 O O    . THR A 1 12  ? -4.875  -3.912  8.943   1.00 0.00 ? 12  THR A O    7  
ATOM 10888 C CB   . THR A 1 12  ? -3.374  -1.244  7.575   1.00 0.00 ? 12  THR A CB   7  
ATOM 10889 O OG1  . THR A 1 12  ? -2.835  0.067   7.777   1.00 0.00 ? 12  THR A OG1  7  
ATOM 10890 C CG2  . THR A 1 12  ? -4.766  -1.139  6.973   1.00 0.00 ? 12  THR A CG2  7  
ATOM 10891 H H    . THR A 1 12  ? -1.312  -1.815  9.107   1.00 0.00 ? 12  THR A H    7  
ATOM 10892 H HA   . THR A 1 12  ? -4.178  -1.571  9.532   1.00 0.00 ? 12  THR A HA   7  
ATOM 10893 H HB   . THR A 1 12  ? -2.739  -1.784  6.886   1.00 0.00 ? 12  THR A HB   7  
ATOM 10894 H HG1  . THR A 1 12  ? -2.255  0.061   8.542   1.00 0.00 ? 12  THR A HG1  7  
ATOM 10895 H HG21 . THR A 1 12  ? -4.763  -1.566  5.981   1.00 0.00 ? 12  THR A HG21 7  
ATOM 10896 H HG22 . THR A 1 12  ? -5.056  -0.100  6.917   1.00 0.00 ? 12  THR A HG22 7  
ATOM 10897 H HG23 . THR A 1 12  ? -5.468  -1.675  7.593   1.00 0.00 ? 12  THR A HG23 7  
ATOM 10898 N N    . LYS A 1 13  ? -2.823  -4.205  8.067   1.00 0.00 ? 13  LYS A N    7  
ATOM 10899 C CA   . LYS A 1 13  ? -3.036  -5.613  7.756   1.00 0.00 ? 13  LYS A CA   7  
ATOM 10900 C C    . LYS A 1 13  ? -1.714  -6.374  7.742   1.00 0.00 ? 13  LYS A C    7  
ATOM 10901 O O    . LYS A 1 13  ? -0.669  -5.815  7.410   1.00 0.00 ? 13  LYS A O    7  
ATOM 10902 C CB   . LYS A 1 13  ? -3.734  -5.758  6.401   1.00 0.00 ? 13  LYS A CB   7  
ATOM 10903 C CG   . LYS A 1 13  ? -4.295  -7.147  6.151   1.00 0.00 ? 13  LYS A CG   7  
ATOM 10904 C CD   . LYS A 1 13  ? -5.077  -7.206  4.849   1.00 0.00 ? 13  LYS A CD   7  
ATOM 10905 C CE   . LYS A 1 13  ? -5.676  -8.585  4.622   1.00 0.00 ? 13  LYS A CE   7  
ATOM 10906 N NZ   . LYS A 1 13  ? -6.780  -8.875  5.578   1.00 0.00 ? 13  LYS A NZ   7  
ATOM 10907 H H    . LYS A 1 13  ? -1.961  -3.793  7.849   1.00 0.00 ? 13  LYS A H    7  
ATOM 10908 H HA   . LYS A 1 13  ? -3.670  -6.031  8.524   1.00 0.00 ? 13  LYS A HA   7  
ATOM 10909 H HB2  . LYS A 1 13  ? -4.548  -5.049  6.352   1.00 0.00 ? 13  LYS A HB2  7  
ATOM 10910 H HB3  . LYS A 1 13  ? -3.024  -5.532  5.618   1.00 0.00 ? 13  LYS A HB3  7  
ATOM 10911 H HG2  . LYS A 1 13  ? -3.478  -7.851  6.100   1.00 0.00 ? 13  LYS A HG2  7  
ATOM 10912 H HG3  . LYS A 1 13  ? -4.951  -7.413  6.967   1.00 0.00 ? 13  LYS A HG3  7  
ATOM 10913 H HD2  . LYS A 1 13  ? -5.876  -6.481  4.886   1.00 0.00 ? 13  LYS A HD2  7  
ATOM 10914 H HD3  . LYS A 1 13  ? -4.412  -6.972  4.029   1.00 0.00 ? 13  LYS A HD3  7  
ATOM 10915 H HE2  . LYS A 1 13  ? -6.061  -8.634  3.615   1.00 0.00 ? 13  LYS A HE2  7  
ATOM 10916 H HE3  . LYS A 1 13  ? -4.900  -9.326  4.746   1.00 0.00 ? 13  LYS A HE3  7  
ATOM 10917 H HZ1  . LYS A 1 13  ? -7.650  -8.390  5.277   1.00 0.00 ? 13  LYS A HZ1  7  
ATOM 10918 H HZ2  . LYS A 1 13  ? -6.525  -8.544  6.530   1.00 0.00 ? 13  LYS A HZ2  7  
ATOM 10919 H HZ3  . LYS A 1 13  ? -6.962  -9.898  5.615   1.00 0.00 ? 13  LYS A HZ3  7  
ATOM 10920 N N    . ALA A 1 14  ? -1.768  -7.652  8.103   1.00 0.00 ? 14  ALA A N    7  
ATOM 10921 C CA   . ALA A 1 14  ? -0.575  -8.489  8.128   1.00 0.00 ? 14  ALA A CA   7  
ATOM 10922 C C    . ALA A 1 14  ? -0.915  -9.939  7.799   1.00 0.00 ? 14  ALA A C    7  
ATOM 10923 O O    . ALA A 1 14  ? -1.822  -10.523 8.389   1.00 0.00 ? 14  ALA A O    7  
ATOM 10924 C CB   . ALA A 1 14  ? 0.104   -8.400  9.487   1.00 0.00 ? 14  ALA A CB   7  
ATOM 10925 H H    . ALA A 1 14  ? -2.631  -8.041  8.356   1.00 0.00 ? 14  ALA A H    7  
ATOM 10926 H HA   . ALA A 1 14  ? 0.113   -8.113  7.384   1.00 0.00 ? 14  ALA A HA   7  
ATOM 10927 H HB1  . ALA A 1 14  ? 1.079   -8.861  9.431   1.00 0.00 ? 14  ALA A HB1  7  
ATOM 10928 H HB2  . ALA A 1 14  ? 0.210   -7.363  9.768   1.00 0.00 ? 14  ALA A HB2  7  
ATOM 10929 H HB3  . ALA A 1 14  ? -0.496  -8.913  10.223  1.00 0.00 ? 14  ALA A HB3  7  
ATOM 10930 N N    . GLY A 1 15  ? -0.180  -10.514 6.851   1.00 0.00 ? 15  GLY A N    7  
ATOM 10931 C CA   . GLY A 1 15  ? -0.420  -11.890 6.459   1.00 0.00 ? 15  GLY A CA   7  
ATOM 10932 C C    . GLY A 1 15  ? 0.659   -12.428 5.541   1.00 0.00 ? 15  GLY A C    7  
ATOM 10933 O O    . GLY A 1 15  ? 1.417   -11.661 4.947   1.00 0.00 ? 15  GLY A O    7  
ATOM 10934 H H    . GLY A 1 15  ? 0.530   -9.999  6.414   1.00 0.00 ? 15  GLY A H    7  
ATOM 10935 H HA2  . GLY A 1 15  ? -0.462  -12.504 7.347   1.00 0.00 ? 15  GLY A HA2  7  
ATOM 10936 H HA3  . GLY A 1 15  ? -1.371  -11.947 5.949   1.00 0.00 ? 15  GLY A HA3  7  
ATOM 10937 N N    . TRP A 1 16  ? 0.731   -13.749 5.426   1.00 0.00 ? 16  TRP A N    7  
ATOM 10938 C CA   . TRP A 1 16  ? 1.727   -14.389 4.574   1.00 0.00 ? 16  TRP A CA   7  
ATOM 10939 C C    . TRP A 1 16  ? 1.348   -14.264 3.103   1.00 0.00 ? 16  TRP A C    7  
ATOM 10940 O O    . TRP A 1 16  ? 0.312   -14.772 2.673   1.00 0.00 ? 16  TRP A O    7  
ATOM 10941 C CB   . TRP A 1 16  ? 1.878   -15.864 4.951   1.00 0.00 ? 16  TRP A CB   7  
ATOM 10942 C CG   . TRP A 1 16  ? 2.539   -16.073 6.280   1.00 0.00 ? 16  TRP A CG   7  
ATOM 10943 C CD1  . TRP A 1 16  ? 1.923   -16.164 7.496   1.00 0.00 ? 16  TRP A CD1  7  
ATOM 10944 C CD2  . TRP A 1 16  ? 3.942   -16.215 6.527   1.00 0.00 ? 16  TRP A CD2  7  
ATOM 10945 N NE1  . TRP A 1 16  ? 2.859   -16.354 8.483   1.00 0.00 ? 16  TRP A NE1  7  
ATOM 10946 C CE2  . TRP A 1 16  ? 4.105   -16.390 7.915   1.00 0.00 ? 16  TRP A CE2  7  
ATOM 10947 C CE3  . TRP A 1 16  ? 5.076   -16.214 5.710   1.00 0.00 ? 16  TRP A CE3  7  
ATOM 10948 C CZ2  . TRP A 1 16  ? 5.356   -16.560 8.502   1.00 0.00 ? 16  TRP A CZ2  7  
ATOM 10949 C CZ3  . TRP A 1 16  ? 6.317   -16.383 6.294   1.00 0.00 ? 16  TRP A CZ3  7  
ATOM 10950 C CH2  . TRP A 1 16  ? 6.450   -16.555 7.678   1.00 0.00 ? 16  TRP A CH2  7  
ATOM 10951 H H    . TRP A 1 16  ? 0.099   -14.308 5.925   1.00 0.00 ? 16  TRP A H    7  
ATOM 10952 H HA   . TRP A 1 16  ? 2.670   -13.888 4.735   1.00 0.00 ? 16  TRP A HA   7  
ATOM 10953 H HB2  . TRP A 1 16  ? 0.901   -16.321 4.989   1.00 0.00 ? 16  TRP A HB2  7  
ATOM 10954 H HB3  . TRP A 1 16  ? 2.476   -16.360 4.199   1.00 0.00 ? 16  TRP A HB3  7  
ATOM 10955 H HD1  . TRP A 1 16  ? 0.857   -16.093 7.644   1.00 0.00 ? 16  TRP A HD1  7  
ATOM 10956 H HE1  . TRP A 1 16  ? 2.666   -16.450 9.440   1.00 0.00 ? 16  TRP A HE1  7  
ATOM 10957 H HE3  . TRP A 1 16  ? 4.994   -16.083 4.641   1.00 0.00 ? 16  TRP A HE3  7  
ATOM 10958 H HZ2  . TRP A 1 16  ? 5.475   -16.695 9.567   1.00 0.00 ? 16  TRP A HZ2  7  
ATOM 10959 H HZ3  . TRP A 1 16  ? 7.205   -16.384 5.679   1.00 0.00 ? 16  TRP A HZ3  7  
ATOM 10960 H HH2  . TRP A 1 16  ? 7.438   -16.683 8.091   1.00 0.00 ? 16  TRP A HH2  7  
ATOM 10961 N N    . LEU A 1 17  ? 2.192   -13.584 2.335   1.00 0.00 ? 17  LEU A N    7  
ATOM 10962 C CA   . LEU A 1 17  ? 1.945   -13.392 0.910   1.00 0.00 ? 17  LEU A CA   7  
ATOM 10963 C C    . LEU A 1 17  ? 3.121   -13.896 0.080   1.00 0.00 ? 17  LEU A C    7  
ATOM 10964 O O    . LEU A 1 17  ? 4.269   -13.521 0.319   1.00 0.00 ? 17  LEU A O    7  
ATOM 10965 C CB   . LEU A 1 17  ? 1.691   -11.913 0.611   1.00 0.00 ? 17  LEU A CB   7  
ATOM 10966 C CG   . LEU A 1 17  ? 0.251   -11.430 0.785   1.00 0.00 ? 17  LEU A CG   7  
ATOM 10967 C CD1  . LEU A 1 17  ? 0.186   -9.912  0.721   1.00 0.00 ? 17  LEU A CD1  7  
ATOM 10968 C CD2  . LEU A 1 17  ? -0.651  -12.049 -0.273  1.00 0.00 ? 17  LEU A CD2  7  
ATOM 10969 H H    . LEU A 1 17  ? 3.001   -13.202 2.734   1.00 0.00 ? 17  LEU A H    7  
ATOM 10970 H HA   . LEU A 1 17  ? 1.064   -13.960 0.647   1.00 0.00 ? 17  LEU A HA   7  
ATOM 10971 H HB2  . LEU A 1 17  ? 2.317   -11.331 1.270   1.00 0.00 ? 17  LEU A HB2  7  
ATOM 10972 H HB3  . LEU A 1 17  ? 1.982   -11.730 -0.414  1.00 0.00 ? 17  LEU A HB3  7  
ATOM 10973 H HG   . LEU A 1 17  ? -0.110  -11.739 1.756   1.00 0.00 ? 17  LEU A HG   7  
ATOM 10974 H HD11 . LEU A 1 17  ? 0.531   -9.497  1.656   1.00 0.00 ? 17  LEU A HD11 7  
ATOM 10975 H HD12 . LEU A 1 17  ? -0.833  -9.603  0.544   1.00 0.00 ? 17  LEU A HD12 7  
ATOM 10976 H HD13 . LEU A 1 17  ? 0.814   -9.559  -0.084  1.00 0.00 ? 17  LEU A HD13 7  
ATOM 10977 H HD21 . LEU A 1 17  ? -0.455  -13.110 -0.335  1.00 0.00 ? 17  LEU A HD21 7  
ATOM 10978 H HD22 . LEU A 1 17  ? -0.451  -11.590 -1.230  1.00 0.00 ? 17  LEU A HD22 7  
ATOM 10979 H HD23 . LEU A 1 17  ? -1.684  -11.888 -0.004  1.00 0.00 ? 17  LEU A HD23 7  
ATOM 10980 N N    . PHE A 1 18  ? 2.827   -14.748 -0.897  1.00 0.00 ? 18  PHE A N    7  
ATOM 10981 C CA   . PHE A 1 18  ? 3.860   -15.303 -1.764  1.00 0.00 ? 18  PHE A CA   7  
ATOM 10982 C C    . PHE A 1 18  ? 4.367   -14.252 -2.748  1.00 0.00 ? 18  PHE A C    7  
ATOM 10983 O O    . PHE A 1 18  ? 3.607   -13.732 -3.565  1.00 0.00 ? 18  PHE A O    7  
ATOM 10984 C CB   . PHE A 1 18  ? 3.319   -16.514 -2.527  1.00 0.00 ? 18  PHE A CB   7  
ATOM 10985 C CG   . PHE A 1 18  ? 3.106   -17.722 -1.660  1.00 0.00 ? 18  PHE A CG   7  
ATOM 10986 C CD1  . PHE A 1 18  ? 2.184   -17.695 -0.626  1.00 0.00 ? 18  PHE A CD1  7  
ATOM 10987 C CD2  . PHE A 1 18  ? 3.827   -18.885 -1.880  1.00 0.00 ? 18  PHE A CD2  7  
ATOM 10988 C CE1  . PHE A 1 18  ? 1.987   -18.805 0.173   1.00 0.00 ? 18  PHE A CE1  7  
ATOM 10989 C CE2  . PHE A 1 18  ? 3.633   -19.998 -1.085  1.00 0.00 ? 18  PHE A CE2  7  
ATOM 10990 C CZ   . PHE A 1 18  ? 2.711   -19.959 -0.057  1.00 0.00 ? 18  PHE A CZ   7  
ATOM 10991 H H    . PHE A 1 18  ? 1.893   -15.009 -1.038  1.00 0.00 ? 18  PHE A H    7  
ATOM 10992 H HA   . PHE A 1 18  ? 4.681   -15.619 -1.139  1.00 0.00 ? 18  PHE A HA   7  
ATOM 10993 H HB2  . PHE A 1 18  ? 2.371   -16.255 -2.973  1.00 0.00 ? 18  PHE A HB2  7  
ATOM 10994 H HB3  . PHE A 1 18  ? 4.018   -16.781 -3.305  1.00 0.00 ? 18  PHE A HB3  7  
ATOM 10995 H HD1  . PHE A 1 18  ? 1.616   -16.795 -0.445  1.00 0.00 ? 18  PHE A HD1  7  
ATOM 10996 H HD2  . PHE A 1 18  ? 4.549   -18.916 -2.685  1.00 0.00 ? 18  PHE A HD2  7  
ATOM 10997 H HE1  . PHE A 1 18  ? 1.265   -18.772 0.976   1.00 0.00 ? 18  PHE A HE1  7  
ATOM 10998 H HE2  . PHE A 1 18  ? 4.202   -20.898 -1.268  1.00 0.00 ? 18  PHE A HE2  7  
ATOM 10999 H HZ   . PHE A 1 18  ? 2.559   -20.827 0.566   1.00 0.00 ? 18  PHE A HZ   7  
ATOM 11000 N N    . LYS A 1 19  ? 5.657   -13.945 -2.663  1.00 0.00 ? 19  LYS A N    7  
ATOM 11001 C CA   . LYS A 1 19  ? 6.268   -12.957 -3.545  1.00 0.00 ? 19  LYS A CA   7  
ATOM 11002 C C    . LYS A 1 19  ? 6.888   -13.628 -4.766  1.00 0.00 ? 19  LYS A C    7  
ATOM 11003 O O    . LYS A 1 19  ? 7.925   -14.283 -4.664  1.00 0.00 ? 19  LYS A O    7  
ATOM 11004 C CB   . LYS A 1 19  ? 7.334   -12.160 -2.790  1.00 0.00 ? 19  LYS A CB   7  
ATOM 11005 C CG   . LYS A 1 19  ? 7.593   -10.783 -3.377  1.00 0.00 ? 19  LYS A CG   7  
ATOM 11006 C CD   . LYS A 1 19  ? 8.637   -10.023 -2.576  1.00 0.00 ? 19  LYS A CD   7  
ATOM 11007 C CE   . LYS A 1 19  ? 8.757   -8.581  -3.044  1.00 0.00 ? 19  LYS A CE   7  
ATOM 11008 N NZ   . LYS A 1 19  ? 10.063  -7.979  -2.657  1.00 0.00 ? 19  LYS A NZ   7  
ATOM 11009 H H    . LYS A 1 19  ? 6.212   -14.394 -1.991  1.00 0.00 ? 19  LYS A H    7  
ATOM 11010 H HA   . LYS A 1 19  ? 5.493   -12.282 -3.875  1.00 0.00 ? 19  LYS A HA   7  
ATOM 11011 H HB2  . LYS A 1 19  ? 7.018   -12.038 -1.765  1.00 0.00 ? 19  LYS A HB2  7  
ATOM 11012 H HB3  . LYS A 1 19  ? 8.261   -12.715 -2.808  1.00 0.00 ? 19  LYS A HB3  7  
ATOM 11013 H HG2  . LYS A 1 19  ? 7.944   -10.894 -4.392  1.00 0.00 ? 19  LYS A HG2  7  
ATOM 11014 H HG3  . LYS A 1 19  ? 6.669   -10.221 -3.372  1.00 0.00 ? 19  LYS A HG3  7  
ATOM 11015 H HD2  . LYS A 1 19  ? 8.354   -10.029 -1.534  1.00 0.00 ? 19  LYS A HD2  7  
ATOM 11016 H HD3  . LYS A 1 19  ? 9.594   -10.512 -2.694  1.00 0.00 ? 19  LYS A HD3  7  
ATOM 11017 H HE2  . LYS A 1 19  ? 8.664   -8.556  -4.119  1.00 0.00 ? 19  LYS A HE2  7  
ATOM 11018 H HE3  . LYS A 1 19  ? 7.959   -8.005  -2.600  1.00 0.00 ? 19  LYS A HE3  7  
ATOM 11019 H HZ1  . LYS A 1 19  ? 10.585  -7.682  -3.506  1.00 0.00 ? 19  LYS A HZ1  7  
ATOM 11020 H HZ2  . LYS A 1 19  ? 10.636  -8.673  -2.136  1.00 0.00 ? 19  LYS A HZ2  7  
ATOM 11021 H HZ3  . LYS A 1 19  ? 9.908   -7.149  -2.050  1.00 0.00 ? 19  LYS A HZ3  7  
ATOM 11022 N N    . GLN A 1 20  ? 6.247   -13.460 -5.918  1.00 0.00 ? 20  GLN A N    7  
ATOM 11023 C CA   . GLN A 1 20  ? 6.738   -14.049 -7.158  1.00 0.00 ? 20  GLN A CA   7  
ATOM 11024 C C    . GLN A 1 20  ? 8.258   -13.949 -7.244  1.00 0.00 ? 20  GLN A C    7  
ATOM 11025 O O    . GLN A 1 20  ? 8.866   -13.062 -6.646  1.00 0.00 ? 20  GLN A O    7  
ATOM 11026 C CB   . GLN A 1 20  ? 6.101   -13.357 -8.364  1.00 0.00 ? 20  GLN A CB   7  
ATOM 11027 C CG   . GLN A 1 20  ? 6.375   -14.059 -9.684  1.00 0.00 ? 20  GLN A CG   7  
ATOM 11028 C CD   . GLN A 1 20  ? 5.596   -13.458 -10.837 1.00 0.00 ? 20  GLN A CD   7  
ATOM 11029 O OE1  . GLN A 1 20  ? 5.529   -12.238 -10.988 1.00 0.00 ? 20  GLN A OE1  7  
ATOM 11030 N NE2  . GLN A 1 20  ? 5.001   -14.315 -11.659 1.00 0.00 ? 20  GLN A NE2  7  
ATOM 11031 H H    . GLN A 1 20  ? 5.426   -12.927 -5.934  1.00 0.00 ? 20  GLN A H    7  
ATOM 11032 H HA   . GLN A 1 20  ? 6.458   -15.091 -7.163  1.00 0.00 ? 20  GLN A HA   7  
ATOM 11033 H HB2  . GLN A 1 20  ? 5.032   -13.316 -8.217  1.00 0.00 ? 20  GLN A HB2  7  
ATOM 11034 H HB3  . GLN A 1 20  ? 6.485   -12.350 -8.430  1.00 0.00 ? 20  GLN A HB3  7  
ATOM 11035 H HG2  . GLN A 1 20  ? 7.429   -13.985 -9.905  1.00 0.00 ? 20  GLN A HG2  7  
ATOM 11036 H HG3  . GLN A 1 20  ? 6.101   -15.099 -9.586  1.00 0.00 ? 20  GLN A HG3  7  
ATOM 11037 H HE21 . GLN A 1 20  ? 5.095   -15.273 -11.477 1.00 0.00 ? 20  GLN A HE21 7  
ATOM 11038 H HE22 . GLN A 1 20  ? 4.490   -13.954 -12.413 1.00 0.00 ? 20  GLN A HE22 7  
ATOM 11039 N N    . ALA A 1 21  ? 8.864   -14.865 -7.991  1.00 0.00 ? 21  ALA A N    7  
ATOM 11040 C CA   . ALA A 1 21  ? 10.313  -14.879 -8.157  1.00 0.00 ? 21  ALA A CA   7  
ATOM 11041 C C    . ALA A 1 21  ? 10.745  -13.949 -9.285  1.00 0.00 ? 21  ALA A C    7  
ATOM 11042 O O    . ALA A 1 21  ? 10.784  -14.346 -10.450 1.00 0.00 ? 21  ALA A O    7  
ATOM 11043 C CB   . ALA A 1 21  ? 10.800  -16.296 -8.422  1.00 0.00 ? 21  ALA A CB   7  
ATOM 11044 H H    . ALA A 1 21  ? 8.325   -15.547 -8.443  1.00 0.00 ? 21  ALA A H    7  
ATOM 11045 H HA   . ALA A 1 21  ? 10.757  -14.539 -7.233  1.00 0.00 ? 21  ALA A HA   7  
ATOM 11046 H HB1  . ALA A 1 21  ? 10.060  -17.002 -8.073  1.00 0.00 ? 21  ALA A HB1  7  
ATOM 11047 H HB2  . ALA A 1 21  ? 10.954  -16.431 -9.483  1.00 0.00 ? 21  ALA A HB2  7  
ATOM 11048 H HB3  . ALA A 1 21  ? 11.730  -16.460 -7.899  1.00 0.00 ? 21  ALA A HB3  7  
ATOM 11049 N N    . SER A 1 22  ? 11.069  -12.709 -8.932  1.00 0.00 ? 22  SER A N    7  
ATOM 11050 C CA   . SER A 1 22  ? 11.494  -11.721 -9.917  1.00 0.00 ? 22  SER A CA   7  
ATOM 11051 C C    . SER A 1 22  ? 12.532  -12.312 -10.866 1.00 0.00 ? 22  SER A C    7  
ATOM 11052 O O    . SER A 1 22  ? 12.407  -12.202 -12.086 1.00 0.00 ? 22  SER A O    7  
ATOM 11053 C CB   . SER A 1 22  ? 12.070  -10.488 -9.217  1.00 0.00 ? 22  SER A CB   7  
ATOM 11054 O OG   . SER A 1 22  ? 13.141  -10.843 -8.359  1.00 0.00 ? 22  SER A OG   7  
ATOM 11055 H H    . SER A 1 22  ? 11.018  -12.453 -7.988  1.00 0.00 ? 22  SER A H    7  
ATOM 11056 H HA   . SER A 1 22  ? 10.627  -11.427 -10.488 1.00 0.00 ? 22  SER A HA   7  
ATOM 11057 H HB2  . SER A 1 22  ? 12.434  -9.794  -9.958  1.00 0.00 ? 22  SER A HB2  7  
ATOM 11058 H HB3  . SER A 1 22  ? 11.295  -10.016 -8.630  1.00 0.00 ? 22  SER A HB3  7  
ATOM 11059 H HG   . SER A 1 22  ? 13.950  -10.430 -8.669  1.00 0.00 ? 22  SER A HG   7  
ATOM 11060 N N    . SER A 1 23  ? 13.557  -12.939 -10.297 1.00 0.00 ? 23  SER A N    7  
ATOM 11061 C CA   . SER A 1 23  ? 14.619  -13.544 -11.092 1.00 0.00 ? 23  SER A CA   7  
ATOM 11062 C C    . SER A 1 23  ? 14.498  -15.065 -11.092 1.00 0.00 ? 23  SER A C    7  
ATOM 11063 O O    . SER A 1 23  ? 13.628  -15.630 -10.431 1.00 0.00 ? 23  SER A O    7  
ATOM 11064 C CB   . SER A 1 23  ? 15.989  -13.131 -10.550 1.00 0.00 ? 23  SER A CB   7  
ATOM 11065 O OG   . SER A 1 23  ? 16.244  -13.736 -9.294  1.00 0.00 ? 23  SER A OG   7  
ATOM 11066 H H    . SER A 1 23  ? 13.600  -12.993 -9.319  1.00 0.00 ? 23  SER A H    7  
ATOM 11067 H HA   . SER A 1 23  ? 14.520  -13.186 -12.106 1.00 0.00 ? 23  SER A HA   7  
ATOM 11068 H HB2  . SER A 1 23  ? 16.756  -13.437 -11.245 1.00 0.00 ? 23  SER A HB2  7  
ATOM 11069 H HB3  . SER A 1 23  ? 16.017  -12.057 -10.431 1.00 0.00 ? 23  SER A HB3  7  
ATOM 11070 H HG   . SER A 1 23  ? 16.509  -13.063 -8.662  1.00 0.00 ? 23  SER A HG   7  
ATOM 11071 N N    . GLY A 1 24  ? 15.378  -15.723 -11.841 1.00 0.00 ? 24  GLY A N    7  
ATOM 11072 C CA   . GLY A 1 24  ? 15.353  -17.172 -11.915 1.00 0.00 ? 24  GLY A CA   7  
ATOM 11073 C C    . GLY A 1 24  ? 14.030  -17.703 -12.430 1.00 0.00 ? 24  GLY A C    7  
ATOM 11074 O O    . GLY A 1 24  ? 13.236  -16.960 -13.007 1.00 0.00 ? 24  GLY A O    7  
ATOM 11075 H H    . GLY A 1 24  ? 16.049  -15.220 -12.347 1.00 0.00 ? 24  GLY A H    7  
ATOM 11076 H HA2  . GLY A 1 24  ? 16.143  -17.501 -12.573 1.00 0.00 ? 24  GLY A HA2  7  
ATOM 11077 H HA3  . GLY A 1 24  ? 15.529  -17.574 -10.928 1.00 0.00 ? 24  GLY A HA3  7  
ATOM 11078 N N    . VAL A 1 25  ? 13.792  -18.995 -12.224 1.00 0.00 ? 25  VAL A N    7  
ATOM 11079 C CA   . VAL A 1 25  ? 12.557  -19.626 -12.672 1.00 0.00 ? 25  VAL A CA   7  
ATOM 11080 C C    . VAL A 1 25  ? 11.337  -18.918 -12.093 1.00 0.00 ? 25  VAL A C    7  
ATOM 11081 O O    . VAL A 1 25  ? 11.404  -18.319 -11.020 1.00 0.00 ? 25  VAL A O    7  
ATOM 11082 C CB   . VAL A 1 25  ? 12.510  -21.113 -12.276 1.00 0.00 ? 25  VAL A CB   7  
ATOM 11083 C CG1  . VAL A 1 25  ? 11.993  -21.271 -10.854 1.00 0.00 ? 25  VAL A CG1  7  
ATOM 11084 C CG2  . VAL A 1 25  ? 11.650  -21.899 -13.255 1.00 0.00 ? 25  VAL A CG2  7  
ATOM 11085 H H    . VAL A 1 25  ? 14.463  -19.536 -11.758 1.00 0.00 ? 25  VAL A H    7  
ATOM 11086 H HA   . VAL A 1 25  ? 12.520  -19.561 -13.750 1.00 0.00 ? 25  VAL A HA   7  
ATOM 11087 H HB   . VAL A 1 25  ? 13.515  -21.507 -12.315 1.00 0.00 ? 25  VAL A HB   7  
ATOM 11088 H HG11 . VAL A 1 25  ? 12.602  -21.992 -10.328 1.00 0.00 ? 25  VAL A HG11 7  
ATOM 11089 H HG12 . VAL A 1 25  ? 12.039  -20.320 -10.346 1.00 0.00 ? 25  VAL A HG12 7  
ATOM 11090 H HG13 . VAL A 1 25  ? 10.970  -21.617 -10.880 1.00 0.00 ? 25  VAL A HG13 7  
ATOM 11091 H HG21 . VAL A 1 25  ? 10.608  -21.756 -13.012 1.00 0.00 ? 25  VAL A HG21 7  
ATOM 11092 H HG22 . VAL A 1 25  ? 11.837  -21.548 -14.260 1.00 0.00 ? 25  VAL A HG22 7  
ATOM 11093 H HG23 . VAL A 1 25  ? 11.896  -22.948 -13.188 1.00 0.00 ? 25  VAL A HG23 7  
ATOM 11094 N N    . LYS A 1 26  ? 10.220  -18.993 -12.810 1.00 0.00 ? 26  LYS A N    7  
ATOM 11095 C CA   . LYS A 1 26  ? 8.983   -18.362 -12.368 1.00 0.00 ? 26  LYS A CA   7  
ATOM 11096 C C    . LYS A 1 26  ? 8.359   -19.137 -11.212 1.00 0.00 ? 26  LYS A C    7  
ATOM 11097 O O    . LYS A 1 26  ? 7.458   -19.951 -11.414 1.00 0.00 ? 26  LYS A O    7  
ATOM 11098 C CB   . LYS A 1 26  ? 7.990   -18.270 -13.529 1.00 0.00 ? 26  LYS A CB   7  
ATOM 11099 C CG   . LYS A 1 26  ? 8.175   -17.033 -14.391 1.00 0.00 ? 26  LYS A CG   7  
ATOM 11100 C CD   . LYS A 1 26  ? 7.474   -15.825 -13.790 1.00 0.00 ? 26  LYS A CD   7  
ATOM 11101 C CE   . LYS A 1 26  ? 6.037   -15.717 -14.275 1.00 0.00 ? 26  LYS A CE   7  
ATOM 11102 N NZ   . LYS A 1 26  ? 5.098   -16.475 -13.403 1.00 0.00 ? 26  LYS A NZ   7  
ATOM 11103 H H    . LYS A 1 26  ? 10.229  -19.486 -13.658 1.00 0.00 ? 26  LYS A H    7  
ATOM 11104 H HA   . LYS A 1 26  ? 9.221   -17.365 -12.029 1.00 0.00 ? 26  LYS A HA   7  
ATOM 11105 H HB2  . LYS A 1 26  ? 8.107   -19.141 -14.156 1.00 0.00 ? 26  LYS A HB2  7  
ATOM 11106 H HB3  . LYS A 1 26  ? 6.986   -18.257 -13.128 1.00 0.00 ? 26  LYS A HB3  7  
ATOM 11107 H HG2  . LYS A 1 26  ? 9.230   -16.818 -14.475 1.00 0.00 ? 26  LYS A HG2  7  
ATOM 11108 H HG3  . LYS A 1 26  ? 7.765   -17.224 -15.372 1.00 0.00 ? 26  LYS A HG3  7  
ATOM 11109 H HD2  . LYS A 1 26  ? 7.473   -15.918 -12.715 1.00 0.00 ? 26  LYS A HD2  7  
ATOM 11110 H HD3  . LYS A 1 26  ? 8.010   -14.931 -14.076 1.00 0.00 ? 26  LYS A HD3  7  
ATOM 11111 H HE2  . LYS A 1 26  ? 5.750   -14.676 -14.280 1.00 0.00 ? 26  LYS A HE2  7  
ATOM 11112 H HE3  . LYS A 1 26  ? 5.979   -16.110 -15.279 1.00 0.00 ? 26  LYS A HE3  7  
ATOM 11113 H HZ1  . LYS A 1 26  ? 5.595   -16.812 -12.553 1.00 0.00 ? 26  LYS A HZ1  7  
ATOM 11114 H HZ2  . LYS A 1 26  ? 4.717   -17.295 -13.916 1.00 0.00 ? 26  LYS A HZ2  7  
ATOM 11115 H HZ3  . LYS A 1 26  ? 4.309   -15.865 -13.111 1.00 0.00 ? 26  LYS A HZ3  7  
ATOM 11116 N N    . GLN A 1 27  ? 8.844   -18.879 -10.002 1.00 0.00 ? 27  GLN A N    7  
ATOM 11117 C CA   . GLN A 1 27  ? 8.332   -19.553 -8.815  1.00 0.00 ? 27  GLN A CA   7  
ATOM 11118 C C    . GLN A 1 27  ? 7.739   -18.549 -7.831  1.00 0.00 ? 27  GLN A C    7  
ATOM 11119 O O    . GLN A 1 27  ? 7.778   -17.341 -8.064  1.00 0.00 ? 27  GLN A O    7  
ATOM 11120 C CB   . GLN A 1 27  ? 9.446   -20.352 -8.136  1.00 0.00 ? 27  GLN A CB   7  
ATOM 11121 C CG   . GLN A 1 27  ? 10.642  -19.505 -7.731  1.00 0.00 ? 27  GLN A CG   7  
ATOM 11122 C CD   . GLN A 1 27  ? 11.857  -20.342 -7.379  1.00 0.00 ? 27  GLN A CD   7  
ATOM 11123 O OE1  . GLN A 1 27  ? 12.098  -21.390 -7.977  1.00 0.00 ? 27  GLN A OE1  7  
ATOM 11124 N NE2  . GLN A 1 27  ? 12.630  -19.881 -6.403  1.00 0.00 ? 27  GLN A NE2  7  
ATOM 11125 H H    . GLN A 1 27  ? 9.562   -18.220 -9.905  1.00 0.00 ? 27  GLN A H    7  
ATOM 11126 H HA   . GLN A 1 27  ? 7.555   -20.233 -9.128  1.00 0.00 ? 27  GLN A HA   7  
ATOM 11127 H HB2  . GLN A 1 27  ? 9.048   -20.822 -7.249  1.00 0.00 ? 27  GLN A HB2  7  
ATOM 11128 H HB3  . GLN A 1 27  ? 9.789   -21.118 -8.816  1.00 0.00 ? 27  GLN A HB3  7  
ATOM 11129 H HG2  . GLN A 1 27  ? 10.900  -18.853 -8.552  1.00 0.00 ? 27  GLN A HG2  7  
ATOM 11130 H HG3  . GLN A 1 27  ? 10.371  -18.910 -6.871  1.00 0.00 ? 27  GLN A HG3  7  
ATOM 11131 H HE21 . GLN A 1 27  ? 12.376  -19.039 -5.969  1.00 0.00 ? 27  GLN A HE21 7  
ATOM 11132 H HE22 . GLN A 1 27  ? 13.421  -20.401 -6.154  1.00 0.00 ? 27  GLN A HE22 7  
ATOM 11133 N N    . TRP A 1 28  ? 7.191   -19.057 -6.733  1.00 0.00 ? 28  TRP A N    7  
ATOM 11134 C CA   . TRP A 1 28  ? 6.590   -18.204 -5.715  1.00 0.00 ? 28  TRP A CA   7  
ATOM 11135 C C    . TRP A 1 28  ? 7.142   -18.534 -4.332  1.00 0.00 ? 28  TRP A C    7  
ATOM 11136 O O    . TRP A 1 28  ? 7.107   -19.685 -3.899  1.00 0.00 ? 28  TRP A O    7  
ATOM 11137 C CB   . TRP A 1 28  ? 5.068   -18.363 -5.721  1.00 0.00 ? 28  TRP A CB   7  
ATOM 11138 C CG   . TRP A 1 28  ? 4.411   -17.742 -6.916  1.00 0.00 ? 28  TRP A CG   7  
ATOM 11139 C CD1  . TRP A 1 28  ? 4.404   -18.228 -8.193  1.00 0.00 ? 28  TRP A CD1  7  
ATOM 11140 C CD2  . TRP A 1 28  ? 3.668   -16.519 -6.947  1.00 0.00 ? 28  TRP A CD2  7  
ATOM 11141 N NE1  . TRP A 1 28  ? 3.701   -17.381 -9.014  1.00 0.00 ? 28  TRP A NE1  7  
ATOM 11142 C CE2  . TRP A 1 28  ? 3.238   -16.325 -8.274  1.00 0.00 ? 28  TRP A CE2  7  
ATOM 11143 C CE3  . TRP A 1 28  ? 3.322   -15.569 -5.982  1.00 0.00 ? 28  TRP A CE3  7  
ATOM 11144 C CZ2  . TRP A 1 28  ? 2.482   -15.221 -8.658  1.00 0.00 ? 28  TRP A CZ2  7  
ATOM 11145 C CZ3  . TRP A 1 28  ? 2.571   -14.474 -6.364  1.00 0.00 ? 28  TRP A CZ3  7  
ATOM 11146 C CH2  . TRP A 1 28  ? 2.158   -14.307 -7.693  1.00 0.00 ? 28  TRP A CH2  7  
ATOM 11147 H H    . TRP A 1 28  ? 7.191   -20.029 -6.604  1.00 0.00 ? 28  TRP A H    7  
ATOM 11148 H HA   . TRP A 1 28  ? 6.837   -17.180 -5.953  1.00 0.00 ? 28  TRP A HA   7  
ATOM 11149 H HB2  . TRP A 1 28  ? 4.822   -19.414 -5.714  1.00 0.00 ? 28  TRP A HB2  7  
ATOM 11150 H HB3  . TRP A 1 28  ? 4.662   -17.895 -4.836  1.00 0.00 ? 28  TRP A HB3  7  
ATOM 11151 H HD1  . TRP A 1 28  ? 4.886   -19.144 -8.497  1.00 0.00 ? 28  TRP A HD1  7  
ATOM 11152 H HE1  . TRP A 1 28  ? 3.553   -17.513 -9.975  1.00 0.00 ? 28  TRP A HE1  7  
ATOM 11153 H HE3  . TRP A 1 28  ? 3.631   -15.680 -4.953  1.00 0.00 ? 28  TRP A HE3  7  
ATOM 11154 H HZ2  . TRP A 1 28  ? 2.155   -15.078 -9.678  1.00 0.00 ? 28  TRP A HZ2  7  
ATOM 11155 H HZ3  . TRP A 1 28  ? 2.295   -13.729 -5.632  1.00 0.00 ? 28  TRP A HZ3  7  
ATOM 11156 H HH2  . TRP A 1 28  ? 1.573   -13.436 -7.946  1.00 0.00 ? 28  TRP A HH2  7  
ATOM 11157 N N    . ASN A 1 29  ? 7.651   -17.517 -3.645  1.00 0.00 ? 29  ASN A N    7  
ATOM 11158 C CA   . ASN A 1 29  ? 8.211   -17.701 -2.311  1.00 0.00 ? 29  ASN A CA   7  
ATOM 11159 C C    . ASN A 1 29  ? 7.313   -17.069 -1.252  1.00 0.00 ? 29  ASN A C    7  
ATOM 11160 O O    . ASN A 1 29  ? 6.965   -15.891 -1.339  1.00 0.00 ? 29  ASN A O    7  
ATOM 11161 C CB   . ASN A 1 29  ? 9.613   -17.093 -2.235  1.00 0.00 ? 29  ASN A CB   7  
ATOM 11162 C CG   . ASN A 1 29  ? 10.619  -17.853 -3.078  1.00 0.00 ? 29  ASN A CG   7  
ATOM 11163 O OD1  . ASN A 1 29  ? 11.556  -18.456 -2.553  1.00 0.00 ? 29  ASN A OD1  7  
ATOM 11164 N ND2  . ASN A 1 29  ? 10.429  -17.828 -4.392  1.00 0.00 ? 29  ASN A ND2  7  
ATOM 11165 H H    . ASN A 1 29  ? 7.650   -16.622 -4.043  1.00 0.00 ? 29  ASN A H    7  
ATOM 11166 H HA   . ASN A 1 29  ? 8.278   -18.762 -2.123  1.00 0.00 ? 29  ASN A HA   7  
ATOM 11167 H HB2  . ASN A 1 29  ? 9.576   -16.073 -2.588  1.00 0.00 ? 29  ASN A HB2  7  
ATOM 11168 H HB3  . ASN A 1 29  ? 9.949   -17.103 -1.209  1.00 0.00 ? 29  ASN A HB3  7  
ATOM 11169 H HD21 . ASN A 1 29  ? 9.661   -17.328 -4.740  1.00 0.00 ? 29  ASN A HD21 7  
ATOM 11170 H HD22 . ASN A 1 29  ? 11.064  -18.312 -4.960  1.00 0.00 ? 29  ASN A HD22 7  
ATOM 11171 N N    . LYS A 1 30  ? 6.940   -17.860 -0.251  1.00 0.00 ? 30  LYS A N    7  
ATOM 11172 C CA   . LYS A 1 30  ? 6.084   -17.379 0.827   1.00 0.00 ? 30  LYS A CA   7  
ATOM 11173 C C    . LYS A 1 30  ? 6.844   -16.421 1.739   1.00 0.00 ? 30  LYS A C    7  
ATOM 11174 O O    . LYS A 1 30  ? 7.959   -16.713 2.170   1.00 0.00 ? 30  LYS A O    7  
ATOM 11175 C CB   . LYS A 1 30  ? 5.546   -18.556 1.642   1.00 0.00 ? 30  LYS A CB   7  
ATOM 11176 C CG   . LYS A 1 30  ? 4.511   -18.156 2.679   1.00 0.00 ? 30  LYS A CG   7  
ATOM 11177 C CD   . LYS A 1 30  ? 3.582   -19.310 3.015   1.00 0.00 ? 30  LYS A CD   7  
ATOM 11178 C CE   . LYS A 1 30  ? 3.082   -19.225 4.449   1.00 0.00 ? 30  LYS A CE   7  
ATOM 11179 N NZ   . LYS A 1 30  ? 1.724   -19.817 4.599   1.00 0.00 ? 30  LYS A NZ   7  
ATOM 11180 H H    . LYS A 1 30  ? 7.250   -18.790 -0.237  1.00 0.00 ? 30  LYS A H    7  
ATOM 11181 H HA   . LYS A 1 30  ? 5.255   -16.851 0.381   1.00 0.00 ? 30  LYS A HA   7  
ATOM 11182 H HB2  . LYS A 1 30  ? 5.093   -19.268 0.968   1.00 0.00 ? 30  LYS A HB2  7  
ATOM 11183 H HB3  . LYS A 1 30  ? 6.371   -19.032 2.153   1.00 0.00 ? 30  LYS A HB3  7  
ATOM 11184 H HG2  . LYS A 1 30  ? 5.018   -17.843 3.579   1.00 0.00 ? 30  LYS A HG2  7  
ATOM 11185 H HG3  . LYS A 1 30  ? 3.924   -17.335 2.290   1.00 0.00 ? 30  LYS A HG3  7  
ATOM 11186 H HD2  . LYS A 1 30  ? 2.733   -19.284 2.348   1.00 0.00 ? 30  LYS A HD2  7  
ATOM 11187 H HD3  . LYS A 1 30  ? 4.116   -20.241 2.883   1.00 0.00 ? 30  LYS A HD3  7  
ATOM 11188 H HE2  . LYS A 1 30  ? 3.770   -19.757 5.088   1.00 0.00 ? 30  LYS A HE2  7  
ATOM 11189 H HE3  . LYS A 1 30  ? 3.048   -18.187 4.743   1.00 0.00 ? 30  LYS A HE3  7  
ATOM 11190 H HZ1  . LYS A 1 30  ? 1.019   -19.063 4.733   1.00 0.00 ? 30  LYS A HZ1  7  
ATOM 11191 H HZ2  . LYS A 1 30  ? 1.699   -20.449 5.425   1.00 0.00 ? 30  LYS A HZ2  7  
ATOM 11192 H HZ3  . LYS A 1 30  ? 1.476   -20.363 3.750   1.00 0.00 ? 30  LYS A HZ3  7  
ATOM 11193 N N    . ARG A 1 31  ? 6.233   -15.277 2.029   1.00 0.00 ? 31  ARG A N    7  
ATOM 11194 C CA   . ARG A 1 31  ? 6.852   -14.277 2.890   1.00 0.00 ? 31  ARG A CA   7  
ATOM 11195 C C    . ARG A 1 31  ? 5.803   -13.573 3.747   1.00 0.00 ? 31  ARG A C    7  
ATOM 11196 O O    . ARG A 1 31  ? 4.615   -13.587 3.427   1.00 0.00 ? 31  ARG A O    7  
ATOM 11197 C CB   . ARG A 1 31  ? 7.612   -13.249 2.049   1.00 0.00 ? 31  ARG A CB   7  
ATOM 11198 C CG   . ARG A 1 31  ? 8.814   -12.649 2.761   1.00 0.00 ? 31  ARG A CG   7  
ATOM 11199 C CD   . ARG A 1 31  ? 10.027  -13.562 2.671   1.00 0.00 ? 31  ARG A CD   7  
ATOM 11200 N NE   . ARG A 1 31  ? 9.926   -14.698 3.583   1.00 0.00 ? 31  ARG A NE   7  
ATOM 11201 C CZ   . ARG A 1 31  ? 10.646  -15.807 3.458   1.00 0.00 ? 31  ARG A CZ   7  
ATOM 11202 N NH1  . ARG A 1 31  ? 11.514  -15.929 2.464   1.00 0.00 ? 31  ARG A NH1  7  
ATOM 11203 N NH2  . ARG A 1 31  ? 10.497  -16.798 4.328   1.00 0.00 ? 31  ARG A NH2  7  
ATOM 11204 H H    . ARG A 1 31  ? 5.344   -15.101 1.655   1.00 0.00 ? 31  ARG A H    7  
ATOM 11205 H HA   . ARG A 1 31  ? 7.549   -14.784 3.540   1.00 0.00 ? 31  ARG A HA   7  
ATOM 11206 H HB2  . ARG A 1 31  ? 7.959   -13.727 1.145   1.00 0.00 ? 31  ARG A HB2  7  
ATOM 11207 H HB3  . ARG A 1 31  ? 6.938   -12.447 1.788   1.00 0.00 ? 31  ARG A HB3  7  
ATOM 11208 H HG2  . ARG A 1 31  ? 9.056   -11.702 2.303   1.00 0.00 ? 31  ARG A HG2  7  
ATOM 11209 H HG3  . ARG A 1 31  ? 8.565   -12.496 3.800   1.00 0.00 ? 31  ARG A HG3  7  
ATOM 11210 H HD2  . ARG A 1 31  ? 10.109  -13.931 1.660   1.00 0.00 ? 31  ARG A HD2  7  
ATOM 11211 H HD3  . ARG A 1 31  ? 10.909  -12.991 2.918   1.00 0.00 ? 31  ARG A HD3  7  
ATOM 11212 H HE   . ARG A 1 31  ? 9.290   -14.629 4.325   1.00 0.00 ? 31  ARG A HE   7  
ATOM 11213 H HH11 . ARG A 1 31  ? 11.629  -15.184 1.807   1.00 0.00 ? 31  ARG A HH11 7  
ATOM 11214 H HH12 . ARG A 1 31  ? 12.056  -16.765 2.373   1.00 0.00 ? 31  ARG A HH12 7  
ATOM 11215 H HH21 . ARG A 1 31  ? 9.843   -16.709 5.079   1.00 0.00 ? 31  ARG A HH21 7  
ATOM 11216 H HH22 . ARG A 1 31  ? 11.039  -17.632 4.233   1.00 0.00 ? 31  ARG A HH22 7  
ATOM 11217 N N    . TRP A 1 32  ? 6.252   -12.959 4.836   1.00 0.00 ? 32  TRP A N    7  
ATOM 11218 C CA   . TRP A 1 32  ? 5.352   -12.250 5.739   1.00 0.00 ? 32  TRP A CA   7  
ATOM 11219 C C    . TRP A 1 32  ? 5.188   -10.796 5.313   1.00 0.00 ? 32  TRP A C    7  
ATOM 11220 O O    . TRP A 1 32  ? 6.114   -9.994  5.435   1.00 0.00 ? 32  TRP A O    7  
ATOM 11221 C CB   . TRP A 1 32  ? 5.879   -12.318 7.173   1.00 0.00 ? 32  TRP A CB   7  
ATOM 11222 C CG   . TRP A 1 32  ? 4.935   -11.736 8.181   1.00 0.00 ? 32  TRP A CG   7  
ATOM 11223 C CD1  . TRP A 1 32  ? 5.178   -10.690 9.024   1.00 0.00 ? 32  TRP A CD1  7  
ATOM 11224 C CD2  . TRP A 1 32  ? 3.598   -12.170 8.452   1.00 0.00 ? 32  TRP A CD2  7  
ATOM 11225 N NE1  . TRP A 1 32  ? 4.073   -10.447 9.803   1.00 0.00 ? 32  TRP A NE1  7  
ATOM 11226 C CE2  . TRP A 1 32  ? 3.089   -11.340 9.471   1.00 0.00 ? 32  TRP A CE2  7  
ATOM 11227 C CE3  . TRP A 1 32  ? 2.780   -13.176 7.933   1.00 0.00 ? 32  TRP A CE3  7  
ATOM 11228 C CZ2  . TRP A 1 32  ? 1.801   -11.489 9.979   1.00 0.00 ? 32  TRP A CZ2  7  
ATOM 11229 C CZ3  . TRP A 1 32  ? 1.502   -13.323 8.438   1.00 0.00 ? 32  TRP A CZ3  7  
ATOM 11230 C CH2  . TRP A 1 32  ? 1.022   -12.483 9.451   1.00 0.00 ? 32  TRP A CH2  7  
ATOM 11231 H H    . TRP A 1 32  ? 7.211   -12.983 5.038   1.00 0.00 ? 32  TRP A H    7  
ATOM 11232 H HA   . TRP A 1 32  ? 4.389   -12.737 5.696   1.00 0.00 ? 32  TRP A HA   7  
ATOM 11233 H HB2  . TRP A 1 32  ? 6.055   -13.350 7.438   1.00 0.00 ? 32  TRP A HB2  7  
ATOM 11234 H HB3  . TRP A 1 32  ? 6.810   -11.771 7.233   1.00 0.00 ? 32  TRP A HB3  7  
ATOM 11235 H HD1  . TRP A 1 32  ? 6.108   -10.144 9.063   1.00 0.00 ? 32  TRP A HD1  7  
ATOM 11236 H HE1  . TRP A 1 32  ? 4.000   -9.745  10.484  1.00 0.00 ? 32  TRP A HE1  7  
ATOM 11237 H HE3  . TRP A 1 32  ? 3.131   -13.834 7.151   1.00 0.00 ? 32  TRP A HE3  7  
ATOM 11238 H HZ2  . TRP A 1 32  ? 1.417   -10.850 10.759  1.00 0.00 ? 32  TRP A HZ2  7  
ATOM 11239 H HZ3  . TRP A 1 32  ? 0.855   -14.096 8.048   1.00 0.00 ? 32  TRP A HZ3  7  
ATOM 11240 H HH2  . TRP A 1 32  ? 0.018   -12.634 9.816   1.00 0.00 ? 32  TRP A HH2  7  
ATOM 11241 N N    . PHE A 1 33  ? 4.003   -10.461 4.811   1.00 0.00 ? 33  PHE A N    7  
ATOM 11242 C CA   . PHE A 1 33  ? 3.718   -9.102  4.366   1.00 0.00 ? 33  PHE A CA   7  
ATOM 11243 C C    . PHE A 1 33  ? 2.849   -8.368  5.383   1.00 0.00 ? 33  PHE A C    7  
ATOM 11244 O O    . PHE A 1 33  ? 1.805   -8.869  5.801   1.00 0.00 ? 33  PHE A O    7  
ATOM 11245 C CB   . PHE A 1 33  ? 3.021   -9.125  3.004   1.00 0.00 ? 33  PHE A CB   7  
ATOM 11246 C CG   . PHE A 1 33  ? 3.968   -9.281  1.849   1.00 0.00 ? 33  PHE A CG   7  
ATOM 11247 C CD1  . PHE A 1 33  ? 4.512   -10.518 1.544   1.00 0.00 ? 33  PHE A CD1  7  
ATOM 11248 C CD2  . PHE A 1 33  ? 4.314   -8.190  1.068   1.00 0.00 ? 33  PHE A CD2  7  
ATOM 11249 C CE1  . PHE A 1 33  ? 5.383   -10.665 0.481   1.00 0.00 ? 33  PHE A CE1  7  
ATOM 11250 C CE2  . PHE A 1 33  ? 5.185   -8.331  0.004   1.00 0.00 ? 33  PHE A CE2  7  
ATOM 11251 C CZ   . PHE A 1 33  ? 5.721   -9.570  -0.289  1.00 0.00 ? 33  PHE A CZ   7  
ATOM 11252 H H    . PHE A 1 33  ? 3.304   -11.145 4.739   1.00 0.00 ? 33  PHE A H    7  
ATOM 11253 H HA   . PHE A 1 33  ? 4.658   -8.581  4.271   1.00 0.00 ? 33  PHE A HA   7  
ATOM 11254 H HB2  . PHE A 1 33  ? 2.326   -9.951  2.977   1.00 0.00 ? 33  PHE A HB2  7  
ATOM 11255 H HB3  . PHE A 1 33  ? 2.480   -8.200  2.869   1.00 0.00 ? 33  PHE A HB3  7  
ATOM 11256 H HD1  . PHE A 1 33  ? 4.249   -11.376 2.147   1.00 0.00 ? 33  PHE A HD1  7  
ATOM 11257 H HD2  . PHE A 1 33  ? 3.897   -7.220  1.296   1.00 0.00 ? 33  PHE A HD2  7  
ATOM 11258 H HE1  . PHE A 1 33  ? 5.801   -11.635 0.255   1.00 0.00 ? 33  PHE A HE1  7  
ATOM 11259 H HE2  . PHE A 1 33  ? 5.448   -7.473  -0.597  1.00 0.00 ? 33  PHE A HE2  7  
ATOM 11260 H HZ   . PHE A 1 33  ? 6.401   -9.683  -1.120  1.00 0.00 ? 33  PHE A HZ   7  
ATOM 11261 N N    . VAL A 1 34  ? 3.288   -7.177  5.777   1.00 0.00 ? 34  VAL A N    7  
ATOM 11262 C CA   . VAL A 1 34  ? 2.551   -6.372  6.744   1.00 0.00 ? 34  VAL A CA   7  
ATOM 11263 C C    . VAL A 1 34  ? 2.309   -4.963  6.216   1.00 0.00 ? 34  VAL A C    7  
ATOM 11264 O O    . VAL A 1 34  ? 3.214   -4.126  6.212   1.00 0.00 ? 34  VAL A O    7  
ATOM 11265 C CB   . VAL A 1 34  ? 3.299   -6.284  8.088   1.00 0.00 ? 34  VAL A CB   7  
ATOM 11266 C CG1  . VAL A 1 34  ? 2.520   -5.432  9.078   1.00 0.00 ? 34  VAL A CG1  7  
ATOM 11267 C CG2  . VAL A 1 34  ? 3.549   -7.675  8.650   1.00 0.00 ? 34  VAL A CG2  7  
ATOM 11268 H H    . VAL A 1 34  ? 4.127   -6.831  5.408   1.00 0.00 ? 34  VAL A H    7  
ATOM 11269 H HA   . VAL A 1 34  ? 1.597   -6.849  6.918   1.00 0.00 ? 34  VAL A HA   7  
ATOM 11270 H HB   . VAL A 1 34  ? 4.255   -5.812  7.914   1.00 0.00 ? 34  VAL A HB   7  
ATOM 11271 H HG11 . VAL A 1 34  ? 1.964   -4.677  8.543   1.00 0.00 ? 34  VAL A HG11 7  
ATOM 11272 H HG12 . VAL A 1 34  ? 1.837   -6.058  9.633   1.00 0.00 ? 34  VAL A HG12 7  
ATOM 11273 H HG13 . VAL A 1 34  ? 3.208   -4.955  9.761   1.00 0.00 ? 34  VAL A HG13 7  
ATOM 11274 H HG21 . VAL A 1 34  ? 4.499   -8.042  8.291   1.00 0.00 ? 34  VAL A HG21 7  
ATOM 11275 H HG22 . VAL A 1 34  ? 3.565   -7.630  9.729   1.00 0.00 ? 34  VAL A HG22 7  
ATOM 11276 H HG23 . VAL A 1 34  ? 2.762   -8.341  8.330   1.00 0.00 ? 34  VAL A HG23 7  
ATOM 11277 N N    . LEU A 1 35  ? 1.084   -4.705  5.772   1.00 0.00 ? 35  LEU A N    7  
ATOM 11278 C CA   . LEU A 1 35  ? 0.722   -3.395  5.241   1.00 0.00 ? 35  LEU A CA   7  
ATOM 11279 C C    . LEU A 1 35  ? 0.640   -2.359  6.358   1.00 0.00 ? 35  LEU A C    7  
ATOM 11280 O O    . LEU A 1 35  ? -0.156  -2.495  7.287   1.00 0.00 ? 35  LEU A O    7  
ATOM 11281 C CB   . LEU A 1 35  ? -0.615  -3.474  4.503   1.00 0.00 ? 35  LEU A CB   7  
ATOM 11282 C CG   . LEU A 1 35  ? -1.335  -2.144  4.275   1.00 0.00 ? 35  LEU A CG   7  
ATOM 11283 C CD1  . LEU A 1 35  ? -0.556  -1.275  3.301   1.00 0.00 ? 35  LEU A CD1  7  
ATOM 11284 C CD2  . LEU A 1 35  ? -2.749  -2.384  3.766   1.00 0.00 ? 35  LEU A CD2  7  
ATOM 11285 H H    . LEU A 1 35  ? 0.406   -5.412  5.801   1.00 0.00 ? 35  LEU A H    7  
ATOM 11286 H HA   . LEU A 1 35  ? 1.492   -3.096  4.545   1.00 0.00 ? 35  LEU A HA   7  
ATOM 11287 H HB2  . LEU A 1 35  ? -0.434  -3.921  3.538   1.00 0.00 ? 35  LEU A HB2  7  
ATOM 11288 H HB3  . LEU A 1 35  ? -1.271  -4.113  5.076   1.00 0.00 ? 35  LEU A HB3  7  
ATOM 11289 H HG   . LEU A 1 35  ? -1.403  -1.613  5.215   1.00 0.00 ? 35  LEU A HG   7  
ATOM 11290 H HD11 . LEU A 1 35  ? -0.261  -0.360  3.791   1.00 0.00 ? 35  LEU A HD11 7  
ATOM 11291 H HD12 . LEU A 1 35  ? -1.177  -1.043  2.449   1.00 0.00 ? 35  LEU A HD12 7  
ATOM 11292 H HD13 . LEU A 1 35  ? 0.325   -1.806  2.970   1.00 0.00 ? 35  LEU A HD13 7  
ATOM 11293 H HD21 . LEU A 1 35  ? -3.388  -2.657  4.593   1.00 0.00 ? 35  LEU A HD21 7  
ATOM 11294 H HD22 . LEU A 1 35  ? -2.739  -3.184  3.040   1.00 0.00 ? 35  LEU A HD22 7  
ATOM 11295 H HD23 . LEU A 1 35  ? -3.123  -1.483  3.304   1.00 0.00 ? 35  LEU A HD23 7  
ATOM 11296 N N    . VAL A 1 36  ? 1.466   -1.322  6.258   1.00 0.00 ? 36  VAL A N    7  
ATOM 11297 C CA   . VAL A 1 36  ? 1.484   -0.261  7.258   1.00 0.00 ? 36  VAL A CA   7  
ATOM 11298 C C    . VAL A 1 36  ? 0.452   0.814   6.937   1.00 0.00 ? 36  VAL A C    7  
ATOM 11299 O O    . VAL A 1 36  ? -0.337  0.672   6.002   1.00 0.00 ? 36  VAL A O    7  
ATOM 11300 C CB   . VAL A 1 36  ? 2.875   0.392   7.358   1.00 0.00 ? 36  VAL A CB   7  
ATOM 11301 C CG1  . VAL A 1 36  ? 3.009   1.521   6.347   1.00 0.00 ? 36  VAL A CG1  7  
ATOM 11302 C CG2  . VAL A 1 36  ? 3.126   0.897   8.770   1.00 0.00 ? 36  VAL A CG2  7  
ATOM 11303 H H    . VAL A 1 36  ? 2.077   -1.270  5.494   1.00 0.00 ? 36  VAL A H    7  
ATOM 11304 H HA   . VAL A 1 36  ? 1.246   -0.700  8.216   1.00 0.00 ? 36  VAL A HA   7  
ATOM 11305 H HB   . VAL A 1 36  ? 3.619   -0.357  7.128   1.00 0.00 ? 36  VAL A HB   7  
ATOM 11306 H HG11 . VAL A 1 36  ? 2.375   2.344   6.642   1.00 0.00 ? 36  VAL A HG11 7  
ATOM 11307 H HG12 . VAL A 1 36  ? 4.037   1.851   6.310   1.00 0.00 ? 36  VAL A HG12 7  
ATOM 11308 H HG13 . VAL A 1 36  ? 2.709   1.168   5.372   1.00 0.00 ? 36  VAL A HG13 7  
ATOM 11309 H HG21 . VAL A 1 36  ? 4.089   0.548   9.111   1.00 0.00 ? 36  VAL A HG21 7  
ATOM 11310 H HG22 . VAL A 1 36  ? 3.113   1.978   8.775   1.00 0.00 ? 36  VAL A HG22 7  
ATOM 11311 H HG23 . VAL A 1 36  ? 2.354   0.526   9.428   1.00 0.00 ? 36  VAL A HG23 7  
ATOM 11312 N N    . ASP A 1 37  ? 0.464   1.889   7.717   1.00 0.00 ? 37  ASP A N    7  
ATOM 11313 C CA   . ASP A 1 37  ? -0.471  2.991   7.515   1.00 0.00 ? 37  ASP A CA   7  
ATOM 11314 C C    . ASP A 1 37  ? -0.841  3.126   6.041   1.00 0.00 ? 37  ASP A C    7  
ATOM 11315 O O    . ASP A 1 37  ? -2.011  3.026   5.673   1.00 0.00 ? 37  ASP A O    7  
ATOM 11316 C CB   . ASP A 1 37  ? 0.134   4.300   8.024   1.00 0.00 ? 37  ASP A CB   7  
ATOM 11317 C CG   . ASP A 1 37  ? 1.519   4.555   7.462   1.00 0.00 ? 37  ASP A CG   7  
ATOM 11318 O OD1  . ASP A 1 37  ? 1.615   5.004   6.301   1.00 0.00 ? 37  ASP A OD1  7  
ATOM 11319 O OD2  . ASP A 1 37  ? 2.506   4.307   8.185   1.00 0.00 ? 37  ASP A OD2  7  
ATOM 11320 H H    . ASP A 1 37  ? 1.117   1.944   8.445   1.00 0.00 ? 37  ASP A H    7  
ATOM 11321 H HA   . ASP A 1 37  ? -1.365  2.775   8.079   1.00 0.00 ? 37  ASP A HA   7  
ATOM 11322 H HB2  . ASP A 1 37  ? -0.507  5.121   7.736   1.00 0.00 ? 37  ASP A HB2  7  
ATOM 11323 H HB3  . ASP A 1 37  ? 0.203   4.262   9.101   1.00 0.00 ? 37  ASP A HB3  7  
ATOM 11324 N N    . ARG A 1 38  ? 0.164   3.355   5.202   1.00 0.00 ? 38  ARG A N    7  
ATOM 11325 C CA   . ARG A 1 38  ? -0.056  3.507   3.769   1.00 0.00 ? 38  ARG A CA   7  
ATOM 11326 C C    . ARG A 1 38  ? 0.914   2.637   2.975   1.00 0.00 ? 38  ARG A C    7  
ATOM 11327 O O    . ARG A 1 38  ? 0.583   2.147   1.894   1.00 0.00 ? 38  ARG A O    7  
ATOM 11328 C CB   . ARG A 1 38  ? 0.103   4.972   3.359   1.00 0.00 ? 38  ARG A CB   7  
ATOM 11329 C CG   . ARG A 1 38  ? -1.190  5.767   3.427   1.00 0.00 ? 38  ARG A CG   7  
ATOM 11330 C CD   . ARG A 1 38  ? -1.210  6.887   2.397   1.00 0.00 ? 38  ARG A CD   7  
ATOM 11331 N NE   . ARG A 1 38  ? -2.034  8.013   2.829   1.00 0.00 ? 38  ARG A NE   7  
ATOM 11332 C CZ   . ARG A 1 38  ? -1.690  8.841   3.809   1.00 0.00 ? 38  ARG A CZ   7  
ATOM 11333 N NH1  . ARG A 1 38  ? -0.545  8.671   4.455   1.00 0.00 ? 38  ARG A NH1  7  
ATOM 11334 N NH2  . ARG A 1 38  ? -2.493  9.843   4.145   1.00 0.00 ? 38  ARG A NH2  7  
ATOM 11335 H H    . ARG A 1 38  ? 1.076   3.425   5.556   1.00 0.00 ? 38  ARG A H    7  
ATOM 11336 H HA   . ARG A 1 38  ? -1.065  3.189   3.553   1.00 0.00 ? 38  ARG A HA   7  
ATOM 11337 H HB2  . ARG A 1 38  ? 0.823   5.441   4.014   1.00 0.00 ? 38  ARG A HB2  7  
ATOM 11338 H HB3  . ARG A 1 38  ? 0.472   5.011   2.345   1.00 0.00 ? 38  ARG A HB3  7  
ATOM 11339 H HG2  . ARG A 1 38  ? -2.020  5.103   3.236   1.00 0.00 ? 38  ARG A HG2  7  
ATOM 11340 H HG3  . ARG A 1 38  ? -1.287  6.195   4.413   1.00 0.00 ? 38  ARG A HG3  7  
ATOM 11341 H HD2  . ARG A 1 38  ? -0.199  7.232   2.241   1.00 0.00 ? 38  ARG A HD2  7  
ATOM 11342 H HD3  . ARG A 1 38  ? -1.605  6.498   1.471   1.00 0.00 ? 38  ARG A HD3  7  
ATOM 11343 H HE   . ARG A 1 38  ? -2.885  8.157   2.366   1.00 0.00 ? 38  ARG A HE   7  
ATOM 11344 H HH11 . ARG A 1 38  ? 0.063   7.918   4.204   1.00 0.00 ? 38  ARG A HH11 7  
ATOM 11345 H HH12 . ARG A 1 38  ? -0.288  9.297   5.192   1.00 0.00 ? 38  ARG A HH12 7  
ATOM 11346 H HH21 . ARG A 1 38  ? -3.358  9.974   3.660   1.00 0.00 ? 38  ARG A HH21 7  
ATOM 11347 H HH22 . ARG A 1 38  ? -2.234  10.466  4.882   1.00 0.00 ? 38  ARG A HH22 7  
ATOM 11348 N N    . CYS A 1 39  ? 2.112   2.449   3.517   1.00 0.00 ? 39  CYS A N    7  
ATOM 11349 C CA   . CYS A 1 39  ? 3.131   1.639   2.859   1.00 0.00 ? 39  CYS A CA   7  
ATOM 11350 C C    . CYS A 1 39  ? 2.912   0.156   3.139   1.00 0.00 ? 39  CYS A C    7  
ATOM 11351 O O    . CYS A 1 39  ? 1.974   -0.222  3.843   1.00 0.00 ? 39  CYS A O    7  
ATOM 11352 C CB   . CYS A 1 39  ? 4.526   2.058   3.327   1.00 0.00 ? 39  CYS A CB   7  
ATOM 11353 S SG   . CYS A 1 39  ? 5.086   3.640   2.654   1.00 0.00 ? 39  CYS A SG   7  
ATOM 11354 H H    . CYS A 1 39  ? 2.317   2.865   4.381   1.00 0.00 ? 39  CYS A H    7  
ATOM 11355 H HA   . CYS A 1 39  ? 3.052   1.808   1.796   1.00 0.00 ? 39  CYS A HA   7  
ATOM 11356 H HB2  . CYS A 1 39  ? 4.526   2.142   4.404   1.00 0.00 ? 39  CYS A HB2  7  
ATOM 11357 H HB3  . CYS A 1 39  ? 5.238   1.303   3.031   1.00 0.00 ? 39  CYS A HB3  7  
ATOM 11358 H HG   . CYS A 1 39  ? 5.595   3.415   1.452   1.00 0.00 ? 39  CYS A HG   7  
ATOM 11359 N N    . LEU A 1 40  ? 3.781   -0.680  2.582   1.00 0.00 ? 40  LEU A N    7  
ATOM 11360 C CA   . LEU A 1 40  ? 3.682   -2.123  2.770   1.00 0.00 ? 40  LEU A CA   7  
ATOM 11361 C C    . LEU A 1 40  ? 5.062   -2.744  2.962   1.00 0.00 ? 40  LEU A C    7  
ATOM 11362 O O    . LEU A 1 40  ? 5.876   -2.771  2.039   1.00 0.00 ? 40  LEU A O    7  
ATOM 11363 C CB   . LEU A 1 40  ? 2.983   -2.767  1.571   1.00 0.00 ? 40  LEU A CB   7  
ATOM 11364 C CG   . LEU A 1 40  ? 3.067   -4.291  1.484   1.00 0.00 ? 40  LEU A CG   7  
ATOM 11365 C CD1  . LEU A 1 40  ? 2.285   -4.934  2.620   1.00 0.00 ? 40  LEU A CD1  7  
ATOM 11366 C CD2  . LEU A 1 40  ? 2.552   -4.778  0.138   1.00 0.00 ? 40  LEU A CD2  7  
ATOM 11367 H H    . LEU A 1 40  ? 4.507   -0.320  2.032   1.00 0.00 ? 40  LEU A H    7  
ATOM 11368 H HA   . LEU A 1 40  ? 3.093   -2.302  3.658   1.00 0.00 ? 40  LEU A HA   7  
ATOM 11369 H HB2  . LEU A 1 40  ? 1.940   -2.495  1.611   1.00 0.00 ? 40  LEU A HB2  7  
ATOM 11370 H HB3  . LEU A 1 40  ? 3.426   -2.359  0.673   1.00 0.00 ? 40  LEU A HB3  7  
ATOM 11371 H HG   . LEU A 1 40  ? 4.100   -4.595  1.578   1.00 0.00 ? 40  LEU A HG   7  
ATOM 11372 H HD11 . LEU A 1 40  ? 2.493   -5.993  2.646   1.00 0.00 ? 40  LEU A HD11 7  
ATOM 11373 H HD12 . LEU A 1 40  ? 1.228   -4.779  2.462   1.00 0.00 ? 40  LEU A HD12 7  
ATOM 11374 H HD13 . LEU A 1 40  ? 2.578   -4.485  3.558   1.00 0.00 ? 40  LEU A HD13 7  
ATOM 11375 H HD21 . LEU A 1 40  ? 2.398   -5.846  0.176   1.00 0.00 ? 40  LEU A HD21 7  
ATOM 11376 H HD22 . LEU A 1 40  ? 3.277   -4.546  -0.630  1.00 0.00 ? 40  LEU A HD22 7  
ATOM 11377 H HD23 . LEU A 1 40  ? 1.617   -4.287  -0.089  1.00 0.00 ? 40  LEU A HD23 7  
ATOM 11378 N N    . PHE A 1 41  ? 5.318   -3.243  4.167   1.00 0.00 ? 41  PHE A N    7  
ATOM 11379 C CA   . PHE A 1 41  ? 6.599   -3.865  4.480   1.00 0.00 ? 41  PHE A CA   7  
ATOM 11380 C C    . PHE A 1 41  ? 6.483   -5.386  4.469   1.00 0.00 ? 41  PHE A C    7  
ATOM 11381 O O    . PHE A 1 41  ? 5.385   -5.935  4.376   1.00 0.00 ? 41  PHE A O    7  
ATOM 11382 C CB   . PHE A 1 41  ? 7.100   -3.390  5.846   1.00 0.00 ? 41  PHE A CB   7  
ATOM 11383 C CG   . PHE A 1 41  ? 7.200   -1.896  5.962   1.00 0.00 ? 41  PHE A CG   7  
ATOM 11384 C CD1  . PHE A 1 41  ? 8.173   -1.198  5.264   1.00 0.00 ? 41  PHE A CD1  7  
ATOM 11385 C CD2  . PHE A 1 41  ? 6.323   -1.190  6.768   1.00 0.00 ? 41  PHE A CD2  7  
ATOM 11386 C CE1  . PHE A 1 41  ? 8.268   0.177   5.369   1.00 0.00 ? 41  PHE A CE1  7  
ATOM 11387 C CE2  . PHE A 1 41  ? 6.413   0.185   6.877   1.00 0.00 ? 41  PHE A CE2  7  
ATOM 11388 C CZ   . PHE A 1 41  ? 7.386   0.869   6.176   1.00 0.00 ? 41  PHE A CZ   7  
ATOM 11389 H H    . PHE A 1 41  ? 4.628   -3.192  4.862   1.00 0.00 ? 41  PHE A H    7  
ATOM 11390 H HA   . PHE A 1 41  ? 7.306   -3.564  3.723   1.00 0.00 ? 41  PHE A HA   7  
ATOM 11391 H HB2  . PHE A 1 41  ? 6.421   -3.737  6.611   1.00 0.00 ? 41  PHE A HB2  7  
ATOM 11392 H HB3  . PHE A 1 41  ? 8.080   -3.805  6.026   1.00 0.00 ? 41  PHE A HB3  7  
ATOM 11393 H HD1  . PHE A 1 41  ? 8.862   -1.738  4.632   1.00 0.00 ? 41  PHE A HD1  7  
ATOM 11394 H HD2  . PHE A 1 41  ? 5.560   -1.724  7.317   1.00 0.00 ? 41  PHE A HD2  7  
ATOM 11395 H HE1  . PHE A 1 41  ? 9.030   0.709   4.820   1.00 0.00 ? 41  PHE A HE1  7  
ATOM 11396 H HE2  . PHE A 1 41  ? 5.722   0.723   7.509   1.00 0.00 ? 41  PHE A HE2  7  
ATOM 11397 H HZ   . PHE A 1 41  ? 7.459   1.943   6.260   1.00 0.00 ? 41  PHE A HZ   7  
ATOM 11398 N N    . TYR A 1 42  ? 7.623   -6.061  4.564   1.00 0.00 ? 42  TYR A N    7  
ATOM 11399 C CA   . TYR A 1 42  ? 7.650   -7.519  4.562   1.00 0.00 ? 42  TYR A CA   7  
ATOM 11400 C C    . TYR A 1 42  ? 8.892   -8.042  5.277   1.00 0.00 ? 42  TYR A C    7  
ATOM 11401 O O    . TYR A 1 42  ? 9.916   -7.361  5.345   1.00 0.00 ? 42  TYR A O    7  
ATOM 11402 C CB   . TYR A 1 42  ? 7.614   -8.048  3.127   1.00 0.00 ? 42  TYR A CB   7  
ATOM 11403 C CG   . TYR A 1 42  ? 8.886   -7.788  2.353   1.00 0.00 ? 42  TYR A CG   7  
ATOM 11404 C CD1  . TYR A 1 42  ? 9.930   -8.704  2.365   1.00 0.00 ? 42  TYR A CD1  7  
ATOM 11405 C CD2  . TYR A 1 42  ? 9.044   -6.625  1.609   1.00 0.00 ? 42  TYR A CD2  7  
ATOM 11406 C CE1  . TYR A 1 42  ? 11.095  -8.470  1.660   1.00 0.00 ? 42  TYR A CE1  7  
ATOM 11407 C CE2  . TYR A 1 42  ? 10.204  -6.383  0.900   1.00 0.00 ? 42  TYR A CE2  7  
ATOM 11408 C CZ   . TYR A 1 42  ? 11.227  -7.308  0.928   1.00 0.00 ? 42  TYR A CZ   7  
ATOM 11409 O OH   . TYR A 1 42  ? 12.384  -7.071  0.223   1.00 0.00 ? 42  TYR A OH   7  
ATOM 11410 H H    . TYR A 1 42  ? 8.466   -5.568  4.636   1.00 0.00 ? 42  TYR A H    7  
ATOM 11411 H HA   . TYR A 1 42  ? 6.773   -7.868  5.086   1.00 0.00 ? 42  TYR A HA   7  
ATOM 11412 H HB2  . TYR A 1 42  ? 7.452   -9.115  3.149   1.00 0.00 ? 42  TYR A HB2  7  
ATOM 11413 H HB3  . TYR A 1 42  ? 6.800   -7.576  2.597   1.00 0.00 ? 42  TYR A HB3  7  
ATOM 11414 H HD1  . TYR A 1 42  ? 9.823   -9.614  2.938   1.00 0.00 ? 42  TYR A HD1  7  
ATOM 11415 H HD2  . TYR A 1 42  ? 8.241   -5.902  1.589   1.00 0.00 ? 42  TYR A HD2  7  
ATOM 11416 H HE1  . TYR A 1 42  ? 11.895  -9.194  1.682   1.00 0.00 ? 42  TYR A HE1  7  
ATOM 11417 H HE2  . TYR A 1 42  ? 10.308  -5.473  0.327   1.00 0.00 ? 42  TYR A HE2  7  
ATOM 11418 H HH   . TYR A 1 42  ? 13.073  -7.667  0.529   1.00 0.00 ? 42  TYR A HH   7  
ATOM 11419 N N    . TYR A 1 43  ? 8.794   -9.255  5.809   1.00 0.00 ? 43  TYR A N    7  
ATOM 11420 C CA   . TYR A 1 43  ? 9.908   -9.870  6.521   1.00 0.00 ? 43  TYR A CA   7  
ATOM 11421 C C    . TYR A 1 43  ? 10.007  -11.357 6.197   1.00 0.00 ? 43  TYR A C    7  
ATOM 11422 O O    . TYR A 1 43  ? 8.999   -12.021 5.952   1.00 0.00 ? 43  TYR A O    7  
ATOM 11423 C CB   . TYR A 1 43  ? 9.746   -9.675  8.030   1.00 0.00 ? 43  TYR A CB   7  
ATOM 11424 C CG   . TYR A 1 43  ? 9.231   -8.305  8.411   1.00 0.00 ? 43  TYR A CG   7  
ATOM 11425 C CD1  . TYR A 1 43  ? 7.927   -7.926  8.122   1.00 0.00 ? 43  TYR A CD1  7  
ATOM 11426 C CD2  . TYR A 1 43  ? 10.050  -7.391  9.063   1.00 0.00 ? 43  TYR A CD2  7  
ATOM 11427 C CE1  . TYR A 1 43  ? 7.453   -6.675  8.468   1.00 0.00 ? 43  TYR A CE1  7  
ATOM 11428 C CE2  . TYR A 1 43  ? 9.584   -6.138  9.414   1.00 0.00 ? 43  TYR A CE2  7  
ATOM 11429 C CZ   . TYR A 1 43  ? 8.285   -5.785  9.114   1.00 0.00 ? 43  TYR A CZ   7  
ATOM 11430 O OH   . TYR A 1 43  ? 7.817   -4.539  9.462   1.00 0.00 ? 43  TYR A OH   7  
ATOM 11431 H H    . TYR A 1 43  ? 7.952   -9.748  5.722   1.00 0.00 ? 43  TYR A H    7  
ATOM 11432 H HA   . TYR A 1 43  ? 10.817  -9.382  6.201   1.00 0.00 ? 43  TYR A HA   7  
ATOM 11433 H HB2  . TYR A 1 43  ? 9.049   -10.407 8.408   1.00 0.00 ? 43  TYR A HB2  7  
ATOM 11434 H HB3  . TYR A 1 43  ? 10.704  -9.815  8.509   1.00 0.00 ? 43  TYR A HB3  7  
ATOM 11435 H HD1  . TYR A 1 43  ? 7.277   -8.625  7.616   1.00 0.00 ? 43  TYR A HD1  7  
ATOM 11436 H HD2  . TYR A 1 43  ? 11.067  -7.670  9.296   1.00 0.00 ? 43  TYR A HD2  7  
ATOM 11437 H HE1  . TYR A 1 43  ? 6.436   -6.398  8.233   1.00 0.00 ? 43  TYR A HE1  7  
ATOM 11438 H HE2  . TYR A 1 43  ? 10.236  -5.441  9.920   1.00 0.00 ? 43  TYR A HE2  7  
ATOM 11439 H HH   . TYR A 1 43  ? 6.870   -4.499  9.307   1.00 0.00 ? 43  TYR A HH   7  
ATOM 11440 N N    . LYS A 1 44  ? 11.230  -11.876 6.198   1.00 0.00 ? 44  LYS A N    7  
ATOM 11441 C CA   . LYS A 1 44  ? 11.464  -13.285 5.907   1.00 0.00 ? 44  LYS A CA   7  
ATOM 11442 C C    . LYS A 1 44  ? 10.505  -14.171 6.696   1.00 0.00 ? 44  LYS A C    7  
ATOM 11443 O O    . LYS A 1 44  ? 10.063  -15.211 6.209   1.00 0.00 ? 44  LYS A O    7  
ATOM 11444 C CB   . LYS A 1 44  ? 12.911  -13.662 6.236   1.00 0.00 ? 44  LYS A CB   7  
ATOM 11445 C CG   . LYS A 1 44  ? 13.893  -13.336 5.124   1.00 0.00 ? 44  LYS A CG   7  
ATOM 11446 C CD   . LYS A 1 44  ? 14.013  -14.482 4.134   1.00 0.00 ? 44  LYS A CD   7  
ATOM 11447 C CE   . LYS A 1 44  ? 14.819  -14.076 2.908   1.00 0.00 ? 44  LYS A CE   7  
ATOM 11448 N NZ   . LYS A 1 44  ? 14.848  -15.155 1.882   1.00 0.00 ? 44  LYS A NZ   7  
ATOM 11449 H H    . LYS A 1 44  ? 11.995  -11.296 6.401   1.00 0.00 ? 44  LYS A H    7  
ATOM 11450 H HA   . LYS A 1 44  ? 11.293  -13.439 4.852   1.00 0.00 ? 44  LYS A HA   7  
ATOM 11451 H HB2  . LYS A 1 44  ? 13.215  -13.129 7.125   1.00 0.00 ? 44  LYS A HB2  7  
ATOM 11452 H HB3  . LYS A 1 44  ? 12.958  -14.724 6.430   1.00 0.00 ? 44  LYS A HB3  7  
ATOM 11453 H HG2  . LYS A 1 44  ? 13.550  -12.456 4.600   1.00 0.00 ? 44  LYS A HG2  7  
ATOM 11454 H HG3  . LYS A 1 44  ? 14.863  -13.144 5.559   1.00 0.00 ? 44  LYS A HG3  7  
ATOM 11455 H HD2  . LYS A 1 44  ? 14.507  -15.313 4.616   1.00 0.00 ? 44  LYS A HD2  7  
ATOM 11456 H HD3  . LYS A 1 44  ? 13.023  -14.781 3.820   1.00 0.00 ? 44  LYS A HD3  7  
ATOM 11457 H HE2  . LYS A 1 44  ? 14.373  -13.193 2.477   1.00 0.00 ? 44  LYS A HE2  7  
ATOM 11458 H HE3  . LYS A 1 44  ? 15.830  -13.856 3.216   1.00 0.00 ? 44  LYS A HE3  7  
ATOM 11459 H HZ1  . LYS A 1 44  ? 15.135  -16.055 2.319   1.00 0.00 ? 44  LYS A HZ1  7  
ATOM 11460 H HZ2  . LYS A 1 44  ? 15.526  -14.916 1.132   1.00 0.00 ? 44  LYS A HZ2  7  
ATOM 11461 H HZ3  . LYS A 1 44  ? 13.905  -15.272 1.459   1.00 0.00 ? 44  LYS A HZ3  7  
ATOM 11462 N N    . ASP A 1 45  ? 10.186  -13.751 7.915   1.00 0.00 ? 45  ASP A N    7  
ATOM 11463 C CA   . ASP A 1 45  ? 9.277   -14.504 8.770   1.00 0.00 ? 45  ASP A CA   7  
ATOM 11464 C C    . ASP A 1 45  ? 8.448   -13.566 9.642   1.00 0.00 ? 45  ASP A C    7  
ATOM 11465 O O    . ASP A 1 45  ? 8.548   -12.346 9.525   1.00 0.00 ? 45  ASP A O    7  
ATOM 11466 C CB   . ASP A 1 45  ? 10.061  -15.479 9.651   1.00 0.00 ? 45  ASP A CB   7  
ATOM 11467 C CG   . ASP A 1 45  ? 11.361  -14.885 10.156  1.00 0.00 ? 45  ASP A CG   7  
ATOM 11468 O OD1  . ASP A 1 45  ? 12.156  -14.400 9.323   1.00 0.00 ? 45  ASP A OD1  7  
ATOM 11469 O OD2  . ASP A 1 45  ? 11.584  -14.904 11.384  1.00 0.00 ? 45  ASP A OD2  7  
ATOM 11470 H H    . ASP A 1 45  ? 10.571  -12.913 8.248   1.00 0.00 ? 45  ASP A H    7  
ATOM 11471 H HA   . ASP A 1 45  ? 8.611   -15.066 8.133   1.00 0.00 ? 45  ASP A HA   7  
ATOM 11472 H HB2  . ASP A 1 45  ? 9.456   -15.750 10.504  1.00 0.00 ? 45  ASP A HB2  7  
ATOM 11473 H HB3  . ASP A 1 45  ? 10.289  -16.366 9.079   1.00 0.00 ? 45  ASP A HB3  7  
ATOM 11474 N N    . GLU A 1 46  ? 7.629   -14.146 10.514  1.00 0.00 ? 46  GLU A N    7  
ATOM 11475 C CA   . GLU A 1 46  ? 6.781   -13.361 11.403  1.00 0.00 ? 46  GLU A CA   7  
ATOM 11476 C C    . GLU A 1 46  ? 7.592   -12.786 12.561  1.00 0.00 ? 46  GLU A C    7  
ATOM 11477 O O    . GLU A 1 46  ? 7.195   -12.887 13.722  1.00 0.00 ? 46  GLU A O    7  
ATOM 11478 C CB   . GLU A 1 46  ? 5.637   -14.221 11.944  1.00 0.00 ? 46  GLU A CB   7  
ATOM 11479 C CG   . GLU A 1 46  ? 6.106   -15.472 12.669  1.00 0.00 ? 46  GLU A CG   7  
ATOM 11480 C CD   . GLU A 1 46  ? 5.041   -16.052 13.579  1.00 0.00 ? 46  GLU A CD   7  
ATOM 11481 O OE1  . GLU A 1 46  ? 4.463   -15.287 14.379  1.00 0.00 ? 46  GLU A OE1  7  
ATOM 11482 O OE2  . GLU A 1 46  ? 4.787   -17.272 13.493  1.00 0.00 ? 46  GLU A OE2  7  
ATOM 11483 H H    . GLU A 1 46  ? 7.594   -15.125 10.560  1.00 0.00 ? 46  GLU A H    7  
ATOM 11484 H HA   . GLU A 1 46  ? 6.365   -12.546 10.831  1.00 0.00 ? 46  GLU A HA   7  
ATOM 11485 H HB2  . GLU A 1 46  ? 5.051   -13.629 12.632  1.00 0.00 ? 46  GLU A HB2  7  
ATOM 11486 H HB3  . GLU A 1 46  ? 5.009   -14.523 11.119  1.00 0.00 ? 46  GLU A HB3  7  
ATOM 11487 H HG2  . GLU A 1 46  ? 6.377   -16.217 11.936  1.00 0.00 ? 46  GLU A HG2  7  
ATOM 11488 H HG3  . GLU A 1 46  ? 6.972   -15.223 13.265  1.00 0.00 ? 46  GLU A HG3  7  
ATOM 11489 N N    . LYS A 1 47  ? 8.731   -12.184 12.236  1.00 0.00 ? 47  LYS A N    7  
ATOM 11490 C CA   . LYS A 1 47  ? 9.599   -11.592 13.247  1.00 0.00 ? 47  LYS A CA   7  
ATOM 11491 C C    . LYS A 1 47  ? 9.402   -10.081 13.316  1.00 0.00 ? 47  LYS A C    7  
ATOM 11492 O O    . LYS A 1 47  ? 9.594   -9.469  14.366  1.00 0.00 ? 47  LYS A O    7  
ATOM 11493 C CB   . LYS A 1 47  ? 11.064  -11.913 12.942  1.00 0.00 ? 47  LYS A CB   7  
ATOM 11494 C CG   . LYS A 1 47  ? 11.431  -11.745 11.478  1.00 0.00 ? 47  LYS A CG   7  
ATOM 11495 C CD   . LYS A 1 47  ? 12.936  -11.670 11.286  1.00 0.00 ? 47  LYS A CD   7  
ATOM 11496 C CE   . LYS A 1 47  ? 13.301  -10.833 10.069  1.00 0.00 ? 47  LYS A CE   7  
ATOM 11497 N NZ   . LYS A 1 47  ? 12.999  -11.544 8.796   1.00 0.00 ? 47  LYS A NZ   7  
ATOM 11498 H H    . LYS A 1 47  ? 8.993   -12.136 11.293  1.00 0.00 ? 47  LYS A H    7  
ATOM 11499 H HA   . LYS A 1 47  ? 9.336   -12.021 14.202  1.00 0.00 ? 47  LYS A HA   7  
ATOM 11500 H HB2  . LYS A 1 47  ? 11.693  -11.258 13.527  1.00 0.00 ? 47  LYS A HB2  7  
ATOM 11501 H HB3  . LYS A 1 47  ? 11.262  -12.936 13.226  1.00 0.00 ? 47  LYS A HB3  7  
ATOM 11502 H HG2  . LYS A 1 47  ? 11.050  -12.589 10.922  1.00 0.00 ? 47  LYS A HG2  7  
ATOM 11503 H HG3  . LYS A 1 47  ? 10.983  -10.835 11.106  1.00 0.00 ? 47  LYS A HG3  7  
ATOM 11504 H HD2  . LYS A 1 47  ? 13.381  -11.222 12.162  1.00 0.00 ? 47  LYS A HD2  7  
ATOM 11505 H HD3  . LYS A 1 47  ? 13.325  -12.670 11.154  1.00 0.00 ? 47  LYS A HD3  7  
ATOM 11506 H HE2  . LYS A 1 47  ? 12.739  -9.913  10.099  1.00 0.00 ? 47  LYS A HE2  7  
ATOM 11507 H HE3  . LYS A 1 47  ? 14.358  -10.611 10.105  1.00 0.00 ? 47  LYS A HE3  7  
ATOM 11508 H HZ1  . LYS A 1 47  ? 13.883  -11.807 8.315   1.00 0.00 ? 47  LYS A HZ1  7  
ATOM 11509 H HZ2  . LYS A 1 47  ? 12.445  -10.929 8.166   1.00 0.00 ? 47  LYS A HZ2  7  
ATOM 11510 H HZ3  . LYS A 1 47  ? 12.452  -12.407 8.990   1.00 0.00 ? 47  LYS A HZ3  7  
ATOM 11511 N N    . GLU A 1 48  ? 9.017   -9.487  12.190  1.00 0.00 ? 48  GLU A N    7  
ATOM 11512 C CA   . GLU A 1 48  ? 8.794   -8.047  12.125  1.00 0.00 ? 48  GLU A CA   7  
ATOM 11513 C C    . GLU A 1 48  ? 9.853   -7.296  12.928  1.00 0.00 ? 48  GLU A C    7  
ATOM 11514 O O    . GLU A 1 48  ? 9.541   -6.353  13.654  1.00 0.00 ? 48  GLU A O    7  
ATOM 11515 C CB   . GLU A 1 48  ? 7.399   -7.701  12.649  1.00 0.00 ? 48  GLU A CB   7  
ATOM 11516 C CG   . GLU A 1 48  ? 6.964   -8.551  13.831  1.00 0.00 ? 48  GLU A CG   7  
ATOM 11517 C CD   . GLU A 1 48  ? 5.550   -8.243  14.282  1.00 0.00 ? 48  GLU A CD   7  
ATOM 11518 O OE1  . GLU A 1 48  ? 5.152   -7.061  14.219  1.00 0.00 ? 48  GLU A OE1  7  
ATOM 11519 O OE2  . GLU A 1 48  ? 4.841   -9.184  14.697  1.00 0.00 ? 48  GLU A OE2  7  
ATOM 11520 H H    . GLU A 1 48  ? 8.881   -10.029 11.386  1.00 0.00 ? 48  GLU A H    7  
ATOM 11521 H HA   . GLU A 1 48  ? 8.865   -7.748  11.090  1.00 0.00 ? 48  GLU A HA   7  
ATOM 11522 H HB2  . GLU A 1 48  ? 7.390   -6.665  12.955  1.00 0.00 ? 48  GLU A HB2  7  
ATOM 11523 H HB3  . GLU A 1 48  ? 6.684   -7.838  11.851  1.00 0.00 ? 48  GLU A HB3  7  
ATOM 11524 H HG2  . GLU A 1 48  ? 7.017   -9.592  13.547  1.00 0.00 ? 48  GLU A HG2  7  
ATOM 11525 H HG3  . GLU A 1 48  ? 7.637   -8.370  14.656  1.00 0.00 ? 48  GLU A HG3  7  
ATOM 11526 N N    . GLU A 1 49  ? 11.105  -7.722  12.790  1.00 0.00 ? 49  GLU A N    7  
ATOM 11527 C CA   . GLU A 1 49  ? 12.208  -7.090  13.503  1.00 0.00 ? 49  GLU A CA   7  
ATOM 11528 C C    . GLU A 1 49  ? 12.998  -6.169  12.578  1.00 0.00 ? 49  GLU A C    7  
ATOM 11529 O O    . GLU A 1 49  ? 12.999  -4.950  12.750  1.00 0.00 ? 49  GLU A O    7  
ATOM 11530 C CB   . GLU A 1 49  ? 13.136  -8.152  14.096  1.00 0.00 ? 49  GLU A CB   7  
ATOM 11531 C CG   . GLU A 1 49  ? 12.598  -8.789  15.367  1.00 0.00 ? 49  GLU A CG   7  
ATOM 11532 C CD   . GLU A 1 49  ? 12.997  -8.027  16.615  1.00 0.00 ? 49  GLU A CD   7  
ATOM 11533 O OE1  . GLU A 1 49  ? 12.611  -6.846  16.740  1.00 0.00 ? 49  GLU A OE1  7  
ATOM 11534 O OE2  . GLU A 1 49  ? 13.697  -8.612  17.469  1.00 0.00 ? 49  GLU A OE2  7  
ATOM 11535 H H    . GLU A 1 49  ? 11.290  -8.478  12.195  1.00 0.00 ? 49  GLU A H    7  
ATOM 11536 H HA   . GLU A 1 49  ? 11.791  -6.501  14.306  1.00 0.00 ? 49  GLU A HA   7  
ATOM 11537 H HB2  . GLU A 1 49  ? 13.287  -8.931  13.363  1.00 0.00 ? 49  GLU A HB2  7  
ATOM 11538 H HB3  . GLU A 1 49  ? 14.088  -7.695  14.323  1.00 0.00 ? 49  GLU A HB3  7  
ATOM 11539 H HG2  . GLU A 1 49  ? 11.520  -8.819  15.311  1.00 0.00 ? 49  GLU A HG2  7  
ATOM 11540 H HG3  . GLU