data_2DA2
# 
_entry.id   2DA2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DA2         
RCSB  RCSB025173   
WWPDB D_1000025173 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk003000131.3 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DA2 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-13 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohnishi, S.'                                            1 
'Kigawa, T.'                                             2 
'Tochio, N.'                                             3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Yokoyama, S.'                                           6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the second homeobox domain of AT-binding transcription factor 1 (ATBF1)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohnishi, S.'  1 
primary 'Kigawa, T.'   2 
primary 'Tochio, N.'   3 
primary 'Koshiba, S.'  4 
primary 'Inoue, M.'    5 
primary 'Yokoyama, S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Alpha-fetoprotein enhancer binding protein' 
_entity.formula_weight             7908.690 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'The second homeobox domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AT motif-binding factor, AT-binding transcription factor 1, ATBF1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGRSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARKSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk003000131.3 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  ARG n 
1 9  SER n 
1 10 SER n 
1 11 ARG n 
1 12 THR n 
1 13 ARG n 
1 14 PHE n 
1 15 THR n 
1 16 ASP n 
1 17 TYR n 
1 18 GLN n 
1 19 LEU n 
1 20 ARG n 
1 21 VAL n 
1 22 LEU n 
1 23 GLN n 
1 24 ASP n 
1 25 PHE n 
1 26 PHE n 
1 27 ASP n 
1 28 ALA n 
1 29 ASN n 
1 30 ALA n 
1 31 TYR n 
1 32 PRO n 
1 33 LYS n 
1 34 ASP n 
1 35 ASP n 
1 36 GLU n 
1 37 PHE n 
1 38 GLU n 
1 39 GLN n 
1 40 LEU n 
1 41 SER n 
1 42 ASN n 
1 43 LEU n 
1 44 LEU n 
1 45 ASN n 
1 46 LEU n 
1 47 PRO n 
1 48 THR n 
1 49 ARG n 
1 50 VAL n 
1 51 ILE n 
1 52 VAL n 
1 53 VAL n 
1 54 TRP n 
1 55 PHE n 
1 56 GLN n 
1 57 ASN n 
1 58 ALA n 
1 59 ARG n 
1 60 GLN n 
1 61 LYS n 
1 62 ALA n 
1 63 ARG n 
1 64 LYS n 
1 65 SER n 
1 66 GLY n 
1 67 PRO n 
1 68 SER n 
1 69 SER n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ATBF1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050620-20 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ATBF1_HUMAN 
_struct_ref.pdbx_db_accession          Q15911 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RSSRTRFTDYQLRVLQDFFDANAYPKDDEFEQLSNLLNLPTRVIVVWFQNARQKARK 
_struct_ref.pdbx_align_begin           2243 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DA2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15911 
_struct_ref_seq.db_align_beg                  2243 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  2299 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DA2 GLY A 1  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 1  1  
1 2DA2 SER A 2  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 2  2  
1 2DA2 SER A 3  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 3  3  
1 2DA2 GLY A 4  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 4  4  
1 2DA2 SER A 5  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 5  5  
1 2DA2 SER A 6  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 6  6  
1 2DA2 GLY A 7  ? UNP Q15911 ? ? 'CLONING ARTIFACT' 7  7  
1 2DA2 SER A 65 ? UNP Q15911 ? ? 'CLONING ARTIFACT' 65 8  
1 2DA2 GLY A 66 ? UNP Q15911 ? ? 'CLONING ARTIFACT' 66 9  
1 2DA2 PRO A 67 ? UNP Q15911 ? ? 'CLONING ARTIFACT' 67 10 
1 2DA2 SER A 68 ? UNP Q15911 ? ? 'CLONING ARTIFACT' 68 11 
1 2DA2 SER A 69 ? UNP Q15911 ? ? 'CLONING ARTIFACT' 69 12 
1 2DA2 GLY A 70 ? UNP Q15911 ? ? 'CLONING ARTIFACT' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.1mM protein U-15N,13C; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DA2 
_pdbx_nmr_refine.method             'torsion angle dynamics, restrained molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DA2 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DA2 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 3.5      Bruker          1 
processing           NMRPipe 20030801 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira  0.932    'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DA2 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DA2 
_struct.title                     'Solution structure of the second homeobox domain of AT-binding transcription factor 1 (ATBF1)' 
_struct.pdbx_descriptor           'Alpha-fetoprotein enhancer binding protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DA2 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 15 ? ASN A 29 ? THR A 15 ASN A 29 1 ? 15 
HELX_P HELX_P2 2 LYS A 33 ? LEU A 44 ? LYS A 33 LEU A 44 1 ? 12 
HELX_P HELX_P3 3 PRO A 47 ? ARG A 63 ? PRO A 47 ARG A 63 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2DA2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DA2 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 16.943  1.091   -33.854 1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 16.276  0.368   -32.787 1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 14.811  0.738   -32.663 1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 14.130  0.948   -33.667 1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 16.827  2.061   -33.933 1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? 16.354  -0.691  -32.982 1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? 16.771  0.589   -31.853 1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? 14.324  0.816   -31.429 1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? 12.929  1.157   -31.178 1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? 12.740  2.670   -31.131 1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? 13.437  3.372   -30.398 1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? 12.458  0.532   -29.863 1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? 12.495  -0.883  -29.929 1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? 14.917  0.636   -30.669 1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? 12.339  0.757   -31.989 1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? 13.101  0.860   -29.061 1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? 11.443  0.845   -29.663 1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? 13.229  -1.209  -29.404 1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? 11.792  3.167   -31.919 1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? 11.513  4.597   -31.972 1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? 11.111  5.123   -30.598 1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? 11.694  6.081   -30.092 1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? 10.403  4.884   -32.985 1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? 10.895  4.818   -34.313 1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? 11.270  2.556   -32.481 1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? 12.415  5.099   -32.287 1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? 9.616   4.155   -32.869 1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? 10.007  5.874   -32.809 1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? 10.434  4.125   -34.791 1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? 10.109  4.488   -29.997 1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? 9.645   4.905   -28.687 1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? 8.843   3.826   -27.986 1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? 9.406   2.860   -27.472 1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? 9.681   3.729   -30.448 1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? 10.500  5.157   -28.078 1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? 9.024   5.782   -28.800 1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? 7.524   3.992   -27.963 1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? 6.644   3.027   -27.314 1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? 7.233   2.561   -25.986 1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? 7.200   1.374   -25.662 1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? 6.407   1.825   -28.230 1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? 7.625   1.168   -28.535 1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? 7.135   4.783   -28.390 1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? 5.700   3.516   -27.124 1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? 5.748   1.125   -27.738 1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? 5.952   2.161   -29.150 1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? 7.828   0.532   -27.845 1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? 7.773   3.505   -25.222 1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? 8.373   3.192   -23.930 1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? 7.352   3.340   -22.806 1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? 6.312   3.974   -22.976 1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? 9.573   4.105   -23.668 1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? 10.614  3.858   -24.597 1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? 7.769   4.434   -25.535 1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? 8.711   2.167   -23.962 1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? 9.265   5.135   -23.756 1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? 9.947   3.925   -22.670 1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? 10.245  3.485   -25.400 1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? 7.659   2.748   -21.655 1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? 6.759   2.824   -20.519 1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? 6.550   1.478   -19.853 1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? 7.513   0.774   -19.548 1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? 8.503   2.256   -21.577 1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? 7.168   3.513   -19.796 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? 5.803   3.197   -20.857 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8  ? 5.291   1.121   -19.626 1.00 0.00 ? 8  ARG A N    1  
ATOM 67    C CA   . ARG A 1 8  ? 4.960   -0.148  -18.989 1.00 0.00 ? 8  ARG A CA   1  
ATOM 68    C C    . ARG A 1 8  ? 4.178   -1.047  -19.943 1.00 0.00 ? 8  ARG A C    1  
ATOM 69    O O    . ARG A 1 8  ? 4.274   -2.273  -19.875 1.00 0.00 ? 8  ARG A O    1  
ATOM 70    C CB   . ARG A 1 8  ? 4.146   0.093   -17.717 1.00 0.00 ? 8  ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8  ? 2.944   1.000   -17.925 1.00 0.00 ? 8  ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8  ? 3.303   2.460   -17.700 1.00 0.00 ? 8  ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8  ? 3.642   2.733   -16.306 1.00 0.00 ? 8  ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8  ? 4.062   3.915   -15.869 1.00 0.00 ? 8  ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8  ? 4.193   4.929   -16.713 1.00 0.00 ? 8  ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8  ? 4.350   4.085   -14.585 1.00 0.00 ? 8  ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8  ? 4.567   1.725   -19.893 1.00 0.00 ? 8  ARG A H    1  
ATOM 78    H HA   . ARG A 1 8  ? 5.885   -0.639  -18.727 1.00 0.00 ? 8  ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8  ? 3.792   -0.857  -17.344 1.00 0.00 ? 8  ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8  ? 4.787   0.545   -16.975 1.00 0.00 ? 8  ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8  ? 2.585   0.881   -18.936 1.00 0.00 ? 8  ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8  ? 2.168   0.718   -17.229 1.00 0.00 ? 8  ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8  ? 4.151   2.709   -18.321 1.00 0.00 ? 8  ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8  ? 2.459   3.072   -17.982 1.00 0.00 ? 8  ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8  ? 3.552   1.997   -15.665 1.00 0.00 ? 8  ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8  ? 3.975   4.804   -17.681 1.00 0.00 ? 8  ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8  ? 4.508   5.819   -16.381 1.00 0.00 ? 8  ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8  ? 4.253   3.323   -13.946 1.00 0.00 ? 8  ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8  ? 4.666   4.975   -14.257 1.00 0.00 ? 8  ARG A HH22 1  
ATOM 90    N N    . SER A 1 9  ? 3.405   -0.430  -20.830 1.00 0.00 ? 9  SER A N    1  
ATOM 91    C CA   . SER A 1 9  ? 2.604   -1.174  -21.795 1.00 0.00 ? 9  SER A CA   1  
ATOM 92    C C    . SER A 1 9  ? 2.098   -2.480  -21.188 1.00 0.00 ? 9  SER A C    1  
ATOM 93    O O    . SER A 1 9  ? 2.133   -3.530  -21.830 1.00 0.00 ? 9  SER A O    1  
ATOM 94    C CB   . SER A 1 9  ? 3.423   -1.467  -23.053 1.00 0.00 ? 9  SER A CB   1  
ATOM 95    O OG   . SER A 1 9  ? 4.571   -2.240  -22.745 1.00 0.00 ? 9  SER A OG   1  
ATOM 96    H H    . SER A 1 9  ? 3.371   0.550   -20.835 1.00 0.00 ? 9  SER A H    1  
ATOM 97    H HA   . SER A 1 9  ? 1.755   -0.563  -22.063 1.00 0.00 ? 9  SER A HA   1  
ATOM 98    H HB2  . SER A 1 9  ? 2.815   -2.013  -23.757 1.00 0.00 ? 9  SER A HB2  1  
ATOM 99    H HB3  . SER A 1 9  ? 3.741   -0.535  -23.498 1.00 0.00 ? 9  SER A HB3  1  
ATOM 100   H HG   . SER A 1 9  ? 4.938   -2.604  -23.554 1.00 0.00 ? 9  SER A HG   1  
ATOM 101   N N    . SER A 1 10 ? 1.627   -2.405  -19.947 1.00 0.00 ? 10 SER A N    1  
ATOM 102   C CA   . SER A 1 10 ? 1.118   -3.581  -19.251 1.00 0.00 ? 10 SER A CA   1  
ATOM 103   C C    . SER A 1 10 ? -0.408  -3.593  -19.252 1.00 0.00 ? 10 SER A C    1  
ATOM 104   O O    . SER A 1 10 ? -1.031  -4.651  -19.347 1.00 0.00 ? 10 SER A O    1  
ATOM 105   C CB   . SER A 1 10 ? 1.638   -3.614  -17.813 1.00 0.00 ? 10 SER A CB   1  
ATOM 106   O OG   . SER A 1 10 ? 1.290   -4.829  -17.172 1.00 0.00 ? 10 SER A OG   1  
ATOM 107   H H    . SER A 1 10 ? 1.626   -1.539  -19.488 1.00 0.00 ? 10 SER A H    1  
ATOM 108   H HA   . SER A 1 10 ? 1.473   -4.456  -19.774 1.00 0.00 ? 10 SER A HA   1  
ATOM 109   H HB2  . SER A 1 10 ? 2.714   -3.520  -17.820 1.00 0.00 ? 10 SER A HB2  1  
ATOM 110   H HB3  . SER A 1 10 ? 1.209   -2.792  -17.259 1.00 0.00 ? 10 SER A HB3  1  
ATOM 111   H HG   . SER A 1 10 ? 0.409   -4.753  -16.799 1.00 0.00 ? 10 SER A HG   1  
ATOM 112   N N    . ARG A 1 11 ? -1.003  -2.410  -19.145 1.00 0.00 ? 11 ARG A N    1  
ATOM 113   C CA   . ARG A 1 11 ? -2.456  -2.283  -19.132 1.00 0.00 ? 11 ARG A CA   1  
ATOM 114   C C    . ARG A 1 11 ? -3.058  -3.056  -17.963 1.00 0.00 ? 11 ARG A C    1  
ATOM 115   O O    . ARG A 1 11 ? -4.080  -3.729  -18.108 1.00 0.00 ? 11 ARG A O    1  
ATOM 116   C CB   . ARG A 1 11 ? -3.045  -2.791  -20.450 1.00 0.00 ? 11 ARG A CB   1  
ATOM 117   C CG   . ARG A 1 11 ? -2.641  -1.960  -21.657 1.00 0.00 ? 11 ARG A CG   1  
ATOM 118   C CD   . ARG A 1 11 ? -3.469  -0.689  -21.761 1.00 0.00 ? 11 ARG A CD   1  
ATOM 119   N NE   . ARG A 1 11 ? -3.188  0.048   -22.990 1.00 0.00 ? 11 ARG A NE   1  
ATOM 120   C CZ   . ARG A 1 11 ? -4.037  0.908   -23.542 1.00 0.00 ? 11 ARG A CZ   1  
ATOM 121   N NH1  . ARG A 1 11 ? -5.214  1.138   -22.976 1.00 0.00 ? 11 ARG A NH1  1  
ATOM 122   N NH2  . ARG A 1 11 ? -3.709  1.541   -24.661 1.00 0.00 ? 11 ARG A NH2  1  
ATOM 123   H H    . ARG A 1 11 ? -0.453  -1.602  -19.073 1.00 0.00 ? 11 ARG A H    1  
ATOM 124   H HA   . ARG A 1 11 ? -2.697  -1.237  -19.020 1.00 0.00 ? 11 ARG A HA   1  
ATOM 125   H HB2  . ARG A 1 11 ? -2.713  -3.806  -20.612 1.00 0.00 ? 11 ARG A HB2  1  
ATOM 126   H HB3  . ARG A 1 11 ? -4.122  -2.779  -20.377 1.00 0.00 ? 11 ARG A HB3  1  
ATOM 127   H HG2  . ARG A 1 11 ? -1.599  -1.691  -21.565 1.00 0.00 ? 11 ARG A HG2  1  
ATOM 128   H HG3  . ARG A 1 11 ? -2.785  -2.548  -22.551 1.00 0.00 ? 11 ARG A HG3  1  
ATOM 129   H HD2  . ARG A 1 11 ? -4.515  -0.955  -21.744 1.00 0.00 ? 11 ARG A HD2  1  
ATOM 130   H HD3  . ARG A 1 11 ? -3.243  -0.058  -20.914 1.00 0.00 ? 11 ARG A HD3  1  
ATOM 131   H HE   . ARG A 1 11 ? -2.324  -0.107  -23.425 1.00 0.00 ? 11 ARG A HE   1  
ATOM 132   H HH11 . ARG A 1 11 ? -5.463  0.664   -22.132 1.00 0.00 ? 11 ARG A HH11 1  
ATOM 133   H HH12 . ARG A 1 11 ? -5.851  1.787   -23.393 1.00 0.00 ? 11 ARG A HH12 1  
ATOM 134   H HH21 . ARG A 1 11 ? -2.823  1.370   -25.091 1.00 0.00 ? 11 ARG A HH21 1  
ATOM 135   H HH22 . ARG A 1 11 ? -4.349  2.187   -25.076 1.00 0.00 ? 11 ARG A HH22 1  
ATOM 136   N N    . THR A 1 12 ? -2.418  -2.956  -16.802 1.00 0.00 ? 12 THR A N    1  
ATOM 137   C CA   . THR A 1 12 ? -2.889  -3.646  -15.607 1.00 0.00 ? 12 THR A CA   1  
ATOM 138   C C    . THR A 1 12 ? -3.350  -2.655  -14.545 1.00 0.00 ? 12 THR A C    1  
ATOM 139   O O    . THR A 1 12 ? -2.577  -1.809  -14.095 1.00 0.00 ? 12 THR A O    1  
ATOM 140   C CB   . THR A 1 12 ? -1.793  -4.548  -15.010 1.00 0.00 ? 12 THR A CB   1  
ATOM 141   O OG1  . THR A 1 12 ? -1.379  -5.521  -15.976 1.00 0.00 ? 12 THR A OG1  1  
ATOM 142   C CG2  . THR A 1 12 ? -2.293  -5.251  -13.757 1.00 0.00 ? 12 THR A CG2  1  
ATOM 143   H H    . THR A 1 12 ? -1.610  -2.405  -16.749 1.00 0.00 ? 12 THR A H    1  
ATOM 144   H HA   . THR A 1 12 ? -3.725  -4.270  -15.891 1.00 0.00 ? 12 THR A HA   1  
ATOM 145   H HB   . THR A 1 12 ? -0.945  -3.932  -14.746 1.00 0.00 ? 12 THR A HB   1  
ATOM 146   H HG1  . THR A 1 12 ? -1.543  -5.185  -16.860 1.00 0.00 ? 12 THR A HG1  1  
ATOM 147   H HG21 . THR A 1 12 ? -1.676  -6.115  -13.559 1.00 0.00 ? 12 THR A HG21 1  
ATOM 148   H HG22 . THR A 1 12 ? -3.315  -5.564  -13.904 1.00 0.00 ? 12 THR A HG22 1  
ATOM 149   H HG23 . THR A 1 12 ? -2.240  -4.572  -12.919 1.00 0.00 ? 12 THR A HG23 1  
ATOM 150   N N    . ARG A 1 13 ? -4.614  -2.765  -14.148 1.00 0.00 ? 13 ARG A N    1  
ATOM 151   C CA   . ARG A 1 13 ? -5.177  -1.877  -13.138 1.00 0.00 ? 13 ARG A CA   1  
ATOM 152   C C    . ARG A 1 13 ? -5.744  -2.675  -11.968 1.00 0.00 ? 13 ARG A C    1  
ATOM 153   O O    . ARG A 1 13 ? -6.620  -3.522  -12.146 1.00 0.00 ? 13 ARG A O    1  
ATOM 154   C CB   . ARG A 1 13 ? -6.273  -1.003  -13.751 1.00 0.00 ? 13 ARG A CB   1  
ATOM 155   C CG   . ARG A 1 13 ? -6.945  -0.077  -12.751 1.00 0.00 ? 13 ARG A CG   1  
ATOM 156   C CD   . ARG A 1 13 ? -5.984  0.988   -12.245 1.00 0.00 ? 13 ARG A CD   1  
ATOM 157   N NE   . ARG A 1 13 ? -6.538  1.735   -11.119 1.00 0.00 ? 13 ARG A NE   1  
ATOM 158   C CZ   . ARG A 1 13 ? -7.355  2.774   -11.257 1.00 0.00 ? 13 ARG A CZ   1  
ATOM 159   N NH1  . ARG A 1 13 ? -7.710  3.186   -12.466 1.00 0.00 ? 13 ARG A NH1  1  
ATOM 160   N NH2  . ARG A 1 13 ? -7.818  3.402   -10.184 1.00 0.00 ? 13 ARG A NH2  1  
ATOM 161   H H    . ARG A 1 13 ? -5.181  -3.459  -14.544 1.00 0.00 ? 13 ARG A H    1  
ATOM 162   H HA   . ARG A 1 13 ? -4.383  -1.242  -12.775 1.00 0.00 ? 13 ARG A HA   1  
ATOM 163   H HB2  . ARG A 1 13 ? -5.839  -0.397  -14.533 1.00 0.00 ? 13 ARG A HB2  1  
ATOM 164   H HB3  . ARG A 1 13 ? -7.029  -1.643  -14.181 1.00 0.00 ? 13 ARG A HB3  1  
ATOM 165   H HG2  . ARG A 1 13 ? -7.783  0.408   -13.229 1.00 0.00 ? 13 ARG A HG2  1  
ATOM 166   H HG3  . ARG A 1 13 ? -7.294  -0.661  -11.913 1.00 0.00 ? 13 ARG A HG3  1  
ATOM 167   H HD2  . ARG A 1 13 ? -5.069  0.509   -11.931 1.00 0.00 ? 13 ARG A HD2  1  
ATOM 168   H HD3  . ARG A 1 13 ? -5.772  1.674   -13.052 1.00 0.00 ? 13 ARG A HD3  1  
ATOM 169   H HE   . ARG A 1 13 ? -6.288  1.448   -10.217 1.00 0.00 ? 13 ARG A HE   1  
ATOM 170   H HH11 . ARG A 1 13 ? -7.364  2.714   -13.276 1.00 0.00 ? 13 ARG A HH11 1  
ATOM 171   H HH12 . ARG A 1 13 ? -8.326  3.968   -12.567 1.00 0.00 ? 13 ARG A HH12 1  
ATOM 172   H HH21 . ARG A 1 13 ? -7.552  3.094   -9.271  1.00 0.00 ? 13 ARG A HH21 1  
ATOM 173   H HH22 . ARG A 1 13 ? -8.432  4.184   -10.289 1.00 0.00 ? 13 ARG A HH22 1  
ATOM 174   N N    . PHE A 1 14 ? -5.238  -2.400  -10.770 1.00 0.00 ? 14 PHE A N    1  
ATOM 175   C CA   . PHE A 1 14 ? -5.692  -3.093  -9.570  1.00 0.00 ? 14 PHE A CA   1  
ATOM 176   C C    . PHE A 1 14 ? -6.833  -2.332  -8.902  1.00 0.00 ? 14 PHE A C    1  
ATOM 177   O O    . PHE A 1 14 ? -7.006  -1.131  -9.118  1.00 0.00 ? 14 PHE A O    1  
ATOM 178   C CB   . PHE A 1 14 ? -4.534  -3.265  -8.586  1.00 0.00 ? 14 PHE A CB   1  
ATOM 179   C CG   . PHE A 1 14 ? -3.241  -3.657  -9.244  1.00 0.00 ? 14 PHE A CG   1  
ATOM 180   C CD1  . PHE A 1 14 ? -2.467  -2.712  -9.898  1.00 0.00 ? 14 PHE A CD1  1  
ATOM 181   C CD2  . PHE A 1 14 ? -2.801  -4.970  -9.209  1.00 0.00 ? 14 PHE A CD2  1  
ATOM 182   C CE1  . PHE A 1 14 ? -1.277  -3.069  -10.504 1.00 0.00 ? 14 PHE A CE1  1  
ATOM 183   C CE2  . PHE A 1 14 ? -1.612  -5.333  -9.813  1.00 0.00 ? 14 PHE A CE2  1  
ATOM 184   C CZ   . PHE A 1 14 ? -0.850  -4.382  -10.462 1.00 0.00 ? 14 PHE A CZ   1  
ATOM 185   H H    . PHE A 1 14 ? -4.542  -1.714  -10.692 1.00 0.00 ? 14 PHE A H    1  
ATOM 186   H HA   . PHE A 1 14 ? -6.050  -4.067  -9.867  1.00 0.00 ? 14 PHE A HA   1  
ATOM 187   H HB2  . PHE A 1 14 ? -4.371  -2.334  -8.065  1.00 0.00 ? 14 PHE A HB2  1  
ATOM 188   H HB3  . PHE A 1 14 ? -4.790  -4.033  -7.871  1.00 0.00 ? 14 PHE A HB3  1  
ATOM 189   H HD1  . PHE A 1 14 ? -2.801  -1.685  -9.931  1.00 0.00 ? 14 PHE A HD1  1  
ATOM 190   H HD2  . PHE A 1 14 ? -3.397  -5.716  -8.703  1.00 0.00 ? 14 PHE A HD2  1  
ATOM 191   H HE1  . PHE A 1 14 ? -0.684  -2.323  -11.011 1.00 0.00 ? 14 PHE A HE1  1  
ATOM 192   H HE2  . PHE A 1 14 ? -1.280  -6.360  -9.779  1.00 0.00 ? 14 PHE A HE2  1  
ATOM 193   H HZ   . PHE A 1 14 ? 0.080   -4.663  -10.935 1.00 0.00 ? 14 PHE A HZ   1  
ATOM 194   N N    . THR A 1 15 ? -7.611  -3.038  -8.088  1.00 0.00 ? 15 THR A N    1  
ATOM 195   C CA   . THR A 1 15 ? -8.737  -2.432  -7.389  1.00 0.00 ? 15 THR A CA   1  
ATOM 196   C C    . THR A 1 15 ? -8.428  -2.244  -5.908  1.00 0.00 ? 15 THR A C    1  
ATOM 197   O O    . THR A 1 15 ? -7.589  -2.948  -5.345  1.00 0.00 ? 15 THR A O    1  
ATOM 198   C CB   . THR A 1 15 ? -10.012 -3.284  -7.531  1.00 0.00 ? 15 THR A CB   1  
ATOM 199   O OG1  . THR A 1 15 ? -11.081 -2.696  -6.781  1.00 0.00 ? 15 THR A OG1  1  
ATOM 200   C CG2  . THR A 1 15 ? -9.769  -4.706  -7.049  1.00 0.00 ? 15 THR A CG2  1  
ATOM 201   H H    . THR A 1 15 ? -7.423  -3.991  -7.956  1.00 0.00 ? 15 THR A H    1  
ATOM 202   H HA   . THR A 1 15 ? -8.924  -1.465  -7.833  1.00 0.00 ? 15 THR A HA   1  
ATOM 203   H HB   . THR A 1 15 ? -10.291 -3.316  -8.575  1.00 0.00 ? 15 THR A HB   1  
ATOM 204   H HG1  . THR A 1 15 ? -10.767 -2.467  -5.902  1.00 0.00 ? 15 THR A HG1  1  
ATOM 205   H HG21 . THR A 1 15 ? -10.687 -5.271  -7.117  1.00 0.00 ? 15 THR A HG21 1  
ATOM 206   H HG22 . THR A 1 15 ? -9.435  -4.686  -6.022  1.00 0.00 ? 15 THR A HG22 1  
ATOM 207   H HG23 . THR A 1 15 ? -9.014  -5.171  -7.664  1.00 0.00 ? 15 THR A HG23 1  
ATOM 208   N N    . ASP A 1 16 ? -9.109  -1.291  -5.282  1.00 0.00 ? 16 ASP A N    1  
ATOM 209   C CA   . ASP A 1 16 ? -8.909  -1.012  -3.865  1.00 0.00 ? 16 ASP A CA   1  
ATOM 210   C C    . ASP A 1 16 ? -8.623  -2.296  -3.093  1.00 0.00 ? 16 ASP A C    1  
ATOM 211   O O    . ASP A 1 16 ? -7.723  -2.341  -2.255  1.00 0.00 ? 16 ASP A O    1  
ATOM 212   C CB   . ASP A 1 16 ? -10.138 -0.314  -3.281  1.00 0.00 ? 16 ASP A CB   1  
ATOM 213   C CG   . ASP A 1 16 ? -10.172 1.166   -3.605  1.00 0.00 ? 16 ASP A CG   1  
ATOM 214   O OD1  . ASP A 1 16 ? -9.536  1.950   -2.870  1.00 0.00 ? 16 ASP A OD1  1  
ATOM 215   O OD2  . ASP A 1 16 ? -10.834 1.542   -4.595  1.00 0.00 ? 16 ASP A OD2  1  
ATOM 216   H H    . ASP A 1 16 ? -9.764  -0.763  -5.786  1.00 0.00 ? 16 ASP A H    1  
ATOM 217   H HA   . ASP A 1 16 ? -8.057  -0.355  -3.774  1.00 0.00 ? 16 ASP A HA   1  
ATOM 218   H HB2  . ASP A 1 16 ? -11.030 -0.772  -3.685  1.00 0.00 ? 16 ASP A HB2  1  
ATOM 219   H HB3  . ASP A 1 16 ? -10.134 -0.430  -2.208  1.00 0.00 ? 16 ASP A HB3  1  
ATOM 220   N N    . TYR A 1 17 ? -9.395  -3.338  -3.382  1.00 0.00 ? 17 TYR A N    1  
ATOM 221   C CA   . TYR A 1 17 ? -9.227  -4.622  -2.713  1.00 0.00 ? 17 TYR A CA   1  
ATOM 222   C C    . TYR A 1 17 ? -7.795  -5.128  -2.855  1.00 0.00 ? 17 TYR A C    1  
ATOM 223   O O    . TYR A 1 17 ? -7.176  -5.551  -1.879  1.00 0.00 ? 17 TYR A O    1  
ATOM 224   C CB   . TYR A 1 17 ? -10.202 -5.651  -3.287  1.00 0.00 ? 17 TYR A CB   1  
ATOM 225   C CG   . TYR A 1 17 ? -9.707  -7.076  -3.187  1.00 0.00 ? 17 TYR A CG   1  
ATOM 226   C CD1  . TYR A 1 17 ? -9.199  -7.573  -1.993  1.00 0.00 ? 17 TYR A CD1  1  
ATOM 227   C CD2  . TYR A 1 17 ? -9.747  -7.925  -4.286  1.00 0.00 ? 17 TYR A CD2  1  
ATOM 228   C CE1  . TYR A 1 17 ? -8.745  -8.875  -1.897  1.00 0.00 ? 17 TYR A CE1  1  
ATOM 229   C CE2  . TYR A 1 17 ? -9.296  -9.228  -4.198  1.00 0.00 ? 17 TYR A CE2  1  
ATOM 230   C CZ   . TYR A 1 17 ? -8.796  -9.698  -3.002  1.00 0.00 ? 17 TYR A CZ   1  
ATOM 231   O OH   . TYR A 1 17 ? -8.344  -10.995 -2.911  1.00 0.00 ? 17 TYR A OH   1  
ATOM 232   H H    . TYR A 1 17 ? -10.096 -3.240  -4.060  1.00 0.00 ? 17 TYR A H    1  
ATOM 233   H HA   . TYR A 1 17 ? -9.445  -4.481  -1.664  1.00 0.00 ? 17 TYR A HA   1  
ATOM 234   H HB2  . TYR A 1 17 ? -11.138 -5.588  -2.753  1.00 0.00 ? 17 TYR A HB2  1  
ATOM 235   H HB3  . TYR A 1 17 ? -10.373 -5.432  -4.331  1.00 0.00 ? 17 TYR A HB3  1  
ATOM 236   H HD1  . TYR A 1 17 ? -9.160  -6.926  -1.129  1.00 0.00 ? 17 TYR A HD1  1  
ATOM 237   H HD2  . TYR A 1 17 ? -10.139 -7.554  -5.221  1.00 0.00 ? 17 TYR A HD2  1  
ATOM 238   H HE1  . TYR A 1 17 ? -8.353  -9.243  -0.960  1.00 0.00 ? 17 TYR A HE1  1  
ATOM 239   H HE2  . TYR A 1 17 ? -9.335  -9.873  -5.064  1.00 0.00 ? 17 TYR A HE2  1  
ATOM 240   H HH   . TYR A 1 17 ? -7.761  -11.078 -2.153  1.00 0.00 ? 17 TYR A HH   1  
ATOM 241   N N    . GLN A 1 18 ? -7.276  -5.079  -4.077  1.00 0.00 ? 18 GLN A N    1  
ATOM 242   C CA   . GLN A 1 18 ? -5.916  -5.531  -4.348  1.00 0.00 ? 18 GLN A CA   1  
ATOM 243   C C    . GLN A 1 18 ? -4.895  -4.511  -3.856  1.00 0.00 ? 18 GLN A C    1  
ATOM 244   O O    . GLN A 1 18 ? -3.951  -4.856  -3.144  1.00 0.00 ? 18 GLN A O    1  
ATOM 245   C CB   . GLN A 1 18 ? -5.727  -5.779  -5.846  1.00 0.00 ? 18 GLN A CB   1  
ATOM 246   C CG   . GLN A 1 18 ? -6.711  -6.782  -6.425  1.00 0.00 ? 18 GLN A CG   1  
ATOM 247   C CD   . GLN A 1 18 ? -6.137  -7.550  -7.600  1.00 0.00 ? 18 GLN A CD   1  
ATOM 248   O OE1  . GLN A 1 18 ? -5.548  -6.967  -8.510  1.00 0.00 ? 18 GLN A OE1  1  
ATOM 249   N NE2  . GLN A 1 18 ? -6.307  -8.867  -7.585  1.00 0.00 ? 18 GLN A NE2  1  
ATOM 250   H H    . GLN A 1 18 ? -7.819  -4.731  -4.814  1.00 0.00 ? 18 GLN A H    1  
ATOM 251   H HA   . GLN A 1 18 ? -5.764  -6.459  -3.817  1.00 0.00 ? 18 GLN A HA   1  
ATOM 252   H HB2  . GLN A 1 18 ? -5.848  -4.843  -6.371  1.00 0.00 ? 18 GLN A HB2  1  
ATOM 253   H HB3  . GLN A 1 18 ? -4.727  -6.150  -6.014  1.00 0.00 ? 18 GLN A HB3  1  
ATOM 254   H HG2  . GLN A 1 18 ? -6.984  -7.486  -5.654  1.00 0.00 ? 18 GLN A HG2  1  
ATOM 255   H HG3  . GLN A 1 18 ? -7.592  -6.252  -6.756  1.00 0.00 ? 18 GLN A HG3  1  
ATOM 256   H HE21 . GLN A 1 18 ? -6.787  -9.264  -6.828  1.00 0.00 ? 18 GLN A HE21 1  
ATOM 257   H HE22 . GLN A 1 18 ? -5.947  -9.388  -8.332  1.00 0.00 ? 18 GLN A HE22 1  
ATOM 258   N N    . LEU A 1 19 ? -5.089  -3.255  -4.240  1.00 0.00 ? 19 LEU A N    1  
ATOM 259   C CA   . LEU A 1 19 ? -4.184  -2.183  -3.839  1.00 0.00 ? 19 LEU A CA   1  
ATOM 260   C C    . LEU A 1 19 ? -4.022  -2.147  -2.322  1.00 0.00 ? 19 LEU A C    1  
ATOM 261   O O    . LEU A 1 19 ? -2.976  -1.750  -1.809  1.00 0.00 ? 19 LEU A O    1  
ATOM 262   C CB   . LEU A 1 19 ? -4.704  -0.835  -4.340  1.00 0.00 ? 19 LEU A CB   1  
ATOM 263   C CG   . LEU A 1 19 ? -4.501  -0.549  -5.829  1.00 0.00 ? 19 LEU A CG   1  
ATOM 264   C CD1  . LEU A 1 19 ? -5.131  0.782   -6.207  1.00 0.00 ? 19 LEU A CD1  1  
ATOM 265   C CD2  . LEU A 1 19 ? -3.020  -0.558  -6.177  1.00 0.00 ? 19 LEU A CD2  1  
ATOM 266   H H    . LEU A 1 19 ? -5.859  -3.041  -4.807  1.00 0.00 ? 19 LEU A H    1  
ATOM 267   H HA   . LEU A 1 19 ? -3.221  -2.378  -4.287  1.00 0.00 ? 19 LEU A HA   1  
ATOM 268   H HB2  . LEU A 1 19 ? -5.763  -0.793  -4.137  1.00 0.00 ? 19 LEU A HB2  1  
ATOM 269   H HB3  . LEU A 1 19 ? -4.200  -0.059  -3.782  1.00 0.00 ? 19 LEU A HB3  1  
ATOM 270   H HG   . LEU A 1 19 ? -4.986  -1.324  -6.407  1.00 0.00 ? 19 LEU A HG   1  
ATOM 271   H HD11 . LEU A 1 19 ? -4.455  1.585   -5.956  1.00 0.00 ? 19 LEU A HD11 1  
ATOM 272   H HD12 . LEU A 1 19 ? -6.058  0.909   -5.666  1.00 0.00 ? 19 LEU A HD12 1  
ATOM 273   H HD13 . LEU A 1 19 ? -5.330  0.797   -7.269  1.00 0.00 ? 19 LEU A HD13 1  
ATOM 274   H HD21 . LEU A 1 19 ? -2.444  -0.777  -5.290  1.00 0.00 ? 19 LEU A HD21 1  
ATOM 275   H HD22 . LEU A 1 19 ? -2.735  0.411   -6.561  1.00 0.00 ? 19 LEU A HD22 1  
ATOM 276   H HD23 . LEU A 1 19 ? -2.830  -1.313  -6.925  1.00 0.00 ? 19 LEU A HD23 1  
ATOM 277   N N    . ARG A 1 20 ? -5.064  -2.565  -1.611  1.00 0.00 ? 20 ARG A N    1  
ATOM 278   C CA   . ARG A 1 20 ? -5.038  -2.581  -0.154  1.00 0.00 ? 20 ARG A CA   1  
ATOM 279   C C    . ARG A 1 20 ? -3.994  -3.567  0.360   1.00 0.00 ? 20 ARG A C    1  
ATOM 280   O O    . ARG A 1 20 ? -3.169  -3.229  1.209   1.00 0.00 ? 20 ARG A O    1  
ATOM 281   C CB   . ARG A 1 20 ? -6.416  -2.947  0.399   1.00 0.00 ? 20 ARG A CB   1  
ATOM 282   C CG   . ARG A 1 20 ? -6.567  -2.679  1.888   1.00 0.00 ? 20 ARG A CG   1  
ATOM 283   C CD   . ARG A 1 20 ? -5.894  -3.761  2.718   1.00 0.00 ? 20 ARG A CD   1  
ATOM 284   N NE   . ARG A 1 20 ? -6.421  -3.813  4.079   1.00 0.00 ? 20 ARG A NE   1  
ATOM 285   C CZ   . ARG A 1 20 ? -6.169  -2.891  5.001   1.00 0.00 ? 20 ARG A CZ   1  
ATOM 286   N NH1  . ARG A 1 20 ? -5.402  -1.850  4.709   1.00 0.00 ? 20 ARG A NH1  1  
ATOM 287   N NH2  . ARG A 1 20 ? -6.686  -3.008  6.218   1.00 0.00 ? 20 ARG A NH2  1  
ATOM 288   H H    . ARG A 1 20 ? -5.871  -2.869  -2.078  1.00 0.00 ? 20 ARG A H    1  
ATOM 289   H HA   . ARG A 1 20 ? -4.776  -1.589  0.184   1.00 0.00 ? 20 ARG A HA   1  
ATOM 290   H HB2  . ARG A 1 20 ? -7.166  -2.371  -0.125  1.00 0.00 ? 20 ARG A HB2  1  
ATOM 291   H HB3  . ARG A 1 20 ? -6.594  -3.997  0.224   1.00 0.00 ? 20 ARG A HB3  1  
ATOM 292   H HG2  . ARG A 1 20 ? -6.112  -1.728  2.121   1.00 0.00 ? 20 ARG A HG2  1  
ATOM 293   H HG3  . ARG A 1 20 ? -7.617  -2.649  2.134   1.00 0.00 ? 20 ARG A HG3  1  
ATOM 294   H HD2  . ARG A 1 20 ? -6.058  -4.716  2.242   1.00 0.00 ? 20 ARG A HD2  1  
ATOM 295   H HD3  . ARG A 1 20 ? -4.834  -3.557  2.760   1.00 0.00 ? 20 ARG A HD3  1  
ATOM 296   H HE   . ARG A 1 20 ? -6.991  -4.574  4.316   1.00 0.00 ? 20 ARG A HE   1  
ATOM 297   H HH11 . ARG A 1 20 ? -5.012  -1.758  3.793   1.00 0.00 ? 20 ARG A HH11 1  
ATOM 298   H HH12 . ARG A 1 20 ? -5.215  -1.156  5.405   1.00 0.00 ? 20 ARG A HH12 1  
ATOM 299   H HH21 . ARG A 1 20 ? -7.265  -3.792  6.441   1.00 0.00 ? 20 ARG A HH21 1  
ATOM 300   H HH22 . ARG A 1 20 ? -6.496  -2.314  6.911   1.00 0.00 ? 20 ARG A HH22 1  
ATOM 301   N N    . VAL A 1 21 ? -4.036  -4.790  -0.160  1.00 0.00 ? 21 VAL A N    1  
ATOM 302   C CA   . VAL A 1 21 ? -3.094  -5.826  0.246   1.00 0.00 ? 21 VAL A CA   1  
ATOM 303   C C    . VAL A 1 21 ? -1.692  -5.528  -0.274  1.00 0.00 ? 21 VAL A C    1  
ATOM 304   O O    . VAL A 1 21 ? -0.703  -5.703  0.440   1.00 0.00 ? 21 VAL A O    1  
ATOM 305   C CB   . VAL A 1 21 ? -3.533  -7.213  -0.261  1.00 0.00 ? 21 VAL A CB   1  
ATOM 306   C CG1  . VAL A 1 21 ? -2.525  -8.275  0.150   1.00 0.00 ? 21 VAL A CG1  1  
ATOM 307   C CG2  . VAL A 1 21 ? -4.921  -7.555  0.260   1.00 0.00 ? 21 VAL A CG2  1  
ATOM 308   H H    . VAL A 1 21 ? -4.717  -5.000  -0.832  1.00 0.00 ? 21 VAL A H    1  
ATOM 309   H HA   . VAL A 1 21 ? -3.069  -5.852  1.325   1.00 0.00 ? 21 VAL A HA   1  
ATOM 310   H HB   . VAL A 1 21 ? -3.573  -7.184  -1.340  1.00 0.00 ? 21 VAL A HB   1  
ATOM 311   H HG11 . VAL A 1 21 ? -2.357  -8.219  1.216   1.00 0.00 ? 21 VAL A HG11 1  
ATOM 312   H HG12 . VAL A 1 21 ? -2.907  -9.253  -0.105  1.00 0.00 ? 21 VAL A HG12 1  
ATOM 313   H HG13 . VAL A 1 21 ? -1.593  -8.107  -0.370  1.00 0.00 ? 21 VAL A HG13 1  
ATOM 314   H HG21 . VAL A 1 21 ? -5.505  -6.651  0.346   1.00 0.00 ? 21 VAL A HG21 1  
ATOM 315   H HG22 . VAL A 1 21 ? -5.407  -8.233  -0.427  1.00 0.00 ? 21 VAL A HG22 1  
ATOM 316   H HG23 . VAL A 1 21 ? -4.838  -8.024  1.229   1.00 0.00 ? 21 VAL A HG23 1  
ATOM 317   N N    . LEU A 1 22 ? -1.613  -5.077  -1.521  1.00 0.00 ? 22 LEU A N    1  
ATOM 318   C CA   . LEU A 1 22 ? -0.331  -4.753  -2.138  1.00 0.00 ? 22 LEU A CA   1  
ATOM 319   C C    . LEU A 1 22 ? 0.345   -3.595  -1.411  1.00 0.00 ? 22 LEU A C    1  
ATOM 320   O O    . LEU A 1 22 ? 1.528   -3.665  -1.078  1.00 0.00 ? 22 LEU A O    1  
ATOM 321   C CB   . LEU A 1 22 ? -0.527  -4.400  -3.613  1.00 0.00 ? 22 LEU A CB   1  
ATOM 322   C CG   . LEU A 1 22 ? -1.035  -5.529  -4.511  1.00 0.00 ? 22 LEU A CG   1  
ATOM 323   C CD1  . LEU A 1 22 ? -1.493  -4.978  -5.853  1.00 0.00 ? 22 LEU A CD1  1  
ATOM 324   C CD2  . LEU A 1 22 ? 0.045   -6.583  -4.706  1.00 0.00 ? 22 LEU A CD2  1  
ATOM 325   H H    . LEU A 1 22 ? -2.435  -4.958  -2.040  1.00 0.00 ? 22 LEU A H    1  
ATOM 326   H HA   . LEU A 1 22 ? 0.301   -5.626  -2.065  1.00 0.00 ? 22 LEU A HA   1  
ATOM 327   H HB2  . LEU A 1 22 ? -1.237  -3.590  -3.667  1.00 0.00 ? 22 LEU A HB2  1  
ATOM 328   H HB3  . LEU A 1 22 ? 0.425   -4.069  -4.002  1.00 0.00 ? 22 LEU A HB3  1  
ATOM 329   H HG   . LEU A 1 22 ? -1.885  -6.002  -4.038  1.00 0.00 ? 22 LEU A HG   1  
ATOM 330   H HD11 . LEU A 1 22 ? -2.569  -5.036  -5.918  1.00 0.00 ? 22 LEU A HD11 1  
ATOM 331   H HD12 . LEU A 1 22 ? -1.052  -5.559  -6.650  1.00 0.00 ? 22 LEU A HD12 1  
ATOM 332   H HD13 . LEU A 1 22 ? -1.181  -3.948  -5.944  1.00 0.00 ? 22 LEU A HD13 1  
ATOM 333   H HD21 . LEU A 1 22 ? 0.998   -6.097  -4.858  1.00 0.00 ? 22 LEU A HD21 1  
ATOM 334   H HD22 . LEU A 1 22 ? -0.193  -7.187  -5.570  1.00 0.00 ? 22 LEU A HD22 1  
ATOM 335   H HD23 . LEU A 1 22 ? 0.097   -7.211  -3.829  1.00 0.00 ? 22 LEU A HD23 1  
ATOM 336   N N    . GLN A 1 23 ? -0.414  -2.532  -1.168  1.00 0.00 ? 23 GLN A N    1  
ATOM 337   C CA   . GLN A 1 23 ? 0.112   -1.359  -0.479  1.00 0.00 ? 23 GLN A CA   1  
ATOM 338   C C    . GLN A 1 23 ? 0.387   -1.668  0.989   1.00 0.00 ? 23 GLN A C    1  
ATOM 339   O O    . GLN A 1 23 ? 1.365   -1.186  1.562   1.00 0.00 ? 23 GLN A O    1  
ATOM 340   C CB   . GLN A 1 23 ? -0.869  -0.192  -0.592  1.00 0.00 ? 23 GLN A CB   1  
ATOM 341   C CG   . GLN A 1 23 ? -0.216  1.171   -0.424  1.00 0.00 ? 23 GLN A CG   1  
ATOM 342   C CD   . GLN A 1 23 ? 0.955   1.377   -1.364  1.00 0.00 ? 23 GLN A CD   1  
ATOM 343   O OE1  . GLN A 1 23 ? 0.779   1.767   -2.518  1.00 0.00 ? 23 GLN A OE1  1  
ATOM 344   N NE2  . GLN A 1 23 ? 2.161   1.115   -0.873  1.00 0.00 ? 23 GLN A NE2  1  
ATOM 345   H H    . GLN A 1 23 ? -1.350  -2.536  -1.458  1.00 0.00 ? 23 GLN A H    1  
ATOM 346   H HA   . GLN A 1 23 ? 1.041   -1.084  -0.956  1.00 0.00 ? 23 GLN A HA   1  
ATOM 347   H HB2  . GLN A 1 23 ? -1.339  -0.224  -1.564  1.00 0.00 ? 23 GLN A HB2  1  
ATOM 348   H HB3  . GLN A 1 23 ? -1.628  -0.299  0.169   1.00 0.00 ? 23 GLN A HB3  1  
ATOM 349   H HG2  . GLN A 1 23 ? -0.953  1.936   -0.620  1.00 0.00 ? 23 GLN A HG2  1  
ATOM 350   H HG3  . GLN A 1 23 ? 0.136   1.263   0.593   1.00 0.00 ? 23 GLN A HG3  1  
ATOM 351   H HE21 . GLN A 1 23 ? 2.225   0.806   0.056   1.00 0.00 ? 23 GLN A HE21 1  
ATOM 352   H HE22 . GLN A 1 23 ? 2.936   1.238   -1.458  1.00 0.00 ? 23 GLN A HE22 1  
ATOM 353   N N    . ASP A 1 24 ? -0.482  -2.472  1.592   1.00 0.00 ? 24 ASP A N    1  
ATOM 354   C CA   . ASP A 1 24 ? -0.333  -2.845  2.994   1.00 0.00 ? 24 ASP A CA   1  
ATOM 355   C C    . ASP A 1 24 ? 0.929   -3.676  3.203   1.00 0.00 ? 24 ASP A C    1  
ATOM 356   O O    . ASP A 1 24 ? 1.637   -3.510  4.197   1.00 0.00 ? 24 ASP A O    1  
ATOM 357   C CB   . ASP A 1 24 ? -1.558  -3.627  3.468   1.00 0.00 ? 24 ASP A CB   1  
ATOM 358   C CG   . ASP A 1 24 ? -1.444  -4.058  4.917   1.00 0.00 ? 24 ASP A CG   1  
ATOM 359   O OD1  . ASP A 1 24 ? -1.301  -3.176  5.790   1.00 0.00 ? 24 ASP A OD1  1  
ATOM 360   O OD2  . ASP A 1 24 ? -1.499  -5.278  5.179   1.00 0.00 ? 24 ASP A OD2  1  
ATOM 361   H H    . ASP A 1 24 ? -1.241  -2.823  1.081   1.00 0.00 ? 24 ASP A H    1  
ATOM 362   H HA   . ASP A 1 24 ? -0.251  -1.937  3.572   1.00 0.00 ? 24 ASP A HA   1  
ATOM 363   H HB2  . ASP A 1 24 ? -2.436  -3.006  3.366   1.00 0.00 ? 24 ASP A HB2  1  
ATOM 364   H HB3  . ASP A 1 24 ? -1.673  -4.509  2.857   1.00 0.00 ? 24 ASP A HB3  1  
ATOM 365   N N    . PHE A 1 25 ? 1.205   -4.572  2.261   1.00 0.00 ? 25 PHE A N    1  
ATOM 366   C CA   . PHE A 1 25 ? 2.380   -5.431  2.344   1.00 0.00 ? 25 PHE A CA   1  
ATOM 367   C C    . PHE A 1 25 ? 3.658   -4.628  2.117   1.00 0.00 ? 25 PHE A C    1  
ATOM 368   O O    . PHE A 1 25 ? 4.723   -4.978  2.625   1.00 0.00 ? 25 PHE A O    1  
ATOM 369   C CB   . PHE A 1 25 ? 2.286   -6.561  1.316   1.00 0.00 ? 25 PHE A CB   1  
ATOM 370   C CG   . PHE A 1 25 ? 3.267   -7.672  1.555   1.00 0.00 ? 25 PHE A CG   1  
ATOM 371   C CD1  . PHE A 1 25 ? 4.625   -7.468  1.371   1.00 0.00 ? 25 PHE A CD1  1  
ATOM 372   C CD2  . PHE A 1 25 ? 2.831   -8.922  1.965   1.00 0.00 ? 25 PHE A CD2  1  
ATOM 373   C CE1  . PHE A 1 25 ? 5.530   -8.489  1.590   1.00 0.00 ? 25 PHE A CE1  1  
ATOM 374   C CE2  . PHE A 1 25 ? 3.732   -9.947  2.186   1.00 0.00 ? 25 PHE A CE2  1  
ATOM 375   C CZ   . PHE A 1 25 ? 5.083   -9.730  1.998   1.00 0.00 ? 25 PHE A CZ   1  
ATOM 376   H H    . PHE A 1 25 ? 0.603   -4.657  1.492   1.00 0.00 ? 25 PHE A H    1  
ATOM 377   H HA   . PHE A 1 25 ? 2.409   -5.858  3.334   1.00 0.00 ? 25 PHE A HA   1  
ATOM 378   H HB2  . PHE A 1 25 ? 1.293   -6.983  1.346   1.00 0.00 ? 25 PHE A HB2  1  
ATOM 379   H HB3  . PHE A 1 25 ? 2.472   -6.158  0.332   1.00 0.00 ? 25 PHE A HB3  1  
ATOM 380   H HD1  . PHE A 1 25 ? 4.976   -6.496  1.051   1.00 0.00 ? 25 PHE A HD1  1  
ATOM 381   H HD2  . PHE A 1 25 ? 1.775   -9.094  2.112   1.00 0.00 ? 25 PHE A HD2  1  
ATOM 382   H HE1  . PHE A 1 25 ? 6.586   -8.315  1.442   1.00 0.00 ? 25 PHE A HE1  1  
ATOM 383   H HE2  . PHE A 1 25 ? 3.380   -10.917 2.505   1.00 0.00 ? 25 PHE A HE2  1  
ATOM 384   H HZ   . PHE A 1 25 ? 5.789   -10.529 2.171   1.00 0.00 ? 25 PHE A HZ   1  
ATOM 385   N N    . PHE A 1 26 ? 3.543   -3.549  1.350   1.00 0.00 ? 26 PHE A N    1  
ATOM 386   C CA   . PHE A 1 26 ? 4.688   -2.696  1.054   1.00 0.00 ? 26 PHE A CA   1  
ATOM 387   C C    . PHE A 1 26 ? 5.059   -1.844  2.264   1.00 0.00 ? 26 PHE A C    1  
ATOM 388   O O    . PHE A 1 26 ? 6.227   -1.759  2.643   1.00 0.00 ? 26 PHE A O    1  
ATOM 389   C CB   . PHE A 1 26 ? 4.384   -1.795  -0.144  1.00 0.00 ? 26 PHE A CB   1  
ATOM 390   C CG   . PHE A 1 26 ? 5.497   -0.843  -0.477  1.00 0.00 ? 26 PHE A CG   1  
ATOM 391   C CD1  . PHE A 1 26 ? 5.714   0.287   0.294   1.00 0.00 ? 26 PHE A CD1  1  
ATOM 392   C CD2  . PHE A 1 26 ? 6.327   -1.080  -1.561  1.00 0.00 ? 26 PHE A CD2  1  
ATOM 393   C CE1  . PHE A 1 26 ? 6.737   1.165   -0.011  1.00 0.00 ? 26 PHE A CE1  1  
ATOM 394   C CE2  . PHE A 1 26 ? 7.353   -0.206  -1.870  1.00 0.00 ? 26 PHE A CE2  1  
ATOM 395   C CZ   . PHE A 1 26 ? 7.558   0.917   -1.093  1.00 0.00 ? 26 PHE A CZ   1  
ATOM 396   H H    . PHE A 1 26 ? 2.667   -3.321  0.973   1.00 0.00 ? 26 PHE A H    1  
ATOM 397   H HA   . PHE A 1 26 ? 5.522   -3.335  0.810   1.00 0.00 ? 26 PHE A HA   1  
ATOM 398   H HB2  . PHE A 1 26 ? 4.204   -2.411  -1.013  1.00 0.00 ? 26 PHE A HB2  1  
ATOM 399   H HB3  . PHE A 1 26 ? 3.500   -1.212  0.068   1.00 0.00 ? 26 PHE A HB3  1  
ATOM 400   H HD1  . PHE A 1 26 ? 5.073   0.482   1.141   1.00 0.00 ? 26 PHE A HD1  1  
ATOM 401   H HD2  . PHE A 1 26 ? 6.168   -1.959  -2.169  1.00 0.00 ? 26 PHE A HD2  1  
ATOM 402   H HE1  . PHE A 1 26 ? 6.896   2.042   0.598   1.00 0.00 ? 26 PHE A HE1  1  
ATOM 403   H HE2  . PHE A 1 26 ? 7.993   -0.403  -2.717  1.00 0.00 ? 26 PHE A HE2  1  
ATOM 404   H HZ   . PHE A 1 26 ? 8.358   1.602   -1.334  1.00 0.00 ? 26 PHE A HZ   1  
ATOM 405   N N    . ASP A 1 27 ? 4.056   -1.214  2.866   1.00 0.00 ? 27 ASP A N    1  
ATOM 406   C CA   . ASP A 1 27 ? 4.275   -0.368  4.034   1.00 0.00 ? 27 ASP A CA   1  
ATOM 407   C C    . ASP A 1 27 ? 5.015   -1.133  5.127   1.00 0.00 ? 27 ASP A C    1  
ATOM 408   O O    . ASP A 1 27 ? 5.761   -0.547  5.911   1.00 0.00 ? 27 ASP A O    1  
ATOM 409   C CB   . ASP A 1 27 ? 2.941   0.151   4.572   1.00 0.00 ? 27 ASP A CB   1  
ATOM 410   C CG   . ASP A 1 27 ? 3.112   1.344   5.491   1.00 0.00 ? 27 ASP A CG   1  
ATOM 411   O OD1  . ASP A 1 27 ? 3.969   1.277   6.396   1.00 0.00 ? 27 ASP A OD1  1  
ATOM 412   O OD2  . ASP A 1 27 ? 2.388   2.345   5.306   1.00 0.00 ? 27 ASP A OD2  1  
ATOM 413   H H    . ASP A 1 27 ? 3.146   -1.321  2.517   1.00 0.00 ? 27 ASP A H    1  
ATOM 414   H HA   . ASP A 1 27 ? 4.880   0.471   3.727   1.00 0.00 ? 27 ASP A HA   1  
ATOM 415   H HB2  . ASP A 1 27 ? 2.316   0.447   3.741   1.00 0.00 ? 27 ASP A HB2  1  
ATOM 416   H HB3  . ASP A 1 27 ? 2.450   -0.638  5.122   1.00 0.00 ? 27 ASP A HB3  1  
ATOM 417   N N    . ALA A 1 28 ? 4.802   -2.444  5.174   1.00 0.00 ? 28 ALA A N    1  
ATOM 418   C CA   . ALA A 1 28 ? 5.450   -3.288  6.170   1.00 0.00 ? 28 ALA A CA   1  
ATOM 419   C C    . ALA A 1 28 ? 6.722   -3.917  5.613   1.00 0.00 ? 28 ALA A C    1  
ATOM 420   O O    . ALA A 1 28 ? 7.738   -3.998  6.302   1.00 0.00 ? 28 ALA A O    1  
ATOM 421   C CB   . ALA A 1 28 ? 4.491   -4.368  6.649   1.00 0.00 ? 28 ALA A CB   1  
ATOM 422   H H    . ALA A 1 28 ? 4.196   -2.853  4.521   1.00 0.00 ? 28 ALA A H    1  
ATOM 423   H HA   . ALA A 1 28 ? 5.707   -2.668  7.016   1.00 0.00 ? 28 ALA A HA   1  
ATOM 424   H HB1  . ALA A 1 28 ? 4.233   -5.012  5.821   1.00 0.00 ? 28 ALA A HB1  1  
ATOM 425   H HB2  . ALA A 1 28 ? 4.965   -4.951  7.425   1.00 0.00 ? 28 ALA A HB2  1  
ATOM 426   H HB3  . ALA A 1 28 ? 3.596   -3.907  7.040   1.00 0.00 ? 28 ALA A HB3  1  
ATOM 427   N N    . ASN A 1 29 ? 6.659   -4.362  4.362   1.00 0.00 ? 29 ASN A N    1  
ATOM 428   C CA   . ASN A 1 29 ? 7.807   -4.985  3.713   1.00 0.00 ? 29 ASN A CA   1  
ATOM 429   C C    . ASN A 1 29 ? 7.820   -4.678  2.219   1.00 0.00 ? 29 ASN A C    1  
ATOM 430   O O    . ASN A 1 29 ? 6.846   -4.938  1.513   1.00 0.00 ? 29 ASN A O    1  
ATOM 431   C CB   . ASN A 1 29 ? 7.784   -6.499  3.935   1.00 0.00 ? 29 ASN A CB   1  
ATOM 432   C CG   . ASN A 1 29 ? 9.083   -7.163  3.519   1.00 0.00 ? 29 ASN A CG   1  
ATOM 433   O OD1  . ASN A 1 29 ? 10.169  -6.658  3.802   1.00 0.00 ? 29 ASN A OD1  1  
ATOM 434   N ND2  . ASN A 1 29 ? 8.975   -8.301  2.844   1.00 0.00 ? 29 ASN A ND2  1  
ATOM 435   H H    . ASN A 1 29 ? 5.820   -4.269  3.863   1.00 0.00 ? 29 ASN A H    1  
ATOM 436   H HA   . ASN A 1 29 ? 8.701   -4.578  4.160   1.00 0.00 ? 29 ASN A HA   1  
ATOM 437   H HB2  . ASN A 1 29 ? 7.618   -6.701  4.983   1.00 0.00 ? 29 ASN A HB2  1  
ATOM 438   H HB3  . ASN A 1 29 ? 6.980   -6.929  3.357   1.00 0.00 ? 29 ASN A HB3  1  
ATOM 439   H HD21 . ASN A 1 29 ? 8.077   -8.644  2.654   1.00 0.00 ? 29 ASN A HD21 1  
ATOM 440   H HD22 . ASN A 1 29 ? 9.799   -8.752  2.564   1.00 0.00 ? 29 ASN A HD22 1  
ATOM 441   N N    . ALA A 1 30 ? 8.930   -4.124  1.744   1.00 0.00 ? 30 ALA A N    1  
ATOM 442   C CA   . ALA A 1 30 ? 9.072   -3.785  0.333   1.00 0.00 ? 30 ALA A CA   1  
ATOM 443   C C    . ALA A 1 30 ? 10.248  -4.525  -0.294  1.00 0.00 ? 30 ALA A C    1  
ATOM 444   O O    . ALA A 1 30 ? 10.650  -4.230  -1.420  1.00 0.00 ? 30 ALA A O    1  
ATOM 445   C CB   . ALA A 1 30 ? 9.242   -2.282  0.167   1.00 0.00 ? 30 ALA A CB   1  
ATOM 446   H H    . ALA A 1 30 ? 9.673   -3.941  2.356   1.00 0.00 ? 30 ALA A H    1  
ATOM 447   H HA   . ALA A 1 30 ? 8.163   -4.078  -0.173  1.00 0.00 ? 30 ALA A HA   1  
ATOM 448   H HB1  . ALA A 1 30 ? 9.853   -2.084  -0.701  1.00 0.00 ? 30 ALA A HB1  1  
ATOM 449   H HB2  . ALA A 1 30 ? 8.273   -1.822  0.038   1.00 0.00 ? 30 ALA A HB2  1  
ATOM 450   H HB3  . ALA A 1 30 ? 9.720   -1.874  1.045   1.00 0.00 ? 30 ALA A HB3  1  
ATOM 451   N N    . TYR A 1 31 ? 10.796  -5.486  0.441   1.00 0.00 ? 31 TYR A N    1  
ATOM 452   C CA   . TYR A 1 31 ? 11.929  -6.266  -0.043  1.00 0.00 ? 31 TYR A CA   1  
ATOM 453   C C    . TYR A 1 31 ? 11.719  -7.753  0.222   1.00 0.00 ? 31 TYR A C    1  
ATOM 454   O O    . TYR A 1 31 ? 12.632  -8.473  0.629   1.00 0.00 ? 31 TYR A O    1  
ATOM 455   C CB   . TYR A 1 31 ? 13.222  -5.795  0.624   1.00 0.00 ? 31 TYR A CB   1  
ATOM 456   C CG   . TYR A 1 31 ? 13.287  -4.298  0.830   1.00 0.00 ? 31 TYR A CG   1  
ATOM 457   C CD1  . TYR A 1 31 ? 13.175  -3.424  -0.245  1.00 0.00 ? 31 TYR A CD1  1  
ATOM 458   C CD2  . TYR A 1 31 ? 13.460  -3.758  2.098   1.00 0.00 ? 31 TYR A CD2  1  
ATOM 459   C CE1  . TYR A 1 31 ? 13.234  -2.056  -0.062  1.00 0.00 ? 31 TYR A CE1  1  
ATOM 460   C CE2  . TYR A 1 31 ? 13.519  -2.391  2.291   1.00 0.00 ? 31 TYR A CE2  1  
ATOM 461   C CZ   . TYR A 1 31 ? 13.406  -1.545  1.208   1.00 0.00 ? 31 TYR A CZ   1  
ATOM 462   O OH   . TYR A 1 31 ? 13.465  -0.183  1.395   1.00 0.00 ? 31 TYR A OH   1  
ATOM 463   H H    . TYR A 1 31 ? 10.432  -5.674  1.330   1.00 0.00 ? 31 TYR A H    1  
ATOM 464   H HA   . TYR A 1 31 ? 12.008  -6.110  -1.109  1.00 0.00 ? 31 TYR A HA   1  
ATOM 465   H HB2  . TYR A 1 31 ? 13.313  -6.266  1.591   1.00 0.00 ? 31 TYR A HB2  1  
ATOM 466   H HB3  . TYR A 1 31 ? 14.062  -6.082  0.009   1.00 0.00 ? 31 TYR A HB3  1  
ATOM 467   H HD1  . TYR A 1 31 ? 13.041  -3.828  -1.238  1.00 0.00 ? 31 TYR A HD1  1  
ATOM 468   H HD2  . TYR A 1 31 ? 13.549  -4.424  2.944   1.00 0.00 ? 31 TYR A HD2  1  
ATOM 469   H HE1  . TYR A 1 31 ? 13.145  -1.392  -0.909  1.00 0.00 ? 31 TYR A HE1  1  
ATOM 470   H HE2  . TYR A 1 31 ? 13.654  -1.991  3.284   1.00 0.00 ? 31 TYR A HE2  1  
ATOM 471   H HH   . TYR A 1 31 ? 13.969  0.009   2.190   1.00 0.00 ? 31 TYR A HH   1  
ATOM 472   N N    . PRO A 1 32 ? 10.487  -8.227  -0.013  1.00 0.00 ? 32 PRO A N    1  
ATOM 473   C CA   . PRO A 1 32 ? 10.127  -9.633  0.192   1.00 0.00 ? 32 PRO A CA   1  
ATOM 474   C C    . PRO A 1 32 ? 10.783  -10.555 -0.830  1.00 0.00 ? 32 PRO A C    1  
ATOM 475   O O    . PRO A 1 32 ? 11.242  -10.107 -1.881  1.00 0.00 ? 32 PRO A O    1  
ATOM 476   C CB   . PRO A 1 32 ? 8.606   -9.639  0.019   1.00 0.00 ? 32 PRO A CB   1  
ATOM 477   C CG   . PRO A 1 32 ? 8.319   -8.464  -0.851  1.00 0.00 ? 32 PRO A CG   1  
ATOM 478   C CD   . PRO A 1 32 ? 9.350   -7.427  -0.499  1.00 0.00 ? 32 PRO A CD   1  
ATOM 479   H HA   . PRO A 1 32 ? 10.378  -9.966  1.189   1.00 0.00 ? 32 PRO A HA   1  
ATOM 480   H HB2  . PRO A 1 32 ? 8.298   -10.563 -0.450  1.00 0.00 ? 32 PRO A HB2  1  
ATOM 481   H HB3  . PRO A 1 32 ? 8.129   -9.542  0.982   1.00 0.00 ? 32 PRO A HB3  1  
ATOM 482   H HG2  . PRO A 1 32 ? 8.410   -8.745  -1.889  1.00 0.00 ? 32 PRO A HG2  1  
ATOM 483   H HG3  . PRO A 1 32 ? 7.327   -8.090  -0.647  1.00 0.00 ? 32 PRO A HG3  1  
ATOM 484   H HD2  . PRO A 1 32 ? 9.626   -6.857  -1.374  1.00 0.00 ? 32 PRO A HD2  1  
ATOM 485   H HD3  . PRO A 1 32 ? 8.979   -6.775  0.278   1.00 0.00 ? 32 PRO A HD3  1  
ATOM 486   N N    . LYS A 1 33 ? 10.824  -11.846 -0.516  1.00 0.00 ? 33 LYS A N    1  
ATOM 487   C CA   . LYS A 1 33 ? 11.422  -12.832 -1.407  1.00 0.00 ? 33 LYS A CA   1  
ATOM 488   C C    . LYS A 1 33 ? 10.349  -13.570 -2.201  1.00 0.00 ? 33 LYS A C    1  
ATOM 489   O O    . LYS A 1 33 ? 9.158   -13.451 -1.912  1.00 0.00 ? 33 LYS A O    1  
ATOM 490   C CB   . LYS A 1 33 ? 12.258  -13.833 -0.606  1.00 0.00 ? 33 LYS A CB   1  
ATOM 491   C CG   . LYS A 1 33 ? 13.371  -13.187 0.201   1.00 0.00 ? 33 LYS A CG   1  
ATOM 492   C CD   . LYS A 1 33 ? 14.493  -14.170 0.490   1.00 0.00 ? 33 LYS A CD   1  
ATOM 493   C CE   . LYS A 1 33 ? 14.226  -14.963 1.761   1.00 0.00 ? 33 LYS A CE   1  
ATOM 494   N NZ   . LYS A 1 33 ? 13.274  -16.084 1.525   1.00 0.00 ? 33 LYS A NZ   1  
ATOM 495   H H    . LYS A 1 33 ? 10.441  -12.142 0.337   1.00 0.00 ? 33 LYS A H    1  
ATOM 496   H HA   . LYS A 1 33 ? 12.066  -12.308 -2.097  1.00 0.00 ? 33 LYS A HA   1  
ATOM 497   H HB2  . LYS A 1 33 ? 11.608  -14.363 0.074   1.00 0.00 ? 33 LYS A HB2  1  
ATOM 498   H HB3  . LYS A 1 33 ? 12.703  -14.541 -1.291  1.00 0.00 ? 33 LYS A HB3  1  
ATOM 499   H HG2  . LYS A 1 33 ? 13.771  -12.354 -0.357  1.00 0.00 ? 33 LYS A HG2  1  
ATOM 500   H HG3  . LYS A 1 33 ? 12.964  -12.833 1.138   1.00 0.00 ? 33 LYS A HG3  1  
ATOM 501   H HD2  . LYS A 1 33 ? 14.579  -14.858 -0.338  1.00 0.00 ? 33 LYS A HD2  1  
ATOM 502   H HD3  . LYS A 1 33 ? 15.418  -13.623 0.605   1.00 0.00 ? 33 LYS A HD3  1  
ATOM 503   H HE2  . LYS A 1 33 ? 15.160  -15.365 2.121   1.00 0.00 ? 33 LYS A HE2  1  
ATOM 504   H HE3  . LYS A 1 33 ? 13.810  -14.298 2.503   1.00 0.00 ? 33 LYS A HE3  1  
ATOM 505   H HZ1  . LYS A 1 33 ? 12.704  -16.253 2.379   1.00 0.00 ? 33 LYS A HZ1  1  
ATOM 506   H HZ2  . LYS A 1 33 ? 13.796  -16.953 1.293   1.00 0.00 ? 33 LYS A HZ2  1  
ATOM 507   H HZ3  . LYS A 1 33 ? 12.637  -15.852 0.737   1.00 0.00 ? 33 LYS A HZ3  1  
ATOM 508   N N    . ASP A 1 34 ? 10.778  -14.333 -3.200  1.00 0.00 ? 34 ASP A N    1  
ATOM 509   C CA   . ASP A 1 34 ? 9.853   -15.093 -4.034  1.00 0.00 ? 34 ASP A CA   1  
ATOM 510   C C    . ASP A 1 34 ? 8.774   -15.756 -3.183  1.00 0.00 ? 34 ASP A C    1  
ATOM 511   O O    . ASP A 1 34 ? 7.581   -15.588 -3.435  1.00 0.00 ? 34 ASP A O    1  
ATOM 512   C CB   . ASP A 1 34 ? 10.610  -16.153 -4.836  1.00 0.00 ? 34 ASP A CB   1  
ATOM 513   C CG   . ASP A 1 34 ? 9.679   -17.087 -5.583  1.00 0.00 ? 34 ASP A CG   1  
ATOM 514   O OD1  . ASP A 1 34 ? 9.335   -16.780 -6.744  1.00 0.00 ? 34 ASP A OD1  1  
ATOM 515   O OD2  . ASP A 1 34 ? 9.294   -18.126 -5.008  1.00 0.00 ? 34 ASP A OD2  1  
ATOM 516   H H    . ASP A 1 34 ? 11.740  -14.387 -3.381  1.00 0.00 ? 34 ASP A H    1  
ATOM 517   H HA   . ASP A 1 34 ? 9.382   -14.405 -4.719  1.00 0.00 ? 34 ASP A HA   1  
ATOM 518   H HB2  . ASP A 1 34 ? 11.250  -15.662 -5.555  1.00 0.00 ? 34 ASP A HB2  1  
ATOM 519   H HB3  . ASP A 1 34 ? 11.216  -16.740 -4.163  1.00 0.00 ? 34 ASP A HB3  1  
ATOM 520   N N    . ASP A 1 35 ? 9.202   -16.510 -2.177  1.00 0.00 ? 35 ASP A N    1  
ATOM 521   C CA   . ASP A 1 35 ? 8.272   -17.198 -1.289  1.00 0.00 ? 35 ASP A CA   1  
ATOM 522   C C    . ASP A 1 35 ? 7.173   -16.253 -0.814  1.00 0.00 ? 35 ASP A C    1  
ATOM 523   O O    . ASP A 1 35 ? 5.989   -16.584 -0.873  1.00 0.00 ? 35 ASP A O    1  
ATOM 524   C CB   . ASP A 1 35 ? 9.017   -17.778 -0.085  1.00 0.00 ? 35 ASP A CB   1  
ATOM 525   C CG   . ASP A 1 35 ? 8.346   -19.020 0.468   1.00 0.00 ? 35 ASP A CG   1  
ATOM 526   O OD1  . ASP A 1 35 ? 8.530   -20.106 -0.120  1.00 0.00 ? 35 ASP A OD1  1  
ATOM 527   O OD2  . ASP A 1 35 ? 7.637   -18.905 1.489   1.00 0.00 ? 35 ASP A OD2  1  
ATOM 528   H H    . ASP A 1 35 ? 10.166  -16.605 -2.027  1.00 0.00 ? 35 ASP A H    1  
ATOM 529   H HA   . ASP A 1 35 ? 7.820   -18.006 -1.844  1.00 0.00 ? 35 ASP A HA   1  
ATOM 530   H HB2  . ASP A 1 35 ? 10.023  -18.038 -0.384  1.00 0.00 ? 35 ASP A HB2  1  
ATOM 531   H HB3  . ASP A 1 35 ? 9.059   -17.034 0.696   1.00 0.00 ? 35 ASP A HB3  1  
ATOM 532   N N    . GLU A 1 36 ? 7.573   -15.076 -0.344  1.00 0.00 ? 36 GLU A N    1  
ATOM 533   C CA   . GLU A 1 36 ? 6.621   -14.084 0.142   1.00 0.00 ? 36 GLU A CA   1  
ATOM 534   C C    . GLU A 1 36 ? 5.718   -13.598 -0.987  1.00 0.00 ? 36 GLU A C    1  
ATOM 535   O O    . GLU A 1 36 ? 4.493   -13.614 -0.868  1.00 0.00 ? 36 GLU A O    1  
ATOM 536   C CB   . GLU A 1 36 ? 7.360   -12.898 0.766   1.00 0.00 ? 36 GLU A CB   1  
ATOM 537   C CG   . GLU A 1 36 ? 8.162   -13.263 2.004   1.00 0.00 ? 36 GLU A CG   1  
ATOM 538   C CD   . GLU A 1 36 ? 7.290   -13.781 3.132   1.00 0.00 ? 36 GLU A CD   1  
ATOM 539   O OE1  . GLU A 1 36 ? 6.119   -13.356 3.218   1.00 0.00 ? 36 GLU A OE1  1  
ATOM 540   O OE2  . GLU A 1 36 ? 7.779   -14.610 3.928   1.00 0.00 ? 36 GLU A OE2  1  
ATOM 541   H H    . GLU A 1 36 ? 8.531   -14.870 -0.323  1.00 0.00 ? 36 GLU A H    1  
ATOM 542   H HA   . GLU A 1 36 ? 6.010   -14.553 0.898   1.00 0.00 ? 36 GLU A HA   1  
ATOM 543   H HB2  . GLU A 1 36 ? 8.037   -12.485 0.032   1.00 0.00 ? 36 GLU A HB2  1  
ATOM 544   H HB3  . GLU A 1 36 ? 6.638   -12.144 1.041   1.00 0.00 ? 36 GLU A HB3  1  
ATOM 545   H HG2  . GLU A 1 36 ? 8.876   -14.029 1.742   1.00 0.00 ? 36 GLU A HG2  1  
ATOM 546   H HG3  . GLU A 1 36 ? 8.688   -12.385 2.349   1.00 0.00 ? 36 GLU A HG3  1  
ATOM 547   N N    . PHE A 1 37 ? 6.332   -13.164 -2.083  1.00 0.00 ? 37 PHE A N    1  
ATOM 548   C CA   . PHE A 1 37 ? 5.585   -12.671 -3.234  1.00 0.00 ? 37 PHE A CA   1  
ATOM 549   C C    . PHE A 1 37 ? 4.450   -13.625 -3.595  1.00 0.00 ? 37 PHE A C    1  
ATOM 550   O O    . PHE A 1 37 ? 3.362   -13.195 -3.977  1.00 0.00 ? 37 PHE A O    1  
ATOM 551   C CB   . PHE A 1 37 ? 6.516   -12.492 -4.435  1.00 0.00 ? 37 PHE A CB   1  
ATOM 552   C CG   . PHE A 1 37 ? 7.130   -11.123 -4.518  1.00 0.00 ? 37 PHE A CG   1  
ATOM 553   C CD1  . PHE A 1 37 ? 6.473   -10.094 -5.174  1.00 0.00 ? 37 PHE A CD1  1  
ATOM 554   C CD2  . PHE A 1 37 ? 8.362   -10.866 -3.940  1.00 0.00 ? 37 PHE A CD2  1  
ATOM 555   C CE1  . PHE A 1 37 ? 7.036   -8.834  -5.253  1.00 0.00 ? 37 PHE A CE1  1  
ATOM 556   C CE2  . PHE A 1 37 ? 8.930   -9.608  -4.016  1.00 0.00 ? 37 PHE A CE2  1  
ATOM 557   C CZ   . PHE A 1 37 ? 8.265   -8.591  -4.672  1.00 0.00 ? 37 PHE A CZ   1  
ATOM 558   H H    . PHE A 1 37 ? 7.312   -13.176 -2.118  1.00 0.00 ? 37 PHE A H    1  
ATOM 559   H HA   . PHE A 1 37 ? 5.164   -11.714 -2.970  1.00 0.00 ? 37 PHE A HA   1  
ATOM 560   H HB2  . PHE A 1 37 ? 7.318   -13.211 -4.370  1.00 0.00 ? 37 PHE A HB2  1  
ATOM 561   H HB3  . PHE A 1 37 ? 5.957   -12.662 -5.343  1.00 0.00 ? 37 PHE A HB3  1  
ATOM 562   H HD1  . PHE A 1 37 ? 5.512   -10.283 -5.628  1.00 0.00 ? 37 PHE A HD1  1  
ATOM 563   H HD2  . PHE A 1 37 ? 8.883   -11.662 -3.426  1.00 0.00 ? 37 PHE A HD2  1  
ATOM 564   H HE1  . PHE A 1 37 ? 6.515   -8.041  -5.767  1.00 0.00 ? 37 PHE A HE1  1  
ATOM 565   H HE2  . PHE A 1 37 ? 9.891   -9.421  -3.560  1.00 0.00 ? 37 PHE A HE2  1  
ATOM 566   H HZ   . PHE A 1 37 ? 8.707   -7.607  -4.732  1.00 0.00 ? 37 PHE A HZ   1  
ATOM 567   N N    . GLU A 1 38 ? 4.713   -14.922 -3.471  1.00 0.00 ? 38 GLU A N    1  
ATOM 568   C CA   . GLU A 1 38 ? 3.714   -15.937 -3.785  1.00 0.00 ? 38 GLU A CA   1  
ATOM 569   C C    . GLU A 1 38 ? 2.467   -15.758 -2.923  1.00 0.00 ? 38 GLU A C    1  
ATOM 570   O O    . GLU A 1 38 ? 1.344   -15.915 -3.400  1.00 0.00 ? 38 GLU A O    1  
ATOM 571   C CB   . GLU A 1 38 ? 4.294   -17.337 -3.577  1.00 0.00 ? 38 GLU A CB   1  
ATOM 572   C CG   . GLU A 1 38 ? 5.102   -17.843 -4.761  1.00 0.00 ? 38 GLU A CG   1  
ATOM 573   C CD   . GLU A 1 38 ? 4.238   -18.512 -5.813  1.00 0.00 ? 38 GLU A CD   1  
ATOM 574   O OE1  . GLU A 1 38 ? 3.414   -19.374 -5.445  1.00 0.00 ? 38 GLU A OE1  1  
ATOM 575   O OE2  . GLU A 1 38 ? 4.387   -18.171 -7.005  1.00 0.00 ? 38 GLU A OE2  1  
ATOM 576   H H    . GLU A 1 38 ? 5.599   -15.203 -3.161  1.00 0.00 ? 38 GLU A H    1  
ATOM 577   H HA   . GLU A 1 38 ? 3.439   -15.822 -4.822  1.00 0.00 ? 38 GLU A HA   1  
ATOM 578   H HB2  . GLU A 1 38 ? 4.937   -17.323 -2.709  1.00 0.00 ? 38 GLU A HB2  1  
ATOM 579   H HB3  . GLU A 1 38 ? 3.482   -18.028 -3.401  1.00 0.00 ? 38 GLU A HB3  1  
ATOM 580   H HG2  . GLU A 1 38 ? 5.613   -17.008 -5.215  1.00 0.00 ? 38 GLU A HG2  1  
ATOM 581   H HG3  . GLU A 1 38 ? 5.828   -18.559 -4.405  1.00 0.00 ? 38 GLU A HG3  1  
ATOM 582   N N    . GLN A 1 39 ? 2.675   -15.431 -1.652  1.00 0.00 ? 39 GLN A N    1  
ATOM 583   C CA   . GLN A 1 39 ? 1.569   -15.232 -0.724  1.00 0.00 ? 39 GLN A CA   1  
ATOM 584   C C    . GLN A 1 39 ? 0.565   -14.228 -1.280  1.00 0.00 ? 39 GLN A C    1  
ATOM 585   O O    . GLN A 1 39 ? -0.647  -14.428 -1.184  1.00 0.00 ? 39 GLN A O    1  
ATOM 586   C CB   . GLN A 1 39 ? 2.092   -14.752 0.631   1.00 0.00 ? 39 GLN A CB   1  
ATOM 587   C CG   . GLN A 1 39 ? 3.101   -15.696 1.263   1.00 0.00 ? 39 GLN A CG   1  
ATOM 588   C CD   . GLN A 1 39 ? 2.445   -16.879 1.947   1.00 0.00 ? 39 GLN A CD   1  
ATOM 589   O OE1  . GLN A 1 39 ? 1.337   -17.280 1.591   1.00 0.00 ? 39 GLN A OE1  1  
ATOM 590   N NE2  . GLN A 1 39 ? 3.128   -17.446 2.935   1.00 0.00 ? 39 GLN A NE2  1  
ATOM 591   H H    . GLN A 1 39 ? 3.594   -15.321 -1.331  1.00 0.00 ? 39 GLN A H    1  
ATOM 592   H HA   . GLN A 1 39 ? 1.073   -16.182 -0.591  1.00 0.00 ? 39 GLN A HA   1  
ATOM 593   H HB2  . GLN A 1 39 ? 2.564   -13.789 0.501   1.00 0.00 ? 39 GLN A HB2  1  
ATOM 594   H HB3  . GLN A 1 39 ? 1.257   -14.646 1.309   1.00 0.00 ? 39 GLN A HB3  1  
ATOM 595   H HG2  . GLN A 1 39 ? 3.761   -16.066 0.493   1.00 0.00 ? 39 GLN A HG2  1  
ATOM 596   H HG3  . GLN A 1 39 ? 3.677   -15.149 1.996   1.00 0.00 ? 39 GLN A HG3  1  
ATOM 597   H HE21 . GLN A 1 39 ? 4.004   -17.072 3.165   1.00 0.00 ? 39 GLN A HE21 1  
ATOM 598   H HE22 . GLN A 1 39 ? 2.727   -18.212 3.395   1.00 0.00 ? 39 GLN A HE22 1  
ATOM 599   N N    . LEU A 1 40 ? 1.076   -13.148 -1.861  1.00 0.00 ? 40 LEU A N    1  
ATOM 600   C CA   . LEU A 1 40 ? 0.224   -12.111 -2.433  1.00 0.00 ? 40 LEU A CA   1  
ATOM 601   C C    . LEU A 1 40 ? -0.392  -12.577 -3.748  1.00 0.00 ? 40 LEU A C    1  
ATOM 602   O O    . LEU A 1 40 ? -1.556  -12.297 -4.033  1.00 0.00 ? 40 LEU A O    1  
ATOM 603   C CB   . LEU A 1 40 ? 1.028   -10.830 -2.658  1.00 0.00 ? 40 LEU A CB   1  
ATOM 604   C CG   . LEU A 1 40 ? 1.594   -10.163 -1.404  1.00 0.00 ? 40 LEU A CG   1  
ATOM 605   C CD1  . LEU A 1 40 ? 2.864   -9.395  -1.734  1.00 0.00 ? 40 LEU A CD1  1  
ATOM 606   C CD2  . LEU A 1 40 ? 0.558   -9.240  -0.778  1.00 0.00 ? 40 LEU A CD2  1  
ATOM 607   H H    . LEU A 1 40 ? 2.049   -13.045 -1.906  1.00 0.00 ? 40 LEU A H    1  
ATOM 608   H HA   . LEU A 1 40 ? -0.570  -11.909 -1.729  1.00 0.00 ? 40 LEU A HA   1  
ATOM 609   H HB2  . LEU A 1 40 ? 1.857   -11.069 -3.307  1.00 0.00 ? 40 LEU A HB2  1  
ATOM 610   H HB3  . LEU A 1 40 ? 0.382   -10.117 -3.151  1.00 0.00 ? 40 LEU A HB3  1  
ATOM 611   H HG   . LEU A 1 40 ? 1.844   -10.926 -0.680  1.00 0.00 ? 40 LEU A HG   1  
ATOM 612   H HD11 . LEU A 1 40 ? 2.877   -8.466  -1.184  1.00 0.00 ? 40 LEU A HD11 1  
ATOM 613   H HD12 . LEU A 1 40 ? 2.894   -9.187  -2.793  1.00 0.00 ? 40 LEU A HD12 1  
ATOM 614   H HD13 . LEU A 1 40 ? 3.725   -9.988  -1.461  1.00 0.00 ? 40 LEU A HD13 1  
ATOM 615   H HD21 . LEU A 1 40 ? 0.534   -8.306  -1.321  1.00 0.00 ? 40 LEU A HD21 1  
ATOM 616   H HD22 . LEU A 1 40 ? 0.822   -9.049  0.252   1.00 0.00 ? 40 LEU A HD22 1  
ATOM 617   H HD23 . LEU A 1 40 ? -0.414  -9.708  -0.821  1.00 0.00 ? 40 LEU A HD23 1  
ATOM 618   N N    . SER A 1 41 ? 0.397   -13.290 -4.545  1.00 0.00 ? 41 SER A N    1  
ATOM 619   C CA   . SER A 1 41 ? -0.070  -13.794 -5.832  1.00 0.00 ? 41 SER A CA   1  
ATOM 620   C C    . SER A 1 41 ? -1.179  -14.824 -5.641  1.00 0.00 ? 41 SER A C    1  
ATOM 621   O O    . SER A 1 41 ? -2.097  -14.921 -6.455  1.00 0.00 ? 41 SER A O    1  
ATOM 622   C CB   . SER A 1 41 ? 1.090   -14.415 -6.612  1.00 0.00 ? 41 SER A CB   1  
ATOM 623   O OG   . SER A 1 41 ? 0.616   -15.306 -7.607  1.00 0.00 ? 41 SER A OG   1  
ATOM 624   H H    . SER A 1 41 ? 1.316   -13.480 -4.262  1.00 0.00 ? 41 SER A H    1  
ATOM 625   H HA   . SER A 1 41 ? -0.463  -12.958 -6.392  1.00 0.00 ? 41 SER A HA   1  
ATOM 626   H HB2  . SER A 1 41 ? 1.660   -13.632 -7.089  1.00 0.00 ? 41 SER A HB2  1  
ATOM 627   H HB3  . SER A 1 41 ? 1.727   -14.960 -5.930  1.00 0.00 ? 41 SER A HB3  1  
ATOM 628   H HG   . SER A 1 41 ? -0.282  -15.068 -7.848  1.00 0.00 ? 41 SER A HG   1  
ATOM 629   N N    . ASN A 1 42 ? -1.087  -15.591 -4.560  1.00 0.00 ? 42 ASN A N    1  
ATOM 630   C CA   . ASN A 1 42 ? -2.081  -16.615 -4.262  1.00 0.00 ? 42 ASN A CA   1  
ATOM 631   C C    . ASN A 1 42 ? -3.357  -15.989 -3.706  1.00 0.00 ? 42 ASN A C    1  
ATOM 632   O O    . ASN A 1 42 ? -4.461  -16.472 -3.960  1.00 0.00 ? 42 ASN A O    1  
ATOM 633   C CB   . ASN A 1 42 ? -1.519  -17.626 -3.261  1.00 0.00 ? 42 ASN A CB   1  
ATOM 634   C CG   . ASN A 1 42 ? -0.675  -18.693 -3.930  1.00 0.00 ? 42 ASN A CG   1  
ATOM 635   O OD1  . ASN A 1 42 ? -1.201  -19.627 -4.536  1.00 0.00 ? 42 ASN A OD1  1  
ATOM 636   N ND2  . ASN A 1 42 ? 0.642   -18.559 -3.823  1.00 0.00 ? 42 ASN A ND2  1  
ATOM 637   H H    . ASN A 1 42 ? -0.331  -15.466 -3.948  1.00 0.00 ? 42 ASN A H    1  
ATOM 638   H HA   . ASN A 1 42 ? -2.317  -17.126 -5.183  1.00 0.00 ? 42 ASN A HA   1  
ATOM 639   H HB2  . ASN A 1 42 ? -0.903  -17.106 -2.541  1.00 0.00 ? 42 ASN A HB2  1  
ATOM 640   H HB3  . ASN A 1 42 ? -2.336  -18.109 -2.747  1.00 0.00 ? 42 ASN A HB3  1  
ATOM 641   H HD21 . ASN A 1 42 ? 0.991   -17.790 -3.326  1.00 0.00 ? 42 ASN A HD21 1  
ATOM 642   H HD22 . ASN A 1 42 ? 1.212   -19.235 -4.247  1.00 0.00 ? 42 ASN A HD22 1  
ATOM 643   N N    . LEU A 1 43 ? -3.198  -14.910 -2.948  1.00 0.00 ? 43 LEU A N    1  
ATOM 644   C CA   . LEU A 1 43 ? -4.337  -14.216 -2.356  1.00 0.00 ? 43 LEU A CA   1  
ATOM 645   C C    . LEU A 1 43 ? -5.066  -13.377 -3.401  1.00 0.00 ? 43 LEU A C    1  
ATOM 646   O O    . LEU A 1 43 ? -6.259  -13.566 -3.642  1.00 0.00 ? 43 LEU A O    1  
ATOM 647   C CB   . LEU A 1 43 ? -3.873  -13.324 -1.203  1.00 0.00 ? 43 LEU A CB   1  
ATOM 648   C CG   . LEU A 1 43 ? -4.863  -12.255 -0.741  1.00 0.00 ? 43 LEU A CG   1  
ATOM 649   C CD1  . LEU A 1 43 ? -6.136  -12.898 -0.213  1.00 0.00 ? 43 LEU A CD1  1  
ATOM 650   C CD2  . LEU A 1 43 ? -4.232  -11.367 0.322   1.00 0.00 ? 43 LEU A CD2  1  
ATOM 651   H H    . LEU A 1 43 ? -2.294  -14.571 -2.781  1.00 0.00 ? 43 LEU A H    1  
ATOM 652   H HA   . LEU A 1 43 ? -5.016  -14.962 -1.973  1.00 0.00 ? 43 LEU A HA   1  
ATOM 653   H HB2  . LEU A 1 43 ? -3.656  -13.961 -0.359  1.00 0.00 ? 43 LEU A HB2  1  
ATOM 654   H HB3  . LEU A 1 43 ? -2.967  -12.824 -1.516  1.00 0.00 ? 43 LEU A HB3  1  
ATOM 655   H HG   . LEU A 1 43 ? -5.130  -11.632 -1.584  1.00 0.00 ? 43 LEU A HG   1  
ATOM 656   H HD11 . LEU A 1 43 ? -6.593  -13.486 -0.995  1.00 0.00 ? 43 LEU A HD11 1  
ATOM 657   H HD12 . LEU A 1 43 ? -6.822  -12.129 0.107   1.00 0.00 ? 43 LEU A HD12 1  
ATOM 658   H HD13 . LEU A 1 43 ? -5.895  -13.537 0.624   1.00 0.00 ? 43 LEU A HD13 1  
ATOM 659   H HD21 . LEU A 1 43 ? -3.157  -11.391 0.218   1.00 0.00 ? 43 LEU A HD21 1  
ATOM 660   H HD22 . LEU A 1 43 ? -4.507  -11.728 1.302   1.00 0.00 ? 43 LEU A HD22 1  
ATOM 661   H HD23 . LEU A 1 43 ? -4.584  -10.353 0.199   1.00 0.00 ? 43 LEU A HD23 1  
ATOM 662   N N    . LEU A 1 44 ? -4.341  -12.451 -4.020  1.00 0.00 ? 44 LEU A N    1  
ATOM 663   C CA   . LEU A 1 44 ? -4.918  -11.584 -5.041  1.00 0.00 ? 44 LEU A CA   1  
ATOM 664   C C    . LEU A 1 44 ? -5.086  -12.333 -6.359  1.00 0.00 ? 44 LEU A C    1  
ATOM 665   O O    . LEU A 1 44 ? -5.728  -11.841 -7.286  1.00 0.00 ? 44 LEU A O    1  
ATOM 666   C CB   . LEU A 1 44 ? -4.036  -10.352 -5.250  1.00 0.00 ? 44 LEU A CB   1  
ATOM 667   C CG   . LEU A 1 44 ? -3.739  -9.520  -4.003  1.00 0.00 ? 44 LEU A CG   1  
ATOM 668   C CD1  . LEU A 1 44 ? -2.651  -8.497  -4.290  1.00 0.00 ? 44 LEU A CD1  1  
ATOM 669   C CD2  . LEU A 1 44 ? -5.003  -8.831  -3.508  1.00 0.00 ? 44 LEU A CD2  1  
ATOM 670   H H    . LEU A 1 44 ? -3.396  -12.348 -3.785  1.00 0.00 ? 44 LEU A H    1  
ATOM 671   H HA   . LEU A 1 44 ? -5.890  -11.266 -4.695  1.00 0.00 ? 44 LEU A HA   1  
ATOM 672   H HB2  . LEU A 1 44 ? -3.093  -10.686 -5.657  1.00 0.00 ? 44 LEU A HB2  1  
ATOM 673   H HB3  . LEU A 1 44 ? -4.528  -9.711  -5.968  1.00 0.00 ? 44 LEU A HB3  1  
ATOM 674   H HG   . LEU A 1 44 ? -3.384  -10.173 -3.217  1.00 0.00 ? 44 LEU A HG   1  
ATOM 675   H HD11 . LEU A 1 44 ? -2.943  -7.887  -5.131  1.00 0.00 ? 44 LEU A HD11 1  
ATOM 676   H HD12 . LEU A 1 44 ? -1.727  -9.009  -4.519  1.00 0.00 ? 44 LEU A HD12 1  
ATOM 677   H HD13 . LEU A 1 44 ? -2.508  -7.870  -3.421  1.00 0.00 ? 44 LEU A HD13 1  
ATOM 678   H HD21 . LEU A 1 44 ? -5.597  -8.520  -4.354  1.00 0.00 ? 44 LEU A HD21 1  
ATOM 679   H HD22 . LEU A 1 44 ? -4.735  -7.966  -2.919  1.00 0.00 ? 44 LEU A HD22 1  
ATOM 680   H HD23 . LEU A 1 44 ? -5.573  -9.518  -2.901  1.00 0.00 ? 44 LEU A HD23 1  
ATOM 681   N N    . ASN A 1 45 ? -4.506  -13.527 -6.434  1.00 0.00 ? 45 ASN A N    1  
ATOM 682   C CA   . ASN A 1 45 ? -4.593  -14.345 -7.638  1.00 0.00 ? 45 ASN A CA   1  
ATOM 683   C C    . ASN A 1 45 ? -3.920  -13.650 -8.818  1.00 0.00 ? 45 ASN A C    1  
ATOM 684   O O    . ASN A 1 45 ? -4.355  -13.783 -9.962  1.00 0.00 ? 45 ASN A O    1  
ATOM 685   C CB   . ASN A 1 45 ? -6.056  -14.641 -7.974  1.00 0.00 ? 45 ASN A CB   1  
ATOM 686   C CG   . ASN A 1 45 ? -6.554  -15.914 -7.317  1.00 0.00 ? 45 ASN A CG   1  
ATOM 687   O OD1  . ASN A 1 45 ? -6.062  -17.006 -7.602  1.00 0.00 ? 45 ASN A OD1  1  
ATOM 688   N ND2  . ASN A 1 45 ? -7.534  -15.778 -6.432  1.00 0.00 ? 45 ASN A ND2  1  
ATOM 689   H H    . ASN A 1 45 ? -4.008  -13.866 -5.661  1.00 0.00 ? 45 ASN A H    1  
ATOM 690   H HA   . ASN A 1 45 ? -4.082  -15.275 -7.444  1.00 0.00 ? 45 ASN A HA   1  
ATOM 691   H HB2  . ASN A 1 45 ? -6.671  -13.820 -7.634  1.00 0.00 ? 45 ASN A HB2  1  
ATOM 692   H HB3  . ASN A 1 45 ? -6.161  -14.745 -9.043  1.00 0.00 ? 45 ASN A HB3  1  
ATOM 693   H HD21 . ASN A 1 45 ? -7.877  -14.877 -6.254  1.00 0.00 ? 45 ASN A HD21 1  
ATOM 694   H HD22 . ASN A 1 45 ? -7.875  -16.585 -5.991  1.00 0.00 ? 45 ASN A HD22 1  
ATOM 695   N N    . LEU A 1 46 ? -2.856  -12.908 -8.531  1.00 0.00 ? 46 LEU A N    1  
ATOM 696   C CA   . LEU A 1 46 ? -2.121  -12.192 -9.568  1.00 0.00 ? 46 LEU A CA   1  
ATOM 697   C C    . LEU A 1 46 ? -0.707  -12.745 -9.715  1.00 0.00 ? 46 LEU A C    1  
ATOM 698   O O    . LEU A 1 46 ? -0.121  -13.276 -8.771  1.00 0.00 ? 46 LEU A O    1  
ATOM 699   C CB   . LEU A 1 46 ? -2.065  -10.698 -9.242  1.00 0.00 ? 46 LEU A CB   1  
ATOM 700   C CG   . LEU A 1 46 ? -3.413  -9.995  -9.080  1.00 0.00 ? 46 LEU A CG   1  
ATOM 701   C CD1  . LEU A 1 46 ? -3.221  -8.595  -8.517  1.00 0.00 ? 46 LEU A CD1  1  
ATOM 702   C CD2  . LEU A 1 46 ? -4.148  -9.940  -10.412 1.00 0.00 ? 46 LEU A CD2  1  
ATOM 703   H H    . LEU A 1 46 ? -2.557  -12.839 -7.601  1.00 0.00 ? 46 LEU A H    1  
ATOM 704   H HA   . LEU A 1 46 ? -2.647  -12.328 -10.501 1.00 0.00 ? 46 LEU A HA   1  
ATOM 705   H HB2  . LEU A 1 46 ? -1.519  -10.582 -8.318  1.00 0.00 ? 46 LEU A HB2  1  
ATOM 706   H HB3  . LEU A 1 46 ? -1.527  -10.206 -10.040 1.00 0.00 ? 46 LEU A HB3  1  
ATOM 707   H HG   . LEU A 1 46 ? -4.022  -10.554 -8.384  1.00 0.00 ? 46 LEU A HG   1  
ATOM 708   H HD11 . LEU A 1 46 ? -3.961  -8.410  -7.754  1.00 0.00 ? 46 LEU A HD11 1  
ATOM 709   H HD12 . LEU A 1 46 ? -3.332  -7.870  -9.310  1.00 0.00 ? 46 LEU A HD12 1  
ATOM 710   H HD13 . LEU A 1 46 ? -2.232  -8.512  -8.090  1.00 0.00 ? 46 LEU A HD13 1  
ATOM 711   H HD21 . LEU A 1 46 ? -3.680  -9.206  -11.051 1.00 0.00 ? 46 LEU A HD21 1  
ATOM 712   H HD22 . LEU A 1 46 ? -5.179  -9.664  -10.242 1.00 0.00 ? 46 LEU A HD22 1  
ATOM 713   H HD23 . LEU A 1 46 ? -4.108  -10.909 -10.885 1.00 0.00 ? 46 LEU A HD23 1  
ATOM 714   N N    . PRO A 1 47 ? -0.144  -12.618 -10.925 1.00 0.00 ? 47 PRO A N    1  
ATOM 715   C CA   . PRO A 1 47 ? 1.209   -13.097 -11.224 1.00 0.00 ? 47 PRO A CA   1  
ATOM 716   C C    . PRO A 1 47 ? 2.284   -12.269 -10.528 1.00 0.00 ? 47 PRO A C    1  
ATOM 717   O O    . PRO A 1 47 ? 2.291   -11.040 -10.618 1.00 0.00 ? 47 PRO A O    1  
ATOM 718   C CB   . PRO A 1 47 ? 1.313   -12.942 -12.743 1.00 0.00 ? 47 PRO A CB   1  
ATOM 719   C CG   . PRO A 1 47 ? 0.344   -11.862 -13.081 1.00 0.00 ? 47 PRO A CG   1  
ATOM 720   C CD   . PRO A 1 47 ? -0.785  -11.996 -12.096 1.00 0.00 ? 47 PRO A CD   1  
ATOM 721   H HA   . PRO A 1 47 ? 1.329   -14.137 -10.957 1.00 0.00 ? 47 PRO A HA   1  
ATOM 722   H HB2  . PRO A 1 47 ? 2.323   -12.665 -13.010 1.00 0.00 ? 47 PRO A HB2  1  
ATOM 723   H HB3  . PRO A 1 47 ? 1.050   -13.872 -13.222 1.00 0.00 ? 47 PRO A HB3  1  
ATOM 724   H HG2  . PRO A 1 47 ? 0.819   -10.898 -12.979 1.00 0.00 ? 47 PRO A HG2  1  
ATOM 725   H HG3  . PRO A 1 47 ? -0.020  -11.998 -14.088 1.00 0.00 ? 47 PRO A HG3  1  
ATOM 726   H HD2  . PRO A 1 47 ? -1.184  -11.024 -11.846 1.00 0.00 ? 47 PRO A HD2  1  
ATOM 727   H HD3  . PRO A 1 47 ? -1.560  -12.633 -12.495 1.00 0.00 ? 47 PRO A HD3  1  
ATOM 728   N N    . THR A 1 48 ? 3.192   -12.948 -9.834  1.00 0.00 ? 48 THR A N    1  
ATOM 729   C CA   . THR A 1 48 ? 4.271   -12.275 -9.123  1.00 0.00 ? 48 THR A CA   1  
ATOM 730   C C    . THR A 1 48 ? 4.893   -11.178 -9.979  1.00 0.00 ? 48 THR A C    1  
ATOM 731   O O    . THR A 1 48 ? 5.189   -10.088 -9.488  1.00 0.00 ? 48 THR A O    1  
ATOM 732   C CB   . THR A 1 48 ? 5.371   -13.267 -8.701  1.00 0.00 ? 48 THR A CB   1  
ATOM 733   O OG1  . THR A 1 48 ? 5.514   -14.290 -9.693  1.00 0.00 ? 48 THR A OG1  1  
ATOM 734   C CG2  . THR A 1 48 ? 5.043   -13.900 -7.357  1.00 0.00 ? 48 THR A CG2  1  
ATOM 735   H H    . THR A 1 48 ? 3.132   -13.926 -9.800  1.00 0.00 ? 48 THR A H    1  
ATOM 736   H HA   . THR A 1 48 ? 3.855   -11.830 -8.230  1.00 0.00 ? 48 THR A HA   1  
ATOM 737   H HB   . THR A 1 48 ? 6.304   -12.730 -8.612  1.00 0.00 ? 48 THR A HB   1  
ATOM 738   H HG1  . THR A 1 48 ? 6.444   -14.504 -9.801  1.00 0.00 ? 48 THR A HG1  1  
ATOM 739   H HG21 . THR A 1 48 ? 4.354   -14.718 -7.503  1.00 0.00 ? 48 THR A HG21 1  
ATOM 740   H HG22 . THR A 1 48 ? 4.593   -13.160 -6.712  1.00 0.00 ? 48 THR A HG22 1  
ATOM 741   H HG23 . THR A 1 48 ? 5.950   -14.269 -6.903  1.00 0.00 ? 48 THR A HG23 1  
ATOM 742   N N    . ARG A 1 49 ? 5.087   -11.472 -11.260 1.00 0.00 ? 49 ARG A N    1  
ATOM 743   C CA   . ARG A 1 49 ? 5.675   -10.509 -12.184 1.00 0.00 ? 49 ARG A CA   1  
ATOM 744   C C    . ARG A 1 49 ? 4.959   -9.165  -12.096 1.00 0.00 ? 49 ARG A C    1  
ATOM 745   O O    . ARG A 1 49 ? 5.585   -8.109  -12.196 1.00 0.00 ? 49 ARG A O    1  
ATOM 746   C CB   . ARG A 1 49 ? 5.610   -11.041 -13.617 1.00 0.00 ? 49 ARG A CB   1  
ATOM 747   C CG   . ARG A 1 49 ? 4.243   -10.885 -14.263 1.00 0.00 ? 49 ARG A CG   1  
ATOM 748   C CD   . ARG A 1 49 ? 4.110   -9.544  -14.968 1.00 0.00 ? 49 ARG A CD   1  
ATOM 749   N NE   . ARG A 1 49 ? 2.944   -9.502  -15.846 1.00 0.00 ? 49 ARG A NE   1  
ATOM 750   C CZ   . ARG A 1 49 ? 2.840   -8.687  -16.890 1.00 0.00 ? 49 ARG A CZ   1  
ATOM 751   N NH1  . ARG A 1 49 ? 3.827   -7.853  -17.185 1.00 0.00 ? 49 ARG A NH1  1  
ATOM 752   N NH2  . ARG A 1 49 ? 1.747   -8.707  -17.643 1.00 0.00 ? 49 ARG A NH2  1  
ATOM 753   H H    . ARG A 1 49 ? 4.830   -12.357 -11.592 1.00 0.00 ? 49 ARG A H    1  
ATOM 754   H HA   . ARG A 1 49 ? 6.709   -10.372 -11.907 1.00 0.00 ? 49 ARG A HA   1  
ATOM 755   H HB2  . ARG A 1 49 ? 6.331   -10.508 -14.219 1.00 0.00 ? 49 ARG A HB2  1  
ATOM 756   H HB3  . ARG A 1 49 ? 5.864   -12.090 -13.610 1.00 0.00 ? 49 ARG A HB3  1  
ATOM 757   H HG2  . ARG A 1 49 ? 4.106   -11.675 -14.987 1.00 0.00 ? 49 ARG A HG2  1  
ATOM 758   H HG3  . ARG A 1 49 ? 3.484   -10.958 -13.499 1.00 0.00 ? 49 ARG A HG3  1  
ATOM 759   H HD2  . ARG A 1 49 ? 4.016   -8.769  -14.222 1.00 0.00 ? 49 ARG A HD2  1  
ATOM 760   H HD3  . ARG A 1 49 ? 4.999   -9.372  -15.556 1.00 0.00 ? 49 ARG A HD3  1  
ATOM 761   H HE   . ARG A 1 49 ? 2.202   -10.110 -15.646 1.00 0.00 ? 49 ARG A HE   1  
ATOM 762   H HH11 . ARG A 1 49 ? 4.652   -7.837  -16.621 1.00 0.00 ? 49 ARG A HH11 1  
ATOM 763   H HH12 . ARG A 1 49 ? 3.747   -7.242  -17.973 1.00 0.00 ? 49 ARG A HH12 1  
ATOM 764   H HH21 . ARG A 1 49 ? 1.001   -9.335  -17.423 1.00 0.00 ? 49 ARG A HH21 1  
ATOM 765   H HH22 . ARG A 1 49 ? 1.670   -8.094  -18.428 1.00 0.00 ? 49 ARG A HH22 1  
ATOM 766   N N    . VAL A 1 50 ? 3.644   -9.211  -11.910 1.00 0.00 ? 50 VAL A N    1  
ATOM 767   C CA   . VAL A 1 50 ? 2.843   -7.997  -11.808 1.00 0.00 ? 50 VAL A CA   1  
ATOM 768   C C    . VAL A 1 50 ? 3.059   -7.307  -10.466 1.00 0.00 ? 50 VAL A C    1  
ATOM 769   O O    . VAL A 1 50 ? 3.118   -6.079  -10.390 1.00 0.00 ? 50 VAL A O    1  
ATOM 770   C CB   . VAL A 1 50 ? 1.343   -8.298  -11.982 1.00 0.00 ? 50 VAL A CB   1  
ATOM 771   C CG1  . VAL A 1 50 ? 0.501   -7.156  -11.434 1.00 0.00 ? 50 VAL A CG1  1  
ATOM 772   C CG2  . VAL A 1 50 ? 1.018   -8.556  -13.446 1.00 0.00 ? 50 VAL A CG2  1  
ATOM 773   H H    . VAL A 1 50 ? 3.202   -10.083 -11.838 1.00 0.00 ? 50 VAL A H    1  
ATOM 774   H HA   . VAL A 1 50 ? 3.149   -7.328  -12.599 1.00 0.00 ? 50 VAL A HA   1  
ATOM 775   H HB   . VAL A 1 50 ? 1.108   -9.191  -11.420 1.00 0.00 ? 50 VAL A HB   1  
ATOM 776   H HG11 . VAL A 1 50 ? 0.731   -6.249  -11.974 1.00 0.00 ? 50 VAL A HG11 1  
ATOM 777   H HG12 . VAL A 1 50 ? -0.546  -7.391  -11.552 1.00 0.00 ? 50 VAL A HG12 1  
ATOM 778   H HG13 . VAL A 1 50 ? 0.723   -7.016  -10.386 1.00 0.00 ? 50 VAL A HG13 1  
ATOM 779   H HG21 . VAL A 1 50 ? 0.966   -7.615  -13.973 1.00 0.00 ? 50 VAL A HG21 1  
ATOM 780   H HG22 . VAL A 1 50 ? 1.790   -9.172  -13.883 1.00 0.00 ? 50 VAL A HG22 1  
ATOM 781   H HG23 . VAL A 1 50 ? 0.068   -9.064  -13.520 1.00 0.00 ? 50 VAL A HG23 1  
ATOM 782   N N    . ILE A 1 51 ? 3.177   -8.104  -9.409  1.00 0.00 ? 51 ILE A N    1  
ATOM 783   C CA   . ILE A 1 51 ? 3.388   -7.569  -8.070  1.00 0.00 ? 51 ILE A CA   1  
ATOM 784   C C    . ILE A 1 51 ? 4.795   -6.999  -7.921  1.00 0.00 ? 51 ILE A C    1  
ATOM 785   O O    . ILE A 1 51 ? 5.014   -6.046  -7.174  1.00 0.00 ? 51 ILE A O    1  
ATOM 786   C CB   . ILE A 1 51 ? 3.166   -8.647  -6.992  1.00 0.00 ? 51 ILE A CB   1  
ATOM 787   C CG1  . ILE A 1 51 ? 1.849   -9.385  -7.241  1.00 0.00 ? 51 ILE A CG1  1  
ATOM 788   C CG2  . ILE A 1 51 ? 3.175   -8.020  -5.606  1.00 0.00 ? 51 ILE A CG2  1  
ATOM 789   C CD1  . ILE A 1 51 ? 1.700   -10.648 -6.422  1.00 0.00 ? 51 ILE A CD1  1  
ATOM 790   H H    . ILE A 1 51 ? 3.121   -9.074  -9.533  1.00 0.00 ? 51 ILE A H    1  
ATOM 791   H HA   . ILE A 1 51 ? 2.671   -6.776  -7.911  1.00 0.00 ? 51 ILE A HA   1  
ATOM 792   H HB   . ILE A 1 51 ? 3.982   -9.352  -7.047  1.00 0.00 ? 51 ILE A HB   1  
ATOM 793   H HG12 . ILE A 1 51 ? 1.026   -8.732  -6.996  1.00 0.00 ? 51 ILE A HG12 1  
ATOM 794   H HG13 . ILE A 1 51 ? 1.789   -9.656  -8.285  1.00 0.00 ? 51 ILE A HG13 1  
ATOM 795   H HG21 . ILE A 1 51 ? 2.829   -8.742  -4.882  1.00 0.00 ? 51 ILE A HG21 1  
ATOM 796   H HG22 . ILE A 1 51 ? 4.179   -7.713  -5.356  1.00 0.00 ? 51 ILE A HG22 1  
ATOM 797   H HG23 . ILE A 1 51 ? 2.522   -7.160  -5.596  1.00 0.00 ? 51 ILE A HG23 1  
ATOM 798   H HD11 . ILE A 1 51 ? 2.076   -11.489 -6.985  1.00 0.00 ? 51 ILE A HD11 1  
ATOM 799   H HD12 . ILE A 1 51 ? 2.258   -10.550 -5.503  1.00 0.00 ? 51 ILE A HD12 1  
ATOM 800   H HD13 . ILE A 1 51 ? 0.656   -10.806 -6.193  1.00 0.00 ? 51 ILE A HD13 1  
ATOM 801   N N    . VAL A 1 52 ? 5.745   -7.589  -8.639  1.00 0.00 ? 52 VAL A N    1  
ATOM 802   C CA   . VAL A 1 52 ? 7.131   -7.138  -8.590  1.00 0.00 ? 52 VAL A CA   1  
ATOM 803   C C    . VAL A 1 52 ? 7.279   -5.747  -9.195  1.00 0.00 ? 52 VAL A C    1  
ATOM 804   O O    . VAL A 1 52 ? 7.833   -4.842  -8.571  1.00 0.00 ? 52 VAL A O    1  
ATOM 805   C CB   . VAL A 1 52 ? 8.065   -8.112  -9.334  1.00 0.00 ? 52 VAL A CB   1  
ATOM 806   C CG1  . VAL A 1 52 ? 9.461   -7.522  -9.458  1.00 0.00 ? 52 VAL A CG1  1  
ATOM 807   C CG2  . VAL A 1 52 ? 8.105   -9.457  -8.626  1.00 0.00 ? 52 VAL A CG2  1  
ATOM 808   H H    . VAL A 1 52 ? 5.509   -8.345  -9.216  1.00 0.00 ? 52 VAL A H    1  
ATOM 809   H HA   . VAL A 1 52 ? 7.434   -7.104  -7.553  1.00 0.00 ? 52 VAL A HA   1  
ATOM 810   H HB   . VAL A 1 52 ? 7.673   -8.264  -10.329 1.00 0.00 ? 52 VAL A HB   1  
ATOM 811   H HG11 . VAL A 1 52 ? 9.928   -7.497  -8.484  1.00 0.00 ? 52 VAL A HG11 1  
ATOM 812   H HG12 . VAL A 1 52 ? 10.052  -8.132  -10.126 1.00 0.00 ? 52 VAL A HG12 1  
ATOM 813   H HG13 . VAL A 1 52 ? 9.395   -6.518  -9.850  1.00 0.00 ? 52 VAL A HG13 1  
ATOM 814   H HG21 . VAL A 1 52 ? 7.930   -9.313  -7.570  1.00 0.00 ? 52 VAL A HG21 1  
ATOM 815   H HG22 . VAL A 1 52 ? 7.340   -10.102 -9.033  1.00 0.00 ? 52 VAL A HG22 1  
ATOM 816   H HG23 . VAL A 1 52 ? 9.074   -9.912  -8.771  1.00 0.00 ? 52 VAL A HG23 1  
ATOM 817   N N    . VAL A 1 53 ? 6.777   -5.582  -10.415 1.00 0.00 ? 53 VAL A N    1  
ATOM 818   C CA   . VAL A 1 53 ? 6.852   -4.300  -11.105 1.00 0.00 ? 53 VAL A CA   1  
ATOM 819   C C    . VAL A 1 53 ? 6.220   -3.190  -10.272 1.00 0.00 ? 53 VAL A C    1  
ATOM 820   O O    . VAL A 1 53 ? 6.725   -2.069  -10.228 1.00 0.00 ? 53 VAL A O    1  
ATOM 821   C CB   . VAL A 1 53 ? 6.153   -4.359  -12.476 1.00 0.00 ? 53 VAL A CB   1  
ATOM 822   C CG1  . VAL A 1 53 ? 6.209   -3.004  -13.164 1.00 0.00 ? 53 VAL A CG1  1  
ATOM 823   C CG2  . VAL A 1 53 ? 6.781   -5.436  -13.348 1.00 0.00 ? 53 VAL A CG2  1  
ATOM 824   H H    . VAL A 1 53 ? 6.347   -6.341  -10.861 1.00 0.00 ? 53 VAL A H    1  
ATOM 825   H HA   . VAL A 1 53 ? 7.894   -4.067  -11.266 1.00 0.00 ? 53 VAL A HA   1  
ATOM 826   H HB   . VAL A 1 53 ? 5.115   -4.614  -12.318 1.00 0.00 ? 53 VAL A HB   1  
ATOM 827   H HG11 . VAL A 1 53 ? 6.343   -3.145  -14.226 1.00 0.00 ? 53 VAL A HG11 1  
ATOM 828   H HG12 . VAL A 1 53 ? 5.288   -2.469  -12.984 1.00 0.00 ? 53 VAL A HG12 1  
ATOM 829   H HG13 . VAL A 1 53 ? 7.039   -2.435  -12.770 1.00 0.00 ? 53 VAL A HG13 1  
ATOM 830   H HG21 . VAL A 1 53 ? 7.759   -5.684  -12.963 1.00 0.00 ? 53 VAL A HG21 1  
ATOM 831   H HG22 . VAL A 1 53 ? 6.156   -6.317  -13.340 1.00 0.00 ? 53 VAL A HG22 1  
ATOM 832   H HG23 . VAL A 1 53 ? 6.875   -5.071  -14.360 1.00 0.00 ? 53 VAL A HG23 1  
ATOM 833   N N    . TRP A 1 54 ? 5.112   -3.511  -9.613  1.00 0.00 ? 54 TRP A N    1  
ATOM 834   C CA   . TRP A 1 54 ? 4.411   -2.541  -8.780  1.00 0.00 ? 54 TRP A CA   1  
ATOM 835   C C    . TRP A 1 54 ? 5.234   -2.186  -7.547  1.00 0.00 ? 54 TRP A C    1  
ATOM 836   O O    . TRP A 1 54 ? 5.355   -1.015  -7.184  1.00 0.00 ? 54 TRP A O    1  
ATOM 837   C CB   . TRP A 1 54 ? 3.048   -3.091  -8.358  1.00 0.00 ? 54 TRP A CB   1  
ATOM 838   C CG   . TRP A 1 54 ? 2.230   -2.113  -7.570  1.00 0.00 ? 54 TRP A CG   1  
ATOM 839   C CD1  . TRP A 1 54 ? 1.176   -1.372  -8.025  1.00 0.00 ? 54 TRP A CD1  1  
ATOM 840   C CD2  . TRP A 1 54 ? 2.400   -1.767  -6.191  1.00 0.00 ? 54 TRP A CD2  1  
ATOM 841   N NE1  . TRP A 1 54 ? 0.681   -0.587  -7.012  1.00 0.00 ? 54 TRP A NE1  1  
ATOM 842   C CE2  . TRP A 1 54 ? 1.414   -0.812  -5.876  1.00 0.00 ? 54 TRP A CE2  1  
ATOM 843   C CE3  . TRP A 1 54 ? 3.288   -2.174  -5.192  1.00 0.00 ? 54 TRP A CE3  1  
ATOM 844   C CZ2  . TRP A 1 54 ? 1.294   -0.258  -4.605  1.00 0.00 ? 54 TRP A CZ2  1  
ATOM 845   C CZ3  . TRP A 1 54 ? 3.168   -1.623  -3.930  1.00 0.00 ? 54 TRP A CZ3  1  
ATOM 846   C CH2  . TRP A 1 54 ? 2.177   -0.674  -3.645  1.00 0.00 ? 54 TRP A CH2  1  
ATOM 847   H H    . TRP A 1 54 ? 4.758   -4.422  -9.687  1.00 0.00 ? 54 TRP A H    1  
ATOM 848   H HA   . TRP A 1 54 ? 4.262   -1.647  -9.368  1.00 0.00 ? 54 TRP A HA   1  
ATOM 849   H HB2  . TRP A 1 54 ? 2.486   -3.361  -9.240  1.00 0.00 ? 54 TRP A HB2  1  
ATOM 850   H HB3  . TRP A 1 54 ? 3.196   -3.970  -7.747  1.00 0.00 ? 54 TRP A HB3  1  
ATOM 851   H HD1  . TRP A 1 54 ? 0.800   -1.407  -9.036  1.00 0.00 ? 54 TRP A HD1  1  
ATOM 852   H HE1  . TRP A 1 54 ? -0.075  0.032   -7.089  1.00 0.00 ? 54 TRP A HE1  1  
ATOM 853   H HE3  . TRP A 1 54 ? 4.058   -2.904  -5.392  1.00 0.00 ? 54 TRP A HE3  1  
ATOM 854   H HZ2  . TRP A 1 54 ? 0.536   0.474   -4.369  1.00 0.00 ? 54 TRP A HZ2  1  
ATOM 855   H HZ3  . TRP A 1 54 ? 3.846   -1.924  -3.145  1.00 0.00 ? 54 TRP A HZ3  1  
ATOM 856   H HH2  . TRP A 1 54 ? 2.120   -0.270  -2.646  1.00 0.00 ? 54 TRP A HH2  1  
ATOM 857   N N    . PHE A 1 55 ? 5.799   -3.203  -6.905  1.00 0.00 ? 55 PHE A N    1  
ATOM 858   C CA   . PHE A 1 55 ? 6.610   -2.998  -5.711  1.00 0.00 ? 55 PHE A CA   1  
ATOM 859   C C    . PHE A 1 55 ? 7.882   -2.223  -6.044  1.00 0.00 ? 55 PHE A C    1  
ATOM 860   O O    . PHE A 1 55 ? 8.295   -1.337  -5.296  1.00 0.00 ? 55 PHE A O    1  
ATOM 861   C CB   . PHE A 1 55 ? 6.970   -4.343  -5.076  1.00 0.00 ? 55 PHE A CB   1  
ATOM 862   C CG   . PHE A 1 55 ? 5.975   -4.808  -4.052  1.00 0.00 ? 55 PHE A CG   1  
ATOM 863   C CD1  . PHE A 1 55 ? 4.655   -5.039  -4.405  1.00 0.00 ? 55 PHE A CD1  1  
ATOM 864   C CD2  . PHE A 1 55 ? 6.358   -5.014  -2.737  1.00 0.00 ? 55 PHE A CD2  1  
ATOM 865   C CE1  . PHE A 1 55 ? 3.736   -5.468  -3.466  1.00 0.00 ? 55 PHE A CE1  1  
ATOM 866   C CE2  . PHE A 1 55 ? 5.444   -5.443  -1.793  1.00 0.00 ? 55 PHE A CE2  1  
ATOM 867   C CZ   . PHE A 1 55 ? 4.131   -5.669  -2.158  1.00 0.00 ? 55 PHE A CZ   1  
ATOM 868   H H    . PHE A 1 55 ? 5.666   -4.114  -7.242  1.00 0.00 ? 55 PHE A H    1  
ATOM 869   H HA   . PHE A 1 55 ? 6.026   -2.423  -5.009  1.00 0.00 ? 55 PHE A HA   1  
ATOM 870   H HB2  . PHE A 1 55 ? 7.027   -5.094  -5.849  1.00 0.00 ? 55 PHE A HB2  1  
ATOM 871   H HB3  . PHE A 1 55 ? 7.931   -4.258  -4.591  1.00 0.00 ? 55 PHE A HB3  1  
ATOM 872   H HD1  . PHE A 1 55 ? 4.345   -4.882  -5.429  1.00 0.00 ? 55 PHE A HD1  1  
ATOM 873   H HD2  . PHE A 1 55 ? 7.384   -4.836  -2.449  1.00 0.00 ? 55 PHE A HD2  1  
ATOM 874   H HE1  . PHE A 1 55 ? 2.710   -5.644  -3.755  1.00 0.00 ? 55 PHE A HE1  1  
ATOM 875   H HE2  . PHE A 1 55 ? 5.755   -5.599  -0.771  1.00 0.00 ? 55 PHE A HE2  1  
ATOM 876   H HZ   . PHE A 1 55 ? 3.415   -6.004  -1.423  1.00 0.00 ? 55 PHE A HZ   1  
ATOM 877   N N    . GLN A 1 56 ? 8.498   -2.565  -7.171  1.00 0.00 ? 56 GLN A N    1  
ATOM 878   C CA   . GLN A 1 56 ? 9.723   -1.903  -7.603  1.00 0.00 ? 56 GLN A CA   1  
ATOM 879   C C    . GLN A 1 56 ? 9.520   -0.395  -7.705  1.00 0.00 ? 56 GLN A C    1  
ATOM 880   O O    . GLN A 1 56 ? 10.266  0.383   -7.112  1.00 0.00 ? 56 GLN A O    1  
ATOM 881   C CB   . GLN A 1 56 ? 10.181  -2.461  -8.952  1.00 0.00 ? 56 GLN A CB   1  
ATOM 882   C CG   . GLN A 1 56 ? 10.977  -3.751  -8.838  1.00 0.00 ? 56 GLN A CG   1  
ATOM 883   C CD   . GLN A 1 56 ? 11.987  -3.915  -9.957  1.00 0.00 ? 56 GLN A CD   1  
ATOM 884   O OE1  . GLN A 1 56 ? 12.530  -2.934  -10.467 1.00 0.00 ? 56 GLN A OE1  1  
ATOM 885   N NE2  . GLN A 1 56 ? 12.244  -5.158  -10.346 1.00 0.00 ? 56 GLN A NE2  1  
ATOM 886   H H    . GLN A 1 56 ? 8.120   -3.280  -7.725  1.00 0.00 ? 56 GLN A H    1  
ATOM 887   H HA   . GLN A 1 56 ? 10.485  -2.102  -6.865  1.00 0.00 ? 56 GLN A HA   1  
ATOM 888   H HB2  . GLN A 1 56 ? 9.312   -2.652  -9.563  1.00 0.00 ? 56 GLN A HB2  1  
ATOM 889   H HB3  . GLN A 1 56 ? 10.800  -1.724  -9.441  1.00 0.00 ? 56 GLN A HB3  1  
ATOM 890   H HG2  . GLN A 1 56 ? 11.504  -3.752  -7.896  1.00 0.00 ? 56 GLN A HG2  1  
ATOM 891   H HG3  . GLN A 1 56 ? 10.291  -4.585  -8.867  1.00 0.00 ? 56 GLN A HG3  1  
ATOM 892   H HE21 . GLN A 1 56 ? 11.772  -5.890  -9.896  1.00 0.00 ? 56 GLN A HE21 1  
ATOM 893   H HE22 . GLN A 1 56 ? 12.891  -5.292  -11.068 1.00 0.00 ? 56 GLN A HE22 1  
ATOM 894   N N    . ASN A 1 57 ? 8.506   0.010   -8.462  1.00 0.00 ? 57 ASN A N    1  
ATOM 895   C CA   . ASN A 1 57 ? 8.205   1.426   -8.643  1.00 0.00 ? 57 ASN A CA   1  
ATOM 896   C C    . ASN A 1 57 ? 7.876   2.087   -7.308  1.00 0.00 ? 57 ASN A C    1  
ATOM 897   O O    . ASN A 1 57 ? 8.464   3.105   -6.947  1.00 0.00 ? 57 ASN A O    1  
ATOM 898   C CB   . ASN A 1 57 ? 7.035   1.600   -9.614  1.00 0.00 ? 57 ASN A CB   1  
ATOM 899   C CG   . ASN A 1 57 ? 7.459   1.453   -11.063 1.00 0.00 ? 57 ASN A CG   1  
ATOM 900   O OD1  . ASN A 1 57 ? 7.623   2.443   -11.776 1.00 0.00 ? 57 ASN A OD1  1  
ATOM 901   N ND2  . ASN A 1 57 ? 7.638   0.214   -11.504 1.00 0.00 ? 57 ASN A ND2  1  
ATOM 902   H H    . ASN A 1 57 ? 7.946   -0.658  -8.910  1.00 0.00 ? 57 ASN A H    1  
ATOM 903   H HA   . ASN A 1 57 ? 9.081   1.900   -9.060  1.00 0.00 ? 57 ASN A HA   1  
ATOM 904   H HB2  . ASN A 1 57 ? 6.285   0.852   -9.401  1.00 0.00 ? 57 ASN A HB2  1  
ATOM 905   H HB3  . ASN A 1 57 ? 6.607   2.582   -9.480  1.00 0.00 ? 57 ASN A HB3  1  
ATOM 906   H HD21 . ASN A 1 57 ? 7.489   -0.526  -10.879 1.00 0.00 ? 57 ASN A HD21 1  
ATOM 907   H HD22 . ASN A 1 57 ? 7.913   0.090   -12.436 1.00 0.00 ? 57 ASN A HD22 1  
ATOM 908   N N    . ALA A 1 58 ? 6.932   1.499   -6.580  1.00 0.00 ? 58 ALA A N    1  
ATOM 909   C CA   . ALA A 1 58 ? 6.526   2.029   -5.284  1.00 0.00 ? 58 ALA A CA   1  
ATOM 910   C C    . ALA A 1 58 ? 7.734   2.490   -4.477  1.00 0.00 ? 58 ALA A C    1  
ATOM 911   O O    . ALA A 1 58 ? 7.663   3.475   -3.743  1.00 0.00 ? 58 ALA A O    1  
ATOM 912   C CB   . ALA A 1 58 ? 5.738   0.983   -4.510  1.00 0.00 ? 58 ALA A CB   1  
ATOM 913   H H    . ALA A 1 58 ? 6.499   0.689   -6.922  1.00 0.00 ? 58 ALA A H    1  
ATOM 914   H HA   . ALA A 1 58 ? 5.877   2.876   -5.458  1.00 0.00 ? 58 ALA A HA   1  
ATOM 915   H HB1  . ALA A 1 58 ? 6.002   1.037   -3.463  1.00 0.00 ? 58 ALA A HB1  1  
ATOM 916   H HB2  . ALA A 1 58 ? 4.681   1.170   -4.625  1.00 0.00 ? 58 ALA A HB2  1  
ATOM 917   H HB3  . ALA A 1 58 ? 5.974   0.000   -4.890  1.00 0.00 ? 58 ALA A HB3  1  
ATOM 918   N N    . ARG A 1 59 ? 8.843   1.770   -4.616  1.00 0.00 ? 59 ARG A N    1  
ATOM 919   C CA   . ARG A 1 59 ? 10.066  2.104   -3.898  1.00 0.00 ? 59 ARG A CA   1  
ATOM 920   C C    . ARG A 1 59 ? 10.688  3.384   -4.449  1.00 0.00 ? 59 ARG A C    1  
ATOM 921   O O    . ARG A 1 59 ? 11.135  4.245   -3.691  1.00 0.00 ? 59 ARG A O    1  
ATOM 922   C CB   . ARG A 1 59 ? 11.070  0.954   -3.994  1.00 0.00 ? 59 ARG A CB   1  
ATOM 923   C CG   . ARG A 1 59 ? 10.668  -0.274  -3.194  1.00 0.00 ? 59 ARG A CG   1  
ATOM 924   C CD   . ARG A 1 59 ? 11.782  -1.308  -3.162  1.00 0.00 ? 59 ARG A CD   1  
ATOM 925   N NE   . ARG A 1 59 ? 12.067  -1.847  -4.490  1.00 0.00 ? 59 ARG A NE   1  
ATOM 926   C CZ   . ARG A 1 59 ? 13.221  -2.415  -4.821  1.00 0.00 ? 59 ARG A CZ   1  
ATOM 927   N NH1  . ARG A 1 59 ? 14.193  -2.519  -3.925  1.00 0.00 ? 59 ARG A NH1  1  
ATOM 928   N NH2  . ARG A 1 59 ? 13.404  -2.881  -6.049  1.00 0.00 ? 59 ARG A NH2  1  
ATOM 929   H H    . ARG A 1 59 ? 8.838   0.995   -5.217  1.00 0.00 ? 59 ARG A H    1  
ATOM 930   H HA   . ARG A 1 59 ? 9.810   2.261   -2.861  1.00 0.00 ? 59 ARG A HA   1  
ATOM 931   H HB2  . ARG A 1 59 ? 11.170  0.664   -5.030  1.00 0.00 ? 59 ARG A HB2  1  
ATOM 932   H HB3  . ARG A 1 59 ? 12.027  1.296   -3.631  1.00 0.00 ? 59 ARG A HB3  1  
ATOM 933   H HG2  . ARG A 1 59 ? 10.442  0.026   -2.181  1.00 0.00 ? 59 ARG A HG2  1  
ATOM 934   H HG3  . ARG A 1 59 ? 9.792   -0.715  -3.645  1.00 0.00 ? 59 ARG A HG3  1  
ATOM 935   H HD2  . ARG A 1 59 ? 12.676  -0.843  -2.774  1.00 0.00 ? 59 ARG A HD2  1  
ATOM 936   H HD3  . ARG A 1 59 ? 11.486  -2.117  -2.512  1.00 0.00 ? 59 ARG A HD3  1  
ATOM 937   H HE   . ARG A 1 59 ? 11.362  -1.780  -5.167  1.00 0.00 ? 59 ARG A HE   1  
ATOM 938   H HH11 . ARG A 1 59 ? 14.057  -2.169  -2.999  1.00 0.00 ? 59 ARG A HH11 1  
ATOM 939   H HH12 . ARG A 1 59 ? 15.061  -2.949  -4.177  1.00 0.00 ? 59 ARG A HH12 1  
ATOM 940   H HH21 . ARG A 1 59 ? 12.673  -2.805  -6.727  1.00 0.00 ? 59 ARG A HH21 1  
ATOM 941   H HH22 . ARG A 1 59 ? 14.273  -3.309  -6.297  1.00 0.00 ? 59 ARG A HH22 1  
ATOM 942   N N    . GLN A 1 60 ? 10.714  3.500   -5.773  1.00 0.00 ? 60 GLN A N    1  
ATOM 943   C CA   . GLN A 1 60 ? 11.283  4.674   -6.425  1.00 0.00 ? 60 GLN A CA   1  
ATOM 944   C C    . GLN A 1 60 ? 10.530  5.938   -6.023  1.00 0.00 ? 60 GLN A C    1  
ATOM 945   O O    . GLN A 1 60 ? 11.138  6.971   -5.738  1.00 0.00 ? 60 GLN A O    1  
ATOM 946   C CB   . GLN A 1 60 ? 11.246  4.507   -7.945  1.00 0.00 ? 60 GLN A CB   1  
ATOM 947   C CG   . GLN A 1 60 ? 12.117  3.369   -8.453  1.00 0.00 ? 60 GLN A CG   1  
ATOM 948   C CD   . GLN A 1 60 ? 13.595  3.621   -8.228  1.00 0.00 ? 60 GLN A CD   1  
ATOM 949   O OE1  . GLN A 1 60 ? 14.024  4.763   -8.061  1.00 0.00 ? 60 GLN A OE1  1  
ATOM 950   N NE2  . GLN A 1 60 ? 14.384  2.553   -8.223  1.00 0.00 ? 60 GLN A NE2  1  
ATOM 951   H H    . GLN A 1 60 ? 10.343  2.781   -6.324  1.00 0.00 ? 60 GLN A H    1  
ATOM 952   H HA   . GLN A 1 60 ? 12.310  4.765   -6.107  1.00 0.00 ? 60 GLN A HA   1  
ATOM 953   H HB2  . GLN A 1 60 ? 10.228  4.316   -8.250  1.00 0.00 ? 60 GLN A HB2  1  
ATOM 954   H HB3  . GLN A 1 60 ? 11.585  5.424   -8.405  1.00 0.00 ? 60 GLN A HB3  1  
ATOM 955   H HG2  . GLN A 1 60 ? 11.840  2.462   -7.937  1.00 0.00 ? 60 GLN A HG2  1  
ATOM 956   H HG3  . GLN A 1 60 ? 11.945  3.247   -9.512  1.00 0.00 ? 60 GLN A HG3  1  
ATOM 957   H HE21 . GLN A 1 60 ? 13.972  1.674   -8.364  1.00 0.00 ? 60 GLN A HE21 1  
ATOM 958   H HE22 . GLN A 1 60 ? 15.343  2.686   -8.081  1.00 0.00 ? 60 GLN A HE22 1  
ATOM 959   N N    . LYS A 1 61 ? 9.205   5.851   -6.001  1.00 0.00 ? 61 LYS A N    1  
ATOM 960   C CA   . LYS A 1 61 ? 8.368   6.986   -5.633  1.00 0.00 ? 61 LYS A CA   1  
ATOM 961   C C    . LYS A 1 61 ? 8.534   7.328   -4.156  1.00 0.00 ? 61 LYS A C    1  
ATOM 962   O O    . LYS A 1 61 ? 8.440   8.490   -3.763  1.00 0.00 ? 61 LYS A O    1  
ATOM 963   C CB   . LYS A 1 61 ? 6.899   6.684   -5.936  1.00 0.00 ? 61 LYS A CB   1  
ATOM 964   C CG   . LYS A 1 61 ? 6.247   5.758   -4.923  1.00 0.00 ? 61 LYS A CG   1  
ATOM 965   C CD   . LYS A 1 61 ? 4.732   5.865   -4.964  1.00 0.00 ? 61 LYS A CD   1  
ATOM 966   C CE   . LYS A 1 61 ? 4.110   5.472   -3.633  1.00 0.00 ? 61 LYS A CE   1  
ATOM 967   N NZ   . LYS A 1 61 ? 3.995   3.994   -3.489  1.00 0.00 ? 61 LYS A NZ   1  
ATOM 968   H H    . LYS A 1 61 ? 8.778   5.000   -6.238  1.00 0.00 ? 61 LYS A H    1  
ATOM 969   H HA   . LYS A 1 61 ? 8.681   7.834   -6.223  1.00 0.00 ? 61 LYS A HA   1  
ATOM 970   H HB2  . LYS A 1 61 ? 6.348   7.612   -5.951  1.00 0.00 ? 61 LYS A HB2  1  
ATOM 971   H HB3  . LYS A 1 61 ? 6.833   6.220   -6.910  1.00 0.00 ? 61 LYS A HB3  1  
ATOM 972   H HG2  . LYS A 1 61 ? 6.532   4.740   -5.143  1.00 0.00 ? 61 LYS A HG2  1  
ATOM 973   H HG3  . LYS A 1 61 ? 6.591   6.024   -3.933  1.00 0.00 ? 61 LYS A HG3  1  
ATOM 974   H HD2  . LYS A 1 61 ? 4.457   6.884   -5.190  1.00 0.00 ? 61 LYS A HD2  1  
ATOM 975   H HD3  . LYS A 1 61 ? 4.355   5.209   -5.736  1.00 0.00 ? 61 LYS A HD3  1  
ATOM 976   H HE2  . LYS A 1 61 ? 4.726   5.856   -2.835  1.00 0.00 ? 61 LYS A HE2  1  
ATOM 977   H HE3  . LYS A 1 61 ? 3.124   5.909   -3.569  1.00 0.00 ? 61 LYS A HE3  1  
ATOM 978   H HZ1  . LYS A 1 61 ? 4.490   3.680   -2.630  1.00 0.00 ? 61 LYS A HZ1  1  
ATOM 979   H HZ2  . LYS A 1 61 ? 4.420   3.521   -4.312  1.00 0.00 ? 61 LYS A HZ2  1  
ATOM 980   H HZ3  . LYS A 1 61 ? 2.995   3.718   -3.421  1.00 0.00 ? 61 LYS A HZ3  1  
ATOM 981   N N    . ALA A 1 62 ? 8.782   6.307   -3.341  1.00 0.00 ? 62 ALA A N    1  
ATOM 982   C CA   . ALA A 1 62 ? 8.964   6.500   -1.908  1.00 0.00 ? 62 ALA A CA   1  
ATOM 983   C C    . ALA A 1 62 ? 10.224  7.310   -1.619  1.00 0.00 ? 62 ALA A C    1  
ATOM 984   O O    . ALA A 1 62 ? 10.227  8.180   -0.748  1.00 0.00 ? 62 ALA A O    1  
ATOM 985   C CB   . ALA A 1 62 ? 9.024   5.156   -1.198  1.00 0.00 ? 62 ALA A CB   1  
ATOM 986   H H    . ALA A 1 62 ? 8.845   5.403   -3.714  1.00 0.00 ? 62 ALA A H    1  
ATOM 987   H HA   . ALA A 1 62 ? 8.107   7.040   -1.532  1.00 0.00 ? 62 ALA A HA   1  
ATOM 988   H HB1  . ALA A 1 62 ? 8.037   4.719   -1.172  1.00 0.00 ? 62 ALA A HB1  1  
ATOM 989   H HB2  . ALA A 1 62 ? 9.696   4.498   -1.729  1.00 0.00 ? 62 ALA A HB2  1  
ATOM 990   H HB3  . ALA A 1 62 ? 9.382   5.298   -0.189  1.00 0.00 ? 62 ALA A HB3  1  
ATOM 991   N N    . ARG A 1 63 ? 11.291  7.018   -2.354  1.00 0.00 ? 63 ARG A N    1  
ATOM 992   C CA   . ARG A 1 63 ? 12.557  7.718   -2.175  1.00 0.00 ? 63 ARG A CA   1  
ATOM 993   C C    . ARG A 1 63 ? 12.397  9.210   -2.450  1.00 0.00 ? 63 ARG A C    1  
ATOM 994   O O    . ARG A 1 63 ? 11.977  9.611   -3.535  1.00 0.00 ? 63 ARG A O    1  
ATOM 995   C CB   . ARG A 1 63 ? 13.625  7.130   -3.099  1.00 0.00 ? 63 ARG A CB   1  
ATOM 996   C CG   . ARG A 1 63 ? 14.120  5.760   -2.664  1.00 0.00 ? 63 ARG A CG   1  
ATOM 997   C CD   . ARG A 1 63 ? 15.510  5.471   -3.210  1.00 0.00 ? 63 ARG A CD   1  
ATOM 998   N NE   . ARG A 1 63 ? 16.127  4.321   -2.555  1.00 0.00 ? 63 ARG A NE   1  
ATOM 999   C CZ   . ARG A 1 63 ? 17.223  3.719   -3.005  1.00 0.00 ? 63 ARG A CZ   1  
ATOM 1000  N NH1  . ARG A 1 63 ? 17.819  4.157   -4.106  1.00 0.00 ? 63 ARG A NH1  1  
ATOM 1001  N NH2  . ARG A 1 63 ? 17.724  2.678   -2.353  1.00 0.00 ? 63 ARG A NH2  1  
ATOM 1002  H H    . ARG A 1 63 ? 11.227  6.314   -3.033  1.00 0.00 ? 63 ARG A H    1  
ATOM 1003  H HA   . ARG A 1 63 ? 12.868  7.584   -1.150  1.00 0.00 ? 63 ARG A HA   1  
ATOM 1004  H HB2  . ARG A 1 63 ? 13.214  7.040   -4.094  1.00 0.00 ? 63 ARG A HB2  1  
ATOM 1005  H HB3  . ARG A 1 63 ? 14.470  7.802   -3.127  1.00 0.00 ? 63 ARG A HB3  1  
ATOM 1006  H HG2  . ARG A 1 63 ? 14.156  5.726   -1.586  1.00 0.00 ? 63 ARG A HG2  1  
ATOM 1007  H HG3  . ARG A 1 63 ? 13.436  5.008   -3.028  1.00 0.00 ? 63 ARG A HG3  1  
ATOM 1008  H HD2  . ARG A 1 63 ? 15.432  5.271   -4.269  1.00 0.00 ? 63 ARG A HD2  1  
ATOM 1009  H HD3  . ARG A 1 63 ? 16.131  6.340   -3.053  1.00 0.00 ? 63 ARG A HD3  1  
ATOM 1010  H HE   . ARG A 1 63 ? 15.703  3.982   -1.740  1.00 0.00 ? 63 ARG A HE   1  
ATOM 1011  H HH11 . ARG A 1 63 ? 17.443  4.942   -4.598  1.00 0.00 ? 63 ARG A HH11 1  
ATOM 1012  H HH12 . ARG A 1 63 ? 18.644  3.702   -4.442  1.00 0.00 ? 63 ARG A HH12 1  
ATOM 1013  H HH21 . ARG A 1 63 ? 17.278  2.346   -1.523  1.00 0.00 ? 63 ARG A HH21 1  
ATOM 1014  H HH22 . ARG A 1 63 ? 18.549  2.226   -2.692  1.00 0.00 ? 63 ARG A HH22 1  
ATOM 1015  N N    . LYS A 1 64 ? 12.734  10.028  -1.458  1.00 0.00 ? 64 LYS A N    1  
ATOM 1016  C CA   . LYS A 1 64 ? 12.629  11.477  -1.592  1.00 0.00 ? 64 LYS A CA   1  
ATOM 1017  C C    . LYS A 1 64 ? 13.751  12.176  -0.831  1.00 0.00 ? 64 LYS A C    1  
ATOM 1018  O O    . LYS A 1 64 ? 14.232  11.674  0.184   1.00 0.00 ? 64 LYS A O    1  
ATOM 1019  C CB   . LYS A 1 64 ? 11.271  11.959  -1.077  1.00 0.00 ? 64 LYS A CB   1  
ATOM 1020  C CG   . LYS A 1 64 ? 11.098  11.801  0.424   1.00 0.00 ? 64 LYS A CG   1  
ATOM 1021  C CD   . LYS A 1 64 ? 9.664   12.064  0.851   1.00 0.00 ? 64 LYS A CD   1  
ATOM 1022  C CE   . LYS A 1 64 ? 8.751   10.905  0.480   1.00 0.00 ? 64 LYS A CE   1  
ATOM 1023  N NZ   . LYS A 1 64 ? 8.948   9.734   1.379   1.00 0.00 ? 64 LYS A NZ   1  
ATOM 1024  H H    . LYS A 1 64 ? 13.063  9.649   -0.616  1.00 0.00 ? 64 LYS A H    1  
ATOM 1025  H HA   . LYS A 1 64 ? 12.714  11.720  -2.640  1.00 0.00 ? 64 LYS A HA   1  
ATOM 1026  H HB2  . LYS A 1 64 ? 11.157  13.005  -1.323  1.00 0.00 ? 64 LYS A HB2  1  
ATOM 1027  H HB3  . LYS A 1 64 ? 10.491  11.395  -1.569  1.00 0.00 ? 64 LYS A HB3  1  
ATOM 1028  H HG2  . LYS A 1 64 ? 11.367  10.794  0.704   1.00 0.00 ? 64 LYS A HG2  1  
ATOM 1029  H HG3  . LYS A 1 64 ? 11.748  12.503  0.927   1.00 0.00 ? 64 LYS A HG3  1  
ATOM 1030  H HD2  . LYS A 1 64 ? 9.635   12.201  1.922   1.00 0.00 ? 64 LYS A HD2  1  
ATOM 1031  H HD3  . LYS A 1 64 ? 9.310   12.961  0.362   1.00 0.00 ? 64 LYS A HD3  1  
ATOM 1032  H HE2  . LYS A 1 64 ? 7.726   11.235  0.551   1.00 0.00 ? 64 LYS A HE2  1  
ATOM 1033  H HE3  . LYS A 1 64 ? 8.963   10.608  -0.537  1.00 0.00 ? 64 LYS A HE3  1  
ATOM 1034  H HZ1  . LYS A 1 64 ? 8.402   9.862   2.255   1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 1035  H HZ2  . LYS A 1 64 ? 9.954   9.635   1.621   1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 1036  H HZ3  . LYS A 1 64 ? 8.628   8.864   0.907   1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 1037  N N    . SER A 1 65 ? 14.161  13.338  -1.328  1.00 0.00 ? 65 SER A N    1  
ATOM 1038  C CA   . SER A 1 65 ? 15.228  14.106  -0.696  1.00 0.00 ? 65 SER A CA   1  
ATOM 1039  C C    . SER A 1 65 ? 14.938  15.602  -0.768  1.00 0.00 ? 65 SER A C    1  
ATOM 1040  O O    . SER A 1 65 ? 14.196  16.060  -1.636  1.00 0.00 ? 65 SER A O    1  
ATOM 1041  C CB   . SER A 1 65 ? 16.570  13.802  -1.367  1.00 0.00 ? 65 SER A CB   1  
ATOM 1042  O OG   . SER A 1 65 ? 17.545  14.769  -1.018  1.00 0.00 ? 65 SER A OG   1  
ATOM 1043  H H    . SER A 1 65 ? 13.738  13.687  -2.141  1.00 0.00 ? 65 SER A H    1  
ATOM 1044  H HA   . SER A 1 65 ? 15.279  13.810  0.341   1.00 0.00 ? 65 SER A HA   1  
ATOM 1045  H HB2  . SER A 1 65 ? 16.915  12.830  -1.051  1.00 0.00 ? 65 SER A HB2  1  
ATOM 1046  H HB3  . SER A 1 65 ? 16.442  13.808  -2.440  1.00 0.00 ? 65 SER A HB3  1  
ATOM 1047  H HG   . SER A 1 65 ? 18.353  14.600  -1.507  1.00 0.00 ? 65 SER A HG   1  
ATOM 1048  N N    . GLY A 1 66 ? 15.529  16.358  0.152   1.00 0.00 ? 66 GLY A N    1  
ATOM 1049  C CA   . GLY A 1 66 ? 15.322  17.794  0.176   1.00 0.00 ? 66 GLY A CA   1  
ATOM 1050  C C    . GLY A 1 66 ? 15.101  18.325  1.579   1.00 0.00 ? 66 GLY A C    1  
ATOM 1051  O O    . GLY A 1 66 ? 15.463  17.690  2.569   1.00 0.00 ? 66 GLY A O    1  
ATOM 1052  H H    . GLY A 1 66 ? 16.110  15.937  0.819   1.00 0.00 ? 66 GLY A H    1  
ATOM 1053  H HA2  . GLY A 1 66 ? 16.188  18.279  -0.249  1.00 0.00 ? 66 GLY A HA2  1  
ATOM 1054  H HA3  . GLY A 1 66 ? 14.457  18.032  -0.426  1.00 0.00 ? 66 GLY A HA3  1  
ATOM 1055  N N    . PRO A 1 67 ? 14.494  19.517  1.676   1.00 0.00 ? 67 PRO A N    1  
ATOM 1056  C CA   . PRO A 1 67 ? 14.213  20.159  2.963   1.00 0.00 ? 67 PRO A CA   1  
ATOM 1057  C C    . PRO A 1 67 ? 13.126  19.432  3.749   1.00 0.00 ? 67 PRO A C    1  
ATOM 1058  O O    . PRO A 1 67 ? 12.746  19.858  4.839   1.00 0.00 ? 67 PRO A O    1  
ATOM 1059  C CB   . PRO A 1 67 ? 13.739  21.559  2.565   1.00 0.00 ? 67 PRO A CB   1  
ATOM 1060  C CG   . PRO A 1 67 ? 13.201  21.399  1.185   1.00 0.00 ? 67 PRO A CG   1  
ATOM 1061  C CD   . PRO A 1 67 ? 14.035  20.329  0.537   1.00 0.00 ? 67 PRO A CD   1  
ATOM 1062  H HA   . PRO A 1 67 ? 15.103  20.238  3.570   1.00 0.00 ? 67 PRO A HA   1  
ATOM 1063  H HB2  . PRO A 1 67 ? 12.974  21.892  3.252   1.00 0.00 ? 67 PRO A HB2  1  
ATOM 1064  H HB3  . PRO A 1 67 ? 14.573  22.245  2.586   1.00 0.00 ? 67 PRO A HB3  1  
ATOM 1065  H HG2  . PRO A 1 67 ? 12.166  21.093  1.228   1.00 0.00 ? 67 PRO A HG2  1  
ATOM 1066  H HG3  . PRO A 1 67 ? 13.296  22.328  0.644   1.00 0.00 ? 67 PRO A HG3  1  
ATOM 1067  H HD2  . PRO A 1 67 ? 13.435  19.740  -0.140  1.00 0.00 ? 67 PRO A HD2  1  
ATOM 1068  H HD3  . PRO A 1 67 ? 14.873  20.769  0.016   1.00 0.00 ? 67 PRO A HD3  1  
ATOM 1069  N N    . SER A 1 68 ? 12.631  18.334  3.187   1.00 0.00 ? 68 SER A N    1  
ATOM 1070  C CA   . SER A 1 68 ? 11.585  17.550  3.834   1.00 0.00 ? 68 SER A CA   1  
ATOM 1071  C C    . SER A 1 68 ? 12.029  17.091  5.220   1.00 0.00 ? 68 SER A C    1  
ATOM 1072  O O    . SER A 1 68 ? 13.202  16.789  5.439   1.00 0.00 ? 68 SER A O    1  
ATOM 1073  C CB   . SER A 1 68 ? 11.222  16.338  2.975   1.00 0.00 ? 68 SER A CB   1  
ATOM 1074  O OG   . SER A 1 68 ? 12.325  15.457  2.844   1.00 0.00 ? 68 SER A OG   1  
ATOM 1075  H H    . SER A 1 68 ? 12.975  18.046  2.316   1.00 0.00 ? 68 SER A H    1  
ATOM 1076  H HA   . SER A 1 68 ? 10.715  18.181  3.938   1.00 0.00 ? 68 SER A HA   1  
ATOM 1077  H HB2  . SER A 1 68 ? 10.404  15.805  3.435   1.00 0.00 ? 68 SER A HB2  1  
ATOM 1078  H HB3  . SER A 1 68 ? 10.926  16.673  1.991   1.00 0.00 ? 68 SER A HB3  1  
ATOM 1079  H HG   . SER A 1 68 ? 12.025  14.620  2.481   1.00 0.00 ? 68 SER A HG   1  
ATOM 1080  N N    . SER A 1 69 ? 11.082  17.041  6.151   1.00 0.00 ? 69 SER A N    1  
ATOM 1081  C CA   . SER A 1 69 ? 11.375  16.623  7.517   1.00 0.00 ? 69 SER A CA   1  
ATOM 1082  C C    . SER A 1 69 ? 10.220  15.810  8.095   1.00 0.00 ? 69 SER A C    1  
ATOM 1083  O O    . SER A 1 69 ? 9.125   15.783  7.537   1.00 0.00 ? 69 SER A O    1  
ATOM 1084  C CB   . SER A 1 69 ? 11.647  17.842  8.399   1.00 0.00 ? 69 SER A CB   1  
ATOM 1085  O OG   . SER A 1 69 ? 11.991  17.452  9.717   1.00 0.00 ? 69 SER A OG   1  
ATOM 1086  H H    . SER A 1 69 ? 10.165  17.294  5.914   1.00 0.00 ? 69 SER A H    1  
ATOM 1087  H HA   . SER A 1 69 ? 12.259  16.003  7.492   1.00 0.00 ? 69 SER A HA   1  
ATOM 1088  H HB2  . SER A 1 69 ? 12.463  18.411  7.981   1.00 0.00 ? 69 SER A HB2  1  
ATOM 1089  H HB3  . SER A 1 69 ? 10.761  18.460  8.439   1.00 0.00 ? 69 SER A HB3  1  
ATOM 1090  H HG   . SER A 1 69 ? 11.195  17.384  10.249  1.00 0.00 ? 69 SER A HG   1  
ATOM 1091  N N    . GLY A 1 70 ? 10.476  15.148  9.220   1.00 0.00 ? 70 GLY A N    1  
ATOM 1092  C CA   . GLY A 1 70 ? 9.450   14.343  9.856   1.00 0.00 ? 70 GLY A CA   1  
ATOM 1093  C C    . GLY A 1 70 ? 9.989   13.030  10.389  1.00 0.00 ? 70 GLY A C    1  
ATOM 1094  O O    . GLY A 1 70 ? 10.039  12.034  9.668   1.00 0.00 ? 70 GLY A O    1  
ATOM 1095  H H    . GLY A 1 70 ? 11.369  15.206  9.620   1.00 0.00 ? 70 GLY A H    1  
ATOM 1096  H HA2  . GLY A 1 70 ? 9.024   14.904  10.675  1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1097  H HA3  . GLY A 1 70 ? 8.674   14.133  9.134   1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1098  N N    . GLY A 1 1  ? 16.956  -5.469  -13.624 1.00 0.00 ? 1  GLY A N    2  
ATOM 1099  C CA   . GLY A 1 1  ? 15.556  -5.262  -13.946 1.00 0.00 ? 1  GLY A CA   2  
ATOM 1100  C C    . GLY A 1 1  ? 15.300  -5.257  -15.440 1.00 0.00 ? 1  GLY A C    2  
ATOM 1101  O O    . GLY A 1 1  ? 15.267  -6.311  -16.075 1.00 0.00 ? 1  GLY A O    2  
ATOM 1102  H H1   . GLY A 1 1  ? 17.651  -5.092  -14.203 1.00 0.00 ? 1  GLY A H1   2  
ATOM 1103  H HA2  . GLY A 1 1  ? 14.974  -6.051  -13.494 1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1104  H HA3  . GLY A 1 1  ? 15.240  -4.314  -13.535 1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1105  N N    . SER A 1 2  ? 15.115  -4.067  -16.003 1.00 0.00 ? 2  SER A N    2  
ATOM 1106  C CA   . SER A 1 2  ? 14.855  -3.929  -17.431 1.00 0.00 ? 2  SER A CA   2  
ATOM 1107  C C    . SER A 1 2  ? 16.116  -3.502  -18.175 1.00 0.00 ? 2  SER A C    2  
ATOM 1108  O O    . SER A 1 2  ? 17.018  -2.898  -17.594 1.00 0.00 ? 2  SER A O    2  
ATOM 1109  C CB   . SER A 1 2  ? 13.738  -2.911  -17.671 1.00 0.00 ? 2  SER A CB   2  
ATOM 1110  O OG   . SER A 1 2  ? 14.127  -1.617  -17.245 1.00 0.00 ? 2  SER A OG   2  
ATOM 1111  H H    . SER A 1 2  ? 15.153  -3.263  -15.444 1.00 0.00 ? 2  SER A H    2  
ATOM 1112  H HA   . SER A 1 2  ? 14.539  -4.892  -17.805 1.00 0.00 ? 2  SER A HA   2  
ATOM 1113  H HB2  . SER A 1 2  ? 13.508  -2.876  -18.725 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1114  H HB3  . SER A 1 2  ? 12.858  -3.210  -17.120 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1115  H HG   . SER A 1 2  ? 13.682  -1.404  -16.421 1.00 0.00 ? 2  SER A HG   2  
ATOM 1116  N N    . SER A 1 3  ? 16.172  -3.821  -19.464 1.00 0.00 ? 3  SER A N    2  
ATOM 1117  C CA   . SER A 1 3  ? 17.325  -3.474  -20.288 1.00 0.00 ? 3  SER A CA   2  
ATOM 1118  C C    . SER A 1 3  ? 16.885  -2.766  -21.566 1.00 0.00 ? 3  SER A C    2  
ATOM 1119  O O    . SER A 1 3  ? 17.461  -1.751  -21.956 1.00 0.00 ? 3  SER A O    2  
ATOM 1120  C CB   . SER A 1 3  ? 18.125  -4.730  -20.636 1.00 0.00 ? 3  SER A CB   2  
ATOM 1121  O OG   . SER A 1 3  ? 17.302  -5.705  -21.253 1.00 0.00 ? 3  SER A OG   2  
ATOM 1122  H H    . SER A 1 3  ? 15.422  -4.303  -19.870 1.00 0.00 ? 3  SER A H    2  
ATOM 1123  H HA   . SER A 1 3  ? 17.951  -2.805  -19.717 1.00 0.00 ? 3  SER A HA   2  
ATOM 1124  H HB2  . SER A 1 3  ? 18.923  -4.469  -21.315 1.00 0.00 ? 3  SER A HB2  2  
ATOM 1125  H HB3  . SER A 1 3  ? 18.544  -5.149  -19.733 1.00 0.00 ? 3  SER A HB3  2  
ATOM 1126  H HG   . SER A 1 3  ? 17.079  -5.420  -22.142 1.00 0.00 ? 3  SER A HG   2  
ATOM 1127  N N    . GLY A 1 4  ? 15.860  -3.311  -22.214 1.00 0.00 ? 4  GLY A N    2  
ATOM 1128  C CA   . GLY A 1 4  ? 15.360  -2.720  -23.442 1.00 0.00 ? 4  GLY A CA   2  
ATOM 1129  C C    . GLY A 1 4  ? 13.850  -2.798  -23.550 1.00 0.00 ? 4  GLY A C    2  
ATOM 1130  O O    . GLY A 1 4  ? 13.314  -3.666  -24.238 1.00 0.00 ? 4  GLY A O    2  
ATOM 1131  H H    . GLY A 1 4  ? 15.440  -4.121  -21.856 1.00 0.00 ? 4  GLY A H    2  
ATOM 1132  H HA2  . GLY A 1 4  ? 15.661  -1.684  -23.478 1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1133  H HA3  . GLY A 1 4  ? 15.796  -3.240  -24.282 1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1134  N N    . SER A 1 5  ? 13.162  -1.889  -22.866 1.00 0.00 ? 5  SER A N    2  
ATOM 1135  C CA   . SER A 1 5  ? 11.704  -1.861  -22.883 1.00 0.00 ? 5  SER A CA   2  
ATOM 1136  C C    . SER A 1 5  ? 11.183  -0.481  -22.494 1.00 0.00 ? 5  SER A C    2  
ATOM 1137  O O    . SER A 1 5  ? 11.642  0.117   -21.522 1.00 0.00 ? 5  SER A O    2  
ATOM 1138  C CB   . SER A 1 5  ? 11.142  -2.918  -21.932 1.00 0.00 ? 5  SER A CB   2  
ATOM 1139  O OG   . SER A 1 5  ? 9.738   -3.042  -22.079 1.00 0.00 ? 5  SER A OG   2  
ATOM 1140  H H    . SER A 1 5  ? 13.647  -1.222  -22.335 1.00 0.00 ? 5  SER A H    2  
ATOM 1141  H HA   . SER A 1 5  ? 11.381  -2.085  -23.889 1.00 0.00 ? 5  SER A HA   2  
ATOM 1142  H HB2  . SER A 1 5  ? 11.599  -3.872  -22.146 1.00 0.00 ? 5  SER A HB2  2  
ATOM 1143  H HB3  . SER A 1 5  ? 11.362  -2.635  -20.912 1.00 0.00 ? 5  SER A HB3  2  
ATOM 1144  H HG   . SER A 1 5  ? 9.308   -2.261  -21.721 1.00 0.00 ? 5  SER A HG   2  
ATOM 1145  N N    . SER A 1 6  ? 10.219  0.018   -23.262 1.00 0.00 ? 6  SER A N    2  
ATOM 1146  C CA   . SER A 1 6  ? 9.636   1.329   -23.001 1.00 0.00 ? 6  SER A CA   2  
ATOM 1147  C C    . SER A 1 6  ? 9.258   1.473   -21.530 1.00 0.00 ? 6  SER A C    2  
ATOM 1148  O O    . SER A 1 6  ? 9.274   0.501   -20.776 1.00 0.00 ? 6  SER A O    2  
ATOM 1149  C CB   . SER A 1 6  ? 8.403   1.546   -23.880 1.00 0.00 ? 6  SER A CB   2  
ATOM 1150  O OG   . SER A 1 6  ? 8.774   1.881   -25.207 1.00 0.00 ? 6  SER A OG   2  
ATOM 1151  H H    . SER A 1 6  ? 9.895   -0.507  -24.024 1.00 0.00 ? 6  SER A H    2  
ATOM 1152  H HA   . SER A 1 6  ? 10.377  2.076   -23.245 1.00 0.00 ? 6  SER A HA   2  
ATOM 1153  H HB2  . SER A 1 6  ? 7.815   0.641   -23.902 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1154  H HB3  . SER A 1 6  ? 7.810   2.351   -23.471 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1155  H HG   . SER A 1 6  ? 7.996   1.876   -25.768 1.00 0.00 ? 6  SER A HG   2  
ATOM 1156  N N    . GLY A 1 7  ? 8.917   2.694   -21.130 1.00 0.00 ? 7  GLY A N    2  
ATOM 1157  C CA   . GLY A 1 7  ? 8.539   2.944   -19.751 1.00 0.00 ? 7  GLY A CA   2  
ATOM 1158  C C    . GLY A 1 7  ? 7.593   1.891   -19.209 1.00 0.00 ? 7  GLY A C    2  
ATOM 1159  O O    . GLY A 1 7  ? 7.856   1.286   -18.169 1.00 0.00 ? 7  GLY A O    2  
ATOM 1160  H H    . GLY A 1 7  ? 8.922   3.431   -21.776 1.00 0.00 ? 7  GLY A H    2  
ATOM 1161  H HA2  . GLY A 1 7  ? 9.431   2.959   -19.142 1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1162  H HA3  . GLY A 1 7  ? 8.058   3.909   -19.691 1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1163  N N    . ARG A 1 8  ? 6.488   1.672   -19.914 1.00 0.00 ? 8  ARG A N    2  
ATOM 1164  C CA   . ARG A 1 8  ? 5.497   0.687   -19.496 1.00 0.00 ? 8  ARG A CA   2  
ATOM 1165  C C    . ARG A 1 8  ? 5.102   -0.215  -20.661 1.00 0.00 ? 8  ARG A C    2  
ATOM 1166  O O    . ARG A 1 8  ? 5.175   0.187   -21.823 1.00 0.00 ? 8  ARG A O    2  
ATOM 1167  C CB   . ARG A 1 8  ? 4.258   1.386   -18.934 1.00 0.00 ? 8  ARG A CB   2  
ATOM 1168  C CG   . ARG A 1 8  ? 3.489   2.190   -19.970 1.00 0.00 ? 8  ARG A CG   2  
ATOM 1169  C CD   . ARG A 1 8  ? 2.583   3.221   -19.316 1.00 0.00 ? 8  ARG A CD   2  
ATOM 1170  N NE   . ARG A 1 8  ? 3.344   4.298   -18.689 1.00 0.00 ? 8  ARG A NE   2  
ATOM 1171  C CZ   . ARG A 1 8  ? 2.853   5.513   -18.469 1.00 0.00 ? 8  ARG A CZ   2  
ATOM 1172  N NH1  . ARG A 1 8  ? 1.609   5.803   -18.824 1.00 0.00 ? 8  ARG A NH1  2  
ATOM 1173  N NH2  . ARG A 1 8  ? 3.608   6.441   -17.893 1.00 0.00 ? 8  ARG A NH2  2  
ATOM 1174  H H    . ARG A 1 8  ? 6.334   2.186   -20.735 1.00 0.00 ? 8  ARG A H    2  
ATOM 1175  H HA   . ARG A 1 8  ? 5.940   0.080   -18.720 1.00 0.00 ? 8  ARG A HA   2  
ATOM 1176  H HB2  . ARG A 1 8  ? 3.592   0.640   -18.524 1.00 0.00 ? 8  ARG A HB2  2  
ATOM 1177  H HB3  . ARG A 1 8  ? 4.564   2.056   -18.145 1.00 0.00 ? 8  ARG A HB3  2  
ATOM 1178  H HG2  . ARG A 1 8  ? 4.193   2.701   -20.611 1.00 0.00 ? 8  ARG A HG2  2  
ATOM 1179  H HG3  . ARG A 1 8  ? 2.886   1.516   -20.560 1.00 0.00 ? 8  ARG A HG3  2  
ATOM 1180  H HD2  . ARG A 1 8  ? 1.936   3.642   -20.070 1.00 0.00 ? 8  ARG A HD2  2  
ATOM 1181  H HD3  . ARG A 1 8  ? 1.986   2.729   -18.563 1.00 0.00 ? 8  ARG A HD3  2  
ATOM 1182  H HE   . ARG A 1 8  ? 4.266   4.106   -18.419 1.00 0.00 ? 8  ARG A HE   2  
ATOM 1183  H HH11 . ARG A 1 8  ? 1.038   5.106   -19.257 1.00 0.00 ? 8  ARG A HH11 2  
ATOM 1184  H HH12 . ARG A 1 8  ? 1.242   6.718   -18.656 1.00 0.00 ? 8  ARG A HH12 2  
ATOM 1185  H HH21 . ARG A 1 8  ? 4.546   6.226   -17.624 1.00 0.00 ? 8  ARG A HH21 2  
ATOM 1186  H HH22 . ARG A 1 8  ? 3.238   7.354   -17.729 1.00 0.00 ? 8  ARG A HH22 2  
ATOM 1187  N N    . SER A 1 9  ? 4.683   -1.435  -20.343 1.00 0.00 ? 9  SER A N    2  
ATOM 1188  C CA   . SER A 1 9  ? 4.280   -2.396  -21.363 1.00 0.00 ? 9  SER A CA   2  
ATOM 1189  C C    . SER A 1 9  ? 2.813   -2.780  -21.198 1.00 0.00 ? 9  SER A C    2  
ATOM 1190  O O    . SER A 1 9  ? 1.998   -2.561  -22.094 1.00 0.00 ? 9  SER A O    2  
ATOM 1191  C CB   . SER A 1 9  ? 5.158   -3.647  -21.292 1.00 0.00 ? 9  SER A CB   2  
ATOM 1192  O OG   . SER A 1 9  ? 6.471   -3.375  -21.750 1.00 0.00 ? 9  SER A OG   2  
ATOM 1193  H H    . SER A 1 9  ? 4.647   -1.697  -19.399 1.00 0.00 ? 9  SER A H    2  
ATOM 1194  H HA   . SER A 1 9  ? 4.411   -1.929  -22.328 1.00 0.00 ? 9  SER A HA   2  
ATOM 1195  H HB2  . SER A 1 9  ? 5.210   -3.988  -20.269 1.00 0.00 ? 9  SER A HB2  2  
ATOM 1196  H HB3  . SER A 1 9  ? 4.727   -4.421  -21.909 1.00 0.00 ? 9  SER A HB3  2  
ATOM 1197  H HG   . SER A 1 9  ? 6.976   -2.959  -21.048 1.00 0.00 ? 9  SER A HG   2  
ATOM 1198  N N    . SER A 1 10 ? 2.485   -3.356  -20.046 1.00 0.00 ? 10 SER A N    2  
ATOM 1199  C CA   . SER A 1 10 ? 1.117   -3.775  -19.763 1.00 0.00 ? 10 SER A CA   2  
ATOM 1200  C C    . SER A 1 10 ? 0.458   -2.836  -18.757 1.00 0.00 ? 10 SER A C    2  
ATOM 1201  O O    . SER A 1 10 ? 1.090   -2.395  -17.797 1.00 0.00 ? 10 SER A O    2  
ATOM 1202  C CB   . SER A 1 10 ? 1.101   -5.208  -19.228 1.00 0.00 ? 10 SER A CB   2  
ATOM 1203  O OG   . SER A 1 10 ? -0.119  -5.856  -19.542 1.00 0.00 ? 10 SER A OG   2  
ATOM 1204  H H    . SER A 1 10 ? 3.180   -3.504  -19.371 1.00 0.00 ? 10 SER A H    2  
ATOM 1205  H HA   . SER A 1 10 ? 0.561   -3.739  -20.688 1.00 0.00 ? 10 SER A HA   2  
ATOM 1206  H HB2  . SER A 1 10 ? 1.914   -5.764  -19.669 1.00 0.00 ? 10 SER A HB2  2  
ATOM 1207  H HB3  . SER A 1 10 ? 1.218   -5.189  -18.154 1.00 0.00 ? 10 SER A HB3  2  
ATOM 1208  H HG   . SER A 1 10 ? -0.252  -5.846  -20.493 1.00 0.00 ? 10 SER A HG   2  
ATOM 1209  N N    . ARG A 1 11 ? -0.817  -2.536  -18.985 1.00 0.00 ? 11 ARG A N    2  
ATOM 1210  C CA   . ARG A 1 11 ? -1.562  -1.649  -18.100 1.00 0.00 ? 11 ARG A CA   2  
ATOM 1211  C C    . ARG A 1 11 ? -2.578  -2.433  -17.274 1.00 0.00 ? 11 ARG A C    2  
ATOM 1212  O O    . ARG A 1 11 ? -3.752  -2.523  -17.637 1.00 0.00 ? 11 ARG A O    2  
ATOM 1213  C CB   . ARG A 1 11 ? -2.275  -0.565  -18.911 1.00 0.00 ? 11 ARG A CB   2  
ATOM 1214  C CG   . ARG A 1 11 ? -1.382  0.611   -19.272 1.00 0.00 ? 11 ARG A CG   2  
ATOM 1215  C CD   . ARG A 1 11 ? -2.159  1.696   -20.001 1.00 0.00 ? 11 ARG A CD   2  
ATOM 1216  N NE   . ARG A 1 11 ? -3.148  2.336   -19.137 1.00 0.00 ? 11 ARG A NE   2  
ATOM 1217  C CZ   . ARG A 1 11 ? -3.615  3.563   -19.338 1.00 0.00 ? 11 ARG A CZ   2  
ATOM 1218  N NH1  . ARG A 1 11 ? -3.185  4.279   -20.368 1.00 0.00 ? 11 ARG A NH1  2  
ATOM 1219  N NH2  . ARG A 1 11 ? -4.513  4.076   -18.508 1.00 0.00 ? 11 ARG A NH2  2  
ATOM 1220  H H    . ARG A 1 11 ? -1.266  -2.919  -19.767 1.00 0.00 ? 11 ARG A H    2  
ATOM 1221  H HA   . ARG A 1 11 ? -0.857  -1.179  -17.430 1.00 0.00 ? 11 ARG A HA   2  
ATOM 1222  H HB2  . ARG A 1 11 ? -2.645  -1.002  -19.827 1.00 0.00 ? 11 ARG A HB2  2  
ATOM 1223  H HB3  . ARG A 1 11 ? -3.109  -0.193  -18.336 1.00 0.00 ? 11 ARG A HB3  2  
ATOM 1224  H HG2  . ARG A 1 11 ? -0.967  1.028   -18.367 1.00 0.00 ? 11 ARG A HG2  2  
ATOM 1225  H HG3  . ARG A 1 11 ? -0.584  0.262   -19.910 1.00 0.00 ? 11 ARG A HG3  2  
ATOM 1226  H HD2  . ARG A 1 11 ? -1.464  2.444   -20.352 1.00 0.00 ? 11 ARG A HD2  2  
ATOM 1227  H HD3  . ARG A 1 11 ? -2.666  1.252   -20.845 1.00 0.00 ? 11 ARG A HD3  2  
ATOM 1228  H HE   . ARG A 1 11 ? -3.479  1.824   -18.370 1.00 0.00 ? 11 ARG A HE   2  
ATOM 1229  H HH11 . ARG A 1 11 ? -2.509  3.895   -20.996 1.00 0.00 ? 11 ARG A HH11 2  
ATOM 1230  H HH12 . ARG A 1 11 ? -3.539  5.203   -20.517 1.00 0.00 ? 11 ARG A HH12 2  
ATOM 1231  H HH21 . ARG A 1 11 ? -4.840  3.539   -17.730 1.00 0.00 ? 11 ARG A HH21 2  
ATOM 1232  H HH22 . ARG A 1 11 ? -4.864  5.000   -18.659 1.00 0.00 ? 11 ARG A HH22 2  
ATOM 1233  N N    . THR A 1 12 ? -2.120  -2.999  -16.163 1.00 0.00 ? 12 THR A N    2  
ATOM 1234  C CA   . THR A 1 12 ? -2.987  -3.777  -15.287 1.00 0.00 ? 12 THR A CA   2  
ATOM 1235  C C    . THR A 1 12 ? -3.426  -2.957  -14.079 1.00 0.00 ? 12 THR A C    2  
ATOM 1236  O O    . THR A 1 12 ? -2.744  -2.932  -13.054 1.00 0.00 ? 12 THR A O    2  
ATOM 1237  C CB   . THR A 1 12 ? -2.288  -5.059  -14.797 1.00 0.00 ? 12 THR A CB   2  
ATOM 1238  O OG1  . THR A 1 12 ? -1.885  -5.855  -15.917 1.00 0.00 ? 12 THR A OG1  2  
ATOM 1239  C CG2  . THR A 1 12 ? -3.210  -5.868  -13.898 1.00 0.00 ? 12 THR A CG2  2  
ATOM 1240  H H    . THR A 1 12 ? -1.175  -2.891  -15.927 1.00 0.00 ? 12 THR A H    2  
ATOM 1241  H HA   . THR A 1 12 ? -3.862  -4.063  -15.853 1.00 0.00 ? 12 THR A HA   2  
ATOM 1242  H HB   . THR A 1 12 ? -1.411  -4.778  -14.231 1.00 0.00 ? 12 THR A HB   2  
ATOM 1243  H HG1  . THR A 1 12 ? -1.190  -6.460  -15.646 1.00 0.00 ? 12 THR A HG1  2  
ATOM 1244  H HG21 . THR A 1 12 ? -2.852  -5.821  -12.880 1.00 0.00 ? 12 THR A HG21 2  
ATOM 1245  H HG22 . THR A 1 12 ? -3.223  -6.896  -14.228 1.00 0.00 ? 12 THR A HG22 2  
ATOM 1246  H HG23 . THR A 1 12 ? -4.208  -5.461  -13.947 1.00 0.00 ? 12 THR A HG23 2  
ATOM 1247  N N    . ARG A 1 13 ? -4.567  -2.289  -14.205 1.00 0.00 ? 13 ARG A N    2  
ATOM 1248  C CA   . ARG A 1 13 ? -5.096  -1.468  -13.123 1.00 0.00 ? 13 ARG A CA   2  
ATOM 1249  C C    . ARG A 1 13 ? -5.735  -2.337  -12.044 1.00 0.00 ? 13 ARG A C    2  
ATOM 1250  O O    . ARG A 1 13 ? -6.682  -3.078  -12.308 1.00 0.00 ? 13 ARG A O    2  
ATOM 1251  C CB   . ARG A 1 13 ? -6.123  -0.472  -13.665 1.00 0.00 ? 13 ARG A CB   2  
ATOM 1252  C CG   . ARG A 1 13 ? -6.771  0.382   -12.587 1.00 0.00 ? 13 ARG A CG   2  
ATOM 1253  C CD   . ARG A 1 13 ? -7.939  1.185   -13.139 1.00 0.00 ? 13 ARG A CD   2  
ATOM 1254  N NE   . ARG A 1 13 ? -9.165  0.394   -13.202 1.00 0.00 ? 13 ARG A NE   2  
ATOM 1255  C CZ   . ARG A 1 13 ? -9.975  0.210   -12.166 1.00 0.00 ? 13 ARG A CZ   2  
ATOM 1256  N NH1  . ARG A 1 13 ? -9.690  0.757   -10.992 1.00 0.00 ? 13 ARG A NH1  2  
ATOM 1257  N NH2  . ARG A 1 13 ? -11.073 -0.523  -12.302 1.00 0.00 ? 13 ARG A NH2  2  
ATOM 1258  H H    . ARG A 1 13 ? -5.066  -2.349  -15.047 1.00 0.00 ? 13 ARG A H    2  
ATOM 1259  H HA   . ARG A 1 13 ? -4.273  -0.922  -12.688 1.00 0.00 ? 13 ARG A HA   2  
ATOM 1260  H HB2  . ARG A 1 13 ? -5.634  0.186   -14.368 1.00 0.00 ? 13 ARG A HB2  2  
ATOM 1261  H HB3  . ARG A 1 13 ? -6.901  -1.018  -14.176 1.00 0.00 ? 13 ARG A HB3  2  
ATOM 1262  H HG2  . ARG A 1 13 ? -7.132  -0.262  -11.799 1.00 0.00 ? 13 ARG A HG2  2  
ATOM 1263  H HG3  . ARG A 1 13 ? -6.033  1.063   -12.189 1.00 0.00 ? 13 ARG A HG3  2  
ATOM 1264  H HD2  . ARG A 1 13 ? -8.105  2.039   -12.500 1.00 0.00 ? 13 ARG A HD2  2  
ATOM 1265  H HD3  . ARG A 1 13 ? -7.687  1.523   -14.133 1.00 0.00 ? 13 ARG A HD3  2  
ATOM 1266  H HE   . ARG A 1 13 ? -9.394  -0.020  -14.060 1.00 0.00 ? 13 ARG A HE   2  
ATOM 1267  H HH11 . ARG A 1 13 ? -8.864  1.311   -10.887 1.00 0.00 ? 13 ARG A HH11 2  
ATOM 1268  H HH12 . ARG A 1 13 ? -10.302 0.618   -10.213 1.00 0.00 ? 13 ARG A HH12 2  
ATOM 1269  H HH21 . ARG A 1 13 ? -11.291 -0.937  -13.185 1.00 0.00 ? 13 ARG A HH21 2  
ATOM 1270  H HH22 . ARG A 1 13 ? -11.681 -0.661  -11.521 1.00 0.00 ? 13 ARG A HH22 2  
ATOM 1271  N N    . PHE A 1 14 ? -5.210  -2.241  -10.826 1.00 0.00 ? 14 PHE A N    2  
ATOM 1272  C CA   . PHE A 1 14 ? -5.728  -3.019  -9.707  1.00 0.00 ? 14 PHE A CA   2  
ATOM 1273  C C    . PHE A 1 14 ? -6.913  -2.313  -9.055  1.00 0.00 ? 14 PHE A C    2  
ATOM 1274  O O    . PHE A 1 14 ? -7.185  -1.144  -9.334  1.00 0.00 ? 14 PHE A O    2  
ATOM 1275  C CB   . PHE A 1 14 ? -4.628  -3.255  -8.671  1.00 0.00 ? 14 PHE A CB   2  
ATOM 1276  C CG   . PHE A 1 14 ? -3.328  -3.712  -9.269  1.00 0.00 ? 14 PHE A CG   2  
ATOM 1277  C CD1  . PHE A 1 14 ? -2.399  -2.792  -9.725  1.00 0.00 ? 14 PHE A CD1  2  
ATOM 1278  C CD2  . PHE A 1 14 ? -3.037  -5.063  -9.376  1.00 0.00 ? 14 PHE A CD2  2  
ATOM 1279  C CE1  . PHE A 1 14 ? -1.202  -3.209  -10.276 1.00 0.00 ? 14 PHE A CE1  2  
ATOM 1280  C CE2  . PHE A 1 14 ? -1.841  -5.486  -9.926  1.00 0.00 ? 14 PHE A CE2  2  
ATOM 1281  C CZ   . PHE A 1 14 ? -0.923  -4.558  -10.378 1.00 0.00 ? 14 PHE A CZ   2  
ATOM 1282  H H    . PHE A 1 14 ? -4.456  -1.632  -10.678 1.00 0.00 ? 14 PHE A H    2  
ATOM 1283  H HA   . PHE A 1 14 ? -6.059  -3.972  -10.092 1.00 0.00 ? 14 PHE A HA   2  
ATOM 1284  H HB2  . PHE A 1 14 ? -4.442  -2.335  -8.138  1.00 0.00 ? 14 PHE A HB2  2  
ATOM 1285  H HB3  . PHE A 1 14 ? -4.957  -4.011  -7.973  1.00 0.00 ? 14 PHE A HB3  2  
ATOM 1286  H HD1  . PHE A 1 14 ? -2.616  -1.736  -9.647  1.00 0.00 ? 14 PHE A HD1  2  
ATOM 1287  H HD2  . PHE A 1 14 ? -3.754  -5.790  -9.025  1.00 0.00 ? 14 PHE A HD2  2  
ATOM 1288  H HE1  . PHE A 1 14 ? -0.486  -2.481  -10.629 1.00 0.00 ? 14 PHE A HE1  2  
ATOM 1289  H HE2  . PHE A 1 14 ? -1.626  -6.541  -10.005 1.00 0.00 ? 14 PHE A HE2  2  
ATOM 1290  H HZ   . PHE A 1 14 ? 0.011   -4.886  -10.808 1.00 0.00 ? 14 PHE A HZ   2  
ATOM 1291  N N    . THR A 1 15 ? -7.617  -3.030  -8.185  1.00 0.00 ? 15 THR A N    2  
ATOM 1292  C CA   . THR A 1 15 ? -8.774  -2.474  -7.494  1.00 0.00 ? 15 THR A CA   2  
ATOM 1293  C C    . THR A 1 15 ? -8.477  -2.252  -6.016  1.00 0.00 ? 15 THR A C    2  
ATOM 1294  O O    . THR A 1 15 ? -7.655  -2.954  -5.426  1.00 0.00 ? 15 THR A O    2  
ATOM 1295  C CB   . THR A 1 15 ? -10.003 -3.393  -7.628  1.00 0.00 ? 15 THR A CB   2  
ATOM 1296  O OG1  . THR A 1 15 ? -11.030 -2.972  -6.723  1.00 0.00 ? 15 THR A OG1  2  
ATOM 1297  C CG2  . THR A 1 15 ? -9.630  -4.840  -7.341  1.00 0.00 ? 15 THR A CG2  2  
ATOM 1298  H H    . THR A 1 15 ? -7.351  -3.956  -8.005  1.00 0.00 ? 15 THR A H    2  
ATOM 1299  H HA   . THR A 1 15 ? -9.010  -1.524  -7.951  1.00 0.00 ? 15 THR A HA   2  
ATOM 1300  H HB   . THR A 1 15 ? -10.375 -3.327  -8.640  1.00 0.00 ? 15 THR A HB   2  
ATOM 1301  H HG1  . THR A 1 15 ? -11.847 -3.432  -6.930  1.00 0.00 ? 15 THR A HG1  2  
ATOM 1302  H HG21 . THR A 1 15 ? -10.507 -5.463  -7.433  1.00 0.00 ? 15 THR A HG21 2  
ATOM 1303  H HG22 . THR A 1 15 ? -9.235  -4.919  -6.339  1.00 0.00 ? 15 THR A HG22 2  
ATOM 1304  H HG23 . THR A 1 15 ? -8.883  -5.166  -8.049  1.00 0.00 ? 15 THR A HG23 2  
ATOM 1305  N N    . ASP A 1 16 ? -9.151  -1.274  -5.422  1.00 0.00 ? 16 ASP A N    2  
ATOM 1306  C CA   . ASP A 1 16 ? -8.961  -0.960  -4.011  1.00 0.00 ? 16 ASP A CA   2  
ATOM 1307  C C    . ASP A 1 16 ? -8.682  -2.226  -3.206  1.00 0.00 ? 16 ASP A C    2  
ATOM 1308  O O    . ASP A 1 16 ? -7.766  -2.263  -2.385  1.00 0.00 ? 16 ASP A O    2  
ATOM 1309  C CB   . ASP A 1 16 ? -10.194 -0.248  -3.454  1.00 0.00 ? 16 ASP A CB   2  
ATOM 1310  C CG   . ASP A 1 16 ? -10.726 0.812   -4.398  1.00 0.00 ? 16 ASP A CG   2  
ATOM 1311  O OD1  . ASP A 1 16 ? -9.914  1.607   -4.917  1.00 0.00 ? 16 ASP A OD1  2  
ATOM 1312  O OD2  . ASP A 1 16 ? -11.955 0.847   -4.619  1.00 0.00 ? 16 ASP A OD2  2  
ATOM 1313  H H    . ASP A 1 16 ? -9.793  -0.749  -5.946  1.00 0.00 ? 16 ASP A H    2  
ATOM 1314  H HA   . ASP A 1 16 ? -8.109  -0.302  -3.929  1.00 0.00 ? 16 ASP A HA   2  
ATOM 1315  H HB2  . ASP A 1 16 ? -10.975 -0.975  -3.282  1.00 0.00 ? 16 ASP A HB2  2  
ATOM 1316  H HB3  . ASP A 1 16 ? -9.936  0.225   -2.518  1.00 0.00 ? 16 ASP A HB3  2  
ATOM 1317  N N    . TYR A 1 17 ? -9.479  -3.261  -3.447  1.00 0.00 ? 17 TYR A N    2  
ATOM 1318  C CA   . TYR A 1 17 ? -9.321  -4.528  -2.743  1.00 0.00 ? 17 TYR A CA   2  
ATOM 1319  C C    . TYR A 1 17 ? -7.897  -5.058  -2.887  1.00 0.00 ? 17 TYR A C    2  
ATOM 1320  O O    . TYR A 1 17 ? -7.283  -5.489  -1.912  1.00 0.00 ? 17 TYR A O    2  
ATOM 1321  C CB   . TYR A 1 17 ? -10.317 -5.559  -3.275  1.00 0.00 ? 17 TYR A CB   2  
ATOM 1322  C CG   . TYR A 1 17 ? -9.894  -6.991  -3.034  1.00 0.00 ? 17 TYR A CG   2  
ATOM 1323  C CD1  . TYR A 1 17 ? -9.445  -7.402  -1.785  1.00 0.00 ? 17 TYR A CD1  2  
ATOM 1324  C CD2  . TYR A 1 17 ? -9.941  -7.931  -4.055  1.00 0.00 ? 17 TYR A CD2  2  
ATOM 1325  C CE1  . TYR A 1 17 ? -9.056  -8.709  -1.560  1.00 0.00 ? 17 TYR A CE1  2  
ATOM 1326  C CE2  . TYR A 1 17 ? -9.556  -9.240  -3.839  1.00 0.00 ? 17 TYR A CE2  2  
ATOM 1327  C CZ   . TYR A 1 17 ? -9.114  -9.624  -2.590  1.00 0.00 ? 17 TYR A CZ   2  
ATOM 1328  O OH   . TYR A 1 17 ? -8.728  -10.927 -2.372  1.00 0.00 ? 17 TYR A OH   2  
ATOM 1329  H H    . TYR A 1 17 ? -10.192 -3.171  -4.114  1.00 0.00 ? 17 TYR A H    2  
ATOM 1330  H HA   . TYR A 1 17 ? -9.523  -4.353  -1.696  1.00 0.00 ? 17 TYR A HA   2  
ATOM 1331  H HB2  . TYR A 1 17 ? -11.271 -5.411  -2.792  1.00 0.00 ? 17 TYR A HB2  2  
ATOM 1332  H HB3  . TYR A 1 17 ? -10.433 -5.422  -4.340  1.00 0.00 ? 17 TYR A HB3  2  
ATOM 1333  H HD1  . TYR A 1 17 ? -9.400  -6.683  -0.980  1.00 0.00 ? 17 TYR A HD1  2  
ATOM 1334  H HD2  . TYR A 1 17 ? -10.288 -7.627  -5.032  1.00 0.00 ? 17 TYR A HD2  2  
ATOM 1335  H HE1  . TYR A 1 17 ? -8.710  -9.010  -0.582  1.00 0.00 ? 17 TYR A HE1  2  
ATOM 1336  H HE2  . TYR A 1 17 ? -9.601  -9.957  -4.646  1.00 0.00 ? 17 TYR A HE2  2  
ATOM 1337  H HH   . TYR A 1 17 ? -9.496  -11.500 -2.420  1.00 0.00 ? 17 TYR A HH   2  
ATOM 1338  N N    . GLN A 1 18 ? -7.381  -5.020  -4.111  1.00 0.00 ? 18 GLN A N    2  
ATOM 1339  C CA   . GLN A 1 18 ? -6.030  -5.496  -4.384  1.00 0.00 ? 18 GLN A CA   2  
ATOM 1340  C C    . GLN A 1 18 ? -4.990  -4.494  -3.894  1.00 0.00 ? 18 GLN A C    2  
ATOM 1341  O O    . GLN A 1 18 ? -4.061  -4.852  -3.169  1.00 0.00 ? 18 GLN A O    2  
ATOM 1342  C CB   . GLN A 1 18 ? -5.848  -5.747  -5.882  1.00 0.00 ? 18 GLN A CB   2  
ATOM 1343  C CG   . GLN A 1 18 ? -6.846  -6.738  -6.459  1.00 0.00 ? 18 GLN A CG   2  
ATOM 1344  C CD   . GLN A 1 18 ? -6.287  -7.509  -7.639  1.00 0.00 ? 18 GLN A CD   2  
ATOM 1345  O OE1  . GLN A 1 18 ? -5.807  -6.922  -8.608  1.00 0.00 ? 18 GLN A OE1  2  
ATOM 1346  N NE2  . GLN A 1 18 ? -6.348  -8.834  -7.562  1.00 0.00 ? 18 GLN A NE2  2  
ATOM 1347  H H    . GLN A 1 18 ? -7.920  -4.665  -4.847  1.00 0.00 ? 18 GLN A H    2  
ATOM 1348  H HA   . GLN A 1 18 ? -5.893  -6.426  -3.854  1.00 0.00 ? 18 GLN A HA   2  
ATOM 1349  H HB2  . GLN A 1 18 ? -5.958  -4.810  -6.408  1.00 0.00 ? 18 GLN A HB2  2  
ATOM 1350  H HB3  . GLN A 1 18 ? -4.853  -6.131  -6.053  1.00 0.00 ? 18 GLN A HB3  2  
ATOM 1351  H HG2  . GLN A 1 18 ? -7.123  -7.441  -5.688  1.00 0.00 ? 18 GLN A HG2  2  
ATOM 1352  H HG3  . GLN A 1 18 ? -7.723  -6.197  -6.784  1.00 0.00 ? 18 GLN A HG3  2  
ATOM 1353  H HE21 . GLN A 1 18 ? -6.745  -9.233  -6.759  1.00 0.00 ? 18 GLN A HE21 2  
ATOM 1354  H HE22 . GLN A 1 18 ? -5.995  -9.357  -8.310  1.00 0.00 ? 18 GLN A HE22 2  
ATOM 1355  N N    . LEU A 1 19 ? -5.152  -3.238  -4.295  1.00 0.00 ? 19 LEU A N    2  
ATOM 1356  C CA   . LEU A 1 19 ? -4.226  -2.183  -3.897  1.00 0.00 ? 19 LEU A CA   2  
ATOM 1357  C C    . LEU A 1 19 ? -4.079  -2.132  -2.379  1.00 0.00 ? 19 LEU A C    2  
ATOM 1358  O O    . LEU A 1 19 ? -3.031  -1.749  -1.860  1.00 0.00 ? 19 LEU A O    2  
ATOM 1359  C CB   . LEU A 1 19 ? -4.710  -0.829  -4.420  1.00 0.00 ? 19 LEU A CB   2  
ATOM 1360  C CG   . LEU A 1 19 ? -4.556  -0.596  -5.923  1.00 0.00 ? 19 LEU A CG   2  
ATOM 1361  C CD1  . LEU A 1 19 ? -5.190  0.726   -6.326  1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1362  C CD2  . LEU A 1 19 ? -3.087  -0.629  -6.320  1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1363  H H    . LEU A 1 19 ? -5.911  -3.014  -4.872  1.00 0.00 ? 19 LEU A H    2  
ATOM 1364  H HA   . LEU A 1 19 ? -3.263  -2.405  -4.332  1.00 0.00 ? 19 LEU A HA   2  
ATOM 1365  H HB2  . LEU A 1 19 ? -5.757  -0.736  -4.176  1.00 0.00 ? 19 LEU A HB2  2  
ATOM 1366  H HB3  . LEU A 1 19 ? -4.152  -0.059  -3.906  1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1367  H HG   . LEU A 1 19 ? -5.066  -1.386  -6.457  1.00 0.00 ? 19 LEU A HG   2  
ATOM 1368  H HD11 . LEU A 1 19 ? -5.269  0.774   -7.402  1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1369  H HD12 . LEU A 1 19 ? -4.575  1.542   -5.974  1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1370  H HD13 . LEU A 1 19 ? -6.174  0.802   -5.887  1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1371  H HD21 . LEU A 1 19 ? -2.557  0.155   -5.800  1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1372  H HD22 . LEU A 1 19 ? -2.999  -0.477  -7.386  1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1373  H HD23 . LEU A 1 19 ? -2.664  -1.587  -6.056  1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1374  N N    . ARG A 1 20 ? -5.136  -2.522  -1.674  1.00 0.00 ? 20 ARG A N    2  
ATOM 1375  C CA   . ARG A 1 20 ? -5.124  -2.521  -0.216  1.00 0.00 ? 20 ARG A CA   2  
ATOM 1376  C C    . ARG A 1 20 ? -4.105  -3.523  0.319   1.00 0.00 ? 20 ARG A C    2  
ATOM 1377  O O    . ARG A 1 20 ? -3.269  -3.185  1.158   1.00 0.00 ? 20 ARG A O    2  
ATOM 1378  C CB   . ARG A 1 20 ? -6.515  -2.853  0.327   1.00 0.00 ? 20 ARG A CB   2  
ATOM 1379  C CG   . ARG A 1 20 ? -6.696  -2.500  1.794   1.00 0.00 ? 20 ARG A CG   2  
ATOM 1380  C CD   . ARG A 1 20 ? -6.225  -3.627  2.700   1.00 0.00 ? 20 ARG A CD   2  
ATOM 1381  N NE   . ARG A 1 20 ? -5.945  -3.158  4.055   1.00 0.00 ? 20 ARG A NE   2  
ATOM 1382  C CZ   . ARG A 1 20 ? -5.965  -3.947  5.124   1.00 0.00 ? 20 ARG A CZ   2  
ATOM 1383  N NH1  . ARG A 1 20 ? -6.249  -5.236  4.996   1.00 0.00 ? 20 ARG A NH1  2  
ATOM 1384  N NH2  . ARG A 1 20 ? -5.699  -3.447  6.324   1.00 0.00 ? 20 ARG A NH2  2  
ATOM 1385  H H    . ARG A 1 20 ? -5.943  -2.816  -2.145  1.00 0.00 ? 20 ARG A H    2  
ATOM 1386  H HA   . ARG A 1 20 ? -4.845  -1.531  0.113   1.00 0.00 ? 20 ARG A HA   2  
ATOM 1387  H HB2  . ARG A 1 20 ? -7.252  -2.309  -0.246  1.00 0.00 ? 20 ARG A HB2  2  
ATOM 1388  H HB3  . ARG A 1 20 ? -6.690  -3.912  0.209   1.00 0.00 ? 20 ARG A HB3  2  
ATOM 1389  H HG2  . ARG A 1 20 ? -6.123  -1.612  2.014   1.00 0.00 ? 20 ARG A HG2  2  
ATOM 1390  H HG3  . ARG A 1 20 ? -7.743  -2.312  1.982   1.00 0.00 ? 20 ARG A HG3  2  
ATOM 1391  H HD2  . ARG A 1 20 ? -6.995  -4.383  2.743   1.00 0.00 ? 20 ARG A HD2  2  
ATOM 1392  H HD3  . ARG A 1 20 ? -5.325  -4.053  2.283   1.00 0.00 ? 20 ARG A HD3  2  
ATOM 1393  H HE   . ARG A 1 20 ? -5.733  -2.209  4.172   1.00 0.00 ? 20 ARG A HE   2  
ATOM 1394  H HH11 . ARG A 1 20 ? -6.448  -5.616  4.093   1.00 0.00 ? 20 ARG A HH11 2  
ATOM 1395  H HH12 . ARG A 1 20 ? -6.261  -5.827  5.802   1.00 0.00 ? 20 ARG A HH12 2  
ATOM 1396  H HH21 . ARG A 1 20 ? -5.484  -2.476  6.424   1.00 0.00 ? 20 ARG A HH21 2  
ATOM 1397  H HH22 . ARG A 1 20 ? -5.714  -4.041  7.127   1.00 0.00 ? 20 ARG A HH22 2  
ATOM 1398  N N    . VAL A 1 21 ? -4.180  -4.756  -0.171  1.00 0.00 ? 21 VAL A N    2  
ATOM 1399  C CA   . VAL A 1 21 ? -3.265  -5.807  0.258   1.00 0.00 ? 21 VAL A CA   2  
ATOM 1400  C C    . VAL A 1 21 ? -1.843  -5.522  -0.212  1.00 0.00 ? 21 VAL A C    2  
ATOM 1401  O O    . VAL A 1 21 ? -0.880  -5.723  0.529   1.00 0.00 ? 21 VAL A O    2  
ATOM 1402  C CB   . VAL A 1 21 ? -3.703  -7.184  -0.273  1.00 0.00 ? 21 VAL A CB   2  
ATOM 1403  C CG1  . VAL A 1 21 ? -2.733  -8.265  0.180   1.00 0.00 ? 21 VAL A CG1  2  
ATOM 1404  C CG2  . VAL A 1 21 ? -5.119  -7.504  0.181   1.00 0.00 ? 21 VAL A CG2  2  
ATOM 1405  H H    . VAL A 1 21 ? -4.868  -4.964  -0.837  1.00 0.00 ? 21 VAL A H    2  
ATOM 1406  H HA   . VAL A 1 21 ? -3.277  -5.840  1.338   1.00 0.00 ? 21 VAL A HA   2  
ATOM 1407  H HB   . VAL A 1 21 ? -3.692  -7.152  -1.353  1.00 0.00 ? 21 VAL A HB   2  
ATOM 1408  H HG11 . VAL A 1 21 ? -2.753  -9.084  -0.524  1.00 0.00 ? 21 VAL A HG11 2  
ATOM 1409  H HG12 . VAL A 1 21 ? -1.735  -7.855  0.230   1.00 0.00 ? 21 VAL A HG12 2  
ATOM 1410  H HG13 . VAL A 1 21 ? -3.024  -8.623  1.156   1.00 0.00 ? 21 VAL A HG13 2  
ATOM 1411  H HG21 . VAL A 1 21 ? -5.191  -7.376  1.251   1.00 0.00 ? 21 VAL A HG21 2  
ATOM 1412  H HG22 . VAL A 1 21 ? -5.814  -6.836  -0.308  1.00 0.00 ? 21 VAL A HG22 2  
ATOM 1413  H HG23 . VAL A 1 21 ? -5.360  -8.524  -0.078  1.00 0.00 ? 21 VAL A HG23 2  
ATOM 1414  N N    . LEU A 1 22 ? -1.718  -5.051  -1.448  1.00 0.00 ? 22 LEU A N    2  
ATOM 1415  C CA   . LEU A 1 22 ? -0.412  -4.738  -2.019  1.00 0.00 ? 22 LEU A CA   2  
ATOM 1416  C C    . LEU A 1 22 ? 0.256   -3.599  -1.256  1.00 0.00 ? 22 LEU A C    2  
ATOM 1417  O O    . LEU A 1 22 ? 1.438   -3.674  -0.920  1.00 0.00 ? 22 LEU A O    2  
ATOM 1418  C CB   . LEU A 1 22 ? -0.556  -4.362  -3.495  1.00 0.00 ? 22 LEU A CB   2  
ATOM 1419  C CG   . LEU A 1 22 ? -1.086  -5.460  -4.419  1.00 0.00 ? 22 LEU A CG   2  
ATOM 1420  C CD1  . LEU A 1 22 ? -1.468  -4.880  -5.772  1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1421  C CD2  . LEU A 1 22 ? -0.051  -6.564  -4.582  1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1422  H H    . LEU A 1 22 ? -2.521  -4.912  -1.991  1.00 0.00 ? 22 LEU A H    2  
ATOM 1423  H HA   . LEU A 1 22 ? 0.205   -5.620  -1.939  1.00 0.00 ? 22 LEU A HA   2  
ATOM 1424  H HB2  . LEU A 1 22 ? -1.231  -3.523  -3.558  1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1425  H HB3  . LEU A 1 22 ? 0.419   -4.066  -3.856  1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1426  H HG   . LEU A 1 22 ? -1.973  -5.894  -3.979  1.00 0.00 ? 22 LEU A HG   2  
ATOM 1427  H HD11 . LEU A 1 22 ? -2.475  -4.495  -5.727  1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1428  H HD12 . LEU A 1 22 ? -1.411  -5.654  -6.523  1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1429  H HD13 . LEU A 1 22 ? -0.787  -4.081  -6.026  1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1430  H HD21 . LEU A 1 22 ? 0.940   -6.138  -4.536  1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1431  H HD22 . LEU A 1 22 ? -0.191  -7.049  -5.538  1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1432  H HD23 . LEU A 1 22 ? -0.170  -7.288  -3.790  1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1433  N N    . GLN A 1 23 ? -0.509  -2.547  -0.983  1.00 0.00 ? 23 GLN A N    2  
ATOM 1434  C CA   . GLN A 1 23 ? 0.010   -1.393  -0.258  1.00 0.00 ? 23 GLN A CA   2  
ATOM 1435  C C    . GLN A 1 23 ? 0.295   -1.749  1.198   1.00 0.00 ? 23 GLN A C    2  
ATOM 1436  O O    . GLN A 1 23 ? 1.276   -1.286  1.780   1.00 0.00 ? 23 GLN A O    2  
ATOM 1437  C CB   . GLN A 1 23 ? -0.983  -0.232  -0.327  1.00 0.00 ? 23 GLN A CB   2  
ATOM 1438  C CG   . GLN A 1 23 ? -0.352  1.125   -0.060  1.00 0.00 ? 23 GLN A CG   2  
ATOM 1439  C CD   . GLN A 1 23 ? 0.494   1.138   1.198   1.00 0.00 ? 23 GLN A CD   2  
ATOM 1440  O OE1  . GLN A 1 23 ? 0.014   0.820   2.286   1.00 0.00 ? 23 GLN A OE1  2  
ATOM 1441  N NE2  . GLN A 1 23 ? 1.762   1.506   1.055   1.00 0.00 ? 23 GLN A NE2  2  
ATOM 1442  H H    . GLN A 1 23 ? -1.443  -2.546  -1.277  1.00 0.00 ? 23 GLN A H    2  
ATOM 1443  H HA   . GLN A 1 23 ? 0.934   -1.093  -0.729  1.00 0.00 ? 23 GLN A HA   2  
ATOM 1444  H HB2  . GLN A 1 23 ? -1.427  -0.211  -1.311  1.00 0.00 ? 23 GLN A HB2  2  
ATOM 1445  H HB3  . GLN A 1 23 ? -1.759  -0.394  0.407   1.00 0.00 ? 23 GLN A HB3  2  
ATOM 1446  H HG2  . GLN A 1 23 ? 0.275   1.388   -0.899  1.00 0.00 ? 23 GLN A HG2  2  
ATOM 1447  H HG3  . GLN A 1 23 ? -1.138  1.859   0.045   1.00 0.00 ? 23 GLN A HG3  2  
ATOM 1448  H HE21 . GLN A 1 23 ? 2.075   1.747   0.158   1.00 0.00 ? 23 GLN A HE21 2  
ATOM 1449  H HE22 . GLN A 1 23 ? 2.331   1.525   1.852   1.00 0.00 ? 23 GLN A HE22 2  
ATOM 1450  N N    . ASP A 1 24 ? -0.569  -2.572  1.780   1.00 0.00 ? 24 ASP A N    2  
ATOM 1451  C CA   . ASP A 1 24 ? -0.411  -2.991  3.168   1.00 0.00 ? 24 ASP A CA   2  
ATOM 1452  C C    . ASP A 1 24 ? 0.873   -3.796  3.350   1.00 0.00 ? 24 ASP A C    2  
ATOM 1453  O O    . ASP A 1 24 ? 1.559   -3.669  4.364   1.00 0.00 ? 24 ASP A O    2  
ATOM 1454  C CB   . ASP A 1 24 ? -1.615  -3.821  3.614   1.00 0.00 ? 24 ASP A CB   2  
ATOM 1455  C CG   . ASP A 1 24 ? -1.547  -4.199  5.080   1.00 0.00 ? 24 ASP A CG   2  
ATOM 1456  O OD1  . ASP A 1 24 ? -0.494  -4.715  5.511   1.00 0.00 ? 24 ASP A OD1  2  
ATOM 1457  O OD2  . ASP A 1 24 ? -2.546  -3.980  5.797   1.00 0.00 ? 24 ASP A OD2  2  
ATOM 1458  H H    . ASP A 1 24 ? -1.332  -2.908  1.264   1.00 0.00 ? 24 ASP A H    2  
ATOM 1459  H HA   . ASP A 1 24 ? -0.352  -2.102  3.778   1.00 0.00 ? 24 ASP A HA   2  
ATOM 1460  H HB2  . ASP A 1 24 ? -2.518  -3.250  3.451   1.00 0.00 ? 24 ASP A HB2  2  
ATOM 1461  H HB3  . ASP A 1 24 ? -1.657  -4.727  3.028   1.00 0.00 ? 24 ASP A HB3  2  
ATOM 1462  N N    . PHE A 1 25 ? 1.190   -4.625  2.361   1.00 0.00 ? 25 PHE A N    2  
ATOM 1463  C CA   . PHE A 1 25 ? 2.389   -5.453  2.412   1.00 0.00 ? 25 PHE A CA   2  
ATOM 1464  C C    . PHE A 1 25 ? 3.639   -4.617  2.150   1.00 0.00 ? 25 PHE A C    2  
ATOM 1465  O O    . PHE A 1 25 ? 4.722   -4.926  2.646   1.00 0.00 ? 25 PHE A O    2  
ATOM 1466  C CB   . PHE A 1 25 ? 2.296   -6.586  1.389   1.00 0.00 ? 25 PHE A CB   2  
ATOM 1467  C CG   . PHE A 1 25 ? 3.322   -7.664  1.594   1.00 0.00 ? 25 PHE A CG   2  
ATOM 1468  C CD1  . PHE A 1 25 ? 4.666   -7.410  1.376   1.00 0.00 ? 25 PHE A CD1  2  
ATOM 1469  C CD2  . PHE A 1 25 ? 2.941   -8.932  2.003   1.00 0.00 ? 25 PHE A CD2  2  
ATOM 1470  C CE1  . PHE A 1 25 ? 5.613   -8.400  1.564   1.00 0.00 ? 25 PHE A CE1  2  
ATOM 1471  C CE2  . PHE A 1 25 ? 3.883   -9.926  2.194   1.00 0.00 ? 25 PHE A CE2  2  
ATOM 1472  C CZ   . PHE A 1 25 ? 5.220   -9.660  1.972   1.00 0.00 ? 25 PHE A CZ   2  
ATOM 1473  H H    . PHE A 1 25 ? 0.602   -4.682  1.578   1.00 0.00 ? 25 PHE A H    2  
ATOM 1474  H HA   . PHE A 1 25 ? 2.456   -5.877  3.402   1.00 0.00 ? 25 PHE A HA   2  
ATOM 1475  H HB2  . PHE A 1 25 ? 1.320   -7.042  1.454   1.00 0.00 ? 25 PHE A HB2  2  
ATOM 1476  H HB3  . PHE A 1 25 ? 2.434   -6.180  0.398   1.00 0.00 ? 25 PHE A HB3  2  
ATOM 1477  H HD1  . PHE A 1 25 ? 4.975   -6.425  1.056   1.00 0.00 ? 25 PHE A HD1  2  
ATOM 1478  H HD2  . PHE A 1 25 ? 1.896   -9.142  2.176   1.00 0.00 ? 25 PHE A HD2  2  
ATOM 1479  H HE1  . PHE A 1 25 ? 6.658   -8.188  1.390   1.00 0.00 ? 25 PHE A HE1  2  
ATOM 1480  H HE2  . PHE A 1 25 ? 3.574   -10.910 2.513   1.00 0.00 ? 25 PHE A HE2  2  
ATOM 1481  H HZ   . PHE A 1 25 ? 5.958   -10.434 2.121   1.00 0.00 ? 25 PHE A HZ   2  
ATOM 1482  N N    . PHE A 1 26 ? 3.479   -3.556  1.365   1.00 0.00 ? 26 PHE A N    2  
ATOM 1483  C CA   . PHE A 1 26 ? 4.594   -2.675  1.034   1.00 0.00 ? 26 PHE A CA   2  
ATOM 1484  C C    . PHE A 1 26 ? 4.968   -1.800  2.227   1.00 0.00 ? 26 PHE A C    2  
ATOM 1485  O O    . PHE A 1 26 ? 6.141   -1.681  2.579   1.00 0.00 ? 26 PHE A O    2  
ATOM 1486  C CB   . PHE A 1 26 ? 4.237   -1.796  -0.166  1.00 0.00 ? 26 PHE A CB   2  
ATOM 1487  C CG   . PHE A 1 26 ? 5.319   -0.821  -0.537  1.00 0.00 ? 26 PHE A CG   2  
ATOM 1488  C CD1  . PHE A 1 26 ? 5.438   0.388   0.130   1.00 0.00 ? 26 PHE A CD1  2  
ATOM 1489  C CD2  . PHE A 1 26 ? 6.216   -1.114  -1.551  1.00 0.00 ? 26 PHE A CD2  2  
ATOM 1490  C CE1  . PHE A 1 26 ? 6.431   1.286   -0.210  1.00 0.00 ? 26 PHE A CE1  2  
ATOM 1491  C CE2  . PHE A 1 26 ? 7.211   -0.220  -1.895  1.00 0.00 ? 26 PHE A CE2  2  
ATOM 1492  C CZ   . PHE A 1 26 ? 7.320   0.982   -1.223  1.00 0.00 ? 26 PHE A CZ   2  
ATOM 1493  H H    . PHE A 1 26 ? 2.591   -3.361  0.999   1.00 0.00 ? 26 PHE A H    2  
ATOM 1494  H HA   . PHE A 1 26 ? 5.439   -3.294  0.778   1.00 0.00 ? 26 PHE A HA   2  
ATOM 1495  H HB2  . PHE A 1 26 ? 4.052   -2.426  -1.023  1.00 0.00 ? 26 PHE A HB2  2  
ATOM 1496  H HB3  . PHE A 1 26 ? 3.345   -1.233  0.062   1.00 0.00 ? 26 PHE A HB3  2  
ATOM 1497  H HD1  . PHE A 1 26 ? 4.745   0.627   0.923   1.00 0.00 ? 26 PHE A HD1  2  
ATOM 1498  H HD2  . PHE A 1 26 ? 6.132   -2.055  -2.078  1.00 0.00 ? 26 PHE A HD2  2  
ATOM 1499  H HE1  . PHE A 1 26 ? 6.514   2.225   0.317   1.00 0.00 ? 26 PHE A HE1  2  
ATOM 1500  H HE2  . PHE A 1 26 ? 7.904   -0.461  -2.687  1.00 0.00 ? 26 PHE A HE2  2  
ATOM 1501  H HZ   . PHE A 1 26 ? 8.097   1.683   -1.490  1.00 0.00 ? 26 PHE A HZ   2  
ATOM 1502  N N    . ASP A 1 27 ? 3.962   -1.190  2.844   1.00 0.00 ? 27 ASP A N    2  
ATOM 1503  C CA   . ASP A 1 27 ? 4.184   -0.326  3.998   1.00 0.00 ? 27 ASP A CA   2  
ATOM 1504  C C    . ASP A 1 27 ? 4.979   -1.054  5.077   1.00 0.00 ? 27 ASP A C    2  
ATOM 1505  O O    . ASP A 1 27 ? 5.722   -0.435  5.838   1.00 0.00 ? 27 ASP A O    2  
ATOM 1506  C CB   . ASP A 1 27 ? 2.847   0.153   4.567   1.00 0.00 ? 27 ASP A CB   2  
ATOM 1507  C CG   . ASP A 1 27 ? 3.012   1.309   5.535   1.00 0.00 ? 27 ASP A CG   2  
ATOM 1508  O OD1  . ASP A 1 27 ? 3.088   2.465   5.070   1.00 0.00 ? 27 ASP A OD1  2  
ATOM 1509  O OD2  . ASP A 1 27 ? 3.062   1.057   6.757   1.00 0.00 ? 27 ASP A OD2  2  
ATOM 1510  H H    . ASP A 1 27 ? 3.048   -1.325  2.516   1.00 0.00 ? 27 ASP A H    2  
ATOM 1511  H HA   . ASP A 1 27 ? 4.751   0.530   3.666   1.00 0.00 ? 27 ASP A HA   2  
ATOM 1512  H HB2  . ASP A 1 27 ? 2.212   0.475   3.755   1.00 0.00 ? 27 ASP A HB2  2  
ATOM 1513  H HB3  . ASP A 1 27 ? 2.372   -0.665  5.089   1.00 0.00 ? 27 ASP A HB3  2  
ATOM 1514  N N    . ALA A 1 28 ? 4.817   -2.372  5.137   1.00 0.00 ? 28 ALA A N    2  
ATOM 1515  C CA   . ALA A 1 28 ? 5.520   -3.184  6.122   1.00 0.00 ? 28 ALA A CA   2  
ATOM 1516  C C    . ALA A 1 28 ? 6.802   -3.769  5.537   1.00 0.00 ? 28 ALA A C    2  
ATOM 1517  O O    . ALA A 1 28 ? 7.839   -3.797  6.197   1.00 0.00 ? 28 ALA A O    2  
ATOM 1518  C CB   . ALA A 1 28 ? 4.616   -4.296  6.632   1.00 0.00 ? 28 ALA A CB   2  
ATOM 1519  H H    . ALA A 1 28 ? 4.211   -2.808  4.503   1.00 0.00 ? 28 ALA A H    2  
ATOM 1520  H HA   . ALA A 1 28 ? 5.775   -2.548  6.958   1.00 0.00 ? 28 ALA A HA   2  
ATOM 1521  H HB1  . ALA A 1 28 ? 5.180   -4.947  7.284   1.00 0.00 ? 28 ALA A HB1  2  
ATOM 1522  H HB2  . ALA A 1 28 ? 3.790   -3.865  7.180   1.00 0.00 ? 28 ALA A HB2  2  
ATOM 1523  H HB3  . ALA A 1 28 ? 4.236   -4.863  5.796   1.00 0.00 ? 28 ALA A HB3  2  
ATOM 1524  N N    . ASN A 1 29 ? 6.721   -4.235  4.295   1.00 0.00 ? 29 ASN A N    2  
ATOM 1525  C CA   . ASN A 1 29 ? 7.875   -4.820  3.622   1.00 0.00 ? 29 ASN A CA   2  
ATOM 1526  C C    . ASN A 1 29 ? 7.814   -4.566  2.119   1.00 0.00 ? 29 ASN A C    2  
ATOM 1527  O O    . ASN A 1 29 ? 6.812   -4.862  1.469   1.00 0.00 ? 29 ASN A O    2  
ATOM 1528  C CB   . ASN A 1 29 ? 7.941   -6.324  3.895   1.00 0.00 ? 29 ASN A CB   2  
ATOM 1529  C CG   . ASN A 1 29 ? 9.255   -6.935  3.447   1.00 0.00 ? 29 ASN A CG   2  
ATOM 1530  O OD1  . ASN A 1 29 ? 10.330  -6.468  3.824   1.00 0.00 ? 29 ASN A OD1  2  
ATOM 1531  N ND2  . ASN A 1 29 ? 9.174   -7.986  2.639   1.00 0.00 ? 29 ASN A ND2  2  
ATOM 1532  H H    . ASN A 1 29 ? 5.865   -4.184  3.820   1.00 0.00 ? 29 ASN A H    2  
ATOM 1533  H HA   . ASN A 1 29 ? 8.763   -4.352  4.019   1.00 0.00 ? 29 ASN A HA   2  
ATOM 1534  H HB2  . ASN A 1 29 ? 7.829   -6.497  4.955   1.00 0.00 ? 29 ASN A HB2  2  
ATOM 1535  H HB3  . ASN A 1 29 ? 7.138   -6.816  3.367   1.00 0.00 ? 29 ASN A HB3  2  
ATOM 1536  H HD21 . ASN A 1 29 ? 8.284   -8.304  2.381   1.00 0.00 ? 29 ASN A HD21 2  
ATOM 1537  H HD22 . ASN A 1 29 ? 10.008  -8.401  2.335   1.00 0.00 ? 29 ASN A HD22 2  
ATOM 1538  N N    . ALA A 1 30 ? 8.894   -4.017  1.573   1.00 0.00 ? 30 ALA A N    2  
ATOM 1539  C CA   . ALA A 1 30 ? 8.965   -3.726  0.147   1.00 0.00 ? 30 ALA A CA   2  
ATOM 1540  C C    . ALA A 1 30 ? 10.136  -4.455  -0.505  1.00 0.00 ? 30 ALA A C    2  
ATOM 1541  O O    . ALA A 1 30 ? 10.492  -4.177  -1.650  1.00 0.00 ? 30 ALA A O    2  
ATOM 1542  C CB   . ALA A 1 30 ? 9.082   -2.226  -0.081  1.00 0.00 ? 30 ALA A CB   2  
ATOM 1543  H H    . ALA A 1 30 ? 9.662   -3.804  2.143   1.00 0.00 ? 30 ALA A H    2  
ATOM 1544  H HA   . ALA A 1 30 ? 8.045   -4.064  -0.309  1.00 0.00 ? 30 ALA A HA   2  
ATOM 1545  H HB1  . ALA A 1 30 ? 9.595   -1.775  0.756   1.00 0.00 ? 30 ALA A HB1  2  
ATOM 1546  H HB2  . ALA A 1 30 ? 9.640   -2.042  -0.987  1.00 0.00 ? 30 ALA A HB2  2  
ATOM 1547  H HB3  . ALA A 1 30 ? 8.095   -1.798  -0.172  1.00 0.00 ? 30 ALA A HB3  2  
ATOM 1548  N N    . TYR A 1 31 ? 10.730  -5.387  0.232   1.00 0.00 ? 31 TYR A N    2  
ATOM 1549  C CA   . TYR A 1 31 ? 11.863  -6.153  -0.273  1.00 0.00 ? 31 TYR A CA   2  
ATOM 1550  C C    . TYR A 1 31 ? 11.685  -7.641  0.014   1.00 0.00 ? 31 TYR A C    2  
ATOM 1551  O O    . TYR A 1 31 ? 12.621  -8.340  0.403   1.00 0.00 ? 31 TYR A O    2  
ATOM 1552  C CB   . TYR A 1 31 ? 13.165  -5.653  0.354   1.00 0.00 ? 31 TYR A CB   2  
ATOM 1553  C CG   . TYR A 1 31 ? 13.268  -4.145  0.412   1.00 0.00 ? 31 TYR A CG   2  
ATOM 1554  C CD1  . TYR A 1 31 ? 12.675  -3.427  1.442   1.00 0.00 ? 31 TYR A CD1  2  
ATOM 1555  C CD2  . TYR A 1 31 ? 13.962  -3.439  -0.564  1.00 0.00 ? 31 TYR A CD2  2  
ATOM 1556  C CE1  . TYR A 1 31 ? 12.766  -2.050  1.498   1.00 0.00 ? 31 TYR A CE1  2  
ATOM 1557  C CE2  . TYR A 1 31 ? 14.060  -2.062  -0.515  1.00 0.00 ? 31 TYR A CE2  2  
ATOM 1558  C CZ   . TYR A 1 31 ? 13.460  -1.372  0.518   1.00 0.00 ? 31 TYR A CZ   2  
ATOM 1559  O OH   . TYR A 1 31 ? 13.555  0.000   0.571   1.00 0.00 ? 31 TYR A OH   2  
ATOM 1560  H H    . TYR A 1 31 ? 10.400  -5.563  1.138   1.00 0.00 ? 31 TYR A H    2  
ATOM 1561  H HA   . TYR A 1 31 ? 11.911  -6.008  -1.343  1.00 0.00 ? 31 TYR A HA   2  
ATOM 1562  H HB2  . TYR A 1 31 ? 13.238  -6.028  1.363   1.00 0.00 ? 31 TYR A HB2  2  
ATOM 1563  H HB3  . TYR A 1 31 ? 14.000  -6.021  -0.224  1.00 0.00 ? 31 TYR A HB3  2  
ATOM 1564  H HD1  . TYR A 1 31 ? 12.132  -3.961  2.209   1.00 0.00 ? 31 TYR A HD1  2  
ATOM 1565  H HD2  . TYR A 1 31 ? 14.430  -3.983  -1.372  1.00 0.00 ? 31 TYR A HD2  2  
ATOM 1566  H HE1  . TYR A 1 31 ? 12.297  -1.509  2.307   1.00 0.00 ? 31 TYR A HE1  2  
ATOM 1567  H HE2  . TYR A 1 31 ? 14.603  -1.531  -1.283  1.00 0.00 ? 31 TYR A HE2  2  
ATOM 1568  H HH   . TYR A 1 31 ? 12.676  0.383   0.524   1.00 0.00 ? 31 TYR A HH   2  
ATOM 1569  N N    . PRO A 1 32 ? 10.455  -8.138  -0.181  1.00 0.00 ? 32 PRO A N    2  
ATOM 1570  C CA   . PRO A 1 32 ? 10.125  -9.547  0.050   1.00 0.00 ? 32 PRO A CA   2  
ATOM 1571  C C    . PRO A 1 32 ? 10.767  -10.470 -0.981  1.00 0.00 ? 32 PRO A C    2  
ATOM 1572  O O    . PRO A 1 32 ? 11.145  -10.035 -2.069  1.00 0.00 ? 32 PRO A O    2  
ATOM 1573  C CB   . PRO A 1 32 ? 8.600   -9.580  -0.081  1.00 0.00 ? 32 PRO A CB   2  
ATOM 1574  C CG   . PRO A 1 32 ? 8.269   -8.420  -0.955  1.00 0.00 ? 32 PRO A CG   2  
ATOM 1575  C CD   . PRO A 1 32 ? 9.292   -7.362  -0.643  1.00 0.00 ? 32 PRO A CD   2  
ATOM 1576  H HA   . PRO A 1 32 ? 10.410  -9.864  1.042   1.00 0.00 ? 32 PRO A HA   2  
ATOM 1577  H HB2  . PRO A 1 32 ? 8.294   -10.514 -0.531  1.00 0.00 ? 32 PRO A HB2  2  
ATOM 1578  H HB3  . PRO A 1 32 ? 8.149   -9.480  0.895   1.00 0.00 ? 32 PRO A HB3  2  
ATOM 1579  H HG2  . PRO A 1 32 ? 8.335   -8.711  -1.992  1.00 0.00 ? 32 PRO A HG2  2  
ATOM 1580  H HG3  . PRO A 1 32 ? 7.277   -8.060  -0.726  1.00 0.00 ? 32 PRO A HG3  2  
ATOM 1581  H HD2  . PRO A 1 32 ? 9.533   -6.797  -1.531  1.00 0.00 ? 32 PRO A HD2  2  
ATOM 1582  H HD3  . PRO A 1 32 ? 8.932   -6.707  0.137   1.00 0.00 ? 32 PRO A HD3  2  
ATOM 1583  N N    . LYS A 1 33 ? 10.888  -11.746 -0.632  1.00 0.00 ? 33 LYS A N    2  
ATOM 1584  C CA   . LYS A 1 33 ? 11.483  -12.731 -1.526  1.00 0.00 ? 33 LYS A CA   2  
ATOM 1585  C C    . LYS A 1 33 ? 10.407  -13.472 -2.313  1.00 0.00 ? 33 LYS A C    2  
ATOM 1586  O O    . LYS A 1 33 ? 9.221   -13.383 -1.996  1.00 0.00 ? 33 LYS A O    2  
ATOM 1587  C CB   . LYS A 1 33 ? 12.326  -13.730 -0.730  1.00 0.00 ? 33 LYS A CB   2  
ATOM 1588  C CG   . LYS A 1 33 ? 13.521  -13.100 -0.035  1.00 0.00 ? 33 LYS A CG   2  
ATOM 1589  C CD   . LYS A 1 33 ? 14.624  -14.116 0.209   1.00 0.00 ? 33 LYS A CD   2  
ATOM 1590  C CE   . LYS A 1 33 ? 14.306  -15.007 1.400   1.00 0.00 ? 33 LYS A CE   2  
ATOM 1591  N NZ   . LYS A 1 33 ? 15.539  -15.589 2.002   1.00 0.00 ? 33 LYS A NZ   2  
ATOM 1592  H H    . LYS A 1 33 ? 10.568  -12.033 0.250   1.00 0.00 ? 33 LYS A H    2  
ATOM 1593  H HA   . LYS A 1 33 ? 12.122  -12.206 -2.220  1.00 0.00 ? 33 LYS A HA   2  
ATOM 1594  H HB2  . LYS A 1 33 ? 11.702  -14.192 0.021   1.00 0.00 ? 33 LYS A HB2  2  
ATOM 1595  H HB3  . LYS A 1 33 ? 12.689  -14.494 -1.403  1.00 0.00 ? 33 LYS A HB3  2  
ATOM 1596  H HG2  . LYS A 1 33 ? 13.909  -12.306 -0.656  1.00 0.00 ? 33 LYS A HG2  2  
ATOM 1597  H HG3  . LYS A 1 33 ? 13.201  -12.694 0.914   1.00 0.00 ? 33 LYS A HG3  2  
ATOM 1598  H HD2  . LYS A 1 33 ? 14.733  -14.735 -0.669  1.00 0.00 ? 33 LYS A HD2  2  
ATOM 1599  H HD3  . LYS A 1 33 ? 15.549  -13.591 0.400   1.00 0.00 ? 33 LYS A HD3  2  
ATOM 1600  H HE2  . LYS A 1 33 ? 13.795  -14.419 2.147   1.00 0.00 ? 33 LYS A HE2  2  
ATOM 1601  H HE3  . LYS A 1 33 ? 13.663  -15.810 1.071   1.00 0.00 ? 33 LYS A HE3  2  
ATOM 1602  H HZ1  . LYS A 1 33 ? 15.504  -16.627 1.951   1.00 0.00 ? 33 LYS A HZ1  2  
ATOM 1603  H HZ2  . LYS A 1 33 ? 15.618  -15.304 2.998   1.00 0.00 ? 33 LYS A HZ2  2  
ATOM 1604  H HZ3  . LYS A 1 33 ? 16.379  -15.255 1.488   1.00 0.00 ? 33 LYS A HZ3  2  
ATOM 1605  N N    . ASP A 1 34 ? 10.828  -14.203 -3.339  1.00 0.00 ? 34 ASP A N    2  
ATOM 1606  C CA   . ASP A 1 34 ? 9.900   -14.962 -4.170  1.00 0.00 ? 34 ASP A CA   2  
ATOM 1607  C C    . ASP A 1 34 ? 8.858   -15.672 -3.311  1.00 0.00 ? 34 ASP A C    2  
ATOM 1608  O O    . ASP A 1 34 ? 7.657   -15.564 -3.559  1.00 0.00 ? 34 ASP A O    2  
ATOM 1609  C CB   . ASP A 1 34 ? 10.660  -15.982 -5.020  1.00 0.00 ? 34 ASP A CB   2  
ATOM 1610  C CG   . ASP A 1 34 ? 11.740  -16.700 -4.234  1.00 0.00 ? 34 ASP A CG   2  
ATOM 1611  O OD1  . ASP A 1 34 ? 12.806  -16.093 -4.001  1.00 0.00 ? 34 ASP A OD1  2  
ATOM 1612  O OD2  . ASP A 1 34 ? 11.519  -17.869 -3.854  1.00 0.00 ? 34 ASP A OD2  2  
ATOM 1613  H H    . ASP A 1 34 ? 11.787  -14.234 -3.542  1.00 0.00 ? 34 ASP A H    2  
ATOM 1614  H HA   . ASP A 1 34 ? 9.396   -14.267 -4.824  1.00 0.00 ? 34 ASP A HA   2  
ATOM 1615  H HB2  . ASP A 1 34 ? 9.964   -16.718 -5.395  1.00 0.00 ? 34 ASP A HB2  2  
ATOM 1616  H HB3  . ASP A 1 34 ? 11.123  -15.473 -5.852  1.00 0.00 ? 34 ASP A HB3  2  
ATOM 1617  N N    . ASP A 1 35 ? 9.326   -16.398 -2.302  1.00 0.00 ? 35 ASP A N    2  
ATOM 1618  C CA   . ASP A 1 35 ? 8.435   -17.127 -1.407  1.00 0.00 ? 35 ASP A CA   2  
ATOM 1619  C C    . ASP A 1 35 ? 7.312   -16.224 -0.905  1.00 0.00 ? 35 ASP A C    2  
ATOM 1620  O O    . ASP A 1 35 ? 6.138   -16.590 -0.959  1.00 0.00 ? 35 ASP A O    2  
ATOM 1621  C CB   . ASP A 1 35 ? 9.219   -17.693 -0.222  1.00 0.00 ? 35 ASP A CB   2  
ATOM 1622  C CG   . ASP A 1 35 ? 8.601   -18.964 0.327   1.00 0.00 ? 35 ASP A CG   2  
ATOM 1623  O OD1  . ASP A 1 35 ? 8.870   -20.046 -0.236  1.00 0.00 ? 35 ASP A OD1  2  
ATOM 1624  O OD2  . ASP A 1 35 ? 7.849   -18.876 1.320   1.00 0.00 ? 35 ASP A OD2  2  
ATOM 1625  H H    . ASP A 1 35 ? 10.294  -16.445 -2.156  1.00 0.00 ? 35 ASP A H    2  
ATOM 1626  H HA   . ASP A 1 35 ? 8.001   -17.944 -1.963  1.00 0.00 ? 35 ASP A HA   2  
ATOM 1627  H HB2  . ASP A 1 35 ? 10.228  -17.913 -0.538  1.00 0.00 ? 35 ASP A HB2  2  
ATOM 1628  H HB3  . ASP A 1 35 ? 9.246   -16.956 0.568   1.00 0.00 ? 35 ASP A HB3  2  
ATOM 1629  N N    . GLU A 1 36 ? 7.682   -15.044 -0.417  1.00 0.00 ? 36 GLU A N    2  
ATOM 1630  C CA   . GLU A 1 36 ? 6.705   -14.090 0.095   1.00 0.00 ? 36 GLU A CA   2  
ATOM 1631  C C    . GLU A 1 36 ? 5.774   -13.614 -1.016  1.00 0.00 ? 36 GLU A C    2  
ATOM 1632  O O    . GLU A 1 36 ? 4.551   -13.665 -0.881  1.00 0.00 ? 36 GLU A O    2  
ATOM 1633  C CB   . GLU A 1 36 ? 7.414   -12.892 0.730   1.00 0.00 ? 36 GLU A CB   2  
ATOM 1634  C CG   . GLU A 1 36 ? 8.276   -13.258 1.926   1.00 0.00 ? 36 GLU A CG   2  
ATOM 1635  C CD   . GLU A 1 36 ? 7.512   -14.036 2.980   1.00 0.00 ? 36 GLU A CD   2  
ATOM 1636  O OE1  . GLU A 1 36 ? 7.134   -15.194 2.707   1.00 0.00 ? 36 GLU A OE1  2  
ATOM 1637  O OE2  . GLU A 1 36 ? 7.292   -13.485 4.079   1.00 0.00 ? 36 GLU A OE2  2  
ATOM 1638  H H    . GLU A 1 36 ? 8.633   -14.809 -0.402  1.00 0.00 ? 36 GLU A H    2  
ATOM 1639  H HA   . GLU A 1 36 ? 6.118   -14.590 0.850   1.00 0.00 ? 36 GLU A HA   2  
ATOM 1640  H HB2  . GLU A 1 36 ? 8.043   -12.426 -0.013  1.00 0.00 ? 36 GLU A HB2  2  
ATOM 1641  H HB3  . GLU A 1 36 ? 6.669   -12.180 1.055   1.00 0.00 ? 36 GLU A HB3  2  
ATOM 1642  H HG2  . GLU A 1 36 ? 9.104   -13.862 1.585   1.00 0.00 ? 36 GLU A HG2  2  
ATOM 1643  H HG3  . GLU A 1 36 ? 8.654   -12.351 2.373   1.00 0.00 ? 36 GLU A HG3  2  
ATOM 1644  N N    . PHE A 1 37 ? 6.361   -13.151 -2.114  1.00 0.00 ? 37 PHE A N    2  
ATOM 1645  C CA   . PHE A 1 37 ? 5.586   -12.664 -3.249  1.00 0.00 ? 37 PHE A CA   2  
ATOM 1646  C C    . PHE A 1 37 ? 4.460   -13.634 -3.594  1.00 0.00 ? 37 PHE A C    2  
ATOM 1647  O O    . PHE A 1 37 ? 3.359   -13.219 -3.955  1.00 0.00 ? 37 PHE A O    2  
ATOM 1648  C CB   . PHE A 1 37 ? 6.492   -12.464 -4.465  1.00 0.00 ? 37 PHE A CB   2  
ATOM 1649  C CG   . PHE A 1 37 ? 7.078   -11.084 -4.556  1.00 0.00 ? 37 PHE A CG   2  
ATOM 1650  C CD1  . PHE A 1 37 ? 6.372   -10.055 -5.158  1.00 0.00 ? 37 PHE A CD1  2  
ATOM 1651  C CD2  . PHE A 1 37 ? 8.335   -10.815 -4.038  1.00 0.00 ? 37 PHE A CD2  2  
ATOM 1652  C CE1  . PHE A 1 37 ? 6.909   -8.785  -5.244  1.00 0.00 ? 37 PHE A CE1  2  
ATOM 1653  C CE2  . PHE A 1 37 ? 8.877   -9.546  -4.120  1.00 0.00 ? 37 PHE A CE2  2  
ATOM 1654  C CZ   . PHE A 1 37 ? 8.162   -8.529  -4.723  1.00 0.00 ? 37 PHE A CZ   2  
ATOM 1655  H H    . PHE A 1 37 ? 7.341   -13.136 -2.162  1.00 0.00 ? 37 PHE A H    2  
ATOM 1656  H HA   . PHE A 1 37 ? 5.155   -11.714 -2.972  1.00 0.00 ? 37 PHE A HA   2  
ATOM 1657  H HB2  . PHE A 1 37 ? 7.310   -13.168 -4.416  1.00 0.00 ? 37 PHE A HB2  2  
ATOM 1658  H HB3  . PHE A 1 37 ? 5.922   -12.643 -5.364  1.00 0.00 ? 37 PHE A HB3  2  
ATOM 1659  H HD1  . PHE A 1 37 ? 5.391   -10.253 -5.565  1.00 0.00 ? 37 PHE A HD1  2  
ATOM 1660  H HD2  . PHE A 1 37 ? 8.895   -11.610 -3.566  1.00 0.00 ? 37 PHE A HD2  2  
ATOM 1661  H HE1  . PHE A 1 37 ? 6.348   -7.991  -5.715  1.00 0.00 ? 37 PHE A HE1  2  
ATOM 1662  H HE2  . PHE A 1 37 ? 9.857   -9.350  -3.712  1.00 0.00 ? 37 PHE A HE2  2  
ATOM 1663  H HZ   . PHE A 1 37 ? 8.584   -7.537  -4.788  1.00 0.00 ? 37 PHE A HZ   2  
ATOM 1664  N N    . GLU A 1 38 ? 4.745   -14.927 -3.481  1.00 0.00 ? 38 GLU A N    2  
ATOM 1665  C CA   . GLU A 1 38 ? 3.756   -15.956 -3.783  1.00 0.00 ? 38 GLU A CA   2  
ATOM 1666  C C    . GLU A 1 38 ? 2.522   -15.800 -2.899  1.00 0.00 ? 38 GLU A C    2  
ATOM 1667  O O    . GLU A 1 38 ? 1.395   -15.998 -3.351  1.00 0.00 ? 38 GLU A O    2  
ATOM 1668  C CB   . GLU A 1 38 ? 4.362   -17.348 -3.592  1.00 0.00 ? 38 GLU A CB   2  
ATOM 1669  C CG   . GLU A 1 38 ? 5.192   -17.818 -4.774  1.00 0.00 ? 38 GLU A CG   2  
ATOM 1670  C CD   . GLU A 1 38 ? 4.389   -17.890 -6.059  1.00 0.00 ? 38 GLU A CD   2  
ATOM 1671  O OE1  . GLU A 1 38 ? 3.283   -18.469 -6.036  1.00 0.00 ? 38 GLU A OE1  2  
ATOM 1672  O OE2  . GLU A 1 38 ? 4.868   -17.367 -7.087  1.00 0.00 ? 38 GLU A OE2  2  
ATOM 1673  H H    . GLU A 1 38 ? 5.641   -15.196 -3.189  1.00 0.00 ? 38 GLU A H    2  
ATOM 1674  H HA   . GLU A 1 38 ? 3.462   -15.841 -4.815  1.00 0.00 ? 38 GLU A HA   2  
ATOM 1675  H HB2  . GLU A 1 38 ? 4.994   -17.335 -2.716  1.00 0.00 ? 38 GLU A HB2  2  
ATOM 1676  H HB3  . GLU A 1 38 ? 3.562   -18.057 -3.436  1.00 0.00 ? 38 GLU A HB3  2  
ATOM 1677  H HG2  . GLU A 1 38 ? 6.012   -17.131 -4.919  1.00 0.00 ? 38 GLU A HG2  2  
ATOM 1678  H HG3  . GLU A 1 38 ? 5.582   -18.801 -4.556  1.00 0.00 ? 38 GLU A HG3  2  
ATOM 1679  N N    . GLN A 1 39 ? 2.746   -15.446 -1.638  1.00 0.00 ? 39 GLN A N    2  
ATOM 1680  C CA   . GLN A 1 39 ? 1.652   -15.265 -0.690  1.00 0.00 ? 39 GLN A CA   2  
ATOM 1681  C C    . GLN A 1 39 ? 0.628   -14.269 -1.224  1.00 0.00 ? 39 GLN A C    2  
ATOM 1682  O O    . GLN A 1 39 ? -0.579  -14.472 -1.091  1.00 0.00 ? 39 GLN A O    2  
ATOM 1683  C CB   . GLN A 1 39 ? 2.192   -14.786 0.658   1.00 0.00 ? 39 GLN A CB   2  
ATOM 1684  C CG   . GLN A 1 39 ? 3.171   -15.756 1.301   1.00 0.00 ? 39 GLN A CG   2  
ATOM 1685  C CD   . GLN A 1 39 ? 3.252   -15.591 2.806   1.00 0.00 ? 39 GLN A CD   2  
ATOM 1686  O OE1  . GLN A 1 39 ? 2.486   -16.201 3.552   1.00 0.00 ? 39 GLN A OE1  2  
ATOM 1687  N NE2  . GLN A 1 39 ? 4.185   -14.762 3.261   1.00 0.00 ? 39 GLN A NE2  2  
ATOM 1688  H H    . GLN A 1 39 ? 3.667   -15.303 -1.338  1.00 0.00 ? 39 GLN A H    2  
ATOM 1689  H HA   . GLN A 1 39 ? 1.170   -16.221 -0.556  1.00 0.00 ? 39 GLN A HA   2  
ATOM 1690  H HB2  . GLN A 1 39 ? 2.695   -13.841 0.516   1.00 0.00 ? 39 GLN A HB2  2  
ATOM 1691  H HB3  . GLN A 1 39 ? 1.362   -14.645 1.335   1.00 0.00 ? 39 GLN A HB3  2  
ATOM 1692  H HG2  . GLN A 1 39 ? 2.854   -16.765 1.082   1.00 0.00 ? 39 GLN A HG2  2  
ATOM 1693  H HG3  . GLN A 1 39 ? 4.151   -15.588 0.881   1.00 0.00 ? 39 GLN A HG3  2  
ATOM 1694  H HE21 . GLN A 1 39 ? 4.759   -14.309 2.608   1.00 0.00 ? 39 GLN A HE21 2  
ATOM 1695  H HE22 . GLN A 1 39 ? 4.260   -14.636 4.229   1.00 0.00 ? 39 GLN A HE22 2  
ATOM 1696  N N    . LEU A 1 40 ? 1.118   -13.192 -1.829  1.00 0.00 ? 40 LEU A N    2  
ATOM 1697  C CA   . LEU A 1 40 ? 0.245   -12.163 -2.384  1.00 0.00 ? 40 LEU A CA   2  
ATOM 1698  C C    . LEU A 1 40 ? -0.373  -12.625 -3.700  1.00 0.00 ? 40 LEU A C    2  
ATOM 1699  O O    . LEU A 1 40 ? -1.564  -12.427 -3.941  1.00 0.00 ? 40 LEU A O    2  
ATOM 1700  C CB   . LEU A 1 40 ? 1.026   -10.867 -2.601  1.00 0.00 ? 40 LEU A CB   2  
ATOM 1701  C CG   . LEU A 1 40 ? 1.560   -10.185 -1.341  1.00 0.00 ? 40 LEU A CG   2  
ATOM 1702  C CD1  . LEU A 1 40 ? 2.803   -9.369  -1.660  1.00 0.00 ? 40 LEU A CD1  2  
ATOM 1703  C CD2  . LEU A 1 40 ? 0.488   -9.305  -0.716  1.00 0.00 ? 40 LEU A CD2  2  
ATOM 1704  H H    . LEU A 1 40 ? 2.088   -13.086 -1.906  1.00 0.00 ? 40 LEU A H    2  
ATOM 1705  H HA   . LEU A 1 40 ? -0.547  -11.982 -1.673  1.00 0.00 ? 40 LEU A HA   2  
ATOM 1706  H HB2  . LEU A 1 40 ? 1.869   -11.091 -3.237  1.00 0.00 ? 40 LEU A HB2  2  
ATOM 1707  H HB3  . LEU A 1 40 ? 0.373   -10.168 -3.105  1.00 0.00 ? 40 LEU A HB3  2  
ATOM 1708  H HG   . LEU A 1 40 ? 1.835   -10.942 -0.619  1.00 0.00 ? 40 LEU A HG   2  
ATOM 1709  H HD11 . LEU A 1 40 ? 2.766   -8.433  -1.125  1.00 0.00 ? 40 LEU A HD11 2  
ATOM 1710  H HD12 . LEU A 1 40 ? 2.843   -9.175  -2.722  1.00 0.00 ? 40 LEU A HD12 2  
ATOM 1711  H HD13 . LEU A 1 40 ? 3.682   -9.921  -1.362  1.00 0.00 ? 40 LEU A HD13 2  
ATOM 1712  H HD21 . LEU A 1 40 ? -0.431  -9.407  -1.274  1.00 0.00 ? 40 LEU A HD21 2  
ATOM 1713  H HD22 . LEU A 1 40 ? 0.810   -8.274  -0.739  1.00 0.00 ? 40 LEU A HD22 2  
ATOM 1714  H HD23 . LEU A 1 40 ? 0.323   -9.609  0.307   1.00 0.00 ? 40 LEU A HD23 2  
ATOM 1715  N N    . SER A 1 41 ? 0.444   -13.243 -4.547  1.00 0.00 ? 41 SER A N    2  
ATOM 1716  C CA   . SER A 1 41 ? -0.022  -13.731 -5.840  1.00 0.00 ? 41 SER A CA   2  
ATOM 1717  C C    . SER A 1 41 ? -1.129  -14.766 -5.663  1.00 0.00 ? 41 SER A C    2  
ATOM 1718  O O    . SER A 1 41 ? -2.043  -14.859 -6.480  1.00 0.00 ? 41 SER A O    2  
ATOM 1719  C CB   . SER A 1 41 ? 1.140   -14.340 -6.627  1.00 0.00 ? 41 SER A CB   2  
ATOM 1720  O OG   . SER A 1 41 ? 0.677   -15.306 -7.555  1.00 0.00 ? 41 SER A OG   2  
ATOM 1721  H H    . SER A 1 41 ? 1.383   -13.370 -4.297  1.00 0.00 ? 41 SER A H    2  
ATOM 1722  H HA   . SER A 1 41 ? -0.416  -12.890 -6.389  1.00 0.00 ? 41 SER A HA   2  
ATOM 1723  H HB2  . SER A 1 41 ? 1.655   -13.559 -7.166  1.00 0.00 ? 41 SER A HB2  2  
ATOM 1724  H HB3  . SER A 1 41 ? 1.825   -14.817 -5.941  1.00 0.00 ? 41 SER A HB3  2  
ATOM 1725  H HG   . SER A 1 41 ? 1.352   -15.462 -8.219  1.00 0.00 ? 41 SER A HG   2  
ATOM 1726  N N    . ASN A 1 42 ? -1.038  -15.542 -4.587  1.00 0.00 ? 42 ASN A N    2  
ATOM 1727  C CA   . ASN A 1 42 ? -2.031  -16.571 -4.302  1.00 0.00 ? 42 ASN A CA   2  
ATOM 1728  C C    . ASN A 1 42 ? -3.297  -15.957 -3.713  1.00 0.00 ? 42 ASN A C    2  
ATOM 1729  O O    . ASN A 1 42 ? -4.406  -16.427 -3.971  1.00 0.00 ? 42 ASN A O    2  
ATOM 1730  C CB   . ASN A 1 42 ? -1.456  -17.609 -3.335  1.00 0.00 ? 42 ASN A CB   2  
ATOM 1731  C CG   . ASN A 1 42 ? -0.608  -18.649 -4.041  1.00 0.00 ? 42 ASN A CG   2  
ATOM 1732  O OD1  . ASN A 1 42 ? -1.126  -19.509 -4.755  1.00 0.00 ? 42 ASN A OD1  2  
ATOM 1733  N ND2  . ASN A 1 42 ? 0.703   -18.576 -3.844  1.00 0.00 ? 42 ASN A ND2  2  
ATOM 1734  H H    . ASN A 1 42 ? -0.285  -15.420 -3.971  1.00 0.00 ? 42 ASN A H    2  
ATOM 1735  H HA   . ASN A 1 42 ? -2.280  -17.058 -5.232  1.00 0.00 ? 42 ASN A HA   2  
ATOM 1736  H HB2  . ASN A 1 42 ? -0.841  -17.108 -2.603  1.00 0.00 ? 42 ASN A HB2  2  
ATOM 1737  H HB3  . ASN A 1 42 ? -2.268  -18.113 -2.833  1.00 0.00 ? 42 ASN A HB3  2  
ATOM 1738  H HD21 . ASN A 1 42 ? 1.045   -17.865 -3.262  1.00 0.00 ? 42 ASN A HD21 2  
ATOM 1739  H HD22 . ASN A 1 42 ? 1.275   -19.236 -4.289  1.00 0.00 ? 42 ASN A HD22 2  
ATOM 1740  N N    . LEU A 1 43 ? -3.124  -14.905 -2.920  1.00 0.00 ? 43 LEU A N    2  
ATOM 1741  C CA   . LEU A 1 43 ? -4.253  -14.225 -2.294  1.00 0.00 ? 43 LEU A CA   2  
ATOM 1742  C C    . LEU A 1 43 ? -5.031  -13.405 -3.318  1.00 0.00 ? 43 LEU A C    2  
ATOM 1743  O O    . LEU A 1 43 ? -6.228  -13.617 -3.519  1.00 0.00 ? 43 LEU A O    2  
ATOM 1744  C CB   . LEU A 1 43 ? -3.764  -13.318 -1.164  1.00 0.00 ? 43 LEU A CB   2  
ATOM 1745  C CG   . LEU A 1 43 ? -4.743  -12.240 -0.696  1.00 0.00 ? 43 LEU A CG   2  
ATOM 1746  C CD1  . LEU A 1 43 ? -6.035  -12.871 -0.202  1.00 0.00 ? 43 LEU A CD1  2  
ATOM 1747  C CD2  . LEU A 1 43 ? -4.114  -11.385 0.394   1.00 0.00 ? 43 LEU A CD2  2  
ATOM 1748  H H    . LEU A 1 43 ? -2.217  -14.577 -2.752  1.00 0.00 ? 43 LEU A H    2  
ATOM 1749  H HA   . LEU A 1 43 ? -4.907  -14.979 -1.882  1.00 0.00 ? 43 LEU A HA   2  
ATOM 1750  H HB2  . LEU A 1 43 ? -3.531  -13.943 -0.315  1.00 0.00 ? 43 LEU A HB2  2  
ATOM 1751  H HB3  . LEU A 1 43 ? -2.864  -12.825 -1.503  1.00 0.00 ? 43 LEU A HB3  2  
ATOM 1752  H HG   . LEU A 1 43 ? -4.984  -11.596 -1.531  1.00 0.00 ? 43 LEU A HG   2  
ATOM 1753  H HD11 . LEU A 1 43 ? -6.730  -12.095 0.079   1.00 0.00 ? 43 LEU A HD11 2  
ATOM 1754  H HD12 . LEU A 1 43 ? -5.827  -13.495 0.654   1.00 0.00 ? 43 LEU A HD12 2  
ATOM 1755  H HD13 . LEU A 1 43 ? -6.466  -13.473 -0.989  1.00 0.00 ? 43 LEU A HD13 2  
ATOM 1756  H HD21 . LEU A 1 43 ? -4.269  -11.855 1.354   1.00 0.00 ? 43 LEU A HD21 2  
ATOM 1757  H HD22 . LEU A 1 43 ? -4.573  -10.407 0.394   1.00 0.00 ? 43 LEU A HD22 2  
ATOM 1758  H HD23 . LEU A 1 43 ? -3.055  -11.286 0.207   1.00 0.00 ? 43 LEU A HD23 2  
ATOM 1759  N N    . LEU A 1 44 ? -4.344  -12.471 -3.966  1.00 0.00 ? 44 LEU A N    2  
ATOM 1760  C CA   . LEU A 1 44 ? -4.970  -11.620 -4.972  1.00 0.00 ? 44 LEU A CA   2  
ATOM 1761  C C    . LEU A 1 44 ? -5.140  -12.370 -6.289  1.00 0.00 ? 44 LEU A C    2  
ATOM 1762  O O    . LEU A 1 44 ? -5.809  -11.893 -7.205  1.00 0.00 ? 44 LEU A O    2  
ATOM 1763  C CB   . LEU A 1 44 ? -4.133  -10.359 -5.194  1.00 0.00 ? 44 LEU A CB   2  
ATOM 1764  C CG   . LEU A 1 44 ? -3.804  -9.543  -3.944  1.00 0.00 ? 44 LEU A CG   2  
ATOM 1765  C CD1  . LEU A 1 44 ? -2.725  -8.515  -4.246  1.00 0.00 ? 44 LEU A CD1  2  
ATOM 1766  C CD2  . LEU A 1 44 ? -5.054  -8.864  -3.405  1.00 0.00 ? 44 LEU A CD2  2  
ATOM 1767  H H    . LEU A 1 44 ? -3.393  -12.349 -3.763  1.00 0.00 ? 44 LEU A H    2  
ATOM 1768  H HA   . LEU A 1 44 ? -5.945  -11.336 -4.605  1.00 0.00 ? 44 LEU A HA   2  
ATOM 1769  H HB2  . LEU A 1 44 ? -3.201  -10.657 -5.650  1.00 0.00 ? 44 LEU A HB2  2  
ATOM 1770  H HB3  . LEU A 1 44 ? -4.676  -9.719  -5.875  1.00 0.00 ? 44 LEU A HB3  2  
ATOM 1771  H HG   . LEU A 1 44 ? -3.426  -10.207 -3.178  1.00 0.00 ? 44 LEU A HG   2  
ATOM 1772  H HD11 . LEU A 1 44 ? -2.782  -8.228  -5.285  1.00 0.00 ? 44 LEU A HD11 2  
ATOM 1773  H HD12 . LEU A 1 44 ? -1.754  -8.942  -4.043  1.00 0.00 ? 44 LEU A HD12 2  
ATOM 1774  H HD13 . LEU A 1 44 ? -2.872  -7.645  -3.623  1.00 0.00 ? 44 LEU A HD13 2  
ATOM 1775  H HD21 . LEU A 1 44 ? -5.612  -9.564  -2.801  1.00 0.00 ? 44 LEU A HD21 2  
ATOM 1776  H HD22 . LEU A 1 44 ? -5.668  -8.533  -4.231  1.00 0.00 ? 44 LEU A HD22 2  
ATOM 1777  H HD23 . LEU A 1 44 ? -4.771  -8.013  -2.803  1.00 0.00 ? 44 LEU A HD23 2  
ATOM 1778  N N    . ASN A 1 45 ? -4.531  -13.548 -6.377  1.00 0.00 ? 45 ASN A N    2  
ATOM 1779  C CA   . ASN A 1 45 ? -4.617  -14.365 -7.582  1.00 0.00 ? 45 ASN A CA   2  
ATOM 1780  C C    . ASN A 1 45 ? -3.920  -13.681 -8.754  1.00 0.00 ? 45 ASN A C    2  
ATOM 1781  O O    . ASN A 1 45 ? -4.319  -13.843 -9.908  1.00 0.00 ? 45 ASN A O    2  
ATOM 1782  C CB   . ASN A 1 45 ? -6.080  -14.640 -7.934  1.00 0.00 ? 45 ASN A CB   2  
ATOM 1783  C CG   . ASN A 1 45 ? -6.228  -15.715 -8.994  1.00 0.00 ? 45 ASN A CG   2  
ATOM 1784  O OD1  . ASN A 1 45 ? -6.620  -15.435 -10.126 1.00 0.00 ? 45 ASN A OD1  2  
ATOM 1785  N ND2  . ASN A 1 45 ? -5.914  -16.952 -8.629  1.00 0.00 ? 45 ASN A ND2  2  
ATOM 1786  H H    . ASN A 1 45 ? -4.012  -13.876 -5.613  1.00 0.00 ? 45 ASN A H    2  
ATOM 1787  H HA   . ASN A 1 45 ? -4.122  -15.304 -7.381  1.00 0.00 ? 45 ASN A HA   2  
ATOM 1788  H HB2  . ASN A 1 45 ? -6.603  -14.963 -7.046  1.00 0.00 ? 45 ASN A HB2  2  
ATOM 1789  H HB3  . ASN A 1 45 ? -6.532  -13.732 -8.302  1.00 0.00 ? 45 ASN A HB3  2  
ATOM 1790  H HD21 . ASN A 1 45 ? -5.608  -17.101 -7.709  1.00 0.00 ? 45 ASN A HD21 2  
ATOM 1791  H HD22 . ASN A 1 45 ? -5.999  -17.666 -9.294  1.00 0.00 ? 45 ASN A HD22 2  
ATOM 1792  N N    . LEU A 1 46 ? -2.876  -12.918 -8.450  1.00 0.00 ? 46 LEU A N    2  
ATOM 1793  C CA   . LEU A 1 46 ? -2.122  -12.209 -9.478  1.00 0.00 ? 46 LEU A CA   2  
ATOM 1794  C C    . LEU A 1 46 ? -0.706  -12.763 -9.594  1.00 0.00 ? 46 LEU A C    2  
ATOM 1795  O O    . LEU A 1 46 ? -0.123  -13.253 -8.626  1.00 0.00 ? 46 LEU A O    2  
ATOM 1796  C CB   . LEU A 1 46 ? -2.071  -10.713 -9.161  1.00 0.00 ? 46 LEU A CB   2  
ATOM 1797  C CG   . LEU A 1 46 ? -3.422  -10.004 -9.052  1.00 0.00 ? 46 LEU A CG   2  
ATOM 1798  C CD1  . LEU A 1 46 ? -3.233  -8.564  -8.602  1.00 0.00 ? 46 LEU A CD1  2  
ATOM 1799  C CD2  . LEU A 1 46 ? -4.160  -10.057 -10.381 1.00 0.00 ? 46 LEU A CD2  2  
ATOM 1800  H H    . LEU A 1 46 ? -2.605  -12.828 -7.513  1.00 0.00 ? 46 LEU A H    2  
ATOM 1801  H HA   . LEU A 1 46 ? -2.630  -12.352 -10.419 1.00 0.00 ? 46 LEU A HA   2  
ATOM 1802  H HB2  . LEU A 1 46 ? -1.558  -10.592 -8.219  1.00 0.00 ? 46 LEU A HB2  2  
ATOM 1803  H HB3  . LEU A 1 46 ? -1.504  -10.229 -9.943  1.00 0.00 ? 46 LEU A HB3  2  
ATOM 1804  H HG   . LEU A 1 46 ? -4.027  -10.508 -8.312  1.00 0.00 ? 46 LEU A HG   2  
ATOM 1805  H HD11 . LEU A 1 46 ? -3.129  -7.927  -9.467  1.00 0.00 ? 46 LEU A HD11 2  
ATOM 1806  H HD12 . LEU A 1 46 ? -2.345  -8.490  -7.992  1.00 0.00 ? 46 LEU A HD12 2  
ATOM 1807  H HD13 . LEU A 1 46 ? -4.092  -8.252  -8.025  1.00 0.00 ? 46 LEU A HD13 2  
ATOM 1808  H HD21 . LEU A 1 46 ? -3.631  -9.461  -11.111 1.00 0.00 ? 46 LEU A HD21 2  
ATOM 1809  H HD22 . LEU A 1 46 ? -5.159  -9.665  -10.254 1.00 0.00 ? 46 LEU A HD22 2  
ATOM 1810  H HD23 . LEU A 1 46 ? -4.214  -11.080 -10.723 1.00 0.00 ? 46 LEU A HD23 2  
ATOM 1811  N N    . PRO A 1 47 ? -0.137  -12.684 -10.806 1.00 0.00 ? 47 PRO A N    2  
ATOM 1812  C CA   . PRO A 1 47 ? 1.219   -13.171 -11.077 1.00 0.00 ? 47 PRO A CA   2  
ATOM 1813  C C    . PRO A 1 47 ? 2.288   -12.311 -10.411 1.00 0.00 ? 47 PRO A C    2  
ATOM 1814  O O    . PRO A 1 47 ? 2.247   -11.082 -10.486 1.00 0.00 ? 47 PRO A O    2  
ATOM 1815  C CB   . PRO A 1 47 ? 1.331   -13.078 -12.601 1.00 0.00 ? 47 PRO A CB   2  
ATOM 1816  C CG   . PRO A 1 47 ? 0.361   -12.016 -12.988 1.00 0.00 ? 47 PRO A CG   2  
ATOM 1817  C CD   . PRO A 1 47 ? -0.773  -12.113 -12.005 1.00 0.00 ? 47 PRO A CD   2  
ATOM 1818  H HA   . PRO A 1 47 ? 1.341   -14.199 -10.768 1.00 0.00 ? 47 PRO A HA   2  
ATOM 1819  H HB2  . PRO A 1 47 ? 2.342   -12.810 -12.875 1.00 0.00 ? 47 PRO A HB2  2  
ATOM 1820  H HB3  . PRO A 1 47 ? 1.073   -14.029 -13.043 1.00 0.00 ? 47 PRO A HB3  2  
ATOM 1821  H HG2  . PRO A 1 47 ? 0.831   -11.047 -12.924 1.00 0.00 ? 47 PRO A HG2  2  
ATOM 1822  H HG3  . PRO A 1 47 ? 0.002   -12.195 -13.991 1.00 0.00 ? 47 PRO A HG3  2  
ATOM 1823  H HD2  . PRO A 1 47 ? -1.177  -11.133 -11.797 1.00 0.00 ? 47 PRO A HD2  2  
ATOM 1824  H HD3  . PRO A 1 47 ? -1.544  -12.769 -12.381 1.00 0.00 ? 47 PRO A HD3  2  
ATOM 1825  N N    . THR A 1 48 ? 3.245   -12.964 -9.760  1.00 0.00 ? 48 THR A N    2  
ATOM 1826  C CA   . THR A 1 48 ? 4.325   -12.259 -9.080  1.00 0.00 ? 48 THR A CA   2  
ATOM 1827  C C    . THR A 1 48 ? 4.924   -11.178 -9.973  1.00 0.00 ? 48 THR A C    2  
ATOM 1828  O O    . THR A 1 48 ? 5.221   -10.075 -9.514  1.00 0.00 ? 48 THR A O    2  
ATOM 1829  C CB   . THR A 1 48 ? 5.442   -13.227 -8.646  1.00 0.00 ? 48 THR A CB   2  
ATOM 1830  O OG1  . THR A 1 48 ? 5.673   -14.200 -9.671  1.00 0.00 ? 48 THR A OG1  2  
ATOM 1831  C CG2  . THR A 1 48 ? 5.075   -13.929 -7.347  1.00 0.00 ? 48 THR A CG2  2  
ATOM 1832  H H    . THR A 1 48 ? 3.224   -13.943 -9.737  1.00 0.00 ? 48 THR A H    2  
ATOM 1833  H HA   . THR A 1 48 ? 3.915   -11.795 -8.195  1.00 0.00 ? 48 THR A HA   2  
ATOM 1834  H HB   . THR A 1 48 ? 6.348   -12.659 -8.487  1.00 0.00 ? 48 THR A HB   2  
ATOM 1835  H HG1  . THR A 1 48 ? 6.423   -14.748 -9.428  1.00 0.00 ? 48 THR A HG1  2  
ATOM 1836  H HG21 . THR A 1 48 ? 4.434   -14.772 -7.562  1.00 0.00 ? 48 THR A HG21 2  
ATOM 1837  H HG22 . THR A 1 48 ? 4.556   -13.238 -6.699  1.00 0.00 ? 48 THR A HG22 2  
ATOM 1838  H HG23 . THR A 1 48 ? 5.973   -14.276 -6.860  1.00 0.00 ? 48 THR A HG23 2  
ATOM 1839  N N    . ARG A 1 49 ? 5.097   -11.501 -11.250 1.00 0.00 ? 49 ARG A N    2  
ATOM 1840  C CA   . ARG A 1 49 ? 5.661   -10.557 -12.208 1.00 0.00 ? 49 ARG A CA   2  
ATOM 1841  C C    . ARG A 1 49 ? 4.919   -9.224  -12.157 1.00 0.00 ? 49 ARG A C    2  
ATOM 1842  O O    . ARG A 1 49 ? 5.507   -8.166  -12.384 1.00 0.00 ? 49 ARG A O    2  
ATOM 1843  C CB   . ARG A 1 49 ? 5.599   -11.134 -13.623 1.00 0.00 ? 49 ARG A CB   2  
ATOM 1844  C CG   . ARG A 1 49 ? 4.275   -10.882 -14.326 1.00 0.00 ? 49 ARG A CG   2  
ATOM 1845  C CD   . ARG A 1 49 ? 4.297   -9.575  -15.103 1.00 0.00 ? 49 ARG A CD   2  
ATOM 1846  N NE   . ARG A 1 49 ? 4.845   -9.747  -16.447 1.00 0.00 ? 49 ARG A NE   2  
ATOM 1847  C CZ   . ARG A 1 49 ? 4.129   -10.167 -17.484 1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1848  N NH1  . ARG A 1 49 ? 2.844   -10.458 -17.333 1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1849  N NH2  . ARG A 1 49 ? 4.699   -10.298 -18.675 1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1850  H H    . ARG A 1 49 ? 4.840   -12.396 -11.557 1.00 0.00 ? 49 ARG A H    2  
ATOM 1851  H HA   . ARG A 1 49 ? 6.694   -10.391 -11.941 1.00 0.00 ? 49 ARG A HA   2  
ATOM 1852  H HB2  . ARG A 1 49 ? 6.386   -10.691 -14.215 1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1853  H HB3  . ARG A 1 49 ? 5.756   -12.201 -13.570 1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1854  H HG2  . ARG A 1 49 ? 4.083   -11.693 -15.013 1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1855  H HG3  . ARG A 1 49 ? 3.489   -10.838 -13.588 1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1856  H HD2  . ARG A 1 49 ? 3.288   -9.201  -15.182 1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1857  H HD3  . ARG A 1 49 ? 4.904   -8.863  -14.565 1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1858  H HE   . ARG A 1 49 ? 5.792   -9.538  -16.581 1.00 0.00 ? 49 ARG A HE   2  
ATOM 1859  H HH11 . ARG A 1 49 ? 2.412   -10.359 -16.436 1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1860  H HH12 . ARG A 1 49 ? 2.307   -10.773 -18.115 1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1861  H HH21 . ARG A 1 49 ? 5.667   -10.080 -18.793 1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1862  H HH22 . ARG A 1 49 ? 4.159   -10.615 -19.455 1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1863  N N    . VAL A 1 50 ? 3.625   -9.283  -11.860 1.00 0.00 ? 50 VAL A N    2  
ATOM 1864  C CA   . VAL A 1 50 ? 2.804   -8.082  -11.779 1.00 0.00 ? 50 VAL A CA   2  
ATOM 1865  C C    . VAL A 1 50 ? 2.996   -7.372  -10.444 1.00 0.00 ? 50 VAL A C    2  
ATOM 1866  O O    . VAL A 1 50 ? 3.005   -6.143  -10.378 1.00 0.00 ? 50 VAL A O    2  
ATOM 1867  C CB   . VAL A 1 50 ? 1.310   -8.410  -11.963 1.00 0.00 ? 50 VAL A CB   2  
ATOM 1868  C CG1  . VAL A 1 50 ? 0.445   -7.267  -11.453 1.00 0.00 ? 50 VAL A CG1  2  
ATOM 1869  C CG2  . VAL A 1 50 ? 1.006   -8.708  -13.423 1.00 0.00 ? 50 VAL A CG2  2  
ATOM 1870  H H    . VAL A 1 50 ? 3.214   -10.156 -11.689 1.00 0.00 ? 50 VAL A H    2  
ATOM 1871  H HA   . VAL A 1 50 ? 3.105   -7.417  -12.576 1.00 0.00 ? 50 VAL A HA   2  
ATOM 1872  H HB   . VAL A 1 50 ? 1.082   -9.291  -11.382 1.00 0.00 ? 50 VAL A HB   2  
ATOM 1873  H HG11 . VAL A 1 50 ? 0.644   -7.107  -10.403 1.00 0.00 ? 50 VAL A HG11 2  
ATOM 1874  H HG12 . VAL A 1 50 ? 0.674   -6.367  -12.005 1.00 0.00 ? 50 VAL A HG12 2  
ATOM 1875  H HG13 . VAL A 1 50 ? -0.597  -7.517  -11.587 1.00 0.00 ? 50 VAL A HG13 2  
ATOM 1876  H HG21 . VAL A 1 50 ? 0.920   -7.781  -13.969 1.00 0.00 ? 50 VAL A HG21 2  
ATOM 1877  H HG22 . VAL A 1 50 ? 1.806   -9.301  -13.844 1.00 0.00 ? 50 VAL A HG22 2  
ATOM 1878  H HG23 . VAL A 1 50 ? 0.078   -9.255  -13.494 1.00 0.00 ? 50 VAL A HG23 2  
ATOM 1879  N N    . ILE A 1 51 ? 3.151   -8.155  -9.381  1.00 0.00 ? 51 ILE A N    2  
ATOM 1880  C CA   . ILE A 1 51 ? 3.346   -7.602  -8.047  1.00 0.00 ? 51 ILE A CA   2  
ATOM 1881  C C    . ILE A 1 51 ? 4.755   -7.042  -7.884  1.00 0.00 ? 51 ILE A C    2  
ATOM 1882  O O    . ILE A 1 51 ? 4.986   -6.134  -7.086  1.00 0.00 ? 51 ILE A O    2  
ATOM 1883  C CB   . ILE A 1 51 ? 3.096   -8.660  -6.957  1.00 0.00 ? 51 ILE A CB   2  
ATOM 1884  C CG1  . ILE A 1 51 ? 1.804   -9.427  -7.246  1.00 0.00 ? 51 ILE A CG1  2  
ATOM 1885  C CG2  . ILE A 1 51 ? 3.033   -8.003  -5.586  1.00 0.00 ? 51 ILE A CG2  2  
ATOM 1886  C CD1  . ILE A 1 51 ? 1.605   -10.634 -6.356  1.00 0.00 ? 51 ILE A CD1  2  
ATOM 1887  H H    . ILE A 1 51 ? 3.135   -9.128  -9.498  1.00 0.00 ? 51 ILE A H    2  
ATOM 1888  H HA   . ILE A 1 51 ? 2.634   -6.800  -7.912  1.00 0.00 ? 51 ILE A HA   2  
ATOM 1889  H HB   . ILE A 1 51 ? 3.925   -9.351  -6.961  1.00 0.00 ? 51 ILE A HB   2  
ATOM 1890  H HG12 . ILE A 1 51 ? 0.962   -8.768  -7.102  1.00 0.00 ? 51 ILE A HG12 2  
ATOM 1891  H HG13 . ILE A 1 51 ? 1.818   -9.768  -8.271  1.00 0.00 ? 51 ILE A HG13 2  
ATOM 1892  H HG21 . ILE A 1 51 ? 3.921   -7.408  -5.431  1.00 0.00 ? 51 ILE A HG21 2  
ATOM 1893  H HG22 . ILE A 1 51 ? 2.162   -7.369  -5.531  1.00 0.00 ? 51 ILE A HG22 2  
ATOM 1894  H HG23 . ILE A 1 51 ? 2.973   -8.765  -4.824  1.00 0.00 ? 51 ILE A HG23 2  
ATOM 1895  H HD11 . ILE A 1 51 ? 0.550   -10.847 -6.268  1.00 0.00 ? 51 ILE A HD11 2  
ATOM 1896  H HD12 . ILE A 1 51 ? 2.111   -11.485 -6.785  1.00 0.00 ? 51 ILE A HD12 2  
ATOM 1897  H HD13 . ILE A 1 51 ? 2.014   -10.429 -5.376  1.00 0.00 ? 51 ILE A HD13 2  
ATOM 1898  N N    . VAL A 1 52 ? 5.695   -7.591  -8.647  1.00 0.00 ? 52 VAL A N    2  
ATOM 1899  C CA   . VAL A 1 52 ? 7.082   -7.145  -8.590  1.00 0.00 ? 52 VAL A CA   2  
ATOM 1900  C C    . VAL A 1 52 ? 7.232   -5.739  -9.160  1.00 0.00 ? 52 VAL A C    2  
ATOM 1901  O O    . VAL A 1 52 ? 7.801   -4.855  -8.520  1.00 0.00 ? 52 VAL A O    2  
ATOM 1902  C CB   . VAL A 1 52 ? 8.011   -8.102  -9.361  1.00 0.00 ? 52 VAL A CB   2  
ATOM 1903  C CG1  . VAL A 1 52 ? 9.438   -7.575  -9.362  1.00 0.00 ? 52 VAL A CG1  2  
ATOM 1904  C CG2  . VAL A 1 52 ? 7.950   -9.499  -8.764  1.00 0.00 ? 52 VAL A CG2  2  
ATOM 1905  H H    . VAL A 1 52 ? 5.450   -8.312  -9.264  1.00 0.00 ? 52 VAL A H    2  
ATOM 1906  H HA   . VAL A 1 52 ? 7.388   -7.137  -7.554  1.00 0.00 ? 52 VAL A HA   2  
ATOM 1907  H HB   . VAL A 1 52 ? 7.670   -8.155  -10.384 1.00 0.00 ? 52 VAL A HB   2  
ATOM 1908  H HG11 . VAL A 1 52 ? 9.990   -8.032  -10.171 1.00 0.00 ? 52 VAL A HG11 2  
ATOM 1909  H HG12 . VAL A 1 52 ? 9.427   -6.503  -9.493  1.00 0.00 ? 52 VAL A HG12 2  
ATOM 1910  H HG13 . VAL A 1 52 ? 9.912   -7.818  -8.422  1.00 0.00 ? 52 VAL A HG13 2  
ATOM 1911  H HG21 . VAL A 1 52 ? 8.954   -9.871  -8.617  1.00 0.00 ? 52 VAL A HG21 2  
ATOM 1912  H HG22 . VAL A 1 52 ? 7.437   -9.464  -7.813  1.00 0.00 ? 52 VAL A HG22 2  
ATOM 1913  H HG23 . VAL A 1 52 ? 7.417   -10.156 -9.435  1.00 0.00 ? 52 VAL A HG23 2  
ATOM 1914  N N    . VAL A 1 53 ? 6.717   -5.539  -10.369 1.00 0.00 ? 53 VAL A N    2  
ATOM 1915  C CA   . VAL A 1 53 ? 6.791   -4.240  -11.026 1.00 0.00 ? 53 VAL A CA   2  
ATOM 1916  C C    . VAL A 1 53 ? 6.176   -3.149  -10.158 1.00 0.00 ? 53 VAL A C    2  
ATOM 1917  O O    . VAL A 1 53 ? 6.697   -2.036  -10.079 1.00 0.00 ? 53 VAL A O    2  
ATOM 1918  C CB   . VAL A 1 53 ? 6.076   -4.259  -12.391 1.00 0.00 ? 53 VAL A CB   2  
ATOM 1919  C CG1  . VAL A 1 53 ? 6.087   -2.874  -13.019 1.00 0.00 ? 53 VAL A CG1  2  
ATOM 1920  C CG2  . VAL A 1 53 ? 6.723   -5.278  -13.316 1.00 0.00 ? 53 VAL A CG2  2  
ATOM 1921  H H    . VAL A 1 53 ? 6.275   -6.283  -10.830 1.00 0.00 ? 53 VAL A H    2  
ATOM 1922  H HA   . VAL A 1 53 ? 7.833   -4.009  -11.193 1.00 0.00 ? 53 VAL A HA   2  
ATOM 1923  H HB   . VAL A 1 53 ? 5.048   -4.550  -12.232 1.00 0.00 ? 53 VAL A HB   2  
ATOM 1924  H HG11 . VAL A 1 53 ? 6.860   -2.276  -12.558 1.00 0.00 ? 53 VAL A HG11 2  
ATOM 1925  H HG12 . VAL A 1 53 ? 6.279   -2.960  -14.078 1.00 0.00 ? 53 VAL A HG12 2  
ATOM 1926  H HG13 . VAL A 1 53 ? 5.128   -2.401  -12.864 1.00 0.00 ? 53 VAL A HG13 2  
ATOM 1927  H HG21 . VAL A 1 53 ? 6.305   -6.255  -13.124 1.00 0.00 ? 53 VAL A HG21 2  
ATOM 1928  H HG22 . VAL A 1 53 ? 6.535   -5.002  -14.344 1.00 0.00 ? 53 VAL A HG22 2  
ATOM 1929  H HG23 . VAL A 1 53 ? 7.788   -5.301  -13.139 1.00 0.00 ? 53 VAL A HG23 2  
ATOM 1930  N N    . TRP A 1 54 ? 5.065   -3.474  -9.508  1.00 0.00 ? 54 TRP A N    2  
ATOM 1931  C CA   . TRP A 1 54 ? 4.378   -2.521  -8.643  1.00 0.00 ? 54 TRP A CA   2  
ATOM 1932  C C    . TRP A 1 54 ? 5.215   -2.204  -7.409  1.00 0.00 ? 54 TRP A C    2  
ATOM 1933  O O    . TRP A 1 54 ? 5.325   -1.047  -7.002  1.00 0.00 ? 54 TRP A O    2  
ATOM 1934  C CB   . TRP A 1 54 ? 3.015   -3.073  -8.223  1.00 0.00 ? 54 TRP A CB   2  
ATOM 1935  C CG   . TRP A 1 54 ? 2.187   -2.089  -7.453  1.00 0.00 ? 54 TRP A CG   2  
ATOM 1936  C CD1  . TRP A 1 54 ? 1.150   -1.340  -7.931  1.00 0.00 ? 54 TRP A CD1  2  
ATOM 1937  C CD2  . TRP A 1 54 ? 2.328   -1.746  -6.070  1.00 0.00 ? 54 TRP A CD2  2  
ATOM 1938  N NE1  . TRP A 1 54 ? 0.638   -0.552  -6.929  1.00 0.00 ? 54 TRP A NE1  2  
ATOM 1939  C CE2  . TRP A 1 54 ? 1.343   -0.783  -5.777  1.00 0.00 ? 54 TRP A CE2  2  
ATOM 1940  C CE3  . TRP A 1 54 ? 3.189   -2.160  -5.051  1.00 0.00 ? 54 TRP A CE3  2  
ATOM 1941  C CZ2  . TRP A 1 54 ? 1.198   -0.229  -4.508  1.00 0.00 ? 54 TRP A CZ2  2  
ATOM 1942  C CZ3  . TRP A 1 54 ? 3.045   -1.609  -3.792  1.00 0.00 ? 54 TRP A CZ3  2  
ATOM 1943  C CH2  . TRP A 1 54 ? 2.055   -0.652  -3.529  1.00 0.00 ? 54 TRP A CH2  2  
ATOM 1944  H H    . TRP A 1 54 ? 4.697   -4.377  -9.611  1.00 0.00 ? 54 TRP A H    2  
ATOM 1945  H HA   . TRP A 1 54 ? 4.229   -1.612  -9.207  1.00 0.00 ? 54 TRP A HA   2  
ATOM 1946  H HB2  . TRP A 1 54 ? 2.460   -3.358  -9.104  1.00 0.00 ? 54 TRP A HB2  2  
ATOM 1947  H HB3  . TRP A 1 54 ? 3.164   -3.943  -7.600  1.00 0.00 ? 54 TRP A HB3  2  
ATOM 1948  H HD1  . TRP A 1 54 ? 0.796   -1.371  -8.951  1.00 0.00 ? 54 TRP A HD1  2  
ATOM 1949  H HE1  . TRP A 1 54 ? -0.112  0.073   -7.023  1.00 0.00 ? 54 TRP A HE1  2  
ATOM 1950  H HE3  . TRP A 1 54 ? 3.958   -2.896  -5.234  1.00 0.00 ? 54 TRP A HE3  2  
ATOM 1951  H HZ2  . TRP A 1 54 ? 0.440   0.509   -4.290  1.00 0.00 ? 54 TRP A HZ2  2  
ATOM 1952  H HZ3  . TRP A 1 54 ? 3.702   -1.916  -2.992  1.00 0.00 ? 54 TRP A HZ3  2  
ATOM 1953  H HH2  . TRP A 1 54 ? 1.979   -0.249  -2.531  1.00 0.00 ? 54 TRP A HH2  2  
ATOM 1954  N N    . PHE A 1 55 ? 5.803   -3.238  -6.817  1.00 0.00 ? 55 PHE A N    2  
ATOM 1955  C CA   . PHE A 1 55 ? 6.630   -3.069  -5.628  1.00 0.00 ? 55 PHE A CA   2  
ATOM 1956  C C    . PHE A 1 55 ? 7.918   -2.323  -5.962  1.00 0.00 ? 55 PHE A C    2  
ATOM 1957  O O    . PHE A 1 55 ? 8.398   -1.509  -5.174  1.00 0.00 ? 55 PHE A O    2  
ATOM 1958  C CB   . PHE A 1 55 ? 6.961   -4.431  -5.013  1.00 0.00 ? 55 PHE A CB   2  
ATOM 1959  C CG   . PHE A 1 55 ? 5.963   -4.885  -3.987  1.00 0.00 ? 55 PHE A CG   2  
ATOM 1960  C CD1  . PHE A 1 55 ? 4.639   -5.098  -4.337  1.00 0.00 ? 55 PHE A CD1  2  
ATOM 1961  C CD2  . PHE A 1 55 ? 6.347   -5.097  -2.673  1.00 0.00 ? 55 PHE A CD2  2  
ATOM 1962  C CE1  . PHE A 1 55 ? 3.717   -5.516  -3.395  1.00 0.00 ? 55 PHE A CE1  2  
ATOM 1963  C CE2  . PHE A 1 55 ? 5.430   -5.516  -1.728  1.00 0.00 ? 55 PHE A CE2  2  
ATOM 1964  C CZ   . PHE A 1 55 ? 4.113   -5.724  -2.089  1.00 0.00 ? 55 PHE A CZ   2  
ATOM 1965  H H    . PHE A 1 55 ? 5.677   -4.137  -7.188  1.00 0.00 ? 55 PHE A H    2  
ATOM 1966  H HA   . PHE A 1 55 ? 6.067   -2.489  -4.913  1.00 0.00 ? 55 PHE A HA   2  
ATOM 1967  H HB2  . PHE A 1 55 ? 6.992   -5.173  -5.796  1.00 0.00 ? 55 PHE A HB2  2  
ATOM 1968  H HB3  . PHE A 1 55 ? 7.928   -4.376  -4.536  1.00 0.00 ? 55 PHE A HB3  2  
ATOM 1969  H HD1  . PHE A 1 55 ? 4.328   -4.935  -5.359  1.00 0.00 ? 55 PHE A HD1  2  
ATOM 1970  H HD2  . PHE A 1 55 ? 7.376   -4.934  -2.389  1.00 0.00 ? 55 PHE A HD2  2  
ATOM 1971  H HE1  . PHE A 1 55 ? 2.689   -5.678  -3.681  1.00 0.00 ? 55 PHE A HE1  2  
ATOM 1972  H HE2  . PHE A 1 55 ? 5.743   -5.678  -0.707  1.00 0.00 ? 55 PHE A HE2  2  
ATOM 1973  H HZ   . PHE A 1 55 ? 3.395   -6.052  -1.352  1.00 0.00 ? 55 PHE A HZ   2  
ATOM 1974  N N    . GLN A 1 56 ? 8.471   -2.606  -7.137  1.00 0.00 ? 56 GLN A N    2  
ATOM 1975  C CA   . GLN A 1 56 ? 9.703   -1.963  -7.576  1.00 0.00 ? 56 GLN A CA   2  
ATOM 1976  C C    . GLN A 1 56 ? 9.525   -0.451  -7.670  1.00 0.00 ? 56 GLN A C    2  
ATOM 1977  O O    . GLN A 1 56 ? 10.294  0.312   -7.088  1.00 0.00 ? 56 GLN A O    2  
ATOM 1978  C CB   . GLN A 1 56 ? 10.141  -2.521  -8.931  1.00 0.00 ? 56 GLN A CB   2  
ATOM 1979  C CG   . GLN A 1 56 ? 10.857  -3.859  -8.835  1.00 0.00 ? 56 GLN A CG   2  
ATOM 1980  C CD   . GLN A 1 56 ? 11.817  -4.091  -9.985  1.00 0.00 ? 56 GLN A CD   2  
ATOM 1981  O OE1  . GLN A 1 56 ? 12.176  -3.160  -10.707 1.00 0.00 ? 56 GLN A OE1  2  
ATOM 1982  N NE2  . GLN A 1 56 ? 12.239  -5.337  -10.162 1.00 0.00 ? 56 GLN A NE2  2  
ATOM 1983  H H    . GLN A 1 56 ? 8.040   -3.263  -7.722  1.00 0.00 ? 56 GLN A H    2  
ATOM 1984  H HA   . GLN A 1 56 ? 10.468  -2.177  -6.845  1.00 0.00 ? 56 GLN A HA   2  
ATOM 1985  H HB2  . GLN A 1 56 ? 9.268   -2.648  -9.554  1.00 0.00 ? 56 GLN A HB2  2  
ATOM 1986  H HB3  . GLN A 1 56 ? 10.808  -1.814  -9.400  1.00 0.00 ? 56 GLN A HB3  2  
ATOM 1987  H HG2  . GLN A 1 56 ? 11.414  -3.890  -7.910  1.00 0.00 ? 56 GLN A HG2  2  
ATOM 1988  H HG3  . GLN A 1 56 ? 10.119  -4.648  -8.836  1.00 0.00 ? 56 GLN A HG3  2  
ATOM 1989  H HE21 . GLN A 1 56 ? 11.910  -6.028  -9.549  1.00 0.00 ? 56 GLN A HE21 2  
ATOM 1990  H HE22 . GLN A 1 56 ? 12.859  -5.516  -10.898 1.00 0.00 ? 56 GLN A HE22 2  
ATOM 1991  N N    . ASN A 1 57 ? 8.504   -0.025  -8.407  1.00 0.00 ? 57 ASN A N    2  
ATOM 1992  C CA   . ASN A 1 57 ? 8.225   1.396   -8.578  1.00 0.00 ? 57 ASN A CA   2  
ATOM 1993  C C    . ASN A 1 57 ? 7.920   2.056   -7.236  1.00 0.00 ? 57 ASN A C    2  
ATOM 1994  O O    . ASN A 1 57 ? 8.494   3.090   -6.897  1.00 0.00 ? 57 ASN A O    2  
ATOM 1995  C CB   . ASN A 1 57 ? 7.049   1.595   -9.536  1.00 0.00 ? 57 ASN A CB   2  
ATOM 1996  C CG   . ASN A 1 57 ? 7.444   1.395   -10.986 1.00 0.00 ? 57 ASN A CG   2  
ATOM 1997  O OD1  . ASN A 1 57 ? 7.561   2.356   -11.747 1.00 0.00 ? 57 ASN A OD1  2  
ATOM 1998  N ND2  . ASN A 1 57 ? 7.651   0.143   -11.376 1.00 0.00 ? 57 ASN A ND2  2  
ATOM 1999  H H    . ASN A 1 57 ? 7.925   -0.682  -8.847  1.00 0.00 ? 57 ASN A H    2  
ATOM 2000  H HA   . ASN A 1 57 ? 9.104   1.858   -9.001  1.00 0.00 ? 57 ASN A HA   2  
ATOM 2001  H HB2  . ASN A 1 57 ? 6.272   0.884   -9.294  1.00 0.00 ? 57 ASN A HB2  2  
ATOM 2002  H HB3  . ASN A 1 57 ? 6.663   2.596   -9.421  1.00 0.00 ? 57 ASN A HB3  2  
ATOM 2003  H HD21 . ASN A 1 57 ? 7.540   -0.572  -10.715 1.00 0.00 ? 57 ASN A HD21 2  
ATOM 2004  H HD22 . ASN A 1 57 ? 7.909   -0.014  -12.308 1.00 0.00 ? 57 ASN A HD22 2  
ATOM 2005  N N    . ALA A 1 58 ? 7.014   1.449   -6.477  1.00 0.00 ? 58 ALA A N    2  
ATOM 2006  C CA   . ALA A 1 58 ? 6.635   1.975   -5.172  1.00 0.00 ? 58 ALA A CA   2  
ATOM 2007  C C    . ALA A 1 58 ? 7.861   2.416   -4.380  1.00 0.00 ? 58 ALA A C    2  
ATOM 2008  O O    . ALA A 1 58 ? 7.837   3.441   -3.700  1.00 0.00 ? 58 ALA A O    2  
ATOM 2009  C CB   . ALA A 1 58 ? 5.846   0.933   -4.392  1.00 0.00 ? 58 ALA A CB   2  
ATOM 2010  H H    . ALA A 1 58 ? 6.592   0.627   -6.802  1.00 0.00 ? 58 ALA A H    2  
ATOM 2011  H HA   . ALA A 1 58 ? 5.994   2.831   -5.330  1.00 0.00 ? 58 ALA A HA   2  
ATOM 2012  H HB1  . ALA A 1 58 ? 4.894   0.768   -4.874  1.00 0.00 ? 58 ALA A HB1  2  
ATOM 2013  H HB2  . ALA A 1 58 ? 6.402   0.008   -4.364  1.00 0.00 ? 58 ALA A HB2  2  
ATOM 2014  H HB3  . ALA A 1 58 ? 5.683   1.286   -3.384  1.00 0.00 ? 58 ALA A HB3  2  
ATOM 2015  N N    . ARG A 1 59 ? 8.932   1.634   -4.473  1.00 0.00 ? 59 ARG A N    2  
ATOM 2016  C CA   . ARG A 1 59 ? 10.167  1.943   -3.763  1.00 0.00 ? 59 ARG A CA   2  
ATOM 2017  C C    . ARG A 1 59 ? 10.835  3.183   -4.350  1.00 0.00 ? 59 ARG A C    2  
ATOM 2018  O O    . ARG A 1 59 ? 11.330  4.038   -3.616  1.00 0.00 ? 59 ARG A O    2  
ATOM 2019  C CB   . ARG A 1 59 ? 11.128  0.755   -3.828  1.00 0.00 ? 59 ARG A CB   2  
ATOM 2020  C CG   . ARG A 1 59 ? 10.686  -0.433  -2.988  1.00 0.00 ? 59 ARG A CG   2  
ATOM 2021  C CD   . ARG A 1 59 ? 11.850  -1.362  -2.680  1.00 0.00 ? 59 ARG A CD   2  
ATOM 2022  N NE   . ARG A 1 59 ? 12.504  -1.841  -3.895  1.00 0.00 ? 59 ARG A NE   2  
ATOM 2023  C CZ   . ARG A 1 59 ? 12.055  -2.861  -4.618  1.00 0.00 ? 59 ARG A CZ   2  
ATOM 2024  N NH1  . ARG A 1 59 ? 10.957  -3.506  -4.251  1.00 0.00 ? 59 ARG A NH1  2  
ATOM 2025  N NH2  . ARG A 1 59 ? 12.706  -3.238  -5.711  1.00 0.00 ? 59 ARG A NH2  2  
ATOM 2026  H H    . ARG A 1 59 ? 8.890   0.829   -5.031  1.00 0.00 ? 59 ARG A H    2  
ATOM 2027  H HA   . ARG A 1 59 ? 9.917   2.137   -2.731  1.00 0.00 ? 59 ARG A HA   2  
ATOM 2028  H HB2  . ARG A 1 59 ? 11.213  0.430   -4.854  1.00 0.00 ? 59 ARG A HB2  2  
ATOM 2029  H HB3  . ARG A 1 59 ? 12.099  1.073   -3.478  1.00 0.00 ? 59 ARG A HB3  2  
ATOM 2030  H HG2  . ARG A 1 59 ? 10.273  -0.071  -2.058  1.00 0.00 ? 59 ARG A HG2  2  
ATOM 2031  H HG3  . ARG A 1 59 ? 9.931   -0.983  -3.530  1.00 0.00 ? 59 ARG A HG3  2  
ATOM 2032  H HD2  . ARG A 1 59 ? 12.571  -0.827  -2.081  1.00 0.00 ? 59 ARG A HD2  2  
ATOM 2033  H HD3  . ARG A 1 59 ? 11.478  -2.210  -2.124  1.00 0.00 ? 59 ARG A HD3  2  
ATOM 2034  H HE   . ARG A 1 59 ? 13.317  -1.379  -4.185  1.00 0.00 ? 59 ARG A HE   2  
ATOM 2035  H HH11 . ARG A 1 59 ? 10.464  -3.224  -3.428  1.00 0.00 ? 59 ARG A HH11 2  
ATOM 2036  H HH12 . ARG A 1 59 ? 10.621  -4.273  -4.797  1.00 0.00 ? 59 ARG A HH12 2  
ATOM 2037  H HH21 . ARG A 1 59 ? 13.535  -2.754  -5.992  1.00 0.00 ? 59 ARG A HH21 2  
ATOM 2038  H HH22 . ARG A 1 59 ? 12.368  -4.006  -6.255  1.00 0.00 ? 59 ARG A HH22 2  
ATOM 2039  N N    . GLN A 1 60 ? 10.845  3.273   -5.676  1.00 0.00 ? 60 GLN A N    2  
ATOM 2040  C CA   . GLN A 1 60 ? 11.453  4.408   -6.360  1.00 0.00 ? 60 GLN A CA   2  
ATOM 2041  C C    . GLN A 1 60 ? 10.725  5.704   -6.018  1.00 0.00 ? 60 GLN A C    2  
ATOM 2042  O O    . GLN A 1 60 ? 11.347  6.752   -5.847  1.00 0.00 ? 60 GLN A O    2  
ATOM 2043  C CB   . GLN A 1 60 ? 11.440  4.185   -7.873  1.00 0.00 ? 60 GLN A CB   2  
ATOM 2044  C CG   . GLN A 1 60 ? 12.148  2.912   -8.307  1.00 0.00 ? 60 GLN A CG   2  
ATOM 2045  C CD   . GLN A 1 60 ? 13.579  2.843   -7.811  1.00 0.00 ? 60 GLN A CD   2  
ATOM 2046  O OE1  . GLN A 1 60 ? 14.397  3.711   -8.116  1.00 0.00 ? 60 GLN A OE1  2  
ATOM 2047  N NE2  . GLN A 1 60 ? 13.890  1.806   -7.043  1.00 0.00 ? 60 GLN A NE2  2  
ATOM 2048  H H    . GLN A 1 60 ? 10.434  2.559   -6.206  1.00 0.00 ? 60 GLN A H    2  
ATOM 2049  H HA   . GLN A 1 60 ? 12.477  4.486   -6.026  1.00 0.00 ? 60 GLN A HA   2  
ATOM 2050  H HB2  . GLN A 1 60 ? 10.415  4.134   -8.208  1.00 0.00 ? 60 GLN A HB2  2  
ATOM 2051  H HB3  . GLN A 1 60 ? 11.925  5.023   -8.352  1.00 0.00 ? 60 GLN A HB3  2  
ATOM 2052  H HG2  . GLN A 1 60 ? 11.607  2.063   -7.917  1.00 0.00 ? 60 GLN A HG2  2  
ATOM 2053  H HG3  . GLN A 1 60 ? 12.153  2.869   -9.386  1.00 0.00 ? 60 GLN A HG3  2  
ATOM 2054  H HE21 . GLN A 1 60 ? 13.187  1.152   -6.842  1.00 0.00 ? 60 GLN A HE21 2  
ATOM 2055  H HE22 . GLN A 1 60 ? 14.807  1.735   -6.709  1.00 0.00 ? 60 GLN A HE22 2  
ATOM 2056  N N    . LYS A 1 61 ? 9.402   5.625   -5.920  1.00 0.00 ? 61 LYS A N    2  
ATOM 2057  C CA   . LYS A 1 61 ? 8.588   6.790   -5.597  1.00 0.00 ? 61 LYS A CA   2  
ATOM 2058  C C    . LYS A 1 61 ? 8.709   7.147   -4.119  1.00 0.00 ? 61 LYS A C    2  
ATOM 2059  O O    . LYS A 1 61 ? 8.802   8.320   -3.760  1.00 0.00 ? 61 LYS A O    2  
ATOM 2060  C CB   . LYS A 1 61 ? 7.122   6.527   -5.951  1.00 0.00 ? 61 LYS A CB   2  
ATOM 2061  C CG   . LYS A 1 61 ? 6.899   6.204   -7.418  1.00 0.00 ? 61 LYS A CG   2  
ATOM 2062  C CD   . LYS A 1 61 ? 5.673   5.328   -7.616  1.00 0.00 ? 61 LYS A CD   2  
ATOM 2063  C CE   . LYS A 1 61 ? 4.411   6.163   -7.772  1.00 0.00 ? 61 LYS A CE   2  
ATOM 2064  N NZ   . LYS A 1 61 ? 4.113   6.952   -6.546  1.00 0.00 ? 61 LYS A NZ   2  
ATOM 2065  H H    . LYS A 1 61 ? 8.963   4.760   -6.067  1.00 0.00 ? 61 LYS A H    2  
ATOM 2066  H HA   . LYS A 1 61 ? 8.948   7.620   -6.186  1.00 0.00 ? 61 LYS A HA   2  
ATOM 2067  H HB2  . LYS A 1 61 ? 6.766   5.695   -5.362  1.00 0.00 ? 61 LYS A HB2  2  
ATOM 2068  H HB3  . LYS A 1 61 ? 6.542   7.405   -5.706  1.00 0.00 ? 61 LYS A HB3  2  
ATOM 2069  H HG2  . LYS A 1 61 ? 6.762   7.125   -7.964  1.00 0.00 ? 61 LYS A HG2  2  
ATOM 2070  H HG3  . LYS A 1 61 ? 7.767   5.683   -7.798  1.00 0.00 ? 61 LYS A HG3  2  
ATOM 2071  H HD2  . LYS A 1 61 ? 5.808   4.730   -8.505  1.00 0.00 ? 61 LYS A HD2  2  
ATOM 2072  H HD3  . LYS A 1 61 ? 5.562   4.680   -6.757  1.00 0.00 ? 61 LYS A HD3  2  
ATOM 2073  H HE2  . LYS A 1 61 ? 4.544   6.840   -8.602  1.00 0.00 ? 61 LYS A HE2  2  
ATOM 2074  H HE3  . LYS A 1 61 ? 3.581   5.502   -7.976  1.00 0.00 ? 61 LYS A HE3  2  
ATOM 2075  H HZ1  . LYS A 1 61 ? 4.703   7.808   -6.520  1.00 0.00 ? 61 LYS A HZ1  2  
ATOM 2076  H HZ2  . LYS A 1 61 ? 4.309   6.384   -5.698  1.00 0.00 ? 61 LYS A HZ2  2  
ATOM 2077  H HZ3  . LYS A 1 61 ? 3.112   7.234   -6.537  1.00 0.00 ? 61 LYS A HZ3  2  
ATOM 2078  N N    . ALA A 1 62 ? 8.708   6.127   -3.267  1.00 0.00 ? 62 ALA A N    2  
ATOM 2079  C CA   . ALA A 1 62 ? 8.822   6.333   -1.829  1.00 0.00 ? 62 ALA A CA   2  
ATOM 2080  C C    . ALA A 1 62 ? 10.190  6.896   -1.461  1.00 0.00 ? 62 ALA A C    2  
ATOM 2081  O O    . ALA A 1 62 ? 10.299  7.790   -0.621  1.00 0.00 ? 62 ALA A O    2  
ATOM 2082  C CB   . ALA A 1 62 ? 8.569   5.029   -1.087  1.00 0.00 ? 62 ALA A CB   2  
ATOM 2083  H H    . ALA A 1 62 ? 8.631   5.214   -3.614  1.00 0.00 ? 62 ALA A H    2  
ATOM 2084  H HA   . ALA A 1 62 ? 8.061   7.041   -1.532  1.00 0.00 ? 62 ALA A HA   2  
ATOM 2085  H HB1  . ALA A 1 62 ? 9.512   4.543   -0.883  1.00 0.00 ? 62 ALA A HB1  2  
ATOM 2086  H HB2  . ALA A 1 62 ? 8.062   5.236   -0.157  1.00 0.00 ? 62 ALA A HB2  2  
ATOM 2087  H HB3  . ALA A 1 62 ? 7.955   4.382   -1.696  1.00 0.00 ? 62 ALA A HB3  2  
ATOM 2088  N N    . ARG A 1 63 ? 11.232  6.367   -2.094  1.00 0.00 ? 63 ARG A N    2  
ATOM 2089  C CA   . ARG A 1 63 ? 12.594  6.817   -1.832  1.00 0.00 ? 63 ARG A CA   2  
ATOM 2090  C C    . ARG A 1 63 ? 12.814  8.228   -2.369  1.00 0.00 ? 63 ARG A C    2  
ATOM 2091  O O    . ARG A 1 63 ? 11.911  8.831   -2.950  1.00 0.00 ? 63 ARG A O    2  
ATOM 2092  C CB   . ARG A 1 63 ? 13.602  5.855   -2.465  1.00 0.00 ? 63 ARG A CB   2  
ATOM 2093  C CG   . ARG A 1 63 ? 13.608  5.894   -3.985  1.00 0.00 ? 63 ARG A CG   2  
ATOM 2094  C CD   . ARG A 1 63 ? 14.527  4.830   -4.565  1.00 0.00 ? 63 ARG A CD   2  
ATOM 2095  N NE   . ARG A 1 63 ? 14.958  5.160   -5.921  1.00 0.00 ? 63 ARG A NE   2  
ATOM 2096  C CZ   . ARG A 1 63 ? 15.996  5.942   -6.193  1.00 0.00 ? 63 ARG A CZ   2  
ATOM 2097  N NH1  . ARG A 1 63 ? 16.706  6.473   -5.207  1.00 0.00 ? 63 ARG A NH1  2  
ATOM 2098  N NH2  . ARG A 1 63 ? 16.326  6.195   -7.453  1.00 0.00 ? 63 ARG A NH2  2  
ATOM 2099  H H    . ARG A 1 63 ? 11.082  5.658   -2.754  1.00 0.00 ? 63 ARG A H    2  
ATOM 2100  H HA   . ARG A 1 63 ? 12.741  6.824   -0.762  1.00 0.00 ? 63 ARG A HA   2  
ATOM 2101  H HB2  . ARG A 1 63 ? 14.592  6.109   -2.117  1.00 0.00 ? 63 ARG A HB2  2  
ATOM 2102  H HB3  . ARG A 1 63 ? 13.366  4.849   -2.154  1.00 0.00 ? 63 ARG A HB3  2  
ATOM 2103  H HG2  . ARG A 1 63 ? 12.605  5.721   -4.344  1.00 0.00 ? 63 ARG A HG2  2  
ATOM 2104  H HG3  . ARG A 1 63 ? 13.947  6.866   -4.309  1.00 0.00 ? 63 ARG A HG3  2  
ATOM 2105  H HD2  . ARG A 1 63 ? 15.398  4.742   -3.933  1.00 0.00 ? 63 ARG A HD2  2  
ATOM 2106  H HD3  . ARG A 1 63 ? 13.999  3.889   -4.584  1.00 0.00 ? 63 ARG A HD3  2  
ATOM 2107  H HE   . ARG A 1 63 ? 14.447  4.778   -6.665  1.00 0.00 ? 63 ARG A HE   2  
ATOM 2108  H HH11 . ARG A 1 63 ? 16.461  6.283   -4.257  1.00 0.00 ? 63 ARG A HH11 2  
ATOM 2109  H HH12 . ARG A 1 63 ? 17.488  7.061   -5.414  1.00 0.00 ? 63 ARG A HH12 2  
ATOM 2110  H HH21 . ARG A 1 63 ? 15.793  5.797   -8.199  1.00 0.00 ? 63 ARG A HH21 2  
ATOM 2111  H HH22 . ARG A 1 63 ? 17.107  6.785   -7.656  1.00 0.00 ? 63 ARG A HH22 2  
ATOM 2112  N N    . LYS A 1 64 ? 14.020  8.749   -2.172  1.00 0.00 ? 64 LYS A N    2  
ATOM 2113  C CA   . LYS A 1 64 ? 14.361  10.088  -2.636  1.00 0.00 ? 64 LYS A CA   2  
ATOM 2114  C C    . LYS A 1 64 ? 15.014  10.037  -4.014  1.00 0.00 ? 64 LYS A C    2  
ATOM 2115  O O    . LYS A 1 64 ? 15.680  9.061   -4.359  1.00 0.00 ? 64 LYS A O    2  
ATOM 2116  C CB   . LYS A 1 64 ? 15.300  10.772  -1.640  1.00 0.00 ? 64 LYS A CB   2  
ATOM 2117  C CG   . LYS A 1 64 ? 15.603  12.220  -1.985  1.00 0.00 ? 64 LYS A CG   2  
ATOM 2118  C CD   . LYS A 1 64 ? 16.407  12.898  -0.889  1.00 0.00 ? 64 LYS A CD   2  
ATOM 2119  C CE   . LYS A 1 64 ? 17.846  12.405  -0.867  1.00 0.00 ? 64 LYS A CE   2  
ATOM 2120  N NZ   . LYS A 1 64 ? 18.616  12.889  -2.047  1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2121  H H    . LYS A 1 64 ? 14.699  8.219   -1.702  1.00 0.00 ? 64 LYS A H    2  
ATOM 2122  H HA   . LYS A 1 64 ? 13.447  10.658  -2.706  1.00 0.00 ? 64 LYS A HA   2  
ATOM 2123  H HB2  . LYS A 1 64 ? 14.848  10.745  -0.660  1.00 0.00 ? 64 LYS A HB2  2  
ATOM 2124  H HB3  . LYS A 1 64 ? 16.233  10.229  -1.612  1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2125  H HG2  . LYS A 1 64 ? 16.169  12.252  -2.904  1.00 0.00 ? 64 LYS A HG2  2  
ATOM 2126  H HG3  . LYS A 1 64 ? 14.670  12.752  -2.116  1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2127  H HD2  . LYS A 1 64 ? 16.407  13.965  -1.060  1.00 0.00 ? 64 LYS A HD2  2  
ATOM 2128  H HD3  . LYS A 1 64 ? 15.948  12.686  0.067   1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2129  H HE2  . LYS A 1 64 ? 18.322  12.763  0.033   1.00 0.00 ? 64 LYS A HE2  2  
ATOM 2130  H HE3  . LYS A 1 64 ? 17.842  11.325  -0.868  1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2131  H HZ1  . LYS A 1 64 ? 18.123  13.691  -2.490  1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2132  H HZ2  . LYS A 1 64 ? 18.712  12.127  -2.747  1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2133  H HZ3  . LYS A 1 64 ? 19.564  13.198  -1.753  1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2134  N N    . SER A 1 65 ? 14.820  11.094  -4.795  1.00 0.00 ? 65 SER A N    2  
ATOM 2135  C CA   . SER A 1 65 ? 15.389  11.168  -6.136  1.00 0.00 ? 65 SER A CA   2  
ATOM 2136  C C    . SER A 1 65 ? 15.119  12.531  -6.767  1.00 0.00 ? 65 SER A C    2  
ATOM 2137  O O    . SER A 1 65 ? 14.058  13.121  -6.566  1.00 0.00 ? 65 SER A O    2  
ATOM 2138  C CB   . SER A 1 65 ? 14.811  10.061  -7.020  1.00 0.00 ? 65 SER A CB   2  
ATOM 2139  O OG   . SER A 1 65 ? 15.362  10.109  -8.324  1.00 0.00 ? 65 SER A OG   2  
ATOM 2140  H H    . SER A 1 65 ? 14.280  11.841  -4.463  1.00 0.00 ? 65 SER A H    2  
ATOM 2141  H HA   . SER A 1 65 ? 16.456  11.029  -6.052  1.00 0.00 ? 65 SER A HA   2  
ATOM 2142  H HB2  . SER A 1 65 ? 15.035  9.100   -6.583  1.00 0.00 ? 65 SER A HB2  2  
ATOM 2143  H HB3  . SER A 1 65 ? 13.739  10.183  -7.090  1.00 0.00 ? 65 SER A HB3  2  
ATOM 2144  H HG   . SER A 1 65 ? 15.622  9.226   -8.595  1.00 0.00 ? 65 SER A HG   2  
ATOM 2145  N N    . GLY A 1 66 ? 16.089  13.026  -7.530  1.00 0.00 ? 66 GLY A N    2  
ATOM 2146  C CA   . GLY A 1 66 ? 15.938  14.315  -8.178  1.00 0.00 ? 66 GLY A CA   2  
ATOM 2147  C C    . GLY A 1 66 ? 17.040  14.592  -9.181  1.00 0.00 ? 66 GLY A C    2  
ATOM 2148  O O    . GLY A 1 66 ? 18.188  14.184  -9.003  1.00 0.00 ? 66 GLY A O    2  
ATOM 2149  H H    . GLY A 1 66 ? 16.914  12.511  -7.654  1.00 0.00 ? 66 GLY A H    2  
ATOM 2150  H HA2  . GLY A 1 66 ? 14.986  14.340  -8.688  1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2151  H HA3  . GLY A 1 66 ? 15.951  15.088  -7.424  1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2152  N N    . PRO A 1 67 ? 16.693  15.301  -10.266 1.00 0.00 ? 67 PRO A N    2  
ATOM 2153  C CA   . PRO A 1 67 ? 17.648  15.647  -11.324 1.00 0.00 ? 67 PRO A CA   2  
ATOM 2154  C C    . PRO A 1 67 ? 18.678  16.672  -10.862 1.00 0.00 ? 67 PRO A C    2  
ATOM 2155  O O    . PRO A 1 67 ? 18.442  17.878  -10.933 1.00 0.00 ? 67 PRO A O    2  
ATOM 2156  C CB   . PRO A 1 67 ? 16.761  16.237  -12.423 1.00 0.00 ? 67 PRO A CB   2  
ATOM 2157  C CG   . PRO A 1 67 ? 15.559  16.749  -11.706 1.00 0.00 ? 67 PRO A CG   2  
ATOM 2158  C CD   . PRO A 1 67 ? 15.343  15.819  -10.544 1.00 0.00 ? 67 PRO A CD   2  
ATOM 2159  H HA   . PRO A 1 67 ? 18.157  14.772  -11.701 1.00 0.00 ? 67 PRO A HA   2  
ATOM 2160  H HB2  . PRO A 1 67 ? 17.290  17.034  -12.927 1.00 0.00 ? 67 PRO A HB2  2  
ATOM 2161  H HB3  . PRO A 1 67 ? 16.499  15.466  -13.132 1.00 0.00 ? 67 PRO A HB3  2  
ATOM 2162  H HG2  . PRO A 1 67 ? 15.742  17.753  -11.354 1.00 0.00 ? 67 PRO A HG2  2  
ATOM 2163  H HG3  . PRO A 1 67 ? 14.704  16.730  -12.364 1.00 0.00 ? 67 PRO A HG3  2  
ATOM 2164  H HD2  . PRO A 1 67 ? 14.956  16.361  -9.694  1.00 0.00 ? 67 PRO A HD2  2  
ATOM 2165  H HD3  . PRO A 1 67 ? 14.673  15.019  -10.820 1.00 0.00 ? 67 PRO A HD3  2  
ATOM 2166  N N    . SER A 1 68 ? 19.821  16.185  -10.390 1.00 0.00 ? 68 SER A N    2  
ATOM 2167  C CA   . SER A 1 68 ? 20.886  17.060  -9.914  1.00 0.00 ? 68 SER A CA   2  
ATOM 2168  C C    . SER A 1 68 ? 20.317  18.204  -9.080  1.00 0.00 ? 68 SER A C    2  
ATOM 2169  O O    . SER A 1 68 ? 20.738  19.353  -9.214  1.00 0.00 ? 68 SER A O    2  
ATOM 2170  C CB   . SER A 1 68 ? 21.681  17.620  -11.094 1.00 0.00 ? 68 SER A CB   2  
ATOM 2171  O OG   . SER A 1 68 ? 20.934  18.601  -11.793 1.00 0.00 ? 68 SER A OG   2  
ATOM 2172  H H    . SER A 1 68 ? 19.949  15.214  -10.359 1.00 0.00 ? 68 SER A H    2  
ATOM 2173  H HA   . SER A 1 68 ? 21.545  16.471  -9.293  1.00 0.00 ? 68 SER A HA   2  
ATOM 2174  H HB2  . SER A 1 68 ? 22.592  18.070  -10.731 1.00 0.00 ? 68 SER A HB2  2  
ATOM 2175  H HB3  . SER A 1 68 ? 21.923  16.817  -11.775 1.00 0.00 ? 68 SER A HB3  2  
ATOM 2176  H HG   . SER A 1 68 ? 20.137  18.203  -12.150 1.00 0.00 ? 68 SER A HG   2  
ATOM 2177  N N    . SER A 1 69 ? 19.358  17.881  -8.219  1.00 0.00 ? 69 SER A N    2  
ATOM 2178  C CA   . SER A 1 69 ? 18.727  18.881  -7.366  1.00 0.00 ? 69 SER A CA   2  
ATOM 2179  C C    . SER A 1 69 ? 19.772  19.807  -6.751  1.00 0.00 ? 69 SER A C    2  
ATOM 2180  O O    . SER A 1 69 ? 20.542  19.402  -5.881  1.00 0.00 ? 69 SER A O    2  
ATOM 2181  C CB   . SER A 1 69 ? 17.917  18.202  -6.260  1.00 0.00 ? 69 SER A CB   2  
ATOM 2182  O OG   . SER A 1 69 ? 17.011  19.111  -5.659  1.00 0.00 ? 69 SER A OG   2  
ATOM 2183  H H    . SER A 1 69 ? 19.065  16.947  -8.158  1.00 0.00 ? 69 SER A H    2  
ATOM 2184  H HA   . SER A 1 69 ? 18.060  19.468  -7.980  1.00 0.00 ? 69 SER A HA   2  
ATOM 2185  H HB2  . SER A 1 69 ? 17.358  17.379  -6.680  1.00 0.00 ? 69 SER A HB2  2  
ATOM 2186  H HB3  . SER A 1 69 ? 18.591  17.829  -5.502  1.00 0.00 ? 69 SER A HB3  2  
ATOM 2187  H HG   . SER A 1 69 ? 16.111  18.809  -5.805  1.00 0.00 ? 69 SER A HG   2  
ATOM 2188  N N    . GLY A 1 70 ? 19.793  21.054  -7.211  1.00 0.00 ? 70 GLY A N    2  
ATOM 2189  C CA   . GLY A 1 70 ? 20.747  22.019  -6.697  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2190  C C    . GLY A 1 70 ? 20.074  23.253  -6.127  1.00 0.00 ? 70 GLY A C    2  
ATOM 2191  O O    . GLY A 1 70 ? 20.745  24.188  -5.691  1.00 0.00 ? 70 GLY A O    2  
ATOM 2192  H H    . GLY A 1 70 ? 19.156  21.321  -7.906  1.00 0.00 ? 70 GLY A H    2  
ATOM 2193  H HA2  . GLY A 1 70 ? 21.333  21.551  -5.920  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2194  H HA3  . GLY A 1 70 ? 21.405  22.320  -7.498  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2195  N N    . GLY A 1 1  ? 7.774   -19.469 -19.034 1.00 0.00 ? 1  GLY A N    3  
ATOM 2196  C CA   . GLY A 1 1  ? 7.510   -20.416 -20.101 1.00 0.00 ? 1  GLY A CA   3  
ATOM 2197  C C    . GLY A 1 1  ? 7.142   -19.734 -21.404 1.00 0.00 ? 1  GLY A C    3  
ATOM 2198  O O    . GLY A 1 1  ? 6.083   -19.116 -21.511 1.00 0.00 ? 1  GLY A O    3  
ATOM 2199  H H1   . GLY A 1 1  ? 7.954   -19.793 -18.127 1.00 0.00 ? 1  GLY A H1   3  
ATOM 2200  H HA2  . GLY A 1 1  ? 8.391   -21.019 -20.259 1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2201  H HA3  . GLY A 1 1  ? 6.695   -21.059 -19.802 1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2202  N N    . SER A 1 2  ? 8.018   -19.846 -22.397 1.00 0.00 ? 2  SER A N    3  
ATOM 2203  C CA   . SER A 1 2  ? 7.783   -19.230 -23.697 1.00 0.00 ? 2  SER A CA   3  
ATOM 2204  C C    . SER A 1 2  ? 7.668   -17.715 -23.568 1.00 0.00 ? 2  SER A C    3  
ATOM 2205  O O    . SER A 1 2  ? 6.808   -17.091 -24.189 1.00 0.00 ? 2  SER A O    3  
ATOM 2206  C CB   . SER A 1 2  ? 6.510   -19.797 -24.330 1.00 0.00 ? 2  SER A CB   3  
ATOM 2207  O OG   . SER A 1 2  ? 6.692   -21.147 -24.720 1.00 0.00 ? 2  SER A OG   3  
ATOM 2208  H H    . SER A 1 2  ? 8.845   -20.352 -22.250 1.00 0.00 ? 2  SER A H    3  
ATOM 2209  H HA   . SER A 1 2  ? 8.625   -19.464 -24.332 1.00 0.00 ? 2  SER A HA   3  
ATOM 2210  H HB2  . SER A 1 2  ? 5.703   -19.747 -23.616 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2211  H HB3  . SER A 1 2  ? 6.256   -19.214 -25.204 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2212  H HG   . SER A 1 2  ? 7.112   -21.633 -24.006 1.00 0.00 ? 2  SER A HG   3  
ATOM 2213  N N    . SER A 1 3  ? 8.543   -17.129 -22.757 1.00 0.00 ? 3  SER A N    3  
ATOM 2214  C CA   . SER A 1 3  ? 8.539   -15.686 -22.542 1.00 0.00 ? 3  SER A CA   3  
ATOM 2215  C C    . SER A 1 3  ? 9.793   -15.046 -23.129 1.00 0.00 ? 3  SER A C    3  
ATOM 2216  O O    . SER A 1 3  ? 10.909  -15.329 -22.696 1.00 0.00 ? 3  SER A O    3  
ATOM 2217  C CB   . SER A 1 3  ? 8.444   -15.372 -21.048 1.00 0.00 ? 3  SER A CB   3  
ATOM 2218  O OG   . SER A 1 3  ? 9.635   -15.740 -20.373 1.00 0.00 ? 3  SER A OG   3  
ATOM 2219  H H    . SER A 1 3  ? 9.205   -17.680 -22.290 1.00 0.00 ? 3  SER A H    3  
ATOM 2220  H HA   . SER A 1 3  ? 7.673   -15.279 -23.043 1.00 0.00 ? 3  SER A HA   3  
ATOM 2221  H HB2  . SER A 1 3  ? 8.282   -14.313 -20.915 1.00 0.00 ? 3  SER A HB2  3  
ATOM 2222  H HB3  . SER A 1 3  ? 7.617   -15.920 -20.620 1.00 0.00 ? 3  SER A HB3  3  
ATOM 2223  H HG   . SER A 1 3  ? 10.159  -14.955 -20.198 1.00 0.00 ? 3  SER A HG   3  
ATOM 2224  N N    . GLY A 1 4  ? 9.600   -14.181 -24.120 1.00 0.00 ? 4  GLY A N    3  
ATOM 2225  C CA   . GLY A 1 4  ? 10.724  -13.513 -24.752 1.00 0.00 ? 4  GLY A CA   3  
ATOM 2226  C C    . GLY A 1 4  ? 10.423  -12.067 -25.091 1.00 0.00 ? 4  GLY A C    3  
ATOM 2227  O O    . GLY A 1 4  ? 11.256  -11.186 -24.880 1.00 0.00 ? 4  GLY A O    3  
ATOM 2228  H H    . GLY A 1 4  ? 8.687   -13.994 -24.424 1.00 0.00 ? 4  GLY A H    3  
ATOM 2229  H HA2  . GLY A 1 4  ? 11.570  -13.546 -24.083 1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2230  H HA3  . GLY A 1 4  ? 10.975  -14.039 -25.661 1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2231  N N    . SER A 1 5  ? 9.228   -11.821 -25.620 1.00 0.00 ? 5  SER A N    3  
ATOM 2232  C CA   . SER A 1 5  ? 8.821   -10.472 -25.995 1.00 0.00 ? 5  SER A CA   3  
ATOM 2233  C C    . SER A 1 5  ? 7.658   -9.996  -25.131 1.00 0.00 ? 5  SER A C    3  
ATOM 2234  O O    . SER A 1 5  ? 6.654   -10.692 -24.983 1.00 0.00 ? 5  SER A O    3  
ATOM 2235  C CB   . SER A 1 5  ? 8.425   -10.428 -27.472 1.00 0.00 ? 5  SER A CB   3  
ATOM 2236  O OG   . SER A 1 5  ? 7.453   -11.416 -27.769 1.00 0.00 ? 5  SER A OG   3  
ATOM 2237  H H    . SER A 1 5  ? 8.607   -12.566 -25.764 1.00 0.00 ? 5  SER A H    3  
ATOM 2238  H HA   . SER A 1 5  ? 9.664   -9.816  -25.838 1.00 0.00 ? 5  SER A HA   3  
ATOM 2239  H HB2  . SER A 1 5  ? 8.016   -9.457  -27.704 1.00 0.00 ? 5  SER A HB2  3  
ATOM 2240  H HB3  . SER A 1 5  ? 9.299   -10.605 -28.082 1.00 0.00 ? 5  SER A HB3  3  
ATOM 2241  H HG   . SER A 1 5  ? 6.860   -11.517 -27.021 1.00 0.00 ? 5  SER A HG   3  
ATOM 2242  N N    . SER A 1 6  ? 7.802   -8.803  -24.561 1.00 0.00 ? 6  SER A N    3  
ATOM 2243  C CA   . SER A 1 6  ? 6.766   -8.234  -23.708 1.00 0.00 ? 6  SER A CA   3  
ATOM 2244  C C    . SER A 1 6  ? 5.437   -8.146  -24.452 1.00 0.00 ? 6  SER A C    3  
ATOM 2245  O O    . SER A 1 6  ? 5.367   -8.399  -25.654 1.00 0.00 ? 6  SER A O    3  
ATOM 2246  C CB   . SER A 1 6  ? 7.183   -6.844  -23.221 1.00 0.00 ? 6  SER A CB   3  
ATOM 2247  O OG   . SER A 1 6  ? 6.570   -6.533  -21.982 1.00 0.00 ? 6  SER A OG   3  
ATOM 2248  H H    . SER A 1 6  ? 8.626   -8.296  -24.717 1.00 0.00 ? 6  SER A H    3  
ATOM 2249  H HA   . SER A 1 6  ? 6.645   -8.883  -22.854 1.00 0.00 ? 6  SER A HA   3  
ATOM 2250  H HB2  . SER A 1 6  ? 8.255   -6.816  -23.096 1.00 0.00 ? 6  SER A HB2  3  
ATOM 2251  H HB3  . SER A 1 6  ? 6.886   -6.106  -23.952 1.00 0.00 ? 6  SER A HB3  3  
ATOM 2252  H HG   . SER A 1 6  ? 6.965   -5.735  -21.621 1.00 0.00 ? 6  SER A HG   3  
ATOM 2253  N N    . GLY A 1 7  ? 4.382   -7.787  -23.726 1.00 0.00 ? 7  GLY A N    3  
ATOM 2254  C CA   . GLY A 1 7  ? 3.068   -7.672  -24.332 1.00 0.00 ? 7  GLY A CA   3  
ATOM 2255  C C    . GLY A 1 7  ? 2.760   -6.259  -24.785 1.00 0.00 ? 7  GLY A C    3  
ATOM 2256  O O    . GLY A 1 7  ? 2.471   -5.387  -23.965 1.00 0.00 ? 7  GLY A O    3  
ATOM 2257  H H    . GLY A 1 7  ? 4.497   -7.597  -22.771 1.00 0.00 ? 7  GLY A H    3  
ATOM 2258  H HA2  . GLY A 1 7  ? 3.020   -8.331  -25.187 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2259  H HA3  . GLY A 1 7  ? 2.324   -7.978  -23.612 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2260  N N    . ARG A 1 8  ? 2.821   -6.031  -26.092 1.00 0.00 ? 8  ARG A N    3  
ATOM 2261  C CA   . ARG A 1 8  ? 2.549   -4.712  -26.652 1.00 0.00 ? 8  ARG A CA   3  
ATOM 2262  C C    . ARG A 1 8  ? 1.327   -4.082  -25.988 1.00 0.00 ? 8  ARG A C    3  
ATOM 2263  O O    . ARG A 1 8  ? 1.339   -2.903  -25.635 1.00 0.00 ? 8  ARG A O    3  
ATOM 2264  C CB   . ARG A 1 8  ? 2.327   -4.811  -28.162 1.00 0.00 ? 8  ARG A CB   3  
ATOM 2265  C CG   . ARG A 1 8  ? 2.146   -3.463  -28.841 1.00 0.00 ? 8  ARG A CG   3  
ATOM 2266  C CD   . ARG A 1 8  ? 3.474   -2.742  -29.009 1.00 0.00 ? 8  ARG A CD   3  
ATOM 2267  N NE   . ARG A 1 8  ? 4.408   -3.500  -29.838 1.00 0.00 ? 8  ARG A NE   3  
ATOM 2268  C CZ   . ARG A 1 8  ? 5.450   -2.957  -30.456 1.00 0.00 ? 8  ARG A CZ   3  
ATOM 2269  N NH1  . ARG A 1 8  ? 5.691   -1.658  -30.340 1.00 0.00 ? 8  ARG A NH1  3  
ATOM 2270  N NH2  . ARG A 1 8  ? 6.255   -3.713  -31.192 1.00 0.00 ? 8  ARG A NH2  3  
ATOM 2271  H H    . ARG A 1 8  ? 3.057   -6.766  -26.696 1.00 0.00 ? 8  ARG A H    3  
ATOM 2272  H HA   . ARG A 1 8  ? 3.409   -4.087  -26.463 1.00 0.00 ? 8  ARG A HA   3  
ATOM 2273  H HB2  . ARG A 1 8  ? 3.180   -5.302  -28.608 1.00 0.00 ? 8  ARG A HB2  3  
ATOM 2274  H HB3  . ARG A 1 8  ? 1.444   -5.404  -28.346 1.00 0.00 ? 8  ARG A HB3  3  
ATOM 2275  H HG2  . ARG A 1 8  ? 1.707   -3.617  -29.815 1.00 0.00 ? 8  ARG A HG2  3  
ATOM 2276  H HG3  . ARG A 1 8  ? 1.489   -2.854  -28.239 1.00 0.00 ? 8  ARG A HG3  3  
ATOM 2277  H HD2  . ARG A 1 8  ? 3.292   -1.784  -29.474 1.00 0.00 ? 8  ARG A HD2  3  
ATOM 2278  H HD3  . ARG A 1 8  ? 3.913   -2.591  -28.034 1.00 0.00 ? 8  ARG A HD3  3  
ATOM 2279  H HE   . ARG A 1 8  ? 4.249   -4.462  -29.937 1.00 0.00 ? 8  ARG A HE   3  
ATOM 2280  H HH11 . ARG A 1 8  ? 5.087   -1.086  -29.785 1.00 0.00 ? 8  ARG A HH11 3  
ATOM 2281  H HH12 . ARG A 1 8  ? 6.477   -1.251  -30.806 1.00 0.00 ? 8  ARG A HH12 3  
ATOM 2282  H HH21 . ARG A 1 8  ? 6.077   -4.692  -31.282 1.00 0.00 ? 8  ARG A HH21 3  
ATOM 2283  H HH22 . ARG A 1 8  ? 7.039   -3.303  -31.657 1.00 0.00 ? 8  ARG A HH22 3  
ATOM 2284  N N    . SER A 1 9  ? 0.275   -4.876  -25.823 1.00 0.00 ? 9  SER A N    3  
ATOM 2285  C CA   . SER A 1 9  ? -0.956  -4.396  -25.206 1.00 0.00 ? 9  SER A CA   3  
ATOM 2286  C C    . SER A 1 9  ? -1.264  -5.173  -23.929 1.00 0.00 ? 9  SER A C    3  
ATOM 2287  O O    . SER A 1 9  ? -1.465  -6.387  -23.962 1.00 0.00 ? 9  SER A O    3  
ATOM 2288  C CB   . SER A 1 9  ? -2.125  -4.519  -26.186 1.00 0.00 ? 9  SER A CB   3  
ATOM 2289  O OG   . SER A 1 9  ? -1.849  -3.838  -27.397 1.00 0.00 ? 9  SER A OG   3  
ATOM 2290  H H    . SER A 1 9  ? 0.326   -5.808  -26.125 1.00 0.00 ? 9  SER A H    3  
ATOM 2291  H HA   . SER A 1 9  ? -0.817  -3.355  -24.955 1.00 0.00 ? 9  SER A HA   3  
ATOM 2292  H HB2  . SER A 1 9  ? -2.299  -5.561  -26.405 1.00 0.00 ? 9  SER A HB2  3  
ATOM 2293  H HB3  . SER A 1 9  ? -3.011  -4.092  -25.740 1.00 0.00 ? 9  SER A HB3  3  
ATOM 2294  H HG   . SER A 1 9  ? -0.988  -4.106  -27.727 1.00 0.00 ? 9  SER A HG   3  
ATOM 2295  N N    . SER A 1 10 ? -1.298  -4.463  -22.806 1.00 0.00 ? 10 SER A N    3  
ATOM 2296  C CA   . SER A 1 10 ? -1.577  -5.086  -21.517 1.00 0.00 ? 10 SER A CA   3  
ATOM 2297  C C    . SER A 1 10 ? -1.913  -4.032  -20.466 1.00 0.00 ? 10 SER A C    3  
ATOM 2298  O O    . SER A 1 10 ? -1.077  -3.197  -20.120 1.00 0.00 ? 10 SER A O    3  
ATOM 2299  C CB   . SER A 1 10 ? -0.377  -5.917  -21.058 1.00 0.00 ? 10 SER A CB   3  
ATOM 2300  O OG   . SER A 1 10 ? -0.772  -6.914  -20.132 1.00 0.00 ? 10 SER A OG   3  
ATOM 2301  H H    . SER A 1 10 ? -1.129  -3.499  -22.845 1.00 0.00 ? 10 SER A H    3  
ATOM 2302  H HA   . SER A 1 10 ? -2.429  -5.738  -21.641 1.00 0.00 ? 10 SER A HA   3  
ATOM 2303  H HB2  . SER A 1 10 ? 0.075   -6.395  -21.913 1.00 0.00 ? 10 SER A HB2  3  
ATOM 2304  H HB3  . SER A 1 10 ? 0.346   -5.268  -20.584 1.00 0.00 ? 10 SER A HB3  3  
ATOM 2305  H HG   . SER A 1 10 ? -1.306  -7.574  -20.580 1.00 0.00 ? 10 SER A HG   3  
ATOM 2306  N N    . ARG A 1 11 ? -3.142  -4.078  -19.962 1.00 0.00 ? 11 ARG A N    3  
ATOM 2307  C CA   . ARG A 1 11 ? -3.589  -3.127  -18.952 1.00 0.00 ? 11 ARG A CA   3  
ATOM 2308  C C    . ARG A 1 11 ? -3.861  -3.831  -17.626 1.00 0.00 ? 11 ARG A C    3  
ATOM 2309  O O    . ARG A 1 11 ? -5.000  -4.184  -17.319 1.00 0.00 ? 11 ARG A O    3  
ATOM 2310  C CB   . ARG A 1 11 ? -4.851  -2.404  -19.426 1.00 0.00 ? 11 ARG A CB   3  
ATOM 2311  C CG   . ARG A 1 11 ? -4.583  -1.332  -20.469 1.00 0.00 ? 11 ARG A CG   3  
ATOM 2312  C CD   . ARG A 1 11 ? -3.873  -0.131  -19.865 1.00 0.00 ? 11 ARG A CD   3  
ATOM 2313  N NE   . ARG A 1 11 ? -3.604  0.903   -20.860 1.00 0.00 ? 11 ARG A NE   3  
ATOM 2314  C CZ   . ARG A 1 11 ? -2.633  1.802   -20.741 1.00 0.00 ? 11 ARG A CZ   3  
ATOM 2315  N NH1  . ARG A 1 11 ? -1.844  1.794   -19.676 1.00 0.00 ? 11 ARG A NH1  3  
ATOM 2316  N NH2  . ARG A 1 11 ? -2.450  2.713   -21.690 1.00 0.00 ? 11 ARG A NH2  3  
ATOM 2317  H H    . ARG A 1 11 ? -3.762  -4.768  -20.278 1.00 0.00 ? 11 ARG A H    3  
ATOM 2318  H HA   . ARG A 1 11 ? -2.803  -2.402  -18.807 1.00 0.00 ? 11 ARG A HA   3  
ATOM 2319  H HB2  . ARG A 1 11 ? -5.529  -3.129  -19.852 1.00 0.00 ? 11 ARG A HB2  3  
ATOM 2320  H HB3  . ARG A 1 11 ? -5.324  -1.937  -18.575 1.00 0.00 ? 11 ARG A HB3  3  
ATOM 2321  H HG2  . ARG A 1 11 ? -3.963  -1.749  -21.249 1.00 0.00 ? 11 ARG A HG2  3  
ATOM 2322  H HG3  . ARG A 1 11 ? -5.524  -1.009  -20.890 1.00 0.00 ? 11 ARG A HG3  3  
ATOM 2323  H HD2  . ARG A 1 11 ? -4.496  0.285   -19.087 1.00 0.00 ? 11 ARG A HD2  3  
ATOM 2324  H HD3  . ARG A 1 11 ? -2.937  -0.461  -19.439 1.00 0.00 ? 11 ARG A HD3  3  
ATOM 2325  H HE   . ARG A 1 11 ? -4.175  0.928   -21.655 1.00 0.00 ? 11 ARG A HE   3  
ATOM 2326  H HH11 . ARG A 1 11 ? -1.978  1.109   -18.961 1.00 0.00 ? 11 ARG A HH11 3  
ATOM 2327  H HH12 . ARG A 1 11 ? -1.113  2.471   -19.590 1.00 0.00 ? 11 ARG A HH12 3  
ATOM 2328  H HH21 . ARG A 1 11 ? -3.043  2.722   -22.494 1.00 0.00 ? 11 ARG A HH21 3  
ATOM 2329  H HH22 . ARG A 1 11 ? -1.720  3.389   -21.599 1.00 0.00 ? 11 ARG A HH22 3  
ATOM 2330  N N    . THR A 1 12 ? -2.806  -4.033  -16.842 1.00 0.00 ? 12 THR A N    3  
ATOM 2331  C CA   . THR A 1 12 ? -2.930  -4.696  -15.550 1.00 0.00 ? 12 THR A CA   3  
ATOM 2332  C C    . THR A 1 12 ? -3.200  -3.688  -14.438 1.00 0.00 ? 12 THR A C    3  
ATOM 2333  O O    . THR A 1 12 ? -2.270  -3.165  -13.823 1.00 0.00 ? 12 THR A O    3  
ATOM 2334  C CB   . THR A 1 12 ? -1.660  -5.496  -15.205 1.00 0.00 ? 12 THR A CB   3  
ATOM 2335  O OG1  . THR A 1 12 ? -1.284  -6.320  -16.314 1.00 0.00 ? 12 THR A OG1  3  
ATOM 2336  C CG2  . THR A 1 12 ? -1.884  -6.363  -13.975 1.00 0.00 ? 12 THR A CG2  3  
ATOM 2337  H H    . THR A 1 12 ? -1.924  -3.729  -17.141 1.00 0.00 ? 12 THR A H    3  
ATOM 2338  H HA   . THR A 1 12 ? -3.760  -5.385  -15.607 1.00 0.00 ? 12 THR A HA   3  
ATOM 2339  H HB   . THR A 1 12 ? -0.860  -4.800  -14.996 1.00 0.00 ? 12 THR A HB   3  
ATOM 2340  H HG1  . THR A 1 12 ? -0.797  -7.084  -15.994 1.00 0.00 ? 12 THR A HG1  3  
ATOM 2341  H HG21 . THR A 1 12 ? -2.933  -6.605  -13.891 1.00 0.00 ? 12 THR A HG21 3  
ATOM 2342  H HG22 . THR A 1 12 ? -1.567  -5.826  -13.093 1.00 0.00 ? 12 THR A HG22 3  
ATOM 2343  H HG23 . THR A 1 12 ? -1.311  -7.273  -14.068 1.00 0.00 ? 12 THR A HG23 3  
ATOM 2344  N N    . ARG A 1 13 ? -4.477  -3.420  -14.185 1.00 0.00 ? 13 ARG A N    3  
ATOM 2345  C CA   . ARG A 1 13 ? -4.868  -2.474  -13.147 1.00 0.00 ? 13 ARG A CA   3  
ATOM 2346  C C    . ARG A 1 13 ? -5.346  -3.206  -11.897 1.00 0.00 ? 13 ARG A C    3  
ATOM 2347  O O    . ARG A 1 13 ? -5.810  -4.344  -11.970 1.00 0.00 ? 13 ARG A O    3  
ATOM 2348  C CB   . ARG A 1 13 ? -5.970  -1.547  -13.662 1.00 0.00 ? 13 ARG A CB   3  
ATOM 2349  C CG   . ARG A 1 13 ? -6.009  -0.199  -12.961 1.00 0.00 ? 13 ARG A CG   3  
ATOM 2350  C CD   . ARG A 1 13 ? -5.130  0.821   -13.666 1.00 0.00 ? 13 ARG A CD   3  
ATOM 2351  N NE   . ARG A 1 13 ? -5.589  1.093   -15.026 1.00 0.00 ? 13 ARG A NE   3  
ATOM 2352  C CZ   . ARG A 1 13 ? -5.288  2.200   -15.696 1.00 0.00 ? 13 ARG A CZ   3  
ATOM 2353  N NH1  . ARG A 1 13 ? -4.532  3.133   -15.135 1.00 0.00 ? 13 ARG A NH1  3  
ATOM 2354  N NH2  . ARG A 1 13 ? -5.744  2.375   -16.929 1.00 0.00 ? 13 ARG A NH2  3  
ATOM 2355  H H    . ARG A 1 13 ? -5.172  -3.869  -14.709 1.00 0.00 ? 13 ARG A H    3  
ATOM 2356  H HA   . ARG A 1 13 ? -4.001  -1.882  -12.894 1.00 0.00 ? 13 ARG A HA   3  
ATOM 2357  H HB2  . ARG A 1 13 ? -5.817  -1.375  -14.717 1.00 0.00 ? 13 ARG A HB2  3  
ATOM 2358  H HB3  . ARG A 1 13 ? -6.925  -2.030  -13.520 1.00 0.00 ? 13 ARG A HB3  3  
ATOM 2359  H HG2  . ARG A 1 13 ? -7.027  0.163   -12.953 1.00 0.00 ? 13 ARG A HG2  3  
ATOM 2360  H HG3  . ARG A 1 13 ? -5.661  -0.322  -11.946 1.00 0.00 ? 13 ARG A HG3  3  
ATOM 2361  H HD2  . ARG A 1 13 ? -5.144  1.741   -13.101 1.00 0.00 ? 13 ARG A HD2  3  
ATOM 2362  H HD3  . ARG A 1 13 ? -4.120  0.440   -13.706 1.00 0.00 ? 13 ARG A HD3  3  
ATOM 2363  H HE   . ARG A 1 13 ? -6.149  0.416   -15.459 1.00 0.00 ? 13 ARG A HE   3  
ATOM 2364  H HH11 . ARG A 1 13 ? -4.186  3.004   -14.205 1.00 0.00 ? 13 ARG A HH11 3  
ATOM 2365  H HH12 . ARG A 1 13 ? -4.306  3.966   -15.642 1.00 0.00 ? 13 ARG A HH12 3  
ATOM 2366  H HH21 . ARG A 1 13 ? -6.314  1.673   -17.356 1.00 0.00 ? 13 ARG A HH21 3  
ATOM 2367  H HH22 . ARG A 1 13 ? -5.517  3.208   -17.433 1.00 0.00 ? 13 ARG A HH22 3  
ATOM 2368  N N    . PHE A 1 14 ? -5.230  -2.545  -10.750 1.00 0.00 ? 14 PHE A N    3  
ATOM 2369  C CA   . PHE A 1 14 ? -5.649  -3.133  -9.483  1.00 0.00 ? 14 PHE A CA   3  
ATOM 2370  C C    . PHE A 1 14 ? -6.789  -2.331  -8.862  1.00 0.00 ? 14 PHE A C    3  
ATOM 2371  O O    . PHE A 1 14 ? -6.943  -1.139  -9.130  1.00 0.00 ? 14 PHE A O    3  
ATOM 2372  C CB   . PHE A 1 14 ? -4.468  -3.199  -8.512  1.00 0.00 ? 14 PHE A CB   3  
ATOM 2373  C CG   . PHE A 1 14 ? -3.173  -3.581  -9.168  1.00 0.00 ? 14 PHE A CG   3  
ATOM 2374  C CD1  . PHE A 1 14 ? -2.420  -2.637  -9.847  1.00 0.00 ? 14 PHE A CD1  3  
ATOM 2375  C CD2  . PHE A 1 14 ? -2.708  -4.885  -9.106  1.00 0.00 ? 14 PHE A CD2  3  
ATOM 2376  C CE1  . PHE A 1 14 ? -1.227  -2.985  -10.453 1.00 0.00 ? 14 PHE A CE1  3  
ATOM 2377  C CE2  . PHE A 1 14 ? -1.515  -5.239  -9.709  1.00 0.00 ? 14 PHE A CE2  3  
ATOM 2378  C CZ   . PHE A 1 14 ? -0.775  -4.288  -10.384 1.00 0.00 ? 14 PHE A CZ   3  
ATOM 2379  H H    . PHE A 1 14 ? -4.852  -1.640  -10.756 1.00 0.00 ? 14 PHE A H    3  
ATOM 2380  H HA   . PHE A 1 14 ? -5.996  -4.135  -9.682  1.00 0.00 ? 14 PHE A HA   3  
ATOM 2381  H HB2  . PHE A 1 14 ? -4.334  -2.231  -8.053  1.00 0.00 ? 14 PHE A HB2  3  
ATOM 2382  H HB3  . PHE A 1 14 ? -4.682  -3.929  -7.746  1.00 0.00 ? 14 PHE A HB3  3  
ATOM 2383  H HD1  . PHE A 1 14 ? -2.773  -1.616  -9.902  1.00 0.00 ? 14 PHE A HD1  3  
ATOM 2384  H HD2  . PHE A 1 14 ? -3.286  -5.630  -8.580  1.00 0.00 ? 14 PHE A HD2  3  
ATOM 2385  H HE1  . PHE A 1 14 ? -0.651  -2.239  -10.979 1.00 0.00 ? 14 PHE A HE1  3  
ATOM 2386  H HE2  . PHE A 1 14 ? -1.164  -6.258  -9.654  1.00 0.00 ? 14 PHE A HE2  3  
ATOM 2387  H HZ   . PHE A 1 14 ? 0.157   -4.562  -10.855 1.00 0.00 ? 14 PHE A HZ   3  
ATOM 2388  N N    . THR A 1 15 ? -7.586  -2.994  -8.030  1.00 0.00 ? 15 THR A N    3  
ATOM 2389  C CA   . THR A 1 15 ? -8.713  -2.345  -7.371  1.00 0.00 ? 15 THR A CA   3  
ATOM 2390  C C    . THR A 1 15 ? -8.443  -2.151  -5.883  1.00 0.00 ? 15 THR A C    3  
ATOM 2391  O O    . THR A 1 15 ? -7.594  -2.828  -5.304  1.00 0.00 ? 15 THR A O    3  
ATOM 2392  C CB   . THR A 1 15 ? -10.009 -3.158  -7.545  1.00 0.00 ? 15 THR A CB   3  
ATOM 2393  O OG1  . THR A 1 15 ? -11.115 -2.444  -6.981  1.00 0.00 ? 15 THR A OG1  3  
ATOM 2394  C CG2  . THR A 1 15 ? -9.886  -4.520  -6.879  1.00 0.00 ? 15 THR A CG2  3  
ATOM 2395  H H    . THR A 1 15 ? -7.412  -3.942  -7.856  1.00 0.00 ? 15 THR A H    3  
ATOM 2396  H HA   . THR A 1 15 ? -8.856  -1.377  -7.831  1.00 0.00 ? 15 THR A HA   3  
ATOM 2397  H HB   . THR A 1 15 ? -10.186 -3.305  -8.601  1.00 0.00 ? 15 THR A HB   3  
ATOM 2398  H HG1  . THR A 1 15 ? -11.859 -2.476  -7.587  1.00 0.00 ? 15 THR A HG1  3  
ATOM 2399  H HG21 . THR A 1 15 ? -10.065 -5.296  -7.609  1.00 0.00 ? 15 THR A HG21 3  
ATOM 2400  H HG22 . THR A 1 15 ? -10.614 -4.600  -6.084  1.00 0.00 ? 15 THR A HG22 3  
ATOM 2401  H HG23 . THR A 1 15 ? -8.893  -4.633  -6.471  1.00 0.00 ? 15 THR A HG23 3  
ATOM 2402  N N    . ASP A 1 16 ? -9.171  -1.224  -5.271  1.00 0.00 ? 16 ASP A N    3  
ATOM 2403  C CA   . ASP A 1 16 ? -9.011  -0.942  -3.849  1.00 0.00 ? 16 ASP A CA   3  
ATOM 2404  C C    . ASP A 1 16 ? -8.693  -2.217  -3.075  1.00 0.00 ? 16 ASP A C    3  
ATOM 2405  O O    . ASP A 1 16 ? -7.804  -2.233  -2.223  1.00 0.00 ? 16 ASP A O    3  
ATOM 2406  C CB   . ASP A 1 16 ? -10.279 -0.294  -3.290  1.00 0.00 ? 16 ASP A CB   3  
ATOM 2407  C CG   . ASP A 1 16 ? -10.762 0.863   -4.142  1.00 0.00 ? 16 ASP A CG   3  
ATOM 2408  O OD1  . ASP A 1 16 ? -10.061 1.895   -4.194  1.00 0.00 ? 16 ASP A OD1  3  
ATOM 2409  O OD2  . ASP A 1 16 ? -11.841 0.736   -4.758  1.00 0.00 ? 16 ASP A OD2  3  
ATOM 2410  H H    . ASP A 1 16 ? -9.832  -0.717  -5.788  1.00 0.00 ? 16 ASP A H    3  
ATOM 2411  H HA   . ASP A 1 16 ? -8.188  -0.253  -3.738  1.00 0.00 ? 16 ASP A HA   3  
ATOM 2412  H HB2  . ASP A 1 16 ? -11.064 -1.035  -3.244  1.00 0.00 ? 16 ASP A HB2  3  
ATOM 2413  H HB3  . ASP A 1 16 ? -10.079 0.074   -2.295  1.00 0.00 ? 16 ASP A HB3  3  
ATOM 2414  N N    . TYR A 1 17 ? -9.424  -3.284  -3.376  1.00 0.00 ? 17 TYR A N    3  
ATOM 2415  C CA   . TYR A 1 17 ? -9.222  -4.563  -2.707  1.00 0.00 ? 17 TYR A CA   3  
ATOM 2416  C C    . TYR A 1 17 ? -7.785  -5.046  -2.875  1.00 0.00 ? 17 TYR A C    3  
ATOM 2417  O O    . TYR A 1 17 ? -7.111  -5.374  -1.899  1.00 0.00 ? 17 TYR A O    3  
ATOM 2418  C CB   . TYR A 1 17 ? -10.191 -5.611  -3.258  1.00 0.00 ? 17 TYR A CB   3  
ATOM 2419  C CG   . TYR A 1 17 ? -9.765  -7.035  -2.982  1.00 0.00 ? 17 TYR A CG   3  
ATOM 2420  C CD1  . TYR A 1 17 ? -9.361  -7.426  -1.711  1.00 0.00 ? 17 TYR A CD1  3  
ATOM 2421  C CD2  . TYR A 1 17 ? -9.766  -7.989  -3.991  1.00 0.00 ? 17 TYR A CD2  3  
ATOM 2422  C CE1  . TYR A 1 17 ? -8.970  -8.726  -1.454  1.00 0.00 ? 17 TYR A CE1  3  
ATOM 2423  C CE2  . TYR A 1 17 ? -9.378  -9.292  -3.743  1.00 0.00 ? 17 TYR A CE2  3  
ATOM 2424  C CZ   . TYR A 1 17 ? -8.981  -9.655  -2.473  1.00 0.00 ? 17 TYR A CZ   3  
ATOM 2425  O OH   . TYR A 1 17 ? -8.593  -10.951 -2.222  1.00 0.00 ? 17 TYR A OH   3  
ATOM 2426  H H    . TYR A 1 17 ? -10.118 -3.210  -4.065  1.00 0.00 ? 17 TYR A H    3  
ATOM 2427  H HA   . TYR A 1 17 ? -9.421  -4.422  -1.654  1.00 0.00 ? 17 TYR A HA   3  
ATOM 2428  H HB2  . TYR A 1 17 ? -11.162 -5.463  -2.812  1.00 0.00 ? 17 TYR A HB2  3  
ATOM 2429  H HB3  . TYR A 1 17 ? -10.270 -5.489  -4.329  1.00 0.00 ? 17 TYR A HB3  3  
ATOM 2430  H HD1  . TYR A 1 17 ? -9.354  -6.695  -0.915  1.00 0.00 ? 17 TYR A HD1  3  
ATOM 2431  H HD2  . TYR A 1 17 ? -10.077 -7.701  -4.985  1.00 0.00 ? 17 TYR A HD2  3  
ATOM 2432  H HE1  . TYR A 1 17 ? -8.660  -9.011  -0.460  1.00 0.00 ? 17 TYR A HE1  3  
ATOM 2433  H HE2  . TYR A 1 17 ? -9.386  -10.020 -4.541  1.00 0.00 ? 17 TYR A HE2  3  
ATOM 2434  H HH   . TYR A 1 17 ? -8.272  -11.020 -1.320  1.00 0.00 ? 17 TYR A HH   3  
ATOM 2435  N N    . GLN A 1 18 ? -7.323  -5.084  -4.121  1.00 0.00 ? 18 GLN A N    3  
ATOM 2436  C CA   . GLN A 1 18 ? -5.965  -5.526  -4.419  1.00 0.00 ? 18 GLN A CA   3  
ATOM 2437  C C    . GLN A 1 18 ? -4.940  -4.527  -3.893  1.00 0.00 ? 18 GLN A C    3  
ATOM 2438  O O    . GLN A 1 18 ? -4.013  -4.896  -3.170  1.00 0.00 ? 18 GLN A O    3  
ATOM 2439  C CB   . GLN A 1 18 ? -5.786  -5.713  -5.926  1.00 0.00 ? 18 GLN A CB   3  
ATOM 2440  C CG   . GLN A 1 18 ? -6.771  -6.697  -6.539  1.00 0.00 ? 18 GLN A CG   3  
ATOM 2441  C CD   . GLN A 1 18 ? -6.201  -7.418  -7.744  1.00 0.00 ? 18 GLN A CD   3  
ATOM 2442  O OE1  . GLN A 1 18 ? -5.705  -6.791  -8.681  1.00 0.00 ? 18 GLN A OE1  3  
ATOM 2443  N NE2  . GLN A 1 18 ? -6.269  -8.744  -7.728  1.00 0.00 ? 18 GLN A NE2  3  
ATOM 2444  H H    . GLN A 1 18 ? -7.908  -4.810  -4.857  1.00 0.00 ? 18 GLN A H    3  
ATOM 2445  H HA   . GLN A 1 18 ? -5.811  -6.475  -3.927  1.00 0.00 ? 18 GLN A HA   3  
ATOM 2446  H HB2  . GLN A 1 18 ? -5.915  -4.758  -6.413  1.00 0.00 ? 18 GLN A HB2  3  
ATOM 2447  H HB3  . GLN A 1 18 ? -4.786  -6.074  -6.116  1.00 0.00 ? 18 GLN A HB3  3  
ATOM 2448  H HG2  . GLN A 1 18 ? -7.038  -7.431  -5.793  1.00 0.00 ? 18 GLN A HG2  3  
ATOM 2449  H HG3  . GLN A 1 18 ? -7.655  -6.158  -6.844  1.00 0.00 ? 18 GLN A HG3  3  
ATOM 2450  H HE21 . GLN A 1 18 ? -6.679  -9.177  -6.949  1.00 0.00 ? 18 GLN A HE21 3  
ATOM 2451  H HE22 . GLN A 1 18 ? -5.909  -9.236  -8.494  1.00 0.00 ? 18 GLN A HE22 3  
ATOM 2452  N N    . LEU A 1 19 ? -5.112  -3.263  -4.260  1.00 0.00 ? 19 LEU A N    3  
ATOM 2453  C CA   . LEU A 1 19 ? -4.201  -2.209  -3.826  1.00 0.00 ? 19 LEU A CA   3  
ATOM 2454  C C    . LEU A 1 19 ? -4.067  -2.198  -2.307  1.00 0.00 ? 19 LEU A C    3  
ATOM 2455  O O    . LEU A 1 19 ? -3.023  -1.829  -1.768  1.00 0.00 ? 19 LEU A O    3  
ATOM 2456  C CB   . LEU A 1 19 ? -4.694  -0.847  -4.316  1.00 0.00 ? 19 LEU A CB   3  
ATOM 2457  C CG   . LEU A 1 19 ? -4.573  -0.590  -5.819  1.00 0.00 ? 19 LEU A CG   3  
ATOM 2458  C CD1  . LEU A 1 19 ? -5.181  0.755   -6.181  1.00 0.00 ? 19 LEU A CD1  3  
ATOM 2459  C CD2  . LEU A 1 19 ? -3.116  -0.654  -6.255  1.00 0.00 ? 19 LEU A CD2  3  
ATOM 2460  H H    . LEU A 1 19 ? -5.868  -3.030  -4.837  1.00 0.00 ? 19 LEU A H    3  
ATOM 2461  H HA   . LEU A 1 19 ? -3.232  -2.410  -4.259  1.00 0.00 ? 19 LEU A HA   3  
ATOM 2462  H HB2  . LEU A 1 19 ? -5.735  -0.756  -4.049  1.00 0.00 ? 19 LEU A HB2  3  
ATOM 2463  H HB3  . LEU A 1 19 ? -4.124  -0.085  -3.803  1.00 0.00 ? 19 LEU A HB3  3  
ATOM 2464  H HG   . LEU A 1 19 ? -5.116  -1.357  -6.354  1.00 0.00 ? 19 LEU A HG   3  
ATOM 2465  H HD11 . LEU A 1 19 ? -5.287  0.826   -7.253  1.00 0.00 ? 19 LEU A HD11 3  
ATOM 2466  H HD12 . LEU A 1 19 ? -4.537  1.548   -5.830  1.00 0.00 ? 19 LEU A HD12 3  
ATOM 2467  H HD13 . LEU A 1 19 ? -6.152  0.848   -5.716  1.00 0.00 ? 19 LEU A HD13 3  
ATOM 2468  H HD21 . LEU A 1 19 ? -2.935  -1.586  -6.769  1.00 0.00 ? 19 LEU A HD21 3  
ATOM 2469  H HD22 . LEU A 1 19 ? -2.477  -0.591  -5.386  1.00 0.00 ? 19 LEU A HD22 3  
ATOM 2470  H HD23 . LEU A 1 19 ? -2.903  0.171   -6.919  1.00 0.00 ? 19 LEU A HD23 3  
ATOM 2471  N N    . ARG A 1 20 ? -5.130  -2.606  -1.621  1.00 0.00 ? 20 ARG A N    3  
ATOM 2472  C CA   . ARG A 1 20 ? -5.130  -2.643  -0.163  1.00 0.00 ? 20 ARG A CA   3  
ATOM 2473  C C    . ARG A 1 20 ? -4.093  -3.634  0.356   1.00 0.00 ? 20 ARG A C    3  
ATOM 2474  O O    . ARG A 1 20 ? -3.320  -3.322  1.262   1.00 0.00 ? 20 ARG A O    3  
ATOM 2475  C CB   . ARG A 1 20 ? -6.518  -3.022  0.357   1.00 0.00 ? 20 ARG A CB   3  
ATOM 2476  C CG   . ARG A 1 20 ? -6.655  -2.906  1.867   1.00 0.00 ? 20 ARG A CG   3  
ATOM 2477  C CD   . ARG A 1 20 ? -5.991  -4.075  2.578   1.00 0.00 ? 20 ARG A CD   3  
ATOM 2478  N NE   . ARG A 1 20 ? -6.556  -4.301  3.905   1.00 0.00 ? 20 ARG A NE   3  
ATOM 2479  C CZ   . ARG A 1 20 ? -6.415  -5.436  4.580   1.00 0.00 ? 20 ARG A CZ   3  
ATOM 2480  N NH1  . ARG A 1 20 ? -5.730  -6.443  4.056   1.00 0.00 ? 20 ARG A NH1  3  
ATOM 2481  N NH2  . ARG A 1 20 ? -6.959  -5.566  5.784   1.00 0.00 ? 20 ARG A NH2  3  
ATOM 2482  H H    . ARG A 1 20 ? -5.933  -2.888  -2.107  1.00 0.00 ? 20 ARG A H    3  
ATOM 2483  H HA   . ARG A 1 20 ? -4.879  -1.656  0.194   1.00 0.00 ? 20 ARG A HA   3  
ATOM 2484  H HB2  . ARG A 1 20 ? -7.251  -2.373  -0.099  1.00 0.00 ? 20 ARG A HB2  3  
ATOM 2485  H HB3  . ARG A 1 20 ? -6.728  -4.043  0.076   1.00 0.00 ? 20 ARG A HB3  3  
ATOM 2486  H HG2  . ARG A 1 20 ? -6.186  -1.989  2.192   1.00 0.00 ? 20 ARG A HG2  3  
ATOM 2487  H HG3  . ARG A 1 20 ? -7.703  -2.888  2.124   1.00 0.00 ? 20 ARG A HG3  3  
ATOM 2488  H HD2  . ARG A 1 20 ? -6.127  -4.966  1.982   1.00 0.00 ? 20 ARG A HD2  3  
ATOM 2489  H HD3  . ARG A 1 20 ? -4.936  -3.866  2.676   1.00 0.00 ? 20 ARG A HD3  3  
ATOM 2490  H HE   . ARG A 1 20 ? -7.066  -3.570  4.312   1.00 0.00 ? 20 ARG A HE   3  
ATOM 2491  H HH11 . ARG A 1 20 ? -5.318  -6.348  3.150   1.00 0.00 ? 20 ARG A HH11 3  
ATOM 2492  H HH12 . ARG A 1 20 ? -5.624  -7.296  4.567   1.00 0.00 ? 20 ARG A HH12 3  
ATOM 2493  H HH21 . ARG A 1 20 ? -7.476  -4.809  6.183   1.00 0.00 ? 20 ARG A HH21 3  
ATOM 2494  H HH22 . ARG A 1 20 ? -6.853  -6.420  6.291   1.00 0.00 ? 20 ARG A HH22 3  
ATOM 2495  N N    . VAL A 1 21 ? -4.081  -4.830  -0.225  1.00 0.00 ? 21 VAL A N    3  
ATOM 2496  C CA   . VAL A 1 21 ? -3.138  -5.866  0.178   1.00 0.00 ? 21 VAL A CA   3  
ATOM 2497  C C    . VAL A 1 21 ? -1.731  -5.550  -0.314  1.00 0.00 ? 21 VAL A C    3  
ATOM 2498  O O    . VAL A 1 21 ? -0.754  -5.709  0.420   1.00 0.00 ? 21 VAL A O    3  
ATOM 2499  C CB   . VAL A 1 21 ? -3.560  -7.247  -0.359  1.00 0.00 ? 21 VAL A CB   3  
ATOM 2500  C CG1  . VAL A 1 21 ? -2.556  -8.311  0.059   1.00 0.00 ? 21 VAL A CG1  3  
ATOM 2501  C CG2  . VAL A 1 21 ? -4.958  -7.603  0.125   1.00 0.00 ? 21 VAL A CG2  3  
ATOM 2502  H H    . VAL A 1 21 ? -4.722  -5.019  -0.942  1.00 0.00 ? 21 VAL A H    3  
ATOM 2503  H HA   . VAL A 1 21 ? -3.131  -5.910  1.257   1.00 0.00 ? 21 VAL A HA   3  
ATOM 2504  H HB   . VAL A 1 21 ? -3.575  -7.202  -1.438  1.00 0.00 ? 21 VAL A HB   3  
ATOM 2505  H HG11 . VAL A 1 21 ? -1.555  -7.919  -0.038  1.00 0.00 ? 21 VAL A HG11 3  
ATOM 2506  H HG12 . VAL A 1 21 ? -2.736  -8.593  1.086   1.00 0.00 ? 21 VAL A HG12 3  
ATOM 2507  H HG13 . VAL A 1 21 ? -2.665  -9.178  -0.577  1.00 0.00 ? 21 VAL A HG13 3  
ATOM 2508  H HG21 . VAL A 1 21 ? -4.966  -7.639  1.204   1.00 0.00 ? 21 VAL A HG21 3  
ATOM 2509  H HG22 . VAL A 1 21 ? -5.658  -6.853  -0.216  1.00 0.00 ? 21 VAL A HG22 3  
ATOM 2510  H HG23 . VAL A 1 21 ? -5.242  -8.566  -0.271  1.00 0.00 ? 21 VAL A HG23 3  
ATOM 2511  N N    . LEU A 1 22 ? -1.632  -5.102  -1.561  1.00 0.00 ? 22 LEU A N    3  
ATOM 2512  C CA   . LEU A 1 22 ? -0.343  -4.762  -2.152  1.00 0.00 ? 22 LEU A CA   3  
ATOM 2513  C C    . LEU A 1 22 ? 0.312   -3.606  -1.403  1.00 0.00 ? 22 LEU A C    3  
ATOM 2514  O O    . LEU A 1 22 ? 1.504   -3.647  -1.100  1.00 0.00 ? 22 LEU A O    3  
ATOM 2515  C CB   . LEU A 1 22 ? -0.517  -4.395  -3.627  1.00 0.00 ? 22 LEU A CB   3  
ATOM 2516  C CG   . LEU A 1 22 ? -0.987  -5.521  -4.548  1.00 0.00 ? 22 LEU A CG   3  
ATOM 2517  C CD1  . LEU A 1 22 ? -1.307  -4.981  -5.933  1.00 0.00 ? 22 LEU A CD1  3  
ATOM 2518  C CD2  . LEU A 1 22 ? 0.065   -6.617  -4.631  1.00 0.00 ? 22 LEU A CD2  3  
ATOM 2519  H H    . LEU A 1 22 ? -2.445  -4.996  -2.097  1.00 0.00 ? 22 LEU A H    3  
ATOM 2520  H HA   . LEU A 1 22 ? 0.295   -5.630  -2.078  1.00 0.00 ? 22 LEU A HA   3  
ATOM 2521  H HB2  . LEU A 1 22 ? -1.240  -3.596  -3.686  1.00 0.00 ? 22 LEU A HB2  3  
ATOM 2522  H HB3  . LEU A 1 22 ? 0.437   -4.043  -3.994  1.00 0.00 ? 22 LEU A HB3  3  
ATOM 2523  H HG   . LEU A 1 22 ? -1.891  -5.955  -4.143  1.00 0.00 ? 22 LEU A HG   3  
ATOM 2524  H HD11 . LEU A 1 22 ? -1.599  -5.795  -6.578  1.00 0.00 ? 22 LEU A HD11 3  
ATOM 2525  H HD12 . LEU A 1 22 ? -0.432  -4.495  -6.340  1.00 0.00 ? 22 LEU A HD12 3  
ATOM 2526  H HD13 . LEU A 1 22 ? -2.114  -4.267  -5.863  1.00 0.00 ? 22 LEU A HD13 3  
ATOM 2527  H HD21 . LEU A 1 22 ? 0.110   -7.145  -3.689  1.00 0.00 ? 22 LEU A HD21 3  
ATOM 2528  H HD22 . LEU A 1 22 ? 1.029   -6.176  -4.842  1.00 0.00 ? 22 LEU A HD22 3  
ATOM 2529  H HD23 . LEU A 1 22 ? -0.195  -7.308  -5.419  1.00 0.00 ? 22 LEU A HD23 3  
ATOM 2530  N N    . GLN A 1 23 ? -0.476  -2.578  -1.106  1.00 0.00 ? 23 GLN A N    3  
ATOM 2531  C CA   . GLN A 1 23 ? 0.028   -1.411  -0.390  1.00 0.00 ? 23 GLN A CA   3  
ATOM 2532  C C    . GLN A 1 23 ? 0.294   -1.744  1.074   1.00 0.00 ? 23 GLN A C    3  
ATOM 2533  O O    . GLN A 1 23 ? 1.243   -1.238  1.673   1.00 0.00 ? 23 GLN A O    3  
ATOM 2534  C CB   . GLN A 1 23 ? -0.969  -0.255  -0.490  1.00 0.00 ? 23 GLN A CB   3  
ATOM 2535  C CG   . GLN A 1 23 ? -0.328  1.115   -0.346  1.00 0.00 ? 23 GLN A CG   3  
ATOM 2536  C CD   . GLN A 1 23 ? 0.543   1.225   0.889   1.00 0.00 ? 23 GLN A CD   3  
ATOM 2537  O OE1  . GLN A 1 23 ? 0.066   1.079   2.015   1.00 0.00 ? 23 GLN A OE1  3  
ATOM 2538  N NE2  . GLN A 1 23 ? 1.830   1.484   0.686   1.00 0.00 ? 23 GLN A NE2  3  
ATOM 2539  H H    . GLN A 1 23 ? -1.417  -2.604  -1.374  1.00 0.00 ? 23 GLN A H    3  
ATOM 2540  H HA   . GLN A 1 23 ? 0.957   -1.114  -0.853  1.00 0.00 ? 23 GLN A HA   3  
ATOM 2541  H HB2  . GLN A 1 23 ? -1.460  -0.301  -1.451  1.00 0.00 ? 23 GLN A HB2  3  
ATOM 2542  H HB3  . GLN A 1 23 ? -1.709  -0.366  0.289   1.00 0.00 ? 23 GLN A HB3  3  
ATOM 2543  H HG2  . GLN A 1 23 ? 0.283   1.306   -1.216  1.00 0.00 ? 23 GLN A HG2  3  
ATOM 2544  H HG3  . GLN A 1 23 ? -1.108  1.859   -0.286  1.00 0.00 ? 23 GLN A HG3  3  
ATOM 2545  H HE21 . GLN A 1 23 ? 2.140   1.589   -0.238  1.00 0.00 ? 23 GLN A HE21 3  
ATOM 2546  H HE22 . GLN A 1 23 ? 2.416   1.561   1.467   1.00 0.00 ? 23 GLN A HE22 3  
ATOM 2547  N N    . ASP A 1 24 ? -0.550  -2.597  1.644   1.00 0.00 ? 24 ASP A N    3  
ATOM 2548  C CA   . ASP A 1 24 ? -0.406  -2.998  3.039   1.00 0.00 ? 24 ASP A CA   3  
ATOM 2549  C C    . ASP A 1 24 ? 0.880   -3.793  3.246   1.00 0.00 ? 24 ASP A C    3  
ATOM 2550  O O    . ASP A 1 24 ? 1.577   -3.616  4.245   1.00 0.00 ? 24 ASP A O    3  
ATOM 2551  C CB   . ASP A 1 24 ? -1.611  -3.830  3.480   1.00 0.00 ? 24 ASP A CB   3  
ATOM 2552  C CG   . ASP A 1 24 ? -1.497  -4.297  4.918   1.00 0.00 ? 24 ASP A CG   3  
ATOM 2553  O OD1  . ASP A 1 24 ? -0.600  -5.116  5.206   1.00 0.00 ? 24 ASP A OD1  3  
ATOM 2554  O OD2  . ASP A 1 24 ? -2.306  -3.844  5.755   1.00 0.00 ? 24 ASP A OD2  3  
ATOM 2555  H H    . ASP A 1 24 ? -1.287  -2.966  1.114   1.00 0.00 ? 24 ASP A H    3  
ATOM 2556  H HA   . ASP A 1 24 ? -0.360  -2.102  3.639   1.00 0.00 ? 24 ASP A HA   3  
ATOM 2557  H HB2  . ASP A 1 24 ? -2.507  -3.234  3.384   1.00 0.00 ? 24 ASP A HB2  3  
ATOM 2558  H HB3  . ASP A 1 24 ? -1.692  -4.699  2.843   1.00 0.00 ? 24 ASP A HB3  3  
ATOM 2559  N N    . PHE A 1 25 ? 1.187   -4.669  2.295   1.00 0.00 ? 25 PHE A N    3  
ATOM 2560  C CA   . PHE A 1 25 ? 2.388   -5.493  2.374   1.00 0.00 ? 25 PHE A CA   3  
ATOM 2561  C C    . PHE A 1 25 ? 3.638   -4.660  2.104   1.00 0.00 ? 25 PHE A C    3  
ATOM 2562  O O    . PHE A 1 25 ? 4.720   -4.964  2.605   1.00 0.00 ? 25 PHE A O    3  
ATOM 2563  C CB   . PHE A 1 25 ? 2.306   -6.648  1.374   1.00 0.00 ? 25 PHE A CB   3  
ATOM 2564  C CG   . PHE A 1 25 ? 3.345   -7.710  1.598   1.00 0.00 ? 25 PHE A CG   3  
ATOM 2565  C CD1  . PHE A 1 25 ? 4.683   -7.450  1.353   1.00 0.00 ? 25 PHE A CD1  3  
ATOM 2566  C CD2  . PHE A 1 25 ? 2.982   -8.967  2.054   1.00 0.00 ? 25 PHE A CD2  3  
ATOM 2567  C CE1  . PHE A 1 25 ? 5.642   -8.425  1.558   1.00 0.00 ? 25 PHE A CE1  3  
ATOM 2568  C CE2  . PHE A 1 25 ? 3.936   -9.945  2.261   1.00 0.00 ? 25 PHE A CE2  3  
ATOM 2569  C CZ   . PHE A 1 25 ? 5.268   -9.674  2.012   1.00 0.00 ? 25 PHE A CZ   3  
ATOM 2570  H H    . PHE A 1 25 ? 0.592   -4.764  1.522   1.00 0.00 ? 25 PHE A H    3  
ATOM 2571  H HA   . PHE A 1 25 ? 2.447   -5.896  3.373   1.00 0.00 ? 25 PHE A HA   3  
ATOM 2572  H HB2  . PHE A 1 25 ? 1.335   -7.113  1.451   1.00 0.00 ? 25 PHE A HB2  3  
ATOM 2573  H HB3  . PHE A 1 25 ? 2.436   -6.260  0.375   1.00 0.00 ? 25 PHE A HB3  3  
ATOM 2574  H HD1  . PHE A 1 25 ? 4.977   -6.473  0.997   1.00 0.00 ? 25 PHE A HD1  3  
ATOM 2575  H HD2  . PHE A 1 25 ? 1.942   -9.181  2.248   1.00 0.00 ? 25 PHE A HD2  3  
ATOM 2576  H HE1  . PHE A 1 25 ? 6.682   -8.209  1.362   1.00 0.00 ? 25 PHE A HE1  3  
ATOM 2577  H HE2  . PHE A 1 25 ? 3.641   -10.921 2.616   1.00 0.00 ? 25 PHE A HE2  3  
ATOM 2578  H HZ   . PHE A 1 25 ? 6.015   -10.437 2.174   1.00 0.00 ? 25 PHE A HZ   3  
ATOM 2579  N N    . PHE A 1 26 ? 3.479   -3.607  1.309   1.00 0.00 ? 26 PHE A N    3  
ATOM 2580  C CA   . PHE A 1 26 ? 4.594   -2.730  0.970   1.00 0.00 ? 26 PHE A CA   3  
ATOM 2581  C C    . PHE A 1 26 ? 4.967   -1.843  2.154   1.00 0.00 ? 26 PHE A C    3  
ATOM 2582  O O    . PHE A 1 26 ? 6.130   -1.780  2.554   1.00 0.00 ? 26 PHE A O    3  
ATOM 2583  C CB   . PHE A 1 26 ? 4.240   -1.863  -0.239  1.00 0.00 ? 26 PHE A CB   3  
ATOM 2584  C CG   . PHE A 1 26 ? 5.291   -0.845  -0.576  1.00 0.00 ? 26 PHE A CG   3  
ATOM 2585  C CD1  . PHE A 1 26 ? 5.371   0.347   0.126   1.00 0.00 ? 26 PHE A CD1  3  
ATOM 2586  C CD2  . PHE A 1 26 ? 6.201   -1.080  -1.595  1.00 0.00 ? 26 PHE A CD2  3  
ATOM 2587  C CE1  . PHE A 1 26 ? 6.337   1.286   -0.182  1.00 0.00 ? 26 PHE A CE1  3  
ATOM 2588  C CE2  . PHE A 1 26 ? 7.170   -0.145  -1.907  1.00 0.00 ? 26 PHE A CE2  3  
ATOM 2589  C CZ   . PHE A 1 26 ? 7.238   1.039   -1.199  1.00 0.00 ? 26 PHE A CZ   3  
ATOM 2590  H H    . PHE A 1 26 ? 2.591   -3.416  0.940   1.00 0.00 ? 26 PHE A H    3  
ATOM 2591  H HA   . PHE A 1 26 ? 5.440   -3.352  0.721   1.00 0.00 ? 26 PHE A HA   3  
ATOM 2592  H HB2  . PHE A 1 26 ? 4.105   -2.498  -1.102  1.00 0.00 ? 26 PHE A HB2  3  
ATOM 2593  H HB3  . PHE A 1 26 ? 3.319   -1.337  -0.038  1.00 0.00 ? 26 PHE A HB3  3  
ATOM 2594  H HD1  . PHE A 1 26 ? 4.667   0.541   0.923   1.00 0.00 ? 26 PHE A HD1  3  
ATOM 2595  H HD2  . PHE A 1 26 ? 6.148   -2.006  -2.149  1.00 0.00 ? 26 PHE A HD2  3  
ATOM 2596  H HE1  . PHE A 1 26 ? 6.389   2.210   0.373   1.00 0.00 ? 26 PHE A HE1  3  
ATOM 2597  H HE2  . PHE A 1 26 ? 7.873   -0.341  -2.703  1.00 0.00 ? 26 PHE A HE2  3  
ATOM 2598  H HZ   . PHE A 1 26 ? 7.994   1.771   -1.442  1.00 0.00 ? 26 PHE A HZ   3  
ATOM 2599  N N    . ASP A 1 27 ? 3.973   -1.160  2.710   1.00 0.00 ? 27 ASP A N    3  
ATOM 2600  C CA   . ASP A 1 27 ? 4.195   -0.276  3.849   1.00 0.00 ? 27 ASP A CA   3  
ATOM 2601  C C    . ASP A 1 27 ? 4.971   -0.993  4.949   1.00 0.00 ? 27 ASP A C    3  
ATOM 2602  O O    . ASP A 1 27 ? 5.742   -0.374  5.682   1.00 0.00 ? 27 ASP A O    3  
ATOM 2603  C CB   . ASP A 1 27 ? 2.860   0.231   4.396   1.00 0.00 ? 27 ASP A CB   3  
ATOM 2604  C CG   . ASP A 1 27 ? 3.021   1.464   5.263   1.00 0.00 ? 27 ASP A CG   3  
ATOM 2605  O OD1  . ASP A 1 27 ? 3.482   1.323   6.415   1.00 0.00 ? 27 ASP A OD1  3  
ATOM 2606  O OD2  . ASP A 1 27 ? 2.686   2.571   4.790   1.00 0.00 ? 27 ASP A OD2  3  
ATOM 2607  H H    . ASP A 1 27 ? 3.067   -1.252  2.346   1.00 0.00 ? 27 ASP A H    3  
ATOM 2608  H HA   . ASP A 1 27 ? 4.777   0.567   3.506   1.00 0.00 ? 27 ASP A HA   3  
ATOM 2609  H HB2  . ASP A 1 27 ? 2.210   0.478   3.569   1.00 0.00 ? 27 ASP A HB2  3  
ATOM 2610  H HB3  . ASP A 1 27 ? 2.403   -0.547  4.989   1.00 0.00 ? 27 ASP A HB3  3  
ATOM 2611  N N    . ALA A 1 28 ? 4.760   -2.300  5.060   1.00 0.00 ? 28 ALA A N    3  
ATOM 2612  C CA   . ALA A 1 28 ? 5.440   -3.101  6.070   1.00 0.00 ? 28 ALA A CA   3  
ATOM 2613  C C    . ALA A 1 28 ? 6.725   -3.708  5.517   1.00 0.00 ? 28 ALA A C    3  
ATOM 2614  O O    . ALA A 1 28 ? 7.756   -3.717  6.187   1.00 0.00 ? 28 ALA A O    3  
ATOM 2615  C CB   . ALA A 1 28 ? 4.517   -4.196  6.585   1.00 0.00 ? 28 ALA A CB   3  
ATOM 2616  H H    . ALA A 1 28 ? 4.133   -2.737  4.446   1.00 0.00 ? 28 ALA A H    3  
ATOM 2617  H HA   . ALA A 1 28 ? 5.687   -2.453  6.899   1.00 0.00 ? 28 ALA A HA   3  
ATOM 2618  H HB1  . ALA A 1 28 ? 5.063   -4.837  7.261   1.00 0.00 ? 28 ALA A HB1  3  
ATOM 2619  H HB2  . ALA A 1 28 ? 3.684   -3.748  7.107   1.00 0.00 ? 28 ALA A HB2  3  
ATOM 2620  H HB3  . ALA A 1 28 ? 4.150   -4.778  5.753   1.00 0.00 ? 28 ALA A HB3  3  
ATOM 2621  N N    . ASN A 1 29 ? 6.654   -4.214  4.290   1.00 0.00 ? 29 ASN A N    3  
ATOM 2622  C CA   . ASN A 1 29 ? 7.813   -4.824  3.647   1.00 0.00 ? 29 ASN A CA   3  
ATOM 2623  C C    . ASN A 1 29 ? 7.797   -4.568  2.143   1.00 0.00 ? 29 ASN A C    3  
ATOM 2624  O O    . ASN A 1 29 ? 6.825   -4.887  1.459   1.00 0.00 ? 29 ASN A O    3  
ATOM 2625  C CB   . ASN A 1 29 ? 7.839   -6.329  3.919   1.00 0.00 ? 29 ASN A CB   3  
ATOM 2626  C CG   . ASN A 1 29 ? 9.126   -6.979  3.449   1.00 0.00 ? 29 ASN A CG   3  
ATOM 2627  O OD1  . ASN A 1 29 ? 10.219  -6.469  3.696   1.00 0.00 ? 29 ASN A OD1  3  
ATOM 2628  N ND2  . ASN A 1 29 ? 9.002   -8.111  2.766   1.00 0.00 ? 29 ASN A ND2  3  
ATOM 2629  H H    . ASN A 1 29 ? 5.803   -4.177  3.805   1.00 0.00 ? 29 ASN A H    3  
ATOM 2630  H HA   . ASN A 1 29 ? 8.700   -4.375  4.068   1.00 0.00 ? 29 ASN A HA   3  
ATOM 2631  H HB2  . ASN A 1 29 ? 7.741   -6.498  4.982   1.00 0.00 ? 29 ASN A HB2  3  
ATOM 2632  H HB3  . ASN A 1 29 ? 7.012   -6.797  3.407   1.00 0.00 ? 29 ASN A HB3  3  
ATOM 2633  H HD21 . ASN A 1 29 ? 8.099   -8.459  2.606   1.00 0.00 ? 29 ASN A HD21 3  
ATOM 2634  H HD22 . ASN A 1 29 ? 9.817   -8.553  2.450   1.00 0.00 ? 29 ASN A HD22 3  
ATOM 2635  N N    . ALA A 1 30 ? 8.882   -3.992  1.635   1.00 0.00 ? 30 ALA A N    3  
ATOM 2636  C CA   . ALA A 1 30 ? 8.994   -3.695  0.212   1.00 0.00 ? 30 ALA A CA   3  
ATOM 2637  C C    . ALA A 1 30 ? 10.199  -4.401  -0.401  1.00 0.00 ? 30 ALA A C    3  
ATOM 2638  O O    . ALA A 1 30 ? 10.583  -4.120  -1.537  1.00 0.00 ? 30 ALA A O    3  
ATOM 2639  C CB   . ALA A 1 30 ? 9.091   -2.193  -0.008  1.00 0.00 ? 30 ALA A CB   3  
ATOM 2640  H H    . ALA A 1 30 ? 9.624   -3.761  2.232   1.00 0.00 ? 30 ALA A H    3  
ATOM 2641  H HA   . ALA A 1 30 ? 8.097   -4.049  -0.274  1.00 0.00 ? 30 ALA A HA   3  
ATOM 2642  H HB1  . ALA A 1 30 ? 9.866   -1.786  0.625   1.00 0.00 ? 30 ALA A HB1  3  
ATOM 2643  H HB2  . ALA A 1 30 ? 9.330   -1.996  -1.042  1.00 0.00 ? 30 ALA A HB2  3  
ATOM 2644  H HB3  . ALA A 1 30 ? 8.146   -1.732  0.238   1.00 0.00 ? 30 ALA A HB3  3  
ATOM 2645  N N    . TYR A 1 31 ? 10.793  -5.316  0.357   1.00 0.00 ? 31 TYR A N    3  
ATOM 2646  C CA   . TYR A 1 31 ? 11.957  -6.059  -0.111  1.00 0.00 ? 31 TYR A CA   3  
ATOM 2647  C C    . TYR A 1 31 ? 11.812  -7.546  0.193   1.00 0.00 ? 31 TYR A C    3  
ATOM 2648  O O    . TYR A 1 31 ? 12.756  -8.215  0.615   1.00 0.00 ? 31 TYR A O    3  
ATOM 2649  C CB   . TYR A 1 31 ? 13.230  -5.515  0.539   1.00 0.00 ? 31 TYR A CB   3  
ATOM 2650  C CG   . TYR A 1 31 ? 13.425  -4.029  0.339   1.00 0.00 ? 31 TYR A CG   3  
ATOM 2651  C CD1  . TYR A 1 31 ? 12.840  -3.110  1.200   1.00 0.00 ? 31 TYR A CD1  3  
ATOM 2652  C CD2  . TYR A 1 31 ? 14.196  -3.545  -0.711  1.00 0.00 ? 31 TYR A CD2  3  
ATOM 2653  C CE1  . TYR A 1 31 ? 13.015  -1.751  1.021   1.00 0.00 ? 31 TYR A CE1  3  
ATOM 2654  C CE2  . TYR A 1 31 ? 14.378  -2.188  -0.897  1.00 0.00 ? 31 TYR A CE2  3  
ATOM 2655  C CZ   . TYR A 1 31 ? 13.785  -1.295  -0.029  1.00 0.00 ? 31 TYR A CZ   3  
ATOM 2656  O OH   . TYR A 1 31 ? 13.963  0.057   -0.210  1.00 0.00 ? 31 TYR A OH   3  
ATOM 2657  H H    . TYR A 1 31 ? 10.441  -5.495  1.254   1.00 0.00 ? 31 TYR A H    3  
ATOM 2658  H HA   . TYR A 1 31 ? 12.026  -5.927  -1.181  1.00 0.00 ? 31 TYR A HA   3  
ATOM 2659  H HB2  . TYR A 1 31 ? 13.193  -5.705  1.600   1.00 0.00 ? 31 TYR A HB2  3  
ATOM 2660  H HB3  . TYR A 1 31 ? 14.086  -6.022  0.117   1.00 0.00 ? 31 TYR A HB3  3  
ATOM 2661  H HD1  . TYR A 1 31 ? 12.237  -3.470  2.021   1.00 0.00 ? 31 TYR A HD1  3  
ATOM 2662  H HD2  . TYR A 1 31 ? 14.660  -4.247  -1.389  1.00 0.00 ? 31 TYR A HD2  3  
ATOM 2663  H HE1  . TYR A 1 31 ? 12.551  -1.052  1.701   1.00 0.00 ? 31 TYR A HE1  3  
ATOM 2664  H HE2  . TYR A 1 31 ? 14.981  -1.830  -1.718  1.00 0.00 ? 31 TYR A HE2  3  
ATOM 2665  H HH   . TYR A 1 31 ? 14.896  0.269   -0.136  1.00 0.00 ? 31 TYR A HH   3  
ATOM 2666  N N    . PRO A 1 32 ? 10.600  -8.079  -0.026  1.00 0.00 ? 32 PRO A N    3  
ATOM 2667  C CA   . PRO A 1 32 ? 10.302  -9.494  0.216   1.00 0.00 ? 32 PRO A CA   3  
ATOM 2668  C C    . PRO A 1 32 ? 10.994  -10.412 -0.784  1.00 0.00 ? 32 PRO A C    3  
ATOM 2669  O O    . PRO A 1 32 ? 11.676  -9.949  -1.699  1.00 0.00 ? 32 PRO A O    3  
ATOM 2670  C CB   . PRO A 1 32 ? 8.782   -9.569  0.048   1.00 0.00 ? 32 PRO A CB   3  
ATOM 2671  C CG   . PRO A 1 32 ? 8.443   -8.430  -0.850  1.00 0.00 ? 32 PRO A CG   3  
ATOM 2672  C CD   . PRO A 1 32 ? 9.429   -7.341  -0.528  1.00 0.00 ? 32 PRO A CD   3  
ATOM 2673  H HA   . PRO A 1 32 ? 10.570  -9.789  1.220   1.00 0.00 ? 32 PRO A HA   3  
ATOM 2674  H HB2  . PRO A 1 32 ? 8.513   -10.517 -0.396  1.00 0.00 ? 32 PRO A HB2  3  
ATOM 2675  H HB3  . PRO A 1 32 ? 8.304   -9.468  1.011   1.00 0.00 ? 32 PRO A HB3  3  
ATOM 2676  H HG2  . PRO A 1 32 ? 8.543   -8.733  -1.881  1.00 0.00 ? 32 PRO A HG2  3  
ATOM 2677  H HG3  . PRO A 1 32 ? 7.436   -8.094  -0.652  1.00 0.00 ? 32 PRO A HG3  3  
ATOM 2678  H HD2  . PRO A 1 32 ? 9.678   -6.782  -1.418  1.00 0.00 ? 32 PRO A HD2  3  
ATOM 2679  H HD3  . PRO A 1 32 ? 9.032   -6.686  0.233   1.00 0.00 ? 32 PRO A HD3  3  
ATOM 2680  N N    . LYS A 1 33 ? 10.816  -11.716 -0.605  1.00 0.00 ? 33 LYS A N    3  
ATOM 2681  C CA   . LYS A 1 33 ? 11.422  -12.701 -1.493  1.00 0.00 ? 33 LYS A CA   3  
ATOM 2682  C C    . LYS A 1 33 ? 10.353  -13.481 -2.252  1.00 0.00 ? 33 LYS A C    3  
ATOM 2683  O O    . LYS A 1 33 ? 9.166   -13.391 -1.938  1.00 0.00 ? 33 LYS A O    3  
ATOM 2684  C CB   . LYS A 1 33 ? 12.301  -13.666 -0.694  1.00 0.00 ? 33 LYS A CB   3  
ATOM 2685  C CG   . LYS A 1 33 ? 13.017  -13.011 0.474   1.00 0.00 ? 33 LYS A CG   3  
ATOM 2686  C CD   . LYS A 1 33 ? 12.130  -12.945 1.706   1.00 0.00 ? 33 LYS A CD   3  
ATOM 2687  C CE   . LYS A 1 33 ? 12.951  -12.786 2.976   1.00 0.00 ? 33 LYS A CE   3  
ATOM 2688  N NZ   . LYS A 1 33 ? 13.525  -11.417 3.097   1.00 0.00 ? 33 LYS A NZ   3  
ATOM 2689  H H    . LYS A 1 33 ? 10.261  -12.025 0.142   1.00 0.00 ? 33 LYS A H    3  
ATOM 2690  H HA   . LYS A 1 33 ? 12.037  -12.172 -2.205  1.00 0.00 ? 33 LYS A HA   3  
ATOM 2691  H HB2  . LYS A 1 33 ? 11.682  -14.463 -0.309  1.00 0.00 ? 33 LYS A HB2  3  
ATOM 2692  H HB3  . LYS A 1 33 ? 13.045  -14.088 -1.355  1.00 0.00 ? 33 LYS A HB3  3  
ATOM 2693  H HG2  . LYS A 1 33 ? 13.900  -13.585 0.711   1.00 0.00 ? 33 LYS A HG2  3  
ATOM 2694  H HG3  . LYS A 1 33 ? 13.302  -12.007 0.192   1.00 0.00 ? 33 LYS A HG3  3  
ATOM 2695  H HD2  . LYS A 1 33 ? 11.463  -12.101 1.614   1.00 0.00 ? 33 LYS A HD2  3  
ATOM 2696  H HD3  . LYS A 1 33 ? 11.552  -13.856 1.772   1.00 0.00 ? 33 LYS A HD3  3  
ATOM 2697  H HE2  . LYS A 1 33 ? 12.315  -12.976 3.827   1.00 0.00 ? 33 LYS A HE2  3  
ATOM 2698  H HE3  . LYS A 1 33 ? 13.756  -13.505 2.961   1.00 0.00 ? 33 LYS A HE3  3  
ATOM 2699  H HZ1  . LYS A 1 33 ? 13.014  -10.879 3.826   1.00 0.00 ? 33 LYS A HZ1  3  
ATOM 2700  H HZ2  . LYS A 1 33 ? 13.445  -10.914 2.191   1.00 0.00 ? 33 LYS A HZ2  3  
ATOM 2701  H HZ3  . LYS A 1 33 ? 14.529  -11.473 3.363   1.00 0.00 ? 33 LYS A HZ3  3  
ATOM 2702  N N    . ASP A 1 34 ? 10.781  -14.245 -3.250  1.00 0.00 ? 34 ASP A N    3  
ATOM 2703  C CA   . ASP A 1 34 ? 9.860   -15.043 -4.052  1.00 0.00 ? 34 ASP A CA   3  
ATOM 2704  C C    . ASP A 1 34 ? 8.813   -15.715 -3.170  1.00 0.00 ? 34 ASP A C    3  
ATOM 2705  O O    . ASP A 1 34 ? 7.611   -15.565 -3.392  1.00 0.00 ? 34 ASP A O    3  
ATOM 2706  C CB   . ASP A 1 34 ? 10.628  -16.099 -4.849  1.00 0.00 ? 34 ASP A CB   3  
ATOM 2707  C CG   . ASP A 1 34 ? 9.889   -16.531 -6.100  1.00 0.00 ? 34 ASP A CG   3  
ATOM 2708  O OD1  . ASP A 1 34 ? 8.832   -17.183 -5.969  1.00 0.00 ? 34 ASP A OD1  3  
ATOM 2709  O OD2  . ASP A 1 34 ? 10.367  -16.217 -7.210  1.00 0.00 ? 34 ASP A OD2  3  
ATOM 2710  H H    . ASP A 1 34 ? 11.740  -14.275 -3.452  1.00 0.00 ? 34 ASP A H    3  
ATOM 2711  H HA   . ASP A 1 34 ? 9.360   -14.379 -4.741  1.00 0.00 ? 34 ASP A HA   3  
ATOM 2712  H HB2  . ASP A 1 34 ? 11.586  -15.695 -5.141  1.00 0.00 ? 34 ASP A HB2  3  
ATOM 2713  H HB3  . ASP A 1 34 ? 10.783  -16.968 -4.226  1.00 0.00 ? 34 ASP A HB3  3  
ATOM 2714  N N    . ASP A 1 35 ? 9.277   -16.455 -2.169  1.00 0.00 ? 35 ASP A N    3  
ATOM 2715  C CA   . ASP A 1 35 ? 8.380   -17.151 -1.253  1.00 0.00 ? 35 ASP A CA   3  
ATOM 2716  C C    . ASP A 1 35 ? 7.266   -16.224 -0.776  1.00 0.00 ? 35 ASP A C    3  
ATOM 2717  O O    . ASP A 1 35 ? 6.090   -16.588 -0.804  1.00 0.00 ? 35 ASP A O    3  
ATOM 2718  C CB   . ASP A 1 35 ? 9.161   -17.690 -0.053  1.00 0.00 ? 35 ASP A CB   3  
ATOM 2719  C CG   . ASP A 1 35 ? 8.545   -18.952 0.518   1.00 0.00 ? 35 ASP A CG   3  
ATOM 2720  O OD1  . ASP A 1 35 ? 8.090   -19.802 -0.276  1.00 0.00 ? 35 ASP A OD1  3  
ATOM 2721  O OD2  . ASP A 1 35 ? 8.518   -19.089 1.759   1.00 0.00 ? 35 ASP A OD2  3  
ATOM 2722  H H    . ASP A 1 35 ? 10.246  -16.536 -2.044  1.00 0.00 ? 35 ASP A H    3  
ATOM 2723  H HA   . ASP A 1 35 ? 7.939   -17.979 -1.786  1.00 0.00 ? 35 ASP A HA   3  
ATOM 2724  H HB2  . ASP A 1 35 ? 10.172  -17.913 -0.361  1.00 0.00 ? 35 ASP A HB2  3  
ATOM 2725  H HB3  . ASP A 1 35 ? 9.181   -16.938 0.722   1.00 0.00 ? 35 ASP A HB3  3  
ATOM 2726  N N    . GLU A 1 36 ? 7.644   -15.027 -0.339  1.00 0.00 ? 36 GLU A N    3  
ATOM 2727  C CA   . GLU A 1 36 ? 6.676   -14.051 0.146   1.00 0.00 ? 36 GLU A CA   3  
ATOM 2728  C C    . GLU A 1 36 ? 5.735   -13.615 -0.974  1.00 0.00 ? 36 GLU A C    3  
ATOM 2729  O O    . GLU A 1 36 ? 4.514   -13.644 -0.821  1.00 0.00 ? 36 GLU A O    3  
ATOM 2730  C CB   . GLU A 1 36 ? 7.395   -12.831 0.726   1.00 0.00 ? 36 GLU A CB   3  
ATOM 2731  C CG   . GLU A 1 36 ? 8.221   -13.143 1.962   1.00 0.00 ? 36 GLU A CG   3  
ATOM 2732  C CD   . GLU A 1 36 ? 7.367   -13.351 3.197   1.00 0.00 ? 36 GLU A CD   3  
ATOM 2733  O OE1  . GLU A 1 36 ? 6.909   -12.345 3.778   1.00 0.00 ? 36 GLU A OE1  3  
ATOM 2734  O OE2  . GLU A 1 36 ? 7.156   -14.520 3.584   1.00 0.00 ? 36 GLU A OE2  3  
ATOM 2735  H H    . GLU A 1 36 ? 8.596   -14.796 -0.342  1.00 0.00 ? 36 GLU A H    3  
ATOM 2736  H HA   . GLU A 1 36 ? 6.095   -14.519 0.926   1.00 0.00 ? 36 GLU A HA   3  
ATOM 2737  H HB2  . GLU A 1 36 ? 8.052   -12.423 -0.028  1.00 0.00 ? 36 GLU A HB2  3  
ATOM 2738  H HB3  . GLU A 1 36 ? 6.659   -12.086 0.989   1.00 0.00 ? 36 GLU A HB3  3  
ATOM 2739  H HG2  . GLU A 1 36 ? 8.791   -14.042 1.782   1.00 0.00 ? 36 GLU A HG2  3  
ATOM 2740  H HG3  . GLU A 1 36 ? 8.897   -12.320 2.145   1.00 0.00 ? 36 GLU A HG3  3  
ATOM 2741  N N    . PHE A 1 37 ? 6.313   -13.212 -2.101  1.00 0.00 ? 37 PHE A N    3  
ATOM 2742  C CA   . PHE A 1 37 ? 5.527   -12.769 -3.247  1.00 0.00 ? 37 PHE A CA   3  
ATOM 2743  C C    . PHE A 1 37 ? 4.430   -13.776 -3.576  1.00 0.00 ? 37 PHE A C    3  
ATOM 2744  O O    . PHE A 1 37 ? 3.326   -13.400 -3.969  1.00 0.00 ? 37 PHE A O    3  
ATOM 2745  C CB   . PHE A 1 37 ? 6.432   -12.566 -4.464  1.00 0.00 ? 37 PHE A CB   3  
ATOM 2746  C CG   . PHE A 1 37 ? 7.042   -11.196 -4.536  1.00 0.00 ? 37 PHE A CG   3  
ATOM 2747  C CD1  . PHE A 1 37 ? 6.388   -10.165 -5.192  1.00 0.00 ? 37 PHE A CD1  3  
ATOM 2748  C CD2  . PHE A 1 37 ? 8.270   -10.938 -3.948  1.00 0.00 ? 37 PHE A CD2  3  
ATOM 2749  C CE1  . PHE A 1 37 ? 6.948   -8.903  -5.260  1.00 0.00 ? 37 PHE A CE1  3  
ATOM 2750  C CE2  . PHE A 1 37 ? 8.835   -9.678  -4.013  1.00 0.00 ? 37 PHE A CE2  3  
ATOM 2751  C CZ   . PHE A 1 37 ? 8.172   -8.659  -4.669  1.00 0.00 ? 37 PHE A CZ   3  
ATOM 2752  H H    . PHE A 1 37 ? 7.291   -13.212 -2.163  1.00 0.00 ? 37 PHE A H    3  
ATOM 2753  H HA   . PHE A 1 37 ? 5.069   -11.827 -2.989  1.00 0.00 ? 37 PHE A HA   3  
ATOM 2754  H HB2  . PHE A 1 37 ? 7.236   -13.286 -4.430  1.00 0.00 ? 37 PHE A HB2  3  
ATOM 2755  H HB3  . PHE A 1 37 ? 5.853   -12.721 -5.363  1.00 0.00 ? 37 PHE A HB3  3  
ATOM 2756  H HD1  . PHE A 1 37 ? 5.430   -10.354 -5.653  1.00 0.00 ? 37 PHE A HD1  3  
ATOM 2757  H HD2  . PHE A 1 37 ? 8.789   -11.735 -3.434  1.00 0.00 ? 37 PHE A HD2  3  
ATOM 2758  H HE1  . PHE A 1 37 ? 6.428   -8.108  -5.773  1.00 0.00 ? 37 PHE A HE1  3  
ATOM 2759  H HE2  . PHE A 1 37 ? 9.792   -9.491  -3.549  1.00 0.00 ? 37 PHE A HE2  3  
ATOM 2760  H HZ   . PHE A 1 37 ? 8.612   -7.674  -4.721  1.00 0.00 ? 37 PHE A HZ   3  
ATOM 2761  N N    . GLU A 1 38 ? 4.743   -15.058 -3.413  1.00 0.00 ? 38 GLU A N    3  
ATOM 2762  C CA   . GLU A 1 38 ? 3.784   -16.120 -3.695  1.00 0.00 ? 38 GLU A CA   3  
ATOM 2763  C C    . GLU A 1 38 ? 2.522   -15.950 -2.854  1.00 0.00 ? 38 GLU A C    3  
ATOM 2764  O O    . GLU A 1 38 ? 1.408   -16.126 -3.346  1.00 0.00 ? 38 GLU A O    3  
ATOM 2765  C CB   . GLU A 1 38 ? 4.411   -17.489 -3.423  1.00 0.00 ? 38 GLU A CB   3  
ATOM 2766  C CG   . GLU A 1 38 ? 5.449   -17.898 -4.454  1.00 0.00 ? 38 GLU A CG   3  
ATOM 2767  C CD   . GLU A 1 38 ? 6.430   -18.923 -3.919  1.00 0.00 ? 38 GLU A CD   3  
ATOM 2768  O OE1  . GLU A 1 38 ? 5.977   -19.981 -3.435  1.00 0.00 ? 38 GLU A OE1  3  
ATOM 2769  O OE2  . GLU A 1 38 ? 7.650   -18.667 -3.985  1.00 0.00 ? 38 GLU A OE2  3  
ATOM 2770  H H    . GLU A 1 38 ? 5.640   -15.295 -3.097  1.00 0.00 ? 38 GLU A H    3  
ATOM 2771  H HA   . GLU A 1 38 ? 3.517   -16.057 -4.739  1.00 0.00 ? 38 GLU A HA   3  
ATOM 2772  H HB2  . GLU A 1 38 ? 4.885   -17.468 -2.453  1.00 0.00 ? 38 GLU A HB2  3  
ATOM 2773  H HB3  . GLU A 1 38 ? 3.629   -18.234 -3.415  1.00 0.00 ? 38 GLU A HB3  3  
ATOM 2774  H HG2  . GLU A 1 38 ? 4.941   -18.321 -5.309  1.00 0.00 ? 38 GLU A HG2  3  
ATOM 2775  H HG3  . GLU A 1 38 ? 5.999   -17.021 -4.761  1.00 0.00 ? 38 GLU A HG3  3  
ATOM 2776  N N    . GLN A 1 39 ? 2.707   -15.608 -1.583  1.00 0.00 ? 39 GLN A N    3  
ATOM 2777  C CA   . GLN A 1 39 ? 1.583   -15.415 -0.673  1.00 0.00 ? 39 GLN A CA   3  
ATOM 2778  C C    . GLN A 1 39 ? 0.567   -14.442 -1.261  1.00 0.00 ? 39 GLN A C    3  
ATOM 2779  O O    . GLN A 1 39 ? -0.630  -14.729 -1.305  1.00 0.00 ? 39 GLN A O    3  
ATOM 2780  C CB   . GLN A 1 39 ? 2.078   -14.900 0.680   1.00 0.00 ? 39 GLN A CB   3  
ATOM 2781  C CG   . GLN A 1 39 ? 2.858   -15.934 1.476   1.00 0.00 ? 39 GLN A CG   3  
ATOM 2782  C CD   . GLN A 1 39 ? 1.968   -16.773 2.372   1.00 0.00 ? 39 GLN A CD   3  
ATOM 2783  O OE1  . GLN A 1 39 ? 0.800   -16.449 2.586   1.00 0.00 ? 39 GLN A OE1  3  
ATOM 2784  N NE2  . GLN A 1 39 ? 2.518   -17.860 2.902   1.00 0.00 ? 39 GLN A NE2  3  
ATOM 2785  H H    . GLN A 1 39 ? 3.619   -15.482 -1.249  1.00 0.00 ? 39 GLN A H    3  
ATOM 2786  H HA   . GLN A 1 39 ? 1.105   -16.373 -0.530  1.00 0.00 ? 39 GLN A HA   3  
ATOM 2787  H HB2  . GLN A 1 39 ? 2.718   -14.047 0.515   1.00 0.00 ? 39 GLN A HB2  3  
ATOM 2788  H HB3  . GLN A 1 39 ? 1.226   -14.593 1.268   1.00 0.00 ? 39 GLN A HB3  3  
ATOM 2789  H HG2  . GLN A 1 39 ? 3.369   -16.590 0.787   1.00 0.00 ? 39 GLN A HG2  3  
ATOM 2790  H HG3  . GLN A 1 39 ? 3.584   -15.423 2.091   1.00 0.00 ? 39 GLN A HG3  3  
ATOM 2791  H HE21 . GLN A 1 39 ? 3.454   -18.055 2.689   1.00 0.00 ? 39 GLN A HE21 3  
ATOM 2792  H HE22 . GLN A 1 39 ? 1.966   -18.420 3.486   1.00 0.00 ? 39 GLN A HE22 3  
ATOM 2793  N N    . LEU A 1 40 ? 1.051   -13.289 -1.710  1.00 0.00 ? 40 LEU A N    3  
ATOM 2794  C CA   . LEU A 1 40 ? 0.185   -12.272 -2.295  1.00 0.00 ? 40 LEU A CA   3  
ATOM 2795  C C    . LEU A 1 40 ? -0.347  -12.724 -3.652  1.00 0.00 ? 40 LEU A C    3  
ATOM 2796  O O    . LEU A 1 40 ? -1.526  -12.548 -3.957  1.00 0.00 ? 40 LEU A O    3  
ATOM 2797  C CB   . LEU A 1 40 ? 0.945   -10.953 -2.446  1.00 0.00 ? 40 LEU A CB   3  
ATOM 2798  C CG   . LEU A 1 40 ? 1.512   -10.354 -1.159  1.00 0.00 ? 40 LEU A CG   3  
ATOM 2799  C CD1  . LEU A 1 40 ? 2.777   -9.562  -1.451  1.00 0.00 ? 40 LEU A CD1  3  
ATOM 2800  C CD2  . LEU A 1 40 ? 0.475   -9.473  -0.478  1.00 0.00 ? 40 LEU A CD2  3  
ATOM 2801  H H    . LEU A 1 40 ? 2.014   -13.117 -1.648  1.00 0.00 ? 40 LEU A H    3  
ATOM 2802  H HA   . LEU A 1 40 ? -0.650  -12.123 -1.627  1.00 0.00 ? 40 LEU A HA   3  
ATOM 2803  H HB2  . LEU A 1 40 ? 1.768   -11.121 -3.124  1.00 0.00 ? 40 LEU A HB2  3  
ATOM 2804  H HB3  . LEU A 1 40 ? 0.267   -10.230 -2.878  1.00 0.00 ? 40 LEU A HB3  3  
ATOM 2805  H HG   . LEU A 1 40 ? 1.770   -11.155 -0.480  1.00 0.00 ? 40 LEU A HG   3  
ATOM 2806  H HD11 . LEU A 1 40 ? 3.421   -10.137 -2.099  1.00 0.00 ? 40 LEU A HD11 3  
ATOM 2807  H HD12 . LEU A 1 40 ? 3.293   -9.353  -0.526  1.00 0.00 ? 40 LEU A HD12 3  
ATOM 2808  H HD13 . LEU A 1 40 ? 2.516   -8.632  -1.936  1.00 0.00 ? 40 LEU A HD13 3  
ATOM 2809  H HD21 . LEU A 1 40 ? 0.427   -8.519  -0.982  1.00 0.00 ? 40 LEU A HD21 3  
ATOM 2810  H HD22 . LEU A 1 40 ? 0.755   -9.321  0.555   1.00 0.00 ? 40 LEU A HD22 3  
ATOM 2811  H HD23 . LEU A 1 40 ? -0.491  -9.954  -0.523  1.00 0.00 ? 40 LEU A HD23 3  
ATOM 2812  N N    . SER A 1 41 ? 0.531   -13.309 -4.461  1.00 0.00 ? 41 SER A N    3  
ATOM 2813  C CA   . SER A 1 41 ? 0.151   -13.785 -5.785  1.00 0.00 ? 41 SER A CA   3  
ATOM 2814  C C    . SER A 1 41 ? -0.989  -14.795 -5.693  1.00 0.00 ? 41 SER A C    3  
ATOM 2815  O O    . SER A 1 41 ? -1.802  -14.916 -6.608  1.00 0.00 ? 41 SER A O    3  
ATOM 2816  C CB   . SER A 1 41 ? 1.353   -14.418 -6.488  1.00 0.00 ? 41 SER A CB   3  
ATOM 2817  O OG   . SER A 1 41 ? 1.428   -15.807 -6.218  1.00 0.00 ? 41 SER A OG   3  
ATOM 2818  H H    . SER A 1 41 ? 1.457   -13.420 -4.160  1.00 0.00 ? 41 SER A H    3  
ATOM 2819  H HA   . SER A 1 41 ? -0.184  -12.934 -6.360  1.00 0.00 ? 41 SER A HA   3  
ATOM 2820  H HB2  . SER A 1 41 ? 1.260   -14.275 -7.554  1.00 0.00 ? 41 SER A HB2  3  
ATOM 2821  H HB3  . SER A 1 41 ? 2.260   -13.946 -6.138  1.00 0.00 ? 41 SER A HB3  3  
ATOM 2822  H HG   . SER A 1 41 ? 1.576   -15.944 -5.279  1.00 0.00 ? 41 SER A HG   3  
ATOM 2823  N N    . ASN A 1 42 ? -1.040  -15.519 -4.579  1.00 0.00 ? 42 ASN A N    3  
ATOM 2824  C CA   . ASN A 1 42 ? -2.079  -16.520 -4.366  1.00 0.00 ? 42 ASN A CA   3  
ATOM 2825  C C    . ASN A 1 42 ? -3.344  -15.880 -3.803  1.00 0.00 ? 42 ASN A C    3  
ATOM 2826  O O    . ASN A 1 42 ? -4.458  -16.318 -4.095  1.00 0.00 ? 42 ASN A O    3  
ATOM 2827  C CB   . ASN A 1 42 ? -1.579  -17.610 -3.415  1.00 0.00 ? 42 ASN A CB   3  
ATOM 2828  C CG   . ASN A 1 42 ? -0.809  -18.699 -4.137  1.00 0.00 ? 42 ASN A CG   3  
ATOM 2829  O OD1  . ASN A 1 42 ? -1.398  -19.583 -4.759  1.00 0.00 ? 42 ASN A OD1  3  
ATOM 2830  N ND2  . ASN A 1 42 ? 0.515   -18.638 -4.059  1.00 0.00 ? 42 ASN A ND2  3  
ATOM 2831  H H    . ASN A 1 42 ? -0.363  -15.378 -3.885  1.00 0.00 ? 42 ASN A H    3  
ATOM 2832  H HA   . ASN A 1 42 ? -2.310  -16.967 -5.321  1.00 0.00 ? 42 ASN A HA   3  
ATOM 2833  H HB2  . ASN A 1 42 ? -0.927  -17.164 -2.678  1.00 0.00 ? 42 ASN A HB2  3  
ATOM 2834  H HB3  . ASN A 1 42 ? -2.424  -18.061 -2.917  1.00 0.00 ? 42 ASN A HB3  3  
ATOM 2835  H HD21 . ASN A 1 42 ? 0.916   -17.905 -3.546  1.00 0.00 ? 42 ASN A HD21 3  
ATOM 2836  H HD22 . ASN A 1 42 ? 1.038   -19.330 -4.517  1.00 0.00 ? 42 ASN A HD22 3  
ATOM 2837  N N    . LEU A 1 43 ? -3.165  -14.841 -2.995  1.00 0.00 ? 43 LEU A N    3  
ATOM 2838  C CA   . LEU A 1 43 ? -4.292  -14.138 -2.391  1.00 0.00 ? 43 LEU A CA   3  
ATOM 2839  C C    . LEU A 1 43 ? -5.040  -13.311 -3.432  1.00 0.00 ? 43 LEU A C    3  
ATOM 2840  O O    . LEU A 1 43 ? -6.236  -13.506 -3.653  1.00 0.00 ? 43 LEU A O    3  
ATOM 2841  C CB   . LEU A 1 43 ? -3.806  -13.234 -1.257  1.00 0.00 ? 43 LEU A CB   3  
ATOM 2842  C CG   . LEU A 1 43 ? -4.780  -12.147 -0.801  1.00 0.00 ? 43 LEU A CG   3  
ATOM 2843  C CD1  . LEU A 1 43 ? -6.096  -12.763 -0.352  1.00 0.00 ? 43 LEU A CD1  3  
ATOM 2844  C CD2  . LEU A 1 43 ? -4.168  -11.317 0.318   1.00 0.00 ? 43 LEU A CD2  3  
ATOM 2845  H H    . LEU A 1 43 ? -2.254  -14.538 -2.800  1.00 0.00 ? 43 LEU A H    3  
ATOM 2846  H HA   . LEU A 1 43 ? -4.965  -14.879 -1.986  1.00 0.00 ? 43 LEU A HA   3  
ATOM 2847  H HB2  . LEU A 1 43 ? -3.587  -13.859 -0.406  1.00 0.00 ? 43 LEU A HB2  3  
ATOM 2848  H HB3  . LEU A 1 43 ? -2.899  -12.748 -1.589  1.00 0.00 ? 43 LEU A HB3  3  
ATOM 2849  H HG   . LEU A 1 43 ? -4.988  -11.487 -1.632  1.00 0.00 ? 43 LEU A HG   3  
ATOM 2850  H HD11 . LEU A 1 43 ? -6.493  -13.379 -1.144  1.00 0.00 ? 43 LEU A HD11 3  
ATOM 2851  H HD12 . LEU A 1 43 ? -6.800  -11.978 -0.119  1.00 0.00 ? 43 LEU A HD12 3  
ATOM 2852  H HD13 . LEU A 1 43 ? -5.928  -13.369 0.526   1.00 0.00 ? 43 LEU A HD13 3  
ATOM 2853  H HD21 . LEU A 1 43 ? -4.696  -11.512 1.240   1.00 0.00 ? 43 LEU A HD21 3  
ATOM 2854  H HD22 . LEU A 1 43 ? -4.247  -10.268 0.073   1.00 0.00 ? 43 LEU A HD22 3  
ATOM 2855  H HD23 . LEU A 1 43 ? -3.128  -11.583 0.435   1.00 0.00 ? 43 LEU A HD23 3  
ATOM 2856  N N    . LEU A 1 44 ? -4.327  -12.390 -4.071  1.00 0.00 ? 44 LEU A N    3  
ATOM 2857  C CA   . LEU A 1 44 ? -4.922  -11.534 -5.091  1.00 0.00 ? 44 LEU A CA   3  
ATOM 2858  C C    . LEU A 1 44 ? -5.084  -12.288 -6.407  1.00 0.00 ? 44 LEU A C    3  
ATOM 2859  O O    . LEU A 1 44 ? -5.697  -11.787 -7.349  1.00 0.00 ? 44 LEU A O    3  
ATOM 2860  C CB   . LEU A 1 44 ? -4.061  -10.288 -5.306  1.00 0.00 ? 44 LEU A CB   3  
ATOM 2861  C CG   . LEU A 1 44 ? -3.702  -9.495  -4.049  1.00 0.00 ? 44 LEU A CG   3  
ATOM 2862  C CD1  . LEU A 1 44 ? -2.594  -8.497  -4.346  1.00 0.00 ? 44 LEU A CD1  3  
ATOM 2863  C CD2  . LEU A 1 44 ? -4.930  -8.784  -3.498  1.00 0.00 ? 44 LEU A CD2  3  
ATOM 2864  H H    . LEU A 1 44 ? -3.379  -12.282 -3.852  1.00 0.00 ? 44 LEU A H    3  
ATOM 2865  H HA   . LEU A 1 44 ? -5.898  -11.231 -4.741  1.00 0.00 ? 44 LEU A HA   3  
ATOM 2866  H HB2  . LEU A 1 44 ? -3.140  -10.600 -5.774  1.00 0.00 ? 44 LEU A HB2  3  
ATOM 2867  H HB3  . LEU A 1 44 ? -4.597  -9.628  -5.973  1.00 0.00 ? 44 LEU A HB3  3  
ATOM 2868  H HG   . LEU A 1 44 ? -3.342  -10.178 -3.291  1.00 0.00 ? 44 LEU A HG   3  
ATOM 2869  H HD11 . LEU A 1 44 ? -2.417  -7.886  -3.474  1.00 0.00 ? 44 LEU A HD11 3  
ATOM 2870  H HD12 . LEU A 1 44 ? -2.888  -7.869  -5.173  1.00 0.00 ? 44 LEU A HD12 3  
ATOM 2871  H HD13 . LEU A 1 44 ? -1.689  -9.029  -4.602  1.00 0.00 ? 44 LEU A HD13 3  
ATOM 2872  H HD21 . LEU A 1 44 ? -5.434  -9.430  -2.795  1.00 0.00 ? 44 LEU A HD21 3  
ATOM 2873  H HD22 . LEU A 1 44 ? -5.600  -8.543  -4.311  1.00 0.00 ? 44 LEU A HD22 3  
ATOM 2874  H HD23 . LEU A 1 44 ? -4.626  -7.876  -3.000  1.00 0.00 ? 44 LEU A HD23 3  
ATOM 2875  N N    . ASN A 1 45 ? -4.532  -13.495 -6.464  1.00 0.00 ? 45 ASN A N    3  
ATOM 2876  C CA   . ASN A 1 45 ? -4.616  -14.319 -7.664  1.00 0.00 ? 45 ASN A CA   3  
ATOM 2877  C C    . ASN A 1 45 ? -3.953  -13.624 -8.849  1.00 0.00 ? 45 ASN A C    3  
ATOM 2878  O O    . ASN A 1 45 ? -4.378  -13.782 -9.994  1.00 0.00 ? 45 ASN A O    3  
ATOM 2879  C CB   . ASN A 1 45 ? -6.078  -14.629 -7.993  1.00 0.00 ? 45 ASN A CB   3  
ATOM 2880  C CG   . ASN A 1 45 ? -6.693  -15.617 -7.021  1.00 0.00 ? 45 ASN A CG   3  
ATOM 2881  O OD1  . ASN A 1 45 ? -6.046  -16.050 -6.066  1.00 0.00 ? 45 ASN A OD1  3  
ATOM 2882  N ND2  . ASN A 1 45 ? -7.948  -15.978 -7.259  1.00 0.00 ? 45 ASN A ND2  3  
ATOM 2883  H H    . ASN A 1 45 ? -4.056  -13.840 -5.680  1.00 0.00 ? 45 ASN A H    3  
ATOM 2884  H HA   . ASN A 1 45 ? -4.097  -15.245 -7.468  1.00 0.00 ? 45 ASN A HA   3  
ATOM 2885  H HB2  . ASN A 1 45 ? -6.650  -13.714 -7.957  1.00 0.00 ? 45 ASN A HB2  3  
ATOM 2886  H HB3  . ASN A 1 45 ? -6.136  -15.046 -8.987  1.00 0.00 ? 45 ASN A HB3  3  
ATOM 2887  H HD21 . ASN A 1 45 ? -8.401  -15.593 -8.039  1.00 0.00 ? 45 ASN A HD21 3  
ATOM 2888  H HD22 . ASN A 1 45 ? -8.370  -16.615 -6.646  1.00 0.00 ? 45 ASN A HD22 3  
ATOM 2889  N N    . LEU A 1 46 ? -2.908  -12.854 -8.566  1.00 0.00 ? 46 LEU A N    3  
ATOM 2890  C CA   . LEU A 1 46 ? -2.184  -12.134 -9.608  1.00 0.00 ? 46 LEU A CA   3  
ATOM 2891  C C    . LEU A 1 46 ? -0.774  -12.692 -9.777  1.00 0.00 ? 46 LEU A C    3  
ATOM 2892  O O    . LEU A 1 46 ? -0.184  -13.245 -8.849  1.00 0.00 ? 46 LEU A O    3  
ATOM 2893  C CB   . LEU A 1 46 ? -2.117  -10.643 -9.274  1.00 0.00 ? 46 LEU A CB   3  
ATOM 2894  C CG   . LEU A 1 46 ? -3.460  -9.923  -9.148  1.00 0.00 ? 46 LEU A CG   3  
ATOM 2895  C CD1  . LEU A 1 46 ? -3.268  -8.535  -8.555  1.00 0.00 ? 46 LEU A CD1  3  
ATOM 2896  C CD2  . LEU A 1 46 ? -4.148  -9.836  -10.502 1.00 0.00 ? 46 LEU A CD2  3  
ATOM 2897  H H    . LEU A 1 46 ? -2.615  -12.767 -7.635  1.00 0.00 ? 46 LEU A H    3  
ATOM 2898  H HA   . LEU A 1 46 ? -2.722  -12.263 -10.535 1.00 0.00 ? 46 LEU A HA   3  
ATOM 2899  H HB2  . LEU A 1 46 ? -1.596  -10.538 -8.334  1.00 0.00 ? 46 LEU A HB2  3  
ATOM 2900  H HB3  . LEU A 1 46 ? -1.551  -10.155 -10.054 1.00 0.00 ? 46 LEU A HB3  3  
ATOM 2901  H HG   . LEU A 1 46 ? -4.101  -10.484 -8.481  1.00 0.00 ? 46 LEU A HG   3  
ATOM 2902  H HD11 . LEU A 1 46 ? -4.043  -8.344  -7.828  1.00 0.00 ? 46 LEU A HD11 3  
ATOM 2903  H HD12 . LEU A 1 46 ? -3.323  -7.798  -9.342  1.00 0.00 ? 46 LEU A HD12 3  
ATOM 2904  H HD13 . LEU A 1 46 ? -2.302  -8.479  -8.076  1.00 0.00 ? 46 LEU A HD13 3  
ATOM 2905  H HD21 . LEU A 1 46 ? -4.312  -10.832 -10.886 1.00 0.00 ? 46 LEU A HD21 3  
ATOM 2906  H HD22 . LEU A 1 46 ? -3.523  -9.284  -11.189 1.00 0.00 ? 46 LEU A HD22 3  
ATOM 2907  H HD23 . LEU A 1 46 ? -5.096  -9.332  -10.392 1.00 0.00 ? 46 LEU A HD23 3  
ATOM 2908  N N    . PRO A 1 47 ? -0.220  -12.544 -10.989 1.00 0.00 ? 47 PRO A N    3  
ATOM 2909  C CA   . PRO A 1 47 ? 1.128   -13.025 -11.308 1.00 0.00 ? 47 PRO A CA   3  
ATOM 2910  C C    . PRO A 1 47 ? 2.213   -12.216 -10.605 1.00 0.00 ? 47 PRO A C    3  
ATOM 2911  O O    . PRO A 1 47 ? 2.220   -10.985 -10.662 1.00 0.00 ? 47 PRO A O    3  
ATOM 2912  C CB   . PRO A 1 47 ? 1.221   -12.840 -12.824 1.00 0.00 ? 47 PRO A CB   3  
ATOM 2913  C CG   . PRO A 1 47 ? 0.256   -11.749 -13.134 1.00 0.00 ? 47 PRO A CG   3  
ATOM 2914  C CD   . PRO A 1 47 ? -0.866  -11.896 -12.143 1.00 0.00 ? 47 PRO A CD   3  
ATOM 2915  H HA   . PRO A 1 47 ? 1.245   -14.070 -11.062 1.00 0.00 ? 47 PRO A HA   3  
ATOM 2916  H HB2  . PRO A 1 47 ? 2.231   -12.564 -13.094 1.00 0.00 ? 47 PRO A HB2  3  
ATOM 2917  H HB3  . PRO A 1 47 ? 0.949   -13.760 -13.320 1.00 0.00 ? 47 PRO A HB3  3  
ATOM 2918  H HG2  . PRO A 1 47 ? 0.736   -10.790 -13.017 1.00 0.00 ? 47 PRO A HG2  3  
ATOM 2919  H HG3  . PRO A 1 47 ? -0.117  -11.864 -14.141 1.00 0.00 ? 47 PRO A HG3  3  
ATOM 2920  H HD2  . PRO A 1 47 ? -1.259  -10.927 -11.871 1.00 0.00 ? 47 PRO A HD2  3  
ATOM 2921  H HD3  . PRO A 1 47 ? -1.648  -12.522 -12.548 1.00 0.00 ? 47 PRO A HD3  3  
ATOM 2922  N N    . THR A 1 48 ? 3.129   -12.914 -9.941  1.00 0.00 ? 48 THR A N    3  
ATOM 2923  C CA   . THR A 1 48 ? 4.218   -12.260 -9.227  1.00 0.00 ? 48 THR A CA   3  
ATOM 2924  C C    . THR A 1 48 ? 4.837   -11.148 -10.066 1.00 0.00 ? 48 THR A C    3  
ATOM 2925  O O    . THR A 1 48 ? 5.151   -10.073 -9.554  1.00 0.00 ? 48 THR A O    3  
ATOM 2926  C CB   . THR A 1 48 ? 5.318   -13.266 -8.837  1.00 0.00 ? 48 THR A CB   3  
ATOM 2927  O OG1  . THR A 1 48 ? 5.450   -14.266 -9.853  1.00 0.00 ? 48 THR A OG1  3  
ATOM 2928  C CG2  . THR A 1 48 ? 4.998   -13.929 -7.505  1.00 0.00 ? 48 THR A CG2  3  
ATOM 2929  H H    . THR A 1 48 ? 3.069   -13.892 -9.932  1.00 0.00 ? 48 THR A H    3  
ATOM 2930  H HA   . THR A 1 48 ? 3.814   -11.832 -8.321  1.00 0.00 ? 48 THR A HA   3  
ATOM 2931  H HB   . THR A 1 48 ? 6.254   -12.734 -8.741  1.00 0.00 ? 48 THR A HB   3  
ATOM 2932  H HG1  . THR A 1 48 ? 5.772   -15.081 -9.461  1.00 0.00 ? 48 THR A HG1  3  
ATOM 2933  H HG21 . THR A 1 48 ? 5.902   -14.337 -7.080  1.00 0.00 ? 48 THR A HG21 3  
ATOM 2934  H HG22 . THR A 1 48 ? 4.282   -14.722 -7.662  1.00 0.00 ? 48 THR A HG22 3  
ATOM 2935  H HG23 . THR A 1 48 ? 4.581   -13.196 -6.830  1.00 0.00 ? 48 THR A HG23 3  
ATOM 2936  N N    . ARG A 1 49 ? 5.009   -11.413 -11.357 1.00 0.00 ? 49 ARG A N    3  
ATOM 2937  C CA   . ARG A 1 49 ? 5.592   -10.434 -12.267 1.00 0.00 ? 49 ARG A CA   3  
ATOM 2938  C C    . ARG A 1 49 ? 4.877   -9.091  -12.150 1.00 0.00 ? 49 ARG A C    3  
ATOM 2939  O O    . ARG A 1 49 ? 5.500   -8.034  -12.246 1.00 0.00 ? 49 ARG A O    3  
ATOM 2940  C CB   . ARG A 1 49 ? 5.518   -10.940 -13.709 1.00 0.00 ? 49 ARG A CB   3  
ATOM 2941  C CG   . ARG A 1 49 ? 4.188   -10.655 -14.387 1.00 0.00 ? 49 ARG A CG   3  
ATOM 2942  C CD   . ARG A 1 49 ? 4.200   -9.309  -15.095 1.00 0.00 ? 49 ARG A CD   3  
ATOM 2943  N NE   . ARG A 1 49 ? 4.999   -9.341  -16.317 1.00 0.00 ? 49 ARG A NE   3  
ATOM 2944  C CZ   . ARG A 1 49 ? 5.521   -8.259  -16.883 1.00 0.00 ? 49 ARG A CZ   3  
ATOM 2945  N NH1  . ARG A 1 49 ? 5.330   -7.065  -16.339 1.00 0.00 ? 49 ARG A NH1  3  
ATOM 2946  N NH2  . ARG A 1 49 ? 6.237   -8.369  -17.994 1.00 0.00 ? 49 ARG A NH2  3  
ATOM 2947  H H    . ARG A 1 49 ? 4.739   -12.288 -11.706 1.00 0.00 ? 49 ARG A H    3  
ATOM 2948  H HA   . ARG A 1 49 ? 6.628   -10.302 -11.993 1.00 0.00 ? 49 ARG A HA   3  
ATOM 2949  H HB2  . ARG A 1 49 ? 6.299   -10.465 -14.285 1.00 0.00 ? 49 ARG A HB2  3  
ATOM 2950  H HB3  . ARG A 1 49 ? 5.677   -12.007 -13.712 1.00 0.00 ? 49 ARG A HB3  3  
ATOM 2951  H HG2  . ARG A 1 49 ? 3.991   -11.430 -15.113 1.00 0.00 ? 49 ARG A HG2  3  
ATOM 2952  H HG3  . ARG A 1 49 ? 3.407   -10.652 -13.640 1.00 0.00 ? 49 ARG A HG3  3  
ATOM 2953  H HD2  . ARG A 1 49 ? 3.185   -9.041  -15.347 1.00 0.00 ? 49 ARG A HD2  3  
ATOM 2954  H HD3  . ARG A 1 49 ? 4.612   -8.569  -14.426 1.00 0.00 ? 49 ARG A HD3  3  
ATOM 2955  H HE   . ARG A 1 49 ? 5.153   -10.213 -16.736 1.00 0.00 ? 49 ARG A HE   3  
ATOM 2956  H HH11 . ARG A 1 49 ? 4.792   -6.979  -15.500 1.00 0.00 ? 49 ARG A HH11 3  
ATOM 2957  H HH12 . ARG A 1 49 ? 5.725   -6.251  -16.766 1.00 0.00 ? 49 ARG A HH12 3  
ATOM 2958  H HH21 . ARG A 1 49 ? 6.384   -9.267  -18.407 1.00 0.00 ? 49 ARG A HH21 3  
ATOM 2959  H HH22 . ARG A 1 49 ? 6.629   -7.554  -18.419 1.00 0.00 ? 49 ARG A HH22 3  
ATOM 2960  N N    . VAL A 1 50 ? 3.565   -9.141  -11.943 1.00 0.00 ? 50 VAL A N    3  
ATOM 2961  C CA   . VAL A 1 50 ? 2.765   -7.929  -11.813 1.00 0.00 ? 50 VAL A CA   3  
ATOM 2962  C C    . VAL A 1 50 ? 2.971   -7.278  -10.450 1.00 0.00 ? 50 VAL A C    3  
ATOM 2963  O O    . VAL A 1 50 ? 2.988   -6.052  -10.332 1.00 0.00 ? 50 VAL A O    3  
ATOM 2964  C CB   . VAL A 1 50 ? 1.265   -8.222  -12.007 1.00 0.00 ? 50 VAL A CB   3  
ATOM 2965  C CG1  . VAL A 1 50 ? 0.422   -7.090  -11.442 1.00 0.00 ? 50 VAL A CG1  3  
ATOM 2966  C CG2  . VAL A 1 50 ? 0.953   -8.447  -13.479 1.00 0.00 ? 50 VAL A CG2  3  
ATOM 2967  H H    . VAL A 1 50 ? 3.124   -10.014 -11.876 1.00 0.00 ? 50 VAL A H    3  
ATOM 2968  H HA   . VAL A 1 50 ? 3.078   -7.238  -12.582 1.00 0.00 ? 50 VAL A HA   3  
ATOM 2969  H HB   . VAL A 1 50 ? 1.023   -9.126  -11.467 1.00 0.00 ? 50 VAL A HB   3  
ATOM 2970  H HG11 . VAL A 1 50 ? 0.688   -6.164  -11.931 1.00 0.00 ? 50 VAL A HG11 3  
ATOM 2971  H HG12 . VAL A 1 50 ? -0.624  -7.300  -11.611 1.00 0.00 ? 50 VAL A HG12 3  
ATOM 2972  H HG13 . VAL A 1 50 ? 0.604   -7.001  -10.381 1.00 0.00 ? 50 VAL A HG13 3  
ATOM 2973  H HG21 . VAL A 1 50 ? 0.888   -7.494  -13.982 1.00 0.00 ? 50 VAL A HG21 3  
ATOM 2974  H HG22 . VAL A 1 50 ? 1.739   -9.037  -13.928 1.00 0.00 ? 50 VAL A HG22 3  
ATOM 2975  H HG23 . VAL A 1 50 ? 0.013   -8.970  -13.572 1.00 0.00 ? 50 VAL A HG23 3  
ATOM 2976  N N    . ILE A 1 51 ? 3.129   -8.106  -9.423  1.00 0.00 ? 51 ILE A N    3  
ATOM 2977  C CA   . ILE A 1 51 ? 3.336   -7.611  -8.067  1.00 0.00 ? 51 ILE A CA   3  
ATOM 2978  C C    . ILE A 1 51 ? 4.743   -7.048  -7.897  1.00 0.00 ? 51 ILE A C    3  
ATOM 2979  O O    . ILE A 1 51 ? 4.966   -6.132  -7.105  1.00 0.00 ? 51 ILE A O    3  
ATOM 2980  C CB   . ILE A 1 51 ? 3.108   -8.719  -7.022  1.00 0.00 ? 51 ILE A CB   3  
ATOM 2981  C CG1  . ILE A 1 51 ? 1.821   -9.485  -7.332  1.00 0.00 ? 51 ILE A CG1  3  
ATOM 2982  C CG2  . ILE A 1 51 ? 3.054   -8.123  -5.623  1.00 0.00 ? 51 ILE A CG2  3  
ATOM 2983  C CD1  . ILE A 1 51 ? 1.612   -10.697 -6.450  1.00 0.00 ? 51 ILE A CD1  3  
ATOM 2984  H H    . ILE A 1 51 ? 3.106   -9.073  -9.580  1.00 0.00 ? 51 ILE A H    3  
ATOM 2985  H HA   . ILE A 1 51 ? 2.620   -6.822  -7.888  1.00 0.00 ? 51 ILE A HA   3  
ATOM 2986  H HB   . ILE A 1 51 ? 3.944   -9.400  -7.065  1.00 0.00 ? 51 ILE A HB   3  
ATOM 2987  H HG12 . ILE A 1 51 ? 0.977   -8.828  -7.197  1.00 0.00 ? 51 ILE A HG12 3  
ATOM 2988  H HG13 . ILE A 1 51 ? 1.850   -9.822  -8.358  1.00 0.00 ? 51 ILE A HG13 3  
ATOM 2989  H HG21 . ILE A 1 51 ? 2.288   -8.624  -5.049  1.00 0.00 ? 51 ILE A HG21 3  
ATOM 2990  H HG22 . ILE A 1 51 ? 4.009   -8.255  -5.138  1.00 0.00 ? 51 ILE A HG22 3  
ATOM 2991  H HG23 . ILE A 1 51 ? 2.825   -7.070  -5.688  1.00 0.00 ? 51 ILE A HG23 3  
ATOM 2992  H HD11 . ILE A 1 51 ? 1.982   -11.577 -6.954  1.00 0.00 ? 51 ILE A HD11 3  
ATOM 2993  H HD12 . ILE A 1 51 ? 2.144   -10.562 -5.521  1.00 0.00 ? 51 ILE A HD12 3  
ATOM 2994  H HD13 . ILE A 1 51 ? 0.558   -10.816 -6.247  1.00 0.00 ? 51 ILE A HD13 3  
ATOM 2995  N N    . VAL A 1 52 ? 5.691   -7.601  -8.648  1.00 0.00 ? 52 VAL A N    3  
ATOM 2996  C CA   . VAL A 1 52 ? 7.077   -7.152  -8.583  1.00 0.00 ? 52 VAL A CA   3  
ATOM 2997  C C    . VAL A 1 52 ? 7.226   -5.745  -9.150  1.00 0.00 ? 52 VAL A C    3  
ATOM 2998  O O    . VAL A 1 52 ? 7.709   -4.839  -8.471  1.00 0.00 ? 52 VAL A O    3  
ATOM 2999  C CB   . VAL A 1 52 ? 8.012   -8.106  -9.350  1.00 0.00 ? 52 VAL A CB   3  
ATOM 3000  C CG1  . VAL A 1 52 ? 9.388   -7.481  -9.521  1.00 0.00 ? 52 VAL A CG1  3  
ATOM 3001  C CG2  . VAL A 1 52 ? 8.110   -9.445  -8.635  1.00 0.00 ? 52 VAL A CG2  3  
ATOM 3002  H H    . VAL A 1 52 ? 5.452   -8.327  -9.261  1.00 0.00 ? 52 VAL A H    3  
ATOM 3003  H HA   . VAL A 1 52 ? 7.377   -7.146  -7.545  1.00 0.00 ? 52 VAL A HA   3  
ATOM 3004  H HB   . VAL A 1 52 ? 7.593   -8.275  -10.331 1.00 0.00 ? 52 VAL A HB   3  
ATOM 3005  H HG11 . VAL A 1 52 ? 9.997   -8.119  -10.145 1.00 0.00 ? 52 VAL A HG11 3  
ATOM 3006  H HG12 . VAL A 1 52 ? 9.288   -6.511  -9.985  1.00 0.00 ? 52 VAL A HG12 3  
ATOM 3007  H HG13 . VAL A 1 52 ? 9.856   -7.372  -8.554  1.00 0.00 ? 52 VAL A HG13 3  
ATOM 3008  H HG21 . VAL A 1 52 ? 8.161   -9.280  -7.569  1.00 0.00 ? 52 VAL A HG21 3  
ATOM 3009  H HG22 . VAL A 1 52 ? 7.239   -10.042 -8.866  1.00 0.00 ? 52 VAL A HG22 3  
ATOM 3010  H HG23 . VAL A 1 52 ? 8.998   -9.964  -8.963  1.00 0.00 ? 52 VAL A HG23 3  
ATOM 3011  N N    . VAL A 1 53 ? 6.808   -5.569  -10.400 1.00 0.00 ? 53 VAL A N    3  
ATOM 3012  C CA   . VAL A 1 53 ? 6.894   -4.272  -11.059 1.00 0.00 ? 53 VAL A CA   3  
ATOM 3013  C C    . VAL A 1 53 ? 6.244   -3.182  -10.214 1.00 0.00 ? 53 VAL A C    3  
ATOM 3014  O O    . VAL A 1 53 ? 6.736   -2.056  -10.150 1.00 0.00 ? 53 VAL A O    3  
ATOM 3015  C CB   . VAL A 1 53 ? 6.222   -4.301  -12.445 1.00 0.00 ? 53 VAL A CB   3  
ATOM 3016  C CG1  . VAL A 1 53 ? 6.236   -2.916  -13.074 1.00 0.00 ? 53 VAL A CG1  3  
ATOM 3017  C CG2  . VAL A 1 53 ? 6.909   -5.314  -13.348 1.00 0.00 ? 53 VAL A CG2  3  
ATOM 3018  H H    . VAL A 1 53 ? 6.433   -6.331  -10.889 1.00 0.00 ? 53 VAL A H    3  
ATOM 3019  H HA   . VAL A 1 53 ? 7.939   -4.034  -11.194 1.00 0.00 ? 53 VAL A HA   3  
ATOM 3020  H HB   . VAL A 1 53 ? 5.193   -4.603  -12.317 1.00 0.00 ? 53 VAL A HB   3  
ATOM 3021  H HG11 . VAL A 1 53 ? 6.439   -3.004  -14.132 1.00 0.00 ? 53 VAL A HG11 3  
ATOM 3022  H HG12 . VAL A 1 53 ? 5.276   -2.445  -12.929 1.00 0.00 ? 53 VAL A HG12 3  
ATOM 3023  H HG13 . VAL A 1 53 ? 7.006   -2.318  -12.609 1.00 0.00 ? 53 VAL A HG13 3  
ATOM 3024  H HG21 . VAL A 1 53 ? 7.950   -5.394  -13.072 1.00 0.00 ? 53 VAL A HG21 3  
ATOM 3025  H HG22 . VAL A 1 53 ? 6.432   -6.277  -13.238 1.00 0.00 ? 53 VAL A HG22 3  
ATOM 3026  H HG23 . VAL A 1 53 ? 6.832   -4.990  -14.376 1.00 0.00 ? 53 VAL A HG23 3  
ATOM 3027  N N    . TRP A 1 54 ? 5.137   -3.525  -9.566  1.00 0.00 ? 54 TRP A N    3  
ATOM 3028  C CA   . TRP A 1 54 ? 4.419   -2.575  -8.723  1.00 0.00 ? 54 TRP A CA   3  
ATOM 3029  C C    . TRP A 1 54 ? 5.229   -2.233  -7.478  1.00 0.00 ? 54 TRP A C    3  
ATOM 3030  O O    . TRP A 1 54 ? 5.356   -1.065  -7.110  1.00 0.00 ? 54 TRP A O    3  
ATOM 3031  C CB   . TRP A 1 54 ? 3.058   -3.146  -8.321  1.00 0.00 ? 54 TRP A CB   3  
ATOM 3032  C CG   . TRP A 1 54 ? 2.217   -2.182  -7.540  1.00 0.00 ? 54 TRP A CG   3  
ATOM 3033  C CD1  . TRP A 1 54 ? 1.155   -1.460  -8.002  1.00 0.00 ? 54 TRP A CD1  3  
ATOM 3034  C CD2  . TRP A 1 54 ? 2.371   -1.835  -6.159  1.00 0.00 ? 54 TRP A CD2  3  
ATOM 3035  N NE1  . TRP A 1 54 ? 0.638   -0.684  -6.992  1.00 0.00 ? 54 TRP A NE1  3  
ATOM 3036  C CE2  . TRP A 1 54 ? 1.366   -0.897  -5.852  1.00 0.00 ? 54 TRP A CE2  3  
ATOM 3037  C CE3  . TRP A 1 54 ? 3.258   -2.226  -5.153  1.00 0.00 ? 54 TRP A CE3  3  
ATOM 3038  C CZ2  . TRP A 1 54 ? 1.227   -0.345  -4.581  1.00 0.00 ? 54 TRP A CZ2  3  
ATOM 3039  C CZ3  . TRP A 1 54 ? 3.119   -1.677  -3.892  1.00 0.00 ? 54 TRP A CZ3  3  
ATOM 3040  C CH2  . TRP A 1 54 ? 2.110   -0.746  -3.615  1.00 0.00 ? 54 TRP A CH2  3  
ATOM 3041  H H    . TRP A 1 54 ? 4.793   -4.439  -9.656  1.00 0.00 ? 54 TRP A H    3  
ATOM 3042  H HA   . TRP A 1 54 ? 4.266   -1.674  -9.298  1.00 0.00 ? 54 TRP A HA   3  
ATOM 3043  H HB2  . TRP A 1 54 ? 2.512   -3.419  -9.211  1.00 0.00 ? 54 TRP A HB2  3  
ATOM 3044  H HB3  . TRP A 1 54 ? 3.211   -4.026  -7.713  1.00 0.00 ? 54 TRP A HB3  3  
ATOM 3045  H HD1  . TRP A 1 54 ? 0.787   -1.501  -9.016  1.00 0.00 ? 54 TRP A HD1  3  
ATOM 3046  H HE1  . TRP A 1 54 ? -0.128  -0.079  -7.076  1.00 0.00 ? 54 TRP A HE1  3  
ATOM 3047  H HE3  . TRP A 1 54 ? 4.043   -2.942  -5.347  1.00 0.00 ? 54 TRP A HE3  3  
ATOM 3048  H HZ2  . TRP A 1 54 ? 0.454   0.373   -4.351  1.00 0.00 ? 54 TRP A HZ2  3  
ATOM 3049  H HZ3  . TRP A 1 54 ? 3.796   -1.967  -3.102  1.00 0.00 ? 54 TRP A HZ3  3  
ATOM 3050  H HH2  . TRP A 1 54 ? 2.038   -0.343  -2.616  1.00 0.00 ? 54 TRP A HH2  3  
ATOM 3051  N N    . PHE A 1 55 ? 5.775   -3.258  -6.832  1.00 0.00 ? 55 PHE A N    3  
ATOM 3052  C CA   . PHE A 1 55 ? 6.573   -3.064  -5.626  1.00 0.00 ? 55 PHE A CA   3  
ATOM 3053  C C    . PHE A 1 55 ? 7.840   -2.272  -5.934  1.00 0.00 ? 55 PHE A C    3  
ATOM 3054  O O    . PHE A 1 55 ? 8.228   -1.384  -5.175  1.00 0.00 ? 55 PHE A O    3  
ATOM 3055  C CB   . PHE A 1 55 ? 6.939   -4.415  -5.010  1.00 0.00 ? 55 PHE A CB   3  
ATOM 3056  C CG   . PHE A 1 55 ? 5.939   -4.906  -4.002  1.00 0.00 ? 55 PHE A CG   3  
ATOM 3057  C CD1  . PHE A 1 55 ? 4.618   -5.117  -4.364  1.00 0.00 ? 55 PHE A CD1  3  
ATOM 3058  C CD2  . PHE A 1 55 ? 6.319   -5.154  -2.693  1.00 0.00 ? 55 PHE A CD2  3  
ATOM 3059  C CE1  . PHE A 1 55 ? 3.695   -5.569  -3.440  1.00 0.00 ? 55 PHE A CE1  3  
ATOM 3060  C CE2  . PHE A 1 55 ? 5.400   -5.606  -1.765  1.00 0.00 ? 55 PHE A CE2  3  
ATOM 3061  C CZ   . PHE A 1 55 ? 4.087   -5.813  -2.138  1.00 0.00 ? 55 PHE A CZ   3  
ATOM 3062  H H    . PHE A 1 55 ? 5.638   -4.166  -7.174  1.00 0.00 ? 55 PHE A H    3  
ATOM 3063  H HA   . PHE A 1 55 ? 5.976   -2.506  -4.921  1.00 0.00 ? 55 PHE A HA   3  
ATOM 3064  H HB2  . PHE A 1 55 ? 7.009   -5.154  -5.794  1.00 0.00 ? 55 PHE A HB2  3  
ATOM 3065  H HB3  . PHE A 1 55 ? 7.895   -4.330  -4.515  1.00 0.00 ? 55 PHE A HB3  3  
ATOM 3066  H HD1  . PHE A 1 55 ? 4.311   -4.927  -5.383  1.00 0.00 ? 55 PHE A HD1  3  
ATOM 3067  H HD2  . PHE A 1 55 ? 7.346   -4.992  -2.399  1.00 0.00 ? 55 PHE A HD2  3  
ATOM 3068  H HE1  . PHE A 1 55 ? 2.669   -5.729  -3.735  1.00 0.00 ? 55 PHE A HE1  3  
ATOM 3069  H HE2  . PHE A 1 55 ? 5.709   -5.796  -0.747  1.00 0.00 ? 55 PHE A HE2  3  
ATOM 3070  H HZ   . PHE A 1 55 ? 3.367   -6.166  -1.415  1.00 0.00 ? 55 PHE A HZ   3  
ATOM 3071  N N    . GLN A 1 56 ? 8.480   -2.601  -7.051  1.00 0.00 ? 56 GLN A N    3  
ATOM 3072  C CA   . GLN A 1 56 ? 9.704   -1.922  -7.458  1.00 0.00 ? 56 GLN A CA   3  
ATOM 3073  C C    . GLN A 1 56 ? 9.493   -0.413  -7.524  1.00 0.00 ? 56 GLN A C    3  
ATOM 3074  O O    . GLN A 1 56 ? 10.235  0.354   -6.912  1.00 0.00 ? 56 GLN A O    3  
ATOM 3075  C CB   . GLN A 1 56 ? 10.174  -2.443  -8.818  1.00 0.00 ? 56 GLN A CB   3  
ATOM 3076  C CG   . GLN A 1 56 ? 10.976  -3.731  -8.732  1.00 0.00 ? 56 GLN A CG   3  
ATOM 3077  C CD   . GLN A 1 56 ? 11.993  -3.861  -9.848  1.00 0.00 ? 56 GLN A CD   3  
ATOM 3078  O OE1  . GLN A 1 56 ? 13.118  -3.373  -9.738  1.00 0.00 ? 56 GLN A OE1  3  
ATOM 3079  N NE2  . GLN A 1 56 ? 11.602  -4.522  -10.932 1.00 0.00 ? 56 GLN A NE2  3  
ATOM 3080  H H    . GLN A 1 56 ? 8.121   -3.318  -7.614  1.00 0.00 ? 56 GLN A H    3  
ATOM 3081  H HA   . GLN A 1 56 ? 10.463  -2.135  -6.720  1.00 0.00 ? 56 GLN A HA   3  
ATOM 3082  H HB2  . GLN A 1 56 ? 9.309   -2.623  -9.439  1.00 0.00 ? 56 GLN A HB2  3  
ATOM 3083  H HB3  . GLN A 1 56 ? 10.792  -1.690  -9.285  1.00 0.00 ? 56 GLN A HB3  3  
ATOM 3084  H HG2  . GLN A 1 56 ? 11.498  -3.753  -7.787  1.00 0.00 ? 56 GLN A HG2  3  
ATOM 3085  H HG3  . GLN A 1 56 ? 10.295  -4.568  -8.785  1.00 0.00 ? 56 GLN A HG3  3  
ATOM 3086  H HE21 . GLN A 1 56 ? 10.691  -4.882  -10.950 1.00 0.00 ? 56 GLN A HE21 3  
ATOM 3087  H HE22 . GLN A 1 56 ? 12.239  -4.620  -11.669 1.00 0.00 ? 56 GLN A HE22 3  
ATOM 3088  N N    . ASN A 1 57 ? 8.476   0.005   -8.271  1.00 0.00 ? 57 ASN A N    3  
ATOM 3089  C CA   . ASN A 1 57 ? 8.168   1.423   -8.417  1.00 0.00 ? 57 ASN A CA   3  
ATOM 3090  C C    . ASN A 1 57 ? 7.855   2.055   -7.064  1.00 0.00 ? 57 ASN A C    3  
ATOM 3091  O O    . ASN A 1 57 ? 8.465   3.051   -6.677  1.00 0.00 ? 57 ASN A O    3  
ATOM 3092  C CB   . ASN A 1 57 ? 6.985   1.614   -9.367  1.00 0.00 ? 57 ASN A CB   3  
ATOM 3093  C CG   . ASN A 1 57 ? 7.395   1.536   -10.825 1.00 0.00 ? 57 ASN A CG   3  
ATOM 3094  O OD1  . ASN A 1 57 ? 7.665   2.555   -11.461 1.00 0.00 ? 57 ASN A OD1  3  
ATOM 3095  N ND2  . ASN A 1 57 ? 7.443   0.322   -11.362 1.00 0.00 ? 57 ASN A ND2  3  
ATOM 3096  H H    . ASN A 1 57 ? 7.920   -0.655  -8.735  1.00 0.00 ? 57 ASN A H    3  
ATOM 3097  H HA   . ASN A 1 57 ? 9.037   1.910   -8.836  1.00 0.00 ? 57 ASN A HA   3  
ATOM 3098  H HB2  . ASN A 1 57 ? 6.251   0.843   -9.178  1.00 0.00 ? 57 ASN A HB2  3  
ATOM 3099  H HB3  . ASN A 1 57 ? 6.539   2.581   -9.189  1.00 0.00 ? 57 ASN A HB3  3  
ATOM 3100  H HD21 . ASN A 1 57 ? 7.214   -0.444  -10.796 1.00 0.00 ? 57 ASN A HD21 3  
ATOM 3101  H HD22 . ASN A 1 57 ? 7.706   0.243   -12.303 1.00 0.00 ? 57 ASN A HD22 3  
ATOM 3102  N N    . ALA A 1 58 ? 6.901   1.467   -6.350  1.00 0.00 ? 58 ALA A N    3  
ATOM 3103  C CA   . ALA A 1 58 ? 6.509   1.970   -5.039  1.00 0.00 ? 58 ALA A CA   3  
ATOM 3104  C C    . ALA A 1 58 ? 7.731   2.342   -4.205  1.00 0.00 ? 58 ALA A C    3  
ATOM 3105  O O    . ALA A 1 58 ? 7.639   3.143   -3.275  1.00 0.00 ? 58 ALA A O    3  
ATOM 3106  C CB   . ALA A 1 58 ? 5.664   0.936   -4.308  1.00 0.00 ? 58 ALA A CB   3  
ATOM 3107  H H    . ALA A 1 58 ? 6.452   0.676   -6.712  1.00 0.00 ? 58 ALA A H    3  
ATOM 3108  H HA   . ALA A 1 58 ? 5.905   2.853   -5.187  1.00 0.00 ? 58 ALA A HA   3  
ATOM 3109  H HB1  . ALA A 1 58 ? 5.547   1.233   -3.276  1.00 0.00 ? 58 ALA A HB1  3  
ATOM 3110  H HB2  . ALA A 1 58 ? 4.693   0.870   -4.776  1.00 0.00 ? 58 ALA A HB2  3  
ATOM 3111  H HB3  . ALA A 1 58 ? 6.153   -0.025  -4.354  1.00 0.00 ? 58 ALA A HB3  3  
ATOM 3112  N N    . ARG A 1 59 ? 8.874   1.754   -4.544  1.00 0.00 ? 59 ARG A N    3  
ATOM 3113  C CA   . ARG A 1 59 ? 10.113  2.023   -3.826  1.00 0.00 ? 59 ARG A CA   3  
ATOM 3114  C C    . ARG A 1 59 ? 10.850  3.211   -4.437  1.00 0.00 ? 59 ARG A C    3  
ATOM 3115  O O    . ARG A 1 59 ? 11.432  4.026   -3.722  1.00 0.00 ? 59 ARG A O    3  
ATOM 3116  C CB   . ARG A 1 59 ? 11.015  0.787   -3.842  1.00 0.00 ? 59 ARG A CB   3  
ATOM 3117  C CG   . ARG A 1 59 ? 10.492  -0.360  -2.994  1.00 0.00 ? 59 ARG A CG   3  
ATOM 3118  C CD   . ARG A 1 59 ? 11.586  -1.370  -2.687  1.00 0.00 ? 59 ARG A CD   3  
ATOM 3119  N NE   . ARG A 1 59 ? 11.750  -2.344  -3.763  1.00 0.00 ? 59 ARG A NE   3  
ATOM 3120  C CZ   . ARG A 1 59 ? 12.499  -2.130  -4.840  1.00 0.00 ? 59 ARG A CZ   3  
ATOM 3121  N NH1  . ARG A 1 59 ? 13.148  -0.983  -4.983  1.00 0.00 ? 59 ARG A NH1  3  
ATOM 3122  N NH2  . ARG A 1 59 ? 12.599  -3.065  -5.776  1.00 0.00 ? 59 ARG A NH2  3  
ATOM 3123  H H    . ARG A 1 59 ? 8.884   1.124   -5.295  1.00 0.00 ? 59 ARG A H    3  
ATOM 3124  H HA   . ARG A 1 59 ? 9.860   2.259   -2.803  1.00 0.00 ? 59 ARG A HA   3  
ATOM 3125  H HB2  . ARG A 1 59 ? 11.111  0.439   -4.860  1.00 0.00 ? 59 ARG A HB2  3  
ATOM 3126  H HB3  . ARG A 1 59 ? 11.991  1.064   -3.472  1.00 0.00 ? 59 ARG A HB3  3  
ATOM 3127  H HG2  . ARG A 1 59 ? 10.111  0.035   -2.064  1.00 0.00 ? 59 ARG A HG2  3  
ATOM 3128  H HG3  . ARG A 1 59 ? 9.696   -0.856  -3.530  1.00 0.00 ? 59 ARG A HG3  3  
ATOM 3129  H HD2  . ARG A 1 59 ? 12.517  -0.841  -2.548  1.00 0.00 ? 59 ARG A HD2  3  
ATOM 3130  H HD3  . ARG A 1 59 ? 11.330  -1.893  -1.777  1.00 0.00 ? 59 ARG A HD3  3  
ATOM 3131  H HE   . ARG A 1 59 ? 11.279  -3.199  -3.678  1.00 0.00 ? 59 ARG A HE   3  
ATOM 3132  H HH11 . ARG A 1 59 ? 13.075  -0.277  -4.278  1.00 0.00 ? 59 ARG A HH11 3  
ATOM 3133  H HH12 . ARG A 1 59 ? 13.712  -0.825  -5.794  1.00 0.00 ? 59 ARG A HH12 3  
ATOM 3134  H HH21 . ARG A 1 59 ? 12.111  -3.931  -5.672  1.00 0.00 ? 59 ARG A HH21 3  
ATOM 3135  H HH22 . ARG A 1 59 ? 13.162  -2.903  -6.586  1.00 0.00 ? 59 ARG A HH22 3  
ATOM 3136  N N    . GLN A 1 60 ? 10.819  3.302   -5.763  1.00 0.00 ? 60 GLN A N    3  
ATOM 3137  C CA   . GLN A 1 60 ? 11.484  4.390   -6.469  1.00 0.00 ? 60 GLN A CA   3  
ATOM 3138  C C    . GLN A 1 60 ? 10.775  5.717   -6.217  1.00 0.00 ? 60 GLN A C    3  
ATOM 3139  O O    . GLN A 1 60 ? 11.405  6.774   -6.190  1.00 0.00 ? 60 GLN A O    3  
ATOM 3140  C CB   . GLN A 1 60 ? 11.529  4.100   -7.970  1.00 0.00 ? 60 GLN A CB   3  
ATOM 3141  C CG   . GLN A 1 60 ? 10.287  4.561   -8.716  1.00 0.00 ? 60 GLN A CG   3  
ATOM 3142  C CD   . GLN A 1 60 ? 10.445  4.472   -10.222 1.00 0.00 ? 60 GLN A CD   3  
ATOM 3143  O OE1  . GLN A 1 60 ? 10.242  5.454   -10.937 1.00 0.00 ? 60 GLN A OE1  3  
ATOM 3144  N NE2  . GLN A 1 60 ? 10.808  3.293   -10.711 1.00 0.00 ? 60 GLN A NE2  3  
ATOM 3145  H H    . GLN A 1 60 ? 10.338  2.621   -6.277  1.00 0.00 ? 60 GLN A H    3  
ATOM 3146  H HA   . GLN A 1 60 ? 12.494  4.459   -6.095  1.00 0.00 ? 60 GLN A HA   3  
ATOM 3147  H HB2  . GLN A 1 60 ? 12.386  4.600   -8.396  1.00 0.00 ? 60 GLN A HB2  3  
ATOM 3148  H HB3  . GLN A 1 60 ? 11.635  3.035   -8.115  1.00 0.00 ? 60 GLN A HB3  3  
ATOM 3149  H HG2  . GLN A 1 60 ? 9.454   3.941   -8.421  1.00 0.00 ? 60 GLN A HG2  3  
ATOM 3150  H HG3  . GLN A 1 60 ? 10.083  5.587   -8.450  1.00 0.00 ? 60 GLN A HG3  3  
ATOM 3151  H HE21 . GLN A 1 60 ? 10.951  2.555   -10.081 1.00 0.00 ? 60 GLN A HE21 3  
ATOM 3152  H HE22 . GLN A 1 60 ? 10.917  3.207   -11.680 1.00 0.00 ? 60 GLN A HE22 3  
ATOM 3153  N N    . LYS A 1 61 ? 9.461   5.654   -6.033  1.00 0.00 ? 61 LYS A N    3  
ATOM 3154  C CA   . LYS A 1 61 ? 8.665   6.850   -5.782  1.00 0.00 ? 61 LYS A CA   3  
ATOM 3155  C C    . LYS A 1 61 ? 8.823   7.316   -4.338  1.00 0.00 ? 61 LYS A C    3  
ATOM 3156  O O    . LYS A 1 61 ? 8.726   8.507   -4.047  1.00 0.00 ? 61 LYS A O    3  
ATOM 3157  C CB   . LYS A 1 61 ? 7.189   6.577   -6.082  1.00 0.00 ? 61 LYS A CB   3  
ATOM 3158  C CG   . LYS A 1 61 ? 6.497   5.740   -5.021  1.00 0.00 ? 61 LYS A CG   3  
ATOM 3159  C CD   . LYS A 1 61 ? 5.000   5.997   -4.997  1.00 0.00 ? 61 LYS A CD   3  
ATOM 3160  C CE   . LYS A 1 61 ? 4.228   4.760   -4.564  1.00 0.00 ? 61 LYS A CE   3  
ATOM 3161  N NZ   . LYS A 1 61 ? 3.840   3.914   -5.726  1.00 0.00 ? 61 LYS A NZ   3  
ATOM 3162  H H    . LYS A 1 61 ? 9.015   4.781   -6.066  1.00 0.00 ? 61 LYS A H    3  
ATOM 3163  H HA   . LYS A 1 61 ? 9.020   7.629   -6.440  1.00 0.00 ? 61 LYS A HA   3  
ATOM 3164  H HB2  . LYS A 1 61 ? 6.670   7.521   -6.162  1.00 0.00 ? 61 LYS A HB2  3  
ATOM 3165  H HB3  . LYS A 1 61 ? 7.117   6.056   -7.026  1.00 0.00 ? 61 LYS A HB3  3  
ATOM 3166  H HG2  . LYS A 1 61 ? 6.668   4.695   -5.231  1.00 0.00 ? 61 LYS A HG2  3  
ATOM 3167  H HG3  . LYS A 1 61 ? 6.911   5.988   -4.054  1.00 0.00 ? 61 LYS A HG3  3  
ATOM 3168  H HD2  . LYS A 1 61 ? 4.791   6.798   -4.303  1.00 0.00 ? 61 LYS A HD2  3  
ATOM 3169  H HD3  . LYS A 1 61 ? 4.676   6.284   -5.988  1.00 0.00 ? 61 LYS A HD3  3  
ATOM 3170  H HE2  . LYS A 1 61 ? 4.849   4.180   -3.899  1.00 0.00 ? 61 LYS A HE2  3  
ATOM 3171  H HE3  . LYS A 1 61 ? 3.336   5.072   -4.043  1.00 0.00 ? 61 LYS A HE3  3  
ATOM 3172  H HZ1  . LYS A 1 61 ? 3.459   3.005   -5.394  1.00 0.00 ? 61 LYS A HZ1  3  
ATOM 3173  H HZ2  . LYS A 1 61 ? 4.668   3.730   -6.327  1.00 0.00 ? 61 LYS A HZ2  3  
ATOM 3174  H HZ3  . LYS A 1 61 ? 3.114   4.396   -6.293  1.00 0.00 ? 61 LYS A HZ3  3  
ATOM 3175  N N    . ALA A 1 62 ? 9.069   6.368   -3.439  1.00 0.00 ? 62 ALA A N    3  
ATOM 3176  C CA   . ALA A 1 62 ? 9.244   6.682   -2.027  1.00 0.00 ? 62 ALA A CA   3  
ATOM 3177  C C    . ALA A 1 62 ? 10.374  7.686   -1.824  1.00 0.00 ? 62 ALA A C    3  
ATOM 3178  O O    . ALA A 1 62 ? 10.290  8.565   -0.966  1.00 0.00 ? 62 ALA A O    3  
ATOM 3179  C CB   . ALA A 1 62 ? 9.514   5.413   -1.233  1.00 0.00 ? 62 ALA A CB   3  
ATOM 3180  H H    . ALA A 1 62 ? 9.135   5.436   -3.733  1.00 0.00 ? 62 ALA A H    3  
ATOM 3181  H HA   . ALA A 1 62 ? 8.322   7.115   -1.664  1.00 0.00 ? 62 ALA A HA   3  
ATOM 3182  H HB1  . ALA A 1 62 ? 10.020  5.666   -0.313  1.00 0.00 ? 62 ALA A HB1  3  
ATOM 3183  H HB2  . ALA A 1 62 ? 8.578   4.923   -1.008  1.00 0.00 ? 62 ALA A HB2  3  
ATOM 3184  H HB3  . ALA A 1 62 ? 10.136  4.750   -1.816  1.00 0.00 ? 62 ALA A HB3  3  
ATOM 3185  N N    . ARG A 1 63 ? 11.431  7.549   -2.618  1.00 0.00 ? 63 ARG A N    3  
ATOM 3186  C CA   . ARG A 1 63 ? 12.578  8.443   -2.524  1.00 0.00 ? 63 ARG A CA   3  
ATOM 3187  C C    . ARG A 1 63 ? 12.137  9.857   -2.157  1.00 0.00 ? 63 ARG A C    3  
ATOM 3188  O O    . ARG A 1 63 ? 11.237  10.420  -2.779  1.00 0.00 ? 63 ARG A O    3  
ATOM 3189  C CB   . ARG A 1 63 ? 13.346  8.464   -3.847  1.00 0.00 ? 63 ARG A CB   3  
ATOM 3190  C CG   . ARG A 1 63 ? 14.132  7.191   -4.115  1.00 0.00 ? 63 ARG A CG   3  
ATOM 3191  C CD   . ARG A 1 63 ? 14.833  7.244   -5.463  1.00 0.00 ? 63 ARG A CD   3  
ATOM 3192  N NE   . ARG A 1 63 ? 16.174  7.814   -5.362  1.00 0.00 ? 63 ARG A NE   3  
ATOM 3193  C CZ   . ARG A 1 63 ? 17.251  7.106   -5.036  1.00 0.00 ? 63 ARG A CZ   3  
ATOM 3194  N NH1  . ARG A 1 63 ? 17.144  5.809   -4.783  1.00 0.00 ? 63 ARG A NH1  3  
ATOM 3195  N NH2  . ARG A 1 63 ? 18.437  7.697   -4.964  1.00 0.00 ? 63 ARG A NH2  3  
ATOM 3196  H H    . ARG A 1 63 ? 11.439  6.829   -3.283  1.00 0.00 ? 63 ARG A H    3  
ATOM 3197  H HA   . ARG A 1 63 ? 13.228  8.068   -1.747  1.00 0.00 ? 63 ARG A HA   3  
ATOM 3198  H HB2  . ARG A 1 63 ? 12.643  8.603   -4.655  1.00 0.00 ? 63 ARG A HB2  3  
ATOM 3199  H HB3  . ARG A 1 63 ? 14.037  9.293   -3.835  1.00 0.00 ? 63 ARG A HB3  3  
ATOM 3200  H HG2  . ARG A 1 63 ? 14.875  7.068   -3.340  1.00 0.00 ? 63 ARG A HG2  3  
ATOM 3201  H HG3  . ARG A 1 63 ? 13.454  6.351   -4.103  1.00 0.00 ? 63 ARG A HG3  3  
ATOM 3202  H HD2  . ARG A 1 63 ? 14.908  6.240   -5.854  1.00 0.00 ? 63 ARG A HD2  3  
ATOM 3203  H HD3  . ARG A 1 63 ? 14.245  7.849   -6.137  1.00 0.00 ? 63 ARG A HD3  3  
ATOM 3204  H HE   . ARG A 1 63 ? 16.276  8.770   -5.545  1.00 0.00 ? 63 ARG A HE   3  
ATOM 3205  H HH11 . ARG A 1 63 ? 16.252  5.362   -4.837  1.00 0.00 ? 63 ARG A HH11 3  
ATOM 3206  H HH12 . ARG A 1 63 ? 17.956  5.279   -4.539  1.00 0.00 ? 63 ARG A HH12 3  
ATOM 3207  H HH21 . ARG A 1 63 ? 18.521  8.674   -5.155  1.00 0.00 ? 63 ARG A HH21 3  
ATOM 3208  H HH22 . ARG A 1 63 ? 19.246  7.164   -4.719  1.00 0.00 ? 63 ARG A HH22 3  
ATOM 3209  N N    . LYS A 1 64 ? 12.778  10.426  -1.141  1.00 0.00 ? 64 LYS A N    3  
ATOM 3210  C CA   . LYS A 1 64 ? 12.454  11.774  -0.690  1.00 0.00 ? 64 LYS A CA   3  
ATOM 3211  C C    . LYS A 1 64 ? 13.362  12.803  -1.356  1.00 0.00 ? 64 LYS A C    3  
ATOM 3212  O O    . LYS A 1 64 ? 14.551  12.559  -1.555  1.00 0.00 ? 64 LYS A O    3  
ATOM 3213  C CB   . LYS A 1 64 ? 12.585  11.871  0.832   1.00 0.00 ? 64 LYS A CB   3  
ATOM 3214  C CG   . LYS A 1 64 ? 13.870  11.265  1.371   1.00 0.00 ? 64 LYS A CG   3  
ATOM 3215  C CD   . LYS A 1 64 ? 13.695  9.793   1.706   1.00 0.00 ? 64 LYS A CD   3  
ATOM 3216  C CE   . LYS A 1 64 ? 14.995  9.023   1.532   1.00 0.00 ? 64 LYS A CE   3  
ATOM 3217  N NZ   . LYS A 1 64 ? 15.853  9.102   2.747   1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3218  H H    . LYS A 1 64 ? 13.488  9.927   -0.684  1.00 0.00 ? 64 LYS A H    3  
ATOM 3219  H HA   . LYS A 1 64 ? 11.431  11.980  -0.968  1.00 0.00 ? 64 LYS A HA   3  
ATOM 3220  H HB2  . LYS A 1 64 ? 12.554  12.911  1.118   1.00 0.00 ? 64 LYS A HB2  3  
ATOM 3221  H HB3  . LYS A 1 64 ? 11.751  11.356  1.286   1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3222  H HG2  . LYS A 1 64 ? 14.644  11.363  0.625   1.00 0.00 ? 64 LYS A HG2  3  
ATOM 3223  H HG3  . LYS A 1 64 ? 14.160  11.797  2.266   1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3224  H HD2  . LYS A 1 64 ? 13.371  9.703   2.733   1.00 0.00 ? 64 LYS A HD2  3  
ATOM 3225  H HD3  . LYS A 1 64 ? 12.945  9.371   1.052   1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3226  H HE2  . LYS A 1 64 ? 14.761  7.989   1.333   1.00 0.00 ? 64 LYS A HE2  3  
ATOM 3227  H HE3  . LYS A 1 64 ? 15.534  9.438   0.693   1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3228  H HZ1  . LYS A 1 64 ? 15.271  9.313   3.582   1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3229  H HZ2  . LYS A 1 64 ? 16.563  9.854   2.634   1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3230  H HZ3  . LYS A 1 64 ? 16.342  8.197   2.898   1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3231  N N    . SER A 1 65 ? 12.793  13.956  -1.695  1.00 0.00 ? 65 SER A N    3  
ATOM 3232  C CA   . SER A 1 65 ? 13.551  15.021  -2.340  1.00 0.00 ? 65 SER A CA   3  
ATOM 3233  C C    . SER A 1 65 ? 13.276  16.365  -1.672  1.00 0.00 ? 65 SER A C    3  
ATOM 3234  O O    . SER A 1 65 ? 12.410  17.122  -2.108  1.00 0.00 ? 65 SER A O    3  
ATOM 3235  C CB   . SER A 1 65 ? 13.200  15.097  -3.828  1.00 0.00 ? 65 SER A CB   3  
ATOM 3236  O OG   . SER A 1 65 ? 11.809  15.294  -4.014  1.00 0.00 ? 65 SER A OG   3  
ATOM 3237  H H    . SER A 1 65 ? 11.840  14.091  -1.510  1.00 0.00 ? 65 SER A H    3  
ATOM 3238  H HA   . SER A 1 65 ? 14.601  14.790  -2.238  1.00 0.00 ? 65 SER A HA   3  
ATOM 3239  H HB2  . SER A 1 65 ? 13.731  15.922  -4.278  1.00 0.00 ? 65 SER A HB2  3  
ATOM 3240  H HB3  . SER A 1 65 ? 13.490  14.175  -4.311  1.00 0.00 ? 65 SER A HB3  3  
ATOM 3241  H HG   . SER A 1 65 ? 11.435  14.531  -4.461  1.00 0.00 ? 65 SER A HG   3  
ATOM 3242  N N    . GLY A 1 66 ? 14.021  16.654  -0.609  1.00 0.00 ? 66 GLY A N    3  
ATOM 3243  C CA   . GLY A 1 66 ? 13.843  17.905  0.103   1.00 0.00 ? 66 GLY A CA   3  
ATOM 3244  C C    . GLY A 1 66 ? 14.826  18.970  -0.341  1.00 0.00 ? 66 GLY A C    3  
ATOM 3245  O O    . GLY A 1 66 ? 14.596  19.691  -1.312  1.00 0.00 ? 66 GLY A O    3  
ATOM 3246  H H    . GLY A 1 66 ? 14.697  16.012  -0.307  1.00 0.00 ? 66 GLY A H    3  
ATOM 3247  H HA2  . GLY A 1 66 ? 12.839  18.264  -0.066  1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3248  H HA3  . GLY A 1 66 ? 13.977  17.727  1.160   1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3249  N N    . PRO A 1 67 ? 15.951  19.081  0.381   1.00 0.00 ? 67 PRO A N    3  
ATOM 3250  C CA   . PRO A 1 67 ? 16.994  20.064  0.076   1.00 0.00 ? 67 PRO A CA   3  
ATOM 3251  C C    . PRO A 1 67 ? 17.739  19.737  -1.215  1.00 0.00 ? 67 PRO A C    3  
ATOM 3252  O O    . PRO A 1 67 ? 18.626  20.479  -1.636  1.00 0.00 ? 67 PRO A O    3  
ATOM 3253  C CB   . PRO A 1 67 ? 17.938  19.965  1.277   1.00 0.00 ? 67 PRO A CB   3  
ATOM 3254  C CG   . PRO A 1 67 ? 17.735  18.587  1.805   1.00 0.00 ? 67 PRO A CG   3  
ATOM 3255  C CD   . PRO A 1 67 ? 16.291  18.255  1.552   1.00 0.00 ? 67 PRO A CD   3  
ATOM 3256  H HA   . PRO A 1 67 ? 16.591  21.064  0.014   1.00 0.00 ? 67 PRO A HA   3  
ATOM 3257  H HB2  . PRO A 1 67 ? 18.957  20.118  0.951   1.00 0.00 ? 67 PRO A HB2  3  
ATOM 3258  H HB3  . PRO A 1 67 ? 17.672  20.712  2.010   1.00 0.00 ? 67 PRO A HB3  3  
ATOM 3259  H HG2  . PRO A 1 67 ? 18.377  17.895  1.282   1.00 0.00 ? 67 PRO A HG2  3  
ATOM 3260  H HG3  . PRO A 1 67 ? 17.944  18.566  2.865   1.00 0.00 ? 67 PRO A HG3  3  
ATOM 3261  H HD2  . PRO A 1 67 ? 16.179  17.204  1.328   1.00 0.00 ? 67 PRO A HD2  3  
ATOM 3262  H HD3  . PRO A 1 67 ? 15.686  18.527  2.404   1.00 0.00 ? 67 PRO A HD3  3  
ATOM 3263  N N    . SER A 1 68 ? 17.371  18.622  -1.838  1.00 0.00 ? 68 SER A N    3  
ATOM 3264  C CA   . SER A 1 68 ? 18.007  18.195  -3.079  1.00 0.00 ? 68 SER A CA   3  
ATOM 3265  C C    . SER A 1 68 ? 17.613  19.110  -4.234  1.00 0.00 ? 68 SER A C    3  
ATOM 3266  O O    . SER A 1 68 ? 16.449  19.159  -4.632  1.00 0.00 ? 68 SER A O    3  
ATOM 3267  C CB   . SER A 1 68 ? 17.622  16.751  -3.403  1.00 0.00 ? 68 SER A CB   3  
ATOM 3268  O OG   . SER A 1 68 ? 16.304  16.678  -3.920  1.00 0.00 ? 68 SER A OG   3  
ATOM 3269  H H    . SER A 1 68 ? 16.658  18.072  -1.452  1.00 0.00 ? 68 SER A H    3  
ATOM 3270  H HA   . SER A 1 68 ? 19.076  18.251  -2.940  1.00 0.00 ? 68 SER A HA   3  
ATOM 3271  H HB2  . SER A 1 68 ? 18.306  16.355  -4.139  1.00 0.00 ? 68 SER A HB2  3  
ATOM 3272  H HB3  . SER A 1 68 ? 17.677  16.155  -2.503  1.00 0.00 ? 68 SER A HB3  3  
ATOM 3273  H HG   . SER A 1 68 ? 15.871  15.890  -3.583  1.00 0.00 ? 68 SER A HG   3  
ATOM 3274  N N    . SER A 1 69 ? 18.591  19.834  -4.768  1.00 0.00 ? 69 SER A N    3  
ATOM 3275  C CA   . SER A 1 69 ? 18.347  20.752  -5.875  1.00 0.00 ? 69 SER A CA   3  
ATOM 3276  C C    . SER A 1 69 ? 17.288  20.192  -6.820  1.00 0.00 ? 69 SER A C    3  
ATOM 3277  O O    . SER A 1 69 ? 17.327  19.020  -7.190  1.00 0.00 ? 69 SER A O    3  
ATOM 3278  C CB   . SER A 1 69 ? 19.644  21.015  -6.642  1.00 0.00 ? 69 SER A CB   3  
ATOM 3279  O OG   . SER A 1 69 ? 20.554  21.771  -5.862  1.00 0.00 ? 69 SER A OG   3  
ATOM 3280  H H    . SER A 1 69 ? 19.499  19.751  -4.406  1.00 0.00 ? 69 SER A H    3  
ATOM 3281  H HA   . SER A 1 69 ? 17.988  21.682  -5.461  1.00 0.00 ? 69 SER A HA   3  
ATOM 3282  H HB2  . SER A 1 69 ? 20.105  20.074  -6.899  1.00 0.00 ? 69 SER A HB2  3  
ATOM 3283  H HB3  . SER A 1 69 ? 19.419  21.564  -7.545  1.00 0.00 ? 69 SER A HB3  3  
ATOM 3284  H HG   . SER A 1 69 ? 20.452  21.538  -4.936  1.00 0.00 ? 69 SER A HG   3  
ATOM 3285  N N    . GLY A 1 70 ? 16.342  21.042  -7.208  1.00 0.00 ? 70 GLY A N    3  
ATOM 3286  C CA   . GLY A 1 70 ? 15.285  20.616  -8.106  1.00 0.00 ? 70 GLY A CA   3  
ATOM 3287  C C    . GLY A 1 70 ? 14.223  21.681  -8.300  1.00 0.00 ? 70 GLY A C    3  
ATOM 3288  O O    . GLY A 1 70 ? 13.265  21.483  -9.047  1.00 0.00 ? 70 GLY A O    3  
ATOM 3289  H H    . GLY A 1 70 ? 16.361  21.966  -6.881  1.00 0.00 ? 70 GLY A H    3  
ATOM 3290  H HA2  . GLY A 1 70 ? 15.718  20.376  -9.066  1.00 0.00 ? 70 GLY A HA2  3  
ATOM 3291  H HA3  . GLY A 1 70 ? 14.819  19.729  -7.701  1.00 0.00 ? 70 GLY A HA3  3  
ATOM 3292  N N    . GLY A 1 1  ? 11.511  -4.163  -15.937 1.00 0.00 ? 1  GLY A N    4  
ATOM 3293  C CA   . GLY A 1 1  ? 10.857  -4.611  -17.153 1.00 0.00 ? 1  GLY A CA   4  
ATOM 3294  C C    . GLY A 1 1  ? 10.557  -3.469  -18.104 1.00 0.00 ? 1  GLY A C    4  
ATOM 3295  O O    . GLY A 1 1  ? 10.543  -2.306  -17.703 1.00 0.00 ? 1  GLY A O    4  
ATOM 3296  H H1   . GLY A 1 1  ? 12.112  -3.389  -15.963 1.00 0.00 ? 1  GLY A H1   4  
ATOM 3297  H HA2  . GLY A 1 1  ? 11.498  -5.323  -17.652 1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3298  H HA3  . GLY A 1 1  ? 9.929   -5.098  -16.891 1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3299  N N    . SER A 1 2  ? 10.317  -3.802  -19.368 1.00 0.00 ? 2  SER A N    4  
ATOM 3300  C CA   . SER A 1 2  ? 10.022  -2.796  -20.381 1.00 0.00 ? 2  SER A CA   4  
ATOM 3301  C C    . SER A 1 2  ? 8.570   -2.896  -20.839 1.00 0.00 ? 2  SER A C    4  
ATOM 3302  O O    . SER A 1 2  ? 8.108   -3.962  -21.245 1.00 0.00 ? 2  SER A O    4  
ATOM 3303  C CB   . SER A 1 2  ? 10.959  -2.956  -21.580 1.00 0.00 ? 2  SER A CB   4  
ATOM 3304  O OG   . SER A 1 2  ? 11.108  -1.733  -22.278 1.00 0.00 ? 2  SER A OG   4  
ATOM 3305  H H    . SER A 1 2  ? 10.343  -4.748  -19.627 1.00 0.00 ? 2  SER A H    4  
ATOM 3306  H HA   . SER A 1 2  ? 10.181  -1.823  -19.939 1.00 0.00 ? 2  SER A HA   4  
ATOM 3307  H HB2  . SER A 1 2  ? 11.929  -3.280  -21.234 1.00 0.00 ? 2  SER A HB2  4  
ATOM 3308  H HB3  . SER A 1 2  ? 10.552  -3.695  -22.254 1.00 0.00 ? 2  SER A HB3  4  
ATOM 3309  H HG   . SER A 1 2  ? 11.994  -1.678  -22.643 1.00 0.00 ? 2  SER A HG   4  
ATOM 3310  N N    . SER A 1 3  ? 7.856   -1.777  -20.771 1.00 0.00 ? 3  SER A N    4  
ATOM 3311  C CA   . SER A 1 3  ? 6.455   -1.738  -21.175 1.00 0.00 ? 3  SER A CA   4  
ATOM 3312  C C    . SER A 1 3  ? 6.223   -0.660  -22.229 1.00 0.00 ? 3  SER A C    4  
ATOM 3313  O O    . SER A 1 3  ? 6.925   0.350   -22.265 1.00 0.00 ? 3  SER A O    4  
ATOM 3314  C CB   . SER A 1 3  ? 5.559   -1.483  -19.961 1.00 0.00 ? 3  SER A CB   4  
ATOM 3315  O OG   . SER A 1 3  ? 5.671   -2.532  -19.015 1.00 0.00 ? 3  SER A OG   4  
ATOM 3316  H H    . SER A 1 3  ? 8.281   -0.958  -20.439 1.00 0.00 ? 3  SER A H    4  
ATOM 3317  H HA   . SER A 1 3  ? 6.206   -2.699  -21.600 1.00 0.00 ? 3  SER A HA   4  
ATOM 3318  H HB2  . SER A 1 3  ? 5.852   -0.557  -19.490 1.00 0.00 ? 3  SER A HB2  4  
ATOM 3319  H HB3  . SER A 1 3  ? 4.531   -1.413  -20.285 1.00 0.00 ? 3  SER A HB3  4  
ATOM 3320  H HG   . SER A 1 3  ? 4.833   -2.643  -18.560 1.00 0.00 ? 3  SER A HG   4  
ATOM 3321  N N    . GLY A 1 4  ? 5.231   -0.882  -23.086 1.00 0.00 ? 4  GLY A N    4  
ATOM 3322  C CA   . GLY A 1 4  ? 4.923   0.079   -24.129 1.00 0.00 ? 4  GLY A CA   4  
ATOM 3323  C C    . GLY A 1 4  ? 3.432   0.300   -24.292 1.00 0.00 ? 4  GLY A C    4  
ATOM 3324  O O    . GLY A 1 4  ? 2.634   -0.196  -23.497 1.00 0.00 ? 4  GLY A O    4  
ATOM 3325  H H    . GLY A 1 4  ? 4.704   -1.705  -23.009 1.00 0.00 ? 4  GLY A H    4  
ATOM 3326  H HA2  . GLY A 1 4  ? 5.392   1.021   -23.886 1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3327  H HA3  . GLY A 1 4  ? 5.326   -0.282  -25.065 1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3328  N N    . SER A 1 5  ? 3.056   1.048   -25.324 1.00 0.00 ? 5  SER A N    4  
ATOM 3329  C CA   . SER A 1 5  ? 1.651   1.339   -25.585 1.00 0.00 ? 5  SER A CA   4  
ATOM 3330  C C    . SER A 1 5  ? 0.974   0.165   -26.286 1.00 0.00 ? 5  SER A C    4  
ATOM 3331  O O    . SER A 1 5  ? 1.042   0.035   -27.509 1.00 0.00 ? 5  SER A O    4  
ATOM 3332  C CB   . SER A 1 5  ? 1.520   2.602   -26.439 1.00 0.00 ? 5  SER A CB   4  
ATOM 3333  O OG   . SER A 1 5  ? 1.891   3.755   -25.704 1.00 0.00 ? 5  SER A OG   4  
ATOM 3334  H H    . SER A 1 5  ? 3.740   1.415   -25.923 1.00 0.00 ? 5  SER A H    4  
ATOM 3335  H HA   . SER A 1 5  ? 1.164   1.504   -24.635 1.00 0.00 ? 5  SER A HA   4  
ATOM 3336  H HB2  . SER A 1 5  ? 2.162   2.518   -27.302 1.00 0.00 ? 5  SER A HB2  4  
ATOM 3337  H HB3  . SER A 1 5  ? 0.494   2.709   -26.761 1.00 0.00 ? 5  SER A HB3  4  
ATOM 3338  H HG   . SER A 1 5  ? 1.155   4.371   -25.681 1.00 0.00 ? 5  SER A HG   4  
ATOM 3339  N N    . SER A 1 6  ? 0.323   -0.689  -25.503 1.00 0.00 ? 6  SER A N    4  
ATOM 3340  C CA   . SER A 1 6  ? -0.363  -1.855  -26.047 1.00 0.00 ? 6  SER A CA   4  
ATOM 3341  C C    . SER A 1 6  ? -1.830  -1.868  -25.626 1.00 0.00 ? 6  SER A C    4  
ATOM 3342  O O    . SER A 1 6  ? -2.207  -2.541  -24.668 1.00 0.00 ? 6  SER A O    4  
ATOM 3343  C CB   . SER A 1 6  ? 0.324   -3.140  -25.581 1.00 0.00 ? 6  SER A CB   4  
ATOM 3344  O OG   . SER A 1 6  ? 1.444   -3.442  -26.394 1.00 0.00 ? 6  SER A OG   4  
ATOM 3345  H H    . SER A 1 6  ? 0.305   -0.531  -24.535 1.00 0.00 ? 6  SER A H    4  
ATOM 3346  H HA   . SER A 1 6  ? -0.310  -1.798  -27.124 1.00 0.00 ? 6  SER A HA   4  
ATOM 3347  H HB2  . SER A 1 6  ? 0.656   -3.019  -24.562 1.00 0.00 ? 6  SER A HB2  4  
ATOM 3348  H HB3  . SER A 1 6  ? -0.378  -3.960  -25.636 1.00 0.00 ? 6  SER A HB3  4  
ATOM 3349  H HG   . SER A 1 6  ? 1.375   -4.346  -26.712 1.00 0.00 ? 6  SER A HG   4  
ATOM 3350  N N    . GLY A 1 7  ? -2.654  -1.117  -26.352 1.00 0.00 ? 7  GLY A N    4  
ATOM 3351  C CA   . GLY A 1 7  ? -4.070  -1.055  -26.039 1.00 0.00 ? 7  GLY A CA   4  
ATOM 3352  C C    . GLY A 1 7  ? -4.545  0.360   -25.780 1.00 0.00 ? 7  GLY A C    4  
ATOM 3353  O O    . GLY A 1 7  ? -3.811  1.176   -25.221 1.00 0.00 ? 7  GLY A O    4  
ATOM 3354  H H    . GLY A 1 7  ? -2.297  -0.601  -27.105 1.00 0.00 ? 7  GLY A H    4  
ATOM 3355  H HA2  . GLY A 1 7  ? -4.628  -1.466  -26.867 1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3356  H HA3  . GLY A 1 7  ? -4.259  -1.653  -25.159 1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3357  N N    . ARG A 1 8  ? -5.775  0.654   -26.189 1.00 0.00 ? 8  ARG A N    4  
ATOM 3358  C CA   . ARG A 1 8  ? -6.346  1.982   -26.000 1.00 0.00 ? 8  ARG A CA   4  
ATOM 3359  C C    . ARG A 1 8  ? -6.631  2.247   -24.524 1.00 0.00 ? 8  ARG A C    4  
ATOM 3360  O O    . ARG A 1 8  ? -7.514  1.627   -23.932 1.00 0.00 ? 8  ARG A O    4  
ATOM 3361  C CB   . ARG A 1 8  ? -7.633  2.128   -26.814 1.00 0.00 ? 8  ARG A CB   4  
ATOM 3362  C CG   . ARG A 1 8  ? -8.186  3.543   -26.830 1.00 0.00 ? 8  ARG A CG   4  
ATOM 3363  C CD   . ARG A 1 8  ? -9.592  3.585   -27.409 1.00 0.00 ? 8  ARG A CD   4  
ATOM 3364  N NE   . ARG A 1 8  ? -10.606 3.260   -26.410 1.00 0.00 ? 8  ARG A NE   4  
ATOM 3365  C CZ   . ARG A 1 8  ? -11.080 4.137   -25.532 1.00 0.00 ? 8  ARG A CZ   4  
ATOM 3366  N NH1  . ARG A 1 8  ? -10.635 5.386   -25.531 1.00 0.00 ? 8  ARG A NH1  4  
ATOM 3367  N NH2  . ARG A 1 8  ? -12.003 3.766   -24.654 1.00 0.00 ? 8  ARG A NH2  4  
ATOM 3368  H H    . ARG A 1 8  ? -6.311  -0.038  -26.628 1.00 0.00 ? 8  ARG A H    4  
ATOM 3369  H HA   . ARG A 1 8  ? -5.625  2.706   -26.350 1.00 0.00 ? 8  ARG A HA   4  
ATOM 3370  H HB2  . ARG A 1 8  ? -7.436  1.830   -27.833 1.00 0.00 ? 8  ARG A HB2  4  
ATOM 3371  H HB3  . ARG A 1 8  ? -8.384  1.475   -26.395 1.00 0.00 ? 8  ARG A HB3  4  
ATOM 3372  H HG2  . ARG A 1 8  ? -8.215  3.921   -25.818 1.00 0.00 ? 8  ARG A HG2  4  
ATOM 3373  H HG3  . ARG A 1 8  ? -7.540  4.166   -27.430 1.00 0.00 ? 8  ARG A HG3  4  
ATOM 3374  H HD2  . ARG A 1 8  ? -9.780  4.578   -27.790 1.00 0.00 ? 8  ARG A HD2  4  
ATOM 3375  H HD3  . ARG A 1 8  ? -9.654  2.872   -28.218 1.00 0.00 ? 8  ARG A HD3  4  
ATOM 3376  H HE   . ARG A 1 8  ? -10.949 2.343   -26.393 1.00 0.00 ? 8  ARG A HE   4  
ATOM 3377  H HH11 . ARG A 1 8  ? -9.941  5.669   -26.193 1.00 0.00 ? 8  ARG A HH11 4  
ATOM 3378  H HH12 . ARG A 1 8  ? -10.995 6.045   -24.870 1.00 0.00 ? 8  ARG A HH12 4  
ATOM 3379  H HH21 . ARG A 1 8  ? -12.341 2.825   -24.652 1.00 0.00 ? 8  ARG A HH21 4  
ATOM 3380  H HH22 . ARG A 1 8  ? -12.359 4.427   -23.994 1.00 0.00 ? 8  ARG A HH22 4  
ATOM 3381  N N    . SER A 1 9  ? -5.878  3.171   -23.937 1.00 0.00 ? 9  SER A N    4  
ATOM 3382  C CA   . SER A 1 9  ? -6.047  3.514   -22.530 1.00 0.00 ? 9  SER A CA   4  
ATOM 3383  C C    . SER A 1 9  ? -6.311  2.266   -21.694 1.00 0.00 ? 9  SER A C    4  
ATOM 3384  O O    . SER A 1 9  ? -7.168  2.267   -20.810 1.00 0.00 ? 9  SER A O    4  
ATOM 3385  C CB   . SER A 1 9  ? -7.197  4.509   -22.361 1.00 0.00 ? 9  SER A CB   4  
ATOM 3386  O OG   . SER A 1 9  ? -6.769  5.834   -22.623 1.00 0.00 ? 9  SER A OG   4  
ATOM 3387  H H    . SER A 1 9  ? -5.190  3.631   -24.463 1.00 0.00 ? 9  SER A H    4  
ATOM 3388  H HA   . SER A 1 9  ? -5.131  3.974   -22.189 1.00 0.00 ? 9  SER A HA   4  
ATOM 3389  H HB2  . SER A 1 9  ? -7.991  4.257   -23.048 1.00 0.00 ? 9  SER A HB2  4  
ATOM 3390  H HB3  . SER A 1 9  ? -7.568  4.457   -21.347 1.00 0.00 ? 9  SER A HB3  4  
ATOM 3391  H HG   . SER A 1 9  ? -5.993  5.814   -23.188 1.00 0.00 ? 9  SER A HG   4  
ATOM 3392  N N    . SER A 1 10 ? -5.569  1.201   -21.981 1.00 0.00 ? 10 SER A N    4  
ATOM 3393  C CA   . SER A 1 10 ? -5.726  -0.056  -21.260 1.00 0.00 ? 10 SER A CA   4  
ATOM 3394  C C    . SER A 1 10 ? -4.433  -0.437  -20.545 1.00 0.00 ? 10 SER A C    4  
ATOM 3395  O O    . SER A 1 10 ? -3.339  -0.271  -21.086 1.00 0.00 ? 10 SER A O    4  
ATOM 3396  C CB   . SER A 1 10 ? -6.137  -1.173  -22.221 1.00 0.00 ? 10 SER A CB   4  
ATOM 3397  O OG   . SER A 1 10 ? -6.557  -2.327  -21.513 1.00 0.00 ? 10 SER A OG   4  
ATOM 3398  H H    . SER A 1 10 ? -4.903  1.262   -22.697 1.00 0.00 ? 10 SER A H    4  
ATOM 3399  H HA   . SER A 1 10 ? -6.504  0.078   -20.523 1.00 0.00 ? 10 SER A HA   4  
ATOM 3400  H HB2  . SER A 1 10 ? -6.951  -0.829  -22.840 1.00 0.00 ? 10 SER A HB2  4  
ATOM 3401  H HB3  . SER A 1 10 ? -5.295  -1.435  -22.846 1.00 0.00 ? 10 SER A HB3  4  
ATOM 3402  H HG   . SER A 1 10 ? -5.894  -3.015  -21.599 1.00 0.00 ? 10 SER A HG   4  
ATOM 3403  N N    . ARG A 1 11 ? -4.566  -0.946  -19.325 1.00 0.00 ? 11 ARG A N    4  
ATOM 3404  C CA   . ARG A 1 11 ? -3.410  -1.349  -18.534 1.00 0.00 ? 11 ARG A CA   4  
ATOM 3405  C C    . ARG A 1 11 ? -3.845  -2.079  -17.266 1.00 0.00 ? 11 ARG A C    4  
ATOM 3406  O O    . ARG A 1 11 ? -5.014  -2.036  -16.882 1.00 0.00 ? 11 ARG A O    4  
ATOM 3407  C CB   . ARG A 1 11 ? -2.565  -0.127  -18.167 1.00 0.00 ? 11 ARG A CB   4  
ATOM 3408  C CG   . ARG A 1 11 ? -3.310  0.897   -17.327 1.00 0.00 ? 11 ARG A CG   4  
ATOM 3409  C CD   . ARG A 1 11 ? -2.522  2.191   -17.198 1.00 0.00 ? 11 ARG A CD   4  
ATOM 3410  N NE   . ARG A 1 11 ? -2.849  2.912   -15.971 1.00 0.00 ? 11 ARG A NE   4  
ATOM 3411  C CZ   . ARG A 1 11 ? -4.029  3.477   -15.743 1.00 0.00 ? 11 ARG A CZ   4  
ATOM 3412  N NH1  . ARG A 1 11 ? -4.990  3.405   -16.654 1.00 0.00 ? 11 ARG A NH1  4  
ATOM 3413  N NH2  . ARG A 1 11 ? -4.251  4.116   -14.601 1.00 0.00 ? 11 ARG A NH2  4  
ATOM 3414  H H    . ARG A 1 11 ? -5.464  -1.054  -18.947 1.00 0.00 ? 11 ARG A H    4  
ATOM 3415  H HA   . ARG A 1 11 ? -2.814  -2.020  -19.135 1.00 0.00 ? 11 ARG A HA   4  
ATOM 3416  H HB2  . ARG A 1 11 ? -1.700  -0.456  -17.610 1.00 0.00 ? 11 ARG A HB2  4  
ATOM 3417  H HB3  . ARG A 1 11 ? -2.238  0.354   -19.076 1.00 0.00 ? 11 ARG A HB3  4  
ATOM 3418  H HG2  . ARG A 1 11 ? -4.259  1.112   -17.795 1.00 0.00 ? 11 ARG A HG2  4  
ATOM 3419  H HG3  . ARG A 1 11 ? -3.477  0.488   -16.341 1.00 0.00 ? 11 ARG A HG3  4  
ATOM 3420  H HD2  . ARG A 1 11 ? -1.468  1.957   -17.196 1.00 0.00 ? 11 ARG A HD2  4  
ATOM 3421  H HD3  . ARG A 1 11 ? -2.749  2.820   -18.046 1.00 0.00 ? 11 ARG A HD3  4  
ATOM 3422  H HE   . ARG A 1 11 ? -2.154  2.978   -15.284 1.00 0.00 ? 11 ARG A HE   4  
ATOM 3423  H HH11 . ARG A 1 11 ? -4.826  2.923   -17.515 1.00 0.00 ? 11 ARG A HH11 4  
ATOM 3424  H HH12 . ARG A 1 11 ? -5.878  3.830   -16.480 1.00 0.00 ? 11 ARG A HH12 4  
ATOM 3425  H HH21 . ARG A 1 11 ? -3.529  4.172   -13.912 1.00 0.00 ? 11 ARG A HH21 4  
ATOM 3426  H HH22 . ARG A 1 11 ? -5.139  4.541   -14.431 1.00 0.00 ? 11 ARG A HH22 4  
ATOM 3427  N N    . THR A 1 12 ? -2.896  -2.751  -16.621 1.00 0.00 ? 12 THR A N    4  
ATOM 3428  C CA   . THR A 1 12 ? -3.181  -3.491  -15.398 1.00 0.00 ? 12 THR A CA   4  
ATOM 3429  C C    . THR A 1 12 ? -3.482  -2.546  -14.241 1.00 0.00 ? 12 THR A C    4  
ATOM 3430  O O    . THR A 1 12 ? -2.586  -2.171  -13.484 1.00 0.00 ? 12 THR A O    4  
ATOM 3431  C CB   . THR A 1 12 ? -2.005  -4.405  -15.008 1.00 0.00 ? 12 THR A CB   4  
ATOM 3432  O OG1  . THR A 1 12 ? -1.651  -5.247  -16.112 1.00 0.00 ? 12 THR A OG1  4  
ATOM 3433  C CG2  . THR A 1 12 ? -2.362  -5.263  -13.804 1.00 0.00 ? 12 THR A CG2  4  
ATOM 3434  H H    . THR A 1 12 ? -1.984  -2.747  -16.977 1.00 0.00 ? 12 THR A H    4  
ATOM 3435  H HA   . THR A 1 12 ? -4.048  -4.111  -15.579 1.00 0.00 ? 12 THR A HA   4  
ATOM 3436  H HB   . THR A 1 12 ? -1.157  -3.786  -14.751 1.00 0.00 ? 12 THR A HB   4  
ATOM 3437  H HG1  . THR A 1 12 ? -0.705  -5.190  -16.267 1.00 0.00 ? 12 THR A HG1  4  
ATOM 3438  H HG21 . THR A 1 12 ? -1.503  -5.848  -13.511 1.00 0.00 ? 12 THR A HG21 4  
ATOM 3439  H HG22 . THR A 1 12 ? -3.177  -5.924  -14.062 1.00 0.00 ? 12 THR A HG22 4  
ATOM 3440  H HG23 . THR A 1 12 ? -2.660  -4.627  -12.985 1.00 0.00 ? 12 THR A HG23 4  
ATOM 3441  N N    . ARG A 1 13 ? -4.748  -2.166  -14.107 1.00 0.00 ? 13 ARG A N    4  
ATOM 3442  C CA   . ARG A 1 13 ? -5.166  -1.264  -13.040 1.00 0.00 ? 13 ARG A CA   4  
ATOM 3443  C C    . ARG A 1 13 ? -5.790  -2.041  -11.885 1.00 0.00 ? 13 ARG A C    4  
ATOM 3444  O O    . ARG A 1 13 ? -6.910  -2.541  -11.992 1.00 0.00 ? 13 ARG A O    4  
ATOM 3445  C CB   . ARG A 1 13 ? -6.165  -0.236  -13.575 1.00 0.00 ? 13 ARG A CB   4  
ATOM 3446  C CG   . ARG A 1 13 ? -6.305  0.994   -12.692 1.00 0.00 ? 13 ARG A CG   4  
ATOM 3447  C CD   . ARG A 1 13 ? -6.838  2.184   -13.475 1.00 0.00 ? 13 ARG A CD   4  
ATOM 3448  N NE   . ARG A 1 13 ? -6.594  3.447   -12.784 1.00 0.00 ? 13 ARG A NE   4  
ATOM 3449  C CZ   . ARG A 1 13 ? -7.314  4.545   -12.983 1.00 0.00 ? 13 ARG A CZ   4  
ATOM 3450  N NH1  . ARG A 1 13 ? -8.320  4.534   -13.847 1.00 0.00 ? 13 ARG A NH1  4  
ATOM 3451  N NH2  . ARG A 1 13 ? -7.030  5.656   -12.316 1.00 0.00 ? 13 ARG A NH2  4  
ATOM 3452  H H    . ARG A 1 13 ? -5.417  -2.499  -14.741 1.00 0.00 ? 13 ARG A H    4  
ATOM 3453  H HA   . ARG A 1 13 ? -4.290  -0.747  -12.680 1.00 0.00 ? 13 ARG A HA   4  
ATOM 3454  H HB2  . ARG A 1 13 ? -5.842  0.087   -14.555 1.00 0.00 ? 13 ARG A HB2  4  
ATOM 3455  H HB3  . ARG A 1 13 ? -7.134  -0.703  -13.660 1.00 0.00 ? 13 ARG A HB3  4  
ATOM 3456  H HG2  . ARG A 1 13 ? -6.989  0.771   -11.887 1.00 0.00 ? 13 ARG A HG2  4  
ATOM 3457  H HG3  . ARG A 1 13 ? -5.337  1.245   -12.286 1.00 0.00 ? 13 ARG A HG3  4  
ATOM 3458  H HD2  . ARG A 1 13 ? -6.352  2.211   -14.438 1.00 0.00 ? 13 ARG A HD2  4  
ATOM 3459  H HD3  . ARG A 1 13 ? -7.902  2.059   -13.612 1.00 0.00 ? 13 ARG A HD3  4  
ATOM 3460  H HE   . ARG A 1 13 ? -5.855  3.477   -12.141 1.00 0.00 ? 13 ARG A HE   4  
ATOM 3461  H HH11 . ARG A 1 13 ? -8.537  3.698   -14.350 1.00 0.00 ? 13 ARG A HH11 4  
ATOM 3462  H HH12 . ARG A 1 13 ? -8.862  5.362   -13.994 1.00 0.00 ? 13 ARG A HH12 4  
ATOM 3463  H HH21 . ARG A 1 13 ? -6.273  5.668   -11.664 1.00 0.00 ? 13 ARG A HH21 4  
ATOM 3464  H HH22 . ARG A 1 13 ? -7.573  6.482   -12.466 1.00 0.00 ? 13 ARG A HH22 4  
ATOM 3465  N N    . PHE A 1 14 ? -5.057  -2.138  -10.780 1.00 0.00 ? 14 PHE A N    4  
ATOM 3466  C CA   . PHE A 1 14 ? -5.538  -2.855  -9.605  1.00 0.00 ? 14 PHE A CA   4  
ATOM 3467  C C    . PHE A 1 14 ? -6.681  -2.098  -8.935  1.00 0.00 ? 14 PHE A C    4  
ATOM 3468  O O    . PHE A 1 14 ? -6.834  -0.890  -9.119  1.00 0.00 ? 14 PHE A O    4  
ATOM 3469  C CB   . PHE A 1 14 ? -4.397  -3.065  -8.607  1.00 0.00 ? 14 PHE A CB   4  
ATOM 3470  C CG   . PHE A 1 14 ? -3.121  -3.535  -9.246  1.00 0.00 ? 14 PHE A CG   4  
ATOM 3471  C CD1  . PHE A 1 14 ? -2.253  -2.632  -9.838  1.00 0.00 ? 14 PHE A CD1  4  
ATOM 3472  C CD2  . PHE A 1 14 ? -2.790  -4.880  -9.254  1.00 0.00 ? 14 PHE A CD2  4  
ATOM 3473  C CE1  . PHE A 1 14 ? -1.078  -3.061  -10.426 1.00 0.00 ? 14 PHE A CE1  4  
ATOM 3474  C CE2  . PHE A 1 14 ? -1.617  -5.316  -9.840  1.00 0.00 ? 14 PHE A CE2  4  
ATOM 3475  C CZ   . PHE A 1 14 ? -0.760  -4.405  -10.428 1.00 0.00 ? 14 PHE A CZ   4  
ATOM 3476  H H    . PHE A 1 14 ? -4.172  -1.718  -10.755 1.00 0.00 ? 14 PHE A H    4  
ATOM 3477  H HA   . PHE A 1 14 ? -5.901  -3.818  -9.930  1.00 0.00 ? 14 PHE A HA   4  
ATOM 3478  H HB2  . PHE A 1 14 ? -4.191  -2.131  -8.105  1.00 0.00 ? 14 PHE A HB2  4  
ATOM 3479  H HB3  . PHE A 1 14 ? -4.696  -3.803  -7.879  1.00 0.00 ? 14 PHE A HB3  4  
ATOM 3480  H HD1  . PHE A 1 14 ? -2.501  -1.579  -9.837  1.00 0.00 ? 14 PHE A HD1  4  
ATOM 3481  H HD2  . PHE A 1 14 ? -3.459  -5.594  -8.796  1.00 0.00 ? 14 PHE A HD2  4  
ATOM 3482  H HE1  . PHE A 1 14 ? -0.411  -2.346  -10.885 1.00 0.00 ? 14 PHE A HE1  4  
ATOM 3483  H HE2  . PHE A 1 14 ? -1.370  -6.367  -9.841  1.00 0.00 ? 14 PHE A HE2  4  
ATOM 3484  H HZ   . PHE A 1 14 ? 0.157   -4.742  -10.886 1.00 0.00 ? 14 PHE A HZ   4  
ATOM 3485  N N    . THR A 1 15 ? -7.484  -2.818  -8.157  1.00 0.00 ? 15 THR A N    4  
ATOM 3486  C CA   . THR A 1 15 ? -8.614  -2.216  -7.461  1.00 0.00 ? 15 THR A CA   4  
ATOM 3487  C C    . THR A 1 15 ? -8.321  -2.054  -5.974  1.00 0.00 ? 15 THR A C    4  
ATOM 3488  O O    . THR A 1 15 ? -7.489  -2.768  -5.414  1.00 0.00 ? 15 THR A O    4  
ATOM 3489  C CB   . THR A 1 15 ? -9.892  -3.059  -7.632  1.00 0.00 ? 15 THR A CB   4  
ATOM 3490  O OG1  . THR A 1 15 ? -10.999 -2.403  -7.004  1.00 0.00 ? 15 THR A OG1  4  
ATOM 3491  C CG2  . THR A 1 15 ? -9.711  -4.445  -7.033  1.00 0.00 ? 15 THR A CG2  4  
ATOM 3492  H H    . THR A 1 15 ? -7.311  -3.776  -8.050  1.00 0.00 ? 15 THR A H    4  
ATOM 3493  H HA   . THR A 1 15 ? -8.791  -1.241  -7.892  1.00 0.00 ? 15 THR A HA   4  
ATOM 3494  H HB   . THR A 1 15 ? -10.098 -3.164  -8.688  1.00 0.00 ? 15 THR A HB   4  
ATOM 3495  H HG1  . THR A 1 15 ? -11.791 -2.537  -7.530  1.00 0.00 ? 15 THR A HG1  4  
ATOM 3496  H HG21 . THR A 1 15 ? -10.484 -4.625  -6.301  1.00 0.00 ? 15 THR A HG21 4  
ATOM 3497  H HG22 . THR A 1 15 ? -8.743  -4.508  -6.557  1.00 0.00 ? 15 THR A HG22 4  
ATOM 3498  H HG23 . THR A 1 15 ? -9.776  -5.186  -7.815  1.00 0.00 ? 15 THR A HG23 4  
ATOM 3499  N N    . ASP A 1 16 ? -9.010  -1.112  -5.340  1.00 0.00 ? 16 ASP A N    4  
ATOM 3500  C CA   . ASP A 1 16 ? -8.825  -0.857  -3.916  1.00 0.00 ? 16 ASP A CA   4  
ATOM 3501  C C    . ASP A 1 16 ? -8.540  -2.154  -3.165  1.00 0.00 ? 16 ASP A C    4  
ATOM 3502  O O    . ASP A 1 16 ? -7.627  -2.218  -2.341  1.00 0.00 ? 16 ASP A O    4  
ATOM 3503  C CB   . ASP A 1 16 ? -10.064 -0.177  -3.332  1.00 0.00 ? 16 ASP A CB   4  
ATOM 3504  C CG   . ASP A 1 16 ? -10.087 1.315   -3.600  1.00 0.00 ? 16 ASP A CG   4  
ATOM 3505  O OD1  . ASP A 1 16 ? -9.248  2.035   -3.019  1.00 0.00 ? 16 ASP A OD1  4  
ATOM 3506  O OD2  . ASP A 1 16 ? -10.942 1.762   -4.392  1.00 0.00 ? 16 ASP A OD2  4  
ATOM 3507  H H    . ASP A 1 16 ? -9.660  -0.575  -5.841  1.00 0.00 ? 16 ASP A H    4  
ATOM 3508  H HA   . ASP A 1 16 ? -7.978  -0.198  -3.804  1.00 0.00 ? 16 ASP A HA   4  
ATOM 3509  H HB2  . ASP A 1 16 ? -10.949 -0.616  -3.772  1.00 0.00 ? 16 ASP A HB2  4  
ATOM 3510  H HB3  . ASP A 1 16 ? -10.083 -0.333  -2.264  1.00 0.00 ? 16 ASP A HB3  4  
ATOM 3511  N N    . TYR A 1 17 ? -9.327  -3.184  -3.453  1.00 0.00 ? 17 TYR A N    4  
ATOM 3512  C CA   . TYR A 1 17 ? -9.162  -4.478  -2.802  1.00 0.00 ? 17 TYR A CA   4  
ATOM 3513  C C    . TYR A 1 17 ? -7.731  -4.985  -2.954  1.00 0.00 ? 17 TYR A C    4  
ATOM 3514  O O    . TYR A 1 17 ? -7.094  -5.379  -1.977  1.00 0.00 ? 17 TYR A O    4  
ATOM 3515  C CB   . TYR A 1 17 ? -10.141 -5.497  -3.389  1.00 0.00 ? 17 TYR A CB   4  
ATOM 3516  C CG   . TYR A 1 17 ? -9.736  -6.934  -3.148  1.00 0.00 ? 17 TYR A CG   4  
ATOM 3517  C CD1  . TYR A 1 17 ? -9.283  -7.349  -1.902  1.00 0.00 ? 17 TYR A CD1  4  
ATOM 3518  C CD2  . TYR A 1 17 ? -9.805  -7.876  -4.167  1.00 0.00 ? 17 TYR A CD2  4  
ATOM 3519  C CE1  . TYR A 1 17 ? -8.912  -8.660  -1.677  1.00 0.00 ? 17 TYR A CE1  4  
ATOM 3520  C CE2  . TYR A 1 17 ? -9.438  -9.190  -3.951  1.00 0.00 ? 17 TYR A CE2  4  
ATOM 3521  C CZ   . TYR A 1 17 ? -8.991  -9.577  -2.705  1.00 0.00 ? 17 TYR A CZ   4  
ATOM 3522  O OH   . TYR A 1 17 ? -8.623  -10.885 -2.486  1.00 0.00 ? 17 TYR A OH   4  
ATOM 3523  H H    . TYR A 1 17 ? -10.038 -3.071  -4.118  1.00 0.00 ? 17 TYR A H    4  
ATOM 3524  H HA   . TYR A 1 17 ? -9.377  -4.351  -1.751  1.00 0.00 ? 17 TYR A HA   4  
ATOM 3525  H HB2  . TYR A 1 17 ? -11.113 -5.348  -2.946  1.00 0.00 ? 17 TYR A HB2  4  
ATOM 3526  H HB3  . TYR A 1 17 ? -10.210 -5.345  -4.456  1.00 0.00 ? 17 TYR A HB3  4  
ATOM 3527  H HD1  . TYR A 1 17 ? -9.222  -6.628  -1.099  1.00 0.00 ? 17 TYR A HD1  4  
ATOM 3528  H HD2  . TYR A 1 17 ? -10.155 -7.568  -5.142  1.00 0.00 ? 17 TYR A HD2  4  
ATOM 3529  H HE1  . TYR A 1 17 ? -8.563  -8.964  -0.702  1.00 0.00 ? 17 TYR A HE1  4  
ATOM 3530  H HE2  . TYR A 1 17 ? -9.499  -9.907  -4.756  1.00 0.00 ? 17 TYR A HE2  4  
ATOM 3531  H HH   . TYR A 1 17 ? -8.573  -11.347 -3.326  1.00 0.00 ? 17 TYR A HH   4  
ATOM 3532  N N    . GLN A 1 18 ? -7.233  -4.972  -4.186  1.00 0.00 ? 18 GLN A N    4  
ATOM 3533  C CA   . GLN A 1 18 ? -5.878  -5.431  -4.467  1.00 0.00 ? 18 GLN A CA   4  
ATOM 3534  C C    . GLN A 1 18 ? -4.847  -4.428  -3.957  1.00 0.00 ? 18 GLN A C    4  
ATOM 3535  O O    . GLN A 1 18 ? -3.923  -4.789  -3.227  1.00 0.00 ? 18 GLN A O    4  
ATOM 3536  C CB   . GLN A 1 18 ? -5.692  -5.651  -5.969  1.00 0.00 ? 18 GLN A CB   4  
ATOM 3537  C CG   . GLN A 1 18 ? -6.691  -6.627  -6.569  1.00 0.00 ? 18 GLN A CG   4  
ATOM 3538  C CD   . GLN A 1 18 ? -6.124  -7.392  -7.748  1.00 0.00 ? 18 GLN A CD   4  
ATOM 3539  O OE1  . GLN A 1 18 ? -5.597  -6.802  -8.691  1.00 0.00 ? 18 GLN A OE1  4  
ATOM 3540  N NE2  . GLN A 1 18 ? -6.228  -8.715  -7.700  1.00 0.00 ? 18 GLN A NE2  4  
ATOM 3541  H H    . GLN A 1 18 ? -7.790  -4.647  -4.923  1.00 0.00 ? 18 GLN A H    4  
ATOM 3542  H HA   . GLN A 1 18 ? -5.732  -6.369  -3.954  1.00 0.00 ? 18 GLN A HA   4  
ATOM 3543  H HB2  . GLN A 1 18 ? -5.798  -4.703  -6.476  1.00 0.00 ? 18 GLN A HB2  4  
ATOM 3544  H HB3  . GLN A 1 18 ? -4.698  -6.034  -6.145  1.00 0.00 ? 18 GLN A HB3  4  
ATOM 3545  H HG2  . GLN A 1 18 ? -6.985  -7.335  -5.808  1.00 0.00 ? 18 GLN A HG2  4  
ATOM 3546  H HG3  . GLN A 1 18 ? -7.559  -6.075  -6.901  1.00 0.00 ? 18 GLN A HG3  4  
ATOM 3547  H HE21 . GLN A 1 18 ? -6.661  -9.117  -6.918  1.00 0.00 ? 18 GLN A HE21 4  
ATOM 3548  H HE22 . GLN A 1 18 ? -5.870  -9.235  -8.449  1.00 0.00 ? 18 GLN A HE22 4  
ATOM 3549  N N    . LEU A 1 19 ? -5.012  -3.169  -4.346  1.00 0.00 ? 19 LEU A N    4  
ATOM 3550  C CA   . LEU A 1 19 ? -4.095  -2.113  -3.928  1.00 0.00 ? 19 LEU A CA   4  
ATOM 3551  C C    . LEU A 1 19 ? -3.995  -2.050  -2.408  1.00 0.00 ? 19 LEU A C    4  
ATOM 3552  O O    . LEU A 1 19 ? -2.960  -1.670  -1.859  1.00 0.00 ? 19 LEU A O    4  
ATOM 3553  C CB   . LEU A 1 19 ? -4.558  -0.763  -4.477  1.00 0.00 ? 19 LEU A CB   4  
ATOM 3554  C CG   . LEU A 1 19 ? -4.466  -0.587  -5.993  1.00 0.00 ? 19 LEU A CG   4  
ATOM 3555  C CD1  . LEU A 1 19 ? -5.029  0.763   -6.409  1.00 0.00 ? 19 LEU A CD1  4  
ATOM 3556  C CD2  . LEU A 1 19 ? -3.025  -0.732  -6.460  1.00 0.00 ? 19 LEU A CD2  4  
ATOM 3557  H H    . LEU A 1 19 ? -5.766  -2.942  -4.928  1.00 0.00 ? 19 LEU A H    4  
ATOM 3558  H HA   . LEU A 1 19 ? -3.120  -2.342  -4.332  1.00 0.00 ? 19 LEU A HA   4  
ATOM 3559  H HB2  . LEU A 1 19 ? -5.589  -0.625  -4.191  1.00 0.00 ? 19 LEU A HB2  4  
ATOM 3560  H HB3  . LEU A 1 19 ? -3.953  0.005   -4.016  1.00 0.00 ? 19 LEU A HB3  4  
ATOM 3561  H HG   . LEU A 1 19 ? -5.054  -1.356  -6.475  1.00 0.00 ? 19 LEU A HG   4  
ATOM 3562  H HD11 . LEU A 1 19 ? -4.565  1.078   -7.332  1.00 0.00 ? 19 LEU A HD11 4  
ATOM 3563  H HD12 . LEU A 1 19 ? -4.827  1.491   -5.638  1.00 0.00 ? 19 LEU A HD12 4  
ATOM 3564  H HD13 . LEU A 1 19 ? -6.097  0.679   -6.553  1.00 0.00 ? 19 LEU A HD13 4  
ATOM 3565  H HD21 . LEU A 1 19 ? -2.871  -0.129  -7.343  1.00 0.00 ? 19 LEU A HD21 4  
ATOM 3566  H HD22 . LEU A 1 19 ? -2.825  -1.768  -6.693  1.00 0.00 ? 19 LEU A HD22 4  
ATOM 3567  H HD23 . LEU A 1 19 ? -2.358  -0.403  -5.678  1.00 0.00 ? 19 LEU A HD23 4  
ATOM 3568  N N    . ARG A 1 20 ? -5.076  -2.426  -1.732  1.00 0.00 ? 20 ARG A N    4  
ATOM 3569  C CA   . ARG A 1 20 ? -5.109  -2.413  -0.275  1.00 0.00 ? 20 ARG A CA   4  
ATOM 3570  C C    . ARG A 1 20 ? -4.135  -3.438  0.301   1.00 0.00 ? 20 ARG A C    4  
ATOM 3571  O O    . ARG A 1 20 ? -3.379  -3.141  1.225   1.00 0.00 ? 20 ARG A O    4  
ATOM 3572  C CB   . ARG A 1 20 ? -6.525  -2.701  0.227   1.00 0.00 ? 20 ARG A CB   4  
ATOM 3573  C CG   . ARG A 1 20 ? -6.659  -2.641  1.740   1.00 0.00 ? 20 ARG A CG   4  
ATOM 3574  C CD   . ARG A 1 20 ? -6.408  -1.236  2.266   1.00 0.00 ? 20 ARG A CD   4  
ATOM 3575  N NE   . ARG A 1 20 ? -6.842  -1.086  3.652   1.00 0.00 ? 20 ARG A NE   4  
ATOM 3576  C CZ   . ARG A 1 20 ? -7.172  0.081   4.197   1.00 0.00 ? 20 ARG A CZ   4  
ATOM 3577  N NH1  . ARG A 1 20 ? -7.118  1.192   3.475   1.00 0.00 ? 20 ARG A NH1  4  
ATOM 3578  N NH2  . ARG A 1 20 ? -7.557  0.137   5.465   1.00 0.00 ? 20 ARG A NH2  4  
ATOM 3579  H H    . ARG A 1 20 ? -5.870  -2.719  -2.225  1.00 0.00 ? 20 ARG A H    4  
ATOM 3580  H HA   . ARG A 1 20 ? -4.813  -1.428  0.055   1.00 0.00 ? 20 ARG A HA   4  
ATOM 3581  H HB2  . ARG A 1 20 ? -7.201  -1.975  -0.201  1.00 0.00 ? 20 ARG A HB2  4  
ATOM 3582  H HB3  . ARG A 1 20 ? -6.816  -3.688  -0.099  1.00 0.00 ? 20 ARG A HB3  4  
ATOM 3583  H HG2  . ARG A 1 20 ? -7.658  -2.943  2.016   1.00 0.00 ? 20 ARG A HG2  4  
ATOM 3584  H HG3  . ARG A 1 20 ? -5.941  -3.315  2.183   1.00 0.00 ? 20 ARG A HG3  4  
ATOM 3585  H HD2  . ARG A 1 20 ? -5.351  -1.027  2.206   1.00 0.00 ? 20 ARG A HD2  4  
ATOM 3586  H HD3  . ARG A 1 20 ? -6.950  -0.534  1.650   1.00 0.00 ? 20 ARG A HD3  4  
ATOM 3587  H HE   . ARG A 1 20 ? -6.889  -1.894  4.204   1.00 0.00 ? 20 ARG A HE   4  
ATOM 3588  H HH11 . ARG A 1 20 ? -6.829  1.152   2.519   1.00 0.00 ? 20 ARG A HH11 4  
ATOM 3589  H HH12 . ARG A 1 20 ? -7.368  2.068   3.887   1.00 0.00 ? 20 ARG A HH12 4  
ATOM 3590  H HH21 . ARG A 1 20 ? -7.600  -0.699  6.012   1.00 0.00 ? 20 ARG A HH21 4  
ATOM 3591  H HH22 . ARG A 1 20 ? -7.805  1.015   5.874   1.00 0.00 ? 20 ARG A HH22 4  
ATOM 3592  N N    . VAL A 1 21 ? -4.161  -4.646  -0.253  1.00 0.00 ? 21 VAL A N    4  
ATOM 3593  C CA   . VAL A 1 21 ? -3.281  -5.715  0.204   1.00 0.00 ? 21 VAL A CA   4  
ATOM 3594  C C    . VAL A 1 21 ? -1.847  -5.482  -0.258  1.00 0.00 ? 21 VAL A C    4  
ATOM 3595  O O    . VAL A 1 21 ? -0.897  -5.705  0.493   1.00 0.00 ? 21 VAL A O    4  
ATOM 3596  C CB   . VAL A 1 21 ? -3.756  -7.089  -0.304  1.00 0.00 ? 21 VAL A CB   4  
ATOM 3597  C CG1  . VAL A 1 21 ? -2.810  -8.187  0.158   1.00 0.00 ? 21 VAL A CG1  4  
ATOM 3598  C CG2  . VAL A 1 21 ? -5.177  -7.367  0.162   1.00 0.00 ? 21 VAL A CG2  4  
ATOM 3599  H H    . VAL A 1 21 ? -4.786  -4.823  -0.987  1.00 0.00 ? 21 VAL A H    4  
ATOM 3600  H HA   . VAL A 1 21 ? -3.303  -5.727  1.284   1.00 0.00 ? 21 VAL A HA   4  
ATOM 3601  H HB   . VAL A 1 21 ? -3.752  -7.072  -1.384  1.00 0.00 ? 21 VAL A HB   4  
ATOM 3602  H HG11 . VAL A 1 21 ? -3.171  -8.605  1.087   1.00 0.00 ? 21 VAL A HG11 4  
ATOM 3603  H HG12 . VAL A 1 21 ? -2.762  -8.961  -0.593  1.00 0.00 ? 21 VAL A HG12 4  
ATOM 3604  H HG13 . VAL A 1 21 ? -1.825  -7.771  0.311   1.00 0.00 ? 21 VAL A HG13 4  
ATOM 3605  H HG21 . VAL A 1 21 ? -5.736  -6.444  0.182   1.00 0.00 ? 21 VAL A HG21 4  
ATOM 3606  H HG22 . VAL A 1 21 ? -5.651  -8.061  -0.518  1.00 0.00 ? 21 VAL A HG22 4  
ATOM 3607  H HG23 . VAL A 1 21 ? -5.154  -7.795  1.154   1.00 0.00 ? 21 VAL A HG23 4  
ATOM 3608  N N    . LEU A 1 22 ? -1.698  -5.033  -1.499  1.00 0.00 ? 22 LEU A N    4  
ATOM 3609  C CA   . LEU A 1 22 ? -0.379  -4.768  -2.064  1.00 0.00 ? 22 LEU A CA   4  
ATOM 3610  C C    . LEU A 1 22 ? 0.320   -3.641  -1.310  1.00 0.00 ? 22 LEU A C    4  
ATOM 3611  O O    . LEU A 1 22 ? 1.499   -3.744  -0.973  1.00 0.00 ? 22 LEU A O    4  
ATOM 3612  C CB   . LEU A 1 22 ? -0.499  -4.409  -3.546  1.00 0.00 ? 22 LEU A CB   4  
ATOM 3613  C CG   . LEU A 1 22 ? -1.053  -5.503  -4.458  1.00 0.00 ? 22 LEU A CG   4  
ATOM 3614  C CD1  . LEU A 1 22 ? -1.407  -4.932  -5.823  1.00 0.00 ? 22 LEU A CD1  4  
ATOM 3615  C CD2  . LEU A 1 22 ? -0.051  -6.640  -4.598  1.00 0.00 ? 22 LEU A CD2  4  
ATOM 3616  H H    . LEU A 1 22 ? -2.492  -4.874  -2.050  1.00 0.00 ? 22 LEU A H    4  
ATOM 3617  H HA   . LEU A 1 22 ? 0.210   -5.668  -1.966  1.00 0.00 ? 22 LEU A HA   4  
ATOM 3618  H HB2  . LEU A 1 22 ? -1.148  -3.551  -3.626  1.00 0.00 ? 22 LEU A HB2  4  
ATOM 3619  H HB3  . LEU A 1 22 ? 0.487   -4.147  -3.903  1.00 0.00 ? 22 LEU A HB3  4  
ATOM 3620  H HG   . LEU A 1 22 ? -1.957  -5.905  -4.021  1.00 0.00 ? 22 LEU A HG   4  
ATOM 3621  H HD11 . LEU A 1 22 ? -2.310  -4.346  -5.744  1.00 0.00 ? 22 LEU A HD11 4  
ATOM 3622  H HD12 . LEU A 1 22 ? -1.562  -5.740  -6.522  1.00 0.00 ? 22 LEU A HD12 4  
ATOM 3623  H HD13 . LEU A 1 22 ? -0.599  -4.305  -6.171  1.00 0.00 ? 22 LEU A HD13 4  
ATOM 3624  H HD21 . LEU A 1 22 ? 0.937   -6.232  -4.751  1.00 0.00 ? 22 LEU A HD21 4  
ATOM 3625  H HD22 . LEU A 1 22 ? -0.321  -7.256  -5.444  1.00 0.00 ? 22 LEU A HD22 4  
ATOM 3626  H HD23 . LEU A 1 22 ? -0.059  -7.239  -3.699  1.00 0.00 ? 22 LEU A HD23 4  
ATOM 3627  N N    . GLN A 1 23 ? -0.417  -2.566  -1.049  1.00 0.00 ? 23 GLN A N    4  
ATOM 3628  C CA   . GLN A 1 23 ? 0.132   -1.420  -0.334  1.00 0.00 ? 23 GLN A CA   4  
ATOM 3629  C C    . GLN A 1 23 ? 0.398   -1.766  1.128   1.00 0.00 ? 23 GLN A C    4  
ATOM 3630  O O    . GLN A 1 23 ? 1.391   -1.329  1.708   1.00 0.00 ? 23 GLN A O    4  
ATOM 3631  C CB   . GLN A 1 23 ? -0.825  -0.230  -0.423  1.00 0.00 ? 23 GLN A CB   4  
ATOM 3632  C CG   . GLN A 1 23 ? -0.137  1.117   -0.278  1.00 0.00 ? 23 GLN A CG   4  
ATOM 3633  C CD   . GLN A 1 23 ? 0.917   1.120   0.812   1.00 0.00 ? 23 GLN A CD   4  
ATOM 3634  O OE1  . GLN A 1 23 ? 0.599   1.066   2.000   1.00 0.00 ? 23 GLN A OE1  4  
ATOM 3635  N NE2  . GLN A 1 23 ? 2.182   1.182   0.412   1.00 0.00 ? 23 GLN A NE2  4  
ATOM 3636  H H    . GLN A 1 23 ? -1.350  -2.543  -1.344  1.00 0.00 ? 23 GLN A H    4  
ATOM 3637  H HA   . GLN A 1 23 ? 1.067   -1.153  -0.803  1.00 0.00 ? 23 GLN A HA   4  
ATOM 3638  H HB2  . GLN A 1 23 ? -1.323  -0.255  -1.380  1.00 0.00 ? 23 GLN A HB2  4  
ATOM 3639  H HB3  . GLN A 1 23 ? -1.564  -0.318  0.360   1.00 0.00 ? 23 GLN A HB3  4  
ATOM 3640  H HG2  . GLN A 1 23 ? 0.337   1.368   -1.215  1.00 0.00 ? 23 GLN A HG2  4  
ATOM 3641  H HG3  . GLN A 1 23 ? -0.881  1.864   -0.041  1.00 0.00 ? 23 GLN A HG3  4  
ATOM 3642  H HE21 . GLN A 1 23 ? 2.361   1.223   -0.551  1.00 0.00 ? 23 GLN A HE21 4  
ATOM 3643  H HE22 . GLN A 1 23 ? 2.884   1.186   1.095   1.00 0.00 ? 23 GLN A HE22 4  
ATOM 3644  N N    . ASP A 1 24 ? -0.497  -2.552  1.716   1.00 0.00 ? 24 ASP A N    4  
ATOM 3645  C CA   . ASP A 1 24 ? -0.359  -2.958  3.110   1.00 0.00 ? 24 ASP A CA   4  
ATOM 3646  C C    . ASP A 1 24 ? 0.913   -3.775  3.315   1.00 0.00 ? 24 ASP A C    4  
ATOM 3647  O O    . ASP A 1 24 ? 1.599   -3.632  4.327   1.00 0.00 ? 24 ASP A O    4  
ATOM 3648  C CB   . ASP A 1 24 ? -1.578  -3.770  3.550   1.00 0.00 ? 24 ASP A CB   4  
ATOM 3649  C CG   . ASP A 1 24 ? -1.486  -4.214  4.997   1.00 0.00 ? 24 ASP A CG   4  
ATOM 3650  O OD1  . ASP A 1 24 ? -0.357  -4.444  5.476   1.00 0.00 ? 24 ASP A OD1  4  
ATOM 3651  O OD2  . ASP A 1 24 ? -2.545  -4.331  5.650   1.00 0.00 ? 24 ASP A OD2  4  
ATOM 3652  H H    . ASP A 1 24 ? -1.268  -2.868  1.200   1.00 0.00 ? 24 ASP A H    4  
ATOM 3653  H HA   . ASP A 1 24 ? -0.298  -2.063  3.711   1.00 0.00 ? 24 ASP A HA   4  
ATOM 3654  H HB2  . ASP A 1 24 ? -2.466  -3.166  3.434   1.00 0.00 ? 24 ASP A HB2  4  
ATOM 3655  H HB3  . ASP A 1 24 ? -1.661  -4.648  2.927   1.00 0.00 ? 24 ASP A HB3  4  
ATOM 3656  N N    . PHE A 1 25 ? 1.222   -4.632  2.348   1.00 0.00 ? 25 PHE A N    4  
ATOM 3657  C CA   . PHE A 1 25 ? 2.410   -5.474  2.423   1.00 0.00 ? 25 PHE A CA   4  
ATOM 3658  C C    . PHE A 1 25 ? 3.672   -4.657  2.165   1.00 0.00 ? 25 PHE A C    4  
ATOM 3659  O O    . PHE A 1 25 ? 4.750   -4.985  2.661   1.00 0.00 ? 25 PHE A O    4  
ATOM 3660  C CB   . PHE A 1 25 ? 2.315   -6.619  1.412   1.00 0.00 ? 25 PHE A CB   4  
ATOM 3661  C CG   . PHE A 1 25 ? 3.326   -7.706  1.641   1.00 0.00 ? 25 PHE A CG   4  
ATOM 3662  C CD1  . PHE A 1 25 ? 4.674   -7.474  1.419   1.00 0.00 ? 25 PHE A CD1  4  
ATOM 3663  C CD2  . PHE A 1 25 ? 2.928   -8.960  2.076   1.00 0.00 ? 25 PHE A CD2  4  
ATOM 3664  C CE1  . PHE A 1 25 ? 5.607   -8.473  1.629   1.00 0.00 ? 25 PHE A CE1  4  
ATOM 3665  C CE2  . PHE A 1 25 ? 3.856   -9.961  2.288   1.00 0.00 ? 25 PHE A CE2  4  
ATOM 3666  C CZ   . PHE A 1 25 ? 5.197   -9.718  2.063   1.00 0.00 ? 25 PHE A CZ   4  
ATOM 3667  H H    . PHE A 1 25 ? 0.635   -4.701  1.565   1.00 0.00 ? 25 PHE A H    4  
ATOM 3668  H HA   . PHE A 1 25 ? 2.460   -5.887  3.418   1.00 0.00 ? 25 PHE A HA   4  
ATOM 3669  H HB2  . PHE A 1 25 ? 1.332   -7.062  1.473   1.00 0.00 ? 25 PHE A HB2  4  
ATOM 3670  H HB3  . PHE A 1 25 ? 2.467   -6.225  0.418   1.00 0.00 ? 25 PHE A HB3  4  
ATOM 3671  H HD1  . PHE A 1 25 ? 4.995   -6.500  1.079   1.00 0.00 ? 25 PHE A HD1  4  
ATOM 3672  H HD2  . PHE A 1 25 ? 1.879   -9.152  2.251   1.00 0.00 ? 25 PHE A HD2  4  
ATOM 3673  H HE1  . PHE A 1 25 ? 6.654   -8.278  1.452   1.00 0.00 ? 25 PHE A HE1  4  
ATOM 3674  H HE2  . PHE A 1 25 ? 3.533   -10.935 2.627   1.00 0.00 ? 25 PHE A HE2  4  
ATOM 3675  H HZ   . PHE A 1 25 ? 5.924   -10.499 2.228   1.00 0.00 ? 25 PHE A HZ   4  
ATOM 3676  N N    . PHE A 1 26 ? 3.531   -3.590  1.385   1.00 0.00 ? 26 PHE A N    4  
ATOM 3677  C CA   . PHE A 1 26 ? 4.659   -2.726  1.059   1.00 0.00 ? 26 PHE A CA   4  
ATOM 3678  C C    . PHE A 1 26 ? 5.044   -1.861  2.255   1.00 0.00 ? 26 PHE A C    4  
ATOM 3679  O O    . PHE A 1 26 ? 6.220   -1.754  2.605   1.00 0.00 ? 26 PHE A O    4  
ATOM 3680  C CB   . PHE A 1 26 ? 4.319   -1.838  -0.139  1.00 0.00 ? 26 PHE A CB   4  
ATOM 3681  C CG   . PHE A 1 26 ? 5.406   -0.862  -0.490  1.00 0.00 ? 26 PHE A CG   4  
ATOM 3682  C CD1  . PHE A 1 26 ? 5.537   0.328   0.206   1.00 0.00 ? 26 PHE A CD1  4  
ATOM 3683  C CD2  . PHE A 1 26 ? 6.297   -1.136  -1.515  1.00 0.00 ? 26 PHE A CD2  4  
ATOM 3684  C CE1  . PHE A 1 26 ? 6.536   1.228   -0.115  1.00 0.00 ? 26 PHE A CE1  4  
ATOM 3685  C CE2  . PHE A 1 26 ? 7.298   -0.241  -1.841  1.00 0.00 ? 26 PHE A CE2  4  
ATOM 3686  C CZ   . PHE A 1 26 ? 7.418   0.943   -1.139  1.00 0.00 ? 26 PHE A CZ   4  
ATOM 3687  H H    . PHE A 1 26 ? 2.646   -3.380  1.019   1.00 0.00 ? 26 PHE A H    4  
ATOM 3688  H HA   . PHE A 1 26 ? 5.496   -3.357  0.803   1.00 0.00 ? 26 PHE A HA   4  
ATOM 3689  H HB2  . PHE A 1 26 ? 4.143   -2.462  -1.002  1.00 0.00 ? 26 PHE A HB2  4  
ATOM 3690  H HB3  . PHE A 1 26 ? 3.425   -1.275  0.081   1.00 0.00 ? 26 PHE A HB3  4  
ATOM 3691  H HD1  . PHE A 1 26 ? 4.849   0.553   1.008   1.00 0.00 ? 26 PHE A HD1  4  
ATOM 3692  H HD2  . PHE A 1 26 ? 6.204   -2.062  -2.065  1.00 0.00 ? 26 PHE A HD2  4  
ATOM 3693  H HE1  . PHE A 1 26 ? 6.628   2.152   0.436   1.00 0.00 ? 26 PHE A HE1  4  
ATOM 3694  H HE2  . PHE A 1 26 ? 7.986   -0.467  -2.642  1.00 0.00 ? 26 PHE A HE2  4  
ATOM 3695  H HZ   . PHE A 1 26 ? 8.199   1.644   -1.392  1.00 0.00 ? 26 PHE A HZ   4  
ATOM 3696  N N    . ASP A 1 27 ? 4.046   -1.244  2.878   1.00 0.00 ? 27 ASP A N    4  
ATOM 3697  C CA   . ASP A 1 27 ? 4.278   -0.388  4.035   1.00 0.00 ? 27 ASP A CA   4  
ATOM 3698  C C    . ASP A 1 27 ? 5.071   -1.128  5.108   1.00 0.00 ? 27 ASP A C    4  
ATOM 3699  O O    . ASP A 1 27 ? 5.814   -0.518  5.876   1.00 0.00 ? 27 ASP A O    4  
ATOM 3700  C CB   . ASP A 1 27 ? 2.948   0.099   4.611   1.00 0.00 ? 27 ASP A CB   4  
ATOM 3701  C CG   . ASP A 1 27 ? 3.133   1.168   5.671   1.00 0.00 ? 27 ASP A CG   4  
ATOM 3702  O OD1  . ASP A 1 27 ? 3.971   0.968   6.574   1.00 0.00 ? 27 ASP A OD1  4  
ATOM 3703  O OD2  . ASP A 1 27 ? 2.438   2.204   5.596   1.00 0.00 ? 27 ASP A OD2  4  
ATOM 3704  H H    . ASP A 1 27 ? 3.130   -1.369  2.552   1.00 0.00 ? 27 ASP A H    4  
ATOM 3705  H HA   . ASP A 1 27 ? 4.852   0.465   3.706   1.00 0.00 ? 27 ASP A HA   4  
ATOM 3706  H HB2  . ASP A 1 27 ? 2.346   0.510   3.814   1.00 0.00 ? 27 ASP A HB2  4  
ATOM 3707  H HB3  . ASP A 1 27 ? 2.428   -0.737  5.055   1.00 0.00 ? 27 ASP A HB3  4  
ATOM 3708  N N    . ALA A 1 28 ? 4.907   -2.446  5.154   1.00 0.00 ? 28 ALA A N    4  
ATOM 3709  C CA   . ALA A 1 28 ? 5.608   -3.269  6.132   1.00 0.00 ? 28 ALA A CA   4  
ATOM 3710  C C    . ALA A 1 28 ? 6.878   -3.866  5.537   1.00 0.00 ? 28 ALA A C    4  
ATOM 3711  O O    . ALA A 1 28 ? 7.923   -3.900  6.186   1.00 0.00 ? 28 ALA A O    4  
ATOM 3712  C CB   . ALA A 1 28 ? 4.694   -4.372  6.646   1.00 0.00 ? 28 ALA A CB   4  
ATOM 3713  H H    . ALA A 1 28 ? 4.301   -2.875  4.515   1.00 0.00 ? 28 ALA A H    4  
ATOM 3714  H HA   . ALA A 1 28 ? 5.876   -2.639  6.968   1.00 0.00 ? 28 ALA A HA   4  
ATOM 3715  H HB1  . ALA A 1 28 ? 3.950   -3.945  7.302   1.00 0.00 ? 28 ALA A HB1  4  
ATOM 3716  H HB2  . ALA A 1 28 ? 4.206   -4.852  5.811   1.00 0.00 ? 28 ALA A HB2  4  
ATOM 3717  H HB3  . ALA A 1 28 ? 5.278   -5.099  7.189   1.00 0.00 ? 28 ALA A HB3  4  
ATOM 3718  N N    . ASN A 1 29 ? 6.781   -4.337  4.298   1.00 0.00 ? 29 ASN A N    4  
ATOM 3719  C CA   . ASN A 1 29 ? 7.923   -4.935  3.616   1.00 0.00 ? 29 ASN A CA   4  
ATOM 3720  C C    . ASN A 1 29 ? 7.859   -4.671  2.114   1.00 0.00 ? 29 ASN A C    4  
ATOM 3721  O O    . ASN A 1 29 ? 6.850   -4.949  1.467   1.00 0.00 ? 29 ASN A O    4  
ATOM 3722  C CB   . ASN A 1 29 ? 7.970   -6.441  3.878   1.00 0.00 ? 29 ASN A CB   4  
ATOM 3723  C CG   . ASN A 1 29 ? 9.233   -7.084  3.338   1.00 0.00 ? 29 ASN A CG   4  
ATOM 3724  O OD1  . ASN A 1 29 ? 10.325  -6.529  3.459   1.00 0.00 ? 29 ASN A OD1  4  
ATOM 3725  N ND2  . ASN A 1 29 ? 9.088   -8.260  2.739   1.00 0.00 ? 29 ASN A ND2  4  
ATOM 3726  H H    . ASN A 1 29 ? 5.921   -4.282  3.831   1.00 0.00 ? 29 ASN A H    4  
ATOM 3727  H HA   . ASN A 1 29 ? 8.820   -4.482  4.011   1.00 0.00 ? 29 ASN A HA   4  
ATOM 3728  H HB2  . ASN A 1 29 ? 7.927   -6.616  4.944   1.00 0.00 ? 29 ASN A HB2  4  
ATOM 3729  H HB3  . ASN A 1 29 ? 7.119   -6.910  3.407   1.00 0.00 ? 29 ASN A HB3  4  
ATOM 3730  H HD21 . ASN A 1 29 ? 8.188   -8.642  2.679   1.00 0.00 ? 29 ASN A HD21 4  
ATOM 3731  H HD22 . ASN A 1 29 ? 9.889   -8.698  2.381   1.00 0.00 ? 29 ASN A HD22 4  
ATOM 3732  N N    . ALA A 1 30 ? 8.944   -4.132  1.567   1.00 0.00 ? 30 ALA A N    4  
ATOM 3733  C CA   . ALA A 1 30 ? 9.012   -3.833  0.142   1.00 0.00 ? 30 ALA A CA   4  
ATOM 3734  C C    . ALA A 1 30 ? 10.176  -4.565  -0.517  1.00 0.00 ? 30 ALA A C    4  
ATOM 3735  O O    . ALA A 1 30 ? 10.526  -4.289  -1.665  1.00 0.00 ? 30 ALA A O    4  
ATOM 3736  C CB   . ALA A 1 30 ? 9.138   -2.333  -0.077  1.00 0.00 ? 30 ALA A CB   4  
ATOM 3737  H H    . ALA A 1 30 ? 9.717   -3.933  2.135   1.00 0.00 ? 30 ALA A H    4  
ATOM 3738  H HA   . ALA A 1 30 ? 8.089   -4.163  -0.313  1.00 0.00 ? 30 ALA A HA   4  
ATOM 3739  H HB1  . ALA A 1 30 ? 8.368   -1.823  0.484   1.00 0.00 ? 30 ALA A HB1  4  
ATOM 3740  H HB2  . ALA A 1 30 ? 10.109  -2.000  0.258   1.00 0.00 ? 30 ALA A HB2  4  
ATOM 3741  H HB3  . ALA A 1 30 ? 9.023   -2.112  -1.128  1.00 0.00 ? 30 ALA A HB3  4  
ATOM 3742  N N    . TYR A 1 31 ? 10.773  -5.499  0.215   1.00 0.00 ? 31 TYR A N    4  
ATOM 3743  C CA   . TYR A 1 31 ? 11.901  -6.268  -0.298  1.00 0.00 ? 31 TYR A CA   4  
ATOM 3744  C C    . TYR A 1 31 ? 11.736  -7.752  0.018   1.00 0.00 ? 31 TYR A C    4  
ATOM 3745  O O    . TYR A 1 31 ? 12.681  -8.439  0.406   1.00 0.00 ? 31 TYR A O    4  
ATOM 3746  C CB   . TYR A 1 31 ? 13.211  -5.751  0.298   1.00 0.00 ? 31 TYR A CB   4  
ATOM 3747  C CG   . TYR A 1 31 ? 13.467  -4.287  0.019   1.00 0.00 ? 31 TYR A CG   4  
ATOM 3748  C CD1  . TYR A 1 31 ? 12.995  -3.303  0.879   1.00 0.00 ? 31 TYR A CD1  4  
ATOM 3749  C CD2  . TYR A 1 31 ? 14.181  -3.888  -1.104  1.00 0.00 ? 31 TYR A CD2  4  
ATOM 3750  C CE1  . TYR A 1 31 ? 13.226  -1.964  0.627   1.00 0.00 ? 31 TYR A CE1  4  
ATOM 3751  C CE2  . TYR A 1 31 ? 14.418  -2.552  -1.363  1.00 0.00 ? 31 TYR A CE2  4  
ATOM 3752  C CZ   . TYR A 1 31 ? 13.938  -1.594  -0.495  1.00 0.00 ? 31 TYR A CZ   4  
ATOM 3753  O OH   . TYR A 1 31 ? 14.171  -0.261  -0.748  1.00 0.00 ? 31 TYR A OH   4  
ATOM 3754  H H    . TYR A 1 31 ? 10.449  -5.674  1.123   1.00 0.00 ? 31 TYR A H    4  
ATOM 3755  H HA   . TYR A 1 31 ? 11.929  -6.141  -1.370  1.00 0.00 ? 31 TYR A HA   4  
ATOM 3756  H HB2  . TYR A 1 31 ? 13.190  -5.885  1.368   1.00 0.00 ? 31 TYR A HB2  4  
ATOM 3757  H HB3  . TYR A 1 31 ? 14.034  -6.316  -0.115  1.00 0.00 ? 31 TYR A HB3  4  
ATOM 3758  H HD1  . TYR A 1 31 ? 12.438  -3.596  1.757   1.00 0.00 ? 31 TYR A HD1  4  
ATOM 3759  H HD2  . TYR A 1 31 ? 14.556  -4.641  -1.783  1.00 0.00 ? 31 TYR A HD2  4  
ATOM 3760  H HE1  . TYR A 1 31 ? 12.851  -1.214  1.307   1.00 0.00 ? 31 TYR A HE1  4  
ATOM 3761  H HE2  . TYR A 1 31 ? 14.975  -2.261  -2.242  1.00 0.00 ? 31 TYR A HE2  4  
ATOM 3762  H HH   . TYR A 1 31 ? 13.680  0.274   -0.120  1.00 0.00 ? 31 TYR A HH   4  
ATOM 3763  N N    . PRO A 1 32 ? 10.506  -8.259  -0.153  1.00 0.00 ? 32 PRO A N    4  
ATOM 3764  C CA   . PRO A 1 32 ? 10.188  -9.666  0.107   1.00 0.00 ? 32 PRO A CA   4  
ATOM 3765  C C    . PRO A 1 32 ? 10.822  -10.602 -0.916  1.00 0.00 ? 32 PRO A C    4  
ATOM 3766  O O    . PRO A 1 32 ? 11.224  -10.175 -1.999  1.00 0.00 ? 32 PRO A O    4  
ATOM 3767  C CB   . PRO A 1 32 ? 8.661   -9.710  -0.003  1.00 0.00 ? 32 PRO A CB   4  
ATOM 3768  C CG   . PRO A 1 32 ? 8.312   -8.567  -0.892  1.00 0.00 ? 32 PRO A CG   4  
ATOM 3769  C CD   . PRO A 1 32 ? 9.333   -7.498  -0.612  1.00 0.00 ? 32 PRO A CD   4  
ATOM 3770  H HA   . PRO A 1 32 ? 10.488  -9.964  1.100   1.00 0.00 ? 32 PRO A HA   4  
ATOM 3771  H HB2  . PRO A 1 32 ? 8.356   -10.653 -0.433  1.00 0.00 ? 32 PRO A HB2  4  
ATOM 3772  H HB3  . PRO A 1 32 ? 8.223   -9.595  0.977   1.00 0.00 ? 32 PRO A HB3  4  
ATOM 3773  H HG2  . PRO A 1 32 ? 8.366   -8.875  -1.925  1.00 0.00 ? 32 PRO A HG2  4  
ATOM 3774  H HG3  . PRO A 1 32 ? 7.321   -8.209  -0.657  1.00 0.00 ? 32 PRO A HG3  4  
ATOM 3775  H HD2  . PRO A 1 32 ? 9.559   -6.947  -1.513  1.00 0.00 ? 32 PRO A HD2  4  
ATOM 3776  H HD3  . PRO A 1 32 ? 8.979   -6.832  0.161   1.00 0.00 ? 32 PRO A HD3  4  
ATOM 3777  N N    . LYS A 1 33 ? 10.908  -11.881 -0.567  1.00 0.00 ? 33 LYS A N    4  
ATOM 3778  C CA   . LYS A 1 33 ? 11.492  -12.880 -1.455  1.00 0.00 ? 33 LYS A CA   4  
ATOM 3779  C C    . LYS A 1 33 ? 10.408  -13.605 -2.246  1.00 0.00 ? 33 LYS A C    4  
ATOM 3780  O O    . LYS A 1 33 ? 9.222   -13.498 -1.934  1.00 0.00 ? 33 LYS A O    4  
ATOM 3781  C CB   . LYS A 1 33 ? 12.314  -13.889 -0.651  1.00 0.00 ? 33 LYS A CB   4  
ATOM 3782  C CG   . LYS A 1 33 ? 13.493  -13.270 0.079   1.00 0.00 ? 33 LYS A CG   4  
ATOM 3783  C CD   . LYS A 1 33 ? 14.622  -14.270 0.263   1.00 0.00 ? 33 LYS A CD   4  
ATOM 3784  C CE   . LYS A 1 33 ? 14.356  -15.202 1.435   1.00 0.00 ? 33 LYS A CE   4  
ATOM 3785  N NZ   . LYS A 1 33 ? 15.389  -16.270 1.541   1.00 0.00 ? 33 LYS A NZ   4  
ATOM 3786  H H    . LYS A 1 33 ? 10.570  -12.161 0.310   1.00 0.00 ? 33 LYS A H    4  
ATOM 3787  H HA   . LYS A 1 33 ? 12.144  -12.368 -2.147  1.00 0.00 ? 33 LYS A HA   4  
ATOM 3788  H HB2  . LYS A 1 33 ? 11.671  -14.358 0.079   1.00 0.00 ? 33 LYS A HB2  4  
ATOM 3789  H HB3  . LYS A 1 33 ? 12.691  -14.646 -1.324  1.00 0.00 ? 33 LYS A HB3  4  
ATOM 3790  H HG2  . LYS A 1 33 ? 13.859  -12.431 -0.494  1.00 0.00 ? 33 LYS A HG2  4  
ATOM 3791  H HG3  . LYS A 1 33 ? 13.164  -12.929 1.051   1.00 0.00 ? 33 LYS A HG3  4  
ATOM 3792  H HD2  . LYS A 1 33 ? 14.720  -14.860 -0.636  1.00 0.00 ? 33 LYS A HD2  4  
ATOM 3793  H HD3  . LYS A 1 33 ? 15.542  -13.732 0.445   1.00 0.00 ? 33 LYS A HD3  4  
ATOM 3794  H HE2  . LYS A 1 33 ? 14.354  -14.623 2.346   1.00 0.00 ? 33 LYS A HE2  4  
ATOM 3795  H HE3  . LYS A 1 33 ? 13.388  -15.662 1.300   1.00 0.00 ? 33 LYS A HE3  4  
ATOM 3796  H HZ1  . LYS A 1 33 ? 16.285  -15.867 1.882   1.00 0.00 ? 33 LYS A HZ1  4  
ATOM 3797  H HZ2  . LYS A 1 33 ? 15.550  -16.705 0.610   1.00 0.00 ? 33 LYS A HZ2  4  
ATOM 3798  H HZ3  . LYS A 1 33 ? 15.076  -17.005 2.206   1.00 0.00 ? 33 LYS A HZ3  4  
ATOM 3799  N N    . ASP A 1 34 ? 10.823  -14.344 -3.269  1.00 0.00 ? 34 ASP A N    4  
ATOM 3800  C CA   . ASP A 1 34 ? 9.887   -15.089 -4.103  1.00 0.00 ? 34 ASP A CA   4  
ATOM 3801  C C    . ASP A 1 34 ? 8.826   -15.776 -3.248  1.00 0.00 ? 34 ASP A C    4  
ATOM 3802  O O    . ASP A 1 34 ? 7.628   -15.628 -3.491  1.00 0.00 ? 34 ASP A O    4  
ATOM 3803  C CB   . ASP A 1 34 ? 10.634  -16.127 -4.942  1.00 0.00 ? 34 ASP A CB   4  
ATOM 3804  C CG   . ASP A 1 34 ? 11.797  -16.749 -4.194  1.00 0.00 ? 34 ASP A CG   4  
ATOM 3805  O OD1  . ASP A 1 34 ? 12.865  -16.107 -4.121  1.00 0.00 ? 34 ASP A OD1  4  
ATOM 3806  O OD2  . ASP A 1 34 ? 11.638  -17.877 -3.683  1.00 0.00 ? 34 ASP A OD2  4  
ATOM 3807  H H    . ASP A 1 34 ? 11.782  -14.389 -3.468  1.00 0.00 ? 34 ASP A H    4  
ATOM 3808  H HA   . ASP A 1 34 ? 9.400   -14.388 -4.764  1.00 0.00 ? 34 ASP A HA   4  
ATOM 3809  H HB2  . ASP A 1 34 ? 9.949   -16.914 -5.223  1.00 0.00 ? 34 ASP A HB2  4  
ATOM 3810  H HB3  . ASP A 1 34 ? 11.015  -15.652 -5.834  1.00 0.00 ? 34 ASP A HB3  4  
ATOM 3811  N N    . ASP A 1 35 ? 9.274   -16.528 -2.249  1.00 0.00 ? 35 ASP A N    4  
ATOM 3812  C CA   . ASP A 1 35 ? 8.364   -17.238 -1.359  1.00 0.00 ? 35 ASP A CA   4  
ATOM 3813  C C    . ASP A 1 35 ? 7.263   -16.310 -0.854  1.00 0.00 ? 35 ASP A C    4  
ATOM 3814  O O    . ASP A 1 35 ? 6.082   -16.653 -0.894  1.00 0.00 ? 35 ASP A O    4  
ATOM 3815  C CB   . ASP A 1 35 ? 9.131   -17.830 -0.176  1.00 0.00 ? 35 ASP A CB   4  
ATOM 3816  C CG   . ASP A 1 35 ? 8.493   -19.100 0.352   1.00 0.00 ? 35 ASP A CG   4  
ATOM 3817  O OD1  . ASP A 1 35 ? 8.080   -19.943 -0.472  1.00 0.00 ? 35 ASP A OD1  4  
ATOM 3818  O OD2  . ASP A 1 35 ? 8.407   -19.251 1.588   1.00 0.00 ? 35 ASP A OD2  4  
ATOM 3819  H H    . ASP A 1 35 ? 10.241  -16.607 -2.107  1.00 0.00 ? 35 ASP A H    4  
ATOM 3820  H HA   . ASP A 1 35 ? 7.910   -18.041 -1.919  1.00 0.00 ? 35 ASP A HA   4  
ATOM 3821  H HB2  . ASP A 1 35 ? 10.140  -18.059 -0.488  1.00 0.00 ? 35 ASP A HB2  4  
ATOM 3822  H HB3  . ASP A 1 35 ? 9.162   -17.104 0.624   1.00 0.00 ? 35 ASP A HB3  4  
ATOM 3823  N N    . GLU A 1 36 ? 7.661   -15.134 -0.377  1.00 0.00 ? 36 GLU A N    4  
ATOM 3824  C CA   . GLU A 1 36 ? 6.707   -14.157 0.137   1.00 0.00 ? 36 GLU A CA   4  
ATOM 3825  C C    . GLU A 1 36 ? 5.783   -13.663 -0.972  1.00 0.00 ? 36 GLU A C    4  
ATOM 3826  O O    . GLU A 1 36 ? 4.560   -13.671 -0.826  1.00 0.00 ? 36 GLU A O    4  
ATOM 3827  C CB   . GLU A 1 36 ? 7.445   -12.974 0.767   1.00 0.00 ? 36 GLU A CB   4  
ATOM 3828  C CG   . GLU A 1 36 ? 8.208   -13.335 2.030   1.00 0.00 ? 36 GLU A CG   4  
ATOM 3829  C CD   . GLU A 1 36 ? 7.293   -13.580 3.214   1.00 0.00 ? 36 GLU A CD   4  
ATOM 3830  O OE1  . GLU A 1 36 ? 6.308   -12.828 3.367   1.00 0.00 ? 36 GLU A OE1  4  
ATOM 3831  O OE2  . GLU A 1 36 ? 7.563   -14.521 3.988   1.00 0.00 ? 36 GLU A OE2  4  
ATOM 3832  H H    . GLU A 1 36 ? 8.616   -14.918 -0.372  1.00 0.00 ? 36 GLU A H    4  
ATOM 3833  H HA   . GLU A 1 36 ? 6.112   -14.643 0.896   1.00 0.00 ? 36 GLU A HA   4  
ATOM 3834  H HB2  . GLU A 1 36 ? 8.147   -12.579 0.047   1.00 0.00 ? 36 GLU A HB2  4  
ATOM 3835  H HB3  . GLU A 1 36 ? 6.726   -12.207 1.013   1.00 0.00 ? 36 GLU A HB3  4  
ATOM 3836  H HG2  . GLU A 1 36 ? 8.781   -14.232 1.846   1.00 0.00 ? 36 GLU A HG2  4  
ATOM 3837  H HG3  . GLU A 1 36 ? 8.880   -12.524 2.274   1.00 0.00 ? 36 GLU A HG3  4  
ATOM 3838  N N    . PHE A 1 37 ? 6.376   -13.232 -2.080  1.00 0.00 ? 37 PHE A N    4  
ATOM 3839  C CA   . PHE A 1 37 ? 5.607   -12.732 -3.214  1.00 0.00 ? 37 PHE A CA   4  
ATOM 3840  C C    . PHE A 1 37 ? 4.462   -13.682 -3.556  1.00 0.00 ? 37 PHE A C    4  
ATOM 3841  O O    . PHE A 1 37 ? 3.368   -13.247 -3.911  1.00 0.00 ? 37 PHE A O    4  
ATOM 3842  C CB   . PHE A 1 37 ? 6.514   -12.550 -4.432  1.00 0.00 ? 37 PHE A CB   4  
ATOM 3843  C CG   . PHE A 1 37 ? 7.127   -11.181 -4.524  1.00 0.00 ? 37 PHE A CG   4  
ATOM 3844  C CD1  . PHE A 1 37 ? 6.456   -10.148 -5.157  1.00 0.00 ? 37 PHE A CD1  4  
ATOM 3845  C CD2  . PHE A 1 37 ? 8.374   -10.928 -3.976  1.00 0.00 ? 37 PHE A CD2  4  
ATOM 3846  C CE1  . PHE A 1 37 ? 7.018   -8.888  -5.243  1.00 0.00 ? 37 PHE A CE1  4  
ATOM 3847  C CE2  . PHE A 1 37 ? 8.941   -9.671  -4.059  1.00 0.00 ? 37 PHE A CE2  4  
ATOM 3848  C CZ   . PHE A 1 37 ? 8.261   -8.649  -4.692  1.00 0.00 ? 37 PHE A CZ   4  
ATOM 3849  H H    . PHE A 1 37 ? 7.355   -13.251 -2.137  1.00 0.00 ? 37 PHE A H    4  
ATOM 3850  H HA   . PHE A 1 37 ? 5.194   -11.775 -2.937  1.00 0.00 ? 37 PHE A HA   4  
ATOM 3851  H HB2  . PHE A 1 37 ? 7.317   -13.270 -4.385  1.00 0.00 ? 37 PHE A HB2  4  
ATOM 3852  H HB3  . PHE A 1 37 ? 5.938   -12.717 -5.329  1.00 0.00 ? 37 PHE A HB3  4  
ATOM 3853  H HD1  . PHE A 1 37 ? 5.482   -10.333 -5.587  1.00 0.00 ? 37 PHE A HD1  4  
ATOM 3854  H HD2  . PHE A 1 37 ? 8.907   -11.727 -3.480  1.00 0.00 ? 37 PHE A HD2  4  
ATOM 3855  H HE1  . PHE A 1 37 ? 6.484   -8.091  -5.738  1.00 0.00 ? 37 PHE A HE1  4  
ATOM 3856  H HE2  . PHE A 1 37 ? 9.914   -9.487  -3.627  1.00 0.00 ? 37 PHE A HE2  4  
ATOM 3857  H HZ   . PHE A 1 37 ? 8.703   -7.666  -4.758  1.00 0.00 ? 37 PHE A HZ   4  
ATOM 3858  N N    . GLU A 1 38 ? 4.726   -14.980 -3.446  1.00 0.00 ? 38 GLU A N    4  
ATOM 3859  C CA   . GLU A 1 38 ? 3.718   -15.991 -3.745  1.00 0.00 ? 38 GLU A CA   4  
ATOM 3860  C C    . GLU A 1 38 ? 2.477   -15.795 -2.879  1.00 0.00 ? 38 GLU A C    4  
ATOM 3861  O O    . GLU A 1 38 ? 1.351   -15.964 -3.345  1.00 0.00 ? 38 GLU A O    4  
ATOM 3862  C CB   . GLU A 1 38 ? 4.290   -17.393 -3.525  1.00 0.00 ? 38 GLU A CB   4  
ATOM 3863  C CG   . GLU A 1 38 ? 5.122   -17.901 -4.691  1.00 0.00 ? 38 GLU A CG   4  
ATOM 3864  C CD   . GLU A 1 38 ? 4.280   -18.234 -5.907  1.00 0.00 ? 38 GLU A CD   4  
ATOM 3865  O OE1  . GLU A 1 38 ? 3.546   -19.243 -5.862  1.00 0.00 ? 38 GLU A OE1  4  
ATOM 3866  O OE2  . GLU A 1 38 ? 4.355   -17.486 -6.904  1.00 0.00 ? 38 GLU A OE2  4  
ATOM 3867  H H    . GLU A 1 38 ? 5.618   -15.265 -3.157  1.00 0.00 ? 38 GLU A H    4  
ATOM 3868  H HA   . GLU A 1 38 ? 3.439   -15.885 -4.782  1.00 0.00 ? 38 GLU A HA   4  
ATOM 3869  H HB2  . GLU A 1 38 ? 4.913   -17.381 -2.643  1.00 0.00 ? 38 GLU A HB2  4  
ATOM 3870  H HB3  . GLU A 1 38 ? 3.473   -18.081 -3.368  1.00 0.00 ? 38 GLU A HB3  4  
ATOM 3871  H HG2  . GLU A 1 38 ? 5.836   -17.139 -4.966  1.00 0.00 ? 38 GLU A HG2  4  
ATOM 3872  H HG3  . GLU A 1 38 ? 5.649   -18.791 -4.381  1.00 0.00 ? 38 GLU A HG3  4  
ATOM 3873  N N    . GLN A 1 39 ? 2.693   -15.438 -1.617  1.00 0.00 ? 39 GLN A N    4  
ATOM 3874  C CA   . GLN A 1 39 ? 1.593   -15.220 -0.686  1.00 0.00 ? 39 GLN A CA   4  
ATOM 3875  C C    . GLN A 1 39 ? 0.605   -14.200 -1.240  1.00 0.00 ? 39 GLN A C    4  
ATOM 3876  O O    . GLN A 1 39 ? -0.610  -14.379 -1.143  1.00 0.00 ? 39 GLN A O    4  
ATOM 3877  C CB   . GLN A 1 39 ? 2.127   -14.748 0.667   1.00 0.00 ? 39 GLN A CB   4  
ATOM 3878  C CG   . GLN A 1 39 ? 3.040   -15.756 1.346   1.00 0.00 ? 39 GLN A CG   4  
ATOM 3879  C CD   . GLN A 1 39 ? 2.276   -16.900 1.982   1.00 0.00 ? 39 GLN A CD   4  
ATOM 3880  O OE1  . GLN A 1 39 ? 1.068   -17.041 1.783   1.00 0.00 ? 39 GLN A OE1  4  
ATOM 3881  N NE2  . GLN A 1 39 ? 2.976   -17.726 2.750   1.00 0.00 ? 39 GLN A NE2  4  
ATOM 3882  H H    . GLN A 1 39 ? 3.614   -15.319 -1.305  1.00 0.00 ? 39 GLN A H    4  
ATOM 3883  H HA   . GLN A 1 39 ? 1.081   -16.161 -0.551  1.00 0.00 ? 39 GLN A HA   4  
ATOM 3884  H HB2  . GLN A 1 39 ? 2.682   -13.833 0.522   1.00 0.00 ? 39 GLN A HB2  4  
ATOM 3885  H HB3  . GLN A 1 39 ? 1.292   -14.553 1.323   1.00 0.00 ? 39 GLN A HB3  4  
ATOM 3886  H HG2  . GLN A 1 39 ? 3.719   -16.161 0.610   1.00 0.00 ? 39 GLN A HG2  4  
ATOM 3887  H HG3  . GLN A 1 39 ? 3.606   -15.249 2.115   1.00 0.00 ? 39 GLN A HG3  4  
ATOM 3888  H HE21 . GLN A 1 39 ? 3.934   -17.551 2.864   1.00 0.00 ? 39 GLN A HE21 4  
ATOM 3889  H HE22 . GLN A 1 39 ? 2.507   -18.474 3.174   1.00 0.00 ? 39 GLN A HE22 4  
ATOM 3890  N N    . LEU A 1 40 ? 1.132   -13.128 -1.821  1.00 0.00 ? 40 LEU A N    4  
ATOM 3891  C CA   . LEU A 1 40 ? 0.297   -12.077 -2.391  1.00 0.00 ? 40 LEU A CA   4  
ATOM 3892  C C    . LEU A 1 40 ? -0.341  -12.537 -3.698  1.00 0.00 ? 40 LEU A C    4  
ATOM 3893  O O    . LEU A 1 40 ? -1.516  -12.275 -3.953  1.00 0.00 ? 40 LEU A O    4  
ATOM 3894  C CB   . LEU A 1 40 ? 1.125   -10.813 -2.631  1.00 0.00 ? 40 LEU A CB   4  
ATOM 3895  C CG   . LEU A 1 40 ? 1.706   -10.145 -1.385  1.00 0.00 ? 40 LEU A CG   4  
ATOM 3896  C CD1  . LEU A 1 40 ? 3.011   -9.439  -1.717  1.00 0.00 ? 40 LEU A CD1  4  
ATOM 3897  C CD2  . LEU A 1 40 ? 0.705   -9.166  -0.789  1.00 0.00 ? 40 LEU A CD2  4  
ATOM 3898  H H    . LEU A 1 40 ? 2.107   -13.040 -1.868  1.00 0.00 ? 40 LEU A H    4  
ATOM 3899  H HA   . LEU A 1 40 ? -0.486  -11.855 -1.681  1.00 0.00 ? 40 LEU A HA   4  
ATOM 3900  H HB2  . LEU A 1 40 ? 1.947   -11.075 -3.279  1.00 0.00 ? 40 LEU A HB2  4  
ATOM 3901  H HB3  . LEU A 1 40 ? 0.491   -10.093 -3.129  1.00 0.00 ? 40 LEU A HB3  4  
ATOM 3902  H HG   . LEU A 1 40 ? 1.917   -10.902 -0.643  1.00 0.00 ? 40 LEU A HG   4  
ATOM 3903  H HD11 . LEU A 1 40 ? 3.149   -8.603  -1.048  1.00 0.00 ? 40 LEU A HD11 4  
ATOM 3904  H HD12 . LEU A 1 40 ? 2.978   -9.083  -2.736  1.00 0.00 ? 40 LEU A HD12 4  
ATOM 3905  H HD13 . LEU A 1 40 ? 3.833   -10.130 -1.604  1.00 0.00 ? 40 LEU A HD13 4  
ATOM 3906  H HD21 . LEU A 1 40 ? -0.276  -9.617  -0.777  1.00 0.00 ? 40 LEU A HD21 4  
ATOM 3907  H HD22 . LEU A 1 40 ? 0.680   -8.267  -1.388  1.00 0.00 ? 40 LEU A HD22 4  
ATOM 3908  H HD23 . LEU A 1 40 ? 1.000   -8.919  0.220   1.00 0.00 ? 40 LEU A HD23 4  
ATOM 3909  N N    . SER A 1 41 ? 0.442   -13.226 -4.522  1.00 0.00 ? 41 SER A N    4  
ATOM 3910  C CA   . SER A 1 41 ? -0.045  -13.722 -5.803  1.00 0.00 ? 41 SER A CA   4  
ATOM 3911  C C    . SER A 1 41 ? -1.167  -14.736 -5.603  1.00 0.00 ? 41 SER A C    4  
ATOM 3912  O O    . SER A 1 41 ? -2.107  -14.803 -6.394  1.00 0.00 ? 41 SER A O    4  
ATOM 3913  C CB   . SER A 1 41 ? 1.098   -14.359 -6.596  1.00 0.00 ? 41 SER A CB   4  
ATOM 3914  O OG   . SER A 1 41 ? 0.610   -15.338 -7.497  1.00 0.00 ? 41 SER A OG   4  
ATOM 3915  H H    . SER A 1 41 ? 1.371   -13.403 -4.262  1.00 0.00 ? 41 SER A H    4  
ATOM 3916  H HA   . SER A 1 41 ? -0.432  -12.880 -6.359  1.00 0.00 ? 41 SER A HA   4  
ATOM 3917  H HB2  . SER A 1 41 ? 1.613   -13.595 -7.157  1.00 0.00 ? 41 SER A HB2  4  
ATOM 3918  H HB3  . SER A 1 41 ? 1.788   -14.830 -5.911  1.00 0.00 ? 41 SER A HB3  4  
ATOM 3919  H HG   . SER A 1 41 ? 0.713   -16.210 -7.110  1.00 0.00 ? 41 SER A HG   4  
ATOM 3920  N N    . ASN A 1 42 ? -1.061  -15.523 -4.537  1.00 0.00 ? 42 ASN A N    4  
ATOM 3921  C CA   . ASN A 1 42 ? -2.066  -16.535 -4.231  1.00 0.00 ? 42 ASN A CA   4  
ATOM 3922  C C    . ASN A 1 42 ? -3.336  -15.892 -3.682  1.00 0.00 ? 42 ASN A C    4  
ATOM 3923  O O    . ASN A 1 42 ? -4.444  -16.364 -3.938  1.00 0.00 ? 42 ASN A O    4  
ATOM 3924  C CB   . ASN A 1 42 ? -1.514  -17.543 -3.221  1.00 0.00 ? 42 ASN A CB   4  
ATOM 3925  C CG   . ASN A 1 42 ? -0.697  -18.636 -3.882  1.00 0.00 ? 42 ASN A CG   4  
ATOM 3926  O OD1  . ASN A 1 42 ? -1.247  -19.575 -4.458  1.00 0.00 ? 42 ASN A OD1  4  
ATOM 3927  N ND2  . ASN A 1 42 ? 0.623   -18.519 -3.802  1.00 0.00 ? 42 ASN A ND2  4  
ATOM 3928  H H    . ASN A 1 42 ? -0.288  -15.422 -3.943  1.00 0.00 ? 42 ASN A H    4  
ATOM 3929  H HA   . ASN A 1 42 ? -2.305  -17.052 -5.148  1.00 0.00 ? 42 ASN A HA   4  
ATOM 3930  H HB2  . ASN A 1 42 ? -0.881  -17.025 -2.515  1.00 0.00 ? 42 ASN A HB2  4  
ATOM 3931  H HB3  . ASN A 1 42 ? -2.336  -18.002 -2.693  1.00 0.00 ? 42 ASN A HB3  4  
ATOM 3932  H HD21 . ASN A 1 42 ? 0.992   -17.745 -3.327  1.00 0.00 ? 42 ASN A HD21 4  
ATOM 3933  H HD22 . ASN A 1 42 ? 1.175   -19.212 -4.222  1.00 0.00 ? 42 ASN A HD22 4  
ATOM 3934  N N    . LEU A 1 43 ? -3.167  -14.812 -2.928  1.00 0.00 ? 43 LEU A N    4  
ATOM 3935  C CA   . LEU A 1 43 ? -4.299  -14.103 -2.343  1.00 0.00 ? 43 LEU A CA   4  
ATOM 3936  C C    . LEU A 1 43 ? -5.042  -13.294 -3.402  1.00 0.00 ? 43 LEU A C    4  
ATOM 3937  O O    . LEU A 1 43 ? -6.236  -13.495 -3.627  1.00 0.00 ? 43 LEU A O    4  
ATOM 3938  C CB   . LEU A 1 43 ? -3.823  -13.179 -1.220  1.00 0.00 ? 43 LEU A CB   4  
ATOM 3939  C CG   . LEU A 1 43 ? -4.806  -12.092 -0.783  1.00 0.00 ? 43 LEU A CG   4  
ATOM 3940  C CD1  . LEU A 1 43 ? -6.085  -12.714 -0.246  1.00 0.00 ? 43 LEU A CD1  4  
ATOM 3941  C CD2  . LEU A 1 43 ? -4.170  -11.187 0.262   1.00 0.00 ? 43 LEU A CD2  4  
ATOM 3942  H H    . LEU A 1 43 ? -2.260  -14.483 -2.759  1.00 0.00 ? 43 LEU A H    4  
ATOM 3943  H HA   . LEU A 1 43 ? -4.974  -14.838 -1.930  1.00 0.00 ? 43 LEU A HA   4  
ATOM 3944  H HB2  . LEU A 1 43 ? -3.603  -13.790 -0.359  1.00 0.00 ? 43 LEU A HB2  4  
ATOM 3945  H HB3  . LEU A 1 43 ? -2.918  -12.692 -1.556  1.00 0.00 ? 43 LEU A HB3  4  
ATOM 3946  H HG   . LEU A 1 43 ? -5.065  -11.484 -1.639  1.00 0.00 ? 43 LEU A HG   4  
ATOM 3947  H HD11 . LEU A 1 43 ? -5.858  -13.306 0.628   1.00 0.00 ? 43 LEU A HD11 4  
ATOM 3948  H HD12 . LEU A 1 43 ? -6.525  -13.345 -1.004  1.00 0.00 ? 43 LEU A HD12 4  
ATOM 3949  H HD13 . LEU A 1 43 ? -6.782  -11.932 0.019   1.00 0.00 ? 43 LEU A HD13 4  
ATOM 3950  H HD21 . LEU A 1 43 ? -3.095  -11.250 0.187   1.00 0.00 ? 43 LEU A HD21 4  
ATOM 3951  H HD22 . LEU A 1 43 ? -4.481  -11.503 1.248   1.00 0.00 ? 43 LEU A HD22 4  
ATOM 3952  H HD23 . LEU A 1 43 ? -4.484  -10.168 0.095   1.00 0.00 ? 43 LEU A HD23 4  
ATOM 3953  N N    . LEU A 1 44 ? -4.327  -12.382 -4.051  1.00 0.00 ? 44 LEU A N    4  
ATOM 3954  C CA   . LEU A 1 44 ? -4.917  -11.545 -5.090  1.00 0.00 ? 44 LEU A CA   4  
ATOM 3955  C C    . LEU A 1 44 ? -5.051  -12.315 -6.400  1.00 0.00 ? 44 LEU A C    4  
ATOM 3956  O O    . LEU A 1 44 ? -5.634  -11.821 -7.364  1.00 0.00 ? 44 LEU A O    4  
ATOM 3957  C CB   . LEU A 1 44 ? -4.066  -10.292 -5.306  1.00 0.00 ? 44 LEU A CB   4  
ATOM 3958  C CG   . LEU A 1 44 ? -3.736  -9.480  -4.053  1.00 0.00 ? 44 LEU A CG   4  
ATOM 3959  C CD1  . LEU A 1 44 ? -2.625  -8.483  -4.341  1.00 0.00 ? 44 LEU A CD1  4  
ATOM 3960  C CD2  . LEU A 1 44 ? -4.977  -8.765  -3.539  1.00 0.00 ? 44 LEU A CD2  4  
ATOM 3961  H H    . LEU A 1 44 ? -3.380  -12.269 -3.828  1.00 0.00 ? 44 LEU A H    4  
ATOM 3962  H HA   . LEU A 1 44 ? -5.901  -11.249 -4.757  1.00 0.00 ? 44 LEU A HA   4  
ATOM 3963  H HB2  . LEU A 1 44 ? -3.135  -10.598 -5.756  1.00 0.00 ? 44 LEU A HB2  4  
ATOM 3964  H HB3  . LEU A 1 44 ? -4.599  -9.646  -5.989  1.00 0.00 ? 44 LEU A HB3  4  
ATOM 3965  H HG   . LEU A 1 44 ? -3.390  -10.150 -3.278  1.00 0.00 ? 44 LEU A HG   4  
ATOM 3966  H HD11 . LEU A 1 44 ? -3.003  -7.695  -4.975  1.00 0.00 ? 44 LEU A HD11 4  
ATOM 3967  H HD12 . LEU A 1 44 ? -1.809  -8.986  -4.839  1.00 0.00 ? 44 LEU A HD12 4  
ATOM 3968  H HD13 . LEU A 1 44 ? -2.272  -8.060  -3.411  1.00 0.00 ? 44 LEU A HD13 4  
ATOM 3969  H HD21 . LEU A 1 44 ? -4.688  -7.837  -3.067  1.00 0.00 ? 44 LEU A HD21 4  
ATOM 3970  H HD22 . LEU A 1 44 ? -5.482  -9.392  -2.818  1.00 0.00 ? 44 LEU A HD22 4  
ATOM 3971  H HD23 . LEU A 1 44 ? -5.641  -8.557  -4.364  1.00 0.00 ? 44 LEU A HD23 4  
ATOM 3972  N N    . ASN A 1 45 ? -4.508  -13.528 -6.425  1.00 0.00 ? 45 ASN A N    4  
ATOM 3973  C CA   . ASN A 1 45 ? -4.569  -14.367 -7.616  1.00 0.00 ? 45 ASN A CA   4  
ATOM 3974  C C    . ASN A 1 45 ? -3.877  -13.689 -8.795  1.00 0.00 ? 45 ASN A C    4  
ATOM 3975  O O    . ASN A 1 45 ? -4.303  -13.828 -9.943  1.00 0.00 ? 45 ASN A O    4  
ATOM 3976  C CB   . ASN A 1 45 ? -6.024  -14.677 -7.974  1.00 0.00 ? 45 ASN A CB   4  
ATOM 3977  C CG   . ASN A 1 45 ? -6.527  -15.940 -7.302  1.00 0.00 ? 45 ASN A CG   4  
ATOM 3978  O OD1  . ASN A 1 45 ? -7.495  -15.909 -6.542  1.00 0.00 ? 45 ASN A OD1  4  
ATOM 3979  N ND2  . ASN A 1 45 ? -5.871  -17.060 -7.580  1.00 0.00 ? 45 ASN A ND2  4  
ATOM 3980  H H    . ASN A 1 45 ? -4.056  -13.867 -5.624  1.00 0.00 ? 45 ASN A H    4  
ATOM 3981  H HA   . ASN A 1 45 ? -4.056  -15.291 -7.397  1.00 0.00 ? 45 ASN A HA   4  
ATOM 3982  H HB2  . ASN A 1 45 ? -6.648  -13.853 -7.661  1.00 0.00 ? 45 ASN A HB2  4  
ATOM 3983  H HB3  . ASN A 1 45 ? -6.107  -14.802 -9.043  1.00 0.00 ? 45 ASN A HB3  4  
ATOM 3984  H HD21 . ASN A 1 45 ? -5.108  -17.010 -8.195  1.00 0.00 ? 45 ASN A HD21 4  
ATOM 3985  H HD22 . ASN A 1 45 ? -6.175  -17.892 -7.160  1.00 0.00 ? 45 ASN A HD22 4  
ATOM 3986  N N    . LEU A 1 46 ? -2.809  -12.955 -8.505  1.00 0.00 ? 46 LEU A N    4  
ATOM 3987  C CA   . LEU A 1 46 ? -2.057  -12.256 -9.541  1.00 0.00 ? 46 LEU A CA   4  
ATOM 3988  C C    . LEU A 1 46 ? -0.639  -12.807 -9.651  1.00 0.00 ? 46 LEU A C    4  
ATOM 3989  O O    . LEU A 1 46 ? -0.061  -13.299 -8.682  1.00 0.00 ? 46 LEU A O    4  
ATOM 3990  C CB   . LEU A 1 46 ? -2.011  -10.756 -9.241  1.00 0.00 ? 46 LEU A CB   4  
ATOM 3991  C CG   . LEU A 1 46 ? -3.362  -10.044 -9.174  1.00 0.00 ? 46 LEU A CG   4  
ATOM 3992  C CD1  . LEU A 1 46 ? -3.194  -8.628  -8.645  1.00 0.00 ? 46 LEU A CD1  4  
ATOM 3993  C CD2  . LEU A 1 46 ? -4.026  -10.029 -10.543 1.00 0.00 ? 46 LEU A CD2  4  
ATOM 3994  H H    . LEU A 1 46 ? -2.517  -12.882 -7.573  1.00 0.00 ? 46 LEU A H    4  
ATOM 3995  H HA   . LEU A 1 46 ? -2.564  -12.411 -10.481 1.00 0.00 ? 46 LEU A HA   4  
ATOM 3996  H HB2  . LEU A 1 46 ? -1.521  -10.624 -8.288  1.00 0.00 ? 46 LEU A HB2  4  
ATOM 3997  H HB3  . LEU A 1 46 ? -1.424  -10.283 -10.015 1.00 0.00 ? 46 LEU A HB3  4  
ATOM 3998  H HG   . LEU A 1 46 ? -4.011  -10.578 -8.493  1.00 0.00 ? 46 LEU A HG   4  
ATOM 3999  H HD11 . LEU A 1 46 ? -4.011  -8.392  -7.982  1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4000  H HD12 . LEU A 1 46 ? -3.189  -7.933  -9.473  1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4001  H HD13 . LEU A 1 46 ? -2.260  -8.553  -8.108  1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4002  H HD21 . LEU A 1 46 ? -3.910  -10.996 -11.009 1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4003  H HD22 . LEU A 1 46 ? -3.560  -9.274  -11.161 1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4004  H HD23 . LEU A 1 46 ? -5.076  -9.805  -10.432 1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4005  N N    . PRO A 1 47 ? -0.063  -12.722 -10.859 1.00 0.00 ? 47 PRO A N    4  
ATOM 4006  C CA   . PRO A 1 47 ? 1.296   -13.204 -11.124 1.00 0.00 ? 47 PRO A CA   4  
ATOM 4007  C C    . PRO A 1 47 ? 2.359   -12.345 -10.448 1.00 0.00 ? 47 PRO A C    4  
ATOM 4008  O O    . PRO A 1 47 ? 2.318   -11.116 -10.521 1.00 0.00 ? 47 PRO A O    4  
ATOM 4009  C CB   . PRO A 1 47 ? 1.417   -13.105 -12.647 1.00 0.00 ? 47 PRO A CB   4  
ATOM 4010  C CG   . PRO A 1 47 ? 0.447   -12.044 -13.035 1.00 0.00 ? 47 PRO A CG   4  
ATOM 4011  C CD   . PRO A 1 47 ? -0.693  -12.147 -12.059 1.00 0.00 ? 47 PRO A CD   4  
ATOM 4012  H HA   . PRO A 1 47 ? 1.418   -14.233 -10.818 1.00 0.00 ? 47 PRO A HA   4  
ATOM 4013  H HB2  . PRO A 1 47 ? 2.429   -12.833 -12.913 1.00 0.00 ? 47 PRO A HB2  4  
ATOM 4014  H HB3  . PRO A 1 47 ? 1.164   -14.054 -13.094 1.00 0.00 ? 47 PRO A HB3  4  
ATOM 4015  H HG2  . PRO A 1 47 ? 0.915   -11.074 -12.964 1.00 0.00 ? 47 PRO A HG2  4  
ATOM 4016  H HG3  . PRO A 1 47 ? 0.095   -12.219 -14.041 1.00 0.00 ? 47 PRO A HG3  4  
ATOM 4017  H HD2  . PRO A 1 47 ? -1.100  -11.169 -11.850 1.00 0.00 ? 47 PRO A HD2  4  
ATOM 4018  H HD3  . PRO A 1 47 ? -1.460  -12.803 -12.443 1.00 0.00 ? 47 PRO A HD3  4  
ATOM 4019  N N    . THR A 1 48 ? 3.311   -12.998 -9.790  1.00 0.00 ? 48 THR A N    4  
ATOM 4020  C CA   . THR A 1 48 ? 4.385   -12.294 -9.100  1.00 0.00 ? 48 THR A CA   4  
ATOM 4021  C C    . THR A 1 48 ? 4.963   -11.185 -9.971  1.00 0.00 ? 48 THR A C    4  
ATOM 4022  O O    . THR A 1 48 ? 5.224   -10.080 -9.494  1.00 0.00 ? 48 THR A O    4  
ATOM 4023  C CB   . THR A 1 48 ? 5.518   -13.256 -8.695  1.00 0.00 ? 48 THR A CB   4  
ATOM 4024  O OG1  . THR A 1 48 ? 5.783   -14.176 -9.759  1.00 0.00 ? 48 THR A OG1  4  
ATOM 4025  C CG2  . THR A 1 48 ? 5.151   -14.022 -7.433  1.00 0.00 ? 48 THR A CG2  4  
ATOM 4026  H H    . THR A 1 48 ? 3.290   -13.978 -9.768  1.00 0.00 ? 48 THR A H    4  
ATOM 4027  H HA   . THR A 1 48 ? 3.974   -11.856 -8.202  1.00 0.00 ? 48 THR A HA   4  
ATOM 4028  H HB   . THR A 1 48 ? 6.409   -12.676 -8.499  1.00 0.00 ? 48 THR A HB   4  
ATOM 4029  H HG1  . THR A 1 48 ? 5.019   -14.742 -9.890  1.00 0.00 ? 48 THR A HG1  4  
ATOM 4030  H HG21 . THR A 1 48 ? 4.668   -13.356 -6.734  1.00 0.00 ? 48 THR A HG21 4  
ATOM 4031  H HG22 . THR A 1 48 ? 6.046   -14.427 -6.985  1.00 0.00 ? 48 THR A HG22 4  
ATOM 4032  H HG23 . THR A 1 48 ? 4.478   -14.828 -7.685  1.00 0.00 ? 48 THR A HG23 4  
ATOM 4033  N N    . ARG A 1 49 ? 5.160   -11.485 -11.251 1.00 0.00 ? 49 ARG A N    4  
ATOM 4034  C CA   . ARG A 1 49 ? 5.708   -10.512 -12.189 1.00 0.00 ? 49 ARG A CA   4  
ATOM 4035  C C    . ARG A 1 49 ? 4.957   -9.187  -12.098 1.00 0.00 ? 49 ARG A C    4  
ATOM 4036  O O    . ARG A 1 49 ? 5.543   -8.117  -12.261 1.00 0.00 ? 49 ARG A O    4  
ATOM 4037  C CB   . ARG A 1 49 ? 5.638   -11.054 -13.617 1.00 0.00 ? 49 ARG A CB   4  
ATOM 4038  C CG   . ARG A 1 49 ? 4.295   -10.822 -14.292 1.00 0.00 ? 49 ARG A CG   4  
ATOM 4039  C CD   . ARG A 1 49 ? 4.266   -9.494  -15.031 1.00 0.00 ? 49 ARG A CD   4  
ATOM 4040  N NE   . ARG A 1 49 ? 4.979   -9.560  -16.304 1.00 0.00 ? 49 ARG A NE   4  
ATOM 4041  C CZ   . ARG A 1 49 ? 4.517   -10.199 -17.373 1.00 0.00 ? 49 ARG A CZ   4  
ATOM 4042  N NH1  . ARG A 1 49 ? 3.348   -10.822 -17.323 1.00 0.00 ? 49 ARG A NH1  4  
ATOM 4043  N NH2  . ARG A 1 49 ? 5.224   -10.214 -18.495 1.00 0.00 ? 49 ARG A NH2  4  
ATOM 4044  H H    . ARG A 1 49 ? 4.932   -12.383 -11.572 1.00 0.00 ? 49 ARG A H    4  
ATOM 4045  H HA   . ARG A 1 49 ? 6.742   -10.345 -11.927 1.00 0.00 ? 49 ARG A HA   4  
ATOM 4046  H HB2  . ARG A 1 49 ? 6.402   -10.573 -14.211 1.00 0.00 ? 49 ARG A HB2  4  
ATOM 4047  H HB3  . ARG A 1 49 ? 5.826   -12.117 -13.596 1.00 0.00 ? 49 ARG A HB3  4  
ATOM 4048  H HG2  . ARG A 1 49 ? 4.115   -11.619 -14.998 1.00 0.00 ? 49 ARG A HG2  4  
ATOM 4049  H HG3  . ARG A 1 49 ? 3.521   -10.823 -13.539 1.00 0.00 ? 49 ARG A HG3  4  
ATOM 4050  H HD2  . ARG A 1 49 ? 3.237   -9.225  -15.220 1.00 0.00 ? 49 ARG A HD2  4  
ATOM 4051  H HD3  . ARG A 1 49 ? 4.727   -8.741  -14.409 1.00 0.00 ? 49 ARG A HD3  4  
ATOM 4052  H HE   . ARG A 1 49 ? 5.845   -9.105  -16.363 1.00 0.00 ? 49 ARG A HE   4  
ATOM 4053  H HH11 . ARG A 1 49 ? 2.813   -10.812 -16.479 1.00 0.00 ? 49 ARG A HH11 4  
ATOM 4054  H HH12 . ARG A 1 49 ? 3.002   -11.302 -18.130 1.00 0.00 ? 49 ARG A HH12 4  
ATOM 4055  H HH21 . ARG A 1 49 ? 6.106   -9.744  -18.537 1.00 0.00 ? 49 ARG A HH21 4  
ATOM 4056  H HH22 . ARG A 1 49 ? 4.876   -10.695 -19.299 1.00 0.00 ? 49 ARG A HH22 4  
ATOM 4057  N N    . VAL A 1 50 ? 3.656   -9.267  -11.838 1.00 0.00 ? 50 VAL A N    4  
ATOM 4058  C CA   . VAL A 1 50 ? 2.824   -8.075  -11.725 1.00 0.00 ? 50 VAL A CA   4  
ATOM 4059  C C    . VAL A 1 50 ? 3.024   -7.390  -10.377 1.00 0.00 ? 50 VAL A C    4  
ATOM 4060  O O    . VAL A 1 50 ? 3.035   -6.162  -10.289 1.00 0.00 ? 50 VAL A O    4  
ATOM 4061  C CB   . VAL A 1 50 ? 1.332   -8.412  -11.900 1.00 0.00 ? 50 VAL A CB   4  
ATOM 4062  C CG1  . VAL A 1 50 ? 0.463   -7.279  -11.377 1.00 0.00 ? 50 VAL A CG1  4  
ATOM 4063  C CG2  . VAL A 1 50 ? 1.020   -8.704  -13.360 1.00 0.00 ? 50 VAL A CG2  4  
ATOM 4064  H H    . VAL A 1 50 ? 3.246   -10.149 -11.718 1.00 0.00 ? 50 VAL A H    4  
ATOM 4065  H HA   . VAL A 1 50 ? 3.112   -7.391  -12.511 1.00 0.00 ? 50 VAL A HA   4  
ATOM 4066  H HB   . VAL A 1 50 ? 1.114   -9.299  -11.324 1.00 0.00 ? 50 VAL A HB   4  
ATOM 4067  H HG11 . VAL A 1 50 ? -0.578  -7.528  -11.522 1.00 0.00 ? 50 VAL A HG11 4  
ATOM 4068  H HG12 . VAL A 1 50 ? 0.656   -7.134  -10.324 1.00 0.00 ? 50 VAL A HG12 4  
ATOM 4069  H HG13 . VAL A 1 50 ? 0.693   -6.371  -11.914 1.00 0.00 ? 50 VAL A HG13 4  
ATOM 4070  H HG21 . VAL A 1 50 ? 0.903   -7.773  -13.895 1.00 0.00 ? 50 VAL A HG21 4  
ATOM 4071  H HG22 . VAL A 1 50 ? 1.831   -9.269  -13.796 1.00 0.00 ? 50 VAL A HG22 4  
ATOM 4072  H HG23 . VAL A 1 50 ? 0.106   -9.275  -13.427 1.00 0.00 ? 50 VAL A HG23 4  
ATOM 4073  N N    . ILE A 1 51 ? 3.183   -8.193  -9.331  1.00 0.00 ? 51 ILE A N    4  
ATOM 4074  C CA   . ILE A 1 51 ? 3.385   -7.665  -7.987  1.00 0.00 ? 51 ILE A CA   4  
ATOM 4075  C C    . ILE A 1 51 ? 4.790   -7.094  -7.826  1.00 0.00 ? 51 ILE A C    4  
ATOM 4076  O O    . ILE A 1 51 ? 5.018   -6.199  -7.012  1.00 0.00 ? 51 ILE A O    4  
ATOM 4077  C CB   . ILE A 1 51 ? 3.157   -8.748  -6.916  1.00 0.00 ? 51 ILE A CB   4  
ATOM 4078  C CG1  . ILE A 1 51 ? 1.869   -9.521  -7.207  1.00 0.00 ? 51 ILE A CG1  4  
ATOM 4079  C CG2  . ILE A 1 51 ? 3.104   -8.120  -5.531  1.00 0.00 ? 51 ILE A CG2  4  
ATOM 4080  C CD1  . ILE A 1 51 ? 1.620   -10.662 -6.246  1.00 0.00 ? 51 ILE A CD1  4  
ATOM 4081  H H    . ILE A 1 51 ? 3.165   -9.163  -9.465  1.00 0.00 ? 51 ILE A H    4  
ATOM 4082  H HA   . ILE A 1 51 ? 2.666   -6.874  -7.829  1.00 0.00 ? 51 ILE A HA   4  
ATOM 4083  H HB   . ILE A 1 51 ? 3.992   -9.431  -6.943  1.00 0.00 ? 51 ILE A HB   4  
ATOM 4084  H HG12 . ILE A 1 51 ? 1.030   -8.846  -7.145  1.00 0.00 ? 51 ILE A HG12 4  
ATOM 4085  H HG13 . ILE A 1 51 ? 1.922   -9.931  -8.205  1.00 0.00 ? 51 ILE A HG13 4  
ATOM 4086  H HG21 . ILE A 1 51 ? 2.081   -7.871  -5.288  1.00 0.00 ? 51 ILE A HG21 4  
ATOM 4087  H HG22 . ILE A 1 51 ? 3.485   -8.821  -4.804  1.00 0.00 ? 51 ILE A HG22 4  
ATOM 4088  H HG23 . ILE A 1 51 ? 3.705   -7.224  -5.518  1.00 0.00 ? 51 ILE A HG23 4  
ATOM 4089  H HD11 . ILE A 1 51 ? 1.995   -10.399 -5.269  1.00 0.00 ? 51 ILE A HD11 4  
ATOM 4090  H HD12 . ILE A 1 51 ? 0.560   -10.857 -6.186  1.00 0.00 ? 51 ILE A HD12 4  
ATOM 4091  H HD13 . ILE A 1 51 ? 2.128   -11.548 -6.600  1.00 0.00 ? 51 ILE A HD13 4  
ATOM 4092  N N    . VAL A 1 52 ? 5.728   -7.616  -8.609  1.00 0.00 ? 52 VAL A N    4  
ATOM 4093  C CA   . VAL A 1 52 ? 7.111   -7.156  -8.556  1.00 0.00 ? 52 VAL A CA   4  
ATOM 4094  C C    . VAL A 1 52 ? 7.250   -5.762  -9.156  1.00 0.00 ? 52 VAL A C    4  
ATOM 4095  O O    . VAL A 1 52 ? 7.772   -4.848  -8.516  1.00 0.00 ? 52 VAL A O    4  
ATOM 4096  C CB   . VAL A 1 52 ? 8.052   -8.120  -9.303  1.00 0.00 ? 52 VAL A CB   4  
ATOM 4097  C CG1  . VAL A 1 52 ? 9.475   -7.582  -9.307  1.00 0.00 ? 52 VAL A CG1  4  
ATOM 4098  C CG2  . VAL A 1 52 ? 7.999   -9.507  -8.678  1.00 0.00 ? 52 VAL A CG2  4  
ATOM 4099  H H    . VAL A 1 52 ? 5.485   -8.327  -9.238  1.00 0.00 ? 52 VAL A H    4  
ATOM 4100  H HA   . VAL A 1 52 ? 7.413   -7.124  -7.519  1.00 0.00 ? 52 VAL A HA   4  
ATOM 4101  H HB   . VAL A 1 52 ? 7.717   -8.197  -10.327 1.00 0.00 ? 52 VAL A HB   4  
ATOM 4102  H HG11 . VAL A 1 52 ? 9.942   -7.794  -8.356  1.00 0.00 ? 52 VAL A HG11 4  
ATOM 4103  H HG12 . VAL A 1 52 ? 10.036  -8.055  -10.099 1.00 0.00 ? 52 VAL A HG12 4  
ATOM 4104  H HG13 . VAL A 1 52 ? 9.455   -6.514  -9.467  1.00 0.00 ? 52 VAL A HG13 4  
ATOM 4105  H HG21 . VAL A 1 52 ? 9.001   -9.898  -8.588  1.00 0.00 ? 52 VAL A HG21 4  
ATOM 4106  H HG22 . VAL A 1 52 ? 7.548   -9.444  -7.699  1.00 0.00 ? 52 VAL A HG22 4  
ATOM 4107  H HG23 . VAL A 1 52 ? 7.411   -10.161 -9.304  1.00 0.00 ? 52 VAL A HG23 4  
ATOM 4108  N N    . VAL A 1 53 ? 6.779   -5.604  -10.389 1.00 0.00 ? 53 VAL A N    4  
ATOM 4109  C CA   . VAL A 1 53 ? 6.849   -4.319  -11.075 1.00 0.00 ? 53 VAL A CA   4  
ATOM 4110  C C    . VAL A 1 53 ? 6.216   -3.214  -10.238 1.00 0.00 ? 53 VAL A C    4  
ATOM 4111  O O    . VAL A 1 53 ? 6.719   -2.091  -10.192 1.00 0.00 ? 53 VAL A O    4  
ATOM 4112  C CB   . VAL A 1 53 ? 6.148   -4.376  -12.445 1.00 0.00 ? 53 VAL A CB   4  
ATOM 4113  C CG1  . VAL A 1 53 ? 6.216   -3.023  -13.137 1.00 0.00 ? 53 VAL A CG1  4  
ATOM 4114  C CG2  . VAL A 1 53 ? 6.766   -5.461  -13.315 1.00 0.00 ? 53 VAL A CG2  4  
ATOM 4115  H H    . VAL A 1 53 ? 6.374   -6.369  -10.847 1.00 0.00 ? 53 VAL A H    4  
ATOM 4116  H HA   . VAL A 1 53 ? 7.891   -4.084  -11.237 1.00 0.00 ? 53 VAL A HA   4  
ATOM 4117  H HB   . VAL A 1 53 ? 5.108   -4.622  -12.285 1.00 0.00 ? 53 VAL A HB   4  
ATOM 4118  H HG11 . VAL A 1 53 ? 7.058   -2.466  -12.753 1.00 0.00 ? 53 VAL A HG11 4  
ATOM 4119  H HG12 . VAL A 1 53 ? 6.333   -3.168  -14.201 1.00 0.00 ? 53 VAL A HG12 4  
ATOM 4120  H HG13 . VAL A 1 53 ? 5.305   -2.475  -12.945 1.00 0.00 ? 53 VAL A HG13 4  
ATOM 4121  H HG21 . VAL A 1 53 ? 6.944   -5.069  -14.305 1.00 0.00 ? 53 VAL A HG21 4  
ATOM 4122  H HG22 . VAL A 1 53 ? 7.703   -5.780  -12.881 1.00 0.00 ? 53 VAL A HG22 4  
ATOM 4123  H HG23 . VAL A 1 53 ? 6.093   -6.302  -13.375 1.00 0.00 ? 53 VAL A HG23 4  
ATOM 4124  N N    . TRP A 1 54 ? 5.111   -3.539  -9.578  1.00 0.00 ? 54 TRP A N    4  
ATOM 4125  C CA   . TRP A 1 54 ? 4.408   -2.573  -8.741  1.00 0.00 ? 54 TRP A CA   4  
ATOM 4126  C C    . TRP A 1 54 ? 5.231   -2.223  -7.505  1.00 0.00 ? 54 TRP A C    4  
ATOM 4127  O O    . TRP A 1 54 ? 5.394   -1.051  -7.167  1.00 0.00 ? 54 TRP A O    4  
ATOM 4128  C CB   . TRP A 1 54 ? 3.045   -3.126  -8.322  1.00 0.00 ? 54 TRP A CB   4  
ATOM 4129  C CG   . TRP A 1 54 ? 2.224   -2.149  -7.536  1.00 0.00 ? 54 TRP A CG   4  
ATOM 4130  C CD1  . TRP A 1 54 ? 1.174   -1.406  -7.993  1.00 0.00 ? 54 TRP A CD1  4  
ATOM 4131  C CD2  . TRP A 1 54 ? 2.387   -1.808  -6.155  1.00 0.00 ? 54 TRP A CD2  4  
ATOM 4132  N NE1  . TRP A 1 54 ? 0.674   -0.624  -6.980  1.00 0.00 ? 54 TRP A NE1  4  
ATOM 4133  C CE2  . TRP A 1 54 ? 1.401   -0.853  -5.842  1.00 0.00 ? 54 TRP A CE2  4  
ATOM 4134  C CE3  . TRP A 1 54 ? 3.269   -2.219  -5.151  1.00 0.00 ? 54 TRP A CE3  4  
ATOM 4135  C CZ2  . TRP A 1 54 ? 1.275   -0.303  -4.569  1.00 0.00 ? 54 TRP A CZ2  4  
ATOM 4136  C CZ3  . TRP A 1 54 ? 3.143   -1.671  -3.889  1.00 0.00 ? 54 TRP A CZ3  4  
ATOM 4137  C CH2  . TRP A 1 54 ? 2.152   -0.723  -3.606  1.00 0.00 ? 54 TRP A CH2  4  
ATOM 4138  H H    . TRP A 1 54 ? 4.758   -4.451  -9.654  1.00 0.00 ? 54 TRP A H    4  
ATOM 4139  H HA   . TRP A 1 54 ? 4.259   -1.676  -9.325  1.00 0.00 ? 54 TRP A HA   4  
ATOM 4140  H HB2  . TRP A 1 54 ? 2.486   -3.396  -9.205  1.00 0.00 ? 54 TRP A HB2  4  
ATOM 4141  H HB3  . TRP A 1 54 ? 3.194   -4.005  -7.711  1.00 0.00 ? 54 TRP A HB3  4  
ATOM 4142  H HD1  . TRP A 1 54 ? 0.803   -1.437  -9.006  1.00 0.00 ? 54 TRP A HD1  4  
ATOM 4143  H HE1  . TRP A 1 54 ? -0.081  -0.004  -7.060  1.00 0.00 ? 54 TRP A HE1  4  
ATOM 4144  H HE3  . TRP A 1 54 ? 4.040   -2.949  -5.350  1.00 0.00 ? 54 TRP A HE3  4  
ATOM 4145  H HZ2  . TRP A 1 54 ? 0.515   0.429   -4.335  1.00 0.00 ? 54 TRP A HZ2  4  
ATOM 4146  H HZ3  . TRP A 1 54 ? 3.816   -1.976  -3.101  1.00 0.00 ? 54 TRP A HZ3  4  
ATOM 4147  H HH2  . TRP A 1 54 ? 2.090   -0.322  -2.606  1.00 0.00 ? 54 TRP A HH2  4  
ATOM 4148  N N    . PHE A 1 55 ? 5.747   -3.248  -6.834  1.00 0.00 ? 55 PHE A N    4  
ATOM 4149  C CA   . PHE A 1 55 ? 6.552   -3.048  -5.635  1.00 0.00 ? 55 PHE A CA   4  
ATOM 4150  C C    . PHE A 1 55 ? 7.824   -2.268  -5.957  1.00 0.00 ? 55 PHE A C    4  
ATOM 4151  O O    . PHE A 1 55 ? 8.237   -1.395  -5.195  1.00 0.00 ? 55 PHE A O    4  
ATOM 4152  C CB   . PHE A 1 55 ? 6.913   -4.396  -5.007  1.00 0.00 ? 55 PHE A CB   4  
ATOM 4153  C CG   . PHE A 1 55 ? 5.915   -4.869  -3.988  1.00 0.00 ? 55 PHE A CG   4  
ATOM 4154  C CD1  . PHE A 1 55 ? 4.596   -5.098  -4.345  1.00 0.00 ? 55 PHE A CD1  4  
ATOM 4155  C CD2  . PHE A 1 55 ? 6.297   -5.084  -2.674  1.00 0.00 ? 55 PHE A CD2  4  
ATOM 4156  C CE1  . PHE A 1 55 ? 3.676   -5.533  -3.411  1.00 0.00 ? 55 PHE A CE1  4  
ATOM 4157  C CE2  . PHE A 1 55 ? 5.381   -5.520  -1.735  1.00 0.00 ? 55 PHE A CE2  4  
ATOM 4158  C CZ   . PHE A 1 55 ? 4.069   -5.744  -2.104  1.00 0.00 ? 55 PHE A CZ   4  
ATOM 4159  H H    . PHE A 1 55 ? 5.582   -4.160  -7.153  1.00 0.00 ? 55 PHE A H    4  
ATOM 4160  H HA   . PHE A 1 55 ? 5.963   -2.479  -4.932  1.00 0.00 ? 55 PHE A HA   4  
ATOM 4161  H HB2  . PHE A 1 55 ? 6.972   -5.143  -5.784  1.00 0.00 ? 55 PHE A HB2  4  
ATOM 4162  H HB3  . PHE A 1 55 ? 7.873   -4.312  -4.520  1.00 0.00 ? 55 PHE A HB3  4  
ATOM 4163  H HD1  . PHE A 1 55 ? 4.288   -4.933  -5.368  1.00 0.00 ? 55 PHE A HD1  4  
ATOM 4164  H HD2  . PHE A 1 55 ? 7.322   -4.908  -2.384  1.00 0.00 ? 55 PHE A HD2  4  
ATOM 4165  H HE1  . PHE A 1 55 ? 2.651   -5.707  -3.703  1.00 0.00 ? 55 PHE A HE1  4  
ATOM 4166  H HE2  . PHE A 1 55 ? 5.690   -5.683  -0.713  1.00 0.00 ? 55 PHE A HE2  4  
ATOM 4167  H HZ   . PHE A 1 55 ? 3.352   -6.084  -1.372  1.00 0.00 ? 55 PHE A HZ   4  
ATOM 4168  N N    . GLN A 1 56 ? 8.437   -2.591  -7.091  1.00 0.00 ? 56 GLN A N    4  
ATOM 4169  C CA   . GLN A 1 56 ? 9.662   -1.921  -7.513  1.00 0.00 ? 56 GLN A CA   4  
ATOM 4170  C C    . GLN A 1 56 ? 9.453   -0.414  -7.609  1.00 0.00 ? 56 GLN A C    4  
ATOM 4171  O O    . GLN A 1 56 ? 10.185  0.364   -6.999  1.00 0.00 ? 56 GLN A O    4  
ATOM 4172  C CB   . GLN A 1 56 ? 10.129  -2.470  -8.862  1.00 0.00 ? 56 GLN A CB   4  
ATOM 4173  C CG   . GLN A 1 56 ? 10.928  -3.759  -8.751  1.00 0.00 ? 56 GLN A CG   4  
ATOM 4174  C CD   . GLN A 1 56 ? 11.942  -3.915  -9.867  1.00 0.00 ? 56 GLN A CD   4  
ATOM 4175  O OE1  . GLN A 1 56 ? 12.770  -3.033  -10.097 1.00 0.00 ? 56 GLN A OE1  4  
ATOM 4176  N NE2  . GLN A 1 56 ? 11.883  -5.042  -10.567 1.00 0.00 ? 56 GLN A NE2  4  
ATOM 4177  H H    . GLN A 1 56 ? 8.059   -3.295  -7.656  1.00 0.00 ? 56 GLN A H    4  
ATOM 4178  H HA   . GLN A 1 56 ? 10.421  -2.120  -6.772  1.00 0.00 ? 56 GLN A HA   4  
ATOM 4179  H HB2  . GLN A 1 56 ? 9.264   -2.660  -9.479  1.00 0.00 ? 56 GLN A HB2  4  
ATOM 4180  H HB3  . GLN A 1 56 ? 10.749  -1.729  -9.344  1.00 0.00 ? 56 GLN A HB3  4  
ATOM 4181  H HG2  . GLN A 1 56 ? 11.452  -3.762  -7.806  1.00 0.00 ? 56 GLN A HG2  4  
ATOM 4182  H HG3  . GLN A 1 56 ? 10.245  -4.595  -8.785  1.00 0.00 ? 56 GLN A HG3  4  
ATOM 4183  H HE21 . GLN A 1 56 ? 11.197  -5.700  -10.327 1.00 0.00 ? 56 GLN A HE21 4  
ATOM 4184  H HE22 . GLN A 1 56 ? 12.526  -5.169  -11.294 1.00 0.00 ? 56 GLN A HE22 4  
ATOM 4185  N N    . ASN A 1 57 ? 8.449   -0.008  -8.380  1.00 0.00 ? 57 ASN A N    4  
ATOM 4186  C CA   . ASN A 1 57 ? 8.144   1.407   -8.557  1.00 0.00 ? 57 ASN A CA   4  
ATOM 4187  C C    . ASN A 1 57 ? 7.761   2.051   -7.228  1.00 0.00 ? 57 ASN A C    4  
ATOM 4188  O O    . ASN A 1 57 ? 8.307   3.086   -6.848  1.00 0.00 ? 57 ASN A O    4  
ATOM 4189  C CB   . ASN A 1 57 ? 7.009   1.583   -9.568  1.00 0.00 ? 57 ASN A CB   4  
ATOM 4190  C CG   . ASN A 1 57 ? 7.482   1.430   -11.001 1.00 0.00 ? 57 ASN A CG   4  
ATOM 4191  O OD1  . ASN A 1 57 ? 8.034   2.362   -11.587 1.00 0.00 ? 57 ASN A OD1  4  
ATOM 4192  N ND2  . ASN A 1 57 ? 7.268   0.250   -11.572 1.00 0.00 ? 57 ASN A ND2  4  
ATOM 4193  H H    . ASN A 1 57 ? 7.900   -0.677  -8.841  1.00 0.00 ? 57 ASN A H    4  
ATOM 4194  H HA   . ASN A 1 57 ? 9.031   1.892   -8.937  1.00 0.00 ? 57 ASN A HA   4  
ATOM 4195  H HB2  . ASN A 1 57 ? 6.249   0.839   -9.379  1.00 0.00 ? 57 ASN A HB2  4  
ATOM 4196  H HB3  . ASN A 1 57 ? 6.581   2.567   -9.452  1.00 0.00 ? 57 ASN A HB3  4  
ATOM 4197  H HD21 . ASN A 1 57 ? 6.823   -0.446  -11.044 1.00 0.00 ? 57 ASN A HD21 4  
ATOM 4198  H HD22 . ASN A 1 57 ? 7.564   0.124   -12.497 1.00 0.00 ? 57 ASN A HD22 4  
ATOM 4199  N N    . ALA A 1 58 ? 6.818   1.431   -6.526  1.00 0.00 ? 58 ALA A N    4  
ATOM 4200  C CA   . ALA A 1 58 ? 6.363   1.941   -5.239  1.00 0.00 ? 58 ALA A CA   4  
ATOM 4201  C C    . ALA A 1 58 ? 7.542   2.365   -4.369  1.00 0.00 ? 58 ALA A C    4  
ATOM 4202  O O    . ALA A 1 58 ? 7.417   3.258   -3.531  1.00 0.00 ? 58 ALA A O    4  
ATOM 4203  C CB   . ALA A 1 58 ? 5.525   0.894   -4.522  1.00 0.00 ? 58 ALA A CB   4  
ATOM 4204  H H    . ALA A 1 58 ? 6.419   0.609   -6.882  1.00 0.00 ? 58 ALA A H    4  
ATOM 4205  H HA   . ALA A 1 58 ? 5.737   2.803   -5.424  1.00 0.00 ? 58 ALA A HA   4  
ATOM 4206  H HB1  . ALA A 1 58 ? 4.679   1.372   -4.050  1.00 0.00 ? 58 ALA A HB1  4  
ATOM 4207  H HB2  . ALA A 1 58 ? 5.174   0.164   -5.235  1.00 0.00 ? 58 ALA A HB2  4  
ATOM 4208  H HB3  . ALA A 1 58 ? 6.127   0.404   -3.771  1.00 0.00 ? 58 ALA A HB3  4  
ATOM 4209  N N    . ARG A 1 59 ? 8.685   1.719   -4.574  1.00 0.00 ? 59 ARG A N    4  
ATOM 4210  C CA   . ARG A 1 59 ? 9.885   2.028   -3.807  1.00 0.00 ? 59 ARG A CA   4  
ATOM 4211  C C    . ARG A 1 59 ? 10.513  3.335   -4.282  1.00 0.00 ? 59 ARG A C    4  
ATOM 4212  O O    . ARG A 1 59 ? 10.924  4.167   -3.473  1.00 0.00 ? 59 ARG A O    4  
ATOM 4213  C CB   . ARG A 1 59 ? 10.900  0.889   -3.927  1.00 0.00 ? 59 ARG A CB   4  
ATOM 4214  C CG   . ARG A 1 59 ? 10.502  -0.364  -3.165  1.00 0.00 ? 59 ARG A CG   4  
ATOM 4215  C CD   . ARG A 1 59 ? 11.722  -1.154  -2.716  1.00 0.00 ? 59 ARG A CD   4  
ATOM 4216  N NE   . ARG A 1 59 ? 12.586  -1.510  -3.837  1.00 0.00 ? 59 ARG A NE   4  
ATOM 4217  C CZ   . ARG A 1 59 ? 12.267  -2.419  -4.752  1.00 0.00 ? 59 ARG A CZ   4  
ATOM 4218  N NH1  . ARG A 1 59 ? 11.108  -3.059  -4.679  1.00 0.00 ? 59 ARG A NH1  4  
ATOM 4219  N NH2  . ARG A 1 59 ? 13.107  -2.688  -5.743  1.00 0.00 ? 59 ARG A NH2  4  
ATOM 4220  H H    . ARG A 1 59 ? 8.722   1.017   -5.257  1.00 0.00 ? 59 ARG A H    4  
ATOM 4221  H HA   . ARG A 1 59 ? 9.599   2.135   -2.772  1.00 0.00 ? 59 ARG A HA   4  
ATOM 4222  H HB2  . ARG A 1 59 ? 11.011  0.630   -4.970  1.00 0.00 ? 59 ARG A HB2  4  
ATOM 4223  H HB3  . ARG A 1 59 ? 11.851  1.229   -3.546  1.00 0.00 ? 59 ARG A HB3  4  
ATOM 4224  H HG2  . ARG A 1 59 ? 9.931   -0.079  -2.294  1.00 0.00 ? 59 ARG A HG2  4  
ATOM 4225  H HG3  . ARG A 1 59 ? 9.897   -0.987  -3.807  1.00 0.00 ? 59 ARG A HG3  4  
ATOM 4226  H HD2  . ARG A 1 59 ? 12.285  -0.554  -2.016  1.00 0.00 ? 59 ARG A HD2  4  
ATOM 4227  H HD3  . ARG A 1 59 ? 11.389  -2.058  -2.228  1.00 0.00 ? 59 ARG A HD3  4  
ATOM 4228  H HE   . ARG A 1 59 ? 13.448  -1.049  -3.911  1.00 0.00 ? 59 ARG A HE   4  
ATOM 4229  H HH11 . ARG A 1 59 ? 10.473  -2.857  -3.934  1.00 0.00 ? 59 ARG A HH11 4  
ATOM 4230  H HH12 . ARG A 1 59 ? 10.869  -3.742  -5.370  1.00 0.00 ? 59 ARG A HH12 4  
ATOM 4231  H HH21 . ARG A 1 59 ? 13.981  -2.207  -5.802  1.00 0.00 ? 59 ARG A HH21 4  
ATOM 4232  H HH22 . ARG A 1 59 ? 12.865  -3.372  -6.431  1.00 0.00 ? 59 ARG A HH22 4  
ATOM 4233  N N    . GLN A 1 60 ? 10.583  3.508   -5.598  1.00 0.00 ? 60 GLN A N    4  
ATOM 4234  C CA   . GLN A 1 60 ? 11.161  4.713   -6.180  1.00 0.00 ? 60 GLN A CA   4  
ATOM 4235  C C    . GLN A 1 60 ? 10.207  5.895   -6.044  1.00 0.00 ? 60 GLN A C    4  
ATOM 4236  O O    . GLN A 1 60 ? 10.633  7.050   -6.009  1.00 0.00 ? 60 GLN A O    4  
ATOM 4237  C CB   . GLN A 1 60 ? 11.499  4.482   -7.654  1.00 0.00 ? 60 GLN A CB   4  
ATOM 4238  C CG   . GLN A 1 60 ? 10.299  4.602   -8.579  1.00 0.00 ? 60 GLN A CG   4  
ATOM 4239  C CD   . GLN A 1 60 ? 10.695  4.695   -10.040 1.00 0.00 ? 60 GLN A CD   4  
ATOM 4240  O OE1  . GLN A 1 60 ? 11.783  4.267   -10.428 1.00 0.00 ? 60 GLN A OE1  4  
ATOM 4241  N NE2  . GLN A 1 60 ? 9.813   5.255   -10.858 1.00 0.00 ? 60 GLN A NE2  4  
ATOM 4242  H H    . GLN A 1 60 ? 10.238  2.809   -6.191  1.00 0.00 ? 60 GLN A H    4  
ATOM 4243  H HA   . GLN A 1 60 ? 12.070  4.937   -5.643  1.00 0.00 ? 60 GLN A HA   4  
ATOM 4244  H HB2  . GLN A 1 60 ? 12.237  5.208   -7.960  1.00 0.00 ? 60 GLN A HB2  4  
ATOM 4245  H HB3  . GLN A 1 60 ? 11.914  3.491   -7.764  1.00 0.00 ? 60 GLN A HB3  4  
ATOM 4246  H HG2  . GLN A 1 60 ? 9.671   3.733   -8.448  1.00 0.00 ? 60 GLN A HG2  4  
ATOM 4247  H HG3  . GLN A 1 60 ? 9.744   5.489   -8.314  1.00 0.00 ? 60 GLN A HG3  4  
ATOM 4248  H HE21 . GLN A 1 60 ? 8.967   5.574   -10.478 1.00 0.00 ? 60 GLN A HE21 4  
ATOM 4249  H HE22 . GLN A 1 60 ? 10.043  5.329   -11.807 1.00 0.00 ? 60 GLN A HE22 4  
ATOM 4250  N N    . LYS A 1 61 ? 8.914   5.600   -5.969  1.00 0.00 ? 61 LYS A N    4  
ATOM 4251  C CA   . LYS A 1 61 ? 7.898   6.637   -5.836  1.00 0.00 ? 61 LYS A CA   4  
ATOM 4252  C C    . LYS A 1 61 ? 7.818   7.139   -4.398  1.00 0.00 ? 61 LYS A C    4  
ATOM 4253  O O    . LYS A 1 61 ? 7.550   8.315   -4.155  1.00 0.00 ? 61 LYS A O    4  
ATOM 4254  C CB   . LYS A 1 61 ? 6.534   6.103   -6.278  1.00 0.00 ? 61 LYS A CB   4  
ATOM 4255  C CG   . LYS A 1 61 ? 6.463   5.765   -7.757  1.00 0.00 ? 61 LYS A CG   4  
ATOM 4256  C CD   . LYS A 1 61 ? 5.218   4.957   -8.085  1.00 0.00 ? 61 LYS A CD   4  
ATOM 4257  C CE   . LYS A 1 61 ? 3.982   5.841   -8.152  1.00 0.00 ? 61 LYS A CE   4  
ATOM 4258  N NZ   . LYS A 1 61 ? 3.879   6.554   -9.455  1.00 0.00 ? 61 LYS A NZ   4  
ATOM 4259  H H    . LYS A 1 61 ? 8.636   4.660   -6.002  1.00 0.00 ? 61 LYS A H    4  
ATOM 4260  H HA   . LYS A 1 61 ? 8.178   7.459   -6.477  1.00 0.00 ? 61 LYS A HA   4  
ATOM 4261  H HB2  . LYS A 1 61 ? 6.311   5.209   -5.714  1.00 0.00 ? 61 LYS A HB2  4  
ATOM 4262  H HB3  . LYS A 1 61 ? 5.782   6.849   -6.064  1.00 0.00 ? 61 LYS A HB3  4  
ATOM 4263  H HG2  . LYS A 1 61 ? 6.444   6.682   -8.326  1.00 0.00 ? 61 LYS A HG2  4  
ATOM 4264  H HG3  . LYS A 1 61 ? 7.337   5.189   -8.027  1.00 0.00 ? 61 LYS A HG3  4  
ATOM 4265  H HD2  . LYS A 1 61 ? 5.354   4.475   -9.042  1.00 0.00 ? 61 LYS A HD2  4  
ATOM 4266  H HD3  . LYS A 1 61 ? 5.074   4.208   -7.320  1.00 0.00 ? 61 LYS A HD3  4  
ATOM 4267  H HE2  . LYS A 1 61 ? 3.107   5.223   -8.019  1.00 0.00 ? 61 LYS A HE2  4  
ATOM 4268  H HE3  . LYS A 1 61 ? 4.033   6.569   -7.356  1.00 0.00 ? 61 LYS A HE3  4  
ATOM 4269  H HZ1  . LYS A 1 61 ? 4.824   6.671   -9.873  1.00 0.00 ? 61 LYS A HZ1  4  
ATOM 4270  H HZ2  . LYS A 1 61 ? 3.456   7.493   -9.316  1.00 0.00 ? 61 LYS A HZ2  4  
ATOM 4271  H HZ3  . LYS A 1 61 ? 3.285   6.011   -10.114 1.00 0.00 ? 61 LYS A HZ3  4  
ATOM 4272  N N    . ALA A 1 62 ? 8.054   6.240   -3.448  1.00 0.00 ? 62 ALA A N    4  
ATOM 4273  C CA   . ALA A 1 62 ? 8.011   6.593   -2.034  1.00 0.00 ? 62 ALA A CA   4  
ATOM 4274  C C    . ALA A 1 62 ? 9.169   7.513   -1.664  1.00 0.00 ? 62 ALA A C    4  
ATOM 4275  O O    . ALA A 1 62 ? 9.002   8.455   -0.889  1.00 0.00 ? 62 ALA A O    4  
ATOM 4276  C CB   . ALA A 1 62 ? 8.036   5.337   -1.176  1.00 0.00 ? 62 ALA A CB   4  
ATOM 4277  H H    . ALA A 1 62 ? 8.262   5.318   -3.704  1.00 0.00 ? 62 ALA A H    4  
ATOM 4278  H HA   . ALA A 1 62 ? 7.080   7.109   -1.847  1.00 0.00 ? 62 ALA A HA   4  
ATOM 4279  H HB1  . ALA A 1 62 ? 7.449   5.500   -0.284  1.00 0.00 ? 62 ALA A HB1  4  
ATOM 4280  H HB2  . ALA A 1 62 ? 7.622   4.511   -1.734  1.00 0.00 ? 62 ALA A HB2  4  
ATOM 4281  H HB3  . ALA A 1 62 ? 9.055   5.111   -0.900  1.00 0.00 ? 62 ALA A HB3  4  
ATOM 4282  N N    . ARG A 1 63 ? 10.343  7.233   -2.221  1.00 0.00 ? 63 ARG A N    4  
ATOM 4283  C CA   . ARG A 1 63 ? 11.529  8.035   -1.946  1.00 0.00 ? 63 ARG A CA   4  
ATOM 4284  C C    . ARG A 1 63 ? 11.438  9.394   -2.635  1.00 0.00 ? 63 ARG A C    4  
ATOM 4285  O O    . ARG A 1 63 ? 11.825  10.416  -2.068  1.00 0.00 ? 63 ARG A O    4  
ATOM 4286  C CB   . ARG A 1 63 ? 12.787  7.299   -2.412  1.00 0.00 ? 63 ARG A CB   4  
ATOM 4287  C CG   . ARG A 1 63 ? 12.867  7.123   -3.920  1.00 0.00 ? 63 ARG A CG   4  
ATOM 4288  C CD   . ARG A 1 63 ? 14.215  6.562   -4.345  1.00 0.00 ? 63 ARG A CD   4  
ATOM 4289  N NE   . ARG A 1 63 ? 14.255  6.255   -5.772  1.00 0.00 ? 63 ARG A NE   4  
ATOM 4290  C CZ   . ARG A 1 63 ? 14.516  7.157   -6.711  1.00 0.00 ? 63 ARG A CZ   4  
ATOM 4291  N NH1  . ARG A 1 63 ? 14.760  8.416   -6.375  1.00 0.00 ? 63 ARG A NH1  4  
ATOM 4292  N NH2  . ARG A 1 63 ? 14.534  6.800   -7.989  1.00 0.00 ? 63 ARG A NH2  4  
ATOM 4293  H H    . ARG A 1 63 ? 10.413  6.469   -2.830  1.00 0.00 ? 63 ARG A H    4  
ATOM 4294  H HA   . ARG A 1 63 ? 11.587  8.189   -0.879  1.00 0.00 ? 63 ARG A HA   4  
ATOM 4295  H HB2  . ARG A 1 63 ? 13.656  7.856   -2.091  1.00 0.00 ? 63 ARG A HB2  4  
ATOM 4296  H HB3  . ARG A 1 63 ? 12.807  6.321   -1.955  1.00 0.00 ? 63 ARG A HB3  4  
ATOM 4297  H HG2  . ARG A 1 63 ? 12.091  6.441   -4.234  1.00 0.00 ? 63 ARG A HG2  4  
ATOM 4298  H HG3  . ARG A 1 63 ? 12.720  8.082   -4.393  1.00 0.00 ? 63 ARG A HG3  4  
ATOM 4299  H HD2  . ARG A 1 63 ? 14.979  7.291   -4.122  1.00 0.00 ? 63 ARG A HD2  4  
ATOM 4300  H HD3  . ARG A 1 63 ? 14.406  5.658   -3.785  1.00 0.00 ? 63 ARG A HD3  4  
ATOM 4301  H HE   . ARG A 1 63 ? 14.077  5.330   -6.042  1.00 0.00 ? 63 ARG A HE   4  
ATOM 4302  H HH11 . ARG A 1 63 ? 14.748  8.688   -5.413  1.00 0.00 ? 63 ARG A HH11 4  
ATOM 4303  H HH12 . ARG A 1 63 ? 14.958  9.093   -7.084  1.00 0.00 ? 63 ARG A HH12 4  
ATOM 4304  H HH21 . ARG A 1 63 ? 14.351  5.852   -8.245  1.00 0.00 ? 63 ARG A HH21 4  
ATOM 4305  H HH22 . ARG A 1 63 ? 14.731  7.480   -8.695  1.00 0.00 ? 63 ARG A HH22 4  
ATOM 4306  N N    . LYS A 1 64 ? 10.924  9.398   -3.860  1.00 0.00 ? 64 LYS A N    4  
ATOM 4307  C CA   . LYS A 1 64 ? 10.781  10.630  -4.626  1.00 0.00 ? 64 LYS A CA   4  
ATOM 4308  C C    . LYS A 1 64 ? 10.234  11.754  -3.752  1.00 0.00 ? 64 LYS A C    4  
ATOM 4309  O O    . LYS A 1 64 ? 10.845  12.816  -3.637  1.00 0.00 ? 64 LYS A O    4  
ATOM 4310  C CB   . LYS A 1 64 ? 9.855   10.405  -5.824  1.00 0.00 ? 64 LYS A CB   4  
ATOM 4311  C CG   . LYS A 1 64 ? 9.647   11.646  -6.674  1.00 0.00 ? 64 LYS A CG   4  
ATOM 4312  C CD   . LYS A 1 64 ? 9.173   11.291  -8.073  1.00 0.00 ? 64 LYS A CD   4  
ATOM 4313  C CE   . LYS A 1 64 ? 9.164   12.509  -8.984  1.00 0.00 ? 64 LYS A CE   4  
ATOM 4314  N NZ   . LYS A 1 64 ? 10.498  12.752  -9.599  1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4315  H H    . LYS A 1 64 ? 10.633  8.550   -4.258  1.00 0.00 ? 64 LYS A H    4  
ATOM 4316  H HA   . LYS A 1 64 ? 11.758  10.912  -4.986  1.00 0.00 ? 64 LYS A HA   4  
ATOM 4317  H HB2  . LYS A 1 64 ? 10.277  9.632   -6.450  1.00 0.00 ? 64 LYS A HB2  4  
ATOM 4318  H HB3  . LYS A 1 64 ? 8.891   10.076  -5.462  1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4319  H HG2  . LYS A 1 64 ? 8.906   12.274  -6.203  1.00 0.00 ? 64 LYS A HG2  4  
ATOM 4320  H HG3  . LYS A 1 64 ? 10.583  12.182  -6.746  1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4321  H HD2  . LYS A 1 64 ? 9.836   10.548  -8.491  1.00 0.00 ? 64 LYS A HD2  4  
ATOM 4322  H HD3  . LYS A 1 64 ? 8.171   10.889  -8.013  1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4323  H HE2  . LYS A 1 64 ? 8.440   12.350  -9.769  1.00 0.00 ? 64 LYS A HE2  4  
ATOM 4324  H HE3  . LYS A 1 64 ? 8.881   13.374  -8.403  1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4325  H HZ1  . LYS A 1 64 ? 11.075  13.351  -8.974  1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4326  H HZ2  . LYS A 1 64 ? 10.388  13.232  -10.515 1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4327  H HZ3  . LYS A 1 64 ? 10.992  11.850  -9.750  1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4328  N N    . SER A 1 65 ? 9.081   11.512  -3.137  1.00 0.00 ? 65 SER A N    4  
ATOM 4329  C CA   . SER A 1 65 ? 8.451   12.505  -2.275  1.00 0.00 ? 65 SER A CA   4  
ATOM 4330  C C    . SER A 1 65 ? 9.427   12.998  -1.211  1.00 0.00 ? 65 SER A C    4  
ATOM 4331  O O    . SER A 1 65 ? 10.108  12.205  -0.563  1.00 0.00 ? 65 SER A O    4  
ATOM 4332  C CB   . SER A 1 65 ? 7.206   11.916  -1.608  1.00 0.00 ? 65 SER A CB   4  
ATOM 4333  O OG   . SER A 1 65 ? 6.548   12.885  -0.810  1.00 0.00 ? 65 SER A OG   4  
ATOM 4334  H H    . SER A 1 65 ? 8.642   10.645  -3.269  1.00 0.00 ? 65 SER A H    4  
ATOM 4335  H HA   . SER A 1 65 ? 8.157   13.341  -2.892  1.00 0.00 ? 65 SER A HA   4  
ATOM 4336  H HB2  . SER A 1 65 ? 6.523   11.570  -2.369  1.00 0.00 ? 65 SER A HB2  4  
ATOM 4337  H HB3  . SER A 1 65 ? 7.496   11.086  -0.980  1.00 0.00 ? 65 SER A HB3  4  
ATOM 4338  H HG   . SER A 1 65 ? 6.095   12.449  -0.085  1.00 0.00 ? 65 SER A HG   4  
ATOM 4339  N N    . GLY A 1 66 ? 9.488   14.314  -1.037  1.00 0.00 ? 66 GLY A N    4  
ATOM 4340  C CA   . GLY A 1 66 ? 10.383  14.892  -0.051  1.00 0.00 ? 66 GLY A CA   4  
ATOM 4341  C C    . GLY A 1 66 ? 10.247  16.399  0.043   1.00 0.00 ? 66 GLY A C    4  
ATOM 4342  O O    . GLY A 1 66 ? 9.390   16.923  0.753   1.00 0.00 ? 66 GLY A O    4  
ATOM 4343  H H    . GLY A 1 66 ? 8.921   14.899  -1.583  1.00 0.00 ? 66 GLY A H    4  
ATOM 4344  H HA2  . GLY A 1 66 ? 10.164  14.460  0.914   1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4345  H HA3  . GLY A 1 66 ? 11.401  14.650  -0.320  1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4346  N N    . PRO A 1 67 ? 11.111  17.121  -0.687  1.00 0.00 ? 67 PRO A N    4  
ATOM 4347  C CA   . PRO A 1 67 ? 11.104  18.587  -0.698  1.00 0.00 ? 67 PRO A CA   4  
ATOM 4348  C C    . PRO A 1 67 ? 9.879   19.155  -1.406  1.00 0.00 ? 67 PRO A C    4  
ATOM 4349  O O    . PRO A 1 67 ? 9.902   19.390  -2.614  1.00 0.00 ? 67 PRO A O    4  
ATOM 4350  C CB   . PRO A 1 67 ? 12.379  18.941  -1.468  1.00 0.00 ? 67 PRO A CB   4  
ATOM 4351  C CG   . PRO A 1 67 ? 12.641  17.756  -2.333  1.00 0.00 ? 67 PRO A CG   4  
ATOM 4352  C CD   . PRO A 1 67 ? 12.159  16.562  -1.556  1.00 0.00 ? 67 PRO A CD   4  
ATOM 4353  H HA   . PRO A 1 67 ? 11.161  18.992  0.302   1.00 0.00 ? 67 PRO A HA   4  
ATOM 4354  H HB2  . PRO A 1 67 ? 12.211  19.832  -2.057  1.00 0.00 ? 67 PRO A HB2  4  
ATOM 4355  H HB3  . PRO A 1 67 ? 13.189  19.109  -0.774  1.00 0.00 ? 67 PRO A HB3  4  
ATOM 4356  H HG2  . PRO A 1 67 ? 12.092  17.848  -3.258  1.00 0.00 ? 67 PRO A HG2  4  
ATOM 4357  H HG3  . PRO A 1 67 ? 13.699  17.673  -2.530  1.00 0.00 ? 67 PRO A HG3  4  
ATOM 4358  H HD2  . PRO A 1 67 ? 11.751  15.818  -2.223  1.00 0.00 ? 67 PRO A HD2  4  
ATOM 4359  H HD3  . PRO A 1 67 ? 12.964  16.145  -0.969  1.00 0.00 ? 67 PRO A HD3  4  
ATOM 4360  N N    . SER A 1 68 ? 8.811   19.375  -0.646  1.00 0.00 ? 68 SER A N    4  
ATOM 4361  C CA   . SER A 1 68 ? 7.575   19.913  -1.201  1.00 0.00 ? 68 SER A CA   4  
ATOM 4362  C C    . SER A 1 68 ? 7.445   21.403  -0.895  1.00 0.00 ? 68 SER A C    4  
ATOM 4363  O O    . SER A 1 68 ? 6.888   22.164  -1.686  1.00 0.00 ? 68 SER A O    4  
ATOM 4364  C CB   . SER A 1 68 ? 6.368   19.159  -0.641  1.00 0.00 ? 68 SER A CB   4  
ATOM 4365  O OG   . SER A 1 68 ? 6.352   19.202  0.775   1.00 0.00 ? 68 SER A OG   4  
ATOM 4366  H H    . SER A 1 68 ? 8.855   19.167  0.311   1.00 0.00 ? 68 SER A H    4  
ATOM 4367  H HA   . SER A 1 68 ? 7.607   19.780  -2.272  1.00 0.00 ? 68 SER A HA   4  
ATOM 4368  H HB2  . SER A 1 68 ? 5.461   19.609  -1.013  1.00 0.00 ? 68 SER A HB2  4  
ATOM 4369  H HB3  . SER A 1 68 ? 6.414   18.127  -0.958  1.00 0.00 ? 68 SER A HB3  4  
ATOM 4370  H HG   . SER A 1 68 ? 7.175   19.581  1.093   1.00 0.00 ? 68 SER A HG   4  
ATOM 4371  N N    . SER A 1 69 ? 7.964   21.810  0.259   1.00 0.00 ? 69 SER A N    4  
ATOM 4372  C CA   . SER A 1 69 ? 7.903   23.207  0.673   1.00 0.00 ? 69 SER A CA   4  
ATOM 4373  C C    . SER A 1 69 ? 8.917   23.491  1.777   1.00 0.00 ? 69 SER A C    4  
ATOM 4374  O O    . SER A 1 69 ? 8.816   22.955  2.880   1.00 0.00 ? 69 SER A O    4  
ATOM 4375  C CB   . SER A 1 69 ? 6.495   23.557  1.155   1.00 0.00 ? 69 SER A CB   4  
ATOM 4376  O OG   . SER A 1 69 ? 6.260   23.048  2.457   1.00 0.00 ? 69 SER A OG   4  
ATOM 4377  H H    . SER A 1 69 ? 8.396   21.155  0.846   1.00 0.00 ? 69 SER A H    4  
ATOM 4378  H HA   . SER A 1 69 ? 8.143   23.818  -0.185  1.00 0.00 ? 69 SER A HA   4  
ATOM 4379  H HB2  . SER A 1 69 ? 6.380   24.630  1.176   1.00 0.00 ? 69 SER A HB2  4  
ATOM 4380  H HB3  . SER A 1 69 ? 5.769   23.131  0.478   1.00 0.00 ? 69 SER A HB3  4  
ATOM 4381  H HG   . SER A 1 69 ? 5.889   22.165  2.393   1.00 0.00 ? 69 SER A HG   4  
ATOM 4382  N N    . GLY A 1 70 ? 9.895   24.339  1.471   1.00 0.00 ? 70 GLY A N    4  
ATOM 4383  C CA   . GLY A 1 70 ? 10.913  24.680  2.447   1.00 0.00 ? 70 GLY A CA   4  
ATOM 4384  C C    . GLY A 1 70 ? 10.330  24.977  3.814   1.00 0.00 ? 70 GLY A C    4  
ATOM 4385  O O    . GLY A 1 70 ? 9.385   25.756  3.937   1.00 0.00 ? 70 GLY A O    4  
ATOM 4386  H H    . GLY A 1 70 ? 9.925   24.736  0.575   1.00 0.00 ? 70 GLY A H    4  
ATOM 4387  H HA2  . GLY A 1 70 ? 11.604  23.854  2.533   1.00 0.00 ? 70 GLY A HA2  4  
ATOM 4388  H HA3  . GLY A 1 70 ? 11.450  25.551  2.100   1.00 0.00 ? 70 GLY A HA3  4  
ATOM 4389  N N    . GLY A 1 1  ? 9.571   -18.798 -15.972 1.00 0.00 ? 1  GLY A N    5  
ATOM 4390  C CA   . GLY A 1 1  ? 9.907   -17.782 -14.992 1.00 0.00 ? 1  GLY A CA   5  
ATOM 4391  C C    . GLY A 1 1  ? 9.760   -16.377 -15.541 1.00 0.00 ? 1  GLY A C    5  
ATOM 4392  O O    . GLY A 1 1  ? 8.860   -16.104 -16.336 1.00 0.00 ? 1  GLY A O    5  
ATOM 4393  H H1   . GLY A 1 1  ? 8.810   -18.662 -16.575 1.00 0.00 ? 1  GLY A H1   5  
ATOM 4394  H HA2  . GLY A 1 1  ? 9.258   -17.893 -14.137 1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4395  H HA3  . GLY A 1 1  ? 10.930  -17.927 -14.677 1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4396  N N    . SER A 1 2  ? 10.645  -15.481 -15.115 1.00 0.00 ? 2  SER A N    5  
ATOM 4397  C CA   . SER A 1 2  ? 10.606  -14.095 -15.565 1.00 0.00 ? 2  SER A CA   5  
ATOM 4398  C C    . SER A 1 2  ? 11.250  -13.951 -16.941 1.00 0.00 ? 2  SER A C    5  
ATOM 4399  O O    . SER A 1 2  ? 12.054  -13.049 -17.171 1.00 0.00 ? 2  SER A O    5  
ATOM 4400  C CB   . SER A 1 2  ? 11.321  -13.190 -14.559 1.00 0.00 ? 2  SER A CB   5  
ATOM 4401  O OG   . SER A 1 2  ? 12.724  -13.380 -14.609 1.00 0.00 ? 2  SER A OG   5  
ATOM 4402  H H    . SER A 1 2  ? 11.339  -15.760 -14.481 1.00 0.00 ? 2  SER A H    5  
ATOM 4403  H HA   . SER A 1 2  ? 9.571   -13.797 -15.632 1.00 0.00 ? 2  SER A HA   5  
ATOM 4404  H HB2  . SER A 1 2  ? 11.102  -12.158 -14.787 1.00 0.00 ? 2  SER A HB2  5  
ATOM 4405  H HB3  . SER A 1 2  ? 10.973  -13.420 -13.562 1.00 0.00 ? 2  SER A HB3  5  
ATOM 4406  H HG   . SER A 1 2  ? 12.975  -14.077 -13.997 1.00 0.00 ? 2  SER A HG   5  
ATOM 4407  N N    . SER A 1 3  ? 10.889  -14.849 -17.852 1.00 0.00 ? 3  SER A N    5  
ATOM 4408  C CA   . SER A 1 3  ? 11.433  -14.827 -19.205 1.00 0.00 ? 3  SER A CA   5  
ATOM 4409  C C    . SER A 1 3  ? 10.320  -14.656 -20.235 1.00 0.00 ? 3  SER A C    5  
ATOM 4410  O O    . SER A 1 3  ? 9.194   -15.107 -20.029 1.00 0.00 ? 3  SER A O    5  
ATOM 4411  C CB   . SER A 1 3  ? 12.210  -16.114 -19.486 1.00 0.00 ? 3  SER A CB   5  
ATOM 4412  O OG   . SER A 1 3  ? 13.127  -15.934 -20.551 1.00 0.00 ? 3  SER A OG   5  
ATOM 4413  H H    . SER A 1 3  ? 10.243  -15.545 -17.607 1.00 0.00 ? 3  SER A H    5  
ATOM 4414  H HA   . SER A 1 3  ? 12.106  -13.986 -19.277 1.00 0.00 ? 3  SER A HA   5  
ATOM 4415  H HB2  . SER A 1 3  ? 12.757  -16.402 -18.601 1.00 0.00 ? 3  SER A HB2  5  
ATOM 4416  H HB3  . SER A 1 3  ? 11.517  -16.899 -19.752 1.00 0.00 ? 3  SER A HB3  5  
ATOM 4417  H HG   . SER A 1 3  ? 13.985  -15.690 -20.197 1.00 0.00 ? 3  SER A HG   5  
ATOM 4418  N N    . GLY A 1 4  ? 10.645  -14.000 -21.344 1.00 0.00 ? 4  GLY A N    5  
ATOM 4419  C CA   . GLY A 1 4  ? 9.664   -13.780 -22.391 1.00 0.00 ? 4  GLY A CA   5  
ATOM 4420  C C    . GLY A 1 4  ? 9.758   -12.391 -22.991 1.00 0.00 ? 4  GLY A C    5  
ATOM 4421  O O    . GLY A 1 4  ? 9.799   -12.237 -24.212 1.00 0.00 ? 4  GLY A O    5  
ATOM 4422  H H    . GLY A 1 4  ? 11.559  -13.662 -21.454 1.00 0.00 ? 4  GLY A H    5  
ATOM 4423  H HA2  . GLY A 1 4  ? 9.816   -14.510 -23.172 1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4424  H HA3  . GLY A 1 4  ? 8.676   -13.913 -21.975 1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4425  N N    . SER A 1 5  ? 9.791   -11.377 -22.132 1.00 0.00 ? 5  SER A N    5  
ATOM 4426  C CA   . SER A 1 5  ? 9.875   -9.994  -22.585 1.00 0.00 ? 5  SER A CA   5  
ATOM 4427  C C    . SER A 1 5  ? 8.999   -9.770  -23.814 1.00 0.00 ? 5  SER A C    5  
ATOM 4428  O O    . SER A 1 5  ? 9.403   -9.100  -24.764 1.00 0.00 ? 5  SER A O    5  
ATOM 4429  C CB   . SER A 1 5  ? 11.326  -9.627  -22.905 1.00 0.00 ? 5  SER A CB   5  
ATOM 4430  O OG   . SER A 1 5  ? 11.847  -10.455 -23.930 1.00 0.00 ? 5  SER A OG   5  
ATOM 4431  H H    . SER A 1 5  ? 9.755   -11.565 -21.171 1.00 0.00 ? 5  SER A H    5  
ATOM 4432  H HA   . SER A 1 5  ? 9.521   -9.361  -21.785 1.00 0.00 ? 5  SER A HA   5  
ATOM 4433  H HB2  . SER A 1 5  ? 11.371  -8.599  -23.231 1.00 0.00 ? 5  SER A HB2  5  
ATOM 4434  H HB3  . SER A 1 5  ? 11.929  -9.750  -22.017 1.00 0.00 ? 5  SER A HB3  5  
ATOM 4435  H HG   . SER A 1 5  ? 12.659  -10.868 -23.627 1.00 0.00 ? 5  SER A HG   5  
ATOM 4436  N N    . SER A 1 6  ? 7.798   -10.338 -23.788 1.00 0.00 ? 6  SER A N    5  
ATOM 4437  C CA   . SER A 1 6  ? 6.865   -10.205 -24.900 1.00 0.00 ? 6  SER A CA   5  
ATOM 4438  C C    . SER A 1 6  ? 5.550   -9.586  -24.436 1.00 0.00 ? 6  SER A C    5  
ATOM 4439  O O    . SER A 1 6  ? 4.946   -10.040 -23.466 1.00 0.00 ? 6  SER A O    5  
ATOM 4440  C CB   . SER A 1 6  ? 6.602   -11.570 -25.539 1.00 0.00 ? 6  SER A CB   5  
ATOM 4441  O OG   . SER A 1 6  ? 6.086   -11.428 -26.851 1.00 0.00 ? 6  SER A OG   5  
ATOM 4442  H H    . SER A 1 6  ? 7.534   -10.861 -23.002 1.00 0.00 ? 6  SER A H    5  
ATOM 4443  H HA   . SER A 1 6  ? 7.316   -9.554  -25.635 1.00 0.00 ? 6  SER A HA   5  
ATOM 4444  H HB2  . SER A 1 6  ? 7.525   -12.126 -25.587 1.00 0.00 ? 6  SER A HB2  5  
ATOM 4445  H HB3  . SER A 1 6  ? 5.885   -12.112 -24.940 1.00 0.00 ? 6  SER A HB3  5  
ATOM 4446  H HG   . SER A 1 6  ? 5.160   -11.179 -26.806 1.00 0.00 ? 6  SER A HG   5  
ATOM 4447  N N    . GLY A 1 7  ? 5.113   -8.544  -25.138 1.00 0.00 ? 7  GLY A N    5  
ATOM 4448  C CA   . GLY A 1 7  ? 3.873   -7.879  -24.783 1.00 0.00 ? 7  GLY A CA   5  
ATOM 4449  C C    . GLY A 1 7  ? 4.100   -6.488  -24.224 1.00 0.00 ? 7  GLY A C    5  
ATOM 4450  O O    . GLY A 1 7  ? 3.689   -6.188  -23.104 1.00 0.00 ? 7  GLY A O    5  
ATOM 4451  H H    . GLY A 1 7  ? 5.637   -8.225  -25.902 1.00 0.00 ? 7  GLY A H    5  
ATOM 4452  H HA2  . GLY A 1 7  ? 3.252   -7.805  -25.664 1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4453  H HA3  . GLY A 1 7  ? 3.358   -8.473  -24.041 1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4454  N N    . ARG A 1 8  ? 4.759   -5.639  -25.006 1.00 0.00 ? 8  ARG A N    5  
ATOM 4455  C CA   . ARG A 1 8  ? 5.043   -4.273  -24.581 1.00 0.00 ? 8  ARG A CA   5  
ATOM 4456  C C    . ARG A 1 8  ? 3.828   -3.653  -23.897 1.00 0.00 ? 8  ARG A C    5  
ATOM 4457  O O    . ARG A 1 8  ? 3.960   -2.942  -22.901 1.00 0.00 ? 8  ARG A O    5  
ATOM 4458  C CB   . ARG A 1 8  ? 5.457   -3.419  -25.781 1.00 0.00 ? 8  ARG A CB   5  
ATOM 4459  C CG   . ARG A 1 8  ? 4.399   -3.344  -26.869 1.00 0.00 ? 8  ARG A CG   5  
ATOM 4460  C CD   . ARG A 1 8  ? 4.685   -2.214  -27.847 1.00 0.00 ? 8  ARG A CD   5  
ATOM 4461  N NE   . ARG A 1 8  ? 4.022   -2.420  -29.131 1.00 0.00 ? 8  ARG A NE   5  
ATOM 4462  C CZ   . ARG A 1 8  ? 4.481   -3.236  -30.073 1.00 0.00 ? 8  ARG A CZ   5  
ATOM 4463  N NH1  . ARG A 1 8  ? 5.601   -3.919  -29.875 1.00 0.00 ? 8  ARG A NH1  5  
ATOM 4464  N NH2  . ARG A 1 8  ? 3.821   -3.371  -31.216 1.00 0.00 ? 8  ARG A NH2  5  
ATOM 4465  H H    . ARG A 1 8  ? 5.061   -5.937  -25.889 1.00 0.00 ? 8  ARG A H    5  
ATOM 4466  H HA   . ARG A 1 8  ? 5.859   -4.308  -23.876 1.00 0.00 ? 8  ARG A HA   5  
ATOM 4467  H HB2  . ARG A 1 8  ? 5.663   -2.415  -25.439 1.00 0.00 ? 8  ARG A HB2  5  
ATOM 4468  H HB3  . ARG A 1 8  ? 6.356   -3.836  -26.210 1.00 0.00 ? 8  ARG A HB3  5  
ATOM 4469  H HG2  . ARG A 1 8  ? 4.386   -4.278  -27.411 1.00 0.00 ? 8  ARG A HG2  5  
ATOM 4470  H HG3  . ARG A 1 8  ? 3.436   -3.177  -26.411 1.00 0.00 ? 8  ARG A HG3  5  
ATOM 4471  H HD2  . ARG A 1 8  ? 4.336   -1.287  -27.417 1.00 0.00 ? 8  ARG A HD2  5  
ATOM 4472  H HD3  . ARG A 1 8  ? 5.751   -2.157  -28.008 1.00 0.00 ? 8  ARG A HD3  5  
ATOM 4473  H HE   . ARG A 1 8  ? 3.193   -1.926  -29.298 1.00 0.00 ? 8  ARG A HE   5  
ATOM 4474  H HH11 . ARG A 1 8  ? 6.100   -3.820  -29.015 1.00 0.00 ? 8  ARG A HH11 5  
ATOM 4475  H HH12 . ARG A 1 8  ? 5.944   -4.533  -30.586 1.00 0.00 ? 8  ARG A HH12 5  
ATOM 4476  H HH21 . ARG A 1 8  ? 2.976   -2.858  -31.369 1.00 0.00 ? 8  ARG A HH21 5  
ATOM 4477  H HH22 . ARG A 1 8  ? 4.167   -3.985  -31.925 1.00 0.00 ? 8  ARG A HH22 5  
ATOM 4478  N N    . SER A 1 9  ? 2.646   -3.926  -24.440 1.00 0.00 ? 9  SER A N    5  
ATOM 4479  C CA   . SER A 1 9  ? 1.408   -3.392  -23.884 1.00 0.00 ? 9  SER A CA   5  
ATOM 4480  C C    . SER A 1 9  ? 0.941   -4.226  -22.695 1.00 0.00 ? 9  SER A C    5  
ATOM 4481  O O    . SER A 1 9  ? 0.084   -5.099  -22.833 1.00 0.00 ? 9  SER A O    5  
ATOM 4482  C CB   . SER A 1 9  ? 0.317   -3.356  -24.956 1.00 0.00 ? 9  SER A CB   5  
ATOM 4483  O OG   . SER A 1 9  ? -0.679  -2.400  -24.638 1.00 0.00 ? 9  SER A OG   5  
ATOM 4484  H H    . SER A 1 9  ? 2.606   -4.500  -25.234 1.00 0.00 ? 9  SER A H    5  
ATOM 4485  H HA   . SER A 1 9  ? 1.603   -2.385  -23.548 1.00 0.00 ? 9  SER A HA   5  
ATOM 4486  H HB2  . SER A 1 9  ? 0.758   -3.096  -25.907 1.00 0.00 ? 9  SER A HB2  5  
ATOM 4487  H HB3  . SER A 1 9  ? -0.145  -4.330  -25.029 1.00 0.00 ? 9  SER A HB3  5  
ATOM 4488  H HG   . SER A 1 9  ? -0.709  -2.272  -23.687 1.00 0.00 ? 9  SER A HG   5  
ATOM 4489  N N    . SER A 1 10 ? 1.511   -3.950  -21.527 1.00 0.00 ? 10 SER A N    5  
ATOM 4490  C CA   . SER A 1 10 ? 1.157   -4.677  -20.313 1.00 0.00 ? 10 SER A CA   5  
ATOM 4491  C C    . SER A 1 10 ? 0.651   -3.722  -19.236 1.00 0.00 ? 10 SER A C    5  
ATOM 4492  O O    . SER A 1 10 ? 1.418   -3.256  -18.394 1.00 0.00 ? 10 SER A O    5  
ATOM 4493  C CB   . SER A 1 10 ? 2.365   -5.458  -19.791 1.00 0.00 ? 10 SER A CB   5  
ATOM 4494  O OG   . SER A 1 10 ? 2.617   -6.601  -20.590 1.00 0.00 ? 10 SER A OG   5  
ATOM 4495  H H    . SER A 1 10 ? 2.188   -3.243  -21.481 1.00 0.00 ? 10 SER A H    5  
ATOM 4496  H HA   . SER A 1 10 ? 0.369   -5.372  -20.561 1.00 0.00 ? 10 SER A HA   5  
ATOM 4497  H HB2  . SER A 1 10 ? 3.237   -4.822  -19.808 1.00 0.00 ? 10 SER A HB2  5  
ATOM 4498  H HB3  . SER A 1 10 ? 2.171   -5.778  -18.777 1.00 0.00 ? 10 SER A HB3  5  
ATOM 4499  H HG   . SER A 1 10 ? 2.077   -7.333  -20.283 1.00 0.00 ? 10 SER A HG   5  
ATOM 4500  N N    . ARG A 1 11 ? -0.646  -3.435  -19.272 1.00 0.00 ? 11 ARG A N    5  
ATOM 4501  C CA   . ARG A 1 11 ? -1.256  -2.535  -18.300 1.00 0.00 ? 11 ARG A CA   5  
ATOM 4502  C C    . ARG A 1 11 ? -2.259  -3.280  -17.424 1.00 0.00 ? 11 ARG A C    5  
ATOM 4503  O O    . ARG A 1 11 ? -3.203  -3.892  -17.923 1.00 0.00 ? 11 ARG A O    5  
ATOM 4504  C CB   . ARG A 1 11 ? -1.951  -1.375  -19.015 1.00 0.00 ? 11 ARG A CB   5  
ATOM 4505  C CG   . ARG A 1 11 ? -2.860  -1.815  -20.151 1.00 0.00 ? 11 ARG A CG   5  
ATOM 4506  C CD   . ARG A 1 11 ? -2.093  -1.956  -21.456 1.00 0.00 ? 11 ARG A CD   5  
ATOM 4507  N NE   . ARG A 1 11 ? -1.854  -0.663  -22.092 1.00 0.00 ? 11 ARG A NE   5  
ATOM 4508  C CZ   . ARG A 1 11 ? -2.742  -0.048  -22.865 1.00 0.00 ? 11 ARG A CZ   5  
ATOM 4509  N NH1  . ARG A 1 11 ? -3.922  -0.606  -23.097 1.00 0.00 ? 11 ARG A NH1  5  
ATOM 4510  N NH2  . ARG A 1 11 ? -2.450  1.127   -23.408 1.00 0.00 ? 11 ARG A NH2  5  
ATOM 4511  H H    . ARG A 1 11 ? -1.207  -3.838  -19.968 1.00 0.00 ? 11 ARG A H    5  
ATOM 4512  H HA   . ARG A 1 11 ? -0.470  -2.141  -17.674 1.00 0.00 ? 11 ARG A HA   5  
ATOM 4513  H HB2  . ARG A 1 11 ? -2.547  -0.830  -18.297 1.00 0.00 ? 11 ARG A HB2  5  
ATOM 4514  H HB3  . ARG A 1 11 ? -1.199  -0.715  -19.421 1.00 0.00 ? 11 ARG A HB3  5  
ATOM 4515  H HG2  . ARG A 1 11 ? -3.298  -2.770  -19.899 1.00 0.00 ? 11 ARG A HG2  5  
ATOM 4516  H HG3  . ARG A 1 11 ? -3.642  -1.081  -20.279 1.00 0.00 ? 11 ARG A HG3  5  
ATOM 4517  H HD2  . ARG A 1 11 ? -1.143  -2.426  -21.251 1.00 0.00 ? 11 ARG A HD2  5  
ATOM 4518  H HD3  . ARG A 1 11 ? -2.665  -2.577  -22.129 1.00 0.00 ? 11 ARG A HD3  5  
ATOM 4519  H HE   . ARG A 1 11 ? -0.988  -0.233  -21.934 1.00 0.00 ? 11 ARG A HE   5  
ATOM 4520  H HH11 . ARG A 1 11 ? -4.145  -1.491  -22.688 1.00 0.00 ? 11 ARG A HH11 5  
ATOM 4521  H HH12 . ARG A 1 11 ? -4.590  -0.140  -23.679 1.00 0.00 ? 11 ARG A HH12 5  
ATOM 4522  H HH21 . ARG A 1 11 ? -1.562  1.551   -23.235 1.00 0.00 ? 11 ARG A HH21 5  
ATOM 4523  H HH22 . ARG A 1 11 ? -3.119  1.588   -23.990 1.00 0.00 ? 11 ARG A HH22 5  
ATOM 4524  N N    . THR A 1 12 ? -2.046  -3.224  -16.112 1.00 0.00 ? 12 THR A N    5  
ATOM 4525  C CA   . THR A 1 12 ? -2.929  -3.894  -15.166 1.00 0.00 ? 12 THR A CA   5  
ATOM 4526  C C    . THR A 1 12 ? -3.442  -2.922  -14.110 1.00 0.00 ? 12 THR A C    5  
ATOM 4527  O O    . THR A 1 12 ? -2.666  -2.371  -13.330 1.00 0.00 ? 12 THR A O    5  
ATOM 4528  C CB   . THR A 1 12 ? -2.215  -5.066  -14.465 1.00 0.00 ? 12 THR A CB   5  
ATOM 4529  O OG1  . THR A 1 12 ? -3.116  -5.719  -13.564 1.00 0.00 ? 12 THR A OG1  5  
ATOM 4530  C CG2  . THR A 1 12 ? -0.993  -4.577  -13.702 1.00 0.00 ? 12 THR A CG2  5  
ATOM 4531  H H    . THR A 1 12 ? -1.276  -2.721  -15.775 1.00 0.00 ? 12 THR A H    5  
ATOM 4532  H HA   . THR A 1 12 ? -3.769  -4.290  -15.717 1.00 0.00 ? 12 THR A HA   5  
ATOM 4533  H HB   . THR A 1 12 ? -1.893  -5.773  -15.216 1.00 0.00 ? 12 THR A HB   5  
ATOM 4534  H HG1  . THR A 1 12 ? -3.674  -5.064  -13.138 1.00 0.00 ? 12 THR A HG1  5  
ATOM 4535  H HG21 . THR A 1 12 ? -0.394  -5.423  -13.400 1.00 0.00 ? 12 THR A HG21 5  
ATOM 4536  H HG22 . THR A 1 12 ? -1.310  -4.029  -12.827 1.00 0.00 ? 12 THR A HG22 5  
ATOM 4537  H HG23 . THR A 1 12 ? -0.407  -3.930  -14.338 1.00 0.00 ? 12 THR A HG23 5  
ATOM 4538  N N    . ARG A 1 13 ? -4.755  -2.717  -14.091 1.00 0.00 ? 13 ARG A N    5  
ATOM 4539  C CA   . ARG A 1 13 ? -5.373  -1.810  -13.130 1.00 0.00 ? 13 ARG A CA   5  
ATOM 4540  C C    . ARG A 1 13 ? -5.882  -2.574  -11.911 1.00 0.00 ? 13 ARG A C    5  
ATOM 4541  O O    . ARG A 1 13 ? -6.814  -3.372  -12.011 1.00 0.00 ? 13 ARG A O    5  
ATOM 4542  C CB   . ARG A 1 13 ? -6.525  -1.047  -13.785 1.00 0.00 ? 13 ARG A CB   5  
ATOM 4543  C CG   . ARG A 1 13 ? -6.084  0.210   -14.519 1.00 0.00 ? 13 ARG A CG   5  
ATOM 4544  C CD   . ARG A 1 13 ? -6.008  1.404   -13.581 1.00 0.00 ? 13 ARG A CD   5  
ATOM 4545  N NE   . ARG A 1 13 ? -7.328  1.821   -13.117 1.00 0.00 ? 13 ARG A NE   5  
ATOM 4546  C CZ   . ARG A 1 13 ? -7.583  3.023   -12.612 1.00 0.00 ? 13 ARG A CZ   5  
ATOM 4547  N NH1  . ARG A 1 13 ? -6.614  3.922   -12.507 1.00 0.00 ? 13 ARG A NH1  5  
ATOM 4548  N NH2  . ARG A 1 13 ? -8.811  3.328   -12.211 1.00 0.00 ? 13 ARG A NH2  5  
ATOM 4549  H H    . ARG A 1 13 ? -5.323  -3.186  -14.738 1.00 0.00 ? 13 ARG A H    5  
ATOM 4550  H HA   . ARG A 1 13 ? -4.621  -1.104  -12.810 1.00 0.00 ? 13 ARG A HA   5  
ATOM 4551  H HB2  . ARG A 1 13 ? -7.016  -1.697  -14.494 1.00 0.00 ? 13 ARG A HB2  5  
ATOM 4552  H HB3  . ARG A 1 13 ? -7.232  -0.762  -13.021 1.00 0.00 ? 13 ARG A HB3  5  
ATOM 4553  H HG2  . ARG A 1 13 ? -5.108  0.040   -14.949 1.00 0.00 ? 13 ARG A HG2  5  
ATOM 4554  H HG3  . ARG A 1 13 ? -6.794  0.424   -15.304 1.00 0.00 ? 13 ARG A HG3  5  
ATOM 4555  H HD2  . ARG A 1 13 ? -5.404  1.136   -12.727 1.00 0.00 ? 13 ARG A HD2  5  
ATOM 4556  H HD3  . ARG A 1 13 ? -5.544  2.226   -14.105 1.00 0.00 ? 13 ARG A HD3  5  
ATOM 4557  H HE   . ARG A 1 13 ? -8.059  1.173   -13.185 1.00 0.00 ? 13 ARG A HE   5  
ATOM 4558  H HH11 . ARG A 1 13 ? -5.689  3.695   -12.809 1.00 0.00 ? 13 ARG A HH11 5  
ATOM 4559  H HH12 . ARG A 1 13 ? -6.810  4.826   -12.127 1.00 0.00 ? 13 ARG A HH12 5  
ATOM 4560  H HH21 . ARG A 1 13 ? -9.544  2.654   -12.289 1.00 0.00 ? 13 ARG A HH21 5  
ATOM 4561  H HH22 . ARG A 1 13 ? -9.002  4.233   -11.831 1.00 0.00 ? 13 ARG A HH22 5  
ATOM 4562  N N    . PHE A 1 14 ? -5.263  -2.324  -10.762 1.00 0.00 ? 14 PHE A N    5  
ATOM 4563  C CA   . PHE A 1 14 ? -5.653  -2.989  -9.524  1.00 0.00 ? 14 PHE A CA   5  
ATOM 4564  C C    . PHE A 1 14 ? -6.789  -2.237  -8.837  1.00 0.00 ? 14 PHE A C    5  
ATOM 4565  O O    . PHE A 1 14 ? -6.929  -1.023  -8.991  1.00 0.00 ? 14 PHE A O    5  
ATOM 4566  C CB   . PHE A 1 14 ? -4.454  -3.098  -8.580  1.00 0.00 ? 14 PHE A CB   5  
ATOM 4567  C CG   . PHE A 1 14 ? -3.194  -3.550  -9.260  1.00 0.00 ? 14 PHE A CG   5  
ATOM 4568  C CD1  . PHE A 1 14 ? -3.026  -4.876  -9.625  1.00 0.00 ? 14 PHE A CD1  5  
ATOM 4569  C CD2  . PHE A 1 14 ? -2.177  -2.650  -9.536  1.00 0.00 ? 14 PHE A CD2  5  
ATOM 4570  C CE1  . PHE A 1 14 ? -1.867  -5.295  -10.251 1.00 0.00 ? 14 PHE A CE1  5  
ATOM 4571  C CE2  . PHE A 1 14 ? -1.016  -3.063  -10.162 1.00 0.00 ? 14 PHE A CE2  5  
ATOM 4572  C CZ   . PHE A 1 14 ? -0.862  -4.387  -10.521 1.00 0.00 ? 14 PHE A CZ   5  
ATOM 4573  H H    . PHE A 1 14 ? -4.527  -1.677  -10.746 1.00 0.00 ? 14 PHE A H    5  
ATOM 4574  H HA   . PHE A 1 14 ? -5.994  -3.981  -9.775  1.00 0.00 ? 14 PHE A HA   5  
ATOM 4575  H HB2  . PHE A 1 14 ? -4.263  -2.131  -8.139  1.00 0.00 ? 14 PHE A HB2  5  
ATOM 4576  H HB3  . PHE A 1 14 ? -4.683  -3.806  -7.798  1.00 0.00 ? 14 PHE A HB3  5  
ATOM 4577  H HD1  . PHE A 1 14 ? -3.811  -5.587  -9.416  1.00 0.00 ? 14 PHE A HD1  5  
ATOM 4578  H HD2  . PHE A 1 14 ? -2.298  -1.612  -9.255  1.00 0.00 ? 14 PHE A HD2  5  
ATOM 4579  H HE1  . PHE A 1 14 ? -1.748  -6.332  -10.531 1.00 0.00 ? 14 PHE A HE1  5  
ATOM 4580  H HE2  . PHE A 1 14 ? -0.233  -2.350  -10.371 1.00 0.00 ? 14 PHE A HE2  5  
ATOM 4581  H HZ   . PHE A 1 14 ? 0.045   -4.713  -11.009 1.00 0.00 ? 14 PHE A HZ   5  
ATOM 4582  N N    . THR A 1 15 ? -7.600  -2.967  -8.078  1.00 0.00 ? 15 THR A N    5  
ATOM 4583  C CA   . THR A 1 15 ? -8.725  -2.372  -7.368  1.00 0.00 ? 15 THR A CA   5  
ATOM 4584  C C    . THR A 1 15 ? -8.419  -2.216  -5.883  1.00 0.00 ? 15 THR A C    5  
ATOM 4585  O O    . THR A 1 15 ? -7.587  -2.938  -5.333  1.00 0.00 ? 15 THR A O    5  
ATOM 4586  C CB   . THR A 1 15 ? -10.003 -3.216  -7.532  1.00 0.00 ? 15 THR A CB   5  
ATOM 4587  O OG1  . THR A 1 15 ? -11.104 -2.569  -6.885  1.00 0.00 ? 15 THR A OG1  5  
ATOM 4588  C CG2  . THR A 1 15 ? -9.811  -4.607  -6.947  1.00 0.00 ? 15 THR A CG2  5  
ATOM 4589  H H    . THR A 1 15 ? -7.437  -3.930  -7.995  1.00 0.00 ? 15 THR A H    5  
ATOM 4590  H HA   . THR A 1 15 ? -8.908  -1.395  -7.793  1.00 0.00 ? 15 THR A HA   5  
ATOM 4591  H HB   . THR A 1 15 ? -10.221 -3.312  -8.586  1.00 0.00 ? 15 THR A HB   5  
ATOM 4592  H HG1  . THR A 1 15 ? -11.791 -2.383  -7.530  1.00 0.00 ? 15 THR A HG1  5  
ATOM 4593  H HG21 . THR A 1 15 ? -9.344  -4.528  -5.976  1.00 0.00 ? 15 THR A HG21 5  
ATOM 4594  H HG22 . THR A 1 15 ? -9.182  -5.190  -7.603  1.00 0.00 ? 15 THR A HG22 5  
ATOM 4595  H HG23 . THR A 1 15 ? -10.771 -5.090  -6.846  1.00 0.00 ? 15 THR A HG23 5  
ATOM 4596  N N    . ASP A 1 16 ? -9.095  -1.271  -5.240  1.00 0.00 ? 16 ASP A N    5  
ATOM 4597  C CA   . ASP A 1 16 ? -8.896  -1.023  -3.817  1.00 0.00 ? 16 ASP A CA   5  
ATOM 4598  C C    . ASP A 1 16 ? -8.598  -2.322  -3.075  1.00 0.00 ? 16 ASP A C    5  
ATOM 4599  O O    . ASP A 1 16 ? -7.700  -2.376  -2.234  1.00 0.00 ? 16 ASP A O    5  
ATOM 4600  C CB   . ASP A 1 16 ? -10.132 -0.350  -3.217  1.00 0.00 ? 16 ASP A CB   5  
ATOM 4601  C CG   . ASP A 1 16 ? -10.548 0.889   -3.986  1.00 0.00 ? 16 ASP A CG   5  
ATOM 4602  O OD1  . ASP A 1 16 ? -11.299 0.750   -4.973  1.00 0.00 ? 16 ASP A OD1  5  
ATOM 4603  O OD2  . ASP A 1 16 ? -10.121 1.997   -3.600  1.00 0.00 ? 16 ASP A OD2  5  
ATOM 4604  H H    . ASP A 1 16 ? -9.745  -0.728  -5.734  1.00 0.00 ? 16 ASP A H    5  
ATOM 4605  H HA   . ASP A 1 16 ? -8.051  -0.360  -3.711  1.00 0.00 ? 16 ASP A HA   5  
ATOM 4606  H HB2  . ASP A 1 16 ? -10.955 -1.050  -3.227  1.00 0.00 ? 16 ASP A HB2  5  
ATOM 4607  H HB3  . ASP A 1 16 ? -9.920  -0.066  -2.197  1.00 0.00 ? 16 ASP A HB3  5  
ATOM 4608  N N    . TYR A 1 17 ? -9.357  -3.365  -3.391  1.00 0.00 ? 17 TYR A N    5  
ATOM 4609  C CA   . TYR A 1 17 ? -9.176  -4.663  -2.752  1.00 0.00 ? 17 TYR A CA   5  
ATOM 4610  C C    . TYR A 1 17 ? -7.743  -5.158  -2.920  1.00 0.00 ? 17 TYR A C    5  
ATOM 4611  O O    . TYR A 1 17 ? -7.104  -5.580  -1.957  1.00 0.00 ? 17 TYR A O    5  
ATOM 4612  C CB   . TYR A 1 17 ? -10.152 -5.684  -3.338  1.00 0.00 ? 17 TYR A CB   5  
ATOM 4613  C CG   . TYR A 1 17 ? -9.679  -7.115  -3.216  1.00 0.00 ? 17 TYR A CG   5  
ATOM 4614  C CD1  . TYR A 1 17 ? -9.198  -7.607  -2.009  1.00 0.00 ? 17 TYR A CD1  5  
ATOM 4615  C CD2  . TYR A 1 17 ? -9.710  -7.974  -4.307  1.00 0.00 ? 17 TYR A CD2  5  
ATOM 4616  C CE1  . TYR A 1 17 ? -8.763  -8.913  -1.893  1.00 0.00 ? 17 TYR A CE1  5  
ATOM 4617  C CE2  . TYR A 1 17 ? -9.279  -9.281  -4.200  1.00 0.00 ? 17 TYR A CE2  5  
ATOM 4618  C CZ   . TYR A 1 17 ? -8.806  -9.747  -2.991  1.00 0.00 ? 17 TYR A CZ   5  
ATOM 4619  O OH   . TYR A 1 17 ? -8.374  -11.048 -2.880  1.00 0.00 ? 17 TYR A OH   5  
ATOM 4620  H H    . TYR A 1 17 ? -10.056 -3.260  -4.069  1.00 0.00 ? 17 TYR A H    5  
ATOM 4621  H HA   . TYR A 1 17 ? -9.383  -4.546  -1.698  1.00 0.00 ? 17 TYR A HA   5  
ATOM 4622  H HB2  . TYR A 1 17 ? -11.098 -5.604  -2.824  1.00 0.00 ? 17 TYR A HB2  5  
ATOM 4623  H HB3  . TYR A 1 17 ? -10.299 -5.471  -4.387  1.00 0.00 ? 17 TYR A HB3  5  
ATOM 4624  H HD1  . TYR A 1 17 ? -9.165  -6.952  -1.150  1.00 0.00 ? 17 TYR A HD1  5  
ATOM 4625  H HD2  . TYR A 1 17 ? -10.081 -7.606  -5.253  1.00 0.00 ? 17 TYR A HD2  5  
ATOM 4626  H HE1  . TYR A 1 17 ? -8.393  -9.278  -0.946  1.00 0.00 ? 17 TYR A HE1  5  
ATOM 4627  H HE2  . TYR A 1 17 ? -9.312  -9.934  -5.060  1.00 0.00 ? 17 TYR A HE2  5  
ATOM 4628  H HH   . TYR A 1 17 ? -8.745  -11.570 -3.595  1.00 0.00 ? 17 TYR A HH   5  
ATOM 4629  N N    . GLN A 1 18 ? -7.245  -5.104  -4.152  1.00 0.00 ? 18 GLN A N    5  
ATOM 4630  C CA   . GLN A 1 18 ? -5.888  -5.546  -4.447  1.00 0.00 ? 18 GLN A CA   5  
ATOM 4631  C C    . GLN A 1 18 ? -4.864  -4.531  -3.952  1.00 0.00 ? 18 GLN A C    5  
ATOM 4632  O O    . GLN A 1 18 ? -3.906  -4.884  -3.263  1.00 0.00 ? 18 GLN A O    5  
ATOM 4633  C CB   . GLN A 1 18 ? -5.718  -5.768  -5.951  1.00 0.00 ? 18 GLN A CB   5  
ATOM 4634  C CG   . GLN A 1 18 ? -6.738  -6.726  -6.544  1.00 0.00 ? 18 GLN A CG   5  
ATOM 4635  C CD   . GLN A 1 18 ? -6.226  -7.431  -7.785  1.00 0.00 ? 18 GLN A CD   5  
ATOM 4636  O OE1  . GLN A 1 18 ? -5.773  -6.790  -8.734  1.00 0.00 ? 18 GLN A OE1  5  
ATOM 4637  N NE2  . GLN A 1 18 ? -6.293  -8.757  -7.783  1.00 0.00 ? 18 GLN A NE2  5  
ATOM 4638  H H    . GLN A 1 18 ? -7.804  -4.758  -4.878  1.00 0.00 ? 18 GLN A H    5  
ATOM 4639  H HA   . GLN A 1 18 ? -5.726  -6.482  -3.934  1.00 0.00 ? 18 GLN A HA   5  
ATOM 4640  H HB2  . GLN A 1 18 ? -5.811  -4.819  -6.456  1.00 0.00 ? 18 GLN A HB2  5  
ATOM 4641  H HB3  . GLN A 1 18 ? -4.732  -6.169  -6.134  1.00 0.00 ? 18 GLN A HB3  5  
ATOM 4642  H HG2  . GLN A 1 18 ? -6.987  -7.471  -5.803  1.00 0.00 ? 18 GLN A HG2  5  
ATOM 4643  H HG3  . GLN A 1 18 ? -7.626  -6.169  -6.805  1.00 0.00 ? 18 GLN A HG3  5  
ATOM 4644  H HE21 . GLN A 1 18 ? -6.667  -9.200  -6.992  1.00 0.00 ? 18 GLN A HE21 5  
ATOM 4645  H HE22 . GLN A 1 18 ? -5.970  -9.238  -8.572  1.00 0.00 ? 18 GLN A HE22 5  
ATOM 4646  N N    . LEU A 1 19 ? -5.072  -3.268  -4.307  1.00 0.00 ? 19 LEU A N    5  
ATOM 4647  C CA   . LEU A 1 19 ? -4.166  -2.199  -3.899  1.00 0.00 ? 19 LEU A CA   5  
ATOM 4648  C C    . LEU A 1 19 ? -4.023  -2.157  -2.381  1.00 0.00 ? 19 LEU A C    5  
ATOM 4649  O O    . LEU A 1 19 ? -2.987  -1.747  -1.856  1.00 0.00 ? 19 LEU A O    5  
ATOM 4650  C CB   . LEU A 1 19 ? -4.672  -0.851  -4.413  1.00 0.00 ? 19 LEU A CB   5  
ATOM 4651  C CG   . LEU A 1 19 ? -4.506  -0.598  -5.912  1.00 0.00 ? 19 LEU A CG   5  
ATOM 4652  C CD1  . LEU A 1 19 ? -5.101  0.748   -6.295  1.00 0.00 ? 19 LEU A CD1  5  
ATOM 4653  C CD2  . LEU A 1 19 ? -3.037  -0.665  -6.304  1.00 0.00 ? 19 LEU A CD2  5  
ATOM 4654  H H    . LEU A 1 19 ? -5.852  -3.047  -4.857  1.00 0.00 ? 19 LEU A H    5  
ATOM 4655  H HA   . LEU A 1 19 ? -3.198  -2.401  -4.334  1.00 0.00 ? 19 LEU A HA   5  
ATOM 4656  H HB2  . LEU A 1 19 ? -5.724  -0.782  -4.181  1.00 0.00 ? 19 LEU A HB2  5  
ATOM 4657  H HB3  . LEU A 1 19 ? -4.137  -0.074  -3.884  1.00 0.00 ? 19 LEU A HB3  5  
ATOM 4658  H HG   . LEU A 1 19 ? -5.035  -1.365  -6.460  1.00 0.00 ? 19 LEU A HG   5  
ATOM 4659  H HD11 . LEU A 1 19 ? -4.310  1.475   -6.399  1.00 0.00 ? 19 LEU A HD11 5  
ATOM 4660  H HD12 . LEU A 1 19 ? -5.787  1.070   -5.526  1.00 0.00 ? 19 LEU A HD12 5  
ATOM 4661  H HD13 . LEU A 1 19 ? -5.630  0.654   -7.232  1.00 0.00 ? 19 LEU A HD13 5  
ATOM 4662  H HD21 . LEU A 1 19 ? -2.831  -1.620  -6.765  1.00 0.00 ? 19 LEU A HD21 5  
ATOM 4663  H HD22 . LEU A 1 19 ? -2.423  -0.551  -5.422  1.00 0.00 ? 19 LEU A HD22 5  
ATOM 4664  H HD23 . LEU A 1 19 ? -2.815  0.128   -7.003  1.00 0.00 ? 19 LEU A HD23 5  
ATOM 4665  N N    . ARG A 1 20 ? -5.068  -2.586  -1.681  1.00 0.00 ? 20 ARG A N    5  
ATOM 4666  C CA   . ARG A 1 20 ? -5.059  -2.598  -0.223  1.00 0.00 ? 20 ARG A CA   5  
ATOM 4667  C C    . ARG A 1 20 ? -4.035  -3.598  0.305   1.00 0.00 ? 20 ARG A C    5  
ATOM 4668  O O    . ARG A 1 20 ? -3.220  -3.271  1.168   1.00 0.00 ? 20 ARG A O    5  
ATOM 4669  C CB   . ARG A 1 20 ? -6.449  -2.942  0.314   1.00 0.00 ? 20 ARG A CB   5  
ATOM 4670  C CG   . ARG A 1 20 ? -6.548  -2.881  1.830   1.00 0.00 ? 20 ARG A CG   5  
ATOM 4671  C CD   . ARG A 1 20 ? -6.486  -1.448  2.335   1.00 0.00 ? 20 ARG A CD   5  
ATOM 4672  N NE   . ARG A 1 20 ? -7.720  -0.716  2.059   1.00 0.00 ? 20 ARG A NE   5  
ATOM 4673  C CZ   . ARG A 1 20 ? -8.120  0.339   2.759   1.00 0.00 ? 20 ARG A CZ   5  
ATOM 4674  N NH1  . ARG A 1 20 ? -7.389  0.784   3.771   1.00 0.00 ? 20 ARG A NH1  5  
ATOM 4675  N NH2  . ARG A 1 20 ? -9.255  0.952   2.447   1.00 0.00 ? 20 ARG A NH2  5  
ATOM 4676  H H    . ARG A 1 20 ? -5.865  -2.901  -2.156  1.00 0.00 ? 20 ARG A H    5  
ATOM 4677  H HA   . ARG A 1 20 ? -4.786  -1.609  0.115   1.00 0.00 ? 20 ARG A HA   5  
ATOM 4678  H HB2  . ARG A 1 20 ? -7.165  -2.247  -0.100  1.00 0.00 ? 20 ARG A HB2  5  
ATOM 4679  H HB3  . ARG A 1 20 ? -6.706  -3.941  -0.002  1.00 0.00 ? 20 ARG A HB3  5  
ATOM 4680  H HG2  . ARG A 1 20 ? -7.486  -3.319  2.138   1.00 0.00 ? 20 ARG A HG2  5  
ATOM 4681  H HG3  . ARG A 1 20 ? -5.730  -3.440  2.257   1.00 0.00 ? 20 ARG A HG3  5  
ATOM 4682  H HD2  . ARG A 1 20 ? -6.319  -1.463  3.401   1.00 0.00 ? 20 ARG A HD2  5  
ATOM 4683  H HD3  . ARG A 1 20 ? -5.664  -0.945  1.849   1.00 0.00 ? 20 ARG A HD3  5  
ATOM 4684  H HE   . ARG A 1 20 ? -8.276  -1.028  1.315   1.00 0.00 ? 20 ARG A HE   5  
ATOM 4685  H HH11 . ARG A 1 20 ? -6.533  0.325   4.008   1.00 0.00 ? 20 ARG A HH11 5  
ATOM 4686  H HH12 . ARG A 1 20 ? -7.692  1.580   4.296   1.00 0.00 ? 20 ARG A HH12 5  
ATOM 4687  H HH21 . ARG A 1 20 ? -9.809  0.620   1.684   1.00 0.00 ? 20 ARG A HH21 5  
ATOM 4688  H HH22 . ARG A 1 20 ? -9.556  1.746   2.974   1.00 0.00 ? 20 ARG A HH22 5  
ATOM 4689  N N    . VAL A 1 21 ? -4.084  -4.819  -0.218  1.00 0.00 ? 21 VAL A N    5  
ATOM 4690  C CA   . VAL A 1 21 ? -3.161  -5.868  0.201   1.00 0.00 ? 21 VAL A CA   5  
ATOM 4691  C C    . VAL A 1 21 ? -1.746  -5.582  -0.289  1.00 0.00 ? 21 VAL A C    5  
ATOM 4692  O O    . VAL A 1 21 ? -0.773  -5.788  0.437   1.00 0.00 ? 21 VAL A O    5  
ATOM 4693  C CB   . VAL A 1 21 ? -3.605  -7.247  -0.321  1.00 0.00 ? 21 VAL A CB   5  
ATOM 4694  C CG1  . VAL A 1 21 ? -2.580  -8.311  0.043   1.00 0.00 ? 21 VAL A CG1  5  
ATOM 4695  C CG2  . VAL A 1 21 ? -4.978  -7.608  0.227   1.00 0.00 ? 21 VAL A CG2  5  
ATOM 4696  H H    . VAL A 1 21 ? -4.756  -5.020  -0.902  1.00 0.00 ? 21 VAL A H    5  
ATOM 4697  H HA   . VAL A 1 21 ? -3.158  -5.899  1.281   1.00 0.00 ? 21 VAL A HA   5  
ATOM 4698  H HB   . VAL A 1 21 ? -3.672  -7.198  -1.398  1.00 0.00 ? 21 VAL A HB   5  
ATOM 4699  H HG11 . VAL A 1 21 ? -1.683  -7.835  0.410   1.00 0.00 ? 21 VAL A HG11 5  
ATOM 4700  H HG12 . VAL A 1 21 ? -2.987  -8.956  0.808   1.00 0.00 ? 21 VAL A HG12 5  
ATOM 4701  H HG13 . VAL A 1 21 ? -2.343  -8.896  -0.834  1.00 0.00 ? 21 VAL A HG13 5  
ATOM 4702  H HG21 . VAL A 1 21 ? -5.676  -6.818  -0.007  1.00 0.00 ? 21 VAL A HG21 5  
ATOM 4703  H HG22 . VAL A 1 21 ? -5.314  -8.531  -0.223  1.00 0.00 ? 21 VAL A HG22 5  
ATOM 4704  H HG23 . VAL A 1 21 ? -4.917  -7.731  1.298   1.00 0.00 ? 21 VAL A HG23 5  
ATOM 4705  N N    . LEU A 1 22 ? -1.639  -5.107  -1.525  1.00 0.00 ? 22 LEU A N    5  
ATOM 4706  C CA   . LEU A 1 22 ? -0.342  -4.792  -2.114  1.00 0.00 ? 22 LEU A CA   5  
ATOM 4707  C C    . LEU A 1 22 ? 0.325   -3.636  -1.375  1.00 0.00 ? 22 LEU A C    5  
ATOM 4708  O O    . LEU A 1 22 ? 1.524   -3.672  -1.101  1.00 0.00 ? 22 LEU A O    5  
ATOM 4709  C CB   . LEU A 1 22 ? -0.503  -4.441  -3.594  1.00 0.00 ? 22 LEU A CB   5  
ATOM 4710  C CG   . LEU A 1 22 ? -1.068  -5.546  -4.488  1.00 0.00 ? 22 LEU A CG   5  
ATOM 4711  C CD1  . LEU A 1 22 ? -1.487  -4.980  -5.836  1.00 0.00 ? 22 LEU A CD1  5  
ATOM 4712  C CD2  . LEU A 1 22 ? -0.047  -6.660  -4.669  1.00 0.00 ? 22 LEU A CD2  5  
ATOM 4713  H H    . LEU A 1 22 ? -2.450  -4.964  -2.055  1.00 0.00 ? 22 LEU A H    5  
ATOM 4714  H HA   . LEU A 1 22 ? 0.284   -5.668  -2.026  1.00 0.00 ? 22 LEU A HA   5  
ATOM 4715  H HB2  . LEU A 1 22 ? -1.164  -3.591  -3.662  1.00 0.00 ? 22 LEU A HB2  5  
ATOM 4716  H HB3  . LEU A 1 22 ? 0.471   -4.170  -3.977  1.00 0.00 ? 22 LEU A HB3  5  
ATOM 4717  H HG   . LEU A 1 22 ? -1.945  -5.968  -4.017  1.00 0.00 ? 22 LEU A HG   5  
ATOM 4718  H HD11 . LEU A 1 22 ? -2.550  -4.792  -5.833  1.00 0.00 ? 22 LEU A HD11 5  
ATOM 4719  H HD12 . LEU A 1 22 ? -1.249  -5.691  -6.614  1.00 0.00 ? 22 LEU A HD12 5  
ATOM 4720  H HD13 . LEU A 1 22 ? -0.957  -4.056  -6.018  1.00 0.00 ? 22 LEU A HD13 5  
ATOM 4721  H HD21 . LEU A 1 22 ? -0.078  -7.319  -3.813  1.00 0.00 ? 22 LEU A HD21 5  
ATOM 4722  H HD22 . LEU A 1 22 ? 0.941   -6.232  -4.757  1.00 0.00 ? 22 LEU A HD22 5  
ATOM 4723  H HD23 . LEU A 1 22 ? -0.279  -7.219  -5.563  1.00 0.00 ? 22 LEU A HD23 5  
ATOM 4724  N N    . GLN A 1 23 ? -0.462  -2.613  -1.055  1.00 0.00 ? 23 GLN A N    5  
ATOM 4725  C CA   . GLN A 1 23 ? 0.053   -1.447  -0.346  1.00 0.00 ? 23 GLN A CA   5  
ATOM 4726  C C    . GLN A 1 23 ? 0.326   -1.776  1.118   1.00 0.00 ? 23 GLN A C    5  
ATOM 4727  O O    . GLN A 1 23 ? 1.306   -1.309  1.697   1.00 0.00 ? 23 GLN A O    5  
ATOM 4728  C CB   . GLN A 1 23 ? -0.938  -0.286  -0.444  1.00 0.00 ? 23 GLN A CB   5  
ATOM 4729  C CG   . GLN A 1 23 ? -0.329  1.064   -0.101  1.00 0.00 ? 23 GLN A CG   5  
ATOM 4730  C CD   . GLN A 1 23 ? 0.632   1.558   -1.164  1.00 0.00 ? 23 GLN A CD   5  
ATOM 4731  O OE1  . GLN A 1 23 ? 0.216   2.085   -2.196  1.00 0.00 ? 23 GLN A OE1  5  
ATOM 4732  N NE2  . GLN A 1 23 ? 1.925   1.390   -0.917  1.00 0.00 ? 23 GLN A NE2  5  
ATOM 4733  H H    . GLN A 1 23 ? -1.409  -2.644  -1.300  1.00 0.00 ? 23 GLN A H    5  
ATOM 4734  H HA   . GLN A 1 23 ? 0.981   -1.157  -0.816  1.00 0.00 ? 23 GLN A HA   5  
ATOM 4735  H HB2  . GLN A 1 23 ? -1.320  -0.239  -1.453  1.00 0.00 ? 23 GLN A HB2  5  
ATOM 4736  H HB3  . GLN A 1 23 ? -1.758  -0.470  0.234   1.00 0.00 ? 23 GLN A HB3  5  
ATOM 4737  H HG2  . GLN A 1 23 ? -1.125  1.786   0.006   1.00 0.00 ? 23 GLN A HG2  5  
ATOM 4738  H HG3  . GLN A 1 23 ? 0.204   0.976   0.834   1.00 0.00 ? 23 GLN A HG3  5  
ATOM 4739  H HE21 . GLN A 1 23 ? 2.183   0.961   -0.074  1.00 0.00 ? 23 GLN A HE21 5  
ATOM 4740  H HE22 . GLN A 1 23 ? 2.569   1.699   -1.587  1.00 0.00 ? 23 GLN A HE22 5  
ATOM 4741  N N    . ASP A 1 24 ? -0.548  -2.583  1.710   1.00 0.00 ? 24 ASP A N    5  
ATOM 4742  C CA   . ASP A 1 24 ? -0.402  -2.975  3.107   1.00 0.00 ? 24 ASP A CA   5  
ATOM 4743  C C    . ASP A 1 24 ? 0.888   -3.763  3.318   1.00 0.00 ? 24 ASP A C    5  
ATOM 4744  O O    . ASP A 1 24 ? 1.571   -3.596  4.328   1.00 0.00 ? 24 ASP A O    5  
ATOM 4745  C CB   . ASP A 1 24 ? -1.603  -3.810  3.554   1.00 0.00 ? 24 ASP A CB   5  
ATOM 4746  C CG   . ASP A 1 24 ? -1.503  -4.239  5.004   1.00 0.00 ? 24 ASP A CG   5  
ATOM 4747  O OD1  . ASP A 1 24 ? -0.889  -5.294  5.269   1.00 0.00 ? 24 ASP A OD1  5  
ATOM 4748  O OD2  . ASP A 1 24 ? -2.039  -3.521  5.874   1.00 0.00 ? 24 ASP A OD2  5  
ATOM 4749  H H    . ASP A 1 24 ? -1.310  -2.923  1.196   1.00 0.00 ? 24 ASP A H    5  
ATOM 4750  H HA   . ASP A 1 24 ? -0.359  -2.075  3.702   1.00 0.00 ? 24 ASP A HA   5  
ATOM 4751  H HB2  . ASP A 1 24 ? -2.504  -3.226  3.432   1.00 0.00 ? 24 ASP A HB2  5  
ATOM 4752  H HB3  . ASP A 1 24 ? -1.666  -4.695  2.938   1.00 0.00 ? 24 ASP A HB3  5  
ATOM 4753  N N    . PHE A 1 25 ? 1.213   -4.623  2.358   1.00 0.00 ? 25 PHE A N    5  
ATOM 4754  C CA   . PHE A 1 25 ? 2.419   -5.438  2.439   1.00 0.00 ? 25 PHE A CA   5  
ATOM 4755  C C    . PHE A 1 25 ? 3.664   -4.596  2.177   1.00 0.00 ? 25 PHE A C    5  
ATOM 4756  O O    . PHE A 1 25 ? 4.747   -4.896  2.679   1.00 0.00 ? 25 PHE A O    5  
ATOM 4757  C CB   . PHE A 1 25 ? 2.349   -6.592  1.436   1.00 0.00 ? 25 PHE A CB   5  
ATOM 4758  C CG   . PHE A 1 25 ? 3.399   -7.642  1.656   1.00 0.00 ? 25 PHE A CG   5  
ATOM 4759  C CD1  . PHE A 1 25 ? 4.736   -7.364  1.422   1.00 0.00 ? 25 PHE A CD1  5  
ATOM 4760  C CD2  . PHE A 1 25 ? 3.049   -8.909  2.096   1.00 0.00 ? 25 PHE A CD2  5  
ATOM 4761  C CE1  . PHE A 1 25 ? 5.705   -8.329  1.624   1.00 0.00 ? 25 PHE A CE1  5  
ATOM 4762  C CE2  . PHE A 1 25 ? 4.014   -9.877  2.300   1.00 0.00 ? 25 PHE A CE2  5  
ATOM 4763  C CZ   . PHE A 1 25 ? 5.343   -9.587  2.063   1.00 0.00 ? 25 PHE A CZ   5  
ATOM 4764  H H    . PHE A 1 25 ? 0.627   -4.711  1.577   1.00 0.00 ? 25 PHE A H    5  
ATOM 4765  H HA   . PHE A 1 25 ? 2.477   -5.844  3.437   1.00 0.00 ? 25 PHE A HA   5  
ATOM 4766  H HB2  . PHE A 1 25 ? 1.383   -7.068  1.513   1.00 0.00 ? 25 PHE A HB2  5  
ATOM 4767  H HB3  . PHE A 1 25 ? 2.474   -6.199  0.438   1.00 0.00 ? 25 PHE A HB3  5  
ATOM 4768  H HD1  . PHE A 1 25 ? 5.020   -6.379  1.078   1.00 0.00 ? 25 PHE A HD1  5  
ATOM 4769  H HD2  . PHE A 1 25 ? 2.010   -9.137  2.282   1.00 0.00 ? 25 PHE A HD2  5  
ATOM 4770  H HE1  . PHE A 1 25 ? 6.744   -8.099  1.437   1.00 0.00 ? 25 PHE A HE1  5  
ATOM 4771  H HE2  . PHE A 1 25 ? 3.728   -10.861 2.643   1.00 0.00 ? 25 PHE A HE2  5  
ATOM 4772  H HZ   . PHE A 1 25 ? 6.099   -10.342 2.222   1.00 0.00 ? 25 PHE A HZ   5  
ATOM 4773  N N    . PHE A 1 26 ? 3.501   -3.541  1.386   1.00 0.00 ? 26 PHE A N    5  
ATOM 4774  C CA   . PHE A 1 26 ? 4.611   -2.655  1.054   1.00 0.00 ? 26 PHE A CA   5  
ATOM 4775  C C    . PHE A 1 26 ? 4.980   -1.776  2.246   1.00 0.00 ? 26 PHE A C    5  
ATOM 4776  O O    . PHE A 1 26 ? 6.147   -1.691  2.630   1.00 0.00 ? 26 PHE A O    5  
ATOM 4777  C CB   . PHE A 1 26 ? 4.251   -1.779  -0.147  1.00 0.00 ? 26 PHE A CB   5  
ATOM 4778  C CG   . PHE A 1 26 ? 5.325   -0.795  -0.515  1.00 0.00 ? 26 PHE A CG   5  
ATOM 4779  C CD1  . PHE A 1 26 ? 5.443   0.407   0.164   1.00 0.00 ? 26 PHE A CD1  5  
ATOM 4780  C CD2  . PHE A 1 26 ? 6.216   -1.073  -1.539  1.00 0.00 ? 26 PHE A CD2  5  
ATOM 4781  C CE1  . PHE A 1 26 ? 6.430   1.314   -0.173  1.00 0.00 ? 26 PHE A CE1  5  
ATOM 4782  C CE2  . PHE A 1 26 ? 7.205   -0.169  -1.880  1.00 0.00 ? 26 PHE A CE2  5  
ATOM 4783  C CZ   . PHE A 1 26 ? 7.313   1.025   -1.195  1.00 0.00 ? 26 PHE A CZ   5  
ATOM 4784  H H    . PHE A 1 26 ? 2.613   -3.353  1.016   1.00 0.00 ? 26 PHE A H    5  
ATOM 4785  H HA   . PHE A 1 26 ? 5.460   -3.270  0.799   1.00 0.00 ? 26 PHE A HA   5  
ATOM 4786  H HB2  . PHE A 1 26 ? 4.074   -2.412  -1.004  1.00 0.00 ? 26 PHE A HB2  5  
ATOM 4787  H HB3  . PHE A 1 26 ? 3.353   -1.224  0.077   1.00 0.00 ? 26 PHE A HB3  5  
ATOM 4788  H HD1  . PHE A 1 26 ? 4.754   0.634   0.964   1.00 0.00 ? 26 PHE A HD1  5  
ATOM 4789  H HD2  . PHE A 1 26 ? 6.133   -2.008  -2.075  1.00 0.00 ? 26 PHE A HD2  5  
ATOM 4790  H HE1  . PHE A 1 26 ? 6.512   2.247   0.364   1.00 0.00 ? 26 PHE A HE1  5  
ATOM 4791  H HE2  . PHE A 1 26 ? 7.894   -0.399  -2.680  1.00 0.00 ? 26 PHE A HE2  5  
ATOM 4792  H HZ   . PHE A 1 26 ? 8.084   1.733   -1.461  1.00 0.00 ? 26 PHE A HZ   5  
ATOM 4793  N N    . ASP A 1 27 ? 3.978   -1.125  2.826   1.00 0.00 ? 27 ASP A N    5  
ATOM 4794  C CA   . ASP A 1 27 ? 4.196   -0.252  3.974   1.00 0.00 ? 27 ASP A CA   5  
ATOM 4795  C C    . ASP A 1 27 ? 5.009   -0.964  5.051   1.00 0.00 ? 27 ASP A C    5  
ATOM 4796  O O    . ASP A 1 27 ? 5.748   -0.331  5.804   1.00 0.00 ? 27 ASP A O    5  
ATOM 4797  C CB   . ASP A 1 27 ? 2.857   0.211   4.551   1.00 0.00 ? 27 ASP A CB   5  
ATOM 4798  C CG   . ASP A 1 27 ? 2.961   1.552   5.249   1.00 0.00 ? 27 ASP A CG   5  
ATOM 4799  O OD1  . ASP A 1 27 ? 3.173   2.568   4.555   1.00 0.00 ? 27 ASP A OD1  5  
ATOM 4800  O OD2  . ASP A 1 27 ? 2.828   1.586   6.491   1.00 0.00 ? 27 ASP A OD2  5  
ATOM 4801  H H    . ASP A 1 27 ? 3.070   -1.234  2.473   1.00 0.00 ? 27 ASP A H    5  
ATOM 4802  H HA   . ASP A 1 27 ? 4.749   0.610   3.635   1.00 0.00 ? 27 ASP A HA   5  
ATOM 4803  H HB2  . ASP A 1 27 ? 2.138   0.298   3.749   1.00 0.00 ? 27 ASP A HB2  5  
ATOM 4804  H HB3  . ASP A 1 27 ? 2.507   -0.521  5.264   1.00 0.00 ? 27 ASP A HB3  5  
ATOM 4805  N N    . ALA A 1 28 ? 4.865   -2.284  5.118   1.00 0.00 ? 28 ALA A N    5  
ATOM 4806  C CA   . ALA A 1 28 ? 5.587   -3.082  6.102   1.00 0.00 ? 28 ALA A CA   5  
ATOM 4807  C C    . ALA A 1 28 ? 6.874   -3.647  5.512   1.00 0.00 ? 28 ALA A C    5  
ATOM 4808  O O    . ALA A 1 28 ? 7.925   -3.618  6.151   1.00 0.00 ? 28 ALA A O    5  
ATOM 4809  C CB   . ALA A 1 28 ? 4.703   -4.206  6.620   1.00 0.00 ? 28 ALA A CB   5  
ATOM 4810  H H    . ALA A 1 28 ? 4.261   -2.731  4.490   1.00 0.00 ? 28 ALA A H    5  
ATOM 4811  H HA   . ALA A 1 28 ? 5.835   -2.440  6.934   1.00 0.00 ? 28 ALA A HA   5  
ATOM 4812  H HB1  . ALA A 1 28 ? 3.855   -3.786  7.141   1.00 0.00 ? 28 ALA A HB1  5  
ATOM 4813  H HB2  . ALA A 1 28 ? 4.356   -4.803  5.789   1.00 0.00 ? 28 ALA A HB2  5  
ATOM 4814  H HB3  . ALA A 1 28 ? 5.270   -4.827  7.297   1.00 0.00 ? 28 ALA A HB3  5  
ATOM 4815  N N    . ASN A 1 29 ? 6.784   -4.162  4.290   1.00 0.00 ? 29 ASN A N    5  
ATOM 4816  C CA   . ASN A 1 29 ? 7.943   -4.735  3.615   1.00 0.00 ? 29 ASN A CA   5  
ATOM 4817  C C    . ASN A 1 29 ? 7.871   -4.492  2.111   1.00 0.00 ? 29 ASN A C    5  
ATOM 4818  O O    . ASN A 1 29 ? 6.874   -4.813  1.466   1.00 0.00 ? 29 ASN A O    5  
ATOM 4819  C CB   . ASN A 1 29 ? 8.032   -6.236  3.897   1.00 0.00 ? 29 ASN A CB   5  
ATOM 4820  C CG   . ASN A 1 29 ? 9.365   -6.826  3.476   1.00 0.00 ? 29 ASN A CG   5  
ATOM 4821  O OD1  . ASN A 1 29 ? 10.423  -6.364  3.904   1.00 0.00 ? 29 ASN A OD1  5  
ATOM 4822  N ND2  . ASN A 1 29 ? 9.318   -7.851  2.634   1.00 0.00 ? 29 ASN A ND2  5  
ATOM 4823  H H    . ASN A 1 29 ? 5.918   -4.156  3.831   1.00 0.00 ? 29 ASN A H    5  
ATOM 4824  H HA   . ASN A 1 29 ? 8.826   -4.252  4.005   1.00 0.00 ? 29 ASN A HA   5  
ATOM 4825  H HB2  . ASN A 1 29 ? 7.904   -6.406  4.956   1.00 0.00 ? 29 ASN A HB2  5  
ATOM 4826  H HB3  . ASN A 1 29 ? 7.247   -6.745  3.357   1.00 0.00 ? 29 ASN A HB3  5  
ATOM 4827  H HD21 . ASN A 1 29 ? 8.440   -8.166  2.335   1.00 0.00 ? 29 ASN A HD21 5  
ATOM 4828  H HD22 . ASN A 1 29 ? 10.165  -8.252  2.346   1.00 0.00 ? 29 ASN A HD22 5  
ATOM 4829  N N    . ALA A 1 30 ? 8.938   -3.923  1.558   1.00 0.00 ? 30 ALA A N    5  
ATOM 4830  C CA   . ALA A 1 30 ? 8.997   -3.639  0.129   1.00 0.00 ? 30 ALA A CA   5  
ATOM 4831  C C    . ALA A 1 30 ? 10.162  -4.372  -0.528  1.00 0.00 ? 30 ALA A C    5  
ATOM 4832  O O    . ALA A 1 30 ? 10.506  -4.105  -1.680  1.00 0.00 ? 30 ALA A O    5  
ATOM 4833  C CB   . ALA A 1 30 ? 9.114   -2.141  -0.107  1.00 0.00 ? 30 ALA A CB   5  
ATOM 4834  H H    . ALA A 1 30 ? 9.703   -3.690  2.124   1.00 0.00 ? 30 ALA A H    5  
ATOM 4835  H HA   . ALA A 1 30 ? 8.073   -3.978  -0.317  1.00 0.00 ? 30 ALA A HA   5  
ATOM 4836  H HB1  . ALA A 1 30 ? 9.819   -1.720  0.595   1.00 0.00 ? 30 ALA A HB1  5  
ATOM 4837  H HB2  . ALA A 1 30 ? 9.457   -1.961  -1.115  1.00 0.00 ? 30 ALA A HB2  5  
ATOM 4838  H HB3  . ALA A 1 30 ? 8.148   -1.678  0.033   1.00 0.00 ? 30 ALA A HB3  5  
ATOM 4839  N N    . TYR A 1 31 ? 10.765  -5.296  0.211   1.00 0.00 ? 31 TYR A N    5  
ATOM 4840  C CA   . TYR A 1 31 ? 11.894  -6.066  -0.299  1.00 0.00 ? 31 TYR A CA   5  
ATOM 4841  C C    . TYR A 1 31 ? 11.715  -7.553  -0.010  1.00 0.00 ? 31 TYR A C    5  
ATOM 4842  O O    . TYR A 1 31 ? 12.652  -8.255  0.370   1.00 0.00 ? 31 TYR A O    5  
ATOM 4843  C CB   . TYR A 1 31 ? 13.200  -5.568  0.322   1.00 0.00 ? 31 TYR A CB   5  
ATOM 4844  C CG   . TYR A 1 31 ? 13.469  -4.101  0.071   1.00 0.00 ? 31 TYR A CG   5  
ATOM 4845  C CD1  . TYR A 1 31 ? 14.135  -3.683  -1.074  1.00 0.00 ? 31 TYR A CD1  5  
ATOM 4846  C CD2  . TYR A 1 31 ? 13.058  -3.134  0.980   1.00 0.00 ? 31 TYR A CD2  5  
ATOM 4847  C CE1  . TYR A 1 31 ? 14.384  -2.344  -1.307  1.00 0.00 ? 31 TYR A CE1  5  
ATOM 4848  C CE2  . TYR A 1 31 ? 13.301  -1.793  0.755   1.00 0.00 ? 31 TYR A CE2  5  
ATOM 4849  C CZ   . TYR A 1 31 ? 13.965  -1.403  -0.390  1.00 0.00 ? 31 TYR A CZ   5  
ATOM 4850  O OH   . TYR A 1 31 ? 14.210  -0.068  -0.617  1.00 0.00 ? 31 TYR A OH   5  
ATOM 4851  H H    . TYR A 1 31 ? 10.446  -5.464  1.122   1.00 0.00 ? 31 TYR A H    5  
ATOM 4852  H HA   . TYR A 1 31 ? 11.937  -5.921  -1.369  1.00 0.00 ? 31 TYR A HA   5  
ATOM 4853  H HB2  . TYR A 1 31 ? 13.164  -5.720  1.389   1.00 0.00 ? 31 TYR A HB2  5  
ATOM 4854  H HB3  . TYR A 1 31 ? 14.024  -6.132  -0.090  1.00 0.00 ? 31 TYR A HB3  5  
ATOM 4855  H HD1  . TYR A 1 31 ? 14.462  -4.422  -1.791  1.00 0.00 ? 31 TYR A HD1  5  
ATOM 4856  H HD2  . TYR A 1 31 ? 12.539  -3.443  1.876   1.00 0.00 ? 31 TYR A HD2  5  
ATOM 4857  H HE1  . TYR A 1 31 ? 14.903  -2.038  -2.203  1.00 0.00 ? 31 TYR A HE1  5  
ATOM 4858  H HE2  . TYR A 1 31 ? 12.974  -1.056  1.473   1.00 0.00 ? 31 TYR A HE2  5  
ATOM 4859  H HH   . TYR A 1 31 ? 15.133  0.052   -0.854  1.00 0.00 ? 31 TYR A HH   5  
ATOM 4860  N N    . PRO A 1 32 ? 10.481  -8.046  -0.195  1.00 0.00 ? 32 PRO A N    5  
ATOM 4861  C CA   . PRO A 1 32 ? 10.148  -9.454  0.039   1.00 0.00 ? 32 PRO A CA   5  
ATOM 4862  C C    . PRO A 1 32 ? 10.779  -10.379 -0.997  1.00 0.00 ? 32 PRO A C    5  
ATOM 4863  O O    . PRO A 1 32 ? 11.210  -9.934  -2.061  1.00 0.00 ? 32 PRO A O    5  
ATOM 4864  C CB   . PRO A 1 32 ? 8.622   -9.483  -0.078  1.00 0.00 ? 32 PRO A CB   5  
ATOM 4865  C CG   . PRO A 1 32 ? 8.288   -8.321  -0.949  1.00 0.00 ? 32 PRO A CG   5  
ATOM 4866  C CD   . PRO A 1 32 ? 9.316   -7.267  -0.647  1.00 0.00 ? 32 PRO A CD   5  
ATOM 4867  H HA   . PRO A 1 32 ? 10.441  -9.772  1.029   1.00 0.00 ? 32 PRO A HA   5  
ATOM 4868  H HB2  . PRO A 1 32 ? 8.310   -10.416 -0.526  1.00 0.00 ? 32 PRO A HB2  5  
ATOM 4869  H HB3  . PRO A 1 32 ? 8.181   -9.381  0.902   1.00 0.00 ? 32 PRO A HB3  5  
ATOM 4870  H HG2  . PRO A 1 32 ? 8.344   -8.613  -1.987  1.00 0.00 ? 32 PRO A HG2  5  
ATOM 4871  H HG3  . PRO A 1 32 ? 7.299   -7.958  -0.713  1.00 0.00 ? 32 PRO A HG3  5  
ATOM 4872  H HD2  . PRO A 1 32 ? 9.552   -6.703  -1.537  1.00 0.00 ? 32 PRO A HD2  5  
ATOM 4873  H HD3  . PRO A 1 32 ? 8.965   -6.611  0.136   1.00 0.00 ? 32 PRO A HD3  5  
ATOM 4874  N N    . LYS A 1 33 ? 10.831  -11.668 -0.680  1.00 0.00 ? 33 LYS A N    5  
ATOM 4875  C CA   . LYS A 1 33 ? 11.407  -12.656 -1.583  1.00 0.00 ? 33 LYS A CA   5  
ATOM 4876  C C    . LYS A 1 33 ? 10.314  -13.456 -2.284  1.00 0.00 ? 33 LYS A C    5  
ATOM 4877  O O    . LYS A 1 33 ? 9.133   -13.331 -1.956  1.00 0.00 ? 33 LYS A O    5  
ATOM 4878  C CB   . LYS A 1 33 ? 12.333  -13.602 -0.814  1.00 0.00 ? 33 LYS A CB   5  
ATOM 4879  C CG   . LYS A 1 33 ? 13.319  -12.885 0.091   1.00 0.00 ? 33 LYS A CG   5  
ATOM 4880  C CD   . LYS A 1 33 ? 14.596  -12.525 -0.650  1.00 0.00 ? 33 LYS A CD   5  
ATOM 4881  C CE   . LYS A 1 33 ? 14.502  -11.145 -1.284  1.00 0.00 ? 33 LYS A CE   5  
ATOM 4882  N NZ   . LYS A 1 33 ? 14.871  -10.068 -0.324  1.00 0.00 ? 33 LYS A NZ   5  
ATOM 4883  H H    . LYS A 1 33 ? 10.471  -11.962 0.184   1.00 0.00 ? 33 LYS A H    5  
ATOM 4884  H HA   . LYS A 1 33 ? 11.984  -12.129 -2.328  1.00 0.00 ? 33 LYS A HA   5  
ATOM 4885  H HB2  . LYS A 1 33 ? 11.730  -14.260 -0.205  1.00 0.00 ? 33 LYS A HB2  5  
ATOM 4886  H HB3  . LYS A 1 33 ? 12.892  -14.195 -1.524  1.00 0.00 ? 33 LYS A HB3  5  
ATOM 4887  H HG2  . LYS A 1 33 ? 12.862  -11.979 0.460   1.00 0.00 ? 33 LYS A HG2  5  
ATOM 4888  H HG3  . LYS A 1 33 ? 13.566  -13.530 0.922   1.00 0.00 ? 33 LYS A HG3  5  
ATOM 4889  H HD2  . LYS A 1 33 ? 15.421  -12.533 0.046   1.00 0.00 ? 33 LYS A HD2  5  
ATOM 4890  H HD3  . LYS A 1 33 ? 14.770  -13.257 -1.427  1.00 0.00 ? 33 LYS A HD3  5  
ATOM 4891  H HE2  . LYS A 1 33 ? 15.171  -11.106 -2.130  1.00 0.00 ? 33 LYS A HE2  5  
ATOM 4892  H HE3  . LYS A 1 33 ? 13.488  -10.986 -1.619  1.00 0.00 ? 33 LYS A HE3  5  
ATOM 4893  H HZ1  . LYS A 1 33 ? 15.369  -9.302  -0.822  1.00 0.00 ? 33 LYS A HZ1  5  
ATOM 4894  H HZ2  . LYS A 1 33 ? 15.495  -10.448 0.416   1.00 0.00 ? 33 LYS A HZ2  5  
ATOM 4895  H HZ3  . LYS A 1 33 ? 14.017  -9.679  0.122   1.00 0.00 ? 33 LYS A HZ3  5  
ATOM 4896  N N    . ASP A 1 34 ? 10.714  -14.279 -3.247  1.00 0.00 ? 34 ASP A N    5  
ATOM 4897  C CA   . ASP A 1 34 ? 9.768   -15.101 -3.992  1.00 0.00 ? 34 ASP A CA   5  
ATOM 4898  C C    . ASP A 1 34 ? 8.730   -15.717 -3.059  1.00 0.00 ? 34 ASP A C    5  
ATOM 4899  O O    . ASP A 1 34 ? 7.528   -15.507 -3.226  1.00 0.00 ? 34 ASP A O    5  
ATOM 4900  C CB   . ASP A 1 34 ? 10.506  -16.204 -4.752  1.00 0.00 ? 34 ASP A CB   5  
ATOM 4901  C CG   . ASP A 1 34 ? 11.047  -15.726 -6.085  1.00 0.00 ? 34 ASP A CG   5  
ATOM 4902  O OD1  . ASP A 1 34 ? 12.058  -14.993 -6.087  1.00 0.00 ? 34 ASP A OD1  5  
ATOM 4903  O OD2  . ASP A 1 34 ? 10.460  -16.086 -7.127  1.00 0.00 ? 34 ASP A OD2  5  
ATOM 4904  H H    . ASP A 1 34 ? 11.668  -14.334 -3.463  1.00 0.00 ? 34 ASP A H    5  
ATOM 4905  H HA   . ASP A 1 34 ? 9.262   -14.464 -4.702  1.00 0.00 ? 34 ASP A HA   5  
ATOM 4906  H HB2  . ASP A 1 34 ? 11.335  -16.553 -4.153  1.00 0.00 ? 34 ASP A HB2  5  
ATOM 4907  H HB3  . ASP A 1 34 ? 9.827   -17.025 -4.932  1.00 0.00 ? 34 ASP A HB3  5  
ATOM 4908  N N    . ASP A 1 35 ? 9.202   -16.477 -2.077  1.00 0.00 ? 35 ASP A N    5  
ATOM 4909  C CA   . ASP A 1 35 ? 8.315   -17.123 -1.116  1.00 0.00 ? 35 ASP A CA   5  
ATOM 4910  C C    . ASP A 1 35 ? 7.206   -16.173 -0.676  1.00 0.00 ? 35 ASP A C    5  
ATOM 4911  O O    . ASP A 1 35 ? 6.028   -16.525 -0.705  1.00 0.00 ? 35 ASP A O    5  
ATOM 4912  C CB   . ASP A 1 35 ? 9.109   -17.601 0.101   1.00 0.00 ? 35 ASP A CB   5  
ATOM 4913  C CG   . ASP A 1 35 ? 8.496   -18.828 0.746   1.00 0.00 ? 35 ASP A CG   5  
ATOM 4914  O OD1  . ASP A 1 35 ? 8.413   -19.875 0.070   1.00 0.00 ? 35 ASP A OD1  5  
ATOM 4915  O OD2  . ASP A 1 35 ? 8.101   -18.743 1.927   1.00 0.00 ? 35 ASP A OD2  5  
ATOM 4916  H H    . ASP A 1 35 ? 10.171  -16.606 -1.996  1.00 0.00 ? 35 ASP A H    5  
ATOM 4917  H HA   . ASP A 1 35 ? 7.868   -17.978 -1.601  1.00 0.00 ? 35 ASP A HA   5  
ATOM 4918  H HB2  . ASP A 1 35 ? 10.116  -17.843 -0.206  1.00 0.00 ? 35 ASP A HB2  5  
ATOM 4919  H HB3  . ASP A 1 35 ? 9.141   -16.809 0.835   1.00 0.00 ? 35 ASP A HB3  5  
ATOM 4920  N N    . GLU A 1 36 ? 7.594   -14.969 -0.267  1.00 0.00 ? 36 GLU A N    5  
ATOM 4921  C CA   . GLU A 1 36 ? 6.631   -13.969 0.181   1.00 0.00 ? 36 GLU A CA   5  
ATOM 4922  C C    . GLU A 1 36 ? 5.707   -13.554 -0.959  1.00 0.00 ? 36 GLU A C    5  
ATOM 4923  O O    . GLU A 1 36 ? 4.483   -13.616 -0.836  1.00 0.00 ? 36 GLU A O    5  
ATOM 4924  C CB   . GLU A 1 36 ? 7.358   -12.742 0.736   1.00 0.00 ? 36 GLU A CB   5  
ATOM 4925  C CG   . GLU A 1 36 ? 8.239   -13.047 1.936   1.00 0.00 ? 36 GLU A CG   5  
ATOM 4926  C CD   . GLU A 1 36 ? 7.453   -13.596 3.112   1.00 0.00 ? 36 GLU A CD   5  
ATOM 4927  O OE1  . GLU A 1 36 ? 6.895   -14.705 2.987   1.00 0.00 ? 36 GLU A OE1  5  
ATOM 4928  O OE2  . GLU A 1 36 ? 7.398   -12.914 4.157   1.00 0.00 ? 36 GLU A OE2  5  
ATOM 4929  H H    . GLU A 1 36 ? 8.548   -14.748 -0.267  1.00 0.00 ? 36 GLU A H    5  
ATOM 4930  H HA   . GLU A 1 36 ? 6.037   -14.410 0.968   1.00 0.00 ? 36 GLU A HA   5  
ATOM 4931  H HB2  . GLU A 1 36 ? 7.978   -12.323 -0.043  1.00 0.00 ? 36 GLU A HB2  5  
ATOM 4932  H HB3  . GLU A 1 36 ? 6.624   -12.008 1.033   1.00 0.00 ? 36 GLU A HB3  5  
ATOM 4933  H HG2  . GLU A 1 36 ? 8.980   -13.777 1.647   1.00 0.00 ? 36 GLU A HG2  5  
ATOM 4934  H HG3  . GLU A 1 36 ? 8.732   -12.137 2.245   1.00 0.00 ? 36 GLU A HG3  5  
ATOM 4935  N N    . PHE A 1 37 ? 6.301   -13.129 -2.070  1.00 0.00 ? 37 PHE A N    5  
ATOM 4936  C CA   . PHE A 1 37 ? 5.531   -12.702 -3.232  1.00 0.00 ? 37 PHE A CA   5  
ATOM 4937  C C    . PHE A 1 37 ? 4.440   -13.714 -3.565  1.00 0.00 ? 37 PHE A C    5  
ATOM 4938  O O    . PHE A 1 37 ? 3.344   -13.345 -3.986  1.00 0.00 ? 37 PHE A O    5  
ATOM 4939  C CB   . PHE A 1 37 ? 6.453   -12.514 -4.439  1.00 0.00 ? 37 PHE A CB   5  
ATOM 4940  C CG   . PHE A 1 37 ? 7.038   -11.134 -4.538  1.00 0.00 ? 37 PHE A CG   5  
ATOM 4941  C CD1  . PHE A 1 37 ? 6.349   -10.120 -5.182  1.00 0.00 ? 37 PHE A CD1  5  
ATOM 4942  C CD2  . PHE A 1 37 ? 8.277   -10.852 -3.986  1.00 0.00 ? 37 PHE A CD2  5  
ATOM 4943  C CE1  . PHE A 1 37 ? 6.885   -8.849  -5.275  1.00 0.00 ? 37 PHE A CE1  5  
ATOM 4944  C CE2  . PHE A 1 37 ? 8.819   -9.583  -4.076  1.00 0.00 ? 37 PHE A CE2  5  
ATOM 4945  C CZ   . PHE A 1 37 ? 8.121   -8.580  -4.720  1.00 0.00 ? 37 PHE A CZ   5  
ATOM 4946  H H    . PHE A 1 37 ? 7.280   -13.102 -2.108  1.00 0.00 ? 37 PHE A H    5  
ATOM 4947  H HA   . PHE A 1 37 ? 5.069   -11.757 -2.993  1.00 0.00 ? 37 PHE A HA   5  
ATOM 4948  H HB2  . PHE A 1 37 ? 7.270   -13.216 -4.372  1.00 0.00 ? 37 PHE A HB2  5  
ATOM 4949  H HB3  . PHE A 1 37 ? 5.894   -12.704 -5.343  1.00 0.00 ? 37 PHE A HB3  5  
ATOM 4950  H HD1  . PHE A 1 37 ? 5.382   -10.328 -5.615  1.00 0.00 ? 37 PHE A HD1  5  
ATOM 4951  H HD2  . PHE A 1 37 ? 8.824   -11.636 -3.481  1.00 0.00 ? 37 PHE A HD2  5  
ATOM 4952  H HE1  . PHE A 1 37 ? 6.338   -8.067  -5.779  1.00 0.00 ? 37 PHE A HE1  5  
ATOM 4953  H HE2  . PHE A 1 37 ? 9.785   -9.377  -3.641  1.00 0.00 ? 37 PHE A HE2  5  
ATOM 4954  H HZ   . PHE A 1 37 ? 8.543   -7.589  -4.791  1.00 0.00 ? 37 PHE A HZ   5  
ATOM 4955  N N    . GLU A 1 38 ? 4.748   -14.993 -3.372  1.00 0.00 ? 38 GLU A N    5  
ATOM 4956  C CA   . GLU A 1 38 ? 3.794   -16.059 -3.652  1.00 0.00 ? 38 GLU A CA   5  
ATOM 4957  C C    . GLU A 1 38 ? 2.521   -15.880 -2.830  1.00 0.00 ? 38 GLU A C    5  
ATOM 4958  O O    . GLU A 1 38 ? 1.412   -16.029 -3.344  1.00 0.00 ? 38 GLU A O    5  
ATOM 4959  C CB   . GLU A 1 38 ? 4.418   -17.424 -3.355  1.00 0.00 ? 38 GLU A CB   5  
ATOM 4960  C CG   . GLU A 1 38 ? 5.433   -17.868 -4.394  1.00 0.00 ? 38 GLU A CG   5  
ATOM 4961  C CD   . GLU A 1 38 ? 6.512   -18.761 -3.812  1.00 0.00 ? 38 GLU A CD   5  
ATOM 4962  O OE1  . GLU A 1 38 ? 6.187   -19.895 -3.403  1.00 0.00 ? 38 GLU A OE1  5  
ATOM 4963  O OE2  . GLU A 1 38 ? 7.682   -18.325 -3.765  1.00 0.00 ? 38 GLU A OE2  5  
ATOM 4964  H H    . GLU A 1 38 ? 5.638   -15.225 -3.034  1.00 0.00 ? 38 GLU A H    5  
ATOM 4965  H HA   . GLU A 1 38 ? 3.541   -16.010 -4.701  1.00 0.00 ? 38 GLU A HA   5  
ATOM 4966  H HB2  . GLU A 1 38 ? 4.911   -17.380 -2.395  1.00 0.00 ? 38 GLU A HB2  5  
ATOM 4967  H HB3  . GLU A 1 38 ? 3.632   -18.164 -3.311  1.00 0.00 ? 38 GLU A HB3  5  
ATOM 4968  H HG2  . GLU A 1 38 ? 4.919   -18.413 -5.172  1.00 0.00 ? 38 GLU A HG2  5  
ATOM 4969  H HG3  . GLU A 1 38 ? 5.901   -16.993 -4.819  1.00 0.00 ? 38 GLU A HG3  5  
ATOM 4970  N N    . GLN A 1 39 ? 2.689   -15.560 -1.551  1.00 0.00 ? 39 GLN A N    5  
ATOM 4971  C CA   . GLN A 1 39 ? 1.554   -15.362 -0.658  1.00 0.00 ? 39 GLN A CA   5  
ATOM 4972  C C    . GLN A 1 39 ? 0.535   -14.410 -1.276  1.00 0.00 ? 39 GLN A C    5  
ATOM 4973  O O    . GLN A 1 39 ? -0.657  -14.715 -1.336  1.00 0.00 ? 39 GLN A O    5  
ATOM 4974  C CB   . GLN A 1 39 ? 2.028   -14.816 0.690   1.00 0.00 ? 39 GLN A CB   5  
ATOM 4975  C CG   . GLN A 1 39 ? 2.789   -15.833 1.525   1.00 0.00 ? 39 GLN A CG   5  
ATOM 4976  C CD   . GLN A 1 39 ? 1.872   -16.720 2.342   1.00 0.00 ? 39 GLN A CD   5  
ATOM 4977  O OE1  . GLN A 1 39 ? 0.886   -16.254 2.915   1.00 0.00 ? 39 GLN A OE1  5  
ATOM 4978  N NE2  . GLN A 1 39 ? 2.191   -18.008 2.401   1.00 0.00 ? 39 GLN A NE2  5  
ATOM 4979  H H    . GLN A 1 39 ? 3.598   -15.455 -1.201  1.00 0.00 ? 39 GLN A H    5  
ATOM 4980  H HA   . GLN A 1 39 ? 1.084   -16.321 -0.502  1.00 0.00 ? 39 GLN A HA   5  
ATOM 4981  H HB2  . GLN A 1 39 ? 2.675   -13.969 0.514   1.00 0.00 ? 39 GLN A HB2  5  
ATOM 4982  H HB3  . GLN A 1 39 ? 1.168   -14.490 1.255   1.00 0.00 ? 39 GLN A HB3  5  
ATOM 4983  H HG2  . GLN A 1 39 ? 3.374   -16.457 0.865   1.00 0.00 ? 39 GLN A HG2  5  
ATOM 4984  H HG3  . GLN A 1 39 ? 3.449   -15.305 2.198   1.00 0.00 ? 39 GLN A HG3  5  
ATOM 4985  H HE21 . GLN A 1 39 ? 2.992   -18.308 1.921   1.00 0.00 ? 39 GLN A HE21 5  
ATOM 4986  H HE22 . GLN A 1 39 ? 1.616   -18.604 2.923   1.00 0.00 ? 39 GLN A HE22 5  
ATOM 4987  N N    . LEU A 1 40 ? 1.011   -13.257 -1.733  1.00 0.00 ? 40 LEU A N    5  
ATOM 4988  C CA   . LEU A 1 40 ? 0.140   -12.260 -2.346  1.00 0.00 ? 40 LEU A CA   5  
ATOM 4989  C C    . LEU A 1 40 ? -0.390  -12.752 -3.689  1.00 0.00 ? 40 LEU A C    5  
ATOM 4990  O O    . LEU A 1 40 ? -1.566  -12.575 -4.005  1.00 0.00 ? 40 LEU A O    5  
ATOM 4991  C CB   . LEU A 1 40 ? 0.895   -10.943 -2.534  1.00 0.00 ? 40 LEU A CB   5  
ATOM 4992  C CG   . LEU A 1 40 ? 1.392   -10.265 -1.257  1.00 0.00 ? 40 LEU A CG   5  
ATOM 4993  C CD1  . LEU A 1 40 ? 2.638   -9.440  -1.540  1.00 0.00 ? 40 LEU A CD1  5  
ATOM 4994  C CD2  . LEU A 1 40 ? 0.299   -9.394  -0.656  1.00 0.00 ? 40 LEU A CD2  5  
ATOM 4995  H H    . LEU A 1 40 ? 1.969   -13.071 -1.656  1.00 0.00 ? 40 LEU A H    5  
ATOM 4996  H HA   . LEU A 1 40 ? -0.694  -12.095 -1.681  1.00 0.00 ? 40 LEU A HA   5  
ATOM 4997  H HB2  . LEU A 1 40 ? 1.753   -11.140 -3.159  1.00 0.00 ? 40 LEU A HB2  5  
ATOM 4998  H HB3  . LEU A 1 40 ? 0.234   -10.253 -3.040  1.00 0.00 ? 40 LEU A HB3  5  
ATOM 4999  H HG   . LEU A 1 40 ? 1.652   -11.024 -0.532  1.00 0.00 ? 40 LEU A HG   5  
ATOM 5000  H HD11 . LEU A 1 40 ? 2.607   -9.078  -2.556  1.00 0.00 ? 40 LEU A HD11 5  
ATOM 5001  H HD12 . LEU A 1 40 ? 3.515   -10.056 -1.403  1.00 0.00 ? 40 LEU A HD12 5  
ATOM 5002  H HD13 . LEU A 1 40 ? 2.677   -8.603  -0.859  1.00 0.00 ? 40 LEU A HD13 5  
ATOM 5003  H HD21 . LEU A 1 40 ? 0.555   -9.148  0.364   1.00 0.00 ? 40 LEU A HD21 5  
ATOM 5004  H HD22 . LEU A 1 40 ? -0.639  -9.930  -0.672  1.00 0.00 ? 40 LEU A HD22 5  
ATOM 5005  H HD23 . LEU A 1 40 ? 0.204   -8.486  -1.232  1.00 0.00 ? 40 LEU A HD23 5  
ATOM 5006  N N    . SER A 1 41 ? 0.485   -13.372 -4.474  1.00 0.00 ? 41 SER A N    5  
ATOM 5007  C CA   . SER A 1 41 ? 0.106   -13.888 -5.783  1.00 0.00 ? 41 SER A CA   5  
ATOM 5008  C C    . SER A 1 41 ? -1.035  -14.895 -5.661  1.00 0.00 ? 41 SER A C    5  
ATOM 5009  O O    . SER A 1 41 ? -1.849  -15.040 -6.571  1.00 0.00 ? 41 SER A O    5  
ATOM 5010  C CB   . SER A 1 41 ? 1.308   -14.544 -6.465  1.00 0.00 ? 41 SER A CB   5  
ATOM 5011  O OG   . SER A 1 41 ? 1.383   -15.924 -6.151  1.00 0.00 ? 41 SER A OG   5  
ATOM 5012  H H    . SER A 1 41 ? 1.409   -13.482 -4.165  1.00 0.00 ? 41 SER A H    5  
ATOM 5013  H HA   . SER A 1 41 ? -0.228  -13.055 -6.384  1.00 0.00 ? 41 SER A HA   5  
ATOM 5014  H HB2  . SER A 1 41 ? 1.217   -14.435 -7.535  1.00 0.00 ? 41 SER A HB2  5  
ATOM 5015  H HB3  . SER A 1 41 ? 2.215   -14.061 -6.130  1.00 0.00 ? 41 SER A HB3  5  
ATOM 5016  H HG   . SER A 1 41 ? 2.279   -16.237 -6.292  1.00 0.00 ? 41 SER A HG   5  
ATOM 5017  N N    . ASN A 1 42 ? -1.085  -15.587 -4.527  1.00 0.00 ? 42 ASN A N    5  
ATOM 5018  C CA   . ASN A 1 42 ? -2.125  -16.580 -4.285  1.00 0.00 ? 42 ASN A CA   5  
ATOM 5019  C C    . ASN A 1 42 ? -3.401  -15.919 -3.775  1.00 0.00 ? 42 ASN A C    5  
ATOM 5020  O O    . ASN A 1 42 ? -4.509  -16.361 -4.084  1.00 0.00 ? 42 ASN A O    5  
ATOM 5021  C CB   . ASN A 1 42 ? -1.638  -17.621 -3.274  1.00 0.00 ? 42 ASN A CB   5  
ATOM 5022  C CG   . ASN A 1 42 ? -0.864  -18.748 -3.932  1.00 0.00 ? 42 ASN A CG   5  
ATOM 5023  O OD1  . ASN A 1 42 ? -1.448  -19.716 -4.417  1.00 0.00 ? 42 ASN A OD1  5  
ATOM 5024  N ND2  . ASN A 1 42 ? 0.458   -18.625 -3.949  1.00 0.00 ? 42 ASN A ND2  5  
ATOM 5025  H H    . ASN A 1 42 ? -0.407  -15.426 -3.838  1.00 0.00 ? 42 ASN A H    5  
ATOM 5026  H HA   . ASN A 1 42 ? -2.338  -17.073 -5.221  1.00 0.00 ? 42 ASN A HA   5  
ATOM 5027  H HB2  . ASN A 1 42 ? -0.993  -17.140 -2.553  1.00 0.00 ? 42 ASN A HB2  5  
ATOM 5028  H HB3  . ASN A 1 42 ? -2.490  -18.045 -2.763  1.00 0.00 ? 42 ASN A HB3  5  
ATOM 5029  H HD21 . ASN A 1 42 ? 0.855   -17.826 -3.543  1.00 0.00 ? 42 ASN A HD21 5  
ATOM 5030  H HD22 . ASN A 1 42 ? 0.983   -19.338 -4.369  1.00 0.00 ? 42 ASN A HD22 5  
ATOM 5031  N N    . LEU A 1 43 ? -3.239  -14.857 -2.993  1.00 0.00 ? 43 LEU A N    5  
ATOM 5032  C CA   . LEU A 1 43 ? -4.378  -14.132 -2.441  1.00 0.00 ? 43 LEU A CA   5  
ATOM 5033  C C    . LEU A 1 43 ? -5.083  -13.319 -3.522  1.00 0.00 ? 43 LEU A C    5  
ATOM 5034  O O    . LEU A 1 43 ? -6.273  -13.505 -3.778  1.00 0.00 ? 43 LEU A O    5  
ATOM 5035  C CB   . LEU A 1 43 ? -3.921  -13.210 -1.309  1.00 0.00 ? 43 LEU A CB   5  
ATOM 5036  C CG   . LEU A 1 43 ? -4.897  -12.103 -0.909  1.00 0.00 ? 43 LEU A CG   5  
ATOM 5037  C CD1  . LEU A 1 43 ? -6.216  -12.698 -0.439  1.00 0.00 ? 43 LEU A CD1  5  
ATOM 5038  C CD2  . LEU A 1 43 ? -4.291  -11.223 0.174   1.00 0.00 ? 43 LEU A CD2  5  
ATOM 5039  H H    . LEU A 1 43 ? -2.332  -14.552 -2.783  1.00 0.00 ? 43 LEU A H    5  
ATOM 5040  H HA   . LEU A 1 43 ? -5.072  -14.859 -2.044  1.00 0.00 ? 43 LEU A HA   5  
ATOM 5041  H HB2  . LEU A 1 43 ? -3.739  -13.821 -0.438  1.00 0.00 ? 43 LEU A HB2  5  
ATOM 5042  H HB3  . LEU A 1 43 ? -2.997  -12.742 -1.618  1.00 0.00 ? 43 LEU A HB3  5  
ATOM 5043  H HG   . LEU A 1 43 ? -5.101  -11.482 -1.771  1.00 0.00 ? 43 LEU A HG   5  
ATOM 5044  H HD11 . LEU A 1 43 ? -6.914  -11.903 -0.228  1.00 0.00 ? 43 LEU A HD11 5  
ATOM 5045  H HD12 . LEU A 1 43 ? -6.049  -13.279 0.456   1.00 0.00 ? 43 LEU A HD12 5  
ATOM 5046  H HD13 . LEU A 1 43 ? -6.618  -13.336 -1.212  1.00 0.00 ? 43 LEU A HD13 5  
ATOM 5047  H HD21 . LEU A 1 43 ? -3.337  -11.629 0.475   1.00 0.00 ? 43 LEU A HD21 5  
ATOM 5048  H HD22 . LEU A 1 43 ? -4.955  -11.192 1.026   1.00 0.00 ? 43 LEU A HD22 5  
ATOM 5049  H HD23 . LEU A 1 43 ? -4.152  -10.223 -0.211  1.00 0.00 ? 43 LEU A HD23 5  
ATOM 5050  N N    . LEU A 1 44 ? -4.340  -12.418 -4.155  1.00 0.00 ? 44 LEU A N    5  
ATOM 5051  C CA   . LEU A 1 44 ? -4.892  -11.577 -5.211  1.00 0.00 ? 44 LEU A CA   5  
ATOM 5052  C C    . LEU A 1 44 ? -5.042  -12.362 -6.510  1.00 0.00 ? 44 LEU A C    5  
ATOM 5053  O O    . LEU A 1 44 ? -5.653  -11.887 -7.467  1.00 0.00 ? 44 LEU A O    5  
ATOM 5054  C CB   . LEU A 1 44 ? -3.997  -10.357 -5.440  1.00 0.00 ? 44 LEU A CB   5  
ATOM 5055  C CG   . LEU A 1 44 ? -3.635  -9.547  -4.194  1.00 0.00 ? 44 LEU A CG   5  
ATOM 5056  C CD1  . LEU A 1 44 ? -2.486  -8.596  -4.491  1.00 0.00 ? 44 LEU A CD1  5  
ATOM 5057  C CD2  . LEU A 1 44 ? -4.847  -8.780  -3.686  1.00 0.00 ? 44 LEU A CD2  5  
ATOM 5058  H H    . LEU A 1 44 ? -3.398  -12.315 -3.908  1.00 0.00 ? 44 LEU A H    5  
ATOM 5059  H HA   . LEU A 1 44 ? -5.868  -11.242 -4.892  1.00 0.00 ? 44 LEU A HA   5  
ATOM 5060  H HB2  . LEU A 1 44 ? -3.078  -10.701 -5.889  1.00 0.00 ? 44 LEU A HB2  5  
ATOM 5061  H HB3  . LEU A 1 44 ? -4.507  -9.698  -6.128  1.00 0.00 ? 44 LEU A HB3  5  
ATOM 5062  H HG   . LEU A 1 44 ? -3.315  -10.224 -3.414  1.00 0.00 ? 44 LEU A HG   5  
ATOM 5063  H HD11 . LEU A 1 44 ? -1.824  -8.556  -3.640  1.00 0.00 ? 44 LEU A HD11 5  
ATOM 5064  H HD12 . LEU A 1 44 ? -2.878  -7.610  -4.690  1.00 0.00 ? 44 LEU A HD12 5  
ATOM 5065  H HD13 . LEU A 1 44 ? -1.942  -8.948  -5.356  1.00 0.00 ? 44 LEU A HD13 5  
ATOM 5066  H HD21 . LEU A 1 44 ? -4.521  -7.984  -3.033  1.00 0.00 ? 44 LEU A HD21 5  
ATOM 5067  H HD22 . LEU A 1 44 ? -5.494  -9.451  -3.139  1.00 0.00 ? 44 LEU A HD22 5  
ATOM 5068  H HD23 . LEU A 1 44 ? -5.386  -8.362  -4.523  1.00 0.00 ? 44 LEU A HD23 5  
ATOM 5069  N N    . ASN A 1 45 ? -4.482  -13.567 -6.535  1.00 0.00 ? 45 ASN A N    5  
ATOM 5070  C CA   . ASN A 1 45 ? -4.555  -14.419 -7.717  1.00 0.00 ? 45 ASN A CA   5  
ATOM 5071  C C    . ASN A 1 45 ? -3.873  -13.756 -8.909  1.00 0.00 ? 45 ASN A C    5  
ATOM 5072  O O    . ASN A 1 45 ? -4.247  -13.986 -10.060 1.00 0.00 ? 45 ASN A O    5  
ATOM 5073  C CB   . ASN A 1 45 ? -6.014  -14.730 -8.058  1.00 0.00 ? 45 ASN A CB   5  
ATOM 5074  C CG   . ASN A 1 45 ? -6.515  -15.984 -7.368  1.00 0.00 ? 45 ASN A CG   5  
ATOM 5075  O OD1  . ASN A 1 45 ? -7.303  -15.914 -6.424  1.00 0.00 ? 45 ASN A OD1  5  
ATOM 5076  N ND2  . ASN A 1 45 ? -6.059  -17.139 -7.837  1.00 0.00 ? 45 ASN A ND2  5  
ATOM 5077  H H    . ASN A 1 45 ? -4.008  -13.891 -5.741  1.00 0.00 ? 45 ASN A H    5  
ATOM 5078  H HA   . ASN A 1 45 ? -4.043  -15.342 -7.491  1.00 0.00 ? 45 ASN A HA   5  
ATOM 5079  H HB2  . ASN A 1 45 ? -6.634  -13.900 -7.748  1.00 0.00 ? 45 ASN A HB2  5  
ATOM 5080  H HB3  . ASN A 1 45 ? -6.108  -14.865 -9.124  1.00 0.00 ? 45 ASN A HB3  5  
ATOM 5081  H HD21 . ASN A 1 45 ? -5.433  -17.118 -8.591  1.00 0.00 ? 45 ASN A HD21 5  
ATOM 5082  H HD22 . ASN A 1 45 ? -6.367  -17.966 -7.410  1.00 0.00 ? 45 ASN A HD22 5  
ATOM 5083  N N    . LEU A 1 46 ? -2.869  -12.933 -8.627  1.00 0.00 ? 46 LEU A N    5  
ATOM 5084  C CA   . LEU A 1 46 ? -2.132  -12.237 -9.675  1.00 0.00 ? 46 LEU A CA   5  
ATOM 5085  C C    . LEU A 1 46 ? -0.714  -12.784 -9.800  1.00 0.00 ? 46 LEU A C    5  
ATOM 5086  O O    . LEU A 1 46 ? -0.135  -13.300 -8.844  1.00 0.00 ? 46 LEU A O    5  
ATOM 5087  C CB   . LEU A 1 46 ? -2.088  -10.736 -9.384  1.00 0.00 ? 46 LEU A CB   5  
ATOM 5088  C CG   . LEU A 1 46 ? -3.441  -10.028 -9.302  1.00 0.00 ? 46 LEU A CG   5  
ATOM 5089  C CD1  . LEU A 1 46 ? -3.277  -8.627  -8.735  1.00 0.00 ? 46 LEU A CD1  5  
ATOM 5090  C CD2  . LEU A 1 46 ? -4.101  -9.978  -10.672 1.00 0.00 ? 46 LEU A CD2  5  
ATOM 5091  H H    . LEU A 1 46 ? -2.616  -12.790 -7.691  1.00 0.00 ? 46 LEU A H    5  
ATOM 5092  H HA   . LEU A 1 46 ? -2.651  -12.399 -10.608 1.00 0.00 ? 46 LEU A HA   5  
ATOM 5093  H HB2  . LEU A 1 46 ? -1.585  -10.597 -8.440  1.00 0.00 ? 46 LEU A HB2  5  
ATOM 5094  H HB3  . LEU A 1 46 ? -1.515  -10.264 -10.170 1.00 0.00 ? 46 LEU A HB3  5  
ATOM 5095  H HG   . LEU A 1 46 ? -4.090  -10.583 -8.638  1.00 0.00 ? 46 LEU A HG   5  
ATOM 5096  H HD11 . LEU A 1 46 ? -2.336  -8.558  -8.212  1.00 0.00 ? 46 LEU A HD11 5  
ATOM 5097  H HD12 . LEU A 1 46 ? -4.086  -8.419  -8.050  1.00 0.00 ? 46 LEU A HD12 5  
ATOM 5098  H HD13 . LEU A 1 46 ? -3.296  -7.908  -9.541  1.00 0.00 ? 46 LEU A HD13 5  
ATOM 5099  H HD21 . LEU A 1 46 ? -5.127  -9.655  -10.566 1.00 0.00 ? 46 LEU A HD21 5  
ATOM 5100  H HD22 . LEU A 1 46 ? -4.078  -10.961 -11.119 1.00 0.00 ? 46 LEU A HD22 5  
ATOM 5101  H HD23 . LEU A 1 46 ? -3.568  -9.282  -11.303 1.00 0.00 ? 46 LEU A HD23 5  
ATOM 5102  N N    . PRO A 1 47 ? -0.138  -12.667 -11.006 1.00 0.00 ? 47 PRO A N    5  
ATOM 5103  C CA   . PRO A 1 47 ? 1.221   -13.141 -11.283 1.00 0.00 ? 47 PRO A CA   5  
ATOM 5104  C C    . PRO A 1 47 ? 2.283   -12.298 -10.585 1.00 0.00 ? 47 PRO A C    5  
ATOM 5105  O O    . PRO A 1 47 ? 2.269   -11.069 -10.667 1.00 0.00 ? 47 PRO A O    5  
ATOM 5106  C CB   . PRO A 1 47 ? 1.342   -13.002 -12.803 1.00 0.00 ? 47 PRO A CB   5  
ATOM 5107  C CG   . PRO A 1 47 ? 0.370   -11.932 -13.164 1.00 0.00 ? 47 PRO A CG   5  
ATOM 5108  C CD   . PRO A 1 47 ? -0.769  -12.062 -12.191 1.00 0.00 ? 47 PRO A CD   5  
ATOM 5109  H HA   . PRO A 1 47 ? 1.345   -14.177 -11.003 1.00 0.00 ? 47 PRO A HA   5  
ATOM 5110  H HB2  . PRO A 1 47 ? 2.354   -12.723 -13.062 1.00 0.00 ? 47 PRO A HB2  5  
ATOM 5111  H HB3  . PRO A 1 47 ? 1.090   -13.940 -13.274 1.00 0.00 ? 47 PRO A HB3  5  
ATOM 5112  H HG2  . PRO A 1 47 ? 0.838   -10.964 -13.068 1.00 0.00 ? 47 PRO A HG2  5  
ATOM 5113  H HG3  . PRO A 1 47 ? 0.019   -12.082 -14.174 1.00 0.00 ? 47 PRO A HG3  5  
ATOM 5114  H HD2  . PRO A 1 47 ? -1.177  -11.090 -11.956 1.00 0.00 ? 47 PRO A HD2  5  
ATOM 5115  H HD3  . PRO A 1 47 ? -1.535  -12.708 -12.591 1.00 0.00 ? 47 PRO A HD3  5  
ATOM 5116  N N    . THR A 1 48 ? 3.205   -12.966 -9.898  1.00 0.00 ? 48 THR A N    5  
ATOM 5117  C CA   . THR A 1 48 ? 4.274   -12.278 -9.185  1.00 0.00 ? 48 THR A CA   5  
ATOM 5118  C C    . THR A 1 48 ? 4.893   -11.183 -10.046 1.00 0.00 ? 48 THR A C    5  
ATOM 5119  O O    . THR A 1 48 ? 5.185   -10.090 -9.562  1.00 0.00 ? 48 THR A O    5  
ATOM 5120  C CB   . THR A 1 48 ? 5.379   -13.258 -8.748  1.00 0.00 ? 48 THR A CB   5  
ATOM 5121  O OG1  . THR A 1 48 ? 5.565   -14.265 -9.750  1.00 0.00 ? 48 THR A OG1  5  
ATOM 5122  C CG2  . THR A 1 48 ? 5.028   -13.914 -7.422  1.00 0.00 ? 48 THR A CG2  5  
ATOM 5123  H H    . THR A 1 48 ? 3.163   -13.944 -9.870  1.00 0.00 ? 48 THR A H    5  
ATOM 5124  H HA   . THR A 1 48 ? 3.849   -11.829 -8.299  1.00 0.00 ? 48 THR A HA   5  
ATOM 5125  H HB   . THR A 1 48 ? 6.301   -12.707 -8.628  1.00 0.00 ? 48 THR A HB   5  
ATOM 5126  H HG1  . THR A 1 48 ? 5.054   -15.044 -9.518  1.00 0.00 ? 48 THR A HG1  5  
ATOM 5127  H HG21 . THR A 1 48 ? 5.925   -14.300 -6.962  1.00 0.00 ? 48 THR A HG21 5  
ATOM 5128  H HG22 . THR A 1 48 ? 4.334   -14.723 -7.593  1.00 0.00 ? 48 THR A HG22 5  
ATOM 5129  H HG23 . THR A 1 48 ? 4.575   -13.183 -6.769  1.00 0.00 ? 48 THR A HG23 5  
ATOM 5130  N N    . ARG A 1 49 ? 5.091   -11.483 -11.326 1.00 0.00 ? 49 ARG A N    5  
ATOM 5131  C CA   . ARG A 1 49 ? 5.676   -10.524 -12.254 1.00 0.00 ? 49 ARG A CA   5  
ATOM 5132  C C    . ARG A 1 49 ? 4.943   -9.187  -12.189 1.00 0.00 ? 49 ARG A C    5  
ATOM 5133  O O    . ARG A 1 49 ? 5.551   -8.126  -12.324 1.00 0.00 ? 49 ARG A O    5  
ATOM 5134  C CB   . ARG A 1 49 ? 5.633   -11.072 -13.682 1.00 0.00 ? 49 ARG A CB   5  
ATOM 5135  C CG   . ARG A 1 49 ? 4.292   -10.876 -14.370 1.00 0.00 ? 49 ARG A CG   5  
ATOM 5136  C CD   . ARG A 1 49 ? 4.243   -9.560  -15.130 1.00 0.00 ? 49 ARG A CD   5  
ATOM 5137  N NE   . ARG A 1 49 ? 5.161   -9.549  -16.266 1.00 0.00 ? 49 ARG A NE   5  
ATOM 5138  C CZ   . ARG A 1 49 ? 4.998   -10.299 -17.350 1.00 0.00 ? 49 ARG A CZ   5  
ATOM 5139  N NH1  . ARG A 1 49 ? 3.957   -11.115 -17.444 1.00 0.00 ? 49 ARG A NH1  5  
ATOM 5140  N NH2  . ARG A 1 49 ? 5.876   -10.234 -18.342 1.00 0.00 ? 49 ARG A NH2  5  
ATOM 5141  H H    . ARG A 1 49 ? 4.838   -12.372 -11.653 1.00 0.00 ? 49 ARG A H    5  
ATOM 5142  H HA   . ARG A 1 49 ? 6.706   -10.370 -11.968 1.00 0.00 ? 49 ARG A HA   5  
ATOM 5143  H HB2  . ARG A 1 49 ? 6.390   -10.574 -14.269 1.00 0.00 ? 49 ARG A HB2  5  
ATOM 5144  H HB3  . ARG A 1 49 ? 5.848   -12.130 -13.655 1.00 0.00 ? 49 ARG A HB3  5  
ATOM 5145  H HG2  . ARG A 1 49 ? 4.133   -11.686 -15.065 1.00 0.00 ? 49 ARG A HG2  5  
ATOM 5146  H HG3  . ARG A 1 49 ? 3.512   -10.880 -13.623 1.00 0.00 ? 49 ARG A HG3  5  
ATOM 5147  H HD2  . ARG A 1 49 ? 3.237   -9.405  -15.491 1.00 0.00 ? 49 ARG A HD2  5  
ATOM 5148  H HD3  . ARG A 1 49 ? 4.510   -8.760  -14.455 1.00 0.00 ? 49 ARG A HD3  5  
ATOM 5149  H HE   . ARG A 1 49 ? 5.937   -8.953  -16.216 1.00 0.00 ? 49 ARG A HE   5  
ATOM 5150  H HH11 . ARG A 1 49 ? 3.293   -11.166 -16.699 1.00 0.00 ? 49 ARG A HH11 5  
ATOM 5151  H HH12 . ARG A 1 49 ? 3.835   -11.678 -18.262 1.00 0.00 ? 49 ARG A HH12 5  
ATOM 5152  H HH21 . ARG A 1 49 ? 6.662   -9.620  -18.274 1.00 0.00 ? 49 ARG A HH21 5  
ATOM 5153  H HH22 . ARG A 1 49 ? 5.752   -10.799 -19.157 1.00 0.00 ? 49 ARG A HH22 5  
ATOM 5154  N N    . VAL A 1 50 ? 3.631   -9.247  -11.982 1.00 0.00 ? 50 VAL A N    5  
ATOM 5155  C CA   . VAL A 1 50 ? 2.814   -8.042  -11.898 1.00 0.00 ? 50 VAL A CA   5  
ATOM 5156  C C    . VAL A 1 50 ? 2.991   -7.352  -10.551 1.00 0.00 ? 50 VAL A C    5  
ATOM 5157  O O    . VAL A 1 50 ? 3.020   -6.123  -10.471 1.00 0.00 ? 50 VAL A O    5  
ATOM 5158  C CB   . VAL A 1 50 ? 1.322   -8.360  -12.108 1.00 0.00 ? 50 VAL A CB   5  
ATOM 5159  C CG1  . VAL A 1 50 ? 0.455   -7.224  -11.588 1.00 0.00 ? 50 VAL A CG1  5  
ATOM 5160  C CG2  . VAL A 1 50 ? 1.037   -8.630  -13.578 1.00 0.00 ? 50 VAL A CG2  5  
ATOM 5161  H H    . VAL A 1 50 ? 3.203   -10.123 -11.882 1.00 0.00 ? 50 VAL A H    5  
ATOM 5162  H HA   . VAL A 1 50 ? 3.131   -7.369  -12.681 1.00 0.00 ? 50 VAL A HA   5  
ATOM 5163  H HB   . VAL A 1 50 ? 1.082   -9.252  -11.547 1.00 0.00 ? 50 VAL A HB   5  
ATOM 5164  H HG11 . VAL A 1 50 ? -0.570  -7.388  -11.886 1.00 0.00 ? 50 VAL A HG11 5  
ATOM 5165  H HG12 . VAL A 1 50 ? 0.517   -7.187  -10.510 1.00 0.00 ? 50 VAL A HG12 5  
ATOM 5166  H HG13 . VAL A 1 50 ? 0.804   -6.288  -12.001 1.00 0.00 ? 50 VAL A HG13 5  
ATOM 5167  H HG21 . VAL A 1 50 ? 0.956   -7.692  -14.106 1.00 0.00 ? 50 VAL A HG21 5  
ATOM 5168  H HG22 . VAL A 1 50 ? 1.842   -9.213  -14.000 1.00 0.00 ? 50 VAL A HG22 5  
ATOM 5169  H HG23 . VAL A 1 50 ? 0.110   -9.177  -13.671 1.00 0.00 ? 50 VAL A HG23 5  
ATOM 5170  N N    . ILE A 1 51 ? 3.109   -8.149  -9.494  1.00 0.00 ? 51 ILE A N    5  
ATOM 5171  C CA   . ILE A 1 51 ? 3.284   -7.613  -8.150  1.00 0.00 ? 51 ILE A CA   5  
ATOM 5172  C C    . ILE A 1 51 ? 4.684   -7.037  -7.966  1.00 0.00 ? 51 ILE A C    5  
ATOM 5173  O O    . ILE A 1 51 ? 4.886   -6.107  -7.185  1.00 0.00 ? 51 ILE A O    5  
ATOM 5174  C CB   . ILE A 1 51 ? 3.041   -8.692  -7.078  1.00 0.00 ? 51 ILE A CB   5  
ATOM 5175  C CG1  . ILE A 1 51 ? 1.753   -9.462  -7.381  1.00 0.00 ? 51 ILE A CG1  5  
ATOM 5176  C CG2  . ILE A 1 51 ? 2.974   -8.060  -5.696  1.00 0.00 ? 51 ILE A CG2  5  
ATOM 5177  C CD1  . ILE A 1 51 ? 1.581   -10.707 -6.539  1.00 0.00 ? 51 ILE A CD1  5  
ATOM 5178  H H    . ILE A 1 51 ? 3.078   -9.119  -9.622  1.00 0.00 ? 51 ILE A H    5  
ATOM 5179  H HA   . ILE A 1 51 ? 2.560   -6.824  -8.008  1.00 0.00 ? 51 ILE A HA   5  
ATOM 5180  H HB   . ILE A 1 51 ? 3.874   -9.378  -7.094  1.00 0.00 ? 51 ILE A HB   5  
ATOM 5181  H HG12 . ILE A 1 51 ? 0.906   -8.819  -7.198  1.00 0.00 ? 51 ILE A HG12 5  
ATOM 5182  H HG13 . ILE A 1 51 ? 1.757   -9.760  -8.419  1.00 0.00 ? 51 ILE A HG13 5  
ATOM 5183  H HG21 . ILE A 1 51 ? 2.313   -8.639  -5.067  1.00 0.00 ? 51 ILE A HG21 5  
ATOM 5184  H HG22 . ILE A 1 51 ? 3.962   -8.045  -5.260  1.00 0.00 ? 51 ILE A HG22 5  
ATOM 5185  H HG23 . ILE A 1 51 ? 2.601   -7.051  -5.779  1.00 0.00 ? 51 ILE A HG23 5  
ATOM 5186  H HD11 . ILE A 1 51 ? 2.032   -10.552 -5.570  1.00 0.00 ? 51 ILE A HD11 5  
ATOM 5187  H HD12 . ILE A 1 51 ? 0.530   -10.919 -6.419  1.00 0.00 ? 51 ILE A HD12 5  
ATOM 5188  H HD13 . ILE A 1 51 ? 2.063   -11.541 -7.029  1.00 0.00 ? 51 ILE A HD13 5  
ATOM 5189  N N    . VAL A 1 52 ? 5.648   -7.594  -8.692  1.00 0.00 ? 52 VAL A N    5  
ATOM 5190  C CA   . VAL A 1 52 ? 7.029   -7.134  -8.612  1.00 0.00 ? 52 VAL A CA   5  
ATOM 5191  C C    . VAL A 1 52 ? 7.174   -5.730  -9.189  1.00 0.00 ? 52 VAL A C    5  
ATOM 5192  O O    . VAL A 1 52 ? 7.679   -4.824  -8.526  1.00 0.00 ? 52 VAL A O    5  
ATOM 5193  C CB   . VAL A 1 52 ? 7.982   -8.085  -9.359  1.00 0.00 ? 52 VAL A CB   5  
ATOM 5194  C CG1  . VAL A 1 52 ? 9.382   -7.494  -9.428  1.00 0.00 ? 52 VAL A CG1  5  
ATOM 5195  C CG2  . VAL A 1 52 ? 8.003   -9.451  -8.690  1.00 0.00 ? 52 VAL A CG2  5  
ATOM 5196  H H    . VAL A 1 52 ? 5.424   -8.332  -9.297  1.00 0.00 ? 52 VAL A H    5  
ATOM 5197  H HA   . VAL A 1 52 ? 7.315   -7.116  -7.571  1.00 0.00 ? 52 VAL A HA   5  
ATOM 5198  H HB   . VAL A 1 52 ? 7.617   -8.208  -10.369 1.00 0.00 ? 52 VAL A HB   5  
ATOM 5199  H HG11 . VAL A 1 52 ? 9.324   -6.473  -9.776  1.00 0.00 ? 52 VAL A HG11 5  
ATOM 5200  H HG12 . VAL A 1 52 ? 9.831   -7.516  -8.446  1.00 0.00 ? 52 VAL A HG12 5  
ATOM 5201  H HG13 . VAL A 1 52 ? 9.984   -8.073  -10.113 1.00 0.00 ? 52 VAL A HG13 5  
ATOM 5202  H HG21 . VAL A 1 52 ? 9.012   -9.836  -8.692  1.00 0.00 ? 52 VAL A HG21 5  
ATOM 5203  H HG22 . VAL A 1 52 ? 7.656   -9.358  -7.671  1.00 0.00 ? 52 VAL A HG22 5  
ATOM 5204  H HG23 . VAL A 1 52 ? 7.357   -10.127 -9.229  1.00 0.00 ? 52 VAL A HG23 5  
ATOM 5205  N N    . VAL A 1 53 ? 6.729   -5.557  -10.430 1.00 0.00 ? 53 VAL A N    5  
ATOM 5206  C CA   . VAL A 1 53 ? 6.808   -4.263  -11.096 1.00 0.00 ? 53 VAL A CA   5  
ATOM 5207  C C    . VAL A 1 53 ? 6.183   -3.165  -10.242 1.00 0.00 ? 53 VAL A C    5  
ATOM 5208  O O    . VAL A 1 53 ? 6.683   -2.041  -10.194 1.00 0.00 ? 53 VAL A O    5  
ATOM 5209  C CB   . VAL A 1 53 ? 6.106   -4.294  -12.467 1.00 0.00 ? 53 VAL A CB   5  
ATOM 5210  C CG1  . VAL A 1 53 ? 6.134   -2.917  -13.113 1.00 0.00 ? 53 VAL A CG1  5  
ATOM 5211  C CG2  . VAL A 1 53 ? 6.753   -5.330  -13.373 1.00 0.00 ? 53 VAL A CG2  5  
ATOM 5212  H H    . VAL A 1 53 ? 6.337   -6.317  -10.907 1.00 0.00 ? 53 VAL A H    5  
ATOM 5213  H HA   . VAL A 1 53 ? 7.851   -4.032  -11.255 1.00 0.00 ? 53 VAL A HA   5  
ATOM 5214  H HB   . VAL A 1 53 ? 5.074   -4.574  -12.314 1.00 0.00 ? 53 VAL A HB   5  
ATOM 5215  H HG11 . VAL A 1 53 ? 6.949   -2.342  -12.698 1.00 0.00 ? 53 VAL A HG11 5  
ATOM 5216  H HG12 . VAL A 1 53 ? 6.272   -3.022  -14.179 1.00 0.00 ? 53 VAL A HG12 5  
ATOM 5217  H HG13 . VAL A 1 53 ? 5.201   -2.409  -12.919 1.00 0.00 ? 53 VAL A HG13 5  
ATOM 5218  H HG21 . VAL A 1 53 ? 6.834   -4.932  -14.373 1.00 0.00 ? 53 VAL A HG21 5  
ATOM 5219  H HG22 . VAL A 1 53 ? 7.738   -5.571  -13.000 1.00 0.00 ? 53 VAL A HG22 5  
ATOM 5220  H HG23 . VAL A 1 53 ? 6.146   -6.224  -13.389 1.00 0.00 ? 53 VAL A HG23 5  
ATOM 5221  N N    . TRP A 1 54 ? 5.087   -3.499  -9.570  1.00 0.00 ? 54 TRP A N    5  
ATOM 5222  C CA   . TRP A 1 54 ? 4.393   -2.541  -8.716  1.00 0.00 ? 54 TRP A CA   5  
ATOM 5223  C C    . TRP A 1 54 ? 5.231   -2.198  -7.489  1.00 0.00 ? 54 TRP A C    5  
ATOM 5224  O O    . TRP A 1 54 ? 5.407   -1.027  -7.153  1.00 0.00 ? 54 TRP A O    5  
ATOM 5225  C CB   . TRP A 1 54 ? 3.038   -3.101  -8.283  1.00 0.00 ? 54 TRP A CB   5  
ATOM 5226  C CG   . TRP A 1 54 ? 2.222   -2.131  -7.483  1.00 0.00 ? 54 TRP A CG   5  
ATOM 5227  C CD1  . TRP A 1 54 ? 1.188   -1.362  -7.935  1.00 0.00 ? 54 TRP A CD1  5  
ATOM 5228  C CD2  . TRP A 1 54 ? 2.374   -1.826  -6.093  1.00 0.00 ? 54 TRP A CD2  5  
ATOM 5229  N NE1  . TRP A 1 54 ? 0.688   -0.596  -6.910  1.00 0.00 ? 54 TRP A NE1  5  
ATOM 5230  C CE2  . TRP A 1 54 ? 1.398   -0.863  -5.769  1.00 0.00 ? 54 TRP A CE2  5  
ATOM 5231  C CE3  . TRP A 1 54 ? 3.238   -2.273  -5.090  1.00 0.00 ? 54 TRP A CE3  5  
ATOM 5232  C CZ2  . TRP A 1 54 ? 1.265   -0.341  -4.485  1.00 0.00 ? 54 TRP A CZ2  5  
ATOM 5233  C CZ3  . TRP A 1 54 ? 3.105   -1.754  -3.816  1.00 0.00 ? 54 TRP A CZ3  5  
ATOM 5234  C CH2  . TRP A 1 54 ? 2.125   -0.797  -3.522  1.00 0.00 ? 54 TRP A CH2  5  
ATOM 5235  H H    . TRP A 1 54 ? 4.736   -4.411  -9.649  1.00 0.00 ? 54 TRP A H    5  
ATOM 5236  H HA   . TRP A 1 54 ? 4.233   -1.641  -9.291  1.00 0.00 ? 54 TRP A HA   5  
ATOM 5237  H HB2  . TRP A 1 54 ? 2.469   -3.371  -9.161  1.00 0.00 ? 54 TRP A HB2  5  
ATOM 5238  H HB3  . TRP A 1 54 ? 3.198   -3.982  -7.678  1.00 0.00 ? 54 TRP A HB3  5  
ATOM 5239  H HD1  . TRP A 1 54 ? 0.828   -1.364  -8.953  1.00 0.00 ? 54 TRP A HD1  5  
ATOM 5240  H HE1  . TRP A 1 54 ? -0.057  0.037   -6.983  1.00 0.00 ? 54 TRP A HE1  5  
ATOM 5241  H HE3  . TRP A 1 54 ? 4.000   -3.010  -5.297  1.00 0.00 ? 54 TRP A HE3  5  
ATOM 5242  H HZ2  . TRP A 1 54 ? 0.514   0.396   -4.242  1.00 0.00 ? 54 TRP A HZ2  5  
ATOM 5243  H HZ3  . TRP A 1 54 ? 3.764   -2.087  -3.028  1.00 0.00 ? 54 TRP A HZ3  5  
ATOM 5244  H HH2  . TRP A 1 54 ? 2.057   -0.419  -2.514  1.00 0.00 ? 54 TRP A HH2  5  
ATOM 5245  N N    . PHE A 1 55 ? 5.746   -3.227  -6.824  1.00 0.00 ? 55 PHE A N    5  
ATOM 5246  C CA   . PHE A 1 55 ? 6.565   -3.034  -5.633  1.00 0.00 ? 55 PHE A CA   5  
ATOM 5247  C C    . PHE A 1 55 ? 7.838   -2.261  -5.968  1.00 0.00 ? 55 PHE A C    5  
ATOM 5248  O O    . PHE A 1 55 ? 8.262   -1.388  -5.211  1.00 0.00 ? 55 PHE A O    5  
ATOM 5249  C CB   . PHE A 1 55 ? 6.925   -4.385  -5.011  1.00 0.00 ? 55 PHE A CB   5  
ATOM 5250  C CG   . PHE A 1 55 ? 5.938   -4.851  -3.979  1.00 0.00 ? 55 PHE A CG   5  
ATOM 5251  C CD1  . PHE A 1 55 ? 4.628   -5.133  -4.331  1.00 0.00 ? 55 PHE A CD1  5  
ATOM 5252  C CD2  . PHE A 1 55 ? 6.320   -5.006  -2.656  1.00 0.00 ? 55 PHE A CD2  5  
ATOM 5253  C CE1  . PHE A 1 55 ? 3.718   -5.562  -3.384  1.00 0.00 ? 55 PHE A CE1  5  
ATOM 5254  C CE2  . PHE A 1 55 ? 5.415   -5.436  -1.705  1.00 0.00 ? 55 PHE A CE2  5  
ATOM 5255  C CZ   . PHE A 1 55 ? 4.111   -5.713  -2.069  1.00 0.00 ? 55 PHE A CZ   5  
ATOM 5256  H H    . PHE A 1 55 ? 5.570   -4.138  -7.141  1.00 0.00 ? 55 PHE A H    5  
ATOM 5257  H HA   . PHE A 1 55 ? 5.987   -2.462  -4.923  1.00 0.00 ? 55 PHE A HA   5  
ATOM 5258  H HB2  . PHE A 1 55 ? 6.968   -5.131  -5.789  1.00 0.00 ? 55 PHE A HB2  5  
ATOM 5259  H HB3  . PHE A 1 55 ? 7.892   -4.308  -4.537  1.00 0.00 ? 55 PHE A HB3  5  
ATOM 5260  H HD1  . PHE A 1 55 ? 4.319   -5.015  -5.360  1.00 0.00 ? 55 PHE A HD1  5  
ATOM 5261  H HD2  . PHE A 1 55 ? 7.339   -4.789  -2.369  1.00 0.00 ? 55 PHE A HD2  5  
ATOM 5262  H HE1  . PHE A 1 55 ? 2.700   -5.778  -3.672  1.00 0.00 ? 55 PHE A HE1  5  
ATOM 5263  H HE2  . PHE A 1 55 ? 5.725   -5.553  -0.677  1.00 0.00 ? 55 PHE A HE2  5  
ATOM 5264  H HZ   . PHE A 1 55 ? 3.402   -6.049  -1.327  1.00 0.00 ? 55 PHE A HZ   5  
ATOM 5265  N N    . GLN A 1 56 ? 8.440   -2.589  -7.106  1.00 0.00 ? 56 GLN A N    5  
ATOM 5266  C CA   . GLN A 1 56 ? 9.665   -1.927  -7.540  1.00 0.00 ? 56 GLN A CA   5  
ATOM 5267  C C    . GLN A 1 56 ? 9.466   -0.417  -7.626  1.00 0.00 ? 56 GLN A C    5  
ATOM 5268  O O    . GLN A 1 56 ? 10.183  0.351   -6.987  1.00 0.00 ? 56 GLN A O    5  
ATOM 5269  C CB   . GLN A 1 56 ? 10.111  -2.472  -8.898  1.00 0.00 ? 56 GLN A CB   5  
ATOM 5270  C CG   . GLN A 1 56 ? 10.883  -3.778  -8.805  1.00 0.00 ? 56 GLN A CG   5  
ATOM 5271  C CD   . GLN A 1 56 ? 11.874  -3.953  -9.938  1.00 0.00 ? 56 GLN A CD   5  
ATOM 5272  O OE1  . GLN A 1 56 ? 12.316  -2.978  -10.547 1.00 0.00 ? 56 GLN A OE1  5  
ATOM 5273  N NE2  . GLN A 1 56 ? 12.228  -5.199  -10.229 1.00 0.00 ? 56 GLN A NE2  5  
ATOM 5274  H H    . GLN A 1 56 ? 8.053   -3.293  -7.666  1.00 0.00 ? 56 GLN A H    5  
ATOM 5275  H HA   . GLN A 1 56 ? 10.431  -2.135  -6.809  1.00 0.00 ? 56 GLN A HA   5  
ATOM 5276  H HB2  . GLN A 1 56 ? 9.237   -2.638  -9.511  1.00 0.00 ? 56 GLN A HB2  5  
ATOM 5277  H HB3  . GLN A 1 56 ? 10.743  -1.739  -9.377  1.00 0.00 ? 56 GLN A HB3  5  
ATOM 5278  H HG2  . GLN A 1 56 ? 11.423  -3.797  -7.870  1.00 0.00 ? 56 GLN A HG2  5  
ATOM 5279  H HG3  . GLN A 1 56 ? 10.181  -4.599  -8.830  1.00 0.00 ? 56 GLN A HG3  5  
ATOM 5280  H HE21 . GLN A 1 56 ? 11.834  -5.927  -9.702  1.00 0.00 ? 56 GLN A HE21 5  
ATOM 5281  H HE22 . GLN A 1 56 ? 12.867  -5.341  -10.957 1.00 0.00 ? 56 GLN A HE22 5  
ATOM 5282  N N    . ASN A 1 57 ? 8.486   0.002   -8.421  1.00 0.00 ? 57 ASN A N    5  
ATOM 5283  C CA   . ASN A 1 57 ? 8.193   1.420   -8.592  1.00 0.00 ? 57 ASN A CA   5  
ATOM 5284  C C    . ASN A 1 57 ? 7.864   2.072   -7.252  1.00 0.00 ? 57 ASN A C    5  
ATOM 5285  O O    . ASN A 1 57 ? 8.416   3.116   -6.906  1.00 0.00 ? 57 ASN A O    5  
ATOM 5286  C CB   . ASN A 1 57 ? 7.027   1.608   -9.564  1.00 0.00 ? 57 ASN A CB   5  
ATOM 5287  C CG   . ASN A 1 57 ? 7.456   1.480   -11.013 1.00 0.00 ? 57 ASN A CG   5  
ATOM 5288  O OD1  . ASN A 1 57 ? 8.171   2.334   -11.538 1.00 0.00 ? 57 ASN A OD1  5  
ATOM 5289  N ND2  . ASN A 1 57 ? 7.020   0.410   -11.667 1.00 0.00 ? 57 ASN A ND2  5  
ATOM 5290  H H    . ASN A 1 57 ? 7.948   -0.659  -8.905  1.00 0.00 ? 57 ASN A H    5  
ATOM 5291  H HA   . ASN A 1 57 ? 9.073   1.893   -9.002  1.00 0.00 ? 57 ASN A HA   5  
ATOM 5292  H HB2  . ASN A 1 57 ? 6.275   0.859   -9.364  1.00 0.00 ? 57 ASN A HB2  5  
ATOM 5293  H HB3  . ASN A 1 57 ? 6.600   2.589   -9.419  1.00 0.00 ? 57 ASN A HB3  5  
ATOM 5294  H HD21 . ASN A 1 57 ? 6.454   -0.229  -11.185 1.00 0.00 ? 57 ASN A HD21 5  
ATOM 5295  H HD22 . ASN A 1 57 ? 7.283   0.302   -12.605 1.00 0.00 ? 57 ASN A HD22 5  
ATOM 5296  N N    . ALA A 1 58 ? 6.960   1.449   -6.504  1.00 0.00 ? 58 ALA A N    5  
ATOM 5297  C CA   . ALA A 1 58 ? 6.558   1.967   -5.202  1.00 0.00 ? 58 ALA A CA   5  
ATOM 5298  C C    . ALA A 1 58 ? 7.772   2.389   -4.381  1.00 0.00 ? 58 ALA A C    5  
ATOM 5299  O O    . ALA A 1 58 ? 7.733   3.394   -3.670  1.00 0.00 ? 58 ALA A O    5  
ATOM 5300  C CB   . ALA A 1 58 ? 5.745   0.925   -4.447  1.00 0.00 ? 58 ALA A CB   5  
ATOM 5301  H H    . ALA A 1 58 ? 6.554   0.621   -6.834  1.00 0.00 ? 58 ALA A H    5  
ATOM 5302  H HA   . ALA A 1 58 ? 5.929   2.830   -5.365  1.00 0.00 ? 58 ALA A HA   5  
ATOM 5303  H HB1  . ALA A 1 58 ? 5.229   1.399   -3.625  1.00 0.00 ? 58 ALA A HB1  5  
ATOM 5304  H HB2  . ALA A 1 58 ? 5.025   0.478   -5.116  1.00 0.00 ? 58 ALA A HB2  5  
ATOM 5305  H HB3  . ALA A 1 58 ? 6.406   0.161   -4.065  1.00 0.00 ? 58 ALA A HB3  5  
ATOM 5306  N N    . ARG A 1 59 ? 8.848   1.616   -4.483  1.00 0.00 ? 59 ARG A N    5  
ATOM 5307  C CA   . ARG A 1 59 ? 10.072  1.910   -3.749  1.00 0.00 ? 59 ARG A CA   5  
ATOM 5308  C C    . ARG A 1 59 ? 10.755  3.156   -4.305  1.00 0.00 ? 59 ARG A C    5  
ATOM 5309  O O    . ARG A 1 59 ? 11.263  3.985   -3.551  1.00 0.00 ? 59 ARG A O    5  
ATOM 5310  C CB   . ARG A 1 59 ? 11.030  0.719   -3.814  1.00 0.00 ? 59 ARG A CB   5  
ATOM 5311  C CG   . ARG A 1 59 ? 10.549  -0.493  -3.034  1.00 0.00 ? 59 ARG A CG   5  
ATOM 5312  C CD   . ARG A 1 59 ? 11.672  -1.495  -2.812  1.00 0.00 ? 59 ARG A CD   5  
ATOM 5313  N NE   . ARG A 1 59 ? 11.850  -2.380  -3.960  1.00 0.00 ? 59 ARG A NE   5  
ATOM 5314  C CZ   . ARG A 1 59 ? 12.585  -2.069  -5.022  1.00 0.00 ? 59 ARG A CZ   5  
ATOM 5315  N NH1  . ARG A 1 59 ? 13.207  -0.899  -5.082  1.00 0.00 ? 59 ARG A NH1  5  
ATOM 5316  N NH2  . ARG A 1 59 ? 12.699  -2.928  -6.026  1.00 0.00 ? 59 ARG A NH2  5  
ATOM 5317  H H    . ARG A 1 59 ? 8.818   0.829   -5.066  1.00 0.00 ? 59 ARG A H    5  
ATOM 5318  H HA   . ARG A 1 59 ? 9.806   2.090   -2.718  1.00 0.00 ? 59 ARG A HA   5  
ATOM 5319  H HB2  . ARG A 1 59 ? 11.155  0.429   -4.847  1.00 0.00 ? 59 ARG A HB2  5  
ATOM 5320  H HB3  . ARG A 1 59 ? 11.987  1.020   -3.416  1.00 0.00 ? 59 ARG A HB3  5  
ATOM 5321  H HG2  . ARG A 1 59 ? 10.177  -0.168  -2.074  1.00 0.00 ? 59 ARG A HG2  5  
ATOM 5322  H HG3  . ARG A 1 59 ? 9.755   -0.973  -3.587  1.00 0.00 ? 59 ARG A HG3  5  
ATOM 5323  H HD2  . ARG A 1 59 ? 12.591  -0.953  -2.642  1.00 0.00 ? 59 ARG A HD2  5  
ATOM 5324  H HD3  . ARG A 1 59 ? 11.438  -2.090  -1.942  1.00 0.00 ? 59 ARG A HD3  5  
ATOM 5325  H HE   . ARG A 1 59 ? 11.400  -3.250  -3.936  1.00 0.00 ? 59 ARG A HE   5  
ATOM 5326  H HH11 . ARG A 1 59 ? 13.123  -0.250  -4.326  1.00 0.00 ? 59 ARG A HH11 5  
ATOM 5327  H HH12 . ARG A 1 59 ? 13.760  -0.667  -5.882  1.00 0.00 ? 59 ARG A HH12 5  
ATOM 5328  H HH21 . ARG A 1 59 ? 12.232  -3.810  -5.985  1.00 0.00 ? 59 ARG A HH21 5  
ATOM 5329  H HH22 . ARG A 1 59 ? 13.252  -2.692  -6.825  1.00 0.00 ? 59 ARG A HH22 5  
ATOM 5330  N N    . GLN A 1 60 ? 10.761  3.280   -5.628  1.00 0.00 ? 60 GLN A N    5  
ATOM 5331  C CA   . GLN A 1 60 ? 11.382  4.425   -6.285  1.00 0.00 ? 60 GLN A CA   5  
ATOM 5332  C C    . GLN A 1 60 ? 10.699  5.725   -5.872  1.00 0.00 ? 60 GLN A C    5  
ATOM 5333  O O    . GLN A 1 60 ? 11.355  6.749   -5.678  1.00 0.00 ? 60 GLN A O    5  
ATOM 5334  C CB   . GLN A 1 60 ? 11.321  4.263   -7.805  1.00 0.00 ? 60 GLN A CB   5  
ATOM 5335  C CG   . GLN A 1 60 ? 12.302  3.236   -8.347  1.00 0.00 ? 60 GLN A CG   5  
ATOM 5336  C CD   . GLN A 1 60 ? 13.702  3.795   -8.509  1.00 0.00 ? 60 GLN A CD   5  
ATOM 5337  O OE1  . GLN A 1 60 ? 14.178  4.559   -7.669  1.00 0.00 ? 60 GLN A OE1  5  
ATOM 5338  N NE2  . GLN A 1 60 ? 14.369  3.417   -9.593  1.00 0.00 ? 60 GLN A NE2  5  
ATOM 5339  H H    . GLN A 1 60 ? 10.339  2.586   -6.175  1.00 0.00 ? 60 GLN A H    5  
ATOM 5340  H HA   . GLN A 1 60 ? 12.416  4.462   -5.977  1.00 0.00 ? 60 GLN A HA   5  
ATOM 5341  H HB2  . GLN A 1 60 ? 10.323  3.957   -8.082  1.00 0.00 ? 60 GLN A HB2  5  
ATOM 5342  H HB3  . GLN A 1 60 ? 11.539  5.215   -8.265  1.00 0.00 ? 60 GLN A HB3  5  
ATOM 5343  H HG2  . GLN A 1 60 ? 12.342  2.400   -7.665  1.00 0.00 ? 60 GLN A HG2  5  
ATOM 5344  H HG3  . GLN A 1 60 ? 11.952  2.897   -9.310  1.00 0.00 ? 60 GLN A HG3  5  
ATOM 5345  H HE21 . GLN A 1 60 ? 13.925  2.807   -10.219 1.00 0.00 ? 60 GLN A HE21 5  
ATOM 5346  H HE22 . GLN A 1 60 ? 15.275  3.764   -9.723  1.00 0.00 ? 60 GLN A HE22 5  
ATOM 5347  N N    . LYS A 1 61 ? 9.378   5.678   -5.740  1.00 0.00 ? 61 LYS A N    5  
ATOM 5348  C CA   . LYS A 1 61 ? 8.605   6.851   -5.350  1.00 0.00 ? 61 LYS A CA   5  
ATOM 5349  C C    . LYS A 1 61 ? 8.969   7.297   -3.937  1.00 0.00 ? 61 LYS A C    5  
ATOM 5350  O O    . LYS A 1 61 ? 9.085   8.491   -3.664  1.00 0.00 ? 61 LYS A O    5  
ATOM 5351  C CB   . LYS A 1 61 ? 7.107   6.551   -5.432  1.00 0.00 ? 61 LYS A CB   5  
ATOM 5352  C CG   . LYS A 1 61 ? 6.609   6.321   -6.848  1.00 0.00 ? 61 LYS A CG   5  
ATOM 5353  C CD   . LYS A 1 61 ? 5.167   5.843   -6.862  1.00 0.00 ? 61 LYS A CD   5  
ATOM 5354  C CE   . LYS A 1 61 ? 4.775   5.293   -8.225  1.00 0.00 ? 61 LYS A CE   5  
ATOM 5355  N NZ   . LYS A 1 61 ? 4.838   6.338   -9.284  1.00 0.00 ? 61 LYS A NZ   5  
ATOM 5356  H H    . LYS A 1 61 ? 8.911   4.832   -5.909  1.00 0.00 ? 61 LYS A H    5  
ATOM 5357  H HA   . LYS A 1 61 ? 8.842   7.648   -6.038  1.00 0.00 ? 61 LYS A HA   5  
ATOM 5358  H HB2  . LYS A 1 61 ? 6.897   5.665   -4.851  1.00 0.00 ? 61 LYS A HB2  5  
ATOM 5359  H HB3  . LYS A 1 61 ? 6.562   7.384   -5.012  1.00 0.00 ? 61 LYS A HB3  5  
ATOM 5360  H HG2  . LYS A 1 61 ? 6.675   7.248   -7.399  1.00 0.00 ? 61 LYS A HG2  5  
ATOM 5361  H HG3  . LYS A 1 61 ? 7.231   5.574   -7.322  1.00 0.00 ? 61 LYS A HG3  5  
ATOM 5362  H HD2  . LYS A 1 61 ? 5.048   5.063   -6.124  1.00 0.00 ? 61 LYS A HD2  5  
ATOM 5363  H HD3  . LYS A 1 61 ? 4.519   6.673   -6.618  1.00 0.00 ? 61 LYS A HD3  5  
ATOM 5364  H HE2  . LYS A 1 61 ? 5.449   4.491   -8.483  1.00 0.00 ? 61 LYS A HE2  5  
ATOM 5365  H HE3  . LYS A 1 61 ? 3.766   4.911   -8.167  1.00 0.00 ? 61 LYS A HE3  5  
ATOM 5366  H HZ1  . LYS A 1 61 ? 4.692   7.280   -8.865  1.00 0.00 ? 61 LYS A HZ1  5  
ATOM 5367  H HZ2  . LYS A 1 61 ? 4.100   6.170   -9.996  1.00 0.00 ? 61 LYS A HZ2  5  
ATOM 5368  H HZ3  . LYS A 1 61 ? 5.767   6.319   -9.751  1.00 0.00 ? 61 LYS A HZ3  5  
ATOM 5369  N N    . ALA A 1 62 ? 9.149   6.329   -3.044  1.00 0.00 ? 62 ALA A N    5  
ATOM 5370  C CA   . ALA A 1 62 ? 9.503   6.622   -1.661  1.00 0.00 ? 62 ALA A CA   5  
ATOM 5371  C C    . ALA A 1 62 ? 10.774  7.461   -1.586  1.00 0.00 ? 62 ALA A C    5  
ATOM 5372  O O    . ALA A 1 62 ? 10.872  8.385   -0.777  1.00 0.00 ? 62 ALA A O    5  
ATOM 5373  C CB   . ALA A 1 62 ? 9.673   5.331   -0.875  1.00 0.00 ? 62 ALA A CB   5  
ATOM 5374  H H    . ALA A 1 62 ? 9.042   5.396   -3.323  1.00 0.00 ? 62 ALA A H    5  
ATOM 5375  H HA   . ALA A 1 62 ? 8.689   7.179   -1.219  1.00 0.00 ? 62 ALA A HA   5  
ATOM 5376  H HB1  . ALA A 1 62 ? 8.732   5.063   -0.416  1.00 0.00 ? 62 ALA A HB1  5  
ATOM 5377  H HB2  . ALA A 1 62 ? 9.986   4.542   -1.542  1.00 0.00 ? 62 ALA A HB2  5  
ATOM 5378  H HB3  . ALA A 1 62 ? 10.419  5.472   -0.108  1.00 0.00 ? 62 ALA A HB3  5  
ATOM 5379  N N    . ARG A 1 63 ? 11.745  7.134   -2.432  1.00 0.00 ? 63 ARG A N    5  
ATOM 5380  C CA   . ARG A 1 63 ? 13.011  7.856   -2.459  1.00 0.00 ? 63 ARG A CA   5  
ATOM 5381  C C    . ARG A 1 63 ? 12.791  9.324   -2.814  1.00 0.00 ? 63 ARG A C    5  
ATOM 5382  O O    . ARG A 1 63 ? 12.517  9.661   -3.966  1.00 0.00 ? 63 ARG A O    5  
ATOM 5383  C CB   . ARG A 1 63 ? 13.967  7.214   -3.466  1.00 0.00 ? 63 ARG A CB   5  
ATOM 5384  C CG   . ARG A 1 63 ? 14.482  5.851   -3.034  1.00 0.00 ? 63 ARG A CG   5  
ATOM 5385  C CD   . ARG A 1 63 ? 15.832  5.541   -3.660  1.00 0.00 ? 63 ARG A CD   5  
ATOM 5386  N NE   . ARG A 1 63 ? 16.916  6.281   -3.019  1.00 0.00 ? 63 ARG A NE   5  
ATOM 5387  C CZ   . ARG A 1 63 ? 18.083  6.529   -3.603  1.00 0.00 ? 63 ARG A CZ   5  
ATOM 5388  N NH1  . ARG A 1 63 ? 18.316  6.099   -4.835  1.00 0.00 ? 63 ARG A NH1  5  
ATOM 5389  N NH2  . ARG A 1 63 ? 19.019  7.209   -2.954  1.00 0.00 ? 63 ARG A NH2  5  
ATOM 5390  H H    . ARG A 1 63 ? 11.607  6.387   -3.053  1.00 0.00 ? 63 ARG A H    5  
ATOM 5391  H HA   . ARG A 1 63 ? 13.448  7.797   -1.474  1.00 0.00 ? 63 ARG A HA   5  
ATOM 5392  H HB2  . ARG A 1 63 ? 13.453  7.098   -4.409  1.00 0.00 ? 63 ARG A HB2  5  
ATOM 5393  H HB3  . ARG A 1 63 ? 14.815  7.867   -3.605  1.00 0.00 ? 63 ARG A HB3  5  
ATOM 5394  H HG2  . ARG A 1 63 ? 14.585  5.840   -1.959  1.00 0.00 ? 63 ARG A HG2  5  
ATOM 5395  H HG3  . ARG A 1 63 ? 13.772  5.096   -3.337  1.00 0.00 ? 63 ARG A HG3  5  
ATOM 5396  H HD2  . ARG A 1 63 ? 16.025  4.483   -3.563  1.00 0.00 ? 63 ARG A HD2  5  
ATOM 5397  H HD3  . ARG A 1 63 ? 15.798  5.806   -4.706  1.00 0.00 ? 63 ARG A HD3  5  
ATOM 5398  H HE   . ARG A 1 63 ? 16.765  6.608   -2.108  1.00 0.00 ? 63 ARG A HE   5  
ATOM 5399  H HH11 . ARG A 1 63 ? 17.611  5.587   -5.327  1.00 0.00 ? 63 ARG A HH11 5  
ATOM 5400  H HH12 . ARG A 1 63 ? 19.195  6.288   -5.273  1.00 0.00 ? 63 ARG A HH12 5  
ATOM 5401  H HH21 . ARG A 1 63 ? 18.847  7.535   -2.025  1.00 0.00 ? 63 ARG A HH21 5  
ATOM 5402  H HH22 . ARG A 1 63 ? 19.897  7.395   -3.394  1.00 0.00 ? 63 ARG A HH22 5  
ATOM 5403  N N    . LYS A 1 64 ? 12.914  10.193  -1.816  1.00 0.00 ? 64 LYS A N    5  
ATOM 5404  C CA   . LYS A 1 64 ? 12.730  11.625  -2.021  1.00 0.00 ? 64 LYS A CA   5  
ATOM 5405  C C    . LYS A 1 64 ? 13.332  12.065  -3.352  1.00 0.00 ? 64 LYS A C    5  
ATOM 5406  O O    . LYS A 1 64 ? 14.195  11.387  -3.908  1.00 0.00 ? 64 LYS A O    5  
ATOM 5407  C CB   . LYS A 1 64 ? 13.369  12.411  -0.875  1.00 0.00 ? 64 LYS A CB   5  
ATOM 5408  C CG   . LYS A 1 64 ? 14.886  12.330  -0.852  1.00 0.00 ? 64 LYS A CG   5  
ATOM 5409  C CD   . LYS A 1 64 ? 15.477  13.232  0.218   1.00 0.00 ? 64 LYS A CD   5  
ATOM 5410  C CE   . LYS A 1 64 ? 15.441  12.571  1.587   1.00 0.00 ? 64 LYS A CE   5  
ATOM 5411  N NZ   . LYS A 1 64 ? 16.504  11.539  1.732   1.00 0.00 ? 64 LYS A NZ   5  
ATOM 5412  H H    . LYS A 1 64 ? 13.134  9.863   -0.920  1.00 0.00 ? 64 LYS A H    5  
ATOM 5413  H HA   . LYS A 1 64 ? 11.669  11.824  -2.036  1.00 0.00 ? 64 LYS A HA   5  
ATOM 5414  H HB2  . LYS A 1 64 ? 13.086  13.449  -0.965  1.00 0.00 ? 64 LYS A HB2  5  
ATOM 5415  H HB3  . LYS A 1 64 ? 12.995  12.025  0.063   1.00 0.00 ? 64 LYS A HB3  5  
ATOM 5416  H HG2  . LYS A 1 64 ? 15.180  11.310  -0.650  1.00 0.00 ? 64 LYS A HG2  5  
ATOM 5417  H HG3  . LYS A 1 64 ? 15.267  12.632  -1.817  1.00 0.00 ? 64 LYS A HG3  5  
ATOM 5418  H HD2  . LYS A 1 64 ? 16.503  13.453  -0.036  1.00 0.00 ? 64 LYS A HD2  5  
ATOM 5419  H HD3  . LYS A 1 64 ? 14.908  14.151  0.256   1.00 0.00 ? 64 LYS A HD3  5  
ATOM 5420  H HE2  . LYS A 1 64 ? 15.581  13.329  2.342   1.00 0.00 ? 64 LYS A HE2  5  
ATOM 5421  H HE3  . LYS A 1 64 ? 14.476  12.104  1.721   1.00 0.00 ? 64 LYS A HE3  5  
ATOM 5422  H HZ1  . LYS A 1 64 ? 17.342  11.810  1.180   1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 5423  H HZ2  . LYS A 1 64 ? 16.159  10.620  1.389   1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 5424  H HZ3  . LYS A 1 64 ? 16.775  11.443  2.732   1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 5425  N N    . SER A 1 65 ? 12.872  13.206  -3.855  1.00 0.00 ? 65 SER A N    5  
ATOM 5426  C CA   . SER A 1 65 ? 13.364  13.736  -5.122  1.00 0.00 ? 65 SER A CA   5  
ATOM 5427  C C    . SER A 1 65 ? 14.713  14.424  -4.935  1.00 0.00 ? 65 SER A C    5  
ATOM 5428  O O    . SER A 1 65 ? 14.940  15.519  -5.447  1.00 0.00 ? 65 SER A O    5  
ATOM 5429  C CB   . SER A 1 65 ? 12.354  14.721  -5.713  1.00 0.00 ? 65 SER A CB   5  
ATOM 5430  O OG   . SER A 1 65 ? 12.061  15.762  -4.798  1.00 0.00 ? 65 SER A OG   5  
ATOM 5431  H H    . SER A 1 65 ? 12.184  13.702  -3.364  1.00 0.00 ? 65 SER A H    5  
ATOM 5432  H HA   . SER A 1 65 ? 13.488  12.907  -5.802  1.00 0.00 ? 65 SER A HA   5  
ATOM 5433  H HB2  . SER A 1 65 ? 12.763  15.154  -6.614  1.00 0.00 ? 65 SER A HB2  5  
ATOM 5434  H HB3  . SER A 1 65 ? 11.440  14.196  -5.949  1.00 0.00 ? 65 SER A HB3  5  
ATOM 5435  H HG   . SER A 1 65 ? 11.110  15.880  -4.741  1.00 0.00 ? 65 SER A HG   5  
ATOM 5436  N N    . GLY A 1 66 ? 15.606  13.772  -4.196  1.00 0.00 ? 66 GLY A N    5  
ATOM 5437  C CA   . GLY A 1 66 ? 16.922  14.335  -3.954  1.00 0.00 ? 66 GLY A CA   5  
ATOM 5438  C C    . GLY A 1 66 ? 16.856  15.749  -3.411  1.00 0.00 ? 66 GLY A C    5  
ATOM 5439  O O    . GLY A 1 66 ? 15.791  16.250  -3.050  1.00 0.00 ? 66 GLY A O    5  
ATOM 5440  H H    . GLY A 1 66 ? 15.370  12.902  -3.813  1.00 0.00 ? 66 GLY A H    5  
ATOM 5441  H HA2  . GLY A 1 66 ? 17.443  13.712  -3.243  1.00 0.00 ? 66 GLY A HA2  5  
ATOM 5442  H HA3  . GLY A 1 66 ? 17.473  14.344  -4.883  1.00 0.00 ? 66 GLY A HA3  5  
ATOM 5443  N N    . PRO A 1 67 ? 18.018  16.416  -3.345  1.00 0.00 ? 67 PRO A N    5  
ATOM 5444  C CA   . PRO A 1 67 ? 18.115  17.790  -2.842  1.00 0.00 ? 67 PRO A CA   5  
ATOM 5445  C C    . PRO A 1 67 ? 17.475  18.800  -3.788  1.00 0.00 ? 67 PRO A C    5  
ATOM 5446  O O    . PRO A 1 67 ? 17.510  20.005  -3.540  1.00 0.00 ? 67 PRO A O    5  
ATOM 5447  C CB   . PRO A 1 67 ? 19.624  18.027  -2.747  1.00 0.00 ? 67 PRO A CB   5  
ATOM 5448  C CG   . PRO A 1 67 ? 20.218  17.092  -3.743  1.00 0.00 ? 67 PRO A CG   5  
ATOM 5449  C CD   . PRO A 1 67 ? 19.326  15.881  -3.758  1.00 0.00 ? 67 PRO A CD   5  
ATOM 5450  H HA   . PRO A 1 67 ? 17.671  17.885  -1.862  1.00 0.00 ? 67 PRO A HA   5  
ATOM 5451  H HB2  . PRO A 1 67 ? 19.845  19.057  -2.989  1.00 0.00 ? 67 PRO A HB2  5  
ATOM 5452  H HB3  . PRO A 1 67 ? 19.964  17.806  -1.746  1.00 0.00 ? 67 PRO A HB3  5  
ATOM 5453  H HG2  . PRO A 1 67 ? 20.236  17.557  -4.717  1.00 0.00 ? 67 PRO A HG2  5  
ATOM 5454  H HG3  . PRO A 1 67 ? 21.217  16.818  -3.438  1.00 0.00 ? 67 PRO A HG3  5  
ATOM 5455  H HD2  . PRO A 1 67 ? 19.276  15.462  -4.752  1.00 0.00 ? 67 PRO A HD2  5  
ATOM 5456  H HD3  . PRO A 1 67 ? 19.680  15.144  -3.053  1.00 0.00 ? 67 PRO A HD3  5  
ATOM 5457  N N    . SER A 1 68 ? 16.891  18.301  -4.873  1.00 0.00 ? 68 SER A N    5  
ATOM 5458  C CA   . SER A 1 68 ? 16.247  19.161  -5.858  1.00 0.00 ? 68 SER A CA   5  
ATOM 5459  C C    . SER A 1 68 ? 14.767  18.815  -5.997  1.00 0.00 ? 68 SER A C    5  
ATOM 5460  O O    . SER A 1 68 ? 14.394  17.939  -6.777  1.00 0.00 ? 68 SER A O    5  
ATOM 5461  C CB   . SER A 1 68 ? 16.942  19.029  -7.215  1.00 0.00 ? 68 SER A CB   5  
ATOM 5462  O OG   . SER A 1 68 ? 16.151  19.588  -8.250  1.00 0.00 ? 68 SER A OG   5  
ATOM 5463  H H    . SER A 1 68 ? 16.897  17.331  -5.015  1.00 0.00 ? 68 SER A H    5  
ATOM 5464  H HA   . SER A 1 68 ? 16.335  20.182  -5.516  1.00 0.00 ? 68 SER A HA   5  
ATOM 5465  H HB2  . SER A 1 68 ? 17.889  19.546  -7.183  1.00 0.00 ? 68 SER A HB2  5  
ATOM 5466  H HB3  . SER A 1 68 ? 17.109  17.984  -7.430  1.00 0.00 ? 68 SER A HB3  5  
ATOM 5467  H HG   . SER A 1 68 ? 16.615  20.332  -8.641  1.00 0.00 ? 68 SER A HG   5  
ATOM 5468  N N    . SER A 1 69 ? 13.930  19.509  -5.233  1.00 0.00 ? 69 SER A N    5  
ATOM 5469  C CA   . SER A 1 69 ? 12.491  19.273  -5.266  1.00 0.00 ? 69 SER A CA   5  
ATOM 5470  C C    . SER A 1 69 ? 11.968  19.309  -6.699  1.00 0.00 ? 69 SER A C    5  
ATOM 5471  O O    . SER A 1 69 ? 11.236  18.418  -7.127  1.00 0.00 ? 69 SER A O    5  
ATOM 5472  C CB   . SER A 1 69 ? 11.762  20.318  -4.419  1.00 0.00 ? 69 SER A CB   5  
ATOM 5473  O OG   . SER A 1 69 ? 10.400  19.970  -4.241  1.00 0.00 ? 69 SER A OG   5  
ATOM 5474  H H    . SER A 1 69 ? 14.288  20.194  -4.631  1.00 0.00 ? 69 SER A H    5  
ATOM 5475  H HA   . SER A 1 69 ? 12.306  18.293  -4.852  1.00 0.00 ? 69 SER A HA   5  
ATOM 5476  H HB2  . SER A 1 69 ? 12.233  20.384  -3.450  1.00 0.00 ? 69 SER A HB2  5  
ATOM 5477  H HB3  . SER A 1 69 ? 11.815  21.278  -4.912  1.00 0.00 ? 69 SER A HB3  5  
ATOM 5478  H HG   . SER A 1 69 ? 10.256  19.692  -3.333  1.00 0.00 ? 69 SER A HG   5  
ATOM 5479  N N    . GLY A 1 70 ? 12.349  20.348  -7.436  1.00 0.00 ? 70 GLY A N    5  
ATOM 5480  C CA   . GLY A 1 70 ? 11.910  20.482  -8.813  1.00 0.00 ? 70 GLY A CA   5  
ATOM 5481  C C    . GLY A 1 70 ? 12.488  19.408  -9.713  1.00 0.00 ? 70 GLY A C    5  
ATOM 5482  O O    . GLY A 1 70 ? 12.088  19.277  -10.870 1.00 0.00 ? 70 GLY A O    5  
ATOM 5483  H H    . GLY A 1 70 ? 12.934  21.028  -7.042  1.00 0.00 ? 70 GLY A H    5  
ATOM 5484  H HA2  . GLY A 1 70 ? 10.832  20.420  -8.843  1.00 0.00 ? 70 GLY A HA2  5  
ATOM 5485  H HA3  . GLY A 1 70 ? 12.216  21.449  -9.183  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 5486  N N    . GLY A 1 1  ? -2.810  7.923   -32.222 1.00 0.00 ? 1  GLY A N    6  
ATOM 5487  C CA   . GLY A 1 1  ? -2.540  9.000   -33.157 1.00 0.00 ? 1  GLY A CA   6  
ATOM 5488  C C    . GLY A 1 1  ? -3.776  9.424   -33.926 1.00 0.00 ? 1  GLY A C    6  
ATOM 5489  O O    . GLY A 1 1  ? -4.407  10.428  -33.595 1.00 0.00 ? 1  GLY A O    6  
ATOM 5490  H H1   . GLY A 1 1  ? -2.461  7.972   -31.308 1.00 0.00 ? 1  GLY A H1   6  
ATOM 5491  H HA2  . GLY A 1 1  ? -2.160  9.850   -32.610 1.00 0.00 ? 1  GLY A HA2  6  
ATOM 5492  H HA3  . GLY A 1 1  ? -1.789  8.671   -33.860 1.00 0.00 ? 1  GLY A HA3  6  
ATOM 5493  N N    . SER A 1 2  ? -4.123  8.657   -34.955 1.00 0.00 ? 2  SER A N    6  
ATOM 5494  C CA   . SER A 1 2  ? -5.289  8.962   -35.776 1.00 0.00 ? 2  SER A CA   6  
ATOM 5495  C C    . SER A 1 2  ? -6.579  8.712   -35.002 1.00 0.00 ? 2  SER A C    6  
ATOM 5496  O O    . SER A 1 2  ? -7.483  9.547   -34.994 1.00 0.00 ? 2  SER A O    6  
ATOM 5497  C CB   . SER A 1 2  ? -5.275  8.118   -37.052 1.00 0.00 ? 2  SER A CB   6  
ATOM 5498  O OG   . SER A 1 2  ? -4.132  8.404   -37.840 1.00 0.00 ? 2  SER A OG   6  
ATOM 5499  H H    . SER A 1 2  ? -3.580  7.870   -35.168 1.00 0.00 ? 2  SER A H    6  
ATOM 5500  H HA   . SER A 1 2  ? -5.241  10.006  -36.045 1.00 0.00 ? 2  SER A HA   6  
ATOM 5501  H HB2  . SER A 1 2  ? -5.262  7.071   -36.788 1.00 0.00 ? 2  SER A HB2  6  
ATOM 5502  H HB3  . SER A 1 2  ? -6.161  8.333   -37.632 1.00 0.00 ? 2  SER A HB3  6  
ATOM 5503  H HG   . SER A 1 2  ? -4.407  8.791   -38.674 1.00 0.00 ? 2  SER A HG   6  
ATOM 5504  N N    . SER A 1 3  ? -6.657  7.555   -34.352 1.00 0.00 ? 3  SER A N    6  
ATOM 5505  C CA   . SER A 1 3  ? -7.838  7.191   -33.577 1.00 0.00 ? 3  SER A CA   6  
ATOM 5506  C C    . SER A 1 3  ? -8.043  8.157   -32.414 1.00 0.00 ? 3  SER A C    6  
ATOM 5507  O O    . SER A 1 3  ? -9.151  8.639   -32.180 1.00 0.00 ? 3  SER A O    6  
ATOM 5508  C CB   . SER A 1 3  ? -7.708  5.761   -33.050 1.00 0.00 ? 3  SER A CB   6  
ATOM 5509  O OG   . SER A 1 3  ? -7.614  4.831   -34.115 1.00 0.00 ? 3  SER A OG   6  
ATOM 5510  H H    . SER A 1 3  ? -5.903  6.930   -34.397 1.00 0.00 ? 3  SER A H    6  
ATOM 5511  H HA   . SER A 1 3  ? -8.695  7.248   -34.232 1.00 0.00 ? 3  SER A HA   6  
ATOM 5512  H HB2  . SER A 1 3  ? -6.819  5.684   -32.442 1.00 0.00 ? 3  SER A HB2  6  
ATOM 5513  H HB3  . SER A 1 3  ? -8.575  5.520   -32.452 1.00 0.00 ? 3  SER A HB3  6  
ATOM 5514  H HG   . SER A 1 3  ? -6.835  4.284   -33.996 1.00 0.00 ? 3  SER A HG   6  
ATOM 5515  N N    . GLY A 1 4  ? -6.965  8.437   -31.687 1.00 0.00 ? 4  GLY A N    6  
ATOM 5516  C CA   . GLY A 1 4  ? -7.047  9.344   -30.557 1.00 0.00 ? 4  GLY A CA   6  
ATOM 5517  C C    . GLY A 1 4  ? -6.093  8.967   -29.441 1.00 0.00 ? 4  GLY A C    6  
ATOM 5518  O O    . GLY A 1 4  ? -4.905  8.745   -29.679 1.00 0.00 ? 4  GLY A O    6  
ATOM 5519  H H    . GLY A 1 4  ? -6.107  8.023   -31.920 1.00 0.00 ? 4  GLY A H    6  
ATOM 5520  H HA2  . GLY A 1 4  ? -6.814  10.343  -30.894 1.00 0.00 ? 4  GLY A HA2  6  
ATOM 5521  H HA3  . GLY A 1 4  ? -8.056  9.330   -30.172 1.00 0.00 ? 4  GLY A HA3  6  
ATOM 5522  N N    . SER A 1 5  ? -6.612  8.895   -28.220 1.00 0.00 ? 5  SER A N    6  
ATOM 5523  C CA   . SER A 1 5  ? -5.797  8.548   -27.062 1.00 0.00 ? 5  SER A CA   6  
ATOM 5524  C C    . SER A 1 5  ? -6.007  7.089   -26.667 1.00 0.00 ? 5  SER A C    6  
ATOM 5525  O O    . SER A 1 5  ? -7.075  6.521   -26.894 1.00 0.00 ? 5  SER A O    6  
ATOM 5526  C CB   . SER A 1 5  ? -6.134  9.461   -25.882 1.00 0.00 ? 5  SER A CB   6  
ATOM 5527  O OG   . SER A 1 5  ? -5.525  8.999   -24.689 1.00 0.00 ? 5  SER A OG   6  
ATOM 5528  H H    . SER A 1 5  ? -7.566  9.083   -28.095 1.00 0.00 ? 5  SER A H    6  
ATOM 5529  H HA   . SER A 1 5  ? -4.761  8.690   -27.331 1.00 0.00 ? 5  SER A HA   6  
ATOM 5530  H HB2  . SER A 1 5  ? -5.781  10.459  -26.089 1.00 0.00 ? 5  SER A HB2  6  
ATOM 5531  H HB3  . SER A 1 5  ? -7.206  9.480   -25.740 1.00 0.00 ? 5  SER A HB3  6  
ATOM 5532  H HG   . SER A 1 5  ? -4.648  9.381   -24.609 1.00 0.00 ? 5  SER A HG   6  
ATOM 5533  N N    . SER A 1 6  ? -4.979  6.489   -26.076 1.00 0.00 ? 6  SER A N    6  
ATOM 5534  C CA   . SER A 1 6  ? -5.048  5.095   -25.653 1.00 0.00 ? 6  SER A CA   6  
ATOM 5535  C C    . SER A 1 6  ? -4.068  4.824   -24.514 1.00 0.00 ? 6  SER A C    6  
ATOM 5536  O O    . SER A 1 6  ? -2.856  4.779   -24.721 1.00 0.00 ? 6  SER A O    6  
ATOM 5537  C CB   . SER A 1 6  ? -4.748  4.167   -26.831 1.00 0.00 ? 6  SER A CB   6  
ATOM 5538  O OG   . SER A 1 6  ? -5.767  4.243   -27.812 1.00 0.00 ? 6  SER A OG   6  
ATOM 5539  H H    . SER A 1 6  ? -4.154  6.995   -25.923 1.00 0.00 ? 6  SER A H    6  
ATOM 5540  H HA   . SER A 1 6  ? -6.051  4.904   -25.301 1.00 0.00 ? 6  SER A HA   6  
ATOM 5541  H HB2  . SER A 1 6  ? -3.809  4.452   -27.281 1.00 0.00 ? 6  SER A HB2  6  
ATOM 5542  H HB3  . SER A 1 6  ? -4.682  3.148   -26.476 1.00 0.00 ? 6  SER A HB3  6  
ATOM 5543  H HG   . SER A 1 6  ? -6.226  3.402   -27.863 1.00 0.00 ? 6  SER A HG   6  
ATOM 5544  N N    . GLY A 1 7  ? -4.604  4.643   -23.311 1.00 0.00 ? 7  GLY A N    6  
ATOM 5545  C CA   . GLY A 1 7  ? -3.765  4.378   -22.157 1.00 0.00 ? 7  GLY A CA   6  
ATOM 5546  C C    . GLY A 1 7  ? -2.921  3.130   -22.328 1.00 0.00 ? 7  GLY A C    6  
ATOM 5547  O O    . GLY A 1 7  ? -3.424  2.012   -22.218 1.00 0.00 ? 7  GLY A O    6  
ATOM 5548  H H    . GLY A 1 7  ? -5.578  4.689   -23.206 1.00 0.00 ? 7  GLY A H    6  
ATOM 5549  H HA2  . GLY A 1 7  ? -3.112  5.223   -22.000 1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5550  H HA3  . GLY A 1 7  ? -4.395  4.256   -21.289 1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5551  N N    . ARG A 1 8  ? -1.634  3.321   -22.600 1.00 0.00 ? 8  ARG A N    6  
ATOM 5552  C CA   . ARG A 1 8  ? -0.719  2.202   -22.790 1.00 0.00 ? 8  ARG A CA   6  
ATOM 5553  C C    . ARG A 1 8  ? 0.081   1.932   -21.519 1.00 0.00 ? 8  ARG A C    6  
ATOM 5554  O O    . ARG A 1 8  ? 0.179   0.792   -21.065 1.00 0.00 ? 8  ARG A O    6  
ATOM 5555  C CB   . ARG A 1 8  ? 0.233   2.485   -23.953 1.00 0.00 ? 8  ARG A CB   6  
ATOM 5556  C CG   . ARG A 1 8  ? -0.464  2.582   -25.301 1.00 0.00 ? 8  ARG A CG   6  
ATOM 5557  C CD   . ARG A 1 8  ? 0.526   2.851   -26.422 1.00 0.00 ? 8  ARG A CD   6  
ATOM 5558  N NE   . ARG A 1 8  ? 1.041   4.217   -26.382 1.00 0.00 ? 8  ARG A NE   6  
ATOM 5559  C CZ   . ARG A 1 8  ? 2.085   4.588   -25.648 1.00 0.00 ? 8  ARG A CZ   6  
ATOM 5560  N NH1  . ARG A 1 8  ? 2.721   3.699   -24.897 1.00 0.00 ? 8  ARG A NH1  6  
ATOM 5561  N NH2  . ARG A 1 8  ? 2.494   5.850   -25.664 1.00 0.00 ? 8  ARG A NH2  6  
ATOM 5562  H H    . ARG A 1 8  ? -1.292  4.236   -22.676 1.00 0.00 ? 8  ARG A H    6  
ATOM 5563  H HA   . ARG A 1 8  ? -1.308  1.328   -23.023 1.00 0.00 ? 8  ARG A HA   6  
ATOM 5564  H HB2  . ARG A 1 8  ? 0.741   3.420   -23.768 1.00 0.00 ? 8  ARG A HB2  6  
ATOM 5565  H HB3  . ARG A 1 8  ? 0.963   1.692   -24.006 1.00 0.00 ? 8  ARG A HB3  6  
ATOM 5566  H HG2  . ARG A 1 8  ? -0.973  1.650   -25.500 1.00 0.00 ? 8  ARG A HG2  6  
ATOM 5567  H HG3  . ARG A 1 8  ? -1.183  3.387   -25.266 1.00 0.00 ? 8  ARG A HG3  6  
ATOM 5568  H HD2  . ARG A 1 8  ? 1.353   2.162   -26.328 1.00 0.00 ? 8  ARG A HD2  6  
ATOM 5569  H HD3  . ARG A 1 8  ? 0.031   2.691   -27.368 1.00 0.00 ? 8  ARG A HD3  6  
ATOM 5570  H HE   . ARG A 1 8  ? 0.586   4.890   -26.929 1.00 0.00 ? 8  ARG A HE   6  
ATOM 5571  H HH11 . ARG A 1 8  ? 2.415   2.747   -24.884 1.00 0.00 ? 8  ARG A HH11 6  
ATOM 5572  H HH12 . ARG A 1 8  ? 3.507   3.980   -24.346 1.00 0.00 ? 8  ARG A HH12 6  
ATOM 5573  H HH21 . ARG A 1 8  ? 2.017   6.523   -26.228 1.00 0.00 ? 8  ARG A HH21 6  
ATOM 5574  H HH22 . ARG A 1 8  ? 3.279   6.128   -25.111 1.00 0.00 ? 8  ARG A HH22 6  
ATOM 5575  N N    . SER A 1 9  ? 0.651   2.989   -20.949 1.00 0.00 ? 9  SER A N    6  
ATOM 5576  C CA   . SER A 1 9  ? 1.445   2.866   -19.732 1.00 0.00 ? 9  SER A CA   6  
ATOM 5577  C C    . SER A 1 9  ? 0.773   1.925   -18.737 1.00 0.00 ? 9  SER A C    6  
ATOM 5578  O O    . SER A 1 9  ? 1.385   0.969   -18.259 1.00 0.00 ? 9  SER A O    6  
ATOM 5579  C CB   . SER A 1 9  ? 1.653   4.240   -19.092 1.00 0.00 ? 9  SER A CB   6  
ATOM 5580  O OG   . SER A 1 9  ? 0.412   4.864   -18.812 1.00 0.00 ? 9  SER A OG   6  
ATOM 5581  H H    . SER A 1 9  ? 0.536   3.872   -21.358 1.00 0.00 ? 9  SER A H    6  
ATOM 5582  H HA   . SER A 1 9  ? 2.407   2.456   -20.005 1.00 0.00 ? 9  SER A HA   6  
ATOM 5583  H HB2  . SER A 1 9  ? 2.200   4.125   -18.169 1.00 0.00 ? 9  SER A HB2  6  
ATOM 5584  H HB3  . SER A 1 9  ? 2.214   4.868   -19.768 1.00 0.00 ? 9  SER A HB3  6  
ATOM 5585  H HG   . SER A 1 9  ? -0.075  4.990   -19.630 1.00 0.00 ? 9  SER A HG   6  
ATOM 5586  N N    . SER A 1 10 ? -0.490  2.202   -18.430 1.00 0.00 ? 10 SER A N    6  
ATOM 5587  C CA   . SER A 1 10 ? -1.245  1.383   -17.489 1.00 0.00 ? 10 SER A CA   6  
ATOM 5588  C C    . SER A 1 10 ? -1.870  0.183   -18.194 1.00 0.00 ? 10 SER A C    6  
ATOM 5589  O O    . SER A 1 10 ? -2.962  0.277   -18.753 1.00 0.00 ? 10 SER A O    6  
ATOM 5590  C CB   . SER A 1 10 ? -2.336  2.218   -16.815 1.00 0.00 ? 10 SER A CB   6  
ATOM 5591  O OG   . SER A 1 10 ? -2.882  1.537   -15.699 1.00 0.00 ? 10 SER A OG   6  
ATOM 5592  H H    . SER A 1 10 ? -0.923  2.977   -18.845 1.00 0.00 ? 10 SER A H    6  
ATOM 5593  H HA   . SER A 1 10 ? -0.559  1.026   -16.735 1.00 0.00 ? 10 SER A HA   6  
ATOM 5594  H HB2  . SER A 1 10 ? -1.914  3.153   -16.480 1.00 0.00 ? 10 SER A HB2  6  
ATOM 5595  H HB3  . SER A 1 10 ? -3.126  2.413   -17.526 1.00 0.00 ? 10 SER A HB3  6  
ATOM 5596  H HG   . SER A 1 10 ? -3.819  1.383   -15.845 1.00 0.00 ? 10 SER A HG   6  
ATOM 5597  N N    . ARG A 1 11 ? -1.168  -0.946  -18.161 1.00 0.00 ? 11 ARG A N    6  
ATOM 5598  C CA   . ARG A 1 11 ? -1.652  -2.165  -18.797 1.00 0.00 ? 11 ARG A CA   6  
ATOM 5599  C C    . ARG A 1 11 ? -2.635  -2.898  -17.889 1.00 0.00 ? 11 ARG A C    6  
ATOM 5600  O O    . ARG A 1 11 ? -3.777  -3.158  -18.272 1.00 0.00 ? 11 ARG A O    6  
ATOM 5601  C CB   . ARG A 1 11 ? -0.480  -3.084  -19.146 1.00 0.00 ? 11 ARG A CB   6  
ATOM 5602  C CG   . ARG A 1 11 ? -0.889  -4.328  -19.916 1.00 0.00 ? 11 ARG A CG   6  
ATOM 5603  C CD   . ARG A 1 11 ? -0.881  -4.082  -21.417 1.00 0.00 ? 11 ARG A CD   6  
ATOM 5604  N NE   . ARG A 1 11 ? -0.703  -5.319  -22.174 1.00 0.00 ? 11 ARG A NE   6  
ATOM 5605  C CZ   . ARG A 1 11 ? -1.699  -6.145  -22.475 1.00 0.00 ? 11 ARG A CZ   6  
ATOM 5606  N NH1  . ARG A 1 11 ? -2.936  -5.867  -22.087 1.00 0.00 ? 11 ARG A NH1  6  
ATOM 5607  N NH2  . ARG A 1 11 ? -1.458  -7.251  -23.167 1.00 0.00 ? 11 ARG A NH2  6  
ATOM 5608  H H    . ARG A 1 11 ? -0.304  -0.958  -17.700 1.00 0.00 ? 11 ARG A H    6  
ATOM 5609  H HA   . ARG A 1 11 ? -2.161  -1.885  -19.707 1.00 0.00 ? 11 ARG A HA   6  
ATOM 5610  H HB2  . ARG A 1 11 ? 0.229   -2.533  -19.746 1.00 0.00 ? 11 ARG A HB2  6  
ATOM 5611  H HB3  . ARG A 1 11 ? 0.001   -3.396  -18.231 1.00 0.00 ? 11 ARG A HB3  6  
ATOM 5612  H HG2  . ARG A 1 11 ? -0.197  -5.125  -19.690 1.00 0.00 ? 11 ARG A HG2  6  
ATOM 5613  H HG3  . ARG A 1 11 ? -1.885  -4.617  -19.613 1.00 0.00 ? 11 ARG A HG3  6  
ATOM 5614  H HD2  . ARG A 1 11 ? -1.820  -3.630  -21.700 1.00 0.00 ? 11 ARG A HD2  6  
ATOM 5615  H HD3  . ARG A 1 11 ? -0.072  -3.407  -21.653 1.00 0.00 ? 11 ARG A HD3  6  
ATOM 5616  H HE   . ARG A 1 11 ? 0.203   -5.543  -22.470 1.00 0.00 ? 11 ARG A HE   6  
ATOM 5617  H HH11 . ARG A 1 11 ? -3.121  -5.034  -21.567 1.00 0.00 ? 11 ARG A HH11 6  
ATOM 5618  H HH12 . ARG A 1 11 ? -3.684  -6.490  -22.317 1.00 0.00 ? 11 ARG A HH12 6  
ATOM 5619  H HH21 . ARG A 1 11 ? -0.527  -7.463  -23.462 1.00 0.00 ? 11 ARG A HH21 6  
ATOM 5620  H HH22 . ARG A 1 11 ? -2.208  -7.872  -23.394 1.00 0.00 ? 11 ARG A HH22 6  
ATOM 5621  N N    . THR A 1 12 ? -2.184  -3.231  -16.684 1.00 0.00 ? 12 THR A N    6  
ATOM 5622  C CA   . THR A 1 12 ? -3.022  -3.936  -15.722 1.00 0.00 ? 12 THR A CA   6  
ATOM 5623  C C    . THR A 1 12 ? -3.359  -3.046  -14.531 1.00 0.00 ? 12 THR A C    6  
ATOM 5624  O O    . THR A 1 12 ? -2.481  -2.681  -13.749 1.00 0.00 ? 12 THR A O    6  
ATOM 5625  C CB   . THR A 1 12 ? -2.336  -5.218  -15.213 1.00 0.00 ? 12 THR A CB   6  
ATOM 5626  O OG1  . THR A 1 12 ? -1.880  -6.002  -16.320 1.00 0.00 ? 12 THR A OG1  6  
ATOM 5627  C CG2  . THR A 1 12 ? -3.291  -6.040  -14.361 1.00 0.00 ? 12 THR A CG2  6  
ATOM 5628  H H    . THR A 1 12 ? -1.265  -2.997  -16.437 1.00 0.00 ? 12 THR A H    6  
ATOM 5629  H HA   . THR A 1 12 ? -3.938  -4.217  -16.221 1.00 0.00 ? 12 THR A HA   6  
ATOM 5630  H HB   . THR A 1 12 ? -1.487  -4.937  -14.606 1.00 0.00 ? 12 THR A HB   6  
ATOM 5631  H HG1  . THR A 1 12 ? -1.558  -5.421  -17.013 1.00 0.00 ? 12 THR A HG1  6  
ATOM 5632  H HG21 . THR A 1 12 ? -2.726  -6.730  -13.751 1.00 0.00 ? 12 THR A HG21 6  
ATOM 5633  H HG22 . THR A 1 12 ? -3.961  -6.593  -15.003 1.00 0.00 ? 12 THR A HG22 6  
ATOM 5634  H HG23 . THR A 1 12 ? -3.863  -5.382  -13.725 1.00 0.00 ? 12 THR A HG23 6  
ATOM 5635  N N    . ARG A 1 13 ? -4.636  -2.702  -14.399 1.00 0.00 ? 13 ARG A N    6  
ATOM 5636  C CA   . ARG A 1 13 ? -5.089  -1.854  -13.302 1.00 0.00 ? 13 ARG A CA   6  
ATOM 5637  C C    . ARG A 1 13 ? -5.606  -2.697  -12.141 1.00 0.00 ? 13 ARG A C    6  
ATOM 5638  O O    . ARG A 1 13 ? -6.249  -3.727  -12.346 1.00 0.00 ? 13 ARG A O    6  
ATOM 5639  C CB   . ARG A 1 13 ? -6.186  -0.903  -13.784 1.00 0.00 ? 13 ARG A CB   6  
ATOM 5640  C CG   . ARG A 1 13 ? -7.509  -1.594  -14.069 1.00 0.00 ? 13 ARG A CG   6  
ATOM 5641  C CD   . ARG A 1 13 ? -8.671  -0.614  -14.023 1.00 0.00 ? 13 ARG A CD   6  
ATOM 5642  N NE   . ARG A 1 13 ? -8.900  0.025   -15.316 1.00 0.00 ? 13 ARG A NE   6  
ATOM 5643  C CZ   . ARG A 1 13 ? -9.499  1.201   -15.459 1.00 0.00 ? 13 ARG A CZ   6  
ATOM 5644  N NH1  . ARG A 1 13 ? -9.928  1.864   -14.394 1.00 0.00 ? 13 ARG A NH1  6  
ATOM 5645  N NH2  . ARG A 1 13 ? -9.671  1.717   -16.670 1.00 0.00 ? 13 ARG A NH2  6  
ATOM 5646  H H    . ARG A 1 13 ? -5.289  -3.024  -15.054 1.00 0.00 ? 13 ARG A H    6  
ATOM 5647  H HA   . ARG A 1 13 ? -4.245  -1.273  -12.962 1.00 0.00 ? 13 ARG A HA   6  
ATOM 5648  H HB2  . ARG A 1 13 ? -6.353  -0.151  -13.027 1.00 0.00 ? 13 ARG A HB2  6  
ATOM 5649  H HB3  . ARG A 1 13 ? -5.854  -0.421  -14.692 1.00 0.00 ? 13 ARG A HB3  6  
ATOM 5650  H HG2  . ARG A 1 13 ? -7.468  -2.040  -15.052 1.00 0.00 ? 13 ARG A HG2  6  
ATOM 5651  H HG3  . ARG A 1 13 ? -7.669  -2.364  -13.328 1.00 0.00 ? 13 ARG A HG3  6  
ATOM 5652  H HD2  . ARG A 1 13 ? -9.564  -1.148  -13.733 1.00 0.00 ? 13 ARG A HD2  6  
ATOM 5653  H HD3  . ARG A 1 13 ? -8.453  0.148   -13.289 1.00 0.00 ? 13 ARG A HD3  6  
ATOM 5654  H HE   . ARG A 1 13 ? -8.591  -0.448  -16.117 1.00 0.00 ? 13 ARG A HE   6  
ATOM 5655  H HH11 . ARG A 1 13 ? -9.799  1.478   -13.481 1.00 0.00 ? 13 ARG A HH11 6  
ATOM 5656  H HH12 . ARG A 1 13 ? -10.378 2.751   -14.504 1.00 0.00 ? 13 ARG A HH12 6  
ATOM 5657  H HH21 . ARG A 1 13 ? -9.349  1.220   -17.475 1.00 0.00 ? 13 ARG A HH21 6  
ATOM 5658  H HH22 . ARG A 1 13 ? -10.123 2.602   -16.776 1.00 0.00 ? 13 ARG A HH22 6  
ATOM 5659  N N    . PHE A 1 14 ? -5.320  -2.254  -10.921 1.00 0.00 ? 14 PHE A N    6  
ATOM 5660  C CA   . PHE A 1 14 ? -5.755  -2.969  -9.727  1.00 0.00 ? 14 PHE A CA   6  
ATOM 5661  C C    . PHE A 1 14 ? -6.893  -2.225  -9.032  1.00 0.00 ? 14 PHE A C    6  
ATOM 5662  O O    . PHE A 1 14 ? -7.122  -1.042  -9.284  1.00 0.00 ? 14 PHE A O    6  
ATOM 5663  C CB   . PHE A 1 14 ? -4.583  -3.149  -8.760  1.00 0.00 ? 14 PHE A CB   6  
ATOM 5664  C CG   . PHE A 1 14 ? -3.299  -3.531  -9.439  1.00 0.00 ? 14 PHE A CG   6  
ATOM 5665  C CD1  . PHE A 1 14 ? -2.499  -2.567  -10.030 1.00 0.00 ? 14 PHE A CD1  6  
ATOM 5666  C CD2  . PHE A 1 14 ? -2.893  -4.855  -9.487  1.00 0.00 ? 14 PHE A CD2  6  
ATOM 5667  C CE1  . PHE A 1 14 ? -1.317  -2.915  -10.655 1.00 0.00 ? 14 PHE A CE1  6  
ATOM 5668  C CE2  . PHE A 1 14 ? -1.711  -5.209  -10.110 1.00 0.00 ? 14 PHE A CE2  6  
ATOM 5669  C CZ   . PHE A 1 14 ? -0.923  -4.238  -10.696 1.00 0.00 ? 14 PHE A CZ   6  
ATOM 5670  H H    . PHE A 1 14 ? -4.804  -1.427  -10.822 1.00 0.00 ? 14 PHE A H    6  
ATOM 5671  H HA   . PHE A 1 14 ? -6.111  -3.940  -10.034 1.00 0.00 ? 14 PHE A HA   6  
ATOM 5672  H HB2  . PHE A 1 14 ? -4.416  -2.223  -8.231  1.00 0.00 ? 14 PHE A HB2  6  
ATOM 5673  H HB3  . PHE A 1 14 ? -4.828  -3.925  -8.050  1.00 0.00 ? 14 PHE A HB3  6  
ATOM 5674  H HD1  . PHE A 1 14 ? -2.807  -1.531  -9.998  1.00 0.00 ? 14 PHE A HD1  6  
ATOM 5675  H HD2  . PHE A 1 14 ? -3.508  -5.616  -9.030  1.00 0.00 ? 14 PHE A HD2  6  
ATOM 5676  H HE1  . PHE A 1 14 ? -0.703  -2.153  -11.112 1.00 0.00 ? 14 PHE A HE1  6  
ATOM 5677  H HE2  . PHE A 1 14 ? -1.405  -6.244  -10.142 1.00 0.00 ? 14 PHE A HE2  6  
ATOM 5678  H HZ   . PHE A 1 14 ? 0.001   -4.512  -11.184 1.00 0.00 ? 14 PHE A HZ   6  
ATOM 5679  N N    . THR A 1 15 ? -7.603  -2.928  -8.156  1.00 0.00 ? 15 THR A N    6  
ATOM 5680  C CA   . THR A 1 15 ? -8.717  -2.337  -7.426  1.00 0.00 ? 15 THR A CA   6  
ATOM 5681  C C    . THR A 1 15 ? -8.386  -2.184  -5.946  1.00 0.00 ? 15 THR A C    6  
ATOM 5682  O O    . THR A 1 15 ? -7.563  -2.924  -5.404  1.00 0.00 ? 15 THR A O    6  
ATOM 5683  C CB   . THR A 1 15 ? -9.996  -3.185  -7.568  1.00 0.00 ? 15 THR A CB   6  
ATOM 5684  O OG1  . THR A 1 15 ? -11.082 -2.554  -6.881  1.00 0.00 ? 15 THR A OG1  6  
ATOM 5685  C CG2  . THR A 1 15 ? -9.782  -4.585  -7.012  1.00 0.00 ? 15 THR A CG2  6  
ATOM 5686  H H    . THR A 1 15 ? -7.372  -3.868  -7.998  1.00 0.00 ? 15 THR A H    6  
ATOM 5687  H HA   . THR A 1 15 ? -8.910  -1.360  -7.844  1.00 0.00 ? 15 THR A HA   6  
ATOM 5688  H HB   . THR A 1 15 ? -10.241 -3.265  -8.618  1.00 0.00 ? 15 THR A HB   6  
ATOM 5689  H HG1  . THR A 1 15 ? -10.945 -2.624  -5.933  1.00 0.00 ? 15 THR A HG1  6  
ATOM 5690  H HG21 . THR A 1 15 ? -10.583 -4.827  -6.329  1.00 0.00 ? 15 THR A HG21 6  
ATOM 5691  H HG22 . THR A 1 15 ? -8.838  -4.623  -6.488  1.00 0.00 ? 15 THR A HG22 6  
ATOM 5692  H HG23 . THR A 1 15 ? -9.773  -5.297  -7.823  1.00 0.00 ? 15 THR A HG23 6  
ATOM 5693  N N    . ASP A 1 16 ? -9.030  -1.222  -5.296  1.00 0.00 ? 16 ASP A N    6  
ATOM 5694  C CA   . ASP A 1 16 ? -8.805  -0.973  -3.877  1.00 0.00 ? 16 ASP A CA   6  
ATOM 5695  C C    . ASP A 1 16 ? -8.534  -2.277  -3.133  1.00 0.00 ? 16 ASP A C    6  
ATOM 5696  O O    . ASP A 1 16 ? -7.623  -2.356  -2.309  1.00 0.00 ? 16 ASP A O    6  
ATOM 5697  C CB   . ASP A 1 16 ? -10.012 -0.262  -3.264  1.00 0.00 ? 16 ASP A CB   6  
ATOM 5698  C CG   . ASP A 1 16 ? -10.351 1.029   -3.983  1.00 0.00 ? 16 ASP A CG   6  
ATOM 5699  O OD1  . ASP A 1 16 ? -10.488 0.998   -5.224  1.00 0.00 ? 16 ASP A OD1  6  
ATOM 5700  O OD2  . ASP A 1 16 ? -10.479 2.070   -3.305  1.00 0.00 ? 16 ASP A OD2  6  
ATOM 5701  H H    . ASP A 1 16 ? -9.674  -0.665  -5.783  1.00 0.00 ? 16 ASP A H    6  
ATOM 5702  H HA   . ASP A 1 16 ? -7.939  -0.335  -3.786  1.00 0.00 ? 16 ASP A HA   6  
ATOM 5703  H HB2  . ASP A 1 16 ? -10.870 -0.916  -3.314  1.00 0.00 ? 16 ASP A HB2  6  
ATOM 5704  H HB3  . ASP A 1 16 ? -9.800  -0.032  -2.230  1.00 0.00 ? 16 ASP A HB3  6  
ATOM 5705  N N    . TYR A 1 17 ? -9.333  -3.297  -3.428  1.00 0.00 ? 17 TYR A N    6  
ATOM 5706  C CA   . TYR A 1 17 ? -9.182  -4.596  -2.785  1.00 0.00 ? 17 TYR A CA   6  
ATOM 5707  C C    . TYR A 1 17 ? -7.761  -5.126  -2.954  1.00 0.00 ? 17 TYR A C    6  
ATOM 5708  O O    . TYR A 1 17 ? -7.142  -5.589  -1.996  1.00 0.00 ? 17 TYR A O    6  
ATOM 5709  C CB   . TYR A 1 17 ? -10.183 -5.596  -3.366  1.00 0.00 ? 17 TYR A CB   6  
ATOM 5710  C CG   . TYR A 1 17 ? -9.743  -7.037  -3.241  1.00 0.00 ? 17 TYR A CG   6  
ATOM 5711  C CD1  . TYR A 1 17 ? -9.179  -7.511  -2.063  1.00 0.00 ? 17 TYR A CD1  6  
ATOM 5712  C CD2  . TYR A 1 17 ? -9.889  -7.923  -4.300  1.00 0.00 ? 17 TYR A CD2  6  
ATOM 5713  C CE1  . TYR A 1 17 ? -8.774  -8.827  -1.944  1.00 0.00 ? 17 TYR A CE1  6  
ATOM 5714  C CE2  . TYR A 1 17 ? -9.489  -9.241  -4.190  1.00 0.00 ? 17 TYR A CE2  6  
ATOM 5715  C CZ   . TYR A 1 17 ? -8.932  -9.688  -3.010  1.00 0.00 ? 17 TYR A CZ   6  
ATOM 5716  O OH   . TYR A 1 17 ? -8.530  -10.999 -2.897  1.00 0.00 ? 17 TYR A OH   6  
ATOM 5717  H H    . TYR A 1 17 ? -10.041 -3.172  -4.094  1.00 0.00 ? 17 TYR A H    6  
ATOM 5718  H HA   . TYR A 1 17 ? -9.384  -4.470  -1.731  1.00 0.00 ? 17 TYR A HA   6  
ATOM 5719  H HB2  . TYR A 1 17 ? -11.126 -5.492  -2.851  1.00 0.00 ? 17 TYR A HB2  6  
ATOM 5720  H HB3  . TYR A 1 17 ? -10.327 -5.382  -4.415  1.00 0.00 ? 17 TYR A HB3  6  
ATOM 5721  H HD1  . TYR A 1 17 ? -9.057  -6.835  -1.229  1.00 0.00 ? 17 TYR A HD1  6  
ATOM 5722  H HD2  . TYR A 1 17 ? -10.325 -7.570  -5.224  1.00 0.00 ? 17 TYR A HD2  6  
ATOM 5723  H HE1  . TYR A 1 17 ? -8.338  -9.177  -1.020  1.00 0.00 ? 17 TYR A HE1  6  
ATOM 5724  H HE2  . TYR A 1 17 ? -9.611  -9.915  -5.025  1.00 0.00 ? 17 TYR A HE2  6  
ATOM 5725  H HH   . TYR A 1 17 ? -8.821  -11.491 -3.668  1.00 0.00 ? 17 TYR A HH   6  
ATOM 5726  N N    . GLN A 1 18 ? -7.251  -5.054  -4.179  1.00 0.00 ? 18 GLN A N    6  
ATOM 5727  C CA   . GLN A 1 18 ? -5.904  -5.526  -4.474  1.00 0.00 ? 18 GLN A CA   6  
ATOM 5728  C C    . GLN A 1 18 ? -4.858  -4.533  -3.978  1.00 0.00 ? 18 GLN A C    6  
ATOM 5729  O O    . GLN A 1 18 ? -3.903  -4.909  -3.297  1.00 0.00 ? 18 GLN A O    6  
ATOM 5730  C CB   . GLN A 1 18 ? -5.738  -5.752  -5.978  1.00 0.00 ? 18 GLN A CB   6  
ATOM 5731  C CG   . GLN A 1 18 ? -6.746  -6.728  -6.562  1.00 0.00 ? 18 GLN A CG   6  
ATOM 5732  C CD   . GLN A 1 18 ? -6.202  -7.484  -7.758  1.00 0.00 ? 18 GLN A CD   6  
ATOM 5733  O OE1  . GLN A 1 18 ? -5.689  -6.886  -8.704  1.00 0.00 ? 18 GLN A OE1  6  
ATOM 5734  N NE2  . GLN A 1 18 ? -6.311  -8.807  -7.721  1.00 0.00 ? 18 GLN A NE2  6  
ATOM 5735  H H    . GLN A 1 18 ? -7.794  -4.675  -4.901  1.00 0.00 ? 18 GLN A H    6  
ATOM 5736  H HA   . GLN A 1 18 ? -5.762  -6.465  -3.961  1.00 0.00 ? 18 GLN A HA   6  
ATOM 5737  H HB2  . GLN A 1 18 ? -5.848  -4.806  -6.486  1.00 0.00 ? 18 GLN A HB2  6  
ATOM 5738  H HB3  . GLN A 1 18 ? -4.746  -6.138  -6.165  1.00 0.00 ? 18 GLN A HB3  6  
ATOM 5739  H HG2  . GLN A 1 18 ? -7.021  -7.441  -5.799  1.00 0.00 ? 18 GLN A HG2  6  
ATOM 5740  H HG3  . GLN A 1 18 ? -7.623  -6.177  -6.871  1.00 0.00 ? 18 GLN A HG3  6  
ATOM 5741  H HE21 . GLN A 1 18 ? -6.732  -9.215  -6.935  1.00 0.00 ? 18 GLN A HE21 6  
ATOM 5742  H HE22 . GLN A 1 18 ? -5.968  -9.321  -8.481  1.00 0.00 ? 18 GLN A HE22 6  
ATOM 5743  N N    . LEU A 1 19 ? -5.044  -3.264  -4.324  1.00 0.00 ? 19 LEU A N    6  
ATOM 5744  C CA   . LEU A 1 19 ? -4.116  -2.216  -3.915  1.00 0.00 ? 19 LEU A CA   6  
ATOM 5745  C C    . LEU A 1 19 ? -3.962  -2.188  -2.398  1.00 0.00 ? 19 LEU A C    6  
ATOM 5746  O O    . LEU A 1 19 ? -2.901  -1.838  -1.878  1.00 0.00 ? 19 LEU A O    6  
ATOM 5747  C CB   . LEU A 1 19 ? -4.601  -0.854  -4.415  1.00 0.00 ? 19 LEU A CB   6  
ATOM 5748  C CG   . LEU A 1 19 ? -4.475  -0.607  -5.918  1.00 0.00 ? 19 LEU A CG   6  
ATOM 5749  C CD1  . LEU A 1 19 ? -5.241  0.644   -6.320  1.00 0.00 ? 19 LEU A CD1  6  
ATOM 5750  C CD2  . LEU A 1 19 ? -3.012  -0.490  -6.319  1.00 0.00 ? 19 LEU A CD2  6  
ATOM 5751  H H    . LEU A 1 19 ? -5.823  -3.026  -4.868  1.00 0.00 ? 19 LEU A H    6  
ATOM 5752  H HA   . LEU A 1 19 ? -3.155  -2.431  -4.358  1.00 0.00 ? 19 LEU A HA   6  
ATOM 5753  H HB2  . LEU A 1 19 ? -5.643  -0.757  -4.150  1.00 0.00 ? 19 LEU A HB2  6  
ATOM 5754  H HB3  . LEU A 1 19 ? -4.029  -0.092  -3.904  1.00 0.00 ? 19 LEU A HB3  6  
ATOM 5755  H HG   . LEU A 1 19 ? -4.903  -1.445  -6.451  1.00 0.00 ? 19 LEU A HG   6  
ATOM 5756  H HD11 . LEU A 1 19 ? -5.561  0.556   -7.348  1.00 0.00 ? 19 LEU A HD11 6  
ATOM 5757  H HD12 . LEU A 1 19 ? -4.601  1.507   -6.215  1.00 0.00 ? 19 LEU A HD12 6  
ATOM 5758  H HD13 . LEU A 1 19 ? -6.106  0.757   -5.682  1.00 0.00 ? 19 LEU A HD13 6  
ATOM 5759  H HD21 . LEU A 1 19 ? -2.670  0.519   -6.141  1.00 0.00 ? 19 LEU A HD21 6  
ATOM 5760  H HD22 . LEU A 1 19 ? -2.906  -0.727  -7.368  1.00 0.00 ? 19 LEU A HD22 6  
ATOM 5761  H HD23 . LEU A 1 19 ? -2.422  -1.179  -5.732  1.00 0.00 ? 19 LEU A HD23 6  
ATOM 5762  N N    . ARG A 1 20 ? -5.025  -2.559  -1.693  1.00 0.00 ? 20 ARG A N    6  
ATOM 5763  C CA   . ARG A 1 20 ? -5.007  -2.578  -0.235  1.00 0.00 ? 20 ARG A CA   6  
ATOM 5764  C C    . ARG A 1 20 ? -3.990  -3.590  0.284   1.00 0.00 ? 20 ARG A C    6  
ATOM 5765  O O    . ARG A 1 20 ? -3.194  -3.287  1.172   1.00 0.00 ? 20 ARG A O    6  
ATOM 5766  C CB   . ARG A 1 20 ? -6.398  -2.911  0.309   1.00 0.00 ? 20 ARG A CB   6  
ATOM 5767  C CG   . ARG A 1 20 ? -6.506  -2.787  1.820   1.00 0.00 ? 20 ARG A CG   6  
ATOM 5768  C CD   . ARG A 1 20 ? -6.445  -1.335  2.266   1.00 0.00 ? 20 ARG A CD   6  
ATOM 5769  N NE   . ARG A 1 20 ? -7.749  -0.683  2.188   1.00 0.00 ? 20 ARG A NE   6  
ATOM 5770  C CZ   . ARG A 1 20 ? -8.670  -0.765  3.142   1.00 0.00 ? 20 ARG A CZ   6  
ATOM 5771  N NH1  . ARG A 1 20 ? -8.430  -1.468  4.241   1.00 0.00 ? 20 ARG A NH1  6  
ATOM 5772  N NH2  . ARG A 1 20 ? -9.834  -0.144  2.999   1.00 0.00 ? 20 ARG A NH2  6  
ATOM 5773  H H    . ARG A 1 20 ? -5.842  -2.827  -2.164  1.00 0.00 ? 20 ARG A H    6  
ATOM 5774  H HA   . ARG A 1 20 ? -4.723  -1.593  0.106   1.00 0.00 ? 20 ARG A HA   6  
ATOM 5775  H HB2  . ARG A 1 20 ? -7.117  -2.239  -0.137  1.00 0.00 ? 20 ARG A HB2  6  
ATOM 5776  H HB3  . ARG A 1 20 ? -6.645  -3.925  0.034   1.00 0.00 ? 20 ARG A HB3  6  
ATOM 5777  H HG2  . ARG A 1 20 ? -7.447  -3.211  2.140   1.00 0.00 ? 20 ARG A HG2  6  
ATOM 5778  H HG3  . ARG A 1 20 ? -5.691  -3.329  2.276   1.00 0.00 ? 20 ARG A HG3  6  
ATOM 5779  H HD2  . ARG A 1 20 ? -6.096  -1.300  3.287   1.00 0.00 ? 20 ARG A HD2  6  
ATOM 5780  H HD3  . ARG A 1 20 ? -5.750  -0.806  1.630   1.00 0.00 ? 20 ARG A HD3  6  
ATOM 5781  H HE   . ARG A 1 20 ? -7.948  -0.158  1.385   1.00 0.00 ? 20 ARG A HE   6  
ATOM 5782  H HH11 . ARG A 1 20 ? -7.554  -1.937  4.352   1.00 0.00 ? 20 ARG A HH11 6  
ATOM 5783  H HH12 . ARG A 1 20 ? -9.125  -1.528  4.958   1.00 0.00 ? 20 ARG A HH12 6  
ATOM 5784  H HH21 . ARG A 1 20 ? -10.018 0.387   2.172   1.00 0.00 ? 20 ARG A HH21 6  
ATOM 5785  H HH22 . ARG A 1 20 ? -10.526 -0.207  3.717   1.00 0.00 ? 20 ARG A HH22 6  
ATOM 5786  N N    . VAL A 1 21 ? -4.024  -4.795  -0.277  1.00 0.00 ? 21 VAL A N    6  
ATOM 5787  C CA   . VAL A 1 21 ? -3.106  -5.853  0.128   1.00 0.00 ? 21 VAL A CA   6  
ATOM 5788  C C    . VAL A 1 21 ? -1.690  -5.568  -0.360  1.00 0.00 ? 21 VAL A C    6  
ATOM 5789  O O    . VAL A 1 21 ? -0.716  -5.797  0.358   1.00 0.00 ? 21 VAL A O    6  
ATOM 5790  C CB   . VAL A 1 21 ? -3.556  -7.224  -0.410  1.00 0.00 ? 21 VAL A CB   6  
ATOM 5791  C CG1  . VAL A 1 21 ? -2.580  -8.311  0.013   1.00 0.00 ? 21 VAL A CG1  6  
ATOM 5792  C CG2  . VAL A 1 21 ? -4.965  -7.546  0.067   1.00 0.00 ? 21 VAL A CG2  6  
ATOM 5793  H H    . VAL A 1 21 ? -4.682  -4.977  -0.980  1.00 0.00 ? 21 VAL A H    6  
ATOM 5794  H HA   . VAL A 1 21 ? -3.102  -5.897  1.208   1.00 0.00 ? 21 VAL A HA   6  
ATOM 5795  H HB   . VAL A 1 21 ? -3.566  -7.179  -1.489  1.00 0.00 ? 21 VAL A HB   6  
ATOM 5796  H HG11 . VAL A 1 21 ? -1.710  -7.857  0.465   1.00 0.00 ? 21 VAL A HG11 6  
ATOM 5797  H HG12 . VAL A 1 21 ? -3.057  -8.966  0.727   1.00 0.00 ? 21 VAL A HG12 6  
ATOM 5798  H HG13 . VAL A 1 21 ? -2.278  -8.881  -0.853  1.00 0.00 ? 21 VAL A HG13 6  
ATOM 5799  H HG21 . VAL A 1 21 ? -5.621  -6.722  -0.169  1.00 0.00 ? 21 VAL A HG21 6  
ATOM 5800  H HG22 . VAL A 1 21 ? -5.317  -8.440  -0.428  1.00 0.00 ? 21 VAL A HG22 6  
ATOM 5801  H HG23 . VAL A 1 21 ? -4.956  -7.706  1.135   1.00 0.00 ? 21 VAL A HG23 6  
ATOM 5802  N N    . LEU A 1 22 ? -1.583  -5.067  -1.586  1.00 0.00 ? 22 LEU A N    6  
ATOM 5803  C CA   . LEU A 1 22 ? -0.285  -4.749  -2.171  1.00 0.00 ? 22 LEU A CA   6  
ATOM 5804  C C    . LEU A 1 22 ? 0.375   -3.588  -1.436  1.00 0.00 ? 22 LEU A C    6  
ATOM 5805  O O    . LEU A 1 22 ? 1.577   -3.610  -1.173  1.00 0.00 ? 22 LEU A O    6  
ATOM 5806  C CB   . LEU A 1 22 ? -0.443  -4.405  -3.654  1.00 0.00 ? 22 LEU A CB   6  
ATOM 5807  C CG   . LEU A 1 22 ? -0.912  -5.544  -4.560  1.00 0.00 ? 22 LEU A CG   6  
ATOM 5808  C CD1  . LEU A 1 22 ? -1.361  -5.002  -5.908  1.00 0.00 ? 22 LEU A CD1  6  
ATOM 5809  C CD2  . LEU A 1 22 ? 0.195   -6.573  -4.740  1.00 0.00 ? 22 LEU A CD2  6  
ATOM 5810  H H    . LEU A 1 22 ? -2.394  -4.906  -2.110  1.00 0.00 ? 22 LEU A H    6  
ATOM 5811  H HA   . LEU A 1 22 ? 0.343   -5.622  -2.078  1.00 0.00 ? 22 LEU A HA   6  
ATOM 5812  H HB2  . LEU A 1 22 ? -1.160  -3.603  -3.732  1.00 0.00 ? 22 LEU A HB2  6  
ATOM 5813  H HB3  . LEU A 1 22 ? 0.517   -4.065  -4.017  1.00 0.00 ? 22 LEU A HB3  6  
ATOM 5814  H HG   . LEU A 1 22 ? -1.757  -6.037  -4.101  1.00 0.00 ? 22 LEU A HG   6  
ATOM 5815  H HD11 . LEU A 1 22 ? -0.666  -4.247  -6.243  1.00 0.00 ? 22 LEU A HD11 6  
ATOM 5816  H HD12 . LEU A 1 22 ? -2.345  -4.566  -5.811  1.00 0.00 ? 22 LEU A HD12 6  
ATOM 5817  H HD13 . LEU A 1 22 ? -1.394  -5.807  -6.627  1.00 0.00 ? 22 LEU A HD13 6  
ATOM 5818  H HD21 . LEU A 1 22 ? -0.193  -7.428  -5.274  1.00 0.00 ? 22 LEU A HD21 6  
ATOM 5819  H HD22 . LEU A 1 22 ? 0.554   -6.887  -3.771  1.00 0.00 ? 22 LEU A HD22 6  
ATOM 5820  H HD23 . LEU A 1 22 ? 1.007   -6.135  -5.301  1.00 0.00 ? 22 LEU A HD23 6  
ATOM 5821  N N    . GLN A 1 23 ? -0.420  -2.576  -1.104  1.00 0.00 ? 23 GLN A N    6  
ATOM 5822  C CA   . GLN A 1 23 ? 0.087   -1.406  -0.397  1.00 0.00 ? 23 GLN A CA   6  
ATOM 5823  C C    . GLN A 1 23 ? 0.352   -1.729  1.070   1.00 0.00 ? 23 GLN A C    6  
ATOM 5824  O O    . GLN A 1 23 ? 1.340   -1.274  1.647   1.00 0.00 ? 23 GLN A O    6  
ATOM 5825  C CB   . GLN A 1 23 ? -0.906  -0.247  -0.505  1.00 0.00 ? 23 GLN A CB   6  
ATOM 5826  C CG   . GLN A 1 23 ? -0.263  1.122   -0.353  1.00 0.00 ? 23 GLN A CG   6  
ATOM 5827  C CD   . GLN A 1 23 ? 0.980   1.281   -1.206  1.00 0.00 ? 23 GLN A CD   6  
ATOM 5828  O OE1  . GLN A 1 23 ? 0.908   1.734   -2.349  1.00 0.00 ? 23 GLN A OE1  6  
ATOM 5829  N NE2  . GLN A 1 23 ? 2.129   0.908   -0.655  1.00 0.00 ? 23 GLN A NE2  6  
ATOM 5830  H H    . GLN A 1 23 ? -1.370  -2.616  -1.341  1.00 0.00 ? 23 GLN A H    6  
ATOM 5831  H HA   . GLN A 1 23 ? 1.017   -1.115  -0.862  1.00 0.00 ? 23 GLN A HA   6  
ATOM 5832  H HB2  . GLN A 1 23 ? -1.387  -0.290  -1.471  1.00 0.00 ? 23 GLN A HB2  6  
ATOM 5833  H HB3  . GLN A 1 23 ? -1.654  -0.357  0.266   1.00 0.00 ? 23 GLN A HB3  6  
ATOM 5834  H HG2  . GLN A 1 23 ? -0.979  1.876   -0.643  1.00 0.00 ? 23 GLN A HG2  6  
ATOM 5835  H HG3  . GLN A 1 23 ? 0.008   1.264   0.683   1.00 0.00 ? 23 GLN A HG3  6  
ATOM 5836  H HE21 . GLN A 1 23 ? 2.109   0.554   0.260   1.00 0.00 ? 23 GLN A HE21 6  
ATOM 5837  H HE22 . GLN A 1 23 ? 2.947   0.999   -1.184  1.00 0.00 ? 23 GLN A HE22 6  
ATOM 5838  N N    . ASP A 1 24 ? -0.537  -2.515  1.667   1.00 0.00 ? 24 ASP A N    6  
ATOM 5839  C CA   . ASP A 1 24 ? -0.399  -2.900  3.067   1.00 0.00 ? 24 ASP A CA   6  
ATOM 5840  C C    . ASP A 1 24 ? 0.879   -3.705  3.286   1.00 0.00 ? 24 ASP A C    6  
ATOM 5841  O O    . ASP A 1 24 ? 1.596   -3.496  4.265   1.00 0.00 ? 24 ASP A O    6  
ATOM 5842  C CB   . ASP A 1 24 ? -1.613  -3.715  3.516   1.00 0.00 ? 24 ASP A CB   6  
ATOM 5843  C CG   . ASP A 1 24 ? -1.512  -4.154  4.963   1.00 0.00 ? 24 ASP A CG   6  
ATOM 5844  O OD1  . ASP A 1 24 ? -0.974  -3.380  5.783   1.00 0.00 ? 24 ASP A OD1  6  
ATOM 5845  O OD2  . ASP A 1 24 ? -1.971  -5.272  5.277   1.00 0.00 ? 24 ASP A OD2  6  
ATOM 5846  H H    . ASP A 1 24 ? -1.304  -2.846  1.153   1.00 0.00 ? 24 ASP A H    6  
ATOM 5847  H HA   . ASP A 1 24 ? -0.346  -1.997  3.655   1.00 0.00 ? 24 ASP A HA   6  
ATOM 5848  H HB2  . ASP A 1 24 ? -2.504  -3.114  3.403   1.00 0.00 ? 24 ASP A HB2  6  
ATOM 5849  H HB3  . ASP A 1 24 ? -1.697  -4.595  2.896   1.00 0.00 ? 24 ASP A HB3  6  
ATOM 5850  N N    . PHE A 1 25 ? 1.156   -4.626  2.369   1.00 0.00 ? 25 PHE A N    6  
ATOM 5851  C CA   . PHE A 1 25 ? 2.346   -5.464  2.463   1.00 0.00 ? 25 PHE A CA   6  
ATOM 5852  C C    . PHE A 1 25 ? 3.607   -4.652  2.178   1.00 0.00 ? 25 PHE A C    6  
ATOM 5853  O O    . PHE A 1 25 ? 4.687   -4.966  2.678   1.00 0.00 ? 25 PHE A O    6  
ATOM 5854  C CB   . PHE A 1 25 ? 2.249   -6.636  1.485   1.00 0.00 ? 25 PHE A CB   6  
ATOM 5855  C CG   . PHE A 1 25 ? 3.288   -7.696  1.715   1.00 0.00 ? 25 PHE A CG   6  
ATOM 5856  C CD1  . PHE A 1 25 ? 4.626   -7.441  1.457   1.00 0.00 ? 25 PHE A CD1  6  
ATOM 5857  C CD2  . PHE A 1 25 ? 2.928   -8.948  2.187   1.00 0.00 ? 25 PHE A CD2  6  
ATOM 5858  C CE1  . PHE A 1 25 ? 5.585   -8.413  1.667   1.00 0.00 ? 25 PHE A CE1  6  
ATOM 5859  C CE2  . PHE A 1 25 ? 3.883   -9.924  2.400   1.00 0.00 ? 25 PHE A CE2  6  
ATOM 5860  C CZ   . PHE A 1 25 ? 5.213   -9.657  2.138   1.00 0.00 ? 25 PHE A CZ   6  
ATOM 5861  H H    . PHE A 1 25 ? 0.546   -4.746  1.612   1.00 0.00 ? 25 PHE A H    6  
ATOM 5862  H HA   . PHE A 1 25 ? 2.401   -5.849  3.470   1.00 0.00 ? 25 PHE A HA   6  
ATOM 5863  H HB2  . PHE A 1 25 ? 1.278   -7.098  1.584   1.00 0.00 ? 25 PHE A HB2  6  
ATOM 5864  H HB3  . PHE A 1 25 ? 2.367   -6.266  0.478   1.00 0.00 ? 25 PHE A HB3  6  
ATOM 5865  H HD1  . PHE A 1 25 ? 4.918   -6.467  1.087   1.00 0.00 ? 25 PHE A HD1  6  
ATOM 5866  H HD2  . PHE A 1 25 ? 1.889   -9.158  2.392   1.00 0.00 ? 25 PHE A HD2  6  
ATOM 5867  H HE1  . PHE A 1 25 ? 6.623   -8.201  1.461   1.00 0.00 ? 25 PHE A HE1  6  
ATOM 5868  H HE2  . PHE A 1 25 ? 3.589   -10.896 2.768   1.00 0.00 ? 25 PHE A HE2  6  
ATOM 5869  H HZ   . PHE A 1 25 ? 5.960   -10.418 2.304   1.00 0.00 ? 25 PHE A HZ   6  
ATOM 5870  N N    . PHE A 1 26 ? 3.460   -3.607  1.370   1.00 0.00 ? 26 PHE A N    6  
ATOM 5871  C CA   . PHE A 1 26 ? 4.586   -2.751  1.016   1.00 0.00 ? 26 PHE A CA   6  
ATOM 5872  C C    . PHE A 1 26 ? 4.981   -1.859  2.189   1.00 0.00 ? 26 PHE A C    6  
ATOM 5873  O O    . PHE A 1 26 ? 6.152   -1.786  2.561   1.00 0.00 ? 26 PHE A O    6  
ATOM 5874  C CB   . PHE A 1 26 ? 4.236   -1.889  -0.199  1.00 0.00 ? 26 PHE A CB   6  
ATOM 5875  C CG   . PHE A 1 26 ? 5.292   -0.876  -0.539  1.00 0.00 ? 26 PHE A CG   6  
ATOM 5876  C CD1  . PHE A 1 26 ? 5.429   0.279   0.214   1.00 0.00 ? 26 PHE A CD1  6  
ATOM 5877  C CD2  . PHE A 1 26 ? 6.146   -1.078  -1.611  1.00 0.00 ? 26 PHE A CD2  6  
ATOM 5878  C CE1  . PHE A 1 26 ? 6.399   1.214   -0.097  1.00 0.00 ? 26 PHE A CE1  6  
ATOM 5879  C CE2  . PHE A 1 26 ? 7.118   -0.147  -1.926  1.00 0.00 ? 26 PHE A CE2  6  
ATOM 5880  C CZ   . PHE A 1 26 ? 7.245   1.000   -1.168  1.00 0.00 ? 26 PHE A CZ   6  
ATOM 5881  H H    . PHE A 1 26 ? 2.573   -3.408  1.002   1.00 0.00 ? 26 PHE A H    6  
ATOM 5882  H HA   . PHE A 1 26 ? 5.420   -3.388  0.767   1.00 0.00 ? 26 PHE A HA   6  
ATOM 5883  H HB2  . PHE A 1 26 ? 4.103   -2.529  -1.059  1.00 0.00 ? 26 PHE A HB2  6  
ATOM 5884  H HB3  . PHE A 1 26 ? 3.316   -1.360  -0.003  1.00 0.00 ? 26 PHE A HB3  6  
ATOM 5885  H HD1  . PHE A 1 26 ? 4.770   0.447   1.053   1.00 0.00 ? 26 PHE A HD1  6  
ATOM 5886  H HD2  . PHE A 1 26 ? 6.047   -1.976  -2.205  1.00 0.00 ? 26 PHE A HD2  6  
ATOM 5887  H HE1  . PHE A 1 26 ? 6.497   2.109   0.498   1.00 0.00 ? 26 PHE A HE1  6  
ATOM 5888  H HE2  . PHE A 1 26 ? 7.777   -0.318  -2.764  1.00 0.00 ? 26 PHE A HE2  6  
ATOM 5889  H HZ   . PHE A 1 26 ? 8.003   1.728   -1.413  1.00 0.00 ? 26 PHE A HZ   6  
ATOM 5890  N N    . ASP A 1 27 ? 3.995   -1.182  2.768   1.00 0.00 ? 27 ASP A N    6  
ATOM 5891  C CA   . ASP A 1 27 ? 4.238   -0.295  3.900   1.00 0.00 ? 27 ASP A CA   6  
ATOM 5892  C C    . ASP A 1 27 ? 5.047   -1.004  4.982   1.00 0.00 ? 27 ASP A C    6  
ATOM 5893  O O    . ASP A 1 27 ? 5.815   -0.375  5.708   1.00 0.00 ? 27 ASP A O    6  
ATOM 5894  C CB   . ASP A 1 27 ? 2.913   0.202   4.479   1.00 0.00 ? 27 ASP A CB   6  
ATOM 5895  C CG   . ASP A 1 27 ? 3.082   1.449   5.325   1.00 0.00 ? 27 ASP A CG   6  
ATOM 5896  O OD1  . ASP A 1 27 ? 3.802   1.382   6.343   1.00 0.00 ? 27 ASP A OD1  6  
ATOM 5897  O OD2  . ASP A 1 27 ? 2.495   2.492   4.968   1.00 0.00 ? 27 ASP A OD2  6  
ATOM 5898  H H    . ASP A 1 27 ? 3.082   -1.282  2.427   1.00 0.00 ? 27 ASP A H    6  
ATOM 5899  H HA   . ASP A 1 27 ? 4.804   0.551   3.542   1.00 0.00 ? 27 ASP A HA   6  
ATOM 5900  H HB2  . ASP A 1 27 ? 2.236   0.429   3.668   1.00 0.00 ? 27 ASP A HB2  6  
ATOM 5901  H HB3  . ASP A 1 27 ? 2.483   -0.574  5.095   1.00 0.00 ? 27 ASP A HB3  6  
ATOM 5902  N N    . ALA A 1 28 ? 4.866   -2.317  5.084   1.00 0.00 ? 28 ALA A N    6  
ATOM 5903  C CA   . ALA A 1 28 ? 5.579   -3.111  6.077   1.00 0.00 ? 28 ALA A CA   6  
ATOM 5904  C C    . ALA A 1 28 ? 6.848   -3.717  5.487   1.00 0.00 ? 28 ALA A C    6  
ATOM 5905  O O    . ALA A 1 28 ? 7.905   -3.700  6.116   1.00 0.00 ? 28 ALA A O    6  
ATOM 5906  C CB   . ALA A 1 28 ? 4.675   -4.205  6.625   1.00 0.00 ? 28 ALA A CB   6  
ATOM 5907  H H    . ALA A 1 28 ? 4.239   -2.762  4.476   1.00 0.00 ? 28 ALA A H    6  
ATOM 5908  H HA   . ALA A 1 28 ? 5.850   -2.458  6.894   1.00 0.00 ? 28 ALA A HA   6  
ATOM 5909  H HB1  . ALA A 1 28 ? 5.238   -4.828  7.305   1.00 0.00 ? 28 ALA A HB1  6  
ATOM 5910  H HB2  . ALA A 1 28 ? 3.845   -3.757  7.150   1.00 0.00 ? 28 ALA A HB2  6  
ATOM 5911  H HB3  . ALA A 1 28 ? 4.303   -4.807  5.810   1.00 0.00 ? 28 ALA A HB3  6  
ATOM 5912  N N    . ASN A 1 29 ? 6.735   -4.251  4.275   1.00 0.00 ? 29 ASN A N    6  
ATOM 5913  C CA   . ASN A 1 29 ? 7.874   -4.864  3.601   1.00 0.00 ? 29 ASN A CA   6  
ATOM 5914  C C    . ASN A 1 29 ? 7.826   -4.597  2.100   1.00 0.00 ? 29 ASN A C    6  
ATOM 5915  O O    . ASN A 1 29 ? 6.843   -4.920  1.433   1.00 0.00 ? 29 ASN A O    6  
ATOM 5916  C CB   . ASN A 1 29 ? 7.897   -6.372  3.862   1.00 0.00 ? 29 ASN A CB   6  
ATOM 5917  C CG   . ASN A 1 29 ? 9.218   -7.006  3.469   1.00 0.00 ? 29 ASN A CG   6  
ATOM 5918  O OD1  . ASN A 1 29 ? 10.287  -6.506  3.818   1.00 0.00 ? 29 ASN A OD1  6  
ATOM 5919  N ND2  . ASN A 1 29 ? 9.148   -8.113  2.740   1.00 0.00 ? 29 ASN A ND2  6  
ATOM 5920  H H    . ASN A 1 29 ? 5.865   -4.234  3.824   1.00 0.00 ? 29 ASN A H    6  
ATOM 5921  H HA   . ASN A 1 29 ? 8.774   -4.424  4.005   1.00 0.00 ? 29 ASN A HA   6  
ATOM 5922  H HB2  . ASN A 1 29 ? 7.732   -6.551  4.914   1.00 0.00 ? 29 ASN A HB2  6  
ATOM 5923  H HB3  . ASN A 1 29 ? 7.109   -6.842  3.292   1.00 0.00 ? 29 ASN A HB3  6  
ATOM 5924  H HD21 . ASN A 1 29 ? 8.261   -8.454  2.499   1.00 0.00 ? 29 ASN A HD21 6  
ATOM 5925  H HD22 . ASN A 1 29 ? 9.987   -8.545  2.473   1.00 0.00 ? 29 ASN A HD22 6  
ATOM 5926  N N    . ALA A 1 30 ? 8.894   -4.005  1.575   1.00 0.00 ? 30 ALA A N    6  
ATOM 5927  C CA   . ALA A 1 30 ? 8.975   -3.696  0.153   1.00 0.00 ? 30 ALA A CA   6  
ATOM 5928  C C    . ALA A 1 30 ? 10.138  -4.432  -0.503  1.00 0.00 ? 30 ALA A C    6  
ATOM 5929  O O    . ALA A 1 30 ? 10.489  -4.160  -1.652  1.00 0.00 ? 30 ALA A O    6  
ATOM 5930  C CB   . ALA A 1 30 ? 9.112   -2.195  -0.055  1.00 0.00 ? 30 ALA A CB   6  
ATOM 5931  H H    . ALA A 1 30 ? 9.646   -3.771  2.158   1.00 0.00 ? 30 ALA A H    6  
ATOM 5932  H HA   . ALA A 1 30 ? 8.052   -4.016  -0.311  1.00 0.00 ? 30 ALA A HA   6  
ATOM 5933  H HB1  . ALA A 1 30 ? 8.155   -1.721  0.107   1.00 0.00 ? 30 ALA A HB1  6  
ATOM 5934  H HB2  . ALA A 1 30 ? 9.833   -1.800  0.645   1.00 0.00 ? 30 ALA A HB2  6  
ATOM 5935  H HB3  . ALA A 1 30 ? 9.444   -2.001  -1.063  1.00 0.00 ? 30 ALA A HB3  6  
ATOM 5936  N N    . TYR A 1 31 ? 10.734  -5.363  0.233   1.00 0.00 ? 31 TYR A N    6  
ATOM 5937  C CA   . TYR A 1 31 ? 11.860  -6.136  -0.276  1.00 0.00 ? 31 TYR A CA   6  
ATOM 5938  C C    . TYR A 1 31 ? 11.671  -7.624  0.002   1.00 0.00 ? 31 TYR A C    6  
ATOM 5939  O O    . TYR A 1 31 ? 12.601  -8.334  0.382   1.00 0.00 ? 31 TYR A O    6  
ATOM 5940  C CB   . TYR A 1 31 ? 13.166  -5.650  0.355   1.00 0.00 ? 31 TYR A CB   6  
ATOM 5941  C CG   . TYR A 1 31 ? 13.375  -4.157  0.240   1.00 0.00 ? 31 TYR A CG   6  
ATOM 5942  C CD1  . TYR A 1 31 ? 12.823  -3.284  1.169   1.00 0.00 ? 31 TYR A CD1  6  
ATOM 5943  C CD2  . TYR A 1 31 ? 14.127  -3.619  -0.797  1.00 0.00 ? 31 TYR A CD2  6  
ATOM 5944  C CE1  . TYR A 1 31 ? 13.011  -1.920  1.068   1.00 0.00 ? 31 TYR A CE1  6  
ATOM 5945  C CE2  . TYR A 1 31 ? 14.322  -2.256  -0.906  1.00 0.00 ? 31 TYR A CE2  6  
ATOM 5946  C CZ   . TYR A 1 31 ? 13.762  -1.410  0.028   1.00 0.00 ? 31 TYR A CZ   6  
ATOM 5947  O OH   . TYR A 1 31 ? 13.953  -0.052  -0.076  1.00 0.00 ? 31 TYR A OH   6  
ATOM 5948  H H    . TYR A 1 31 ? 10.409  -5.535  1.142   1.00 0.00 ? 31 TYR A H    6  
ATOM 5949  H HA   . TYR A 1 31 ? 11.910  -5.984  -1.345  1.00 0.00 ? 31 TYR A HA   6  
ATOM 5950  H HB2  . TYR A 1 31 ? 13.167  -5.905  1.404   1.00 0.00 ? 31 TYR A HB2  6  
ATOM 5951  H HB3  . TYR A 1 31 ? 13.997  -6.140  -0.130  1.00 0.00 ? 31 TYR A HB3  6  
ATOM 5952  H HD1  . TYR A 1 31 ? 12.236  -3.687  1.983   1.00 0.00 ? 31 TYR A HD1  6  
ATOM 5953  H HD2  . TYR A 1 31 ? 14.565  -4.284  -1.528  1.00 0.00 ? 31 TYR A HD2  6  
ATOM 5954  H HE1  . TYR A 1 31 ? 12.573  -1.257  1.800   1.00 0.00 ? 31 TYR A HE1  6  
ATOM 5955  H HE2  . TYR A 1 31 ? 14.909  -1.856  -1.720  1.00 0.00 ? 31 TYR A HE2  6  
ATOM 5956  H HH   . TYR A 1 31 ? 14.787  0.187   0.336   1.00 0.00 ? 31 TYR A HH   6  
ATOM 5957  N N    . PRO A 1 32 ? 10.435  -8.108  -0.193  1.00 0.00 ? 32 PRO A N    6  
ATOM 5958  C CA   . PRO A 1 32 ? 10.093  -9.516  0.028   1.00 0.00 ? 32 PRO A CA   6  
ATOM 5959  C C    . PRO A 1 32 ? 10.724  -10.437 -1.010  1.00 0.00 ? 32 PRO A C    6  
ATOM 5960  O O    . PRO A 1 32 ? 11.071  -10.005 -2.110  1.00 0.00 ? 32 PRO A O    6  
ATOM 5961  C CB   . PRO A 1 32 ? 8.567   -9.535  -0.097  1.00 0.00 ? 32 PRO A CB   6  
ATOM 5962  C CG   . PRO A 1 32 ? 8.244   -8.365  -0.962  1.00 0.00 ? 32 PRO A CG   6  
ATOM 5963  C CD   . PRO A 1 32 ? 9.278   -7.319  -0.646  1.00 0.00 ? 32 PRO A CD   6  
ATOM 5964  H HA   . PRO A 1 32 ? 10.378  -9.843  1.018   1.00 0.00 ? 32 PRO A HA   6  
ATOM 5965  H HB2  . PRO A 1 32 ? 8.252   -10.463 -0.552  1.00 0.00 ? 32 PRO A HB2  6  
ATOM 5966  H HB3  . PRO A 1 32 ? 8.121   -9.437  0.881   1.00 0.00 ? 32 PRO A HB3  6  
ATOM 5967  H HG2  . PRO A 1 32 ? 8.304   -8.649  -2.001  1.00 0.00 ? 32 PRO A HG2  6  
ATOM 5968  H HG3  . PRO A 1 32 ? 7.256   -7.998  -0.728  1.00 0.00 ? 32 PRO A HG3  6  
ATOM 5969  H HD2  . PRO A 1 32 ? 9.521   -6.750  -1.531  1.00 0.00 ? 32 PRO A HD2  6  
ATOM 5970  H HD3  . PRO A 1 32 ? 8.926   -6.666  0.139   1.00 0.00 ? 32 PRO A HD3  6  
ATOM 5971  N N    . LYS A 1 33 ? 10.869  -11.709 -0.656  1.00 0.00 ? 33 LYS A N    6  
ATOM 5972  C CA   . LYS A 1 33 ? 11.457  -12.693 -1.558  1.00 0.00 ? 33 LYS A CA   6  
ATOM 5973  C C    . LYS A 1 33 ? 10.373  -13.450 -2.319  1.00 0.00 ? 33 LYS A C    6  
ATOM 5974  O O    . LYS A 1 33 ? 9.184   -13.298 -2.038  1.00 0.00 ? 33 LYS A O    6  
ATOM 5975  C CB   . LYS A 1 33 ? 12.327  -13.678 -0.774  1.00 0.00 ? 33 LYS A CB   6  
ATOM 5976  C CG   . LYS A 1 33 ? 13.266  -13.007 0.214   1.00 0.00 ? 33 LYS A CG   6  
ATOM 5977  C CD   . LYS A 1 33 ? 14.583  -12.624 -0.441  1.00 0.00 ? 33 LYS A CD   6  
ATOM 5978  C CE   . LYS A 1 33 ? 15.192  -11.393 0.213   1.00 0.00 ? 33 LYS A CE   6  
ATOM 5979  N NZ   . LYS A 1 33 ? 14.733  -10.135 -0.439  1.00 0.00 ? 33 LYS A NZ   6  
ATOM 5980  H H    . LYS A 1 33 ? 10.573  -11.994 0.234   1.00 0.00 ? 33 LYS A H    6  
ATOM 5981  H HA   . LYS A 1 33 ? 12.076  -12.165 -2.267  1.00 0.00 ? 33 LYS A HA   6  
ATOM 5982  H HB2  . LYS A 1 33 ? 11.684  -14.352 -0.227  1.00 0.00 ? 33 LYS A HB2  6  
ATOM 5983  H HB3  . LYS A 1 33 ? 12.922  -14.249 -1.473  1.00 0.00 ? 33 LYS A HB3  6  
ATOM 5984  H HG2  . LYS A 1 33 ? 12.794  -12.115 0.597   1.00 0.00 ? 33 LYS A HG2  6  
ATOM 5985  H HG3  . LYS A 1 33 ? 13.465  -13.690 1.028   1.00 0.00 ? 33 LYS A HG3  6  
ATOM 5986  H HD2  . LYS A 1 33 ? 15.275  -13.447 -0.347  1.00 0.00 ? 33 LYS A HD2  6  
ATOM 5987  H HD3  . LYS A 1 33 ? 14.408  -12.416 -1.487  1.00 0.00 ? 33 LYS A HD3  6  
ATOM 5988  H HE2  . LYS A 1 33 ? 14.906  -11.375 1.253   1.00 0.00 ? 33 LYS A HE2  6  
ATOM 5989  H HE3  . LYS A 1 33 ? 16.268  -11.456 0.136   1.00 0.00 ? 33 LYS A HE3  6  
ATOM 5990  H HZ1  . LYS A 1 33 ? 14.804  -10.222 -1.473  1.00 0.00 ? 33 LYS A HZ1  6  
ATOM 5991  H HZ2  . LYS A 1 33 ? 15.323  -9.336  -0.128  1.00 0.00 ? 33 LYS A HZ2  6  
ATOM 5992  H HZ3  . LYS A 1 33 ? 13.744  -9.941  -0.185  1.00 0.00 ? 33 LYS A HZ3  6  
ATOM 5993  N N    . ASP A 1 34 ? 10.791  -14.266 -3.280  1.00 0.00 ? 34 ASP A N    6  
ATOM 5994  C CA   . ASP A 1 34 ? 9.856   -15.048 -4.079  1.00 0.00 ? 34 ASP A CA   6  
ATOM 5995  C C    . ASP A 1 34 ? 8.823   -15.734 -3.190  1.00 0.00 ? 34 ASP A C    6  
ATOM 5996  O O    . ASP A 1 34 ? 7.619   -15.630 -3.426  1.00 0.00 ? 34 ASP A O    6  
ATOM 5997  C CB   . ASP A 1 34 ? 10.608  -16.092 -4.907  1.00 0.00 ? 34 ASP A CB   6  
ATOM 5998  C CG   . ASP A 1 34 ? 9.769   -16.643 -6.043  1.00 0.00 ? 34 ASP A CG   6  
ATOM 5999  O OD1  . ASP A 1 34 ? 8.606   -17.021 -5.792  1.00 0.00 ? 34 ASP A OD1  6  
ATOM 6000  O OD2  . ASP A 1 34 ? 10.277  -16.698 -7.183  1.00 0.00 ? 34 ASP A OD2  6  
ATOM 6001  H H    . ASP A 1 34 ? 11.752  -14.344 -3.456  1.00 0.00 ? 34 ASP A H    6  
ATOM 6002  H HA   . ASP A 1 34 ? 9.344   -14.372 -4.748  1.00 0.00 ? 34 ASP A HA   6  
ATOM 6003  H HB2  . ASP A 1 34 ? 11.494  -15.639 -5.326  1.00 0.00 ? 34 ASP A HB2  6  
ATOM 6004  H HB3  . ASP A 1 34 ? 10.896  -16.911 -4.265  1.00 0.00 ? 34 ASP A HB3  6  
ATOM 6005  N N    . ASP A 1 35 ? 9.302   -16.435 -2.168  1.00 0.00 ? 35 ASP A N    6  
ATOM 6006  C CA   . ASP A 1 35 ? 8.420   -17.138 -1.244  1.00 0.00 ? 35 ASP A CA   6  
ATOM 6007  C C    . ASP A 1 35 ? 7.314   -16.216 -0.739  1.00 0.00 ? 35 ASP A C    6  
ATOM 6008  O O    . ASP A 1 35 ? 6.144   -16.594 -0.711  1.00 0.00 ? 35 ASP A O    6  
ATOM 6009  C CB   . ASP A 1 35 ? 9.220   -17.690 -0.062  1.00 0.00 ? 35 ASP A CB   6  
ATOM 6010  C CG   . ASP A 1 35 ? 8.612   -18.956 0.508   1.00 0.00 ? 35 ASP A CG   6  
ATOM 6011  O OD1  . ASP A 1 35 ? 7.372   -19.093 0.456   1.00 0.00 ? 35 ASP A OD1  6  
ATOM 6012  O OD2  . ASP A 1 35 ? 9.376   -19.808 1.008   1.00 0.00 ? 35 ASP A OD2  6  
ATOM 6013  H H    . ASP A 1 35 ? 10.271  -16.480 -2.032  1.00 0.00 ? 35 ASP A H    6  
ATOM 6014  H HA   . ASP A 1 35 ? 7.969   -17.962 -1.777  1.00 0.00 ? 35 ASP A HA   6  
ATOM 6015  H HB2  . ASP A 1 35 ? 10.226  -17.911 -0.389  1.00 0.00 ? 35 ASP A HB2  6  
ATOM 6016  H HB3  . ASP A 1 35 ? 9.255   -16.945 0.719   1.00 0.00 ? 35 ASP A HB3  6  
ATOM 6017  N N    . GLU A 1 36 ? 7.695   -15.006 -0.342  1.00 0.00 ? 36 GLU A N    6  
ATOM 6018  C CA   . GLU A 1 36 ? 6.736   -14.031 0.164   1.00 0.00 ? 36 GLU A CA   6  
ATOM 6019  C C    . GLU A 1 36 ? 5.777   -13.590 -0.939  1.00 0.00 ? 36 GLU A C    6  
ATOM 6020  O O    . GLU A 1 36 ? 4.559   -13.613 -0.763  1.00 0.00 ? 36 GLU A O    6  
ATOM 6021  C CB   . GLU A 1 36 ? 7.465   -12.815 0.738   1.00 0.00 ? 36 GLU A CB   6  
ATOM 6022  C CG   . GLU A 1 36 ? 8.346   -13.141 1.932   1.00 0.00 ? 36 GLU A CG   6  
ATOM 6023  C CD   . GLU A 1 36 ? 7.591   -13.086 3.246   1.00 0.00 ? 36 GLU A CD   6  
ATOM 6024  O OE1  . GLU A 1 36 ? 7.394   -11.970 3.770   1.00 0.00 ? 36 GLU A OE1  6  
ATOM 6025  O OE2  . GLU A 1 36 ? 7.197   -14.159 3.750   1.00 0.00 ? 36 GLU A OE2  6  
ATOM 6026  H H    . GLU A 1 36 ? 8.644   -14.764 -0.388  1.00 0.00 ? 36 GLU A H    6  
ATOM 6027  H HA   . GLU A 1 36 ? 6.167   -14.503 0.951   1.00 0.00 ? 36 GLU A HA   6  
ATOM 6028  H HB2  . GLU A 1 36 ? 8.085   -12.385 -0.035  1.00 0.00 ? 36 GLU A HB2  6  
ATOM 6029  H HB3  . GLU A 1 36 ? 6.732   -12.084 1.046   1.00 0.00 ? 36 GLU A HB3  6  
ATOM 6030  H HG2  . GLU A 1 36 ? 8.747   -14.135 1.807   1.00 0.00 ? 36 GLU A HG2  6  
ATOM 6031  H HG3  . GLU A 1 36 ? 9.157   -12.429 1.970   1.00 0.00 ? 36 GLU A HG3  6  
ATOM 6032  N N    . PHE A 1 37 ? 6.336   -13.188 -2.075  1.00 0.00 ? 37 PHE A N    6  
ATOM 6033  C CA   . PHE A 1 37 ? 5.532   -12.740 -3.206  1.00 0.00 ? 37 PHE A CA   6  
ATOM 6034  C C    . PHE A 1 37 ? 4.417   -13.737 -3.510  1.00 0.00 ? 37 PHE A C    6  
ATOM 6035  O O    . PHE A 1 37 ? 3.310   -13.350 -3.882  1.00 0.00 ? 37 PHE A O    6  
ATOM 6036  C CB   . PHE A 1 37 ? 6.414   -12.551 -4.442  1.00 0.00 ? 37 PHE A CB   6  
ATOM 6037  C CG   . PHE A 1 37 ? 6.978   -11.165 -4.570  1.00 0.00 ? 37 PHE A CG   6  
ATOM 6038  C CD1  . PHE A 1 37 ? 6.284   -10.180 -5.254  1.00 0.00 ? 37 PHE A CD1  6  
ATOM 6039  C CD2  . PHE A 1 37 ? 8.203   -10.847 -4.006  1.00 0.00 ? 37 PHE A CD2  6  
ATOM 6040  C CE1  . PHE A 1 37 ? 6.802   -8.904  -5.373  1.00 0.00 ? 37 PHE A CE1  6  
ATOM 6041  C CE2  . PHE A 1 37 ? 8.726   -9.573  -4.122  1.00 0.00 ? 37 PHE A CE2  6  
ATOM 6042  C CZ   . PHE A 1 37 ? 8.024   -8.600  -4.806  1.00 0.00 ? 37 PHE A CZ   6  
ATOM 6043  H H    . PHE A 1 37 ? 7.313   -13.193 -2.155  1.00 0.00 ? 37 PHE A H    6  
ATOM 6044  H HA   . PHE A 1 37 ? 5.090   -11.792 -2.942  1.00 0.00 ? 37 PHE A HA   6  
ATOM 6045  H HB2  . PHE A 1 37 ? 7.241   -13.243 -4.395  1.00 0.00 ? 37 PHE A HB2  6  
ATOM 6046  H HB3  . PHE A 1 37 ? 5.829   -12.756 -5.327  1.00 0.00 ? 37 PHE A HB3  6  
ATOM 6047  H HD1  . PHE A 1 37 ? 5.327   -10.416 -5.697  1.00 0.00 ? 37 PHE A HD1  6  
ATOM 6048  H HD2  . PHE A 1 37 ? 8.754   -11.608 -3.471  1.00 0.00 ? 37 PHE A HD2  6  
ATOM 6049  H HE1  . PHE A 1 37 ? 6.250   -8.145  -5.908  1.00 0.00 ? 37 PHE A HE1  6  
ATOM 6050  H HE2  . PHE A 1 37 ? 9.682   -9.339  -3.677  1.00 0.00 ? 37 PHE A HE2  6  
ATOM 6051  H HZ   . PHE A 1 37 ? 8.430   -7.604  -4.898  1.00 0.00 ? 37 PHE A HZ   6  
ATOM 6052  N N    . GLU A 1 38 ? 4.720   -15.021 -3.348  1.00 0.00 ? 38 GLU A N    6  
ATOM 6053  C CA   . GLU A 1 38 ? 3.744   -16.073 -3.607  1.00 0.00 ? 38 GLU A CA   6  
ATOM 6054  C C    . GLU A 1 38 ? 2.502   -15.888 -2.740  1.00 0.00 ? 38 GLU A C    6  
ATOM 6055  O O    . GLU A 1 38 ? 1.376   -16.058 -3.207  1.00 0.00 ? 38 GLU A O    6  
ATOM 6056  C CB   . GLU A 1 38 ? 4.361   -17.448 -3.345  1.00 0.00 ? 38 GLU A CB   6  
ATOM 6057  C CG   . GLU A 1 38 ? 5.033   -18.056 -4.564  1.00 0.00 ? 38 GLU A CG   6  
ATOM 6058  C CD   . GLU A 1 38 ? 4.074   -18.863 -5.417  1.00 0.00 ? 38 GLU A CD   6  
ATOM 6059  O OE1  . GLU A 1 38 ? 3.270   -18.248 -6.149  1.00 0.00 ? 38 GLU A OE1  6  
ATOM 6060  O OE2  . GLU A 1 38 ? 4.126   -20.109 -5.353  1.00 0.00 ? 38 GLU A OE2  6  
ATOM 6061  H H    . GLU A 1 38 ? 5.620   -15.267 -3.050  1.00 0.00 ? 38 GLU A H    6  
ATOM 6062  H HA   . GLU A 1 38 ? 3.456   -16.010 -4.645  1.00 0.00 ? 38 GLU A HA   6  
ATOM 6063  H HB2  . GLU A 1 38 ? 5.099   -17.355 -2.561  1.00 0.00 ? 38 GLU A HB2  6  
ATOM 6064  H HB3  . GLU A 1 38 ? 3.584   -18.121 -3.015  1.00 0.00 ? 38 GLU A HB3  6  
ATOM 6065  H HG2  . GLU A 1 38 ? 5.444   -17.261 -5.167  1.00 0.00 ? 38 GLU A HG2  6  
ATOM 6066  H HG3  . GLU A 1 38 ? 5.831   -18.705 -4.234  1.00 0.00 ? 38 GLU A HG3  6  
ATOM 6067  N N    . GLN A 1 39 ? 2.716   -15.538 -1.476  1.00 0.00 ? 39 GLN A N    6  
ATOM 6068  C CA   . GLN A 1 39 ? 1.615   -15.331 -0.543  1.00 0.00 ? 39 GLN A CA   6  
ATOM 6069  C C    . GLN A 1 39 ? 0.596   -14.350 -1.114  1.00 0.00 ? 39 GLN A C    6  
ATOM 6070  O O    . GLN A 1 39 ? -0.607  -14.617 -1.113  1.00 0.00 ? 39 GLN A O    6  
ATOM 6071  C CB   . GLN A 1 39 ? 2.143   -14.814 0.796   1.00 0.00 ? 39 GLN A CB   6  
ATOM 6072  C CG   . GLN A 1 39 ? 2.912   -15.858 1.590   1.00 0.00 ? 39 GLN A CG   6  
ATOM 6073  C CD   . GLN A 1 39 ? 2.968   -15.540 3.071   1.00 0.00 ? 39 GLN A CD   6  
ATOM 6074  O OE1  . GLN A 1 39 ? 2.275   -14.643 3.552   1.00 0.00 ? 39 GLN A OE1  6  
ATOM 6075  N NE2  . GLN A 1 39 ? 3.796   -16.275 3.804   1.00 0.00 ? 39 GLN A NE2  6  
ATOM 6076  H H    . GLN A 1 39 ? 3.636   -15.417 -1.163  1.00 0.00 ? 39 GLN A H    6  
ATOM 6077  H HA   . GLN A 1 39 ? 1.130   -16.282 -0.386  1.00 0.00 ? 39 GLN A HA   6  
ATOM 6078  H HB2  . GLN A 1 39 ? 2.799   -13.977 0.612   1.00 0.00 ? 39 GLN A HB2  6  
ATOM 6079  H HB3  . GLN A 1 39 ? 1.307   -14.482 1.395   1.00 0.00 ? 39 GLN A HB3  6  
ATOM 6080  H HG2  . GLN A 1 39 ? 2.432   -16.816 1.461   1.00 0.00 ? 39 GLN A HG2  6  
ATOM 6081  H HG3  . GLN A 1 39 ? 3.922   -15.908 1.209   1.00 0.00 ? 39 GLN A HG3  6  
ATOM 6082  H HE21 . GLN A 1 39 ? 4.319   -16.971 3.352   1.00 0.00 ? 39 GLN A HE21 6  
ATOM 6083  H HE22 . GLN A 1 39 ? 3.853   -16.091 4.764   1.00 0.00 ? 39 GLN A HE22 6  
ATOM 6084  N N    . LEU A 1 40 ? 1.083   -13.214 -1.600  1.00 0.00 ? 40 LEU A N    6  
ATOM 6085  C CA   . LEU A 1 40 ? 0.215   -12.192 -2.174  1.00 0.00 ? 40 LEU A CA   6  
ATOM 6086  C C    . LEU A 1 40 ? -0.307  -12.625 -3.540  1.00 0.00 ? 40 LEU A C    6  
ATOM 6087  O O    . LEU A 1 40 ? -1.472  -12.404 -3.870  1.00 0.00 ? 40 LEU A O    6  
ATOM 6088  C CB   . LEU A 1 40 ? 0.968   -10.867 -2.300  1.00 0.00 ? 40 LEU A CB   6  
ATOM 6089  C CG   . LEU A 1 40 ? 1.473   -10.255 -0.992  1.00 0.00 ? 40 LEU A CG   6  
ATOM 6090  C CD1  . LEU A 1 40 ? 2.742   -9.452  -1.234  1.00 0.00 ? 40 LEU A CD1  6  
ATOM 6091  C CD2  . LEU A 1 40 ? 0.398   -9.380  -0.363  1.00 0.00 ? 40 LEU A CD2  6  
ATOM 6092  H H    . LEU A 1 40 ? 2.050   -13.058 -1.573  1.00 0.00 ? 40 LEU A H    6  
ATOM 6093  H HA   . LEU A 1 40 ? -0.624  -12.058 -1.508  1.00 0.00 ? 40 LEU A HA   6  
ATOM 6094  H HB2  . LEU A 1 40 ? 1.822   -11.031 -2.939  1.00 0.00 ? 40 LEU A HB2  6  
ATOM 6095  H HB3  . LEU A 1 40 ? 0.304   -10.153 -2.766  1.00 0.00 ? 40 LEU A HB3  6  
ATOM 6096  H HG   . LEU A 1 40 ? 1.708   -11.049 -0.298  1.00 0.00 ? 40 LEU A HG   6  
ATOM 6097  H HD11 . LEU A 1 40 ? 3.480   -9.714  -0.491  1.00 0.00 ? 40 LEU A HD11 6  
ATOM 6098  H HD12 . LEU A 1 40 ? 2.520   -8.398  -1.164  1.00 0.00 ? 40 LEU A HD12 6  
ATOM 6099  H HD13 . LEU A 1 40 ? 3.127   -9.675  -2.218  1.00 0.00 ? 40 LEU A HD13 6  
ATOM 6100  H HD21 . LEU A 1 40 ? -0.521  -9.941  -0.285  1.00 0.00 ? 40 LEU A HD21 6  
ATOM 6101  H HD22 . LEU A 1 40 ? 0.237   -8.508  -0.981  1.00 0.00 ? 40 LEU A HD22 6  
ATOM 6102  H HD23 . LEU A 1 40 ? 0.717   -9.071  0.621   1.00 0.00 ? 40 LEU A HD23 6  
ATOM 6103  N N    . SER A 1 41 ? 0.563   -13.246 -4.330  1.00 0.00 ? 41 SER A N    6  
ATOM 6104  C CA   . SER A 1 41 ? 0.191   -13.709 -5.662  1.00 0.00 ? 41 SER A CA   6  
ATOM 6105  C C    . SER A 1 41 ? -0.948  -14.721 -5.586  1.00 0.00 ? 41 SER A C    6  
ATOM 6106  O O    . SER A 1 41 ? -1.769  -14.817 -6.498  1.00 0.00 ? 41 SER A O    6  
ATOM 6107  C CB   . SER A 1 41 ? 1.398   -14.335 -6.363  1.00 0.00 ? 41 SER A CB   6  
ATOM 6108  O OG   . SER A 1 41 ? 1.471   -15.727 -6.108  1.00 0.00 ? 41 SER A OG   6  
ATOM 6109  H H    . SER A 1 41 ? 1.478   -13.393 -4.011  1.00 0.00 ? 41 SER A H    6  
ATOM 6110  H HA   . SER A 1 41 ? -0.140  -12.853 -6.230  1.00 0.00 ? 41 SER A HA   6  
ATOM 6111  H HB2  . SER A 1 41 ? 1.313   -14.181 -7.428  1.00 0.00 ? 41 SER A HB2  6  
ATOM 6112  H HB3  . SER A 1 41 ? 2.303   -13.868 -6.003  1.00 0.00 ? 41 SER A HB3  6  
ATOM 6113  H HG   . SER A 1 41 ? 2.212   -16.103 -6.588  1.00 0.00 ? 41 SER A HG   6  
ATOM 6114  N N    . ASN A 1 42 ? -0.991  -15.474 -4.492  1.00 0.00 ? 42 ASN A N    6  
ATOM 6115  C CA   . ASN A 1 42 ? -2.029  -16.479 -4.296  1.00 0.00 ? 42 ASN A CA   6  
ATOM 6116  C C    . ASN A 1 42 ? -3.313  -15.841 -3.776  1.00 0.00 ? 42 ASN A C    6  
ATOM 6117  O O    . ASN A 1 42 ? -4.416  -16.273 -4.115  1.00 0.00 ? 42 ASN A O    6  
ATOM 6118  C CB   . ASN A 1 42 ? -1.549  -17.555 -3.319  1.00 0.00 ? 42 ASN A CB   6  
ATOM 6119  C CG   . ASN A 1 42 ? -0.760  -18.651 -4.008  1.00 0.00 ? 42 ASN A CG   6  
ATOM 6120  O OD1  . ASN A 1 42 ? -1.307  -19.425 -4.794  1.00 0.00 ? 42 ASN A OD1  6  
ATOM 6121  N ND2  . ASN A 1 42 ? 0.534   -18.722 -3.715  1.00 0.00 ? 42 ASN A ND2  6  
ATOM 6122  H H    . ASN A 1 42 ? -0.308  -15.351 -3.800  1.00 0.00 ? 42 ASN A H    6  
ATOM 6123  H HA   . ASN A 1 42 ? -2.230  -16.938 -5.252  1.00 0.00 ? 42 ASN A HA   6  
ATOM 6124  H HB2  . ASN A 1 42 ? -0.916  -17.097 -2.573  1.00 0.00 ? 42 ASN A HB2  6  
ATOM 6125  H HB3  . ASN A 1 42 ? -2.404  -18.001 -2.835  1.00 0.00 ? 42 ASN A HB3  6  
ATOM 6126  H HD21 . ASN A 1 42 ? 0.901   -18.073 -3.080  1.00 0.00 ? 42 ASN A HD21 6  
ATOM 6127  H HD22 . ASN A 1 42 ? 1.068   -19.421 -4.147  1.00 0.00 ? 42 ASN A HD22 6  
ATOM 6128  N N    . LEU A 1 43 ? -3.164  -14.810 -2.952  1.00 0.00 ? 43 LEU A N    6  
ATOM 6129  C CA   . LEU A 1 43 ? -4.311  -14.111 -2.385  1.00 0.00 ? 43 LEU A CA   6  
ATOM 6130  C C    . LEU A 1 43 ? -5.032  -13.292 -3.452  1.00 0.00 ? 43 LEU A C    6  
ATOM 6131  O O    . LEU A 1 43 ? -6.220  -13.494 -3.707  1.00 0.00 ? 43 LEU A O    6  
ATOM 6132  C CB   . LEU A 1 43 ? -3.864  -13.198 -1.242  1.00 0.00 ? 43 LEU A CB   6  
ATOM 6133  C CG   . LEU A 1 43 ? -4.851  -12.106 -0.829  1.00 0.00 ? 43 LEU A CG   6  
ATOM 6134  C CD1  . LEU A 1 43 ? -6.161  -12.720 -0.362  1.00 0.00 ? 43 LEU A CD1  6  
ATOM 6135  C CD2  . LEU A 1 43 ? -4.252  -11.229 0.261   1.00 0.00 ? 43 LEU A CD2  6  
ATOM 6136  H H    . LEU A 1 43 ? -2.260  -14.511 -2.719  1.00 0.00 ? 43 LEU A H    6  
ATOM 6137  H HA   . LEU A 1 43 ? -4.993  -14.853 -1.996  1.00 0.00 ? 43 LEU A HA   6  
ATOM 6138  H HB2  . LEU A 1 43 ? -3.676  -13.817 -0.378  1.00 0.00 ? 43 LEU A HB2  6  
ATOM 6139  H HB3  . LEU A 1 43 ? -2.944  -12.717 -1.544  1.00 0.00 ? 43 LEU A HB3  6  
ATOM 6140  H HG   . LEU A 1 43 ? -5.063  -11.479 -1.684  1.00 0.00 ? 43 LEU A HG   6  
ATOM 6141  H HD11 . LEU A 1 43 ? -6.868  -11.934 -0.139  1.00 0.00 ? 43 LEU A HD11 6  
ATOM 6142  H HD12 . LEU A 1 43 ? -5.986  -13.309 0.526   1.00 0.00 ? 43 LEU A HD12 6  
ATOM 6143  H HD13 . LEU A 1 43 ? -6.560  -13.353 -1.141  1.00 0.00 ? 43 LEU A HD13 6  
ATOM 6144  H HD21 . LEU A 1 43 ? -4.639  -10.225 0.169   1.00 0.00 ? 43 LEU A HD21 6  
ATOM 6145  H HD22 . LEU A 1 43 ? -3.176  -11.211 0.157   1.00 0.00 ? 43 LEU A HD22 6  
ATOM 6146  H HD23 . LEU A 1 43 ? -4.514  -11.629 1.229   1.00 0.00 ? 43 LEU A HD23 6  
ATOM 6147  N N    . LEU A 1 44 ? -4.305  -12.370 -4.073  1.00 0.00 ? 44 LEU A N    6  
ATOM 6148  C CA   . LEU A 1 44 ? -4.874  -11.522 -5.115  1.00 0.00 ? 44 LEU A CA   6  
ATOM 6149  C C    . LEU A 1 44 ? -5.028  -12.294 -6.422  1.00 0.00 ? 44 LEU A C    6  
ATOM 6150  O O    . LEU A 1 44 ? -5.626  -11.802 -7.378  1.00 0.00 ? 44 LEU A O    6  
ATOM 6151  C CB   . LEU A 1 44 ? -3.992  -10.292 -5.337  1.00 0.00 ? 44 LEU A CB   6  
ATOM 6152  C CG   . LEU A 1 44 ? -3.609  -9.505  -4.083  1.00 0.00 ? 44 LEU A CG   6  
ATOM 6153  C CD1  . LEU A 1 44 ? -2.508  -8.505  -4.396  1.00 0.00 ? 44 LEU A CD1  6  
ATOM 6154  C CD2  . LEU A 1 44 ? -4.826  -8.798  -3.504  1.00 0.00 ? 44 LEU A CD2  6  
ATOM 6155  H H    . LEU A 1 44 ? -3.364  -12.255 -3.826  1.00 0.00 ? 44 LEU A H    6  
ATOM 6156  H HA   . LEU A 1 44 ? -5.850  -11.200 -4.784  1.00 0.00 ? 44 LEU A HA   6  
ATOM 6157  H HB2  . LEU A 1 44 ? -3.081  -10.620 -5.812  1.00 0.00 ? 44 LEU A HB2  6  
ATOM 6158  H HB3  . LEU A 1 44 ? -4.521  -9.622  -6.000  1.00 0.00 ? 44 LEU A HB3  6  
ATOM 6159  H HG   . LEU A 1 44 ? -3.234  -10.192 -3.336  1.00 0.00 ? 44 LEU A HG   6  
ATOM 6160  H HD11 . LEU A 1 44 ? -1.700  -9.007  -4.907  1.00 0.00 ? 44 LEU A HD11 6  
ATOM 6161  H HD12 . LEU A 1 44 ? -2.140  -8.075  -3.476  1.00 0.00 ? 44 LEU A HD12 6  
ATOM 6162  H HD13 . LEU A 1 44 ? -2.902  -7.721  -5.026  1.00 0.00 ? 44 LEU A HD13 6  
ATOM 6163  H HD21 . LEU A 1 44 ? -5.571  -8.675  -4.277  1.00 0.00 ? 44 LEU A HD21 6  
ATOM 6164  H HD22 . LEU A 1 44 ? -4.534  -7.828  -3.128  1.00 0.00 ? 44 LEU A HD22 6  
ATOM 6165  H HD23 . LEU A 1 44 ? -5.237  -9.389  -2.699  1.00 0.00 ? 44 LEU A HD23 6  
ATOM 6166  N N    . ASN A 1 45 ? -4.486  -13.507 -6.454  1.00 0.00 ? 45 ASN A N    6  
ATOM 6167  C CA   . ASN A 1 45 ? -4.564  -14.348 -7.643  1.00 0.00 ? 45 ASN A CA   6  
ATOM 6168  C C    . ASN A 1 45 ? -3.898  -13.668 -8.835  1.00 0.00 ? 45 ASN A C    6  
ATOM 6169  O O    . ASN A 1 45 ? -4.325  -13.838 -9.978  1.00 0.00 ? 45 ASN A O    6  
ATOM 6170  C CB   . ASN A 1 45 ? -6.024  -14.666 -7.972  1.00 0.00 ? 45 ASN A CB   6  
ATOM 6171  C CG   . ASN A 1 45 ? -6.647  -15.625 -6.976  1.00 0.00 ? 45 ASN A CG   6  
ATOM 6172  O OD1  . ASN A 1 45 ? -5.944  -16.375 -6.298  1.00 0.00 ? 45 ASN A OD1  6  
ATOM 6173  N ND2  . ASN A 1 45 ? -7.971  -15.605 -6.884  1.00 0.00 ? 45 ASN A ND2  6  
ATOM 6174  H H    . ASN A 1 45 ? -4.021  -13.844 -5.660  1.00 0.00 ? 45 ASN A H    6  
ATOM 6175  H HA   . ASN A 1 45 ? -4.044  -15.270 -7.431  1.00 0.00 ? 45 ASN A HA   6  
ATOM 6176  H HB2  . ASN A 1 45 ? -6.596  -13.749 -7.965  1.00 0.00 ? 45 ASN A HB2  6  
ATOM 6177  H HB3  . ASN A 1 45 ? -6.077  -15.110 -8.955  1.00 0.00 ? 45 ASN A HB3  6  
ATOM 6178  H HD21 . ASN A 1 45 ? -8.466  -14.982 -7.456  1.00 0.00 ? 45 ASN A HD21 6  
ATOM 6179  H HD22 . ASN A 1 45 ? -8.400  -16.215 -6.248  1.00 0.00 ? 45 ASN A HD22 6  
ATOM 6180  N N    . LEU A 1 46 ? -2.851  -12.899 -8.561  1.00 0.00 ? 46 LEU A N    6  
ATOM 6181  C CA   . LEU A 1 46 ? -2.124  -12.193 -9.611  1.00 0.00 ? 46 LEU A CA   6  
ATOM 6182  C C    . LEU A 1 46 ? -0.714  -12.753 -9.767  1.00 0.00 ? 46 LEU A C    6  
ATOM 6183  O O    . LEU A 1 46 ? -0.126  -13.293 -8.830  1.00 0.00 ? 46 LEU A O    6  
ATOM 6184  C CB   . LEU A 1 46 ? -2.060  -10.697 -9.297  1.00 0.00 ? 46 LEU A CB   6  
ATOM 6185  C CG   . LEU A 1 46 ? -3.403  -9.974  -9.199  1.00 0.00 ? 46 LEU A CG   6  
ATOM 6186  C CD1  . LEU A 1 46 ? -3.225  -8.599  -8.575  1.00 0.00 ? 46 LEU A CD1  6  
ATOM 6187  C CD2  . LEU A 1 46 ? -4.047  -9.858  -10.573 1.00 0.00 ? 46 LEU A CD2  6  
ATOM 6188  H H    . LEU A 1 46 ? -2.558  -12.802 -7.631  1.00 0.00 ? 46 LEU A H    6  
ATOM 6189  H HA   . LEU A 1 46 ? -2.660  -12.336 -10.537 1.00 0.00 ? 46 LEU A HA   6  
ATOM 6190  H HB2  . LEU A 1 46 ? -1.552  -10.580 -8.352  1.00 0.00 ? 46 LEU A HB2  6  
ATOM 6191  H HB3  . LEU A 1 46 ? -1.482  -10.221 -10.076 1.00 0.00 ? 46 LEU A HB3  6  
ATOM 6192  H HG   . LEU A 1 46 ? -4.067  -10.545 -8.565  1.00 0.00 ? 46 LEU A HG   6  
ATOM 6193  H HD11 . LEU A 1 46 ? -2.294  -8.569  -8.029  1.00 0.00 ? 46 LEU A HD11 6  
ATOM 6194  H HD12 . LEU A 1 46 ? -4.044  -8.401  -7.899  1.00 0.00 ? 46 LEU A HD12 6  
ATOM 6195  H HD13 . LEU A 1 46 ? -3.211  -7.849  -9.352  1.00 0.00 ? 46 LEU A HD13 6  
ATOM 6196  H HD21 . LEU A 1 46 ? -5.070  -9.529  -10.464 1.00 0.00 ? 46 LEU A HD21 6  
ATOM 6197  H HD22 . LEU A 1 46 ? -4.029  -10.821 -11.062 1.00 0.00 ? 46 LEU A HD22 6  
ATOM 6198  H HD23 . LEU A 1 46 ? -3.500  -9.141  -11.168 1.00 0.00 ? 46 LEU A HD23 6  
ATOM 6199  N N    . PRO A 1 47 ? -0.155  -12.619 -10.979 1.00 0.00 ? 47 PRO A N    6  
ATOM 6200  C CA   . PRO A 1 47 ? 1.194   -13.103 -11.286 1.00 0.00 ? 47 PRO A CA   6  
ATOM 6201  C C    . PRO A 1 47 ? 2.276   -12.284 -10.590 1.00 0.00 ? 47 PRO A C    6  
ATOM 6202  O O    . PRO A 1 47 ? 2.272   -11.054 -10.647 1.00 0.00 ? 47 PRO A O    6  
ATOM 6203  C CB   . PRO A 1 47 ? 1.293   -12.937 -12.805 1.00 0.00 ? 47 PRO A CB   6  
ATOM 6204  C CG   . PRO A 1 47 ? 0.328   -11.851 -13.131 1.00 0.00 ? 47 PRO A CG   6  
ATOM 6205  C CD   . PRO A 1 47 ? -0.797  -11.986 -12.143 1.00 0.00 ? 47 PRO A CD   6  
ATOM 6206  H HA   . PRO A 1 47 ? 1.311   -14.145 -11.028 1.00 0.00 ? 47 PRO A HA   6  
ATOM 6207  H HB2  . PRO A 1 47 ? 2.304   -12.664 -13.075 1.00 0.00 ? 47 PRO A HB2  6  
ATOM 6208  H HB3  . PRO A 1 47 ? 1.024   -13.863 -13.290 1.00 0.00 ? 47 PRO A HB3  6  
ATOM 6209  H HG2  . PRO A 1 47 ? 0.807   -10.890 -13.025 1.00 0.00 ? 47 PRO A HG2  6  
ATOM 6210  H HG3  . PRO A 1 47 ? -0.041  -11.978 -14.138 1.00 0.00 ? 47 PRO A HG3  6  
ATOM 6211  H HD2  . PRO A 1 47 ? -1.191  -11.014 -11.885 1.00 0.00 ? 47 PRO A HD2  6  
ATOM 6212  H HD3  . PRO A 1 47 ? -1.577  -12.617 -12.543 1.00 0.00 ? 47 PRO A HD3  6  
ATOM 6213  N N    . THR A 1 48 ? 3.203   -12.974 -9.932  1.00 0.00 ? 48 THR A N    6  
ATOM 6214  C CA   . THR A 1 48 ? 4.290   -12.311 -9.224  1.00 0.00 ? 48 THR A CA   6  
ATOM 6215  C C    . THR A 1 48 ? 4.899   -11.198 -10.069 1.00 0.00 ? 48 THR A C    6  
ATOM 6216  O O    . THR A 1 48 ? 5.236   -10.131 -9.557  1.00 0.00 ? 48 THR A O    6  
ATOM 6217  C CB   . THR A 1 48 ? 5.398   -13.309 -8.835  1.00 0.00 ? 48 THR A CB   6  
ATOM 6218  O OG1  . THR A 1 48 ? 5.560   -14.288 -9.866  1.00 0.00 ? 48 THR A OG1  6  
ATOM 6219  C CG2  . THR A 1 48 ? 5.066   -13.999 -7.520  1.00 0.00 ? 48 THR A CG2  6  
ATOM 6220  H H    . THR A 1 48 ? 3.152   -13.953 -9.923  1.00 0.00 ? 48 THR A H    6  
ATOM 6221  H HA   . THR A 1 48 ? 3.886   -11.883 -8.318  1.00 0.00 ? 48 THR A HA   6  
ATOM 6222  H HB   . THR A 1 48 ? 6.324   -12.766 -8.715  1.00 0.00 ? 48 THR A HB   6  
ATOM 6223  H HG1  . THR A 1 48 ? 6.425   -14.189 -10.269 1.00 0.00 ? 48 THR A HG1  6  
ATOM 6224  H HG21 . THR A 1 48 ? 4.628   -13.285 -6.839  1.00 0.00 ? 48 THR A HG21 6  
ATOM 6225  H HG22 . THR A 1 48 ? 5.970   -14.402 -7.088  1.00 0.00 ? 48 THR A HG22 6  
ATOM 6226  H HG23 . THR A 1 48 ? 4.366   -14.800 -7.702  1.00 0.00 ? 48 THR A HG23 6  
ATOM 6227  N N    . ARG A 1 49 ? 5.036   -11.454 -11.366 1.00 0.00 ? 49 ARG A N    6  
ATOM 6228  C CA   . ARG A 1 49 ? 5.605   -10.473 -12.282 1.00 0.00 ? 49 ARG A CA   6  
ATOM 6229  C C    . ARG A 1 49 ? 4.878   -9.136  -12.167 1.00 0.00 ? 49 ARG A C    6  
ATOM 6230  O O    . ARG A 1 49 ? 5.491   -8.073  -12.268 1.00 0.00 ? 49 ARG A O    6  
ATOM 6231  C CB   . ARG A 1 49 ? 5.529   -10.984 -13.722 1.00 0.00 ? 49 ARG A CB   6  
ATOM 6232  C CG   . ARG A 1 49 ? 4.196   -10.707 -14.398 1.00 0.00 ? 49 ARG A CG   6  
ATOM 6233  C CD   . ARG A 1 49 ? 4.200   -9.362  -15.107 1.00 0.00 ? 49 ARG A CD   6  
ATOM 6234  N NE   . ARG A 1 49 ? 4.935   -9.410  -16.368 1.00 0.00 ? 49 ARG A NE   6  
ATOM 6235  C CZ   . ARG A 1 49 ? 4.430   -9.901  -17.495 1.00 0.00 ? 49 ARG A CZ   6  
ATOM 6236  N NH1  . ARG A 1 49 ? 3.195   -10.382 -17.517 1.00 0.00 ? 49 ARG A NH1  6  
ATOM 6237  N NH2  . ARG A 1 49 ? 5.161   -9.911  -18.602 1.00 0.00 ? 49 ARG A NH2  6  
ATOM 6238  H H    . ARG A 1 49 ? 4.748   -12.323 -11.715 1.00 0.00 ? 49 ARG A H    6  
ATOM 6239  H HA   . ARG A 1 49 ? 6.641   -10.330 -12.014 1.00 0.00 ? 49 ARG A HA   6  
ATOM 6240  H HB2  . ARG A 1 49 ? 6.307   -10.509 -14.302 1.00 0.00 ? 49 ARG A HB2  6  
ATOM 6241  H HB3  . ARG A 1 49 ? 5.692   -12.051 -13.721 1.00 0.00 ? 49 ARG A HB3  6  
ATOM 6242  H HG2  . ARG A 1 49 ? 4.002   -11.483 -15.123 1.00 0.00 ? 49 ARG A HG2  6  
ATOM 6243  H HG3  . ARG A 1 49 ? 3.417   -10.708 -13.650 1.00 0.00 ? 49 ARG A HG3  6  
ATOM 6244  H HD2  . ARG A 1 49 ? 3.180   -9.072  -15.307 1.00 0.00 ? 49 ARG A HD2  6  
ATOM 6245  H HD3  . ARG A 1 49 ? 4.661   -8.630  -14.460 1.00 0.00 ? 49 ARG A HD3  6  
ATOM 6246  H HE   . ARG A 1 49 ? 5.850   -9.060  -16.374 1.00 0.00 ? 49 ARG A HE   6  
ATOM 6247  H HH11 . ARG A 1 49 ? 2.642   -10.375 -16.684 1.00 0.00 ? 49 ARG A HH11 6  
ATOM 6248  H HH12 . ARG A 1 49 ? 2.817   -10.750 -18.367 1.00 0.00 ? 49 ARG A HH12 6  
ATOM 6249  H HH21 . ARG A 1 49 ? 6.093   -9.549  -18.589 1.00 0.00 ? 49 ARG A HH21 6  
ATOM 6250  H HH22 . ARG A 1 49 ? 4.781   -10.280 -19.449 1.00 0.00 ? 49 ARG A HH22 6  
ATOM 6251  N N    . VAL A 1 50 ? 3.567   -9.197  -11.955 1.00 0.00 ? 50 VAL A N    6  
ATOM 6252  C CA   . VAL A 1 50 ? 2.756   -7.992  -11.826 1.00 0.00 ? 50 VAL A CA   6  
ATOM 6253  C C    . VAL A 1 50 ? 2.969   -7.330  -10.469 1.00 0.00 ? 50 VAL A C    6  
ATOM 6254  O O    . VAL A 1 50 ? 3.020   -6.104  -10.367 1.00 0.00 ? 50 VAL A O    6  
ATOM 6255  C CB   . VAL A 1 50 ? 1.258   -8.302  -12.005 1.00 0.00 ? 50 VAL A CB   6  
ATOM 6256  C CG1  . VAL A 1 50 ? 0.409   -7.174  -11.439 1.00 0.00 ? 50 VAL A CG1  6  
ATOM 6257  C CG2  . VAL A 1 50 ? 0.935   -8.539  -13.472 1.00 0.00 ? 50 VAL A CG2  6  
ATOM 6258  H H    . VAL A 1 50 ? 3.135   -10.074 -11.884 1.00 0.00 ? 50 VAL A H    6  
ATOM 6259  H HA   . VAL A 1 50 ? 3.055   -7.304  -12.603 1.00 0.00 ? 50 VAL A HA   6  
ATOM 6260  H HB   . VAL A 1 50 ? 1.030   -9.205  -11.457 1.00 0.00 ? 50 VAL A HB   6  
ATOM 6261  H HG11 . VAL A 1 50 ? 0.644   -6.254  -11.952 1.00 0.00 ? 50 VAL A HG11 6  
ATOM 6262  H HG12 . VAL A 1 50 ? -0.637  -7.407  -11.576 1.00 0.00 ? 50 VAL A HG12 6  
ATOM 6263  H HG13 . VAL A 1 50 ? 0.617   -7.061  -10.385 1.00 0.00 ? 50 VAL A HG13 6  
ATOM 6264  H HG21 . VAL A 1 50 ? 0.838   -7.589  -13.976 1.00 0.00 ? 50 VAL A HG21 6  
ATOM 6265  H HG22 . VAL A 1 50 ? 1.731   -9.109  -13.929 1.00 0.00 ? 50 VAL A HG22 6  
ATOM 6266  H HG23 . VAL A 1 50 ? 0.008   -9.087  -13.553 1.00 0.00 ? 50 VAL A HG23 6  
ATOM 6267  N N    . ILE A 1 51 ? 3.092   -8.149  -9.430  1.00 0.00 ? 51 ILE A N    6  
ATOM 6268  C CA   . ILE A 1 51 ? 3.301   -7.643  -8.079  1.00 0.00 ? 51 ILE A CA   6  
ATOM 6269  C C    . ILE A 1 51 ? 4.705   -7.070  -7.918  1.00 0.00 ? 51 ILE A C    6  
ATOM 6270  O O    . ILE A 1 51 ? 4.922   -6.140  -7.141  1.00 0.00 ? 51 ILE A O    6  
ATOM 6271  C CB   . ILE A 1 51 ? 3.083   -8.744  -7.025  1.00 0.00 ? 51 ILE A CB   6  
ATOM 6272  C CG1  . ILE A 1 51 ? 1.782   -9.499  -7.305  1.00 0.00 ? 51 ILE A CG1  6  
ATOM 6273  C CG2  . ILE A 1 51 ? 3.063   -8.143  -5.628  1.00 0.00 ? 51 ILE A CG2  6  
ATOM 6274  C CD1  . ILE A 1 51 ? 1.622   -10.755 -6.477  1.00 0.00 ? 51 ILE A CD1  6  
ATOM 6275  H H    . ILE A 1 51 ? 3.042   -9.117  -9.576  1.00 0.00 ? 51 ILE A H    6  
ATOM 6276  H HA   . ILE A 1 51 ? 2.581   -6.857  -7.903  1.00 0.00 ? 51 ILE A HA   6  
ATOM 6277  H HB   . ILE A 1 51 ? 3.911   -9.434  -7.082  1.00 0.00 ? 51 ILE A HB   6  
ATOM 6278  H HG12 . ILE A 1 51 ? 0.946   -8.853  -7.093  1.00 0.00 ? 51 ILE A HG12 6  
ATOM 6279  H HG13 . ILE A 1 51 ? 1.757   -9.783  -8.348  1.00 0.00 ? 51 ILE A HG13 6  
ATOM 6280  H HG21 . ILE A 1 51 ? 2.408   -8.724  -4.996  1.00 0.00 ? 51 ILE A HG21 6  
ATOM 6281  H HG22 . ILE A 1 51 ? 4.061   -8.155  -5.217  1.00 0.00 ? 51 ILE A HG22 6  
ATOM 6282  H HG23 . ILE A 1 51 ? 2.706   -7.126  -5.678  1.00 0.00 ? 51 ILE A HG23 6  
ATOM 6283  H HD11 . ILE A 1 51 ? 2.130   -10.631 -5.532  1.00 0.00 ? 51 ILE A HD11 6  
ATOM 6284  H HD12 . ILE A 1 51 ? 0.573   -10.939 -6.302  1.00 0.00 ? 51 ILE A HD12 6  
ATOM 6285  H HD13 . ILE A 1 51 ? 2.050   -11.593 -7.008  1.00 0.00 ? 51 ILE A HD13 6  
ATOM 6286  N N    . VAL A 1 52 ? 5.656   -7.631  -8.658  1.00 0.00 ? 52 VAL A N    6  
ATOM 6287  C CA   . VAL A 1 52 ? 7.039   -7.175  -8.600  1.00 0.00 ? 52 VAL A CA   6  
ATOM 6288  C C    . VAL A 1 52 ? 7.180   -5.771  -9.176  1.00 0.00 ? 52 VAL A C    6  
ATOM 6289  O O    . VAL A 1 52 ? 7.713   -4.871  -8.526  1.00 0.00 ? 52 VAL A O    6  
ATOM 6290  C CB   . VAL A 1 52 ? 7.977   -8.128  -9.364  1.00 0.00 ? 52 VAL A CB   6  
ATOM 6291  C CG1  . VAL A 1 52 ? 9.373   -7.532  -9.471  1.00 0.00 ? 52 VAL A CG1  6  
ATOM 6292  C CG2  . VAL A 1 52 ? 8.021   -9.489  -8.687  1.00 0.00 ? 52 VAL A CG2  6  
ATOM 6293  H H    . VAL A 1 52 ? 5.421   -8.369  -9.258  1.00 0.00 ? 52 VAL A H    6  
ATOM 6294  H HA   . VAL A 1 52 ? 7.343   -7.160  -7.563  1.00 0.00 ? 52 VAL A HA   6  
ATOM 6295  H HB   . VAL A 1 52 ? 7.588   -8.258  -10.363 1.00 0.00 ? 52 VAL A HB   6  
ATOM 6296  H HG11 . VAL A 1 52 ? 9.965   -8.123  -10.154 1.00 0.00 ? 52 VAL A HG11 6  
ATOM 6297  H HG12 . VAL A 1 52 ? 9.304   -6.518  -9.837  1.00 0.00 ? 52 VAL A HG12 6  
ATOM 6298  H HG13 . VAL A 1 52 ? 9.840   -7.533  -8.498  1.00 0.00 ? 52 VAL A HG13 6  
ATOM 6299  H HG21 . VAL A 1 52 ? 8.696   -9.450  -7.845  1.00 0.00 ? 52 VAL A HG21 6  
ATOM 6300  H HG22 . VAL A 1 52 ? 7.031   -9.752  -8.343  1.00 0.00 ? 52 VAL A HG22 6  
ATOM 6301  H HG23 . VAL A 1 52 ? 8.366   -10.231 -9.391  1.00 0.00 ? 52 VAL A HG23 6  
ATOM 6302  N N    . VAL A 1 53 ? 6.697   -5.589  -10.401 1.00 0.00 ? 53 VAL A N    6  
ATOM 6303  C CA   . VAL A 1 53 ? 6.766   -4.293  -11.065 1.00 0.00 ? 53 VAL A CA   6  
ATOM 6304  C C    . VAL A 1 53 ? 6.129   -3.202  -10.212 1.00 0.00 ? 53 VAL A C    6  
ATOM 6305  O O    . VAL A 1 53 ? 6.641   -2.086  -10.129 1.00 0.00 ? 53 VAL A O    6  
ATOM 6306  C CB   . VAL A 1 53 ? 6.069   -4.327  -12.438 1.00 0.00 ? 53 VAL A CB   6  
ATOM 6307  C CG1  . VAL A 1 53 ? 6.118   -2.957  -13.097 1.00 0.00 ? 53 VAL A CG1  6  
ATOM 6308  C CG2  . VAL A 1 53 ? 6.706   -5.381  -13.332 1.00 0.00 ? 53 VAL A CG2  6  
ATOM 6309  H H    . VAL A 1 53 ? 6.283   -6.344  -10.869 1.00 0.00 ? 53 VAL A H    6  
ATOM 6310  H HA   . VAL A 1 53 ? 7.808   -4.052  -11.220 1.00 0.00 ? 53 VAL A HA   6  
ATOM 6311  H HB   . VAL A 1 53 ? 5.033   -4.593  -12.287 1.00 0.00 ? 53 VAL A HB   6  
ATOM 6312  H HG11 . VAL A 1 53 ? 6.244   -3.076  -14.164 1.00 0.00 ? 53 VAL A HG11 6  
ATOM 6313  H HG12 . VAL A 1 53 ? 5.197   -2.429  -12.899 1.00 0.00 ? 53 VAL A HG12 6  
ATOM 6314  H HG13 . VAL A 1 53 ? 6.949   -2.396  -12.698 1.00 0.00 ? 53 VAL A HG13 6  
ATOM 6315  H HG21 . VAL A 1 53 ? 6.067   -6.251  -13.372 1.00 0.00 ? 53 VAL A HG21 6  
ATOM 6316  H HG22 . VAL A 1 53 ? 6.832   -4.981  -14.328 1.00 0.00 ? 53 VAL A HG22 6  
ATOM 6317  H HG23 . VAL A 1 53 ? 7.669   -5.659  -12.932 1.00 0.00 ? 53 VAL A HG23 6  
ATOM 6318  N N    . TRP A 1 54 ? 5.010   -3.534  -9.578  1.00 0.00 ? 54 TRP A N    6  
ATOM 6319  C CA   . TRP A 1 54 ? 4.302   -2.582  -8.729  1.00 0.00 ? 54 TRP A CA   6  
ATOM 6320  C C    . TRP A 1 54 ? 5.122   -2.245  -7.488  1.00 0.00 ? 54 TRP A C    6  
ATOM 6321  O O    . TRP A 1 54 ? 5.247   -1.079  -7.113  1.00 0.00 ? 54 TRP A O    6  
ATOM 6322  C CB   . TRP A 1 54 ? 2.942   -3.147  -8.318  1.00 0.00 ? 54 TRP A CB   6  
ATOM 6323  C CG   . TRP A 1 54 ? 2.106   -2.177  -7.538  1.00 0.00 ? 54 TRP A CG   6  
ATOM 6324  C CD1  . TRP A 1 54 ? 1.055   -1.441  -8.005  1.00 0.00 ? 54 TRP A CD1  6  
ATOM 6325  C CD2  . TRP A 1 54 ? 2.254   -1.837  -6.156  1.00 0.00 ? 54 TRP A CD2  6  
ATOM 6326  N NE1  . TRP A 1 54 ? 0.540   -0.664  -6.996  1.00 0.00 ? 54 TRP A NE1  6  
ATOM 6327  C CE2  . TRP A 1 54 ? 1.258   -0.889  -5.851  1.00 0.00 ? 54 TRP A CE2  6  
ATOM 6328  C CE3  . TRP A 1 54 ? 3.130   -2.242  -5.145  1.00 0.00 ? 54 TRP A CE3  6  
ATOM 6329  C CZ2  . TRP A 1 54 ? 1.116   -0.341  -4.579  1.00 0.00 ? 54 TRP A CZ2  6  
ATOM 6330  C CZ3  . TRP A 1 54 ? 2.988   -1.698  -3.883  1.00 0.00 ? 54 TRP A CZ3  6  
ATOM 6331  C CH2  . TRP A 1 54 ? 1.987   -0.756  -3.608  1.00 0.00 ? 54 TRP A CH2  6  
ATOM 6332  H H    . TRP A 1 54 ? 4.651   -4.440  -9.683  1.00 0.00 ? 54 TRP A H    6  
ATOM 6333  H HA   . TRP A 1 54 ? 4.149   -1.679  -9.301  1.00 0.00 ? 54 TRP A HA   6  
ATOM 6334  H HB2  . TRP A 1 54 ? 2.391   -3.424  -9.205  1.00 0.00 ? 54 TRP A HB2  6  
ATOM 6335  H HB3  . TRP A 1 54 ? 3.095   -4.024  -7.705  1.00 0.00 ? 54 TRP A HB3  6  
ATOM 6336  H HD1  . TRP A 1 54 ? 0.694   -1.474  -9.022  1.00 0.00 ? 54 TRP A HD1  6  
ATOM 6337  H HE1  . TRP A 1 54 ? -0.219  -0.049  -7.082  1.00 0.00 ? 54 TRP A HE1  6  
ATOM 6338  H HE3  . TRP A 1 54 ? 3.907   -2.967  -5.337  1.00 0.00 ? 54 TRP A HE3  6  
ATOM 6339  H HZ2  . TRP A 1 54 ? 0.349   0.385   -4.351  1.00 0.00 ? 54 TRP A HZ2  6  
ATOM 6340  H HZ3  . TRP A 1 54 ? 3.655   -1.999  -3.089  1.00 0.00 ? 54 TRP A HZ3  6  
ATOM 6341  H HH2  . TRP A 1 54 ? 1.913   -0.357  -2.608  1.00 0.00 ? 54 TRP A HH2  6  
ATOM 6342  N N    . PHE A 1 55 ? 5.679   -3.272  -6.855  1.00 0.00 ? 55 PHE A N    6  
ATOM 6343  C CA   . PHE A 1 55 ? 6.487   -3.084  -5.656  1.00 0.00 ? 55 PHE A CA   6  
ATOM 6344  C C    . PHE A 1 55 ? 7.754   -2.293  -5.971  1.00 0.00 ? 55 PHE A C    6  
ATOM 6345  O O    . PHE A 1 55 ? 8.153   -1.412  -5.210  1.00 0.00 ? 55 PHE A O    6  
ATOM 6346  C CB   . PHE A 1 55 ? 6.856   -4.438  -5.046  1.00 0.00 ? 55 PHE A CB   6  
ATOM 6347  C CG   . PHE A 1 55 ? 5.867   -4.926  -4.027  1.00 0.00 ? 55 PHE A CG   6  
ATOM 6348  C CD1  . PHE A 1 55 ? 4.548   -5.161  -4.380  1.00 0.00 ? 55 PHE A CD1  6  
ATOM 6349  C CD2  . PHE A 1 55 ? 6.256   -5.150  -2.716  1.00 0.00 ? 55 PHE A CD2  6  
ATOM 6350  C CE1  . PHE A 1 55 ? 3.635   -5.610  -3.444  1.00 0.00 ? 55 PHE A CE1  6  
ATOM 6351  C CE2  . PHE A 1 55 ? 5.348   -5.600  -1.777  1.00 0.00 ? 55 PHE A CE2  6  
ATOM 6352  C CZ   . PHE A 1 55 ? 4.036   -5.829  -2.141  1.00 0.00 ? 55 PHE A CZ   6  
ATOM 6353  H H    . PHE A 1 55 ? 5.544   -4.178  -7.203  1.00 0.00 ? 55 PHE A H    6  
ATOM 6354  H HA   . PHE A 1 55 ? 5.897   -2.527  -4.944  1.00 0.00 ? 55 PHE A HA   6  
ATOM 6355  H HB2  . PHE A 1 55 ? 6.913   -5.175  -5.833  1.00 0.00 ? 55 PHE A HB2  6  
ATOM 6356  H HB3  . PHE A 1 55 ? 7.819   -4.357  -4.564  1.00 0.00 ? 55 PHE A HB3  6  
ATOM 6357  H HD1  . PHE A 1 55 ? 4.233   -4.989  -5.400  1.00 0.00 ? 55 PHE A HD1  6  
ATOM 6358  H HD2  . PHE A 1 55 ? 7.282   -4.970  -2.430  1.00 0.00 ? 55 PHE A HD2  6  
ATOM 6359  H HE1  . PHE A 1 55 ? 2.610   -5.789  -3.733  1.00 0.00 ? 55 PHE A HE1  6  
ATOM 6360  H HE2  . PHE A 1 55 ? 5.664   -5.770  -0.758  1.00 0.00 ? 55 PHE A HE2  6  
ATOM 6361  H HZ   . PHE A 1 55 ? 3.324   -6.181  -1.409  1.00 0.00 ? 55 PHE A HZ   6  
ATOM 6362  N N    . GLN A 1 56 ? 8.380   -2.616  -7.098  1.00 0.00 ? 56 GLN A N    6  
ATOM 6363  C CA   . GLN A 1 56 ? 9.602   -1.937  -7.514  1.00 0.00 ? 56 GLN A CA   6  
ATOM 6364  C C    . GLN A 1 56 ? 9.389   -0.428  -7.585  1.00 0.00 ? 56 GLN A C    6  
ATOM 6365  O O    . GLN A 1 56 ? 10.098  0.339   -6.935  1.00 0.00 ? 56 GLN A O    6  
ATOM 6366  C CB   . GLN A 1 56 ? 10.065  -2.463  -8.873  1.00 0.00 ? 56 GLN A CB   6  
ATOM 6367  C CG   . GLN A 1 56 ? 10.845  -3.765  -8.788  1.00 0.00 ? 56 GLN A CG   6  
ATOM 6368  C CD   . GLN A 1 56 ? 11.850  -3.918  -9.912  1.00 0.00 ? 56 GLN A CD   6  
ATOM 6369  O OE1  . GLN A 1 56 ? 13.056  -3.995  -9.676  1.00 0.00 ? 56 GLN A OE1  6  
ATOM 6370  N NE2  . GLN A 1 56 ? 11.358  -3.962  -11.145 1.00 0.00 ? 56 GLN A NE2  6  
ATOM 6371  H H    . GLN A 1 56 ? 8.013   -3.327  -7.663  1.00 0.00 ? 56 GLN A H    6  
ATOM 6372  H HA   . GLN A 1 56 ? 10.364  -2.146  -6.778  1.00 0.00 ? 56 GLN A HA   6  
ATOM 6373  H HB2  . GLN A 1 56 ? 9.199   -2.626  -9.497  1.00 0.00 ? 56 GLN A HB2  6  
ATOM 6374  H HB3  . GLN A 1 56 ? 10.698  -1.720  -9.337  1.00 0.00 ? 56 GLN A HB3  6  
ATOM 6375  H HG2  . GLN A 1 56 ? 11.374  -3.792  -7.847  1.00 0.00 ? 56 GLN A HG2  6  
ATOM 6376  H HG3  . GLN A 1 56 ? 10.149  -4.589  -8.832  1.00 0.00 ? 56 GLN A HG3  6  
ATOM 6377  H HE21 . GLN A 1 56 ? 10.386  -3.893  -11.258 1.00 0.00 ? 56 GLN A HE21 6  
ATOM 6378  H HE22 . GLN A 1 56 ? 11.985  -4.060  -11.891 1.00 0.00 ? 56 GLN A HE22 6  
ATOM 6379  N N    . ASN A 1 57 ? 8.408   -0.010  -8.379  1.00 0.00 ? 57 ASN A N    6  
ATOM 6380  C CA   . ASN A 1 57 ? 8.103   1.407   -8.535  1.00 0.00 ? 57 ASN A CA   6  
ATOM 6381  C C    . ASN A 1 57 ? 7.795   2.049   -7.186  1.00 0.00 ? 57 ASN A C    6  
ATOM 6382  O O    . ASN A 1 57 ? 8.369   3.079   -6.832  1.00 0.00 ? 57 ASN A O    6  
ATOM 6383  C CB   . ASN A 1 57 ? 6.916   1.593   -9.483  1.00 0.00 ? 57 ASN A CB   6  
ATOM 6384  C CG   . ASN A 1 57 ? 7.320   1.490   -10.941 1.00 0.00 ? 57 ASN A CG   6  
ATOM 6385  O OD1  . ASN A 1 57 ? 7.597   2.497   -11.593 1.00 0.00 ? 57 ASN A OD1  6  
ATOM 6386  N ND2  . ASN A 1 57 ? 7.356   0.268   -11.461 1.00 0.00 ? 57 ASN A ND2  6  
ATOM 6387  H H    . ASN A 1 57 ? 7.877   -0.671  -8.871  1.00 0.00 ? 57 ASN A H    6  
ATOM 6388  H HA   . ASN A 1 57 ? 8.971   1.888   -8.960  1.00 0.00 ? 57 ASN A HA   6  
ATOM 6389  H HB2  . ASN A 1 57 ? 6.178   0.831   -9.280  1.00 0.00 ? 57 ASN A HB2  6  
ATOM 6390  H HB3  . ASN A 1 57 ? 6.479   2.566   -9.317  1.00 0.00 ? 57 ASN A HB3  6  
ATOM 6391  H HD21 . ASN A 1 57 ? 7.123   -0.488  -10.882 1.00 0.00 ? 57 ASN A HD21 6  
ATOM 6392  H HD22 . ASN A 1 57 ? 7.614   0.173   -12.401 1.00 0.00 ? 57 ASN A HD22 6  
ATOM 6393  N N    . ALA A 1 58 ? 6.886   1.434   -6.437  1.00 0.00 ? 58 ALA A N    6  
ATOM 6394  C CA   . ALA A 1 58 ? 6.504   1.943   -5.126  1.00 0.00 ? 58 ALA A CA   6  
ATOM 6395  C C    . ALA A 1 58 ? 7.728   2.382   -4.330  1.00 0.00 ? 58 ALA A C    6  
ATOM 6396  O O    . ALA A 1 58 ? 7.701   3.406   -3.646  1.00 0.00 ? 58 ALA A O    6  
ATOM 6397  C CB   . ALA A 1 58 ? 5.722   0.888   -4.357  1.00 0.00 ? 58 ALA A CB   6  
ATOM 6398  H H    . ALA A 1 58 ? 6.464   0.616   -6.774  1.00 0.00 ? 58 ALA A H    6  
ATOM 6399  H HA   . ALA A 1 58 ? 5.858   2.797   -5.275  1.00 0.00 ? 58 ALA A HA   6  
ATOM 6400  H HB1  . ALA A 1 58 ? 6.339   0.012   -4.222  1.00 0.00 ? 58 ALA A HB1  6  
ATOM 6401  H HB2  . ALA A 1 58 ? 5.440   1.282   -3.392  1.00 0.00 ? 58 ALA A HB2  6  
ATOM 6402  H HB3  . ALA A 1 58 ? 4.835   0.623   -4.912  1.00 0.00 ? 58 ALA A HB3  6  
ATOM 6403  N N    . ARG A 1 59 ? 8.800   1.602   -4.422  1.00 0.00 ? 59 ARG A N    6  
ATOM 6404  C CA   . ARG A 1 59 ? 10.033  1.910   -3.709  1.00 0.00 ? 59 ARG A CA   6  
ATOM 6405  C C    . ARG A 1 59 ? 10.690  3.166   -4.275  1.00 0.00 ? 59 ARG A C    6  
ATOM 6406  O O    . ARG A 1 59 ? 11.141  4.033   -3.526  1.00 0.00 ? 59 ARG A O    6  
ATOM 6407  C CB   . ARG A 1 59 ? 11.005  0.732   -3.794  1.00 0.00 ? 59 ARG A CB   6  
ATOM 6408  C CG   . ARG A 1 59 ? 10.579  -0.469  -2.966  1.00 0.00 ? 59 ARG A CG   6  
ATOM 6409  C CD   . ARG A 1 59 ? 11.766  -1.351  -2.612  1.00 0.00 ? 59 ARG A CD   6  
ATOM 6410  N NE   . ARG A 1 59 ? 12.459  -1.840  -3.801  1.00 0.00 ? 59 ARG A NE   6  
ATOM 6411  C CZ   . ARG A 1 59 ? 11.997  -2.819  -4.570  1.00 0.00 ? 59 ARG A CZ   6  
ATOM 6412  N NH1  . ARG A 1 59 ? 10.847  -3.411  -4.276  1.00 0.00 ? 59 ARG A NH1  6  
ATOM 6413  N NH2  . ARG A 1 59 ? 12.685  -3.209  -5.636  1.00 0.00 ? 59 ARG A NH2  6  
ATOM 6414  H H    . ARG A 1 59 ? 8.760   0.800   -4.984  1.00 0.00 ? 59 ARG A H    6  
ATOM 6415  H HA   . ARG A 1 59 ? 9.783   2.085   -2.673  1.00 0.00 ? 59 ARG A HA   6  
ATOM 6416  H HB2  . ARG A 1 59 ? 11.085  0.420   -4.825  1.00 0.00 ? 59 ARG A HB2  6  
ATOM 6417  H HB3  . ARG A 1 59 ? 11.975  1.055   -3.447  1.00 0.00 ? 59 ARG A HB3  6  
ATOM 6418  H HG2  . ARG A 1 59 ? 10.119  -0.121  -2.053  1.00 0.00 ? 59 ARG A HG2  6  
ATOM 6419  H HG3  . ARG A 1 59 ? 9.866   -1.050  -3.532  1.00 0.00 ? 59 ARG A HG3  6  
ATOM 6420  H HD2  . ARG A 1 59 ? 12.459  -0.777  -2.014  1.00 0.00 ? 59 ARG A HD2  6  
ATOM 6421  H HD3  . ARG A 1 59 ? 11.412  -2.195  -2.039  1.00 0.00 ? 59 ARG A HD3  6  
ATOM 6422  H HE   . ARG A 1 59 ? 13.311  -1.417  -4.036  1.00 0.00 ? 59 ARG A HE   6  
ATOM 6423  H HH11 . ARG A 1 59 ? 10.326  -3.119  -3.474  1.00 0.00 ? 59 ARG A HH11 6  
ATOM 6424  H HH12 . ARG A 1 59 ? 10.501  -4.148  -4.857  1.00 0.00 ? 59 ARG A HH12 6  
ATOM 6425  H HH21 . ARG A 1 59 ? 13.552  -2.765  -5.860  1.00 0.00 ? 59 ARG A HH21 6  
ATOM 6426  H HH22 . ARG A 1 59 ? 12.336  -3.946  -6.213  1.00 0.00 ? 59 ARG A HH22 6  
ATOM 6427  N N    . GLN A 1 60 ? 10.739  3.256   -5.600  1.00 0.00 ? 60 GLN A N    6  
ATOM 6428  C CA   . GLN A 1 60 ? 11.341  4.405   -6.265  1.00 0.00 ? 60 GLN A CA   6  
ATOM 6429  C C    . GLN A 1 60 ? 10.656  5.701   -5.841  1.00 0.00 ? 60 GLN A C    6  
ATOM 6430  O O    . GLN A 1 60 ? 11.313  6.716   -5.609  1.00 0.00 ? 60 GLN A O    6  
ATOM 6431  C CB   . GLN A 1 60 ? 11.257  4.244   -7.784  1.00 0.00 ? 60 GLN A CB   6  
ATOM 6432  C CG   . GLN A 1 60 ? 12.054  3.063   -8.315  1.00 0.00 ? 60 GLN A CG   6  
ATOM 6433  C CD   . GLN A 1 60 ? 11.756  2.766   -9.772  1.00 0.00 ? 60 GLN A CD   6  
ATOM 6434  O OE1  . GLN A 1 60 ? 10.917  1.921   -10.086 1.00 0.00 ? 60 GLN A OE1  6  
ATOM 6435  N NE2  . GLN A 1 60 ? 12.443  3.462   -10.671 1.00 0.00 ? 60 GLN A NE2  6  
ATOM 6436  H H    . GLN A 1 60 ? 10.362  2.533   -6.142  1.00 0.00 ? 60 GLN A H    6  
ATOM 6437  H HA   . GLN A 1 60 ? 12.380  4.450   -5.974  1.00 0.00 ? 60 GLN A HA   6  
ATOM 6438  H HB2  . GLN A 1 60 ? 10.223  4.108   -8.063  1.00 0.00 ? 60 GLN A HB2  6  
ATOM 6439  H HB3  . GLN A 1 60 ? 11.632  5.143   -8.251  1.00 0.00 ? 60 GLN A HB3  6  
ATOM 6440  H HG2  . GLN A 1 60 ? 13.107  3.282   -8.217  1.00 0.00 ? 60 GLN A HG2  6  
ATOM 6441  H HG3  . GLN A 1 60 ? 11.812  2.190   -7.728  1.00 0.00 ? 60 GLN A HG3  6  
ATOM 6442  H HE21 . GLN A 1 60 ? 13.096  4.118   -10.347 1.00 0.00 ? 60 GLN A HE21 6  
ATOM 6443  H HE22 . GLN A 1 60 ? 12.271  3.290   -11.619 1.00 0.00 ? 60 GLN A HE22 6  
ATOM 6444  N N    . LYS A 1 61 ? 9.332   5.659   -5.742  1.00 0.00 ? 61 LYS A N    6  
ATOM 6445  C CA   . LYS A 1 61 ? 8.557   6.828   -5.345  1.00 0.00 ? 61 LYS A CA   6  
ATOM 6446  C C    . LYS A 1 61 ? 8.858   7.216   -3.901  1.00 0.00 ? 61 LYS A C    6  
ATOM 6447  O O    . LYS A 1 61 ? 9.021   8.394   -3.585  1.00 0.00 ? 61 LYS A O    6  
ATOM 6448  C CB   . LYS A 1 61 ? 7.060   6.554   -5.509  1.00 0.00 ? 61 LYS A CB   6  
ATOM 6449  C CG   . LYS A 1 61 ? 6.618   6.441   -6.958  1.00 0.00 ? 61 LYS A CG   6  
ATOM 6450  C CD   . LYS A 1 61 ? 5.124   6.674   -7.104  1.00 0.00 ? 61 LYS A CD   6  
ATOM 6451  C CE   . LYS A 1 61 ? 4.656   6.416   -8.529  1.00 0.00 ? 61 LYS A CE   6  
ATOM 6452  N NZ   . LYS A 1 61 ? 5.287   7.353   -9.498  1.00 0.00 ? 61 LYS A NZ   6  
ATOM 6453  H H    . LYS A 1 61 ? 8.864   4.820   -5.940  1.00 0.00 ? 61 LYS A H    6  
ATOM 6454  H HA   . LYS A 1 61 ? 8.837   7.647   -5.990  1.00 0.00 ? 61 LYS A HA   6  
ATOM 6455  H HB2  . LYS A 1 61 ? 6.819   5.627   -5.008  1.00 0.00 ? 61 LYS A HB2  6  
ATOM 6456  H HB3  . LYS A 1 61 ? 6.506   7.358   -5.047  1.00 0.00 ? 61 LYS A HB3  6  
ATOM 6457  H HG2  . LYS A 1 61 ? 7.146   7.179   -7.544  1.00 0.00 ? 61 LYS A HG2  6  
ATOM 6458  H HG3  . LYS A 1 61 ? 6.857   5.452   -7.322  1.00 0.00 ? 61 LYS A HG3  6  
ATOM 6459  H HD2  . LYS A 1 61 ? 4.597   6.007   -6.438  1.00 0.00 ? 61 LYS A HD2  6  
ATOM 6460  H HD3  . LYS A 1 61 ? 4.900   7.699   -6.842  1.00 0.00 ? 61 LYS A HD3  6  
ATOM 6461  H HE2  . LYS A 1 61 ? 4.914   5.403   -8.800  1.00 0.00 ? 61 LYS A HE2  6  
ATOM 6462  H HE3  . LYS A 1 61 ? 3.584   6.537   -8.569  1.00 0.00 ? 61 LYS A HE3  6  
ATOM 6463  H HZ1  . LYS A 1 61 ? 6.034   6.865   -10.033 1.00 0.00 ? 61 LYS A HZ1  6  
ATOM 6464  H HZ2  . LYS A 1 61 ? 5.708   8.159   -8.994  1.00 0.00 ? 61 LYS A HZ2  6  
ATOM 6465  H HZ3  . LYS A 1 61 ? 4.574   7.710   -10.166 1.00 0.00 ? 61 LYS A HZ3  6  
ATOM 6466  N N    . ALA A 1 62 ? 8.931   6.216   -3.028  1.00 0.00 ? 62 ALA A N    6  
ATOM 6467  C CA   . ALA A 1 62 ? 9.216   6.453   -1.618  1.00 0.00 ? 62 ALA A CA   6  
ATOM 6468  C C    . ALA A 1 62 ? 10.559  7.152   -1.439  1.00 0.00 ? 62 ALA A C    6  
ATOM 6469  O O    . ALA A 1 62 ? 10.689  8.067   -0.626  1.00 0.00 ? 62 ALA A O    6  
ATOM 6470  C CB   . ALA A 1 62 ? 9.195   5.140   -0.848  1.00 0.00 ? 62 ALA A CB   6  
ATOM 6471  H H    . ALA A 1 62 ? 8.791   5.298   -3.340  1.00 0.00 ? 62 ALA A H    6  
ATOM 6472  H HA   . ALA A 1 62 ? 8.435   7.086   -1.221  1.00 0.00 ? 62 ALA A HA   6  
ATOM 6473  H HB1  . ALA A 1 62 ? 8.186   4.928   -0.526  1.00 0.00 ? 62 ALA A HB1  6  
ATOM 6474  H HB2  . ALA A 1 62 ? 9.545   4.343   -1.487  1.00 0.00 ? 62 ALA A HB2  6  
ATOM 6475  H HB3  . ALA A 1 62 ? 9.840   5.220   0.015   1.00 0.00 ? 62 ALA A HB3  6  
ATOM 6476  N N    . ARG A 1 63 ? 11.555  6.716   -2.203  1.00 0.00 ? 63 ARG A N    6  
ATOM 6477  C CA   . ARG A 1 63 ? 12.888  7.300   -2.127  1.00 0.00 ? 63 ARG A CA   6  
ATOM 6478  C C    . ARG A 1 63 ? 12.811  8.797   -1.842  1.00 0.00 ? 63 ARG A C    6  
ATOM 6479  O O    . ARG A 1 63 ? 12.133  9.541   -2.551  1.00 0.00 ? 63 ARG A O    6  
ATOM 6480  C CB   . ARG A 1 63 ? 13.650  7.057   -3.432  1.00 0.00 ? 63 ARG A CB   6  
ATOM 6481  C CG   . ARG A 1 63 ? 14.049  5.606   -3.643  1.00 0.00 ? 63 ARG A CG   6  
ATOM 6482  C CD   . ARG A 1 63 ? 15.243  5.225   -2.781  1.00 0.00 ? 63 ARG A CD   6  
ATOM 6483  N NE   . ARG A 1 63 ? 16.483  5.821   -3.271  1.00 0.00 ? 63 ARG A NE   6  
ATOM 6484  C CZ   . ARG A 1 63 ? 17.233  5.279   -4.223  1.00 0.00 ? 63 ARG A CZ   6  
ATOM 6485  N NH1  . ARG A 1 63 ? 16.870  4.134   -4.786  1.00 0.00 ? 63 ARG A NH1  6  
ATOM 6486  N NH2  . ARG A 1 63 ? 18.348  5.881   -4.615  1.00 0.00 ? 63 ARG A NH2  6  
ATOM 6487  H H    . ARG A 1 63 ? 11.389  5.983   -2.833  1.00 0.00 ? 63 ARG A H    6  
ATOM 6488  H HA   . ARG A 1 63 ? 13.416  6.818   -1.318  1.00 0.00 ? 63 ARG A HA   6  
ATOM 6489  H HB2  . ARG A 1 63 ? 13.027  7.360   -4.260  1.00 0.00 ? 63 ARG A HB2  6  
ATOM 6490  H HB3  . ARG A 1 63 ? 14.547  7.657   -3.428  1.00 0.00 ? 63 ARG A HB3  6  
ATOM 6491  H HG2  . ARG A 1 63 ? 13.215  4.971   -3.382  1.00 0.00 ? 63 ARG A HG2  6  
ATOM 6492  H HG3  . ARG A 1 63 ? 14.305  5.460   -4.682  1.00 0.00 ? 63 ARG A HG3  6  
ATOM 6493  H HD2  . ARG A 1 63 ? 15.065  5.566   -1.772  1.00 0.00 ? 63 ARG A HD2  6  
ATOM 6494  H HD3  . ARG A 1 63 ? 15.344  4.150   -2.785  1.00 0.00 ? 63 ARG A HD3  6  
ATOM 6495  H HE   . ARG A 1 63 ? 16.770  6.667   -2.868  1.00 0.00 ? 63 ARG A HE   6  
ATOM 6496  H HH11 . ARG A 1 63 ? 16.030  3.679   -4.494  1.00 0.00 ? 63 ARG A HH11 6  
ATOM 6497  H HH12 . ARG A 1 63 ? 17.436  3.729   -5.505  1.00 0.00 ? 63 ARG A HH12 6  
ATOM 6498  H HH21 . ARG A 1 63 ? 18.625  6.744   -4.193  1.00 0.00 ? 63 ARG A HH21 6  
ATOM 6499  H HH22 . ARG A 1 63 ? 18.912  5.472   -5.332  1.00 0.00 ? 63 ARG A HH22 6  
ATOM 6500  N N    . LYS A 1 64 ? 13.510  9.231   -0.799  1.00 0.00 ? 64 LYS A N    6  
ATOM 6501  C CA   . LYS A 1 64 ? 13.522  10.639  -0.419  1.00 0.00 ? 64 LYS A CA   6  
ATOM 6502  C C    . LYS A 1 64 ? 14.636  10.922  0.584   1.00 0.00 ? 64 LYS A C    6  
ATOM 6503  O O    . LYS A 1 64 ? 15.002  10.058  1.381   1.00 0.00 ? 64 LYS A O    6  
ATOM 6504  C CB   . LYS A 1 64 ? 12.171  11.040  0.178   1.00 0.00 ? 64 LYS A CB   6  
ATOM 6505  C CG   . LYS A 1 64 ? 12.005  12.539  0.356   1.00 0.00 ? 64 LYS A CG   6  
ATOM 6506  C CD   . LYS A 1 64 ? 10.643  12.884  0.933   1.00 0.00 ? 64 LYS A CD   6  
ATOM 6507  C CE   . LYS A 1 64 ? 10.542  14.362  1.279   1.00 0.00 ? 64 LYS A CE   6  
ATOM 6508  N NZ   . LYS A 1 64 ? 11.062  14.649  2.645   1.00 0.00 ? 64 LYS A NZ   6  
ATOM 6509  H H    . LYS A 1 64 ? 14.031  8.590   -0.272  1.00 0.00 ? 64 LYS A H    6  
ATOM 6510  H HA   . LYS A 1 64 ? 13.700  11.222  -1.310  1.00 0.00 ? 64 LYS A HA   6  
ATOM 6511  H HB2  . LYS A 1 64 ? 11.385  10.687  -0.474  1.00 0.00 ? 64 LYS A HB2  6  
ATOM 6512  H HB3  . LYS A 1 64 ? 12.064  10.569  1.144   1.00 0.00 ? 64 LYS A HB3  6  
ATOM 6513  H HG2  . LYS A 1 64 ? 12.770  12.899  1.028   1.00 0.00 ? 64 LYS A HG2  6  
ATOM 6514  H HG3  . LYS A 1 64 ? 12.112  13.021  -0.605  1.00 0.00 ? 64 LYS A HG3  6  
ATOM 6515  H HD2  . LYS A 1 64 ? 9.882   12.644  0.206   1.00 0.00 ? 64 LYS A HD2  6  
ATOM 6516  H HD3  . LYS A 1 64 ? 10.483  12.302  1.830   1.00 0.00 ? 64 LYS A HD3  6  
ATOM 6517  H HE2  . LYS A 1 64 ? 11.115  14.926  0.559   1.00 0.00 ? 64 LYS A HE2  6  
ATOM 6518  H HE3  . LYS A 1 64 ? 9.506   14.660  1.228   1.00 0.00 ? 64 LYS A HE3  6  
ATOM 6519  H HZ1  . LYS A 1 64 ? 11.754  15.425  2.608   1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 6520  H HZ2  . LYS A 1 64 ? 11.527  13.804  3.035   1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 6521  H HZ3  . LYS A 1 64 ? 10.282  14.924  3.274   1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 6522  N N    . SER A 1 65 ? 15.171  12.138  0.540   1.00 0.00 ? 65 SER A N    6  
ATOM 6523  C CA   . SER A 1 65 ? 16.245  12.534  1.444   1.00 0.00 ? 65 SER A CA   6  
ATOM 6524  C C    . SER A 1 65 ? 15.713  13.424  2.563   1.00 0.00 ? 65 SER A C    6  
ATOM 6525  O O    . SER A 1 65 ? 15.807  13.082  3.741   1.00 0.00 ? 65 SER A O    6  
ATOM 6526  C CB   . SER A 1 65 ? 17.345  13.267  0.673   1.00 0.00 ? 65 SER A CB   6  
ATOM 6527  O OG   . SER A 1 65 ? 18.351  13.743  1.549   1.00 0.00 ? 65 SER A OG   6  
ATOM 6528  H H    . SER A 1 65 ? 14.837  12.784  -0.118  1.00 0.00 ? 65 SER A H    6  
ATOM 6529  H HA   . SER A 1 65 ? 16.659  11.637  1.879   1.00 0.00 ? 65 SER A HA   6  
ATOM 6530  H HB2  . SER A 1 65 ? 17.794  12.591  -0.039  1.00 0.00 ? 65 SER A HB2  6  
ATOM 6531  H HB3  . SER A 1 65 ? 16.913  14.108  0.148   1.00 0.00 ? 65 SER A HB3  6  
ATOM 6532  H HG   . SER A 1 65 ? 18.824  12.998  1.928   1.00 0.00 ? 65 SER A HG   6  
ATOM 6533  N N    . GLY A 1 66 ? 15.154  14.570  2.184   1.00 0.00 ? 66 GLY A N    6  
ATOM 6534  C CA   . GLY A 1 66 ? 14.615  15.492  3.167   1.00 0.00 ? 66 GLY A CA   6  
ATOM 6535  C C    . GLY A 1 66 ? 15.636  16.515  3.623   1.00 0.00 ? 66 GLY A C    6  
ATOM 6536  O O    . GLY A 1 66 ? 16.832  16.234  3.710   1.00 0.00 ? 66 GLY A O    6  
ATOM 6537  H H    . GLY A 1 66 ? 15.107  14.790  1.230   1.00 0.00 ? 66 GLY A H    6  
ATOM 6538  H HA2  . GLY A 1 66 ? 13.771  16.009  2.734   1.00 0.00 ? 66 GLY A HA2  6  
ATOM 6539  H HA3  . GLY A 1 66 ? 14.278  14.929  4.025   1.00 0.00 ? 66 GLY A HA3  6  
ATOM 6540  N N    . PRO A 1 67 ? 15.165  17.735  3.922   1.00 0.00 ? 67 PRO A N    6  
ATOM 6541  C CA   . PRO A 1 67 ? 16.029  18.828  4.376   1.00 0.00 ? 67 PRO A CA   6  
ATOM 6542  C C    . PRO A 1 67 ? 16.579  18.589  5.778   1.00 0.00 ? 67 PRO A C    6  
ATOM 6543  O O    . PRO A 1 67 ? 15.866  18.114  6.662   1.00 0.00 ? 67 PRO A O    6  
ATOM 6544  C CB   . PRO A 1 67 ? 15.099  20.043  4.366   1.00 0.00 ? 67 PRO A CB   6  
ATOM 6545  C CG   . PRO A 1 67 ? 13.732  19.475  4.533   1.00 0.00 ? 67 PRO A CG   6  
ATOM 6546  C CD   . PRO A 1 67 ? 13.751  18.140  3.842   1.00 0.00 ? 67 PRO A CD   6  
ATOM 6547  H HA   . PRO A 1 67 ? 16.849  18.995  3.693   1.00 0.00 ? 67 PRO A HA   6  
ATOM 6548  H HB2  . PRO A 1 67 ? 15.356  20.703  5.183   1.00 0.00 ? 67 PRO A HB2  6  
ATOM 6549  H HB3  . PRO A 1 67 ? 15.196  20.568  3.428   1.00 0.00 ? 67 PRO A HB3  6  
ATOM 6550  H HG2  . PRO A 1 67 ? 13.511  19.351  5.582   1.00 0.00 ? 67 PRO A HG2  6  
ATOM 6551  H HG3  . PRO A 1 67 ? 13.005  20.126  4.069   1.00 0.00 ? 67 PRO A HG3  6  
ATOM 6552  H HD2  . PRO A 1 67 ? 13.118  17.436  4.361   1.00 0.00 ? 67 PRO A HD2  6  
ATOM 6553  H HD3  . PRO A 1 67 ? 13.439  18.243  2.813   1.00 0.00 ? 67 PRO A HD3  6  
ATOM 6554  N N    . SER A 1 68 ? 17.851  18.922  5.975   1.00 0.00 ? 68 SER A N    6  
ATOM 6555  C CA   . SER A 1 68 ? 18.497  18.740  7.269   1.00 0.00 ? 68 SER A CA   6  
ATOM 6556  C C    . SER A 1 68 ? 17.671  19.376  8.383   1.00 0.00 ? 68 SER A C    6  
ATOM 6557  O O    . SER A 1 68 ? 17.183  20.498  8.246   1.00 0.00 ? 68 SER A O    6  
ATOM 6558  C CB   . SER A 1 68 ? 19.902  19.346  7.251   1.00 0.00 ? 68 SER A CB   6  
ATOM 6559  O OG   . SER A 1 68 ? 19.851  20.756  7.386   1.00 0.00 ? 68 SER A OG   6  
ATOM 6560  H H    . SER A 1 68 ? 18.367  19.296  5.230   1.00 0.00 ? 68 SER A H    6  
ATOM 6561  H HA   . SER A 1 68 ? 18.574  17.679  7.455   1.00 0.00 ? 68 SER A HA   6  
ATOM 6562  H HB2  . SER A 1 68 ? 20.477  18.939  8.069   1.00 0.00 ? 68 SER A HB2  6  
ATOM 6563  H HB3  . SER A 1 68 ? 20.384  19.102  6.315   1.00 0.00 ? 68 SER A HB3  6  
ATOM 6564  H HG   . SER A 1 68 ? 19.224  21.115  6.754   1.00 0.00 ? 68 SER A HG   6  
ATOM 6565  N N    . SER A 1 69 ? 17.518  18.651  9.486   1.00 0.00 ? 69 SER A N    6  
ATOM 6566  C CA   . SER A 1 69 ? 16.748  19.141  10.623  1.00 0.00 ? 69 SER A CA   6  
ATOM 6567  C C    . SER A 1 69 ? 17.668  19.729  11.689  1.00 0.00 ? 69 SER A C    6  
ATOM 6568  O O    . SER A 1 69 ? 18.808  19.294  11.850  1.00 0.00 ? 69 SER A O    6  
ATOM 6569  C CB   . SER A 1 69 ? 15.909  18.011  11.223  1.00 0.00 ? 69 SER A CB   6  
ATOM 6570  O OG   . SER A 1 69 ? 16.732  16.948  11.671  1.00 0.00 ? 69 SER A OG   6  
ATOM 6571  H H    . SER A 1 69 ? 17.932  17.763  9.535   1.00 0.00 ? 69 SER A H    6  
ATOM 6572  H HA   . SER A 1 69 ? 16.088  19.918  10.266  1.00 0.00 ? 69 SER A HA   6  
ATOM 6573  H HB2  . SER A 1 69 ? 15.345  18.391  12.061  1.00 0.00 ? 69 SER A HB2  6  
ATOM 6574  H HB3  . SER A 1 69 ? 15.230  17.634  10.473  1.00 0.00 ? 69 SER A HB3  6  
ATOM 6575  H HG   . SER A 1 69 ? 17.532  17.305  12.063  1.00 0.00 ? 69 SER A HG   6  
ATOM 6576  N N    . GLY A 1 70 ? 17.163  20.721  12.416  1.00 0.00 ? 70 GLY A N    6  
ATOM 6577  C CA   . GLY A 1 70 ? 17.951  21.353  13.458  1.00 0.00 ? 70 GLY A CA   6  
ATOM 6578  C C    . GLY A 1 70 ? 18.653  20.345  14.346  1.00 0.00 ? 70 GLY A C    6  
ATOM 6579  O O    . GLY A 1 70 ? 19.703  20.637  14.919  1.00 0.00 ? 70 GLY A O    6  
ATOM 6580  H H    . GLY A 1 70 ? 16.247  21.026  12.244  1.00 0.00 ? 70 GLY A H    6  
ATOM 6581  H HA2  . GLY A 1 70 ? 18.691  21.989  12.998  1.00 0.00 ? 70 GLY A HA2  6  
ATOM 6582  H HA3  . GLY A 1 70 ? 17.298  21.960  14.069  1.00 0.00 ? 70 GLY A HA3  6  
ATOM 6583  N N    . GLY A 1 1  ? -13.947 -8.287  -14.116 1.00 0.00 ? 1  GLY A N    7  
ATOM 6584  C CA   . GLY A 1 1  ? -12.679 -8.988  -14.211 1.00 0.00 ? 1  GLY A CA   7  
ATOM 6585  C C    . GLY A 1 1  ? -11.536 -8.070  -14.594 1.00 0.00 ? 1  GLY A C    7  
ATOM 6586  O O    . GLY A 1 1  ? -11.431 -6.953  -14.087 1.00 0.00 ? 1  GLY A O    7  
ATOM 6587  H H1   . GLY A 1 1  ? -14.692 -8.546  -14.697 1.00 0.00 ? 1  GLY A H1   7  
ATOM 6588  H HA2  . GLY A 1 1  ? -12.459 -9.442  -13.256 1.00 0.00 ? 1  GLY A HA2  7  
ATOM 6589  H HA3  . GLY A 1 1  ? -12.766 -9.766  -14.956 1.00 0.00 ? 1  GLY A HA3  7  
ATOM 6590  N N    . SER A 1 2  ? -10.675 -8.541  -15.490 1.00 0.00 ? 2  SER A N    7  
ATOM 6591  C CA   . SER A 1 2  ? -9.530  -7.757  -15.937 1.00 0.00 ? 2  SER A CA   7  
ATOM 6592  C C    . SER A 1 2  ? -9.675  -7.372  -17.406 1.00 0.00 ? 2  SER A C    7  
ATOM 6593  O O    . SER A 1 2  ? -9.636  -8.227  -18.290 1.00 0.00 ? 2  SER A O    7  
ATOM 6594  C CB   . SER A 1 2  ? -8.234  -8.543  -15.730 1.00 0.00 ? 2  SER A CB   7  
ATOM 6595  O OG   . SER A 1 2  ? -7.926  -8.664  -14.352 1.00 0.00 ? 2  SER A OG   7  
ATOM 6596  H H    . SER A 1 2  ? -10.813 -9.440  -15.858 1.00 0.00 ? 2  SER A H    7  
ATOM 6597  H HA   . SER A 1 2  ? -9.493  -6.856  -15.343 1.00 0.00 ? 2  SER A HA   7  
ATOM 6598  H HB2  . SER A 1 2  ? -8.345  -9.532  -16.150 1.00 0.00 ? 2  SER A HB2  7  
ATOM 6599  H HB3  . SER A 1 2  ? -7.422  -8.031  -16.225 1.00 0.00 ? 2  SER A HB3  7  
ATOM 6600  H HG   . SER A 1 2  ? -7.796  -9.590  -14.133 1.00 0.00 ? 2  SER A HG   7  
ATOM 6601  N N    . SER A 1 3  ? -9.844  -6.078  -17.658 1.00 0.00 ? 3  SER A N    7  
ATOM 6602  C CA   . SER A 1 3  ? -9.999  -5.578  -19.019 1.00 0.00 ? 3  SER A CA   7  
ATOM 6603  C C    . SER A 1 3  ? -9.873  -4.058  -19.058 1.00 0.00 ? 3  SER A C    7  
ATOM 6604  O O    . SER A 1 3  ? -9.996  -3.388  -18.033 1.00 0.00 ? 3  SER A O    7  
ATOM 6605  C CB   . SER A 1 3  ? -11.354 -6.003  -19.590 1.00 0.00 ? 3  SER A CB   7  
ATOM 6606  O OG   . SER A 1 3  ? -11.373 -5.882  -21.002 1.00 0.00 ? 3  SER A OG   7  
ATOM 6607  H H    . SER A 1 3  ? -9.867  -5.444  -16.910 1.00 0.00 ? 3  SER A H    7  
ATOM 6608  H HA   . SER A 1 3  ? -9.213  -6.008  -19.622 1.00 0.00 ? 3  SER A HA   7  
ATOM 6609  H HB2  . SER A 1 3  ? -11.545 -7.032  -19.326 1.00 0.00 ? 3  SER A HB2  7  
ATOM 6610  H HB3  . SER A 1 3  ? -12.129 -5.375  -19.176 1.00 0.00 ? 3  SER A HB3  7  
ATOM 6611  H HG   . SER A 1 3  ? -11.403 -4.954  -21.243 1.00 0.00 ? 3  SER A HG   7  
ATOM 6612  N N    . GLY A 1 4  ? -9.627  -3.520  -20.248 1.00 0.00 ? 4  GLY A N    7  
ATOM 6613  C CA   . GLY A 1 4  ? -9.488  -2.084  -20.400 1.00 0.00 ? 4  GLY A CA   7  
ATOM 6614  C C    . GLY A 1 4  ? -8.357  -1.706  -21.336 1.00 0.00 ? 4  GLY A C    7  
ATOM 6615  O O    . GLY A 1 4  ? -8.587  -1.112  -22.389 1.00 0.00 ? 4  GLY A O    7  
ATOM 6616  H H    . GLY A 1 4  ? -9.539  -4.104  -21.031 1.00 0.00 ? 4  GLY A H    7  
ATOM 6617  H HA2  . GLY A 1 4  ? -10.412 -1.683  -20.788 1.00 0.00 ? 4  GLY A HA2  7  
ATOM 6618  H HA3  . GLY A 1 4  ? -9.298  -1.648  -19.430 1.00 0.00 ? 4  GLY A HA3  7  
ATOM 6619  N N    . SER A 1 5  ? -7.133  -2.049  -20.950 1.00 0.00 ? 5  SER A N    7  
ATOM 6620  C CA   . SER A 1 5  ? -5.961  -1.737  -21.760 1.00 0.00 ? 5  SER A CA   7  
ATOM 6621  C C    . SER A 1 5  ? -6.203  -2.089  -23.225 1.00 0.00 ? 5  SER A C    7  
ATOM 6622  O O    . SER A 1 5  ? -7.219  -2.693  -23.569 1.00 0.00 ? 5  SER A O    7  
ATOM 6623  C CB   . SER A 1 5  ? -4.738  -2.494  -21.238 1.00 0.00 ? 5  SER A CB   7  
ATOM 6624  O OG   . SER A 1 5  ? -4.848  -3.883  -21.497 1.00 0.00 ? 5  SER A OG   7  
ATOM 6625  H H    . SER A 1 5  ? -7.014  -2.522  -20.099 1.00 0.00 ? 5  SER A H    7  
ATOM 6626  H HA   . SER A 1 5  ? -5.777  -0.676  -21.683 1.00 0.00 ? 5  SER A HA   7  
ATOM 6627  H HB2  . SER A 1 5  ? -3.851  -2.118  -21.725 1.00 0.00 ? 5  SER A HB2  7  
ATOM 6628  H HB3  . SER A 1 5  ? -4.654  -2.344  -20.171 1.00 0.00 ? 5  SER A HB3  7  
ATOM 6629  H HG   . SER A 1 5  ? -4.257  -4.123  -22.215 1.00 0.00 ? 5  SER A HG   7  
ATOM 6630  N N    . SER A 1 6  ? -5.263  -1.706  -24.083 1.00 0.00 ? 6  SER A N    7  
ATOM 6631  C CA   . SER A 1 6  ? -5.375  -1.976  -25.511 1.00 0.00 ? 6  SER A CA   7  
ATOM 6632  C C    . SER A 1 6  ? -4.647  -3.265  -25.879 1.00 0.00 ? 6  SER A C    7  
ATOM 6633  O O    . SER A 1 6  ? -3.995  -3.884  -25.039 1.00 0.00 ? 6  SER A O    7  
ATOM 6634  C CB   . SER A 1 6  ? -4.807  -0.808  -26.319 1.00 0.00 ? 6  SER A CB   7  
ATOM 6635  O OG   . SER A 1 6  ? -3.454  -0.562  -25.978 1.00 0.00 ? 6  SER A OG   7  
ATOM 6636  H H    . SER A 1 6  ? -4.476  -1.227  -23.746 1.00 0.00 ? 6  SER A H    7  
ATOM 6637  H HA   . SER A 1 6  ? -6.423  -2.090  -25.746 1.00 0.00 ? 6  SER A HA   7  
ATOM 6638  H HB2  . SER A 1 6  ? -4.864  -1.040  -27.372 1.00 0.00 ? 6  SER A HB2  7  
ATOM 6639  H HB3  . SER A 1 6  ? -5.385  0.082   -26.115 1.00 0.00 ? 6  SER A HB3  7  
ATOM 6640  H HG   . SER A 1 6  ? -2.884  -1.135  -26.496 1.00 0.00 ? 6  SER A HG   7  
ATOM 6641  N N    . GLY A 1 7  ? -4.763  -3.664  -27.142 1.00 0.00 ? 7  GLY A N    7  
ATOM 6642  C CA   . GLY A 1 7  ? -4.111  -4.877  -27.600 1.00 0.00 ? 7  GLY A CA   7  
ATOM 6643  C C    . GLY A 1 7  ? -2.620  -4.872  -27.326 1.00 0.00 ? 7  GLY A C    7  
ATOM 6644  O O    . GLY A 1 7  ? -2.061  -5.873  -26.876 1.00 0.00 ? 7  GLY A O    7  
ATOM 6645  H H    . GLY A 1 7  ? -5.295  -3.130  -27.768 1.00 0.00 ? 7  GLY A H    7  
ATOM 6646  H HA2  . GLY A 1 7  ? -4.556  -5.723  -27.098 1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6647  H HA3  . GLY A 1 7  ? -4.269  -4.978  -28.663 1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6648  N N    . ARG A 1 8  ? -1.973  -3.744  -27.600 1.00 0.00 ? 8  ARG A N    7  
ATOM 6649  C CA   . ARG A 1 8  ? -0.537  -3.615  -27.384 1.00 0.00 ? 8  ARG A CA   7  
ATOM 6650  C C    . ARG A 1 8  ? -0.232  -2.457  -26.437 1.00 0.00 ? 8  ARG A C    7  
ATOM 6651  O O    . ARG A 1 8  ? -0.114  -1.309  -26.863 1.00 0.00 ? 8  ARG A O    7  
ATOM 6652  C CB   . ARG A 1 8  ? 0.184   -3.402  -28.716 1.00 0.00 ? 8  ARG A CB   7  
ATOM 6653  C CG   . ARG A 1 8  ? -0.433  -2.309  -29.574 1.00 0.00 ? 8  ARG A CG   7  
ATOM 6654  C CD   . ARG A 1 8  ? 0.607   -1.648  -30.466 1.00 0.00 ? 8  ARG A CD   7  
ATOM 6655  N NE   . ARG A 1 8  ? 0.099   -0.426  -31.085 1.00 0.00 ? 8  ARG A NE   7  
ATOM 6656  C CZ   . ARG A 1 8  ? -0.608  -0.411  -32.209 1.00 0.00 ? 8  ARG A CZ   7  
ATOM 6657  N NH1  . ARG A 1 8  ? -0.890  -1.546  -32.834 1.00 0.00 ? 8  ARG A NH1  7  
ATOM 6658  N NH2  . ARG A 1 8  ? -1.035  0.741   -32.710 1.00 0.00 ? 8  ARG A NH2  7  
ATOM 6659  H H    . ARG A 1 8  ? -2.473  -2.981  -27.957 1.00 0.00 ? 8  ARG A H    7  
ATOM 6660  H HA   . ARG A 1 8  ? -0.185  -4.532  -26.937 1.00 0.00 ? 8  ARG A HA   7  
ATOM 6661  H HB2  . ARG A 1 8  ? 1.212   -3.135  -28.517 1.00 0.00 ? 8  ARG A HB2  7  
ATOM 6662  H HB3  . ARG A 1 8  ? 0.161   -4.325  -29.275 1.00 0.00 ? 8  ARG A HB3  7  
ATOM 6663  H HG2  . ARG A 1 8  ? -1.200  -2.744  -30.197 1.00 0.00 ? 8  ARG A HG2  7  
ATOM 6664  H HG3  . ARG A 1 8  ? -0.870  -1.562  -28.929 1.00 0.00 ? 8  ARG A HG3  7  
ATOM 6665  H HD2  . ARG A 1 8  ? 1.472   -1.404  -29.867 1.00 0.00 ? 8  ARG A HD2  7  
ATOM 6666  H HD3  . ARG A 1 8  ? 0.890   -2.343  -31.242 1.00 0.00 ? 8  ARG A HD3  7  
ATOM 6667  H HE   . ARG A 1 8  ? 0.296   0.424   -30.639 1.00 0.00 ? 8  ARG A HE   7  
ATOM 6668  H HH11 . ARG A 1 8  ? -0.570  -2.415  -32.458 1.00 0.00 ? 8  ARG A HH11 7  
ATOM 6669  H HH12 . ARG A 1 8  ? -1.424  -1.531  -33.680 1.00 0.00 ? 8  ARG A HH12 7  
ATOM 6670  H HH21 . ARG A 1 8  ? -0.824  1.599   -32.242 1.00 0.00 ? 8  ARG A HH21 7  
ATOM 6671  H HH22 . ARG A 1 8  ? -1.566  0.752   -33.556 1.00 0.00 ? 8  ARG A HH22 7  
ATOM 6672  N N    . SER A 1 9  ? -0.106  -2.769  -25.151 1.00 0.00 ? 9  SER A N    7  
ATOM 6673  C CA   . SER A 1 9  ? 0.181   -1.755  -24.144 1.00 0.00 ? 9  SER A CA   7  
ATOM 6674  C C    . SER A 1 9  ? 0.480   -2.400  -22.794 1.00 0.00 ? 9  SER A C    7  
ATOM 6675  O O    . SER A 1 9  ? -0.399  -2.991  -22.167 1.00 0.00 ? 9  SER A O    7  
ATOM 6676  C CB   . SER A 1 9  ? -0.999  -0.790  -24.010 1.00 0.00 ? 9  SER A CB   7  
ATOM 6677  O OG   . SER A 1 9  ? -0.592  0.436   -23.427 1.00 0.00 ? 9  SER A OG   7  
ATOM 6678  H H    . SER A 1 9  ? -0.211  -3.703  -24.874 1.00 0.00 ? 9  SER A H    7  
ATOM 6679  H HA   . SER A 1 9  ? 1.052   -1.203  -24.467 1.00 0.00 ? 9  SER A HA   7  
ATOM 6680  H HB2  . SER A 1 9  ? -1.409  -0.590  -24.988 1.00 0.00 ? 9  SER A HB2  7  
ATOM 6681  H HB3  . SER A 1 9  ? -1.758  -1.238  -23.385 1.00 0.00 ? 9  SER A HB3  7  
ATOM 6682  H HG   . SER A 1 9  ? -0.970  1.167   -23.921 1.00 0.00 ? 9  SER A HG   7  
ATOM 6683  N N    . SER A 1 10 ? 1.728   -2.280  -22.352 1.00 0.00 ? 10 SER A N    7  
ATOM 6684  C CA   . SER A 1 10 ? 2.146   -2.854  -21.078 1.00 0.00 ? 10 SER A CA   7  
ATOM 6685  C C    . SER A 1 10 ? 1.618   -2.027  -19.910 1.00 0.00 ? 10 SER A C    7  
ATOM 6686  O O    . SER A 1 10 ? 2.269   -1.087  -19.456 1.00 0.00 ? 10 SER A O    7  
ATOM 6687  C CB   . SER A 1 10 ? 3.672   -2.938  -21.009 1.00 0.00 ? 10 SER A CB   7  
ATOM 6688  O OG   . SER A 1 10 ? 4.087   -3.975  -20.136 1.00 0.00 ? 10 SER A OG   7  
ATOM 6689  H H    . SER A 1 10 ? 2.384   -1.797  -22.897 1.00 0.00 ? 10 SER A H    7  
ATOM 6690  H HA   . SER A 1 10 ? 1.736   -3.851  -21.013 1.00 0.00 ? 10 SER A HA   7  
ATOM 6691  H HB2  . SER A 1 10 ? 4.064   -3.136  -21.994 1.00 0.00 ? 10 SER A HB2  7  
ATOM 6692  H HB3  . SER A 1 10 ? 4.066   -2.000  -20.646 1.00 0.00 ? 10 SER A HB3  7  
ATOM 6693  H HG   . SER A 1 10 ? 4.020   -3.674  -19.227 1.00 0.00 ? 10 SER A HG   7  
ATOM 6694  N N    . ARG A 1 11 ? 0.432   -2.385  -19.429 1.00 0.00 ? 11 ARG A N    7  
ATOM 6695  C CA   . ARG A 1 11 ? -0.186  -1.676  -18.315 1.00 0.00 ? 11 ARG A CA   7  
ATOM 6696  C C    . ARG A 1 11 ? -1.058  -2.618  -17.488 1.00 0.00 ? 11 ARG A C    7  
ATOM 6697  O O    . ARG A 1 11 ? -1.566  -3.618  -17.995 1.00 0.00 ? 11 ARG A O    7  
ATOM 6698  C CB   . ARG A 1 11 ? -1.027  -0.507  -18.830 1.00 0.00 ? 11 ARG A CB   7  
ATOM 6699  C CG   . ARG A 1 11 ? -0.207  0.724   -19.183 1.00 0.00 ? 11 ARG A CG   7  
ATOM 6700  C CD   . ARG A 1 11 ? -1.022  1.723   -19.989 1.00 0.00 ? 11 ARG A CD   7  
ATOM 6701  N NE   . ARG A 1 11 ? -2.082  2.334   -19.192 1.00 0.00 ? 11 ARG A NE   7  
ATOM 6702  C CZ   . ARG A 1 11 ? -1.894  3.382   -18.398 1.00 0.00 ? 11 ARG A CZ   7  
ATOM 6703  N NH1  . ARG A 1 11 ? -0.692  3.933   -18.295 1.00 0.00 ? 11 ARG A NH1  7  
ATOM 6704  N NH2  . ARG A 1 11 ? -2.909  3.882   -17.705 1.00 0.00 ? 11 ARG A NH2  7  
ATOM 6705  H H    . ARG A 1 11 ? -0.040  -3.144  -19.833 1.00 0.00 ? 11 ARG A H    7  
ATOM 6706  H HA   . ARG A 1 11 ? 0.603   -1.292  -17.687 1.00 0.00 ? 11 ARG A HA   7  
ATOM 6707  H HB2  . ARG A 1 11 ? -1.559  -0.823  -19.715 1.00 0.00 ? 11 ARG A HB2  7  
ATOM 6708  H HB3  . ARG A 1 11 ? -1.742  -0.231  -18.069 1.00 0.00 ? 11 ARG A HB3  7  
ATOM 6709  H HG2  . ARG A 1 11 ? 0.124   1.198   -18.270 1.00 0.00 ? 11 ARG A HG2  7  
ATOM 6710  H HG3  . ARG A 1 11 ? 0.650   0.419   -19.764 1.00 0.00 ? 11 ARG A HG3  7  
ATOM 6711  H HD2  . ARG A 1 11 ? -0.362  2.499   -20.348 1.00 0.00 ? 11 ARG A HD2  7  
ATOM 6712  H HD3  . ARG A 1 11 ? -1.465  1.211   -20.830 1.00 0.00 ? 11 ARG A HD3  7  
ATOM 6713  H HE   . ARG A 1 11 ? -2.978  1.943   -19.253 1.00 0.00 ? 11 ARG A HE   7  
ATOM 6714  H HH11 . ARG A 1 11 ? 0.075   3.559   -18.817 1.00 0.00 ? 11 ARG A HH11 7  
ATOM 6715  H HH12 . ARG A 1 11 ? -0.553  4.723   -17.697 1.00 0.00 ? 11 ARG A HH12 7  
ATOM 6716  H HH21 . ARG A 1 11 ? -3.816  3.470   -17.780 1.00 0.00 ? 11 ARG A HH21 7  
ATOM 6717  H HH22 . ARG A 1 11 ? -2.766  4.670   -17.107 1.00 0.00 ? 11 ARG A HH22 7  
ATOM 6718  N N    . THR A 1 12 ? -1.226  -2.291  -16.210 1.00 0.00 ? 12 THR A N    7  
ATOM 6719  C CA   . THR A 1 12 ? -2.033  -3.107  -15.312 1.00 0.00 ? 12 THR A CA   7  
ATOM 6720  C C    . THR A 1 12 ? -2.787  -2.240  -14.310 1.00 0.00 ? 12 THR A C    7  
ATOM 6721  O O    . THR A 1 12 ? -2.210  -1.345  -13.693 1.00 0.00 ? 12 THR A O    7  
ATOM 6722  C CB   . THR A 1 12 ? -1.167  -4.124  -14.545 1.00 0.00 ? 12 THR A CB   7  
ATOM 6723  O OG1  . THR A 1 12 ? -0.417  -4.923  -15.467 1.00 0.00 ? 12 THR A OG1  7  
ATOM 6724  C CG2  . THR A 1 12 ? -2.031  -5.022  -13.673 1.00 0.00 ? 12 THR A CG2  7  
ATOM 6725  H H    . THR A 1 12 ? -0.795  -1.482  -15.864 1.00 0.00 ? 12 THR A H    7  
ATOM 6726  H HA   . THR A 1 12 ? -2.748  -3.653  -15.910 1.00 0.00 ? 12 THR A HA   7  
ATOM 6727  H HB   . THR A 1 12 ? -0.481  -3.582  -13.909 1.00 0.00 ? 12 THR A HB   7  
ATOM 6728  H HG1  . THR A 1 12 ? -0.973  -5.631  -15.802 1.00 0.00 ? 12 THR A HG1  7  
ATOM 6729  H HG21 . THR A 1 12 ? -2.181  -5.970  -14.170 1.00 0.00 ? 12 THR A HG21 7  
ATOM 6730  H HG22 . THR A 1 12 ? -2.987  -4.549  -13.505 1.00 0.00 ? 12 THR A HG22 7  
ATOM 6731  H HG23 . THR A 1 12 ? -1.539  -5.186  -12.727 1.00 0.00 ? 12 THR A HG23 7  
ATOM 6732  N N    . ARG A 1 13 ? -4.078  -2.513  -14.152 1.00 0.00 ? 13 ARG A N    7  
ATOM 6733  C CA   . ARG A 1 13 ? -4.911  -1.757  -13.225 1.00 0.00 ? 13 ARG A CA   7  
ATOM 6734  C C    . ARG A 1 13 ? -5.436  -2.656  -12.109 1.00 0.00 ? 13 ARG A C    7  
ATOM 6735  O O    . ARG A 1 13 ? -5.988  -3.725  -12.367 1.00 0.00 ? 13 ARG A O    7  
ATOM 6736  C CB   . ARG A 1 13 ? -6.082  -1.111  -13.967 1.00 0.00 ? 13 ARG A CB   7  
ATOM 6737  C CG   . ARG A 1 13 ? -7.114  -0.481  -13.046 1.00 0.00 ? 13 ARG A CG   7  
ATOM 6738  C CD   . ARG A 1 13 ? -6.781  0.973   -12.748 1.00 0.00 ? 13 ARG A CD   7  
ATOM 6739  N NE   . ARG A 1 13 ? -7.548  1.489   -11.618 1.00 0.00 ? 13 ARG A NE   7  
ATOM 6740  C CZ   . ARG A 1 13 ? -7.811  2.779   -11.436 1.00 0.00 ? 13 ARG A CZ   7  
ATOM 6741  N NH1  . ARG A 1 13 ? -7.370  3.678   -12.305 1.00 0.00 ? 13 ARG A NH1  7  
ATOM 6742  N NH2  . ARG A 1 13 ? -8.516  3.171   -10.383 1.00 0.00 ? 13 ARG A NH2  7  
ATOM 6743  H H    . ARG A 1 13 ? -4.481  -3.239  -14.673 1.00 0.00 ? 13 ARG A H    7  
ATOM 6744  H HA   . ARG A 1 13 ? -4.301  -0.980  -12.788 1.00 0.00 ? 13 ARG A HA   7  
ATOM 6745  H HB2  . ARG A 1 13 ? -5.698  -0.341  -14.621 1.00 0.00 ? 13 ARG A HB2  7  
ATOM 6746  H HB3  . ARG A 1 13 ? -6.575  -1.865  -14.562 1.00 0.00 ? 13 ARG A HB3  7  
ATOM 6747  H HG2  . ARG A 1 13 ? -8.083  -0.526  -13.522 1.00 0.00 ? 13 ARG A HG2  7  
ATOM 6748  H HG3  . ARG A 1 13 ? -7.140  -1.033  -12.119 1.00 0.00 ? 13 ARG A HG3  7  
ATOM 6749  H HD2  . ARG A 1 13 ? -5.728  1.048   -12.520 1.00 0.00 ? 13 ARG A HD2  7  
ATOM 6750  H HD3  . ARG A 1 13 ? -7.003  1.565   -13.623 1.00 0.00 ? 13 ARG A HD3  7  
ATOM 6751  H HE   . ARG A 1 13 ? -7.884  0.842   -10.964 1.00 0.00 ? 13 ARG A HE   7  
ATOM 6752  H HH11 . ARG A 1 13 ? -6.839  3.385   -13.100 1.00 0.00 ? 13 ARG A HH11 7  
ATOM 6753  H HH12 . ARG A 1 13 ? -7.570  4.648   -12.166 1.00 0.00 ? 13 ARG A HH12 7  
ATOM 6754  H HH21 . ARG A 1 13 ? -8.850  2.496   -9.725  1.00 0.00 ? 13 ARG A HH21 7  
ATOM 6755  H HH22 . ARG A 1 13 ? -8.713  4.142   -10.246 1.00 0.00 ? 13 ARG A HH22 7  
ATOM 6756  N N    . PHE A 1 14 ? -5.260  -2.214  -10.868 1.00 0.00 ? 14 PHE A N    7  
ATOM 6757  C CA   . PHE A 1 14 ? -5.714  -2.979  -9.713  1.00 0.00 ? 14 PHE A CA   7  
ATOM 6758  C C    . PHE A 1 14 ? -6.895  -2.291  -9.035  1.00 0.00 ? 14 PHE A C    7  
ATOM 6759  O O    . PHE A 1 14 ? -7.179  -1.121  -9.293  1.00 0.00 ? 14 PHE A O    7  
ATOM 6760  C CB   . PHE A 1 14 ? -4.571  -3.158  -8.711  1.00 0.00 ? 14 PHE A CB   7  
ATOM 6761  C CG   . PHE A 1 14 ? -3.270  -3.550  -9.351  1.00 0.00 ? 14 PHE A CG   7  
ATOM 6762  C CD1  . PHE A 1 14 ? -2.466  -2.598  -9.957  1.00 0.00 ? 14 PHE A CD1  7  
ATOM 6763  C CD2  . PHE A 1 14 ? -2.850  -4.870  -9.347  1.00 0.00 ? 14 PHE A CD2  7  
ATOM 6764  C CE1  . PHE A 1 14 ? -1.268  -2.955  -10.546 1.00 0.00 ? 14 PHE A CE1  7  
ATOM 6765  C CE2  . PHE A 1 14 ? -1.653  -5.233  -9.934  1.00 0.00 ? 14 PHE A CE2  7  
ATOM 6766  C CZ   . PHE A 1 14 ? -0.861  -4.274  -10.535 1.00 0.00 ? 14 PHE A CZ   7  
ATOM 6767  H H    . PHE A 1 14 ? -4.812  -1.353  -10.726 1.00 0.00 ? 14 PHE A H    7  
ATOM 6768  H HA   . PHE A 1 14 ? -6.030  -3.950  -10.062 1.00 0.00 ? 14 PHE A HA   7  
ATOM 6769  H HB2  . PHE A 1 14 ? -4.415  -2.229  -8.184  1.00 0.00 ? 14 PHE A HB2  7  
ATOM 6770  H HB3  . PHE A 1 14 ? -4.840  -3.928  -8.004  1.00 0.00 ? 14 PHE A HB3  7  
ATOM 6771  H HD1  . PHE A 1 14 ? -2.783  -1.564  -9.966  1.00 0.00 ? 14 PHE A HD1  7  
ATOM 6772  H HD2  . PHE A 1 14 ? -3.469  -5.622  -8.878  1.00 0.00 ? 14 PHE A HD2  7  
ATOM 6773  H HE1  . PHE A 1 14 ? -0.651  -2.202  -11.015 1.00 0.00 ? 14 PHE A HE1  7  
ATOM 6774  H HE2  . PHE A 1 14 ? -1.337  -6.266  -9.924  1.00 0.00 ? 14 PHE A HE2  7  
ATOM 6775  H HZ   . PHE A 1 14 ? 0.075   -4.555  -10.994 1.00 0.00 ? 14 PHE A HZ   7  
ATOM 6776  N N    . THR A 1 15 ? -7.583  -3.027  -8.168  1.00 0.00 ? 15 THR A N    7  
ATOM 6777  C CA   . THR A 1 15 ? -8.735  -2.490  -7.454  1.00 0.00 ? 15 THR A CA   7  
ATOM 6778  C C    . THR A 1 15 ? -8.417  -2.277  -5.979  1.00 0.00 ? 15 THR A C    7  
ATOM 6779  O O    . THR A 1 15 ? -7.549  -2.946  -5.418  1.00 0.00 ? 15 THR A O    7  
ATOM 6780  C CB   . THR A 1 15 ? -9.956  -3.422  -7.576  1.00 0.00 ? 15 THR A CB   7  
ATOM 6781  O OG1  . THR A 1 15 ? -10.992 -2.990  -6.687  1.00 0.00 ? 15 THR A OG1  7  
ATOM 6782  C CG2  . THR A 1 15 ? -9.573  -4.859  -7.255  1.00 0.00 ? 15 THR A CG2  7  
ATOM 6783  H H    . THR A 1 15 ? -7.309  -3.954  -8.005  1.00 0.00 ? 15 THR A H    7  
ATOM 6784  H HA   . THR A 1 15 ? -8.989  -1.539  -7.899  1.00 0.00 ? 15 THR A HA   7  
ATOM 6785  H HB   . THR A 1 15 ? -10.322 -3.380  -8.591  1.00 0.00 ? 15 THR A HB   7  
ATOM 6786  H HG1  . THR A 1 15 ? -11.511 -3.748  -6.408  1.00 0.00 ? 15 THR A HG1  7  
ATOM 6787  H HG21 . THR A 1 15 ? -9.184  -4.913  -6.249  1.00 0.00 ? 15 THR A HG21 7  
ATOM 6788  H HG22 . THR A 1 15 ? -8.819  -5.194  -7.952  1.00 0.00 ? 15 THR A HG22 7  
ATOM 6789  H HG23 . THR A 1 15 ? -10.445 -5.490  -7.338  1.00 0.00 ? 15 THR A HG23 7  
ATOM 6790  N N    . ASP A 1 16 ? -9.126  -1.342  -5.355  1.00 0.00 ? 16 ASP A N    7  
ATOM 6791  C CA   . ASP A 1 16 ? -8.920  -1.042  -3.943  1.00 0.00 ? 16 ASP A CA   7  
ATOM 6792  C C    . ASP A 1 16 ? -8.645  -2.317  -3.151  1.00 0.00 ? 16 ASP A C    7  
ATOM 6793  O O    . ASP A 1 16 ? -7.792  -2.337  -2.264  1.00 0.00 ? 16 ASP A O    7  
ATOM 6794  C CB   . ASP A 1 16 ? -10.143 -0.324  -3.369  1.00 0.00 ? 16 ASP A CB   7  
ATOM 6795  C CG   . ASP A 1 16 ? -10.565 0.863   -4.211  1.00 0.00 ? 16 ASP A CG   7  
ATOM 6796  O OD1  . ASP A 1 16 ? -10.956 0.653   -5.378  1.00 0.00 ? 16 ASP A OD1  7  
ATOM 6797  O OD2  . ASP A 1 16 ? -10.503 2.003   -3.704  1.00 0.00 ? 16 ASP A OD2  7  
ATOM 6798  H H    . ASP A 1 16 ? -9.804  -0.842  -5.856  1.00 0.00 ? 16 ASP A H    7  
ATOM 6799  H HA   . ASP A 1 16 ? -8.062  -0.392  -3.863  1.00 0.00 ? 16 ASP A HA   7  
ATOM 6800  H HB2  . ASP A 1 16 ? -10.969 -1.018  -3.318  1.00 0.00 ? 16 ASP A HB2  7  
ATOM 6801  H HB3  . ASP A 1 16 ? -9.911  0.027   -2.374  1.00 0.00 ? 16 ASP A HB3  7  
ATOM 6802  N N    . TYR A 1 17 ? -9.374  -3.378  -3.477  1.00 0.00 ? 17 TYR A N    7  
ATOM 6803  C CA   . TYR A 1 17 ? -9.212  -4.656  -2.794  1.00 0.00 ? 17 TYR A CA   7  
ATOM 6804  C C    . TYR A 1 17 ? -7.779  -5.165  -2.924  1.00 0.00 ? 17 TYR A C    7  
ATOM 6805  O O    . TYR A 1 17 ? -7.178  -5.614  -1.948  1.00 0.00 ? 17 TYR A O    7  
ATOM 6806  C CB   . TYR A 1 17 ? -10.186 -5.690  -3.362  1.00 0.00 ? 17 TYR A CB   7  
ATOM 6807  C CG   . TYR A 1 17 ? -9.691  -7.114  -3.248  1.00 0.00 ? 17 TYR A CG   7  
ATOM 6808  C CD1  . TYR A 1 17 ? -9.123  -7.581  -2.069  1.00 0.00 ? 17 TYR A CD1  7  
ATOM 6809  C CD2  . TYR A 1 17 ? -9.792  -7.993  -4.320  1.00 0.00 ? 17 TYR A CD2  7  
ATOM 6810  C CE1  . TYR A 1 17 ? -8.670  -8.881  -1.961  1.00 0.00 ? 17 TYR A CE1  7  
ATOM 6811  C CE2  . TYR A 1 17 ? -9.342  -9.295  -4.220  1.00 0.00 ? 17 TYR A CE2  7  
ATOM 6812  C CZ   . TYR A 1 17 ? -8.782  -9.735  -3.038  1.00 0.00 ? 17 TYR A CZ   7  
ATOM 6813  O OH   . TYR A 1 17 ? -8.331  -11.031 -2.935  1.00 0.00 ? 17 TYR A OH   7  
ATOM 6814  H H    . TYR A 1 17 ? -10.039 -3.301  -4.193  1.00 0.00 ? 17 TYR A H    7  
ATOM 6815  H HA   . TYR A 1 17 ? -9.434  -4.504  -1.748  1.00 0.00 ? 17 TYR A HA   7  
ATOM 6816  H HB2  . TYR A 1 17 ? -11.123 -5.621  -2.831  1.00 0.00 ? 17 TYR A HB2  7  
ATOM 6817  H HB3  . TYR A 1 17 ? -10.353 -5.479  -4.408  1.00 0.00 ? 17 TYR A HB3  7  
ATOM 6818  H HD1  . TYR A 1 17 ? -9.037  -6.910  -1.227  1.00 0.00 ? 17 TYR A HD1  7  
ATOM 6819  H HD2  . TYR A 1 17 ? -10.231 -7.645  -5.244  1.00 0.00 ? 17 TYR A HD2  7  
ATOM 6820  H HE1  . TYR A 1 17 ? -8.231  -9.226  -1.036  1.00 0.00 ? 17 TYR A HE1  7  
ATOM 6821  H HE2  . TYR A 1 17 ? -9.429  -9.964  -5.064  1.00 0.00 ? 17 TYR A HE2  7  
ATOM 6822  H HH   . TYR A 1 17 ? -7.607  -11.167 -3.550  1.00 0.00 ? 17 TYR A HH   7  
ATOM 6823  N N    . GLN A 1 18 ? -7.240  -5.091  -4.136  1.00 0.00 ? 18 GLN A N    7  
ATOM 6824  C CA   . GLN A 1 18 ? -5.878  -5.544  -4.395  1.00 0.00 ? 18 GLN A CA   7  
ATOM 6825  C C    . GLN A 1 18 ? -4.861  -4.523  -3.896  1.00 0.00 ? 18 GLN A C    7  
ATOM 6826  O O    . GLN A 1 18 ? -3.911  -4.870  -3.193  1.00 0.00 ? 18 GLN A O    7  
ATOM 6827  C CB   . GLN A 1 18 ? -5.677  -5.793  -5.891  1.00 0.00 ? 18 GLN A CB   7  
ATOM 6828  C CG   . GLN A 1 18 ? -6.691  -6.754  -6.490  1.00 0.00 ? 18 GLN A CG   7  
ATOM 6829  C CD   . GLN A 1 18 ? -6.177  -7.441  -7.739  1.00 0.00 ? 18 GLN A CD   7  
ATOM 6830  O OE1  . GLN A 1 18 ? -5.769  -6.786  -8.699  1.00 0.00 ? 18 GLN A OE1  7  
ATOM 6831  N NE2  . GLN A 1 18 ? -6.194  -8.769  -7.734  1.00 0.00 ? 18 GLN A NE2  7  
ATOM 6832  H H    . GLN A 1 18 ? -7.770  -4.723  -4.874  1.00 0.00 ? 18 GLN A H    7  
ATOM 6833  H HA   . GLN A 1 18 ? -5.731  -6.471  -3.862  1.00 0.00 ? 18 GLN A HA   7  
ATOM 6834  H HB2  . GLN A 1 18 ? -5.752  -4.851  -6.414  1.00 0.00 ? 18 GLN A HB2  7  
ATOM 6835  H HB3  . GLN A 1 18 ? -4.690  -6.203  -6.046  1.00 0.00 ? 18 GLN A HB3  7  
ATOM 6836  H HG2  . GLN A 1 18 ? -6.930  -7.508  -5.755  1.00 0.00 ? 18 GLN A HG2  7  
ATOM 6837  H HG3  . GLN A 1 18 ? -7.585  -6.202  -6.742  1.00 0.00 ? 18 GLN A HG3  7  
ATOM 6838  H HE21 . GLN A 1 18 ? -6.534  -9.224  -6.934  1.00 0.00 ? 18 GLN A HE21 7  
ATOM 6839  H HE22 . GLN A 1 18 ? -5.868  -9.239  -8.528  1.00 0.00 ? 18 GLN A HE22 7  
ATOM 6840  N N    . LEU A 1 19 ? -5.066  -3.263  -4.264  1.00 0.00 ? 19 LEU A N    7  
ATOM 6841  C CA   . LEU A 1 19 ? -4.166  -2.190  -3.853  1.00 0.00 ? 19 LEU A CA   7  
ATOM 6842  C C    . LEU A 1 19 ? -4.024  -2.149  -2.335  1.00 0.00 ? 19 LEU A C    7  
ATOM 6843  O O    . LEU A 1 19 ? -2.969  -1.794  -1.809  1.00 0.00 ? 19 LEU A O    7  
ATOM 6844  C CB   . LEU A 1 19 ? -4.678  -0.844  -4.366  1.00 0.00 ? 19 LEU A CB   7  
ATOM 6845  C CG   . LEU A 1 19 ? -4.489  -0.578  -5.860  1.00 0.00 ? 19 LEU A CG   7  
ATOM 6846  C CD1  . LEU A 1 19 ? -5.145  0.736   -6.256  1.00 0.00 ? 19 LEU A CD1  7  
ATOM 6847  C CD2  . LEU A 1 19 ? -3.010  -0.567  -6.217  1.00 0.00 ? 19 LEU A CD2  7  
ATOM 6848  H H    . LEU A 1 19 ? -5.840  -3.047  -4.824  1.00 0.00 ? 19 LEU A H    7  
ATOM 6849  H HA   . LEU A 1 19 ? -3.197  -2.387  -4.288  1.00 0.00 ? 19 LEU A HA   7  
ATOM 6850  H HB2  . LEU A 1 19 ? -5.734  -0.789  -4.152  1.00 0.00 ? 19 LEU A HB2  7  
ATOM 6851  H HB3  . LEU A 1 19 ? -4.161  -0.065  -3.823  1.00 0.00 ? 19 LEU A HB3  7  
ATOM 6852  H HG   . LEU A 1 19 ? -4.964  -1.370  -6.423  1.00 0.00 ? 19 LEU A HG   7  
ATOM 6853  H HD11 . LEU A 1 19 ? -4.455  1.548   -6.084  1.00 0.00 ? 19 LEU A HD11 7  
ATOM 6854  H HD12 . LEU A 1 19 ? -6.035  0.887   -5.663  1.00 0.00 ? 19 LEU A HD12 7  
ATOM 6855  H HD13 . LEU A 1 19 ? -5.411  0.704   -7.303  1.00 0.00 ? 19 LEU A HD13 7  
ATOM 6856  H HD21 . LEU A 1 19 ? -2.717  0.432   -6.504  1.00 0.00 ? 19 LEU A HD21 7  
ATOM 6857  H HD22 . LEU A 1 19 ? -2.833  -1.244  -7.040  1.00 0.00 ? 19 LEU A HD22 7  
ATOM 6858  H HD23 . LEU A 1 19 ? -2.431  -0.881  -5.361  1.00 0.00 ? 19 LEU A HD23 7  
ATOM 6859  N N    . ARG A 1 20 ? -5.094  -2.516  -1.636  1.00 0.00 ? 20 ARG A N    7  
ATOM 6860  C CA   . ARG A 1 20 ? -5.088  -2.522  -0.178  1.00 0.00 ? 20 ARG A CA   7  
ATOM 6861  C C    . ARG A 1 20 ? -4.083  -3.537  0.358   1.00 0.00 ? 20 ARG A C    7  
ATOM 6862  O O    . ARG A 1 20 ? -3.318  -3.243  1.277   1.00 0.00 ? 20 ARG A O    7  
ATOM 6863  C CB   . ARG A 1 20 ? -6.486  -2.840  0.357   1.00 0.00 ? 20 ARG A CB   7  
ATOM 6864  C CG   . ARG A 1 20 ? -6.598  -2.732  1.868   1.00 0.00 ? 20 ARG A CG   7  
ATOM 6865  C CD   . ARG A 1 20 ? -6.464  -1.291  2.335   1.00 0.00 ? 20 ARG A CD   7  
ATOM 6866  N NE   . ARG A 1 20 ? -7.647  -0.498  2.011   1.00 0.00 ? 20 ARG A NE   7  
ATOM 6867  C CZ   . ARG A 1 20 ? -7.862  0.726   2.479   1.00 0.00 ? 20 ARG A CZ   7  
ATOM 6868  N NH1  . ARG A 1 20 ? -6.978  1.295   3.287   1.00 0.00 ? 20 ARG A NH1  7  
ATOM 6869  N NH2  . ARG A 1 20 ? -8.962  1.384   2.137   1.00 0.00 ? 20 ARG A NH2  7  
ATOM 6870  H H    . ARG A 1 20 ? -5.906  -2.789  -2.112  1.00 0.00 ? 20 ARG A H    7  
ATOM 6871  H HA   . ARG A 1 20 ? -4.801  -1.536  0.156   1.00 0.00 ? 20 ARG A HA   7  
ATOM 6872  H HB2  . ARG A 1 20 ? -7.193  -2.153  -0.085  1.00 0.00 ? 20 ARG A HB2  7  
ATOM 6873  H HB3  . ARG A 1 20 ? -6.747  -3.848  0.069   1.00 0.00 ? 20 ARG A HB3  7  
ATOM 6874  H HG2  . ARG A 1 20 ? -7.562  -3.110  2.176   1.00 0.00 ? 20 ARG A HG2  7  
ATOM 6875  H HG3  . ARG A 1 20 ? -5.816  -3.323  2.321   1.00 0.00 ? 20 ARG A HG3  7  
ATOM 6876  H HD2  . ARG A 1 20 ? -6.322  -1.285  3.406   1.00 0.00 ? 20 ARG A HD2  7  
ATOM 6877  H HD3  . ARG A 1 20 ? -5.603  -0.850  1.856   1.00 0.00 ? 20 ARG A HD3  7  
ATOM 6878  H HE   . ARG A 1 20 ? -8.313  -0.900  1.415   1.00 0.00 ? 20 ARG A HE   7  
ATOM 6879  H HH11 . ARG A 1 20 ? -6.148  0.802   3.545   1.00 0.00 ? 20 ARG A HH11 7  
ATOM 6880  H HH12 . ARG A 1 20 ? -7.142  2.218   3.637   1.00 0.00 ? 20 ARG A HH12 7  
ATOM 6881  H HH21 . ARG A 1 20 ? -9.631  0.959   1.528   1.00 0.00 ? 20 ARG A HH21 7  
ATOM 6882  H HH22 . ARG A 1 20 ? -9.123  2.306   2.490   1.00 0.00 ? 20 ARG A HH22 7  
ATOM 6883  N N    . VAL A 1 21 ? -4.091  -4.732  -0.223  1.00 0.00 ? 21 VAL A N    7  
ATOM 6884  C CA   . VAL A 1 21 ? -3.179  -5.791  0.196   1.00 0.00 ? 21 VAL A CA   7  
ATOM 6885  C C    . VAL A 1 21 ? -1.759  -5.516  -0.285  1.00 0.00 ? 21 VAL A C    7  
ATOM 6886  O O    . VAL A 1 21 ? -0.792  -5.723  0.449   1.00 0.00 ? 21 VAL A O    7  
ATOM 6887  C CB   . VAL A 1 21 ? -3.633  -7.164  -0.335  1.00 0.00 ? 21 VAL A CB   7  
ATOM 6888  C CG1  . VAL A 1 21 ? -2.664  -8.252  0.103   1.00 0.00 ? 21 VAL A CG1  7  
ATOM 6889  C CG2  . VAL A 1 21 ? -5.046  -7.476  0.134   1.00 0.00 ? 21 VAL A CG2  7  
ATOM 6890  H H    . VAL A 1 21 ? -4.723  -4.907  -0.950  1.00 0.00 ? 21 VAL A H    7  
ATOM 6891  H HA   . VAL A 1 21 ? -3.183  -5.827  1.276   1.00 0.00 ? 21 VAL A HA   7  
ATOM 6892  H HB   . VAL A 1 21 ? -3.634  -7.127  -1.415  1.00 0.00 ? 21 VAL A HB   7  
ATOM 6893  H HG11 . VAL A 1 21 ? -3.211  -9.043  0.595   1.00 0.00 ? 21 VAL A HG11 7  
ATOM 6894  H HG12 . VAL A 1 21 ? -2.153  -8.649  -0.762  1.00 0.00 ? 21 VAL A HG12 7  
ATOM 6895  H HG13 . VAL A 1 21 ? -1.941  -7.835  0.789   1.00 0.00 ? 21 VAL A HG13 7  
ATOM 6896  H HG21 . VAL A 1 21 ? -5.654  -6.587  0.058   1.00 0.00 ? 21 VAL A HG21 7  
ATOM 6897  H HG22 . VAL A 1 21 ? -5.468  -8.254  -0.486  1.00 0.00 ? 21 VAL A HG22 7  
ATOM 6898  H HG23 . VAL A 1 21 ? -5.020  -7.809  1.160   1.00 0.00 ? 21 VAL A HG23 7  
ATOM 6899  N N    . LEU A 1 22 ? -1.640  -5.047  -1.522  1.00 0.00 ? 22 LEU A N    7  
ATOM 6900  C CA   . LEU A 1 22 ? -0.337  -4.742  -2.103  1.00 0.00 ? 22 LEU A CA   7  
ATOM 6901  C C    . LEU A 1 22 ? 0.326   -3.580  -1.371  1.00 0.00 ? 22 LEU A C    7  
ATOM 6902  O O    . LEU A 1 22 ? 1.521   -3.619  -1.080  1.00 0.00 ? 22 LEU A O    7  
ATOM 6903  C CB   . LEU A 1 22 ? -0.484  -4.407  -3.588  1.00 0.00 ? 22 LEU A CB   7  
ATOM 6904  C CG   . LEU A 1 22 ? -1.075  -5.509  -4.469  1.00 0.00 ? 22 LEU A CG   7  
ATOM 6905  C CD1  . LEU A 1 22 ? -1.438  -4.959  -5.839  1.00 0.00 ? 22 LEU A CD1  7  
ATOM 6906  C CD2  . LEU A 1 22 ? -0.100  -6.669  -4.599  1.00 0.00 ? 22 LEU A CD2  7  
ATOM 6907  H H    . LEU A 1 22 ? -2.447  -4.903  -2.059  1.00 0.00 ? 22 LEU A H    7  
ATOM 6908  H HA   . LEU A 1 22 ? 0.285   -5.619  -1.999  1.00 0.00 ? 22 LEU A HA   7  
ATOM 6909  H HB2  . LEU A 1 22 ? -1.121  -3.541  -3.670  1.00 0.00 ? 22 LEU A HB2  7  
ATOM 6910  H HB3  . LEU A 1 22 ? 0.498   -4.168  -3.971  1.00 0.00 ? 22 LEU A HB3  7  
ATOM 6911  H HG   . LEU A 1 22 ? -1.980  -5.881  -4.009  1.00 0.00 ? 22 LEU A HG   7  
ATOM 6912  H HD11 . LEU A 1 22 ? -2.472  -4.648  -5.840  1.00 0.00 ? 22 LEU A HD11 7  
ATOM 6913  H HD12 . LEU A 1 22 ? -1.292  -5.726  -6.585  1.00 0.00 ? 22 LEU A HD12 7  
ATOM 6914  H HD13 . LEU A 1 22 ? -0.807  -4.112  -6.066  1.00 0.00 ? 22 LEU A HD13 7  
ATOM 6915  H HD21 . LEU A 1 22 ? -0.278  -7.380  -3.805  1.00 0.00 ? 22 LEU A HD21 7  
ATOM 6916  H HD22 . LEU A 1 22 ? 0.912   -6.298  -4.528  1.00 0.00 ? 22 LEU A HD22 7  
ATOM 6917  H HD23 . LEU A 1 22 ? -0.241  -7.153  -5.554  1.00 0.00 ? 22 LEU A HD23 7  
ATOM 6918  N N    . GLN A 1 23 ? -0.458  -2.548  -1.076  1.00 0.00 ? 23 GLN A N    7  
ATOM 6919  C CA   . GLN A 1 23 ? 0.054   -1.375  -0.377  1.00 0.00 ? 23 GLN A CA   7  
ATOM 6920  C C    . GLN A 1 23 ? 0.333   -1.694  1.089   1.00 0.00 ? 23 GLN A C    7  
ATOM 6921  O O    . GLN A 1 23 ? 1.285   -1.179  1.676   1.00 0.00 ? 23 GLN A O    7  
ATOM 6922  C CB   . GLN A 1 23 ? -0.943  -0.219  -0.479  1.00 0.00 ? 23 GLN A CB   7  
ATOM 6923  C CG   . GLN A 1 23 ? -0.316  1.146   -0.250  1.00 0.00 ? 23 GLN A CG   7  
ATOM 6924  C CD   . GLN A 1 23 ? 0.748   1.480   -1.277  1.00 0.00 ? 23 GLN A CD   7  
ATOM 6925  O OE1  . GLN A 1 23 ? 0.439   1.895   -2.395  1.00 0.00 ? 23 GLN A OE1  7  
ATOM 6926  N NE2  . GLN A 1 23 ? 2.009   1.300   -0.904  1.00 0.00 ? 23 GLN A NE2  7  
ATOM 6927  H H    . GLN A 1 23 ? -1.402  -2.576  -1.335  1.00 0.00 ? 23 GLN A H    7  
ATOM 6928  H HA   . GLN A 1 23 ? 0.979   -1.084  -0.851  1.00 0.00 ? 23 GLN A HA   7  
ATOM 6929  H HB2  . GLN A 1 23 ? -1.386  -0.228  -1.463  1.00 0.00 ? 23 GLN A HB2  7  
ATOM 6930  H HB3  . GLN A 1 23 ? -1.719  -0.363  0.258   1.00 0.00 ? 23 GLN A HB3  7  
ATOM 6931  H HG2  . GLN A 1 23 ? -1.090  1.897   -0.300  1.00 0.00 ? 23 GLN A HG2  7  
ATOM 6932  H HG3  . GLN A 1 23 ? 0.135   1.161   0.732   1.00 0.00 ? 23 GLN A HG3  7  
ATOM 6933  H HE21 . GLN A 1 23 ? 2.180   0.965   0.001   1.00 0.00 ? 23 GLN A HE21 7  
ATOM 6934  H HE22 . GLN A 1 23 ? 2.717   1.507   -1.549  1.00 0.00 ? 23 GLN A HE22 7  
ATOM 6935  N N    . ASP A 1 24 ? -0.503  -2.545  1.673   1.00 0.00 ? 24 ASP A N    7  
ATOM 6936  C CA   . ASP A 1 24 ? -0.346  -2.933  3.070   1.00 0.00 ? 24 ASP A CA   7  
ATOM 6937  C C    . ASP A 1 24 ? 0.934   -3.740  3.269   1.00 0.00 ? 24 ASP A C    7  
ATOM 6938  O O    . ASP A 1 24 ? 1.650   -3.553  4.253   1.00 0.00 ? 24 ASP A O    7  
ATOM 6939  C CB   . ASP A 1 24 ? -1.554  -3.748  3.534   1.00 0.00 ? 24 ASP A CB   7  
ATOM 6940  C CG   . ASP A 1 24 ? -1.438  -4.181  4.982   1.00 0.00 ? 24 ASP A CG   7  
ATOM 6941  O OD1  . ASP A 1 24 ? -1.850  -3.404  5.869   1.00 0.00 ? 24 ASP A OD1  7  
ATOM 6942  O OD2  . ASP A 1 24 ? -0.937  -5.298  5.229   1.00 0.00 ? 24 ASP A OD2  7  
ATOM 6943  H H    . ASP A 1 24 ? -1.243  -2.923  1.152   1.00 0.00 ? 24 ASP A H    7  
ATOM 6944  H HA   . ASP A 1 24 ? -0.283  -2.031  3.660   1.00 0.00 ? 24 ASP A HA   7  
ATOM 6945  H HB2  . ASP A 1 24 ? -2.447  -3.149  3.427   1.00 0.00 ? 24 ASP A HB2  7  
ATOM 6946  H HB3  . ASP A 1 24 ? -1.642  -4.631  2.919   1.00 0.00 ? 24 ASP A HB3  7  
ATOM 6947  N N    . PHE A 1 25 ? 1.215   -4.636  2.330   1.00 0.00 ? 25 PHE A N    7  
ATOM 6948  C CA   . PHE A 1 25 ? 2.407   -5.473  2.404   1.00 0.00 ? 25 PHE A CA   7  
ATOM 6949  C C    . PHE A 1 25 ? 3.667   -4.646  2.165   1.00 0.00 ? 25 PHE A C    7  
ATOM 6950  O O    . PHE A 1 25 ? 4.735   -4.956  2.693   1.00 0.00 ? 25 PHE A O    7  
ATOM 6951  C CB   . PHE A 1 25 ? 2.325   -6.606  1.378   1.00 0.00 ? 25 PHE A CB   7  
ATOM 6952  C CG   . PHE A 1 25 ? 3.330   -7.698  1.610   1.00 0.00 ? 25 PHE A CG   7  
ATOM 6953  C CD1  . PHE A 1 25 ? 4.679   -7.475  1.385   1.00 0.00 ? 25 PHE A CD1  7  
ATOM 6954  C CD2  . PHE A 1 25 ? 2.925   -8.947  2.051   1.00 0.00 ? 25 PHE A CD2  7  
ATOM 6955  C CE1  . PHE A 1 25 ? 5.606   -8.478  1.598   1.00 0.00 ? 25 PHE A CE1  7  
ATOM 6956  C CE2  . PHE A 1 25 ? 3.848   -9.954  2.265   1.00 0.00 ? 25 PHE A CE2  7  
ATOM 6957  C CZ   . PHE A 1 25 ? 5.190   -9.719  2.037   1.00 0.00 ? 25 PHE A CZ   7  
ATOM 6958  H H    . PHE A 1 25 ? 0.605   -4.739  1.569   1.00 0.00 ? 25 PHE A H    7  
ATOM 6959  H HA   . PHE A 1 25 ? 2.452   -5.898  3.394   1.00 0.00 ? 25 PHE A HA   7  
ATOM 6960  H HB2  . PHE A 1 25 ? 1.341   -7.047  1.418   1.00 0.00 ? 25 PHE A HB2  7  
ATOM 6961  H HB3  . PHE A 1 25 ? 2.494   -6.201  0.392   1.00 0.00 ? 25 PHE A HB3  7  
ATOM 6962  H HD1  . PHE A 1 25 ? 5.006   -6.504  1.041   1.00 0.00 ? 25 PHE A HD1  7  
ATOM 6963  H HD2  . PHE A 1 25 ? 1.876   -9.133  2.228   1.00 0.00 ? 25 PHE A HD2  7  
ATOM 6964  H HE1  . PHE A 1 25 ? 6.655   -8.290  1.419   1.00 0.00 ? 25 PHE A HE1  7  
ATOM 6965  H HE2  . PHE A 1 25 ? 3.520   -10.923 2.609   1.00 0.00 ? 25 PHE A HE2  7  
ATOM 6966  H HZ   . PHE A 1 25 ? 5.913   -10.503 2.205   1.00 0.00 ? 25 PHE A HZ   7  
ATOM 6967  N N    . PHE A 1 26 ? 3.534   -3.593  1.366   1.00 0.00 ? 26 PHE A N    7  
ATOM 6968  C CA   . PHE A 1 26 ? 4.661   -2.721  1.056   1.00 0.00 ? 26 PHE A CA   7  
ATOM 6969  C C    . PHE A 1 26 ? 5.023   -1.851  2.256   1.00 0.00 ? 26 PHE A C    7  
ATOM 6970  O O    . PHE A 1 26 ? 6.182   -1.792  2.667   1.00 0.00 ? 26 PHE A O    7  
ATOM 6971  C CB   . PHE A 1 26 ? 4.333   -1.837  -0.149  1.00 0.00 ? 26 PHE A CB   7  
ATOM 6972  C CG   . PHE A 1 26 ? 5.428   -0.871  -0.500  1.00 0.00 ? 26 PHE A CG   7  
ATOM 6973  C CD1  . PHE A 1 26 ? 5.620   0.280   0.247   1.00 0.00 ? 26 PHE A CD1  7  
ATOM 6974  C CD2  . PHE A 1 26 ? 6.267   -1.115  -1.576  1.00 0.00 ? 26 PHE A CD2  7  
ATOM 6975  C CE1  . PHE A 1 26 ? 6.627   1.171   -0.075  1.00 0.00 ? 26 PHE A CE1  7  
ATOM 6976  C CE2  . PHE A 1 26 ? 7.276   -0.228  -1.902  1.00 0.00 ? 26 PHE A CE2  7  
ATOM 6977  C CZ   . PHE A 1 26 ? 7.456   0.916   -1.149  1.00 0.00 ? 26 PHE A CZ   7  
ATOM 6978  H H    . PHE A 1 26 ? 2.656   -3.397  0.975   1.00 0.00 ? 26 PHE A H    7  
ATOM 6979  H HA   . PHE A 1 26 ? 5.506   -3.347  0.813   1.00 0.00 ? 26 PHE A HA   7  
ATOM 6980  H HB2  . PHE A 1 26 ? 4.157   -2.465  -1.010  1.00 0.00 ? 26 PHE A HB2  7  
ATOM 6981  H HB3  . PHE A 1 26 ? 3.442   -1.267  0.064   1.00 0.00 ? 26 PHE A HB3  7  
ATOM 6982  H HD1  . PHE A 1 26 ? 4.973   0.481   1.088   1.00 0.00 ? 26 PHE A HD1  7  
ATOM 6983  H HD2  . PHE A 1 26 ? 6.126   -2.010  -2.165  1.00 0.00 ? 26 PHE A HD2  7  
ATOM 6984  H HE1  . PHE A 1 26 ? 6.766   2.065   0.515   1.00 0.00 ? 26 PHE A HE1  7  
ATOM 6985  H HE2  . PHE A 1 26 ? 7.922   -0.431  -2.742  1.00 0.00 ? 26 PHE A HE2  7  
ATOM 6986  H HZ   . PHE A 1 26 ? 8.243   1.611   -1.402  1.00 0.00 ? 26 PHE A HZ   7  
ATOM 6987  N N    . ASP A 1 27 ? 4.022   -1.177  2.813   1.00 0.00 ? 27 ASP A N    7  
ATOM 6988  C CA   . ASP A 1 27 ? 4.233   -0.310  3.966   1.00 0.00 ? 27 ASP A CA   7  
ATOM 6989  C C    . ASP A 1 27 ? 4.993   -1.045  5.066   1.00 0.00 ? 27 ASP A C    7  
ATOM 6990  O O    . ASP A 1 27 ? 5.775   -0.443  5.802   1.00 0.00 ? 27 ASP A O    7  
ATOM 6991  C CB   . ASP A 1 27 ? 2.893   0.194   4.504   1.00 0.00 ? 27 ASP A CB   7  
ATOM 6992  C CG   . ASP A 1 27 ? 3.060   1.170   5.652   1.00 0.00 ? 27 ASP A CG   7  
ATOM 6993  O OD1  . ASP A 1 27 ? 3.851   0.873   6.572   1.00 0.00 ? 27 ASP A OD1  7  
ATOM 6994  O OD2  . ASP A 1 27 ? 2.400   2.229   5.632   1.00 0.00 ? 27 ASP A OD2  7  
ATOM 6995  H H    . ASP A 1 27 ? 3.120   -1.266  2.440   1.00 0.00 ? 27 ASP A H    7  
ATOM 6996  H HA   . ASP A 1 27 ? 4.822   0.535   3.643   1.00 0.00 ? 27 ASP A HA   7  
ATOM 6997  H HB2  . ASP A 1 27 ? 2.358   0.692   3.709   1.00 0.00 ? 27 ASP A HB2  7  
ATOM 6998  H HB3  . ASP A 1 27 ? 2.313   -0.648  4.851   1.00 0.00 ? 27 ASP A HB3  7  
ATOM 6999  N N    . ALA A 1 28 ? 4.756   -2.348  5.173   1.00 0.00 ? 28 ALA A N    7  
ATOM 7000  C CA   . ALA A 1 28 ? 5.419   -3.164  6.183   1.00 0.00 ? 28 ALA A CA   7  
ATOM 7001  C C    . ALA A 1 28 ? 6.712   -3.764  5.642   1.00 0.00 ? 28 ALA A C    7  
ATOM 7002  O O    . ALA A 1 28 ? 7.730   -3.795  6.332   1.00 0.00 ? 28 ALA A O    7  
ATOM 7003  C CB   . ALA A 1 28 ? 4.486   -4.265  6.667   1.00 0.00 ? 28 ALA A CB   7  
ATOM 7004  H H    . ALA A 1 28 ? 4.122   -2.771  4.558   1.00 0.00 ? 28 ALA A H    7  
ATOM 7005  H HA   . ALA A 1 28 ? 5.653   -2.529  7.025   1.00 0.00 ? 28 ALA A HA   7  
ATOM 7006  H HB1  . ALA A 1 28 ? 4.107   -4.814  5.817   1.00 0.00 ? 28 ALA A HB1  7  
ATOM 7007  H HB2  . ALA A 1 28 ? 5.028   -4.936  7.317   1.00 0.00 ? 28 ALA A HB2  7  
ATOM 7008  H HB3  . ALA A 1 28 ? 3.662   -3.826  7.208   1.00 0.00 ? 28 ALA A HB3  7  
ATOM 7009  N N    . ASN A 1 29 ? 6.665   -4.241  4.402   1.00 0.00 ? 29 ASN A N    7  
ATOM 7010  C CA   . ASN A 1 29 ? 7.833   -4.841  3.769   1.00 0.00 ? 29 ASN A CA   7  
ATOM 7011  C C    . ASN A 1 29 ? 7.832   -4.580  2.265   1.00 0.00 ? 29 ASN A C    7  
ATOM 7012  O O    . ASN A 1 29 ? 6.865   -4.894  1.571   1.00 0.00 ? 29 ASN A O    7  
ATOM 7013  C CB   . ASN A 1 29 ? 7.866   -6.348  4.035   1.00 0.00 ? 29 ASN A CB   7  
ATOM 7014  C CG   . ASN A 1 29 ? 9.191   -6.975  3.648   1.00 0.00 ? 29 ASN A CG   7  
ATOM 7015  O OD1  . ASN A 1 29 ? 10.248  -6.565  4.128   1.00 0.00 ? 29 ASN A OD1  7  
ATOM 7016  N ND2  . ASN A 1 29 ? 9.140   -7.974  2.775   1.00 0.00 ? 29 ASN A ND2  7  
ATOM 7017  H H    . ASN A 1 29 ? 5.824   -4.188  3.901   1.00 0.00 ? 29 ASN A H    7  
ATOM 7018  H HA   . ASN A 1 29 ? 8.713   -4.389  4.200   1.00 0.00 ? 29 ASN A HA   7  
ATOM 7019  H HB2  . ASN A 1 29 ? 7.700   -6.524  5.088   1.00 0.00 ? 29 ASN A HB2  7  
ATOM 7020  H HB3  . ASN A 1 29 ? 7.082   -6.826  3.467   1.00 0.00 ? 29 ASN A HB3  7  
ATOM 7021  H HD21 . ASN A 1 29 ? 8.262   -8.247  2.434   1.00 0.00 ? 29 ASN A HD21 7  
ATOM 7022  H HD22 . ASN A 1 29 ? 9.982   -8.398  2.508   1.00 0.00 ? 29 ASN A HD22 7  
ATOM 7023  N N    . ALA A 1 30 ? 8.921   -4.003  1.770   1.00 0.00 ? 30 ALA A N    7  
ATOM 7024  C CA   . ALA A 1 30 ? 9.047   -3.701  0.349   1.00 0.00 ? 30 ALA A CA   7  
ATOM 7025  C C    . ALA A 1 30 ? 10.247  -4.419  -0.260  1.00 0.00 ? 30 ALA A C    7  
ATOM 7026  O O    . ALA A 1 30 ? 10.646  -4.134  -1.389  1.00 0.00 ? 30 ALA A O    7  
ATOM 7027  C CB   . ALA A 1 30 ? 9.165   -2.199  0.137   1.00 0.00 ? 30 ALA A CB   7  
ATOM 7028  H H    . ALA A 1 30 ? 9.659   -3.776  2.374   1.00 0.00 ? 30 ALA A H    7  
ATOM 7029  H HA   . ALA A 1 30 ? 8.149   -4.041  -0.145  1.00 0.00 ? 30 ALA A HA   7  
ATOM 7030  H HB1  . ALA A 1 30 ? 8.959   -1.966  -0.898  1.00 0.00 ? 30 ALA A HB1  7  
ATOM 7031  H HB2  . ALA A 1 30 ? 8.453   -1.690  0.770   1.00 0.00 ? 30 ALA A HB2  7  
ATOM 7032  H HB3  . ALA A 1 30 ? 10.165  -1.878  0.387   1.00 0.00 ? 30 ALA A HB3  7  
ATOM 7033  N N    . TYR A 1 31 ? 10.820  -5.350  0.495   1.00 0.00 ? 31 TYR A N    7  
ATOM 7034  C CA   . TYR A 1 31 ? 11.976  -6.106  0.031   1.00 0.00 ? 31 TYR A CA   7  
ATOM 7035  C C    . TYR A 1 31 ? 11.787  -7.599  0.279   1.00 0.00 ? 31 TYR A C    7  
ATOM 7036  O O    . TYR A 1 31 ? 12.705  -8.307  0.693   1.00 0.00 ? 31 TYR A O    7  
ATOM 7037  C CB   . TYR A 1 31 ? 13.246  -5.618  0.731   1.00 0.00 ? 31 TYR A CB   7  
ATOM 7038  C CG   . TYR A 1 31 ? 13.666  -4.225  0.320   1.00 0.00 ? 31 TYR A CG   7  
ATOM 7039  C CD1  . TYR A 1 31 ? 12.835  -3.134  0.539   1.00 0.00 ? 31 TYR A CD1  7  
ATOM 7040  C CD2  . TYR A 1 31 ? 14.896  -4.000  -0.286  1.00 0.00 ? 31 TYR A CD2  7  
ATOM 7041  C CE1  . TYR A 1 31 ? 13.215  -1.860  0.165   1.00 0.00 ? 31 TYR A CE1  7  
ATOM 7042  C CE2  . TYR A 1 31 ? 15.285  -2.729  -0.662  1.00 0.00 ? 31 TYR A CE2  7  
ATOM 7043  C CZ   . TYR A 1 31 ? 14.441  -1.662  -0.435  1.00 0.00 ? 31 TYR A CZ   7  
ATOM 7044  O OH   . TYR A 1 31 ? 14.824  -0.394  -0.808  1.00 0.00 ? 31 TYR A OH   7  
ATOM 7045  H H    . TYR A 1 31 ? 10.457  -5.532  1.387   1.00 0.00 ? 31 TYR A H    7  
ATOM 7046  H HA   . TYR A 1 31 ? 12.077  -5.939  -1.032  1.00 0.00 ? 31 TYR A HA   7  
ATOM 7047  H HB2  . TYR A 1 31 ? 13.081  -5.613  1.797   1.00 0.00 ? 31 TYR A HB2  7  
ATOM 7048  H HB3  . TYR A 1 31 ? 14.058  -6.292  0.499   1.00 0.00 ? 31 TYR A HB3  7  
ATOM 7049  H HD1  . TYR A 1 31 ? 11.875  -3.292  1.009   1.00 0.00 ? 31 TYR A HD1  7  
ATOM 7050  H HD2  . TYR A 1 31 ? 15.556  -4.837  -0.462  1.00 0.00 ? 31 TYR A HD2  7  
ATOM 7051  H HE1  . TYR A 1 31 ? 12.554  -1.024  0.343   1.00 0.00 ? 31 TYR A HE1  7  
ATOM 7052  H HE2  . TYR A 1 31 ? 16.245  -2.573  -1.132  1.00 0.00 ? 31 TYR A HE2  7  
ATOM 7053  H HH   . TYR A 1 31 ? 14.043  0.147   -0.948  1.00 0.00 ? 31 TYR A HH   7  
ATOM 7054  N N    . PRO A 1 32 ? 10.566  -8.091  0.021   1.00 0.00 ? 32 PRO A N    7  
ATOM 7055  C CA   . PRO A 1 32 ? 10.226  -9.504  0.207   1.00 0.00 ? 32 PRO A CA   7  
ATOM 7056  C C    . PRO A 1 32 ? 10.912  -10.406 -0.813  1.00 0.00 ? 32 PRO A C    7  
ATOM 7057  O O    . PRO A 1 32 ? 11.491  -9.928  -1.790  1.00 0.00 ? 32 PRO A O    7  
ATOM 7058  C CB   . PRO A 1 32 ? 8.708   -9.533  0.011   1.00 0.00 ? 32 PRO A CB   7  
ATOM 7059  C CG   . PRO A 1 32 ? 8.415   -8.354  -0.852  1.00 0.00 ? 32 PRO A CG   7  
ATOM 7060  C CD   . PRO A 1 32 ? 9.424   -7.304  -0.475  1.00 0.00 ? 32 PRO A CD   7  
ATOM 7061  H HA   . PRO A 1 32 ? 10.468  -9.842  1.204   1.00 0.00 ? 32 PRO A HA   7  
ATOM 7062  H HB2  . PRO A 1 32 ? 8.422   -10.457 -0.471  1.00 0.00 ? 32 PRO A HB2  7  
ATOM 7063  H HB3  . PRO A 1 32 ? 8.216   -9.453  0.969   1.00 0.00 ? 32 PRO A HB3  7  
ATOM 7064  H HG2  . PRO A 1 32 ? 8.526   -8.624  -1.891  1.00 0.00 ? 32 PRO A HG2  7  
ATOM 7065  H HG3  . PRO A 1 32 ? 7.414   -7.998  -0.659  1.00 0.00 ? 32 PRO A HG3  7  
ATOM 7066  H HD2  . PRO A 1 32 ? 9.703   -6.721  -1.340  1.00 0.00 ? 32 PRO A HD2  7  
ATOM 7067  H HD3  . PRO A 1 32 ? 9.031   -6.666  0.302   1.00 0.00 ? 32 PRO A HD3  7  
ATOM 7068  N N    . LYS A 1 33 ? 10.844  -11.712 -0.583  1.00 0.00 ? 33 LYS A N    7  
ATOM 7069  C CA   . LYS A 1 33 ? 11.457  -12.682 -1.483  1.00 0.00 ? 33 LYS A CA   7  
ATOM 7070  C C    . LYS A 1 33 ? 10.394  -13.435 -2.277  1.00 0.00 ? 33 LYS A C    7  
ATOM 7071  O O    . LYS A 1 33 ? 9.201   -13.320 -1.998  1.00 0.00 ? 33 LYS A O    7  
ATOM 7072  C CB   . LYS A 1 33 ? 12.315  -13.672 -0.692  1.00 0.00 ? 33 LYS A CB   7  
ATOM 7073  C CG   . LYS A 1 33 ? 13.337  -13.004 0.212   1.00 0.00 ? 33 LYS A CG   7  
ATOM 7074  C CD   . LYS A 1 33 ? 14.575  -12.583 -0.563  1.00 0.00 ? 33 LYS A CD   7  
ATOM 7075  C CE   . LYS A 1 33 ? 15.284  -11.418 0.111   1.00 0.00 ? 33 LYS A CE   7  
ATOM 7076  N NZ   . LYS A 1 33 ? 16.067  -11.858 1.299   1.00 0.00 ? 33 LYS A NZ   7  
ATOM 7077  H H    . LYS A 1 33 ? 10.369  -12.033 0.213   1.00 0.00 ? 33 LYS A H    7  
ATOM 7078  H HA   . LYS A 1 33 ? 12.089  -12.142 -2.172  1.00 0.00 ? 33 LYS A HA   7  
ATOM 7079  H HB2  . LYS A 1 33 ? 11.667  -14.281 -0.079  1.00 0.00 ? 33 LYS A HB2  7  
ATOM 7080  H HB3  . LYS A 1 33 ? 12.842  -14.309 -1.387  1.00 0.00 ? 33 LYS A HB3  7  
ATOM 7081  H HG2  . LYS A 1 33 ? 12.891  -12.129 0.660   1.00 0.00 ? 33 LYS A HG2  7  
ATOM 7082  H HG3  . LYS A 1 33 ? 13.628  -13.700 0.987   1.00 0.00 ? 33 LYS A HG3  7  
ATOM 7083  H HD2  . LYS A 1 33 ? 15.255  -13.420 -0.620  1.00 0.00 ? 33 LYS A HD2  7  
ATOM 7084  H HD3  . LYS A 1 33 ? 14.281  -12.287 -1.560  1.00 0.00 ? 33 LYS A HD3  7  
ATOM 7085  H HE2  . LYS A 1 33 ? 15.953  -10.961 -0.602  1.00 0.00 ? 33 LYS A HE2  7  
ATOM 7086  H HE3  . LYS A 1 33 ? 14.544  -10.696 0.424   1.00 0.00 ? 33 LYS A HE3  7  
ATOM 7087  H HZ1  . LYS A 1 33 ? 16.049  -12.895 1.375   1.00 0.00 ? 33 LYS A HZ1  7  
ATOM 7088  H HZ2  . LYS A 1 33 ? 15.659  -11.451 2.165   1.00 0.00 ? 33 LYS A HZ2  7  
ATOM 7089  H HZ3  . LYS A 1 33 ? 17.054  -11.543 1.213   1.00 0.00 ? 33 LYS A HZ3  7  
ATOM 7090  N N    . ASP A 1 34 ? 10.836  -14.205 -3.265  1.00 0.00 ? 34 ASP A N    7  
ATOM 7091  C CA   . ASP A 1 34 ? 9.923   -14.979 -4.097  1.00 0.00 ? 34 ASP A CA   7  
ATOM 7092  C C    . ASP A 1 34 ? 8.881   -15.695 -3.242  1.00 0.00 ? 34 ASP A C    7  
ATOM 7093  O O    . ASP A 1 34 ? 7.683   -15.619 -3.513  1.00 0.00 ? 34 ASP A O    7  
ATOM 7094  C CB   . ASP A 1 34 ? 10.700  -15.997 -4.934  1.00 0.00 ? 34 ASP A CB   7  
ATOM 7095  C CG   . ASP A 1 34 ? 11.230  -15.401 -6.223  1.00 0.00 ? 34 ASP A CG   7  
ATOM 7096  O OD1  . ASP A 1 34 ? 10.416  -14.890 -7.020  1.00 0.00 ? 34 ASP A OD1  7  
ATOM 7097  O OD2  . ASP A 1 34 ? 12.460  -15.447 -6.437  1.00 0.00 ? 34 ASP A OD2  7  
ATOM 7098  H H    . ASP A 1 34 ? 11.800  -14.255 -3.438  1.00 0.00 ? 34 ASP A H    7  
ATOM 7099  H HA   . ASP A 1 34 ? 9.416   -14.294 -4.760  1.00 0.00 ? 34 ASP A HA   7  
ATOM 7100  H HB2  . ASP A 1 34 ? 11.536  -16.363 -4.358  1.00 0.00 ? 34 ASP A HB2  7  
ATOM 7101  H HB3  . ASP A 1 34 ? 10.048  -16.822 -5.181  1.00 0.00 ? 34 ASP A HB3  7  
ATOM 7102  N N    . ASP A 1 35 ? 9.347   -16.389 -2.210  1.00 0.00 ? 35 ASP A N    7  
ATOM 7103  C CA   . ASP A 1 35 ? 8.457   -17.119 -1.315  1.00 0.00 ? 35 ASP A CA   7  
ATOM 7104  C C    . ASP A 1 35 ? 7.332   -16.218 -0.815  1.00 0.00 ? 35 ASP A C    7  
ATOM 7105  O O    . ASP A 1 35 ? 6.163   -16.600 -0.836  1.00 0.00 ? 35 ASP A O    7  
ATOM 7106  C CB   . ASP A 1 35 ? 9.241   -17.683 -0.129  1.00 0.00 ? 35 ASP A CB   7  
ATOM 7107  C CG   . ASP A 1 35 ? 8.638   -18.967 0.405   1.00 0.00 ? 35 ASP A CG   7  
ATOM 7108  O OD1  . ASP A 1 35 ? 8.971   -20.046 -0.128  1.00 0.00 ? 35 ASP A OD1  7  
ATOM 7109  O OD2  . ASP A 1 35 ? 7.834   -18.893 1.358   1.00 0.00 ? 35 ASP A OD2  7  
ATOM 7110  H H    . ASP A 1 35 ? 10.314  -16.412 -2.046  1.00 0.00 ? 35 ASP A H    7  
ATOM 7111  H HA   . ASP A 1 35 ? 8.025   -17.937 -1.871  1.00 0.00 ? 35 ASP A HA   7  
ATOM 7112  H HB2  . ASP A 1 35 ? 10.256  -17.886 -0.440  1.00 0.00 ? 35 ASP A HB2  7  
ATOM 7113  H HB3  . ASP A 1 35 ? 9.252   -16.953 0.667   1.00 0.00 ? 35 ASP A HB3  7  
ATOM 7114  N N    . GLU A 1 36 ? 7.695   -15.021 -0.364  1.00 0.00 ? 36 GLU A N    7  
ATOM 7115  C CA   . GLU A 1 36 ? 6.716   -14.067 0.144   1.00 0.00 ? 36 GLU A CA   7  
ATOM 7116  C C    . GLU A 1 36 ? 5.771   -13.616 -0.966  1.00 0.00 ? 36 GLU A C    7  
ATOM 7117  O O    . GLU A 1 36 ? 4.550   -13.660 -0.812  1.00 0.00 ? 36 GLU A O    7  
ATOM 7118  C CB   . GLU A 1 36 ? 7.422   -12.854 0.753   1.00 0.00 ? 36 GLU A CB   7  
ATOM 7119  C CG   . GLU A 1 36 ? 8.375   -13.207 1.882   1.00 0.00 ? 36 GLU A CG   7  
ATOM 7120  C CD   . GLU A 1 36 ? 7.658   -13.462 3.193   1.00 0.00 ? 36 GLU A CD   7  
ATOM 7121  O OE1  . GLU A 1 36 ? 7.052   -12.512 3.732   1.00 0.00 ? 36 GLU A OE1  7  
ATOM 7122  O OE2  . GLU A 1 36 ? 7.703   -14.611 3.681   1.00 0.00 ? 36 GLU A OE2  7  
ATOM 7123  H H    . GLU A 1 36 ? 8.644   -14.774 -0.372  1.00 0.00 ? 36 GLU A H    7  
ATOM 7124  H HA   . GLU A 1 36 ? 6.140   -14.561 0.912   1.00 0.00 ? 36 GLU A HA   7  
ATOM 7125  H HB2  . GLU A 1 36 ? 7.983   -12.352 -0.022  1.00 0.00 ? 36 GLU A HB2  7  
ATOM 7126  H HB3  . GLU A 1 36 ? 6.675   -12.176 1.140   1.00 0.00 ? 36 GLU A HB3  7  
ATOM 7127  H HG2  . GLU A 1 36 ? 8.921   -14.098 1.609   1.00 0.00 ? 36 GLU A HG2  7  
ATOM 7128  H HG3  . GLU A 1 36 ? 9.068   -12.390 2.020   1.00 0.00 ? 36 GLU A HG3  7  
ATOM 7129  N N    . PHE A 1 37 ? 6.344   -13.181 -2.083  1.00 0.00 ? 37 PHE A N    7  
ATOM 7130  C CA   . PHE A 1 37 ? 5.553   -12.720 -3.218  1.00 0.00 ? 37 PHE A CA   7  
ATOM 7131  C C    . PHE A 1 37 ? 4.439   -13.710 -3.544  1.00 0.00 ? 37 PHE A C    7  
ATOM 7132  O O    . PHE A 1 37 ? 3.332   -13.316 -3.907  1.00 0.00 ? 37 PHE A O    7  
ATOM 7133  C CB   . PHE A 1 37 ? 6.449   -12.521 -4.443  1.00 0.00 ? 37 PHE A CB   7  
ATOM 7134  C CG   . PHE A 1 37 ? 7.044   -11.145 -4.534  1.00 0.00 ? 37 PHE A CG   7  
ATOM 7135  C CD1  . PHE A 1 37 ? 8.257   -10.859 -3.930  1.00 0.00 ? 37 PHE A CD1  7  
ATOM 7136  C CD2  . PHE A 1 37 ? 6.389   -10.137 -5.223  1.00 0.00 ? 37 PHE A CD2  7  
ATOM 7137  C CE1  . PHE A 1 37 ? 8.808   -9.594  -4.012  1.00 0.00 ? 37 PHE A CE1  7  
ATOM 7138  C CE2  . PHE A 1 37 ? 6.934   -8.870  -5.309  1.00 0.00 ? 37 PHE A CE2  7  
ATOM 7139  C CZ   . PHE A 1 37 ? 8.145   -8.598  -4.702  1.00 0.00 ? 37 PHE A CZ   7  
ATOM 7140  H H    . PHE A 1 37 ? 7.322   -13.170 -2.145  1.00 0.00 ? 37 PHE A H    7  
ATOM 7141  H HA   . PHE A 1 37 ? 5.110   -11.773 -2.950  1.00 0.00 ? 37 PHE A HA   7  
ATOM 7142  H HB2  . PHE A 1 37 ? 7.261   -13.231 -4.405  1.00 0.00 ? 37 PHE A HB2  7  
ATOM 7143  H HB3  . PHE A 1 37 ? 5.867   -12.693 -5.336  1.00 0.00 ? 37 PHE A HB3  7  
ATOM 7144  H HD1  . PHE A 1 37 ? 8.777   -11.638 -3.390  1.00 0.00 ? 37 PHE A HD1  7  
ATOM 7145  H HD2  . PHE A 1 37 ? 5.441   -10.348 -5.698  1.00 0.00 ? 37 PHE A HD2  7  
ATOM 7146  H HE1  . PHE A 1 37 ? 9.754   -9.385  -3.536  1.00 0.00 ? 37 PHE A HE1  7  
ATOM 7147  H HE2  . PHE A 1 37 ? 6.414   -8.093  -5.849  1.00 0.00 ? 37 PHE A HE2  7  
ATOM 7148  H HZ   . PHE A 1 37 ? 8.573   -7.609  -4.768  1.00 0.00 ? 37 PHE A HZ   7  
ATOM 7149  N N    . GLU A 1 38 ? 4.743   -14.998 -3.411  1.00 0.00 ? 38 GLU A N    7  
ATOM 7150  C CA   . GLU A 1 38 ? 3.767   -16.045 -3.692  1.00 0.00 ? 38 GLU A CA   7  
ATOM 7151  C C    . GLU A 1 38 ? 2.517   -15.867 -2.836  1.00 0.00 ? 38 GLU A C    7  
ATOM 7152  O O    . GLU A 1 38 ? 1.395   -15.995 -3.326  1.00 0.00 ? 38 GLU A O    7  
ATOM 7153  C CB   . GLU A 1 38 ? 4.380   -17.424 -3.440  1.00 0.00 ? 38 GLU A CB   7  
ATOM 7154  C CG   . GLU A 1 38 ? 5.107   -17.997 -4.646  1.00 0.00 ? 38 GLU A CG   7  
ATOM 7155  C CD   . GLU A 1 38 ? 4.175   -18.283 -5.807  1.00 0.00 ? 38 GLU A CD   7  
ATOM 7156  O OE1  . GLU A 1 38 ? 3.346   -19.210 -5.688  1.00 0.00 ? 38 GLU A OE1  7  
ATOM 7157  O OE2  . GLU A 1 38 ? 4.275   -17.581 -6.835  1.00 0.00 ? 38 GLU A OE2  7  
ATOM 7158  H H    . GLU A 1 38 ? 5.643   -15.249 -3.118  1.00 0.00 ? 38 GLU A H    7  
ATOM 7159  H HA   . GLU A 1 38 ? 3.490   -15.969 -4.733  1.00 0.00 ? 38 GLU A HA   7  
ATOM 7160  H HB2  . GLU A 1 38 ? 5.083   -17.349 -2.624  1.00 0.00 ? 38 GLU A HB2  7  
ATOM 7161  H HB3  . GLU A 1 38 ? 3.592   -18.109 -3.163  1.00 0.00 ? 38 GLU A HB3  7  
ATOM 7162  H HG2  . GLU A 1 38 ? 5.853   -17.287 -4.970  1.00 0.00 ? 38 GLU A HG2  7  
ATOM 7163  H HG3  . GLU A 1 38 ? 5.590   -18.918 -4.354  1.00 0.00 ? 38 GLU A HG3  7  
ATOM 7164  N N    . GLN A 1 39 ? 2.720   -15.573 -1.556  1.00 0.00 ? 39 GLN A N    7  
ATOM 7165  C CA   . GLN A 1 39 ? 1.609   -15.379 -0.632  1.00 0.00 ? 39 GLN A CA   7  
ATOM 7166  C C    . GLN A 1 39 ? 0.584   -14.408 -1.208  1.00 0.00 ? 39 GLN A C    7  
ATOM 7167  O O    . GLN A 1 39 ? -0.618  -14.678 -1.197  1.00 0.00 ? 39 GLN A O    7  
ATOM 7168  C CB   . GLN A 1 39 ? 2.121   -14.860 0.713   1.00 0.00 ? 39 GLN A CB   7  
ATOM 7169  C CG   . GLN A 1 39 ? 2.937   -15.881 1.489   1.00 0.00 ? 39 GLN A CG   7  
ATOM 7170  C CD   . GLN A 1 39 ? 2.072   -16.924 2.169   1.00 0.00 ? 39 GLN A CD   7  
ATOM 7171  O OE1  . GLN A 1 39 ? 1.163   -17.487 1.559   1.00 0.00 ? 39 GLN A OE1  7  
ATOM 7172  N NE2  . GLN A 1 39 ? 2.351   -17.188 3.440   1.00 0.00 ? 39 GLN A NE2  7  
ATOM 7173  H H    . GLN A 1 39 ? 3.638   -15.484 -1.226  1.00 0.00 ? 39 GLN A H    7  
ATOM 7174  H HA   . GLN A 1 39 ? 1.134   -16.337 -0.480  1.00 0.00 ? 39 GLN A HA   7  
ATOM 7175  H HB2  . GLN A 1 39 ? 2.741   -13.993 0.538   1.00 0.00 ? 39 GLN A HB2  7  
ATOM 7176  H HB3  . GLN A 1 39 ? 1.275   -14.571 1.319   1.00 0.00 ? 39 GLN A HB3  7  
ATOM 7177  H HG2  . GLN A 1 39 ? 3.607   -16.382 0.806   1.00 0.00 ? 39 GLN A HG2  7  
ATOM 7178  H HG3  . GLN A 1 39 ? 3.513   -15.365 2.242   1.00 0.00 ? 39 GLN A HG3  7  
ATOM 7179  H HE21 . GLN A 1 39 ? 3.090   -16.699 3.862   1.00 0.00 ? 39 GLN A HE21 7  
ATOM 7180  H HE22 . GLN A 1 39 ? 1.808   -17.857 3.904   1.00 0.00 ? 39 GLN A HE22 7  
ATOM 7181  N N    . LEU A 1 40 ? 1.065   -13.277 -1.712  1.00 0.00 ? 40 LEU A N    7  
ATOM 7182  C CA   . LEU A 1 40 ? 0.191   -12.265 -2.293  1.00 0.00 ? 40 LEU A CA   7  
ATOM 7183  C C    . LEU A 1 40 ? -0.355  -12.726 -3.641  1.00 0.00 ? 40 LEU A C    7  
ATOM 7184  O O    . LEU A 1 40 ? -1.528  -12.518 -3.951  1.00 0.00 ? 40 LEU A O    7  
ATOM 7185  C CB   . LEU A 1 40 ? 0.946   -10.945 -2.460  1.00 0.00 ? 40 LEU A CB   7  
ATOM 7186  C CG   . LEU A 1 40 ? 1.466   -10.303 -1.174  1.00 0.00 ? 40 LEU A CG   7  
ATOM 7187  C CD1  . LEU A 1 40 ? 2.702   -9.464  -1.459  1.00 0.00 ? 40 LEU A CD1  7  
ATOM 7188  C CD2  . LEU A 1 40 ? 0.382   -9.455  -0.525  1.00 0.00 ? 40 LEU A CD2  7  
ATOM 7189  H H    . LEU A 1 40 ? 2.032   -13.119 -1.693  1.00 0.00 ? 40 LEU A H    7  
ATOM 7190  H HA   . LEU A 1 40 ? -0.637  -12.114 -1.616  1.00 0.00 ? 40 LEU A HA   7  
ATOM 7191  H HB2  . LEU A 1 40 ? 1.792   -11.128 -3.104  1.00 0.00 ? 40 LEU A HB2  7  
ATOM 7192  H HB3  . LEU A 1 40 ? 0.278   -10.241 -2.937  1.00 0.00 ? 40 LEU A HB3  7  
ATOM 7193  H HG   . LEU A 1 40 ? 1.745   -11.081 -0.477  1.00 0.00 ? 40 LEU A HG   7  
ATOM 7194  H HD11 . LEU A 1 40 ? 3.457   -9.671  -0.715  1.00 0.00 ? 40 LEU A HD11 7  
ATOM 7195  H HD12 . LEU A 1 40 ? 2.442   -8.416  -1.425  1.00 0.00 ? 40 LEU A HD12 7  
ATOM 7196  H HD13 . LEU A 1 40 ? 3.085   -9.708  -2.439  1.00 0.00 ? 40 LEU A HD13 7  
ATOM 7197  H HD21 . LEU A 1 40 ? 0.541   -9.424  0.543   1.00 0.00 ? 40 LEU A HD21 7  
ATOM 7198  H HD22 . LEU A 1 40 ? -0.586  -9.888  -0.732  1.00 0.00 ? 40 LEU A HD22 7  
ATOM 7199  H HD23 . LEU A 1 40 ? 0.422   -8.452  -0.924  1.00 0.00 ? 40 LEU A HD23 7  
ATOM 7200  N N    . SER A 1 41 ? 0.504   -13.354 -4.438  1.00 0.00 ? 41 SER A N    7  
ATOM 7201  C CA   . SER A 1 41 ? 0.109   -13.843 -5.753  1.00 0.00 ? 41 SER A CA   7  
ATOM 7202  C C    . SER A 1 41 ? -1.039  -14.842 -5.639  1.00 0.00 ? 41 SER A C    7  
ATOM 7203  O O    . SER A 1 41 ? -1.860  -14.967 -6.547  1.00 0.00 ? 41 SER A O    7  
ATOM 7204  C CB   . SER A 1 41 ? 1.300   -14.497 -6.457  1.00 0.00 ? 41 SER A CB   7  
ATOM 7205  O OG   . SER A 1 41 ? 1.365   -15.882 -6.169  1.00 0.00 ? 41 SER A OG   7  
ATOM 7206  H H    . SER A 1 41 ? 1.426   -13.490 -4.134  1.00 0.00 ? 41 SER A H    7  
ATOM 7207  H HA   . SER A 1 41 ? -0.223  -12.997 -6.336  1.00 0.00 ? 41 SER A HA   7  
ATOM 7208  H HB2  . SER A 1 41 ? 1.199   -14.368 -7.524  1.00 0.00 ? 41 SER A HB2  7  
ATOM 7209  H HB3  . SER A 1 41 ? 2.214   -14.028 -6.122  1.00 0.00 ? 41 SER A HB3  7  
ATOM 7210  H HG   . SER A 1 41 ? 0.956   -16.378 -6.882  1.00 0.00 ? 41 SER A HG   7  
ATOM 7211  N N    . ASN A 1 42 ? -1.089  -15.552 -4.517  1.00 0.00 ? 42 ASN A N    7  
ATOM 7212  C CA   . ASN A 1 42 ? -2.135  -16.540 -4.282  1.00 0.00 ? 42 ASN A CA   7  
ATOM 7213  C C    . ASN A 1 42 ? -3.400  -15.877 -3.746  1.00 0.00 ? 42 ASN A C    7  
ATOM 7214  O O    . ASN A 1 42 ? -4.515  -16.304 -4.049  1.00 0.00 ? 42 ASN A O    7  
ATOM 7215  C CB   . ASN A 1 42 ? -1.648  -17.606 -3.299  1.00 0.00 ? 42 ASN A CB   7  
ATOM 7216  C CG   . ASN A 1 42 ? -0.892  -18.726 -3.987  1.00 0.00 ? 42 ASN A CG   7  
ATOM 7217  O OD1  . ASN A 1 42 ? -1.482  -19.548 -4.690  1.00 0.00 ? 42 ASN A OD1  7  
ATOM 7218  N ND2  . ASN A 1 42 ? 0.420   -18.764 -3.789  1.00 0.00 ? 42 ASN A ND2  7  
ATOM 7219  H H    . ASN A 1 42 ? -0.405  -15.407 -3.829  1.00 0.00 ? 42 ASN A H    7  
ATOM 7220  H HA   . ASN A 1 42 ? -2.363  -17.012 -5.227  1.00 0.00 ? 42 ASN A HA   7  
ATOM 7221  H HB2  . ASN A 1 42 ? -0.990  -17.146 -2.576  1.00 0.00 ? 42 ASN A HB2  7  
ATOM 7222  H HB3  . ASN A 1 42 ? -2.498  -18.031 -2.787  1.00 0.00 ? 42 ASN A HB3  7  
ATOM 7223  H HD21 . ASN A 1 42 ? 0.822   -18.077 -3.217  1.00 0.00 ? 42 ASN A HD21 7  
ATOM 7224  H HD22 . ASN A 1 42 ? 0.933   -19.477 -4.222  1.00 0.00 ? 42 ASN A HD22 7  
ATOM 7225  N N    . LEU A 1 43 ? -3.219  -14.830 -2.948  1.00 0.00 ? 43 LEU A N    7  
ATOM 7226  C CA   . LEU A 1 43 ? -4.346  -14.107 -2.368  1.00 0.00 ? 43 LEU A CA   7  
ATOM 7227  C C    . LEU A 1 43 ? -5.059  -13.272 -3.427  1.00 0.00 ? 43 LEU A C    7  
ATOM 7228  O O    . LEU A 1 43 ? -6.254  -13.445 -3.669  1.00 0.00 ? 43 LEU A O    7  
ATOM 7229  C CB   . LEU A 1 43 ? -3.866  -13.205 -1.229  1.00 0.00 ? 43 LEU A CB   7  
ATOM 7230  C CG   . LEU A 1 43 ? -4.829  -12.098 -0.799  1.00 0.00 ? 43 LEU A CG   7  
ATOM 7231  C CD1  . LEU A 1 43 ? -6.161  -12.688 -0.363  1.00 0.00 ? 43 LEU A CD1  7  
ATOM 7232  C CD2  . LEU A 1 43 ? -4.220  -11.267 0.321   1.00 0.00 ? 43 LEU A CD2  7  
ATOM 7233  H H    . LEU A 1 43 ? -2.307  -14.537 -2.743  1.00 0.00 ? 43 LEU A H    7  
ATOM 7234  H HA   . LEU A 1 43 ? -5.039  -14.834 -1.974  1.00 0.00 ? 43 LEU A HA   7  
ATOM 7235  H HB2  . LEU A 1 43 ? -3.677  -13.831 -0.370  1.00 0.00 ? 43 LEU A HB2  7  
ATOM 7236  H HB3  . LEU A 1 43 ? -2.943  -12.739 -1.543  1.00 0.00 ? 43 LEU A HB3  7  
ATOM 7237  H HG   . LEU A 1 43 ? -5.014  -11.444 -1.640  1.00 0.00 ? 43 LEU A HG   7  
ATOM 7238  H HD11 . LEU A 1 43 ? -6.008  -13.330 0.491   1.00 0.00 ? 43 LEU A HD11 7  
ATOM 7239  H HD12 . LEU A 1 43 ? -6.583  -13.263 -1.174  1.00 0.00 ? 43 LEU A HD12 7  
ATOM 7240  H HD13 . LEU A 1 43 ? -6.839  -11.890 -0.098  1.00 0.00 ? 43 LEU A HD13 7  
ATOM 7241  H HD21 . LEU A 1 43 ? -4.201  -11.849 1.230   1.00 0.00 ? 43 LEU A HD21 7  
ATOM 7242  H HD22 . LEU A 1 43 ? -4.816  -10.379 0.475   1.00 0.00 ? 43 LEU A HD22 7  
ATOM 7243  H HD23 . LEU A 1 43 ? -3.213  -10.984 0.052   1.00 0.00 ? 43 LEU A HD23 7  
ATOM 7244  N N    . LEU A 1 44 ? -4.318  -12.367 -4.057  1.00 0.00 ? 44 LEU A N    7  
ATOM 7245  C CA   . LEU A 1 44 ? -4.878  -11.506 -5.093  1.00 0.00 ? 44 LEU A CA   7  
ATOM 7246  C C    . LEU A 1 44 ? -5.078  -12.277 -6.394  1.00 0.00 ? 44 LEU A C    7  
ATOM 7247  O O    . LEU A 1 44 ? -5.758  -11.810 -7.305  1.00 0.00 ? 44 LEU A O    7  
ATOM 7248  C CB   . LEU A 1 44 ? -3.963  -10.304 -5.335  1.00 0.00 ? 44 LEU A CB   7  
ATOM 7249  C CG   . LEU A 1 44 ? -3.619  -9.464  -4.104  1.00 0.00 ? 44 LEU A CG   7  
ATOM 7250  C CD1  . LEU A 1 44 ? -2.501  -8.483  -4.423  1.00 0.00 ? 44 LEU A CD1  7  
ATOM 7251  C CD2  . LEU A 1 44 ? -4.851  -8.726  -3.600  1.00 0.00 ? 44 LEU A CD2  7  
ATOM 7252  H H    . LEU A 1 44 ? -3.371  -12.275 -3.822  1.00 0.00 ? 44 LEU A H    7  
ATOM 7253  H HA   . LEU A 1 44 ? -5.838  -11.153 -4.747  1.00 0.00 ? 44 LEU A HA   7  
ATOM 7254  H HB2  . LEU A 1 44 ? -3.039  -10.671 -5.753  1.00 0.00 ? 44 LEU A HB2  7  
ATOM 7255  H HB3  . LEU A 1 44 ? -4.450  -9.658  -6.052  1.00 0.00 ? 44 LEU A HB3  7  
ATOM 7256  H HG   . LEU A 1 44 ? -3.274  -10.118 -3.315  1.00 0.00 ? 44 LEU A HG   7  
ATOM 7257  H HD11 . LEU A 1 44 ? -1.609  -9.029  -4.687  1.00 0.00 ? 44 LEU A HD11 7  
ATOM 7258  H HD12 . LEU A 1 44 ? -2.305  -7.868  -3.557  1.00 0.00 ? 44 LEU A HD12 7  
ATOM 7259  H HD13 . LEU A 1 44 ? -2.799  -7.855  -5.250  1.00 0.00 ? 44 LEU A HD13 7  
ATOM 7260  H HD21 . LEU A 1 44 ? -5.455  -8.419  -4.441  1.00 0.00 ? 44 LEU A HD21 7  
ATOM 7261  H HD22 . LEU A 1 44 ? -4.545  -7.854  -3.040  1.00 0.00 ? 44 LEU A HD22 7  
ATOM 7262  H HD23 . LEU A 1 44 ? -5.427  -9.380  -2.963  1.00 0.00 ? 44 LEU A HD23 7  
ATOM 7263  N N    . ASN A 1 45 ? -4.481  -13.462 -6.470  1.00 0.00 ? 45 ASN A N    7  
ATOM 7264  C CA   . ASN A 1 45 ? -4.594  -14.300 -7.659  1.00 0.00 ? 45 ASN A CA   7  
ATOM 7265  C C    . ASN A 1 45 ? -3.914  -13.641 -8.855  1.00 0.00 ? 45 ASN A C    7  
ATOM 7266  O O    . ASN A 1 45 ? -4.310  -13.853 -10.002 1.00 0.00 ? 45 ASN A O    7  
ATOM 7267  C CB   . ASN A 1 45 ? -6.065  -14.570 -7.979  1.00 0.00 ? 45 ASN A CB   7  
ATOM 7268  C CG   . ASN A 1 45 ? -6.241  -15.677 -9.001  1.00 0.00 ? 45 ASN A CG   7  
ATOM 7269  O OD1  . ASN A 1 45 ? -6.861  -15.480 -10.046 1.00 0.00 ? 45 ASN A OD1  7  
ATOM 7270  N ND2  . ASN A 1 45 ? -5.694  -16.850 -8.702  1.00 0.00 ? 45 ASN A ND2  7  
ATOM 7271  H H    . ASN A 1 45 ? -3.951  -13.781 -5.710  1.00 0.00 ? 45 ASN A H    7  
ATOM 7272  H HA   . ASN A 1 45 ? -4.102  -15.238 -7.451  1.00 0.00 ? 45 ASN A HA   7  
ATOM 7273  H HB2  . ASN A 1 45 ? -6.578  -14.859 -7.073  1.00 0.00 ? 45 ASN A HB2  7  
ATOM 7274  H HB3  . ASN A 1 45 ? -6.514  -13.669 -8.370  1.00 0.00 ? 45 ASN A HB3  7  
ATOM 7275  H HD21 . ASN A 1 45 ? -5.215  -16.934 -7.851  1.00 0.00 ? 45 ASN A HD21 7  
ATOM 7276  H HD22 . ASN A 1 45 ? -5.792  -17.583 -9.345  1.00 0.00 ? 45 ASN A HD22 7  
ATOM 7277  N N    . LEU A 1 46 ? -2.890  -12.842 -8.580  1.00 0.00 ? 46 LEU A N    7  
ATOM 7278  C CA   . LEU A 1 46 ? -2.153  -12.152 -9.634  1.00 0.00 ? 46 LEU A CA   7  
ATOM 7279  C C    . LEU A 1 46 ? -0.743  -12.717 -9.773  1.00 0.00 ? 46 LEU A C    7  
ATOM 7280  O O    . LEU A 1 46 ? -0.163  -13.244 -8.824  1.00 0.00 ? 46 LEU A O    7  
ATOM 7281  C CB   . LEU A 1 46 ? -2.087  -10.652 -9.339  1.00 0.00 ? 46 LEU A CB   7  
ATOM 7282  C CG   . LEU A 1 46 ? -3.430  -9.927  -9.244  1.00 0.00 ? 46 LEU A CG   7  
ATOM 7283  C CD1  . LEU A 1 46 ? -3.242  -8.528  -8.679  1.00 0.00 ? 46 LEU A CD1  7  
ATOM 7284  C CD2  . LEU A 1 46 ? -4.101  -9.867  -10.608 1.00 0.00 ? 46 LEU A CD2  7  
ATOM 7285  H H    . LEU A 1 46 ? -2.621  -12.712 -7.648  1.00 0.00 ? 46 LEU A H    7  
ATOM 7286  H HA   . LEU A 1 46 ? -2.683  -12.305 -10.563 1.00 0.00 ? 46 LEU A HA   7  
ATOM 7287  H HB2  . LEU A 1 46 ? -1.574  -10.523 -8.399  1.00 0.00 ? 46 LEU A HB2  7  
ATOM 7288  H HB3  . LEU A 1 46 ? -1.513  -10.186 -10.127 1.00 0.00 ? 46 LEU A HB3  7  
ATOM 7289  H HG   . LEU A 1 46 ? -4.080  -10.472 -8.574  1.00 0.00 ? 46 LEU A HG   7  
ATOM 7290  H HD11 . LEU A 1 46 ? -2.257  -8.444  -8.245  1.00 0.00 ? 46 LEU A HD11 7  
ATOM 7291  H HD12 . LEU A 1 46 ? -3.987  -8.344  -7.919  1.00 0.00 ? 46 LEU A HD12 7  
ATOM 7292  H HD13 . LEU A 1 46 ? -3.350  -7.802  -9.471  1.00 0.00 ? 46 LEU A HD13 7  
ATOM 7293  H HD21 . LEU A 1 46 ? -5.141  -9.603  -10.486 1.00 0.00 ? 46 LEU A HD21 7  
ATOM 7294  H HD22 . LEU A 1 46 ? -4.030  -10.833 -11.087 1.00 0.00 ? 46 LEU A HD22 7  
ATOM 7295  H HD23 . LEU A 1 46 ? -3.610  -9.124  -11.219 1.00 0.00 ? 46 LEU A HD23 7  
ATOM 7296  N N    . PRO A 1 47 ? -0.177  -12.604 -10.983 1.00 0.00 ? 47 PRO A N    7  
ATOM 7297  C CA   . PRO A 1 47 ? 1.173   -13.095 -11.275 1.00 0.00 ? 47 PRO A CA   7  
ATOM 7298  C C    . PRO A 1 47 ? 2.253   -12.268 -10.584 1.00 0.00 ? 47 PRO A C    7  
ATOM 7299  O O    . PRO A 1 47 ? 2.234   -11.038 -10.633 1.00 0.00 ? 47 PRO A O    7  
ATOM 7300  C CB   . PRO A 1 47 ? 1.282   -12.953 -12.795 1.00 0.00 ? 47 PRO A CB   7  
ATOM 7301  C CG   . PRO A 1 47 ? 0.322   -11.869 -13.144 1.00 0.00 ? 47 PRO A CG   7  
ATOM 7302  C CD   . PRO A 1 47 ? -0.810  -11.987 -12.161 1.00 0.00 ? 47 PRO A CD   7  
ATOM 7303  H HA   . PRO A 1 47 ? 1.285   -14.133 -10.999 1.00 0.00 ? 47 PRO A HA   7  
ATOM 7304  H HB2  . PRO A 1 47 ? 2.295   -12.686 -13.062 1.00 0.00 ? 47 PRO A HB2  7  
ATOM 7305  H HB3  . PRO A 1 47 ? 1.013   -13.886 -13.267 1.00 0.00 ? 47 PRO A HB3  7  
ATOM 7306  H HG2  . PRO A 1 47 ? 0.803   -10.908 -13.049 1.00 0.00 ? 47 PRO A HG2  7  
ATOM 7307  H HG3  . PRO A 1 47 ? -0.041  -12.011 -14.151 1.00 0.00 ? 47 PRO A HG3  7  
ATOM 7308  H HD2  . PRO A 1 47 ? -1.203  -11.010 -11.920 1.00 0.00 ? 47 PRO A HD2  7  
ATOM 7309  H HD3  . PRO A 1 47 ? -1.589  -12.622 -12.556 1.00 0.00 ? 47 PRO A HD3  7  
ATOM 7310  N N    . THR A 1 48 ? 3.194   -12.952 -9.940  1.00 0.00 ? 48 THR A N    7  
ATOM 7311  C CA   . THR A 1 48 ? 4.281   -12.281 -9.239  1.00 0.00 ? 48 THR A CA   7  
ATOM 7312  C C    . THR A 1 48 ? 4.893   -11.180 -10.098 1.00 0.00 ? 48 THR A C    7  
ATOM 7313  O O    . THR A 1 48 ? 5.310   -10.140 -9.586  1.00 0.00 ? 48 THR A O    7  
ATOM 7314  C CB   . THR A 1 48 ? 5.386   -13.274 -8.834  1.00 0.00 ? 48 THR A CB   7  
ATOM 7315  O OG1  . THR A 1 48 ? 5.621   -14.205 -9.897  1.00 0.00 ? 48 THR A OG1  7  
ATOM 7316  C CG2  . THR A 1 48 ? 5.001   -14.027 -7.569  1.00 0.00 ? 48 THR A CG2  7  
ATOM 7317  H H    . THR A 1 48 ? 3.154   -13.931 -9.937  1.00 0.00 ? 48 THR A H    7  
ATOM 7318  H HA   . THR A 1 48 ? 3.876   -11.840 -8.340  1.00 0.00 ? 48 THR A HA   7  
ATOM 7319  H HB   . THR A 1 48 ? 6.295   -12.721 -8.643  1.00 0.00 ? 48 THR A HB   7  
ATOM 7320  H HG1  . THR A 1 48 ? 5.993   -15.014 -9.537  1.00 0.00 ? 48 THR A HG1  7  
ATOM 7321  H HG21 . THR A 1 48 ? 4.515   -13.351 -6.882  1.00 0.00 ? 48 THR A HG21 7  
ATOM 7322  H HG22 . THR A 1 48 ? 5.889   -14.433 -7.108  1.00 0.00 ? 48 THR A HG22 7  
ATOM 7323  H HG23 . THR A 1 48 ? 4.326   -14.831 -7.821  1.00 0.00 ? 48 THR A HG23 7  
ATOM 7324  N N    . ARG A 1 49 ? 4.942   -11.414 -11.405 1.00 0.00 ? 49 ARG A N    7  
ATOM 7325  C CA   . ARG A 1 49 ? 5.504   -10.442 -12.335 1.00 0.00 ? 49 ARG A CA   7  
ATOM 7326  C C    . ARG A 1 49 ? 4.771   -9.107  -12.234 1.00 0.00 ? 49 ARG A C    7  
ATOM 7327  O O    . ARG A 1 49 ? 5.375   -8.043  -12.370 1.00 0.00 ? 49 ARG A O    7  
ATOM 7328  C CB   . ARG A 1 49 ? 5.426   -10.971 -13.768 1.00 0.00 ? 49 ARG A CB   7  
ATOM 7329  C CG   . ARG A 1 49 ? 4.114   -10.652 -14.465 1.00 0.00 ? 49 ARG A CG   7  
ATOM 7330  C CD   . ARG A 1 49 ? 4.184   -9.324  -15.203 1.00 0.00 ? 49 ARG A CD   7  
ATOM 7331  N NE   . ARG A 1 49 ? 4.663   -9.484  -16.573 1.00 0.00 ? 49 ARG A NE   7  
ATOM 7332  C CZ   . ARG A 1 49 ? 5.233   -8.508  -17.271 1.00 0.00 ? 49 ARG A CZ   7  
ATOM 7333  N NH1  . ARG A 1 49 ? 5.396   -7.309  -16.729 1.00 0.00 ? 49 ARG A NH1  7  
ATOM 7334  N NH2  . ARG A 1 49 ? 5.643   -8.731  -18.513 1.00 0.00 ? 49 ARG A NH2  7  
ATOM 7335  H H    . ARG A 1 49 ? 4.594   -12.262 -11.752 1.00 0.00 ? 49 ARG A H    7  
ATOM 7336  H HA   . ARG A 1 49 ? 6.540   -10.291 -12.071 1.00 0.00 ? 49 ARG A HA   7  
ATOM 7337  H HB2  . ARG A 1 49 ? 6.230   -10.536 -14.344 1.00 0.00 ? 49 ARG A HB2  7  
ATOM 7338  H HB3  . ARG A 1 49 ? 5.548   -12.044 -13.749 1.00 0.00 ? 49 ARG A HB3  7  
ATOM 7339  H HG2  . ARG A 1 49 ? 3.895   -11.435 -15.176 1.00 0.00 ? 49 ARG A HG2  7  
ATOM 7340  H HG3  . ARG A 1 49 ? 3.328   -10.603 -13.727 1.00 0.00 ? 49 ARG A HG3  7  
ATOM 7341  H HD2  . ARG A 1 49 ? 3.197   -8.888  -15.226 1.00 0.00 ? 49 ARG A HD2  7  
ATOM 7342  H HD3  . ARG A 1 49 ? 4.856   -8.667  -14.671 1.00 0.00 ? 49 ARG A HD3  7  
ATOM 7343  H HE   . ARG A 1 49 ? 4.553   -10.362 -16.993 1.00 0.00 ? 49 ARG A HE   7  
ATOM 7344  H HH11 . ARG A 1 49 ? 5.089   -7.138  -15.793 1.00 0.00 ? 49 ARG A HH11 7  
ATOM 7345  H HH12 . ARG A 1 49 ? 5.827   -6.576  -17.257 1.00 0.00 ? 49 ARG A HH12 7  
ATOM 7346  H HH21 . ARG A 1 49 ? 5.523   -9.634  -18.925 1.00 0.00 ? 49 ARG A HH21 7  
ATOM 7347  H HH22 . ARG A 1 49 ? 6.072   -7.996  -19.037 1.00 0.00 ? 49 ARG A HH22 7  
ATOM 7348  N N    . VAL A 1 50 ? 3.465   -9.172  -11.994 1.00 0.00 ? 50 VAL A N    7  
ATOM 7349  C CA   . VAL A 1 50 ? 2.649   -7.969  -11.875 1.00 0.00 ? 50 VAL A CA   7  
ATOM 7350  C C    . VAL A 1 50 ? 2.854   -7.299  -10.521 1.00 0.00 ? 50 VAL A C    7  
ATOM 7351  O O    . VAL A 1 50 ? 2.865   -6.072  -10.419 1.00 0.00 ? 50 VAL A O    7  
ATOM 7352  C CB   . VAL A 1 50 ? 1.153   -8.285  -12.058 1.00 0.00 ? 50 VAL A CB   7  
ATOM 7353  C CG1  . VAL A 1 50 ? 0.297   -7.146  -11.526 1.00 0.00 ? 50 VAL A CG1  7  
ATOM 7354  C CG2  . VAL A 1 50 ? 0.842   -8.557  -13.522 1.00 0.00 ? 50 VAL A CG2  7  
ATOM 7355  H H    . VAL A 1 50 ? 3.040   -10.049 -11.895 1.00 0.00 ? 50 VAL A H    7  
ATOM 7356  H HA   . VAL A 1 50 ? 2.949   -7.283  -12.654 1.00 0.00 ? 50 VAL A HA   7  
ATOM 7357  H HB   . VAL A 1 50 ? 0.922   -9.175  -11.491 1.00 0.00 ? 50 VAL A HB   7  
ATOM 7358  H HG11 . VAL A 1 50 ? -0.741  -7.340  -11.751 1.00 0.00 ? 50 VAL A HG11 7  
ATOM 7359  H HG12 . VAL A 1 50 ? 0.426   -7.068  -10.456 1.00 0.00 ? 50 VAL A HG12 7  
ATOM 7360  H HG13 . VAL A 1 50 ? 0.599   -6.220  -11.993 1.00 0.00 ? 50 VAL A HG13 7  
ATOM 7361  H HG21 . VAL A 1 50 ? 0.721   -7.619  -14.044 1.00 0.00 ? 50 VAL A HG21 7  
ATOM 7362  H HG22 . VAL A 1 50 ? 1.655   -9.114  -13.966 1.00 0.00 ? 50 VAL A HG22 7  
ATOM 7363  H HG23 . VAL A 1 50 ? -0.070  -9.131  -13.596 1.00 0.00 ? 50 VAL A HG23 7  
ATOM 7364  N N    . ILE A 1 51 ? 3.016   -8.113  -9.483  1.00 0.00 ? 51 ILE A N    7  
ATOM 7365  C CA   . ILE A 1 51 ? 3.222   -7.598  -8.134  1.00 0.00 ? 51 ILE A CA   7  
ATOM 7366  C C    . ILE A 1 51 ? 4.631   -7.040  -7.968  1.00 0.00 ? 51 ILE A C    7  
ATOM 7367  O O    . ILE A 1 51 ? 4.851   -6.099  -7.206  1.00 0.00 ? 51 ILE A O    7  
ATOM 7368  C CB   . ILE A 1 51 ? 2.986   -8.689  -7.073  1.00 0.00 ? 51 ILE A CB   7  
ATOM 7369  C CG1  . ILE A 1 51 ? 1.692   -9.450  -7.371  1.00 0.00 ? 51 ILE A CG1  7  
ATOM 7370  C CG2  . ILE A 1 51 ? 2.937   -8.074  -5.683  1.00 0.00 ? 51 ILE A CG2  7  
ATOM 7371  C CD1  . ILE A 1 51 ? 1.549   -10.732 -6.581  1.00 0.00 ? 51 ILE A CD1  7  
ATOM 7372  H H    . ILE A 1 51 ? 2.997   -9.081  -9.627  1.00 0.00 ? 51 ILE A H    7  
ATOM 7373  H HA   . ILE A 1 51 ? 2.509   -6.803  -7.969  1.00 0.00 ? 51 ILE A HA   7  
ATOM 7374  H HB   . ILE A 1 51 ? 3.816   -9.378  -7.107  1.00 0.00 ? 51 ILE A HB   7  
ATOM 7375  H HG12 . ILE A 1 51 ? 0.849   -8.820  -7.136  1.00 0.00 ? 51 ILE A HG12 7  
ATOM 7376  H HG13 . ILE A 1 51 ? 1.666   -9.702  -8.422  1.00 0.00 ? 51 ILE A HG13 7  
ATOM 7377  H HG21 . ILE A 1 51 ? 3.926   -7.745  -5.400  1.00 0.00 ? 51 ILE A HG21 7  
ATOM 7378  H HG22 . ILE A 1 51 ? 2.265   -7.229  -5.687  1.00 0.00 ? 51 ILE A HG22 7  
ATOM 7379  H HG23 . ILE A 1 51 ? 2.586   -8.810  -4.975  1.00 0.00 ? 51 ILE A HG23 7  
ATOM 7380  H HD11 . ILE A 1 51 ? 2.034   -10.620 -5.622  1.00 0.00 ? 51 ILE A HD11 7  
ATOM 7381  H HD12 . ILE A 1 51 ? 0.502   -10.949 -6.433  1.00 0.00 ? 51 ILE A HD12 7  
ATOM 7382  H HD13 . ILE A 1 51 ? 2.011   -11.543 -7.125  1.00 0.00 ? 51 ILE A HD13 7  
ATOM 7383  N N    . VAL A 1 52 ? 5.582   -7.625  -8.689  1.00 0.00 ? 52 VAL A N    7  
ATOM 7384  C CA   . VAL A 1 52 ? 6.970   -7.184  -8.624  1.00 0.00 ? 52 VAL A CA   7  
ATOM 7385  C C    . VAL A 1 52 ? 7.128   -5.779  -9.195  1.00 0.00 ? 52 VAL A C    7  
ATOM 7386  O O    . VAL A 1 52 ? 7.629   -4.877  -8.523  1.00 0.00 ? 52 VAL A O    7  
ATOM 7387  C CB   . VAL A 1 52 ? 7.900   -8.144  -9.390  1.00 0.00 ? 52 VAL A CB   7  
ATOM 7388  C CG1  . VAL A 1 52 ? 9.331   -7.628  -9.372  1.00 0.00 ? 52 VAL A CG1  7  
ATOM 7389  C CG2  . VAL A 1 52 ? 7.822   -9.544  -8.800  1.00 0.00 ? 52 VAL A CG2  7  
ATOM 7390  H H    . VAL A 1 52 ? 5.345   -8.370  -9.279  1.00 0.00 ? 52 VAL A H    7  
ATOM 7391  H HA   . VAL A 1 52 ? 7.270   -7.176  -7.587  1.00 0.00 ? 52 VAL A HA   7  
ATOM 7392  H HB   . VAL A 1 52 ? 7.570   -8.190  -10.417 1.00 0.00 ? 52 VAL A HB   7  
ATOM 7393  H HG11 . VAL A 1 52 ? 9.800   -7.900  -8.438  1.00 0.00 ? 52 VAL A HG11 7  
ATOM 7394  H HG12 . VAL A 1 52 ? 9.882   -8.065  -10.193 1.00 0.00 ? 52 VAL A HG12 7  
ATOM 7395  H HG13 . VAL A 1 52 ? 9.327   -6.553  -9.473  1.00 0.00 ? 52 VAL A HG13 7  
ATOM 7396  H HG21 . VAL A 1 52 ? 7.509   -10.239 -9.564  1.00 0.00 ? 52 VAL A HG21 7  
ATOM 7397  H HG22 . VAL A 1 52 ? 8.794   -9.833  -8.427  1.00 0.00 ? 52 VAL A HG22 7  
ATOM 7398  H HG23 . VAL A 1 52 ? 7.109   -9.554  -7.989  1.00 0.00 ? 52 VAL A HG23 7  
ATOM 7399  N N    . VAL A 1 53 ? 6.696   -5.599  -10.439 1.00 0.00 ? 53 VAL A N    7  
ATOM 7400  C CA   . VAL A 1 53 ? 6.788   -4.303  -11.101 1.00 0.00 ? 53 VAL A CA   7  
ATOM 7401  C C    . VAL A 1 53 ? 6.166   -3.205  -10.246 1.00 0.00 ? 53 VAL A C    7  
ATOM 7402  O O    . VAL A 1 53 ? 6.688   -2.093  -10.170 1.00 0.00 ? 53 VAL A O    7  
ATOM 7403  C CB   . VAL A 1 53 ? 6.093   -4.324  -12.475 1.00 0.00 ? 53 VAL A CB   7  
ATOM 7404  C CG1  . VAL A 1 53 ? 6.136   -2.946  -13.117 1.00 0.00 ? 53 VAL A CG1  7  
ATOM 7405  C CG2  . VAL A 1 53 ? 6.736   -5.363  -13.381 1.00 0.00 ? 53 VAL A CG2  7  
ATOM 7406  H H    . VAL A 1 53 ? 6.306   -6.357  -10.924 1.00 0.00 ? 53 VAL A H    7  
ATOM 7407  H HA   . VAL A 1 53 ? 7.834   -4.079  -11.253 1.00 0.00 ? 53 VAL A HA   7  
ATOM 7408  H HB   . VAL A 1 53 ? 5.058   -4.596  -12.328 1.00 0.00 ? 53 VAL A HB   7  
ATOM 7409  H HG11 . VAL A 1 53 ? 6.938   -2.370  -12.678 1.00 0.00 ? 53 VAL A HG11 7  
ATOM 7410  H HG12 . VAL A 1 53 ? 6.303   -3.048  -14.179 1.00 0.00 ? 53 VAL A HG12 7  
ATOM 7411  H HG13 . VAL A 1 53 ? 5.196   -2.440  -12.946 1.00 0.00 ? 53 VAL A HG13 7  
ATOM 7412  H HG21 . VAL A 1 53 ? 7.577   -5.811  -12.873 1.00 0.00 ? 53 VAL A HG21 7  
ATOM 7413  H HG22 . VAL A 1 53 ? 6.012   -6.128  -13.623 1.00 0.00 ? 53 VAL A HG22 7  
ATOM 7414  H HG23 . VAL A 1 53 ? 7.075   -4.889  -14.290 1.00 0.00 ? 53 VAL A HG23 7  
ATOM 7415  N N    . TRP A 1 54 ? 5.048   -3.524  -9.603  1.00 0.00 ? 54 TRP A N    7  
ATOM 7416  C CA   . TRP A 1 54 ? 4.355   -2.564  -8.752  1.00 0.00 ? 54 TRP A CA   7  
ATOM 7417  C C    . TRP A 1 54 ? 5.187   -2.229  -7.519  1.00 0.00 ? 54 TRP A C    7  
ATOM 7418  O O    . TRP A 1 54 ? 5.321   -1.064  -7.147  1.00 0.00 ? 54 TRP A O    7  
ATOM 7419  C CB   . TRP A 1 54 ? 2.993   -3.117  -8.329  1.00 0.00 ? 54 TRP A CB   7  
ATOM 7420  C CG   . TRP A 1 54 ? 2.176   -2.142  -7.536  1.00 0.00 ? 54 TRP A CG   7  
ATOM 7421  C CD1  . TRP A 1 54 ? 1.126   -1.395  -7.987  1.00 0.00 ? 54 TRP A CD1  7  
ATOM 7422  C CD2  . TRP A 1 54 ? 2.345   -1.809  -6.154  1.00 0.00 ? 54 TRP A CD2  7  
ATOM 7423  N NE1  . TRP A 1 54 ? 0.632   -0.616  -6.968  1.00 0.00 ? 54 TRP A NE1  7  
ATOM 7424  C CE2  . TRP A 1 54 ? 1.361   -0.853  -5.833  1.00 0.00 ? 54 TRP A CE2  7  
ATOM 7425  C CE3  . TRP A 1 54 ? 3.229   -2.226  -5.155  1.00 0.00 ? 54 TRP A CE3  7  
ATOM 7426  C CZ2  . TRP A 1 54 ? 1.241   -0.308  -4.557  1.00 0.00 ? 54 TRP A CZ2  7  
ATOM 7427  C CZ3  . TRP A 1 54 ? 3.108   -1.685  -3.890  1.00 0.00 ? 54 TRP A CZ3  7  
ATOM 7428  C CH2  . TRP A 1 54 ? 2.120   -0.735  -3.599  1.00 0.00 ? 54 TRP A CH2  7  
ATOM 7429  H H    . TRP A 1 54 ? 4.680   -4.428  -9.703  1.00 0.00 ? 54 TRP A H    7  
ATOM 7430  H HA   . TRP A 1 54 ? 4.204   -1.662  -9.327  1.00 0.00 ? 54 TRP A HA   7  
ATOM 7431  H HB2  . TRP A 1 54 ? 2.430   -3.383  -9.211  1.00 0.00 ? 54 TRP A HB2  7  
ATOM 7432  H HB3  . TRP A 1 54 ? 3.143   -3.999  -7.723  1.00 0.00 ? 54 TRP A HB3  7  
ATOM 7433  H HD1  . TRP A 1 54 ? 0.752   -1.420  -8.999  1.00 0.00 ? 54 TRP A HD1  7  
ATOM 7434  H HE1  . TRP A 1 54 ? -0.123  0.006   -7.042  1.00 0.00 ? 54 TRP A HE1  7  
ATOM 7435  H HE3  . TRP A 1 54 ? 3.998   -2.957  -5.360  1.00 0.00 ? 54 TRP A HE3  7  
ATOM 7436  H HZ2  . TRP A 1 54 ? 0.484   0.424   -4.317  1.00 0.00 ? 54 TRP A HZ2  7  
ATOM 7437  H HZ3  . TRP A 1 54 ? 3.783   -1.995  -3.105  1.00 0.00 ? 54 TRP A HZ3  7  
ATOM 7438  H HH2  . TRP A 1 54 ? 2.063   -0.339  -2.597  1.00 0.00 ? 54 TRP A HH2  7  
ATOM 7439  N N    . PHE A 1 55 ? 5.743   -3.259  -6.889  1.00 0.00 ? 55 PHE A N    7  
ATOM 7440  C CA   . PHE A 1 55 ? 6.562   -3.073  -5.697  1.00 0.00 ? 55 PHE A CA   7  
ATOM 7441  C C    . PHE A 1 55 ? 7.841   -2.310  -6.028  1.00 0.00 ? 55 PHE A C    7  
ATOM 7442  O O    . PHE A 1 55 ? 8.288   -1.462  -5.256  1.00 0.00 ? 55 PHE A O    7  
ATOM 7443  C CB   . PHE A 1 55 ? 6.909   -4.427  -5.075  1.00 0.00 ? 55 PHE A CB   7  
ATOM 7444  C CG   . PHE A 1 55 ? 5.915   -4.887  -4.047  1.00 0.00 ? 55 PHE A CG   7  
ATOM 7445  C CD1  . PHE A 1 55 ? 4.592   -5.108  -4.394  1.00 0.00 ? 55 PHE A CD1  7  
ATOM 7446  C CD2  . PHE A 1 55 ? 6.304   -5.098  -2.734  1.00 0.00 ? 55 PHE A CD2  7  
ATOM 7447  C CE1  . PHE A 1 55 ? 3.675   -5.532  -3.450  1.00 0.00 ? 55 PHE A CE1  7  
ATOM 7448  C CE2  . PHE A 1 55 ? 5.392   -5.522  -1.786  1.00 0.00 ? 55 PHE A CE2  7  
ATOM 7449  C CZ   . PHE A 1 55 ? 4.075   -5.738  -2.145  1.00 0.00 ? 55 PHE A CZ   7  
ATOM 7450  H H    . PHE A 1 55 ? 5.600   -4.165  -7.234  1.00 0.00 ? 55 PHE A H    7  
ATOM 7451  H HA   . PHE A 1 55 ? 5.987   -2.497  -4.988  1.00 0.00 ? 55 PHE A HA   7  
ATOM 7452  H HB2  . PHE A 1 55 ? 6.950   -5.173  -5.854  1.00 0.00 ? 55 PHE A HB2  7  
ATOM 7453  H HB3  . PHE A 1 55 ? 7.875   -4.358  -4.597  1.00 0.00 ? 55 PHE A HB3  7  
ATOM 7454  H HD1  . PHE A 1 55 ? 4.278   -4.947  -5.415  1.00 0.00 ? 55 PHE A HD1  7  
ATOM 7455  H HD2  . PHE A 1 55 ? 7.333   -4.928  -2.451  1.00 0.00 ? 55 PHE A HD2  7  
ATOM 7456  H HE1  . PHE A 1 55 ? 2.647   -5.700  -3.734  1.00 0.00 ? 55 PHE A HE1  7  
ATOM 7457  H HE2  . PHE A 1 55 ? 5.707   -5.682  -0.766  1.00 0.00 ? 55 PHE A HE2  7  
ATOM 7458  H HZ   . PHE A 1 55 ? 3.361   -6.070  -1.406  1.00 0.00 ? 55 PHE A HZ   7  
ATOM 7459  N N    . GLN A 1 56 ? 8.425   -2.619  -7.182  1.00 0.00 ? 56 GLN A N    7  
ATOM 7460  C CA   . GLN A 1 56 ? 9.653   -1.963  -7.615  1.00 0.00 ? 56 GLN A CA   7  
ATOM 7461  C C    . GLN A 1 56 ? 9.463   -0.453  -7.702  1.00 0.00 ? 56 GLN A C    7  
ATOM 7462  O O    . GLN A 1 56 ? 10.246  0.314   -7.144  1.00 0.00 ? 56 GLN A O    7  
ATOM 7463  C CB   . GLN A 1 56 ? 10.097  -2.512  -8.972  1.00 0.00 ? 56 GLN A CB   7  
ATOM 7464  C CG   . GLN A 1 56 ? 10.866  -3.820  -8.878  1.00 0.00 ? 56 GLN A CG   7  
ATOM 7465  C CD   . GLN A 1 56 ? 11.852  -4.001  -10.015 1.00 0.00 ? 56 GLN A CD   7  
ATOM 7466  O OE1  . GLN A 1 56 ? 12.396  -3.029  -10.541 1.00 0.00 ? 56 GLN A OE1  7  
ATOM 7467  N NE2  . GLN A 1 56 ? 12.089  -5.249  -10.401 1.00 0.00 ? 56 GLN A NE2  7  
ATOM 7468  H H    . GLN A 1 56 ? 8.021   -3.303  -7.754  1.00 0.00 ? 56 GLN A H    7  
ATOM 7469  H HA   . GLN A 1 56 ? 10.418  -2.176  -6.884  1.00 0.00 ? 56 GLN A HA   7  
ATOM 7470  H HB2  . GLN A 1 56 ? 9.223   -2.676  -9.585  1.00 0.00 ? 56 GLN A HB2  7  
ATOM 7471  H HB3  . GLN A 1 56 ? 10.731  -1.781  -9.453  1.00 0.00 ? 56 GLN A HB3  7  
ATOM 7472  H HG2  . GLN A 1 56 ? 11.410  -3.837  -7.945  1.00 0.00 ? 56 GLN A HG2  7  
ATOM 7473  H HG3  . GLN A 1 56 ? 10.162  -4.638  -8.897  1.00 0.00 ? 56 GLN A HG3  7  
ATOM 7474  H HE21 . GLN A 1 56 ? 11.618  -5.974  -9.937  1.00 0.00 ? 56 GLN A HE21 7  
ATOM 7475  H HE22 . GLN A 1 56 ? 12.721  -5.395  -11.134 1.00 0.00 ? 56 GLN A HE22 7  
ATOM 7476  N N    . ASN A 1 57 ? 8.417   -0.032  -8.406  1.00 0.00 ? 57 ASN A N    7  
ATOM 7477  C CA   . ASN A 1 57 ? 8.124   1.387   -8.567  1.00 0.00 ? 57 ASN A CA   7  
ATOM 7478  C C    . ASN A 1 57 ? 7.878   2.048   -7.214  1.00 0.00 ? 57 ASN A C    7  
ATOM 7479  O O    . ASN A 1 57 ? 8.511   3.048   -6.876  1.00 0.00 ? 57 ASN A O    7  
ATOM 7480  C CB   . ASN A 1 57 ? 6.904   1.579   -9.471  1.00 0.00 ? 57 ASN A CB   7  
ATOM 7481  C CG   . ASN A 1 57 ? 7.242   1.417   -10.940 1.00 0.00 ? 57 ASN A CG   7  
ATOM 7482  O OD1  . ASN A 1 57 ? 7.745   2.341   -11.579 1.00 0.00 ? 57 ASN A OD1  7  
ATOM 7483  N ND2  . ASN A 1 57 ? 6.966   0.237   -11.484 1.00 0.00 ? 57 ASN A ND2  7  
ATOM 7484  H H    . ASN A 1 57 ? 7.828   -0.692  -8.829  1.00 0.00 ? 57 ASN A H    7  
ATOM 7485  H HA   . ASN A 1 57 ? 8.981   1.852   -9.031  1.00 0.00 ? 57 ASN A HA   7  
ATOM 7486  H HB2  . ASN A 1 57 ? 6.153   0.847   -9.211  1.00 0.00 ? 57 ASN A HB2  7  
ATOM 7487  H HB3  . ASN A 1 57 ? 6.503   2.570   -9.319  1.00 0.00 ? 57 ASN A HB3  7  
ATOM 7488  H HD21 . ASN A 1 57 ? 6.566   -0.453  -10.914 1.00 0.00 ? 57 ASN A HD21 7  
ATOM 7489  H HD22 . ASN A 1 57 ? 7.175   0.104   -12.432 1.00 0.00 ? 57 ASN A HD22 7  
ATOM 7490  N N    . ALA A 1 58 ? 6.954   1.482   -6.445  1.00 0.00 ? 58 ALA A N    7  
ATOM 7491  C CA   . ALA A 1 58 ? 6.626   2.014   -5.128  1.00 0.00 ? 58 ALA A CA   7  
ATOM 7492  C C    . ALA A 1 58 ? 7.883   2.449   -4.383  1.00 0.00 ? 58 ALA A C    7  
ATOM 7493  O O    . ALA A 1 58 ? 7.886   3.470   -3.695  1.00 0.00 ? 58 ALA A O    7  
ATOM 7494  C CB   . ALA A 1 58 ? 5.860   0.980   -4.317  1.00 0.00 ? 58 ALA A CB   7  
ATOM 7495  H H    . ALA A 1 58 ? 6.483   0.687   -6.770  1.00 0.00 ? 58 ALA A H    7  
ATOM 7496  H HA   . ALA A 1 58 ? 5.985   2.874   -5.266  1.00 0.00 ? 58 ALA A HA   7  
ATOM 7497  H HB1  . ALA A 1 58 ? 6.402   0.045   -4.323  1.00 0.00 ? 58 ALA A HB1  7  
ATOM 7498  H HB2  . ALA A 1 58 ? 5.753   1.327   -3.300  1.00 0.00 ? 58 ALA A HB2  7  
ATOM 7499  H HB3  . ALA A 1 58 ? 4.883   0.832   -4.752  1.00 0.00 ? 58 ALA A HB3  7  
ATOM 7500  N N    . ARG A 1 59 ? 8.949   1.668   -4.523  1.00 0.00 ? 59 ARG A N    7  
ATOM 7501  C CA   . ARG A 1 59 ? 10.212  1.972   -3.861  1.00 0.00 ? 59 ARG A CA   7  
ATOM 7502  C C    . ARG A 1 59 ? 10.842  3.233   -4.445  1.00 0.00 ? 59 ARG A C    7  
ATOM 7503  O O    . ARG A 1 59 ? 11.308  4.103   -3.710  1.00 0.00 ? 59 ARG A O    7  
ATOM 7504  C CB   . ARG A 1 59 ? 11.180  0.796   -3.997  1.00 0.00 ? 59 ARG A CB   7  
ATOM 7505  C CG   . ARG A 1 59 ? 10.803  -0.404  -3.143  1.00 0.00 ? 59 ARG A CG   7  
ATOM 7506  C CD   . ARG A 1 59 ? 11.833  -1.517  -3.262  1.00 0.00 ? 59 ARG A CD   7  
ATOM 7507  N NE   . ARG A 1 59 ? 13.196  -0.997  -3.325  1.00 0.00 ? 59 ARG A NE   7  
ATOM 7508  C CZ   . ARG A 1 59 ? 13.783  -0.608  -4.451  1.00 0.00 ? 59 ARG A CZ   7  
ATOM 7509  N NH1  . ARG A 1 59 ? 13.129  -0.679  -5.602  1.00 0.00 ? 59 ARG A NH1  7  
ATOM 7510  N NH2  . ARG A 1 59 ? 15.027  -0.145  -4.428  1.00 0.00 ? 59 ARG A NH2  7  
ATOM 7511  H H    . ARG A 1 59 ? 8.884   0.868   -5.085  1.00 0.00 ? 59 ARG A H    7  
ATOM 7512  H HA   . ARG A 1 59 ? 10.006  2.139   -2.814  1.00 0.00 ? 59 ARG A HA   7  
ATOM 7513  H HB2  . ARG A 1 59 ? 11.203  0.481   -5.030  1.00 0.00 ? 59 ARG A HB2  7  
ATOM 7514  H HB3  . ARG A 1 59 ? 12.167  1.122   -3.706  1.00 0.00 ? 59 ARG A HB3  7  
ATOM 7515  H HG2  . ARG A 1 59 ? 10.742  -0.094  -2.110  1.00 0.00 ? 59 ARG A HG2  7  
ATOM 7516  H HG3  . ARG A 1 59 ? 9.843   -0.778  -3.467  1.00 0.00 ? 59 ARG A HG3  7  
ATOM 7517  H HD2  . ARG A 1 59 ? 11.745  -2.164  -2.402  1.00 0.00 ? 59 ARG A HD2  7  
ATOM 7518  H HD3  . ARG A 1 59 ? 11.631  -2.082  -4.159  1.00 0.00 ? 59 ARG A HD3  7  
ATOM 7519  H HE   . ARG A 1 59 ? 13.698  -0.936  -2.486  1.00 0.00 ? 59 ARG A HE   7  
ATOM 7520  H HH11 . ARG A 1 59 ? 12.191  -1.026  -5.623  1.00 0.00 ? 59 ARG A HH11 7  
ATOM 7521  H HH12 . ARG A 1 59 ? 13.572  -0.384  -6.449  1.00 0.00 ? 59 ARG A HH12 7  
ATOM 7522  H HH21 . ARG A 1 59 ? 15.523  -0.090  -3.562  1.00 0.00 ? 59 ARG A HH21 7  
ATOM 7523  H HH22 . ARG A 1 59 ? 15.467  0.147   -5.276  1.00 0.00 ? 59 ARG A HH22 7  
ATOM 7524  N N    . GLN A 1 60 ? 10.852  3.324   -5.771  1.00 0.00 ? 60 GLN A N    7  
ATOM 7525  C CA   . GLN A 1 60 ? 11.426  4.478   -6.454  1.00 0.00 ? 60 GLN A CA   7  
ATOM 7526  C C    . GLN A 1 60 ? 10.724  5.764   -6.031  1.00 0.00 ? 60 GLN A C    7  
ATOM 7527  O O    . GLN A 1 60 ? 11.362  6.801   -5.848  1.00 0.00 ? 60 GLN A O    7  
ATOM 7528  C CB   . GLN A 1 60 ? 11.326  4.302   -7.970  1.00 0.00 ? 60 GLN A CB   7  
ATOM 7529  C CG   . GLN A 1 60 ? 12.024  3.054   -8.485  1.00 0.00 ? 60 GLN A CG   7  
ATOM 7530  C CD   . GLN A 1 60 ? 12.128  3.026   -9.997  1.00 0.00 ? 60 GLN A CD   7  
ATOM 7531  O OE1  . GLN A 1 60 ? 12.803  3.861   -10.600 1.00 0.00 ? 60 GLN A OE1  7  
ATOM 7532  N NE2  . GLN A 1 60 ? 11.459  2.062   -10.620 1.00 0.00 ? 60 GLN A NE2  7  
ATOM 7533  H H    . GLN A 1 60 ? 10.465  2.598   -6.303  1.00 0.00 ? 60 GLN A H    7  
ATOM 7534  H HA   . GLN A 1 60 ? 12.467  4.543   -6.176  1.00 0.00 ? 60 GLN A HA   7  
ATOM 7535  H HB2  . GLN A 1 60 ? 10.283  4.246   -8.246  1.00 0.00 ? 60 GLN A HB2  7  
ATOM 7536  H HB3  . GLN A 1 60 ? 11.771  5.161   -8.450  1.00 0.00 ? 60 GLN A HB3  7  
ATOM 7537  H HG2  . GLN A 1 60 ? 13.020  3.017   -8.070  1.00 0.00 ? 60 GLN A HG2  7  
ATOM 7538  H HG3  . GLN A 1 60 ? 11.467  2.187   -8.161  1.00 0.00 ? 60 GLN A HG3  7  
ATOM 7539  H HE21 . GLN A 1 60 ? 10.941  1.433   -10.075 1.00 0.00 ? 60 GLN A HE21 7  
ATOM 7540  H HE22 . GLN A 1 60 ? 11.509  2.021   -11.597 1.00 0.00 ? 60 GLN A HE22 7  
ATOM 7541  N N    . LYS A 1 61 ? 9.406   5.691   -5.878  1.00 0.00 ? 61 LYS A N    7  
ATOM 7542  C CA   . LYS A 1 61 ? 8.616   6.849   -5.477  1.00 0.00 ? 61 LYS A CA   7  
ATOM 7543  C C    . LYS A 1 61 ? 8.737   7.096   -3.976  1.00 0.00 ? 61 LYS A C    7  
ATOM 7544  O O    . LYS A 1 61 ? 8.767   8.241   -3.527  1.00 0.00 ? 61 LYS A O    7  
ATOM 7545  C CB   . LYS A 1 61 ? 7.147   6.646   -5.855  1.00 0.00 ? 61 LYS A CB   7  
ATOM 7546  C CG   . LYS A 1 61 ? 6.384   5.767   -4.879  1.00 0.00 ? 61 LYS A CG   7  
ATOM 7547  C CD   . LYS A 1 61 ? 4.883   5.883   -5.081  1.00 0.00 ? 61 LYS A CD   7  
ATOM 7548  C CE   . LYS A 1 61 ? 4.118   5.024   -4.085  1.00 0.00 ? 61 LYS A CE   7  
ATOM 7549  N NZ   . LYS A 1 61 ? 2.719   4.773   -4.528  1.00 0.00 ? 61 LYS A NZ   7  
ATOM 7550  H H    . LYS A 1 61 ? 8.954   4.836   -6.039  1.00 0.00 ? 61 LYS A H    7  
ATOM 7551  H HA   . LYS A 1 61 ? 8.999   7.710   -6.003  1.00 0.00 ? 61 LYS A HA   7  
ATOM 7552  H HB2  . LYS A 1 61 ? 6.662   7.610   -5.894  1.00 0.00 ? 61 LYS A HB2  7  
ATOM 7553  H HB3  . LYS A 1 61 ? 7.100   6.188   -6.832  1.00 0.00 ? 61 LYS A HB3  7  
ATOM 7554  H HG2  . LYS A 1 61 ? 6.678   4.738   -5.029  1.00 0.00 ? 61 LYS A HG2  7  
ATOM 7555  H HG3  . LYS A 1 61 ? 6.627   6.069   -3.870  1.00 0.00 ? 61 LYS A HG3  7  
ATOM 7556  H HD2  . LYS A 1 61 ? 4.589   6.914   -4.950  1.00 0.00 ? 61 LYS A HD2  7  
ATOM 7557  H HD3  . LYS A 1 61 ? 4.637   5.561   -6.083  1.00 0.00 ? 61 LYS A HD3  7  
ATOM 7558  H HE2  . LYS A 1 61 ? 4.628   4.079   -3.978  1.00 0.00 ? 61 LYS A HE2  7  
ATOM 7559  H HE3  . LYS A 1 61 ? 4.099   5.532   -3.132  1.00 0.00 ? 61 LYS A HE3  7  
ATOM 7560  H HZ1  . LYS A 1 61 ? 2.694   4.608   -5.555  1.00 0.00 ? 61 LYS A HZ1  7  
ATOM 7561  H HZ2  . LYS A 1 61 ? 2.121   5.594   -4.306  1.00 0.00 ? 61 LYS A HZ2  7  
ATOM 7562  H HZ3  . LYS A 1 61 ? 2.336   3.936   -4.044  1.00 0.00 ? 61 LYS A HZ3  7  
ATOM 7563  N N    . ALA A 1 62 ? 8.807   6.014   -3.207  1.00 0.00 ? 62 ALA A N    7  
ATOM 7564  C CA   . ALA A 1 62 ? 8.928   6.114   -1.758  1.00 0.00 ? 62 ALA A CA   7  
ATOM 7565  C C    . ALA A 1 62 ? 10.159  6.924   -1.364  1.00 0.00 ? 62 ALA A C    7  
ATOM 7566  O O    . ALA A 1 62 ? 10.106  7.746   -0.449  1.00 0.00 ? 62 ALA A O    7  
ATOM 7567  C CB   . ALA A 1 62 ? 8.985   4.726   -1.136  1.00 0.00 ? 62 ALA A CB   7  
ATOM 7568  H H    . ALA A 1 62 ? 8.778   5.128   -3.624  1.00 0.00 ? 62 ALA A H    7  
ATOM 7569  H HA   . ALA A 1 62 ? 8.046   6.613   -1.383  1.00 0.00 ? 62 ALA A HA   7  
ATOM 7570  H HB1  . ALA A 1 62 ? 9.576   4.762   -0.232  1.00 0.00 ? 62 ALA A HB1  7  
ATOM 7571  H HB2  . ALA A 1 62 ? 7.985   4.396   -0.900  1.00 0.00 ? 62 ALA A HB2  7  
ATOM 7572  H HB3  . ALA A 1 62 ? 9.437   4.038   -1.835  1.00 0.00 ? 62 ALA A HB3  7  
ATOM 7573  N N    . ARG A 1 63 ? 11.266  6.685   -2.060  1.00 0.00 ? 63 ARG A N    7  
ATOM 7574  C CA   . ARG A 1 63 ? 12.510  7.391   -1.781  1.00 0.00 ? 63 ARG A CA   7  
ATOM 7575  C C    . ARG A 1 63 ? 12.253  8.877   -1.550  1.00 0.00 ? 63 ARG A C    7  
ATOM 7576  O O    . ARG A 1 63 ? 11.723  9.569   -2.420  1.00 0.00 ? 63 ARG A O    7  
ATOM 7577  C CB   . ARG A 1 63 ? 13.496  7.207   -2.936  1.00 0.00 ? 63 ARG A CB   7  
ATOM 7578  C CG   . ARG A 1 63 ? 14.012  5.784   -3.076  1.00 0.00 ? 63 ARG A CG   7  
ATOM 7579  C CD   . ARG A 1 63 ? 15.292  5.733   -3.896  1.00 0.00 ? 63 ARG A CD   7  
ATOM 7580  N NE   . ARG A 1 63 ? 15.433  4.469   -4.612  1.00 0.00 ? 63 ARG A NE   7  
ATOM 7581  C CZ   . ARG A 1 63 ? 16.185  4.319   -5.697  1.00 0.00 ? 63 ARG A CZ   7  
ATOM 7582  N NH1  . ARG A 1 63 ? 16.860  5.349   -6.187  1.00 0.00 ? 63 ARG A NH1  7  
ATOM 7583  N NH2  . ARG A 1 63 ? 16.262  3.136   -6.294  1.00 0.00 ? 63 ARG A NH2  7  
ATOM 7584  H H    . ARG A 1 63 ? 11.245  6.017   -2.777  1.00 0.00 ? 63 ARG A H    7  
ATOM 7585  H HA   . ARG A 1 63 ? 12.938  6.968   -0.884  1.00 0.00 ? 63 ARG A HA   7  
ATOM 7586  H HB2  . ARG A 1 63 ? 13.006  7.480   -3.859  1.00 0.00 ? 63 ARG A HB2  7  
ATOM 7587  H HB3  . ARG A 1 63 ? 14.341  7.859   -2.780  1.00 0.00 ? 63 ARG A HB3  7  
ATOM 7588  H HG2  . ARG A 1 63 ? 14.212  5.385   -2.092  1.00 0.00 ? 63 ARG A HG2  7  
ATOM 7589  H HG3  . ARG A 1 63 ? 13.258  5.184   -3.563  1.00 0.00 ? 63 ARG A HG3  7  
ATOM 7590  H HD2  . ARG A 1 63 ? 15.277  6.542   -4.611  1.00 0.00 ? 63 ARG A HD2  7  
ATOM 7591  H HD3  . ARG A 1 63 ? 16.134  5.856   -3.231  1.00 0.00 ? 63 ARG A HD3  7  
ATOM 7592  H HE   . ARG A 1 63 ? 14.942  3.694   -4.267  1.00 0.00 ? 63 ARG A HE   7  
ATOM 7593  H HH11 . ARG A 1 63 ? 16.804  6.241   -5.739  1.00 0.00 ? 63 ARG A HH11 7  
ATOM 7594  H HH12 . ARG A 1 63 ? 17.426  5.233   -7.004  1.00 0.00 ? 63 ARG A HH12 7  
ATOM 7595  H HH21 . ARG A 1 63 ? 15.755  2.357   -5.927  1.00 0.00 ? 63 ARG A HH21 7  
ATOM 7596  H HH22 . ARG A 1 63 ? 16.828  3.024   -7.110  1.00 0.00 ? 63 ARG A HH22 7  
ATOM 7597  N N    . LYS A 1 64 ? 12.630  9.362   -0.372  1.00 0.00 ? 64 LYS A N    7  
ATOM 7598  C CA   . LYS A 1 64 ? 12.441  10.766  -0.026  1.00 0.00 ? 64 LYS A CA   7  
ATOM 7599  C C    . LYS A 1 64 ? 13.705  11.346  0.600   1.00 0.00 ? 64 LYS A C    7  
ATOM 7600  O O    . LYS A 1 64 ? 14.505  10.622  1.193   1.00 0.00 ? 64 LYS A O    7  
ATOM 7601  C CB   . LYS A 1 64 ? 11.264  10.920  0.940   1.00 0.00 ? 64 LYS A CB   7  
ATOM 7602  C CG   . LYS A 1 64 ? 11.465  10.201  2.263   1.00 0.00 ? 64 LYS A CG   7  
ATOM 7603  C CD   . LYS A 1 64 ? 12.137  11.097  3.289   1.00 0.00 ? 64 LYS A CD   7  
ATOM 7604  C CE   . LYS A 1 64 ? 11.138  12.031  3.953   1.00 0.00 ? 64 LYS A CE   7  
ATOM 7605  N NZ   . LYS A 1 64 ? 10.966  13.296  3.187   1.00 0.00 ? 64 LYS A NZ   7  
ATOM 7606  H H    . LYS A 1 64 ? 13.047  8.760   0.280   1.00 0.00 ? 64 LYS A H    7  
ATOM 7607  H HA   . LYS A 1 64 ? 12.223  11.305  -0.935  1.00 0.00 ? 64 LYS A HA   7  
ATOM 7608  H HB2  . LYS A 1 64 ? 11.117  11.970  1.144   1.00 0.00 ? 64 LYS A HB2  7  
ATOM 7609  H HB3  . LYS A 1 64 ? 10.375  10.525  0.470   1.00 0.00 ? 64 LYS A HB3  7  
ATOM 7610  H HG2  . LYS A 1 64 ? 10.502  9.894   2.645   1.00 0.00 ? 64 LYS A HG2  7  
ATOM 7611  H HG3  . LYS A 1 64 ? 12.083  9.330   2.098   1.00 0.00 ? 64 LYS A HG3  7  
ATOM 7612  H HD2  . LYS A 1 64 ? 12.596  10.480  4.047   1.00 0.00 ? 64 LYS A HD2  7  
ATOM 7613  H HD3  . LYS A 1 64 ? 12.896  11.688  2.795   1.00 0.00 ? 64 LYS A HD3  7  
ATOM 7614  H HE2  . LYS A 1 64 ? 10.185  11.529  4.020   1.00 0.00 ? 64 LYS A HE2  7  
ATOM 7615  H HE3  . LYS A 1 64 ? 11.491  12.267  4.947   1.00 0.00 ? 64 LYS A HE3  7  
ATOM 7616  H HZ1  . LYS A 1 64 ? 11.829  13.506  2.647   1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 7617  H HZ2  . LYS A 1 64 ? 10.777  14.085  3.837   1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 7618  H HZ3  . LYS A 1 64 ? 10.168  13.208  2.525   1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 7619  N N    . SER A 1 65 ? 13.879  12.657  0.464   1.00 0.00 ? 65 SER A N    7  
ATOM 7620  C CA   . SER A 1 65 ? 15.047  13.335  1.015   1.00 0.00 ? 65 SER A CA   7  
ATOM 7621  C C    . SER A 1 65 ? 14.847  14.847  1.016   1.00 0.00 ? 65 SER A C    7  
ATOM 7622  O O    . SER A 1 65 ? 13.926  15.364  0.385   1.00 0.00 ? 65 SER A O    7  
ATOM 7623  C CB   . SER A 1 65 ? 16.297  12.975  0.210   1.00 0.00 ? 65 SER A CB   7  
ATOM 7624  O OG   . SER A 1 65 ? 16.216  13.478  -1.112  1.00 0.00 ? 65 SER A OG   7  
ATOM 7625  H H    . SER A 1 65 ? 13.206  13.181  -0.019  1.00 0.00 ? 65 SER A H    7  
ATOM 7626  H HA   . SER A 1 65 ? 15.175  13.000  2.033   1.00 0.00 ? 65 SER A HA   7  
ATOM 7627  H HB2  . SER A 1 65 ? 17.166  13.398  0.691   1.00 0.00 ? 65 SER A HB2  7  
ATOM 7628  H HB3  . SER A 1 65 ? 16.398  11.900  0.168   1.00 0.00 ? 65 SER A HB3  7  
ATOM 7629  H HG   . SER A 1 65 ? 16.513  14.391  -1.126  1.00 0.00 ? 65 SER A HG   7  
ATOM 7630  N N    . GLY A 1 66 ? 15.719  15.553  1.730   1.00 0.00 ? 66 GLY A N    7  
ATOM 7631  C CA   . GLY A 1 66 ? 15.623  16.999  1.801   1.00 0.00 ? 66 GLY A CA   7  
ATOM 7632  C C    . GLY A 1 66 ? 16.285  17.564  3.042   1.00 0.00 ? 66 GLY A C    7  
ATOM 7633  O O    . GLY A 1 66 ? 16.423  16.887  4.061   1.00 0.00 ? 66 GLY A O    7  
ATOM 7634  H H    . GLY A 1 66 ? 16.434  15.087  2.213   1.00 0.00 ? 66 GLY A H    7  
ATOM 7635  H HA2  . GLY A 1 66 ? 16.095  17.424  0.928   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 7636  H HA3  . GLY A 1 66 ? 14.579  17.278  1.806   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 7637  N N    . PRO A 1 67 ? 16.711  18.834  2.963   1.00 0.00 ? 67 PRO A N    7  
ATOM 7638  C CA   . PRO A 1 67 ? 17.372  19.517  4.080   1.00 0.00 ? 67 PRO A CA   7  
ATOM 7639  C C    . PRO A 1 67 ? 16.414  19.806  5.231   1.00 0.00 ? 67 PRO A C    7  
ATOM 7640  O O    . PRO A 1 67 ? 16.796  20.413  6.231   1.00 0.00 ? 67 PRO A O    7  
ATOM 7641  C CB   . PRO A 1 67 ? 17.865  20.824  3.453   1.00 0.00 ? 67 PRO A CB   7  
ATOM 7642  C CG   . PRO A 1 67 ? 16.950  21.061  2.301   1.00 0.00 ? 67 PRO A CG   7  
ATOM 7643  C CD   . PRO A 1 67 ? 16.580  19.700  1.780   1.00 0.00 ? 67 PRO A CD   7  
ATOM 7644  H HA   . PRO A 1 67 ? 18.215  18.952  4.448   1.00 0.00 ? 67 PRO A HA   7  
ATOM 7645  H HB2  . PRO A 1 67 ? 17.800  21.621  4.180   1.00 0.00 ? 67 PRO A HB2  7  
ATOM 7646  H HB3  . PRO A 1 67 ? 18.888  20.708  3.128   1.00 0.00 ? 67 PRO A HB3  7  
ATOM 7647  H HG2  . PRO A 1 67 ? 16.069  21.587  2.634   1.00 0.00 ? 67 PRO A HG2  7  
ATOM 7648  H HG3  . PRO A 1 67 ? 17.462  21.628  1.538   1.00 0.00 ? 67 PRO A HG3  7  
ATOM 7649  H HD2  . PRO A 1 67 ? 15.565  19.700  1.412   1.00 0.00 ? 67 PRO A HD2  7  
ATOM 7650  H HD3  . PRO A 1 67 ? 17.265  19.395  1.002   1.00 0.00 ? 67 PRO A HD3  7  
ATOM 7651  N N    . SER A 1 68 ? 15.168  19.367  5.082   1.00 0.00 ? 68 SER A N    7  
ATOM 7652  C CA   . SER A 1 68 ? 14.155  19.582  6.109   1.00 0.00 ? 68 SER A CA   7  
ATOM 7653  C C    . SER A 1 68 ? 14.147  18.433  7.113   1.00 0.00 ? 68 SER A C    7  
ATOM 7654  O O    . SER A 1 68 ? 14.138  18.652  8.324   1.00 0.00 ? 68 SER A O    7  
ATOM 7655  C CB   . SER A 1 68 ? 12.773  19.725  5.469   1.00 0.00 ? 68 SER A CB   7  
ATOM 7656  O OG   . SER A 1 68 ? 11.803  20.102  6.430   1.00 0.00 ? 68 SER A OG   7  
ATOM 7657  H H    . SER A 1 68 ? 14.925  18.889  4.262   1.00 0.00 ? 68 SER A H    7  
ATOM 7658  H HA   . SER A 1 68 ? 14.398  20.496  6.628   1.00 0.00 ? 68 SER A HA   7  
ATOM 7659  H HB2  . SER A 1 68 ? 12.812  20.480  4.699   1.00 0.00 ? 68 SER A HB2  7  
ATOM 7660  H HB3  . SER A 1 68 ? 12.482  18.780  5.033   1.00 0.00 ? 68 SER A HB3  7  
ATOM 7661  H HG   . SER A 1 68 ? 11.817  19.481  7.162   1.00 0.00 ? 68 SER A HG   7  
ATOM 7662  N N    . SER A 1 69 ? 14.149  17.207  6.599   1.00 0.00 ? 69 SER A N    7  
ATOM 7663  C CA   . SER A 1 69 ? 14.138  16.022  7.450   1.00 0.00 ? 69 SER A CA   7  
ATOM 7664  C C    . SER A 1 69 ? 14.308  14.755  6.618   1.00 0.00 ? 69 SER A C    7  
ATOM 7665  O O    . SER A 1 69 ? 13.539  14.498  5.692   1.00 0.00 ? 69 SER A O    7  
ATOM 7666  C CB   . SER A 1 69 ? 12.833  15.952  8.245   1.00 0.00 ? 69 SER A CB   7  
ATOM 7667  O OG   . SER A 1 69 ? 11.708  16.031  7.388   1.00 0.00 ? 69 SER A OG   7  
ATOM 7668  H H    . SER A 1 69 ? 14.156  17.097  5.625   1.00 0.00 ? 69 SER A H    7  
ATOM 7669  H HA   . SER A 1 69 ? 14.966  16.100  8.138   1.00 0.00 ? 69 SER A HA   7  
ATOM 7670  H HB2  . SER A 1 69 ? 12.794  15.018  8.785   1.00 0.00 ? 69 SER A HB2  7  
ATOM 7671  H HB3  . SER A 1 69 ? 12.797  16.774  8.945   1.00 0.00 ? 69 SER A HB3  7  
ATOM 7672  H HG   . SER A 1 69 ? 11.230  16.846  7.561   1.00 0.00 ? 69 SER A HG   7  
ATOM 7673  N N    . GLY A 1 70 ? 15.323  13.965  6.955   1.00 0.00 ? 70 GLY A N    7  
ATOM 7674  C CA   . GLY A 1 70 ? 15.578  12.733  6.230   1.00 0.00 ? 70 GLY A CA   7  
ATOM 7675  C C    . GLY A 1 70 ? 16.225  11.673  7.098   1.00 0.00 ? 70 GLY A C    7  
ATOM 7676  O O    . GLY A 1 70 ? 17.445  11.652  7.258   1.00 0.00 ? 70 GLY A O    7  
ATOM 7677  H H    . GLY A 1 70 ? 15.904  14.220  7.702   1.00 0.00 ? 70 GLY A H    7  
ATOM 7678  H HA2  . GLY A 1 70 ? 14.642  12.352  5.851   1.00 0.00 ? 70 GLY A HA2  7  
ATOM 7679  H HA3  . GLY A 1 70 ? 16.231  12.948  5.397   1.00 0.00 ? 70 GLY A HA3  7  
ATOM 7680  N N    . GLY A 1 1  ? 17.893  -5.421  -24.830 1.00 0.00 ? 1  GLY A N    8  
ATOM 7681  C CA   . GLY A 1 1  ? 19.158  -5.157  -25.490 1.00 0.00 ? 1  GLY A CA   8  
ATOM 7682  C C    . GLY A 1 1  ? 19.048  -4.069  -26.540 1.00 0.00 ? 1  GLY A C    8  
ATOM 7683  O O    . GLY A 1 1  ? 18.437  -4.270  -27.590 1.00 0.00 ? 1  GLY A O    8  
ATOM 7684  H H1   . GLY A 1 1  ? 17.443  -6.281  -24.963 1.00 0.00 ? 1  GLY A H1   8  
ATOM 7685  H HA2  . GLY A 1 1  ? 19.882  -4.855  -24.748 1.00 0.00 ? 1  GLY A HA2  8  
ATOM 7686  H HA3  . GLY A 1 1  ? 19.500  -6.065  -25.964 1.00 0.00 ? 1  GLY A HA3  8  
ATOM 7687  N N    . SER A 1 2  ? 19.640  -2.913  -26.257 1.00 0.00 ? 2  SER A N    8  
ATOM 7688  C CA   . SER A 1 2  ? 19.601  -1.788  -27.184 1.00 0.00 ? 2  SER A CA   8  
ATOM 7689  C C    . SER A 1 2  ? 18.165  -1.461  -27.582 1.00 0.00 ? 2  SER A C    8  
ATOM 7690  O O    . SER A 1 2  ? 17.879  -1.192  -28.748 1.00 0.00 ? 2  SER A O    8  
ATOM 7691  C CB   . SER A 1 2  ? 20.430  -2.098  -28.431 1.00 0.00 ? 2  SER A CB   8  
ATOM 7692  O OG   . SER A 1 2  ? 20.781  -0.910  -29.119 1.00 0.00 ? 2  SER A OG   8  
ATOM 7693  H H    . SER A 1 2  ? 20.112  -2.815  -25.404 1.00 0.00 ? 2  SER A H    8  
ATOM 7694  H HA   . SER A 1 2  ? 20.027  -0.931  -26.682 1.00 0.00 ? 2  SER A HA   8  
ATOM 7695  H HB2  . SER A 1 2  ? 21.334  -2.612  -28.141 1.00 0.00 ? 2  SER A HB2  8  
ATOM 7696  H HB3  . SER A 1 2  ? 19.855  -2.728  -29.095 1.00 0.00 ? 2  SER A HB3  8  
ATOM 7697  H HG   . SER A 1 2  ? 21.728  -0.899  -29.278 1.00 0.00 ? 2  SER A HG   8  
ATOM 7698  N N    . SER A 1 3  ? 17.266  -1.487  -26.603 1.00 0.00 ? 3  SER A N    8  
ATOM 7699  C CA   . SER A 1 3  ? 15.858  -1.198  -26.850 1.00 0.00 ? 3  SER A CA   8  
ATOM 7700  C C    . SER A 1 3  ? 15.124  -0.917  -25.543 1.00 0.00 ? 3  SER A C    8  
ATOM 7701  O O    . SER A 1 3  ? 15.614  -1.238  -24.461 1.00 0.00 ? 3  SER A O    8  
ATOM 7702  C CB   . SER A 1 3  ? 15.196  -2.368  -27.580 1.00 0.00 ? 3  SER A CB   8  
ATOM 7703  O OG   . SER A 1 3  ? 15.353  -2.248  -28.983 1.00 0.00 ? 3  SER A OG   8  
ATOM 7704  H H    . SER A 1 3  ? 17.556  -1.709  -25.693 1.00 0.00 ? 3  SER A H    8  
ATOM 7705  H HA   . SER A 1 3  ? 15.806  -0.319  -27.475 1.00 0.00 ? 3  SER A HA   8  
ATOM 7706  H HB2  . SER A 1 3  ? 15.649  -3.293  -27.257 1.00 0.00 ? 3  SER A HB2  8  
ATOM 7707  H HB3  . SER A 1 3  ? 14.141  -2.383  -27.347 1.00 0.00 ? 3  SER A HB3  8  
ATOM 7708  H HG   . SER A 1 3  ? 14.673  -1.668  -29.333 1.00 0.00 ? 3  SER A HG   8  
ATOM 7709  N N    . GLY A 1 4  ? 13.943  -0.315  -25.652 1.00 0.00 ? 4  GLY A N    8  
ATOM 7710  C CA   . GLY A 1 4  ? 13.159  0.000   -24.472 1.00 0.00 ? 4  GLY A CA   8  
ATOM 7711  C C    . GLY A 1 4  ? 11.802  -0.675  -24.482 1.00 0.00 ? 4  GLY A C    8  
ATOM 7712  O O    . GLY A 1 4  ? 11.699  -1.881  -24.254 1.00 0.00 ? 4  GLY A O    8  
ATOM 7713  H H    . GLY A 1 4  ? 13.602  -0.082  -26.541 1.00 0.00 ? 4  GLY A H    8  
ATOM 7714  H HA2  . GLY A 1 4  ? 13.703  -0.320  -23.596 1.00 0.00 ? 4  GLY A HA2  8  
ATOM 7715  H HA3  . GLY A 1 4  ? 13.016  1.069   -24.424 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 7716  N N    . SER A 1 5  ? 10.757  0.103   -24.744 1.00 0.00 ? 5  SER A N    8  
ATOM 7717  C CA   . SER A 1 5  ? 9.398   -0.425  -24.776 1.00 0.00 ? 5  SER A CA   8  
ATOM 7718  C C    . SER A 1 5  ? 8.752   -0.180  -26.136 1.00 0.00 ? 5  SER A C    8  
ATOM 7719  O O    . SER A 1 5  ? 9.168   0.706   -26.882 1.00 0.00 ? 5  SER A O    8  
ATOM 7720  C CB   . SER A 1 5  ? 8.553   0.215   -23.673 1.00 0.00 ? 5  SER A CB   8  
ATOM 7721  O OG   . SER A 1 5  ? 7.253   -0.348  -23.636 1.00 0.00 ? 5  SER A OG   8  
ATOM 7722  H H    . SER A 1 5  ? 10.904  1.057   -24.917 1.00 0.00 ? 5  SER A H    8  
ATOM 7723  H HA   . SER A 1 5  ? 9.453   -1.490  -24.604 1.00 0.00 ? 5  SER A HA   8  
ATOM 7724  H HB2  . SER A 1 5  ? 9.029   0.054   -22.719 1.00 0.00 ? 5  SER A HB2  8  
ATOM 7725  H HB3  . SER A 1 5  ? 8.468   1.276   -23.859 1.00 0.00 ? 5  SER A HB3  8  
ATOM 7726  H HG   . SER A 1 5  ? 6.806   -0.068  -22.834 1.00 0.00 ? 5  SER A HG   8  
ATOM 7727  N N    . SER A 1 6  ? 7.731   -0.971  -26.451 1.00 0.00 ? 6  SER A N    8  
ATOM 7728  C CA   . SER A 1 6  ? 7.029   -0.843  -27.722 1.00 0.00 ? 6  SER A CA   8  
ATOM 7729  C C    . SER A 1 6  ? 5.608   -0.330  -27.508 1.00 0.00 ? 6  SER A C    8  
ATOM 7730  O O    . SER A 1 6  ? 4.674   -1.110  -27.331 1.00 0.00 ? 6  SER A O    8  
ATOM 7731  C CB   . SER A 1 6  ? 6.993   -2.190  -28.447 1.00 0.00 ? 6  SER A CB   8  
ATOM 7732  O OG   . SER A 1 6  ? 8.297   -2.612  -28.804 1.00 0.00 ? 6  SER A OG   8  
ATOM 7733  H H    . SER A 1 6  ? 7.446   -1.659  -25.813 1.00 0.00 ? 6  SER A H    8  
ATOM 7734  H HA   . SER A 1 6  ? 7.568   -0.131  -28.329 1.00 0.00 ? 6  SER A HA   8  
ATOM 7735  H HB2  . SER A 1 6  ? 6.552   -2.932  -27.799 1.00 0.00 ? 6  SER A HB2  8  
ATOM 7736  H HB3  . SER A 1 6  ? 6.399   -2.096  -29.345 1.00 0.00 ? 6  SER A HB3  8  
ATOM 7737  H HG   . SER A 1 6  ? 8.249   -3.461  -29.249 1.00 0.00 ? 6  SER A HG   8  
ATOM 7738  N N    . GLY A 1 7  ? 5.454   0.991   -27.526 1.00 0.00 ? 7  GLY A N    8  
ATOM 7739  C CA   . GLY A 1 7  ? 4.145   1.588   -27.333 1.00 0.00 ? 7  GLY A CA   8  
ATOM 7740  C C    . GLY A 1 7  ? 3.620   1.391   -25.925 1.00 0.00 ? 7  GLY A C    8  
ATOM 7741  O O    . GLY A 1 7  ? 4.387   1.110   -25.003 1.00 0.00 ? 7  GLY A O    8  
ATOM 7742  H H    . GLY A 1 7  ? 6.235   1.565   -27.672 1.00 0.00 ? 7  GLY A H    8  
ATOM 7743  H HA2  . GLY A 1 7  ? 4.210   2.646   -27.538 1.00 0.00 ? 7  GLY A HA2  8  
ATOM 7744  H HA3  . GLY A 1 7  ? 3.451   1.139   -28.029 1.00 0.00 ? 7  GLY A HA3  8  
ATOM 7745  N N    . ARG A 1 8  ? 2.310   1.540   -25.756 1.00 0.00 ? 8  ARG A N    8  
ATOM 7746  C CA   . ARG A 1 8  ? 1.685   1.380   -24.449 1.00 0.00 ? 8  ARG A CA   8  
ATOM 7747  C C    . ARG A 1 8  ? 1.372   -0.087  -24.173 1.00 0.00 ? 8  ARG A C    8  
ATOM 7748  O O    . ARG A 1 8  ? 0.490   -0.673  -24.801 1.00 0.00 ? 8  ARG A O    8  
ATOM 7749  C CB   . ARG A 1 8  ? 0.402   2.210   -24.369 1.00 0.00 ? 8  ARG A CB   8  
ATOM 7750  C CG   . ARG A 1 8  ? 0.643   3.673   -24.032 1.00 0.00 ? 8  ARG A CG   8  
ATOM 7751  C CD   . ARG A 1 8  ? -0.571  4.528   -24.360 1.00 0.00 ? 8  ARG A CD   8  
ATOM 7752  N NE   . ARG A 1 8  ? -0.694  4.777   -25.794 1.00 0.00 ? 8  ARG A NE   8  
ATOM 7753  C CZ   . ARG A 1 8  ? -1.843  5.069   -26.393 1.00 0.00 ? 8  ARG A CZ   8  
ATOM 7754  N NH1  . ARG A 1 8  ? -2.962  5.147   -25.686 1.00 0.00 ? 8  ARG A NH1  8  
ATOM 7755  N NH2  . ARG A 1 8  ? -1.874  5.283   -27.702 1.00 0.00 ? 8  ARG A NH2  8  
ATOM 7756  H H    . ARG A 1 8  ? 1.751   1.765   -26.530 1.00 0.00 ? 8  ARG A H    8  
ATOM 7757  H HA   . ARG A 1 8  ? 2.380   1.735   -23.703 1.00 0.00 ? 8  ARG A HA   8  
ATOM 7758  H HB2  . ARG A 1 8  ? -0.104  2.162   -25.322 1.00 0.00 ? 8  ARG A HB2  8  
ATOM 7759  H HB3  . ARG A 1 8  ? -0.238  1.789   -23.609 1.00 0.00 ? 8  ARG A HB3  8  
ATOM 7760  H HG2  . ARG A 1 8  ? 0.856   3.759   -22.977 1.00 0.00 ? 8  ARG A HG2  8  
ATOM 7761  H HG3  . ARG A 1 8  ? 1.488   4.029   -24.603 1.00 0.00 ? 8  ARG A HG3  8  
ATOM 7762  H HD2  . ARG A 1 8  ? -1.458  4.016   -24.016 1.00 0.00 ? 8  ARG A HD2  8  
ATOM 7763  H HD3  . ARG A 1 8  ? -0.478  5.472   -23.846 1.00 0.00 ? 8  ARG A HD3  8  
ATOM 7764  H HE   . ARG A 1 8  ? 0.121   4.724   -26.335 1.00 0.00 ? 8  ARG A HE   8  
ATOM 7765  H HH11 . ARG A 1 8  ? -2.941  4.987   -24.699 1.00 0.00 ? 8  ARG A HH11 8  
ATOM 7766  H HH12 . ARG A 1 8  ? -3.826  5.368   -26.139 1.00 0.00 ? 8  ARG A HH12 8  
ATOM 7767  H HH21 . ARG A 1 8  ? -1.033  5.225   -28.238 1.00 0.00 ? 8  ARG A HH21 8  
ATOM 7768  H HH22 . ARG A 1 8  ? -2.739  5.502   -28.152 1.00 0.00 ? 8  ARG A HH22 8  
ATOM 7769  N N    . SER A 1 9  ? 2.100   -0.674  -23.229 1.00 0.00 ? 9  SER A N    8  
ATOM 7770  C CA   . SER A 1 9  ? 1.904   -2.074  -22.871 1.00 0.00 ? 9  SER A CA   8  
ATOM 7771  C C    . SER A 1 9  ? 0.562   -2.274  -22.173 1.00 0.00 ? 9  SER A C    8  
ATOM 7772  O O    . SER A 1 9  ? -0.072  -1.313  -21.737 1.00 0.00 ? 9  SER A O    8  
ATOM 7773  C CB   . SER A 1 9  ? 3.039   -2.556  -21.966 1.00 0.00 ? 9  SER A CB   8  
ATOM 7774  O OG   . SER A 1 9  ? 3.128   -3.971  -21.968 1.00 0.00 ? 9  SER A OG   8  
ATOM 7775  H H    . SER A 1 9  ? 2.788   -0.154  -22.763 1.00 0.00 ? 9  SER A H    8  
ATOM 7776  H HA   . SER A 1 9  ? 1.911   -2.653  -23.783 1.00 0.00 ? 9  SER A HA   8  
ATOM 7777  H HB2  . SER A 1 9  ? 3.974   -2.149  -22.318 1.00 0.00 ? 9  SER A HB2  8  
ATOM 7778  H HB3  . SER A 1 9  ? 2.857   -2.220  -20.956 1.00 0.00 ? 9  SER A HB3  8  
ATOM 7779  H HG   . SER A 1 9  ? 3.998   -4.237  -21.664 1.00 0.00 ? 9  SER A HG   8  
ATOM 7780  N N    . SER A 1 10 ? 0.135   -3.528  -22.072 1.00 0.00 ? 10 SER A N    8  
ATOM 7781  C CA   . SER A 1 10 ? -1.133  -3.855  -21.430 1.00 0.00 ? 10 SER A CA   8  
ATOM 7782  C C    . SER A 1 10 ? -1.363  -2.978  -20.203 1.00 0.00 ? 10 SER A C    8  
ATOM 7783  O O    . SER A 1 10 ? -0.491  -2.853  -19.343 1.00 0.00 ? 10 SER A O    8  
ATOM 7784  C CB   . SER A 1 10 ? -1.160  -5.331  -21.028 1.00 0.00 ? 10 SER A CB   8  
ATOM 7785  O OG   . SER A 1 10 ? -0.116  -5.631  -20.119 1.00 0.00 ? 10 SER A OG   8  
ATOM 7786  H H    . SER A 1 10 ? 0.686   -4.251  -22.440 1.00 0.00 ? 10 SER A H    8  
ATOM 7787  H HA   . SER A 1 10 ? -1.923  -3.670  -22.143 1.00 0.00 ? 10 SER A HA   8  
ATOM 7788  H HB2  . SER A 1 10 ? -2.106  -5.556  -20.559 1.00 0.00 ? 10 SER A HB2  8  
ATOM 7789  H HB3  . SER A 1 10 ? -1.041  -5.944  -21.910 1.00 0.00 ? 10 SER A HB3  8  
ATOM 7790  H HG   . SER A 1 10 ? -0.447  -5.574  -19.220 1.00 0.00 ? 10 SER A HG   8  
ATOM 7791  N N    . ARG A 1 11 ? -2.544  -2.372  -20.130 1.00 0.00 ? 11 ARG A N    8  
ATOM 7792  C CA   . ARG A 1 11 ? -2.889  -1.505  -19.010 1.00 0.00 ? 11 ARG A CA   8  
ATOM 7793  C C    . ARG A 1 11 ? -3.472  -2.314  -17.856 1.00 0.00 ? 11 ARG A C    8  
ATOM 7794  O O    . ARG A 1 11 ? -4.665  -2.621  -17.838 1.00 0.00 ? 11 ARG A O    8  
ATOM 7795  C CB   . ARG A 1 11 ? -3.889  -0.436  -19.454 1.00 0.00 ? 11 ARG A CB   8  
ATOM 7796  C CG   . ARG A 1 11 ? -3.959  0.760   -18.519 1.00 0.00 ? 11 ARG A CG   8  
ATOM 7797  C CD   . ARG A 1 11 ? -4.908  0.506   -17.359 1.00 0.00 ? 11 ARG A CD   8  
ATOM 7798  N NE   . ARG A 1 11 ? -6.300  0.751   -17.726 1.00 0.00 ? 11 ARG A NE   8  
ATOM 7799  C CZ   . ARG A 1 11 ? -6.870  1.950   -17.687 1.00 0.00 ? 11 ARG A CZ   8  
ATOM 7800  N NH1  . ARG A 1 11 ? -6.171  3.008   -17.300 1.00 0.00 ? 11 ARG A NH1  8  
ATOM 7801  N NH2  . ARG A 1 11 ? -8.142  2.093   -18.038 1.00 0.00 ? 11 ARG A NH2  8  
ATOM 7802  H H    . ARG A 1 11 ? -3.198  -2.510  -20.847 1.00 0.00 ? 11 ARG A H    8  
ATOM 7803  H HA   . ARG A 1 11 ? -1.985  -1.021  -18.674 1.00 0.00 ? 11 ARG A HA   8  
ATOM 7804  H HB2  . ARG A 1 11 ? -3.608  -0.082  -20.435 1.00 0.00 ? 11 ARG A HB2  8  
ATOM 7805  H HB3  . ARG A 1 11 ? -4.872  -0.880  -19.509 1.00 0.00 ? 11 ARG A HB3  8  
ATOM 7806  H HG2  . ARG A 1 11 ? -2.972  0.955   -18.126 1.00 0.00 ? 11 ARG A HG2  8  
ATOM 7807  H HG3  . ARG A 1 11 ? -4.304  1.620   -19.074 1.00 0.00 ? 11 ARG A HG3  8  
ATOM 7808  H HD2  . ARG A 1 11 ? -4.804  -0.522  -17.045 1.00 0.00 ? 11 ARG A HD2  8  
ATOM 7809  H HD3  . ARG A 1 11 ? -4.640  1.160   -16.542 1.00 0.00 ? 11 ARG A HD3  8  
ATOM 7810  H HE   . ARG A 1 11 ? -6.835  -0.017  -18.016 1.00 0.00 ? 11 ARG A HE   8  
ATOM 7811  H HH11 . ARG A 1 11 ? -5.212  2.903   -17.036 1.00 0.00 ? 11 ARG A HH11 8  
ATOM 7812  H HH12 . ARG A 1 11 ? -6.602  3.910   -17.273 1.00 0.00 ? 11 ARG A HH12 8  
ATOM 7813  H HH21 . ARG A 1 11 ? -8.672  1.298   -18.331 1.00 0.00 ? 11 ARG A HH21 8  
ATOM 7814  H HH22 . ARG A 1 11 ? -8.570  2.996   -18.008 1.00 0.00 ? 11 ARG A HH22 8  
ATOM 7815  N N    . THR A 1 12 ? -2.624  -2.658  -16.892 1.00 0.00 ? 12 THR A N    8  
ATOM 7816  C CA   . THR A 1 12 ? -3.054  -3.433  -15.735 1.00 0.00 ? 12 THR A CA   8  
ATOM 7817  C C    . THR A 1 12 ? -3.454  -2.522  -14.581 1.00 0.00 ? 12 THR A C    8  
ATOM 7818  O O    . THR A 1 12 ? -2.610  -1.854  -13.983 1.00 0.00 ? 12 THR A O    8  
ATOM 7819  C CB   . THR A 1 12 ? -1.946  -4.391  -15.258 1.00 0.00 ? 12 THR A CB   8  
ATOM 7820  O OG1  . THR A 1 12 ? -1.507  -5.214  -16.344 1.00 0.00 ? 12 THR A OG1  8  
ATOM 7821  C CG2  . THR A 1 12 ? -2.443  -5.269  -14.119 1.00 0.00 ? 12 THR A CG2  8  
ATOM 7822  H H    . THR A 1 12 ? -1.685  -2.384  -16.963 1.00 0.00 ? 12 THR A H    8  
ATOM 7823  H HA   . THR A 1 12 ? -3.909  -4.024  -16.029 1.00 0.00 ? 12 THR A HA   8  
ATOM 7824  H HB   . THR A 1 12 ? -1.112  -3.803  -14.901 1.00 0.00 ? 12 THR A HB   8  
ATOM 7825  H HG1  . THR A 1 12 ? -2.236  -5.356  -16.953 1.00 0.00 ? 12 THR A HG1  8  
ATOM 7826  H HG21 . THR A 1 12 ? -1.848  -5.087  -13.237 1.00 0.00 ? 12 THR A HG21 8  
ATOM 7827  H HG22 . THR A 1 12 ? -2.360  -6.308  -14.403 1.00 0.00 ? 12 THR A HG22 8  
ATOM 7828  H HG23 . THR A 1 12 ? -3.476  -5.035  -13.910 1.00 0.00 ? 12 THR A HG23 8  
ATOM 7829  N N    . ARG A 1 13 ? -4.747  -2.500  -14.272 1.00 0.00 ? 13 ARG A N    8  
ATOM 7830  C CA   . ARG A 1 13 ? -5.259  -1.669  -13.189 1.00 0.00 ? 13 ARG A CA   8  
ATOM 7831  C C    . ARG A 1 13 ? -5.771  -2.531  -12.039 1.00 0.00 ? 13 ARG A C    8  
ATOM 7832  O O    . ARG A 1 13 ? -6.507  -3.495  -12.251 1.00 0.00 ? 13 ARG A O    8  
ATOM 7833  C CB   . ARG A 1 13 ? -6.381  -0.763  -13.699 1.00 0.00 ? 13 ARG A CB   8  
ATOM 7834  C CG   . ARG A 1 13 ? -6.577  0.493   -12.865 1.00 0.00 ? 13 ARG A CG   8  
ATOM 7835  C CD   . ARG A 1 13 ? -5.697  1.631   -13.358 1.00 0.00 ? 13 ARG A CD   8  
ATOM 7836  N NE   . ARG A 1 13 ? -5.524  2.668   -12.344 1.00 0.00 ? 13 ARG A NE   8  
ATOM 7837  C CZ   . ARG A 1 13 ? -5.216  3.928   -12.626 1.00 0.00 ? 13 ARG A CZ   8  
ATOM 7838  N NH1  . ARG A 1 13 ? -5.047  4.307   -13.886 1.00 0.00 ? 13 ARG A NH1  8  
ATOM 7839  N NH2  . ARG A 1 13 ? -5.076  4.814   -11.648 1.00 0.00 ? 13 ARG A NH2  8  
ATOM 7840  H H    . ARG A 1 13 ? -5.371  -3.054  -14.786 1.00 0.00 ? 13 ARG A H    8  
ATOM 7841  H HA   . ARG A 1 13 ? -4.447  -1.055  -12.830 1.00 0.00 ? 13 ARG A HA   8  
ATOM 7842  H HB2  . ARG A 1 13 ? -6.154  -0.464  -14.712 1.00 0.00 ? 13 ARG A HB2  8  
ATOM 7843  H HB3  . ARG A 1 13 ? -7.306  -1.319  -13.696 1.00 0.00 ? 13 ARG A HB3  8  
ATOM 7844  H HG2  . ARG A 1 13 ? -7.611  0.798   -12.929 1.00 0.00 ? 13 ARG A HG2  8  
ATOM 7845  H HG3  . ARG A 1 13 ? -6.326  0.274   -11.838 1.00 0.00 ? 13 ARG A HG3  8  
ATOM 7846  H HD2  . ARG A 1 13 ? -4.729  1.233   -13.620 1.00 0.00 ? 13 ARG A HD2  8  
ATOM 7847  H HD3  . ARG A 1 13 ? -6.155  2.069   -14.233 1.00 0.00 ? 13 ARG A HD3  8  
ATOM 7848  H HE   . ARG A 1 13 ? -5.644  2.410   -11.406 1.00 0.00 ? 13 ARG A HE   8  
ATOM 7849  H HH11 . ARG A 1 13 ? -5.153  3.642   -14.625 1.00 0.00 ? 13 ARG A HH11 8  
ATOM 7850  H HH12 . ARG A 1 13 ? -4.816  5.257   -14.096 1.00 0.00 ? 13 ARG A HH12 8  
ATOM 7851  H HH21 . ARG A 1 13 ? -5.202  4.532   -10.697 1.00 0.00 ? 13 ARG A HH21 8  
ATOM 7852  H HH22 . ARG A 1 13 ? -4.843  5.762   -11.861 1.00 0.00 ? 13 ARG A HH22 8  
ATOM 7853  N N    . PHE A 1 14 ? -5.375  -2.178  -10.820 1.00 0.00 ? 14 PHE A N    8  
ATOM 7854  C CA   . PHE A 1 14 ? -5.792  -2.920  -9.636  1.00 0.00 ? 14 PHE A CA   8  
ATOM 7855  C C    . PHE A 1 14 ? -6.958  -2.223  -8.940  1.00 0.00 ? 14 PHE A C    8  
ATOM 7856  O O    . PHE A 1 14 ? -7.200  -1.033  -9.148  1.00 0.00 ? 14 PHE A O    8  
ATOM 7857  C CB   . PHE A 1 14 ? -4.621  -3.071  -8.664  1.00 0.00 ? 14 PHE A CB   8  
ATOM 7858  C CG   . PHE A 1 14 ? -3.337  -3.477  -9.331  1.00 0.00 ? 14 PHE A CG   8  
ATOM 7859  C CD1  . PHE A 1 14 ? -3.017  -4.816  -9.489  1.00 0.00 ? 14 PHE A CD1  8  
ATOM 7860  C CD2  . PHE A 1 14 ? -2.452  -2.520  -9.799  1.00 0.00 ? 14 PHE A CD2  8  
ATOM 7861  C CE1  . PHE A 1 14 ? -1.836  -5.192  -10.102 1.00 0.00 ? 14 PHE A CE1  8  
ATOM 7862  C CE2  . PHE A 1 14 ? -1.270  -2.890  -10.413 1.00 0.00 ? 14 PHE A CE2  8  
ATOM 7863  C CZ   . PHE A 1 14 ? -0.962  -4.228  -10.565 1.00 0.00 ? 14 PHE A CZ   8  
ATOM 7864  H H    . PHE A 1 14 ? -4.788  -1.400  -10.715 1.00 0.00 ? 14 PHE A H    8  
ATOM 7865  H HA   . PHE A 1 14 ? -6.113  -3.899  -9.955  1.00 0.00 ? 14 PHE A HA   8  
ATOM 7866  H HB2  . PHE A 1 14 ? -4.451  -2.128  -8.166  1.00 0.00 ? 14 PHE A HB2  8  
ATOM 7867  H HB3  . PHE A 1 14 ? -4.867  -3.823  -7.929  1.00 0.00 ? 14 PHE A HB3  8  
ATOM 7868  H HD1  . PHE A 1 14 ? -3.700  -5.571  -9.129  1.00 0.00 ? 14 PHE A HD1  8  
ATOM 7869  H HD2  . PHE A 1 14 ? -2.691  -1.472  -9.680  1.00 0.00 ? 14 PHE A HD2  8  
ATOM 7870  H HE1  . PHE A 1 14 ? -1.599  -6.238  -10.220 1.00 0.00 ? 14 PHE A HE1  8  
ATOM 7871  H HE2  . PHE A 1 14 ? -0.589  -2.133  -10.774 1.00 0.00 ? 14 PHE A HE2  8  
ATOM 7872  H HZ   . PHE A 1 14 ? -0.039  -4.519  -11.044 1.00 0.00 ? 14 PHE A HZ   8  
ATOM 7873  N N    . THR A 1 15 ? -7.679  -2.973  -8.112  1.00 0.00 ? 15 THR A N    8  
ATOM 7874  C CA   . THR A 1 15 ? -8.821  -2.429  -7.387  1.00 0.00 ? 15 THR A CA   8  
ATOM 7875  C C    . THR A 1 15 ? -8.491  -2.232  -5.912  1.00 0.00 ? 15 THR A C    8  
ATOM 7876  O O    . THR A 1 15 ? -7.641  -2.929  -5.357  1.00 0.00 ? 15 THR A O    8  
ATOM 7877  C CB   . THR A 1 15 ? -10.052 -3.347  -7.508  1.00 0.00 ? 15 THR A CB   8  
ATOM 7878  O OG1  . THR A 1 15 ? -11.106 -2.866  -6.666  1.00 0.00 ? 15 THR A OG1  8  
ATOM 7879  C CG2  . THR A 1 15 ? -9.701  -4.777  -7.125  1.00 0.00 ? 15 THR A CG2  8  
ATOM 7880  H H    . THR A 1 15 ? -7.437  -3.914  -7.988  1.00 0.00 ? 15 THR A H    8  
ATOM 7881  H HA   . THR A 1 15 ? -9.067  -1.472  -7.822  1.00 0.00 ? 15 THR A HA   8  
ATOM 7882  H HB   . THR A 1 15 ? -10.389 -3.337  -8.535  1.00 0.00 ? 15 THR A HB   8  
ATOM 7883  H HG1  . THR A 1 15 ? -11.664 -3.602  -6.401  1.00 0.00 ? 15 THR A HG1  8  
ATOM 7884  H HG21 . THR A 1 15 ? -9.011  -5.184  -7.848  1.00 0.00 ? 15 THR A HG21 8  
ATOM 7885  H HG22 . THR A 1 15 ? -10.600 -5.375  -7.107  1.00 0.00 ? 15 THR A HG22 8  
ATOM 7886  H HG23 . THR A 1 15 ? -9.244  -4.784  -6.147  1.00 0.00 ? 15 THR A HG23 8  
ATOM 7887  N N    . ASP A 1 16 ? -9.169  -1.280  -5.281  1.00 0.00 ? 16 ASP A N    8  
ATOM 7888  C CA   . ASP A 1 16 ? -8.950  -0.992  -3.868  1.00 0.00 ? 16 ASP A CA   8  
ATOM 7889  C C    . ASP A 1 16 ? -8.622  -2.268  -3.099  1.00 0.00 ? 16 ASP A C    8  
ATOM 7890  O O    . ASP A 1 16 ? -7.708  -2.290  -2.274  1.00 0.00 ? 16 ASP A O    8  
ATOM 7891  C CB   . ASP A 1 16 ? -10.184 -0.320  -3.265  1.00 0.00 ? 16 ASP A CB   8  
ATOM 7892  C CG   . ASP A 1 16 ? -10.201 1.178   -3.499  1.00 0.00 ? 16 ASP A CG   8  
ATOM 7893  O OD1  . ASP A 1 16 ? -9.109  1.769   -3.638  1.00 0.00 ? 16 ASP A OD1  8  
ATOM 7894  O OD2  . ASP A 1 16 ? -11.305 1.758   -3.544  1.00 0.00 ? 16 ASP A OD2  8  
ATOM 7895  H H    . ASP A 1 16 ? -9.834  -0.758  -5.778  1.00 0.00 ? 16 ASP A H    8  
ATOM 7896  H HA   . ASP A 1 16 ? -8.111  -0.317  -3.794  1.00 0.00 ? 16 ASP A HA   8  
ATOM 7897  H HB2  . ASP A 1 16 ? -11.072 -0.745  -3.711  1.00 0.00 ? 16 ASP A HB2  8  
ATOM 7898  H HB3  . ASP A 1 16 ? -10.200 -0.501  -2.200  1.00 0.00 ? 16 ASP A HB3  8  
ATOM 7899  N N    . TYR A 1 17 ? -9.374  -3.328  -3.373  1.00 0.00 ? 17 TYR A N    8  
ATOM 7900  C CA   . TYR A 1 17 ? -9.166  -4.606  -2.704  1.00 0.00 ? 17 TYR A CA   8  
ATOM 7901  C C    . TYR A 1 17 ? -7.729  -5.086  -2.880  1.00 0.00 ? 17 TYR A C    8  
ATOM 7902  O O    . TYR A 1 17 ? -7.057  -5.435  -1.910  1.00 0.00 ? 17 TYR A O    8  
ATOM 7903  C CB   . TYR A 1 17 ? -10.136 -5.655  -3.251  1.00 0.00 ? 17 TYR A CB   8  
ATOM 7904  C CG   . TYR A 1 17 ? -9.618  -7.072  -3.145  1.00 0.00 ? 17 TYR A CG   8  
ATOM 7905  C CD1  . TYR A 1 17 ? -9.157  -7.576  -1.935  1.00 0.00 ? 17 TYR A CD1  8  
ATOM 7906  C CD2  . TYR A 1 17 ? -9.589  -7.907  -4.256  1.00 0.00 ? 17 TYR A CD2  8  
ATOM 7907  C CE1  . TYR A 1 17 ? -8.682  -8.869  -1.834  1.00 0.00 ? 17 TYR A CE1  8  
ATOM 7908  C CE2  . TYR A 1 17 ? -9.118  -9.202  -4.164  1.00 0.00 ? 17 TYR A CE2  8  
ATOM 7909  C CZ   . TYR A 1 17 ? -8.665  -9.678  -2.951  1.00 0.00 ? 17 TYR A CZ   8  
ATOM 7910  O OH   . TYR A 1 17 ? -8.193  -10.967 -2.856  1.00 0.00 ? 17 TYR A OH   8  
ATOM 7911  H H    . TYR A 1 17 ? -10.087 -3.248  -4.040  1.00 0.00 ? 17 TYR A H    8  
ATOM 7912  H HA   . TYR A 1 17 ? -9.360  -4.465  -1.651  1.00 0.00 ? 17 TYR A HA   8  
ATOM 7913  H HB2  . TYR A 1 17 ? -11.063 -5.600  -2.700  1.00 0.00 ? 17 TYR A HB2  8  
ATOM 7914  H HB3  . TYR A 1 17 ? -10.329 -5.449  -4.293  1.00 0.00 ? 17 TYR A HB3  8  
ATOM 7915  H HD1  . TYR A 1 17 ? -9.171  -6.939  -1.062  1.00 0.00 ? 17 TYR A HD1  8  
ATOM 7916  H HD2  . TYR A 1 17 ? -9.944  -7.530  -5.204  1.00 0.00 ? 17 TYR A HD2  8  
ATOM 7917  H HE1  . TYR A 1 17 ? -8.327  -9.243  -0.885  1.00 0.00 ? 17 TYR A HE1  8  
ATOM 7918  H HE2  . TYR A 1 17 ? -9.104  -9.835  -5.038  1.00 0.00 ? 17 TYR A HE2  8  
ATOM 7919  H HH   . TYR A 1 17 ? -8.106  -11.342 -3.736  1.00 0.00 ? 17 TYR A HH   8  
ATOM 7920  N N    . GLN A 1 18 ? -7.264  -5.098  -4.125  1.00 0.00 ? 18 GLN A N    8  
ATOM 7921  C CA   . GLN A 1 18 ? -5.907  -5.535  -4.430  1.00 0.00 ? 18 GLN A CA   8  
ATOM 7922  C C    . GLN A 1 18 ? -4.885  -4.513  -3.943  1.00 0.00 ? 18 GLN A C    8  
ATOM 7923  O O    . GLN A 1 18 ? -3.912  -4.862  -3.273  1.00 0.00 ? 18 GLN A O    8  
ATOM 7924  C CB   . GLN A 1 18 ? -5.746  -5.759  -5.934  1.00 0.00 ? 18 GLN A CB   8  
ATOM 7925  C CG   . GLN A 1 18 ? -6.748  -6.744  -6.513  1.00 0.00 ? 18 GLN A CG   8  
ATOM 7926  C CD   . GLN A 1 18 ? -6.207  -7.487  -7.719  1.00 0.00 ? 18 GLN A CD   8  
ATOM 7927  O OE1  . GLN A 1 18 ? -5.747  -6.876  -8.684  1.00 0.00 ? 18 GLN A OE1  8  
ATOM 7928  N NE2  . GLN A 1 18 ? -6.259  -8.813  -7.670  1.00 0.00 ? 18 GLN A NE2  8  
ATOM 7929  H H    . GLN A 1 18 ? -7.848  -4.808  -4.856  1.00 0.00 ? 18 GLN A H    8  
ATOM 7930  H HA   . GLN A 1 18 ? -5.736  -6.468  -3.916  1.00 0.00 ? 18 GLN A HA   8  
ATOM 7931  H HB2  . GLN A 1 18 ? -5.867  -4.814  -6.442  1.00 0.00 ? 18 GLN A HB2  8  
ATOM 7932  H HB3  . GLN A 1 18 ? -4.752  -6.137  -6.125  1.00 0.00 ? 18 GLN A HB3  8  
ATOM 7933  H HG2  . GLN A 1 18 ? -7.007  -7.465  -5.752  1.00 0.00 ? 18 GLN A HG2  8  
ATOM 7934  H HG3  . GLN A 1 18 ? -7.634  -6.202  -6.810  1.00 0.00 ? 18 GLN A HG3  8  
ATOM 7935  H HE21 . GLN A 1 18 ? -6.640  -9.231  -6.869  1.00 0.00 ? 18 GLN A HE21 8  
ATOM 7936  H HE22 . GLN A 1 18 ? -5.917  -9.318  -8.435  1.00 0.00 ? 18 GLN A HE22 8  
ATOM 7937  N N    . LEU A 1 19 ? -5.110  -3.249  -4.286  1.00 0.00 ? 19 LEU A N    8  
ATOM 7938  C CA   . LEU A 1 19 ? -4.209  -2.175  -3.884  1.00 0.00 ? 19 LEU A CA   8  
ATOM 7939  C C    . LEU A 1 19 ? -4.035  -2.147  -2.369  1.00 0.00 ? 19 LEU A C    8  
ATOM 7940  O O    . LEU A 1 19 ? -2.977  -1.774  -1.862  1.00 0.00 ? 19 LEU A O    8  
ATOM 7941  C CB   . LEU A 1 19 ? -4.740  -0.826  -4.372  1.00 0.00 ? 19 LEU A CB   8  
ATOM 7942  C CG   . LEU A 1 19 ? -4.546  -0.527  -5.859  1.00 0.00 ? 19 LEU A CG   8  
ATOM 7943  C CD1  . LEU A 1 19 ? -5.184  0.805   -6.223  1.00 0.00 ? 19 LEU A CD1  8  
ATOM 7944  C CD2  . LEU A 1 19 ? -3.067  -0.526  -6.214  1.00 0.00 ? 19 LEU A CD2  8  
ATOM 7945  H H    . LEU A 1 19 ? -5.902  -3.032  -4.820  1.00 0.00 ? 19 LEU A H    8  
ATOM 7946  H HA   . LEU A 1 19 ? -3.248  -2.361  -4.341  1.00 0.00 ? 19 LEU A HA   8  
ATOM 7947  H HB2  . LEU A 1 19 ? -5.799  -0.794  -4.164  1.00 0.00 ? 19 LEU A HB2  8  
ATOM 7948  H HB3  . LEU A 1 19 ? -4.240  -0.051  -3.810  1.00 0.00 ? 19 LEU A HB3  8  
ATOM 7949  H HG   . LEU A 1 19 ? -5.031  -1.299  -6.442  1.00 0.00 ? 19 LEU A HG   8  
ATOM 7950  H HD11 . LEU A 1 19 ? -4.528  1.610   -5.931  1.00 0.00 ? 19 LEU A HD11 8  
ATOM 7951  H HD12 . LEU A 1 19 ? -6.128  0.904   -5.709  1.00 0.00 ? 19 LEU A HD12 8  
ATOM 7952  H HD13 . LEU A 1 19 ? -5.351  0.844   -7.290  1.00 0.00 ? 19 LEU A HD13 8  
ATOM 7953  H HD21 . LEU A 1 19 ? -2.804  0.422   -6.659  1.00 0.00 ? 19 LEU A HD21 8  
ATOM 7954  H HD22 . LEU A 1 19 ? -2.865  -1.321  -6.918  1.00 0.00 ? 19 LEU A HD22 8  
ATOM 7955  H HD23 . LEU A 1 19 ? -2.482  -0.679  -5.320  1.00 0.00 ? 19 LEU A HD23 8  
ATOM 7956  N N    . ARG A 1 20 ? -5.080  -2.546  -1.651  1.00 0.00 ? 20 ARG A N    8  
ATOM 7957  C CA   . ARG A 1 20 ? -5.043  -2.568  -0.194  1.00 0.00 ? 20 ARG A CA   8  
ATOM 7958  C C    . ARG A 1 20 ? -4.010  -3.573  0.308   1.00 0.00 ? 20 ARG A C    8  
ATOM 7959  O O    . ARG A 1 20 ? -3.212  -3.268  1.195   1.00 0.00 ? 20 ARG A O    8  
ATOM 7960  C CB   . ARG A 1 20 ? -6.423  -2.916  0.367   1.00 0.00 ? 20 ARG A CB   8  
ATOM 7961  C CG   . ARG A 1 20 ? -6.536  -2.718  1.870   1.00 0.00 ? 20 ARG A CG   8  
ATOM 7962  C CD   . ARG A 1 20 ? -5.934  -3.887  2.634   1.00 0.00 ? 20 ARG A CD   8  
ATOM 7963  N NE   . ARG A 1 20 ? -6.350  -3.899  4.034   1.00 0.00 ? 20 ARG A NE   8  
ATOM 7964  C CZ   . ARG A 1 20 ? -5.874  -3.062  4.949   1.00 0.00 ? 20 ARG A CZ   8  
ATOM 7965  N NH1  . ARG A 1 20 ? -4.971  -2.151  4.613   1.00 0.00 ? 20 ARG A NH1  8  
ATOM 7966  N NH2  . ARG A 1 20 ? -6.301  -3.135  6.203   1.00 0.00 ? 20 ARG A NH2  8  
ATOM 7967  H H    . ARG A 1 20 ? -5.896  -2.832  -2.113  1.00 0.00 ? 20 ARG A H    8  
ATOM 7968  H HA   . ARG A 1 20 ? -4.764  -1.582  0.146   1.00 0.00 ? 20 ARG A HA   8  
ATOM 7969  H HB2  . ARG A 1 20 ? -7.162  -2.292  -0.113  1.00 0.00 ? 20 ARG A HB2  8  
ATOM 7970  H HB3  . ARG A 1 20 ? -6.638  -3.951  0.145   1.00 0.00 ? 20 ARG A HB3  8  
ATOM 7971  H HG2  . ARG A 1 20 ? -6.012  -1.814  2.145   1.00 0.00 ? 20 ARG A HG2  8  
ATOM 7972  H HG3  . ARG A 1 20 ? -7.579  -2.626  2.133   1.00 0.00 ? 20 ARG A HG3  8  
ATOM 7973  H HD2  . ARG A 1 20 ? -6.252  -4.807  2.166   1.00 0.00 ? 20 ARG A HD2  8  
ATOM 7974  H HD3  . ARG A 1 20 ? -4.858  -3.813  2.588   1.00 0.00 ? 20 ARG A HD3  8  
ATOM 7975  H HE   . ARG A 1 20 ? -7.016  -4.564  4.303   1.00 0.00 ? 20 ARG A HE   8  
ATOM 7976  H HH11 . ARG A 1 20 ? -4.648  -2.093  3.669   1.00 0.00 ? 20 ARG A HH11 8  
ATOM 7977  H HH12 . ARG A 1 20 ? -4.615  -1.521  5.304   1.00 0.00 ? 20 ARG A HH12 8  
ATOM 7978  H HH21 . ARG A 1 20 ? -6.982  -3.820  6.459   1.00 0.00 ? 20 ARG A HH21 8  
ATOM 7979  H HH22 . ARG A 1 20 ? -5.943  -2.505  6.890   1.00 0.00 ? 20 ARG A HH22 8  
ATOM 7980  N N    . VAL A 1 21 ? -4.030  -4.772  -0.265  1.00 0.00 ? 21 VAL A N    8  
ATOM 7981  C CA   . VAL A 1 21 ? -3.095  -5.821  0.124   1.00 0.00 ? 21 VAL A CA   8  
ATOM 7982  C C    . VAL A 1 21 ? -1.686  -5.512  -0.370  1.00 0.00 ? 21 VAL A C    8  
ATOM 7983  O O    . VAL A 1 21 ? -0.709  -5.688  0.359   1.00 0.00 ? 21 VAL A O    8  
ATOM 7984  C CB   . VAL A 1 21 ? -3.531  -7.193  -0.426  1.00 0.00 ? 21 VAL A CB   8  
ATOM 7985  C CG1  . VAL A 1 21 ? -2.496  -8.256  -0.089  1.00 0.00 ? 21 VAL A CG1  8  
ATOM 7986  C CG2  . VAL A 1 21 ? -4.898  -7.575  0.121   1.00 0.00 ? 21 VAL A CG2  8  
ATOM 7987  H H    . VAL A 1 21 ? -4.689  -4.955  -0.967  1.00 0.00 ? 21 VAL A H    8  
ATOM 7988  H HA   . VAL A 1 21 ? -3.084  -5.876  1.203   1.00 0.00 ? 21 VAL A HA   8  
ATOM 7989  H HB   . VAL A 1 21 ? -3.603  -7.120  -1.501  1.00 0.00 ? 21 VAL A HB   8  
ATOM 7990  H HG11 . VAL A 1 21 ? -2.076  -8.650  -1.003  1.00 0.00 ? 21 VAL A HG11 8  
ATOM 7991  H HG12 . VAL A 1 21 ? -1.711  -7.818  0.510   1.00 0.00 ? 21 VAL A HG12 8  
ATOM 7992  H HG13 . VAL A 1 21 ? -2.968  -9.055  0.463   1.00 0.00 ? 21 VAL A HG13 8  
ATOM 7993  H HG21 . VAL A 1 21 ? -5.116  -8.600  -0.142  1.00 0.00 ? 21 VAL A HG21 8  
ATOM 7994  H HG22 . VAL A 1 21 ? -4.898  -7.472  1.197   1.00 0.00 ? 21 VAL A HG22 8  
ATOM 7995  H HG23 . VAL A 1 21 ? -5.650  -6.926  -0.302  1.00 0.00 ? 21 VAL A HG23 8  
ATOM 7996  N N    . LEU A 1 22 ? -1.588  -5.051  -1.612  1.00 0.00 ? 22 LEU A N    8  
ATOM 7997  C CA   . LEU A 1 22 ? -0.298  -4.716  -2.204  1.00 0.00 ? 22 LEU A CA   8  
ATOM 7998  C C    . LEU A 1 22 ? 0.359   -3.559  -1.460  1.00 0.00 ? 22 LEU A C    8  
ATOM 7999  O O    . LEU A 1 22 ? 1.547   -3.608  -1.142  1.00 0.00 ? 22 LEU A O    8  
ATOM 8000  C CB   . LEU A 1 22 ? -0.471  -4.356  -3.681  1.00 0.00 ? 22 LEU A CB   8  
ATOM 8001  C CG   . LEU A 1 22 ? -0.929  -5.489  -4.600  1.00 0.00 ? 22 LEU A CG   8  
ATOM 8002  C CD1  . LEU A 1 22 ? -1.379  -4.937  -5.943  1.00 0.00 ? 22 LEU A CD1  8  
ATOM 8003  C CD2  . LEU A 1 22 ? 0.186   -6.508  -4.786  1.00 0.00 ? 22 LEU A CD2  8  
ATOM 8004  H H    . LEU A 1 22 ? -2.402  -4.932  -2.144  1.00 0.00 ? 22 LEU A H    8  
ATOM 8005  H HA   . LEU A 1 22 ? 0.338   -5.586  -2.127  1.00 0.00 ? 22 LEU A HA   8  
ATOM 8006  H HB2  . LEU A 1 22 ? -1.200  -3.563  -3.744  1.00 0.00 ? 22 LEU A HB2  8  
ATOM 8007  H HB3  . LEU A 1 22 ? 0.481   -3.996  -4.046  1.00 0.00 ? 22 LEU A HB3  8  
ATOM 8008  H HG   . LEU A 1 22 ? -1.772  -5.993  -4.147  1.00 0.00 ? 22 LEU A HG   8  
ATOM 8009  H HD11 . LEU A 1 22 ? -2.225  -4.283  -5.798  1.00 0.00 ? 22 LEU A HD11 8  
ATOM 8010  H HD12 . LEU A 1 22 ? -1.663  -5.754  -6.591  1.00 0.00 ? 22 LEU A HD12 8  
ATOM 8011  H HD13 . LEU A 1 22 ? -0.569  -4.385  -6.396  1.00 0.00 ? 22 LEU A HD13 8  
ATOM 8012  H HD21 . LEU A 1 22 ? 0.776   -6.564  -3.883  1.00 0.00 ? 22 LEU A HD21 8  
ATOM 8013  H HD22 . LEU A 1 22 ? 0.816   -6.205  -5.610  1.00 0.00 ? 22 LEU A HD22 8  
ATOM 8014  H HD23 . LEU A 1 22 ? -0.243  -7.476  -4.997  1.00 0.00 ? 22 LEU A HD23 8  
ATOM 8015  N N    . GLN A 1 23 ? -0.422  -2.520  -1.184  1.00 0.00 ? 23 GLN A N    8  
ATOM 8016  C CA   . GLN A 1 23 ? 0.084   -1.351  -0.475  1.00 0.00 ? 23 GLN A CA   8  
ATOM 8017  C C    . GLN A 1 23 ? 0.335   -1.671  0.995   1.00 0.00 ? 23 GLN A C    8  
ATOM 8018  O O    . GLN A 1 23 ? 1.298   -1.187  1.591   1.00 0.00 ? 23 GLN A O    8  
ATOM 8019  C CB   . GLN A 1 23 ? -0.903  -0.188  -0.594  1.00 0.00 ? 23 GLN A CB   8  
ATOM 8020  C CG   . GLN A 1 23 ? -0.284  1.168   -0.299  1.00 0.00 ? 23 GLN A CG   8  
ATOM 8021  C CD   . GLN A 1 23 ? 0.909   1.471   -1.184  1.00 0.00 ? 23 GLN A CD   8  
ATOM 8022  O OE1  . GLN A 1 23 ? 0.755   1.841   -2.348  1.00 0.00 ? 23 GLN A OE1  8  
ATOM 8023  N NE2  . GLN A 1 23 ? 2.108   1.315   -0.635  1.00 0.00 ? 23 GLN A NE2  8  
ATOM 8024  H H    . GLN A 1 23 ? -1.361  -2.540  -1.463  1.00 0.00 ? 23 GLN A H    8  
ATOM 8025  H HA   . GLN A 1 23 ? 1.019   -1.065  -0.932  1.00 0.00 ? 23 GLN A HA   8  
ATOM 8026  H HB2  . GLN A 1 23 ? -1.298  -0.169  -1.599  1.00 0.00 ? 23 GLN A HB2  8  
ATOM 8027  H HB3  . GLN A 1 23 ? -1.714  -0.348  0.101   1.00 0.00 ? 23 GLN A HB3  8  
ATOM 8028  H HG2  . GLN A 1 23 ? -1.031  1.933   -0.455  1.00 0.00 ? 23 GLN A HG2  8  
ATOM 8029  H HG3  . GLN A 1 23 ? 0.037   1.186   0.732   1.00 0.00 ? 23 GLN A HG3  8  
ATOM 8030  H HE21 . GLN A 1 23 ? 2.155   1.016   0.297   1.00 0.00 ? 23 GLN A HE21 8  
ATOM 8031  H HE22 . GLN A 1 23 ? 2.897   1.502   -1.185  1.00 0.00 ? 23 GLN A HE22 8  
ATOM 8032  N N    . ASP A 1 24 ? -0.537  -2.490  1.574   1.00 0.00 ? 24 ASP A N    8  
ATOM 8033  C CA   . ASP A 1 24 ? -0.410  -2.876  2.974   1.00 0.00 ? 24 ASP A CA   8  
ATOM 8034  C C    . ASP A 1 24 ? 0.868   -3.677  3.203   1.00 0.00 ? 24 ASP A C    8  
ATOM 8035  O O    . ASP A 1 24 ? 1.582   -3.460  4.182   1.00 0.00 ? 24 ASP A O    8  
ATOM 8036  C CB   . ASP A 1 24 ? -1.625  -3.695  3.412   1.00 0.00 ? 24 ASP A CB   8  
ATOM 8037  C CG   . ASP A 1 24 ? -1.509  -4.184  4.842   1.00 0.00 ? 24 ASP A CG   8  
ATOM 8038  O OD1  . ASP A 1 24 ? -0.378  -4.487  5.276   1.00 0.00 ? 24 ASP A OD1  8  
ATOM 8039  O OD2  . ASP A 1 24 ? -2.550  -4.264  5.528   1.00 0.00 ? 24 ASP A OD2  8  
ATOM 8040  H H    . ASP A 1 24 ? -1.284  -2.843  1.046   1.00 0.00 ? 24 ASP A H    8  
ATOM 8041  H HA   . ASP A 1 24 ? -0.364  -1.973  3.564   1.00 0.00 ? 24 ASP A HA   8  
ATOM 8042  H HB2  . ASP A 1 24 ? -2.512  -3.083  3.331   1.00 0.00 ? 24 ASP A HB2  8  
ATOM 8043  H HB3  . ASP A 1 24 ? -1.725  -4.553  2.764   1.00 0.00 ? 24 ASP A HB3  8  
ATOM 8044  N N    . PHE A 1 25 ? 1.150   -4.604  2.294   1.00 0.00 ? 25 PHE A N    8  
ATOM 8045  C CA   . PHE A 1 25 ? 2.341   -5.440  2.398   1.00 0.00 ? 25 PHE A CA   8  
ATOM 8046  C C    . PHE A 1 25 ? 3.603   -4.620  2.151   1.00 0.00 ? 25 PHE A C    8  
ATOM 8047  O O    . PHE A 1 25 ? 4.670   -4.926  2.683   1.00 0.00 ? 25 PHE A O    8  
ATOM 8048  C CB   . PHE A 1 25 ? 2.267   -6.597  1.399   1.00 0.00 ? 25 PHE A CB   8  
ATOM 8049  C CG   . PHE A 1 25 ? 3.310   -7.652  1.626   1.00 0.00 ? 25 PHE A CG   8  
ATOM 8050  C CD1  . PHE A 1 25 ? 4.650   -7.381  1.398   1.00 0.00 ? 25 PHE A CD1  8  
ATOM 8051  C CD2  . PHE A 1 25 ? 2.952   -8.916  2.068   1.00 0.00 ? 25 PHE A CD2  8  
ATOM 8052  C CE1  . PHE A 1 25 ? 5.613   -8.350  1.607   1.00 0.00 ? 25 PHE A CE1  8  
ATOM 8053  C CE2  . PHE A 1 25 ? 3.911   -9.889  2.278   1.00 0.00 ? 25 PHE A CE2  8  
ATOM 8054  C CZ   . PHE A 1 25 ? 5.243   -9.606  2.046   1.00 0.00 ? 25 PHE A CZ   8  
ATOM 8055  H H    . PHE A 1 25 ? 0.542   -4.730  1.536   1.00 0.00 ? 25 PHE A H    8  
ATOM 8056  H HA   . PHE A 1 25 ? 2.377   -5.841  3.399   1.00 0.00 ? 25 PHE A HA   8  
ATOM 8057  H HB2  . PHE A 1 25 ? 1.298   -7.067  1.475   1.00 0.00 ? 25 PHE A HB2  8  
ATOM 8058  H HB3  . PHE A 1 25 ? 2.397   -6.209  0.400   1.00 0.00 ? 25 PHE A HB3  8  
ATOM 8059  H HD1  . PHE A 1 25 ? 4.941   -6.399  1.054   1.00 0.00 ? 25 PHE A HD1  8  
ATOM 8060  H HD2  . PHE A 1 25 ? 1.911   -9.139  2.248   1.00 0.00 ? 25 PHE A HD2  8  
ATOM 8061  H HE1  . PHE A 1 25 ? 6.654   -8.126  1.424   1.00 0.00 ? 25 PHE A HE1  8  
ATOM 8062  H HE2  . PHE A 1 25 ? 3.619   -10.870 2.622   1.00 0.00 ? 25 PHE A HE2  8  
ATOM 8063  H HZ   . PHE A 1 25 ? 5.994   -10.365 2.210   1.00 0.00 ? 25 PHE A HZ   8  
ATOM 8064  N N    . PHE A 1 26 ? 3.474   -3.576  1.339   1.00 0.00 ? 26 PHE A N    8  
ATOM 8065  C CA   . PHE A 1 26 ? 4.605   -2.712  1.019   1.00 0.00 ? 26 PHE A CA   8  
ATOM 8066  C C    . PHE A 1 26 ? 4.975   -1.837  2.213   1.00 0.00 ? 26 PHE A C    8  
ATOM 8067  O O    . PHE A 1 26 ? 6.143   -1.750  2.594   1.00 0.00 ? 26 PHE A O    8  
ATOM 8068  C CB   . PHE A 1 26 ? 4.275   -1.832  -0.189  1.00 0.00 ? 26 PHE A CB   8  
ATOM 8069  C CG   . PHE A 1 26 ? 5.381   -0.886  -0.561  1.00 0.00 ? 26 PHE A CG   8  
ATOM 8070  C CD1  . PHE A 1 26 ? 5.522   0.327   0.094   1.00 0.00 ? 26 PHE A CD1  8  
ATOM 8071  C CD2  . PHE A 1 26 ? 6.280   -1.210  -1.564  1.00 0.00 ? 26 PHE A CD2  8  
ATOM 8072  C CE1  . PHE A 1 26 ? 6.538   1.200   -0.247  1.00 0.00 ? 26 PHE A CE1  8  
ATOM 8073  C CE2  . PHE A 1 26 ? 7.298   -0.341  -1.909  1.00 0.00 ? 26 PHE A CE2  8  
ATOM 8074  C CZ   . PHE A 1 26 ? 7.428   0.865   -1.249  1.00 0.00 ? 26 PHE A CZ   8  
ATOM 8075  H H    . PHE A 1 26 ? 2.598   -3.382  0.945   1.00 0.00 ? 26 PHE A H    8  
ATOM 8076  H HA   . PHE A 1 26 ? 5.445   -3.343  0.775   1.00 0.00 ? 26 PHE A HA   8  
ATOM 8077  H HB2  . PHE A 1 26 ? 4.079   -2.464  -1.042  1.00 0.00 ? 26 PHE A HB2  8  
ATOM 8078  H HB3  . PHE A 1 26 ? 3.395   -1.247  0.030   1.00 0.00 ? 26 PHE A HB3  8  
ATOM 8079  H HD1  . PHE A 1 26 ? 4.827   0.590   0.878   1.00 0.00 ? 26 PHE A HD1  8  
ATOM 8080  H HD2  . PHE A 1 26 ? 6.180   -2.154  -2.082  1.00 0.00 ? 26 PHE A HD2  8  
ATOM 8081  H HE1  . PHE A 1 26 ? 6.637   2.142   0.271   1.00 0.00 ? 26 PHE A HE1  8  
ATOM 8082  H HE2  . PHE A 1 26 ? 7.993   -0.606  -2.693  1.00 0.00 ? 26 PHE A HE2  8  
ATOM 8083  H HZ   . PHE A 1 26 ? 8.222   1.545   -1.517  1.00 0.00 ? 26 PHE A HZ   8  
ATOM 8084  N N    . ASP A 1 27 ? 3.974   -1.190  2.799   1.00 0.00 ? 27 ASP A N    8  
ATOM 8085  C CA   . ASP A 1 27 ? 4.193   -0.322  3.950   1.00 0.00 ? 27 ASP A CA   8  
ATOM 8086  C C    . ASP A 1 27 ? 4.956   -1.058  5.047   1.00 0.00 ? 27 ASP A C    8  
ATOM 8087  O O    . ASP A 1 27 ? 5.731   -0.455  5.789   1.00 0.00 ? 27 ASP A O    8  
ATOM 8088  C CB   . ASP A 1 27 ? 2.857   0.187   4.493   1.00 0.00 ? 27 ASP A CB   8  
ATOM 8089  C CG   . ASP A 1 27 ? 2.995   1.512   5.217   1.00 0.00 ? 27 ASP A CG   8  
ATOM 8090  O OD1  . ASP A 1 27 ? 3.782   2.363   4.754   1.00 0.00 ? 27 ASP A OD1  8  
ATOM 8091  O OD2  . ASP A 1 27 ? 2.314   1.698   6.247   1.00 0.00 ? 27 ASP A OD2  8  
ATOM 8092  H H    . ASP A 1 27 ? 3.065   -1.300  2.449   1.00 0.00 ? 27 ASP A H    8  
ATOM 8093  H HA   . ASP A 1 27 ? 4.783   0.521   3.622   1.00 0.00 ? 27 ASP A HA   8  
ATOM 8094  H HB2  . ASP A 1 27 ? 2.168   0.318   3.672   1.00 0.00 ? 27 ASP A HB2  8  
ATOM 8095  H HB3  . ASP A 1 27 ? 2.456   -0.540  5.183   1.00 0.00 ? 27 ASP A HB3  8  
ATOM 8096  N N    . ALA A 1 28 ? 4.729   -2.364  5.145   1.00 0.00 ? 28 ALA A N    8  
ATOM 8097  C CA   . ALA A 1 28 ? 5.396   -3.181  6.151   1.00 0.00 ? 28 ALA A CA   8  
ATOM 8098  C C    . ALA A 1 28 ? 6.685   -3.783  5.603   1.00 0.00 ? 28 ALA A C    8  
ATOM 8099  O O    . ALA A 1 28 ? 7.698   -3.842  6.299   1.00 0.00 ? 28 ALA A O    8  
ATOM 8100  C CB   . ALA A 1 28 ? 4.464   -4.280  6.639   1.00 0.00 ? 28 ALA A CB   8  
ATOM 8101  H H    . ALA A 1 28 ? 4.100   -2.787  4.524   1.00 0.00 ? 28 ALA A H    8  
ATOM 8102  H HA   . ALA A 1 28 ? 5.635   -2.546  6.992   1.00 0.00 ? 28 ALA A HA   8  
ATOM 8103  H HB1  . ALA A 1 28 ? 4.953   -4.846  7.419   1.00 0.00 ? 28 ALA A HB1  8  
ATOM 8104  H HB2  . ALA A 1 28 ? 3.559   -3.838  7.028   1.00 0.00 ? 28 ALA A HB2  8  
ATOM 8105  H HB3  . ALA A 1 28 ? 4.220   -4.937  5.817   1.00 0.00 ? 28 ALA A HB3  8  
ATOM 8106  N N    . ASN A 1 29 ? 6.640   -4.229  4.352   1.00 0.00 ? 29 ASN A N    8  
ATOM 8107  C CA   . ASN A 1 29 ? 7.805   -4.828  3.711   1.00 0.00 ? 29 ASN A CA   8  
ATOM 8108  C C    . ASN A 1 29 ? 7.788   -4.578  2.207   1.00 0.00 ? 29 ASN A C    8  
ATOM 8109  O O    . ASN A 1 29 ? 6.810   -4.889  1.526   1.00 0.00 ? 29 ASN A O    8  
ATOM 8110  C CB   . ASN A 1 29 ? 7.848   -6.333  3.989   1.00 0.00 ? 29 ASN A CB   8  
ATOM 8111  C CG   . ASN A 1 29 ? 9.184   -6.950  3.620   1.00 0.00 ? 29 ASN A CG   8  
ATOM 8112  O OD1  . ASN A 1 29 ? 10.231  -6.530  4.111   1.00 0.00 ? 29 ASN A OD1  8  
ATOM 8113  N ND2  . ASN A 1 29 ? 9.151   -7.953  2.750   1.00 0.00 ? 29 ASN A ND2  8  
ATOM 8114  H H    . ASN A 1 29 ? 5.803   -4.155  3.847   1.00 0.00 ? 29 ASN A H    8  
ATOM 8115  H HA   . ASN A 1 29 ? 8.687   -4.369  4.131   1.00 0.00 ? 29 ASN A HA   8  
ATOM 8116  H HB2  . ASN A 1 29 ? 7.673   -6.504  5.041   1.00 0.00 ? 29 ASN A HB2  8  
ATOM 8117  H HB3  . ASN A 1 29 ? 7.076   -6.821  3.415   1.00 0.00 ? 29 ASN A HB3  8  
ATOM 8118  H HD21 . ASN A 1 29 ? 8.280   -8.234  2.400   1.00 0.00 ? 29 ASN A HD21 8  
ATOM 8119  H HD22 . ASN A 1 29 ? 10.000  -8.371  2.495   1.00 0.00 ? 29 ASN A HD22 8  
ATOM 8120  N N    . ALA A 1 30 ? 8.876   -4.013  1.694   1.00 0.00 ? 30 ALA A N    8  
ATOM 8121  C CA   . ALA A 1 30 ? 8.987   -3.722  0.270   1.00 0.00 ? 30 ALA A CA   8  
ATOM 8122  C C    . ALA A 1 30 ? 10.167  -4.463  -0.351  1.00 0.00 ? 30 ALA A C    8  
ATOM 8123  O O    . ALA A 1 30 ? 10.552  -4.193  -1.489  1.00 0.00 ? 30 ALA A O    8  
ATOM 8124  C CB   . ALA A 1 30 ? 9.125   -2.224  0.046   1.00 0.00 ? 30 ALA A CB   8  
ATOM 8125  H H    . ALA A 1 30 ? 9.622   -3.787  2.287   1.00 0.00 ? 30 ALA A H    8  
ATOM 8126  H HA   . ALA A 1 30 ? 8.076   -4.051  -0.210  1.00 0.00 ? 30 ALA A HA   8  
ATOM 8127  H HB1  . ALA A 1 30 ? 8.350   -1.706  0.593   1.00 0.00 ? 30 ALA A HB1  8  
ATOM 8128  H HB2  . ALA A 1 30 ? 10.092  -1.895  0.394   1.00 0.00 ? 30 ALA A HB2  8  
ATOM 8129  H HB3  . ALA A 1 30 ? 9.028   -2.007  -1.008  1.00 0.00 ? 30 ALA A HB3  8  
ATOM 8130  N N    . TYR A 1 31 ? 10.736  -5.396  0.403   1.00 0.00 ? 31 TYR A N    8  
ATOM 8131  C CA   . TYR A 1 31 ? 11.875  -6.173  -0.072  1.00 0.00 ? 31 TYR A CA   8  
ATOM 8132  C C    . TYR A 1 31 ? 11.666  -7.661  0.190   1.00 0.00 ? 31 TYR A C    8  
ATOM 8133  O O    . TYR A 1 31 ? 12.580  -8.381  0.595   1.00 0.00 ? 31 TYR A O    8  
ATOM 8134  C CB   . TYR A 1 31 ? 13.161  -5.699  0.606   1.00 0.00 ? 31 TYR A CB   8  
ATOM 8135  C CG   . TYR A 1 31 ? 13.215  -4.204  0.825   1.00 0.00 ? 31 TYR A CG   8  
ATOM 8136  C CD1  . TYR A 1 31 ? 13.150  -3.323  -0.247  1.00 0.00 ? 31 TYR A CD1  8  
ATOM 8137  C CD2  . TYR A 1 31 ? 13.333  -3.673  2.103   1.00 0.00 ? 31 TYR A CD2  8  
ATOM 8138  C CE1  . TYR A 1 31 ? 13.200  -1.956  -0.053  1.00 0.00 ? 31 TYR A CE1  8  
ATOM 8139  C CE2  . TYR A 1 31 ? 13.382  -2.308  2.308   1.00 0.00 ? 31 TYR A CE2  8  
ATOM 8140  C CZ   . TYR A 1 31 ? 13.315  -1.453  1.227   1.00 0.00 ? 31 TYR A CZ   8  
ATOM 8141  O OH   . TYR A 1 31 ? 13.365  -0.093  1.426   1.00 0.00 ? 31 TYR A OH   8  
ATOM 8142  H H    . TYR A 1 31 ? 10.384  -5.566  1.302   1.00 0.00 ? 31 TYR A H    8  
ATOM 8143  H HA   . TYR A 1 31 ? 11.962  -6.016  -1.137  1.00 0.00 ? 31 TYR A HA   8  
ATOM 8144  H HB2  . TYR A 1 31 ? 13.250  -6.178  1.569   1.00 0.00 ? 31 TYR A HB2  8  
ATOM 8145  H HB3  . TYR A 1 31 ? 14.006  -5.976  -0.007  1.00 0.00 ? 31 TYR A HB3  8  
ATOM 8146  H HD1  . TYR A 1 31 ? 13.060  -3.720  -1.248  1.00 0.00 ? 31 TYR A HD1  8  
ATOM 8147  H HD2  . TYR A 1 31 ? 13.385  -4.345  2.948   1.00 0.00 ? 31 TYR A HD2  8  
ATOM 8148  H HE1  . TYR A 1 31 ? 13.148  -1.287  -0.899  1.00 0.00 ? 31 TYR A HE1  8  
ATOM 8149  H HE2  . TYR A 1 31 ? 13.472  -1.914  3.309   1.00 0.00 ? 31 TYR A HE2  8  
ATOM 8150  H HH   . TYR A 1 31 ? 14.243  0.155   1.727   1.00 0.00 ? 31 TYR A HH   8  
ATOM 8151  N N    . PRO A 1 32 ? 10.434  -8.136  -0.046  1.00 0.00 ? 32 PRO A N    8  
ATOM 8152  C CA   . PRO A 1 32 ? 10.075  -9.542  0.156   1.00 0.00 ? 32 PRO A CA   8  
ATOM 8153  C C    . PRO A 1 32 ? 10.732  -10.461 -0.868  1.00 0.00 ? 32 PRO A C    8  
ATOM 8154  O O    . PRO A 1 32 ? 11.099  -10.028 -1.961  1.00 0.00 ? 32 PRO A O    8  
ATOM 8155  C CB   . PRO A 1 32 ? 8.554   -9.549  -0.017  1.00 0.00 ? 32 PRO A CB   8  
ATOM 8156  C CG   . PRO A 1 32 ? 8.267   -8.372  -0.883  1.00 0.00 ? 32 PRO A CG   8  
ATOM 8157  C CD   . PRO A 1 32 ? 9.297   -7.335  -0.529  1.00 0.00 ? 32 PRO A CD   8  
ATOM 8158  H HA   . PRO A 1 32 ? 10.328  -9.877  1.152   1.00 0.00 ? 32 PRO A HA   8  
ATOM 8159  H HB2  . PRO A 1 32 ? 8.247   -10.472 -0.487  1.00 0.00 ? 32 PRO A HB2  8  
ATOM 8160  H HB3  . PRO A 1 32 ? 8.078   -9.454  0.948   1.00 0.00 ? 32 PRO A HB3  8  
ATOM 8161  H HG2  . PRO A 1 32 ? 8.357   -8.651  -1.922  1.00 0.00 ? 32 PRO A HG2  8  
ATOM 8162  H HG3  . PRO A 1 32 ? 7.274   -7.999  -0.678  1.00 0.00 ? 32 PRO A HG3  8  
ATOM 8163  H HD2  . PRO A 1 32 ? 9.571   -6.763  -1.403  1.00 0.00 ? 32 PRO A HD2  8  
ATOM 8164  H HD3  . PRO A 1 32 ? 8.925   -6.685  0.249   1.00 0.00 ? 32 PRO A HD3  8  
ATOM 8165  N N    . LYS A 1 33 ? 10.876  -11.733 -0.509  1.00 0.00 ? 33 LYS A N    8  
ATOM 8166  C CA   . LYS A 1 33 ? 11.487  -12.714 -1.398  1.00 0.00 ? 33 LYS A CA   8  
ATOM 8167  C C    . LYS A 1 33 ? 10.422  -13.478 -2.179  1.00 0.00 ? 33 LYS A C    8  
ATOM 8168  O O    . LYS A 1 33 ? 9.241   -13.439 -1.837  1.00 0.00 ? 33 LYS A O    8  
ATOM 8169  C CB   . LYS A 1 33 ? 12.347  -13.694 -0.595  1.00 0.00 ? 33 LYS A CB   8  
ATOM 8170  C CG   . LYS A 1 33 ? 13.442  -13.020 0.214   1.00 0.00 ? 33 LYS A CG   8  
ATOM 8171  C CD   . LYS A 1 33 ? 14.594  -13.970 0.491   1.00 0.00 ? 33 LYS A CD   8  
ATOM 8172  C CE   . LYS A 1 33 ? 14.348  -14.794 1.746   1.00 0.00 ? 33 LYS A CE   8  
ATOM 8173  N NZ   . LYS A 1 33 ? 14.534  -13.988 2.984   1.00 0.00 ? 33 LYS A NZ   8  
ATOM 8174  H H    . LYS A 1 33 ? 10.564  -12.018 0.375   1.00 0.00 ? 33 LYS A H    8  
ATOM 8175  H HA   . LYS A 1 33 ? 12.117  -12.184 -2.095  1.00 0.00 ? 33 LYS A HA   8  
ATOM 8176  H HB2  . LYS A 1 33 ? 11.709  -14.240 0.085   1.00 0.00 ? 33 LYS A HB2  8  
ATOM 8177  H HB3  . LYS A 1 33 ? 12.810  -14.391 -1.279  1.00 0.00 ? 33 LYS A HB3  8  
ATOM 8178  H HG2  . LYS A 1 33 ? 13.815  -12.171 -0.339  1.00 0.00 ? 33 LYS A HG2  8  
ATOM 8179  H HG3  . LYS A 1 33 ? 13.028  -12.687 1.155   1.00 0.00 ? 33 LYS A HG3  8  
ATOM 8180  H HD2  . LYS A 1 33 ? 14.708  -14.640 -0.348  1.00 0.00 ? 33 LYS A HD2  8  
ATOM 8181  H HD3  . LYS A 1 33 ? 15.500  -13.395 0.621   1.00 0.00 ? 33 LYS A HD3  8  
ATOM 8182  H HE2  . LYS A 1 33 ? 13.337  -15.171 1.720   1.00 0.00 ? 33 LYS A HE2  8  
ATOM 8183  H HE3  . LYS A 1 33 ? 15.041  -15.623 1.758   1.00 0.00 ? 33 LYS A HE3  8  
ATOM 8184  H HZ1  . LYS A 1 33 ? 15.252  -14.429 3.593   1.00 0.00 ? 33 LYS A HZ1  8  
ATOM 8185  H HZ2  . LYS A 1 33 ? 13.639  -13.930 3.510   1.00 0.00 ? 33 LYS A HZ2  8  
ATOM 8186  H HZ3  . LYS A 1 33 ? 14.844  -13.026 2.741   1.00 0.00 ? 33 LYS A HZ3  8  
ATOM 8187  N N    . ASP A 1 34 ? 10.849  -14.172 -3.228  1.00 0.00 ? 34 ASP A N    8  
ATOM 8188  C CA   . ASP A 1 34 ? 9.932   -14.947 -4.056  1.00 0.00 ? 34 ASP A CA   8  
ATOM 8189  C C    . ASP A 1 34 ? 8.913   -15.685 -3.194  1.00 0.00 ? 34 ASP A C    8  
ATOM 8190  O O    . ASP A 1 34 ? 7.714   -15.660 -3.474  1.00 0.00 ? 34 ASP A O    8  
ATOM 8191  C CB   . ASP A 1 34 ? 10.708  -15.945 -4.916  1.00 0.00 ? 34 ASP A CB   8  
ATOM 8192  C CG   . ASP A 1 34 ? 11.565  -15.263 -5.965  1.00 0.00 ? 34 ASP A CG   8  
ATOM 8193  O OD1  . ASP A 1 34 ? 11.004  -14.799 -6.979  1.00 0.00 ? 34 ASP A OD1  8  
ATOM 8194  O OD2  . ASP A 1 34 ? 12.797  -15.193 -5.771  1.00 0.00 ? 34 ASP A OD2  8  
ATOM 8195  H H    . ASP A 1 34 ? 11.804  -14.164 -3.450  1.00 0.00 ? 34 ASP A H    8  
ATOM 8196  H HA   . ASP A 1 34 ? 9.408   -14.260 -4.703  1.00 0.00 ? 34 ASP A HA   8  
ATOM 8197  H HB2  . ASP A 1 34 ? 11.353  -16.535 -4.280  1.00 0.00 ? 34 ASP A HB2  8  
ATOM 8198  H HB3  . ASP A 1 34 ? 10.009  -16.598 -5.418  1.00 0.00 ? 34 ASP A HB3  8  
ATOM 8199  N N    . ASP A 1 35 ? 9.397   -16.341 -2.145  1.00 0.00 ? 35 ASP A N    8  
ATOM 8200  C CA   . ASP A 1 35 ? 8.528   -17.086 -1.242  1.00 0.00 ? 35 ASP A CA   8  
ATOM 8201  C C    . ASP A 1 35 ? 7.382   -16.211 -0.745  1.00 0.00 ? 35 ASP A C    8  
ATOM 8202  O O    . ASP A 1 35 ? 6.226   -16.632 -0.734  1.00 0.00 ? 35 ASP A O    8  
ATOM 8203  C CB   . ASP A 1 35 ? 9.330   -17.621 -0.054  1.00 0.00 ? 35 ASP A CB   8  
ATOM 8204  C CG   . ASP A 1 35 ? 8.757   -18.912 0.497   1.00 0.00 ? 35 ASP A CG   8  
ATOM 8205  O OD1  . ASP A 1 35 ? 8.738   -19.917 -0.244  1.00 0.00 ? 35 ASP A OD1  8  
ATOM 8206  O OD2  . ASP A 1 35 ? 8.328   -18.917 1.670   1.00 0.00 ? 35 ASP A OD2  8  
ATOM 8207  H H    . ASP A 1 35 ? 10.362  -16.323 -1.974  1.00 0.00 ? 35 ASP A H    8  
ATOM 8208  H HA   . ASP A 1 35 ? 8.116   -17.920 -1.790  1.00 0.00 ? 35 ASP A HA   8  
ATOM 8209  H HB2  . ASP A 1 35 ? 10.347  -17.806 -0.369  1.00 0.00 ? 35 ASP A HB2  8  
ATOM 8210  H HB3  . ASP A 1 35 ? 9.330   -16.883 0.734   1.00 0.00 ? 35 ASP A HB3  8  
ATOM 8211  N N    . GLU A 1 36 ? 7.712   -14.990 -0.333  1.00 0.00 ? 36 GLU A N    8  
ATOM 8212  C CA   . GLU A 1 36 ? 6.710   -14.057 0.167   1.00 0.00 ? 36 GLU A CA   8  
ATOM 8213  C C    . GLU A 1 36 ? 5.774   -13.612 -0.953  1.00 0.00 ? 36 GLU A C    8  
ATOM 8214  O O    . GLU A 1 36 ? 4.552   -13.675 -0.818  1.00 0.00 ? 36 GLU A O    8  
ATOM 8215  C CB   . GLU A 1 36 ? 7.386   -12.837 0.797   1.00 0.00 ? 36 GLU A CB   8  
ATOM 8216  C CG   . GLU A 1 36 ? 8.218   -13.168 2.024   1.00 0.00 ? 36 GLU A CG   8  
ATOM 8217  C CD   . GLU A 1 36 ? 7.383   -13.264 3.287   1.00 0.00 ? 36 GLU A CD   8  
ATOM 8218  O OE1  . GLU A 1 36 ? 6.661   -14.270 3.447   1.00 0.00 ? 36 GLU A OE1  8  
ATOM 8219  O OE2  . GLU A 1 36 ? 7.453   -12.331 4.115   1.00 0.00 ? 36 GLU A OE2  8  
ATOM 8220  H H    . GLU A 1 36 ? 8.651   -14.712 -0.366  1.00 0.00 ? 36 GLU A H    8  
ATOM 8221  H HA   . GLU A 1 36 ? 6.130   -14.565 0.923   1.00 0.00 ? 36 GLU A HA   8  
ATOM 8222  H HB2  . GLU A 1 36 ? 8.031   -12.379 0.062   1.00 0.00 ? 36 GLU A HB2  8  
ATOM 8223  H HB3  . GLU A 1 36 ? 6.624   -12.128 1.085   1.00 0.00 ? 36 GLU A HB3  8  
ATOM 8224  H HG2  . GLU A 1 36 ? 8.710   -14.116 1.865   1.00 0.00 ? 36 GLU A HG2  8  
ATOM 8225  H HG3  . GLU A 1 36 ? 8.961   -12.396 2.159   1.00 0.00 ? 36 GLU A HG3  8  
ATOM 8226  N N    . PHE A 1 37 ? 6.357   -13.161 -2.059  1.00 0.00 ? 37 PHE A N    8  
ATOM 8227  C CA   . PHE A 1 37 ? 5.576   -12.703 -3.202  1.00 0.00 ? 37 PHE A CA   8  
ATOM 8228  C C    . PHE A 1 37 ? 4.476   -13.704 -3.546  1.00 0.00 ? 37 PHE A C    8  
ATOM 8229  O O    . PHE A 1 37 ? 3.390   -13.322 -3.979  1.00 0.00 ? 37 PHE A O    8  
ATOM 8230  C CB   . PHE A 1 37 ? 6.485   -12.491 -4.415  1.00 0.00 ? 37 PHE A CB   8  
ATOM 8231  C CG   . PHE A 1 37 ? 7.058   -11.106 -4.500  1.00 0.00 ? 37 PHE A CG   8  
ATOM 8232  C CD1  . PHE A 1 37 ? 6.351   -10.085 -5.114  1.00 0.00 ? 37 PHE A CD1  8  
ATOM 8233  C CD2  . PHE A 1 37 ? 8.304   -10.823 -3.964  1.00 0.00 ? 37 PHE A CD2  8  
ATOM 8234  C CE1  . PHE A 1 37 ? 6.876   -8.809  -5.194  1.00 0.00 ? 37 PHE A CE1  8  
ATOM 8235  C CE2  . PHE A 1 37 ? 8.835   -9.549  -4.040  1.00 0.00 ? 37 PHE A CE2  8  
ATOM 8236  C CZ   . PHE A 1 37 ? 8.119   -8.541  -4.655  1.00 0.00 ? 37 PHE A CZ   8  
ATOM 8237  H H    . PHE A 1 37 ? 7.336   -13.135 -2.107  1.00 0.00 ? 37 PHE A H    8  
ATOM 8238  H HA   . PHE A 1 37 ? 5.120   -11.762 -2.936  1.00 0.00 ? 37 PHE A HA   8  
ATOM 8239  H HB2  . PHE A 1 37 ? 7.308   -13.188 -4.365  1.00 0.00 ? 37 PHE A HB2  8  
ATOM 8240  H HB3  . PHE A 1 37 ? 5.919   -12.673 -5.316  1.00 0.00 ? 37 PHE A HB3  8  
ATOM 8241  H HD1  . PHE A 1 37 ? 5.378   -10.293 -5.535  1.00 0.00 ? 37 PHE A HD1  8  
ATOM 8242  H HD2  . PHE A 1 37 ? 8.865   -11.612 -3.482  1.00 0.00 ? 37 PHE A HD2  8  
ATOM 8243  H HE1  . PHE A 1 37 ? 6.315   -8.023  -5.676  1.00 0.00 ? 37 PHE A HE1  8  
ATOM 8244  H HE2  . PHE A 1 37 ? 9.807   -9.343  -3.618  1.00 0.00 ? 37 PHE A HE2  8  
ATOM 8245  H HZ   . PHE A 1 37 ? 8.532   -7.545  -4.717  1.00 0.00 ? 37 PHE A HZ   8  
ATOM 8246  N N    . GLU A 1 38 ? 4.768   -14.986 -3.348  1.00 0.00 ? 38 GLU A N    8  
ATOM 8247  C CA   . GLU A 1 38 ? 3.804   -16.041 -3.638  1.00 0.00 ? 38 GLU A CA   8  
ATOM 8248  C C    . GLU A 1 38 ? 2.547   -15.877 -2.790  1.00 0.00 ? 38 GLU A C    8  
ATOM 8249  O O    . GLU A 1 38 ? 1.430   -16.043 -3.280  1.00 0.00 ? 38 GLU A O    8  
ATOM 8250  C CB   . GLU A 1 38 ? 4.428   -17.415 -3.385  1.00 0.00 ? 38 GLU A CB   8  
ATOM 8251  C CG   . GLU A 1 38 ? 5.201   -17.961 -4.574  1.00 0.00 ? 38 GLU A CG   8  
ATOM 8252  C CD   . GLU A 1 38 ? 4.297   -18.576 -5.625  1.00 0.00 ? 38 GLU A CD   8  
ATOM 8253  O OE1  . GLU A 1 38 ? 3.344   -19.288 -5.245  1.00 0.00 ? 38 GLU A OE1  8  
ATOM 8254  O OE2  . GLU A 1 38 ? 4.544   -18.346 -6.827  1.00 0.00 ? 38 GLU A OE2  8  
ATOM 8255  H H    . GLU A 1 38 ? 5.652   -15.227 -3.000  1.00 0.00 ? 38 GLU A H    8  
ATOM 8256  H HA   . GLU A 1 38 ? 3.533   -15.965 -4.680  1.00 0.00 ? 38 GLU A HA   8  
ATOM 8257  H HB2  . GLU A 1 38 ? 5.103   -17.342 -2.545  1.00 0.00 ? 38 GLU A HB2  8  
ATOM 8258  H HB3  . GLU A 1 38 ? 3.642   -18.114 -3.143  1.00 0.00 ? 38 GLU A HB3  8  
ATOM 8259  H HG2  . GLU A 1 38 ? 5.756   -17.154 -5.027  1.00 0.00 ? 38 GLU A HG2  8  
ATOM 8260  H HG3  . GLU A 1 38 ? 5.889   -18.717 -4.224  1.00 0.00 ? 38 GLU A HG3  8  
ATOM 8261  N N    . GLN A 1 39 ? 2.737   -15.552 -1.516  1.00 0.00 ? 39 GLN A N    8  
ATOM 8262  C CA   . GLN A 1 39 ? 1.619   -15.367 -0.599  1.00 0.00 ? 39 GLN A CA   8  
ATOM 8263  C C    . GLN A 1 39 ? 0.601   -14.387 -1.173  1.00 0.00 ? 39 GLN A C    8  
ATOM 8264  O O    . GLN A 1 39 ? -0.598  -14.666 -1.200  1.00 0.00 ? 39 GLN A O    8  
ATOM 8265  C CB   . GLN A 1 39 ? 2.120   -14.865 0.756   1.00 0.00 ? 39 GLN A CB   8  
ATOM 8266  C CG   . GLN A 1 39 ? 3.043   -15.844 1.464   1.00 0.00 ? 39 GLN A CG   8  
ATOM 8267  C CD   . GLN A 1 39 ? 3.082   -15.629 2.964   1.00 0.00 ? 39 GLN A CD   8  
ATOM 8268  O OE1  . GLN A 1 39 ? 2.498   -14.676 3.482   1.00 0.00 ? 39 GLN A OE1  8  
ATOM 8269  N NE2  . GLN A 1 39 ? 3.772   -16.515 3.672   1.00 0.00 ? 39 GLN A NE2  8  
ATOM 8270  H H    . GLN A 1 39 ? 3.652   -15.434 -1.184  1.00 0.00 ? 39 GLN A H    8  
ATOM 8271  H HA   . GLN A 1 39 ? 1.140   -16.325 -0.463  1.00 0.00 ? 39 GLN A HA   8  
ATOM 8272  H HB2  . GLN A 1 39 ? 2.657   -13.940 0.608   1.00 0.00 ? 39 GLN A HB2  8  
ATOM 8273  H HB3  . GLN A 1 39 ? 1.269   -14.680 1.395   1.00 0.00 ? 39 GLN A HB3  8  
ATOM 8274  H HG2  . GLN A 1 39 ? 2.698   -16.849 1.270   1.00 0.00 ? 39 GLN A HG2  8  
ATOM 8275  H HG3  . GLN A 1 39 ? 4.042   -15.725 1.072   1.00 0.00 ? 39 GLN A HG3  8  
ATOM 8276  H HE21 . GLN A 1 39 ? 4.213   -17.248 3.192   1.00 0.00 ? 39 GLN A HE21 8  
ATOM 8277  H HE22 . GLN A 1 39 ? 3.815   -16.400 4.643   1.00 0.00 ? 39 GLN A HE22 8  
ATOM 8278  N N    . LEU A 1 40 ? 1.086   -13.237 -1.629  1.00 0.00 ? 40 LEU A N    8  
ATOM 8279  C CA   . LEU A 1 40 ? 0.219   -12.214 -2.203  1.00 0.00 ? 40 LEU A CA   8  
ATOM 8280  C C    . LEU A 1 40 ? -0.306  -12.648 -3.568  1.00 0.00 ? 40 LEU A C    8  
ATOM 8281  O O    . LEU A 1 40 ? -1.485  -12.471 -3.875  1.00 0.00 ? 40 LEU A O    8  
ATOM 8282  C CB   . LEU A 1 40 ? 0.974   -10.891 -2.332  1.00 0.00 ? 40 LEU A CB   8  
ATOM 8283  C CG   . LEU A 1 40 ? 1.481   -10.277 -1.026  1.00 0.00 ? 40 LEU A CG   8  
ATOM 8284  C CD1  . LEU A 1 40 ? 2.739   -9.459  -1.273  1.00 0.00 ? 40 LEU A CD1  8  
ATOM 8285  C CD2  . LEU A 1 40 ? 0.400   -9.417  -0.386  1.00 0.00 ? 40 LEU A CD2  8  
ATOM 8286  H H    . LEU A 1 40 ? 2.051   -13.072 -1.580  1.00 0.00 ? 40 LEU A H    8  
ATOM 8287  H HA   . LEU A 1 40 ? -0.619  -12.078 -1.535  1.00 0.00 ? 40 LEU A HA   8  
ATOM 8288  H HB2  . LEU A 1 40 ? 1.827   -11.058 -2.971  1.00 0.00 ? 40 LEU A HB2  8  
ATOM 8289  H HB3  . LEU A 1 40 ? 0.311   -10.177 -2.799  1.00 0.00 ? 40 LEU A HB3  8  
ATOM 8290  H HG   . LEU A 1 40 ? 1.730   -11.071 -0.335  1.00 0.00 ? 40 LEU A HG   8  
ATOM 8291  H HD11 . LEU A 1 40 ? 2.539   -8.711  -2.026  1.00 0.00 ? 40 LEU A HD11 8  
ATOM 8292  H HD12 . LEU A 1 40 ? 3.530   -10.110 -1.613  1.00 0.00 ? 40 LEU A HD12 8  
ATOM 8293  H HD13 . LEU A 1 40 ? 3.040   -8.975  -0.356  1.00 0.00 ? 40 LEU A HD13 8  
ATOM 8294  H HD21 . LEU A 1 40 ? -0.563  -9.884  -0.531  1.00 0.00 ? 40 LEU A HD21 8  
ATOM 8295  H HD22 . LEU A 1 40 ? 0.399   -8.440  -0.847  1.00 0.00 ? 40 LEU A HD22 8  
ATOM 8296  H HD23 . LEU A 1 40 ? 0.598   -9.318  0.671   1.00 0.00 ? 40 LEU A HD23 8  
ATOM 8297  N N    . SER A 1 41 ? 0.576   -13.220 -4.381  1.00 0.00 ? 41 SER A N    8  
ATOM 8298  C CA   . SER A 1 41 ? 0.202   -13.678 -5.714  1.00 0.00 ? 41 SER A CA   8  
ATOM 8299  C C    . SER A 1 41 ? -0.914  -14.716 -5.638  1.00 0.00 ? 41 SER A C    8  
ATOM 8300  O O    . SER A 1 41 ? -1.763  -14.797 -6.525  1.00 0.00 ? 41 SER A O    8  
ATOM 8301  C CB   . SER A 1 41 ? 1.416   -14.269 -6.433  1.00 0.00 ? 41 SER A CB   8  
ATOM 8302  O OG   . SER A 1 41 ? 1.524   -15.661 -6.191  1.00 0.00 ? 41 SER A OG   8  
ATOM 8303  H H    . SER A 1 41 ? 1.501   -13.334 -4.078  1.00 0.00 ? 41 SER A H    8  
ATOM 8304  H HA   . SER A 1 41 ? -0.155  -12.824 -6.270  1.00 0.00 ? 41 SER A HA   8  
ATOM 8305  H HB2  . SER A 1 41 ? 1.316   -14.108 -7.495  1.00 0.00 ? 41 SER A HB2  8  
ATOM 8306  H HB3  . SER A 1 41 ? 2.313   -13.783 -6.077  1.00 0.00 ? 41 SER A HB3  8  
ATOM 8307  H HG   . SER A 1 41 ? 1.593   -15.818 -5.246  1.00 0.00 ? 41 SER A HG   8  
ATOM 8308  N N    . ASN A 1 42 ? -0.904  -15.509 -4.571  1.00 0.00 ? 42 ASN A N    8  
ATOM 8309  C CA   . ASN A 1 42 ? -1.914  -16.544 -4.379  1.00 0.00 ? 42 ASN A CA   8  
ATOM 8310  C C    . ASN A 1 42 ? -3.199  -15.950 -3.810  1.00 0.00 ? 42 ASN A C    8  
ATOM 8311  O O    . ASN A 1 42 ? -4.300  -16.401 -4.130  1.00 0.00 ? 42 ASN A O    8  
ATOM 8312  C CB   . ASN A 1 42 ? -1.386  -17.634 -3.444  1.00 0.00 ? 42 ASN A CB   8  
ATOM 8313  C CG   . ASN A 1 42 ? -0.511  -18.640 -4.166  1.00 0.00 ? 42 ASN A CG   8  
ATOM 8314  O OD1  . ASN A 1 42 ? -0.946  -19.286 -5.120  1.00 0.00 ? 42 ASN A OD1  8  
ATOM 8315  N ND2  . ASN A 1 42 ? 0.729   -18.779 -3.713  1.00 0.00 ? 42 ASN A ND2  8  
ATOM 8316  H H    . ASN A 1 42 ? -0.201  -15.397 -3.898  1.00 0.00 ? 42 ASN A H    8  
ATOM 8317  H HA   . ASN A 1 42 ? -2.129  -16.981 -5.342  1.00 0.00 ? 42 ASN A HA   8  
ATOM 8318  H HB2  . ASN A 1 42 ? -0.801  -17.175 -2.660  1.00 0.00 ? 42 ASN A HB2  8  
ATOM 8319  H HB3  . ASN A 1 42 ? -2.220  -18.159 -3.005  1.00 0.00 ? 42 ASN A HB3  8  
ATOM 8320  H HD21 . ASN A 1 42 ? 1.007   -18.232 -2.948  1.00 0.00 ? 42 ASN A HD21 8  
ATOM 8321  H HD22 . ASN A 1 42 ? 1.317   -19.422 -4.162  1.00 0.00 ? 42 ASN A HD22 8  
ATOM 8322  N N    . LEU A 1 43 ? -3.052  -14.935 -2.965  1.00 0.00 ? 43 LEU A N    8  
ATOM 8323  C CA   . LEU A 1 43 ? -4.201  -14.278 -2.352  1.00 0.00 ? 43 LEU A CA   8  
ATOM 8324  C C    . LEU A 1 43 ? -4.976  -13.462 -3.382  1.00 0.00 ? 43 LEU A C    8  
ATOM 8325  O O    . LEU A 1 43 ? -6.166  -13.693 -3.605  1.00 0.00 ? 43 LEU A O    8  
ATOM 8326  C CB   . LEU A 1 43 ? -3.744  -13.372 -1.207  1.00 0.00 ? 43 LEU A CB   8  
ATOM 8327  C CG   . LEU A 1 43 ? -4.748  -12.315 -0.745  1.00 0.00 ? 43 LEU A CG   8  
ATOM 8328  C CD1  . LEU A 1 43 ? -6.057  -12.968 -0.329  1.00 0.00 ? 43 LEU A CD1  8  
ATOM 8329  C CD2  . LEU A 1 43 ? -4.171  -11.495 0.399   1.00 0.00 ? 43 LEU A CD2  8  
ATOM 8330  H H    . LEU A 1 43 ? -2.151  -14.620 -2.749  1.00 0.00 ? 43 LEU A H    8  
ATOM 8331  H HA   . LEU A 1 43 ? -4.850  -15.045 -1.956  1.00 0.00 ? 43 LEU A HA   8  
ATOM 8332  H HB2  . LEU A 1 43 ? -3.513  -14.000 -0.361  1.00 0.00 ? 43 LEU A HB2  8  
ATOM 8333  H HB3  . LEU A 1 43 ? -2.848  -12.860 -1.529  1.00 0.00 ? 43 LEU A HB3  8  
ATOM 8334  H HG   . LEU A 1 43 ? -4.958  -11.644 -1.567  1.00 0.00 ? 43 LEU A HG   8  
ATOM 8335  H HD11 . LEU A 1 43 ? -6.768  -12.205 -0.052  1.00 0.00 ? 43 LEU A HD11 8  
ATOM 8336  H HD12 . LEU A 1 43 ? -5.881  -13.620 0.515   1.00 0.00 ? 43 LEU A HD12 8  
ATOM 8337  H HD13 . LEU A 1 43 ? -6.450  -13.545 -1.153  1.00 0.00 ? 43 LEU A HD13 8  
ATOM 8338  H HD21 . LEU A 1 43 ? -3.101  -11.636 0.438   1.00 0.00 ? 43 LEU A HD21 8  
ATOM 8339  H HD22 . LEU A 1 43 ? -4.611  -11.819 1.331   1.00 0.00 ? 43 LEU A HD22 8  
ATOM 8340  H HD23 . LEU A 1 43 ? -4.391  -10.450 0.240   1.00 0.00 ? 43 LEU A HD23 8  
ATOM 8341  N N    . LEU A 1 44 ? -4.295  -12.510 -4.009  1.00 0.00 ? 44 LEU A N    8  
ATOM 8342  C CA   . LEU A 1 44 ? -4.919  -11.661 -5.018  1.00 0.00 ? 44 LEU A CA   8  
ATOM 8343  C C    . LEU A 1 44 ? -5.107  -12.420 -6.328  1.00 0.00 ? 44 LEU A C    8  
ATOM 8344  O O    . LEU A 1 44 ? -5.803  -11.958 -7.230  1.00 0.00 ? 44 LEU A O    8  
ATOM 8345  C CB   . LEU A 1 44 ? -4.070  -10.411 -5.258  1.00 0.00 ? 44 LEU A CB   8  
ATOM 8346  C CG   . LEU A 1 44 ? -3.744  -9.574  -4.020  1.00 0.00 ? 44 LEU A CG   8  
ATOM 8347  C CD1  . LEU A 1 44 ? -2.685  -8.532  -4.344  1.00 0.00 ? 44 LEU A CD1  8  
ATOM 8348  C CD2  . LEU A 1 44 ? -5.002  -8.909  -3.480  1.00 0.00 ? 44 LEU A CD2  8  
ATOM 8349  H H    . LEU A 1 44 ? -3.350  -12.373 -3.789  1.00 0.00 ? 44 LEU A H    8  
ATOM 8350  H HA   . LEU A 1 44 ? -5.888  -11.362 -4.647  1.00 0.00 ? 44 LEU A HA   8  
ATOM 8351  H HB2  . LEU A 1 44 ? -3.136  -10.725 -5.699  1.00 0.00 ? 44 LEU A HB2  8  
ATOM 8352  H HB3  . LEU A 1 44 ? -4.601  -9.780  -5.955  1.00 0.00 ? 44 LEU A HB3  8  
ATOM 8353  H HG   . LEU A 1 44 ? -3.349  -10.221 -3.249  1.00 0.00 ? 44 LEU A HG   8  
ATOM 8354  H HD11 . LEU A 1 44 ? -2.845  -8.155  -5.343  1.00 0.00 ? 44 LEU A HD11 8  
ATOM 8355  H HD12 . LEU A 1 44 ? -1.706  -8.982  -4.281  1.00 0.00 ? 44 LEU A HD12 8  
ATOM 8356  H HD13 . LEU A 1 44 ? -2.753  -7.718  -3.637  1.00 0.00 ? 44 LEU A HD13 8  
ATOM 8357  H HD21 . LEU A 1 44 ? -5.605  -8.559  -4.305  1.00 0.00 ? 44 LEU A HD21 8  
ATOM 8358  H HD22 . LEU A 1 44 ? -4.726  -8.072  -2.855  1.00 0.00 ? 44 LEU A HD22 8  
ATOM 8359  H HD23 . LEU A 1 44 ? -5.565  -9.623  -2.899  1.00 0.00 ? 44 LEU A HD23 8  
ATOM 8360  N N    . ASN A 1 45 ? -4.482  -13.590 -6.423  1.00 0.00 ? 45 ASN A N    8  
ATOM 8361  C CA   . ASN A 1 45 ? -4.582  -14.415 -7.621  1.00 0.00 ? 45 ASN A CA   8  
ATOM 8362  C C    . ASN A 1 45 ? -3.944  -13.715 -8.818  1.00 0.00 ? 45 ASN A C    8  
ATOM 8363  O O    . ASN A 1 45 ? -4.384  -13.882 -9.956  1.00 0.00 ? 45 ASN A O    8  
ATOM 8364  C CB   . ASN A 1 45 ? -6.047  -14.734 -7.925  1.00 0.00 ? 45 ASN A CB   8  
ATOM 8365  C CG   . ASN A 1 45 ? -6.208  -16.022 -8.709  1.00 0.00 ? 45 ASN A CG   8  
ATOM 8366  O OD1  . ASN A 1 45 ? -5.715  -17.074 -8.302  1.00 0.00 ? 45 ASN A OD1  8  
ATOM 8367  N ND2  . ASN A 1 45 ? -6.900  -15.944 -9.840  1.00 0.00 ? 45 ASN A ND2  8  
ATOM 8368  H H    . ASN A 1 45 ? -3.941  -13.906 -5.669  1.00 0.00 ? 45 ASN A H    8  
ATOM 8369  H HA   . ASN A 1 45 ? -4.054  -15.337 -7.434  1.00 0.00 ? 45 ASN A HA   8  
ATOM 8370  H HB2  . ASN A 1 45 ? -6.589  -14.831 -6.995  1.00 0.00 ? 45 ASN A HB2  8  
ATOM 8371  H HB3  . ASN A 1 45 ? -6.474  -13.927 -8.502  1.00 0.00 ? 45 ASN A HB3  8  
ATOM 8372  H HD21 . ASN A 1 45 ? -7.264  -15.072 -10.101 1.00 0.00 ? 45 ASN A HD21 8  
ATOM 8373  H HD22 . ASN A 1 45 ? -7.020  -16.762 -10.366 1.00 0.00 ? 45 ASN A HD22 8  
ATOM 8374  N N    . LEU A 1 46 ? -2.903  -12.933 -8.552  1.00 0.00 ? 46 LEU A N    8  
ATOM 8375  C CA   . LEU A 1 46 ? -2.203  -12.208 -9.607  1.00 0.00 ? 46 LEU A CA   8  
ATOM 8376  C C    . LEU A 1 46 ? -0.791  -12.753 -9.796  1.00 0.00 ? 46 LEU A C    8  
ATOM 8377  O O    . LEU A 1 46 ? -0.185  -13.308 -8.879  1.00 0.00 ? 46 LEU A O    8  
ATOM 8378  C CB   . LEU A 1 46 ? -2.145  -10.716 -9.276  1.00 0.00 ? 46 LEU A CB   8  
ATOM 8379  C CG   . LEU A 1 46 ? -3.491  -9.995  -9.191  1.00 0.00 ? 46 LEU A CG   8  
ATOM 8380  C CD1  . LEU A 1 46 ? -3.324  -8.625  -8.554  1.00 0.00 ? 46 LEU A CD1  8  
ATOM 8381  C CD2  . LEU A 1 46 ? -4.116  -9.870  -10.573 1.00 0.00 ? 46 LEU A CD2  8  
ATOM 8382  H H    . LEU A 1 46 ? -2.598  -12.840 -7.626  1.00 0.00 ? 46 LEU A H    8  
ATOM 8383  H HA   . LEU A 1 46 ? -2.754  -12.344 -10.525 1.00 0.00 ? 46 LEU A HA   8  
ATOM 8384  H HB2  . LEU A 1 46 ? -1.652  -10.608 -8.322  1.00 0.00 ? 46 LEU A HB2  8  
ATOM 8385  H HB3  . LEU A 1 46 ? -1.556  -10.231 -10.041 1.00 0.00 ? 46 LEU A HB3  8  
ATOM 8386  H HG   . LEU A 1 46 ? -4.163  -10.572 -8.570  1.00 0.00 ? 46 LEU A HG   8  
ATOM 8387  H HD11 . LEU A 1 46 ? -2.320  -8.526  -8.170  1.00 0.00 ? 46 LEU A HD11 8  
ATOM 8388  H HD12 . LEU A 1 46 ? -4.031  -8.515  -7.745  1.00 0.00 ? 46 LEU A HD12 8  
ATOM 8389  H HD13 . LEU A 1 46 ? -3.503  -7.859  -9.294  1.00 0.00 ? 46 LEU A HD13 8  
ATOM 8390  H HD21 . LEU A 1 46 ? -4.189  -10.848 -11.025 1.00 0.00 ? 46 LEU A HD21 8  
ATOM 8391  H HD22 . LEU A 1 46 ? -3.500  -9.233  -11.191 1.00 0.00 ? 46 LEU A HD22 8  
ATOM 8392  H HD23 . LEU A 1 46 ? -5.103  -9.440  -10.484 1.00 0.00 ? 46 LEU A HD23 8  
ATOM 8393  N N    . PRO A 1 47 ? -0.252  -12.591 -11.014 1.00 0.00 ? 47 PRO A N    8  
ATOM 8394  C CA   . PRO A 1 47 ? 1.096   -13.057 -11.351 1.00 0.00 ? 47 PRO A CA   8  
ATOM 8395  C C    . PRO A 1 47 ? 2.182   -12.244 -10.654 1.00 0.00 ? 47 PRO A C    8  
ATOM 8396  O O    . PRO A 1 47 ? 2.183   -11.014 -10.707 1.00 0.00 ? 47 PRO A O    8  
ATOM 8397  C CB   . PRO A 1 47 ? 1.171   -12.859 -12.867 1.00 0.00 ? 47 PRO A CB   8  
ATOM 8398  C CG   . PRO A 1 47 ? 0.192   -11.774 -13.156 1.00 0.00 ? 47 PRO A CG   8  
ATOM 8399  C CD   . PRO A 1 47 ? -0.917  -11.938 -12.154 1.00 0.00 ? 47 PRO A CD   8  
ATOM 8400  H HA   . PRO A 1 47 ? 1.225   -14.103 -11.116 1.00 0.00 ? 47 PRO A HA   8  
ATOM 8401  H HB2  . PRO A 1 47 ? 2.175   -12.572 -13.147 1.00 0.00 ? 47 PRO A HB2  8  
ATOM 8402  H HB3  . PRO A 1 47 ? 0.901   -13.777 -13.367 1.00 0.00 ? 47 PRO A HB3  8  
ATOM 8403  H HG2  . PRO A 1 47 ? 0.666   -10.811 -13.037 1.00 0.00 ? 47 PRO A HG2  8  
ATOM 8404  H HG3  . PRO A 1 47 ? -0.191  -11.883 -14.160 1.00 0.00 ? 47 PRO A HG3  8  
ATOM 8405  H HD2  . PRO A 1 47 ? -1.314  -10.975 -11.870 1.00 0.00 ? 47 PRO A HD2  8  
ATOM 8406  H HD3  . PRO A 1 47 ? -1.698  -12.567 -12.555 1.00 0.00 ? 47 PRO A HD3  8  
ATOM 8407  N N    . THR A 1 48 ? 3.109   -12.940 -10.002 1.00 0.00 ? 48 THR A N    8  
ATOM 8408  C CA   . THR A 1 48 ? 4.200   -12.283 -9.294  1.00 0.00 ? 48 THR A CA   8  
ATOM 8409  C C    . THR A 1 48 ? 4.804   -11.163 -10.133 1.00 0.00 ? 48 THR A C    8  
ATOM 8410  O O    . THR A 1 48 ? 5.108   -10.086 -9.621  1.00 0.00 ? 48 THR A O    8  
ATOM 8411  C CB   . THR A 1 48 ? 5.309   -13.284 -8.918  1.00 0.00 ? 48 THR A CB   8  
ATOM 8412  O OG1  . THR A 1 48 ? 5.475   -14.247 -9.965  1.00 0.00 ? 48 THR A OG1  8  
ATOM 8413  C CG2  . THR A 1 48 ? 4.978   -13.996 -7.616  1.00 0.00 ? 48 THR A CG2  8  
ATOM 8414  H H    . THR A 1 48 ? 3.055   -13.918 -9.996  1.00 0.00 ? 48 THR A H    8  
ATOM 8415  H HA   . THR A 1 48 ? 3.801   -11.862 -8.382  1.00 0.00 ? 48 THR A HA   8  
ATOM 8416  H HB   . THR A 1 48 ? 6.235   -12.741 -8.789  1.00 0.00 ? 48 THR A HB   8  
ATOM 8417  H HG1  . THR A 1 48 ? 6.077   -13.899 -10.628 1.00 0.00 ? 48 THR A HG1  8  
ATOM 8418  H HG21 . THR A 1 48 ? 5.880   -14.411 -7.192  1.00 0.00 ? 48 THR A HG21 8  
ATOM 8419  H HG22 . THR A 1 48 ? 4.272   -14.790 -7.809  1.00 0.00 ? 48 THR A HG22 8  
ATOM 8420  H HG23 . THR A 1 48 ? 4.546   -13.291 -6.921  1.00 0.00 ? 48 THR A HG23 8  
ATOM 8421  N N    . ARG A 1 49 ? 4.976   -11.424 -11.425 1.00 0.00 ? 49 ARG A N    8  
ATOM 8422  C CA   . ARG A 1 49 ? 5.545   -10.438 -12.335 1.00 0.00 ? 49 ARG A CA   8  
ATOM 8423  C C    . ARG A 1 49 ? 4.825   -9.098  -12.203 1.00 0.00 ? 49 ARG A C    8  
ATOM 8424  O O    . ARG A 1 49 ? 5.443   -8.038  -12.301 1.00 0.00 ? 49 ARG A O    8  
ATOM 8425  C CB   . ARG A 1 49 ? 5.459   -10.935 -13.779 1.00 0.00 ? 49 ARG A CB   8  
ATOM 8426  C CG   . ARG A 1 49 ? 4.107   -10.691 -14.428 1.00 0.00 ? 49 ARG A CG   8  
ATOM 8427  C CD   . ARG A 1 49 ? 4.064   -9.345  -15.135 1.00 0.00 ? 49 ARG A CD   8  
ATOM 8428  N NE   . ARG A 1 49 ? 4.875   -9.339  -16.350 1.00 0.00 ? 49 ARG A NE   8  
ATOM 8429  C CZ   . ARG A 1 49 ? 4.436   -9.766  -17.529 1.00 0.00 ? 49 ARG A CZ   8  
ATOM 8430  N NH1  . ARG A 1 49 ? 3.199   -10.230 -17.651 1.00 0.00 ? 49 ARG A NH1  8  
ATOM 8431  N NH2  . ARG A 1 49 ? 5.233   -9.729  -18.588 1.00 0.00 ? 49 ARG A NH2  8  
ATOM 8432  H H    . ARG A 1 49 ? 4.714   -12.302 -11.774 1.00 0.00 ? 49 ARG A H    8  
ATOM 8433  H HA   . ARG A 1 49 ? 6.583   -10.303 -12.071 1.00 0.00 ? 49 ARG A HA   8  
ATOM 8434  H HB2  . ARG A 1 49 ? 6.212   -10.431 -14.366 1.00 0.00 ? 49 ARG A HB2  8  
ATOM 8435  H HB3  . ARG A 1 49 ? 5.654   -11.997 -13.793 1.00 0.00 ? 49 ARG A HB3  8  
ATOM 8436  H HG2  . ARG A 1 49 ? 3.918   -11.471 -15.151 1.00 0.00 ? 49 ARG A HG2  8  
ATOM 8437  H HG3  . ARG A 1 49 ? 3.343   -10.711 -13.665 1.00 0.00 ? 49 ARG A HG3  8  
ATOM 8438  H HD2  . ARG A 1 49 ? 3.040   -9.123  -15.397 1.00 0.00 ? 49 ARG A HD2  8  
ATOM 8439  H HD3  . ARG A 1 49 ? 4.435   -8.588  -14.462 1.00 0.00 ? 49 ARG A HD3  8  
ATOM 8440  H HE   . ARG A 1 49 ? 5.791   -9.001  -16.282 1.00 0.00 ? 49 ARG A HE   8  
ATOM 8441  H HH11 . ARG A 1 49 ? 2.596   -10.258 -16.855 1.00 0.00 ? 49 ARG A HH11 8  
ATOM 8442  H HH12 . ARG A 1 49 ? 2.871   -10.549 -18.541 1.00 0.00 ? 49 ARG A HH12 8  
ATOM 8443  H HH21 . ARG A 1 49 ? 6.166   -9.380  -18.500 1.00 0.00 ? 49 ARG A HH21 8  
ATOM 8444  H HH22 . ARG A 1 49 ? 4.902   -10.050 -19.475 1.00 0.00 ? 49 ARG A HH22 8  
ATOM 8445  N N    . VAL A 1 50 ? 3.516   -9.155  -11.982 1.00 0.00 ? 50 VAL A N    8  
ATOM 8446  C CA   . VAL A 1 50 ? 2.712   -7.947  -11.837 1.00 0.00 ? 50 VAL A CA   8  
ATOM 8447  C C    . VAL A 1 50 ? 2.944   -7.293  -10.479 1.00 0.00 ? 50 VAL A C    8  
ATOM 8448  O O    . VAL A 1 50 ? 3.034   -6.069  -10.377 1.00 0.00 ? 50 VAL A O    8  
ATOM 8449  C CB   . VAL A 1 50 ? 1.211   -8.250  -11.998 1.00 0.00 ? 50 VAL A CB   8  
ATOM 8450  C CG1  . VAL A 1 50 ? 0.373   -7.129  -11.402 1.00 0.00 ? 50 VAL A CG1  8  
ATOM 8451  C CG2  . VAL A 1 50 ? 0.865   -8.462  -13.465 1.00 0.00 ? 50 VAL A CG2  8  
ATOM 8452  H H    . VAL A 1 50 ? 3.080   -10.030 -11.914 1.00 0.00 ? 50 VAL A H    8  
ATOM 8453  H HA   . VAL A 1 50 ? 3.005   -7.256  -12.614 1.00 0.00 ? 50 VAL A HA   8  
ATOM 8454  H HB   . VAL A 1 50 ? 0.987   -9.160  -11.462 1.00 0.00 ? 50 VAL A HB   8  
ATOM 8455  H HG11 . VAL A 1 50 ? -0.486  -6.948  -12.031 1.00 0.00 ? 50 VAL A HG11 8  
ATOM 8456  H HG12 . VAL A 1 50 ? 0.043   -7.412  -10.413 1.00 0.00 ? 50 VAL A HG12 8  
ATOM 8457  H HG13 . VAL A 1 50 ? 0.967   -6.229  -11.339 1.00 0.00 ? 50 VAL A HG13 8  
ATOM 8458  H HG21 . VAL A 1 50 ? 0.765   -7.504  -13.952 1.00 0.00 ? 50 VAL A HG21 8  
ATOM 8459  H HG22 . VAL A 1 50 ? 1.652   -9.028  -13.942 1.00 0.00 ? 50 VAL A HG22 8  
ATOM 8460  H HG23 . VAL A 1 50 ? -0.065  -9.005  -13.541 1.00 0.00 ? 50 VAL A HG23 8  
ATOM 8461  N N    . ILE A 1 51 ? 3.041   -8.116  -9.441  1.00 0.00 ? 51 ILE A N    8  
ATOM 8462  C CA   . ILE A 1 51 ? 3.264   -7.616  -8.090  1.00 0.00 ? 51 ILE A CA   8  
ATOM 8463  C C    . ILE A 1 51 ? 4.674   -7.055  -7.937  1.00 0.00 ? 51 ILE A C    8  
ATOM 8464  O O    . ILE A 1 51 ? 4.907   -6.139  -7.148  1.00 0.00 ? 51 ILE A O    8  
ATOM 8465  C CB   . ILE A 1 51 ? 3.047   -8.721  -7.038  1.00 0.00 ? 51 ILE A CB   8  
ATOM 8466  C CG1  . ILE A 1 51 ? 1.730   -9.454  -7.302  1.00 0.00 ? 51 ILE A CG1  8  
ATOM 8467  C CG2  . ILE A 1 51 ? 3.058   -8.128  -5.637  1.00 0.00 ? 51 ILE A CG2  8  
ATOM 8468  C CD1  . ILE A 1 51 ? 1.560   -10.708 -6.473  1.00 0.00 ? 51 ILE A CD1  8  
ATOM 8469  H H    . ILE A 1 51 ? 2.961   -9.081  -9.586  1.00 0.00 ? 51 ILE A H    8  
ATOM 8470  H HA   . ILE A 1 51 ? 2.551   -6.826  -7.904  1.00 0.00 ? 51 ILE A HA   8  
ATOM 8471  H HB   . ILE A 1 51 ? 3.863   -9.423  -7.112  1.00 0.00 ? 51 ILE A HB   8  
ATOM 8472  H HG12 . ILE A 1 51 ? 0.907   -8.795  -7.077  1.00 0.00 ? 51 ILE A HG12 8  
ATOM 8473  H HG13 . ILE A 1 51 ? 1.686   -9.736  -8.344  1.00 0.00 ? 51 ILE A HG13 8  
ATOM 8474  H HG21 . ILE A 1 51 ? 4.079   -8.009  -5.305  1.00 0.00 ? 51 ILE A HG21 8  
ATOM 8475  H HG22 . ILE A 1 51 ? 2.570   -7.165  -5.650  1.00 0.00 ? 51 ILE A HG22 8  
ATOM 8476  H HG23 . ILE A 1 51 ? 2.534   -8.788  -4.962  1.00 0.00 ? 51 ILE A HG23 8  
ATOM 8477  H HD11 . ILE A 1 51 ? 1.836   -11.570 -7.063  1.00 0.00 ? 51 ILE A HD11 8  
ATOM 8478  H HD12 . ILE A 1 51 ? 2.192   -10.651 -5.600  1.00 0.00 ? 51 ILE A HD12 8  
ATOM 8479  H HD13 . ILE A 1 51 ? 0.529   -10.799 -6.165  1.00 0.00 ? 51 ILE A HD13 8  
ATOM 8480  N N    . VAL A 1 52 ? 5.611   -7.609  -8.699  1.00 0.00 ? 52 VAL A N    8  
ATOM 8481  C CA   . VAL A 1 52 ? 6.998   -7.162  -8.651  1.00 0.00 ? 52 VAL A CA   8  
ATOM 8482  C C    . VAL A 1 52 ? 7.145   -5.762  -9.236  1.00 0.00 ? 52 VAL A C    8  
ATOM 8483  O O    . VAL A 1 52 ? 7.692   -4.864  -8.596  1.00 0.00 ? 52 VAL A O    8  
ATOM 8484  C CB   . VAL A 1 52 ? 7.925   -8.126  -9.416  1.00 0.00 ? 52 VAL A CB   8  
ATOM 8485  C CG1  . VAL A 1 52 ? 9.348   -7.588  -9.445  1.00 0.00 ? 52 VAL A CG1  8  
ATOM 8486  C CG2  . VAL A 1 52 ? 7.883   -9.513  -8.792  1.00 0.00 ? 52 VAL A CG2  8  
ATOM 8487  H H    . VAL A 1 52 ? 5.364   -8.335  -9.309  1.00 0.00 ? 52 VAL A H    8  
ATOM 8488  H HA   . VAL A 1 52 ? 7.308   -7.144  -7.616  1.00 0.00 ? 52 VAL A HA   8  
ATOM 8489  H HB   . VAL A 1 52 ? 7.572   -8.201  -10.434 1.00 0.00 ? 52 VAL A HB   8  
ATOM 8490  H HG11 . VAL A 1 52 ? 9.906   -8.091  -10.221 1.00 0.00 ? 52 VAL A HG11 8  
ATOM 8491  H HG12 . VAL A 1 52 ? 9.328   -6.527  -9.643  1.00 0.00 ? 52 VAL A HG12 8  
ATOM 8492  H HG13 . VAL A 1 52 ? 9.819   -7.767  -8.489  1.00 0.00 ? 52 VAL A HG13 8  
ATOM 8493  H HG21 . VAL A 1 52 ? 7.437   -9.451  -7.811  1.00 0.00 ? 52 VAL A HG21 8  
ATOM 8494  H HG22 . VAL A 1 52 ? 7.293   -10.170 -9.415  1.00 0.00 ? 52 VAL A HG22 8  
ATOM 8495  H HG23 . VAL A 1 52 ? 8.887   -9.901  -8.709  1.00 0.00 ? 52 VAL A HG23 8  
ATOM 8496  N N    . VAL A 1 53 ? 6.651   -5.582  -10.457 1.00 0.00 ? 53 VAL A N    8  
ATOM 8497  C CA   . VAL A 1 53 ? 6.725   -4.290  -11.129 1.00 0.00 ? 53 VAL A CA   8  
ATOM 8498  C C    . VAL A 1 53 ? 6.109   -3.189  -10.273 1.00 0.00 ? 53 VAL A C    8  
ATOM 8499  O O    . VAL A 1 53 ? 6.613   -2.068  -10.229 1.00 0.00 ? 53 VAL A O    8  
ATOM 8500  C CB   . VAL A 1 53 ? 6.012   -4.325  -12.494 1.00 0.00 ? 53 VAL A CB   8  
ATOM 8501  C CG1  . VAL A 1 53 ? 6.056   -2.956  -13.155 1.00 0.00 ? 53 VAL A CG1  8  
ATOM 8502  C CG2  . VAL A 1 53 ? 6.635   -5.381  -13.393 1.00 0.00 ? 53 VAL A CG2  8  
ATOM 8503  H H    . VAL A 1 53 ? 6.226   -6.336  -10.917 1.00 0.00 ? 53 VAL A H    8  
ATOM 8504  H HA   . VAL A 1 53 ? 7.768   -4.061  -11.297 1.00 0.00 ? 53 VAL A HA   8  
ATOM 8505  H HB   . VAL A 1 53 ? 4.977   -4.588  -12.329 1.00 0.00 ? 53 VAL A HB   8  
ATOM 8506  H HG11 . VAL A 1 53 ? 5.155   -2.412  -12.914 1.00 0.00 ? 53 VAL A HG11 8  
ATOM 8507  H HG12 . VAL A 1 53 ? 6.915   -2.410  -12.795 1.00 0.00 ? 53 VAL A HG12 8  
ATOM 8508  H HG13 . VAL A 1 53 ? 6.128   -3.076  -14.226 1.00 0.00 ? 53 VAL A HG13 8  
ATOM 8509  H HG21 . VAL A 1 53 ? 7.515   -5.787  -12.915 1.00 0.00 ? 53 VAL A HG21 8  
ATOM 8510  H HG22 . VAL A 1 53 ? 5.922   -6.174  -13.567 1.00 0.00 ? 53 VAL A HG22 8  
ATOM 8511  H HG23 . VAL A 1 53 ? 6.912   -4.934  -14.336 1.00 0.00 ? 53 VAL A HG23 8  
ATOM 8512  N N    . TRP A 1 54 ? 5.015   -3.518  -9.596  1.00 0.00 ? 54 TRP A N    8  
ATOM 8513  C CA   . TRP A 1 54 ? 4.329   -2.557  -8.740  1.00 0.00 ? 54 TRP A CA   8  
ATOM 8514  C C    . TRP A 1 54 ? 5.166   -2.230  -7.508  1.00 0.00 ? 54 TRP A C    8  
ATOM 8515  O O    . TRP A 1 54 ? 5.330   -1.064  -7.149  1.00 0.00 ? 54 TRP A O    8  
ATOM 8516  C CB   . TRP A 1 54 ? 2.965   -3.104  -8.315  1.00 0.00 ? 54 TRP A CB   8  
ATOM 8517  C CG   . TRP A 1 54 ? 2.152   -2.124  -7.525  1.00 0.00 ? 54 TRP A CG   8  
ATOM 8518  C CD1  . TRP A 1 54 ? 1.090   -1.390  -7.973  1.00 0.00 ? 54 TRP A CD1  8  
ATOM 8519  C CD2  . TRP A 1 54 ? 2.336   -1.768  -6.150  1.00 0.00 ? 54 TRP A CD2  8  
ATOM 8520  N NE1  . TRP A 1 54 ? 0.603   -0.601  -6.959  1.00 0.00 ? 54 TRP A NE1  8  
ATOM 8521  C CE2  . TRP A 1 54 ? 1.349   -0.815  -5.831  1.00 0.00 ? 54 TRP A CE2  8  
ATOM 8522  C CE3  . TRP A 1 54 ? 3.236   -2.164  -5.157  1.00 0.00 ? 54 TRP A CE3  8  
ATOM 8523  C CZ2  . TRP A 1 54 ? 1.241   -0.253  -4.562  1.00 0.00 ? 54 TRP A CZ2  8  
ATOM 8524  C CZ3  . TRP A 1 54 ? 3.127   -1.605  -3.898  1.00 0.00 ? 54 TRP A CZ3  8  
ATOM 8525  C CH2  . TRP A 1 54 ? 2.135   -0.659  -3.609  1.00 0.00 ? 54 TRP A CH2  8  
ATOM 8526  H H    . TRP A 1 54 ? 4.660   -4.429  -9.672  1.00 0.00 ? 54 TRP A H    8  
ATOM 8527  H HA   . TRP A 1 54 ? 4.181   -1.652  -9.311  1.00 0.00 ? 54 TRP A HA   8  
ATOM 8528  H HB2  . TRP A 1 54 ? 2.401   -3.372  -9.195  1.00 0.00 ? 54 TRP A HB2  8  
ATOM 8529  H HB3  . TRP A 1 54 ? 3.113   -3.983  -7.705  1.00 0.00 ? 54 TRP A HB3  8  
ATOM 8530  H HD1  . TRP A 1 54 ? 0.703   -1.434  -8.979  1.00 0.00 ? 54 TRP A HD1  8  
ATOM 8531  H HE1  . TRP A 1 54 ? -0.157  0.014   -7.033  1.00 0.00 ? 54 TRP A HE1  8  
ATOM 8532  H HE3  . TRP A 1 54 ? 4.007   -2.893  -5.361  1.00 0.00 ? 54 TRP A HE3  8  
ATOM 8533  H HZ2  . TRP A 1 54 ? 0.481   0.477   -4.323  1.00 0.00 ? 54 TRP A HZ2  8  
ATOM 8534  H HZ3  . TRP A 1 54 ? 3.815   -1.899  -3.118  1.00 0.00 ? 54 TRP A HZ3  8  
ATOM 8535  H HH2  . TRP A 1 54 ? 2.088   -0.248  -2.612  1.00 0.00 ? 54 TRP A HH2  8  
ATOM 8536  N N    . PHE A 1 55 ? 5.692   -3.266  -6.864  1.00 0.00 ? 55 PHE A N    8  
ATOM 8537  C CA   . PHE A 1 55 ? 6.512   -3.088  -5.671  1.00 0.00 ? 55 PHE A CA   8  
ATOM 8538  C C    . PHE A 1 55 ? 7.798   -2.335  -6.002  1.00 0.00 ? 55 PHE A C    8  
ATOM 8539  O O    . PHE A 1 55 ? 8.261   -1.505  -5.221  1.00 0.00 ? 55 PHE A O    8  
ATOM 8540  C CB   . PHE A 1 55 ? 6.848   -4.446  -5.050  1.00 0.00 ? 55 PHE A CB   8  
ATOM 8541  C CG   . PHE A 1 55 ? 5.850   -4.898  -4.023  1.00 0.00 ? 55 PHE A CG   8  
ATOM 8542  C CD1  . PHE A 1 55 ? 4.530   -5.129  -4.374  1.00 0.00 ? 55 PHE A CD1  8  
ATOM 8543  C CD2  . PHE A 1 55 ? 6.232   -5.092  -2.705  1.00 0.00 ? 55 PHE A CD2  8  
ATOM 8544  C CE1  . PHE A 1 55 ? 3.610   -5.546  -3.432  1.00 0.00 ? 55 PHE A CE1  8  
ATOM 8545  C CE2  . PHE A 1 55 ? 5.316   -5.510  -1.758  1.00 0.00 ? 55 PHE A CE2  8  
ATOM 8546  C CZ   . PHE A 1 55 ? 4.003   -5.736  -2.121  1.00 0.00 ? 55 PHE A CZ   8  
ATOM 8547  H H    . PHE A 1 55 ? 5.525   -4.172  -7.199  1.00 0.00 ? 55 PHE A H    8  
ATOM 8548  H HA   . PHE A 1 55 ? 5.942   -2.508  -4.962  1.00 0.00 ? 55 PHE A HA   8  
ATOM 8549  H HB2  . PHE A 1 55 ? 6.882   -5.192  -5.830  1.00 0.00 ? 55 PHE A HB2  8  
ATOM 8550  H HB3  . PHE A 1 55 ? 7.814   -4.385  -4.572  1.00 0.00 ? 55 PHE A HB3  8  
ATOM 8551  H HD1  . PHE A 1 55 ? 4.221   -4.981  -5.400  1.00 0.00 ? 55 PHE A HD1  8  
ATOM 8552  H HD2  . PHE A 1 55 ? 7.259   -4.915  -2.419  1.00 0.00 ? 55 PHE A HD2  8  
ATOM 8553  H HE1  . PHE A 1 55 ? 2.584   -5.722  -3.719  1.00 0.00 ? 55 PHE A HE1  8  
ATOM 8554  H HE2  . PHE A 1 55 ? 5.627   -5.657  -0.734  1.00 0.00 ? 55 PHE A HE2  8  
ATOM 8555  H HZ   . PHE A 1 55 ? 3.286   -6.062  -1.383  1.00 0.00 ? 55 PHE A HZ   8  
ATOM 8556  N N    . GLN A 1 56 ? 8.368   -2.634  -7.165  1.00 0.00 ? 56 GLN A N    8  
ATOM 8557  C CA   . GLN A 1 56 ? 9.601   -1.986  -7.598  1.00 0.00 ? 56 GLN A CA   8  
ATOM 8558  C C    . GLN A 1 56 ? 9.423   -0.474  -7.676  1.00 0.00 ? 56 GLN A C    8  
ATOM 8559  O O    . GLN A 1 56 ? 10.181  0.282   -7.069  1.00 0.00 ? 56 GLN A O    8  
ATOM 8560  C CB   . GLN A 1 56 ? 10.036  -2.531  -8.960  1.00 0.00 ? 56 GLN A CB   8  
ATOM 8561  C CG   . GLN A 1 56 ? 10.785  -3.852  -8.875  1.00 0.00 ? 56 GLN A CG   8  
ATOM 8562  C CD   . GLN A 1 56 ? 11.786  -4.028  -10.000 1.00 0.00 ? 56 GLN A CD   8  
ATOM 8563  O OE1  . GLN A 1 56 ? 12.740  -3.260  -10.124 1.00 0.00 ? 56 GLN A OE1  8  
ATOM 8564  N NE2  . GLN A 1 56 ? 11.573  -5.044  -10.828 1.00 0.00 ? 56 GLN A NE2  8  
ATOM 8565  H H    . GLN A 1 56 ? 7.951   -3.304  -7.744  1.00 0.00 ? 56 GLN A H    8  
ATOM 8566  H HA   . GLN A 1 56 ? 10.366  -2.209  -6.870  1.00 0.00 ? 56 GLN A HA   8  
ATOM 8567  H HB2  . GLN A 1 56 ? 9.160   -2.677  -9.573  1.00 0.00 ? 56 GLN A HB2  8  
ATOM 8568  H HB3  . GLN A 1 56 ? 10.681  -1.807  -9.434  1.00 0.00 ? 56 GLN A HB3  8  
ATOM 8569  H HG2  . GLN A 1 56 ? 11.314  -3.892  -7.934  1.00 0.00 ? 56 GLN A HG2  8  
ATOM 8570  H HG3  . GLN A 1 56 ? 10.069  -4.660  -8.919  1.00 0.00 ? 56 GLN A HG3  8  
ATOM 8571  H HE21 . GLN A 1 56 ? 10.791  -5.614  -10.669 1.00 0.00 ? 56 GLN A HE21 8  
ATOM 8572  H HE22 . GLN A 1 56 ? 12.203  -5.181  -11.564 1.00 0.00 ? 56 GLN A HE22 8  
ATOM 8573  N N    . ASN A 1 57 ? 8.417   -0.039  -8.428  1.00 0.00 ? 57 ASN A N    8  
ATOM 8574  C CA   . ASN A 1 57 ? 8.140   1.384   -8.586  1.00 0.00 ? 57 ASN A CA   8  
ATOM 8575  C C    . ASN A 1 57 ? 7.884   2.042   -7.234  1.00 0.00 ? 57 ASN A C    8  
ATOM 8576  O O    . ASN A 1 57 ? 8.490   3.061   -6.903  1.00 0.00 ? 57 ASN A O    8  
ATOM 8577  C CB   . ASN A 1 57 ? 6.933   1.592   -9.503  1.00 0.00 ? 57 ASN A CB   8  
ATOM 8578  C CG   . ASN A 1 57 ? 7.300   1.499   -10.972 1.00 0.00 ? 57 ASN A CG   8  
ATOM 8579  O OD1  . ASN A 1 57 ? 7.626   2.502   -11.606 1.00 0.00 ? 57 ASN A OD1  8  
ATOM 8580  N ND2  . ASN A 1 57 ? 7.248   0.290   -11.519 1.00 0.00 ? 57 ASN A ND2  8  
ATOM 8581  H H    . ASN A 1 57 ? 7.847   -0.690  -8.888  1.00 0.00 ? 57 ASN A H    8  
ATOM 8582  H HA   . ASN A 1 57 ? 9.007   1.842   -9.038  1.00 0.00 ? 57 ASN A HA   8  
ATOM 8583  H HB2  . ASN A 1 57 ? 6.192   0.835   -9.289  1.00 0.00 ? 57 ASN A HB2  8  
ATOM 8584  H HB3  . ASN A 1 57 ? 6.510   2.567   -9.317  1.00 0.00 ? 57 ASN A HB3  8  
ATOM 8585  H HD21 . ASN A 1 57 ? 6.980   -0.464  -10.953 1.00 0.00 ? 57 ASN A HD21 8  
ATOM 8586  H HD22 . ASN A 1 57 ? 7.481   0.201   -12.467 1.00 0.00 ? 57 ASN A HD22 8  
ATOM 8587  N N    . ALA A 1 58 ? 6.983   1.451   -6.455  1.00 0.00 ? 58 ALA A N    8  
ATOM 8588  C CA   . ALA A 1 58 ? 6.649   1.978   -5.138  1.00 0.00 ? 58 ALA A CA   8  
ATOM 8589  C C    . ALA A 1 58 ? 7.907   2.351   -4.360  1.00 0.00 ? 58 ALA A C    8  
ATOM 8590  O O    . ALA A 1 58 ? 7.916   3.324   -3.606  1.00 0.00 ? 58 ALA A O    8  
ATOM 8591  C CB   . ALA A 1 58 ? 5.825   0.964   -4.358  1.00 0.00 ? 58 ALA A CB   8  
ATOM 8592  H H    . ALA A 1 58 ? 6.534   0.641   -6.774  1.00 0.00 ? 58 ALA A H    8  
ATOM 8593  H HA   . ALA A 1 58 ? 6.047   2.865   -5.276  1.00 0.00 ? 58 ALA A HA   8  
ATOM 8594  H HB1  . ALA A 1 58 ? 6.359   0.026   -4.313  1.00 0.00 ? 58 ALA A HB1  8  
ATOM 8595  H HB2  . ALA A 1 58 ? 5.657   1.332   -3.357  1.00 0.00 ? 58 ALA A HB2  8  
ATOM 8596  H HB3  . ALA A 1 58 ? 4.877   0.815   -4.852  1.00 0.00 ? 58 ALA A HB3  8  
ATOM 8597  N N    . ARG A 1 59 ? 8.966   1.571   -4.549  1.00 0.00 ? 59 ARG A N    8  
ATOM 8598  C CA   . ARG A 1 59 ? 10.229  1.818   -3.863  1.00 0.00 ? 59 ARG A CA   8  
ATOM 8599  C C    . ARG A 1 59 ? 10.892  3.089   -4.386  1.00 0.00 ? 59 ARG A C    8  
ATOM 8600  O O    . ARG A 1 59 ? 11.411  3.893   -3.613  1.00 0.00 ? 59 ARG A O    8  
ATOM 8601  C CB   . ARG A 1 59 ? 11.173  0.628   -4.041  1.00 0.00 ? 59 ARG A CB   8  
ATOM 8602  C CG   . ARG A 1 59 ? 10.725  -0.621  -3.300  1.00 0.00 ? 59 ARG A CG   8  
ATOM 8603  C CD   . ARG A 1 59 ? 11.793  -1.702  -3.333  1.00 0.00 ? 59 ARG A CD   8  
ATOM 8604  N NE   . ARG A 1 59 ? 12.107  -2.120  -4.697  1.00 0.00 ? 59 ARG A NE   8  
ATOM 8605  C CZ   . ARG A 1 59 ? 12.619  -3.307  -5.003  1.00 0.00 ? 59 ARG A CZ   8  
ATOM 8606  N NH1  . ARG A 1 59 ? 12.873  -4.189  -4.047  1.00 0.00 ? 59 ARG A NH1  8  
ATOM 8607  N NH2  . ARG A 1 59 ? 12.878  -3.613  -6.268  1.00 0.00 ? 59 ARG A NH2  8  
ATOM 8608  H H    . ARG A 1 59 ? 8.897   0.810   -5.162  1.00 0.00 ? 59 ARG A H    8  
ATOM 8609  H HA   . ARG A 1 59 ? 10.017  1.944   -2.812  1.00 0.00 ? 59 ARG A HA   8  
ATOM 8610  H HB2  . ARG A 1 59 ? 11.240  0.391   -5.093  1.00 0.00 ? 59 ARG A HB2  8  
ATOM 8611  H HB3  . ARG A 1 59 ? 12.152  0.903   -3.680  1.00 0.00 ? 59 ARG A HB3  8  
ATOM 8612  H HG2  . ARG A 1 59 ? 10.521  -0.364  -2.271  1.00 0.00 ? 59 ARG A HG2  8  
ATOM 8613  H HG3  . ARG A 1 59 ? 9.826   -1.000  -3.763  1.00 0.00 ? 59 ARG A HG3  8  
ATOM 8614  H HD2  . ARG A 1 59 ? 12.690  -1.318  -2.869  1.00 0.00 ? 59 ARG A HD2  8  
ATOM 8615  H HD3  . ARG A 1 59 ? 11.439  -2.557  -2.778  1.00 0.00 ? 59 ARG A HD3  8  
ATOM 8616  H HE   . ARG A 1 59 ? 11.928  -1.483  -5.419  1.00 0.00 ? 59 ARG A HE   8  
ATOM 8617  H HH11 . ARG A 1 59 ? 12.678  -3.962  -3.093  1.00 0.00 ? 59 ARG A HH11 8  
ATOM 8618  H HH12 . ARG A 1 59 ? 13.257  -5.083  -4.280  1.00 0.00 ? 59 ARG A HH12 8  
ATOM 8619  H HH21 . ARG A 1 59 ? 12.688  -2.950  -6.992  1.00 0.00 ? 59 ARG A HH21 8  
ATOM 8620  H HH22 . ARG A 1 59 ? 13.263  -4.506  -6.497  1.00 0.00 ? 59 ARG A HH22 8  
ATOM 8621  N N    . GLN A 1 60 ? 10.869  3.263   -5.704  1.00 0.00 ? 60 GLN A N    8  
ATOM 8622  C CA   . GLN A 1 60 ? 11.469  4.435   -6.330  1.00 0.00 ? 60 GLN A CA   8  
ATOM 8623  C C    . GLN A 1 60 ? 10.758  5.711   -5.890  1.00 0.00 ? 60 GLN A C    8  
ATOM 8624  O O    . GLN A 1 60 ? 11.393  6.737   -5.650  1.00 0.00 ? 60 GLN A O    8  
ATOM 8625  C CB   . GLN A 1 60 ? 11.418  4.308   -7.854  1.00 0.00 ? 60 GLN A CB   8  
ATOM 8626  C CG   . GLN A 1 60 ? 12.208  3.126   -8.392  1.00 0.00 ? 60 GLN A CG   8  
ATOM 8627  C CD   . GLN A 1 60 ? 11.912  2.843   -9.852  1.00 0.00 ? 60 GLN A CD   8  
ATOM 8628  O OE1  . GLN A 1 60 ? 11.565  3.746   -10.613 1.00 0.00 ? 60 GLN A OE1  8  
ATOM 8629  N NE2  . GLN A 1 60 ? 12.048  1.584   -10.250 1.00 0.00 ? 60 GLN A NE2  8  
ATOM 8630  H H    . GLN A 1 60 ? 10.440  2.587   -6.268  1.00 0.00 ? 60 GLN A H    8  
ATOM 8631  H HA   . GLN A 1 60 ? 12.500  4.487   -6.017  1.00 0.00 ? 60 GLN A HA   8  
ATOM 8632  H HB2  . GLN A 1 60 ? 10.389  4.196   -8.159  1.00 0.00 ? 60 GLN A HB2  8  
ATOM 8633  H HB3  . GLN A 1 60 ? 11.819  5.210   -8.292  1.00 0.00 ? 60 GLN A HB3  8  
ATOM 8634  H HG2  . GLN A 1 60 ? 13.262  3.337   -8.289  1.00 0.00 ? 60 GLN A HG2  8  
ATOM 8635  H HG3  . GLN A 1 60 ? 11.958  2.249   -7.813  1.00 0.00 ? 60 GLN A HG3  8  
ATOM 8636  H HE21 . GLN A 1 60 ? 12.327  0.917   -9.588  1.00 0.00 ? 60 GLN A HE21 8  
ATOM 8637  H HE22 . GLN A 1 60 ? 11.863  1.372   -11.188 1.00 0.00 ? 60 GLN A HE22 8  
ATOM 8638  N N    . LYS A 1 61 ? 9.435   5.639   -5.787  1.00 0.00 ? 61 LYS A N    8  
ATOM 8639  C CA   . LYS A 1 61 ? 8.636   6.787   -5.376  1.00 0.00 ? 61 LYS A CA   8  
ATOM 8640  C C    . LYS A 1 61 ? 8.967   7.195   -3.944  1.00 0.00 ? 61 LYS A C    8  
ATOM 8641  O O    . LYS A 1 61 ? 9.081   8.382   -3.637  1.00 0.00 ? 61 LYS A O    8  
ATOM 8642  C CB   . LYS A 1 61 ? 7.144   6.466   -5.494  1.00 0.00 ? 61 LYS A CB   8  
ATOM 8643  C CG   . LYS A 1 61 ? 6.658   6.355   -6.928  1.00 0.00 ? 61 LYS A CG   8  
ATOM 8644  C CD   . LYS A 1 61 ? 5.144   6.236   -6.996  1.00 0.00 ? 61 LYS A CD   8  
ATOM 8645  C CE   . LYS A 1 61 ? 4.667   4.889   -6.476  1.00 0.00 ? 61 LYS A CE   8  
ATOM 8646  N NZ   . LYS A 1 61 ? 4.402   4.922   -5.011  1.00 0.00 ? 61 LYS A NZ   8  
ATOM 8647  H H    . LYS A 1 61 ? 8.985   4.793   -5.993  1.00 0.00 ? 61 LYS A H    8  
ATOM 8648  H HA   . LYS A 1 61 ? 8.871   7.609   -6.035  1.00 0.00 ? 61 LYS A HA   8  
ATOM 8649  H HB2  . LYS A 1 61 ? 6.951   5.527   -4.997  1.00 0.00 ? 61 LYS A HB2  8  
ATOM 8650  H HB3  . LYS A 1 61 ? 6.580   7.246   -5.003  1.00 0.00 ? 61 LYS A HB3  8  
ATOM 8651  H HG2  . LYS A 1 61 ? 6.963   7.237   -7.472  1.00 0.00 ? 61 LYS A HG2  8  
ATOM 8652  H HG3  . LYS A 1 61 ? 7.099   5.479   -7.382  1.00 0.00 ? 61 LYS A HG3  8  
ATOM 8653  H HD2  . LYS A 1 61 ? 4.703   7.017   -6.395  1.00 0.00 ? 61 LYS A HD2  8  
ATOM 8654  H HD3  . LYS A 1 61 ? 4.829   6.348   -8.024  1.00 0.00 ? 61 LYS A HD3  8  
ATOM 8655  H HE2  . LYS A 1 61 ? 3.759   4.620   -6.992  1.00 0.00 ? 61 LYS A HE2  8  
ATOM 8656  H HE3  . LYS A 1 61 ? 5.429   4.150   -6.679  1.00 0.00 ? 61 LYS A HE3  8  
ATOM 8657  H HZ1  . LYS A 1 61 ? 3.452   5.305   -4.829  1.00 0.00 ? 61 LYS A HZ1  8  
ATOM 8658  H HZ2  . LYS A 1 61 ? 5.104   5.523   -4.534  1.00 0.00 ? 61 LYS A HZ2  8  
ATOM 8659  H HZ3  . LYS A 1 61 ? 4.458   3.962   -4.616  1.00 0.00 ? 61 LYS A HZ3  8  
ATOM 8660  N N    . ALA A 1 62 ? 9.122   6.205   -3.072  1.00 0.00 ? 62 ALA A N    8  
ATOM 8661  C CA   . ALA A 1 62 ? 9.443   6.461   -1.673  1.00 0.00 ? 62 ALA A CA   8  
ATOM 8662  C C    . ALA A 1 62 ? 10.728  7.272   -1.545  1.00 0.00 ? 62 ALA A C    8  
ATOM 8663  O O    . ALA A 1 62 ? 10.841  8.141   -0.681  1.00 0.00 ? 62 ALA A O    8  
ATOM 8664  C CB   . ALA A 1 62 ? 9.567   5.150   -0.911  1.00 0.00 ? 62 ALA A CB   8  
ATOM 8665  H H    . ALA A 1 62 ? 9.018   5.279   -3.377  1.00 0.00 ? 62 ALA A H    8  
ATOM 8666  H HA   . ALA A 1 62 ? 8.629   7.025   -1.241  1.00 0.00 ? 62 ALA A HA   8  
ATOM 8667  H HB1  . ALA A 1 62 ? 9.785   5.357   0.126   1.00 0.00 ? 62 ALA A HB1  8  
ATOM 8668  H HB2  . ALA A 1 62 ? 8.638   4.604   -0.982  1.00 0.00 ? 62 ALA A HB2  8  
ATOM 8669  H HB3  . ALA A 1 62 ? 10.365  4.560   -1.337  1.00 0.00 ? 62 ALA A HB3  8  
ATOM 8670  N N    . ARG A 1 63 ? 11.694  6.982   -2.411  1.00 0.00 ? 63 ARG A N    8  
ATOM 8671  C CA   . ARG A 1 63 ? 12.972  7.684   -2.393  1.00 0.00 ? 63 ARG A CA   8  
ATOM 8672  C C    . ARG A 1 63 ? 12.763  9.192   -2.293  1.00 0.00 ? 63 ARG A C    8  
ATOM 8673  O O    . ARG A 1 63 ? 12.138  9.802   -3.161  1.00 0.00 ? 63 ARG A O    8  
ATOM 8674  C CB   . ARG A 1 63 ? 13.778  7.352   -3.650  1.00 0.00 ? 63 ARG A CB   8  
ATOM 8675  C CG   . ARG A 1 63 ? 14.124  5.878   -3.780  1.00 0.00 ? 63 ARG A CG   8  
ATOM 8676  C CD   . ARG A 1 63 ? 15.284  5.496   -2.874  1.00 0.00 ? 63 ARG A CD   8  
ATOM 8677  N NE   . ARG A 1 63 ? 16.035  4.357   -3.397  1.00 0.00 ? 63 ARG A NE   8  
ATOM 8678  C CZ   . ARG A 1 63 ? 17.305  4.113   -3.094  1.00 0.00 ? 63 ARG A CZ   8  
ATOM 8679  N NH1  . ARG A 1 63 ? 17.963  4.922   -2.276  1.00 0.00 ? 63 ARG A NH1  8  
ATOM 8680  N NH2  . ARG A 1 63 ? 17.919  3.056   -3.610  1.00 0.00 ? 63 ARG A NH2  8  
ATOM 8681  H H    . ARG A 1 63 ? 11.545  6.279   -3.077  1.00 0.00 ? 63 ARG A H    8  
ATOM 8682  H HA   . ARG A 1 63 ? 13.521  7.351   -1.525  1.00 0.00 ? 63 ARG A HA   8  
ATOM 8683  H HB2  . ARG A 1 63 ? 13.205  7.643   -4.518  1.00 0.00 ? 63 ARG A HB2  8  
ATOM 8684  H HB3  . ARG A 1 63 ? 14.699  7.916   -3.631  1.00 0.00 ? 63 ARG A HB3  8  
ATOM 8685  H HG2  . ARG A 1 63 ? 13.261  5.290   -3.508  1.00 0.00 ? 63 ARG A HG2  8  
ATOM 8686  H HG3  . ARG A 1 63 ? 14.395  5.671   -4.805  1.00 0.00 ? 63 ARG A HG3  8  
ATOM 8687  H HD2  . ARG A 1 63 ? 15.949  6.343   -2.786  1.00 0.00 ? 63 ARG A HD2  8  
ATOM 8688  H HD3  . ARG A 1 63 ? 14.894  5.242   -1.900  1.00 0.00 ? 63 ARG A HD3  8  
ATOM 8689  H HE   . ARG A 1 63 ? 15.568  3.746   -4.004  1.00 0.00 ? 63 ARG A HE   8  
ATOM 8690  H HH11 . ARG A 1 63 ? 17.502  5.719   -1.885  1.00 0.00 ? 63 ARG A HH11 8  
ATOM 8691  H HH12 . ARG A 1 63 ? 18.918  4.735   -2.049  1.00 0.00 ? 63 ARG A HH12 8  
ATOM 8692  H HH21 . ARG A 1 63 ? 17.426  2.443   -4.227  1.00 0.00 ? 63 ARG A HH21 8  
ATOM 8693  H HH22 . ARG A 1 63 ? 18.875  2.872   -3.382  1.00 0.00 ? 63 ARG A HH22 8  
ATOM 8694  N N    . LYS A 1 64 ? 13.288  9.788   -1.228  1.00 0.00 ? 64 LYS A N    8  
ATOM 8695  C CA   . LYS A 1 64 ? 13.160  11.224  -1.013  1.00 0.00 ? 64 LYS A CA   8  
ATOM 8696  C C    . LYS A 1 64 ? 14.230  11.988  -1.788  1.00 0.00 ? 64 LYS A C    8  
ATOM 8697  O O    . LYS A 1 64 ? 15.273  11.433  -2.135  1.00 0.00 ? 64 LYS A O    8  
ATOM 8698  C CB   . LYS A 1 64 ? 13.267  11.550  0.479   1.00 0.00 ? 64 LYS A CB   8  
ATOM 8699  C CG   . LYS A 1 64 ? 12.654  12.887  0.855   1.00 0.00 ? 64 LYS A CG   8  
ATOM 8700  C CD   . LYS A 1 64 ? 12.245  12.921  2.318   1.00 0.00 ? 64 LYS A CD   8  
ATOM 8701  C CE   . LYS A 1 64 ? 13.441  13.167  3.225   1.00 0.00 ? 64 LYS A CE   8  
ATOM 8702  N NZ   . LYS A 1 64 ? 13.030  13.377  4.641   1.00 0.00 ? 64 LYS A NZ   8  
ATOM 8703  H H    . LYS A 1 64 ? 13.775  9.248   -0.570  1.00 0.00 ? 64 LYS A H    8  
ATOM 8704  H HA   . LYS A 1 64 ? 12.188  11.528  -1.370  1.00 0.00 ? 64 LYS A HA   8  
ATOM 8705  H HB2  . LYS A 1 64 ? 12.765  10.776  1.040   1.00 0.00 ? 64 LYS A HB2  8  
ATOM 8706  H HB3  . LYS A 1 64 ? 14.311  11.565  0.758   1.00 0.00 ? 64 LYS A HB3  8  
ATOM 8707  H HG2  . LYS A 1 64 ? 13.378  13.668  0.676   1.00 0.00 ? 64 LYS A HG2  8  
ATOM 8708  H HG3  . LYS A 1 64 ? 11.779  13.057  0.243   1.00 0.00 ? 64 LYS A HG3  8  
ATOM 8709  H HD2  . LYS A 1 64 ? 11.528  13.715  2.465   1.00 0.00 ? 64 LYS A HD2  8  
ATOM 8710  H HD3  . LYS A 1 64 ? 11.795  11.974  2.579   1.00 0.00 ? 64 LYS A HD3  8  
ATOM 8711  H HE2  . LYS A 1 64 ? 14.098  12.312  3.173   1.00 0.00 ? 64 LYS A HE2  8  
ATOM 8712  H HE3  . LYS A 1 64 ? 13.966  14.045  2.877   1.00 0.00 ? 64 LYS A HE3  8  
ATOM 8713  H HZ1  . LYS A 1 64 ? 12.134  13.904  4.678   1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 8714  H HZ2  . LYS A 1 64 ? 13.758  13.919  5.148   1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 8715  H HZ3  . LYS A 1 64 ? 12.901  12.461  5.115   1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 8716  N N    . SER A 1 65 ? 13.964  13.262  -2.056  1.00 0.00 ? 65 SER A N    8  
ATOM 8717  C CA   . SER A 1 65 ? 14.903  14.100  -2.792  1.00 0.00 ? 65 SER A CA   8  
ATOM 8718  C C    . SER A 1 65 ? 14.591  15.579  -2.582  1.00 0.00 ? 65 SER A C    8  
ATOM 8719  O O    . SER A 1 65 ? 13.452  15.951  -2.303  1.00 0.00 ? 65 SER A O    8  
ATOM 8720  C CB   . SER A 1 65 ? 14.857  13.765  -4.284  1.00 0.00 ? 65 SER A CB   8  
ATOM 8721  O OG   . SER A 1 65 ? 15.595  12.588  -4.565  1.00 0.00 ? 65 SER A OG   8  
ATOM 8722  H H    . SER A 1 65 ? 13.115  13.647  -1.753  1.00 0.00 ? 65 SER A H    8  
ATOM 8723  H HA   . SER A 1 65 ? 15.894  13.897  -2.416  1.00 0.00 ? 65 SER A HA   8  
ATOM 8724  H HB2  . SER A 1 65 ? 13.832  13.613  -4.585  1.00 0.00 ? 65 SER A HB2  8  
ATOM 8725  H HB3  . SER A 1 65 ? 15.280  14.584  -4.848  1.00 0.00 ? 65 SER A HB3  8  
ATOM 8726  H HG   . SER A 1 65 ? 16.500  12.698  -4.266  1.00 0.00 ? 65 SER A HG   8  
ATOM 8727  N N    . GLY A 1 66 ? 15.613  16.418  -2.719  1.00 0.00 ? 66 GLY A N    8  
ATOM 8728  C CA   . GLY A 1 66 ? 15.429  17.847  -2.541  1.00 0.00 ? 66 GLY A CA   8  
ATOM 8729  C C    . GLY A 1 66 ? 16.516  18.470  -1.689  1.00 0.00 ? 66 GLY A C    8  
ATOM 8730  O O    . GLY A 1 66 ? 17.267  17.779  -1.000  1.00 0.00 ? 66 GLY A O    8  
ATOM 8731  H H    . GLY A 1 66 ? 16.499  16.065  -2.943  1.00 0.00 ? 66 GLY A H    8  
ATOM 8732  H HA2  . GLY A 1 66 ? 15.429  18.322  -3.511  1.00 0.00 ? 66 GLY A HA2  8  
ATOM 8733  H HA3  . GLY A 1 66 ? 14.474  18.019  -2.067  1.00 0.00 ? 66 GLY A HA3  8  
ATOM 8734  N N    . PRO A 1 67 ? 16.613  19.807  -1.730  1.00 0.00 ? 67 PRO A N    8  
ATOM 8735  C CA   . PRO A 1 67 ? 17.614  20.552  -0.961  1.00 0.00 ? 67 PRO A CA   8  
ATOM 8736  C C    . PRO A 1 67 ? 17.337  20.520  0.538   1.00 0.00 ? 67 PRO A C    8  
ATOM 8737  O O    . PRO A 1 67 ? 18.054  21.139  1.324   1.00 0.00 ? 67 PRO A O    8  
ATOM 8738  C CB   . PRO A 1 67 ? 17.484  21.980  -1.499  1.00 0.00 ? 67 PRO A CB   8  
ATOM 8739  C CG   . PRO A 1 67 ? 16.087  22.065  -2.010  1.00 0.00 ? 67 PRO A CG   8  
ATOM 8740  C CD   . PRO A 1 67 ? 15.751  20.694  -2.528  1.00 0.00 ? 67 PRO A CD   8  
ATOM 8741  H HA   . PRO A 1 67 ? 18.613  20.185  -1.150  1.00 0.00 ? 67 PRO A HA   8  
ATOM 8742  H HB2  . PRO A 1 67 ? 17.656  22.685  -0.699  1.00 0.00 ? 67 PRO A HB2  8  
ATOM 8743  H HB3  . PRO A 1 67 ? 18.203  22.138  -2.288  1.00 0.00 ? 67 PRO A HB3  8  
ATOM 8744  H HG2  . PRO A 1 67 ? 15.418  22.338  -1.208  1.00 0.00 ? 67 PRO A HG2  8  
ATOM 8745  H HG3  . PRO A 1 67 ? 16.033  22.791  -2.808  1.00 0.00 ? 67 PRO A HG3  8  
ATOM 8746  H HD2  . PRO A 1 67 ? 14.707  20.473  -2.360  1.00 0.00 ? 67 PRO A HD2  8  
ATOM 8747  H HD3  . PRO A 1 67 ? 15.989  20.619  -3.579  1.00 0.00 ? 67 PRO A HD3  8  
ATOM 8748  N N    . SER A 1 68 ? 16.293  19.795  0.926   1.00 0.00 ? 68 SER A N    8  
ATOM 8749  C CA   . SER A 1 68 ? 15.920  19.685  2.332   1.00 0.00 ? 68 SER A CA   8  
ATOM 8750  C C    . SER A 1 68 ? 17.127  19.313  3.187   1.00 0.00 ? 68 SER A C    8  
ATOM 8751  O O    . SER A 1 68 ? 17.434  18.134  3.369   1.00 0.00 ? 68 SER A O    8  
ATOM 8752  C CB   . SER A 1 68 ? 14.815  18.641  2.507   1.00 0.00 ? 68 SER A CB   8  
ATOM 8753  O OG   . SER A 1 68 ? 14.133  18.822  3.736   1.00 0.00 ? 68 SER A OG   8  
ATOM 8754  H H    . SER A 1 68 ? 15.761  19.324  0.251   1.00 0.00 ? 68 SER A H    8  
ATOM 8755  H HA   . SER A 1 68 ? 15.549  20.647  2.652   1.00 0.00 ? 68 SER A HA   8  
ATOM 8756  H HB2  . SER A 1 68 ? 14.105  18.733  1.699   1.00 0.00 ? 68 SER A HB2  8  
ATOM 8757  H HB3  . SER A 1 68 ? 15.251  17.653  2.493   1.00 0.00 ? 68 SER A HB3  8  
ATOM 8758  H HG   . SER A 1 68 ? 13.199  18.639  3.614   1.00 0.00 ? 68 SER A HG   8  
ATOM 8759  N N    . SER A 1 69 ? 17.808  20.327  3.711   1.00 0.00 ? 69 SER A N    8  
ATOM 8760  C CA   . SER A 1 69 ? 18.985  20.108  4.544   1.00 0.00 ? 69 SER A CA   8  
ATOM 8761  C C    . SER A 1 69 ? 18.623  20.180  6.025   1.00 0.00 ? 69 SER A C    8  
ATOM 8762  O O    . SER A 1 69 ? 17.799  20.996  6.435   1.00 0.00 ? 69 SER A O    8  
ATOM 8763  C CB   . SER A 1 69 ? 20.064  21.143  4.221   1.00 0.00 ? 69 SER A CB   8  
ATOM 8764  O OG   . SER A 1 69 ? 21.346  20.683  4.615   1.00 0.00 ? 69 SER A OG   8  
ATOM 8765  H H    . SER A 1 69 ? 17.514  21.244  3.529   1.00 0.00 ? 69 SER A H    8  
ATOM 8766  H HA   . SER A 1 69 ? 19.367  19.122  4.326   1.00 0.00 ? 69 SER A HA   8  
ATOM 8767  H HB2  . SER A 1 69 ? 20.074  21.329  3.158   1.00 0.00 ? 69 SER A HB2  8  
ATOM 8768  H HB3  . SER A 1 69 ? 19.847  22.061  4.746   1.00 0.00 ? 69 SER A HB3  8  
ATOM 8769  H HG   . SER A 1 69 ? 21.336  20.472  5.552   1.00 0.00 ? 69 SER A HG   8  
ATOM 8770  N N    . GLY A 1 70 ? 19.245  19.317  6.822   1.00 0.00 ? 70 GLY A N    8  
ATOM 8771  C CA   . GLY A 1 70 ? 18.976  19.298  8.248   1.00 0.00 ? 70 GLY A CA   8  
ATOM 8772  C C    . GLY A 1 70 ? 18.358  17.991  8.704   1.00 0.00 ? 70 GLY A C    8  
ATOM 8773  O O    . GLY A 1 70 ? 19.058  17.102  9.188   1.00 0.00 ? 70 GLY A O    8  
ATOM 8774  H H    . GLY A 1 70 ? 19.893  18.689  6.439   1.00 0.00 ? 70 GLY A H    8  
ATOM 8775  H HA2  . GLY A 1 70 ? 19.903  19.452  8.781   1.00 0.00 ? 70 GLY A HA2  8  
ATOM 8776  H HA3  . GLY A 1 70 ? 18.298  20.105  8.486   1.00 0.00 ? 70 GLY A HA3  8  
ATOM 8777  N N    . GLY A 1 1  ? 5.799   -11.632 -31.251 1.00 0.00 ? 1  GLY A N    9  
ATOM 8778  C CA   . GLY A 1 1  ? 4.783   -11.021 -32.089 1.00 0.00 ? 1  GLY A CA   9  
ATOM 8779  C C    . GLY A 1 1  ? 4.561   -9.559  -31.758 1.00 0.00 ? 1  GLY A C    9  
ATOM 8780  O O    . GLY A 1 1  ? 4.571   -9.171  -30.590 1.00 0.00 ? 1  GLY A O    9  
ATOM 8781  H H1   . GLY A 1 1  ? 6.666   -11.190 -31.135 1.00 0.00 ? 1  GLY A H1   9  
ATOM 8782  H HA2  . GLY A 1 1  ? 5.087   -11.104 -33.122 1.00 0.00 ? 1  GLY A HA2  9  
ATOM 8783  H HA3  . GLY A 1 1  ? 3.854   -11.554 -31.953 1.00 0.00 ? 1  GLY A HA3  9  
ATOM 8784  N N    . SER A 1 2  ? 4.361   -8.744  -32.790 1.00 0.00 ? 2  SER A N    9  
ATOM 8785  C CA   . SER A 1 2  ? 4.141   -7.315  -32.603 1.00 0.00 ? 2  SER A CA   9  
ATOM 8786  C C    . SER A 1 2  ? 3.130   -7.061  -31.490 1.00 0.00 ? 2  SER A C    9  
ATOM 8787  O O    . SER A 1 2  ? 1.972   -7.468  -31.584 1.00 0.00 ? 2  SER A O    9  
ATOM 8788  C CB   . SER A 1 2  ? 3.653   -6.679  -33.906 1.00 0.00 ? 2  SER A CB   9  
ATOM 8789  O OG   . SER A 1 2  ? 2.328   -7.082  -34.205 1.00 0.00 ? 2  SER A OG   9  
ATOM 8790  H H    . SER A 1 2  ? 4.365   -9.114  -33.698 1.00 0.00 ? 2  SER A H    9  
ATOM 8791  H HA   . SER A 1 2  ? 5.084   -6.868  -32.326 1.00 0.00 ? 2  SER A HA   9  
ATOM 8792  H HB2  . SER A 1 2  ? 3.676   -5.604  -33.810 1.00 0.00 ? 2  SER A HB2  9  
ATOM 8793  H HB3  . SER A 1 2  ? 4.300   -6.982  -34.716 1.00 0.00 ? 2  SER A HB3  9  
ATOM 8794  H HG   . SER A 1 2  ? 2.280   -8.041  -34.218 1.00 0.00 ? 2  SER A HG   9  
ATOM 8795  N N    . SER A 1 3  ? 3.577   -6.386  -30.435 1.00 0.00 ? 3  SER A N    9  
ATOM 8796  C CA   . SER A 1 3  ? 2.713   -6.081  -29.301 1.00 0.00 ? 3  SER A CA   9  
ATOM 8797  C C    . SER A 1 3  ? 2.679   -4.580  -29.032 1.00 0.00 ? 3  SER A C    9  
ATOM 8798  O O    . SER A 1 3  ? 3.423   -3.812  -29.642 1.00 0.00 ? 3  SER A O    9  
ATOM 8799  C CB   . SER A 1 3  ? 3.194   -6.824  -28.053 1.00 0.00 ? 3  SER A CB   9  
ATOM 8800  O OG   . SER A 1 3  ? 2.895   -8.207  -28.135 1.00 0.00 ? 3  SER A OG   9  
ATOM 8801  H H    . SER A 1 3  ? 4.511   -6.089  -30.419 1.00 0.00 ? 3  SER A H    9  
ATOM 8802  H HA   . SER A 1 3  ? 1.715   -6.414  -29.545 1.00 0.00 ? 3  SER A HA   9  
ATOM 8803  H HB2  . SER A 1 3  ? 4.262   -6.704  -27.954 1.00 0.00 ? 3  SER A HB2  9  
ATOM 8804  H HB3  . SER A 1 3  ? 2.703   -6.413  -27.182 1.00 0.00 ? 3  SER A HB3  9  
ATOM 8805  H HG   . SER A 1 3  ? 2.153   -8.339  -28.729 1.00 0.00 ? 3  SER A HG   9  
ATOM 8806  N N    . GLY A 1 4  ? 1.810   -4.169  -28.114 1.00 0.00 ? 4  GLY A N    9  
ATOM 8807  C CA   . GLY A 1 4  ? 1.694   -2.761  -27.780 1.00 0.00 ? 4  GLY A CA   9  
ATOM 8808  C C    . GLY A 1 4  ? 0.758   -2.517  -26.613 1.00 0.00 ? 4  GLY A C    9  
ATOM 8809  O O    . GLY A 1 4  ? 0.503   -3.418  -25.814 1.00 0.00 ? 4  GLY A O    9  
ATOM 8810  H H    . GLY A 1 4  ? 1.242   -4.826  -27.660 1.00 0.00 ? 4  GLY A H    9  
ATOM 8811  H HA2  . GLY A 1 4  ? 2.673   -2.380  -27.528 1.00 0.00 ? 4  GLY A HA2  9  
ATOM 8812  H HA3  . GLY A 1 4  ? 1.322   -2.228  -28.642 1.00 0.00 ? 4  GLY A HA3  9  
ATOM 8813  N N    . SER A 1 5  ? 0.244   -1.295  -26.513 1.00 0.00 ? 5  SER A N    9  
ATOM 8814  C CA   . SER A 1 5  ? -0.665  -0.934  -25.432 1.00 0.00 ? 5  SER A CA   9  
ATOM 8815  C C    . SER A 1 5  ? -2.061  -0.640  -25.972 1.00 0.00 ? 5  SER A C    9  
ATOM 8816  O O    . SER A 1 5  ? -2.239  0.236   -26.819 1.00 0.00 ? 5  SER A O    9  
ATOM 8817  C CB   . SER A 1 5  ? -0.132  0.284   -24.675 1.00 0.00 ? 5  SER A CB   9  
ATOM 8818  O OG   . SER A 1 5  ? 0.003   1.401   -25.535 1.00 0.00 ? 5  SER A OG   9  
ATOM 8819  H H    . SER A 1 5  ? 0.485   -0.620  -27.182 1.00 0.00 ? 5  SER A H    9  
ATOM 8820  H HA   . SER A 1 5  ? -0.723  -1.772  -24.754 1.00 0.00 ? 5  SER A HA   9  
ATOM 8821  H HB2  . SER A 1 5  ? -0.816  0.537   -23.879 1.00 0.00 ? 5  SER A HB2  9  
ATOM 8822  H HB3  . SER A 1 5  ? 0.836   0.048   -24.256 1.00 0.00 ? 5  SER A HB3  9  
ATOM 8823  H HG   . SER A 1 5  ? 0.837   1.344   -26.007 1.00 0.00 ? 5  SER A HG   9  
ATOM 8824  N N    . SER A 1 6  ? -3.049  -1.378  -25.476 1.00 0.00 ? 6  SER A N    9  
ATOM 8825  C CA   . SER A 1 6  ? -4.429  -1.200  -25.910 1.00 0.00 ? 6  SER A CA   9  
ATOM 8826  C C    . SER A 1 6  ? -5.181  -0.271  -24.962 1.00 0.00 ? 6  SER A C    9  
ATOM 8827  O O    . SER A 1 6  ? -6.334  -0.522  -24.614 1.00 0.00 ? 6  SER A O    9  
ATOM 8828  C CB   . SER A 1 6  ? -5.140  -2.552  -25.987 1.00 0.00 ? 6  SER A CB   9  
ATOM 8829  O OG   . SER A 1 6  ? -5.187  -3.177  -24.716 1.00 0.00 ? 6  SER A OG   9  
ATOM 8830  H H    . SER A 1 6  ? -2.843  -2.060  -24.803 1.00 0.00 ? 6  SER A H    9  
ATOM 8831  H HA   . SER A 1 6  ? -4.412  -0.755  -26.894 1.00 0.00 ? 6  SER A HA   9  
ATOM 8832  H HB2  . SER A 1 6  ? -6.149  -2.406  -26.341 1.00 0.00 ? 6  SER A HB2  9  
ATOM 8833  H HB3  . SER A 1 6  ? -4.608  -3.197  -26.673 1.00 0.00 ? 6  SER A HB3  9  
ATOM 8834  H HG   . SER A 1 6  ? -6.071  -3.519  -24.560 1.00 0.00 ? 6  SER A HG   9  
ATOM 8835  N N    . GLY A 1 7  ? -4.519  0.806   -24.549 1.00 0.00 ? 7  GLY A N    9  
ATOM 8836  C CA   . GLY A 1 7  ? -5.139  1.757   -23.645 1.00 0.00 ? 7  GLY A CA   9  
ATOM 8837  C C    . GLY A 1 7  ? -4.198  2.875   -23.246 1.00 0.00 ? 7  GLY A C    9  
ATOM 8838  O O    . GLY A 1 7  ? -3.279  3.219   -23.990 1.00 0.00 ? 7  GLY A O    9  
ATOM 8839  H H    . GLY A 1 7  ? -3.601  0.955   -24.860 1.00 0.00 ? 7  GLY A H    9  
ATOM 8840  H HA2  . GLY A 1 7  ? -6.005  2.184   -24.129 1.00 0.00 ? 7  GLY A HA2  9  
ATOM 8841  H HA3  . GLY A 1 7  ? -5.458  1.235   -22.755 1.00 0.00 ? 7  GLY A HA3  9  
ATOM 8842  N N    . ARG A 1 8  ? -4.426  3.447   -22.068 1.00 0.00 ? 8  ARG A N    9  
ATOM 8843  C CA   . ARG A 1 8  ? -3.593  4.535   -21.572 1.00 0.00 ? 8  ARG A CA   9  
ATOM 8844  C C    . ARG A 1 8  ? -2.515  4.008   -20.628 1.00 0.00 ? 8  ARG A C    9  
ATOM 8845  O O    . ARG A 1 8  ? -2.711  3.957   -19.414 1.00 0.00 ? 8  ARG A O    9  
ATOM 8846  C CB   . ARG A 1 8  ? -4.452  5.576   -20.851 1.00 0.00 ? 8  ARG A CB   9  
ATOM 8847  C CG   . ARG A 1 8  ? -5.508  4.970   -19.941 1.00 0.00 ? 8  ARG A CG   9  
ATOM 8848  C CD   . ARG A 1 8  ? -6.074  6.004   -18.980 1.00 0.00 ? 8  ARG A CD   9  
ATOM 8849  N NE   . ARG A 1 8  ? -6.960  6.950   -19.653 1.00 0.00 ? 8  ARG A NE   9  
ATOM 8850  C CZ   . ARG A 1 8  ? -7.917  7.630   -19.031 1.00 0.00 ? 8  ARG A CZ   9  
ATOM 8851  N NH1  . ARG A 1 8  ? -8.110  7.469   -17.729 1.00 0.00 ? 8  ARG A NH1  9  
ATOM 8852  N NH2  . ARG A 1 8  ? -8.683  8.473   -19.712 1.00 0.00 ? 8  ARG A NH2  9  
ATOM 8853  H H    . ARG A 1 8  ? -5.174  3.129   -21.519 1.00 0.00 ? 8  ARG A H    9  
ATOM 8854  H HA   . ARG A 1 8  ? -3.115  5.001   -22.420 1.00 0.00 ? 8  ARG A HA   9  
ATOM 8855  H HB2  . ARG A 1 8  ? -3.809  6.204   -20.252 1.00 0.00 ? 8  ARG A HB2  9  
ATOM 8856  H HB3  . ARG A 1 8  ? -4.951  6.186   -21.589 1.00 0.00 ? 8  ARG A HB3  9  
ATOM 8857  H HG2  . ARG A 1 8  ? -6.312  4.581   -20.548 1.00 0.00 ? 8  ARG A HG2  9  
ATOM 8858  H HG3  . ARG A 1 8  ? -5.062  4.168   -19.373 1.00 0.00 ? 8  ARG A HG3  9  
ATOM 8859  H HD2  . ARG A 1 8  ? -6.629  5.492   -18.208 1.00 0.00 ? 8  ARG A HD2  9  
ATOM 8860  H HD3  . ARG A 1 8  ? -5.254  6.547   -18.533 1.00 0.00 ? 8  ARG A HD3  9  
ATOM 8861  H HE   . ARG A 1 8  ? -6.835  7.084   -20.615 1.00 0.00 ? 8  ARG A HE   9  
ATOM 8862  H HH11 . ARG A 1 8  ? -7.534  6.836   -17.213 1.00 0.00 ? 8  ARG A HH11 9  
ATOM 8863  H HH12 . ARG A 1 8  ? -8.830  7.984   -17.263 1.00 0.00 ? 8  ARG A HH12 9  
ATOM 8864  H HH21 . ARG A 1 8  ? -8.540  8.596   -20.693 1.00 0.00 ? 8  ARG A HH21 9  
ATOM 8865  H HH22 . ARG A 1 8  ? -9.402  8.984   -19.243 1.00 0.00 ? 8  ARG A HH22 9  
ATOM 8866  N N    . SER A 1 9  ? -1.379  3.618   -21.195 1.00 0.00 ? 9  SER A N    9  
ATOM 8867  C CA   . SER A 1 9  ? -0.272  3.091   -20.406 1.00 0.00 ? 9  SER A CA   9  
ATOM 8868  C C    . SER A 1 9  ? -0.787  2.274   -19.225 1.00 0.00 ? 9  SER A C    9  
ATOM 8869  O O    . SER A 1 9  ? -0.300  2.408   -18.103 1.00 0.00 ? 9  SER A O    9  
ATOM 8870  C CB   . SER A 1 9  ? 0.613   4.233   -19.903 1.00 0.00 ? 9  SER A CB   9  
ATOM 8871  O OG   . SER A 1 9  ? -0.149  5.190   -19.187 1.00 0.00 ? 9  SER A OG   9  
ATOM 8872  H H    . SER A 1 9  ? -1.283  3.683   -22.169 1.00 0.00 ? 9  SER A H    9  
ATOM 8873  H HA   . SER A 1 9  ? 0.315   2.448   -21.045 1.00 0.00 ? 9  SER A HA   9  
ATOM 8874  H HB2  . SER A 1 9  ? 1.374   3.835   -19.249 1.00 0.00 ? 9  SER A HB2  9  
ATOM 8875  H HB3  . SER A 1 9  ? 1.081   4.721   -20.746 1.00 0.00 ? 9  SER A HB3  9  
ATOM 8876  H HG   . SER A 1 9  ? -0.955  4.782   -18.864 1.00 0.00 ? 9  SER A HG   9  
ATOM 8877  N N    . SER A 1 10 ? -1.777  1.426   -19.487 1.00 0.00 ? 10 SER A N    9  
ATOM 8878  C CA   . SER A 1 10 ? -2.363  0.589   -18.447 1.00 0.00 ? 10 SER A CA   9  
ATOM 8879  C C    . SER A 1 10 ? -2.206  -0.890  -18.787 1.00 0.00 ? 10 SER A C    9  
ATOM 8880  O O    . SER A 1 10 ? -2.611  -1.337  -19.860 1.00 0.00 ? 10 SER A O    9  
ATOM 8881  C CB   . SER A 1 10 ? -3.843  0.928   -18.263 1.00 0.00 ? 10 SER A CB   9  
ATOM 8882  O OG   . SER A 1 10 ? -4.010  2.269   -17.836 1.00 0.00 ? 10 SER A OG   9  
ATOM 8883  H H    . SER A 1 10 ? -2.123  1.364   -20.402 1.00 0.00 ? 10 SER A H    9  
ATOM 8884  H HA   . SER A 1 10 ? -1.839  0.792   -17.524 1.00 0.00 ? 10 SER A HA   9  
ATOM 8885  H HB2  . SER A 1 10 ? -4.359  0.796   -19.202 1.00 0.00 ? 10 SER A HB2  9  
ATOM 8886  H HB3  . SER A 1 10 ? -4.271  0.270   -17.521 1.00 0.00 ? 10 SER A HB3  9  
ATOM 8887  H HG   . SER A 1 10 ? -3.265  2.526   -17.288 1.00 0.00 ? 10 SER A HG   9  
ATOM 8888  N N    . ARG A 1 11 ? -1.615  -1.643  -17.865 1.00 0.00 ? 11 ARG A N    9  
ATOM 8889  C CA   . ARG A 1 11 ? -1.403  -3.071  -18.067 1.00 0.00 ? 11 ARG A CA   9  
ATOM 8890  C C    . ARG A 1 11 ? -2.253  -3.889  -17.098 1.00 0.00 ? 11 ARG A C    9  
ATOM 8891  O O    . ARG A 1 11 ? -3.117  -4.662  -17.513 1.00 0.00 ? 11 ARG A O    9  
ATOM 8892  C CB   . ARG A 1 11 ? 0.075   -3.420  -17.885 1.00 0.00 ? 11 ARG A CB   9  
ATOM 8893  C CG   . ARG A 1 11 ? 0.510   -4.652  -18.662 1.00 0.00 ? 11 ARG A CG   9  
ATOM 8894  C CD   . ARG A 1 11 ? 0.641   -4.356  -20.148 1.00 0.00 ? 11 ARG A CD   9  
ATOM 8895  N NE   . ARG A 1 11 ? 1.958   -3.821  -20.485 1.00 0.00 ? 11 ARG A NE   9  
ATOM 8896  C CZ   . ARG A 1 11 ? 3.032   -4.579  -20.676 1.00 0.00 ? 11 ARG A CZ   9  
ATOM 8897  N NH1  . ARG A 1 11 ? 2.946   -5.898  -20.563 1.00 0.00 ? 11 ARG A NH1  9  
ATOM 8898  N NH2  . ARG A 1 11 ? 4.195   -4.018  -20.981 1.00 0.00 ? 11 ARG A NH2  9  
ATOM 8899  H H    . ARG A 1 11 ? -1.314  -1.229  -17.030 1.00 0.00 ? 11 ARG A H    9  
ATOM 8900  H HA   . ARG A 1 11 ? -1.699  -3.311  -19.077 1.00 0.00 ? 11 ARG A HA   9  
ATOM 8901  H HB2  . ARG A 1 11 ? 0.673   -2.584  -18.215 1.00 0.00 ? 11 ARG A HB2  9  
ATOM 8902  H HB3  . ARG A 1 11 ? 0.264   -3.596  -16.837 1.00 0.00 ? 11 ARG A HB3  9  
ATOM 8903  H HG2  . ARG A 1 11 ? 1.467   -4.983  -18.286 1.00 0.00 ? 11 ARG A HG2  9  
ATOM 8904  H HG3  . ARG A 1 11 ? -0.223  -5.432  -18.522 1.00 0.00 ? 11 ARG A HG3  9  
ATOM 8905  H HD2  . ARG A 1 11 ? 0.483   -5.271  -20.699 1.00 0.00 ? 11 ARG A HD2  9  
ATOM 8906  H HD3  . ARG A 1 11 ? -0.113  -3.634  -20.425 1.00 0.00 ? 11 ARG A HD3  9  
ATOM 8907  H HE   . ARG A 1 11 ? 2.044   -2.850  -20.574 1.00 0.00 ? 11 ARG A HE   9  
ATOM 8908  H HH11 . ARG A 1 11 ? 2.070   -6.323  -20.335 1.00 0.00 ? 11 ARG A HH11 9  
ATOM 8909  H HH12 . ARG A 1 11 ? 3.756   -6.466  -20.709 1.00 0.00 ? 11 ARG A HH12 9  
ATOM 8910  H HH21 . ARG A 1 11 ? 4.264   -3.025  -21.067 1.00 0.00 ? 11 ARG A HH21 9  
ATOM 8911  H HH22 . ARG A 1 11 ? 5.003   -4.589  -21.124 1.00 0.00 ? 11 ARG A HH22 9  
ATOM 8912  N N    . THR A 1 12 ? -2.001  -3.713  -15.804 1.00 0.00 ? 12 THR A N    9  
ATOM 8913  C CA   . THR A 1 12 ? -2.740  -4.435  -14.777 1.00 0.00 ? 12 THR A CA   9  
ATOM 8914  C C    . THR A 1 12 ? -3.381  -3.474  -13.782 1.00 0.00 ? 12 THR A C    9  
ATOM 8915  O O    . THR A 1 12 ? -2.782  -3.131  -12.762 1.00 0.00 ? 12 THR A O    9  
ATOM 8916  C CB   . THR A 1 12 ? -1.829  -5.415  -14.013 1.00 0.00 ? 12 THR A CB   9  
ATOM 8917  O OG1  . THR A 1 12 ? -1.093  -6.222  -14.938 1.00 0.00 ? 12 THR A OG1  9  
ATOM 8918  C CG2  . THR A 1 12 ? -2.647  -6.307  -13.091 1.00 0.00 ? 12 THR A CG2  9  
ATOM 8919  H H    . THR A 1 12 ? -1.300  -3.083  -15.537 1.00 0.00 ? 12 THR A H    9  
ATOM 8920  H HA   . THR A 1 12 ? -3.518  -5.005  -15.264 1.00 0.00 ? 12 THR A HA   9  
ATOM 8921  H HB   . THR A 1 12 ? -1.134  -4.843  -13.414 1.00 0.00 ? 12 THR A HB   9  
ATOM 8922  H HG1  . THR A 1 12 ? -1.579  -6.287  -15.764 1.00 0.00 ? 12 THR A HG1  9  
ATOM 8923  H HG21 . THR A 1 12 ? -2.205  -7.292  -13.059 1.00 0.00 ? 12 THR A HG21 9  
ATOM 8924  H HG22 . THR A 1 12 ? -3.658  -6.377  -13.462 1.00 0.00 ? 12 THR A HG22 9  
ATOM 8925  H HG23 . THR A 1 12 ? -2.656  -5.885  -12.097 1.00 0.00 ? 12 THR A HG23 9  
ATOM 8926  N N    . ARG A 1 13 ? -4.600  -3.042  -14.086 1.00 0.00 ? 13 ARG A N    9  
ATOM 8927  C CA   . ARG A 1 13 ? -5.322  -2.119  -13.218 1.00 0.00 ? 13 ARG A CA   9  
ATOM 8928  C C    . ARG A 1 13 ? -5.830  -2.832  -11.968 1.00 0.00 ? 13 ARG A C    9  
ATOM 8929  O O    . ARG A 1 13 ? -6.708  -3.691  -12.045 1.00 0.00 ? 13 ARG A O    9  
ATOM 8930  C CB   . ARG A 1 13 ? -6.494  -1.488  -13.971 1.00 0.00 ? 13 ARG A CB   9  
ATOM 8931  C CG   . ARG A 1 13 ? -7.136  -0.323  -13.234 1.00 0.00 ? 13 ARG A CG   9  
ATOM 8932  C CD   . ARG A 1 13 ? -7.927  0.566   -14.180 1.00 0.00 ? 13 ARG A CD   9  
ATOM 8933  N NE   . ARG A 1 13 ? -8.034  1.935   -13.683 1.00 0.00 ? 13 ARG A NE   9  
ATOM 8934  C CZ   . ARG A 1 13 ? -8.790  2.867   -14.252 1.00 0.00 ? 13 ARG A CZ   9  
ATOM 8935  N NH1  . ARG A 1 13 ? -9.502  2.578   -15.333 1.00 0.00 ? 13 ARG A NH1  9  
ATOM 8936  N NH2  . ARG A 1 13 ? -8.836  4.090   -13.741 1.00 0.00 ? 13 ARG A NH2  9  
ATOM 8937  H H    . ARG A 1 13 ? -5.025  -3.350  -14.913 1.00 0.00 ? 13 ARG A H    9  
ATOM 8938  H HA   . ARG A 1 13 ? -4.636  -1.339  -12.920 1.00 0.00 ? 13 ARG A HA   9  
ATOM 8939  H HB2  . ARG A 1 13 ? -6.143  -1.130  -14.927 1.00 0.00 ? 13 ARG A HB2  9  
ATOM 8940  H HB3  . ARG A 1 13 ? -7.249  -2.243  -14.133 1.00 0.00 ? 13 ARG A HB3  9  
ATOM 8941  H HG2  . ARG A 1 13 ? -7.804  -0.711  -12.480 1.00 0.00 ? 13 ARG A HG2  9  
ATOM 8942  H HG3  . ARG A 1 13 ? -6.361  0.264   -12.765 1.00 0.00 ? 13 ARG A HG3  9  
ATOM 8943  H HD2  . ARG A 1 13 ? -7.430  0.580   -15.139 1.00 0.00 ? 13 ARG A HD2  9  
ATOM 8944  H HD3  . ARG A 1 13 ? -8.919  0.156   -14.294 1.00 0.00 ? 13 ARG A HD3  9  
ATOM 8945  H HE   . ARG A 1 13 ? -7.516  2.170   -12.885 1.00 0.00 ? 13 ARG A HE   9  
ATOM 8946  H HH11 . ARG A 1 13 ? -9.470  1.657   -15.720 1.00 0.00 ? 13 ARG A HH11 9  
ATOM 8947  H HH12 . ARG A 1 13 ? -10.072 3.282   -15.759 1.00 0.00 ? 13 ARG A HH12 9  
ATOM 8948  H HH21 . ARG A 1 13 ? -8.301  4.312   -12.926 1.00 0.00 ? 13 ARG A HH21 9  
ATOM 8949  H HH22 . ARG A 1 13 ? -9.405  4.791   -14.170 1.00 0.00 ? 13 ARG A HH22 9  
ATOM 8950  N N    . PHE A 1 14 ? -5.271  -2.470  -10.818 1.00 0.00 ? 14 PHE A N    9  
ATOM 8951  C CA   . PHE A 1 14 ? -5.666  -3.076  -9.552  1.00 0.00 ? 14 PHE A CA   9  
ATOM 8952  C C    . PHE A 1 14 ? -6.785  -2.276  -8.892  1.00 0.00 ? 14 PHE A C    9  
ATOM 8953  O O    . PHE A 1 14 ? -6.929  -1.076  -9.128  1.00 0.00 ? 14 PHE A O    9  
ATOM 8954  C CB   . PHE A 1 14 ? -4.465  -3.168  -8.609  1.00 0.00 ? 14 PHE A CB   9  
ATOM 8955  C CG   . PHE A 1 14 ? -3.187  -3.546  -9.302  1.00 0.00 ? 14 PHE A CG   9  
ATOM 8956  C CD1  . PHE A 1 14 ? -2.356  -2.571  -9.832  1.00 0.00 ? 14 PHE A CD1  9  
ATOM 8957  C CD2  . PHE A 1 14 ? -2.816  -4.875  -9.424  1.00 0.00 ? 14 PHE A CD2  9  
ATOM 8958  C CE1  . PHE A 1 14 ? -1.179  -2.916  -10.470 1.00 0.00 ? 14 PHE A CE1  9  
ATOM 8959  C CE2  . PHE A 1 14 ? -1.640  -5.225  -10.060 1.00 0.00 ? 14 PHE A CE2  9  
ATOM 8960  C CZ   . PHE A 1 14 ? -0.821  -4.244  -10.585 1.00 0.00 ? 14 PHE A CZ   9  
ATOM 8961  H H    . PHE A 1 14 ? -4.576  -1.779  -10.821 1.00 0.00 ? 14 PHE A H    9  
ATOM 8962  H HA   . PHE A 1 14 ? -6.027  -4.072  -9.760  1.00 0.00 ? 14 PHE A HA   9  
ATOM 8963  H HB2  . PHE A 1 14 ? -4.314  -2.210  -8.135  1.00 0.00 ? 14 PHE A HB2  9  
ATOM 8964  H HB3  . PHE A 1 14 ? -4.666  -3.912  -7.853  1.00 0.00 ? 14 PHE A HB3  9  
ATOM 8965  H HD1  . PHE A 1 14 ? -2.636  -1.531  -9.742  1.00 0.00 ? 14 PHE A HD1  9  
ATOM 8966  H HD2  . PHE A 1 14 ? -3.456  -5.644  -9.016  1.00 0.00 ? 14 PHE A HD2  9  
ATOM 8967  H HE1  . PHE A 1 14 ? -0.542  -2.146  -10.878 1.00 0.00 ? 14 PHE A HE1  9  
ATOM 8968  H HE2  . PHE A 1 14 ? -1.363  -6.265  -10.150 1.00 0.00 ? 14 PHE A HE2  9  
ATOM 8969  H HZ   . PHE A 1 14 ? 0.098   -4.516  -11.082 1.00 0.00 ? 14 PHE A HZ   9  
ATOM 8970  N N    . THR A 1 15 ? -7.577  -2.949  -8.063  1.00 0.00 ? 15 THR A N    9  
ATOM 8971  C CA   . THR A 1 15 ? -8.684  -2.303  -7.369  1.00 0.00 ? 15 THR A CA   9  
ATOM 8972  C C    . THR A 1 15 ? -8.379  -2.133  -5.885  1.00 0.00 ? 15 THR A C    9  
ATOM 8973  O O    . THR A 1 15 ? -7.540  -2.842  -5.329  1.00 0.00 ? 15 THR A O    9  
ATOM 8974  C CB   . THR A 1 15 ? -9.989  -3.106  -7.525  1.00 0.00 ? 15 THR A CB   9  
ATOM 8975  O OG1  . THR A 1 15 ? -11.087 -2.366  -6.979  1.00 0.00 ? 15 THR A OG1  9  
ATOM 8976  C CG2  . THR A 1 15 ? -9.882  -4.453  -6.827  1.00 0.00 ? 15 THR A CG2  9  
ATOM 8977  H H    . THR A 1 15 ? -7.411  -3.904  -7.915  1.00 0.00 ? 15 THR A H    9  
ATOM 8978  H HA   . THR A 1 15 ? -8.830  -1.328  -7.811  1.00 0.00 ? 15 THR A HA   9  
ATOM 8979  H HB   . THR A 1 15 ? -10.167 -3.275  -8.577  1.00 0.00 ? 15 THR A HB   9  
ATOM 8980  H HG1  . THR A 1 15 ? -11.766 -2.975  -6.679  1.00 0.00 ? 15 THR A HG1  9  
ATOM 8981  H HG21 . THR A 1 15 ? -10.615 -4.508  -6.036  1.00 0.00 ? 15 THR A HG21 9  
ATOM 8982  H HG22 . THR A 1 15 ? -8.893  -4.565  -6.410  1.00 0.00 ? 15 THR A HG22 9  
ATOM 8983  H HG23 . THR A 1 15 ? -10.064 -5.243  -7.541  1.00 0.00 ? 15 THR A HG23 9  
ATOM 8984  N N    . ASP A 1 16 ? -9.066  -1.191  -5.249  1.00 0.00 ? 16 ASP A N    9  
ATOM 8985  C CA   . ASP A 1 16 ? -8.869  -0.929  -3.828  1.00 0.00 ? 16 ASP A CA   9  
ATOM 8986  C C    . ASP A 1 16 ? -8.553  -2.219  -3.077  1.00 0.00 ? 16 ASP A C    9  
ATOM 8987  O O    . ASP A 1 16 ? -7.628  -2.266  -2.266  1.00 0.00 ? 16 ASP A O    9  
ATOM 8988  C CB   . ASP A 1 16 ? -10.114 -0.269  -3.232  1.00 0.00 ? 16 ASP A CB   9  
ATOM 8989  C CG   . ASP A 1 16 ? -10.644 0.855   -4.100  1.00 0.00 ? 16 ASP A CG   9  
ATOM 8990  O OD1  . ASP A 1 16 ? -10.112 1.981   -4.004  1.00 0.00 ? 16 ASP A OD1  9  
ATOM 8991  O OD2  . ASP A 1 16 ? -11.591 0.608   -4.876  1.00 0.00 ? 16 ASP A OD2  9  
ATOM 8992  H H    . ASP A 1 16 ? -9.721  -0.659  -5.747  1.00 0.00 ? 16 ASP A H    9  
ATOM 8993  H HA   . ASP A 1 16 ? -8.032  -0.255  -3.727  1.00 0.00 ? 16 ASP A HA   9  
ATOM 8994  H HB2  . ASP A 1 16 ? -10.890 -1.012  -3.124  1.00 0.00 ? 16 ASP A HB2  9  
ATOM 8995  H HB3  . ASP A 1 16 ? -9.869  0.134   -2.261  1.00 0.00 ? 16 ASP A HB3  9  
ATOM 8996  N N    . TYR A 1 17 ? -9.328  -3.262  -3.351  1.00 0.00 ? 17 TYR A N    9  
ATOM 8997  C CA   . TYR A 1 17 ? -9.133  -4.551  -2.698  1.00 0.00 ? 17 TYR A CA   9  
ATOM 8998  C C    . TYR A 1 17 ? -7.704  -5.049  -2.891  1.00 0.00 ? 17 TYR A C    9  
ATOM 8999  O O    . TYR A 1 17 ? -7.043  -5.455  -1.936  1.00 0.00 ? 17 TYR A O    9  
ATOM 9000  C CB   . TYR A 1 17 ? -10.122 -5.580  -3.249  1.00 0.00 ? 17 TYR A CB   9  
ATOM 9001  C CG   . TYR A 1 17 ? -9.710  -7.013  -2.996  1.00 0.00 ? 17 TYR A CG   9  
ATOM 9002  C CD1  . TYR A 1 17 ? -9.239  -7.411  -1.751  1.00 0.00 ? 17 TYR A CD1  9  
ATOM 9003  C CD2  . TYR A 1 17 ? -9.790  -7.968  -4.002  1.00 0.00 ? 17 TYR A CD2  9  
ATOM 9004  C CE1  . TYR A 1 17 ? -8.860  -8.718  -1.515  1.00 0.00 ? 17 TYR A CE1  9  
ATOM 9005  C CE2  . TYR A 1 17 ? -9.415  -9.278  -3.774  1.00 0.00 ? 17 TYR A CE2  9  
ATOM 9006  C CZ   . TYR A 1 17 ? -8.951  -9.648  -2.529  1.00 0.00 ? 17 TYR A CZ   9  
ATOM 9007  O OH   . TYR A 1 17 ? -8.575  -10.952 -2.299  1.00 0.00 ? 17 TYR A OH   9  
ATOM 9008  H H    . TYR A 1 17 ? -10.050 -3.163  -4.006  1.00 0.00 ? 17 TYR A H    9  
ATOM 9009  H HA   . TYR A 1 17 ? -9.317  -4.420  -1.642  1.00 0.00 ? 17 TYR A HA   9  
ATOM 9010  H HB2  . TYR A 1 17 ? -11.086 -5.427  -2.788  1.00 0.00 ? 17 TYR A HB2  9  
ATOM 9011  H HB3  . TYR A 1 17 ? -10.214 -5.445  -4.317  1.00 0.00 ? 17 TYR A HB3  9  
ATOM 9012  H HD1  . TYR A 1 17 ? -9.169  -6.680  -0.958  1.00 0.00 ? 17 TYR A HD1  9  
ATOM 9013  H HD2  . TYR A 1 17 ? -10.154 -7.674  -4.976  1.00 0.00 ? 17 TYR A HD2  9  
ATOM 9014  H HE1  . TYR A 1 17 ? -8.497  -9.008  -0.540  1.00 0.00 ? 17 TYR A HE1  9  
ATOM 9015  H HE2  . TYR A 1 17 ? -9.486  -10.006 -4.569  1.00 0.00 ? 17 TYR A HE2  9  
ATOM 9016  H HH   . TYR A 1 17 ? -8.639  -11.142 -1.360  1.00 0.00 ? 17 TYR A HH   9  
ATOM 9017  N N    . GLN A 1 18 ? -7.235  -5.013  -4.134  1.00 0.00 ? 18 GLN A N    9  
ATOM 9018  C CA   . GLN A 1 18 ? -5.884  -5.461  -4.453  1.00 0.00 ? 18 GLN A CA   9  
ATOM 9019  C C    . GLN A 1 18 ? -4.846  -4.468  -3.939  1.00 0.00 ? 18 GLN A C    9  
ATOM 9020  O O    . GLN A 1 18 ? -3.919  -4.840  -3.218  1.00 0.00 ? 18 GLN A O    9  
ATOM 9021  C CB   . GLN A 1 18 ? -5.728  -5.643  -5.964  1.00 0.00 ? 18 GLN A CB   9  
ATOM 9022  C CG   . GLN A 1 18 ? -6.728  -6.618  -6.565  1.00 0.00 ? 18 GLN A CG   9  
ATOM 9023  C CD   . GLN A 1 18 ? -6.183  -7.336  -7.784  1.00 0.00 ? 18 GLN A CD   9  
ATOM 9024  O OE1  . GLN A 1 18 ? -5.710  -6.706  -8.730  1.00 0.00 ? 18 GLN A OE1  9  
ATOM 9025  N NE2  . GLN A 1 18 ? -6.245  -8.662  -7.767  1.00 0.00 ? 18 GLN A NE2  9  
ATOM 9026  H H    . GLN A 1 18 ? -7.810  -4.679  -4.853  1.00 0.00 ? 18 GLN A H    9  
ATOM 9027  H HA   . GLN A 1 18 ? -5.726  -6.411  -3.967  1.00 0.00 ? 18 GLN A HA   9  
ATOM 9028  H HB2  . GLN A 1 18 ? -5.857  -4.686  -6.445  1.00 0.00 ? 18 GLN A HB2  9  
ATOM 9029  H HB3  . GLN A 1 18 ? -4.733  -6.010  -6.169  1.00 0.00 ? 18 GLN A HB3  9  
ATOM 9030  H HG2  . GLN A 1 18 ? -6.987  -7.354  -5.819  1.00 0.00 ? 18 GLN A HG2  9  
ATOM 9031  H HG3  . GLN A 1 18 ? -7.614  -6.072  -6.853  1.00 0.00 ? 18 GLN A HG3  9  
ATOM 9032  H HE21 . GLN A 1 18 ? -6.636  -9.097  -6.980  1.00 0.00 ? 18 GLN A HE21 9  
ATOM 9033  H HE22 . GLN A 1 18 ? -5.900  -9.152  -8.542  1.00 0.00 ? 18 GLN A HE22 9  
ATOM 9034  N N    . LEU A 1 19 ? -5.008  -3.204  -4.315  1.00 0.00 ? 19 LEU A N    9  
ATOM 9035  C CA   . LEU A 1 19 ? -4.084  -2.157  -3.892  1.00 0.00 ? 19 LEU A CA   9  
ATOM 9036  C C    . LEU A 1 19 ? -3.951  -2.129  -2.373  1.00 0.00 ? 19 LEU A C    9  
ATOM 9037  O O    . LEU A 1 19 ? -2.912  -1.741  -1.838  1.00 0.00 ? 19 LEU A O    9  
ATOM 9038  C CB   . LEU A 1 19 ? -4.561  -0.794  -4.399  1.00 0.00 ? 19 LEU A CB   9  
ATOM 9039  C CG   . LEU A 1 19 ? -4.465  -0.569  -5.908  1.00 0.00 ? 19 LEU A CG   9  
ATOM 9040  C CD1  . LEU A 1 19 ? -5.184  0.712   -6.303  1.00 0.00 ? 19 LEU A CD1  9  
ATOM 9041  C CD2  . LEU A 1 19 ? -3.009  -0.522  -6.349  1.00 0.00 ? 19 LEU A CD2  9  
ATOM 9042  H H    . LEU A 1 19 ? -5.765  -2.968  -4.889  1.00 0.00 ? 19 LEU A H    9  
ATOM 9043  H HA   . LEU A 1 19 ? -3.118  -2.374  -4.322  1.00 0.00 ? 19 LEU A HA   9  
ATOM 9044  H HB2  . LEU A 1 19 ? -5.595  -0.678  -4.112  1.00 0.00 ? 19 LEU A HB2  9  
ATOM 9045  H HB3  . LEU A 1 19 ? -3.966  -0.035  -3.911  1.00 0.00 ? 19 LEU A HB3  9  
ATOM 9046  H HG   . LEU A 1 19 ? -4.945  -1.392  -6.420  1.00 0.00 ? 19 LEU A HG   9  
ATOM 9047  H HD11 . LEU A 1 19 ? -5.270  0.760   -7.378  1.00 0.00 ? 19 LEU A HD11 9  
ATOM 9048  H HD12 . LEU A 1 19 ? -4.623  1.564   -5.948  1.00 0.00 ? 19 LEU A HD12 9  
ATOM 9049  H HD13 . LEU A 1 19 ? -6.170  0.722   -5.861  1.00 0.00 ? 19 LEU A HD13 9  
ATOM 9050  H HD21 . LEU A 1 19 ? -2.690  0.506   -6.429  1.00 0.00 ? 19 LEU A HD21 9  
ATOM 9051  H HD22 . LEU A 1 19 ? -2.909  -1.006  -7.310  1.00 0.00 ? 19 LEU A HD22 9  
ATOM 9052  H HD23 . LEU A 1 19 ? -2.397  -1.034  -5.622  1.00 0.00 ? 19 LEU A HD23 9  
ATOM 9053  N N    . ARG A 1 20 ? -5.008  -2.545  -1.683  1.00 0.00 ? 20 ARG A N    9  
ATOM 9054  C CA   . ARG A 1 20 ? -5.009  -2.569  -0.226  1.00 0.00 ? 20 ARG A CA   9  
ATOM 9055  C C    . ARG A 1 20 ? -3.989  -3.574  0.302   1.00 0.00 ? 20 ARG A C    9  
ATOM 9056  O O    . ARG A 1 20 ? -3.212  -3.269  1.207   1.00 0.00 ? 20 ARG A O    9  
ATOM 9057  C CB   . ARG A 1 20 ? -6.403  -2.917  0.299   1.00 0.00 ? 20 ARG A CB   9  
ATOM 9058  C CG   . ARG A 1 20 ? -6.519  -2.846  1.813   1.00 0.00 ? 20 ARG A CG   9  
ATOM 9059  C CD   . ARG A 1 20 ? -5.964  -4.099  2.473   1.00 0.00 ? 20 ARG A CD   9  
ATOM 9060  N NE   . ARG A 1 20 ? -6.578  -4.350  3.774   1.00 0.00 ? 20 ARG A NE   9  
ATOM 9061  C CZ   . ARG A 1 20 ? -6.204  -3.741  4.893   1.00 0.00 ? 20 ARG A CZ   9  
ATOM 9062  N NH1  . ARG A 1 20 ? -5.224  -2.849  4.870   1.00 0.00 ? 20 ARG A NH1  9  
ATOM 9063  N NH2  . ARG A 1 20 ? -6.812  -4.023  6.039   1.00 0.00 ? 20 ARG A NH2  9  
ATOM 9064  H H    . ARG A 1 20 ? -5.807  -2.843  -2.166  1.00 0.00 ? 20 ARG A H    9  
ATOM 9065  H HA   . ARG A 1 20 ? -4.739  -1.583  0.122   1.00 0.00 ? 20 ARG A HA   9  
ATOM 9066  H HB2  . ARG A 1 20 ? -7.118  -2.228  -0.126  1.00 0.00 ? 20 ARG A HB2  9  
ATOM 9067  H HB3  . ARG A 1 20 ? -6.652  -3.920  -0.013  1.00 0.00 ? 20 ARG A HB3  9  
ATOM 9068  H HG2  . ARG A 1 20 ? -5.964  -1.990  2.168   1.00 0.00 ? 20 ARG A HG2  9  
ATOM 9069  H HG3  . ARG A 1 20 ? -7.559  -2.740  2.081   1.00 0.00 ? 20 ARG A HG3  9  
ATOM 9070  H HD2  . ARG A 1 20 ? -6.153  -4.944  1.828   1.00 0.00 ? 20 ARG A HD2  9  
ATOM 9071  H HD3  . ARG A 1 20 ? -4.899  -3.978  2.605   1.00 0.00 ? 20 ARG A HD3  9  
ATOM 9072  H HE   . ARG A 1 20 ? -7.305  -5.006  3.814   1.00 0.00 ? 20 ARG A HE   9  
ATOM 9073  H HH11 . ARG A 1 20 ? -4.765  -2.633  4.009   1.00 0.00 ? 20 ARG A HH11 9  
ATOM 9074  H HH12 . ARG A 1 20 ? -4.945  -2.390  5.715   1.00 0.00 ? 20 ARG A HH12 9  
ATOM 9075  H HH21 . ARG A 1 20 ? -7.551  -4.695  6.060   1.00 0.00 ? 20 ARG A HH21 9  
ATOM 9076  H HH22 . ARG A 1 20 ? -6.529  -3.564  6.881   1.00 0.00 ? 20 ARG A HH22 9  
ATOM 9077  N N    . VAL A 1 21 ? -3.999  -4.774  -0.269  1.00 0.00 ? 21 VAL A N    9  
ATOM 9078  C CA   . VAL A 1 21 ? -3.075  -5.824  0.144   1.00 0.00 ? 21 VAL A CA   9  
ATOM 9079  C C    . VAL A 1 21 ? -1.661  -5.535  -0.346  1.00 0.00 ? 21 VAL A C    9  
ATOM 9080  O O    . VAL A 1 21 ? -0.687  -5.730  0.383   1.00 0.00 ? 21 VAL A O    9  
ATOM 9081  C CB   . VAL A 1 21 ? -3.519  -7.201  -0.385  1.00 0.00 ? 21 VAL A CB   9  
ATOM 9082  C CG1  . VAL A 1 21 ? -2.519  -8.275  0.016   1.00 0.00 ? 21 VAL A CG1  9  
ATOM 9083  C CG2  . VAL A 1 21 ? -4.912  -7.542  0.121   1.00 0.00 ? 21 VAL A CG2  9  
ATOM 9084  H H    . VAL A 1 21 ? -4.642  -4.958  -0.985  1.00 0.00 ? 21 VAL A H    9  
ATOM 9085  H HA   . VAL A 1 21 ? -3.071  -5.861  1.223   1.00 0.00 ? 21 VAL A HA   9  
ATOM 9086  H HB   . VAL A 1 21 ? -3.551  -7.157  -1.464  1.00 0.00 ? 21 VAL A HB   9  
ATOM 9087  H HG11 . VAL A 1 21 ? -2.651  -9.143  -0.613  1.00 0.00 ? 21 VAL A HG11 9  
ATOM 9088  H HG12 . VAL A 1 21 ? -1.515  -7.894  -0.100  1.00 0.00 ? 21 VAL A HG12 9  
ATOM 9089  H HG13 . VAL A 1 21 ? -2.682  -8.551  1.048   1.00 0.00 ? 21 VAL A HG13 9  
ATOM 9090  H HG21 . VAL A 1 21 ? -4.837  -8.004  1.094   1.00 0.00 ? 21 VAL A HG21 9  
ATOM 9091  H HG22 . VAL A 1 21 ? -5.500  -6.639  0.195   1.00 0.00 ? 21 VAL A HG22 9  
ATOM 9092  H HG23 . VAL A 1 21 ? -5.388  -8.225  -0.566  1.00 0.00 ? 21 VAL A HG23 9  
ATOM 9093  N N    . LEU A 1 22 ? -1.554  -5.070  -1.586  1.00 0.00 ? 22 LEU A N    9  
ATOM 9094  C CA   . LEU A 1 22 ? -0.257  -4.753  -2.175  1.00 0.00 ? 22 LEU A CA   9  
ATOM 9095  C C    . LEU A 1 22 ? 0.406   -3.593  -1.439  1.00 0.00 ? 22 LEU A C    9  
ATOM 9096  O O    . LEU A 1 22 ? 1.589   -3.654  -1.105  1.00 0.00 ? 22 LEU A O    9  
ATOM 9097  C CB   . LEU A 1 22 ? -0.419  -4.406  -3.656  1.00 0.00 ? 22 LEU A CB   9  
ATOM 9098  C CG   . LEU A 1 22 ? -0.965  -5.519  -4.550  1.00 0.00 ? 22 LEU A CG   9  
ATOM 9099  C CD1  . LEU A 1 22 ? -1.371  -4.964  -5.906  1.00 0.00 ? 22 LEU A CD1  9  
ATOM 9100  C CD2  . LEU A 1 22 ? 0.066   -6.627  -4.713  1.00 0.00 ? 22 LEU A CD2  9  
ATOM 9101  H H    . LEU A 1 22 ? -2.365  -4.936  -2.119  1.00 0.00 ? 22 LEU A H    9  
ATOM 9102  H HA   . LEU A 1 22 ? 0.370   -5.627  -2.084  1.00 0.00 ? 22 LEU A HA   9  
ATOM 9103  H HB2  . LEU A 1 22 ? -1.091  -3.565  -3.727  1.00 0.00 ? 22 LEU A HB2  9  
ATOM 9104  H HB3  . LEU A 1 22 ? 0.552   -4.121  -4.036  1.00 0.00 ? 22 LEU A HB3  9  
ATOM 9105  H HG   . LEU A 1 22 ? -1.845  -5.945  -4.087  1.00 0.00 ? 22 LEU A HG   9  
ATOM 9106  H HD11 . LEU A 1 22 ? -2.402  -4.646  -5.871  1.00 0.00 ? 22 LEU A HD11 9  
ATOM 9107  H HD12 . LEU A 1 22 ? -1.256  -5.730  -6.658  1.00 0.00 ? 22 LEU A HD12 9  
ATOM 9108  H HD13 . LEU A 1 22 ? -0.742  -4.121  -6.153  1.00 0.00 ? 22 LEU A HD13 9  
ATOM 9109  H HD21 . LEU A 1 22 ? 0.156   -7.173  -3.785  1.00 0.00 ? 22 LEU A HD21 9  
ATOM 9110  H HD22 . LEU A 1 22 ? 1.022   -6.194  -4.970  1.00 0.00 ? 22 LEU A HD22 9  
ATOM 9111  H HD23 . LEU A 1 22 ? -0.249  -7.299  -5.497  1.00 0.00 ? 22 LEU A HD23 9  
ATOM 9112  N N    . GLN A 1 23 ? -0.365  -2.540  -1.188  1.00 0.00 ? 23 GLN A N    9  
ATOM 9113  C CA   . GLN A 1 23 ? 0.149   -1.367  -0.490  1.00 0.00 ? 23 GLN A CA   9  
ATOM 9114  C C    . GLN A 1 23 ? 0.416   -1.681  0.978   1.00 0.00 ? 23 GLN A C    9  
ATOM 9115  O O    . GLN A 1 23 ? 1.412   -1.235  1.548   1.00 0.00 ? 23 GLN A O    9  
ATOM 9116  C CB   . GLN A 1 23 ? -0.841  -0.206  -0.603  1.00 0.00 ? 23 GLN A CB   9  
ATOM 9117  C CG   . GLN A 1 23 ? -0.239  1.144   -0.246  1.00 0.00 ? 23 GLN A CG   9  
ATOM 9118  C CD   . GLN A 1 23 ? 0.722   1.652   -1.303  1.00 0.00 ? 23 GLN A CD   9  
ATOM 9119  O OE1  . GLN A 1 23 ? 0.318   2.313   -2.260  1.00 0.00 ? 23 GLN A OE1  9  
ATOM 9120  N NE2  . GLN A 1 23 ? 2.003   1.345   -1.135  1.00 0.00 ? 23 GLN A NE2  9  
ATOM 9121  H H    . GLN A 1 23 ? -1.300  -2.551  -1.479  1.00 0.00 ? 23 GLN A H    9  
ATOM 9122  H HA   . GLN A 1 23 ? 1.078   -1.083  -0.959  1.00 0.00 ? 23 GLN A HA   9  
ATOM 9123  H HB2  . GLN A 1 23 ? -1.205  -0.157  -1.618  1.00 0.00 ? 23 GLN A HB2  9  
ATOM 9124  H HB3  . GLN A 1 23 ? -1.672  -0.391  0.060   1.00 0.00 ? 23 GLN A HB3  9  
ATOM 9125  H HG2  . GLN A 1 23 ? -1.038  1.861   -0.134  1.00 0.00 ? 23 GLN A HG2  9  
ATOM 9126  H HG3  . GLN A 1 23 ? 0.293   1.049   0.689   1.00 0.00 ? 23 GLN A HG3  9  
ATOM 9127  H HE21 . GLN A 1 23 ? 2.252   0.814   -0.349  1.00 0.00 ? 23 GLN A HE21 9  
ATOM 9128  H HE22 . GLN A 1 23 ? 2.646   1.660   -1.803  1.00 0.00 ? 23 GLN A HE22 9  
ATOM 9129  N N    . ASP A 1 24 ? -0.480  -2.452  1.586   1.00 0.00 ? 24 ASP A N    9  
ATOM 9130  C CA   . ASP A 1 24 ? -0.340  -2.826  2.988   1.00 0.00 ? 24 ASP A CA   9  
ATOM 9131  C C    . ASP A 1 24 ? 0.926   -3.648  3.208   1.00 0.00 ? 24 ASP A C    9  
ATOM 9132  O O    . ASP A 1 24 ? 1.641   -3.456  4.192   1.00 0.00 ? 24 ASP A O    9  
ATOM 9133  C CB   . ASP A 1 24 ? -1.564  -3.619  3.451   1.00 0.00 ? 24 ASP A CB   9  
ATOM 9134  C CG   . ASP A 1 24 ? -1.464  -4.044  4.903   1.00 0.00 ? 24 ASP A CG   9  
ATOM 9135  O OD1  . ASP A 1 24 ? -1.406  -3.155  5.778   1.00 0.00 ? 24 ASP A OD1  9  
ATOM 9136  O OD2  . ASP A 1 24 ? -1.444  -5.265  5.163   1.00 0.00 ? 24 ASP A OD2  9  
ATOM 9137  H H    . ASP A 1 24 ? -1.253  -2.777  1.079   1.00 0.00 ? 24 ASP A H    9  
ATOM 9138  H HA   . ASP A 1 24 ? -0.270  -1.919  3.569   1.00 0.00 ? 24 ASP A HA   9  
ATOM 9139  H HB2  . ASP A 1 24 ? -2.446  -3.006  3.334   1.00 0.00 ? 24 ASP A HB2  9  
ATOM 9140  H HB3  . ASP A 1 24 ? -1.663  -4.505  2.841   1.00 0.00 ? 24 ASP A HB3  9  
ATOM 9141  N N    . PHE A 1 25 ? 1.197   -4.566  2.285   1.00 0.00 ? 25 PHE A N    9  
ATOM 9142  C CA   . PHE A 1 25 ? 2.376   -5.419  2.379   1.00 0.00 ? 25 PHE A CA   9  
ATOM 9143  C C    . PHE A 1 25 ? 3.649   -4.619  2.117   1.00 0.00 ? 25 PHE A C    9  
ATOM 9144  O O    . PHE A 1 25 ? 4.724   -4.961  2.610   1.00 0.00 ? 25 PHE A O    9  
ATOM 9145  C CB   . PHE A 1 25 ? 2.274   -6.577  1.383   1.00 0.00 ? 25 PHE A CB   9  
ATOM 9146  C CG   . PHE A 1 25 ? 3.294   -7.655  1.612   1.00 0.00 ? 25 PHE A CG   9  
ATOM 9147  C CD1  . PHE A 1 25 ? 4.637   -7.421  1.366   1.00 0.00 ? 25 PHE A CD1  9  
ATOM 9148  C CD2  . PHE A 1 25 ? 2.909   -8.904  2.073   1.00 0.00 ? 25 PHE A CD2  9  
ATOM 9149  C CE1  . PHE A 1 25 ? 5.578   -8.411  1.576   1.00 0.00 ? 25 PHE A CE1  9  
ATOM 9150  C CE2  . PHE A 1 25 ? 3.846   -9.898  2.286   1.00 0.00 ? 25 PHE A CE2  9  
ATOM 9151  C CZ   . PHE A 1 25 ? 5.181   -9.652  2.036   1.00 0.00 ? 25 PHE A CZ   9  
ATOM 9152  H H    . PHE A 1 25 ? 0.589   -4.672  1.523   1.00 0.00 ? 25 PHE A H    9  
ATOM 9153  H HA   . PHE A 1 25 ? 2.416   -5.818  3.380   1.00 0.00 ? 25 PHE A HA   9  
ATOM 9154  H HB2  . PHE A 1 25 ? 1.295   -7.024  1.462   1.00 0.00 ? 25 PHE A HB2  9  
ATOM 9155  H HB3  . PHE A 1 25 ? 2.412   -6.195  0.383   1.00 0.00 ? 25 PHE A HB3  9  
ATOM 9156  H HD1  . PHE A 1 25 ? 4.949   -6.450  1.006   1.00 0.00 ? 25 PHE A HD1  9  
ATOM 9157  H HD2  . PHE A 1 25 ? 1.865   -9.099  2.268   1.00 0.00 ? 25 PHE A HD2  9  
ATOM 9158  H HE1  . PHE A 1 25 ? 6.622   -8.215  1.380   1.00 0.00 ? 25 PHE A HE1  9  
ATOM 9159  H HE2  . PHE A 1 25 ? 3.533   -10.867 2.645   1.00 0.00 ? 25 PHE A HE2  9  
ATOM 9160  H HZ   . PHE A 1 25 ? 5.915   -10.427 2.201   1.00 0.00 ? 25 PHE A HZ   9  
ATOM 9161  N N    . PHE A 1 26 ? 3.519   -3.551  1.336   1.00 0.00 ? 26 PHE A N    9  
ATOM 9162  C CA   . PHE A 1 26 ? 4.658   -2.702  1.006   1.00 0.00 ? 26 PHE A CA   9  
ATOM 9163  C C    . PHE A 1 26 ? 5.044   -1.824  2.193   1.00 0.00 ? 26 PHE A C    9  
ATOM 9164  O O    . PHE A 1 26 ? 6.213   -1.754  2.573   1.00 0.00 ? 26 PHE A O    9  
ATOM 9165  C CB   . PHE A 1 26 ? 4.334   -1.827  -0.206  1.00 0.00 ? 26 PHE A CB   9  
ATOM 9166  C CG   . PHE A 1 26 ? 5.427   -0.856  -0.553  1.00 0.00 ? 26 PHE A CG   9  
ATOM 9167  C CD1  . PHE A 1 26 ? 5.560   0.335   0.143   1.00 0.00 ? 26 PHE A CD1  9  
ATOM 9168  C CD2  . PHE A 1 26 ? 6.320   -1.133  -1.575  1.00 0.00 ? 26 PHE A CD2  9  
ATOM 9169  C CE1  . PHE A 1 26 ? 6.564   1.230   -0.175  1.00 0.00 ? 26 PHE A CE1  9  
ATOM 9170  C CE2  . PHE A 1 26 ? 7.326   -0.242  -1.897  1.00 0.00 ? 26 PHE A CE2  9  
ATOM 9171  C CZ   . PHE A 1 26 ? 7.448   0.941   -1.195  1.00 0.00 ? 26 PHE A CZ   9  
ATOM 9172  H H    . PHE A 1 26 ? 2.636   -3.329  0.972   1.00 0.00 ? 26 PHE A H    9  
ATOM 9173  H HA   . PHE A 1 26 ? 5.490   -3.345  0.763   1.00 0.00 ? 26 PHE A HA   9  
ATOM 9174  H HB2  . PHE A 1 26 ? 4.169   -2.460  -1.065  1.00 0.00 ? 26 PHE A HB2  9  
ATOM 9175  H HB3  . PHE A 1 26 ? 3.438   -1.261  -0.004  1.00 0.00 ? 26 PHE A HB3  9  
ATOM 9176  H HD1  . PHE A 1 26 ? 4.870   0.562   0.942   1.00 0.00 ? 26 PHE A HD1  9  
ATOM 9177  H HD2  . PHE A 1 26 ? 6.225   -2.059  -2.125  1.00 0.00 ? 26 PHE A HD2  9  
ATOM 9178  H HE1  . PHE A 1 26 ? 6.658   2.154   0.376   1.00 0.00 ? 26 PHE A HE1  9  
ATOM 9179  H HE2  . PHE A 1 26 ? 8.016   -0.471  -2.696  1.00 0.00 ? 26 PHE A HE2  9  
ATOM 9180  H HZ   . PHE A 1 26 ? 8.233   1.639   -1.446  1.00 0.00 ? 26 PHE A HZ   9  
ATOM 9181  N N    . ASP A 1 27 ? 4.053   -1.156  2.773   1.00 0.00 ? 27 ASP A N    9  
ATOM 9182  C CA   . ASP A 1 27 ? 4.288   -0.283  3.918   1.00 0.00 ? 27 ASP A CA   9  
ATOM 9183  C C    . ASP A 1 27 ? 5.039   -1.022  5.021   1.00 0.00 ? 27 ASP A C    9  
ATOM 9184  O O    . ASP A 1 27 ? 5.777   -0.415  5.796   1.00 0.00 ? 27 ASP A O    9  
ATOM 9185  C CB   . ASP A 1 27 ? 2.961   0.252   4.458   1.00 0.00 ? 27 ASP A CB   9  
ATOM 9186  C CG   . ASP A 1 27 ? 3.137   1.511   5.284   1.00 0.00 ? 27 ASP A CG   9  
ATOM 9187  O OD1  . ASP A 1 27 ? 3.386   1.391   6.502   1.00 0.00 ? 27 ASP A OD1  9  
ATOM 9188  O OD2  . ASP A 1 27 ? 3.026   2.616   4.713   1.00 0.00 ? 27 ASP A OD2  9  
ATOM 9189  H H    . ASP A 1 27 ? 3.142   -1.254  2.425   1.00 0.00 ? 27 ASP A H    9  
ATOM 9190  H HA   . ASP A 1 27 ? 4.890   0.547   3.583   1.00 0.00 ? 27 ASP A HA   9  
ATOM 9191  H HB2  . ASP A 1 27 ? 2.306   0.478   3.628   1.00 0.00 ? 27 ASP A HB2  9  
ATOM 9192  H HB3  . ASP A 1 27 ? 2.501   -0.503  5.078   1.00 0.00 ? 27 ASP A HB3  9  
ATOM 9193  N N    . ALA A 1 28 ? 4.845   -2.335  5.084   1.00 0.00 ? 28 ALA A N    9  
ATOM 9194  C CA   . ALA A 1 28 ? 5.505   -3.157  6.091   1.00 0.00 ? 28 ALA A CA   9  
ATOM 9195  C C    . ALA A 1 28 ? 6.768   -3.802  5.532   1.00 0.00 ? 28 ALA A C    9  
ATOM 9196  O O    . ALA A 1 28 ? 7.798   -3.857  6.203   1.00 0.00 ? 28 ALA A O    9  
ATOM 9197  C CB   . ALA A 1 28 ? 4.551   -4.223  6.610   1.00 0.00 ? 28 ALA A CB   9  
ATOM 9198  H H    . ALA A 1 28 ? 4.245   -2.762  4.438   1.00 0.00 ? 28 ALA A H    9  
ATOM 9199  H HA   . ALA A 1 28 ? 5.775   -2.517  6.919   1.00 0.00 ? 28 ALA A HA   9  
ATOM 9200  H HB1  . ALA A 1 28 ? 4.113   -4.750  5.775   1.00 0.00 ? 28 ALA A HB1  9  
ATOM 9201  H HB2  . ALA A 1 28 ? 5.094   -4.920  7.231   1.00 0.00 ? 28 ALA A HB2  9  
ATOM 9202  H HB3  . ALA A 1 28 ? 3.770   -3.755  7.191   1.00 0.00 ? 28 ALA A HB3  9  
ATOM 9203  N N    . ASN A 1 29 ? 6.682   -4.290  4.298   1.00 0.00 ? 29 ASN A N    9  
ATOM 9204  C CA   . ASN A 1 29 ? 7.819   -4.932  3.649   1.00 0.00 ? 29 ASN A CA   9  
ATOM 9205  C C    . ASN A 1 29 ? 7.812   -4.663  2.148   1.00 0.00 ? 29 ASN A C    9  
ATOM 9206  O O    . ASN A 1 29 ? 6.828   -4.939  1.462   1.00 0.00 ? 29 ASN A O    9  
ATOM 9207  C CB   . ASN A 1 29 ? 7.795   -6.440  3.908   1.00 0.00 ? 29 ASN A CB   9  
ATOM 9208  C CG   . ASN A 1 29 ? 9.107   -7.109  3.547   1.00 0.00 ? 29 ASN A CG   9  
ATOM 9209  O OD1  . ASN A 1 29 ? 10.180  -6.649  3.937   1.00 0.00 ? 29 ASN A OD1  9  
ATOM 9210  N ND2  . ASN A 1 29 ? 9.026   -8.202  2.796   1.00 0.00 ? 29 ASN A ND2  9  
ATOM 9211  H H    . ASN A 1 29 ? 5.834   -4.216  3.813   1.00 0.00 ? 29 ASN A H    9  
ATOM 9212  H HA   . ASN A 1 29 ? 8.720   -4.517  4.074   1.00 0.00 ? 29 ASN A HA   9  
ATOM 9213  H HB2  . ASN A 1 29 ? 7.600   -6.616  4.956   1.00 0.00 ? 29 ASN A HB2  9  
ATOM 9214  H HB3  . ASN A 1 29 ? 7.009   -6.888  3.320   1.00 0.00 ? 29 ASN A HB3  9  
ATOM 9215  H HD21 . ASN A 1 29 ? 8.138   -8.511  2.521   1.00 0.00 ? 29 ASN A HD21 9  
ATOM 9216  H HD22 . ASN A 1 29 ? 9.859   -8.655  2.548   1.00 0.00 ? 29 ASN A HD22 9  
ATOM 9217  N N    . ALA A 1 30 ? 8.916   -4.122  1.644   1.00 0.00 ? 30 ALA A N    9  
ATOM 9218  C CA   . ALA A 1 30 ? 9.038   -3.818  0.224   1.00 0.00 ? 30 ALA A CA   9  
ATOM 9219  C C    . ALA A 1 30 ? 10.212  -4.565  -0.399  1.00 0.00 ? 30 ALA A C    9  
ATOM 9220  O O    . ALA A 1 30 ? 10.606  -4.289  -1.533  1.00 0.00 ? 30 ALA A O    9  
ATOM 9221  C CB   . ALA A 1 30 ? 9.196   -2.318  0.017   1.00 0.00 ? 30 ALA A CB   9  
ATOM 9222  H H    . ALA A 1 30 ? 9.667   -3.925  2.241   1.00 0.00 ? 30 ALA A H    9  
ATOM 9223  H HA   . ALA A 1 30 ? 8.126   -4.130  -0.264  1.00 0.00 ? 30 ALA A HA   9  
ATOM 9224  H HB1  . ALA A 1 30 ? 9.433   -1.849  0.961   1.00 0.00 ? 30 ALA A HB1  9  
ATOM 9225  H HB2  . ALA A 1 30 ? 9.993   -2.134  -0.688  1.00 0.00 ? 30 ALA A HB2  9  
ATOM 9226  H HB3  . ALA A 1 30 ? 8.273   -1.909  -0.367  1.00 0.00 ? 30 ALA A HB3  9  
ATOM 9227  N N    . TYR A 1 31 ? 10.768  -5.512  0.349   1.00 0.00 ? 31 TYR A N    9  
ATOM 9228  C CA   . TYR A 1 31 ? 11.900  -6.298  -0.129  1.00 0.00 ? 31 TYR A CA   9  
ATOM 9229  C C    . TYR A 1 31 ? 11.690  -7.782  0.152   1.00 0.00 ? 31 TYR A C    9  
ATOM 9230  O O    . TYR A 1 31 ? 12.603  -8.498  0.564   1.00 0.00 ? 31 TYR A O    9  
ATOM 9231  C CB   . TYR A 1 31 ? 13.194  -5.820  0.531   1.00 0.00 ? 31 TYR A CB   9  
ATOM 9232  C CG   . TYR A 1 31 ? 13.263  -4.321  0.715   1.00 0.00 ? 31 TYR A CG   9  
ATOM 9233  C CD1  . TYR A 1 31 ? 13.244  -3.465  -0.379  1.00 0.00 ? 31 TYR A CD1  9  
ATOM 9234  C CD2  . TYR A 1 31 ? 13.347  -3.760  1.984   1.00 0.00 ? 31 TYR A CD2  9  
ATOM 9235  C CE1  . TYR A 1 31 ? 13.307  -2.095  -0.216  1.00 0.00 ? 31 TYR A CE1  9  
ATOM 9236  C CE2  . TYR A 1 31 ? 13.408  -2.391  2.156   1.00 0.00 ? 31 TYR A CE2  9  
ATOM 9237  C CZ   . TYR A 1 31 ? 13.389  -1.563  1.054   1.00 0.00 ? 31 TYR A CZ   9  
ATOM 9238  O OH   . TYR A 1 31 ? 13.452  -0.198  1.221   1.00 0.00 ? 31 TYR A OH   9  
ATOM 9239  H H    . TYR A 1 31 ? 10.410  -5.686  1.244   1.00 0.00 ? 31 TYR A H    9  
ATOM 9240  H HA   . TYR A 1 31 ? 11.977  -6.153  -1.197  1.00 0.00 ? 31 TYR A HA   9  
ATOM 9241  H HB2  . TYR A 1 31 ? 13.284  -6.277  1.504   1.00 0.00 ? 31 TYR A HB2  9  
ATOM 9242  H HB3  . TYR A 1 31 ? 14.033  -6.118  -0.080  1.00 0.00 ? 31 TYR A HB3  9  
ATOM 9243  H HD1  . TYR A 1 31 ? 13.180  -3.885  -1.373  1.00 0.00 ? 31 TYR A HD1  9  
ATOM 9244  H HD2  . TYR A 1 31 ? 13.362  -4.412  2.845   1.00 0.00 ? 31 TYR A HD2  9  
ATOM 9245  H HE1  . TYR A 1 31 ? 13.292  -1.446  -1.079  1.00 0.00 ? 31 TYR A HE1  9  
ATOM 9246  H HE2  . TYR A 1 31 ? 13.473  -1.974  3.150   1.00 0.00 ? 31 TYR A HE2  9  
ATOM 9247  H HH   . TYR A 1 31 ? 14.304  0.039   1.595   1.00 0.00 ? 31 TYR A HH   9  
ATOM 9248  N N    . PRO A 1 32 ? 10.457  -8.258  -0.075  1.00 0.00 ? 32 PRO A N    9  
ATOM 9249  C CA   . PRO A 1 32 ? 10.096  -9.662  0.145   1.00 0.00 ? 32 PRO A CA   9  
ATOM 9250  C C    . PRO A 1 32 ? 10.749  -10.594 -0.869  1.00 0.00 ? 32 PRO A C    9  
ATOM 9251  O O    . PRO A 1 32 ? 11.138  -10.170 -1.958  1.00 0.00 ? 32 PRO A O    9  
ATOM 9252  C CB   . PRO A 1 32 ? 8.575   -9.668  -0.024  1.00 0.00 ? 32 PRO A CB   9  
ATOM 9253  C CG   . PRO A 1 32 ? 8.287   -8.502  -0.905  1.00 0.00 ? 32 PRO A CG   9  
ATOM 9254  C CD   . PRO A 1 32 ? 9.319   -7.462  -0.566  1.00 0.00 ? 32 PRO A CD   9  
ATOM 9255  H HA   . PRO A 1 32 ? 10.350  -9.984  1.144   1.00 0.00 ? 32 PRO A HA   9  
ATOM 9256  H HB2  . PRO A 1 32 ? 8.265   -10.597 -0.483  1.00 0.00 ? 32 PRO A HB2  9  
ATOM 9257  H HB3  . PRO A 1 32 ? 8.101   -9.561  0.940   1.00 0.00 ? 32 PRO A HB3  9  
ATOM 9258  H HG2  . PRO A 1 32 ? 8.374   -8.793  -1.941  1.00 0.00 ? 32 PRO A HG2  9  
ATOM 9259  H HG3  . PRO A 1 32 ? 7.295   -8.125  -0.702  1.00 0.00 ? 32 PRO A HG3  9  
ATOM 9260  H HD2  . PRO A 1 32 ? 9.593   -6.901  -1.447  1.00 0.00 ? 32 PRO A HD2  9  
ATOM 9261  H HD3  . PRO A 1 32 ? 8.950   -6.802  0.205   1.00 0.00 ? 32 PRO A HD3  9  
ATOM 9262  N N    . LYS A 1 33 ? 10.867  -11.867 -0.506  1.00 0.00 ? 33 LYS A N    9  
ATOM 9263  C CA   . LYS A 1 33 ? 11.471  -12.861 -1.385  1.00 0.00 ? 33 LYS A CA   9  
ATOM 9264  C C    . LYS A 1 33 ? 10.404  -13.599 -2.187  1.00 0.00 ? 33 LYS A C    9  
ATOM 9265  O O    . LYS A 1 33 ? 9.211   -13.480 -1.908  1.00 0.00 ? 33 LYS A O    9  
ATOM 9266  C CB   . LYS A 1 33 ? 12.293  -13.861 -0.569  1.00 0.00 ? 33 LYS A CB   9  
ATOM 9267  C CG   . LYS A 1 33 ? 13.473  -13.233 0.153   1.00 0.00 ? 33 LYS A CG   9  
ATOM 9268  C CD   . LYS A 1 33 ? 14.538  -14.264 0.485   1.00 0.00 ? 33 LYS A CD   9  
ATOM 9269  C CE   . LYS A 1 33 ? 14.158  -15.083 1.709   1.00 0.00 ? 33 LYS A CE   9  
ATOM 9270  N NZ   . LYS A 1 33 ? 15.221  -16.058 2.076   1.00 0.00 ? 33 LYS A NZ   9  
ATOM 9271  H H    . LYS A 1 33 ? 10.537  -12.145 0.375   1.00 0.00 ? 33 LYS A H    9  
ATOM 9272  H HA   . LYS A 1 33 ? 12.125  -12.344 -2.070  1.00 0.00 ? 33 LYS A HA   9  
ATOM 9273  H HB2  . LYS A 1 33 ? 11.651  -14.321 0.168   1.00 0.00 ? 33 LYS A HB2  9  
ATOM 9274  H HB3  . LYS A 1 33 ? 12.670  -14.626 -1.233  1.00 0.00 ? 33 LYS A HB3  9  
ATOM 9275  H HG2  . LYS A 1 33 ? 13.908  -12.473 -0.480  1.00 0.00 ? 33 LYS A HG2  9  
ATOM 9276  H HG3  . LYS A 1 33 ? 13.123  -12.781 1.070   1.00 0.00 ? 33 LYS A HG3  9  
ATOM 9277  H HD2  . LYS A 1 33 ? 14.656  -14.931 -0.357  1.00 0.00 ? 33 LYS A HD2  9  
ATOM 9278  H HD3  . LYS A 1 33 ? 15.472  -13.756 0.677   1.00 0.00 ? 33 LYS A HD3  9  
ATOM 9279  H HE2  . LYS A 1 33 ? 13.996  -14.411 2.539   1.00 0.00 ? 33 LYS A HE2  9  
ATOM 9280  H HE3  . LYS A 1 33 ? 13.245  -15.620 1.498   1.00 0.00 ? 33 LYS A HE3  9  
ATOM 9281  H HZ1  . LYS A 1 33 ? 15.927  -16.120 1.314   1.00 0.00 ? 33 LYS A HZ1  9  
ATOM 9282  H HZ2  . LYS A 1 33 ? 14.806  -17.000 2.226   1.00 0.00 ? 33 LYS A HZ2  9  
ATOM 9283  H HZ3  . LYS A 1 33 ? 15.697  -15.758 2.951   1.00 0.00 ? 33 LYS A HZ3  9  
ATOM 9284  N N    . ASP A 1 34 ? 10.840  -14.363 -3.182  1.00 0.00 ? 34 ASP A N    9  
ATOM 9285  C CA   . ASP A 1 34 ? 9.922   -15.123 -4.022  1.00 0.00 ? 34 ASP A CA   9  
ATOM 9286  C C    . ASP A 1 34 ? 8.859   -15.816 -3.177  1.00 0.00 ? 34 ASP A C    9  
ATOM 9287  O O    . ASP A 1 34 ? 7.665   -15.715 -3.458  1.00 0.00 ? 34 ASP A O    9  
ATOM 9288  C CB   . ASP A 1 34 ? 10.690  -16.157 -4.848  1.00 0.00 ? 34 ASP A CB   9  
ATOM 9289  C CG   . ASP A 1 34 ? 11.673  -16.951 -4.011  1.00 0.00 ? 34 ASP A CG   9  
ATOM 9290  O OD1  . ASP A 1 34 ? 12.736  -16.398 -3.660  1.00 0.00 ? 34 ASP A OD1  9  
ATOM 9291  O OD2  . ASP A 1 34 ? 11.380  -18.127 -3.706  1.00 0.00 ? 34 ASP A OD2  9  
ATOM 9292  H H    . ASP A 1 34 ? 11.804  -14.418 -3.355  1.00 0.00 ? 34 ASP A H    9  
ATOM 9293  H HA   . ASP A 1 34 ? 9.436   -14.431 -4.693  1.00 0.00 ? 34 ASP A HA   9  
ATOM 9294  H HB2  . ASP A 1 34 ? 9.987   -16.846 -5.293  1.00 0.00 ? 34 ASP A HB2  9  
ATOM 9295  H HB3  . ASP A 1 34 ? 11.236  -15.651 -5.629  1.00 0.00 ? 34 ASP A HB3  9  
ATOM 9296  N N    . ASP A 1 35 ? 9.301   -16.521 -2.141  1.00 0.00 ? 35 ASP A N    9  
ATOM 9297  C CA   . ASP A 1 35 ? 8.387   -17.232 -1.254  1.00 0.00 ? 35 ASP A CA   9  
ATOM 9298  C C    . ASP A 1 35 ? 7.275   -16.308 -0.766  1.00 0.00 ? 35 ASP A C    9  
ATOM 9299  O O    . ASP A 1 35 ? 6.101   -16.674 -0.783  1.00 0.00 ? 35 ASP A O    9  
ATOM 9300  C CB   . ASP A 1 35 ? 9.148   -17.809 -0.059  1.00 0.00 ? 35 ASP A CB   9  
ATOM 9301  C CG   . ASP A 1 35 ? 8.515   -19.080 0.471   1.00 0.00 ? 35 ASP A CG   9  
ATOM 9302  O OD1  . ASP A 1 35 ? 8.477   -20.081 -0.275  1.00 0.00 ? 35 ASP A OD1  9  
ATOM 9303  O OD2  . ASP A 1 35 ? 8.058   -19.075 1.633   1.00 0.00 ? 35 ASP A OD2  9  
ATOM 9304  H H    . ASP A 1 35 ? 10.265  -16.564 -1.968  1.00 0.00 ? 35 ASP A H    9  
ATOM 9305  H HA   . ASP A 1 35 ? 7.945   -18.042 -1.813  1.00 0.00 ? 35 ASP A HA   9  
ATOM 9306  H HB2  . ASP A 1 35 ? 10.162  -18.033 -0.360  1.00 0.00 ? 35 ASP A HB2  9  
ATOM 9307  H HB3  . ASP A 1 35 ? 9.166   -17.078 0.735   1.00 0.00 ? 35 ASP A HB3  9  
ATOM 9308  N N    . GLU A 1 36 ? 7.656   -15.111 -0.331  1.00 0.00 ? 36 GLU A N    9  
ATOM 9309  C CA   . GLU A 1 36 ? 6.690   -14.137 0.164   1.00 0.00 ? 36 GLU A CA   9  
ATOM 9310  C C    . GLU A 1 36 ? 5.762   -13.674 -0.956  1.00 0.00 ? 36 GLU A C    9  
ATOM 9311  O O    . GLU A 1 36 ? 4.538   -13.729 -0.825  1.00 0.00 ? 36 GLU A O    9  
ATOM 9312  C CB   . GLU A 1 36 ? 7.413   -12.933 0.771   1.00 0.00 ? 36 GLU A CB   9  
ATOM 9313  C CG   . GLU A 1 36 ? 8.219   -13.270 2.014   1.00 0.00 ? 36 GLU A CG   9  
ATOM 9314  C CD   . GLU A 1 36 ? 8.473   -12.060 2.892   1.00 0.00 ? 36 GLU A CD   9  
ATOM 9315  O OE1  . GLU A 1 36 ? 7.496   -11.507 3.437   1.00 0.00 ? 36 GLU A OE1  9  
ATOM 9316  O OE2  . GLU A 1 36 ? 9.650   -11.667 3.033   1.00 0.00 ? 36 GLU A OE2  9  
ATOM 9317  H H    . GLU A 1 36 ? 8.607   -14.878 -0.342  1.00 0.00 ? 36 GLU A H    9  
ATOM 9318  H HA   . GLU A 1 36 ? 6.099   -14.615 0.930   1.00 0.00 ? 36 GLU A HA   9  
ATOM 9319  H HB2  . GLU A 1 36 ? 8.083   -12.520 0.032   1.00 0.00 ? 36 GLU A HB2  9  
ATOM 9320  H HB3  . GLU A 1 36 ? 6.680   -12.185 1.036   1.00 0.00 ? 36 GLU A HB3  9  
ATOM 9321  H HG2  . GLU A 1 36 ? 7.678   -14.006 2.590   1.00 0.00 ? 36 GLU A HG2  9  
ATOM 9322  H HG3  . GLU A 1 36 ? 9.170   -13.682 1.709   1.00 0.00 ? 36 GLU A HG3  9  
ATOM 9323  N N    . PHE A 1 37 ? 6.352   -13.219 -2.056  1.00 0.00 ? 37 PHE A N    9  
ATOM 9324  C CA   . PHE A 1 37 ? 5.579   -12.746 -3.198  1.00 0.00 ? 37 PHE A CA   9  
ATOM 9325  C C    . PHE A 1 37 ? 4.453   -13.719 -3.534  1.00 0.00 ? 37 PHE A C    9  
ATOM 9326  O O    . PHE A 1 37 ? 3.364   -13.309 -3.935  1.00 0.00 ? 37 PHE A O    9  
ATOM 9327  C CB   . PHE A 1 37 ? 6.488   -12.561 -4.415  1.00 0.00 ? 37 PHE A CB   9  
ATOM 9328  C CG   . PHE A 1 37 ? 7.092   -11.189 -4.509  1.00 0.00 ? 37 PHE A CG   9  
ATOM 9329  C CD1  . PHE A 1 37 ? 6.411   -10.159 -5.137  1.00 0.00 ? 37 PHE A CD1  9  
ATOM 9330  C CD2  . PHE A 1 37 ? 8.342   -10.930 -3.970  1.00 0.00 ? 37 PHE A CD2  9  
ATOM 9331  C CE1  . PHE A 1 37 ? 6.965   -8.896  -5.226  1.00 0.00 ? 37 PHE A CE1  9  
ATOM 9332  C CE2  . PHE A 1 37 ? 8.901   -9.669  -4.055  1.00 0.00 ? 37 PHE A CE2  9  
ATOM 9333  C CZ   . PHE A 1 37 ? 8.211   -8.650  -4.683  1.00 0.00 ? 37 PHE A CZ   9  
ATOM 9334  H H    . PHE A 1 37 ? 7.331   -13.201 -2.100  1.00 0.00 ? 37 PHE A H    9  
ATOM 9335  H HA   . PHE A 1 37 ? 5.148   -11.793 -2.934  1.00 0.00 ? 37 PHE A HA   9  
ATOM 9336  H HB2  . PHE A 1 37 ? 7.295   -13.276 -4.364  1.00 0.00 ? 37 PHE A HB2  9  
ATOM 9337  H HB3  . PHE A 1 37 ? 5.915   -12.735 -5.313  1.00 0.00 ? 37 PHE A HB3  9  
ATOM 9338  H HD1  . PHE A 1 37 ? 5.435   -10.350 -5.561  1.00 0.00 ? 37 PHE A HD1  9  
ATOM 9339  H HD2  . PHE A 1 37 ? 8.882   -11.726 -3.478  1.00 0.00 ? 37 PHE A HD2  9  
ATOM 9340  H HE1  . PHE A 1 37 ? 6.423   -8.102  -5.717  1.00 0.00 ? 37 PHE A HE1  9  
ATOM 9341  H HE2  . PHE A 1 37 ? 9.875   -9.480  -3.629  1.00 0.00 ? 37 PHE A HE2  9  
ATOM 9342  H HZ   . PHE A 1 37 ? 8.646   -7.664  -4.751  1.00 0.00 ? 37 PHE A HZ   9  
ATOM 9343  N N    . GLU A 1 38 ? 4.724   -15.010 -3.366  1.00 0.00 ? 38 GLU A N    9  
ATOM 9344  C CA   . GLU A 1 38 ? 3.734   -16.041 -3.653  1.00 0.00 ? 38 GLU A CA   9  
ATOM 9345  C C    . GLU A 1 38 ? 2.483   -15.846 -2.802  1.00 0.00 ? 38 GLU A C    9  
ATOM 9346  O O    . GLU A 1 38 ? 1.361   -15.948 -3.298  1.00 0.00 ? 38 GLU A O    9  
ATOM 9347  C CB   . GLU A 1 38 ? 4.324   -17.430 -3.400  1.00 0.00 ? 38 GLU A CB   9  
ATOM 9348  C CG   . GLU A 1 38 ? 5.141   -17.965 -4.564  1.00 0.00 ? 38 GLU A CG   9  
ATOM 9349  C CD   . GLU A 1 38 ? 4.275   -18.456 -5.708  1.00 0.00 ? 38 GLU A CD   9  
ATOM 9350  O OE1  . GLU A 1 38 ? 3.237   -17.817 -5.981  1.00 0.00 ? 38 GLU A OE1  9  
ATOM 9351  O OE2  . GLU A 1 38 ? 4.635   -19.477 -6.329  1.00 0.00 ? 38 GLU A OE2  9  
ATOM 9352  H H    . GLU A 1 38 ? 5.611   -15.274 -3.043  1.00 0.00 ? 38 GLU A H    9  
ATOM 9353  H HA   . GLU A 1 38 ? 3.463   -15.960 -4.694  1.00 0.00 ? 38 GLU A HA   9  
ATOM 9354  H HB2  . GLU A 1 38 ? 4.962   -17.384 -2.530  1.00 0.00 ? 38 GLU A HB2  9  
ATOM 9355  H HB3  . GLU A 1 38 ? 3.517   -18.121 -3.206  1.00 0.00 ? 38 GLU A HB3  9  
ATOM 9356  H HG2  . GLU A 1 38 ? 5.782   -17.177 -4.930  1.00 0.00 ? 38 GLU A HG2  9  
ATOM 9357  H HG3  . GLU A 1 38 ? 5.748   -18.787 -4.213  1.00 0.00 ? 38 GLU A HG3  9  
ATOM 9358  N N    . GLN A 1 39 ? 2.685   -15.565 -1.519  1.00 0.00 ? 39 GLN A N    9  
ATOM 9359  C CA   . GLN A 1 39 ? 1.573   -15.356 -0.598  1.00 0.00 ? 39 GLN A CA   9  
ATOM 9360  C C    . GLN A 1 39 ? 0.568   -14.364 -1.175  1.00 0.00 ? 39 GLN A C    9  
ATOM 9361  O O    . GLN A 1 39 ? -0.637  -14.619 -1.183  1.00 0.00 ? 39 GLN A O    9  
ATOM 9362  C CB   . GLN A 1 39 ? 2.088   -14.853 0.751   1.00 0.00 ? 39 GLN A CB   9  
ATOM 9363  C CG   . GLN A 1 39 ? 3.011   -15.835 1.455   1.00 0.00 ? 39 GLN A CG   9  
ATOM 9364  C CD   . GLN A 1 39 ? 2.281   -17.062 1.962   1.00 0.00 ? 39 GLN A CD   9  
ATOM 9365  O OE1  . GLN A 1 39 ? 1.762   -17.859 1.179   1.00 0.00 ? 39 GLN A OE1  9  
ATOM 9366  N NE2  . GLN A 1 39 ? 2.235   -17.221 3.280   1.00 0.00 ? 39 GLN A NE2  9  
ATOM 9367  H H    . GLN A 1 39 ? 3.602   -15.496 -1.183  1.00 0.00 ? 39 GLN A H    9  
ATOM 9368  H HA   . GLN A 1 39 ? 1.080   -16.306 -0.454  1.00 0.00 ? 39 GLN A HA   9  
ATOM 9369  H HB2  . GLN A 1 39 ? 2.628   -13.931 0.596   1.00 0.00 ? 39 GLN A HB2  9  
ATOM 9370  H HB3  . GLN A 1 39 ? 1.243   -14.662 1.397   1.00 0.00 ? 39 GLN A HB3  9  
ATOM 9371  H HG2  . GLN A 1 39 ? 3.775   -16.152 0.760   1.00 0.00 ? 39 GLN A HG2  9  
ATOM 9372  H HG3  . GLN A 1 39 ? 3.474   -15.336 2.293   1.00 0.00 ? 39 GLN A HG3  9  
ATOM 9373  H HE21 . GLN A 1 39 ? 2.669   -16.546 3.842   1.00 0.00 ? 39 GLN A HE21 9  
ATOM 9374  H HE22 . GLN A 1 39 ? 1.768   -18.005 3.635   1.00 0.00 ? 39 GLN A HE22 9  
ATOM 9375  N N    . LEU A 1 40 ? 1.071   -13.233 -1.656  1.00 0.00 ? 40 LEU A N    9  
ATOM 9376  C CA   . LEU A 1 40 ? 0.217   -12.201 -2.234  1.00 0.00 ? 40 LEU A CA   9  
ATOM 9377  C C    . LEU A 1 40 ? -0.313  -12.634 -3.597  1.00 0.00 ? 40 LEU A C    9  
ATOM 9378  O O    . LEU A 1 40 ? -1.486  -12.430 -3.911  1.00 0.00 ? 40 LEU A O    9  
ATOM 9379  C CB   . LEU A 1 40 ? 0.990   -10.888 -2.369  1.00 0.00 ? 40 LEU A CB   9  
ATOM 9380  C CG   . LEU A 1 40 ? 1.461   -10.249 -1.062  1.00 0.00 ? 40 LEU A CG   9  
ATOM 9381  C CD1  . LEU A 1 40 ? 2.745   -9.464  -1.284  1.00 0.00 ? 40 LEU A CD1  9  
ATOM 9382  C CD2  . LEU A 1 40 ? 0.376   -9.350  -0.487  1.00 0.00 ? 40 LEU A CD2  9  
ATOM 9383  H H    . LEU A 1 40 ? 2.039   -13.086 -1.622  1.00 0.00 ? 40 LEU A H    9  
ATOM 9384  H HA   . LEU A 1 40 ? -0.619  -12.050 -1.567  1.00 0.00 ? 40 LEU A HA   9  
ATOM 9385  H HB2  . LEU A 1 40 ? 1.862   -11.078 -2.976  1.00 0.00 ? 40 LEU A HB2  9  
ATOM 9386  H HB3  . LEU A 1 40 ? 0.350   -10.178 -2.874  1.00 0.00 ? 40 LEU A HB3  9  
ATOM 9387  H HG   . LEU A 1 40 ? 1.667   -11.028 -0.341  1.00 0.00 ? 40 LEU A HG   9  
ATOM 9388  H HD11 . LEU A 1 40 ? 2.853   -9.240  -2.334  1.00 0.00 ? 40 LEU A HD11 9  
ATOM 9389  H HD12 . LEU A 1 40 ? 3.588   -10.052 -0.952  1.00 0.00 ? 40 LEU A HD12 9  
ATOM 9390  H HD13 . LEU A 1 40 ? 2.705   -8.543  -0.720  1.00 0.00 ? 40 LEU A HD13 9  
ATOM 9391  H HD21 . LEU A 1 40 ? -0.503  -9.402  -1.112  1.00 0.00 ? 40 LEU A HD21 9  
ATOM 9392  H HD22 . LEU A 1 40 ? 0.734   -8.331  -0.453  1.00 0.00 ? 40 LEU A HD22 9  
ATOM 9393  H HD23 . LEU A 1 40 ? 0.128   -9.678  0.511   1.00 0.00 ? 40 LEU A HD23 9  
ATOM 9394  N N    . SER A 1 41 ? 0.558   -13.235 -4.402  1.00 0.00 ? 41 SER A N    9  
ATOM 9395  C CA   . SER A 1 41 ? 0.177   -13.696 -5.732  1.00 0.00 ? 41 SER A CA   9  
ATOM 9396  C C    . SER A 1 41 ? -0.971  -14.697 -5.652  1.00 0.00 ? 41 SER A C    9  
ATOM 9397  O O    . SER A 1 41 ? -1.795  -14.787 -6.561  1.00 0.00 ? 41 SER A O    9  
ATOM 9398  C CB   . SER A 1 41 ? 1.377   -14.334 -6.436  1.00 0.00 ? 41 SER A CB   9  
ATOM 9399  O OG   . SER A 1 41 ? 1.439   -15.726 -6.178  1.00 0.00 ? 41 SER A OG   9  
ATOM 9400  H H    . SER A 1 41 ? 1.479   -13.369 -4.094  1.00 0.00 ? 41 SER A H    9  
ATOM 9401  H HA   . SER A 1 41 ? -0.148  -12.837 -6.300  1.00 0.00 ? 41 SER A HA   9  
ATOM 9402  H HB2  . SER A 1 41 ? 1.289   -14.181 -7.501  1.00 0.00 ? 41 SER A HB2  9  
ATOM 9403  H HB3  . SER A 1 41 ? 2.286   -13.872 -6.080  1.00 0.00 ? 41 SER A HB3  9  
ATOM 9404  H HG   . SER A 1 41 ? 1.139   -16.208 -6.952  1.00 0.00 ? 41 SER A HG   9  
ATOM 9405  N N    . ASN A 1 42 ? -1.018  -15.448 -4.556  1.00 0.00 ? 42 ASN A N    9  
ATOM 9406  C CA   . ASN A 1 42 ? -2.065  -16.444 -4.357  1.00 0.00 ? 42 ASN A CA   9  
ATOM 9407  C C    . ASN A 1 42 ? -3.330  -15.799 -3.800  1.00 0.00 ? 42 ASN A C    9  
ATOM 9408  O O    . ASN A 1 42 ? -4.444  -16.229 -4.102  1.00 0.00 ? 42 ASN A O    9  
ATOM 9409  C CB   . ASN A 1 42 ? -1.579  -17.542 -3.409  1.00 0.00 ? 42 ASN A CB   9  
ATOM 9410  C CG   . ASN A 1 42 ? -0.773  -18.609 -4.124  1.00 0.00 ? 42 ASN A CG   9  
ATOM 9411  O OD1  . ASN A 1 42 ? -1.291  -19.324 -4.981  1.00 0.00 ? 42 ASN A OD1  9  
ATOM 9412  N ND2  . ASN A 1 42 ? 0.504   -18.720 -3.774  1.00 0.00 ? 42 ASN A ND2  9  
ATOM 9413  H H    . ASN A 1 42 ? -0.333  -15.330 -3.866  1.00 0.00 ? 42 ASN A H    9  
ATOM 9414  H HA   . ASN A 1 42 ? -2.291  -16.884 -5.316  1.00 0.00 ? 42 ASN A HA   9  
ATOM 9415  H HB2  . ASN A 1 42 ? -0.956  -17.100 -2.645  1.00 0.00 ? 42 ASN A HB2  9  
ATOM 9416  H HB3  . ASN A 1 42 ? -2.432  -18.012 -2.944  1.00 0.00 ? 42 ASN A HB3  9  
ATOM 9417  H HD21 . ASN A 1 42 ? 0.849   -18.117 -3.083  1.00 0.00 ? 42 ASN A HD21 9  
ATOM 9418  H HD22 . ASN A 1 42 ? 1.048   -19.401 -4.221  1.00 0.00 ? 42 ASN A HD22 9  
ATOM 9419  N N    . LEU A 1 43 ? -3.151  -14.765 -2.985  1.00 0.00 ? 43 LEU A N    9  
ATOM 9420  C CA   . LEU A 1 43 ? -4.278  -14.059 -2.385  1.00 0.00 ? 43 LEU A CA   9  
ATOM 9421  C C    . LEU A 1 43 ? -5.021  -13.233 -3.430  1.00 0.00 ? 43 LEU A C    9  
ATOM 9422  O O    . LEU A 1 43 ? -6.217  -13.425 -3.653  1.00 0.00 ? 43 LEU A O    9  
ATOM 9423  C CB   . LEU A 1 43 ? -3.793  -13.153 -1.252  1.00 0.00 ? 43 LEU A CB   9  
ATOM 9424  C CG   . LEU A 1 43 ? -4.761  -12.055 -0.810  1.00 0.00 ? 43 LEU A CG   9  
ATOM 9425  C CD1  . LEU A 1 43 ? -6.076  -12.659 -0.343  1.00 0.00 ? 43 LEU A CD1  9  
ATOM 9426  C CD2  . LEU A 1 43 ? -4.140  -11.208 0.291   1.00 0.00 ? 43 LEU A CD2  9  
ATOM 9427  H H    . LEU A 1 43 ? -2.240  -14.469 -2.781  1.00 0.00 ? 43 LEU A H    9  
ATOM 9428  H HA   . LEU A 1 43 ? -4.954  -14.798 -1.980  1.00 0.00 ? 43 LEU A HA   9  
ATOM 9429  H HB2  . LEU A 1 43 ? -3.587  -13.776 -0.396  1.00 0.00 ? 43 LEU A HB2  9  
ATOM 9430  H HB3  . LEU A 1 43 ? -2.879  -12.678 -1.578  1.00 0.00 ? 43 LEU A HB3  9  
ATOM 9431  H HG   . LEU A 1 43 ? -4.971  -11.409 -1.651  1.00 0.00 ? 43 LEU A HG   9  
ATOM 9432  H HD11 . LEU A 1 43 ? -6.500  -13.255 -1.136  1.00 0.00 ? 43 LEU A HD11 9  
ATOM 9433  H HD12 . LEU A 1 43 ? -6.763  -11.867 -0.081  1.00 0.00 ? 43 LEU A HD12 9  
ATOM 9434  H HD13 . LEU A 1 43 ? -5.899  -13.282 0.522   1.00 0.00 ? 43 LEU A HD13 9  
ATOM 9435  H HD21 . LEU A 1 43 ? -3.079  -11.407 0.343   1.00 0.00 ? 43 LEU A HD21 9  
ATOM 9436  H HD22 . LEU A 1 43 ? -4.599  -11.456 1.238   1.00 0.00 ? 43 LEU A HD22 9  
ATOM 9437  H HD23 . LEU A 1 43 ? -4.300  -10.162 0.075   1.00 0.00 ? 43 LEU A HD23 9  
ATOM 9438  N N    . LEU A 1 44 ? -4.305  -12.315 -4.069  1.00 0.00 ? 44 LEU A N    9  
ATOM 9439  C CA   . LEU A 1 44 ? -4.896  -11.460 -5.093  1.00 0.00 ? 44 LEU A CA   9  
ATOM 9440  C C    . LEU A 1 44 ? -5.075  -12.223 -6.402  1.00 0.00 ? 44 LEU A C    9  
ATOM 9441  O O    . LEU A 1 44 ? -5.714  -11.735 -7.333  1.00 0.00 ? 44 LEU A O    9  
ATOM 9442  C CB   . LEU A 1 44 ? -4.020  -10.227 -5.324  1.00 0.00 ? 44 LEU A CB   9  
ATOM 9443  C CG   . LEU A 1 44 ? -3.636  -9.434  -4.074  1.00 0.00 ? 44 LEU A CG   9  
ATOM 9444  C CD1  . LEU A 1 44 ? -2.527  -8.442  -4.392  1.00 0.00 ? 44 LEU A CD1  9  
ATOM 9445  C CD2  . LEU A 1 44 ? -4.850  -8.715  -3.505  1.00 0.00 ? 44 LEU A CD2  9  
ATOM 9446  H H    . LEU A 1 44 ? -3.357  -12.208 -3.848  1.00 0.00 ? 44 LEU A H    9  
ATOM 9447  H HA   . LEU A 1 44 ? -5.865  -11.142 -4.740  1.00 0.00 ? 44 LEU A HA   9  
ATOM 9448  H HB2  . LEU A 1 44 ? -3.109  -10.554 -5.801  1.00 0.00 ? 44 LEU A HB2  9  
ATOM 9449  H HB3  . LEU A 1 44 ? -4.554  -9.563  -5.988  1.00 0.00 ? 44 LEU A HB3  9  
ATOM 9450  H HG   . LEU A 1 44 ? -3.266  -10.116 -3.321  1.00 0.00 ? 44 LEU A HG   9  
ATOM 9451  H HD11 . LEU A 1 44 ? -1.650  -8.977  -4.724  1.00 0.00 ? 44 LEU A HD11 9  
ATOM 9452  H HD12 . LEU A 1 44 ? -2.288  -7.873  -3.505  1.00 0.00 ? 44 LEU A HD12 9  
ATOM 9453  H HD13 . LEU A 1 44 ? -2.857  -7.771  -5.171  1.00 0.00 ? 44 LEU A HD13 9  
ATOM 9454  H HD21 . LEU A 1 44 ? -5.296  -9.321  -2.730  1.00 0.00 ? 44 LEU A HD21 9  
ATOM 9455  H HD22 . LEU A 1 44 ? -5.571  -8.548  -4.292  1.00 0.00 ? 44 LEU A HD22 9  
ATOM 9456  H HD23 . LEU A 1 44 ? -4.544  -7.767  -3.089  1.00 0.00 ? 44 LEU A HD23 9  
ATOM 9457  N N    . ASN A 1 45 ? -4.508  -13.423 -6.464  1.00 0.00 ? 45 ASN A N    9  
ATOM 9458  C CA   . ASN A 1 45 ? -4.607  -14.254 -7.658  1.00 0.00 ? 45 ASN A CA   9  
ATOM 9459  C C    . ASN A 1 45 ? -3.941  -13.575 -8.851  1.00 0.00 ? 45 ASN A C    9  
ATOM 9460  O O    . ASN A 1 45 ? -4.380  -13.727 -9.991  1.00 0.00 ? 45 ASN A O    9  
ATOM 9461  C CB   . ASN A 1 45 ? -6.073  -14.550 -7.979  1.00 0.00 ? 45 ASN A CB   9  
ATOM 9462  C CG   . ASN A 1 45 ? -6.228  -15.623 -9.040  1.00 0.00 ? 45 ASN A CG   9  
ATOM 9463  O OD1  . ASN A 1 45 ? -5.520  -16.630 -9.028  1.00 0.00 ? 45 ASN A OD1  9  
ATOM 9464  N ND2  . ASN A 1 45 ? -7.157  -15.411 -9.965  1.00 0.00 ? 45 ASN A ND2  9  
ATOM 9465  H H    . ASN A 1 45 ? -4.011  -13.758 -5.688  1.00 0.00 ? 45 ASN A H    9  
ATOM 9466  H HA   . ASN A 1 45 ? -4.097  -15.184 -7.457  1.00 0.00 ? 45 ASN A HA   9  
ATOM 9467  H HB2  . ASN A 1 45 ? -6.571  -14.885 -7.081  1.00 0.00 ? 45 ASN A HB2  9  
ATOM 9468  H HB3  . ASN A 1 45 ? -6.548  -13.647 -8.333  1.00 0.00 ? 45 ASN A HB3  9  
ATOM 9469  H HD21 . ASN A 1 45 ? -7.683  -14.585 -9.912  1.00 0.00 ? 45 ASN A HD21 9  
ATOM 9470  H HD22 . ASN A 1 45 ? -7.279  -16.088 -10.662 1.00 0.00 ? 45 ASN A HD22 9  
ATOM 9471  N N    . LEU A 1 46 ? -2.879  -12.824 -8.579  1.00 0.00 ? 46 LEU A N    9  
ATOM 9472  C CA   . LEU A 1 46 ? -2.150  -12.121 -9.630  1.00 0.00 ? 46 LEU A CA   9  
ATOM 9473  C C    . LEU A 1 46 ? -0.742  -12.685 -9.788  1.00 0.00 ? 46 LEU A C    9  
ATOM 9474  O O    . LEU A 1 46 ? -0.158  -13.233 -8.852  1.00 0.00 ? 46 LEU A O    9  
ATOM 9475  C CB   . LEU A 1 46 ? -2.081  -10.626 -9.315  1.00 0.00 ? 46 LEU A CB   9  
ATOM 9476  C CG   . LEU A 1 46 ? -3.419  -9.889  -9.255  1.00 0.00 ? 46 LEU A CG   9  
ATOM 9477  C CD1  . LEU A 1 46 ? -3.233  -8.489  -8.692  1.00 0.00 ? 46 LEU A CD1  9  
ATOM 9478  C CD2  . LEU A 1 46 ? -4.059  -9.831  -10.635 1.00 0.00 ? 46 LEU A CD2  9  
ATOM 9479  H H    . LEU A 1 46 ? -2.576  -12.741 -7.651  1.00 0.00 ? 46 LEU A H    9  
ATOM 9480  H HA   . LEU A 1 46 ? -2.687  -12.261 -10.556 1.00 0.00 ? 46 LEU A HA   9  
ATOM 9481  H HB2  . LEU A 1 46 ? -1.597  -10.511 -8.358  1.00 0.00 ? 46 LEU A HB2  9  
ATOM 9482  H HB3  . LEU A 1 46 ? -1.477  -10.156 -10.080 1.00 0.00 ? 46 LEU A HB3  9  
ATOM 9483  H HG   . LEU A 1 46 ? -4.089  -10.427 -8.598  1.00 0.00 ? 46 LEU A HG   9  
ATOM 9484  H HD11 . LEU A 1 46 ? -4.039  -8.265  -8.009  1.00 0.00 ? 46 LEU A HD11 9  
ATOM 9485  H HD12 . LEU A 1 46 ? -3.237  -7.773  -9.500  1.00 0.00 ? 46 LEU A HD12 9  
ATOM 9486  H HD13 . LEU A 1 46 ? -2.290  -8.434  -8.168  1.00 0.00 ? 46 LEU A HD13 9  
ATOM 9487  H HD21 . LEU A 1 46 ? -4.128  -10.829 -11.041 1.00 0.00 ? 46 LEU A HD21 9  
ATOM 9488  H HD22 . LEU A 1 46 ? -3.453  -9.218  -11.286 1.00 0.00 ? 46 LEU A HD22 9  
ATOM 9489  H HD23 . LEU A 1 46 ? -5.048  -9.405  -10.555 1.00 0.00 ? 46 LEU A HD23 9  
ATOM 9490  N N    . PRO A 1 47 ? -0.181  -12.548 -10.998 1.00 0.00 ? 47 PRO A N    9  
ATOM 9491  C CA   . PRO A 1 47 ? 1.166   -13.035 -11.306 1.00 0.00 ? 47 PRO A CA   9  
ATOM 9492  C C    . PRO A 1 47 ? 2.251   -12.225 -10.604 1.00 0.00 ? 47 PRO A C    9  
ATOM 9493  O O    . PRO A 1 47 ? 2.265   -10.995 -10.673 1.00 0.00 ? 47 PRO A O    9  
ATOM 9494  C CB   . PRO A 1 47 ? 1.268   -12.862 -12.824 1.00 0.00 ? 47 PRO A CB   9  
ATOM 9495  C CG   . PRO A 1 47 ? 0.307   -11.769 -13.145 1.00 0.00 ? 47 PRO A CG   9  
ATOM 9496  C CD   . PRO A 1 47 ? -0.820  -11.905 -12.159 1.00 0.00 ? 47 PRO A CD   9  
ATOM 9497  H HA   . PRO A 1 47 ? 1.278   -14.079 -11.054 1.00 0.00 ? 47 PRO A HA   9  
ATOM 9498  H HB2  . PRO A 1 47 ? 2.280   -12.591 -13.091 1.00 0.00 ? 47 PRO A HB2  9  
ATOM 9499  H HB3  . PRO A 1 47 ? 0.995   -13.784 -13.314 1.00 0.00 ? 47 PRO A HB3  9  
ATOM 9500  H HG2  . PRO A 1 47 ? 0.790   -10.811 -13.033 1.00 0.00 ? 47 PRO A HG2  9  
ATOM 9501  H HG3  . PRO A 1 47 ? -0.061  -11.890 -14.154 1.00 0.00 ? 47 PRO A HG3  9  
ATOM 9502  H HD2  . PRO A 1 47 ? -1.210  -10.933 -11.896 1.00 0.00 ? 47 PRO A HD2  9  
ATOM 9503  H HD3  . PRO A 1 47 ? -1.602  -12.531 -12.564 1.00 0.00 ? 47 PRO A HD3  9  
ATOM 9504  N N    . THR A 1 48 ? 3.159   -12.921 -9.928  1.00 0.00 ? 48 THR A N    9  
ATOM 9505  C CA   . THR A 1 48 ? 4.247   -12.266 -9.213  1.00 0.00 ? 48 THR A CA   9  
ATOM 9506  C C    . THR A 1 48 ? 4.880   -11.169 -10.060 1.00 0.00 ? 48 THR A C    9  
ATOM 9507  O O    . THR A 1 48 ? 5.209   -10.095 -9.556  1.00 0.00 ? 48 THR A O    9  
ATOM 9508  C CB   . THR A 1 48 ? 5.336   -13.275 -8.802  1.00 0.00 ? 48 THR A CB   9  
ATOM 9509  O OG1  . THR A 1 48 ? 5.516   -14.250 -9.835  1.00 0.00 ? 48 THR A OG1  9  
ATOM 9510  C CG2  . THR A 1 48 ? 4.967   -13.970 -7.500  1.00 0.00 ? 48 THR A CG2  9  
ATOM 9511  H H    . THR A 1 48 ? 3.095   -13.899 -9.911  1.00 0.00 ? 48 THR A H    9  
ATOM 9512  H HA   . THR A 1 48 ? 3.838   -11.825 -8.315  1.00 0.00 ? 48 THR A HA   9  
ATOM 9513  H HB   . THR A 1 48 ? 6.264   -12.740 -8.656  1.00 0.00 ? 48 THR A HB   9  
ATOM 9514  H HG1  . THR A 1 48 ? 5.832   -15.071 -9.449  1.00 0.00 ? 48 THR A HG1  9  
ATOM 9515  H HG21 . THR A 1 48 ? 4.524   -13.255 -6.823  1.00 0.00 ? 48 THR A HG21 9  
ATOM 9516  H HG22 . THR A 1 48 ? 5.855   -14.389 -7.051  1.00 0.00 ? 48 THR A HG22 9  
ATOM 9517  H HG23 . THR A 1 48 ? 4.259   -14.759 -7.702  1.00 0.00 ? 48 THR A HG23 9  
ATOM 9518  N N    . ARG A 1 49 ? 5.047   -11.445 -11.349 1.00 0.00 ? 49 ARG A N    9  
ATOM 9519  C CA   . ARG A 1 49 ? 5.642   -10.480 -12.266 1.00 0.00 ? 49 ARG A CA   9  
ATOM 9520  C C    . ARG A 1 49 ? 4.932   -9.132  -12.173 1.00 0.00 ? 49 ARG A C    9  
ATOM 9521  O O    . ARG A 1 49 ? 5.561   -8.079  -12.277 1.00 0.00 ? 49 ARG A O    9  
ATOM 9522  C CB   . ARG A 1 49 ? 5.579   -11.003 -13.702 1.00 0.00 ? 49 ARG A CB   9  
ATOM 9523  C CG   . ARG A 1 49 ? 4.234   -10.779 -14.374 1.00 0.00 ? 49 ARG A CG   9  
ATOM 9524  C CD   . ARG A 1 49 ? 4.194   -9.448  -15.109 1.00 0.00 ? 49 ARG A CD   9  
ATOM 9525  N NE   . ARG A 1 49 ? 5.053   -9.450  -16.290 1.00 0.00 ? 49 ARG A NE   9  
ATOM 9526  C CZ   . ARG A 1 49 ? 5.466   -8.345  -16.900 1.00 0.00 ? 49 ARG A CZ   9  
ATOM 9527  N NH1  . ARG A 1 49 ? 5.102   -7.155  -16.441 1.00 0.00 ? 49 ARG A NH1  9  
ATOM 9528  N NH2  . ARG A 1 49 ? 6.247   -8.428  -17.970 1.00 0.00 ? 49 ARG A NH2  9  
ATOM 9529  H H    . ARG A 1 49 ? 4.765   -12.319 -11.692 1.00 0.00 ? 49 ARG A H    9  
ATOM 9530  H HA   . ARG A 1 49 ? 6.676   -10.349 -11.985 1.00 0.00 ? 49 ARG A HA   9  
ATOM 9531  H HB2  . ARG A 1 49 ? 6.337   -10.505 -14.289 1.00 0.00 ? 49 ARG A HB2  9  
ATOM 9532  H HB3  . ARG A 1 49 ? 5.781   -12.064 -13.695 1.00 0.00 ? 49 ARG A HB3  9  
ATOM 9533  H HG2  . ARG A 1 49 ? 4.058   -11.575 -15.082 1.00 0.00 ? 49 ARG A HG2  9  
ATOM 9534  H HG3  . ARG A 1 49 ? 3.460   -10.787 -13.620 1.00 0.00 ? 49 ARG A HG3  9  
ATOM 9535  H HD2  . ARG A 1 49 ? 3.177   -9.252  -15.415 1.00 0.00 ? 49 ARG A HD2  9  
ATOM 9536  H HD3  . ARG A 1 49 ? 4.524   -8.671  -14.437 1.00 0.00 ? 49 ARG A HD3  9  
ATOM 9537  H HE   . ARG A 1 49 ? 5.334   -10.319 -16.646 1.00 0.00 ? 49 ARG A HE   9  
ATOM 9538  H HH11 . ARG A 1 49 ? 4.515   -7.089  -15.635 1.00 0.00 ? 49 ARG A HH11 9  
ATOM 9539  H HH12 . ARG A 1 49 ? 5.416   -6.324  -16.901 1.00 0.00 ? 49 ARG A HH12 9  
ATOM 9540  H HH21 . ARG A 1 49 ? 6.523   -9.323  -18.318 1.00 0.00 ? 49 ARG A HH21 9  
ATOM 9541  H HH22 . ARG A 1 49 ? 6.557   -7.596  -18.428 1.00 0.00 ? 49 ARG A HH22 9  
ATOM 9542  N N    . VAL A 1 50 ? 3.618   -9.174  -11.976 1.00 0.00 ? 50 VAL A N    9  
ATOM 9543  C CA   . VAL A 1 50 ? 2.823   -7.957  -11.868 1.00 0.00 ? 50 VAL A CA   9  
ATOM 9544  C C    . VAL A 1 50 ? 3.020   -7.290  -10.511 1.00 0.00 ? 50 VAL A C    9  
ATOM 9545  O O    . VAL A 1 50 ? 3.088   -6.064  -10.415 1.00 0.00 ? 50 VAL A O    9  
ATOM 9546  C CB   . VAL A 1 50 ? 1.324   -8.246  -12.072 1.00 0.00 ? 50 VAL A CB   9  
ATOM 9547  C CG1  . VAL A 1 50 ? 0.480   -7.106  -11.523 1.00 0.00 ? 50 VAL A CG1  9  
ATOM 9548  C CG2  . VAL A 1 50 ? 1.023   -8.482  -13.544 1.00 0.00 ? 50 VAL A CG2  9  
ATOM 9549  H H    . VAL A 1 50 ? 3.174   -10.044 -11.900 1.00 0.00 ? 50 VAL A H    9  
ATOM 9550  H HA   . VAL A 1 50 ? 3.146   -7.277  -12.643 1.00 0.00 ? 50 VAL A HA   9  
ATOM 9551  H HB   . VAL A 1 50 ? 1.074   -9.144  -11.527 1.00 0.00 ? 50 VAL A HB   9  
ATOM 9552  H HG11 . VAL A 1 50 ? -0.565  -7.314  -11.700 1.00 0.00 ? 50 VAL A HG11 9  
ATOM 9553  H HG12 . VAL A 1 50 ? 0.654   -7.008  -10.461 1.00 0.00 ? 50 VAL A HG12 9  
ATOM 9554  H HG13 . VAL A 1 50 ? 0.752   -6.186  -12.019 1.00 0.00 ? 50 VAL A HG13 9  
ATOM 9555  H HG21 . VAL A 1 50 ? 0.061   -8.962  -13.642 1.00 0.00 ? 50 VAL A HG21 9  
ATOM 9556  H HG22 . VAL A 1 50 ? 1.007   -7.535  -14.065 1.00 0.00 ? 50 VAL A HG22 9  
ATOM 9557  H HG23 . VAL A 1 50 ? 1.786   -9.114  -13.971 1.00 0.00 ? 50 VAL A HG23 9  
ATOM 9558  N N    . ILE A 1 51 ? 3.113   -8.104  -9.465  1.00 0.00 ? 51 ILE A N    9  
ATOM 9559  C CA   . ILE A 1 51 ? 3.304   -7.592  -8.114  1.00 0.00 ? 51 ILE A CA   9  
ATOM 9560  C C    . ILE A 1 51 ? 4.714   -7.041  -7.929  1.00 0.00 ? 51 ILE A C    9  
ATOM 9561  O O    . ILE A 1 51 ? 4.935   -6.124  -7.139  1.00 0.00 ? 51 ILE A O    9  
ATOM 9562  C CB   . ILE A 1 51 ? 3.049   -8.684  -7.058  1.00 0.00 ? 51 ILE A CB   9  
ATOM 9563  C CG1  . ILE A 1 51 ? 1.747   -9.427  -7.365  1.00 0.00 ? 51 ILE A CG1  9  
ATOM 9564  C CG2  . ILE A 1 51 ? 3.001   -8.072  -5.665  1.00 0.00 ? 51 ILE A CG2  9  
ATOM 9565  C CD1  . ILE A 1 51 ? 1.527   -10.644 -6.493  1.00 0.00 ? 51 ILE A CD1  9  
ATOM 9566  H H    . ILE A 1 51 ? 3.051   -9.072  -9.606  1.00 0.00 ? 51 ILE A H    9  
ATOM 9567  H HA   . ILE A 1 51 ? 2.593   -6.794  -7.956  1.00 0.00 ? 51 ILE A HA   9  
ATOM 9568  H HB   . ILE A 1 51 ? 3.871   -9.383  -7.089  1.00 0.00 ? 51 ILE A HB   9  
ATOM 9569  H HG12 . ILE A 1 51 ? 0.915   -8.758  -7.216  1.00 0.00 ? 51 ILE A HG12 9  
ATOM 9570  H HG13 . ILE A 1 51 ? 1.763   -9.754  -8.394  1.00 0.00 ? 51 ILE A HG13 9  
ATOM 9571  H HG21 . ILE A 1 51 ? 2.232   -8.560  -5.084  1.00 0.00 ? 51 ILE A HG21 9  
ATOM 9572  H HG22 . ILE A 1 51 ? 3.956   -8.205  -5.181  1.00 0.00 ? 51 ILE A HG22 9  
ATOM 9573  H HG23 . ILE A 1 51 ? 2.779   -7.018  -5.742  1.00 0.00 ? 51 ILE A HG23 9  
ATOM 9574  H HD11 . ILE A 1 51 ? 0.468   -10.783 -6.331  1.00 0.00 ? 51 ILE A HD11 9  
ATOM 9575  H HD12 . ILE A 1 51 ? 1.936   -11.516 -6.981  1.00 0.00 ? 51 ILE A HD12 9  
ATOM 9576  H HD13 . ILE A 1 51 ? 2.019   -10.499 -5.542  1.00 0.00 ? 51 ILE A HD13 9  
ATOM 9577  N N    . VAL A 1 52 ? 5.665   -7.606  -8.667  1.00 0.00 ? 52 VAL A N    9  
ATOM 9578  C CA   . VAL A 1 52 ? 7.054   -7.170  -8.587  1.00 0.00 ? 52 VAL A CA   9  
ATOM 9579  C C    . VAL A 1 52 ? 7.225   -5.770  -9.167  1.00 0.00 ? 52 VAL A C    9  
ATOM 9580  O O    . VAL A 1 52 ? 7.772   -4.880  -8.517  1.00 0.00 ? 52 VAL A O    9  
ATOM 9581  C CB   . VAL A 1 52 ? 7.991   -8.140  -9.331  1.00 0.00 ? 52 VAL A CB   9  
ATOM 9582  C CG1  . VAL A 1 52 ? 9.400   -7.572  -9.402  1.00 0.00 ? 52 VAL A CG1  9  
ATOM 9583  C CG2  . VAL A 1 52 ? 7.990   -9.504  -8.657  1.00 0.00 ? 52 VAL A CG2  9  
ATOM 9584  H H    . VAL A 1 52 ? 5.427   -8.333  -9.279  1.00 0.00 ? 52 VAL A H    9  
ATOM 9585  H HA   . VAL A 1 52 ? 7.340   -7.154  -7.545  1.00 0.00 ? 52 VAL A HA   9  
ATOM 9586  H HB   . VAL A 1 52 ? 7.624   -8.260  -10.340 1.00 0.00 ? 52 VAL A HB   9  
ATOM 9587  H HG11 . VAL A 1 52 ? 9.360   -6.552  -9.755  1.00 0.00 ? 52 VAL A HG11 9  
ATOM 9588  H HG12 . VAL A 1 52 ? 9.849   -7.598  -8.420  1.00 0.00 ? 52 VAL A HG12 9  
ATOM 9589  H HG13 . VAL A 1 52 ? 9.992   -8.165  -10.085 1.00 0.00 ? 52 VAL A HG13 9  
ATOM 9590  H HG21 . VAL A 1 52 ? 6.991   -9.736  -8.318  1.00 0.00 ? 52 VAL A HG21 9  
ATOM 9591  H HG22 . VAL A 1 52 ? 8.314   -10.255 -9.362  1.00 0.00 ? 52 VAL A HG22 9  
ATOM 9592  H HG23 . VAL A 1 52 ? 8.662   -9.489  -7.813  1.00 0.00 ? 52 VAL A HG23 9  
ATOM 9593  N N    . VAL A 1 53 ? 6.751   -5.583  -10.395 1.00 0.00 ? 53 VAL A N    9  
ATOM 9594  C CA   . VAL A 1 53 ? 6.850   -4.291  -11.063 1.00 0.00 ? 53 VAL A CA   9  
ATOM 9595  C C    . VAL A 1 53 ? 6.212   -3.189  -10.225 1.00 0.00 ? 53 VAL A C    9  
ATOM 9596  O O    . VAL A 1 53 ? 6.727   -2.073  -10.153 1.00 0.00 ? 53 VAL A O    9  
ATOM 9597  C CB   . VAL A 1 53 ? 6.176   -4.323  -12.448 1.00 0.00 ? 53 VAL A CB   9  
ATOM 9598  C CG1  . VAL A 1 53 ? 6.326   -2.980  -13.146 1.00 0.00 ? 53 VAL A CG1  9  
ATOM 9599  C CG2  . VAL A 1 53 ? 6.759   -5.442  -13.298 1.00 0.00 ? 53 VAL A CG2  9  
ATOM 9600  H H    . VAL A 1 53 ? 6.325   -6.332  -10.862 1.00 0.00 ? 53 VAL A H    9  
ATOM 9601  H HA   . VAL A 1 53 ? 7.897   -4.065  -11.201 1.00 0.00 ? 53 VAL A HA   9  
ATOM 9602  H HB   . VAL A 1 53 ? 5.123   -4.516  -12.309 1.00 0.00 ? 53 VAL A HB   9  
ATOM 9603  H HG11 . VAL A 1 53 ? 5.433   -2.392  -12.990 1.00 0.00 ? 53 VAL A HG11 9  
ATOM 9604  H HG12 . VAL A 1 53 ? 7.179   -2.456  -12.740 1.00 0.00 ? 53 VAL A HG12 9  
ATOM 9605  H HG13 . VAL A 1 53 ? 6.471   -3.138  -14.205 1.00 0.00 ? 53 VAL A HG13 9  
ATOM 9606  H HG21 . VAL A 1 53 ? 7.182   -6.199  -12.654 1.00 0.00 ? 53 VAL A HG21 9  
ATOM 9607  H HG22 . VAL A 1 53 ? 5.977   -5.880  -13.902 1.00 0.00 ? 53 VAL A HG22 9  
ATOM 9608  H HG23 . VAL A 1 53 ? 7.529   -5.043  -13.941 1.00 0.00 ? 53 VAL A HG23 9  
ATOM 9609  N N    . TRP A 1 54 ? 5.088   -3.509  -9.594  1.00 0.00 ? 54 TRP A N    9  
ATOM 9610  C CA   . TRP A 1 54 ? 4.379   -2.545  -8.760  1.00 0.00 ? 54 TRP A CA   9  
ATOM 9611  C C    . TRP A 1 54 ? 5.183   -2.214  -7.508  1.00 0.00 ? 54 TRP A C    9  
ATOM 9612  O O    . TRP A 1 54 ? 5.311   -1.049  -7.130  1.00 0.00 ? 54 TRP A O    9  
ATOM 9613  C CB   . TRP A 1 54 ? 3.005   -3.091  -8.369  1.00 0.00 ? 54 TRP A CB   9  
ATOM 9614  C CG   . TRP A 1 54 ? 2.178   -2.116  -7.588  1.00 0.00 ? 54 TRP A CG   9  
ATOM 9615  C CD1  . TRP A 1 54 ? 1.141   -1.361  -8.056  1.00 0.00 ? 54 TRP A CD1  9  
ATOM 9616  C CD2  . TRP A 1 54 ? 2.321   -1.788  -6.201  1.00 0.00 ? 54 TRP A CD2  9  
ATOM 9617  N NE1  . TRP A 1 54 ? 0.630   -0.584  -7.044  1.00 0.00 ? 54 TRP A NE1  9  
ATOM 9618  C CE2  . TRP A 1 54 ? 1.337   -0.828  -5.896  1.00 0.00 ? 54 TRP A CE2  9  
ATOM 9619  C CE3  . TRP A 1 54 ? 3.184   -2.214  -5.187  1.00 0.00 ? 54 TRP A CE3  9  
ATOM 9620  C CZ2  . TRP A 1 54 ? 1.194   -0.289  -4.620  1.00 0.00 ? 54 TRP A CZ2  9  
ATOM 9621  C CZ3  . TRP A 1 54 ? 3.041   -1.677  -3.922  1.00 0.00 ? 54 TRP A CZ3  9  
ATOM 9622  C CH2  . TRP A 1 54 ? 2.052   -0.724  -3.647  1.00 0.00 ? 54 TRP A CH2  9  
ATOM 9623  H H    . TRP A 1 54 ? 4.726   -4.415  -9.691  1.00 0.00 ? 54 TRP A H    9  
ATOM 9624  H HA   . TRP A 1 54 ? 4.247   -1.642  -9.338  1.00 0.00 ? 54 TRP A HA   9  
ATOM 9625  H HB2  . TRP A 1 54 ? 2.459   -3.349  -9.264  1.00 0.00 ? 54 TRP A HB2  9  
ATOM 9626  H HB3  . TRP A 1 54 ? 3.137   -3.977  -7.764  1.00 0.00 ? 54 TRP A HB3  9  
ATOM 9627  H HD1  . TRP A 1 54 ? 0.786   -1.381  -9.075  1.00 0.00 ? 54 TRP A HD1  9  
ATOM 9628  H HE1  . TRP A 1 54 ? -0.119  0.042   -7.130  1.00 0.00 ? 54 TRP A HE1  9  
ATOM 9629  H HE3  . TRP A 1 54 ? 3.952   -2.948  -5.380  1.00 0.00 ? 54 TRP A HE3  9  
ATOM 9630  H HZ2  . TRP A 1 54 ? 0.436   0.447   -4.392  1.00 0.00 ? 54 TRP A HZ2  9  
ATOM 9631  H HZ3  . TRP A 1 54 ? 3.699   -1.994  -3.126  1.00 0.00 ? 54 TRP A HZ3  9  
ATOM 9632  H HH2  . TRP A 1 54 ? 1.977   -0.331  -2.645  1.00 0.00 ? 54 TRP A HH2  9  
ATOM 9633  N N    . PHE A 1 55 ? 5.724   -3.245  -6.867  1.00 0.00 ? 55 PHE A N    9  
ATOM 9634  C CA   . PHE A 1 55 ? 6.516   -3.063  -5.656  1.00 0.00 ? 55 PHE A CA   9  
ATOM 9635  C C    . PHE A 1 55 ? 7.803   -2.300  -5.957  1.00 0.00 ? 55 PHE A C    9  
ATOM 9636  O O    . PHE A 1 55 ? 8.218   -1.434  -5.188  1.00 0.00 ? 55 PHE A O    9  
ATOM 9637  C CB   . PHE A 1 55 ? 6.848   -4.418  -5.029  1.00 0.00 ? 55 PHE A CB   9  
ATOM 9638  C CG   . PHE A 1 55 ? 5.830   -4.880  -4.025  1.00 0.00 ? 55 PHE A CG   9  
ATOM 9639  C CD1  . PHE A 1 55 ? 4.515   -5.097  -4.402  1.00 0.00 ? 55 PHE A CD1  9  
ATOM 9640  C CD2  . PHE A 1 55 ? 6.190   -5.096  -2.705  1.00 0.00 ? 55 PHE A CD2  9  
ATOM 9641  C CE1  . PHE A 1 55 ? 3.576   -5.522  -3.481  1.00 0.00 ? 55 PHE A CE1  9  
ATOM 9642  C CE2  . PHE A 1 55 ? 5.255   -5.522  -1.779  1.00 0.00 ? 55 PHE A CE2  9  
ATOM 9643  C CZ   . PHE A 1 55 ? 3.947   -5.734  -2.168  1.00 0.00 ? 55 PHE A CZ   9  
ATOM 9644  H H    . PHE A 1 55 ? 5.587   -4.150  -7.217  1.00 0.00 ? 55 PHE A H    9  
ATOM 9645  H HA   . PHE A 1 55 ? 5.926   -2.488  -4.959  1.00 0.00 ? 55 PHE A HA   9  
ATOM 9646  H HB2  . PHE A 1 55 ? 6.905   -5.163  -5.809  1.00 0.00 ? 55 PHE A HB2  9  
ATOM 9647  H HB3  . PHE A 1 55 ? 7.803   -4.352  -4.530  1.00 0.00 ? 55 PHE A HB3  9  
ATOM 9648  H HD1  . PHE A 1 55 ? 4.224   -4.931  -5.430  1.00 0.00 ? 55 PHE A HD1  9  
ATOM 9649  H HD2  . PHE A 1 55 ? 7.212   -4.930  -2.399  1.00 0.00 ? 55 PHE A HD2  9  
ATOM 9650  H HE1  . PHE A 1 55 ? 2.554   -5.687  -3.788  1.00 0.00 ? 55 PHE A HE1  9  
ATOM 9651  H HE2  . PHE A 1 55 ? 5.547   -5.686  -0.753  1.00 0.00 ? 55 PHE A HE2  9  
ATOM 9652  H HZ   . PHE A 1 55 ? 3.215   -6.066  -1.447  1.00 0.00 ? 55 PHE A HZ   9  
ATOM 9653  N N    . GLN A 1 56 ? 8.430   -2.630  -7.082  1.00 0.00 ? 56 GLN A N    9  
ATOM 9654  C CA   . GLN A 1 56 ? 9.670   -1.978  -7.484  1.00 0.00 ? 56 GLN A CA   9  
ATOM 9655  C C    . GLN A 1 56 ? 9.487   -0.466  -7.571  1.00 0.00 ? 56 GLN A C    9  
ATOM 9656  O O    . GLN A 1 56 ? 10.230  0.295   -6.954  1.00 0.00 ? 56 GLN A O    9  
ATOM 9657  C CB   . GLN A 1 56 ? 10.145  -2.524  -8.832  1.00 0.00 ? 56 GLN A CB   9  
ATOM 9658  C CG   . GLN A 1 56 ? 10.835  -3.875  -8.732  1.00 0.00 ? 56 GLN A CG   9  
ATOM 9659  C CD   . GLN A 1 56 ? 11.877  -4.079  -9.815  1.00 0.00 ? 56 GLN A CD   9  
ATOM 9660  O OE1  . GLN A 1 56 ? 12.830  -3.309  -9.929  1.00 0.00 ? 56 GLN A OE1  9  
ATOM 9661  N NE2  . GLN A 1 56 ? 11.699  -5.122  -10.617 1.00 0.00 ? 56 GLN A NE2  9  
ATOM 9662  H H    . GLN A 1 56 ? 8.050   -3.329  -7.654  1.00 0.00 ? 56 GLN A H    9  
ATOM 9663  H HA   . GLN A 1 56 ? 10.417  -2.195  -6.735  1.00 0.00 ? 56 GLN A HA   9  
ATOM 9664  H HB2  . GLN A 1 56 ? 9.291   -2.628  -9.486  1.00 0.00 ? 56 GLN A HB2  9  
ATOM 9665  H HB3  . GLN A 1 56 ? 10.839  -1.821  -9.268  1.00 0.00 ? 56 GLN A HB3  9  
ATOM 9666  H HG2  . GLN A 1 56 ? 11.321  -3.946  -7.770  1.00 0.00 ? 56 GLN A HG2  9  
ATOM 9667  H HG3  . GLN A 1 56 ? 10.091  -4.652  -8.817  1.00 0.00 ? 56 GLN A HG3  9  
ATOM 9668  H HE21 . GLN A 1 56 ? 10.915  -5.692  -10.468 1.00 0.00 ? 56 GLN A HE21 9  
ATOM 9669  H HE22 . GLN A 1 56 ? 12.356  -5.278  -11.326 1.00 0.00 ? 56 GLN A HE22 9  
ATOM 9670  N N    . ASN A 1 57 ? 8.492   -0.039  -8.342  1.00 0.00 ? 57 ASN A N    9  
ATOM 9671  C CA   . ASN A 1 57 ? 8.212   1.382   -8.510  1.00 0.00 ? 57 ASN A CA   9  
ATOM 9672  C C    . ASN A 1 57 ? 7.852   2.028   -7.175  1.00 0.00 ? 57 ASN A C    9  
ATOM 9673  O O    . ASN A 1 57 ? 8.410   3.059   -6.803  1.00 0.00 ? 57 ASN A O    9  
ATOM 9674  C CB   . ASN A 1 57 ? 7.071   1.583   -9.510  1.00 0.00 ? 57 ASN A CB   9  
ATOM 9675  C CG   . ASN A 1 57 ? 7.534   1.453   -10.949 1.00 0.00 ? 57 ASN A CG   9  
ATOM 9676  O OD1  . ASN A 1 57 ? 7.977   2.425   -11.560 1.00 0.00 ? 57 ASN A OD1  9  
ATOM 9677  N ND2  . ASN A 1 57 ? 7.432   0.247   -11.495 1.00 0.00 ? 57 ASN A ND2  9  
ATOM 9678  H H    . ASN A 1 57 ? 7.933   -0.695  -8.809  1.00 0.00 ? 57 ASN A H    9  
ATOM 9679  H HA   . ASN A 1 57 ? 9.104   1.852   -8.896  1.00 0.00 ? 57 ASN A HA   9  
ATOM 9680  H HB2  . ASN A 1 57 ? 6.307   0.842   -9.329  1.00 0.00 ? 57 ASN A HB2  9  
ATOM 9681  H HB3  . ASN A 1 57 ? 6.651   2.568   -9.374  1.00 0.00 ? 57 ASN A HB3  9  
ATOM 9682  H HD21 . ASN A 1 57 ? 7.069   -0.481  -10.948 1.00 0.00 ? 57 ASN A HD21 9  
ATOM 9683  H HD22 . ASN A 1 57 ? 7.724   0.134   -12.424 1.00 0.00 ? 57 ASN A HD22 9  
ATOM 9684  N N    . ALA A 1 58 ? 6.917   1.412   -6.460  1.00 0.00 ? 58 ALA A N    9  
ATOM 9685  C CA   . ALA A 1 58 ? 6.484   1.925   -5.165  1.00 0.00 ? 58 ALA A CA   9  
ATOM 9686  C C    . ALA A 1 58 ? 7.677   2.364   -4.323  1.00 0.00 ? 58 ALA A C    9  
ATOM 9687  O O    . ALA A 1 58 ? 7.564   3.267   -3.494  1.00 0.00 ? 58 ALA A O    9  
ATOM 9688  C CB   . ALA A 1 58 ? 5.672   0.872   -4.425  1.00 0.00 ? 58 ALA A CB   9  
ATOM 9689  H H    . ALA A 1 58 ? 6.509   0.593   -6.810  1.00 0.00 ? 58 ALA A H    9  
ATOM 9690  H HA   . ALA A 1 58 ? 5.846   2.779   -5.341  1.00 0.00 ? 58 ALA A HA   9  
ATOM 9691  H HB1  . ALA A 1 58 ? 4.721   0.739   -4.920  1.00 0.00 ? 58 ALA A HB1  9  
ATOM 9692  H HB2  . ALA A 1 58 ? 6.211   -0.064  -4.425  1.00 0.00 ? 58 ALA A HB2  9  
ATOM 9693  H HB3  . ALA A 1 58 ? 5.508   1.194   -3.408  1.00 0.00 ? 58 ALA A HB3  9  
ATOM 9694  N N    . ARG A 1 59 ? 8.819   1.719   -4.540  1.00 0.00 ? 59 ARG A N    9  
ATOM 9695  C CA   . ARG A 1 59 ? 10.032  2.043   -3.799  1.00 0.00 ? 59 ARG A CA   9  
ATOM 9696  C C    . ARG A 1 59 ? 10.630  3.361   -4.283  1.00 0.00 ? 59 ARG A C    9  
ATOM 9697  O O    . ARG A 1 59 ? 11.016  4.210   -3.481  1.00 0.00 ? 59 ARG A O    9  
ATOM 9698  C CB   . ARG A 1 59 ? 11.060  0.920   -3.946  1.00 0.00 ? 59 ARG A CB   9  
ATOM 9699  C CG   . ARG A 1 59 ? 10.645  -0.378  -3.271  1.00 0.00 ? 59 ARG A CG   9  
ATOM 9700  C CD   . ARG A 1 59 ? 11.788  -1.380  -3.240  1.00 0.00 ? 59 ARG A CD   9  
ATOM 9701  N NE   . ARG A 1 59 ? 12.044  -1.959  -4.557  1.00 0.00 ? 59 ARG A NE   9  
ATOM 9702  C CZ   . ARG A 1 59 ? 12.848  -1.407  -5.459  1.00 0.00 ? 59 ARG A CZ   9  
ATOM 9703  N NH1  . ARG A 1 59 ? 13.471  -0.269  -5.187  1.00 0.00 ? 59 ARG A NH1  9  
ATOM 9704  N NH2  . ARG A 1 59 ? 13.030  -1.994  -6.635  1.00 0.00 ? 59 ARG A NH2  9  
ATOM 9705  H H    . ARG A 1 59 ? 8.846   1.009   -5.215  1.00 0.00 ? 59 ARG A H    9  
ATOM 9706  H HA   . ARG A 1 59 ? 9.767   2.143   -2.757  1.00 0.00 ? 59 ARG A HA   9  
ATOM 9707  H HB2  . ARG A 1 59 ? 11.211  0.720   -4.997  1.00 0.00 ? 59 ARG A HB2  9  
ATOM 9708  H HB3  . ARG A 1 59 ? 11.993  1.243   -3.511  1.00 0.00 ? 59 ARG A HB3  9  
ATOM 9709  H HG2  . ARG A 1 59 ? 10.341  -0.164  -2.257  1.00 0.00 ? 59 ARG A HG2  9  
ATOM 9710  H HG3  . ARG A 1 59 ? 9.816   -0.806  -3.815  1.00 0.00 ? 59 ARG A HG3  9  
ATOM 9711  H HD2  . ARG A 1 59 ? 12.681  -0.878  -2.899  1.00 0.00 ? 59 ARG A HD2  9  
ATOM 9712  H HD3  . ARG A 1 59 ? 11.535  -2.172  -2.552  1.00 0.00 ? 59 ARG A HD3  9  
ATOM 9713  H HE   . ARG A 1 59 ? 11.593  -2.800  -4.778  1.00 0.00 ? 59 ARG A HE   9  
ATOM 9714  H HH11 . ARG A 1 59 ? 13.337  0.175   -4.302  1.00 0.00 ? 59 ARG A HH11 9  
ATOM 9715  H HH12 . ARG A 1 59 ? 14.077  0.144   -5.868  1.00 0.00 ? 59 ARG A HH12 9  
ATOM 9716  H HH21 . ARG A 1 59 ? 12.562  -2.852  -6.842  1.00 0.00 ? 59 ARG A HH21 9  
ATOM 9717  H HH22 . ARG A 1 59 ? 13.635  -1.578  -7.313  1.00 0.00 ? 59 ARG A HH22 9  
ATOM 9718  N N    . GLN A 1 60 ? 10.703  3.522   -5.601  1.00 0.00 ? 60 GLN A N    9  
ATOM 9719  C CA   . GLN A 1 60 ? 11.256  4.736   -6.191  1.00 0.00 ? 60 GLN A CA   9  
ATOM 9720  C C    . GLN A 1 60 ? 10.308  5.915   -5.998  1.00 0.00 ? 60 GLN A C    9  
ATOM 9721  O O    . GLN A 1 60 ? 10.740  7.064   -5.907  1.00 0.00 ? 60 GLN A O    9  
ATOM 9722  C CB   . GLN A 1 60 ? 11.529  4.524   -7.681  1.00 0.00 ? 60 GLN A CB   9  
ATOM 9723  C CG   . GLN A 1 60 ? 10.282  4.614   -8.547  1.00 0.00 ? 60 GLN A CG   9  
ATOM 9724  C CD   . GLN A 1 60 ? 10.605  4.819   -10.014 1.00 0.00 ? 60 GLN A CD   9  
ATOM 9725  O OE1  . GLN A 1 60 ? 10.792  3.858   -10.761 1.00 0.00 ? 60 GLN A OE1  9  
ATOM 9726  N NE2  . GLN A 1 60 ? 10.671  6.076   -10.436 1.00 0.00 ? 60 GLN A NE2  9  
ATOM 9727  H H    . GLN A 1 60 ? 10.379  2.809   -6.189  1.00 0.00 ? 60 GLN A H    9  
ATOM 9728  H HA   . GLN A 1 60 ? 12.187  4.953   -5.691  1.00 0.00 ? 60 GLN A HA   9  
ATOM 9729  H HB2  . GLN A 1 60 ? 12.229  5.274   -8.017  1.00 0.00 ? 60 GLN A HB2  9  
ATOM 9730  H HB3  . GLN A 1 60 ? 11.966  3.547   -7.820  1.00 0.00 ? 60 GLN A HB3  9  
ATOM 9731  H HG2  . GLN A 1 60 ? 9.720   3.698   -8.443  1.00 0.00 ? 60 GLN A HG2  9  
ATOM 9732  H HG3  . GLN A 1 60 ? 9.682   5.445   -8.206  1.00 0.00 ? 60 GLN A HG3  9  
ATOM 9733  H HE21 . GLN A 1 60 ? 10.512  6.792   -9.785  1.00 0.00 ? 60 GLN A HE21 9  
ATOM 9734  H HE22 . GLN A 1 60 ? 10.878  6.238   -11.379 1.00 0.00 ? 60 GLN A HE22 9  
ATOM 9735  N N    . LYS A 1 61 ? 9.013   5.623   -5.938  1.00 0.00 ? 61 LYS A N    9  
ATOM 9736  C CA   . LYS A 1 61 ? 8.003   6.659   -5.754  1.00 0.00 ? 61 LYS A CA   9  
ATOM 9737  C C    . LYS A 1 61 ? 7.862   7.026   -4.281  1.00 0.00 ? 61 LYS A C    9  
ATOM 9738  O O    . LYS A 1 61 ? 7.564   8.172   -3.943  1.00 0.00 ? 61 LYS A O    9  
ATOM 9739  C CB   . LYS A 1 61 ? 6.655   6.187   -6.305  1.00 0.00 ? 61 LYS A CB   9  
ATOM 9740  C CG   . LYS A 1 61 ? 6.683   5.864   -7.789  1.00 0.00 ? 61 LYS A CG   9  
ATOM 9741  C CD   . LYS A 1 61 ? 5.569   4.904   -8.171  1.00 0.00 ? 61 LYS A CD   9  
ATOM 9742  C CE   . LYS A 1 61 ? 5.123   5.113   -9.610  1.00 0.00 ? 61 LYS A CE   9  
ATOM 9743  N NZ   . LYS A 1 61 ? 4.443   6.425   -9.795  1.00 0.00 ? 61 LYS A NZ   9  
ATOM 9744  H H    . LYS A 1 61 ? 8.730   4.688   -6.017  1.00 0.00 ? 61 LYS A H    9  
ATOM 9745  H HA   . LYS A 1 61 ? 8.320   7.532   -6.303  1.00 0.00 ? 61 LYS A HA   9  
ATOM 9746  H HB2  . LYS A 1 61 ? 6.351   5.300   -5.770  1.00 0.00 ? 61 LYS A HB2  9  
ATOM 9747  H HB3  . LYS A 1 61 ? 5.922   6.964   -6.141  1.00 0.00 ? 61 LYS A HB3  9  
ATOM 9748  H HG2  . LYS A 1 61 ? 6.564   6.779   -8.350  1.00 0.00 ? 61 LYS A HG2  9  
ATOM 9749  H HG3  . LYS A 1 61 ? 7.635   5.412   -8.031  1.00 0.00 ? 61 LYS A HG3  9  
ATOM 9750  H HD2  . LYS A 1 61 ? 5.925   3.890   -8.061  1.00 0.00 ? 61 LYS A HD2  9  
ATOM 9751  H HD3  . LYS A 1 61 ? 4.726   5.065   -7.515  1.00 0.00 ? 61 LYS A HD3  9  
ATOM 9752  H HE2  . LYS A 1 61 ? 5.990   5.074   -10.252 1.00 0.00 ? 61 LYS A HE2  9  
ATOM 9753  H HE3  . LYS A 1 61 ? 4.439   4.322   -9.880  1.00 0.00 ? 61 LYS A HE3  9  
ATOM 9754  H HZ1  . LYS A 1 61 ? 4.109   6.786   -8.878  1.00 0.00 ? 61 LYS A HZ1  9  
ATOM 9755  H HZ2  . LYS A 1 61 ? 3.627   6.319   -10.431 1.00 0.00 ? 61 LYS A HZ2  9  
ATOM 9756  H HZ3  . LYS A 1 61 ? 5.103   7.115   -10.207 1.00 0.00 ? 61 LYS A HZ3  9  
ATOM 9757  N N    . ALA A 1 62 ? 8.079   6.048   -3.408  1.00 0.00 ? 62 ALA A N    9  
ATOM 9758  C CA   . ALA A 1 62 ? 7.979   6.271   -1.971  1.00 0.00 ? 62 ALA A CA   9  
ATOM 9759  C C    . ALA A 1 62 ? 9.000   7.302   -1.503  1.00 0.00 ? 62 ALA A C    9  
ATOM 9760  O O    . ALA A 1 62 ? 8.725   8.101   -0.608  1.00 0.00 ? 62 ALA A O    9  
ATOM 9761  C CB   . ALA A 1 62 ? 8.166   4.961   -1.220  1.00 0.00 ? 62 ALA A CB   9  
ATOM 9762  H H    . ALA A 1 62 ? 8.313   5.156   -3.738  1.00 0.00 ? 62 ALA A H    9  
ATOM 9763  H HA   . ALA A 1 62 ? 6.986   6.640   -1.758  1.00 0.00 ? 62 ALA A HA   9  
ATOM 9764  H HB1  . ALA A 1 62 ? 7.232   4.417   -1.208  1.00 0.00 ? 62 ALA A HB1  9  
ATOM 9765  H HB2  . ALA A 1 62 ? 8.922   4.368   -1.713  1.00 0.00 ? 62 ALA A HB2  9  
ATOM 9766  H HB3  . ALA A 1 62 ? 8.475   5.168   -0.206  1.00 0.00 ? 62 ALA A HB3  9  
ATOM 9767  N N    . ARG A 1 63 ? 10.181  7.278   -2.113  1.00 0.00 ? 63 ARG A N    9  
ATOM 9768  C CA   . ARG A 1 63 ? 11.244  8.209   -1.757  1.00 0.00 ? 63 ARG A CA   9  
ATOM 9769  C C    . ARG A 1 63 ? 11.038  9.557   -2.443  1.00 0.00 ? 63 ARG A C    9  
ATOM 9770  O O    . ARG A 1 63 ? 11.239  10.611  -1.838  1.00 0.00 ? 63 ARG A O    9  
ATOM 9771  C CB   . ARG A 1 63 ? 12.607  7.632   -2.142  1.00 0.00 ? 63 ARG A CB   9  
ATOM 9772  C CG   . ARG A 1 63 ? 12.831  7.549   -3.643  1.00 0.00 ? 63 ARG A CG   9  
ATOM 9773  C CD   . ARG A 1 63 ? 14.100  6.780   -3.976  1.00 0.00 ? 63 ARG A CD   9  
ATOM 9774  N NE   . ARG A 1 63 ? 14.446  6.879   -5.391  1.00 0.00 ? 63 ARG A NE   9  
ATOM 9775  C CZ   . ARG A 1 63 ? 15.677  6.712   -5.860  1.00 0.00 ? 63 ARG A CZ   9  
ATOM 9776  N NH1  . ARG A 1 63 ? 16.675  6.439   -5.031  1.00 0.00 ? 63 ARG A NH1  9  
ATOM 9777  N NH2  . ARG A 1 63 ? 15.913  6.818   -7.162  1.00 0.00 ? 63 ARG A NH2  9  
ATOM 9778  H H    . ARG A 1 63 ? 10.341  6.617   -2.819  1.00 0.00 ? 63 ARG A H    9  
ATOM 9779  H HA   . ARG A 1 63 ? 11.214  8.354   -0.688  1.00 0.00 ? 63 ARG A HA   9  
ATOM 9780  H HB2  . ARG A 1 63 ? 13.382  8.255   -1.719  1.00 0.00 ? 63 ARG A HB2  9  
ATOM 9781  H HB3  . ARG A 1 63 ? 12.692  6.637   -1.732  1.00 0.00 ? 63 ARG A HB3  9  
ATOM 9782  H HG2  . ARG A 1 63 ? 11.990  7.046   -4.097  1.00 0.00 ? 63 ARG A HG2  9  
ATOM 9783  H HG3  . ARG A 1 63 ? 12.913  8.550   -4.041  1.00 0.00 ? 63 ARG A HG3  9  
ATOM 9784  H HD2  . ARG A 1 63 ? 14.913  7.180   -3.388  1.00 0.00 ? 63 ARG A HD2  9  
ATOM 9785  H HD3  . ARG A 1 63 ? 13.951  5.740   -3.723  1.00 0.00 ? 63 ARG A HD3  9  
ATOM 9786  H HE   . ARG A 1 63 ? 13.724  7.080   -6.022  1.00 0.00 ? 63 ARG A HE   9  
ATOM 9787  H HH11 . ARG A 1 63 ? 16.500  6.358   -4.050  1.00 0.00 ? 63 ARG A HH11 9  
ATOM 9788  H HH12 . ARG A 1 63 ? 17.601  6.313   -5.387  1.00 0.00 ? 63 ARG A HH12 9  
ATOM 9789  H HH21 . ARG A 1 63 ? 15.163  7.024   -7.790  1.00 0.00 ? 63 ARG A HH21 9  
ATOM 9790  H HH22 . ARG A 1 63 ? 16.840  6.693   -7.514  1.00 0.00 ? 63 ARG A HH22 9  
ATOM 9791  N N    . LYS A 1 64 ? 10.637  9.516   -3.708  1.00 0.00 ? 64 LYS A N    9  
ATOM 9792  C CA   . LYS A 1 64 ? 10.402  10.732  -4.477  1.00 0.00 ? 64 LYS A CA   9  
ATOM 9793  C C    . LYS A 1 64 ? 9.413   11.646  -3.762  1.00 0.00 ? 64 LYS A C    9  
ATOM 9794  O O    . LYS A 1 64 ? 8.406   11.186  -3.224  1.00 0.00 ? 64 LYS A O    9  
ATOM 9795  C CB   . LYS A 1 64 ? 9.876   10.385  -5.872  1.00 0.00 ? 64 LYS A CB   9  
ATOM 9796  C CG   . LYS A 1 64 ? 10.013  11.519  -6.873  1.00 0.00 ? 64 LYS A CG   9  
ATOM 9797  C CD   . LYS A 1 64 ? 11.449  11.674  -7.347  1.00 0.00 ? 64 LYS A CD   9  
ATOM 9798  C CE   . LYS A 1 64 ? 11.755  13.112  -7.737  1.00 0.00 ? 64 LYS A CE   9  
ATOM 9799  N NZ   . LYS A 1 64 ? 11.225  13.446  -9.088  1.00 0.00 ? 64 LYS A NZ   9  
ATOM 9800  H H    . LYS A 1 64 ? 10.493  8.645   -4.136  1.00 0.00 ? 64 LYS A H    9  
ATOM 9801  H HA   . LYS A 1 64 ? 11.345  11.249  -4.576  1.00 0.00 ? 64 LYS A HA   9  
ATOM 9802  H HB2  . LYS A 1 64 ? 10.423  9.533   -6.248  1.00 0.00 ? 64 LYS A HB2  9  
ATOM 9803  H HB3  . LYS A 1 64 ? 8.830   10.126  -5.794  1.00 0.00 ? 64 LYS A HB3  9  
ATOM 9804  H HG2  . LYS A 1 64 ? 9.384   11.313  -7.726  1.00 0.00 ? 64 LYS A HG2  9  
ATOM 9805  H HG3  . LYS A 1 64 ? 9.697   12.441  -6.405  1.00 0.00 ? 64 LYS A HG3  9  
ATOM 9806  H HD2  . LYS A 1 64 ? 12.116  11.379  -6.551  1.00 0.00 ? 64 LYS A HD2  9  
ATOM 9807  H HD3  . LYS A 1 64 ? 11.606  11.037  -8.206  1.00 0.00 ? 64 LYS A HD3  9  
ATOM 9808  H HE2  . LYS A 1 64 ? 11.306  13.772  -7.010  1.00 0.00 ? 64 LYS A HE2  9  
ATOM 9809  H HE3  . LYS A 1 64 ? 12.826  13.251  -7.735  1.00 0.00 ? 64 LYS A HE3  9  
ATOM 9810  H HZ1  . LYS A 1 64 ? 10.193  13.574  -9.045  1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 9811  H HZ2  . LYS A 1 64 ? 11.440  12.679  -9.756  1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 9812  H HZ3  . LYS A 1 64 ? 11.658  14.325  -9.435  1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 9813  N N    . SER A 1 65 ? 9.705   12.943  -3.761  1.00 0.00 ? 65 SER A N    9  
ATOM 9814  C CA   . SER A 1 65 ? 8.842   13.921  -3.110  1.00 0.00 ? 65 SER A CA   9  
ATOM 9815  C C    . SER A 1 65 ? 7.915   14.587  -4.123  1.00 0.00 ? 65 SER A C    9  
ATOM 9816  O O    . SER A 1 65 ? 8.343   14.979  -5.208  1.00 0.00 ? 65 SER A O    9  
ATOM 9817  C CB   . SER A 1 65 ? 9.683   14.981  -2.397  1.00 0.00 ? 65 SER A CB   9  
ATOM 9818  O OG   . SER A 1 65 ? 10.549  15.640  -3.304  1.00 0.00 ? 65 SER A OG   9  
ATOM 9819  H H    . SER A 1 65 ? 10.523  13.248  -4.208  1.00 0.00 ? 65 SER A H    9  
ATOM 9820  H HA   . SER A 1 65 ? 8.241   13.399  -2.380  1.00 0.00 ? 65 SER A HA   9  
ATOM 9821  H HB2  . SER A 1 65 ? 9.030   15.712  -1.945  1.00 0.00 ? 65 SER A HB2  9  
ATOM 9822  H HB3  . SER A 1 65 ? 10.279  14.507  -1.629  1.00 0.00 ? 65 SER A HB3  9  
ATOM 9823  H HG   . SER A 1 65 ? 10.048  16.279  -3.818  1.00 0.00 ? 65 SER A HG   9  
ATOM 9824  N N    . GLY A 1 66 ? 6.643   14.712  -3.759  1.00 0.00 ? 66 GLY A N    9  
ATOM 9825  C CA   . GLY A 1 66 ? 5.675   15.331  -4.645  1.00 0.00 ? 66 GLY A CA   9  
ATOM 9826  C C    . GLY A 1 66 ? 4.351   15.605  -3.959  1.00 0.00 ? 66 GLY A C    9  
ATOM 9827  O O    . GLY A 1 66 ? 4.018   16.746  -3.639  1.00 0.00 ? 66 GLY A O    9  
ATOM 9828  H H    . GLY A 1 66 ? 6.358   14.381  -2.881  1.00 0.00 ? 66 GLY A H    9  
ATOM 9829  H HA2  . GLY A 1 66 ? 6.080   16.264  -5.008  1.00 0.00 ? 66 GLY A HA2  9  
ATOM 9830  H HA3  . GLY A 1 66 ? 5.502   14.674  -5.485  1.00 0.00 ? 66 GLY A HA3  9  
ATOM 9831  N N    . PRO A 1 67 ? 3.571   14.540  -3.723  1.00 0.00 ? 67 PRO A N    9  
ATOM 9832  C CA   . PRO A 1 67 ? 2.263   14.646  -3.069  1.00 0.00 ? 67 PRO A CA   9  
ATOM 9833  C C    . PRO A 1 67 ? 2.382   15.008  -1.592  1.00 0.00 ? 67 PRO A C    9  
ATOM 9834  O O    . PRO A 1 67 ? 3.232   14.476  -0.879  1.00 0.00 ? 67 PRO A O    9  
ATOM 9835  C CB   . PRO A 1 67 ? 1.672   13.243  -3.229  1.00 0.00 ? 67 PRO A CB   9  
ATOM 9836  C CG   . PRO A 1 67 ? 2.854   12.346  -3.362  1.00 0.00 ? 67 PRO A CG   9  
ATOM 9837  C CD   . PRO A 1 67 ? 3.905   13.150  -4.077  1.00 0.00 ? 67 PRO A CD   9  
ATOM 9838  H HA   . PRO A 1 67 ? 1.628   15.365  -3.565  1.00 0.00 ? 67 PRO A HA   9  
ATOM 9839  H HB2  . PRO A 1 67 ? 1.083   12.996  -2.356  1.00 0.00 ? 67 PRO A HB2  9  
ATOM 9840  H HB3  . PRO A 1 67 ? 1.050   13.210  -4.111  1.00 0.00 ? 67 PRO A HB3  9  
ATOM 9841  H HG2  . PRO A 1 67 ? 3.205   12.055  -2.385  1.00 0.00 ? 67 PRO A HG2  9  
ATOM 9842  H HG3  . PRO A 1 67 ? 2.590   11.475  -3.943  1.00 0.00 ? 67 PRO A HG3  9  
ATOM 9843  H HD2  . PRO A 1 67 ? 4.889   12.887  -3.719  1.00 0.00 ? 67 PRO A HD2  9  
ATOM 9844  H HD3  . PRO A 1 67 ? 3.836   12.998  -5.144  1.00 0.00 ? 67 PRO A HD3  9  
ATOM 9845  N N    . SER A 1 68 ? 1.524   15.917  -1.140  1.00 0.00 ? 68 SER A N    9  
ATOM 9846  C CA   . SER A 1 68 ? 1.535   16.354  0.251   1.00 0.00 ? 68 SER A CA   9  
ATOM 9847  C C    . SER A 1 68 ? 0.237   17.074  0.605   1.00 0.00 ? 68 SER A C    9  
ATOM 9848  O O    . SER A 1 68 ? -0.559  17.409  -0.272  1.00 0.00 ? 68 SER A O    9  
ATOM 9849  C CB   . SER A 1 68 ? 2.729   17.274  0.510   1.00 0.00 ? 68 SER A CB   9  
ATOM 9850  O OG   . SER A 1 68 ? 2.638   18.457  -0.266  1.00 0.00 ? 68 SER A OG   9  
ATOM 9851  H H    . SER A 1 68 ? 0.869   16.306  -1.758  1.00 0.00 ? 68 SER A H    9  
ATOM 9852  H HA   . SER A 1 68 ? 1.626   15.476  0.873   1.00 0.00 ? 68 SER A HA   9  
ATOM 9853  H HB2  . SER A 1 68 ? 2.752   17.544  1.555   1.00 0.00 ? 68 SER A HB2  9  
ATOM 9854  H HB3  . SER A 1 68 ? 3.641   16.757  0.251   1.00 0.00 ? 68 SER A HB3  9  
ATOM 9855  H HG   . SER A 1 68 ? 3.257   18.408  -0.998  1.00 0.00 ? 68 SER A HG   9  
ATOM 9856  N N    . SER A 1 69 ? 0.031   17.308  1.897   1.00 0.00 ? 69 SER A N    9  
ATOM 9857  C CA   . SER A 1 69 ? -1.172  17.984  2.369   1.00 0.00 ? 69 SER A CA   9  
ATOM 9858  C C    . SER A 1 69 ? -1.485  19.202  1.505   1.00 0.00 ? 69 SER A C    9  
ATOM 9859  O O    . SER A 1 69 ? -0.679  20.125  1.398   1.00 0.00 ? 69 SER A O    9  
ATOM 9860  C CB   . SER A 1 69 ? -1.003  18.411  3.829   1.00 0.00 ? 69 SER A CB   9  
ATOM 9861  O OG   . SER A 1 69 ? -0.733  17.294  4.658   1.00 0.00 ? 69 SER A OG   9  
ATOM 9862  H H    . SER A 1 69 ? 0.703   17.016  2.549   1.00 0.00 ? 69 SER A H    9  
ATOM 9863  H HA   . SER A 1 69 ? -1.993  17.287  2.299   1.00 0.00 ? 69 SER A HA   9  
ATOM 9864  H HB2  . SER A 1 69 ? -0.182  19.108  3.905   1.00 0.00 ? 69 SER A HB2  9  
ATOM 9865  H HB3  . SER A 1 69 ? -1.911  18.886  4.169   1.00 0.00 ? 69 SER A HB3  9  
ATOM 9866  H HG   . SER A 1 69 ? -0.331  16.596  4.135   1.00 0.00 ? 69 SER A HG   9  
ATOM 9867  N N    . GLY A 1 70 ? -2.663  19.195  0.887   1.00 0.00 ? 70 GLY A N    9  
ATOM 9868  C CA   . GLY A 1 70 ? -3.062  20.303  0.040   1.00 0.00 ? 70 GLY A CA   9  
ATOM 9869  C C    . GLY A 1 70 ? -4.034  19.881  -1.045  1.00 0.00 ? 70 GLY A C    9  
ATOM 9870  O O    . GLY A 1 70 ? -4.345  18.698  -1.184  1.00 0.00 ? 70 GLY A O    9  
ATOM 9871  H H    . GLY A 1 70 ? -3.265  18.431  1.009   1.00 0.00 ? 70 GLY A H    9  
ATOM 9872  H HA2  . GLY A 1 70 ? -3.529  21.060  0.652   1.00 0.00 ? 70 GLY A HA2  9  
ATOM 9873  H HA3  . GLY A 1 70 ? -2.182  20.722  -0.425  1.00 0.00 ? 70 GLY A HA3  9  
ATOM 9874  N N    . GLY A 1 1  ? -11.947 -3.690  -35.842 1.00 0.00 ? 1  GLY A N    10 
ATOM 9875  C CA   . GLY A 1 1  ? -12.216 -3.205  -34.500 1.00 0.00 ? 1  GLY A CA   10 
ATOM 9876  C C    . GLY A 1 1  ? -11.261 -3.781  -33.474 1.00 0.00 ? 1  GLY A C    10 
ATOM 9877  O O    . GLY A 1 1  ? -11.337 -4.963  -33.140 1.00 0.00 ? 1  GLY A O    10 
ATOM 9878  H H1   . GLY A 1 1  ? -12.575 -3.492  -36.567 1.00 0.00 ? 1  GLY A H1   10 
ATOM 9879  H HA2  . GLY A 1 1  ? -12.129 -2.129  -34.494 1.00 0.00 ? 1  GLY A HA2  10 
ATOM 9880  H HA3  . GLY A 1 1  ? -13.225 -3.477  -34.228 1.00 0.00 ? 1  GLY A HA3  10 
ATOM 9881  N N    . SER A 1 2  ? -10.358 -2.944  -32.973 1.00 0.00 ? 2  SER A N    10 
ATOM 9882  C CA   . SER A 1 2  ? -9.380  -3.378  -31.982 1.00 0.00 ? 2  SER A CA   10 
ATOM 9883  C C    . SER A 1 2  ? -9.988  -3.380  -30.583 1.00 0.00 ? 2  SER A C    10 
ATOM 9884  O O    . SER A 1 2  ? -10.843 -2.554  -30.264 1.00 0.00 ? 2  SER A O    10 
ATOM 9885  C CB   . SER A 1 2  ? -8.151  -2.467  -32.015 1.00 0.00 ? 2  SER A CB   10 
ATOM 9886  O OG   . SER A 1 2  ? -8.472  -1.161  -31.568 1.00 0.00 ? 2  SER A OG   10 
ATOM 9887  H H    . SER A 1 2  ? -10.348 -2.013  -33.279 1.00 0.00 ? 2  SER A H    10 
ATOM 9888  H HA   . SER A 1 2  ? -9.078  -4.384  -32.233 1.00 0.00 ? 2  SER A HA   10 
ATOM 9889  H HB2  . SER A 1 2  ? -7.386  -2.876  -31.373 1.00 0.00 ? 2  SER A HB2  10 
ATOM 9890  H HB3  . SER A 1 2  ? -7.778  -2.407  -33.027 1.00 0.00 ? 2  SER A HB3  10 
ATOM 9891  H HG   . SER A 1 2  ? -8.559  -0.576  -32.324 1.00 0.00 ? 2  SER A HG   10 
ATOM 9892  N N    . SER A 1 3  ? -9.541  -4.316  -29.752 1.00 0.00 ? 3  SER A N    10 
ATOM 9893  C CA   . SER A 1 3  ? -10.043 -4.430  -28.387 1.00 0.00 ? 3  SER A CA   10 
ATOM 9894  C C    . SER A 1 3  ? -8.908  -4.730  -27.414 1.00 0.00 ? 3  SER A C    10 
ATOM 9895  O O    . SER A 1 3  ? -7.758  -4.903  -27.817 1.00 0.00 ? 3  SER A O    10 
ATOM 9896  C CB   . SER A 1 3  ? -11.106 -5.528  -28.303 1.00 0.00 ? 3  SER A CB   10 
ATOM 9897  O OG   . SER A 1 3  ? -12.366 -5.052  -28.742 1.00 0.00 ? 3  SER A OG   10 
ATOM 9898  H H    . SER A 1 3  ? -8.859  -4.947  -30.065 1.00 0.00 ? 3  SER A H    10 
ATOM 9899  H HA   . SER A 1 3  ? -10.492 -3.485  -28.119 1.00 0.00 ? 3  SER A HA   10 
ATOM 9900  H HB2  . SER A 1 3  ? -10.811 -6.359  -28.925 1.00 0.00 ? 3  SER A HB2  10 
ATOM 9901  H HB3  . SER A 1 3  ? -11.196 -5.859  -27.278 1.00 0.00 ? 3  SER A HB3  10 
ATOM 9902  H HG   . SER A 1 3  ? -12.693 -5.615  -29.447 1.00 0.00 ? 3  SER A HG   10 
ATOM 9903  N N    . GLY A 1 4  ? -9.239  -4.789  -26.127 1.00 0.00 ? 4  GLY A N    10 
ATOM 9904  C CA   . GLY A 1 4  ? -8.237  -5.067  -25.115 1.00 0.00 ? 4  GLY A CA   10 
ATOM 9905  C C    . GLY A 1 4  ? -7.038  -4.146  -25.217 1.00 0.00 ? 4  GLY A C    10 
ATOM 9906  O O    . GLY A 1 4  ? -7.106  -2.982  -24.821 1.00 0.00 ? 4  GLY A O    10 
ATOM 9907  H H    . GLY A 1 4  ? -10.172 -4.643  -25.864 1.00 0.00 ? 4  GLY A H    10 
ATOM 9908  H HA2  . GLY A 1 4  ? -8.685  -4.952  -24.140 1.00 0.00 ? 4  GLY A HA2  10 
ATOM 9909  H HA3  . GLY A 1 4  ? -7.902  -6.088  -25.228 1.00 0.00 ? 4  GLY A HA3  10 
ATOM 9910  N N    . SER A 1 5  ? -5.937  -4.667  -25.748 1.00 0.00 ? 5  SER A N    10 
ATOM 9911  C CA   . SER A 1 5  ? -4.715  -3.884  -25.896 1.00 0.00 ? 5  SER A CA   10 
ATOM 9912  C C    . SER A 1 5  ? -5.014  -2.523  -26.519 1.00 0.00 ? 5  SER A C    10 
ATOM 9913  O O    . SER A 1 5  ? -5.409  -2.434  -27.681 1.00 0.00 ? 5  SER A O    10 
ATOM 9914  C CB   . SER A 1 5  ? -3.701  -4.639  -26.756 1.00 0.00 ? 5  SER A CB   10 
ATOM 9915  O OG   . SER A 1 5  ? -2.470  -3.941  -26.825 1.00 0.00 ? 5  SER A OG   10 
ATOM 9916  H H    . SER A 1 5  ? -5.945  -5.601  -26.045 1.00 0.00 ? 5  SER A H    10 
ATOM 9917  H HA   . SER A 1 5  ? -4.298  -3.732  -24.912 1.00 0.00 ? 5  SER A HA   10 
ATOM 9918  H HB2  . SER A 1 5  ? -3.525  -5.614  -26.328 1.00 0.00 ? 5  SER A HB2  10 
ATOM 9919  H HB3  . SER A 1 5  ? -4.094  -4.752  -27.756 1.00 0.00 ? 5  SER A HB3  10 
ATOM 9920  H HG   . SER A 1 5  ? -2.387  -3.362  -26.064 1.00 0.00 ? 5  SER A HG   10 
ATOM 9921  N N    . SER A 1 6  ? -4.822  -1.466  -25.736 1.00 0.00 ? 6  SER A N    10 
ATOM 9922  C CA   . SER A 1 6  ? -5.074  -0.110  -26.208 1.00 0.00 ? 6  SER A CA   10 
ATOM 9923  C C    . SER A 1 6  ? -3.921  0.817   -25.838 1.00 0.00 ? 6  SER A C    10 
ATOM 9924  O O    . SER A 1 6  ? -4.133  1.954   -25.418 1.00 0.00 ? 6  SER A O    10 
ATOM 9925  C CB   . SER A 1 6  ? -6.381  0.423   -25.618 1.00 0.00 ? 6  SER A CB   10 
ATOM 9926  O OG   . SER A 1 6  ? -7.477  -0.401  -25.977 1.00 0.00 ? 6  SER A OG   10 
ATOM 9927  H H    . SER A 1 6  ? -4.506  -1.603  -24.818 1.00 0.00 ? 6  SER A H    10 
ATOM 9928  H HA   . SER A 1 6  ? -5.163  -0.144  -27.283 1.00 0.00 ? 6  SER A HA   10 
ATOM 9929  H HB2  . SER A 1 6  ? -6.303  0.449   -24.541 1.00 0.00 ? 6  SER A HB2  10 
ATOM 9930  H HB3  . SER A 1 6  ? -6.560  1.422   -25.990 1.00 0.00 ? 6  SER A HB3  10 
ATOM 9931  H HG   . SER A 1 6  ? -7.211  -1.322  -25.935 1.00 0.00 ? 6  SER A HG   10 
ATOM 9932  N N    . GLY A 1 7  ? -2.697  0.322   -25.998 1.00 0.00 ? 7  GLY A N    10 
ATOM 9933  C CA   . GLY A 1 7  ? -1.527  1.118   -25.676 1.00 0.00 ? 7  GLY A CA   10 
ATOM 9934  C C    . GLY A 1 7  ? -0.237  0.333   -25.810 1.00 0.00 ? 7  GLY A C    10 
ATOM 9935  O O    . GLY A 1 7  ? -0.188  -0.853  -25.483 1.00 0.00 ? 7  GLY A O    10 
ATOM 9936  H H    . GLY A 1 7  ? -2.588  -0.591  -26.336 1.00 0.00 ? 7  GLY A H    10 
ATOM 9937  H HA2  . GLY A 1 7  ? -1.489  1.968   -26.341 1.00 0.00 ? 7  GLY A HA2  10 
ATOM 9938  H HA3  . GLY A 1 7  ? -1.615  1.472   -24.660 1.00 0.00 ? 7  GLY A HA3  10 
ATOM 9939  N N    . ARG A 1 8  ? 0.809   0.994   -26.293 1.00 0.00 ? 8  ARG A N    10 
ATOM 9940  C CA   . ARG A 1 8  ? 2.105   0.350   -26.472 1.00 0.00 ? 8  ARG A CA   10 
ATOM 9941  C C    . ARG A 1 8  ? 2.428   -0.558  -25.289 1.00 0.00 ? 8  ARG A C    10 
ATOM 9942  O O    . ARG A 1 8  ? 2.685   -1.750  -25.460 1.00 0.00 ? 8  ARG A O    10 
ATOM 9943  C CB   . ARG A 1 8  ? 3.203   1.401   -26.637 1.00 0.00 ? 8  ARG A CB   10 
ATOM 9944  C CG   . ARG A 1 8  ? 4.600   0.811   -26.746 1.00 0.00 ? 8  ARG A CG   10 
ATOM 9945  C CD   . ARG A 1 8  ? 5.608   1.850   -27.213 1.00 0.00 ? 8  ARG A CD   10 
ATOM 9946  N NE   . ARG A 1 8  ? 5.724   1.885   -28.669 1.00 0.00 ? 8  ARG A NE   10 
ATOM 9947  C CZ   . ARG A 1 8  ? 6.496   1.058   -29.365 1.00 0.00 ? 8  ARG A CZ   10 
ATOM 9948  N NH1  . ARG A 1 8  ? 7.216   0.135   -28.741 1.00 0.00 ? 8  ARG A NH1  10 
ATOM 9949  N NH2  . ARG A 1 8  ? 6.548   1.152   -30.687 1.00 0.00 ? 8  ARG A NH2  10 
ATOM 9950  H H    . ARG A 1 8  ? 0.708   1.938   -26.536 1.00 0.00 ? 8  ARG A H    10 
ATOM 9951  H HA   . ARG A 1 8  ? 2.056   -0.251  -27.368 1.00 0.00 ? 8  ARG A HA   10 
ATOM 9952  H HB2  . ARG A 1 8  ? 3.007   1.973   -27.533 1.00 0.00 ? 8  ARG A HB2  10 
ATOM 9953  H HB3  . ARG A 1 8  ? 3.181   2.064   -25.785 1.00 0.00 ? 8  ARG A HB3  10 
ATOM 9954  H HG2  . ARG A 1 8  ? 4.902   0.443   -25.777 1.00 0.00 ? 8  ARG A HG2  10 
ATOM 9955  H HG3  . ARG A 1 8  ? 4.582   -0.004  -27.454 1.00 0.00 ? 8  ARG A HG3  10 
ATOM 9956  H HD2  . ARG A 1 8  ? 5.293   2.821   -26.863 1.00 0.00 ? 8  ARG A HD2  10 
ATOM 9957  H HD3  . ARG A 1 8  ? 6.572   1.611   -26.790 1.00 0.00 ? 8  ARG A HD3  10 
ATOM 9958  H HE   . ARG A 1 8  ? 5.200   2.558   -29.149 1.00 0.00 ? 8  ARG A HE   10 
ATOM 9959  H HH11 . ARG A 1 8  ? 7.178   0.062   -27.745 1.00 0.00 ? 8  ARG A HH11 10 
ATOM 9960  H HH12 . ARG A 1 8  ? 7.796   -0.487  -29.268 1.00 0.00 ? 8  ARG A HH12 10 
ATOM 9961  H HH21 . ARG A 1 8  ? 6.006   1.845   -31.160 1.00 0.00 ? 8  ARG A HH21 10 
ATOM 9962  H HH22 . ARG A 1 8  ? 7.129   0.529   -31.210 1.00 0.00 ? 8  ARG A HH22 10 
ATOM 9963  N N    . SER A 1 9  ? 2.415   0.014   -24.090 1.00 0.00 ? 9  SER A N    10 
ATOM 9964  C CA   . SER A 1 9  ? 2.712   -0.742  -22.878 1.00 0.00 ? 9  SER A CA   10 
ATOM 9965  C C    . SER A 1 9  ? 1.427   -1.152  -22.166 1.00 0.00 ? 9  SER A C    10 
ATOM 9966  O O    . SER A 1 9  ? 0.626   -0.305  -21.770 1.00 0.00 ? 9  SER A O    10 
ATOM 9967  C CB   . SER A 1 9  ? 3.589   0.086   -21.937 1.00 0.00 ? 9  SER A CB   10 
ATOM 9968  O OG   . SER A 1 9  ? 3.839   -0.611  -20.729 1.00 0.00 ? 9  SER A OG   10 
ATOM 9969  H H    . SER A 1 9  ? 2.204   0.969   -24.018 1.00 0.00 ? 9  SER A H    10 
ATOM 9970  H HA   . SER A 1 9  ? 3.249   -1.632  -23.167 1.00 0.00 ? 9  SER A HA   10 
ATOM 9971  H HB2  . SER A 1 9  ? 4.531   0.297   -22.419 1.00 0.00 ? 9  SER A HB2  10 
ATOM 9972  H HB3  . SER A 1 9  ? 3.087   1.015   -21.706 1.00 0.00 ? 9  SER A HB3  10 
ATOM 9973  H HG   . SER A 1 9  ? 4.015   0.019   -20.026 1.00 0.00 ? 9  SER A HG   10 
ATOM 9974  N N    . SER A 1 10 ? 1.237   -2.457  -22.006 1.00 0.00 ? 10 SER A N    10 
ATOM 9975  C CA   . SER A 1 10 ? 0.047   -2.982  -21.344 1.00 0.00 ? 10 SER A CA   10 
ATOM 9976  C C    . SER A 1 10 ? 0.101   -2.719  -19.842 1.00 0.00 ? 10 SER A C    10 
ATOM 9977  O O    . SER A 1 10 ? 0.686   -3.494  -19.086 1.00 0.00 ? 10 SER A O    10 
ATOM 9978  C CB   . SER A 1 10 ? -0.088  -4.483  -21.607 1.00 0.00 ? 10 SER A CB   10 
ATOM 9979  O OG   . SER A 1 10 ? -1.393  -4.939  -21.297 1.00 0.00 ? 10 SER A OG   10 
ATOM 9980  H H    . SER A 1 10 ? 1.912   -3.083  -22.343 1.00 0.00 ? 10 SER A H    10 
ATOM 9981  H HA   . SER A 1 10 ? -0.812  -2.474  -21.756 1.00 0.00 ? 10 SER A HA   10 
ATOM 9982  H HB2  . SER A 1 10 ? 0.113   -4.683  -22.648 1.00 0.00 ? 10 SER A HB2  10 
ATOM 9983  H HB3  . SER A 1 10 ? 0.623   -5.018  -20.994 1.00 0.00 ? 10 SER A HB3  10 
ATOM 9984  H HG   . SER A 1 10 ? -1.444  -5.154  -20.362 1.00 0.00 ? 10 SER A HG   10 
ATOM 9985  N N    . ARG A 1 11 ? -0.515  -1.620  -19.418 1.00 0.00 ? 11 ARG A N    10 
ATOM 9986  C CA   . ARG A 1 11 ? -0.537  -1.254  -18.007 1.00 0.00 ? 11 ARG A CA   10 
ATOM 9987  C C    . ARG A 1 11 ? -1.600  -2.050  -17.255 1.00 0.00 ? 11 ARG A C    10 
ATOM 9988  O O    . ARG A 1 11 ? -2.605  -2.465  -17.833 1.00 0.00 ? 11 ARG A O    10 
ATOM 9989  C CB   . ARG A 1 11 ? -0.803  0.245   -17.852 1.00 0.00 ? 11 ARG A CB   10 
ATOM 9990  C CG   . ARG A 1 11 ? 0.418   1.111   -18.119 1.00 0.00 ? 11 ARG A CG   10 
ATOM 9991  C CD   . ARG A 1 11 ? 0.032   2.565   -18.340 1.00 0.00 ? 11 ARG A CD   10 
ATOM 9992  N NE   . ARG A 1 11 ? -0.285  3.243   -17.086 1.00 0.00 ? 11 ARG A NE   10 
ATOM 9993  C CZ   . ARG A 1 11 ? 0.631   3.796   -16.297 1.00 0.00 ? 11 ARG A CZ   10 
ATOM 9994  N NH1  . ARG A 1 11 ? 1.913   3.750   -16.632 1.00 0.00 ? 11 ARG A NH1  10 
ATOM 9995  N NH2  . ARG A 1 11 ? 0.264   4.395   -15.172 1.00 0.00 ? 11 ARG A NH2  10 
ATOM 9996  H H    . ARG A 1 11 ? -0.964  -1.042  -20.069 1.00 0.00 ? 11 ARG A H    10 
ATOM 9997  H HA   . ARG A 1 11 ? 0.431   -1.484  -17.589 1.00 0.00 ? 11 ARG A HA   10 
ATOM 9998  H HB2  . ARG A 1 11 ? -1.580  0.535   -18.544 1.00 0.00 ? 11 ARG A HB2  10 
ATOM 9999  H HB3  . ARG A 1 11 ? -1.139  0.436   -16.844 1.00 0.00 ? 11 ARG A HB3  10 
ATOM 10000 H HG2  . ARG A 1 11 ? 1.083   1.051   -17.271 1.00 0.00 ? 11 ARG A HG2  10 
ATOM 10001 H HG3  . ARG A 1 11 ? 0.922   0.743   -19.001 1.00 0.00 ? 11 ARG A HG3  10 
ATOM 10002 H HD2  . ARG A 1 11 ? 0.857   3.075   -18.815 1.00 0.00 ? 11 ARG A HD2  10 
ATOM 10003 H HD3  . ARG A 1 11 ? -0.833  2.600   -18.986 1.00 0.00 ? 11 ARG A HD3  10 
ATOM 10004 H HE   . ARG A 1 11 ? -1.226  3.288   -16.819 1.00 0.00 ? 11 ARG A HE   10 
ATOM 10005 H HH11 . ARG A 1 11 ? 2.192   3.300   -17.480 1.00 0.00 ? 11 ARG A HH11 10 
ATOM 10006 H HH12 . ARG A 1 11 ? 2.600   4.168   -16.037 1.00 0.00 ? 11 ARG A HH12 10 
ATOM 10007 H HH21 . ARG A 1 11 ? -0.701  4.431   -14.916 1.00 0.00 ? 11 ARG A HH21 10 
ATOM 10008 H HH22 . ARG A 1 11 ? 0.954   4.810   -14.579 1.00 0.00 ? 11 ARG A HH22 10 
ATOM 10009 N N    . THR A 1 12 ? -1.370  -2.260  -15.963 1.00 0.00 ? 12 THR A N    10 
ATOM 10010 C CA   . THR A 1 12 ? -2.305  -3.008  -15.132 1.00 0.00 ? 12 THR A CA   10 
ATOM 10011 C C    . THR A 1 12 ? -3.034  -2.087  -14.160 1.00 0.00 ? 12 THR A C    10 
ATOM 10012 O O    . THR A 1 12 ? -2.415  -1.260  -13.490 1.00 0.00 ? 12 THR A O    10 
ATOM 10013 C CB   . THR A 1 12 ? -1.588  -4.113  -14.334 1.00 0.00 ? 12 THR A CB   10 
ATOM 10014 O OG1  . THR A 1 12 ? -0.811  -4.929  -15.217 1.00 0.00 ? 12 THR A OG1  10 
ATOM 10015 C CG2  . THR A 1 12 ? -2.592  -4.979  -13.587 1.00 0.00 ? 12 THR A CG2  10 
ATOM 10016 H H    . THR A 1 12 ? -0.550  -1.904  -15.560 1.00 0.00 ? 12 THR A H    10 
ATOM 10017 H HA   . THR A 1 12 ? -3.030  -3.475  -15.783 1.00 0.00 ? 12 THR A HA   10 
ATOM 10018 H HB   . THR A 1 12 ? -0.931  -3.647  -13.614 1.00 0.00 ? 12 THR A HB   10 
ATOM 10019 H HG1  . THR A 1 12 ? 0.064   -5.061  -14.844 1.00 0.00 ? 12 THR A HG1  10 
ATOM 10020 H HG21 . THR A 1 12 ? -2.766  -4.563  -12.606 1.00 0.00 ? 12 THR A HG21 10 
ATOM 10021 H HG22 . THR A 1 12 ? -2.201  -5.981  -13.490 1.00 0.00 ? 12 THR A HG22 10 
ATOM 10022 H HG23 . THR A 1 12 ? -3.521  -5.007  -14.136 1.00 0.00 ? 12 THR A HG23 10 
ATOM 10023 N N    . ARG A 1 13 ? -4.353  -2.236  -14.088 1.00 0.00 ? 13 ARG A N    10 
ATOM 10024 C CA   . ARG A 1 13 ? -5.167  -1.416  -13.198 1.00 0.00 ? 13 ARG A CA   10 
ATOM 10025 C C    . ARG A 1 13 ? -5.762  -2.260  -12.075 1.00 0.00 ? 13 ARG A C    10 
ATOM 10026 O O    . ARG A 1 13 ? -6.709  -3.018  -12.288 1.00 0.00 ? 13 ARG A O    10 
ATOM 10027 C CB   . ARG A 1 13 ? -6.286  -0.730  -13.983 1.00 0.00 ? 13 ARG A CB   10 
ATOM 10028 C CG   . ARG A 1 13 ? -7.207  -1.700  -14.704 1.00 0.00 ? 13 ARG A CG   10 
ATOM 10029 C CD   . ARG A 1 13 ? -7.832  -1.063  -15.936 1.00 0.00 ? 13 ARG A CD   10 
ATOM 10030 N NE   . ARG A 1 13 ? -9.085  -0.382  -15.623 1.00 0.00 ? 13 ARG A NE   10 
ATOM 10031 C CZ   . ARG A 1 13 ? -9.590  0.602   -16.360 1.00 0.00 ? 13 ARG A CZ   10 
ATOM 10032 N NH1  . ARG A 1 13 ? -8.952  1.017   -17.445 1.00 0.00 ? 13 ARG A NH1  10 
ATOM 10033 N NH2  . ARG A 1 13 ? -10.736 1.173   -16.011 1.00 0.00 ? 13 ARG A NH2  10 
ATOM 10034 H H    . ARG A 1 13 ? -4.790  -2.912  -14.647 1.00 0.00 ? 13 ARG A H    10 
ATOM 10035 H HA   . ARG A 1 13 ? -4.528  -0.661  -12.765 1.00 0.00 ? 13 ARG A HA   10 
ATOM 10036 H HB2  . ARG A 1 13 ? -6.882  -0.143  -13.299 1.00 0.00 ? 13 ARG A HB2  10 
ATOM 10037 H HB3  . ARG A 1 13 ? -5.844  -0.073  -14.717 1.00 0.00 ? 13 ARG A HB3  10 
ATOM 10038 H HG2  . ARG A 1 13 ? -6.637  -2.564  -15.010 1.00 0.00 ? 13 ARG A HG2  10 
ATOM 10039 H HG3  . ARG A 1 13 ? -7.993  -2.005  -14.029 1.00 0.00 ? 13 ARG A HG3  10 
ATOM 10040 H HD2  . ARG A 1 13 ? -7.137  -0.347  -16.346 1.00 0.00 ? 13 ARG A HD2  10 
ATOM 10041 H HD3  . ARG A 1 13 ? -8.025  -1.836  -16.665 1.00 0.00 ? 13 ARG A HD3  10 
ATOM 10042 H HE   . ARG A 1 13 ? -9.573  -0.672  -14.825 1.00 0.00 ? 13 ARG A HE   10 
ATOM 10043 H HH11 . ARG A 1 13 ? -8.089  0.587   -17.711 1.00 0.00 ? 13 ARG A HH11 10 
ATOM 10044 H HH12 . ARG A 1 13 ? -9.335  1.757   -17.999 1.00 0.00 ? 13 ARG A HH12 10 
ATOM 10045 H HH21 . ARG A 1 13 ? -11.220 0.863   -15.193 1.00 0.00 ? 13 ARG A HH21 10 
ATOM 10046 H HH22 . ARG A 1 13 ? -11.115 1.913   -16.565 1.00 0.00 ? 13 ARG A HH22 10 
ATOM 10047 N N    . PHE A 1 14 ? -5.200  -2.125  -10.878 1.00 0.00 ? 14 PHE A N    10 
ATOM 10048 C CA   . PHE A 1 14 ? -5.674  -2.875  -9.721  1.00 0.00 ? 14 PHE A CA   10 
ATOM 10049 C C    . PHE A 1 14 ? -6.828  -2.149  -9.036  1.00 0.00 ? 14 PHE A C    10 
ATOM 10050 O O    . PHE A 1 14 ? -7.071  -0.968  -9.289  1.00 0.00 ? 14 PHE A O    10 
ATOM 10051 C CB   . PHE A 1 14 ? -4.532  -3.095  -8.727  1.00 0.00 ? 14 PHE A CB   10 
ATOM 10052 C CG   . PHE A 1 14 ? -3.231  -3.463  -9.379  1.00 0.00 ? 14 PHE A CG   10 
ATOM 10053 C CD1  . PHE A 1 14 ? -2.426  -2.489  -9.948  1.00 0.00 ? 14 PHE A CD1  10 
ATOM 10054 C CD2  . PHE A 1 14 ? -2.812  -4.783  -9.425  1.00 0.00 ? 14 PHE A CD2  10 
ATOM 10055 C CE1  . PHE A 1 14 ? -1.227  -2.824  -10.549 1.00 0.00 ? 14 PHE A CE1  10 
ATOM 10056 C CE2  . PHE A 1 14 ? -1.615  -5.124  -10.025 1.00 0.00 ? 14 PHE A CE2  10 
ATOM 10057 C CZ   . PHE A 1 14 ? -0.822  -4.144  -10.588 1.00 0.00 ? 14 PHE A CZ   10 
ATOM 10058 H H    . PHE A 1 14 ? -4.448  -1.505  -10.770 1.00 0.00 ? 14 PHE A H    10 
ATOM 10059 H HA   . PHE A 1 14 ? -6.025  -3.834  -10.071 1.00 0.00 ? 14 PHE A HA   10 
ATOM 10060 H HB2  . PHE A 1 14 ? -4.376  -2.187  -8.163  1.00 0.00 ? 14 PHE A HB2  10 
ATOM 10061 H HB3  . PHE A 1 14 ? -4.803  -3.891  -8.050  1.00 0.00 ? 14 PHE A HB3  10 
ATOM 10062 H HD1  . PHE A 1 14 ? -2.743  -1.456  -9.918  1.00 0.00 ? 14 PHE A HD1  10 
ATOM 10063 H HD2  . PHE A 1 14 ? -3.432  -5.551  -8.986  1.00 0.00 ? 14 PHE A HD2  10 
ATOM 10064 H HE1  . PHE A 1 14 ? -0.610  -2.055  -10.989 1.00 0.00 ? 14 PHE A HE1  10 
ATOM 10065 H HE2  . PHE A 1 14 ? -1.300  -6.157  -10.054 1.00 0.00 ? 14 PHE A HE2  10 
ATOM 10066 H HZ   . PHE A 1 14 ? 0.114   -4.407  -11.057 1.00 0.00 ? 14 PHE A HZ   10 
ATOM 10067 N N    . THR A 1 15 ? -7.537  -2.863  -8.168  1.00 0.00 ? 15 THR A N    10 
ATOM 10068 C CA   . THR A 1 15 ? -8.666  -2.289  -7.448  1.00 0.00 ? 15 THR A CA   10 
ATOM 10069 C C    . THR A 1 15 ? -8.343  -2.114  -5.968  1.00 0.00 ? 15 THR A C    10 
ATOM 10070 O O    . THR A 1 15 ? -7.536  -2.856  -5.408  1.00 0.00 ? 15 THR A O    10 
ATOM 10071 C CB   . THR A 1 15 ? -9.926  -3.164  -7.587  1.00 0.00 ? 15 THR A CB   10 
ATOM 10072 O OG1  . THR A 1 15 ? -10.996 -2.609  -6.814  1.00 0.00 ? 15 THR A OG1  10 
ATOM 10073 C CG2  . THR A 1 15 ? -9.648  -4.588  -7.129  1.00 0.00 ? 15 THR A CG2  10 
ATOM 10074 H H    . THR A 1 15 ? -7.295  -3.799  -8.010  1.00 0.00 ? 15 THR A H    10 
ATOM 10075 H HA   . THR A 1 15 ? -8.878  -1.320  -7.877  1.00 0.00 ? 15 THR A HA   10 
ATOM 10076 H HB   . THR A 1 15 ? -10.217 -3.187  -8.627  1.00 0.00 ? 15 THR A HB   10 
ATOM 10077 H HG1  . THR A 1 15 ? -10.880 -1.659  -6.743  1.00 0.00 ? 15 THR A HG1  10 
ATOM 10078 H HG21 . THR A 1 15 ? -8.980  -5.068  -7.829  1.00 0.00 ? 15 THR A HG21 10 
ATOM 10079 H HG22 . THR A 1 15 ? -10.576 -5.138  -7.081  1.00 0.00 ? 15 THR A HG22 10 
ATOM 10080 H HG23 . THR A 1 15 ? -9.190  -4.568  -6.151  1.00 0.00 ? 15 THR A HG23 10 
ATOM 10081 N N    . ASP A 1 16 ? -8.978  -1.130  -5.341  1.00 0.00 ? 16 ASP A N    10 
ATOM 10082 C CA   . ASP A 1 16 ? -8.760  -0.860  -3.925  1.00 0.00 ? 16 ASP A CA   10 
ATOM 10083 C C    . ASP A 1 16 ? -8.503  -2.153  -3.158  1.00 0.00 ? 16 ASP A C    10 
ATOM 10084 O O    . ASP A 1 16 ? -7.604  -2.221  -2.319  1.00 0.00 ? 16 ASP A O    10 
ATOM 10085 C CB   . ASP A 1 16 ? -9.966  -0.131  -3.331  1.00 0.00 ? 16 ASP A CB   10 
ATOM 10086 C CG   . ASP A 1 16 ? -10.476 0.976   -4.233  1.00 0.00 ? 16 ASP A CG   10 
ATOM 10087 O OD1  . ASP A 1 16 ? -11.161 0.661   -5.228  1.00 0.00 ? 16 ASP A OD1  10 
ATOM 10088 O OD2  . ASP A 1 16 ? -10.189 2.157   -3.945  1.00 0.00 ? 16 ASP A OD2  10 
ATOM 10089 H H    . ASP A 1 16 ? -9.610  -0.573  -5.842  1.00 0.00 ? 16 ASP A H    10 
ATOM 10090 H HA   . ASP A 1 16 ? -7.890  -0.226  -3.839  1.00 0.00 ? 16 ASP A HA   10 
ATOM 10091 H HB2  . ASP A 1 16 ? -10.766 -0.840  -3.175  1.00 0.00 ? 16 ASP A HB2  10 
ATOM 10092 H HB3  . ASP A 1 16 ? -9.685  0.303   -2.382  1.00 0.00 ? 16 ASP A HB3  10 
ATOM 10093 N N    . TYR A 1 17 ? -9.298  -3.176  -3.450  1.00 0.00 ? 17 TYR A N    10 
ATOM 10094 C CA   . TYR A 1 17 ? -9.159  -4.466  -2.785  1.00 0.00 ? 17 TYR A CA   10 
ATOM 10095 C C    . TYR A 1 17 ? -7.739  -5.003  -2.930  1.00 0.00 ? 17 TYR A C    10 
ATOM 10096 O O    . TYR A 1 17 ? -7.122  -5.425  -1.952  1.00 0.00 ? 17 TYR A O    10 
ATOM 10097 C CB   . TYR A 1 17 ? -10.158 -5.471  -3.363  1.00 0.00 ? 17 TYR A CB   10 
ATOM 10098 C CG   . TYR A 1 17 ? -9.750  -6.913  -3.162  1.00 0.00 ? 17 TYR A CG   10 
ATOM 10099 C CD1  . TYR A 1 17 ? -9.263  -7.353  -1.938  1.00 0.00 ? 17 TYR A CD1  10 
ATOM 10100 C CD2  . TYR A 1 17 ? -9.851  -7.835  -4.197  1.00 0.00 ? 17 TYR A CD2  10 
ATOM 10101 C CE1  . TYR A 1 17 ? -8.889  -8.670  -1.749  1.00 0.00 ? 17 TYR A CE1  10 
ATOM 10102 C CE2  . TYR A 1 17 ? -9.481  -9.153  -4.017  1.00 0.00 ? 17 TYR A CE2  10 
ATOM 10103 C CZ   . TYR A 1 17 ? -9.000  -9.566  -2.792  1.00 0.00 ? 17 TYR A CZ   10 
ATOM 10104 O OH   . TYR A 1 17 ? -8.628  -10.878 -2.610  1.00 0.00 ? 17 TYR A OH   10 
ATOM 10105 H H    . TYR A 1 17 ? -9.997  -3.060  -4.128  1.00 0.00 ? 17 TYR A H    10 
ATOM 10106 H HA   . TYR A 1 17 ? -9.373  -4.324  -1.736  1.00 0.00 ? 17 TYR A HA   10 
ATOM 10107 H HB2  . TYR A 1 17 ? -11.116 -5.329  -2.889  1.00 0.00 ? 17 TYR A HB2  10 
ATOM 10108 H HB3  . TYR A 1 17 ? -10.258 -5.299  -4.425  1.00 0.00 ? 17 TYR A HB3  10 
ATOM 10109 H HD1  . TYR A 1 17 ? -9.177  -6.649  -1.123  1.00 0.00 ? 17 TYR A HD1  10 
ATOM 10110 H HD2  . TYR A 1 17 ? -10.228 -7.508  -5.155  1.00 0.00 ? 17 TYR A HD2  10 
ATOM 10111 H HE1  . TYR A 1 17 ? -8.512  -8.994  -0.790  1.00 0.00 ? 17 TYR A HE1  10 
ATOM 10112 H HE2  . TYR A 1 17 ? -9.567  -9.855  -4.834  1.00 0.00 ? 17 TYR A HE2  10 
ATOM 10113 H HH   . TYR A 1 17 ? -7.797  -11.041 -3.061  1.00 0.00 ? 17 TYR A HH   10 
ATOM 10114 N N    . GLN A 1 18 ? -7.227  -4.983  -4.156  1.00 0.00 ? 18 GLN A N    10 
ATOM 10115 C CA   . GLN A 1 18 ? -5.880  -5.468  -4.429  1.00 0.00 ? 18 GLN A CA   10 
ATOM 10116 C C    . GLN A 1 18 ? -4.833  -4.480  -3.925  1.00 0.00 ? 18 GLN A C    10 
ATOM 10117 O O    . GLN A 1 18 ? -3.889  -4.860  -3.230  1.00 0.00 ? 18 GLN A O    10 
ATOM 10118 C CB   . GLN A 1 18 ? -5.694  -5.704  -5.929  1.00 0.00 ? 18 GLN A CB   10 
ATOM 10119 C CG   . GLN A 1 18 ? -6.704  -6.673  -6.522  1.00 0.00 ? 18 GLN A CG   10 
ATOM 10120 C CD   . GLN A 1 18 ? -6.148  -7.446  -7.702  1.00 0.00 ? 18 GLN A CD   10 
ATOM 10121 O OE1  . GLN A 1 18 ? -5.585  -6.864  -8.630  1.00 0.00 ? 18 GLN A OE1  10 
ATOM 10122 N NE2  . GLN A 1 18 ? -6.305  -8.764  -7.673  1.00 0.00 ? 18 GLN A NE2  10 
ATOM 10123 H H    . GLN A 1 18 ? -7.769  -4.635  -4.894  1.00 0.00 ? 18 GLN A H    10 
ATOM 10124 H HA   . GLN A 1 18 ? -5.753  -6.405  -3.908  1.00 0.00 ? 18 GLN A HA   10 
ATOM 10125 H HB2  . GLN A 1 18 ? -5.788  -4.760  -6.444  1.00 0.00 ? 18 GLN A HB2  10 
ATOM 10126 H HB3  . GLN A 1 18 ? -4.704  -6.101  -6.099  1.00 0.00 ? 18 GLN A HB3  10 
ATOM 10127 H HG2  . GLN A 1 18 ? -7.000  -7.377  -5.758  1.00 0.00 ? 18 GLN A HG2  10 
ATOM 10128 H HG3  . GLN A 1 18 ? -7.569  -6.115  -6.850  1.00 0.00 ? 18 GLN A HG3  10 
ATOM 10129 H HE21 . GLN A 1 18 ? -6.765  -9.158  -6.903  1.00 0.00 ? 18 GLN A HE21 10 
ATOM 10130 H HE22 . GLN A 1 18 ? -5.956  -9.288  -8.423  1.00 0.00 ? 18 GLN A HE22 10 
ATOM 10131 N N    . LEU A 1 19 ? -5.005  -3.211  -4.278  1.00 0.00 ? 19 LEU A N    10 
ATOM 10132 C CA   . LEU A 1 19 ? -4.075  -2.168  -3.861  1.00 0.00 ? 19 LEU A CA   10 
ATOM 10133 C C    . LEU A 1 19 ? -3.930  -2.143  -2.343  1.00 0.00 ? 19 LEU A C    10 
ATOM 10134 O O    . LEU A 1 19 ? -2.875  -1.788  -1.817  1.00 0.00 ? 19 LEU A O    10 
ATOM 10135 C CB   . LEU A 1 19 ? -4.552  -0.803  -4.362  1.00 0.00 ? 19 LEU A CB   10 
ATOM 10136 C CG   . LEU A 1 19 ? -4.445  -0.566  -5.869  1.00 0.00 ? 19 LEU A CG   10 
ATOM 10137 C CD1  . LEU A 1 19 ? -5.221  0.679   -6.270  1.00 0.00 ? 19 LEU A CD1  10 
ATOM 10138 C CD2  . LEU A 1 19 ? -2.988  -0.447  -6.289  1.00 0.00 ? 19 LEU A CD2  10 
ATOM 10139 H H    . LEU A 1 19 ? -5.776  -2.969  -4.833  1.00 0.00 ? 19 LEU A H    10 
ATOM 10140 H HA   . LEU A 1 19 ? -3.113  -2.387  -4.300  1.00 0.00 ? 19 LEU A HA   10 
ATOM 10141 H HB2  . LEU A 1 19 ? -5.588  -0.691  -4.082  1.00 0.00 ? 19 LEU A HB2  10 
ATOM 10142 H HB3  . LEU A 1 19 ? -3.963  -0.045  -3.865  1.00 0.00 ? 19 LEU A HB3  10 
ATOM 10143 H HG   . LEU A 1 19 ? -4.877  -1.410  -6.391  1.00 0.00 ? 19 LEU A HG   10 
ATOM 10144 H HD11 . LEU A 1 19 ? -6.097  0.774   -5.646  1.00 0.00 ? 19 LEU A HD11 10 
ATOM 10145 H HD12 . LEU A 1 19 ? -5.523  0.598   -7.303  1.00 0.00 ? 19 LEU A HD12 10 
ATOM 10146 H HD13 . LEU A 1 19 ? -4.594  1.549   -6.145  1.00 0.00 ? 19 LEU A HD13 10 
ATOM 10147 H HD21 . LEU A 1 19 ? -2.904  -0.626  -7.350  1.00 0.00 ? 19 LEU A HD21 10 
ATOM 10148 H HD22 . LEU A 1 19 ? -2.398  -1.176  -5.753  1.00 0.00 ? 19 LEU A HD22 10 
ATOM 10149 H HD23 . LEU A 1 19 ? -2.628  0.546   -6.061  1.00 0.00 ? 19 LEU A HD23 10 
ATOM 10150 N N    . ARG A 1 20 ? -4.994  -2.524  -1.645  1.00 0.00 ? 20 ARG A N    10 
ATOM 10151 C CA   . ARG A 1 20 ? -4.985  -2.547  -0.188  1.00 0.00 ? 20 ARG A CA   10 
ATOM 10152 C C    . ARG A 1 20 ? -4.000  -3.589  0.333   1.00 0.00 ? 20 ARG A C    10 
ATOM 10153 O O    . ARG A 1 20 ? -3.232  -3.326  1.259   1.00 0.00 ? 20 ARG A O    10 
ATOM 10154 C CB   . ARG A 1 20 ? -6.387  -2.841  0.348   1.00 0.00 ? 20 ARG A CB   10 
ATOM 10155 C CG   . ARG A 1 20 ? -6.483  -2.786  1.864   1.00 0.00 ? 20 ARG A CG   10 
ATOM 10156 C CD   . ARG A 1 20 ? -6.255  -1.377  2.387   1.00 0.00 ? 20 ARG A CD   10 
ATOM 10157 N NE   . ARG A 1 20 ? -7.311  -0.460  1.967   1.00 0.00 ? 20 ARG A NE   10 
ATOM 10158 C CZ   . ARG A 1 20 ? -7.621  0.653   2.623   1.00 0.00 ? 20 ARG A CZ   10 
ATOM 10159 N NH1  . ARG A 1 20 ? -6.958  0.986   3.722   1.00 0.00 ? 20 ARG A NH1  10 
ATOM 10160 N NH2  . ARG A 1 20 ? -8.595  1.437   2.178   1.00 0.00 ? 20 ARG A NH2  10 
ATOM 10161 H H    . ARG A 1 20 ? -5.806  -2.796  -2.122  1.00 0.00 ? 20 ARG A H    10 
ATOM 10162 H HA   . ARG A 1 20 ? -4.674  -1.572  0.157   1.00 0.00 ? 20 ARG A HA   10 
ATOM 10163 H HB2  . ARG A 1 20 ? -7.075  -2.116  -0.060  1.00 0.00 ? 20 ARG A HB2  10 
ATOM 10164 H HB3  . ARG A 1 20 ? -6.683  -3.828  0.026   1.00 0.00 ? 20 ARG A HB3  10 
ATOM 10165 H HG2  . ARG A 1 20 ? -7.467  -3.115  2.165   1.00 0.00 ? 20 ARG A HG2  10 
ATOM 10166 H HG3  . ARG A 1 20 ? -5.737  -3.443  2.287   1.00 0.00 ? 20 ARG A HG3  10 
ATOM 10167 H HD2  . ARG A 1 20 ? -6.226  -1.407  3.466   1.00 0.00 ? 20 ARG A HD2  10 
ATOM 10168 H HD3  . ARG A 1 20 ? -5.308  -1.017  2.011   1.00 0.00 ? 20 ARG A HD3  10 
ATOM 10169 H HE   . ARG A 1 20 ? -7.814  -0.686  1.158   1.00 0.00 ? 20 ARG A HE   10 
ATOM 10170 H HH11 . ARG A 1 20 ? -6.223  0.398   4.058   1.00 0.00 ? 20 ARG A HH11 10 
ATOM 10171 H HH12 . ARG A 1 20 ? -7.193  1.825   4.213   1.00 0.00 ? 20 ARG A HH12 10 
ATOM 10172 H HH21 . ARG A 1 20 ? -9.097  1.190   1.350   1.00 0.00 ? 20 ARG A HH21 10 
ATOM 10173 H HH22 . ARG A 1 20 ? -8.828  2.274   2.672   1.00 0.00 ? 20 ARG A HH22 10 
ATOM 10174 N N    . VAL A 1 21 ? -4.029  -4.775  -0.267  1.00 0.00 ? 21 VAL A N    10 
ATOM 10175 C CA   . VAL A 1 21 ? -3.139  -5.858  0.136   1.00 0.00 ? 21 VAL A CA   10 
ATOM 10176 C C    . VAL A 1 21 ? -1.705  -5.583  -0.304  1.00 0.00 ? 21 VAL A C    10 
ATOM 10177 O O    . VAL A 1 21 ? -0.760  -5.788  0.459   1.00 0.00 ? 21 VAL A O    10 
ATOM 10178 C CB   . VAL A 1 21 ? -3.595  -7.207  -0.451  1.00 0.00 ? 21 VAL A CB   10 
ATOM 10179 C CG1  . VAL A 1 21 ? -2.624  -8.312  -0.066  1.00 0.00 ? 21 VAL A CG1  10 
ATOM 10180 C CG2  . VAL A 1 21 ? -5.006  -7.539  0.011   1.00 0.00 ? 21 VAL A CG2  10 
ATOM 10181 H H    . VAL A 1 21 ? -4.663  -4.925  -0.999  1.00 0.00 ? 21 VAL A H    10 
ATOM 10182 H HA   . VAL A 1 21 ? -3.168  -5.930  1.213   1.00 0.00 ? 21 VAL A HA   10 
ATOM 10183 H HB   . VAL A 1 21 ? -3.602  -7.124  -1.528  1.00 0.00 ? 21 VAL A HB   10 
ATOM 10184 H HG11 . VAL A 1 21 ? -2.685  -9.112  -0.789  1.00 0.00 ? 21 VAL A HG11 10 
ATOM 10185 H HG12 . VAL A 1 21 ? -1.619  -7.918  -0.045  1.00 0.00 ? 21 VAL A HG12 10 
ATOM 10186 H HG13 . VAL A 1 21 ? -2.882  -8.692  0.912   1.00 0.00 ? 21 VAL A HG13 10 
ATOM 10187 H HG21 . VAL A 1 21 ? -5.430  -8.288  -0.641  1.00 0.00 ? 21 VAL A HG21 10 
ATOM 10188 H HG22 . VAL A 1 21 ? -4.974  -7.918  1.022   1.00 0.00 ? 21 VAL A HG22 10 
ATOM 10189 H HG23 . VAL A 1 21 ? -5.615  -6.648  -0.021  1.00 0.00 ? 21 VAL A HG23 10 
ATOM 10190 N N    . LEU A 1 22 ? -1.550  -5.118  -1.538  1.00 0.00 ? 22 LEU A N    10 
ATOM 10191 C CA   . LEU A 1 22 ? -0.230  -4.813  -2.081  1.00 0.00 ? 22 LEU A CA   10 
ATOM 10192 C C    . LEU A 1 22 ? 0.417   -3.658  -1.324  1.00 0.00 ? 22 LEU A C    10 
ATOM 10193 O O    . LEU A 1 22 ? 1.586   -3.728  -0.948  1.00 0.00 ? 22 LEU A O    10 
ATOM 10194 C CB   . LEU A 1 22 ? -0.335  -4.469  -3.567  1.00 0.00 ? 22 LEU A CB   10 
ATOM 10195 C CG   . LEU A 1 22 ? -0.839  -5.586  -4.481  1.00 0.00 ? 22 LEU A CG   10 
ATOM 10196 C CD1  . LEU A 1 22 ? -1.317  -5.016  -5.808  1.00 0.00 ? 22 LEU A CD1  10 
ATOM 10197 C CD2  . LEU A 1 22 ? 0.251   -6.624  -4.706  1.00 0.00 ? 22 LEU A CD2  10 
ATOM 10198 H H    . LEU A 1 22 ? -2.340  -4.975  -2.099  1.00 0.00 ? 22 LEU A H    10 
ATOM 10199 H HA   . LEU A 1 22 ? 0.386   -5.693  -1.966  1.00 0.00 ? 22 LEU A HA   10 
ATOM 10200 H HB2  . LEU A 1 22 ? -1.010  -3.632  -3.666  1.00 0.00 ? 22 LEU A HB2  10 
ATOM 10201 H HB3  . LEU A 1 22 ? 0.648   -4.179  -3.909  1.00 0.00 ? 22 LEU A HB3  10 
ATOM 10202 H HG   . LEU A 1 22 ? -1.678  -6.078  -4.009  1.00 0.00 ? 22 LEU A HG   10 
ATOM 10203 H HD11 . LEU A 1 22 ? -1.114  -5.724  -6.597  1.00 0.00 ? 22 LEU A HD11 10 
ATOM 10204 H HD12 . LEU A 1 22 ? -0.797  -4.092  -6.011  1.00 0.00 ? 22 LEU A HD12 10 
ATOM 10205 H HD13 . LEU A 1 22 ? -2.379  -4.827  -5.757  1.00 0.00 ? 22 LEU A HD13 10 
ATOM 10206 H HD21 . LEU A 1 22 ? 0.764   -6.813  -3.775  1.00 0.00 ? 22 LEU A HD21 10 
ATOM 10207 H HD22 . LEU A 1 22 ? 0.955   -6.253  -5.437  1.00 0.00 ? 22 LEU A HD22 10 
ATOM 10208 H HD23 . LEU A 1 22 ? -0.193  -7.540  -5.065  1.00 0.00 ? 22 LEU A HD23 10 
ATOM 10209 N N    . GLN A 1 23 ? -0.354  -2.598  -1.101  1.00 0.00 ? 23 GLN A N    10 
ATOM 10210 C CA   . GLN A 1 23 ? 0.144   -1.428  -0.388  1.00 0.00 ? 23 GLN A CA   10 
ATOM 10211 C C    . GLN A 1 23 ? 0.394   -1.752  1.082   1.00 0.00 ? 23 GLN A C    10 
ATOM 10212 O O    . GLN A 1 23 ? 1.359   -1.275  1.678   1.00 0.00 ? 23 GLN A O    10 
ATOM 10213 C CB   . GLN A 1 23 ? -0.849  -0.271  -0.505  1.00 0.00 ? 23 GLN A CB   10 
ATOM 10214 C CG   . GLN A 1 23 ? -0.219  1.096   -0.293  1.00 0.00 ? 23 GLN A CG   10 
ATOM 10215 C CD   . GLN A 1 23 ? 0.724   1.126   0.893   1.00 0.00 ? 23 GLN A CD   10 
ATOM 10216 O OE1  . GLN A 1 23 ? 0.300   0.999   2.042   1.00 0.00 ? 23 GLN A OE1  10 
ATOM 10217 N NE2  . GLN A 1 23 ? 2.013   1.294   0.621   1.00 0.00 ? 23 GLN A NE2  10 
ATOM 10218 H H    . GLN A 1 23 ? -1.278  -2.602  -1.425  1.00 0.00 ? 23 GLN A H    10 
ATOM 10219 H HA   . GLN A 1 23 ? 1.079   -1.136  -0.842  1.00 0.00 ? 23 GLN A HA   10 
ATOM 10220 H HB2  . GLN A 1 23 ? -1.292  -0.291  -1.490  1.00 0.00 ? 23 GLN A HB2  10 
ATOM 10221 H HB3  . GLN A 1 23 ? -1.626  -0.403  0.233   1.00 0.00 ? 23 GLN A HB3  10 
ATOM 10222 H HG2  . GLN A 1 23 ? 0.335   1.365   -1.180  1.00 0.00 ? 23 GLN A HG2  10 
ATOM 10223 H HG3  . GLN A 1 23 ? -1.005  1.818   -0.128  1.00 0.00 ? 23 GLN A HG3  10 
ATOM 10224 H HE21 . GLN A 1 23 ? 2.279   1.390   -0.318  1.00 0.00 ? 23 GLN A HE21 10 
ATOM 10225 H HE22 . GLN A 1 23 ? 2.645   1.318   1.368   1.00 0.00 ? 23 GLN A HE22 10 
ATOM 10226 N N    . ASP A 1 24 ? -0.483  -2.566  1.660   1.00 0.00 ? 24 ASP A N    10 
ATOM 10227 C CA   . ASP A 1 24 ? -0.357  -2.955  3.059   1.00 0.00 ? 24 ASP A CA   10 
ATOM 10228 C C    . ASP A 1 24 ? 0.912   -3.771  3.285   1.00 0.00 ? 24 ASP A C    10 
ATOM 10229 O O    . ASP A 1 24 ? 1.591   -3.613  4.300   1.00 0.00 ? 24 ASP A O    10 
ATOM 10230 C CB   . ASP A 1 24 ? -1.581  -3.761  3.499   1.00 0.00 ? 24 ASP A CB   10 
ATOM 10231 C CG   . ASP A 1 24 ? -1.522  -4.153  4.962   1.00 0.00 ? 24 ASP A CG   10 
ATOM 10232 O OD1  . ASP A 1 24 ? -1.905  -3.324  5.814   1.00 0.00 ? 24 ASP A OD1  10 
ATOM 10233 O OD2  . ASP A 1 24 ? -1.093  -5.288  5.255   1.00 0.00 ? 24 ASP A OD2  10 
ATOM 10234 H H    . ASP A 1 24 ? -1.232  -2.915  1.132   1.00 0.00 ? 24 ASP A H    10 
ATOM 10235 H HA   . ASP A 1 24 ? -0.301  -2.054  3.650   1.00 0.00 ? 24 ASP A HA   10 
ATOM 10236 H HB2  . ASP A 1 24 ? -2.470  -3.169  3.339   1.00 0.00 ? 24 ASP A HB2  10 
ATOM 10237 H HB3  . ASP A 1 24 ? -1.642  -4.662  2.905   1.00 0.00 ? 24 ASP A HB3  10 
ATOM 10238 N N    . PHE A 1 25 ? 1.226   -4.644  2.334   1.00 0.00 ? 25 PHE A N    10 
ATOM 10239 C CA   . PHE A 1 25 ? 2.412   -5.486  2.430   1.00 0.00 ? 25 PHE A CA   10 
ATOM 10240 C C    . PHE A 1 25 ? 3.677   -4.675  2.163   1.00 0.00 ? 25 PHE A C    10 
ATOM 10241 O O    . PHE A 1 25 ? 4.756   -5.007  2.654   1.00 0.00 ? 25 PHE A O    10 
ATOM 10242 C CB   . PHE A 1 25 ? 2.320   -6.649  1.440   1.00 0.00 ? 25 PHE A CB   10 
ATOM 10243 C CG   . PHE A 1 25 ? 3.327   -7.734  1.694   1.00 0.00 ? 25 PHE A CG   10 
ATOM 10244 C CD1  . PHE A 1 25 ? 4.675   -7.514  1.464   1.00 0.00 ? 25 PHE A CD1  10 
ATOM 10245 C CD2  . PHE A 1 25 ? 2.924   -8.974  2.162   1.00 0.00 ? 25 PHE A CD2  10 
ATOM 10246 C CE1  . PHE A 1 25 ? 5.604   -8.510  1.697   1.00 0.00 ? 25 PHE A CE1  10 
ATOM 10247 C CE2  . PHE A 1 25 ? 3.849   -9.974  2.397   1.00 0.00 ? 25 PHE A CE2  10 
ATOM 10248 C CZ   . PHE A 1 25 ? 5.191   -9.742  2.164   1.00 0.00 ? 25 PHE A CZ   10 
ATOM 10249 H H    . PHE A 1 25 ? 0.644   -4.724  1.548   1.00 0.00 ? 25 PHE A H    10 
ATOM 10250 H HA   . PHE A 1 25 ? 2.457   -5.881  3.433   1.00 0.00 ? 25 PHE A HA   10 
ATOM 10251 H HB2  . PHE A 1 25 ? 1.336   -7.088  1.503   1.00 0.00 ? 25 PHE A HB2  10 
ATOM 10252 H HB3  . PHE A 1 25 ? 2.479   -6.274  0.440   1.00 0.00 ? 25 PHE A HB3  10 
ATOM 10253 H HD1  . PHE A 1 25 ? 5.000   -6.549  1.099   1.00 0.00 ? 25 PHE A HD1  10 
ATOM 10254 H HD2  . PHE A 1 25 ? 1.876   -9.158  2.344   1.00 0.00 ? 25 PHE A HD2  10 
ATOM 10255 H HE1  . PHE A 1 25 ? 6.652   -8.325  1.514   1.00 0.00 ? 25 PHE A HE1  10 
ATOM 10256 H HE2  . PHE A 1 25 ? 3.523   -10.937 2.762   1.00 0.00 ? 25 PHE A HE2  10 
ATOM 10257 H HZ   . PHE A 1 25 ? 5.915   -10.522 2.347   1.00 0.00 ? 25 PHE A HZ   10 
ATOM 10258 N N    . PHE A 1 26 ? 3.537   -3.611  1.380   1.00 0.00 ? 26 PHE A N    10 
ATOM 10259 C CA   . PHE A 1 26 ? 4.667   -2.753  1.045   1.00 0.00 ? 26 PHE A CA   10 
ATOM 10260 C C    . PHE A 1 26 ? 5.046   -1.866  2.228   1.00 0.00 ? 26 PHE A C    10 
ATOM 10261 O O    . PHE A 1 26 ? 6.215   -1.782  2.605   1.00 0.00 ? 26 PHE A O    10 
ATOM 10262 C CB   . PHE A 1 26 ? 4.335   -1.885  -0.171  1.00 0.00 ? 26 PHE A CB   10 
ATOM 10263 C CG   . PHE A 1 26 ? 5.409   -0.892  -0.511  1.00 0.00 ? 26 PHE A CG   10 
ATOM 10264 C CD1  . PHE A 1 26 ? 5.563   0.264   0.237   1.00 0.00 ? 26 PHE A CD1  10 
ATOM 10265 C CD2  . PHE A 1 26 ? 6.265   -1.115  -1.577  1.00 0.00 ? 26 PHE A CD2  10 
ATOM 10266 C CE1  . PHE A 1 26 ? 6.550   1.180   -0.074  1.00 0.00 ? 26 PHE A CE1  10 
ATOM 10267 C CE2  . PHE A 1 26 ? 7.254   -0.203  -1.893  1.00 0.00 ? 26 PHE A CE2  10 
ATOM 10268 C CZ   . PHE A 1 26 ? 7.397   0.946   -1.140  1.00 0.00 ? 26 PHE A CZ   10 
ATOM 10269 H H    . PHE A 1 26 ? 2.651   -3.397  1.018   1.00 0.00 ? 26 PHE A H    10 
ATOM 10270 H HA   . PHE A 1 26 ? 5.505   -3.389  0.804   1.00 0.00 ? 26 PHE A HA   10 
ATOM 10271 H HB2  . PHE A 1 26 ? 4.189   -2.523  -1.030  1.00 0.00 ? 26 PHE A HB2  10 
ATOM 10272 H HB3  . PHE A 1 26 ? 3.425   -1.338  0.025   1.00 0.00 ? 26 PHE A HB3  10 
ATOM 10273 H HD1  . PHE A 1 26 ? 4.902   0.449   1.071   1.00 0.00 ? 26 PHE A HD1  10 
ATOM 10274 H HD2  . PHE A 1 26 ? 6.153   -2.014  -2.167  1.00 0.00 ? 26 PHE A HD2  10 
ATOM 10275 H HE1  . PHE A 1 26 ? 6.660   2.077   0.516   1.00 0.00 ? 26 PHE A HE1  10 
ATOM 10276 H HE2  . PHE A 1 26 ? 7.915   -0.390  -2.726  1.00 0.00 ? 26 PHE A HE2  10 
ATOM 10277 H HZ   . PHE A 1 26 ? 8.169   1.660   -1.385  1.00 0.00 ? 26 PHE A HZ   10 
ATOM 10278 N N    . ASP A 1 27 ? 4.050   -1.207  2.808   1.00 0.00 ? 27 ASP A N    10 
ATOM 10279 C CA   . ASP A 1 27 ? 4.277   -0.327  3.949   1.00 0.00 ? 27 ASP A CA   10 
ATOM 10280 C C    . ASP A 1 27 ? 5.052   -1.049  5.047   1.00 0.00 ? 27 ASP A C    10 
ATOM 10281 O O    . ASP A 1 27 ? 5.787   -0.428  5.813   1.00 0.00 ? 27 ASP A O    10 
ATOM 10282 C CB   . ASP A 1 27 ? 2.945   0.184   4.499   1.00 0.00 ? 27 ASP A CB   10 
ATOM 10283 C CG   . ASP A 1 27 ? 3.104   1.448   5.321   1.00 0.00 ? 27 ASP A CG   10 
ATOM 10284 O OD1  . ASP A 1 27 ? 3.234   2.535   4.719   1.00 0.00 ? 27 ASP A OD1  10 
ATOM 10285 O OD2  . ASP A 1 27 ? 3.100   1.351   6.565   1.00 0.00 ? 27 ASP A OD2  10 
ATOM 10286 H H    . ASP A 1 27 ? 3.139   -1.316  2.462   1.00 0.00 ? 27 ASP A H    10 
ATOM 10287 H HA   . ASP A 1 27 ? 4.861   0.514   3.607   1.00 0.00 ? 27 ASP A HA   10 
ATOM 10288 H HB2  . ASP A 1 27 ? 2.279   0.395   3.675   1.00 0.00 ? 27 ASP A HB2  10 
ATOM 10289 H HB3  . ASP A 1 27 ? 2.505   -0.578  5.126   1.00 0.00 ? 27 ASP A HB3  10 
ATOM 10290 N N    . ALA A 1 28 ? 4.880   -2.365  5.117   1.00 0.00 ? 28 ALA A N    10 
ATOM 10291 C CA   . ALA A 1 28 ? 5.563   -3.172  6.121   1.00 0.00 ? 28 ALA A CA   10 
ATOM 10292 C C    . ALA A 1 28 ? 6.830   -3.800  5.550   1.00 0.00 ? 28 ALA A C    10 
ATOM 10293 O O    . ALA A 1 28 ? 7.874   -3.814  6.201   1.00 0.00 ? 28 ALA A O    10 
ATOM 10294 C CB   . ALA A 1 28 ? 4.632   -4.251  6.655   1.00 0.00 ? 28 ALA A CB   10 
ATOM 10295 H H    . ALA A 1 28 ? 4.280   -2.804  4.479   1.00 0.00 ? 28 ALA A H    10 
ATOM 10296 H HA   . ALA A 1 28 ? 5.833   -2.525  6.943   1.00 0.00 ? 28 ALA A HA   10 
ATOM 10297 H HB1  . ALA A 1 28 ? 5.141   -4.817  7.421   1.00 0.00 ? 28 ALA A HB1  10 
ATOM 10298 H HB2  . ALA A 1 28 ? 3.750   -3.789  7.073   1.00 0.00 ? 28 ALA A HB2  10 
ATOM 10299 H HB3  . ALA A 1 28 ? 4.347   -4.910  5.849   1.00 0.00 ? 28 ALA A HB3  10 
ATOM 10300 N N    . ASN A 1 29 ? 6.731   -4.319  4.330   1.00 0.00 ? 29 ASN A N    10 
ATOM 10301 C CA   . ASN A 1 29 ? 7.870   -4.949  3.673   1.00 0.00 ? 29 ASN A CA   10 
ATOM 10302 C C    . ASN A 1 29 ? 7.854   -4.671  2.173   1.00 0.00 ? 29 ASN A C    10 
ATOM 10303 O O    . ASN A 1 29 ? 6.876   -4.965  1.487   1.00 0.00 ? 29 ASN A O    10 
ATOM 10304 C CB   . ASN A 1 29 ? 7.858   -6.459  3.923   1.00 0.00 ? 29 ASN A CB   10 
ATOM 10305 C CG   . ASN A 1 29 ? 9.181   -7.113  3.574   1.00 0.00 ? 29 ASN A CG   10 
ATOM 10306 O OD1  . ASN A 1 29 ? 10.246  -6.632  3.963   1.00 0.00 ? 29 ASN A OD1  10 
ATOM 10307 N ND2  . ASN A 1 29 ? 9.119   -8.216  2.837   1.00 0.00 ? 29 ASN A ND2  10 
ATOM 10308 H H    . ASN A 1 29 ? 5.872   -4.277  3.861   1.00 0.00 ? 29 ASN A H    10 
ATOM 10309 H HA   . ASN A 1 29 ? 8.770   -4.530  4.096   1.00 0.00 ? 29 ASN A HA   10 
ATOM 10310 H HB2  . ASN A 1 29 ? 7.652   -6.643  4.968   1.00 0.00 ? 29 ASN A HB2  10 
ATOM 10311 H HB3  . ASN A 1 29 ? 7.084   -6.912  3.323   1.00 0.00 ? 29 ASN A HB3  10 
ATOM 10312 H HD21 . ASN A 1 29 ? 8.236   -8.541  2.563   1.00 0.00 ? 29 ASN A HD21 10 
ATOM 10313 H HD22 . ASN A 1 29 ? 9.959   -8.660  2.598   1.00 0.00 ? 29 ASN A HD22 10 
ATOM 10314 N N    . ALA A 1 30 ? 8.946   -4.104  1.671   1.00 0.00 ? 30 ALA A N    10 
ATOM 10315 C CA   . ALA A 1 30 ? 9.060   -3.789  0.252   1.00 0.00 ? 30 ALA A CA   10 
ATOM 10316 C C    . ALA A 1 30 ? 10.230  -4.531  -0.383  1.00 0.00 ? 30 ALA A C    10 
ATOM 10317 O O    . ALA A 1 30 ? 10.607  -4.256  -1.523  1.00 0.00 ? 30 ALA A O    10 
ATOM 10318 C CB   . ALA A 1 30 ? 9.215   -2.288  0.056   1.00 0.00 ? 30 ALA A CB   10 
ATOM 10319 H H    . ALA A 1 30 ? 9.694   -3.894  2.268   1.00 0.00 ? 30 ALA A H    10 
ATOM 10320 H HA   . ALA A 1 30 ? 8.145   -4.097  -0.233  1.00 0.00 ? 30 ALA A HA   10 
ATOM 10321 H HB1  . ALA A 1 30 ? 9.674   -2.097  -0.904  1.00 0.00 ? 30 ALA A HB1  10 
ATOM 10322 H HB2  . ALA A 1 30 ? 8.244   -1.818  0.092   1.00 0.00 ? 30 ALA A HB2  10 
ATOM 10323 H HB3  . ALA A 1 30 ? 9.840   -1.886  0.840   1.00 0.00 ? 30 ALA A HB3  10 
ATOM 10324 N N    . TYR A 1 31 ? 10.801  -5.473  0.360   1.00 0.00 ? 31 TYR A N    10 
ATOM 10325 C CA   . TYR A 1 31 ? 11.931  -6.253  -0.130  1.00 0.00 ? 31 TYR A CA   10 
ATOM 10326 C C    . TYR A 1 31 ? 11.725  -7.740  0.141   1.00 0.00 ? 31 TYR A C    10 
ATOM 10327 O O    . TYR A 1 31 ? 12.642  -8.458  0.539   1.00 0.00 ? 31 TYR A O    10 
ATOM 10328 C CB   . TYR A 1 31 ? 13.228  -5.779  0.526   1.00 0.00 ? 31 TYR A CB   10 
ATOM 10329 C CG   . TYR A 1 31 ? 13.668  -4.404  0.076   1.00 0.00 ? 31 TYR A CG   10 
ATOM 10330 C CD1  . TYR A 1 31 ? 12.869  -3.289  0.300   1.00 0.00 ? 31 TYR A CD1  10 
ATOM 10331 C CD2  . TYR A 1 31 ? 14.882  -4.219  -0.574  1.00 0.00 ? 31 TYR A CD2  10 
ATOM 10332 C CE1  . TYR A 1 31 ? 13.266  -2.031  -0.110  1.00 0.00 ? 31 TYR A CE1  10 
ATOM 10333 C CE2  . TYR A 1 31 ? 15.288  -2.965  -0.987  1.00 0.00 ? 31 TYR A CE2  10 
ATOM 10334 C CZ   . TYR A 1 31 ? 14.476  -1.874  -0.753  1.00 0.00 ? 31 TYR A CZ   10 
ATOM 10335 O OH   . TYR A 1 31 ? 14.876  -0.623  -1.163  1.00 0.00 ? 31 TYR A OH   10 
ATOM 10336 H H    . TYR A 1 31 ? 10.456  -5.646  1.260   1.00 0.00 ? 31 TYR A H    10 
ATOM 10337 H HA   . TYR A 1 31 ? 12.002  -6.100  -1.197  1.00 0.00 ? 31 TYR A HA   10 
ATOM 10338 H HB2  . TYR A 1 31 ? 13.092  -5.748  1.596   1.00 0.00 ? 31 TYR A HB2  10 
ATOM 10339 H HB3  . TYR A 1 31 ? 14.020  -6.474  0.288   1.00 0.00 ? 31 TYR A HB3  10 
ATOM 10340 H HD1  . TYR A 1 31 ? 11.922  -3.416  0.805   1.00 0.00 ? 31 TYR A HD1  10 
ATOM 10341 H HD2  . TYR A 1 31 ? 15.516  -5.075  -0.755  1.00 0.00 ? 31 TYR A HD2  10 
ATOM 10342 H HE1  . TYR A 1 31 ? 12.631  -1.177  0.073   1.00 0.00 ? 31 TYR A HE1  10 
ATOM 10343 H HE2  . TYR A 1 31 ? 16.235  -2.841  -1.490  1.00 0.00 ? 31 TYR A HE2  10 
ATOM 10344 H HH   . TYR A 1 31 ? 15.686  -0.697  -1.674  1.00 0.00 ? 31 TYR A HH   10 
ATOM 10345 N N    . PRO A 1 32 ? 10.490  -8.215  -0.081  1.00 0.00 ? 32 PRO A N    10 
ATOM 10346 C CA   . PRO A 1 32 ? 10.133  -9.621  0.132   1.00 0.00 ? 32 PRO A CA   10 
ATOM 10347 C C    . PRO A 1 32 ? 10.779  -10.545 -0.896  1.00 0.00 ? 32 PRO A C    10 
ATOM 10348 O O    . PRO A 1 32 ? 11.208  -10.102 -1.961  1.00 0.00 ? 32 PRO A O    10 
ATOM 10349 C CB   . PRO A 1 32 ? 8.610   -9.628  -0.026  1.00 0.00 ? 32 PRO A CB   10 
ATOM 10350 C CG   . PRO A 1 32 ? 8.314   -8.455  -0.895  1.00 0.00 ? 32 PRO A CG   10 
ATOM 10351 C CD   . PRO A 1 32 ? 9.348   -7.417  -0.556  1.00 0.00 ? 32 PRO A CD   10 
ATOM 10352 H HA   . PRO A 1 32 ? 10.395  -9.951  1.126   1.00 0.00 ? 32 PRO A HA   10 
ATOM 10353 H HB2  . PRO A 1 32 ? 8.298   -10.553 -0.489  1.00 0.00 ? 32 PRO A HB2  10 
ATOM 10354 H HB3  . PRO A 1 32 ? 8.144   -9.529  0.943   1.00 0.00 ? 32 PRO A HB3  10 
ATOM 10355 H HG2  . PRO A 1 32 ? 8.393   -8.738  -1.934  1.00 0.00 ? 32 PRO A HG2  10 
ATOM 10356 H HG3  . PRO A 1 32 ? 7.324   -8.080  -0.681  1.00 0.00 ? 32 PRO A HG3  10 
ATOM 10357 H HD2  . PRO A 1 32 ? 9.614   -6.848  -1.435  1.00 0.00 ? 32 PRO A HD2  10 
ATOM 10358 H HD3  . PRO A 1 32 ? 8.985   -6.763  0.223   1.00 0.00 ? 32 PRO A HD3  10 
ATOM 10359 N N    . LYS A 1 33 ? 10.844  -11.831 -0.569  1.00 0.00 ? 33 LYS A N    10 
ATOM 10360 C CA   . LYS A 1 33 ? 11.436  -12.819 -1.464  1.00 0.00 ? 33 LYS A CA   10 
ATOM 10361 C C    . LYS A 1 33 ? 10.356  -13.562 -2.244  1.00 0.00 ? 33 LYS A C    10 
ATOM 10362 O O    . LYS A 1 33 ? 9.166   -13.420 -1.964  1.00 0.00 ? 33 LYS A O    10 
ATOM 10363 C CB   . LYS A 1 33 ? 12.282  -13.815 -0.668  1.00 0.00 ? 33 LYS A CB   10 
ATOM 10364 C CG   . LYS A 1 33 ? 13.397  -13.163 0.132   1.00 0.00 ? 33 LYS A CG   10 
ATOM 10365 C CD   . LYS A 1 33 ? 14.567  -14.111 0.332   1.00 0.00 ? 33 LYS A CD   10 
ATOM 10366 C CE   . LYS A 1 33 ? 14.299  -15.097 1.459   1.00 0.00 ? 33 LYS A CE   10 
ATOM 10367 N NZ   . LYS A 1 33 ? 14.360  -14.441 2.795   1.00 0.00 ? 33 LYS A NZ   10 
ATOM 10368 H H    . LYS A 1 33 ? 10.484  -12.123 0.295   1.00 0.00 ? 33 LYS A H    10 
ATOM 10369 H HA   . LYS A 1 33 ? 12.072  -12.295 -2.162  1.00 0.00 ? 33 LYS A HA   10 
ATOM 10370 H HB2  . LYS A 1 33 ? 11.640  -14.348 0.017   1.00 0.00 ? 33 LYS A HB2  10 
ATOM 10371 H HB3  . LYS A 1 33 ? 12.726  -14.521 -1.355  1.00 0.00 ? 33 LYS A HB3  10 
ATOM 10372 H HG2  . LYS A 1 33 ? 13.744  -12.288 -0.398  1.00 0.00 ? 33 LYS A HG2  10 
ATOM 10373 H HG3  . LYS A 1 33 ? 13.012  -12.872 1.098   1.00 0.00 ? 33 LYS A HG3  10 
ATOM 10374 H HD2  . LYS A 1 33 ? 14.733  -14.663 -0.581  1.00 0.00 ? 33 LYS A HD2  10 
ATOM 10375 H HD3  . LYS A 1 33 ? 15.450  -13.535 0.572   1.00 0.00 ? 33 LYS A HD3  10 
ATOM 10376 H HE2  . LYS A 1 33 ? 13.318  -15.523 1.321   1.00 0.00 ? 33 LYS A HE2  10 
ATOM 10377 H HE3  . LYS A 1 33 ? 15.041  -15.881 1.418   1.00 0.00 ? 33 LYS A HE3  10 
ATOM 10378 H HZ1  . LYS A 1 33 ? 14.234  -15.150 3.546   1.00 0.00 ? 33 LYS A HZ1  10 
ATOM 10379 H HZ2  . LYS A 1 33 ? 13.607  -13.729 2.878   1.00 0.00 ? 33 LYS A HZ2  10 
ATOM 10380 H HZ3  . LYS A 1 33 ? 15.280  -13.975 2.923   1.00 0.00 ? 33 LYS A HZ3  10 
ATOM 10381 N N    . ASP A 1 34 ? 10.780  -14.355 -3.222  1.00 0.00 ? 34 ASP A N    10 
ATOM 10382 C CA   . ASP A 1 34 ? 9.849   -15.123 -4.041  1.00 0.00 ? 34 ASP A CA   10 
ATOM 10383 C C    . ASP A 1 34 ? 8.788   -15.794 -3.174  1.00 0.00 ? 34 ASP A C    10 
ATOM 10384 O O    . ASP A 1 34 ? 7.591   -15.675 -3.436  1.00 0.00 ? 34 ASP A O    10 
ATOM 10385 C CB   . ASP A 1 34 ? 10.602  -16.176 -4.855  1.00 0.00 ? 34 ASP A CB   10 
ATOM 10386 C CG   . ASP A 1 34 ? 11.574  -15.560 -5.841  1.00 0.00 ? 34 ASP A CG   10 
ATOM 10387 O OD1  . ASP A 1 34 ? 11.127  -14.774 -6.702  1.00 0.00 ? 34 ASP A OD1  10 
ATOM 10388 O OD2  . ASP A 1 34 ? 12.782  -15.864 -5.753  1.00 0.00 ? 34 ASP A OD2  10 
ATOM 10389 H H    . ASP A 1 34 ? 11.742  -14.426 -3.397  1.00 0.00 ? 34 ASP A H    10 
ATOM 10390 H HA   . ASP A 1 34 ? 9.361   -14.439 -4.719  1.00 0.00 ? 34 ASP A HA   10 
ATOM 10391 H HB2  . ASP A 1 34 ? 11.157  -16.813 -4.181  1.00 0.00 ? 34 ASP A HB2  10 
ATOM 10392 H HB3  . ASP A 1 34 ? 9.890   -16.774 -5.404  1.00 0.00 ? 34 ASP A HB3  10 
ATOM 10393 N N    . ASP A 1 35 ? 9.236   -16.500 -2.142  1.00 0.00 ? 35 ASP A N    10 
ATOM 10394 C CA   . ASP A 1 35 ? 8.326   -17.191 -1.236  1.00 0.00 ? 35 ASP A CA   10 
ATOM 10395 C C    . ASP A 1 35 ? 7.228   -16.251 -0.748  1.00 0.00 ? 35 ASP A C    10 
ATOM 10396 O O    . ASP A 1 35 ? 6.047   -16.598 -0.766  1.00 0.00 ? 35 ASP A O    10 
ATOM 10397 C CB   . ASP A 1 35 ? 9.094   -17.760 -0.042  1.00 0.00 ? 35 ASP A CB   10 
ATOM 10398 C CG   . ASP A 1 35 ? 8.445   -19.008 0.523   1.00 0.00 ? 35 ASP A CG   10 
ATOM 10399 O OD1  . ASP A 1 35 ? 7.960   -19.838 -0.275  1.00 0.00 ? 35 ASP A OD1  10 
ATOM 10400 O OD2  . ASP A 1 35 ? 8.422   -19.155 1.762   1.00 0.00 ? 35 ASP A OD2  10 
ATOM 10401 H H    . ASP A 1 35 ? 10.202  -16.558 -1.985  1.00 0.00 ? 35 ASP A H    10 
ATOM 10402 H HA   . ASP A 1 35 ? 7.870   -18.004 -1.780  1.00 0.00 ? 35 ASP A HA   10 
ATOM 10403 H HB2  . ASP A 1 35 ? 10.098  -18.009 -0.355  1.00 0.00 ? 35 ASP A HB2  10 
ATOM 10404 H HB3  . ASP A 1 35 ? 9.139   -17.014 0.738   1.00 0.00 ? 35 ASP A HB3  10 
ATOM 10405 N N    . GLU A 1 36 ? 7.626   -15.060 -0.311  1.00 0.00 ? 36 GLU A N    10 
ATOM 10406 C CA   . GLU A 1 36 ? 6.675   -14.072 0.184   1.00 0.00 ? 36 GLU A CA   10 
ATOM 10407 C C    . GLU A 1 36 ? 5.735   -13.617 -0.928  1.00 0.00 ? 36 GLU A C    10 
ATOM 10408 O O    . GLU A 1 36 ? 4.514   -13.634 -0.770  1.00 0.00 ? 36 GLU A O    10 
ATOM 10409 C CB   . GLU A 1 36 ? 7.415   -12.866 0.766   1.00 0.00 ? 36 GLU A CB   10 
ATOM 10410 C CG   . GLU A 1 36 ? 8.224   -13.191 2.011   1.00 0.00 ? 36 GLU A CG   10 
ATOM 10411 C CD   . GLU A 1 36 ? 7.398   -13.878 3.080   1.00 0.00 ? 36 GLU A CD   10 
ATOM 10412 O OE1  . GLU A 1 36 ? 6.554   -13.200 3.704   1.00 0.00 ? 36 GLU A OE1  10 
ATOM 10413 O OE2  . GLU A 1 36 ? 7.594   -15.092 3.294   1.00 0.00 ? 36 GLU A OE2  10 
ATOM 10414 H H    . GLU A 1 36 ? 8.581   -14.842 -0.321  1.00 0.00 ? 36 GLU A H    10 
ATOM 10415 H HA   . GLU A 1 36 ? 6.091   -14.535 0.965   1.00 0.00 ? 36 GLU A HA   10 
ATOM 10416 H HB2  . GLU A 1 36 ? 8.088   -12.475 0.017   1.00 0.00 ? 36 GLU A HB2  10 
ATOM 10417 H HB3  . GLU A 1 36 ? 6.693   -12.104 1.021   1.00 0.00 ? 36 GLU A HB3  10 
ATOM 10418 H HG2  . GLU A 1 36 ? 9.040   -13.841 1.735   1.00 0.00 ? 36 GLU A HG2  10 
ATOM 10419 H HG3  . GLU A 1 36 ? 8.620   -12.271 2.418   1.00 0.00 ? 36 GLU A HG3  10 
ATOM 10420 N N    . PHE A 1 37 ? 6.313   -13.209 -2.053  1.00 0.00 ? 37 PHE A N    10 
ATOM 10421 C CA   . PHE A 1 37 ? 5.528   -12.748 -3.192  1.00 0.00 ? 37 PHE A CA   10 
ATOM 10422 C C    . PHE A 1 37 ? 4.404   -13.730 -3.513  1.00 0.00 ? 37 PHE A C    10 
ATOM 10423 O O    . PHE A 1 37 ? 3.297   -13.327 -3.866  1.00 0.00 ? 37 PHE A O    10 
ATOM 10424 C CB   . PHE A 1 37 ? 6.426   -12.566 -4.418  1.00 0.00 ? 37 PHE A CB   10 
ATOM 10425 C CG   . PHE A 1 37 ? 7.046   -11.201 -4.509  1.00 0.00 ? 37 PHE A CG   10 
ATOM 10426 C CD1  . PHE A 1 37 ? 6.389   -10.168 -5.157  1.00 0.00 ? 37 PHE A CD1  10 
ATOM 10427 C CD2  . PHE A 1 37 ? 8.287   -10.951 -3.945  1.00 0.00 ? 37 PHE A CD2  10 
ATOM 10428 C CE1  . PHE A 1 37 ? 6.958   -8.912  -5.243  1.00 0.00 ? 37 PHE A CE1  10 
ATOM 10429 C CE2  . PHE A 1 37 ? 8.861   -9.696  -4.027  1.00 0.00 ? 37 PHE A CE2  10 
ATOM 10430 C CZ   . PHE A 1 37 ? 8.195   -8.675  -4.676  1.00 0.00 ? 37 PHE A CZ   10 
ATOM 10431 H H    . PHE A 1 37 ? 7.291   -13.218 -2.119  1.00 0.00 ? 37 PHE A H    10 
ATOM 10432 H HA   . PHE A 1 37 ? 5.093   -11.795 -2.930  1.00 0.00 ? 37 PHE A HA   10 
ATOM 10433 H HB2  . PHE A 1 37 ? 7.225   -13.291 -4.381  1.00 0.00 ? 37 PHE A HB2  10 
ATOM 10434 H HB3  . PHE A 1 37 ? 5.841   -12.726 -5.311  1.00 0.00 ? 37 PHE A HB3  10 
ATOM 10435 H HD1  . PHE A 1 37 ? 5.421   -10.351 -5.600  1.00 0.00 ? 37 PHE A HD1  10 
ATOM 10436 H HD2  . PHE A 1 37 ? 8.809   -11.749 -3.436  1.00 0.00 ? 37 PHE A HD2  10 
ATOM 10437 H HE1  . PHE A 1 37 ? 6.435   -8.115  -5.751  1.00 0.00 ? 37 PHE A HE1  10 
ATOM 10438 H HE2  . PHE A 1 37 ? 9.829   -9.515  -3.583  1.00 0.00 ? 37 PHE A HE2  10 
ATOM 10439 H HZ   . PHE A 1 37 ? 8.642   -7.694  -4.742  1.00 0.00 ? 37 PHE A HZ   10 
ATOM 10440 N N    . GLU A 1 38 ? 4.700   -15.020 -3.386  1.00 0.00 ? 38 GLU A N    10 
ATOM 10441 C CA   . GLU A 1 38 ? 3.716   -16.059 -3.663  1.00 0.00 ? 38 GLU A CA   10 
ATOM 10442 C C    . GLU A 1 38 ? 2.476   -15.880 -2.793  1.00 0.00 ? 38 GLU A C    10 
ATOM 10443 O O    . GLU A 1 38 ? 1.348   -16.026 -3.264  1.00 0.00 ? 38 GLU A O    10 
ATOM 10444 C CB   . GLU A 1 38 ? 4.323   -17.444 -3.426  1.00 0.00 ? 38 GLU A CB   10 
ATOM 10445 C CG   . GLU A 1 38 ? 5.303   -17.871 -4.506  1.00 0.00 ? 38 GLU A CG   10 
ATOM 10446 C CD   . GLU A 1 38 ? 4.662   -17.951 -5.878  1.00 0.00 ? 38 GLU A CD   10 
ATOM 10447 O OE1  . GLU A 1 38 ? 3.454   -18.257 -5.952  1.00 0.00 ? 38 GLU A OE1  10 
ATOM 10448 O OE2  . GLU A 1 38 ? 5.370   -17.706 -6.877  1.00 0.00 ? 38 GLU A OE2  10 
ATOM 10449 H H    . GLU A 1 38 ? 5.601   -15.278 -3.100  1.00 0.00 ? 38 GLU A H    10 
ATOM 10450 H HA   . GLU A 1 38 ? 3.428   -15.975 -4.700  1.00 0.00 ? 38 GLU A HA   10 
ATOM 10451 H HB2  . GLU A 1 38 ? 4.842   -17.439 -2.479  1.00 0.00 ? 38 GLU A HB2  10 
ATOM 10452 H HB3  . GLU A 1 38 ? 3.525   -18.171 -3.386  1.00 0.00 ? 38 GLU A HB3  10 
ATOM 10453 H HG2  . GLU A 1 38 ? 6.112   -17.156 -4.544  1.00 0.00 ? 38 GLU A HG2  10 
ATOM 10454 H HG3  . GLU A 1 38 ? 5.697   -18.845 -4.252  1.00 0.00 ? 38 GLU A HG3  10 
ATOM 10455 N N    . GLN A 1 39 ? 2.694   -15.564 -1.520  1.00 0.00 ? 39 GLN A N    10 
ATOM 10456 C CA   . GLN A 1 39 ? 1.594   -15.366 -0.584  1.00 0.00 ? 39 GLN A CA   10 
ATOM 10457 C C    . GLN A 1 39 ? 0.580   -14.370 -1.137  1.00 0.00 ? 39 GLN A C    10 
ATOM 10458 O O    . GLN A 1 39 ? -0.625  -14.628 -1.136  1.00 0.00 ? 39 GLN A O    10 
ATOM 10459 C CB   . GLN A 1 39 ? 2.126   -14.875 0.764   1.00 0.00 ? 39 GLN A CB   10 
ATOM 10460 C CG   . GLN A 1 39 ? 3.080   -15.851 1.433   1.00 0.00 ? 39 GLN A CG   10 
ATOM 10461 C CD   . GLN A 1 39 ? 3.069   -15.735 2.944   1.00 0.00 ? 39 GLN A CD   10 
ATOM 10462 O OE1  . GLN A 1 39 ? 2.042   -15.954 3.588   1.00 0.00 ? 39 GLN A OE1  10 
ATOM 10463 N NE2  . GLN A 1 39 ? 4.214   -15.388 3.521   1.00 0.00 ? 39 GLN A NE2  10 
ATOM 10464 H H    . GLN A 1 39 ? 3.615   -15.461 -1.204  1.00 0.00 ? 39 GLN A H    10 
ATOM 10465 H HA   . GLN A 1 39 ? 1.104   -16.317 -0.442  1.00 0.00 ? 39 GLN A HA   10 
ATOM 10466 H HB2  . GLN A 1 39 ? 2.646   -13.941 0.614   1.00 0.00 ? 39 GLN A HB2  10 
ATOM 10467 H HB3  . GLN A 1 39 ? 1.290   -14.710 1.428   1.00 0.00 ? 39 GLN A HB3  10 
ATOM 10468 H HG2  . GLN A 1 39 ? 2.795   -16.857 1.163   1.00 0.00 ? 39 GLN A HG2  10 
ATOM 10469 H HG3  . GLN A 1 39 ? 4.081   -15.654 1.079   1.00 0.00 ? 39 GLN A HG3  10 
ATOM 10470 H HE21 . GLN A 1 39 ? 4.991   -15.227 2.945   1.00 0.00 ? 39 GLN A HE21 10 
ATOM 10471 H HE22 . GLN A 1 39 ? 4.234   -15.305 4.496   1.00 0.00 ? 39 GLN A HE22 10 
ATOM 10472 N N    . LEU A 1 40 ? 1.074   -13.231 -1.609  1.00 0.00 ? 40 LEU A N    10 
ATOM 10473 C CA   . LEU A 1 40 ? 0.211   -12.194 -2.166  1.00 0.00 ? 40 LEU A CA   10 
ATOM 10474 C C    . LEU A 1 40 ? -0.310  -12.600 -3.541  1.00 0.00 ? 40 LEU A C    10 
ATOM 10475 O O    . LEU A 1 40 ? -1.472  -12.365 -3.869  1.00 0.00 ? 40 LEU A O    10 
ATOM 10476 C CB   . LEU A 1 40 ? 0.971   -10.870 -2.266  1.00 0.00 ? 40 LEU A CB   10 
ATOM 10477 C CG   . LEU A 1 40 ? 1.475   -10.284 -0.947  1.00 0.00 ? 40 LEU A CG   10 
ATOM 10478 C CD1  . LEU A 1 40 ? 2.746   -9.480  -1.171  1.00 0.00 ? 40 LEU A CD1  10 
ATOM 10479 C CD2  . LEU A 1 40 ? 0.402   -9.419  -0.303  1.00 0.00 ? 40 LEU A CD2  10 
ATOM 10480 H H    . LEU A 1 40 ? 2.042   -13.082 -1.583  1.00 0.00 ? 40 LEU A H    10 
ATOM 10481 H HA   . LEU A 1 40 ? -0.628  -12.069 -1.498  1.00 0.00 ? 40 LEU A HA   10 
ATOM 10482 H HB2  . LEU A 1 40 ? 1.825   -11.027 -2.906  1.00 0.00 ? 40 LEU A HB2  10 
ATOM 10483 H HB3  . LEU A 1 40 ? 0.311   -10.145 -2.721  1.00 0.00 ? 40 LEU A HB3  10 
ATOM 10484 H HG   . LEU A 1 40 ? 1.707   -11.092 -0.267  1.00 0.00 ? 40 LEU A HG   10 
ATOM 10485 H HD11 . LEU A 1 40 ? 3.526   -9.852  -0.524  1.00 0.00 ? 40 LEU A HD11 10 
ATOM 10486 H HD12 . LEU A 1 40 ? 2.559   -8.440  -0.949  1.00 0.00 ? 40 LEU A HD12 10 
ATOM 10487 H HD13 . LEU A 1 40 ? 3.056   -9.578  -2.201  1.00 0.00 ? 40 LEU A HD13 10 
ATOM 10488 H HD21 . LEU A 1 40 ? -0.569  -9.716  -0.672  1.00 0.00 ? 40 LEU A HD21 10 
ATOM 10489 H HD22 . LEU A 1 40 ? 0.579   -8.382  -0.551  1.00 0.00 ? 40 LEU A HD22 10 
ATOM 10490 H HD23 . LEU A 1 40 ? 0.433   -9.544  0.769   1.00 0.00 ? 40 LEU A HD23 10 
ATOM 10491 N N    . SER A 1 41 ? 0.558   -13.213 -4.339  1.00 0.00 ? 41 SER A N    10 
ATOM 10492 C CA   . SER A 1 41 ? 0.186   -13.651 -5.680  1.00 0.00 ? 41 SER A CA   10 
ATOM 10493 C C    . SER A 1 41 ? -0.953  -14.665 -5.623  1.00 0.00 ? 41 SER A C    10 
ATOM 10494 O O    . SER A 1 41 ? -1.795  -14.719 -6.518  1.00 0.00 ? 41 SER A O    10 
ATOM 10495 C CB   . SER A 1 41 ? 1.393   -14.262 -6.393  1.00 0.00 ? 41 SER A CB   10 
ATOM 10496 O OG   . SER A 1 41 ? 1.468   -15.659 -6.164  1.00 0.00 ? 41 SER A OG   10 
ATOM 10497 H H    . SER A 1 41 ? 1.471   -13.373 -4.020  1.00 0.00 ? 41 SER A H    10 
ATOM 10498 H HA   . SER A 1 41 ? -0.147  -12.784 -6.231  1.00 0.00 ? 41 SER A HA   10 
ATOM 10499 H HB2  . SER A 1 41 ? 1.307   -14.088 -7.455  1.00 0.00 ? 41 SER A HB2  10 
ATOM 10500 H HB3  . SER A 1 41 ? 2.298   -13.800 -6.025  1.00 0.00 ? 41 SER A HB3  10 
ATOM 10501 H HG   . SER A 1 41 ? 1.047   -16.125 -6.889  1.00 0.00 ? 41 SER A HG   10 
ATOM 10502 N N    . ASN A 1 42 ? -0.970  -15.468 -4.564  1.00 0.00 ? 42 ASN A N    10 
ATOM 10503 C CA   . ASN A 1 42 ? -2.004  -16.482 -4.390  1.00 0.00 ? 42 ASN A CA   10 
ATOM 10504 C C    . ASN A 1 42 ? -3.295  -15.858 -3.868  1.00 0.00 ? 42 ASN A C    10 
ATOM 10505 O O    . ASN A 1 42 ? -4.393  -16.280 -4.233  1.00 0.00 ? 42 ASN A O    10 
ATOM 10506 C CB   . ASN A 1 42 ? -1.524  -17.569 -3.427  1.00 0.00 ? 42 ASN A CB   10 
ATOM 10507 C CG   . ASN A 1 42 ? -0.714  -18.644 -4.126  1.00 0.00 ? 42 ASN A CG   10 
ATOM 10508 O OD1  . ASN A 1 42 ? -1.268  -19.539 -4.764  1.00 0.00 ? 42 ASN A OD1  10 
ATOM 10509 N ND2  . ASN A 1 42 ? 0.606   -18.560 -4.008  1.00 0.00 ? 42 ASN A ND2  10 
ATOM 10510 H H    . ASN A 1 42 ? -0.270  -15.377 -3.884  1.00 0.00 ? 42 ASN A H    10 
ATOM 10511 H HA   . ASN A 1 42 ? -2.197  -16.927 -5.355  1.00 0.00 ? 42 ASN A HA   10 
ATOM 10512 H HB2  . ASN A 1 42 ? -0.906  -17.119 -2.664  1.00 0.00 ? 42 ASN A HB2  10 
ATOM 10513 H HB3  . ASN A 1 42 ? -2.381  -18.035 -2.963  1.00 0.00 ? 42 ASN A HB3  10 
ATOM 10514 H HD21 . ASN A 1 42 ? 0.978   -17.820 -3.484  1.00 0.00 ? 42 ASN A HD21 10 
ATOM 10515 H HD22 . ASN A 1 42 ? 1.154   -19.241 -4.450  1.00 0.00 ? 42 ASN A HD22 10 
ATOM 10516 N N    . LEU A 1 43 ? -3.155  -14.851 -3.013  1.00 0.00 ? 43 LEU A N    10 
ATOM 10517 C CA   . LEU A 1 43 ? -4.309  -14.167 -2.441  1.00 0.00 ? 43 LEU A CA   10 
ATOM 10518 C C    . LEU A 1 43 ? -5.049  -13.363 -3.505  1.00 0.00 ? 43 LEU A C    10 
ATOM 10519 O O    . LEU A 1 43 ? -6.236  -13.584 -3.752  1.00 0.00 ? 43 LEU A O    10 
ATOM 10520 C CB   . LEU A 1 43 ? -3.868  -13.244 -1.303  1.00 0.00 ? 43 LEU A CB   10 
ATOM 10521 C CG   . LEU A 1 43 ? -4.865  -12.159 -0.895  1.00 0.00 ? 43 LEU A CG   10 
ATOM 10522 C CD1  . LEU A 1 43 ? -6.164  -12.782 -0.409  1.00 0.00 ? 43 LEU A CD1  10 
ATOM 10523 C CD2  . LEU A 1 43 ? -4.266  -11.262 0.179   1.00 0.00 ? 43 LEU A CD2  10 
ATOM 10524 H H    . LEU A 1 43 ? -2.254  -14.559 -2.761  1.00 0.00 ? 43 LEU A H    10 
ATOM 10525 H HA   . LEU A 1 43 ? -4.977  -14.918 -2.046  1.00 0.00 ? 43 LEU A HA   10 
ATOM 10526 H HB2  . LEU A 1 43 ? -3.674  -13.857 -0.437  1.00 0.00 ? 43 LEU A HB2  10 
ATOM 10527 H HB3  . LEU A 1 43 ? -2.953  -12.757 -1.610  1.00 0.00 ? 43 LEU A HB3  10 
ATOM 10528 H HG   . LEU A 1 43 ? -5.091  -11.545 -1.756  1.00 0.00 ? 43 LEU A HG   10 
ATOM 10529 H HD11 . LEU A 1 43 ? -6.579  -13.403 -1.188  1.00 0.00 ? 43 LEU A HD11 10 
ATOM 10530 H HD12 . LEU A 1 43 ? -6.866  -12.001 -0.158  1.00 0.00 ? 43 LEU A HD12 10 
ATOM 10531 H HD13 . LEU A 1 43 ? -5.968  -13.384 0.467   1.00 0.00 ? 43 LEU A HD13 10 
ATOM 10532 H HD21 . LEU A 1 43 ? -4.811  -11.394 1.102   1.00 0.00 ? 43 LEU A HD21 10 
ATOM 10533 H HD22 . LEU A 1 43 ? -4.334  -10.230 -0.135  1.00 0.00 ? 43 LEU A HD22 10 
ATOM 10534 H HD23 . LEU A 1 43 ? -3.230  -11.525 0.331   1.00 0.00 ? 43 LEU A HD23 10 
ATOM 10535 N N    . LEU A 1 44 ? -4.341  -12.432 -4.135  1.00 0.00 ? 44 LEU A N    10 
ATOM 10536 C CA   . LEU A 1 44 ? -4.929  -11.596 -5.175  1.00 0.00 ? 44 LEU A CA   10 
ATOM 10537 C C    . LEU A 1 44 ? -5.045  -12.363 -6.489  1.00 0.00 ? 44 LEU A C    10 
ATOM 10538 O O    . LEU A 1 44 ? -5.629  -11.873 -7.455  1.00 0.00 ? 44 LEU A O    10 
ATOM 10539 C CB   . LEU A 1 44 ? -4.088  -10.335 -5.380  1.00 0.00 ? 44 LEU A CB   10 
ATOM 10540 C CG   . LEU A 1 44 ? -3.767  -9.531  -4.120  1.00 0.00 ? 44 LEU A CG   10 
ATOM 10541 C CD1  . LEU A 1 44 ? -2.663  -8.522  -4.398  1.00 0.00 ? 44 LEU A CD1  10 
ATOM 10542 C CD2  . LEU A 1 44 ? -5.014  -8.830  -3.602  1.00 0.00 ? 44 LEU A CD2  10 
ATOM 10543 H H    . LEU A 1 44 ? -3.400  -12.303 -3.895  1.00 0.00 ? 44 LEU A H    10 
ATOM 10544 H HA   . LEU A 1 44 ? -5.919  -11.311 -4.851  1.00 0.00 ? 44 LEU A HA   10 
ATOM 10545 H HB2  . LEU A 1 44 ? -3.154  -10.631 -5.831  1.00 0.00 ? 44 LEU A HB2  10 
ATOM 10546 H HB3  . LEU A 1 44 ? -4.625  -9.688  -6.059  1.00 0.00 ? 44 LEU A HB3  10 
ATOM 10547 H HG   . LEU A 1 44 ? -3.416  -10.205 -3.350  1.00 0.00 ? 44 LEU A HG   10 
ATOM 10548 H HD11 . LEU A 1 44 ? -1.725  -9.041  -4.525  1.00 0.00 ? 44 LEU A HD11 10 
ATOM 10549 H HD12 . LEU A 1 44 ? -2.585  -7.836  -3.568  1.00 0.00 ? 44 LEU A HD12 10 
ATOM 10550 H HD13 . LEU A 1 44 ? -2.896  -7.973  -5.298  1.00 0.00 ? 44 LEU A HD13 10 
ATOM 10551 H HD21 . LEU A 1 44 ? -5.516  -8.337  -4.421  1.00 0.00 ? 44 LEU A HD21 10 
ATOM 10552 H HD22 . LEU A 1 44 ? -4.732  -8.097  -2.859  1.00 0.00 ? 44 LEU A HD22 10 
ATOM 10553 H HD23 . LEU A 1 44 ? -5.677  -9.557  -3.158  1.00 0.00 ? 44 LEU A HD23 10 
ATOM 10554 N N    . ASN A 1 45 ? -4.487  -13.569 -6.516  1.00 0.00 ? 45 ASN A N    10 
ATOM 10555 C CA   . ASN A 1 45 ? -4.530  -14.404 -7.710  1.00 0.00 ? 45 ASN A CA   10 
ATOM 10556 C C    . ASN A 1 45 ? -3.867  -13.700 -8.890  1.00 0.00 ? 45 ASN A C    10 
ATOM 10557 O O    . ASN A 1 45 ? -4.268  -13.882 -10.041 1.00 0.00 ? 45 ASN A O    10 
ATOM 10558 C CB   . ASN A 1 45 ? -5.977  -14.758 -8.059  1.00 0.00 ? 45 ASN A CB   10 
ATOM 10559 C CG   . ASN A 1 45 ? -6.437  -16.038 -7.389  1.00 0.00 ? 45 ASN A CG   10 
ATOM 10560 O OD1  . ASN A 1 45 ? -6.358  -16.176 -6.168  1.00 0.00 ? 45 ASN A OD1  10 
ATOM 10561 N ND2  . ASN A 1 45 ? -6.921  -16.983 -8.187  1.00 0.00 ? 45 ASN A ND2  10 
ATOM 10562 H H    . ASN A 1 45 ? -4.036  -13.905 -5.713  1.00 0.00 ? 45 ASN A H    10 
ATOM 10563 H HA   . ASN A 1 45 ? -3.988  -15.314 -7.498  1.00 0.00 ? 45 ASN A HA   10 
ATOM 10564 H HB2  . ASN A 1 45 ? -6.624  -13.954 -7.740  1.00 0.00 ? 45 ASN A HB2  10 
ATOM 10565 H HB3  . ASN A 1 45 ? -6.063  -14.882 -9.128  1.00 0.00 ? 45 ASN A HB3  10 
ATOM 10566 H HD21 . ASN A 1 45 ? -6.954  -16.804 -9.150  1.00 0.00 ? 45 ASN A HD21 10 
ATOM 10567 H HD22 . ASN A 1 45 ? -7.226  -17.820 -7.780  1.00 0.00 ? 45 ASN A HD22 10 
ATOM 10568 N N    . LEU A 1 46 ? -2.851  -12.896 -8.598  1.00 0.00 ? 46 LEU A N    10 
ATOM 10569 C CA   . LEU A 1 46 ? -2.132  -12.164 -9.634  1.00 0.00 ? 46 LEU A CA   10 
ATOM 10570 C C    . LEU A 1 46 ? -0.726  -12.726 -9.822  1.00 0.00 ? 46 LEU A C    10 
ATOM 10571 O O    . LEU A 1 46 ? -0.133  -13.299 -8.907  1.00 0.00 ? 46 LEU A O    10 
ATOM 10572 C CB   . LEU A 1 46 ? -2.056  -10.678 -9.278  1.00 0.00 ? 46 LEU A CB   10 
ATOM 10573 C CG   . LEU A 1 46 ? -3.394  -9.947  -9.162  1.00 0.00 ? 46 LEU A CG   10 
ATOM 10574 C CD1  . LEU A 1 46 ? -3.205  -8.590  -8.503  1.00 0.00 ? 46 LEU A CD1  10 
ATOM 10575 C CD2  . LEU A 1 46 ? -4.038  -9.793  -10.532 1.00 0.00 ? 46 LEU A CD2  10 
ATOM 10576 H H    . LEU A 1 46 ? -2.577  -12.792 -7.663  1.00 0.00 ? 46 LEU A H    10 
ATOM 10577 H HA   . LEU A 1 46 ? -2.678  -12.277 -10.559 1.00 0.00 ? 46 LEU A HA   10 
ATOM 10578 H HB2  . LEU A 1 46 ? -1.548  -10.591 -8.330  1.00 0.00 ? 46 LEU A HB2  10 
ATOM 10579 H HB3  . LEU A 1 46 ? -1.474  -10.185 -10.044 1.00 0.00 ? 46 LEU A HB3  10 
ATOM 10580 H HG   . LEU A 1 46 ? -4.062  -10.529 -8.541  1.00 0.00 ? 46 LEU A HG   10 
ATOM 10581 H HD11 . LEU A 1 46 ? -3.207  -7.819  -9.260  1.00 0.00 ? 46 LEU A HD11 10 
ATOM 10582 H HD12 . LEU A 1 46 ? -2.263  -8.574  -7.975  1.00 0.00 ? 46 LEU A HD12 10 
ATOM 10583 H HD13 . LEU A 1 46 ? -4.011  -8.412  -7.806  1.00 0.00 ? 46 LEU A HD13 10 
ATOM 10584 H HD21 . LEU A 1 46 ? -3.988  -10.733 -11.061 1.00 0.00 ? 46 LEU A HD21 10 
ATOM 10585 H HD22 . LEU A 1 46 ? -3.512  -9.034  -11.093 1.00 0.00 ? 46 LEU A HD22 10 
ATOM 10586 H HD23 . LEU A 1 46 ? -5.071  -9.501  -10.413 1.00 0.00 ? 46 LEU A HD23 10 
ATOM 10587 N N    . PRO A 1 47 ? -0.177  -12.557 -11.034 1.00 0.00 ? 47 PRO A N    10 
ATOM 10588 C CA   . PRO A 1 47 ? 1.166   -13.037 -11.369 1.00 0.00 ? 47 PRO A CA   10 
ATOM 10589 C C    . PRO A 1 47 ? 2.259   -12.247 -10.656 1.00 0.00 ? 47 PRO A C    10 
ATOM 10590 O O    . PRO A 1 47 ? 2.285   -11.017 -10.708 1.00 0.00 ? 47 PRO A O    10 
ATOM 10591 C CB   . PRO A 1 47 ? 1.253   -12.823 -12.882 1.00 0.00 ? 47 PRO A CB   10 
ATOM 10592 C CG   . PRO A 1 47 ? 0.291   -11.722 -13.164 1.00 0.00 ? 47 PRO A CG   10 
ATOM 10593 C CD   . PRO A 1 47 ? -0.827  -11.882 -12.171 1.00 0.00 ? 47 PRO A CD   10 
ATOM 10594 H HA   . PRO A 1 47 ? 1.279   -14.088 -11.145 1.00 0.00 ? 47 PRO A HA   10 
ATOM 10595 H HB2  . PRO A 1 47 ? 2.262   -12.547 -13.152 1.00 0.00 ? 47 PRO A HB2  10 
ATOM 10596 H HB3  . PRO A 1 47 ? 0.973   -13.732 -13.394 1.00 0.00 ? 47 PRO A HB3  10 
ATOM 10597 H HG2  . PRO A 1 47 ? 0.776   -10.767 -13.031 1.00 0.00 ? 47 PRO A HG2  10 
ATOM 10598 H HG3  . PRO A 1 47 ? -0.088  -11.815 -14.172 1.00 0.00 ? 47 PRO A HG3  10 
ATOM 10599 H HD2  . PRO A 1 47 ? -1.213  -10.917 -11.878 1.00 0.00 ? 47 PRO A HD2  10 
ATOM 10600 H HD3  . PRO A 1 47 ? -1.613  -12.496 -12.584 1.00 0.00 ? 47 PRO A HD3  10 
ATOM 10601 N N    . THR A 1 48 ? 3.161   -12.962 -9.990  1.00 0.00 ? 48 THR A N    10 
ATOM 10602 C CA   . THR A 1 48 ? 4.255   -12.328 -9.266  1.00 0.00 ? 48 THR A CA   10 
ATOM 10603 C C    . THR A 1 48 ? 4.872   -11.197 -10.082 1.00 0.00 ? 48 THR A C    10 
ATOM 10604 O O    . THR A 1 48 ? 5.178   -10.130 -9.549  1.00 0.00 ? 48 THR A O    10 
ATOM 10605 C CB   . THR A 1 48 ? 5.355   -13.345 -8.906  1.00 0.00 ? 48 THR A CB   10 
ATOM 10606 O OG1  . THR A 1 48 ? 5.489   -14.312 -9.954  1.00 0.00 ? 48 THR A OG1  10 
ATOM 10607 C CG2  . THR A 1 48 ? 5.033   -14.049 -7.597  1.00 0.00 ? 48 THR A CG2  10 
ATOM 10608 H H    . THR A 1 48 ? 3.086   -13.939 -9.985  1.00 0.00 ? 48 THR A H    10 
ATOM 10609 H HA   . THR A 1 48 ? 3.856   -11.920 -8.348  1.00 0.00 ? 48 THR A HA   10 
ATOM 10610 H HB   . THR A 1 48 ? 6.290   -12.816 -8.793  1.00 0.00 ? 48 THR A HB   10 
ATOM 10611 H HG1  . THR A 1 48 ? 5.543   -13.861 -10.800 1.00 0.00 ? 48 THR A HG1  10 
ATOM 10612 H HG21 . THR A 1 48 ? 5.934   -14.485 -7.192  1.00 0.00 ? 48 THR A HG21 10 
ATOM 10613 H HG22 . THR A 1 48 ? 4.305   -14.827 -7.776  1.00 0.00 ? 48 THR A HG22 10 
ATOM 10614 H HG23 . THR A 1 48 ? 4.631   -13.335 -6.894  1.00 0.00 ? 48 THR A HG23 10 
ATOM 10615 N N    . ARG A 1 49 ? 5.050   -11.437 -11.377 1.00 0.00 ? 49 ARG A N    10 
ATOM 10616 C CA   . ARG A 1 49 ? 5.631   -10.438 -12.266 1.00 0.00 ? 49 ARG A CA   10 
ATOM 10617 C C    . ARG A 1 49 ? 4.917   -9.098  -12.117 1.00 0.00 ? 49 ARG A C    10 
ATOM 10618 O O    . ARG A 1 49 ? 5.546   -8.040  -12.156 1.00 0.00 ? 49 ARG A O    10 
ATOM 10619 C CB   . ARG A 1 49 ? 5.553   -10.911 -13.719 1.00 0.00 ? 49 ARG A CB   10 
ATOM 10620 C CG   . ARG A 1 49 ? 4.192   -10.692 -14.359 1.00 0.00 ? 49 ARG A CG   10 
ATOM 10621 C CD   . ARG A 1 49 ? 4.062   -9.286  -14.923 1.00 0.00 ? 49 ARG A CD   10 
ATOM 10622 N NE   . ARG A 1 49 ? 3.087   -9.220  -16.008 1.00 0.00 ? 49 ARG A NE   10 
ATOM 10623 C CZ   . ARG A 1 49 ? 3.373   -9.508  -17.272 1.00 0.00 ? 49 ARG A CZ   10 
ATOM 10624 N NH1  . ARG A 1 49 ? 4.600   -9.881  -17.609 1.00 0.00 ? 49 ARG A NH1  10 
ATOM 10625 N NH2  . ARG A 1 49 ? 2.431   -9.424  -18.203 1.00 0.00 ? 49 ARG A NH2  10 
ATOM 10626 H H    . ARG A 1 49 ? 4.785   -12.307 -11.743 1.00 0.00 ? 49 ARG A H    10 
ATOM 10627 H HA   . ARG A 1 49 ? 6.667   -10.313 -11.992 1.00 0.00 ? 49 ARG A HA   10 
ATOM 10628 H HB2  . ARG A 1 49 ? 6.290   -10.376 -14.299 1.00 0.00 ? 49 ARG A HB2  10 
ATOM 10629 H HB3  . ARG A 1 49 ? 5.777   -11.967 -13.753 1.00 0.00 ? 49 ARG A HB3  10 
ATOM 10630 H HG2  . ARG A 1 49 ? 4.063   -11.403 -15.161 1.00 0.00 ? 49 ARG A HG2  10 
ATOM 10631 H HG3  . ARG A 1 49 ? 3.426   -10.844 -13.614 1.00 0.00 ? 49 ARG A HG3  10 
ATOM 10632 H HD2  . ARG A 1 49 ? 3.750   -8.622  -14.131 1.00 0.00 ? 49 ARG A HD2  10 
ATOM 10633 H HD3  . ARG A 1 49 ? 5.025   -8.972  -15.297 1.00 0.00 ? 49 ARG A HD3  10 
ATOM 10634 H HE   . ARG A 1 49 ? 2.174   -8.946  -15.781 1.00 0.00 ? 49 ARG A HE   10 
ATOM 10635 H HH11 . ARG A 1 49 ? 5.312   -9.946  -16.910 1.00 0.00 ? 49 ARG A HH11 10 
ATOM 10636 H HH12 . ARG A 1 49 ? 4.813   -10.099 -18.562 1.00 0.00 ? 49 ARG A HH12 10 
ATOM 10637 H HH21 . ARG A 1 49 ? 1.505   -9.144  -17.953 1.00 0.00 ? 49 ARG A HH21 10 
ATOM 10638 H HH22 . ARG A 1 49 ? 2.648   -9.642  -19.154 1.00 0.00 ? 49 ARG A HH22 10 
ATOM 10639 N N    . VAL A 1 50 ? 3.600   -9.150  -11.948 1.00 0.00 ? 50 VAL A N    10 
ATOM 10640 C CA   . VAL A 1 50 ? 2.800   -7.940  -11.793 1.00 0.00 ? 50 VAL A CA   10 
ATOM 10641 C C    . VAL A 1 50 ? 3.017   -7.310  -10.422 1.00 0.00 ? 50 VAL A C    10 
ATOM 10642 O O    . VAL A 1 50 ? 3.051   -6.086  -10.289 1.00 0.00 ? 50 VAL A O    10 
ATOM 10643 C CB   . VAL A 1 50 ? 1.299   -8.232  -11.980 1.00 0.00 ? 50 VAL A CB   10 
ATOM 10644 C CG1  . VAL A 1 50 ? 0.459   -7.117  -11.375 1.00 0.00 ? 50 VAL A CG1  10 
ATOM 10645 C CG2  . VAL A 1 50 ? 0.972   -8.417  -13.454 1.00 0.00 ? 50 VAL A CG2  10 
ATOM 10646 H H    . VAL A 1 50 ? 3.155   -10.023 -11.926 1.00 0.00 ? 50 VAL A H    10 
ATOM 10647 H HA   . VAL A 1 50 ? 3.106   -7.238  -12.555 1.00 0.00 ? 50 VAL A HA   10 
ATOM 10648 H HB   . VAL A 1 50 ? 1.065   -9.151  -11.463 1.00 0.00 ? 50 VAL A HB   10 
ATOM 10649 H HG11 . VAL A 1 50 ? -0.588  -7.346  -11.505 1.00 0.00 ? 50 VAL A HG11 10 
ATOM 10650 H HG12 . VAL A 1 50 ? 0.682   -7.029  -10.322 1.00 0.00 ? 50 VAL A HG12 10 
ATOM 10651 H HG13 . VAL A 1 50 ? 0.687   -6.185  -11.871 1.00 0.00 ? 50 VAL A HG13 10 
ATOM 10652 H HG21 . VAL A 1 50 ? 0.021   -8.919  -13.551 1.00 0.00 ? 50 VAL A HG21 10 
ATOM 10653 H HG22 . VAL A 1 50 ? 0.920   -7.451  -13.936 1.00 0.00 ? 50 VAL A HG22 10 
ATOM 10654 H HG23 . VAL A 1 50 ? 1.743   -9.011  -13.922 1.00 0.00 ? 50 VAL A HG23 10 
ATOM 10655 N N    . ILE A 1 51 ? 3.165   -8.153  -9.406  1.00 0.00 ? 51 ILE A N    10 
ATOM 10656 C CA   . ILE A 1 51 ? 3.380   -7.678  -8.045  1.00 0.00 ? 51 ILE A CA   10 
ATOM 10657 C C    . ILE A 1 51 ? 4.783   -7.104  -7.879  1.00 0.00 ? 51 ILE A C    10 
ATOM 10658 O O    . ILE A 1 51 ? 4.998   -6.176  -7.099  1.00 0.00 ? 51 ILE A O    10 
ATOM 10659 C CB   . ILE A 1 51 ? 3.174   -8.805  -7.016  1.00 0.00 ? 51 ILE A CB   10 
ATOM 10660 C CG1  . ILE A 1 51 ? 1.874   -9.558  -7.306  1.00 0.00 ? 51 ILE A CG1  10 
ATOM 10661 C CG2  . ILE A 1 51 ? 3.161   -8.237  -5.604  1.00 0.00 ? 51 ILE A CG2  10 
ATOM 10662 C CD1  . ILE A 1 51 ? 1.690   -10.795 -6.454  1.00 0.00 ? 51 ILE A CD1  10 
ATOM 10663 H H    . ILE A 1 51 ? 3.128   -9.117  -9.576  1.00 0.00 ? 51 ILE A H    10 
ATOM 10664 H HA   . ILE A 1 51 ? 2.658   -6.899  -7.846  1.00 0.00 ? 51 ILE A HA   10 
ATOM 10665 H HB   . ILE A 1 51 ? 4.004   -9.490  -7.094  1.00 0.00 ? 51 ILE A HB   10 
ATOM 10666 H HG12 . ILE A 1 51 ? 1.037   -8.903  -7.123  1.00 0.00 ? 51 ILE A HG12 10 
ATOM 10667 H HG13 . ILE A 1 51 ? 1.867   -9.863  -8.342  1.00 0.00 ? 51 ILE A HG13 10 
ATOM 10668 H HG21 . ILE A 1 51 ? 4.134   -8.368  -5.154  1.00 0.00 ? 51 ILE A HG21 10 
ATOM 10669 H HG22 . ILE A 1 51 ? 2.922   -7.185  -5.642  1.00 0.00 ? 51 ILE A HG22 10 
ATOM 10670 H HG23 . ILE A 1 51 ? 2.419   -8.755  -5.015  1.00 0.00 ? 51 ILE A HG23 10 
ATOM 10671 H HD11 . ILE A 1 51 ? 0.640   -10.931 -6.239  1.00 0.00 ? 51 ILE A HD11 10 
ATOM 10672 H HD12 . ILE A 1 51 ? 2.065   -11.657 -6.985  1.00 0.00 ? 51 ILE A HD12 10 
ATOM 10673 H HD13 . ILE A 1 51 ? 2.233   -10.678 -5.527  1.00 0.00 ? 51 ILE A HD13 10 
ATOM 10674 N N    . VAL A 1 52 ? 5.736   -7.661  -8.620  1.00 0.00 ? 52 VAL A N    10 
ATOM 10675 C CA   . VAL A 1 52 ? 7.119   -7.202  -8.558  1.00 0.00 ? 52 VAL A CA   10 
ATOM 10676 C C    . VAL A 1 52 ? 7.260   -5.799  -9.137  1.00 0.00 ? 52 VAL A C    10 
ATOM 10677 O O    . VAL A 1 52 ? 7.756   -4.889  -8.473  1.00 0.00 ? 52 VAL A O    10 
ATOM 10678 C CB   . VAL A 1 52 ? 8.061   -8.156  -9.316  1.00 0.00 ? 52 VAL A CB   10 
ATOM 10679 C CG1  . VAL A 1 52 ? 9.457   -7.561  -9.415  1.00 0.00 ? 52 VAL A CG1  10 
ATOM 10680 C CG2  . VAL A 1 52 ? 8.099   -9.517  -8.639  1.00 0.00 ? 52 VAL A CG2  10 
ATOM 10681 H H    . VAL A 1 52 ? 5.504   -8.397  -9.223  1.00 0.00 ? 52 VAL A H    10 
ATOM 10682 H HA   . VAL A 1 52 ? 7.419   -7.185  -7.520  1.00 0.00 ? 52 VAL A HA   10 
ATOM 10683 H HB   . VAL A 1 52 ? 7.678   -8.286  -10.318 1.00 0.00 ? 52 VAL A HB   10 
ATOM 10684 H HG11 . VAL A 1 52 ? 10.050  -8.146  -10.102 1.00 0.00 ? 52 VAL A HG11 10 
ATOM 10685 H HG12 . VAL A 1 52 ? 9.391   -6.543  -9.771  1.00 0.00 ? 52 VAL A HG12 10 
ATOM 10686 H HG13 . VAL A 1 52 ? 9.923   -7.572  -8.440  1.00 0.00 ? 52 VAL A HG13 10 
ATOM 10687 H HG21 . VAL A 1 52 ? 8.654   -10.209 -9.255  1.00 0.00 ? 52 VAL A HG21 10 
ATOM 10688 H HG22 . VAL A 1 52 ? 8.580   -9.428  -7.676  1.00 0.00 ? 52 VAL A HG22 10 
ATOM 10689 H HG23 . VAL A 1 52 ? 7.091   -9.882  -8.505  1.00 0.00 ? 52 VAL A HG23 10 
ATOM 10690 N N    . VAL A 1 53 ? 6.819   -5.631  -10.379 1.00 0.00 ? 53 VAL A N    10 
ATOM 10691 C CA   . VAL A 1 53 ? 6.894   -4.338  -11.049 1.00 0.00 ? 53 VAL A CA   10 
ATOM 10692 C C    . VAL A 1 53 ? 6.224   -3.249  -10.217 1.00 0.00 ? 53 VAL A C    10 
ATOM 10693 O O    . VAL A 1 53 ? 6.707   -2.119  -10.151 1.00 0.00 ? 53 VAL A O    10 
ATOM 10694 C CB   . VAL A 1 53 ? 6.233   -4.386  -12.439 1.00 0.00 ? 53 VAL A CB   10 
ATOM 10695 C CG1  . VAL A 1 53 ? 6.244   -3.009  -13.084 1.00 0.00 ? 53 VAL A CG1  10 
ATOM 10696 C CG2  . VAL A 1 53 ? 6.933   -5.405  -13.326 1.00 0.00 ? 53 VAL A CG2  10 
ATOM 10697 H H    . VAL A 1 53 ? 6.434   -6.395  -10.857 1.00 0.00 ? 53 VAL A H    10 
ATOM 10698 H HA   . VAL A 1 53 ? 7.937   -4.088  -11.177 1.00 0.00 ? 53 VAL A HA   10 
ATOM 10699 H HB   . VAL A 1 53 ? 5.205   -4.693  -12.316 1.00 0.00 ? 53 VAL A HB   10 
ATOM 10700 H HG11 . VAL A 1 53 ? 7.043   -2.419  -12.659 1.00 0.00 ? 53 VAL A HG11 10 
ATOM 10701 H HG12 . VAL A 1 53 ? 6.397   -3.110  -14.148 1.00 0.00 ? 53 VAL A HG12 10 
ATOM 10702 H HG13 . VAL A 1 53 ? 5.300   -2.518  -12.901 1.00 0.00 ? 53 VAL A HG13 10 
ATOM 10703 H HG21 . VAL A 1 53 ? 7.014   -5.012  -14.328 1.00 0.00 ? 53 VAL A HG21 10 
ATOM 10704 H HG22 . VAL A 1 53 ? 7.921   -5.604  -12.936 1.00 0.00 ? 53 VAL A HG22 10 
ATOM 10705 H HG23 . VAL A 1 53 ? 6.362   -6.321  -13.342 1.00 0.00 ? 53 VAL A HG23 10 
ATOM 10706 N N    . TRP A 1 54 ? 5.110   -3.598  -9.585  1.00 0.00 ? 54 TRP A N    10 
ATOM 10707 C CA   . TRP A 1 54 ? 4.373   -2.650  -8.757  1.00 0.00 ? 54 TRP A CA   10 
ATOM 10708 C C    . TRP A 1 54 ? 5.161   -2.298  -7.500  1.00 0.00 ? 54 TRP A C    10 
ATOM 10709 O O    . TRP A 1 54 ? 5.258   -1.130  -7.123  1.00 0.00 ? 54 TRP A O    10 
ATOM 10710 C CB   . TRP A 1 54 ? 3.010   -3.228  -8.373  1.00 0.00 ? 54 TRP A CB   10 
ATOM 10711 C CG   . TRP A 1 54 ? 2.159   -2.274  -7.591  1.00 0.00 ? 54 TRP A CG   10 
ATOM 10712 C CD1  . TRP A 1 54 ? 1.088   -1.562  -8.053  1.00 0.00 ? 54 TRP A CD1  10 
ATOM 10713 C CD2  . TRP A 1 54 ? 2.308   -1.926  -6.210  1.00 0.00 ? 54 TRP A CD2  10 
ATOM 10714 N NE1  . TRP A 1 54 ? 0.564   -0.793  -7.042  1.00 0.00 ? 54 TRP A NE1  10 
ATOM 10715 C CE2  . TRP A 1 54 ? 1.293   -0.999  -5.901  1.00 0.00 ? 54 TRP A CE2  10 
ATOM 10716 C CE3  . TRP A 1 54 ? 3.199   -2.310  -5.204  1.00 0.00 ? 54 TRP A CE3  10 
ATOM 10717 C CZ2  . TRP A 1 54 ? 1.148   -0.451  -4.630  1.00 0.00 ? 54 TRP A CZ2  10 
ATOM 10718 C CZ3  . TRP A 1 54 ? 3.053   -1.764  -3.942  1.00 0.00 ? 54 TRP A CZ3  10 
ATOM 10719 C CH2  . TRP A 1 54 ? 2.034   -0.844  -3.664  1.00 0.00 ? 54 TRP A CH2  10 
ATOM 10720 H H    . TRP A 1 54 ? 4.774   -4.514  -9.677  1.00 0.00 ? 54 TRP A H    10 
ATOM 10721 H HA   . TRP A 1 54 ? 4.222   -1.751  -9.337  1.00 0.00 ? 54 TRP A HA   10 
ATOM 10722 H HB2  . TRP A 1 54 ? 2.473   -3.494  -9.271  1.00 0.00 ? 54 TRP A HB2  10 
ATOM 10723 H HB3  . TRP A 1 54 ? 3.159   -4.113  -7.772  1.00 0.00 ? 54 TRP A HB3  10 
ATOM 10724 H HD1  . TRP A 1 54 ? 0.721   -1.606  -9.067  1.00 0.00 ? 54 TRP A HD1  10 
ATOM 10725 H HE1  . TRP A 1 54 ? -0.209  -0.195  -7.125  1.00 0.00 ? 54 TRP A HE1  10 
ATOM 10726 H HE3  . TRP A 1 54 ? 3.991   -3.018  -5.399  1.00 0.00 ? 54 TRP A HE3  10 
ATOM 10727 H HZ2  . TRP A 1 54 ? 0.367   0.259   -4.399  1.00 0.00 ? 54 TRP A HZ2  10 
ATOM 10728 H HZ3  . TRP A 1 54 ? 3.733   -2.048  -3.152  1.00 0.00 ? 54 TRP A HZ3  10 
ATOM 10729 H HH2  . TRP A 1 54 ? 1.958   -0.444  -2.665  1.00 0.00 ? 54 TRP A HH2  10 
ATOM 10730 N N    . PHE A 1 55 ? 5.723   -3.314  -6.855  1.00 0.00 ? 55 PHE A N    10 
ATOM 10731 C CA   . PHE A 1 55 ? 6.503   -3.112  -5.639  1.00 0.00 ? 55 PHE A CA   10 
ATOM 10732 C C    . PHE A 1 55 ? 7.776   -2.324  -5.935  1.00 0.00 ? 55 PHE A C    10 
ATOM 10733 O O    . PHE A 1 55 ? 8.183   -1.467  -5.151  1.00 0.00 ? 55 PHE A O    10 
ATOM 10734 C CB   . PHE A 1 55 ? 6.858   -4.458  -5.005  1.00 0.00 ? 55 PHE A CB   10 
ATOM 10735 C CG   . PHE A 1 55 ? 5.849   -4.932  -3.999  1.00 0.00 ? 55 PHE A CG   10 
ATOM 10736 C CD1  . PHE A 1 55 ? 4.536   -5.166  -4.373  1.00 0.00 ? 55 PHE A CD1  10 
ATOM 10737 C CD2  . PHE A 1 55 ? 6.214   -5.144  -2.679  1.00 0.00 ? 55 PHE A CD2  10 
ATOM 10738 C CE1  . PHE A 1 55 ? 3.604   -5.603  -3.450  1.00 0.00 ? 55 PHE A CE1  10 
ATOM 10739 C CE2  . PHE A 1 55 ? 5.287   -5.581  -1.752  1.00 0.00 ? 55 PHE A CE2  10 
ATOM 10740 C CZ   . PHE A 1 55 ? 3.981   -5.809  -2.137  1.00 0.00 ? 55 PHE A CZ   10 
ATOM 10741 H H    . PHE A 1 55 ? 5.610   -4.223  -7.204  1.00 0.00 ? 55 PHE A H    10 
ATOM 10742 H HA   . PHE A 1 55 ? 5.896   -2.547  -4.948  1.00 0.00 ? 55 PHE A HA   10 
ATOM 10743 H HB2  . PHE A 1 55 ? 6.929   -5.205  -5.781  1.00 0.00 ? 55 PHE A HB2  10 
ATOM 10744 H HB3  . PHE A 1 55 ? 7.812   -4.372  -4.506  1.00 0.00 ? 55 PHE A HB3  10 
ATOM 10745 H HD1  . PHE A 1 55 ? 4.240   -5.004  -5.400  1.00 0.00 ? 55 PHE A HD1  10 
ATOM 10746 H HD2  . PHE A 1 55 ? 7.235   -4.964  -2.376  1.00 0.00 ? 55 PHE A HD2  10 
ATOM 10747 H HE1  . PHE A 1 55 ? 2.584   -5.780  -3.755  1.00 0.00 ? 55 PHE A HE1  10 
ATOM 10748 H HE2  . PHE A 1 55 ? 5.584   -5.741  -0.726  1.00 0.00 ? 55 PHE A HE2  10 
ATOM 10749 H HZ   . PHE A 1 55 ? 3.255   -6.151  -1.414  1.00 0.00 ? 55 PHE A HZ   10 
ATOM 10750 N N    . GLN A 1 56 ? 8.398   -2.621  -7.070  1.00 0.00 ? 56 GLN A N    10 
ATOM 10751 C CA   . GLN A 1 56 ? 9.626   -1.942  -7.469  1.00 0.00 ? 56 GLN A CA   10 
ATOM 10752 C C    . GLN A 1 56 ? 9.403   -0.437  -7.581  1.00 0.00 ? 56 GLN A C    10 
ATOM 10753 O O    . GLN A 1 56 ? 10.197  0.356   -7.077  1.00 0.00 ? 56 GLN A O    10 
ATOM 10754 C CB   . GLN A 1 56 ? 10.130  -2.496  -8.803  1.00 0.00 ? 56 GLN A CB   10 
ATOM 10755 C CG   . GLN A 1 56 ? 10.919  -3.788  -8.666  1.00 0.00 ? 56 GLN A CG   10 
ATOM 10756 C CD   . GLN A 1 56 ? 11.975  -3.943  -9.743  1.00 0.00 ? 56 GLN A CD   10 
ATOM 10757 O OE1  . GLN A 1 56 ? 12.632  -2.976  -10.129 1.00 0.00 ? 56 GLN A OE1  10 
ATOM 10758 N NE2  . GLN A 1 56 ? 12.144  -5.165  -10.234 1.00 0.00 ? 56 GLN A NE2  10 
ATOM 10759 H H    . GLN A 1 56 ? 8.024   -3.314  -7.653  1.00 0.00 ? 56 GLN A H    10 
ATOM 10760 H HA   . GLN A 1 56 ? 10.369  -2.128  -6.708  1.00 0.00 ? 56 GLN A HA   10 
ATOM 10761 H HB2  . GLN A 1 56 ? 9.282   -2.683  -9.445  1.00 0.00 ? 56 GLN A HB2  10 
ATOM 10762 H HB3  . GLN A 1 56 ? 10.767  -1.758  -9.267  1.00 0.00 ? 56 GLN A HB3  10 
ATOM 10763 H HG2  . GLN A 1 56 ? 11.406  -3.797  -7.702  1.00 0.00 ? 56 GLN A HG2  10 
ATOM 10764 H HG3  . GLN A 1 56 ? 10.235  -4.621  -8.730  1.00 0.00 ? 56 GLN A HG3  10 
ATOM 10765 H HE21 . GLN A 1 56 ? 11.584  -5.888  -9.879  1.00 0.00 ? 56 GLN A HE21 10 
ATOM 10766 H HE22 . GLN A 1 56 ? 12.819  -5.295  -10.931 1.00 0.00 ? 56 GLN A HE22 10 
ATOM 10767 N N    . ASN A 1 57 ? 8.318   -0.052  -8.245  1.00 0.00 ? 57 ASN A N    10 
ATOM 10768 C CA   . ASN A 1 57 ? 7.992   1.358   -8.424  1.00 0.00 ? 57 ASN A CA   10 
ATOM 10769 C C    . ASN A 1 57 ? 7.728   2.030   -7.080  1.00 0.00 ? 57 ASN A C    10 
ATOM 10770 O O    . ASN A 1 57 ? 8.368   3.023   -6.735  1.00 0.00 ? 57 ASN A O    10 
ATOM 10771 C CB   . ASN A 1 57 ? 6.769   1.509   -9.331  1.00 0.00 ? 57 ASN A CB   10 
ATOM 10772 C CG   . ASN A 1 57 ? 7.100   1.272   -10.792 1.00 0.00 ? 57 ASN A CG   10 
ATOM 10773 O OD1  . ASN A 1 57 ? 7.762   2.090   -11.430 1.00 0.00 ? 57 ASN A OD1  10 
ATOM 10774 N ND2  . ASN A 1 57 ? 6.639   0.148   -11.328 1.00 0.00 ? 57 ASN A ND2  10 
ATOM 10775 H H    . ASN A 1 57 ? 7.723   -0.732  -8.624  1.00 0.00 ? 57 ASN A H    10 
ATOM 10776 H HA   . ASN A 1 57 ? 8.838   1.837   -8.893  1.00 0.00 ? 57 ASN A HA   10 
ATOM 10777 H HB2  . ASN A 1 57 ? 6.016   0.794   -9.032  1.00 0.00 ? 57 ASN A HB2  10 
ATOM 10778 H HB3  . ASN A 1 57 ? 6.372   2.507   -9.228  1.00 0.00 ? 57 ASN A HB3  10 
ATOM 10779 H HD21 . ASN A 1 57 ? 6.118   -0.457  -10.759 1.00 0.00 ? 57 ASN A HD21 10 
ATOM 10780 H HD22 . ASN A 1 57 ? 6.839   -0.031  -12.271 1.00 0.00 ? 57 ASN A HD22 10 
ATOM 10781 N N    . ALA A 1 58 ? 6.782   1.481   -6.326  1.00 0.00 ? 58 ALA A N    10 
ATOM 10782 C CA   . ALA A 1 58 ? 6.435   2.025   -5.019  1.00 0.00 ? 58 ALA A CA   10 
ATOM 10783 C C    . ALA A 1 58 ? 7.681   2.467   -4.259  1.00 0.00 ? 58 ALA A C    10 
ATOM 10784 O O    . ALA A 1 58 ? 7.624   3.370   -3.426  1.00 0.00 ? 58 ALA A O    10 
ATOM 10785 C CB   . ALA A 1 58 ? 5.657   0.998   -4.209  1.00 0.00 ? 58 ALA A CB   10 
ATOM 10786 H H    . ALA A 1 58 ? 6.306   0.690   -6.656  1.00 0.00 ? 58 ALA A H    10 
ATOM 10787 H HA   . ALA A 1 58 ? 5.797   2.884   -5.173  1.00 0.00 ? 58 ALA A HA   10 
ATOM 10788 H HB1  . ALA A 1 58 ? 5.553   1.347   -3.192  1.00 0.00 ? 58 ALA A HB1  10 
ATOM 10789 H HB2  . ALA A 1 58 ? 4.679   0.862   -4.645  1.00 0.00 ? 58 ALA A HB2  10 
ATOM 10790 H HB3  . ALA A 1 58 ? 6.189   0.059   -4.214  1.00 0.00 ? 58 ALA A HB3  10 
ATOM 10791 N N    . ARG A 1 59 ? 8.806   1.823   -4.553  1.00 0.00 ? 59 ARG A N    10 
ATOM 10792 C CA   . ARG A 1 59 ? 10.067  2.148   -3.896  1.00 0.00 ? 59 ARG A CA   10 
ATOM 10793 C C    . ARG A 1 59 ? 10.663  3.430   -4.469  1.00 0.00 ? 59 ARG A C    10 
ATOM 10794 O O    . ARG A 1 59 ? 11.124  4.297   -3.726  1.00 0.00 ? 59 ARG A O    10 
ATOM 10795 C CB   . ARG A 1 59 ? 11.061  0.996   -4.054  1.00 0.00 ? 59 ARG A CB   10 
ATOM 10796 C CG   . ARG A 1 59 ? 10.711  -0.229  -3.224  1.00 0.00 ? 59 ARG A CG   10 
ATOM 10797 C CD   . ARG A 1 59 ? 11.805  -1.282  -3.296  1.00 0.00 ? 59 ARG A CD   10 
ATOM 10798 N NE   . ARG A 1 59 ? 13.139  -0.685  -3.313  1.00 0.00 ? 59 ARG A NE   10 
ATOM 10799 C CZ   . ARG A 1 59 ? 13.738  -0.257  -4.418  1.00 0.00 ? 59 ARG A CZ   10 
ATOM 10800 N NH1  . ARG A 1 59 ? 13.126  -0.359  -5.590  1.00 0.00 ? 59 ARG A NH1  10 
ATOM 10801 N NH2  . ARG A 1 59 ? 14.952  0.274   -4.353  1.00 0.00 ? 59 ARG A NH2  10 
ATOM 10802 H H    . ARG A 1 59 ? 8.788   1.111   -5.227  1.00 0.00 ? 59 ARG A H    10 
ATOM 10803 H HA   . ARG A 1 59 ? 9.865   2.296   -2.846  1.00 0.00 ? 59 ARG A HA   10 
ATOM 10804 H HB2  . ARG A 1 59 ? 11.092  0.702   -5.093  1.00 0.00 ? 59 ARG A HB2  10 
ATOM 10805 H HB3  . ARG A 1 59 ? 12.040  1.338   -3.756  1.00 0.00 ? 59 ARG A HB3  10 
ATOM 10806 H HG2  . ARG A 1 59 ? 10.582  0.071   -2.194  1.00 0.00 ? 59 ARG A HG2  10 
ATOM 10807 H HG3  . ARG A 1 59 ? 9.790   -0.652  -3.596  1.00 0.00 ? 59 ARG A HG3  10 
ATOM 10808 H HD2  . ARG A 1 59 ? 11.722  -1.928  -2.435  1.00 0.00 ? 59 ARG A HD2  10 
ATOM 10809 H HD3  . ARG A 1 59 ? 11.669  -1.862  -4.196  1.00 0.00 ? 59 ARG A HD3  10 
ATOM 10810 H HE   . ARG A 1 59 ? 13.609  -0.601  -2.458  1.00 0.00 ? 59 ARG A HE   10 
ATOM 10811 H HH11 . ARG A 1 59 ? 12.211  -0.758  -5.642  1.00 0.00 ? 59 ARG A HH11 10 
ATOM 10812 H HH12 . ARG A 1 59 ? 13.579  -0.035  -6.421  1.00 0.00 ? 59 ARG A HH12 10 
ATOM 10813 H HH21 . ARG A 1 59 ? 15.416  0.353   -3.471  1.00 0.00 ? 59 ARG A HH21 10 
ATOM 10814 H HH22 . ARG A 1 59 ? 15.402  0.596   -5.185  1.00 0.00 ? 59 ARG A HH22 10 
ATOM 10815 N N    . GLN A 1 60 ? 10.650  3.543   -5.793  1.00 0.00 ? 60 GLN A N    10 
ATOM 10816 C CA   . GLN A 1 60 ? 11.191  4.719   -6.464  1.00 0.00 ? 60 GLN A CA   10 
ATOM 10817 C C    . GLN A 1 60 ? 10.313  5.941   -6.214  1.00 0.00 ? 60 GLN A C    10 
ATOM 10818 O O    . GLN A 1 60 ? 10.806  7.066   -6.132  1.00 0.00 ? 60 GLN A O    10 
ATOM 10819 C CB   . GLN A 1 60 ? 11.312  4.463   -7.968  1.00 0.00 ? 60 GLN A CB   10 
ATOM 10820 C CG   . GLN A 1 60 ? 9.997   4.604   -8.717  1.00 0.00 ? 60 GLN A CG   10 
ATOM 10821 C CD   . GLN A 1 60 ? 10.191  4.760   -10.212 1.00 0.00 ? 60 GLN A CD   10 
ATOM 10822 O OE1  . GLN A 1 60 ? 10.900  3.976   -10.843 1.00 0.00 ? 60 GLN A OE1  10 
ATOM 10823 N NE2  . GLN A 1 60 ? 9.560   5.777   -10.788 1.00 0.00 ? 60 GLN A NE2  10 
ATOM 10824 H H    . GLN A 1 60 ? 10.269  2.819   -6.331  1.00 0.00 ? 60 GLN A H    10 
ATOM 10825 H HA   . GLN A 1 60 ? 12.174  4.909   -6.060  1.00 0.00 ? 60 GLN A HA   10 
ATOM 10826 H HB2  . GLN A 1 60 ? 12.017  5.168   -8.385  1.00 0.00 ? 60 GLN A HB2  10 
ATOM 10827 H HB3  . GLN A 1 60 ? 11.684  3.461   -8.121  1.00 0.00 ? 60 GLN A HB3  10 
ATOM 10828 H HG2  . GLN A 1 60 ? 9.400   3.722   -8.538  1.00 0.00 ? 60 GLN A HG2  10 
ATOM 10829 H HG3  . GLN A 1 60 ? 9.476   5.472   -8.343  1.00 0.00 ? 60 GLN A HG3  10 
ATOM 10830 H HE21 . GLN A 1 60 ? 9.013   6.362   -10.222 1.00 0.00 ? 60 GLN A HE21 10 
ATOM 10831 H HE22 . GLN A 1 60 ? 9.668   5.902   -11.753 1.00 0.00 ? 60 GLN A HE22 10 
ATOM 10832 N N    . LYS A 1 61 ? 9.010   5.712   -6.093  1.00 0.00 ? 61 LYS A N    10 
ATOM 10833 C CA   . LYS A 1 61 ? 8.062   6.793   -5.850  1.00 0.00 ? 61 LYS A CA   10 
ATOM 10834 C C    . LYS A 1 61 ? 7.910   7.058   -4.356  1.00 0.00 ? 61 LYS A C    10 
ATOM 10835 O O    . LYS A 1 61 ? 7.554   8.162   -3.945  1.00 0.00 ? 61 LYS A O    10 
ATOM 10836 C CB   . LYS A 1 61 ? 6.701   6.451   -6.459  1.00 0.00 ? 61 LYS A CB   10 
ATOM 10837 C CG   . LYS A 1 61 ? 6.717   6.367   -7.976  1.00 0.00 ? 61 LYS A CG   10 
ATOM 10838 C CD   . LYS A 1 61 ? 5.380   5.894   -8.522  1.00 0.00 ? 61 LYS A CD   10 
ATOM 10839 C CE   . LYS A 1 61 ? 4.319   6.978   -8.415  1.00 0.00 ? 61 LYS A CE   10 
ATOM 10840 N NZ   . LYS A 1 61 ? 4.324   7.879   -9.601  1.00 0.00 ? 61 LYS A NZ   10 
ATOM 10841 H H    . LYS A 1 61 ? 8.677   4.792   -6.167  1.00 0.00 ? 61 LYS A H    10 
ATOM 10842 H HA   . LYS A 1 61 ? 8.446   7.683   -6.324  1.00 0.00 ? 61 LYS A HA   10 
ATOM 10843 H HB2  . LYS A 1 61 ? 6.374   5.498   -6.070  1.00 0.00 ? 61 LYS A HB2  10 
ATOM 10844 H HB3  . LYS A 1 61 ? 5.989   7.211   -6.170  1.00 0.00 ? 61 LYS A HB3  10 
ATOM 10845 H HG2  . LYS A 1 61 ? 6.932   7.345   -8.379  1.00 0.00 ? 61 LYS A HG2  10 
ATOM 10846 H HG3  . LYS A 1 61 ? 7.486   5.672   -8.281  1.00 0.00 ? 61 LYS A HG3  10 
ATOM 10847 H HD2  . LYS A 1 61 ? 5.500   5.626   -9.561  1.00 0.00 ? 61 LYS A HD2  10 
ATOM 10848 H HD3  . LYS A 1 61 ? 5.057   5.029   -7.960  1.00 0.00 ? 61 LYS A HD3  10 
ATOM 10849 H HE2  . LYS A 1 61 ? 3.350   6.509   -8.335  1.00 0.00 ? 61 LYS A HE2  10 
ATOM 10850 H HE3  . LYS A 1 61 ? 4.510   7.564   -7.528  1.00 0.00 ? 61 LYS A HE3  10 
ATOM 10851 H HZ1  . LYS A 1 61 ? 5.233   7.805   -10.101 1.00 0.00 ? 61 LYS A HZ1  10 
ATOM 10852 H HZ2  . LYS A 1 61 ? 4.185   8.865   -9.302  1.00 0.00 ? 61 LYS A HZ2  10 
ATOM 10853 H HZ3  . LYS A 1 61 ? 3.559   7.615   -10.254 1.00 0.00 ? 61 LYS A HZ3  10 
ATOM 10854 N N    . ALA A 1 62 ? 8.184   6.039   -3.548  1.00 0.00 ? 62 ALA A N    10 
ATOM 10855 C CA   . ALA A 1 62 ? 8.080   6.164   -2.099  1.00 0.00 ? 62 ALA A CA   10 
ATOM 10856 C C    . ALA A 1 62 ? 8.991   7.270   -1.577  1.00 0.00 ? 62 ALA A C    10 
ATOM 10857 O O    . ALA A 1 62 ? 8.613   8.029   -0.684  1.00 0.00 ? 62 ALA A O    10 
ATOM 10858 C CB   . ALA A 1 62 ? 8.418   4.840   -1.430  1.00 0.00 ? 62 ALA A CB   10 
ATOM 10859 H H    . ALA A 1 62 ? 8.463   5.184   -3.935  1.00 0.00 ? 62 ALA A H    10 
ATOM 10860 H HA   . ALA A 1 62 ? 7.056   6.411   -1.857  1.00 0.00 ? 62 ALA A HA   10 
ATOM 10861 H HB1  . ALA A 1 62 ? 7.525   4.237   -1.355  1.00 0.00 ? 62 ALA A HB1  10 
ATOM 10862 H HB2  . ALA A 1 62 ? 9.157   4.318   -2.019  1.00 0.00 ? 62 ALA A HB2  10 
ATOM 10863 H HB3  . ALA A 1 62 ? 8.811   5.027   -0.441  1.00 0.00 ? 62 ALA A HB3  10 
ATOM 10864 N N    . ARG A 1 63 ? 10.192  7.356   -2.139  1.00 0.00 ? 63 ARG A N    10 
ATOM 10865 C CA   . ARG A 1 63 ? 11.157  8.369   -1.729  1.00 0.00 ? 63 ARG A CA   10 
ATOM 10866 C C    . ARG A 1 63 ? 10.495  9.739   -1.621  1.00 0.00 ? 63 ARG A C    10 
ATOM 10867 O O    . ARG A 1 63 ? 10.072  10.317  -2.623  1.00 0.00 ? 63 ARG A O    10 
ATOM 10868 C CB   . ARG A 1 63 ? 12.320  8.429   -2.722  1.00 0.00 ? 63 ARG A CB   10 
ATOM 10869 C CG   . ARG A 1 63 ? 13.141  7.151   -2.776  1.00 0.00 ? 63 ARG A CG   10 
ATOM 10870 C CD   . ARG A 1 63 ? 14.363  7.311   -3.666  1.00 0.00 ? 63 ARG A CD   10 
ATOM 10871 N NE   . ARG A 1 63 ? 15.239  8.384   -3.204  1.00 0.00 ? 63 ARG A NE   10 
ATOM 10872 C CZ   . ARG A 1 63 ? 15.071  9.662   -3.528  1.00 0.00 ? 63 ARG A CZ   10 
ATOM 10873 N NH1  . ARG A 1 63 ? 14.065  10.023  -4.311  1.00 0.00 ? 63 ARG A NH1  10 
ATOM 10874 N NH2  . ARG A 1 63 ? 15.911  10.580  -3.068  1.00 0.00 ? 63 ARG A NH2  10 
ATOM 10875 H H    . ARG A 1 63 ? 10.436  6.723   -2.847  1.00 0.00 ? 63 ARG A H    10 
ATOM 10876 H HA   . ARG A 1 63 ? 11.539  8.090   -0.758  1.00 0.00 ? 63 ARG A HA   10 
ATOM 10877 H HB2  . ARG A 1 63 ? 11.925  8.619   -3.709  1.00 0.00 ? 63 ARG A HB2  10 
ATOM 10878 H HB3  . ARG A 1 63 ? 12.974  9.240   -2.442  1.00 0.00 ? 63 ARG A HB3  10 
ATOM 10879 H HG2  . ARG A 1 63 ? 13.467  6.901   -1.777  1.00 0.00 ? 63 ARG A HG2  10 
ATOM 10880 H HG3  . ARG A 1 63 ? 12.524  6.354   -3.165  1.00 0.00 ? 63 ARG A HG3  10 
ATOM 10881 H HD2  . ARG A 1 63 ? 14.916  6.384   -3.667  1.00 0.00 ? 63 ARG A HD2  10 
ATOM 10882 H HD3  . ARG A 1 63 ? 14.034  7.535   -4.670  1.00 0.00 ? 63 ARG A HD3  10 
ATOM 10883 H HE   . ARG A 1 63 ? 15.990  8.139   -2.624  1.00 0.00 ? 63 ARG A HE   10 
ATOM 10884 H HH11 . ARG A 1 63 ? 13.430  9.333   -4.659  1.00 0.00 ? 63 ARG A HH11 10 
ATOM 10885 H HH12 . ARG A 1 63 ? 13.940  10.986  -4.553  1.00 0.00 ? 63 ARG A HH12 10 
ATOM 10886 H HH21 . ARG A 1 63 ? 16.671  10.311  -2.477  1.00 0.00 ? 63 ARG A HH21 10 
ATOM 10887 H HH22 . ARG A 1 63 ? 15.784  11.541  -3.312  1.00 0.00 ? 63 ARG A HH22 10 
ATOM 10888 N N    . LYS A 1 64 ? 10.408  10.255  -0.400  1.00 0.00 ? 64 LYS A N    10 
ATOM 10889 C CA   . LYS A 1 64 ? 9.799   11.557  -0.160  1.00 0.00 ? 64 LYS A CA   10 
ATOM 10890 C C    . LYS A 1 64 ? 10.653  12.675  -0.750  1.00 0.00 ? 64 LYS A C    10 
ATOM 10891 O O    . LYS A 1 64 ? 11.540  13.208  -0.084  1.00 0.00 ? 64 LYS A O    10 
ATOM 10892 C CB   . LYS A 1 64 ? 9.607   11.785  1.341   1.00 0.00 ? 64 LYS A CB   10 
ATOM 10893 C CG   . LYS A 1 64 ? 8.442   11.009  1.931   1.00 0.00 ? 64 LYS A CG   10 
ATOM 10894 C CD   . LYS A 1 64 ? 8.082   11.513  3.318   1.00 0.00 ? 64 LYS A CD   10 
ATOM 10895 C CE   . LYS A 1 64 ? 9.026   10.961  4.375   1.00 0.00 ? 64 LYS A CE   10 
ATOM 10896 N NZ   . LYS A 1 64 ? 8.741   11.527  5.723   1.00 0.00 ? 64 LYS A NZ   10 
ATOM 10897 H H    . LYS A 1 64 ? 10.764  9.746   0.360   1.00 0.00 ? 64 LYS A H    10 
ATOM 10898 H HA   . LYS A 1 64 ? 8.833   11.565  -0.642  1.00 0.00 ? 64 LYS A HA   10 
ATOM 10899 H HB2  . LYS A 1 64 ? 10.509  11.487  1.856   1.00 0.00 ? 64 LYS A HB2  10 
ATOM 10900 H HB3  . LYS A 1 64 ? 9.436   12.838  1.514   1.00 0.00 ? 64 LYS A HB3  10 
ATOM 10901 H HG2  . LYS A 1 64 ? 7.584   11.120  1.285   1.00 0.00 ? 64 LYS A HG2  10 
ATOM 10902 H HG3  . LYS A 1 64 ? 8.714   9.965   1.997   1.00 0.00 ? 64 LYS A HG3  10 
ATOM 10903 H HD2  . LYS A 1 64 ? 8.141   12.592  3.327   1.00 0.00 ? 64 LYS A HD2  10 
ATOM 10904 H HD3  . LYS A 1 64 ? 7.073   11.205  3.553   1.00 0.00 ? 64 LYS A HD3  10 
ATOM 10905 H HE2  . LYS A 1 64 ? 8.915   9.889   4.413   1.00 0.00 ? 64 LYS A HE2  10 
ATOM 10906 H HE3  . LYS A 1 64 ? 10.040  11.208  4.097   1.00 0.00 ? 64 LYS A HE3  10 
ATOM 10907 H HZ1  . LYS A 1 64 ? 7.886   12.118  5.689   1.00 0.00 ? 64 LYS A HZ1  10 
ATOM 10908 H HZ2  . LYS A 1 64 ? 9.540   12.111  6.041   1.00 0.00 ? 64 LYS A HZ2  10 
ATOM 10909 H HZ3  . LYS A 1 64 ? 8.592   10.759  6.408   1.00 0.00 ? 64 LYS A HZ3  10 
ATOM 10910 N N    . SER A 1 65 ? 10.378  13.025  -2.002  1.00 0.00 ? 65 SER A N    10 
ATOM 10911 C CA   . SER A 1 65 ? 11.123  14.078  -2.682  1.00 0.00 ? 65 SER A CA   10 
ATOM 10912 C C    . SER A 1 65 ? 10.634  15.457  -2.248  1.00 0.00 ? 65 SER A C    10 
ATOM 10913 O O    . SER A 1 65 ? 9.540   15.884  -2.615  1.00 0.00 ? 65 SER A O    10 
ATOM 10914 C CB   . SER A 1 65 ? 10.987  13.931  -4.199  1.00 0.00 ? 65 SER A CB   10 
ATOM 10915 O OG   . SER A 1 65 ? 9.630   14.011  -4.599  1.00 0.00 ? 65 SER A OG   10 
ATOM 10916 H H    . SER A 1 65 ? 9.658   12.563  -2.481  1.00 0.00 ? 65 SER A H    10 
ATOM 10917 H HA   . SER A 1 65 ? 12.163  13.976  -2.411  1.00 0.00 ? 65 SER A HA   10 
ATOM 10918 H HB2  . SER A 1 65 ? 11.541  14.719  -4.686  1.00 0.00 ? 65 SER A HB2  10 
ATOM 10919 H HB3  . SER A 1 65 ? 11.383  12.972  -4.501  1.00 0.00 ? 65 SER A HB3  10 
ATOM 10920 H HG   . SER A 1 65 ? 9.473   14.855  -5.029  1.00 0.00 ? 65 SER A HG   10 
ATOM 10921 N N    . GLY A 1 66 ? 11.454  16.149  -1.463  1.00 0.00 ? 66 GLY A N    10 
ATOM 10922 C CA   . GLY A 1 66 ? 11.089  17.472  -0.991  1.00 0.00 ? 66 GLY A CA   10 
ATOM 10923 C C    . GLY A 1 66 ? 10.077  17.426  0.136   1.00 0.00 ? 66 GLY A C    10 
ATOM 10924 O O    . GLY A 1 66 ? 9.719   16.359  0.635   1.00 0.00 ? 66 GLY A O    10 
ATOM 10925 H H    . GLY A 1 66 ? 12.315  15.758  -1.202  1.00 0.00 ? 66 GLY A H    10 
ATOM 10926 H HA2  . GLY A 1 66 ? 11.978  17.976  -0.642  1.00 0.00 ? 66 GLY A HA2  10 
ATOM 10927 H HA3  . GLY A 1 66 ? 10.669  18.032  -1.814  1.00 0.00 ? 66 GLY A HA3  10 
ATOM 10928 N N    . PRO A 1 67 ? 9.599   18.607  0.556   1.00 0.00 ? 67 PRO A N    10 
ATOM 10929 C CA   . PRO A 1 67 ? 8.616   18.724  1.637   1.00 0.00 ? 67 PRO A CA   10 
ATOM 10930 C C    . PRO A 1 67 ? 7.242   18.202  1.230   1.00 0.00 ? 67 PRO A C    10 
ATOM 10931 O O    . PRO A 1 67 ? 6.495   18.878  0.523   1.00 0.00 ? 67 PRO A O    10 
ATOM 10932 C CB   . PRO A 1 67 ? 8.558   20.231  1.902   1.00 0.00 ? 67 PRO A CB   10 
ATOM 10933 C CG   . PRO A 1 67 ? 8.978   20.858  0.618   1.00 0.00 ? 67 PRO A CG   10 
ATOM 10934 C CD   . PRO A 1 67 ? 9.981   19.919  0.007   1.00 0.00 ? 67 PRO A CD   10 
ATOM 10935 H HA   . PRO A 1 67 ? 8.945   18.212  2.529   1.00 0.00 ? 67 PRO A HA   10 
ATOM 10936 H HB2  . PRO A 1 67 ? 7.550   20.513  2.170   1.00 0.00 ? 67 PRO A HB2  10 
ATOM 10937 H HB3  . PRO A 1 67 ? 9.234   20.485  2.705   1.00 0.00 ? 67 PRO A HB3  10 
ATOM 10938 H HG2  . PRO A 1 67 ? 8.124   20.969  -0.033  1.00 0.00 ? 67 PRO A HG2  10 
ATOM 10939 H HG3  . PRO A 1 67 ? 9.433   21.818  0.810   1.00 0.00 ? 67 PRO A HG3  10 
ATOM 10940 H HD2  . PRO A 1 67 ? 9.897   19.926  -1.070  1.00 0.00 ? 67 PRO A HD2  10 
ATOM 10941 H HD3  . PRO A 1 67 ? 10.982  20.186  0.311   1.00 0.00 ? 67 PRO A HD3  10 
ATOM 10942 N N    . SER A 1 68 ? 6.915   16.996  1.682   1.00 0.00 ? 68 SER A N    10 
ATOM 10943 C CA   . SER A 1 68 ? 5.632   16.381  1.363   1.00 0.00 ? 68 SER A CA   10 
ATOM 10944 C C    . SER A 1 68 ? 5.369   15.175  2.258   1.00 0.00 ? 68 SER A C    10 
ATOM 10945 O O    . SER A 1 68 ? 6.138   14.213  2.265   1.00 0.00 ? 68 SER A O    10 
ATOM 10946 C CB   . SER A 1 68 ? 5.598   15.957  -0.107  1.00 0.00 ? 68 SER A CB   10 
ATOM 10947 O OG   . SER A 1 68 ? 4.274   15.975  -0.612  1.00 0.00 ? 68 SER A OG   10 
ATOM 10948 H H    . SER A 1 68 ? 7.554   16.506  2.242   1.00 0.00 ? 68 SER A H    10 
ATOM 10949 H HA   . SER A 1 68 ? 4.860   17.117  1.534   1.00 0.00 ? 68 SER A HA   10 
ATOM 10950 H HB2  . SER A 1 68 ? 6.201   16.637  -0.689  1.00 0.00 ? 68 SER A HB2  10 
ATOM 10951 H HB3  . SER A 1 68 ? 5.992   14.956  -0.199  1.00 0.00 ? 68 SER A HB3  10 
ATOM 10952 H HG   . SER A 1 68 ? 4.179   15.298  -1.287  1.00 0.00 ? 68 SER A HG   10 
ATOM 10953 N N    . SER A 1 69 ? 4.277   15.233  3.014   1.00 0.00 ? 69 SER A N    10 
ATOM 10954 C CA   . SER A 1 69 ? 3.913   14.147  3.917   1.00 0.00 ? 69 SER A CA   10 
ATOM 10955 C C    . SER A 1 69 ? 3.179   13.040  3.167   1.00 0.00 ? 69 SER A C    10 
ATOM 10956 O O    . SER A 1 69 ? 2.659   13.255  2.072   1.00 0.00 ? 69 SER A O    10 
ATOM 10957 C CB   . SER A 1 69 ? 3.038   14.675  5.056   1.00 0.00 ? 69 SER A CB   10 
ATOM 10958 O OG   . SER A 1 69 ? 3.758   15.579  5.875   1.00 0.00 ? 69 SER A OG   10 
ATOM 10959 H H    . SER A 1 69 ? 3.703   16.027  2.964   1.00 0.00 ? 69 SER A H    10 
ATOM 10960 H HA   . SER A 1 69 ? 4.824   13.742  4.332   1.00 0.00 ? 69 SER A HA   10 
ATOM 10961 H HB2  . SER A 1 69 ? 2.182   15.186  4.642   1.00 0.00 ? 69 SER A HB2  10 
ATOM 10962 H HB3  . SER A 1 69 ? 2.704   13.845  5.662   1.00 0.00 ? 69 SER A HB3  10 
ATOM 10963 H HG   . SER A 1 69 ? 3.665   15.322  6.795   1.00 0.00 ? 69 SER A HG   10 
ATOM 10964 N N    . GLY A 1 70 ? 3.140   11.853  3.765   1.00 0.00 ? 70 GLY A N    10 
ATOM 10965 C CA   . GLY A 1 70 ? 2.468   10.729  3.141   1.00 0.00 ? 70 GLY A CA   10 
ATOM 10966 C C    . GLY A 1 70 ? 3.264   10.144  1.991   1.00 0.00 ? 70 GLY A C    10 
ATOM 10967 O O    . GLY A 1 70 ? 3.173   10.619  0.859   1.00 0.00 ? 70 GLY A O    10 
ATOM 10968 H H    . GLY A 1 70 ? 3.572   11.740  4.638   1.00 0.00 ? 70 GLY A H    10 
ATOM 10969 H HA2  . GLY A 1 70 ? 2.310   9.961   3.883   1.00 0.00 ? 70 GLY A HA2  10 
ATOM 10970 H HA3  . GLY A 1 70 ? 1.510   11.059  2.769   1.00 0.00 ? 70 GLY A HA3  10 
ATOM 10971 N N    . GLY A 1 1  ? 18.816  -6.506  -18.957 1.00 0.00 ? 1  GLY A N    11 
ATOM 10972 C CA   . GLY A 1 1  ? 18.726  -5.162  -19.498 1.00 0.00 ? 1  GLY A CA   11 
ATOM 10973 C C    . GLY A 1 1  ? 17.441  -4.462  -19.101 1.00 0.00 ? 1  GLY A C    11 
ATOM 10974 O O    . GLY A 1 1  ? 16.666  -4.981  -18.298 1.00 0.00 ? 1  GLY A O    11 
ATOM 10975 H H1   . GLY A 1 1  ? 18.526  -7.270  -19.498 1.00 0.00 ? 1  GLY A H1   11 
ATOM 10976 H HA2  . GLY A 1 1  ? 19.564  -4.584  -19.139 1.00 0.00 ? 1  GLY A HA2  11 
ATOM 10977 H HA3  . GLY A 1 1  ? 18.774  -5.216  -20.576 1.00 0.00 ? 1  GLY A HA3  11 
ATOM 10978 N N    . SER A 1 2  ? 17.216  -3.279  -19.663 1.00 0.00 ? 2  SER A N    11 
ATOM 10979 C CA   . SER A 1 2  ? 16.019  -2.503  -19.359 1.00 0.00 ? 2  SER A CA   11 
ATOM 10980 C C    . SER A 1 2  ? 14.826  -3.007  -20.167 1.00 0.00 ? 2  SER A C    11 
ATOM 10981 O O    . SER A 1 2  ? 14.721  -2.750  -21.366 1.00 0.00 ? 2  SER A O    11 
ATOM 10982 C CB   . SER A 1 2  ? 16.258  -1.021  -19.651 1.00 0.00 ? 2  SER A CB   11 
ATOM 10983 O OG   . SER A 1 2  ? 16.911  -0.386  -18.566 1.00 0.00 ? 2  SER A OG   11 
ATOM 10984 H H    . SER A 1 2  ? 17.872  -2.918  -20.296 1.00 0.00 ? 2  SER A H    11 
ATOM 10985 H HA   . SER A 1 2  ? 15.804  -2.625  -18.308 1.00 0.00 ? 2  SER A HA   11 
ATOM 10986 H HB2  . SER A 1 2  ? 16.874  -0.925  -20.532 1.00 0.00 ? 2  SER A HB2  11 
ATOM 10987 H HB3  . SER A 1 2  ? 15.309  -0.533  -19.820 1.00 0.00 ? 2  SER A HB3  11 
ATOM 10988 H HG   . SER A 1 2  ? 17.862  -0.456  -18.680 1.00 0.00 ? 2  SER A HG   11 
ATOM 10989 N N    . SER A 1 3  ? 13.929  -3.725  -19.500 1.00 0.00 ? 3  SER A N    11 
ATOM 10990 C CA   . SER A 1 3  ? 12.745  -4.269  -20.155 1.00 0.00 ? 3  SER A CA   11 
ATOM 10991 C C    . SER A 1 3  ? 11.479  -3.884  -19.395 1.00 0.00 ? 3  SER A C    11 
ATOM 10992 O O    . SER A 1 3  ? 11.532  -3.518  -18.222 1.00 0.00 ? 3  SER A O    11 
ATOM 10993 C CB   . SER A 1 3  ? 12.847  -5.791  -20.259 1.00 0.00 ? 3  SER A CB   11 
ATOM 10994 O OG   . SER A 1 3  ? 13.854  -6.173  -21.181 1.00 0.00 ? 3  SER A OG   11 
ATOM 10995 H H    . SER A 1 3  ? 14.068  -3.896  -18.545 1.00 0.00 ? 3  SER A H    11 
ATOM 10996 H HA   . SER A 1 3  ? 12.695  -3.851  -21.149 1.00 0.00 ? 3  SER A HA   11 
ATOM 10997 H HB2  . SER A 1 3  ? 13.089  -6.201  -19.290 1.00 0.00 ? 3  SER A HB2  11 
ATOM 10998 H HB3  . SER A 1 3  ? 11.900  -6.191  -20.593 1.00 0.00 ? 3  SER A HB3  11 
ATOM 10999 H HG   . SER A 1 3  ? 13.445  -6.495  -21.987 1.00 0.00 ? 3  SER A HG   11 
ATOM 11000 N N    . GLY A 1 4  ? 10.339  -3.969  -20.075 1.00 0.00 ? 4  GLY A N    11 
ATOM 11001 C CA   . GLY A 1 4  ? 9.075   -3.627  -19.450 1.00 0.00 ? 4  GLY A CA   11 
ATOM 11002 C C    . GLY A 1 4  ? 7.897   -3.805  -20.387 1.00 0.00 ? 4  GLY A C    11 
ATOM 11003 O O    . GLY A 1 4  ? 6.898   -4.428  -20.028 1.00 0.00 ? 4  GLY A O    11 
ATOM 11004 H H    . GLY A 1 4  ? 10.357  -4.267  -21.009 1.00 0.00 ? 4  GLY A H    11 
ATOM 11005 H HA2  . GLY A 1 4  ? 8.932   -4.256  -18.584 1.00 0.00 ? 4  GLY A HA2  11 
ATOM 11006 H HA3  . GLY A 1 4  ? 9.112   -2.595  -19.130 1.00 0.00 ? 4  GLY A HA3  11 
ATOM 11007 N N    . SER A 1 5  ? 8.013   -3.255  -21.592 1.00 0.00 ? 5  SER A N    11 
ATOM 11008 C CA   . SER A 1 5  ? 6.947   -3.352  -22.582 1.00 0.00 ? 5  SER A CA   11 
ATOM 11009 C C    . SER A 1 5  ? 7.507   -3.739  -23.947 1.00 0.00 ? 5  SER A C    11 
ATOM 11010 O O    . SER A 1 5  ? 7.152   -4.777  -24.504 1.00 0.00 ? 5  SER A O    11 
ATOM 11011 C CB   . SER A 1 5  ? 6.195   -2.023  -22.684 1.00 0.00 ? 5  SER A CB   11 
ATOM 11012 O OG   . SER A 1 5  ? 5.189   -1.929  -21.691 1.00 0.00 ? 5  SER A OG   11 
ATOM 11013 H H    . SER A 1 5  ? 8.834   -2.770  -21.819 1.00 0.00 ? 5  SER A H    11 
ATOM 11014 H HA   . SER A 1 5  ? 6.261   -4.119  -22.257 1.00 0.00 ? 5  SER A HA   11 
ATOM 11015 H HB2  . SER A 1 5  ? 6.891   -1.208  -22.554 1.00 0.00 ? 5  SER A HB2  11 
ATOM 11016 H HB3  . SER A 1 5  ? 5.732   -1.949  -23.658 1.00 0.00 ? 5  SER A HB3  11 
ATOM 11017 H HG   . SER A 1 5  ? 5.530   -1.445  -20.935 1.00 0.00 ? 5  SER A HG   11 
ATOM 11018 N N    . SER A 1 6  ? 8.385   -2.895  -24.480 1.00 0.00 ? 6  SER A N    11 
ATOM 11019 C CA   . SER A 1 6  ? 8.993   -3.146  -25.782 1.00 0.00 ? 6  SER A CA   11 
ATOM 11020 C C    . SER A 1 6  ? 7.974   -3.736  -26.752 1.00 0.00 ? 6  SER A C    11 
ATOM 11021 O O    . SER A 1 6  ? 8.279   -4.662  -27.502 1.00 0.00 ? 6  SER A O    11 
ATOM 11022 C CB   . SER A 1 6  ? 10.185  -4.093  -25.638 1.00 0.00 ? 6  SER A CB   11 
ATOM 11023 O OG   . SER A 1 6  ? 11.168  -3.548  -24.774 1.00 0.00 ? 6  SER A OG   11 
ATOM 11024 H H    . SER A 1 6  ? 8.628   -2.083  -23.987 1.00 0.00 ? 6  SER A H    11 
ATOM 11025 H HA   . SER A 1 6  ? 9.339   -2.201  -26.174 1.00 0.00 ? 6  SER A HA   11 
ATOM 11026 H HB2  . SER A 1 6  ? 9.848   -5.034  -25.232 1.00 0.00 ? 6  SER A HB2  11 
ATOM 11027 H HB3  . SER A 1 6  ? 10.629  -4.258  -26.609 1.00 0.00 ? 6  SER A HB3  11 
ATOM 11028 H HG   . SER A 1 6  ? 10.748  -2.960  -24.142 1.00 0.00 ? 6  SER A HG   11 
ATOM 11029 N N    . GLY A 1 7  ? 6.761   -3.192  -26.731 1.00 0.00 ? 7  GLY A N    11 
ATOM 11030 C CA   . GLY A 1 7  ? 5.715   -3.677  -27.612 1.00 0.00 ? 7  GLY A CA   11 
ATOM 11031 C C    . GLY A 1 7  ? 4.331   -3.516  -27.013 1.00 0.00 ? 7  GLY A C    11 
ATOM 11032 O O    . GLY A 1 7  ? 3.870   -2.396  -26.793 1.00 0.00 ? 7  GLY A O    11 
ATOM 11033 H H    . GLY A 1 7  ? 6.575   -2.456  -26.111 1.00 0.00 ? 7  GLY A H    11 
ATOM 11034 H HA2  . GLY A 1 7  ? 5.759   -3.129  -28.541 1.00 0.00 ? 7  GLY A HA2  11 
ATOM 11035 H HA3  . GLY A 1 7  ? 5.887   -4.724  -27.814 1.00 0.00 ? 7  GLY A HA3  11 
ATOM 11036 N N    . ARG A 1 8  ? 3.668   -4.637  -26.751 1.00 0.00 ? 8  ARG A N    11 
ATOM 11037 C CA   . ARG A 1 8  ? 2.328   -4.616  -26.177 1.00 0.00 ? 8  ARG A CA   11 
ATOM 11038 C C    . ARG A 1 8  ? 2.339   -3.971  -24.794 1.00 0.00 ? 8  ARG A C    11 
ATOM 11039 O O    . ARG A 1 8  ? 3.298   -4.120  -24.037 1.00 0.00 ? 8  ARG A O    11 
ATOM 11040 C CB   . ARG A 1 8  ? 1.766   -6.036  -26.085 1.00 0.00 ? 8  ARG A CB   11 
ATOM 11041 C CG   . ARG A 1 8  ? 1.140   -6.528  -27.380 1.00 0.00 ? 8  ARG A CG   11 
ATOM 11042 C CD   . ARG A 1 8  ? -0.337  -6.172  -27.455 1.00 0.00 ? 8  ARG A CD   11 
ATOM 11043 N NE   . ARG A 1 8  ? -0.808  -6.084  -28.834 1.00 0.00 ? 8  ARG A NE   11 
ATOM 11044 C CZ   . ARG A 1 8  ? -0.686  -4.994  -29.585 1.00 0.00 ? 8  ARG A CZ   11 
ATOM 11045 N NH1  . ARG A 1 8  ? -0.109  -3.907  -29.091 1.00 0.00 ? 8  ARG A NH1  11 
ATOM 11046 N NH2  . ARG A 1 8  ? -1.140  -4.991  -30.831 1.00 0.00 ? 8  ARG A NH2  11 
ATOM 11047 H H    . ARG A 1 8  ? 4.089   -5.500  -26.949 1.00 0.00 ? 8  ARG A H    11 
ATOM 11048 H HA   . ARG A 1 8  ? 1.697   -4.030  -26.829 1.00 0.00 ? 8  ARG A HA   11 
ATOM 11049 H HB2  . ARG A 1 8  ? 2.566   -6.710  -25.819 1.00 0.00 ? 8  ARG A HB2  11 
ATOM 11050 H HB3  . ARG A 1 8  ? 1.012   -6.062  -25.313 1.00 0.00 ? 8  ARG A HB3  11 
ATOM 11051 H HG2  . ARG A 1 8  ? 1.652   -6.070  -28.213 1.00 0.00 ? 8  ARG A HG2  11 
ATOM 11052 H HG3  . ARG A 1 8  ? 1.247   -7.601  -27.435 1.00 0.00 ? 8  ARG A HG3  11 
ATOM 11053 H HD2  . ARG A 1 8  ? -0.903  -6.933  -26.939 1.00 0.00 ? 8  ARG A HD2  11 
ATOM 11054 H HD3  . ARG A 1 8  ? -0.489  -5.220  -26.970 1.00 0.00 ? 8  ARG A HD3  11 
ATOM 11055 H HE   . ARG A 1 8  ? -1.238  -6.876  -29.219 1.00 0.00 ? 8  ARG A HE   11 
ATOM 11056 H HH11 . ARG A 1 8  ? 0.236   -3.907  -28.153 1.00 0.00 ? 8  ARG A HH11 11 
ATOM 11057 H HH12 . ARG A 1 8  ? -0.016  -3.089  -29.659 1.00 0.00 ? 8  ARG A HH12 11 
ATOM 11058 H HH21 . ARG A 1 8  ? -1.576  -5.809  -31.207 1.00 0.00 ? 8  ARG A HH21 11 
ATOM 11059 H HH22 . ARG A 1 8  ? -1.048  -4.171  -31.395 1.00 0.00 ? 8  ARG A HH22 11 
ATOM 11060 N N    . SER A 1 9  ? 1.267   -3.255  -24.472 1.00 0.00 ? 9  SER A N    11 
ATOM 11061 C CA   . SER A 1 9  ? 1.155   -2.584  -23.182 1.00 0.00 ? 9  SER A CA   11 
ATOM 11062 C C    . SER A 1 9  ? 0.583   -3.526  -22.127 1.00 0.00 ? 9  SER A C    11 
ATOM 11063 O O    . SER A 1 9  ? 1.165   -3.705  -21.057 1.00 0.00 ? 9  SER A O    11 
ATOM 11064 C CB   . SER A 1 9  ? 0.272   -1.341  -23.304 1.00 0.00 ? 9  SER A CB   11 
ATOM 11065 O OG   . SER A 1 9  ? 0.720   -0.499  -24.352 1.00 0.00 ? 9  SER A OG   11 
ATOM 11066 H H    . SER A 1 9  ? 0.535   -3.174  -25.118 1.00 0.00 ? 9  SER A H    11 
ATOM 11067 H HA   . SER A 1 9  ? 2.147   -2.282  -22.878 1.00 0.00 ? 9  SER A HA   11 
ATOM 11068 H HB2  . SER A 1 9  ? -0.743  -1.643  -23.510 1.00 0.00 ? 9  SER A HB2  11 
ATOM 11069 H HB3  . SER A 1 9  ? 0.303   -0.788  -22.376 1.00 0.00 ? 9  SER A HB3  11 
ATOM 11070 H HG   . SER A 1 9  ? 0.209   0.314   -24.351 1.00 0.00 ? 9  SER A HG   11 
ATOM 11071 N N    . SER A 1 10 ? -0.561  -4.127  -22.438 1.00 0.00 ? 10 SER A N    11 
ATOM 11072 C CA   . SER A 1 10 ? -1.215  -5.049  -21.516 1.00 0.00 ? 10 SER A CA   11 
ATOM 11073 C C    . SER A 1 10 ? -1.108  -4.548  -20.079 1.00 0.00 ? 10 SER A C    11 
ATOM 11074 O O    . SER A 1 10 ? -0.844  -5.322  -19.159 1.00 0.00 ? 10 SER A O    11 
ATOM 11075 C CB   . SER A 1 10 ? -0.596  -6.443  -21.630 1.00 0.00 ? 10 SER A CB   11 
ATOM 11076 O OG   . SER A 1 10 ? -0.905  -7.037  -22.879 1.00 0.00 ? 10 SER A OG   11 
ATOM 11077 H H    . SER A 1 10 ? -0.976  -3.944  -23.307 1.00 0.00 ? 10 SER A H    11 
ATOM 11078 H HA   . SER A 1 10 ? -2.259  -5.104  -21.789 1.00 0.00 ? 10 SER A HA   11 
ATOM 11079 H HB2  . SER A 1 10 ? 0.476   -6.366  -21.537 1.00 0.00 ? 10 SER A HB2  11 
ATOM 11080 H HB3  . SER A 1 10 ? -0.982  -7.071  -20.840 1.00 0.00 ? 10 SER A HB3  11 
ATOM 11081 H HG   . SER A 1 10 ? -0.899  -7.993  -22.789 1.00 0.00 ? 10 SER A HG   11 
ATOM 11082 N N    . ARG A 1 11 ? -1.314  -3.248  -19.895 1.00 0.00 ? 11 ARG A N    11 
ATOM 11083 C CA   . ARG A 1 11 ? -1.239  -2.642  -18.571 1.00 0.00 ? 11 ARG A CA   11 
ATOM 11084 C C    . ARG A 1 11 ? -2.190  -3.337  -17.601 1.00 0.00 ? 11 ARG A C    11 
ATOM 11085 O O    . ARG A 1 11 ? -3.312  -3.695  -17.962 1.00 0.00 ? 11 ARG A O    11 
ATOM 11086 C CB   . ARG A 1 11 ? -1.573  -1.151  -18.650 1.00 0.00 ? 11 ARG A CB   11 
ATOM 11087 C CG   . ARG A 1 11 ? -0.413  -0.292  -19.125 1.00 0.00 ? 11 ARG A CG   11 
ATOM 11088 C CD   . ARG A 1 11 ? -0.888  1.073   -19.599 1.00 0.00 ? 11 ARG A CD   11 
ATOM 11089 N NE   . ARG A 1 11 ? 0.089   1.720   -20.471 1.00 0.00 ? 11 ARG A NE   11 
ATOM 11090 C CZ   . ARG A 1 11 ? -0.169  2.815   -21.177 1.00 0.00 ? 11 ARG A CZ   11 
ATOM 11091 N NH1  . ARG A 1 11 ? -1.365  3.382   -21.115 1.00 0.00 ? 11 ARG A NH1  11 
ATOM 11092 N NH2  . ARG A 1 11 ? 0.773   3.346   -21.947 1.00 0.00 ? 11 ARG A NH2  11 
ATOM 11093 H H    . ARG A 1 11 ? -1.521  -2.682  -20.669 1.00 0.00 ? 11 ARG A H    11 
ATOM 11094 H HA   . ARG A 1 11 ? -0.228  -2.757  -18.211 1.00 0.00 ? 11 ARG A HA   11 
ATOM 11095 H HB2  . ARG A 1 11 ? -2.397  -1.014  -19.334 1.00 0.00 ? 11 ARG A HB2  11 
ATOM 11096 H HB3  . ARG A 1 11 ? -1.868  -0.809  -17.669 1.00 0.00 ? 11 ARG A HB3  11 
ATOM 11097 H HG2  . ARG A 1 11 ? 0.280   -0.154  -18.308 1.00 0.00 ? 11 ARG A HG2  11 
ATOM 11098 H HG3  . ARG A 1 11 ? 0.084   -0.794  -19.941 1.00 0.00 ? 11 ARG A HG3  11 
ATOM 11099 H HD2  . ARG A 1 11 ? -1.813  0.948   -20.142 1.00 0.00 ? 11 ARG A HD2  11 
ATOM 11100 H HD3  . ARG A 1 11 ? -1.059  1.699   -18.737 1.00 0.00 ? 11 ARG A HD3  11 
ATOM 11101 H HE   . ARG A 1 11 ? 0.980   1.318   -20.531 1.00 0.00 ? 11 ARG A HE   11 
ATOM 11102 H HH11 . ARG A 1 11 ? -2.076  2.985   -20.535 1.00 0.00 ? 11 ARG A HH11 11 
ATOM 11103 H HH12 . ARG A 1 11 ? -1.556  4.208   -21.647 1.00 0.00 ? 11 ARG A HH12 11 
ATOM 11104 H HH21 . ARG A 1 11 ? 1.676   2.921   -21.996 1.00 0.00 ? 11 ARG A HH21 11 
ATOM 11105 H HH22 . ARG A 1 11 ? 0.578   4.170   -22.478 1.00 0.00 ? 11 ARG A HH22 11 
ATOM 11106 N N    . THR A 1 12 ? -1.734  -3.526  -16.367 1.00 0.00 ? 12 THR A N    11 
ATOM 11107 C CA   . THR A 1 12 ? -2.542  -4.179  -15.345 1.00 0.00 ? 12 THR A CA   11 
ATOM 11108 C C    . THR A 1 12 ? -3.162  -3.158  -14.398 1.00 0.00 ? 12 THR A C    11 
ATOM 11109 O O    . THR A 1 12 ? -2.511  -2.193  -13.997 1.00 0.00 ? 12 THR A O    11 
ATOM 11110 C CB   . THR A 1 12 ? -1.709  -5.182  -14.525 1.00 0.00 ? 12 THR A CB   11 
ATOM 11111 O OG1  . THR A 1 12 ? -1.065  -6.115  -15.400 1.00 0.00 ? 12 THR A OG1  11 
ATOM 11112 C CG2  . THR A 1 12 ? -2.585  -5.931  -13.533 1.00 0.00 ? 12 THR A CG2  11 
ATOM 11113 H H    . THR A 1 12 ? -0.831  -3.219  -16.139 1.00 0.00 ? 12 THR A H    11 
ATOM 11114 H HA   . THR A 1 12 ? -3.333  -4.722  -15.842 1.00 0.00 ? 12 THR A HA   11 
ATOM 11115 H HB   . THR A 1 12 ? -0.955  -4.636  -13.976 1.00 0.00 ? 12 THR A HB   11 
ATOM 11116 H HG1  . THR A 1 12 ? -0.896  -5.695  -16.247 1.00 0.00 ? 12 THR A HG1  11 
ATOM 11117 H HG21 . THR A 1 12 ? -3.271  -5.240  -13.065 1.00 0.00 ? 12 THR A HG21 11 
ATOM 11118 H HG22 . THR A 1 12 ? -1.964  -6.389  -12.778 1.00 0.00 ? 12 THR A HG22 11 
ATOM 11119 H HG23 . THR A 1 12 ? -3.144  -6.695  -14.053 1.00 0.00 ? 12 THR A HG23 11 
ATOM 11120 N N    . ARG A 1 13 ? -4.425  -3.376  -14.044 1.00 0.00 ? 13 ARG A N    11 
ATOM 11121 C CA   . ARG A 1 13 ? -5.133  -2.473  -13.145 1.00 0.00 ? 13 ARG A CA   11 
ATOM 11122 C C    . ARG A 1 13 ? -5.585  -3.206  -11.885 1.00 0.00 ? 13 ARG A C    11 
ATOM 11123 O O    . ARG A 1 13 ? -6.154  -4.295  -11.957 1.00 0.00 ? 13 ARG A O    11 
ATOM 11124 C CB   . ARG A 1 13 ? -6.342  -1.859  -13.852 1.00 0.00 ? 13 ARG A CB   11 
ATOM 11125 C CG   . ARG A 1 13 ? -5.973  -0.967  -15.026 1.00 0.00 ? 13 ARG A CG   11 
ATOM 11126 C CD   . ARG A 1 13 ? -7.171  -0.705  -15.925 1.00 0.00 ? 13 ARG A CD   11 
ATOM 11127 N NE   . ARG A 1 13 ? -8.052  0.324   -15.378 1.00 0.00 ? 13 ARG A NE   11 
ATOM 11128 C CZ   . ARG A 1 13 ? -9.328  0.458   -15.722 1.00 0.00 ? 13 ARG A CZ   11 
ATOM 11129 N NH1  . ARG A 1 13 ? -9.869  -0.367  -16.607 1.00 0.00 ? 13 ARG A NH1  11 
ATOM 11130 N NH2  . ARG A 1 13 ? -10.065 1.419   -15.180 1.00 0.00 ? 13 ARG A NH2  11 
ATOM 11131 H H    . ARG A 1 13 ? -4.891  -4.162  -14.397 1.00 0.00 ? 13 ARG A H    11 
ATOM 11132 H HA   . ARG A 1 13 ? -4.452  -1.684  -12.863 1.00 0.00 ? 13 ARG A HA   11 
ATOM 11133 H HB2  . ARG A 1 13 ? -6.973  -2.655  -14.219 1.00 0.00 ? 13 ARG A HB2  11 
ATOM 11134 H HB3  . ARG A 1 13 ? -6.899  -1.269  -13.140 1.00 0.00 ? 13 ARG A HB3  11 
ATOM 11135 H HG2  . ARG A 1 13 ? -5.608  -0.023  -14.648 1.00 0.00 ? 13 ARG A HG2  11 
ATOM 11136 H HG3  . ARG A 1 13 ? -5.199  -1.449  -15.603 1.00 0.00 ? 13 ARG A HG3  11 
ATOM 11137 H HD2  . ARG A 1 13 ? -6.815  -0.383  -16.892 1.00 0.00 ? 13 ARG A HD2  11 
ATOM 11138 H HD3  . ARG A 1 13 ? -7.729  -1.622  -16.034 1.00 0.00 ? 13 ARG A HD3  11 
ATOM 11139 H HE   . ARG A 1 13 ? -7.672  0.945   -14.722 1.00 0.00 ? 13 ARG A HE   11 
ATOM 11140 H HH11 . ARG A 1 13 ? -9.317  -1.093  -17.016 1.00 0.00 ? 13 ARG A HH11 11 
ATOM 11141 H HH12 . ARG A 1 13 ? -10.831 -0.265  -16.863 1.00 0.00 ? 13 ARG A HH12 11 
ATOM 11142 H HH21 . ARG A 1 13 ? -9.660  2.043   -14.512 1.00 0.00 ? 13 ARG A HH21 11 
ATOM 11143 H HH22 . ARG A 1 13 ? -11.025 1.519   -15.439 1.00 0.00 ? 13 ARG A HH22 11 
ATOM 11144 N N    . PHE A 1 14 ? -5.326  -2.601  -10.730 1.00 0.00 ? 14 PHE A N    11 
ATOM 11145 C CA   . PHE A 1 14 ? -5.705  -3.196  -9.454  1.00 0.00 ? 14 PHE A CA   11 
ATOM 11146 C C    . PHE A 1 14 ? -6.850  -2.420  -8.810  1.00 0.00 ? 14 PHE A C    11 
ATOM 11147 O O    . PHE A 1 14 ? -7.030  -1.228  -9.066  1.00 0.00 ? 14 PHE A O    11 
ATOM 11148 C CB   . PHE A 1 14 ? -4.503  -3.231  -8.507  1.00 0.00 ? 14 PHE A CB   11 
ATOM 11149 C CG   . PHE A 1 14 ? -3.211  -3.578  -9.191  1.00 0.00 ? 14 PHE A CG   11 
ATOM 11150 C CD1  . PHE A 1 14 ? -2.513  -2.620  -9.908  1.00 0.00 ? 14 PHE A CD1  11 
ATOM 11151 C CD2  . PHE A 1 14 ? -2.696  -4.862  -9.117  1.00 0.00 ? 14 PHE A CD2  11 
ATOM 11152 C CE1  . PHE A 1 14 ? -1.324  -2.935  -10.538 1.00 0.00 ? 14 PHE A CE1  11 
ATOM 11153 C CE2  . PHE A 1 14 ? -1.507  -5.183  -9.745  1.00 0.00 ? 14 PHE A CE2  11 
ATOM 11154 C CZ   . PHE A 1 14 ? -0.821  -4.219  -10.457 1.00 0.00 ? 14 PHE A CZ   11 
ATOM 11155 H H    . PHE A 1 14 ? -4.869  -1.733  -10.737 1.00 0.00 ? 14 PHE A H    11 
ATOM 11156 H HA   . PHE A 1 14 ? -6.032  -4.206  -9.644  1.00 0.00 ? 14 PHE A HA   11 
ATOM 11157 H HB2  . PHE A 1 14 ? -4.385  -2.261  -8.049  1.00 0.00 ? 14 PHE A HB2  11 
ATOM 11158 H HB3  . PHE A 1 14 ? -4.681  -3.968  -7.738  1.00 0.00 ? 14 PHE A HB3  11 
ATOM 11159 H HD1  . PHE A 1 14 ? -2.906  -1.614  -9.972  1.00 0.00 ? 14 PHE A HD1  11 
ATOM 11160 H HD2  . PHE A 1 14 ? -3.232  -5.617  -8.561  1.00 0.00 ? 14 PHE A HD2  11 
ATOM 11161 H HE1  . PHE A 1 14 ? -0.790  -2.178  -11.094 1.00 0.00 ? 14 PHE A HE1  11 
ATOM 11162 H HE2  . PHE A 1 14 ? -1.116  -6.187  -9.680  1.00 0.00 ? 14 PHE A HE2  11 
ATOM 11163 H HZ   . PHE A 1 14 ? 0.108   -4.467  -10.948 1.00 0.00 ? 14 PHE A HZ   11 
ATOM 11164 N N    . THR A 1 15 ? -7.625  -3.104  -7.974  1.00 0.00 ? 15 THR A N    11 
ATOM 11165 C CA   . THR A 1 15 ? -8.754  -2.481  -7.295  1.00 0.00 ? 15 THR A CA   11 
ATOM 11166 C C    . THR A 1 15 ? -8.460  -2.278  -5.813  1.00 0.00 ? 15 THR A C    11 
ATOM 11167 O O    . THR A 1 15 ? -7.603  -2.953  -5.242  1.00 0.00 ? 15 THR A O    11 
ATOM 11168 C CB   . THR A 1 15 ? -10.033 -3.326  -7.442  1.00 0.00 ? 15 THR A CB   11 
ATOM 11169 O OG1  . THR A 1 15 ? -11.181 -2.541  -7.101  1.00 0.00 ? 15 THR A OG1  11 
ATOM 11170 C CG2  . THR A 1 15 ? -9.973  -4.559  -6.553  1.00 0.00 ? 15 THR A CG2  11 
ATOM 11171 H H    . THR A 1 15 ? -7.431  -4.051  -7.811  1.00 0.00 ? 15 THR A H    11 
ATOM 11172 H HA   . THR A 1 15 ? -8.929  -1.518  -7.753  1.00 0.00 ? 15 THR A HA   11 
ATOM 11173 H HB   . THR A 1 15 ? -10.118 -3.647  -8.471  1.00 0.00 ? 15 THR A HB   11 
ATOM 11174 H HG1  . THR A 1 15 ? -11.780 -2.508  -7.851  1.00 0.00 ? 15 THR A HG1  11 
ATOM 11175 H HG21 . THR A 1 15 ? -8.946  -4.763  -6.290  1.00 0.00 ? 15 THR A HG21 11 
ATOM 11176 H HG22 . THR A 1 15 ? -10.385 -5.405  -7.082  1.00 0.00 ? 15 THR A HG22 11 
ATOM 11177 H HG23 . THR A 1 15 ? -10.546 -4.382  -5.655  1.00 0.00 ? 15 THR A HG23 11 
ATOM 11178 N N    . ASP A 1 16 ? -9.177  -1.346  -5.195  1.00 0.00 ? 16 ASP A N    11 
ATOM 11179 C CA   . ASP A 1 16 ? -8.995  -1.056  -3.778  1.00 0.00 ? 16 ASP A CA   11 
ATOM 11180 C C    . ASP A 1 16 ? -8.630  -2.321  -3.006  1.00 0.00 ? 16 ASP A C    11 
ATOM 11181 O O    . ASP A 1 16 ? -7.702  -2.320  -2.197  1.00 0.00 ? 16 ASP A O    11 
ATOM 11182 C CB   . ASP A 1 16 ? -10.266 -0.437  -3.194  1.00 0.00 ? 16 ASP A CB   11 
ATOM 11183 C CG   . ASP A 1 16 ? -10.566 0.929   -3.780  1.00 0.00 ? 16 ASP A CG   11 
ATOM 11184 O OD1  . ASP A 1 16 ? -9.835  1.888   -3.455  1.00 0.00 ? 16 ASP A OD1  11 
ATOM 11185 O OD2  . ASP A 1 16 ? -11.531 1.039   -4.565  1.00 0.00 ? 16 ASP A OD2  11 
ATOM 11186 H H    . ASP A 1 16 ? -9.846  -0.842  -5.704  1.00 0.00 ? 16 ASP A H    11 
ATOM 11187 H HA   . ASP A 1 16 ? -8.186  -0.348  -3.686  1.00 0.00 ? 16 ASP A HA   11 
ATOM 11188 H HB2  . ASP A 1 16 ? -11.103 -1.088  -3.400  1.00 0.00 ? 16 ASP A HB2  11 
ATOM 11189 H HB3  . ASP A 1 16 ? -10.150 -0.333  -2.126  1.00 0.00 ? 16 ASP A HB3  11 
ATOM 11190 N N    . TYR A 1 17 ? -9.367  -3.396  -3.262  1.00 0.00 ? 17 TYR A N    11 
ATOM 11191 C CA   . TYR A 1 17 ? -9.123  -4.667  -2.589  1.00 0.00 ? 17 TYR A CA   11 
ATOM 11192 C C    . TYR A 1 17 ? -7.681  -5.121  -2.788  1.00 0.00 ? 17 TYR A C    11 
ATOM 11193 O O    . TYR A 1 17 ? -6.991  -5.468  -1.830  1.00 0.00 ? 17 TYR A O    11 
ATOM 11194 C CB   . TYR A 1 17 ? -10.083 -5.737  -3.112  1.00 0.00 ? 17 TYR A CB   11 
ATOM 11195 C CG   . TYR A 1 17 ? -9.658  -7.148  -2.775  1.00 0.00 ? 17 TYR A CG   11 
ATOM 11196 C CD1  . TYR A 1 17 ? -9.197  -7.471  -1.505  1.00 0.00 ? 17 TYR A CD1  11 
ATOM 11197 C CD2  . TYR A 1 17 ? -9.717  -8.158  -3.727  1.00 0.00 ? 17 TYR A CD2  11 
ATOM 11198 C CE1  . TYR A 1 17 ? -8.807  -8.759  -1.192  1.00 0.00 ? 17 TYR A CE1  11 
ATOM 11199 C CE2  . TYR A 1 17 ? -9.330  -9.449  -3.423  1.00 0.00 ? 17 TYR A CE2  11 
ATOM 11200 C CZ   . TYR A 1 17 ? -8.876  -9.745  -2.155  1.00 0.00 ? 17 TYR A CZ   11 
ATOM 11201 O OH   . TYR A 1 17 ? -8.489  -11.029 -1.849  1.00 0.00 ? 17 TYR A OH   11 
ATOM 11202 H H    . TYR A 1 17 ? -10.093 -3.334  -3.917  1.00 0.00 ? 17 TYR A H    11 
ATOM 11203 H HA   . TYR A 1 17 ? -9.301  -4.522  -1.534  1.00 0.00 ? 17 TYR A HA   11 
ATOM 11204 H HB2  . TYR A 1 17 ? -11.060 -5.574  -2.684  1.00 0.00 ? 17 TYR A HB2  11 
ATOM 11205 H HB3  . TYR A 1 17 ? -10.149 -5.657  -4.187  1.00 0.00 ? 17 TYR A HB3  11 
ATOM 11206 H HD1  . TYR A 1 17 ? -9.145  -6.697  -0.753  1.00 0.00 ? 17 TYR A HD1  11 
ATOM 11207 H HD2  . TYR A 1 17 ? -10.073 -7.923  -4.720  1.00 0.00 ? 17 TYR A HD2  11 
ATOM 11208 H HE1  . TYR A 1 17 ? -8.452  -8.991  -0.199  1.00 0.00 ? 17 TYR A HE1  11 
ATOM 11209 H HE2  . TYR A 1 17 ? -9.383  -10.221 -4.177  1.00 0.00 ? 17 TYR A HE2  11 
ATOM 11210 H HH   . TYR A 1 17 ? -9.147  -11.435 -1.280  1.00 0.00 ? 17 TYR A HH   11 
ATOM 11211 N N    . GLN A 1 18 ? -7.232  -5.114  -4.039  1.00 0.00 ? 18 GLN A N    11 
ATOM 11212 C CA   . GLN A 1 18 ? -5.872  -5.525  -4.365  1.00 0.00 ? 18 GLN A CA   11 
ATOM 11213 C C    . GLN A 1 18 ? -4.861  -4.488  -3.887  1.00 0.00 ? 18 GLN A C    11 
ATOM 11214 O O    . GLN A 1 18 ? -3.900  -4.818  -3.191  1.00 0.00 ? 18 GLN A O    11 
ATOM 11215 C CB   . GLN A 1 18 ? -5.728  -5.738  -5.873  1.00 0.00 ? 18 GLN A CB   11 
ATOM 11216 C CG   . GLN A 1 18 ? -6.723  -6.735  -6.445  1.00 0.00 ? 18 GLN A CG   11 
ATOM 11217 C CD   . GLN A 1 18 ? -6.204  -7.429  -7.688  1.00 0.00 ? 18 GLN A CD   11 
ATOM 11218 O OE1  . GLN A 1 18 ? -5.670  -6.788  -8.594  1.00 0.00 ? 18 GLN A OE1  11 
ATOM 11219 N NE2  . GLN A 1 18 ? -6.357  -8.747  -7.739  1.00 0.00 ? 18 GLN A NE2  11 
ATOM 11220 H H    . GLN A 1 18 ? -7.830  -4.826  -4.760  1.00 0.00 ? 18 GLN A H    11 
ATOM 11221 H HA   . GLN A 1 18 ? -5.678  -6.459  -3.859  1.00 0.00 ? 18 GLN A HA   11 
ATOM 11222 H HB2  . GLN A 1 18 ? -5.872  -4.792  -6.373  1.00 0.00 ? 18 GLN A HB2  11 
ATOM 11223 H HB3  . GLN A 1 18 ? -4.731  -6.098  -6.080  1.00 0.00 ? 18 GLN A HB3  11 
ATOM 11224 H HG2  . GLN A 1 18 ? -6.933  -7.484  -5.695  1.00 0.00 ? 18 GLN A HG2  11 
ATOM 11225 H HG3  . GLN A 1 18 ? -7.634  -6.212  -6.695  1.00 0.00 ? 18 GLN A HG3  11 
ATOM 11226 H HE21 . GLN A 1 18 ? -6.793  -9.191  -6.981  1.00 0.00 ? 18 GLN A HE21 11 
ATOM 11227 H HE22 . GLN A 1 18 ? -6.032  -9.221  -8.531  1.00 0.00 ? 18 GLN A HE22 11 
ATOM 11228 N N    . LEU A 1 19 ? -5.083  -3.235  -4.265  1.00 0.00 ? 19 LEU A N    11 
ATOM 11229 C CA   . LEU A 1 19 ? -4.190  -2.148  -3.875  1.00 0.00 ? 19 LEU A CA   11 
ATOM 11230 C C    . LEU A 1 19 ? -4.018  -2.103  -2.360  1.00 0.00 ? 19 LEU A C    11 
ATOM 11231 O O    . LEU A 1 19 ? -2.969  -1.699  -1.857  1.00 0.00 ? 19 LEU A O    11 
ATOM 11232 C CB   . LEU A 1 19 ? -4.734  -0.810  -4.378  1.00 0.00 ? 19 LEU A CB   11 
ATOM 11233 C CG   . LEU A 1 19 ? -4.575  -0.541  -5.875  1.00 0.00 ? 19 LEU A CG   11 
ATOM 11234 C CD1  . LEU A 1 19 ? -5.204  0.792   -6.248  1.00 0.00 ? 19 LEU A CD1  11 
ATOM 11235 C CD2  . LEU A 1 19 ? -3.105  -0.568  -6.269  1.00 0.00 ? 19 LEU A CD2  11 
ATOM 11236 H H    . LEU A 1 19 ? -5.865  -3.033  -4.819  1.00 0.00 ? 19 LEU A H    11 
ATOM 11237 H HA   . LEU A 1 19 ? -3.228  -2.331  -4.330  1.00 0.00 ? 19 LEU A HA   11 
ATOM 11238 H HB2  . LEU A 1 19 ? -5.787  -0.772  -4.146  1.00 0.00 ? 19 LEU A HB2  11 
ATOM 11239 H HB3  . LEU A 1 19 ? -4.220  -0.023  -3.844  1.00 0.00 ? 19 LEU A HB3  11 
ATOM 11240 H HG   . LEU A 1 19 ? -5.085  -1.317  -6.430  1.00 0.00 ? 19 LEU A HG   11 
ATOM 11241 H HD11 . LEU A 1 19 ? -4.597  1.597   -5.863  1.00 0.00 ? 19 LEU A HD11 11 
ATOM 11242 H HD12 . LEU A 1 19 ? -6.195  0.854   -5.822  1.00 0.00 ? 19 LEU A HD12 11 
ATOM 11243 H HD13 . LEU A 1 19 ? -5.270  0.871   -7.323  1.00 0.00 ? 19 LEU A HD13 11 
ATOM 11244 H HD21 . LEU A 1 19 ? -2.951  -1.315  -7.033  1.00 0.00 ? 19 LEU A HD21 11 
ATOM 11245 H HD22 . LEU A 1 19 ? -2.505  -0.809  -5.403  1.00 0.00 ? 19 LEU A HD22 11 
ATOM 11246 H HD23 . LEU A 1 19 ? -2.817  0.401   -6.649  1.00 0.00 ? 19 LEU A HD23 11 
ATOM 11247 N N    . ARG A 1 20 ? -5.053  -2.521  -1.639  1.00 0.00 ? 20 ARG A N    11 
ATOM 11248 C CA   . ARG A 1 20 ? -5.015  -2.529  -0.182  1.00 0.00 ? 20 ARG A CA   11 
ATOM 11249 C C    . ARG A 1 20 ? -4.002  -3.549  0.330   1.00 0.00 ? 20 ARG A C    11 
ATOM 11250 O O    . ARG A 1 20 ? -3.220  -3.262  1.238   1.00 0.00 ? 20 ARG A O    11 
ATOM 11251 C CB   . ARG A 1 20 ? -6.401  -2.843  0.384   1.00 0.00 ? 20 ARG A CB   11 
ATOM 11252 C CG   . ARG A 1 20 ? -6.494  -2.682  1.892   1.00 0.00 ? 20 ARG A CG   11 
ATOM 11253 C CD   . ARG A 1 20 ? -6.236  -1.245  2.316   1.00 0.00 ? 20 ARG A CD   11 
ATOM 11254 N NE   . ARG A 1 20 ? -6.422  -1.055  3.752   1.00 0.00 ? 20 ARG A NE   11 
ATOM 11255 C CZ   . ARG A 1 20 ? -7.609  -0.872  4.321   1.00 0.00 ? 20 ARG A CZ   11 
ATOM 11256 N NH1  . ARG A 1 20 ? -8.708  -0.853  3.579   1.00 0.00 ? 20 ARG A NH1  11 
ATOM 11257 N NH2  . ARG A 1 20 ? -7.697  -0.707  5.635   1.00 0.00 ? 20 ARG A NH2  11 
ATOM 11258 H H    . ARG A 1 20 ? -5.861  -2.831  -2.098  1.00 0.00 ? 20 ARG A H    11 
ATOM 11259 H HA   . ARG A 1 20 ? -4.716  -1.545  0.148   1.00 0.00 ? 20 ARG A HA   11 
ATOM 11260 H HB2  . ARG A 1 20 ? -7.122  -2.180  -0.072  1.00 0.00 ? 20 ARG A HB2  11 
ATOM 11261 H HB3  . ARG A 1 20 ? -6.655  -3.863  0.136   1.00 0.00 ? 20 ARG A HB3  11 
ATOM 11262 H HG2  . ARG A 1 20 ? -7.484  -2.968  2.215   1.00 0.00 ? 20 ARG A HG2  11 
ATOM 11263 H HG3  . ARG A 1 20 ? -5.762  -3.324  2.359   1.00 0.00 ? 20 ARG A HG3  11 
ATOM 11264 H HD2  . ARG A 1 20 ? -5.220  -0.984  2.058   1.00 0.00 ? 20 ARG A HD2  11 
ATOM 11265 H HD3  . ARG A 1 20 ? -6.919  -0.599  1.785   1.00 0.00 ? 20 ARG A HD3  11 
ATOM 11266 H HE   . ARG A 1 20 ? -5.624  -1.066  4.319   1.00 0.00 ? 20 ARG A HE   11 
ATOM 11267 H HH11 . ARG A 1 20 ? -8.644  -0.979  2.590   1.00 0.00 ? 20 ARG A HH11 11 
ATOM 11268 H HH12 . ARG A 1 20 ? -9.600  -0.716  4.010   1.00 0.00 ? 20 ARG A HH12 11 
ATOM 11269 H HH21 . ARG A 1 20 ? -6.871  -0.720  6.197   1.00 0.00 ? 20 ARG A HH21 11 
ATOM 11270 H HH22 . ARG A 1 20 ? -8.590  -0.568  6.062   1.00 0.00 ? 20 ARG A HH22 11 
ATOM 11271 N N    . VAL A 1 21 ? -4.021  -4.741  -0.257  1.00 0.00 ? 21 VAL A N    11 
ATOM 11272 C CA   . VAL A 1 21 ? -3.104  -5.803  0.139   1.00 0.00 ? 21 VAL A CA   11 
ATOM 11273 C C    . VAL A 1 21 ? -1.688  -5.516  -0.347  1.00 0.00 ? 21 VAL A C    11 
ATOM 11274 O O    . VAL A 1 21 ? -0.717  -5.711  0.386   1.00 0.00 ? 21 VAL A O    11 
ATOM 11275 C CB   . VAL A 1 21 ? -3.557  -7.169  -0.411  1.00 0.00 ? 21 VAL A CB   11 
ATOM 11276 C CG1  . VAL A 1 21 ? -2.609  -8.268  0.043   1.00 0.00 ? 21 VAL A CG1  11 
ATOM 11277 C CG2  . VAL A 1 21 ? -4.983  -7.471  0.023   1.00 0.00 ? 21 VAL A CG2  11 
ATOM 11278 H H    . VAL A 1 21 ? -4.667  -4.910  -0.975  1.00 0.00 ? 21 VAL A H    11 
ATOM 11279 H HA   . VAL A 1 21 ? -3.100  -5.856  1.218   1.00 0.00 ? 21 VAL A HA   11 
ATOM 11280 H HB   . VAL A 1 21 ? -3.532  -7.126  -1.490  1.00 0.00 ? 21 VAL A HB   11 
ATOM 11281 H HG11 . VAL A 1 21 ? -2.946  -8.666  0.990   1.00 0.00 ? 21 VAL A HG11 11 
ATOM 11282 H HG12 . VAL A 1 21 ? -2.592  -9.058  -0.694  1.00 0.00 ? 21 VAL A HG12 11 
ATOM 11283 H HG13 . VAL A 1 21 ? -1.615  -7.861  0.158   1.00 0.00 ? 21 VAL A HG13 11 
ATOM 11284 H HG21 . VAL A 1 21 ? -5.255  -8.464  -0.303  1.00 0.00 ? 21 VAL A HG21 11 
ATOM 11285 H HG22 . VAL A 1 21 ? -5.052  -7.415  1.100   1.00 0.00 ? 21 VAL A HG22 11 
ATOM 11286 H HG23 . VAL A 1 21 ? -5.655  -6.750  -0.418  1.00 0.00 ? 21 VAL A HG23 11 
ATOM 11287 N N    . LEU A 1 22 ? -1.577  -5.053  -1.587  1.00 0.00 ? 22 LEU A N    11 
ATOM 11288 C CA   . LEU A 1 22 ? -0.278  -4.738  -2.172  1.00 0.00 ? 22 LEU A CA   11 
ATOM 11289 C C    . LEU A 1 22 ? 0.393   -3.590  -1.424  1.00 0.00 ? 22 LEU A C    11 
ATOM 11290 O O    . LEU A 1 22 ? 1.577   -3.658  -1.098  1.00 0.00 ? 22 LEU A O    11 
ATOM 11291 C CB   . LEU A 1 22 ? -0.437  -4.374  -3.650  1.00 0.00 ? 22 LEU A CB   11 
ATOM 11292 C CG   . LEU A 1 22 ? -0.890  -5.505  -4.574  1.00 0.00 ? 22 LEU A CG   11 
ATOM 11293 C CD1  . LEU A 1 22 ? -1.316  -4.952  -5.925  1.00 0.00 ? 22 LEU A CD1  11 
ATOM 11294 C CD2  . LEU A 1 22 ? 0.220   -6.533  -4.742  1.00 0.00 ? 22 LEU A CD2  11 
ATOM 11295 H H    . LEU A 1 22 ? -2.386  -4.918  -2.122  1.00 0.00 ? 22 LEU A H    11 
ATOM 11296 H HA   . LEU A 1 22 ? 0.344   -5.617  -2.091  1.00 0.00 ? 22 LEU A HA   11 
ATOM 11297 H HB2  . LEU A 1 22 ? -1.164  -3.580  -3.718  1.00 0.00 ? 22 LEU A HB2  11 
ATOM 11298 H HB3  . LEU A 1 22 ? 0.519   -4.017  -4.006  1.00 0.00 ? 22 LEU A HB3  11 
ATOM 11299 H HG   . LEU A 1 22 ? -1.743  -6.002  -4.133  1.00 0.00 ? 22 LEU A HG   11 
ATOM 11300 H HD11 . LEU A 1 22 ? -2.032  -4.158  -5.779  1.00 0.00 ? 22 LEU A HD11 11 
ATOM 11301 H HD12 . LEU A 1 22 ? -1.766  -5.740  -6.511  1.00 0.00 ? 22 LEU A HD12 11 
ATOM 11302 H HD13 . LEU A 1 22 ? -0.451  -4.567  -6.445  1.00 0.00 ? 22 LEU A HD13 11 
ATOM 11303 H HD21 . LEU A 1 22 ? 0.865   -6.235  -5.555  1.00 0.00 ? 22 LEU A HD21 11 
ATOM 11304 H HD22 . LEU A 1 22 ? -0.214  -7.498  -4.962  1.00 0.00 ? 22 LEU A HD22 11 
ATOM 11305 H HD23 . LEU A 1 22 ? 0.795   -6.595  -3.830  1.00 0.00 ? 22 LEU A HD23 11 
ATOM 11306 N N    . GLN A 1 23 ? -0.374  -2.539  -1.153  1.00 0.00 ? 23 GLN A N    11 
ATOM 11307 C CA   . GLN A 1 23 ? 0.146   -1.377  -0.442  1.00 0.00 ? 23 GLN A CA   11 
ATOM 11308 C C    . GLN A 1 23 ? 0.378   -1.700  1.031   1.00 0.00 ? 23 GLN A C    11 
ATOM 11309 O O    . GLN A 1 23 ? 1.325   -1.206  1.643   1.00 0.00 ? 23 GLN A O    11 
ATOM 11310 C CB   . GLN A 1 23 ? -0.820  -0.198  -0.572  1.00 0.00 ? 23 GLN A CB   11 
ATOM 11311 C CG   . GLN A 1 23 ? -0.155  1.156   -0.390  1.00 0.00 ? 23 GLN A CG   11 
ATOM 11312 C CD   . GLN A 1 23 ? 0.733   1.210   0.838   1.00 0.00 ? 23 GLN A CD   11 
ATOM 11313 O OE1  . GLN A 1 23 ? 0.288   0.935   1.952   1.00 0.00 ? 23 GLN A OE1  11 
ATOM 11314 N NE2  . GLN A 1 23 ? 1.997   1.566   0.639   1.00 0.00 ? 23 GLN A NE2  11 
ATOM 11315 H H    . GLN A 1 23 ? -1.311  -2.544  -1.439  1.00 0.00 ? 23 GLN A H    11 
ATOM 11316 H HA   . GLN A 1 23 ? 1.090   -1.109  -0.891  1.00 0.00 ? 23 GLN A HA   11 
ATOM 11317 H HB2  . GLN A 1 23 ? -1.272  -0.225  -1.552  1.00 0.00 ? 23 GLN A HB2  11 
ATOM 11318 H HB3  . GLN A 1 23 ? -1.594  -0.298  0.176   1.00 0.00 ? 23 GLN A HB3  11 
ATOM 11319 H HG2  . GLN A 1 23 ? 0.449   1.367   -1.261  1.00 0.00 ? 23 GLN A HG2  11 
ATOM 11320 H HG3  . GLN A 1 23 ? -0.922  1.910   -0.295  1.00 0.00 ? 23 GLN A HG3  11 
ATOM 11321 H HE21 . GLN A 1 23 ? 2.281   1.772   -0.276  1.00 0.00 ? 23 GLN A HE21 11 
ATOM 11322 H HE22 . GLN A 1 23 ? 2.593   1.610   1.415   1.00 0.00 ? 23 GLN A HE22 11 
ATOM 11323 N N    . ASP A 1 24 ? -0.493  -2.530  1.594   1.00 0.00 ? 24 ASP A N    11 
ATOM 11324 C CA   . ASP A 1 24 ? -0.383  -2.919  2.995   1.00 0.00 ? 24 ASP A CA   11 
ATOM 11325 C C    . ASP A 1 24 ? 0.898   -3.710  3.240   1.00 0.00 ? 24 ASP A C    11 
ATOM 11326 O O    . ASP A 1 24 ? 1.570   -3.525  4.255   1.00 0.00 ? 24 ASP A O    11 
ATOM 11327 C CB   . ASP A 1 24 ? -1.597  -3.750  3.412   1.00 0.00 ? 24 ASP A CB   11 
ATOM 11328 C CG   . ASP A 1 24 ? -1.505  -4.229  4.848   1.00 0.00 ? 24 ASP A CG   11 
ATOM 11329 O OD1  . ASP A 1 24 ? -1.559  -3.379  5.762   1.00 0.00 ? 24 ASP A OD1  11 
ATOM 11330 O OD2  . ASP A 1 24 ? -1.381  -5.453  5.058   1.00 0.00 ? 24 ASP A OD2  11 
ATOM 11331 H H    . ASP A 1 24 ? -1.228  -2.891  1.054   1.00 0.00 ? 24 ASP A H    11 
ATOM 11332 H HA   . ASP A 1 24 ? -0.354  -2.018  3.588   1.00 0.00 ? 24 ASP A HA   11 
ATOM 11333 H HB2  . ASP A 1 24 ? -2.489  -3.149  3.310   1.00 0.00 ? 24 ASP A HB2  11 
ATOM 11334 H HB3  . ASP A 1 24 ? -1.674  -4.613  2.768   1.00 0.00 ? 24 ASP A HB3  11 
ATOM 11335 N N    . PHE A 1 25 ? 1.231   -4.593  2.304   1.00 0.00 ? 25 PHE A N    11 
ATOM 11336 C CA   . PHE A 1 25 ? 2.431   -5.413  2.419   1.00 0.00 ? 25 PHE A CA   11 
ATOM 11337 C C    . PHE A 1 25 ? 3.685   -4.584  2.157   1.00 0.00 ? 25 PHE A C    11 
ATOM 11338 O O    . PHE A 1 25 ? 4.761   -4.883  2.675   1.00 0.00 ? 25 PHE A O    11 
ATOM 11339 C CB   . PHE A 1 25 ? 2.368   -6.587  1.439   1.00 0.00 ? 25 PHE A CB   11 
ATOM 11340 C CG   . PHE A 1 25 ? 3.394   -7.650  1.710   1.00 0.00 ? 25 PHE A CG   11 
ATOM 11341 C CD1  . PHE A 1 25 ? 4.740   -7.403  1.492   1.00 0.00 ? 25 PHE A CD1  11 
ATOM 11342 C CD2  . PHE A 1 25 ? 3.013   -8.895  2.181   1.00 0.00 ? 25 PHE A CD2  11 
ATOM 11343 C CE1  . PHE A 1 25 ? 5.687   -8.379  1.741   1.00 0.00 ? 25 PHE A CE1  11 
ATOM 11344 C CE2  . PHE A 1 25 ? 3.956   -9.875  2.432   1.00 0.00 ? 25 PHE A CE2  11 
ATOM 11345 C CZ   . PHE A 1 25 ? 5.294   -9.616  2.210   1.00 0.00 ? 25 PHE A CZ   11 
ATOM 11346 H H    . PHE A 1 25 ? 0.656   -4.695  1.517   1.00 0.00 ? 25 PHE A H    11 
ATOM 11347 H HA   . PHE A 1 25 ? 2.473   -5.798  3.426   1.00 0.00 ? 25 PHE A HA   11 
ATOM 11348 H HB2  . PHE A 1 25 ? 1.393   -7.045  1.500   1.00 0.00 ? 25 PHE A HB2  11 
ATOM 11349 H HB3  . PHE A 1 25 ? 2.526   -6.218  0.437   1.00 0.00 ? 25 PHE A HB3  11 
ATOM 11350 H HD1  . PHE A 1 25 ? 5.049   -6.434  1.125   1.00 0.00 ? 25 PHE A HD1  11 
ATOM 11351 H HD2  . PHE A 1 25 ? 1.967   -9.099  2.354   1.00 0.00 ? 25 PHE A HD2  11 
ATOM 11352 H HE1  . PHE A 1 25 ? 6.733   -8.173  1.566   1.00 0.00 ? 25 PHE A HE1  11 
ATOM 11353 H HE2  . PHE A 1 25 ? 3.646   -10.842 2.799   1.00 0.00 ? 25 PHE A HE2  11 
ATOM 11354 H HZ   . PHE A 1 25 ? 6.033   -10.380 2.406   1.00 0.00 ? 25 PHE A HZ   11 
ATOM 11355 N N    . PHE A 1 26 ? 3.538   -3.540  1.348   1.00 0.00 ? 26 PHE A N    11 
ATOM 11356 C CA   . PHE A 1 26 ? 4.657   -2.667  1.014   1.00 0.00 ? 26 PHE A CA   11 
ATOM 11357 C C    . PHE A 1 26 ? 5.026   -1.779  2.199   1.00 0.00 ? 26 PHE A C    11 
ATOM 11358 O O    . PHE A 1 26 ? 6.198   -1.657  2.556   1.00 0.00 ? 26 PHE A O    11 
ATOM 11359 C CB   . PHE A 1 26 ? 4.313   -1.802  -0.199  1.00 0.00 ? 26 PHE A CB   11 
ATOM 11360 C CG   . PHE A 1 26 ? 5.383   -0.808  -0.550  1.00 0.00 ? 26 PHE A CG   11 
ATOM 11361 C CD1  . PHE A 1 26 ? 5.513   0.372   0.166   1.00 0.00 ? 26 PHE A CD1  11 
ATOM 11362 C CD2  . PHE A 1 26 ? 6.260   -1.053  -1.594  1.00 0.00 ? 26 PHE A CD2  11 
ATOM 11363 C CE1  . PHE A 1 26 ? 6.496   1.289   -0.155  1.00 0.00 ? 26 PHE A CE1  11 
ATOM 11364 C CE2  . PHE A 1 26 ? 7.246   -0.140  -1.919  1.00 0.00 ? 26 PHE A CE2  11 
ATOM 11365 C CZ   . PHE A 1 26 ? 7.364   1.032   -1.198  1.00 0.00 ? 26 PHE A CZ   11 
ATOM 11366 H H    . PHE A 1 26 ? 2.655   -3.353  0.965   1.00 0.00 ? 26 PHE A H    11 
ATOM 11367 H HA   . PHE A 1 26 ? 5.503   -3.292  0.772   1.00 0.00 ? 26 PHE A HA   11 
ATOM 11368 H HB2  . PHE A 1 26 ? 4.161   -2.440  -1.057  1.00 0.00 ? 26 PHE A HB2  11 
ATOM 11369 H HB3  . PHE A 1 26 ? 3.404   -1.255  0.004   1.00 0.00 ? 26 PHE A HB3  11 
ATOM 11370 H HD1  . PHE A 1 26 ? 4.835   0.574   0.983   1.00 0.00 ? 26 PHE A HD1  11 
ATOM 11371 H HD2  . PHE A 1 26 ? 6.168   -1.970  -2.159  1.00 0.00 ? 26 PHE A HD2  11 
ATOM 11372 H HE1  . PHE A 1 26 ? 6.587   2.204   0.411   1.00 0.00 ? 26 PHE A HE1  11 
ATOM 11373 H HE2  . PHE A 1 26 ? 7.923   -0.344  -2.735  1.00 0.00 ? 26 PHE A HE2  11 
ATOM 11374 H HZ   . PHE A 1 26 ? 8.133   1.747   -1.451  1.00 0.00 ? 26 PHE A HZ   11 
ATOM 11375 N N    . ASP A 1 27 ? 4.018   -1.160  2.803   1.00 0.00 ? 27 ASP A N    11 
ATOM 11376 C CA   . ASP A 1 27 ? 4.234   -0.283  3.947   1.00 0.00 ? 27 ASP A CA   11 
ATOM 11377 C C    . ASP A 1 27 ? 5.029   -0.996  5.036   1.00 0.00 ? 27 ASP A C    11 
ATOM 11378 O O    . ASP A 1 27 ? 5.789   -0.371  5.774   1.00 0.00 ? 27 ASP A O    11 
ATOM 11379 C CB   . ASP A 1 27 ? 2.895   0.198   4.509   1.00 0.00 ? 27 ASP A CB   11 
ATOM 11380 C CG   . ASP A 1 27 ? 3.037   1.452   5.350   1.00 0.00 ? 27 ASP A CG   11 
ATOM 11381 O OD1  . ASP A 1 27 ? 3.114   2.553   4.765   1.00 0.00 ? 27 ASP A OD1  11 
ATOM 11382 O OD2  . ASP A 1 27 ? 3.070   1.331   6.592   1.00 0.00 ? 27 ASP A OD2  11 
ATOM 11383 H H    . ASP A 1 27 ? 3.105   -1.297  2.471   1.00 0.00 ? 27 ASP A H    11 
ATOM 11384 H HA   . ASP A 1 27 ? 4.799   0.572   3.608   1.00 0.00 ? 27 ASP A HA   11 
ATOM 11385 H HB2  . ASP A 1 27 ? 2.224   0.411   3.689   1.00 0.00 ? 27 ASP A HB2  11 
ATOM 11386 H HB3  . ASP A 1 27 ? 2.470   -0.581  5.124   1.00 0.00 ? 27 ASP A HB3  11 
ATOM 11387 N N    . ALA A 1 28 ? 4.848   -2.310  5.130   1.00 0.00 ? 28 ALA A N    11 
ATOM 11388 C CA   . ALA A 1 28 ? 5.549   -3.108  6.128   1.00 0.00 ? 28 ALA A CA   11 
ATOM 11389 C C    . ALA A 1 28 ? 6.833   -3.699  5.555   1.00 0.00 ? 28 ALA A C    11 
ATOM 11390 O O    . ALA A 1 28 ? 7.867   -3.723  6.221   1.00 0.00 ? 28 ALA A O    11 
ATOM 11391 C CB   . ALA A 1 28 ? 4.644   -4.214  6.650   1.00 0.00 ? 28 ALA A CB   11 
ATOM 11392 H H    . ALA A 1 28 ? 4.228   -2.752  4.513   1.00 0.00 ? 28 ALA A H    11 
ATOM 11393 H HA   . ALA A 1 28 ? 5.800   -2.462  6.956   1.00 0.00 ? 28 ALA A HA   11 
ATOM 11394 H HB1  . ALA A 1 28 ? 3.708   -3.787  6.981   1.00 0.00 ? 28 ALA A HB1  11 
ATOM 11395 H HB2  . ALA A 1 28 ? 4.454   -4.927  5.860   1.00 0.00 ? 28 ALA A HB2  11 
ATOM 11396 H HB3  . ALA A 1 28 ? 5.125   -4.713  7.477   1.00 0.00 ? 28 ALA A HB3  11 
ATOM 11397 N N    . ASN A 1 29 ? 6.758   -4.175  4.317   1.00 0.00 ? 29 ASN A N    11 
ATOM 11398 C CA   . ASN A 1 29 ? 7.915   -4.768  3.655   1.00 0.00 ? 29 ASN A CA   11 
ATOM 11399 C C    . ASN A 1 29 ? 7.853   -4.543  2.147   1.00 0.00 ? 29 ASN A C    11 
ATOM 11400 O O    . ASN A 1 29 ? 6.853   -4.859  1.503   1.00 0.00 ? 29 ASN A O    11 
ATOM 11401 C CB   . ASN A 1 29 ? 7.990   -6.266  3.956   1.00 0.00 ? 29 ASN A CB   11 
ATOM 11402 C CG   . ASN A 1 29 ? 9.304   -6.880  3.513   1.00 0.00 ? 29 ASN A CG   11 
ATOM 11403 O OD1  . ASN A 1 29 ? 10.373  -6.314  3.740   1.00 0.00 ? 29 ASN A OD1  11 
ATOM 11404 N ND2  . ASN A 1 29 ? 9.229   -8.043  2.878   1.00 0.00 ? 29 ASN A ND2  11 
ATOM 11405 H H    . ASN A 1 29 ? 5.905   -4.128  3.836   1.00 0.00 ? 29 ASN A H    11 
ATOM 11406 H HA   . ASN A 1 29 ? 8.800   -4.287  4.042   1.00 0.00 ? 29 ASN A HA   11 
ATOM 11407 H HB2  . ASN A 1 29 ? 7.884   -6.418  5.020   1.00 0.00 ? 29 ASN A HB2  11 
ATOM 11408 H HB3  . ASN A 1 29 ? 7.186   -6.771  3.442   1.00 0.00 ? 29 ASN A HB3  11 
ATOM 11409 H HD21 . ASN A 1 29 ? 8.342   -8.435  2.731   1.00 0.00 ? 29 ASN A HD21 11 
ATOM 11410 H HD22 . ASN A 1 29 ? 10.063  -8.463  2.581   1.00 0.00 ? 29 ASN A HD22 11 
ATOM 11411 N N    . ALA A 1 30 ? 8.929   -3.996  1.591   1.00 0.00 ? 30 ALA A N    11 
ATOM 11412 C CA   . ALA A 1 30 ? 8.998   -3.732  0.159   1.00 0.00 ? 30 ALA A CA   11 
ATOM 11413 C C    . ALA A 1 30 ? 10.165  -4.477  -0.481  1.00 0.00 ? 30 ALA A C    11 
ATOM 11414 O O    . ALA A 1 30 ? 10.514  -4.228  -1.635  1.00 0.00 ? 30 ALA A O    11 
ATOM 11415 C CB   . ALA A 1 30 ? 9.121   -2.237  -0.096  1.00 0.00 ? 30 ALA A CB   11 
ATOM 11416 H H    . ALA A 1 30 ? 9.695   -3.766  2.157   1.00 0.00 ? 30 ALA A H    11 
ATOM 11417 H HA   . ALA A 1 30 ? 8.076   -4.074  -0.289  1.00 0.00 ? 30 ALA A HA   11 
ATOM 11418 H HB1  . ALA A 1 30 ? 8.449   -1.953  -0.894  1.00 0.00 ? 30 ALA A HB1  11 
ATOM 11419 H HB2  . ALA A 1 30 ? 8.863   -1.696  0.802   1.00 0.00 ? 30 ALA A HB2  11 
ATOM 11420 H HB3  . ALA A 1 30 ? 10.136  -2.002  -0.380  1.00 0.00 ? 30 ALA A HB3  11 
ATOM 11421 N N    . TYR A 1 31 ? 10.763  -5.390  0.275   1.00 0.00 ? 31 TYR A N    11 
ATOM 11422 C CA   . TYR A 1 31 ? 11.893  -6.169  -0.218  1.00 0.00 ? 31 TYR A CA   11 
ATOM 11423 C C    . TYR A 1 31 ? 11.723  -7.648  0.119   1.00 0.00 ? 31 TYR A C    11 
ATOM 11424 O O    . TYR A 1 31 ? 12.665  -8.332  0.518   1.00 0.00 ? 31 TYR A O    11 
ATOM 11425 C CB   . TYR A 1 31 ? 13.200  -5.646  0.380   1.00 0.00 ? 31 TYR A CB   11 
ATOM 11426 C CG   . TYR A 1 31 ? 13.374  -4.151  0.239   1.00 0.00 ? 31 TYR A CG   11 
ATOM 11427 C CD1  . TYR A 1 31 ? 12.845  -3.277  1.180   1.00 0.00 ? 31 TYR A CD1  11 
ATOM 11428 C CD2  . TYR A 1 31 ? 14.070  -3.612  -0.837  1.00 0.00 ? 31 TYR A CD2  11 
ATOM 11429 C CE1  . TYR A 1 31 ? 13.002  -1.910  1.054   1.00 0.00 ? 31 TYR A CE1  11 
ATOM 11430 C CE2  . TYR A 1 31 ? 14.232  -2.246  -0.970  1.00 0.00 ? 31 TYR A CE2  11 
ATOM 11431 C CZ   . TYR A 1 31 ? 13.696  -1.400  -0.022  1.00 0.00 ? 31 TYR A CZ   11 
ATOM 11432 O OH   . TYR A 1 31 ? 13.855  -0.039  -0.151  1.00 0.00 ? 31 TYR A OH   11 
ATOM 11433 H H    . TYR A 1 31 ? 10.439  -5.543  1.187   1.00 0.00 ? 31 TYR A H    11 
ATOM 11434 H HA   . TYR A 1 31 ? 11.929  -6.058  -1.291  1.00 0.00 ? 31 TYR A HA   11 
ATOM 11435 H HB2  . TYR A 1 31 ? 13.228  -5.884  1.432   1.00 0.00 ? 31 TYR A HB2  11 
ATOM 11436 H HB3  . TYR A 1 31 ? 14.032  -6.126  -0.115  1.00 0.00 ? 31 TYR A HB3  11 
ATOM 11437 H HD1  . TYR A 1 31 ? 12.302  -3.681  2.023   1.00 0.00 ? 31 TYR A HD1  11 
ATOM 11438 H HD2  . TYR A 1 31 ? 14.489  -4.277  -1.578  1.00 0.00 ? 31 TYR A HD2  11 
ATOM 11439 H HE1  . TYR A 1 31 ? 12.582  -1.248  1.797   1.00 0.00 ? 31 TYR A HE1  11 
ATOM 11440 H HE2  . TYR A 1 31 ? 14.776  -1.846  -1.814  1.00 0.00 ? 31 TYR A HE2  11 
ATOM 11441 H HH   . TYR A 1 31 ? 13.767  0.376   0.710   1.00 0.00 ? 31 TYR A HH   11 
ATOM 11442 N N    . PRO A 1 32 ? 10.492  -8.154  -0.048  1.00 0.00 ? 32 PRO A N    11 
ATOM 11443 C CA   . PRO A 1 32 ? 10.168  -9.556  0.231   1.00 0.00 ? 32 PRO A CA   11 
ATOM 11444 C C    . PRO A 1 32 ? 10.802  -10.508 -0.777  1.00 0.00 ? 32 PRO A C    11 
ATOM 11445 O O    . PRO A 1 32 ? 11.205  -10.099 -1.866  1.00 0.00 ? 32 PRO A O    11 
ATOM 11446 C CB   . PRO A 1 32 ? 8.642   -9.596  0.118   1.00 0.00 ? 32 PRO A CB   11 
ATOM 11447 C CG   . PRO A 1 32 ? 8.299   -8.465  -0.788  1.00 0.00 ? 32 PRO A CG   11 
ATOM 11448 C CD   . PRO A 1 32 ? 9.321   -7.396  -0.521  1.00 0.00 ? 32 PRO A CD   11 
ATOM 11449 H HA   . PRO A 1 32 ? 10.465  -9.841  1.230   1.00 0.00 ? 32 PRO A HA   11 
ATOM 11450 H HB2  . PRO A 1 32 ? 8.334   -10.545 -0.299  1.00 0.00 ? 32 PRO A HB2  11 
ATOM 11451 H HB3  . PRO A 1 32 ? 8.202   -9.467  1.096   1.00 0.00 ? 32 PRO A HB3  11 
ATOM 11452 H HG2  . PRO A 1 32 ? 8.354   -8.788  -1.816  1.00 0.00 ? 32 PRO A HG2  11 
ATOM 11453 H HG3  . PRO A 1 32 ? 7.308   -8.100  -0.560  1.00 0.00 ? 32 PRO A HG3  11 
ATOM 11454 H HD2  . PRO A 1 32 ? 9.551   -6.858  -1.429  1.00 0.00 ? 32 PRO A HD2  11 
ATOM 11455 H HD3  . PRO A 1 32 ? 8.968   -6.717  0.242   1.00 0.00 ? 32 PRO A HD3  11 
ATOM 11456 N N    . LYS A 1 33 ? 10.887  -11.782 -0.408  1.00 0.00 ? 33 LYS A N    11 
ATOM 11457 C CA   . LYS A 1 33 ? 11.470  -12.795 -1.280  1.00 0.00 ? 33 LYS A CA   11 
ATOM 11458 C C    . LYS A 1 33 ? 10.385  -13.537 -2.054  1.00 0.00 ? 33 LYS A C    11 
ATOM 11459 O O    . LYS A 1 33 ? 9.195   -13.377 -1.781  1.00 0.00 ? 33 LYS A O    11 
ATOM 11460 C CB   . LYS A 1 33 ? 12.297  -13.788 -0.461  1.00 0.00 ? 33 LYS A CB   11 
ATOM 11461 C CG   . LYS A 1 33 ? 13.406  -13.136 0.347   1.00 0.00 ? 33 LYS A CG   11 
ATOM 11462 C CD   . LYS A 1 33 ? 14.462  -14.147 0.761   1.00 0.00 ? 33 LYS A CD   11 
ATOM 11463 C CE   . LYS A 1 33 ? 15.177  -13.717 2.033   1.00 0.00 ? 33 LYS A CE   11 
ATOM 11464 N NZ   . LYS A 1 33 ? 15.957  -12.464 1.834   1.00 0.00 ? 33 LYS A NZ   11 
ATOM 11465 H H    . LYS A 1 33 ? 10.548  -12.048 0.473   1.00 0.00 ? 33 LYS A H    11 
ATOM 11466 H HA   . LYS A 1 33 ? 12.118  -12.294 -1.983  1.00 0.00 ? 33 LYS A HA   11 
ATOM 11467 H HB2  . LYS A 1 33 ? 11.640  -14.307 0.222   1.00 0.00 ? 33 LYS A HB2  11 
ATOM 11468 H HB3  . LYS A 1 33 ? 12.744  -14.506 -1.133  1.00 0.00 ? 33 LYS A HB3  11 
ATOM 11469 H HG2  . LYS A 1 33 ? 13.872  -12.369 -0.253  1.00 0.00 ? 33 LYS A HG2  11 
ATOM 11470 H HG3  . LYS A 1 33 ? 12.978  -12.691 1.234   1.00 0.00 ? 33 LYS A HG3  11 
ATOM 11471 H HD2  . LYS A 1 33 ? 13.987  -15.101 0.934   1.00 0.00 ? 33 LYS A HD2  11 
ATOM 11472 H HD3  . LYS A 1 33 ? 15.188  -14.243 -0.035  1.00 0.00 ? 33 LYS A HD3  11 
ATOM 11473 H HE2  . LYS A 1 33 ? 14.441  -13.554 2.806   1.00 0.00 ? 33 LYS A HE2  11 
ATOM 11474 H HE3  . LYS A 1 33 ? 15.849  -14.506 2.337   1.00 0.00 ? 33 LYS A HE3  11 
ATOM 11475 H HZ1  . LYS A 1 33 ? 16.059  -12.265 0.818   1.00 0.00 ? 33 LYS A HZ1  11 
ATOM 11476 H HZ2  . LYS A 1 33 ? 16.904  -12.563 2.253   1.00 0.00 ? 33 LYS A HZ2  11 
ATOM 11477 H HZ3  . LYS A 1 33 ? 15.471  -11.664 2.287   1.00 0.00 ? 33 LYS A HZ3  11 
ATOM 11478 N N    . ASP A 1 34 ? 10.803  -14.349 -3.019  1.00 0.00 ? 34 ASP A N    11 
ATOM 11479 C CA   . ASP A 1 34 ? 9.867   -15.117 -3.830  1.00 0.00 ? 34 ASP A CA   11 
ATOM 11480 C C    . ASP A 1 34 ? 8.783   -15.747 -2.960  1.00 0.00 ? 34 ASP A C    11 
ATOM 11481 O O    . ASP A 1 34 ? 7.591   -15.532 -3.183  1.00 0.00 ? 34 ASP A O    11 
ATOM 11482 C CB   . ASP A 1 34 ? 10.608  -16.205 -4.610  1.00 0.00 ? 34 ASP A CB   11 
ATOM 11483 C CG   . ASP A 1 34 ? 11.794  -15.658 -5.379  1.00 0.00 ? 34 ASP A CG   11 
ATOM 11484 O OD1  . ASP A 1 34 ? 12.816  -15.331 -4.740  1.00 0.00 ? 34 ASP A OD1  11 
ATOM 11485 O OD2  . ASP A 1 34 ? 11.701  -15.559 -6.620  1.00 0.00 ? 34 ASP A OD2  11 
ATOM 11486 H H    . ASP A 1 34 ? 11.765  -14.434 -3.188  1.00 0.00 ? 34 ASP A H    11 
ATOM 11487 H HA   . ASP A 1 34 ? 9.400   -14.440 -4.530  1.00 0.00 ? 34 ASP A HA   11 
ATOM 11488 H HB2  . ASP A 1 34 ? 10.965  -16.954 -3.919  1.00 0.00 ? 34 ASP A HB2  11 
ATOM 11489 H HB3  . ASP A 1 34 ? 9.926   -16.663 -5.311  1.00 0.00 ? 34 ASP A HB3  11 
ATOM 11490 N N    . ASP A 1 35 ? 9.205   -16.526 -1.970  1.00 0.00 ? 35 ASP A N    11 
ATOM 11491 C CA   . ASP A 1 35 ? 8.271   -17.187 -1.066  1.00 0.00 ? 35 ASP A CA   11 
ATOM 11492 C C    . ASP A 1 35 ? 7.160   -16.233 -0.640  1.00 0.00 ? 35 ASP A C    11 
ATOM 11493 O O    . ASP A 1 35 ? 5.980   -16.578 -0.690  1.00 0.00 ? 35 ASP A O    11 
ATOM 11494 C CB   . ASP A 1 35 ? 9.007   -17.716 0.165   1.00 0.00 ? 35 ASP A CB   11 
ATOM 11495 C CG   . ASP A 1 35 ? 8.349   -18.951 0.748   1.00 0.00 ? 35 ASP A CG   11 
ATOM 11496 O OD1  . ASP A 1 35 ? 8.119   -19.915 -0.012  1.00 0.00 ? 35 ASP A OD1  11 
ATOM 11497 O OD2  . ASP A 1 35 ? 8.064   -18.954 1.963   1.00 0.00 ? 35 ASP A OD2  11 
ATOM 11498 H H    . ASP A 1 35 ? 10.168  -16.659 -1.844  1.00 0.00 ? 35 ASP A H    11 
ATOM 11499 H HA   . ASP A 1 35 ? 7.830   -18.019 -1.595  1.00 0.00 ? 35 ASP A HA   11 
ATOM 11500 H HB2  . ASP A 1 35 ? 10.021  -17.967 -0.110  1.00 0.00 ? 35 ASP A HB2  11 
ATOM 11501 H HB3  . ASP A 1 35 ? 9.024   -16.947 0.924   1.00 0.00 ? 35 ASP A HB3  11 
ATOM 11502 N N    . GLU A 1 36 ? 7.547   -15.032 -0.219  1.00 0.00 ? 36 GLU A N    11 
ATOM 11503 C CA   . GLU A 1 36 ? 6.583   -14.030 0.219   1.00 0.00 ? 36 GLU A CA   11 
ATOM 11504 C C    . GLU A 1 36 ? 5.711   -13.568 -0.946  1.00 0.00 ? 36 GLU A C    11 
ATOM 11505 O O    . GLU A 1 36 ? 4.484   -13.560 -0.852  1.00 0.00 ? 36 GLU A O    11 
ATOM 11506 C CB   . GLU A 1 36 ? 7.305   -12.830 0.835   1.00 0.00 ? 36 GLU A CB   11 
ATOM 11507 C CG   . GLU A 1 36 ? 8.017   -13.153 2.138   1.00 0.00 ? 36 GLU A CG   11 
ATOM 11508 C CD   . GLU A 1 36 ? 7.065   -13.255 3.314   1.00 0.00 ? 36 GLU A CD   11 
ATOM 11509 O OE1  . GLU A 1 36 ? 6.602   -12.199 3.795   1.00 0.00 ? 36 GLU A OE1  11 
ATOM 11510 O OE2  . GLU A 1 36 ? 6.782   -14.389 3.752   1.00 0.00 ? 36 GLU A OE2  11 
ATOM 11511 H H    . GLU A 1 36 ? 8.502   -14.817 -0.202  1.00 0.00 ? 36 GLU A H    11 
ATOM 11512 H HA   . GLU A 1 36 ? 5.951   -14.482 0.968   1.00 0.00 ? 36 GLU A HA   11 
ATOM 11513 H HB2  . GLU A 1 36 ? 8.037   -12.464 0.130   1.00 0.00 ? 36 GLU A HB2  11 
ATOM 11514 H HB3  . GLU A 1 36 ? 6.583   -12.051 1.027   1.00 0.00 ? 36 GLU A HB3  11 
ATOM 11515 H HG2  . GLU A 1 36 ? 8.532   -14.095 2.029   1.00 0.00 ? 36 GLU A HG2  11 
ATOM 11516 H HG3  . GLU A 1 36 ? 8.736   -12.373 2.343   1.00 0.00 ? 36 GLU A HG3  11 
ATOM 11517 N N    . PHE A 1 37 ? 6.355   -13.185 -2.044  1.00 0.00 ? 37 PHE A N    11 
ATOM 11518 C CA   . PHE A 1 37 ? 5.639   -12.721 -3.227  1.00 0.00 ? 37 PHE A CA   11 
ATOM 11519 C C    . PHE A 1 37 ? 4.544   -13.707 -3.622  1.00 0.00 ? 37 PHE A C    11 
ATOM 11520 O O    . PHE A 1 37 ? 3.517   -13.320 -4.178  1.00 0.00 ? 37 PHE A O    11 
ATOM 11521 C CB   . PHE A 1 37 ? 6.611   -12.526 -4.392  1.00 0.00 ? 37 PHE A CB   11 
ATOM 11522 C CG   . PHE A 1 37 ? 7.191   -11.143 -4.464  1.00 0.00 ? 37 PHE A CG   11 
ATOM 11523 C CD1  . PHE A 1 37 ? 6.511   -10.125 -5.113  1.00 0.00 ? 37 PHE A CD1  11 
ATOM 11524 C CD2  . PHE A 1 37 ? 8.417   -10.860 -3.882  1.00 0.00 ? 37 PHE A CD2  11 
ATOM 11525 C CE1  . PHE A 1 37 ? 7.043   -8.851  -5.181  1.00 0.00 ? 37 PHE A CE1  11 
ATOM 11526 C CE2  . PHE A 1 37 ? 8.954   -9.588  -3.947  1.00 0.00 ? 37 PHE A CE2  11 
ATOM 11527 C CZ   . PHE A 1 37 ? 8.265   -8.582  -4.596  1.00 0.00 ? 37 PHE A CZ   11 
ATOM 11528 H H    . PHE A 1 37 ? 7.335   -13.215 -2.058  1.00 0.00 ? 37 PHE A H    11 
ATOM 11529 H HA   . PHE A 1 37 ? 5.184   -11.773 -2.987  1.00 0.00 ? 37 PHE A HA   11 
ATOM 11530 H HB2  . PHE A 1 37 ? 7.429   -13.223 -4.290  1.00 0.00 ? 37 PHE A HB2  11 
ATOM 11531 H HB3  . PHE A 1 37 ? 6.093   -12.719 -5.319  1.00 0.00 ? 37 PHE A HB3  11 
ATOM 11532 H HD1  . PHE A 1 37 ? 5.555   -10.333 -5.570  1.00 0.00 ? 37 PHE A HD1  11 
ATOM 11533 H HD2  . PHE A 1 37 ? 8.956   -11.646 -3.374  1.00 0.00 ? 37 PHE A HD2  11 
ATOM 11534 H HE1  . PHE A 1 37 ? 6.503   -8.066  -5.689  1.00 0.00 ? 37 PHE A HE1  11 
ATOM 11535 H HE2  . PHE A 1 37 ? 9.909   -9.381  -3.489  1.00 0.00 ? 37 PHE A HE2  11 
ATOM 11536 H HZ   . PHE A 1 37 ? 8.683   -7.588  -4.648  1.00 0.00 ? 37 PHE A HZ   11 
ATOM 11537 N N    . GLU A 1 38 ? 4.773   -14.984 -3.331  1.00 0.00 ? 38 GLU A N    11 
ATOM 11538 C CA   . GLU A 1 38 ? 3.807   -16.026 -3.658  1.00 0.00 ? 38 GLU A CA   11 
ATOM 11539 C C    . GLU A 1 38 ? 2.511   -15.830 -2.877  1.00 0.00 ? 38 GLU A C    11 
ATOM 11540 O O    . GLU A 1 38 ? 1.418   -15.957 -3.428  1.00 0.00 ? 38 GLU A O    11 
ATOM 11541 C CB   . GLU A 1 38 ? 4.392   -17.408 -3.357  1.00 0.00 ? 38 GLU A CB   11 
ATOM 11542 C CG   . GLU A 1 38 ? 5.474   -17.836 -4.335  1.00 0.00 ? 38 GLU A CG   11 
ATOM 11543 C CD   . GLU A 1 38 ? 6.042   -19.205 -4.013  1.00 0.00 ? 38 GLU A CD   11 
ATOM 11544 O OE1  . GLU A 1 38 ? 6.698   -19.343 -2.959  1.00 0.00 ? 38 GLU A OE1  11 
ATOM 11545 O OE2  . GLU A 1 38 ? 5.831   -20.138 -4.816  1.00 0.00 ? 38 GLU A OE2  11 
ATOM 11546 H H    . GLU A 1 38 ? 5.611   -15.231 -2.888  1.00 0.00 ? 38 GLU A H    11 
ATOM 11547 H HA   . GLU A 1 38 ? 3.591   -15.959 -4.713  1.00 0.00 ? 38 GLU A HA   11 
ATOM 11548 H HB2  . GLU A 1 38 ? 4.816   -17.398 -2.364  1.00 0.00 ? 38 GLU A HB2  11 
ATOM 11549 H HB3  . GLU A 1 38 ? 3.597   -18.137 -3.392  1.00 0.00 ? 38 GLU A HB3  11 
ATOM 11550 H HG2  . GLU A 1 38 ? 5.053   -17.863 -5.329  1.00 0.00 ? 38 GLU A HG2  11 
ATOM 11551 H HG3  . GLU A 1 38 ? 6.276   -17.113 -4.304  1.00 0.00 ? 38 GLU A HG3  11 
ATOM 11552 N N    . GLN A 1 39 ? 2.643   -15.521 -1.591  1.00 0.00 ? 39 GLN A N    11 
ATOM 11553 C CA   . GLN A 1 39 ? 1.482   -15.309 -0.734  1.00 0.00 ? 39 GLN A CA   11 
ATOM 11554 C C    . GLN A 1 39 ? 0.509   -14.322 -1.370  1.00 0.00 ? 39 GLN A C    11 
ATOM 11555 O O    . GLN A 1 39 ? -0.705  -14.531 -1.351  1.00 0.00 ? 39 GLN A O    11 
ATOM 11556 C CB   . GLN A 1 39 ? 1.922   -14.798 0.639   1.00 0.00 ? 39 GLN A CB   11 
ATOM 11557 C CG   . GLN A 1 39 ? 2.525   -15.876 1.525   1.00 0.00 ? 39 GLN A CG   11 
ATOM 11558 C CD   . GLN A 1 39 ? 1.486   -16.580 2.375   1.00 0.00 ? 39 GLN A CD   11 
ATOM 11559 O OE1  . GLN A 1 39 ? 0.984   -17.644 2.009   1.00 0.00 ? 39 GLN A OE1  11 
ATOM 11560 N NE2  . GLN A 1 39 ? 1.156   -15.990 3.518   1.00 0.00 ? 39 GLN A NE2  11 
ATOM 11561 H H    . GLN A 1 39 ? 3.540   -15.435 -1.210  1.00 0.00 ? 39 GLN A H    11 
ATOM 11562 H HA   . GLN A 1 39 ? 0.983   -16.259 -0.611  1.00 0.00 ? 39 GLN A HA   11 
ATOM 11563 H HB2  . GLN A 1 39 ? 2.659   -14.021 0.501   1.00 0.00 ? 39 GLN A HB2  11 
ATOM 11564 H HB3  . GLN A 1 39 ? 1.064   -14.383 1.147   1.00 0.00 ? 39 GLN A HB3  11 
ATOM 11565 H HG2  . GLN A 1 39 ? 3.011   -16.609 0.899   1.00 0.00 ? 39 GLN A HG2  11 
ATOM 11566 H HG3  . GLN A 1 39 ? 3.254   -15.420 2.178   1.00 0.00 ? 39 GLN A HG3  11 
ATOM 11567 H HE21 . GLN A 1 39 ? 1.596   -15.144 3.745   1.00 0.00 ? 39 GLN A HE21 11 
ATOM 11568 H HE22 . GLN A 1 39 ? 0.487   -16.423 4.087   1.00 0.00 ? 39 GLN A HE22 11 
ATOM 11569 N N    . LEU A 1 40 ? 1.049   -13.246 -1.931  1.00 0.00 ? 40 LEU A N    11 
ATOM 11570 C CA   . LEU A 1 40 ? 0.228   -12.225 -2.573  1.00 0.00 ? 40 LEU A CA   11 
ATOM 11571 C C    . LEU A 1 40 ? -0.360  -12.742 -3.881  1.00 0.00 ? 40 LEU A C    11 
ATOM 11572 O O    . LEU A 1 40 ? -1.551  -12.575 -4.148  1.00 0.00 ? 40 LEU A O    11 
ATOM 11573 C CB   . LEU A 1 40 ? 1.058   -10.966 -2.836  1.00 0.00 ? 40 LEU A CB   11 
ATOM 11574 C CG   . LEU A 1 40 ? 1.557   -10.221 -1.598  1.00 0.00 ? 40 LEU A CG   11 
ATOM 11575 C CD1  . LEU A 1 40 ? 2.875   -9.521  -1.892  1.00 0.00 ? 40 LEU A CD1  11 
ATOM 11576 C CD2  . LEU A 1 40 ? 0.515   -9.221  -1.120  1.00 0.00 ? 40 LEU A CD2  11 
ATOM 11577 H H    . LEU A 1 40 ? 2.022   -13.134 -1.914  1.00 0.00 ? 40 LEU A H    11 
ATOM 11578 H HA   . LEU A 1 40 ? -0.581  -11.979 -1.901  1.00 0.00 ? 40 LEU A HA   11 
ATOM 11579 H HB2  . LEU A 1 40 ? 1.919   -11.254 -3.418  1.00 0.00 ? 40 LEU A HB2  11 
ATOM 11580 H HB3  . LEU A 1 40 ? 0.448   -10.284 -3.411  1.00 0.00 ? 40 LEU A HB3  11 
ATOM 11581 H HG   . LEU A 1 40 ? 1.729   -10.933 -0.802  1.00 0.00 ? 40 LEU A HG   11 
ATOM 11582 H HD11 . LEU A 1 40 ? 2.803   -8.483  -1.606  1.00 0.00 ? 40 LEU A HD11 11 
ATOM 11583 H HD12 . LEU A 1 40 ? 3.091   -9.590  -2.948  1.00 0.00 ? 40 LEU A HD12 11 
ATOM 11584 H HD13 . LEU A 1 40 ? 3.667   -9.995  -1.331  1.00 0.00 ? 40 LEU A HD13 11 
ATOM 11585 H HD21 . LEU A 1 40 ? -0.357  -9.751  -0.766  1.00 0.00 ? 40 LEU A HD21 11 
ATOM 11586 H HD22 . LEU A 1 40 ? 0.234   -8.575  -1.940  1.00 0.00 ? 40 LEU A HD22 11 
ATOM 11587 H HD23 . LEU A 1 40 ? 0.927   -8.627  -0.318  1.00 0.00 ? 40 LEU A HD23 11 
ATOM 11588 N N    . SER A 1 41 ? 0.481   -13.373 -4.694  1.00 0.00 ? 41 SER A N    11 
ATOM 11589 C CA   . SER A 1 41 ? 0.045   -13.914 -5.976  1.00 0.00 ? 41 SER A CA   11 
ATOM 11590 C C    . SER A 1 41 ? -1.111  -14.892 -5.788  1.00 0.00 ? 41 SER A C    11 
ATOM 11591 O O    . SER A 1 41 ? -2.003  -14.985 -6.629  1.00 0.00 ? 41 SER A O    11 
ATOM 11592 C CB   . SER A 1 41 ? 1.209   -14.612 -6.682  1.00 0.00 ? 41 SER A CB   11 
ATOM 11593 O OG   . SER A 1 41 ? 1.254   -15.989 -6.351  1.00 0.00 ? 41 SER A OG   11 
ATOM 11594 H H    . SER A 1 41 ? 1.418   -13.475 -4.426  1.00 0.00 ? 41 SER A H    11 
ATOM 11595 H HA   . SER A 1 41 ? -0.293  -13.090 -6.586  1.00 0.00 ? 41 SER A HA   11 
ATOM 11596 H HB2  . SER A 1 41 ? 1.089   -14.515 -7.750  1.00 0.00 ? 41 SER A HB2  11 
ATOM 11597 H HB3  . SER A 1 41 ? 2.138   -14.150 -6.380  1.00 0.00 ? 41 SER A HB3  11 
ATOM 11598 H HG   . SER A 1 41 ? 2.138   -16.219 -6.054  1.00 0.00 ? 41 SER A HG   11 
ATOM 11599 N N    . ASN A 1 42 ? -1.086  -15.621 -4.677  1.00 0.00 ? 42 ASN A N    11 
ATOM 11600 C CA   . ASN A 1 42 ? -2.131  -16.594 -4.377  1.00 0.00 ? 42 ASN A CA   11 
ATOM 11601 C C    . ASN A 1 42 ? -3.351  -15.910 -3.767  1.00 0.00 ? 42 ASN A C    11 
ATOM 11602 O O    . ASN A 1 42 ? -4.479  -16.380 -3.918  1.00 0.00 ? 42 ASN A O    11 
ATOM 11603 C CB   . ASN A 1 42 ? -1.600  -17.664 -3.421  1.00 0.00 ? 42 ASN A CB   11 
ATOM 11604 C CG   . ASN A 1 42 ? -0.771  -18.715 -4.132  1.00 0.00 ? 42 ASN A CG   11 
ATOM 11605 O OD1  . ASN A 1 42 ? -1.306  -19.687 -4.667  1.00 0.00 ? 42 ASN A OD1  11 
ATOM 11606 N ND2  . ASN A 1 42 ? 0.543   -18.525 -4.142  1.00 0.00 ? 42 ASN A ND2  11 
ATOM 11607 H H    . ASN A 1 42 ? -0.347  -15.502 -4.043  1.00 0.00 ? 42 ASN A H    11 
ATOM 11608 H HA   . ASN A 1 42 ? -2.421  -17.064 -5.304  1.00 0.00 ? 42 ASN A HA   11 
ATOM 11609 H HB2  . ASN A 1 42 ? -0.982  -17.193 -2.670  1.00 0.00 ? 42 ASN A HB2  11 
ATOM 11610 H HB3  . ASN A 1 42 ? -2.434  -18.154 -2.939  1.00 0.00 ? 42 ASN A HB3  11 
ATOM 11611 H HD21 . ASN A 1 42 ? 0.899   -17.728 -3.696  1.00 0.00 ? 42 ASN A HD21 11 
ATOM 11612 H HD22 . ASN A 1 42 ? 1.103   -19.189 -4.596  1.00 0.00 ? 42 ASN A HD22 11 
ATOM 11613 N N    . LEU A 1 43 ? -3.117  -14.799 -3.078  1.00 0.00 ? 43 LEU A N    11 
ATOM 11614 C CA   . LEU A 1 43 ? -4.197  -14.049 -2.445  1.00 0.00 ? 43 LEU A CA   11 
ATOM 11615 C C    . LEU A 1 43 ? -4.979  -13.244 -3.478  1.00 0.00 ? 43 LEU A C    11 
ATOM 11616 O O    . LEU A 1 43 ? -6.188  -13.418 -3.632  1.00 0.00 ? 43 LEU A O    11 
ATOM 11617 C CB   . LEU A 1 43 ? -3.635  -13.115 -1.372  1.00 0.00 ? 43 LEU A CB   11 
ATOM 11618 C CG   . LEU A 1 43 ? -4.567  -11.998 -0.900  1.00 0.00 ? 43 LEU A CG   11 
ATOM 11619 C CD1  . LEU A 1 43 ? -5.870  -12.577 -0.372  1.00 0.00 ? 43 LEU A CD1  11 
ATOM 11620 C CD2  . LEU A 1 43 ? -3.886  -11.151 0.165   1.00 0.00 ? 43 LEU A CD2  11 
ATOM 11621 H H    . LEU A 1 43 ? -2.197  -14.473 -2.993  1.00 0.00 ? 43 LEU A H    11 
ATOM 11622 H HA   . LEU A 1 43 ? -4.864  -14.759 -1.980  1.00 0.00 ? 43 LEU A HA   11 
ATOM 11623 H HB2  . LEU A 1 43 ? -3.378  -13.716 -0.513  1.00 0.00 ? 43 LEU A HB2  11 
ATOM 11624 H HB3  . LEU A 1 43 ? -2.741  -12.656 -1.769  1.00 0.00 ? 43 LEU A HB3  11 
ATOM 11625 H HG   . LEU A 1 43 ? -4.803  -11.357 -1.738  1.00 0.00 ? 43 LEU A HG   11 
ATOM 11626 H HD11 . LEU A 1 43 ? -6.544  -11.773 -0.118  1.00 0.00 ? 43 LEU A HD11 11 
ATOM 11627 H HD12 . LEU A 1 43 ? -5.669  -13.171 0.508   1.00 0.00 ? 43 LEU A HD12 11 
ATOM 11628 H HD13 . LEU A 1 43 ? -6.321  -13.200 -1.131  1.00 0.00 ? 43 LEU A HD13 11 
ATOM 11629 H HD21 . LEU A 1 43 ? -2.815  -11.218 0.047   1.00 0.00 ? 43 LEU A HD21 11 
ATOM 11630 H HD22 . LEU A 1 43 ? -4.164  -11.513 1.144   1.00 0.00 ? 43 LEU A HD22 11 
ATOM 11631 H HD23 . LEU A 1 43 ? -4.197  -10.122 0.060   1.00 0.00 ? 43 LEU A HD23 11 
ATOM 11632 N N    . LEU A 1 44 ? -4.280  -12.363 -4.186  1.00 0.00 ? 44 LEU A N    11 
ATOM 11633 C CA   . LEU A 1 44 ? -4.908  -11.531 -5.207  1.00 0.00 ? 44 LEU A CA   11 
ATOM 11634 C C    . LEU A 1 44 ? -5.046  -12.293 -6.521  1.00 0.00 ? 44 LEU A C    11 
ATOM 11635 O O    . LEU A 1 44 ? -5.641  -11.799 -7.477  1.00 0.00 ? 44 LEU A O    11 
ATOM 11636 C CB   . LEU A 1 44 ? -4.092  -10.256 -5.427  1.00 0.00 ? 44 LEU A CB   11 
ATOM 11637 C CG   . LEU A 1 44 ? -3.704  -9.481  -4.167  1.00 0.00 ? 44 LEU A CG   11 
ATOM 11638 C CD1  . LEU A 1 44 ? -2.568  -8.514  -4.463  1.00 0.00 ? 44 LEU A CD1  11 
ATOM 11639 C CD2  . LEU A 1 44 ? -4.908  -8.737  -3.608  1.00 0.00 ? 44 LEU A CD2  11 
ATOM 11640 H H    . LEU A 1 44 ? -3.319  -12.268 -4.018  1.00 0.00 ? 44 LEU A H    11 
ATOM 11641 H HA   . LEU A 1 44 ? -5.893  -11.262 -4.855  1.00 0.00 ? 44 LEU A HA   11 
ATOM 11642 H HB2  . LEU A 1 44 ? -3.182  -10.530 -5.939  1.00 0.00 ? 44 LEU A HB2  11 
ATOM 11643 H HB3  . LEU A 1 44 ? -4.672  -9.597  -6.057  1.00 0.00 ? 44 LEU A HB3  11 
ATOM 11644 H HG   . LEU A 1 44 ? -3.362  -10.178 -3.414  1.00 0.00 ? 44 LEU A HG   11 
ATOM 11645 H HD11 . LEU A 1 44 ? -2.282  -8.006  -3.554  1.00 0.00 ? 44 LEU A HD11 11 
ATOM 11646 H HD12 . LEU A 1 44 ? -2.894  -7.789  -5.194  1.00 0.00 ? 44 LEU A HD12 11 
ATOM 11647 H HD13 . LEU A 1 44 ? -1.722  -9.062  -4.852  1.00 0.00 ? 44 LEU A HD13 11 
ATOM 11648 H HD21 . LEU A 1 44 ? -4.570  -7.896  -3.020  1.00 0.00 ? 44 LEU A HD21 11 
ATOM 11649 H HD22 . LEU A 1 44 ? -5.486  -9.403  -2.984  1.00 0.00 ? 44 LEU A HD22 11 
ATOM 11650 H HD23 . LEU A 1 44 ? -5.523  -8.382  -4.422  1.00 0.00 ? 44 LEU A HD23 11 
ATOM 11651 N N    . ASN A 1 45 ? -4.493  -13.501 -6.559  1.00 0.00 ? 45 ASN A N    11 
ATOM 11652 C CA   . ASN A 1 45 ? -4.556  -14.333 -7.755  1.00 0.00 ? 45 ASN A CA   11 
ATOM 11653 C C    . ASN A 1 45 ? -3.878  -13.642 -8.934  1.00 0.00 ? 45 ASN A C    11 
ATOM 11654 O O    . ASN A 1 45 ? -4.216  -13.891 -10.092 1.00 0.00 ? 45 ASN A O    11 
ATOM 11655 C CB   . ASN A 1 45 ? -6.011  -14.651 -8.104  1.00 0.00 ? 45 ASN A CB   11 
ATOM 11656 C CG   . ASN A 1 45 ? -6.641  -15.626 -7.128  1.00 0.00 ? 45 ASN A CG   11 
ATOM 11657 O OD1  . ASN A 1 45 ? -7.532  -15.263 -6.359  1.00 0.00 ? 45 ASN A OD1  11 
ATOM 11658 N ND2  . ASN A 1 45 ? -6.179  -16.870 -7.153  1.00 0.00 ? 45 ASN A ND2  11 
ATOM 11659 H H    . ASN A 1 45 ? -4.031  -13.842 -5.764  1.00 0.00 ? 45 ASN A H    11 
ATOM 11660 H HA   . ASN A 1 45 ? -4.036  -15.255 -7.545  1.00 0.00 ? 45 ASN A HA   11 
ATOM 11661 H HB2  . ASN A 1 45 ? -6.586  -13.736 -8.091  1.00 0.00 ? 45 ASN A HB2  11 
ATOM 11662 H HB3  . ASN A 1 45 ? -6.052  -15.083 -9.093  1.00 0.00 ? 45 ASN A HB3  11 
ATOM 11663 H HD21 . ASN A 1 45 ? -5.468  -17.087 -7.792  1.00 0.00 ? 45 ASN A HD21 11 
ATOM 11664 H HD22 . ASN A 1 45 ? -6.568  -17.521 -6.533  1.00 0.00 ? 45 ASN A HD22 11 
ATOM 11665 N N    . LEU A 1 46 ? -2.918  -12.775 -8.632  1.00 0.00 ? 46 LEU A N    11 
ATOM 11666 C CA   . LEU A 1 46 ? -2.190  -12.048 -9.667  1.00 0.00 ? 46 LEU A CA   11 
ATOM 11667 C C    . LEU A 1 46 ? -0.787  -12.617 -9.847  1.00 0.00 ? 46 LEU A C    11 
ATOM 11668 O O    . LEU A 1 46 ? -0.200  -13.190 -8.929  1.00 0.00 ? 46 LEU A O    11 
ATOM 11669 C CB   . LEU A 1 46 ? -2.109  -10.562 -9.312  1.00 0.00 ? 46 LEU A CB   11 
ATOM 11670 C CG   . LEU A 1 46 ? -3.444  -9.825  -9.198  1.00 0.00 ? 46 LEU A CG   11 
ATOM 11671 C CD1  . LEU A 1 46 ? -3.241  -8.445  -8.593  1.00 0.00 ? 46 LEU A CD1  11 
ATOM 11672 C CD2  . LEU A 1 46 ? -4.112  -9.719  -10.561 1.00 0.00 ? 46 LEU A CD2  11 
ATOM 11673 H H    . LEU A 1 46 ? -2.693  -12.619 -7.692  1.00 0.00 ? 46 LEU A H    11 
ATOM 11674 H HA   . LEU A 1 46 ? -2.733  -12.159 -10.594 1.00 0.00 ? 46 LEU A HA   11 
ATOM 11675 H HB2  . LEU A 1 46 ? -1.602  -10.476 -8.364  1.00 0.00 ? 46 LEU A HB2  11 
ATOM 11676 H HB3  . LEU A 1 46 ? -1.523  -10.072 -10.078 1.00 0.00 ? 46 LEU A HB3  11 
ATOM 11677 H HG   . LEU A 1 46 ? -4.101  -10.383 -8.545  1.00 0.00 ? 46 LEU A HG   11 
ATOM 11678 H HD11 . LEU A 1 46 ? -3.294  -7.699  -9.371  1.00 0.00 ? 46 LEU A HD11 11 
ATOM 11679 H HD12 . LEU A 1 46 ? -2.274  -8.400  -8.115  1.00 0.00 ? 46 LEU A HD12 11 
ATOM 11680 H HD13 . LEU A 1 46 ? -4.013  -8.257  -7.860  1.00 0.00 ? 46 LEU A HD13 11 
ATOM 11681 H HD21 . LEU A 1 46 ? -3.766  -10.522 -11.195 1.00 0.00 ? 46 LEU A HD21 11 
ATOM 11682 H HD22 . LEU A 1 46 ? -3.861  -8.770  -11.012 1.00 0.00 ? 46 LEU A HD22 11 
ATOM 11683 H HD23 . LEU A 1 46 ? -5.183  -9.789  -10.443 1.00 0.00 ? 46 LEU A HD23 11 
ATOM 11684 N N    . PRO A 1 47 ? -0.233  -12.455 -11.058 1.00 0.00 ? 47 PRO A N    11 
ATOM 11685 C CA   . PRO A 1 47 ? 1.109   -12.943 -11.387 1.00 0.00 ? 47 PRO A CA   11 
ATOM 11686 C C    . PRO A 1 47 ? 2.203   -12.156 -10.673 1.00 0.00 ? 47 PRO A C    11 
ATOM 11687 O O    . PRO A 1 47 ? 2.228   -10.926 -10.719 1.00 0.00 ? 47 PRO A O    11 
ATOM 11688 C CB   . PRO A 1 47 ? 1.202   -12.735 -12.901 1.00 0.00 ? 47 PRO A CB   11 
ATOM 11689 C CG   . PRO A 1 47 ? 0.246   -11.629 -13.190 1.00 0.00 ? 47 PRO A CG   11 
ATOM 11690 C CD   . PRO A 1 47 ? -0.875  -11.782 -12.200 1.00 0.00 ? 47 PRO A CD   11 
ATOM 11691 H HA   . PRO A 1 47 ? 1.216   -13.994 -11.159 1.00 0.00 ? 47 PRO A HA   11 
ATOM 11692 H HB2  . PRO A 1 47 ? 2.213   -12.464 -13.168 1.00 0.00 ? 47 PRO A HB2  11 
ATOM 11693 H HB3  . PRO A 1 47 ? 0.920   -13.644 -13.410 1.00 0.00 ? 47 PRO A HB3  11 
ATOM 11694 H HG2  . PRO A 1 47 ? 0.736   -10.677 -13.059 1.00 0.00 ? 47 PRO A HG2  11 
ATOM 11695 H HG3  . PRO A 1 47 ? -0.130  -11.724 -14.198 1.00 0.00 ? 47 PRO A HG3  11 
ATOM 11696 H HD2  . PRO A 1 47 ? -1.258  -10.814 -11.911 1.00 0.00 ? 47 PRO A HD2  11 
ATOM 11697 H HD3  . PRO A 1 47 ? -1.664  -12.393 -12.613 1.00 0.00 ? 47 PRO A HD3  11 
ATOM 11698 N N    . THR A 1 48 ? 3.108   -12.873 -10.014 1.00 0.00 ? 48 THR A N    11 
ATOM 11699 C CA   . THR A 1 48 ? 4.204   -12.242 -9.290  1.00 0.00 ? 48 THR A CA   11 
ATOM 11700 C C    . THR A 1 48 ? 4.839   -11.129 -10.116 1.00 0.00 ? 48 THR A C    11 
ATOM 11701 O O    . THR A 1 48 ? 5.170   -10.066 -9.592  1.00 0.00 ? 48 THR A O    11 
ATOM 11702 C CB   . THR A 1 48 ? 5.289   -13.267 -8.908  1.00 0.00 ? 48 THR A CB   11 
ATOM 11703 O OG1  . THR A 1 48 ? 5.409   -14.258 -9.935  1.00 0.00 ? 48 THR A OG1  11 
ATOM 11704 C CG2  . THR A 1 48 ? 4.957   -13.938 -7.584  1.00 0.00 ? 48 THR A CG2  11 
ATOM 11705 H H    . THR A 1 48 ? 3.034   -13.850 -10.015 1.00 0.00 ? 48 THR A H    11 
ATOM 11706 H HA   . THR A 1 48 ? 3.803   -11.818 -8.381  1.00 0.00 ? 48 THR A HA   11 
ATOM 11707 H HB   . THR A 1 48 ? 6.232   -12.748 -8.806  1.00 0.00 ? 48 THR A HB   11 
ATOM 11708 H HG1  . THR A 1 48 ? 5.725   -15.079 -9.551  1.00 0.00 ? 48 THR A HG1  11 
ATOM 11709 H HG21 . THR A 1 48 ? 4.528   -13.212 -6.910  1.00 0.00 ? 48 THR A HG21 11 
ATOM 11710 H HG22 . THR A 1 48 ? 5.859   -14.344 -7.151  1.00 0.00 ? 48 THR A HG22 11 
ATOM 11711 H HG23 . THR A 1 48 ? 4.249   -14.735 -7.753  1.00 0.00 ? 48 THR A HG23 11 
ATOM 11712 N N    . ARG A 1 49 ? 5.007   -11.381 -11.410 1.00 0.00 ? 49 ARG A N    11 
ATOM 11713 C CA   . ARG A 1 49 ? 5.604   -10.400 -12.308 1.00 0.00 ? 49 ARG A CA   11 
ATOM 11714 C C    . ARG A 1 49 ? 4.900   -9.052  -12.186 1.00 0.00 ? 49 ARG A C    11 
ATOM 11715 O O    . ARG A 1 49 ? 5.533   -8.000  -12.270 1.00 0.00 ? 49 ARG A O    11 
ATOM 11716 C CB   . ARG A 1 49 ? 5.536   -10.894 -13.755 1.00 0.00 ? 49 ARG A CB   11 
ATOM 11717 C CG   . ARG A 1 49 ? 4.202   -10.621 -14.429 1.00 0.00 ? 49 ARG A CG   11 
ATOM 11718 C CD   . ARG A 1 49 ? 4.197   -9.272  -15.129 1.00 0.00 ? 49 ARG A CD   11 
ATOM 11719 N NE   . ARG A 1 49 ? 4.990   -9.288  -16.355 1.00 0.00 ? 49 ARG A NE   11 
ATOM 11720 C CZ   . ARG A 1 49 ? 5.055   -8.267  -17.202 1.00 0.00 ? 49 ARG A CZ   11 
ATOM 11721 N NH1  . ARG A 1 49 ? 4.377   -7.154  -16.958 1.00 0.00 ? 49 ARG A NH1  11 
ATOM 11722 N NH2  . ARG A 1 49 ? 5.799   -8.358  -18.297 1.00 0.00 ? 49 ARG A NH2  11 
ATOM 11723 H H    . ARG A 1 49 ? 4.724   -12.248 -11.769 1.00 0.00 ? 49 ARG A H    11 
ATOM 11724 H HA   . ARG A 1 49 ? 6.640   -10.279 -12.027 1.00 0.00 ? 49 ARG A HA   11 
ATOM 11725 H HB2  . ARG A 1 49 ? 6.310   -10.404 -14.327 1.00 0.00 ? 49 ARG A HB2  11 
ATOM 11726 H HB3  . ARG A 1 49 ? 5.710   -11.959 -13.767 1.00 0.00 ? 49 ARG A HB3  11 
ATOM 11727 H HG2  . ARG A 1 49 ? 4.014   -11.394 -15.160 1.00 0.00 ? 49 ARG A HG2  11 
ATOM 11728 H HG3  . ARG A 1 49 ? 3.422   -10.633 -13.682 1.00 0.00 ? 49 ARG A HG3  11 
ATOM 11729 H HD2  . ARG A 1 49 ? 3.178   -9.012  -15.375 1.00 0.00 ? 49 ARG A HD2  11 
ATOM 11730 H HD3  . ARG A 1 49 ? 4.604   -8.531  -14.457 1.00 0.00 ? 49 ARG A HD3  11 
ATOM 11731 H HE   . ARG A 1 49 ? 5.499   -10.101 -16.555 1.00 0.00 ? 49 ARG A HE   11 
ATOM 11732 H HH11 . ARG A 1 49 ? 3.816   -7.083  -16.133 1.00 0.00 ? 49 ARG A HH11 11 
ATOM 11733 H HH12 . ARG A 1 49 ? 4.429   -6.386  -17.597 1.00 0.00 ? 49 ARG A HH12 11 
ATOM 11734 H HH21 . ARG A 1 49 ? 6.312   -9.195  -18.485 1.00 0.00 ? 49 ARG A HH21 11 
ATOM 11735 H HH22 . ARG A 1 49 ? 5.847   -7.589  -18.934 1.00 0.00 ? 49 ARG A HH22 11 
ATOM 11736 N N    . VAL A 1 50 ? 3.586   -9.092  -11.988 1.00 0.00 ? 50 VAL A N    11 
ATOM 11737 C CA   . VAL A 1 50 ? 2.796   -7.874  -11.853 1.00 0.00 ? 50 VAL A CA   11 
ATOM 11738 C C    . VAL A 1 50 ? 3.008   -7.230  -10.488 1.00 0.00 ? 50 VAL A C    11 
ATOM 11739 O O    . VAL A 1 50 ? 3.050   -6.005  -10.369 1.00 0.00 ? 50 VAL A O    11 
ATOM 11740 C CB   . VAL A 1 50 ? 1.294   -8.155  -12.049 1.00 0.00 ? 50 VAL A CB   11 
ATOM 11741 C CG1  . VAL A 1 50 ? 0.459   -7.034  -11.451 1.00 0.00 ? 50 VAL A CG1  11 
ATOM 11742 C CG2  . VAL A 1 50 ? 0.975   -8.340  -13.525 1.00 0.00 ? 50 VAL A CG2  11 
ATOM 11743 H H    . VAL A 1 50 ? 3.138   -9.962  -11.930 1.00 0.00 ? 50 VAL A H    11 
ATOM 11744 H HA   . VAL A 1 50 ? 3.115   -7.183  -12.620 1.00 0.00 ? 50 VAL A HA   11 
ATOM 11745 H HB   . VAL A 1 50 ? 1.050   -9.071  -11.532 1.00 0.00 ? 50 VAL A HB   11 
ATOM 11746 H HG11 . VAL A 1 50 ? 0.714   -6.100  -11.931 1.00 0.00 ? 50 VAL A HG11 11 
ATOM 11747 H HG12 . VAL A 1 50 ? -0.589  -7.244  -11.604 1.00 0.00 ? 50 VAL A HG12 11 
ATOM 11748 H HG13 . VAL A 1 50 ? 0.661   -6.960  -10.392 1.00 0.00 ? 50 VAL A HG13 11 
ATOM 11749 H HG21 . VAL A 1 50 ? 0.943   -7.376  -14.009 1.00 0.00 ? 50 VAL A HG21 11 
ATOM 11750 H HG22 . VAL A 1 50 ? 1.741   -8.948  -13.986 1.00 0.00 ? 50 VAL A HG22 11 
ATOM 11751 H HG23 . VAL A 1 50 ? 0.018   -8.828  -13.628 1.00 0.00 ? 50 VAL A HG23 11 
ATOM 11752 N N    . ILE A 1 51 ? 3.140   -8.062  -9.461  1.00 0.00 ? 51 ILE A N    11 
ATOM 11753 C CA   . ILE A 1 51 ? 3.349   -7.573  -8.104  1.00 0.00 ? 51 ILE A CA   11 
ATOM 11754 C C    . ILE A 1 51 ? 4.760   -7.023  -7.929  1.00 0.00 ? 51 ILE A C    11 
ATOM 11755 O O    . ILE A 1 51 ? 4.986   -6.100  -7.146  1.00 0.00 ? 51 ILE A O    11 
ATOM 11756 C CB   . ILE A 1 51 ? 3.109   -8.683  -7.063  1.00 0.00 ? 51 ILE A CB   11 
ATOM 11757 C CG1  . ILE A 1 51 ? 1.793   -9.407  -7.350  1.00 0.00 ? 51 ILE A CG1  11 
ATOM 11758 C CG2  . ILE A 1 51 ? 3.103   -8.099  -5.658  1.00 0.00 ? 51 ILE A CG2  11 
ATOM 11759 C CD1  . ILE A 1 51 ? 1.619   -10.683 -6.557  1.00 0.00 ? 51 ILE A CD1  11 
ATOM 11760 H H    . ILE A 1 51 ? 3.097   -9.028  -9.620  1.00 0.00 ? 51 ILE A H    11 
ATOM 11761 H HA   . ILE A 1 51 ? 2.639   -6.779  -7.923  1.00 0.00 ? 51 ILE A HA   11 
ATOM 11762 H HB   . ILE A 1 51 ? 3.923   -9.389  -7.129  1.00 0.00 ? 51 ILE A HB   11 
ATOM 11763 H HG12 . ILE A 1 51 ? 0.969   -8.753  -7.110  1.00 0.00 ? 51 ILE A HG12 11 
ATOM 11764 H HG13 . ILE A 1 51 ? 1.751   -9.660  -8.400  1.00 0.00 ? 51 ILE A HG13 11 
ATOM 11765 H HG21 . ILE A 1 51 ? 2.428   -8.667  -5.035  1.00 0.00 ? 51 ILE A HG21 11 
ATOM 11766 H HG22 . ILE A 1 51 ? 4.099   -8.146  -5.244  1.00 0.00 ? 51 ILE A HG22 11 
ATOM 11767 H HG23 . ILE A 1 51 ? 2.778   -7.070  -5.697  1.00 0.00 ? 51 ILE A HG23 11 
ATOM 11768 H HD11 . ILE A 1 51 ? 2.137   -11.490 -7.054  1.00 0.00 ? 51 ILE A HD11 11 
ATOM 11769 H HD12 . ILE A 1 51 ? 2.025   -10.549 -5.566  1.00 0.00 ? 51 ILE A HD12 11 
ATOM 11770 H HD13 . ILE A 1 51 ? 0.567   -10.922 -6.485  1.00 0.00 ? 51 ILE A HD13 11 
ATOM 11771 N N    . VAL A 1 52 ? 5.708   -7.595  -8.665  1.00 0.00 ? 52 VAL A N    11 
ATOM 11772 C CA   . VAL A 1 52 ? 7.098   -7.161  -8.594  1.00 0.00 ? 52 VAL A CA   11 
ATOM 11773 C C    . VAL A 1 52 ? 7.266   -5.760  -9.172  1.00 0.00 ? 52 VAL A C    11 
ATOM 11774 O O    . VAL A 1 52 ? 7.830   -4.875  -8.529  1.00 0.00 ? 52 VAL A O    11 
ATOM 11775 C CB   . VAL A 1 52 ? 8.028   -8.131  -9.346  1.00 0.00 ? 52 VAL A CB   11 
ATOM 11776 C CG1  . VAL A 1 52 ? 9.420   -7.534  -9.487  1.00 0.00 ? 52 VAL A CG1  11 
ATOM 11777 C CG2  . VAL A 1 52 ? 8.084   -9.474  -8.635  1.00 0.00 ? 52 VAL A CG2  11 
ATOM 11778 H H    . VAL A 1 52 ? 5.466   -8.327  -9.270  1.00 0.00 ? 52 VAL A H    11 
ATOM 11779 H HA   . VAL A 1 52 ? 7.391   -7.148  -7.554  1.00 0.00 ? 52 VAL A HA   11 
ATOM 11780 H HB   . VAL A 1 52 ? 7.626   -8.288  -10.336 1.00 0.00 ? 52 VAL A HB   11 
ATOM 11781 H HG11 . VAL A 1 52 ? 9.879   -7.458  -8.512  1.00 0.00 ? 52 VAL A HG11 11 
ATOM 11782 H HG12 . VAL A 1 52 ? 10.022  -8.168  -10.121 1.00 0.00 ? 52 VAL A HG12 11 
ATOM 11783 H HG13 . VAL A 1 52 ? 9.347   -6.550  -9.927  1.00 0.00 ? 52 VAL A HG13 11 
ATOM 11784 H HG21 . VAL A 1 52 ? 9.033   -9.948  -8.837  1.00 0.00 ? 52 VAL A HG21 11 
ATOM 11785 H HG22 . VAL A 1 52 ? 7.977   -9.323  -7.570  1.00 0.00 ? 52 VAL A HG22 11 
ATOM 11786 H HG23 . VAL A 1 52 ? 7.283   -10.104 -8.991  1.00 0.00 ? 52 VAL A HG23 11 
ATOM 11787 N N    . VAL A 1 53 ? 6.772   -5.567  -10.391 1.00 0.00 ? 53 VAL A N    11 
ATOM 11788 C CA   . VAL A 1 53 ? 6.866   -4.273  -11.057 1.00 0.00 ? 53 VAL A CA   11 
ATOM 11789 C C    . VAL A 1 53 ? 6.220   -3.175  -10.219 1.00 0.00 ? 53 VAL A C    11 
ATOM 11790 O O    . VAL A 1 53 ? 6.714   -2.049  -10.167 1.00 0.00 ? 53 VAL A O    11 
ATOM 11791 C CB   . VAL A 1 53 ? 6.197   -4.306  -12.444 1.00 0.00 ? 53 VAL A CB   11 
ATOM 11792 C CG1  . VAL A 1 53 ? 6.311   -2.950  -13.124 1.00 0.00 ? 53 VAL A CG1  11 
ATOM 11793 C CG2  . VAL A 1 53 ? 6.812   -5.398  -13.306 1.00 0.00 ? 53 VAL A CG2  11 
ATOM 11794 H H    . VAL A 1 53 ? 6.334   -6.311  -10.853 1.00 0.00 ? 53 VAL A H    11 
ATOM 11795 H HA   . VAL A 1 53 ? 7.913   -4.041  -11.191 1.00 0.00 ? 53 VAL A HA   11 
ATOM 11796 H HB   . VAL A 1 53 ? 5.149   -4.529  -12.310 1.00 0.00 ? 53 VAL A HB   11 
ATOM 11797 H HG11 . VAL A 1 53 ? 7.130   -2.397  -12.688 1.00 0.00 ? 53 VAL A HG11 11 
ATOM 11798 H HG12 . VAL A 1 53 ? 6.492   -3.091  -14.180 1.00 0.00 ? 53 VAL A HG12 11 
ATOM 11799 H HG13 . VAL A 1 53 ? 5.392   -2.400  -12.986 1.00 0.00 ? 53 VAL A HG13 11 
ATOM 11800 H HG21 . VAL A 1 53 ? 7.233   -4.957  -14.198 1.00 0.00 ? 53 VAL A HG21 11 
ATOM 11801 H HG22 . VAL A 1 53 ? 7.592   -5.899  -12.751 1.00 0.00 ? 53 VAL A HG22 11 
ATOM 11802 H HG23 . VAL A 1 53 ? 6.051   -6.112  -13.581 1.00 0.00 ? 53 VAL A HG23 11 
ATOM 11803 N N    . TRP A 1 54 ? 5.115   -3.512  -9.564  1.00 0.00 ? 54 TRP A N    11 
ATOM 11804 C CA   . TRP A 1 54 ? 4.401   -2.554  -8.727  1.00 0.00 ? 54 TRP A CA   11 
ATOM 11805 C C    . TRP A 1 54 ? 5.200   -2.228  -7.470  1.00 0.00 ? 54 TRP A C    11 
ATOM 11806 O O    . TRP A 1 54 ? 5.303   -1.068  -7.072  1.00 0.00 ? 54 TRP A O    11 
ATOM 11807 C CB   . TRP A 1 54 ? 3.027   -3.106  -8.344  1.00 0.00 ? 54 TRP A CB   11 
ATOM 11808 C CG   . TRP A 1 54 ? 2.194   -2.136  -7.562  1.00 0.00 ? 54 TRP A CG   11 
ATOM 11809 C CD1  . TRP A 1 54 ? 1.131   -1.412  -8.021  1.00 0.00 ? 54 TRP A CD1  11 
ATOM 11810 C CD2  . TRP A 1 54 ? 2.358   -1.783  -6.184  1.00 0.00 ? 54 TRP A CD2  11 
ATOM 11811 N NE1  . TRP A 1 54 ? 0.624   -0.630  -7.012  1.00 0.00 ? 54 TRP A NE1  11 
ATOM 11812 C CE2  . TRP A 1 54 ? 1.358   -0.839  -5.875  1.00 0.00 ? 54 TRP A CE2  11 
ATOM 11813 C CE3  . TRP A 1 54 ? 3.250   -2.173  -5.181  1.00 0.00 ? 54 TRP A CE3  11 
ATOM 11814 C CZ2  . TRP A 1 54 ? 1.229   -0.282  -4.605  1.00 0.00 ? 54 TRP A CZ2  11 
ATOM 11815 C CZ3  . TRP A 1 54 ? 3.120   -1.618  -3.922  1.00 0.00 ? 54 TRP A CZ3  11 
ATOM 11816 C CH2  . TRP A 1 54 ? 2.116   -0.682  -3.643  1.00 0.00 ? 54 TRP A CH2  11 
ATOM 11817 H H    . TRP A 1 54 ? 4.771   -4.426  -9.645  1.00 0.00 ? 54 TRP A H    11 
ATOM 11818 H HA   . TRP A 1 54 ? 4.269   -1.649  -9.301  1.00 0.00 ? 54 TRP A HA   11 
ATOM 11819 H HB2  . TRP A 1 54 ? 2.485   -3.361  -9.242  1.00 0.00 ? 54 TRP A HB2  11 
ATOM 11820 H HB3  . TRP A 1 54 ? 3.159   -3.994  -7.743  1.00 0.00 ? 54 TRP A HB3  11 
ATOM 11821 H HD1  . TRP A 1 54 ? 0.757   -1.456  -9.032  1.00 0.00 ? 54 TRP A HD1  11 
ATOM 11822 H HE1  . TRP A 1 54 ? -0.141  -0.021  -7.093  1.00 0.00 ? 54 TRP A HE1  11 
ATOM 11823 H HE3  . TRP A 1 54 ? 4.030   -2.893  -5.377  1.00 0.00 ? 54 TRP A HE3  11 
ATOM 11824 H HZ2  . TRP A 1 54 ? 0.460   0.440   -4.374  1.00 0.00 ? 54 TRP A HZ2  11 
ATOM 11825 H HZ3  . TRP A 1 54 ? 3.800   -1.907  -3.135  1.00 0.00 ? 54 TRP A HZ3  11 
ATOM 11826 H HH2  . TRP A 1 54 ? 2.052   -0.275  -2.646  1.00 0.00 ? 54 TRP A HH2  11 
ATOM 11827 N N    . PHE A 1 55 ? 5.764   -3.259  -6.849  1.00 0.00 ? 55 PHE A N    11 
ATOM 11828 C CA   . PHE A 1 55 ? 6.554   -3.081  -5.636  1.00 0.00 ? 55 PHE A CA   11 
ATOM 11829 C C    . PHE A 1 55 ? 7.845   -2.323  -5.933  1.00 0.00 ? 55 PHE A C    11 
ATOM 11830 O O    . PHE A 1 55 ? 8.276   -1.480  -5.148  1.00 0.00 ? 55 PHE A O    11 
ATOM 11831 C CB   . PHE A 1 55 ? 6.879   -4.439  -5.010  1.00 0.00 ? 55 PHE A CB   11 
ATOM 11832 C CG   . PHE A 1 55 ? 5.860   -4.895  -4.005  1.00 0.00 ? 55 PHE A CG   11 
ATOM 11833 C CD1  . PHE A 1 55 ? 4.545   -5.113  -4.382  1.00 0.00 ? 55 PHE A CD1  11 
ATOM 11834 C CD2  . PHE A 1 55 ? 6.218   -5.105  -2.683  1.00 0.00 ? 55 PHE A CD2  11 
ATOM 11835 C CE1  . PHE A 1 55 ? 3.605   -5.533  -3.460  1.00 0.00 ? 55 PHE A CE1  11 
ATOM 11836 C CE2  . PHE A 1 55 ? 5.282   -5.525  -1.757  1.00 0.00 ? 55 PHE A CE2  11 
ATOM 11837 C CZ   . PHE A 1 55 ? 3.974   -5.738  -2.145  1.00 0.00 ? 55 PHE A CZ   11 
ATOM 11838 H H    . PHE A 1 55 ? 5.646   -4.161  -7.215  1.00 0.00 ? 55 PHE A H    11 
ATOM 11839 H HA   . PHE A 1 55 ? 5.965   -2.505  -4.940  1.00 0.00 ? 55 PHE A HA   11 
ATOM 11840 H HB2  . PHE A 1 55 ? 6.931   -5.183  -5.790  1.00 0.00 ? 55 PHE A HB2  11 
ATOM 11841 H HB3  . PHE A 1 55 ? 7.835   -4.377  -4.511  1.00 0.00 ? 55 PHE A HB3  11 
ATOM 11842 H HD1  . PHE A 1 55 ? 4.255   -4.952  -5.411  1.00 0.00 ? 55 PHE A HD1  11 
ATOM 11843 H HD2  . PHE A 1 55 ? 7.240   -4.937  -2.377  1.00 0.00 ? 55 PHE A HD2  11 
ATOM 11844 H HE1  . PHE A 1 55 ? 2.583   -5.698  -3.768  1.00 0.00 ? 55 PHE A HE1  11 
ATOM 11845 H HE2  . PHE A 1 55 ? 5.573   -5.685  -0.729  1.00 0.00 ? 55 PHE A HE2  11 
ATOM 11846 H HZ   . PHE A 1 55 ? 3.241   -6.067  -1.424