data_2DB3
# 
_entry.id   2DB3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DB3         
NDB   PR0187       
RCSB  RCSB025204   
WWPDB D_1000025204 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          trt001000262.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DB3 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-14 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sengoku, T.'                                            1 
'Nureki, O.'                                             2 
'Nakamura, A.'                                           3 
'Kobayashi, S.'                                          4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis for RNA unwinding by the DEAD-box protein Drosophila Vasa.'                                           
'Cell(Cambridge,Mass.)'    125 287 300 2006 CELLB5 US 0092-8674 0998 ? 16630817 10.1016/j.cell.2006.01.054 
1       'Crystallization and preliminary X-ray analysis of the helicase domains of Vasa complexed with RNA and an ATP analogue' 
'ACTA CRYSTALLOGR.,SECT.D' 60  320 322 2004 ABCRE6 DK 0907-4449 0766 ? 14747711 10.1107/S0907444903025897  
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sengoku, T.'   1  
primary 'Nureki, O.'    2  
primary 'Nakamura, A.'  3  
primary 'Kobayashi, S.' 4  
primary 'Yokoyama, S.'  5  
1       'Sengoku, T.'   6  
1       'Nureki, O.'    7  
1       'Dohmae, N.'    8  
1       'Nakamura, A.'  9  
1       'Yokoyama, S.'  10 
# 
_cell.entry_id           2DB3 
_cell.length_a           71.050 
_cell.length_b           142.331 
_cell.length_c           130.465 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.86 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2DB3 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(*UP*UP*UP*UP*UP*UP*UP*UP*UP*U)-3'"      3016.700  4    ?       ? ?                  ? 
2 polymer     man 'ATP-dependent RNA helicase vasa'             48340.129 4    3.6.1.3 ? 'RESIDUES 200-623' ? 
3 non-polymer syn 'MAGNESIUM ION'                               24.305    4    ?       ? ?                  ? 
4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   4    ?       ? ?                  ? 
5 water       nat water                                         18.015    1319 ?       ? ?                  ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Vasa protein, Antigen Mab46F11' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no UUUUUUUUUU UUUUUUUUUU E,F,G,H ?              
2 'polypeptide(L)'   no no 
;GPLGSPEFPGEFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPT
PIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKI
GIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTL
MFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFL
SEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRA
TSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTC
;
;GPLGSPEFPGEFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPT
PIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKI
GIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTL
MFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFL
SEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRA
TSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTC
;
A,B,C,D trt001000262.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   U   n 
1 2   U   n 
1 3   U   n 
1 4   U   n 
1 5   U   n 
1 6   U   n 
1 7   U   n 
1 8   U   n 
1 9   U   n 
1 10  U   n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   SER n 
2 6   PRO n 
2 7   GLU n 
2 8   PHE n 
2 9   PRO n 
2 10  GLY n 
2 11  GLU n 
2 12  PHE n 
2 13  TYR n 
2 14  ILE n 
2 15  PRO n 
2 16  PRO n 
2 17  GLU n 
2 18  PRO n 
2 19  SER n 
2 20  ASN n 
2 21  ASP n 
2 22  ALA n 
2 23  ILE n 
2 24  GLU n 
2 25  ILE n 
2 26  PHE n 
2 27  SER n 
2 28  SER n 
2 29  GLY n 
2 30  ILE n 
2 31  ALA n 
2 32  SER n 
2 33  GLY n 
2 34  ILE n 
2 35  HIS n 
2 36  PHE n 
2 37  SER n 
2 38  LYS n 
2 39  TYR n 
2 40  ASN n 
2 41  ASN n 
2 42  ILE n 
2 43  PRO n 
2 44  VAL n 
2 45  LYS n 
2 46  VAL n 
2 47  THR n 
2 48  GLY n 
2 49  SER n 
2 50  ASP n 
2 51  VAL n 
2 52  PRO n 
2 53  GLN n 
2 54  PRO n 
2 55  ILE n 
2 56  GLN n 
2 57  HIS n 
2 58  PHE n 
2 59  THR n 
2 60  SER n 
2 61  ALA n 
2 62  ASP n 
2 63  LEU n 
2 64  ARG n 
2 65  ASP n 
2 66  ILE n 
2 67  ILE n 
2 68  ILE n 
2 69  ASP n 
2 70  ASN n 
2 71  VAL n 
2 72  ASN n 
2 73  LYS n 
2 74  SER n 
2 75  GLY n 
2 76  TYR n 
2 77  LYS n 
2 78  ILE n 
2 79  PRO n 
2 80  THR n 
2 81  PRO n 
2 82  ILE n 
2 83  GLN n 
2 84  LYS n 
2 85  CYS n 
2 86  SER n 
2 87  ILE n 
2 88  PRO n 
2 89  VAL n 
2 90  ILE n 
2 91  SER n 
2 92  SER n 
2 93  GLY n 
2 94  ARG n 
2 95  ASP n 
2 96  LEU n 
2 97  MET n 
2 98  ALA n 
2 99  CYS n 
2 100 ALA n 
2 101 GLN n 
2 102 THR n 
2 103 GLY n 
2 104 SER n 
2 105 GLY n 
2 106 LYS n 
2 107 THR n 
2 108 ALA n 
2 109 ALA n 
2 110 PHE n 
2 111 LEU n 
2 112 LEU n 
2 113 PRO n 
2 114 ILE n 
2 115 LEU n 
2 116 SER n 
2 117 LYS n 
2 118 LEU n 
2 119 LEU n 
2 120 GLU n 
2 121 ASP n 
2 122 PRO n 
2 123 HIS n 
2 124 GLU n 
2 125 LEU n 
2 126 GLU n 
2 127 LEU n 
2 128 GLY n 
2 129 ARG n 
2 130 PRO n 
2 131 GLN n 
2 132 VAL n 
2 133 VAL n 
2 134 ILE n 
2 135 VAL n 
2 136 SER n 
2 137 PRO n 
2 138 THR n 
2 139 ARG n 
2 140 GLU n 
2 141 LEU n 
2 142 ALA n 
2 143 ILE n 
2 144 GLN n 
2 145 ILE n 
2 146 PHE n 
2 147 ASN n 
2 148 GLU n 
2 149 ALA n 
2 150 ARG n 
2 151 LYS n 
2 152 PHE n 
2 153 ALA n 
2 154 PHE n 
2 155 GLU n 
2 156 SER n 
2 157 TYR n 
2 158 LEU n 
2 159 LYS n 
2 160 ILE n 
2 161 GLY n 
2 162 ILE n 
2 163 VAL n 
2 164 TYR n 
2 165 GLY n 
2 166 GLY n 
2 167 THR n 
2 168 SER n 
2 169 PHE n 
2 170 ARG n 
2 171 HIS n 
2 172 GLN n 
2 173 ASN n 
2 174 GLU n 
2 175 CYS n 
2 176 ILE n 
2 177 THR n 
2 178 ARG n 
2 179 GLY n 
2 180 CYS n 
2 181 HIS n 
2 182 VAL n 
2 183 VAL n 
2 184 ILE n 
2 185 ALA n 
2 186 THR n 
2 187 PRO n 
2 188 GLY n 
2 189 ARG n 
2 190 LEU n 
2 191 LEU n 
2 192 ASP n 
2 193 PHE n 
2 194 VAL n 
2 195 ASP n 
2 196 ARG n 
2 197 THR n 
2 198 PHE n 
2 199 ILE n 
2 200 THR n 
2 201 PHE n 
2 202 GLU n 
2 203 ASP n 
2 204 THR n 
2 205 ARG n 
2 206 PHE n 
2 207 VAL n 
2 208 VAL n 
2 209 LEU n 
2 210 ASP n 
2 211 GLU n 
2 212 ALA n 
2 213 ASP n 
2 214 ARG n 
2 215 MET n 
2 216 LEU n 
2 217 ASP n 
2 218 MET n 
2 219 GLY n 
2 220 PHE n 
2 221 SER n 
2 222 GLU n 
2 223 ASP n 
2 224 MET n 
2 225 ARG n 
2 226 ARG n 
2 227 ILE n 
2 228 MET n 
2 229 THR n 
2 230 HIS n 
2 231 VAL n 
2 232 THR n 
2 233 MET n 
2 234 ARG n 
2 235 PRO n 
2 236 GLU n 
2 237 HIS n 
2 238 GLN n 
2 239 THR n 
2 240 LEU n 
2 241 MET n 
2 242 PHE n 
2 243 SER n 
2 244 ALA n 
2 245 THR n 
2 246 PHE n 
2 247 PRO n 
2 248 GLU n 
2 249 GLU n 
2 250 ILE n 
2 251 GLN n 
2 252 ARG n 
2 253 MET n 
2 254 ALA n 
2 255 GLY n 
2 256 GLU n 
2 257 PHE n 
2 258 LEU n 
2 259 LYS n 
2 260 ASN n 
2 261 TYR n 
2 262 VAL n 
2 263 PHE n 
2 264 VAL n 
2 265 ALA n 
2 266 ILE n 
2 267 GLY n 
2 268 ILE n 
2 269 VAL n 
2 270 GLY n 
2 271 GLY n 
2 272 ALA n 
2 273 CYS n 
2 274 SER n 
2 275 ASP n 
2 276 VAL n 
2 277 LYS n 
2 278 GLN n 
2 279 THR n 
2 280 ILE n 
2 281 TYR n 
2 282 GLU n 
2 283 VAL n 
2 284 ASN n 
2 285 LYS n 
2 286 TYR n 
2 287 ALA n 
2 288 LYS n 
2 289 ARG n 
2 290 SER n 
2 291 LYS n 
2 292 LEU n 
2 293 ILE n 
2 294 GLU n 
2 295 ILE n 
2 296 LEU n 
2 297 SER n 
2 298 GLU n 
2 299 GLN n 
2 300 ALA n 
2 301 ASP n 
2 302 GLY n 
2 303 THR n 
2 304 ILE n 
2 305 VAL n 
2 306 PHE n 
2 307 VAL n 
2 308 GLU n 
2 309 THR n 
2 310 LYS n 
2 311 ARG n 
2 312 GLY n 
2 313 ALA n 
2 314 ASP n 
2 315 PHE n 
2 316 LEU n 
2 317 ALA n 
2 318 SER n 
2 319 PHE n 
2 320 LEU n 
2 321 SER n 
2 322 GLU n 
2 323 LYS n 
2 324 GLU n 
2 325 PHE n 
2 326 PRO n 
2 327 THR n 
2 328 THR n 
2 329 SER n 
2 330 ILE n 
2 331 HIS n 
2 332 GLY n 
2 333 ASP n 
2 334 ARG n 
2 335 LEU n 
2 336 GLN n 
2 337 SER n 
2 338 GLN n 
2 339 ARG n 
2 340 GLU n 
2 341 GLN n 
2 342 ALA n 
2 343 LEU n 
2 344 ARG n 
2 345 ASP n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 GLY n 
2 350 SER n 
2 351 MET n 
2 352 LYS n 
2 353 VAL n 
2 354 LEU n 
2 355 ILE n 
2 356 ALA n 
2 357 THR n 
2 358 SER n 
2 359 VAL n 
2 360 ALA n 
2 361 SER n 
2 362 ARG n 
2 363 GLY n 
2 364 LEU n 
2 365 ASP n 
2 366 ILE n 
2 367 LYS n 
2 368 ASN n 
2 369 ILE n 
2 370 LYS n 
2 371 HIS n 
2 372 VAL n 
2 373 ILE n 
2 374 ASN n 
2 375 TYR n 
2 376 ASP n 
2 377 MET n 
2 378 PRO n 
2 379 SER n 
2 380 LYS n 
2 381 ILE n 
2 382 ASP n 
2 383 ASP n 
2 384 TYR n 
2 385 VAL n 
2 386 HIS n 
2 387 ARG n 
2 388 ILE n 
2 389 GLY n 
2 390 ARG n 
2 391 THR n 
2 392 GLY n 
2 393 ARG n 
2 394 VAL n 
2 395 GLY n 
2 396 ASN n 
2 397 ASN n 
2 398 GLY n 
2 399 ARG n 
2 400 ALA n 
2 401 THR n 
2 402 SER n 
2 403 PHE n 
2 404 PHE n 
2 405 ASP n 
2 406 PRO n 
2 407 GLU n 
2 408 LYS n 
2 409 ASP n 
2 410 ARG n 
2 411 ALA n 
2 412 ILE n 
2 413 ALA n 
2 414 ALA n 
2 415 ASP n 
2 416 LEU n 
2 417 VAL n 
2 418 LYS n 
2 419 ILE n 
2 420 LEU n 
2 421 GLU n 
2 422 GLY n 
2 423 SER n 
2 424 GLY n 
2 425 GLN n 
2 426 THR n 
2 427 VAL n 
2 428 PRO n 
2 429 ASP n 
2 430 PHE n 
2 431 LEU n 
2 432 ARG n 
2 433 THR n 
2 434 CYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'fruit fly' 
_entity_src_gen.gene_src_genus                     Drosophila 
_entity_src_gen.pdbx_gene_src_gene                 VASA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 codon plus' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP VASA_DROME 2 
;EFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVI
SSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFR
HQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEI
QRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSI
HGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDR
AIAADLVKILEGSGQTVPDFLRTC
;
200 P09052 ? 
2 PDB 2DB3       1 ? ?   2DB3   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2DB3 A 11 ? 434 ? P09052 200 ? 623 ? 200 623 
2 1 2DB3 B 11 ? 434 ? P09052 200 ? 623 ? 200 623 
3 1 2DB3 C 11 ? 434 ? P09052 200 ? 623 ? 200 623 
4 1 2DB3 D 11 ? 434 ? P09052 200 ? 623 ? 200 623 
5 2 2DB3 E 1  ? 10  ? 2DB3   1   ? 10  ? 1   10  
6 2 2DB3 F 1  ? 10  ? 2DB3   1   ? 10  ? 1   10  
7 2 2DB3 G 1  ? 10  ? 2DB3   1   ? 10  ? 1   10  
8 2 2DB3 H 1  ? 10  ? 2DB3   1   ? 10  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DB3 GLY A 1  ? UNP P09052 ? ? 'CLONING ARTIFACT' 190 1  
1 2DB3 PRO A 2  ? UNP P09052 ? ? 'CLONING ARTIFACT' 191 2  
1 2DB3 LEU A 3  ? UNP P09052 ? ? 'CLONING ARTIFACT' 192 3  
1 2DB3 GLY A 4  ? UNP P09052 ? ? 'CLONING ARTIFACT' 193 4  
1 2DB3 SER A 5  ? UNP P09052 ? ? 'CLONING ARTIFACT' 194 5  
1 2DB3 PRO A 6  ? UNP P09052 ? ? 'CLONING ARTIFACT' 195 6  
1 2DB3 GLU A 7  ? UNP P09052 ? ? 'CLONING ARTIFACT' 196 7  
1 2DB3 PHE A 8  ? UNP P09052 ? ? 'CLONING ARTIFACT' 197 8  
1 2DB3 PRO A 9  ? UNP P09052 ? ? 'CLONING ARTIFACT' 198 9  
1 2DB3 GLY A 10 ? UNP P09052 ? ? 'CLONING ARTIFACT' 199 10 
2 2DB3 GLY B 1  ? UNP P09052 ? ? 'CLONING ARTIFACT' 190 11 
2 2DB3 PRO B 2  ? UNP P09052 ? ? 'CLONING ARTIFACT' 191 12 
2 2DB3 LEU B 3  ? UNP P09052 ? ? 'CLONING ARTIFACT' 192 13 
2 2DB3 GLY B 4  ? UNP P09052 ? ? 'CLONING ARTIFACT' 193 14 
2 2DB3 SER B 5  ? UNP P09052 ? ? 'CLONING ARTIFACT' 194 15 
2 2DB3 PRO B 6  ? UNP P09052 ? ? 'CLONING ARTIFACT' 195 16 
2 2DB3 GLU B 7  ? UNP P09052 ? ? 'CLONING ARTIFACT' 196 17 
2 2DB3 PHE B 8  ? UNP P09052 ? ? 'CLONING ARTIFACT' 197 18 
2 2DB3 PRO B 9  ? UNP P09052 ? ? 'CLONING ARTIFACT' 198 19 
2 2DB3 GLY B 10 ? UNP P09052 ? ? 'CLONING ARTIFACT' 199 20 
3 2DB3 GLY C 1  ? UNP P09052 ? ? 'CLONING ARTIFACT' 190 21 
3 2DB3 PRO C 2  ? UNP P09052 ? ? 'CLONING ARTIFACT' 191 22 
3 2DB3 LEU C 3  ? UNP P09052 ? ? 'CLONING ARTIFACT' 192 23 
3 2DB3 GLY C 4  ? UNP P09052 ? ? 'CLONING ARTIFACT' 193 24 
3 2DB3 SER C 5  ? UNP P09052 ? ? 'CLONING ARTIFACT' 194 25 
3 2DB3 PRO C 6  ? UNP P09052 ? ? 'CLONING ARTIFACT' 195 26 
3 2DB3 GLU C 7  ? UNP P09052 ? ? 'CLONING ARTIFACT' 196 27 
3 2DB3 PHE C 8  ? UNP P09052 ? ? 'CLONING ARTIFACT' 197 28 
3 2DB3 PRO C 9  ? UNP P09052 ? ? 'CLONING ARTIFACT' 198 29 
3 2DB3 GLY C 10 ? UNP P09052 ? ? 'CLONING ARTIFACT' 199 30 
4 2DB3 GLY D 1  ? UNP P09052 ? ? 'CLONING ARTIFACT' 190 31 
4 2DB3 PRO D 2  ? UNP P09052 ? ? 'CLONING ARTIFACT' 191 32 
4 2DB3 LEU D 3  ? UNP P09052 ? ? 'CLONING ARTIFACT' 192 33 
4 2DB3 GLY D 4  ? UNP P09052 ? ? 'CLONING ARTIFACT' 193 34 
4 2DB3 SER D 5  ? UNP P09052 ? ? 'CLONING ARTIFACT' 194 35 
4 2DB3 PRO D 6  ? UNP P09052 ? ? 'CLONING ARTIFACT' 195 36 
4 2DB3 GLU D 7  ? UNP P09052 ? ? 'CLONING ARTIFACT' 196 37 
4 2DB3 PHE D 8  ? UNP P09052 ? ? 'CLONING ARTIFACT' 197 38 
4 2DB3 PRO D 9  ? UNP P09052 ? ? 'CLONING ARTIFACT' 198 39 
4 2DB3 GLY D 10 ? UNP P09052 ? ? 'CLONING ARTIFACT' 199 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                    ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          2DB3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
loop_
_exptl_crystal.id 
_exptl_crystal.density_meas 
_exptl_crystal.density_Matthews 
_exptl_crystal.density_percent_sol 
_exptl_crystal.description 
_exptl_crystal.F_000 
_exptl_crystal.preparation 
1 ? 3.12 60.2 ? ? ? 
2 ? ?    ?    ? ? ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_details    
;0.1M ADA pH 6.5, 0.1M Li2SO4, 1-2% isopropyl alcohol, 69mM Cymal-3, 9-12% PEG4000, pH 6.50, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 ADA                 ? ? ? 
1 2  1 Li2SO4              ? ? ? 
1 3  1 'isopropyl alcohol' ? ? ? 
1 4  1 Cymal-3             ? ? ? 
1 5  1 PEG4000             ? ? ? 
1 6  1 H2O                 ? ? ? 
1 7  2 ADA                 ? ? ? 
1 8  2 Li2SO4              ? ? ? 
1 9  2 PEG4000             ? ? ? 
1 10 2 H2O                 ? ? ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100.0 ? 1 
2 100.0 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD MARRESEARCH 2002-02-22 ? 
2 CCD MARRESEARCH 2003-02-01 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 2 M ? MAD                 x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.912  1.0 
2 0.9794 1.0 
3 0.9796 1.0 
4 0.9840 1.0 
5 0.9710 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'SPRING-8 BEAMLINE BL41XU' SPring-8 BL41XU ? 0.912                            
2 SYNCHROTRON 'SPRING-8 BEAMLINE BL41XU' SPring-8 BL41XU ? '0.9794, 0.9796, 0.9840, 0.9710' 
# 
_reflns.entry_id                     2DB3 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   117511 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         89.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        16.8 
_reflns.B_iso_Wilson_estimate        19.60 
_reflns.pdbx_redundancy              2.700 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.34 
_reflns_shell.percent_possible_all   79.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2DB3 
_refine.ls_number_reflns_obs                     117457 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               2369677.490 
_refine.pdbx_data_cutoff_low_absF                0.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.46 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    89.4 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.25 
_refine.ls_R_factor_R_free_error                 0.002 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  11749 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               39.90 
_refine.aniso_B[1][1]                            -4.10000 
_refine.aniso_B[2][2]                            8.11000 
_refine.aniso_B[3][3]                            -4.01000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            2.20000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.34 
_refine.solvent_model_param_bsol                 45.23 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2DB3 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.31 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.32 
_refine_analyze.Luzzati_sigma_a_free            0.36 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13184 
_refine_hist.pdbx_number_atoms_nucleic_acid   488 
_refine_hist.pdbx_number_atoms_ligand         128 
_refine_hist.number_atoms_solvent             1319 
_refine_hist.number_atoms_total               15119 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        39.46 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.50  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.70 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.92  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.960 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.660 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.490 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.330 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             15530 
_refine_ls_shell.R_factor_R_work                  0.283 
_refine_ls_shell.percent_reflns_obs               79.20 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            0.008 
_refine_ls_shell.percent_reflns_R_free            10.20 
_refine_ls_shell.number_reflns_R_free             1761 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 ANP.PARAM         ANP.TOP     'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
5 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2DB3 
_struct.title                     'Structural basis for RNA unwinding by the DEAD-box protein Drosophila Vasa' 
_struct.pdbx_descriptor           'ATP-dependent RNA helicase vasa(E.C.3.6.1.3)/RNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DB3 
_struct_keywords.pdbx_keywords   HYDROLASE/RNA 
_struct_keywords.text            
;DEAD-BOX, HELICASE, PROTEIN-RNA COMPLEX, ATPase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE-RNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 3 ? 
L N N 4 ? 
M N N 3 ? 
N N N 4 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP E 21  ? PHE E 26  ? ASP A 210 PHE A 215 1 ? 6  
HELX_P HELX_P2  2  HIS E 35  ? ILE E 42  ? HIS A 224 ILE A 231 5 ? 8  
HELX_P HELX_P3  3  HIS E 57  ? ALA E 61  ? HIS A 246 ALA A 250 5 ? 5  
HELX_P HELX_P4  4  ARG E 64  ? SER E 74  ? ARG A 253 SER A 263 1 ? 11 
HELX_P HELX_P5  5  THR E 80  ? SER E 92  ? THR A 269 SER A 281 1 ? 13 
HELX_P HELX_P6  6  GLY E 105 ? ASP E 121 ? GLY A 294 ASP A 310 1 ? 17 
HELX_P HELX_P7  7  THR E 138 ? ALA E 153 ? THR A 327 ALA A 342 1 ? 16 
HELX_P HELX_P8  8  SER E 168 ? THR E 177 ? SER A 357 THR A 366 1 ? 10 
HELX_P HELX_P9  9  THR E 186 ? ARG E 196 ? THR A 375 ARG A 385 1 ? 11 
HELX_P HELX_P10 10 GLU E 211 ? LEU E 216 ? GLU A 400 LEU A 405 1 ? 6  
HELX_P HELX_P11 11 PHE E 220 ? HIS E 230 ? PHE A 409 HIS A 419 1 ? 11 
HELX_P HELX_P12 12 PRO E 247 ? GLU E 256 ? PRO A 436 GLU A 445 1 ? 10 
HELX_P HELX_P13 13 ASN E 284 ? TYR E 286 ? ASN A 473 TYR A 475 5 ? 3  
HELX_P HELX_P14 14 ALA E 287 ? GLN E 299 ? ALA A 476 GLN A 488 1 ? 13 
HELX_P HELX_P15 15 THR E 309 ? LYS E 323 ? THR A 498 LYS A 512 1 ? 15 
HELX_P HELX_P16 16 LEU E 335 ? ASN E 348 ? LEU A 524 ASN A 537 1 ? 14 
HELX_P HELX_P17 17 SER E 358 ? SER E 361 ? SER A 547 SER A 550 5 ? 4  
HELX_P HELX_P18 18 LYS E 380 ? GLY E 389 ? LYS A 569 GLY A 578 1 ? 10 
HELX_P HELX_P19 19 ASP E 409 ? ALA E 411 ? ASP A 598 ALA A 600 5 ? 3  
HELX_P HELX_P20 20 ILE E 412 ? SER E 423 ? ILE A 601 SER A 612 1 ? 12 
HELX_P HELX_P21 21 PRO E 428 ? ARG E 432 ? PRO A 617 ARG A 621 5 ? 5  
HELX_P HELX_P22 22 ASP F 21  ? PHE F 26  ? ASP B 210 PHE B 215 1 ? 6  
HELX_P HELX_P23 23 HIS F 35  ? ILE F 42  ? HIS B 224 ILE B 231 5 ? 8  
HELX_P HELX_P24 24 ARG F 64  ? SER F 74  ? ARG B 253 SER B 263 1 ? 11 
HELX_P HELX_P25 25 THR F 80  ? SER F 92  ? THR B 269 SER B 281 1 ? 13 
HELX_P HELX_P26 26 GLY F 105 ? ASP F 121 ? GLY B 294 ASP B 310 1 ? 17 
HELX_P HELX_P27 27 THR F 138 ? ALA F 153 ? THR B 327 ALA B 342 1 ? 16 
HELX_P HELX_P28 28 SER F 168 ? ARG F 178 ? SER B 357 ARG B 367 1 ? 11 
HELX_P HELX_P29 29 THR F 186 ? ARG F 196 ? THR B 375 ARG B 385 1 ? 11 
HELX_P HELX_P30 30 GLU F 211 ? LEU F 216 ? GLU B 400 LEU B 405 1 ? 6  
HELX_P HELX_P31 31 ASP F 217 ? THR F 229 ? ASP B 406 THR B 418 1 ? 13 
HELX_P HELX_P32 32 PRO F 247 ? GLY F 255 ? PRO B 436 GLY B 444 1 ? 9  
HELX_P HELX_P33 33 GLU F 256 ? LEU F 258 ? GLU B 445 LEU B 447 5 ? 3  
HELX_P HELX_P34 34 ASN F 284 ? TYR F 286 ? ASN B 473 TYR B 475 5 ? 3  
HELX_P HELX_P35 35 ALA F 287 ? GLN F 299 ? ALA B 476 GLN B 488 1 ? 13 
HELX_P HELX_P36 36 THR F 309 ? GLU F 322 ? THR B 498 GLU B 511 1 ? 14 
HELX_P HELX_P37 37 LEU F 335 ? ASN F 348 ? LEU B 524 ASN B 537 1 ? 14 
HELX_P HELX_P38 38 SER F 358 ? SER F 361 ? SER B 547 SER B 550 5 ? 4  
HELX_P HELX_P39 39 LYS F 380 ? GLY F 389 ? LYS B 569 GLY B 578 1 ? 10 
HELX_P HELX_P40 40 ASP F 409 ? ALA F 411 ? ASP B 598 ALA B 600 5 ? 3  
HELX_P HELX_P41 41 ILE F 412 ? SER F 423 ? ILE B 601 SER B 612 1 ? 12 
HELX_P HELX_P42 42 PRO F 428 ? ARG F 432 ? PRO B 617 ARG B 621 5 ? 5  
HELX_P HELX_P43 43 ASP G 21  ? PHE G 26  ? ASP C 210 PHE C 215 1 ? 6  
HELX_P HELX_P44 44 HIS G 35  ? ILE G 42  ? HIS C 224 ILE C 231 5 ? 8  
HELX_P HELX_P45 45 HIS G 57  ? ALA G 61  ? HIS C 246 ALA C 250 5 ? 5  
HELX_P HELX_P46 46 ARG G 64  ? SER G 74  ? ARG C 253 SER C 263 1 ? 11 
HELX_P HELX_P47 47 THR G 80  ? SER G 92  ? THR C 269 SER C 281 1 ? 13 
HELX_P HELX_P48 48 GLY G 105 ? ASP G 121 ? GLY C 294 ASP C 310 1 ? 17 
HELX_P HELX_P49 49 THR G 138 ? ALA G 153 ? THR C 327 ALA C 342 1 ? 16 
HELX_P HELX_P50 50 SER G 168 ? ARG G 178 ? SER C 357 ARG C 367 1 ? 11 
HELX_P HELX_P51 51 THR G 186 ? ARG G 196 ? THR C 375 ARG C 385 1 ? 11 
HELX_P HELX_P52 52 GLU G 211 ? ASP G 217 ? GLU C 400 ASP C 406 1 ? 7  
HELX_P HELX_P53 53 ASP G 217 ? THR G 229 ? ASP C 406 THR C 418 1 ? 13 
HELX_P HELX_P54 54 PRO G 247 ? GLY G 255 ? PRO C 436 GLY C 444 1 ? 9  
HELX_P HELX_P55 55 GLU G 256 ? LEU G 258 ? GLU C 445 LEU C 447 5 ? 3  
HELX_P HELX_P56 56 ASN G 284 ? TYR G 286 ? ASN C 473 TYR C 475 5 ? 3  
HELX_P HELX_P57 57 ALA G 287 ? GLN G 299 ? ALA C 476 GLN C 488 1 ? 13 
HELX_P HELX_P58 58 THR G 309 ? LYS G 323 ? THR C 498 LYS C 512 1 ? 15 
HELX_P HELX_P59 59 LEU G 335 ? ASN G 348 ? LEU C 524 ASN C 537 1 ? 14 
HELX_P HELX_P60 60 SER G 358 ? SER G 361 ? SER C 547 SER C 550 5 ? 4  
HELX_P HELX_P61 61 LYS G 380 ? GLY G 389 ? LYS C 569 GLY C 578 1 ? 10 
HELX_P HELX_P62 62 ASP G 409 ? ALA G 411 ? ASP C 598 ALA C 600 5 ? 3  
HELX_P HELX_P63 63 ILE G 412 ? SER G 423 ? ILE C 601 SER C 612 1 ? 12 
HELX_P HELX_P64 64 PRO G 428 ? ARG G 432 ? PRO C 617 ARG C 621 5 ? 5  
HELX_P HELX_P65 65 ASP H 21  ? PHE H 26  ? ASP D 210 PHE D 215 1 ? 6  
HELX_P HELX_P66 66 PHE H 36  ? ILE H 42  ? PHE D 225 ILE D 231 5 ? 7  
HELX_P HELX_P67 67 ARG H 64  ? SER H 74  ? ARG D 253 SER D 263 1 ? 11 
HELX_P HELX_P68 68 THR H 80  ? SER H 92  ? THR D 269 SER D 281 1 ? 13 
HELX_P HELX_P69 69 GLY H 105 ? ASP H 121 ? GLY D 294 ASP D 310 1 ? 17 
HELX_P HELX_P70 70 THR H 138 ? ALA H 153 ? THR D 327 ALA D 342 1 ? 16 
HELX_P HELX_P71 71 SER H 168 ? ARG H 178 ? SER D 357 ARG D 367 1 ? 11 
HELX_P HELX_P72 72 THR H 186 ? ARG H 196 ? THR D 375 ARG D 385 1 ? 11 
HELX_P HELX_P73 73 GLU H 211 ? LEU H 216 ? GLU D 400 LEU D 405 1 ? 6  
HELX_P HELX_P74 74 ASP H 217 ? THR H 229 ? ASP D 406 THR D 418 1 ? 13 
HELX_P HELX_P75 75 PRO H 247 ? GLY H 255 ? PRO D 436 GLY D 444 1 ? 9  
HELX_P HELX_P76 76 GLU H 256 ? LEU H 258 ? GLU D 445 LEU D 447 5 ? 3  
HELX_P HELX_P77 77 ASN H 284 ? TYR H 286 ? ASN D 473 TYR D 475 5 ? 3  
HELX_P HELX_P78 78 ALA H 287 ? GLN H 299 ? ALA D 476 GLN D 488 1 ? 13 
HELX_P HELX_P79 79 THR H 309 ? GLU H 322 ? THR D 498 GLU D 511 1 ? 14 
HELX_P HELX_P80 80 LEU H 335 ? ASN H 348 ? LEU D 524 ASN D 537 1 ? 14 
HELX_P HELX_P81 81 SER H 358 ? SER H 361 ? SER D 547 SER D 550 5 ? 4  
HELX_P HELX_P82 82 LYS H 380 ? GLY H 389 ? LYS D 569 GLY D 578 1 ? 10 
HELX_P HELX_P83 83 ASP H 409 ? ALA H 411 ? ASP D 598 ALA D 600 5 ? 3  
HELX_P HELX_P84 84 ILE H 412 ? SER H 423 ? ILE D 601 SER D 612 1 ? 12 
HELX_P HELX_P85 85 PRO H 428 ? ARG H 432 ? PRO D 617 ARG D 621 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I MG . MG ? ? ? 1_555 U HOH . O   ? ? A MG 2801 A HOH 2903 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc2  metalc ? ? I MG . MG ? ? ? 1_555 U HOH . O   ? ? A MG 2801 A HOH 3008 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc3  metalc ? ? I MG . MG ? ? ? 1_555 U HOH . O   ? ? A MG 2801 A HOH 3054 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc4  metalc ? ? I MG . MG ? ? ? 1_555 U HOH . O   ? ? A MG 2801 A HOH 3105 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc5  metalc ? ? I MG . MG ? ? ? 1_555 J ANP . O3G ? ? A MG 2801 A ANP 2901 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc6  metalc ? ? I MG . MG ? ? ? 1_555 J ANP . O1B ? ? A MG 2801 A ANP 2901 1_555 ? ? ? ? ? ? ? 2.372 ? 
metalc7  metalc ? ? K MG . MG ? ? ? 1_555 V HOH . O   ? ? B MG 2802 B HOH 3046 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc8  metalc ? ? K MG . MG ? ? ? 1_555 V HOH . O   ? ? B MG 2802 B HOH 3118 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc9  metalc ? ? K MG . MG ? ? ? 1_555 L ANP . O3G ? ? B MG 2802 B ANP 2902 1_555 ? ? ? ? ? ? ? 2.147 ? 
metalc10 metalc ? ? K MG . MG ? ? ? 1_555 L ANP . O1B ? ? B MG 2802 B ANP 2902 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc11 metalc ? ? K MG . MG ? ? ? 1_555 V HOH . O   ? ? B MG 2802 B HOH 2903 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc12 metalc ? ? K MG . MG ? ? ? 1_555 V HOH . O   ? ? B MG 2802 B HOH 3044 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc13 metalc ? ? M MG . MG ? ? ? 1_555 N ANP . O1B ? ? C MG 2803 C ANP 2903 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc14 metalc ? ? M MG . MG ? ? ? 1_555 W HOH . O   ? ? C MG 2803 C HOH 2904 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc15 metalc ? ? M MG . MG ? ? ? 1_555 W HOH . O   ? ? C MG 2803 C HOH 2905 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc16 metalc ? ? M MG . MG ? ? ? 1_555 W HOH . O   ? ? C MG 2803 C HOH 3178 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc17 metalc ? ? M MG . MG ? ? ? 1_555 W HOH . O   ? ? C MG 2803 C HOH 3177 1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc18 metalc ? ? M MG . MG ? ? ? 1_555 N ANP . O3G ? ? C MG 2803 C ANP 2903 1_555 ? ? ? ? ? ? ? 2.118 ? 
metalc19 metalc ? ? O MG . MG ? ? ? 1_555 P ANP . O1B ? ? D MG 2804 D ANP 2904 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc20 metalc ? ? O MG . MG ? ? ? 1_555 X HOH . O   ? ? D MG 2804 D HOH 3034 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc21 metalc ? ? O MG . MG ? ? ? 1_555 X HOH . O   ? ? D MG 2804 D HOH 3095 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc22 metalc ? ? O MG . MG ? ? ? 1_555 X HOH . O   ? ? D MG 2804 D HOH 3096 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc23 metalc ? ? O MG . MG ? ? ? 1_555 X HOH . O   ? ? D MG 2804 D HOH 2905 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc24 metalc ? ? O MG . MG ? ? ? 1_555 P ANP . O3G ? ? D MG 2804 D ANP 2904 1_555 ? ? ? ? ? ? ? 2.201 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 6 ? 
C ? 8 ? 
D ? 6 ? 
E ? 8 ? 
F ? 6 ? 
G ? 8 ? 
H ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? parallel      
C 6 7 ? parallel      
C 7 8 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? parallel      
E 6 7 ? parallel      
E 7 8 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? parallel      
G 7 8 ? parallel      
H 1 2 ? parallel      
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
H 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL E 44  ? THR E 47  ? VAL A 233 THR A 236 
A 2 VAL E 262 ? ILE E 266 ? VAL A 451 ILE A 455 
A 3 LEU E 96  ? CYS E 99  ? LEU A 285 CYS A 288 
A 4 GLN E 238 ? SER E 243 ? GLN A 427 SER A 432 
A 5 PHE E 206 ? ASP E 210 ? PHE A 395 ASP A 399 
A 6 VAL E 132 ? VAL E 135 ? VAL A 321 VAL A 324 
A 7 VAL E 182 ? ALA E 185 ? VAL A 371 ALA A 374 
A 8 ILE E 162 ? VAL E 163 ? ILE A 351 VAL A 352 
B 1 VAL E 276 ? GLU E 282 ? VAL A 465 GLU A 471 
B 2 GLY E 398 ? PHE E 404 ? GLY A 587 PHE A 593 
B 3 HIS E 371 ? ASN E 374 ? HIS A 560 ASN A 563 
B 4 THR E 303 ? PHE E 306 ? THR A 492 PHE A 495 
B 5 VAL E 353 ? ALA E 356 ? VAL A 542 ALA A 545 
B 6 THR E 327 ? ILE E 330 ? THR A 516 ILE A 519 
C 1 VAL F 44  ? THR F 47  ? VAL B 233 THR B 236 
C 2 VAL F 262 ? ILE F 266 ? VAL B 451 ILE B 455 
C 3 LEU F 96  ? ALA F 100 ? LEU B 285 ALA B 289 
C 4 GLN F 238 ? SER F 243 ? GLN B 427 SER B 432 
C 5 PHE F 206 ? ASP F 210 ? PHE B 395 ASP B 399 
C 6 VAL F 132 ? VAL F 135 ? VAL B 321 VAL B 324 
C 7 VAL F 182 ? ALA F 185 ? VAL B 371 ALA B 374 
C 8 ILE F 160 ? VAL F 163 ? ILE B 349 VAL B 352 
D 1 VAL F 276 ? GLU F 282 ? VAL B 465 GLU B 471 
D 2 GLY F 398 ? PHE F 404 ? GLY B 587 PHE B 593 
D 3 HIS F 371 ? ASN F 374 ? HIS B 560 ASN B 563 
D 4 THR F 303 ? PHE F 306 ? THR B 492 PHE B 495 
D 5 VAL F 353 ? ALA F 356 ? VAL B 542 ALA B 545 
D 6 THR F 327 ? ILE F 330 ? THR B 516 ILE B 519 
E 1 VAL G 44  ? THR G 47  ? VAL C 233 THR C 236 
E 2 VAL G 262 ? ILE G 266 ? VAL C 451 ILE C 455 
E 3 LEU G 96  ? CYS G 99  ? LEU C 285 CYS C 288 
E 4 GLN G 238 ? SER G 243 ? GLN C 427 SER C 432 
E 5 PHE G 206 ? LEU G 209 ? PHE C 395 LEU C 398 
E 6 VAL G 132 ? VAL G 135 ? VAL C 321 VAL C 324 
E 7 VAL G 182 ? ALA G 185 ? VAL C 371 ALA C 374 
E 8 ILE G 160 ? VAL G 163 ? ILE C 349 VAL C 352 
F 1 VAL G 276 ? GLU G 282 ? VAL C 465 GLU C 471 
F 2 GLY G 398 ? PHE G 404 ? GLY C 587 PHE C 593 
F 3 HIS G 371 ? ASN G 374 ? HIS C 560 ASN C 563 
F 4 THR G 303 ? PHE G 306 ? THR C 492 PHE C 495 
F 5 VAL G 353 ? ALA G 356 ? VAL C 542 ALA C 545 
F 6 THR G 327 ? ILE G 330 ? THR C 516 ILE C 519 
G 1 VAL H 44  ? THR H 47  ? VAL D 233 THR D 236 
G 2 VAL H 262 ? ILE H 266 ? VAL D 451 ILE D 455 
G 3 LEU H 96  ? CYS H 99  ? LEU D 285 CYS D 288 
G 4 GLN H 238 ? SER H 243 ? GLN D 427 SER D 432 
G 5 PHE H 206 ? ASP H 210 ? PHE D 395 ASP D 399 
G 6 VAL H 132 ? VAL H 135 ? VAL D 321 VAL D 324 
G 7 VAL H 182 ? ALA H 185 ? VAL D 371 ALA D 374 
G 8 ILE H 160 ? VAL H 163 ? ILE D 349 VAL D 352 
H 1 VAL H 276 ? GLU H 282 ? VAL D 465 GLU D 471 
H 2 GLY H 398 ? PHE H 404 ? GLY D 587 PHE D 593 
H 3 HIS H 371 ? ASN H 374 ? HIS D 560 ASN D 563 
H 4 THR H 303 ? PHE H 306 ? THR D 492 PHE D 495 
H 5 VAL H 353 ? ALA H 356 ? VAL D 542 ALA D 545 
H 6 THR H 327 ? ILE H 330 ? THR D 516 ILE D 519 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR E 47  ? N THR A 236 O PHE E 263 ? O PHE A 452 
A 2 3 O VAL E 264 ? O VAL A 453 N CYS E 99  ? N CYS A 288 
A 3 4 N ALA E 98  ? N ALA A 287 O MET E 241 ? O MET A 430 
A 4 5 O LEU E 240 ? O LEU A 429 N LEU E 209 ? N LEU A 398 
A 5 6 O VAL E 208 ? O VAL A 397 N VAL E 135 ? N VAL A 324 
A 6 7 N VAL E 132 ? N VAL A 321 O VAL E 183 ? O VAL A 372 
A 7 8 O ILE E 184 ? O ILE A 373 N VAL E 163 ? N VAL A 352 
B 1 2 N LYS E 277 ? N LYS A 466 O GLY E 398 ? O GLY A 587 
B 2 3 O PHE E 403 ? O PHE A 592 N ASN E 374 ? N ASN A 563 
B 3 4 O ILE E 373 ? O ILE A 562 N PHE E 306 ? N PHE A 495 
B 4 5 N VAL E 305 ? N VAL A 494 O ALA E 356 ? O ALA A 545 
B 5 6 O ILE E 355 ? O ILE A 544 N THR E 328 ? N THR A 517 
C 1 2 N LYS F 45  ? N LYS B 234 O ALA F 265 ? O ALA B 454 
C 2 3 O VAL F 264 ? O VAL B 453 N CYS F 99  ? N CYS B 288 
C 3 4 N ALA F 98  ? N ALA B 287 O MET F 241 ? O MET B 430 
C 4 5 O LEU F 240 ? O LEU B 429 N LEU F 209 ? N LEU B 398 
C 5 6 O VAL F 208 ? O VAL B 397 N VAL F 133 ? N VAL B 322 
C 6 7 N ILE F 134 ? N ILE B 323 O VAL F 183 ? O VAL B 372 
C 7 8 O VAL F 182 ? O VAL B 371 N GLY F 161 ? N GLY B 350 
D 1 2 N TYR F 281 ? N TYR B 470 O PHE F 404 ? O PHE B 593 
D 2 3 O THR F 401 ? O THR B 590 N VAL F 372 ? N VAL B 561 
D 3 4 O ILE F 373 ? O ILE B 562 N PHE F 306 ? N PHE B 495 
D 4 5 N VAL F 305 ? N VAL B 494 O LEU F 354 ? O LEU B 543 
D 5 6 O ILE F 355 ? O ILE B 544 N ILE F 330 ? N ILE B 519 
E 1 2 N THR G 47  ? N THR C 236 O PHE G 263 ? O PHE C 452 
E 2 3 O VAL G 264 ? O VAL C 453 N CYS G 99  ? N CYS C 288 
E 3 4 N ALA G 98  ? N ALA C 287 O MET G 241 ? O MET C 430 
E 4 5 O LEU G 240 ? O LEU C 429 N LEU G 209 ? N LEU C 398 
E 5 6 O VAL G 208 ? O VAL C 397 N VAL G 133 ? N VAL C 322 
E 6 7 N VAL G 132 ? N VAL C 321 O VAL G 183 ? O VAL C 372 
E 7 8 O VAL G 182 ? O VAL C 371 N GLY G 161 ? N GLY C 350 
F 1 2 N TYR G 281 ? N TYR C 470 O PHE G 404 ? O PHE C 593 
F 2 3 O THR G 401 ? O THR C 590 N ASN G 374 ? N ASN C 563 
F 3 4 O ILE G 373 ? O ILE C 562 N PHE G 306 ? N PHE C 495 
F 4 5 N VAL G 305 ? N VAL C 494 O ALA G 356 ? O ALA C 545 
F 5 6 O ILE G 355 ? O ILE C 544 N ILE G 330 ? N ILE C 519 
G 1 2 N LYS H 45  ? N LYS D 234 O ALA H 265 ? O ALA D 454 
G 2 3 O ILE H 266 ? O ILE D 455 N CYS H 99  ? N CYS D 288 
G 3 4 N ALA H 98  ? N ALA D 287 O MET H 241 ? O MET D 430 
G 4 5 O LEU H 240 ? O LEU D 429 N VAL H 207 ? N VAL D 396 
G 5 6 O VAL H 208 ? O VAL D 397 N VAL H 133 ? N VAL D 322 
G 6 7 N ILE H 134 ? N ILE D 323 O ALA H 185 ? O ALA D 374 
G 7 8 O VAL H 182 ? O VAL D 371 N GLY H 161 ? N GLY D 350 
H 1 2 N TYR H 281 ? N TYR D 470 O PHE H 404 ? O PHE D 593 
H 2 3 O THR H 401 ? O THR D 590 N VAL H 372 ? N VAL D 561 
H 3 4 O ILE H 373 ? O ILE D 562 N PHE H 306 ? N PHE D 495 
H 4 5 N VAL H 305 ? N VAL D 494 O LEU H 354 ? O LEU D 543 
H 5 6 O ILE H 355 ? O ILE D 544 N THR H 328 ? N THR D 517 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 2801'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 2802'  
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG C 2803'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG D 2804'  
AC5 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE ANP A 2901' 
AC6 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE ANP B 2902' 
AC7 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE ANP C 2903' 
AC8 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ANP D 2904' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ASP E 210 ? ASP A 399  . ? 1_555 ? 
2   AC1 6  ANP J .   ? ANP A 2901 . ? 1_555 ? 
3   AC1 6  HOH U .   ? HOH A 2903 . ? 1_555 ? 
4   AC1 6  HOH U .   ? HOH A 3008 . ? 1_555 ? 
5   AC1 6  HOH U .   ? HOH A 3054 . ? 1_555 ? 
6   AC1 6  HOH U .   ? HOH A 3105 . ? 1_555 ? 
7   AC2 6  ASP F 210 ? ASP B 399  . ? 1_555 ? 
8   AC2 6  ANP L .   ? ANP B 2902 . ? 1_555 ? 
9   AC2 6  HOH V .   ? HOH B 2903 . ? 1_555 ? 
10  AC2 6  HOH V .   ? HOH B 3044 . ? 1_555 ? 
11  AC2 6  HOH V .   ? HOH B 3046 . ? 1_555 ? 
12  AC2 6  HOH V .   ? HOH B 3118 . ? 1_555 ? 
13  AC3 6  ASP G 210 ? ASP C 399  . ? 1_555 ? 
14  AC3 6  ANP N .   ? ANP C 2903 . ? 1_555 ? 
15  AC3 6  HOH W .   ? HOH C 2904 . ? 1_555 ? 
16  AC3 6  HOH W .   ? HOH C 2905 . ? 1_555 ? 
17  AC3 6  HOH W .   ? HOH C 3177 . ? 1_555 ? 
18  AC3 6  HOH W .   ? HOH C 3178 . ? 1_555 ? 
19  AC4 6  ASP H 210 ? ASP D 399  . ? 1_555 ? 
20  AC4 6  ANP P .   ? ANP D 2904 . ? 1_555 ? 
21  AC4 6  HOH X .   ? HOH D 2905 . ? 1_555 ? 
22  AC4 6  HOH X .   ? HOH D 3034 . ? 1_555 ? 
23  AC4 6  HOH X .   ? HOH D 3095 . ? 1_555 ? 
24  AC4 6  HOH X .   ? HOH D 3096 . ? 1_555 ? 
25  AC5 27 GLY E 29  ? GLY A 218  . ? 1_555 ? 
26  AC5 27 ILE E 30  ? ILE A 219  . ? 1_555 ? 
27  AC5 27 PHE E 36  ? PHE A 225  . ? 1_555 ? 
28  AC5 27 PHE E 58  ? PHE A 247  . ? 1_555 ? 
29  AC5 27 TYR E 76  ? TYR A 265  . ? 1_555 ? 
30  AC5 27 ILE E 78  ? ILE A 267  . ? 1_555 ? 
31  AC5 27 GLN E 83  ? GLN A 272  . ? 1_555 ? 
32  AC5 27 THR E 102 ? THR A 291  . ? 1_555 ? 
33  AC5 27 GLY E 103 ? GLY A 292  . ? 1_555 ? 
34  AC5 27 SER E 104 ? SER A 293  . ? 1_555 ? 
35  AC5 27 GLY E 105 ? GLY A 294  . ? 1_555 ? 
36  AC5 27 LYS E 106 ? LYS A 295  . ? 1_555 ? 
37  AC5 27 THR E 107 ? THR A 296  . ? 1_555 ? 
38  AC5 27 GLU E 211 ? GLU A 400  . ? 1_555 ? 
39  AC5 27 GLY E 363 ? GLY A 552  . ? 1_555 ? 
40  AC5 27 ASP E 365 ? ASP A 554  . ? 1_555 ? 
41  AC5 27 ARG E 390 ? ARG A 579  . ? 1_555 ? 
42  AC5 27 ARG E 393 ? ARG A 582  . ? 1_555 ? 
43  AC5 27 VAL E 394 ? VAL A 583  . ? 1_555 ? 
44  AC5 27 MG  I .   ? MG  A 2801 . ? 1_555 ? 
45  AC5 27 HOH U .   ? HOH A 2902 . ? 1_555 ? 
46  AC5 27 HOH U .   ? HOH A 2903 . ? 1_555 ? 
47  AC5 27 HOH U .   ? HOH A 2905 . ? 1_555 ? 
48  AC5 27 HOH U .   ? HOH A 2910 . ? 1_555 ? 
49  AC5 27 HOH U .   ? HOH A 2912 . ? 1_555 ? 
50  AC5 27 HOH U .   ? HOH A 2934 . ? 1_555 ? 
51  AC5 27 HOH U .   ? HOH A 3030 . ? 1_555 ? 
52  AC6 25 GLY F 29  ? GLY B 218  . ? 1_555 ? 
53  AC6 25 ILE F 30  ? ILE B 219  . ? 1_555 ? 
54  AC6 25 PHE F 58  ? PHE B 247  . ? 1_555 ? 
55  AC6 25 TYR F 76  ? TYR B 265  . ? 1_555 ? 
56  AC6 25 ILE F 78  ? ILE B 267  . ? 1_555 ? 
57  AC6 25 GLN F 83  ? GLN B 272  . ? 1_555 ? 
58  AC6 25 THR F 102 ? THR B 291  . ? 1_555 ? 
59  AC6 25 GLY F 103 ? GLY B 292  . ? 1_555 ? 
60  AC6 25 SER F 104 ? SER B 293  . ? 1_555 ? 
61  AC6 25 GLY F 105 ? GLY B 294  . ? 1_555 ? 
62  AC6 25 LYS F 106 ? LYS B 295  . ? 1_555 ? 
63  AC6 25 THR F 107 ? THR B 296  . ? 1_555 ? 
64  AC6 25 GLU F 211 ? GLU B 400  . ? 1_555 ? 
65  AC6 25 GLY F 363 ? GLY B 552  . ? 1_555 ? 
66  AC6 25 ASP F 365 ? ASP B 554  . ? 1_555 ? 
67  AC6 25 ARG F 390 ? ARG B 579  . ? 1_555 ? 
68  AC6 25 ARG F 393 ? ARG B 582  . ? 1_555 ? 
69  AC6 25 VAL F 394 ? VAL B 583  . ? 1_555 ? 
70  AC6 25 MG  K .   ? MG  B 2802 . ? 1_555 ? 
71  AC6 25 HOH V .   ? HOH B 2924 . ? 1_555 ? 
72  AC6 25 HOH V .   ? HOH B 2935 . ? 1_555 ? 
73  AC6 25 HOH V .   ? HOH B 2945 . ? 1_555 ? 
74  AC6 25 HOH V .   ? HOH B 2948 . ? 1_555 ? 
75  AC6 25 HOH V .   ? HOH B 2971 . ? 1_555 ? 
76  AC6 25 HOH V .   ? HOH B 3044 . ? 1_555 ? 
77  AC7 29 GLY G 29  ? GLY C 218  . ? 1_555 ? 
78  AC7 29 ILE G 30  ? ILE C 219  . ? 1_555 ? 
79  AC7 29 TYR G 76  ? TYR C 265  . ? 1_555 ? 
80  AC7 29 ILE G 78  ? ILE C 267  . ? 1_555 ? 
81  AC7 29 THR G 80  ? THR C 269  . ? 1_555 ? 
82  AC7 29 GLN G 83  ? GLN C 272  . ? 1_555 ? 
83  AC7 29 THR G 102 ? THR C 291  . ? 1_555 ? 
84  AC7 29 GLY G 103 ? GLY C 292  . ? 1_555 ? 
85  AC7 29 SER G 104 ? SER C 293  . ? 1_555 ? 
86  AC7 29 GLY G 105 ? GLY C 294  . ? 1_555 ? 
87  AC7 29 LYS G 106 ? LYS C 295  . ? 1_555 ? 
88  AC7 29 THR G 107 ? THR C 296  . ? 1_555 ? 
89  AC7 29 GLU G 211 ? GLU C 400  . ? 1_555 ? 
90  AC7 29 GLY G 363 ? GLY C 552  . ? 1_555 ? 
91  AC7 29 ASP G 365 ? ASP C 554  . ? 1_555 ? 
92  AC7 29 ARG G 390 ? ARG C 579  . ? 1_555 ? 
93  AC7 29 ARG G 393 ? ARG C 582  . ? 1_555 ? 
94  AC7 29 VAL G 394 ? VAL C 583  . ? 1_555 ? 
95  AC7 29 MG  M .   ? MG  C 2803 . ? 1_555 ? 
96  AC7 29 HOH W .   ? HOH C 2905 . ? 1_555 ? 
97  AC7 29 HOH W .   ? HOH C 2906 . ? 1_555 ? 
98  AC7 29 HOH W .   ? HOH C 2934 . ? 1_555 ? 
99  AC7 29 HOH W .   ? HOH C 2937 . ? 1_555 ? 
100 AC7 29 HOH W .   ? HOH C 2954 . ? 1_555 ? 
101 AC7 29 HOH W .   ? HOH C 2958 . ? 1_555 ? 
102 AC7 29 HOH W .   ? HOH C 2987 . ? 1_555 ? 
103 AC7 29 HOH W .   ? HOH C 3018 . ? 1_555 ? 
104 AC7 29 HOH W .   ? HOH C 3178 . ? 1_555 ? 
105 AC7 29 HOH W .   ? HOH C 3296 . ? 1_555 ? 
106 AC8 23 ILE H 30  ? ILE D 219  . ? 1_555 ? 
107 AC8 23 TYR H 76  ? TYR D 265  . ? 1_555 ? 
108 AC8 23 ILE H 78  ? ILE D 267  . ? 1_555 ? 
109 AC8 23 GLN H 83  ? GLN D 272  . ? 1_555 ? 
110 AC8 23 THR H 102 ? THR D 291  . ? 1_555 ? 
111 AC8 23 GLY H 103 ? GLY D 292  . ? 1_555 ? 
112 AC8 23 SER H 104 ? SER D 293  . ? 1_555 ? 
113 AC8 23 GLY H 105 ? GLY D 294  . ? 1_555 ? 
114 AC8 23 LYS H 106 ? LYS D 295  . ? 1_555 ? 
115 AC8 23 THR H 107 ? THR D 296  . ? 1_555 ? 
116 AC8 23 GLU H 211 ? GLU D 400  . ? 1_555 ? 
117 AC8 23 GLY H 363 ? GLY D 552  . ? 1_555 ? 
118 AC8 23 ASP H 365 ? ASP D 554  . ? 1_555 ? 
119 AC8 23 ARG H 390 ? ARG D 579  . ? 1_555 ? 
120 AC8 23 ARG H 393 ? ARG D 582  . ? 1_555 ? 
121 AC8 23 VAL H 394 ? VAL D 583  . ? 1_555 ? 
122 AC8 23 MG  O .   ? MG  D 2804 . ? 1_555 ? 
123 AC8 23 HOH X .   ? HOH D 2906 . ? 1_555 ? 
124 AC8 23 HOH X .   ? HOH D 2913 . ? 1_555 ? 
125 AC8 23 HOH X .   ? HOH D 2919 . ? 1_555 ? 
126 AC8 23 HOH X .   ? HOH D 2999 . ? 1_555 ? 
127 AC8 23 HOH X .   ? HOH D 3034 . ? 1_555 ? 
128 AC8 23 HOH X .   ? HOH D 3155 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2DB3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DB3 
_atom_sites.fract_transf_matrix[1][1]   0.014075 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000211 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007026 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007666 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O3'" . U   A 1 1   ? 19.361  61.883  57.722  1.00 58.69 ? 1    U   E "O3'" 1 
ATOM   2     P  P     . U   A 1 2   ? 19.358  63.411  57.206  1.00 59.54 ? 2    U   E P     1 
ATOM   3     O  OP1   . U   A 1 2   ? 18.487  64.205  58.123  1.00 58.43 ? 2    U   E OP1   1 
ATOM   4     O  OP2   . U   A 1 2   ? 19.086  63.408  55.739  1.00 58.32 ? 2    U   E OP2   1 
ATOM   5     O  "O5'" . U   A 1 2   ? 20.863  63.889  57.419  1.00 54.79 ? 2    U   E "O5'" 1 
ATOM   6     C  "C5'" . U   A 1 2   ? 21.486  63.775  58.690  1.00 47.54 ? 2    U   E "C5'" 1 
ATOM   7     C  "C4'" . U   A 1 2   ? 22.980  63.840  58.535  1.00 42.89 ? 2    U   E "C4'" 1 
ATOM   8     O  "O4'" . U   A 1 2   ? 23.445  62.709  57.753  1.00 41.04 ? 2    U   E "O4'" 1 
ATOM   9     C  "C3'" . U   A 1 2   ? 23.485  65.035  57.749  1.00 39.38 ? 2    U   E "C3'" 1 
ATOM   10    O  "O3'" . U   A 1 2   ? 23.559  66.180  58.573  1.00 35.78 ? 2    U   E "O3'" 1 
ATOM   11    C  "C2'" . U   A 1 2   ? 24.868  64.567  57.331  1.00 40.44 ? 2    U   E "C2'" 1 
ATOM   12    O  "O2'" . U   A 1 2   ? 25.807  64.687  58.378  1.00 38.56 ? 2    U   E "O2'" 1 
ATOM   13    C  "C1'" . U   A 1 2   ? 24.601  63.090  57.021  1.00 41.80 ? 2    U   E "C1'" 1 
ATOM   14    N  N1    . U   A 1 2   ? 24.363  62.852  55.588  1.00 43.58 ? 2    U   E N1    1 
ATOM   15    C  C2    . U   A 1 2   ? 25.438  63.005  54.740  1.00 43.82 ? 2    U   E C2    1 
ATOM   16    O  O2    . U   A 1 2   ? 26.548  63.288  55.133  1.00 45.53 ? 2    U   E O2    1 
ATOM   17    N  N3    . U   A 1 2   ? 25.168  62.809  53.413  1.00 45.41 ? 2    U   E N3    1 
ATOM   18    C  C4    . U   A 1 2   ? 23.956  62.461  52.856  1.00 45.57 ? 2    U   E C4    1 
ATOM   19    O  O4    . U   A 1 2   ? 23.873  62.321  51.634  1.00 46.21 ? 2    U   E O4    1 
ATOM   20    C  C5    . U   A 1 2   ? 22.889  62.300  53.799  1.00 44.94 ? 2    U   E C5    1 
ATOM   21    C  C6    . U   A 1 2   ? 23.124  62.499  55.102  1.00 44.23 ? 2    U   E C6    1 
ATOM   22    P  P     . U   A 1 3   ? 23.094  67.593  57.993  1.00 32.41 ? 3    U   E P     1 
ATOM   23    O  OP1   . U   A 1 3   ? 23.235  68.621  59.052  1.00 32.85 ? 3    U   E OP1   1 
ATOM   24    O  OP2   . U   A 1 3   ? 21.786  67.401  57.321  1.00 34.55 ? 3    U   E OP2   1 
ATOM   25    O  "O5'" . U   A 1 3   ? 24.158  67.873  56.856  1.00 31.52 ? 3    U   E "O5'" 1 
ATOM   26    C  "C5'" . U   A 1 3   ? 25.519  68.044  57.178  1.00 28.50 ? 3    U   E "C5'" 1 
ATOM   27    C  "C4'" . U   A 1 3   ? 26.321  68.173  55.921  1.00 26.91 ? 3    U   E "C4'" 1 
ATOM   28    O  "O4'" . U   A 1 3   ? 26.290  66.917  55.199  1.00 26.75 ? 3    U   E "O4'" 1 
ATOM   29    C  "C3'" . U   A 1 3   ? 25.776  69.162  54.908  1.00 26.70 ? 3    U   E "C3'" 1 
ATOM   30    O  "O3'" . U   A 1 3   ? 26.098  70.495  55.274  1.00 27.54 ? 3    U   E "O3'" 1 
ATOM   31    C  "C2'" . U   A 1 3   ? 26.478  68.697  53.640  1.00 26.55 ? 3    U   E "C2'" 1 
ATOM   32    O  "O2'" . U   A 1 3   ? 27.851  69.030  53.619  1.00 24.03 ? 3    U   E "O2'" 1 
ATOM   33    C  "C1'" . U   A 1 3   ? 26.380  67.178  53.803  1.00 26.82 ? 3    U   E "C1'" 1 
ATOM   34    N  N1    . U   A 1 3   ? 25.201  66.615  53.131  1.00 27.29 ? 3    U   E N1    1 
ATOM   35    C  C2    . U   A 1 3   ? 25.312  66.377  51.781  1.00 27.39 ? 3    U   E C2    1 
ATOM   36    O  O2    . U   A 1 3   ? 26.321  66.629  51.160  1.00 27.84 ? 3    U   E O2    1 
ATOM   37    N  N3    . U   A 1 3   ? 24.195  65.847  51.187  1.00 27.98 ? 3    U   E N3    1 
ATOM   38    C  C4    . U   A 1 3   ? 22.988  65.548  51.800  1.00 28.77 ? 3    U   E C4    1 
ATOM   39    O  O4    . U   A 1 3   ? 22.048  65.096  51.122  1.00 28.97 ? 3    U   E O4    1 
ATOM   40    C  C5    . U   A 1 3   ? 22.953  65.833  53.205  1.00 26.61 ? 3    U   E C5    1 
ATOM   41    C  C6    . U   A 1 3   ? 24.035  66.340  53.806  1.00 26.59 ? 3    U   E C6    1 
ATOM   42    P  P     . U   A 1 4   ? 25.310  71.711  54.596  1.00 26.88 ? 4    U   E P     1 
ATOM   43    O  OP1   . U   A 1 4   ? 25.637  72.953  55.314  1.00 27.22 ? 4    U   E OP1   1 
ATOM   44    O  OP2   . U   A 1 4   ? 23.899  71.284  54.488  1.00 28.57 ? 4    U   E OP2   1 
ATOM   45    O  "O5'" . U   A 1 4   ? 25.945  71.755  53.130  1.00 28.06 ? 4    U   E "O5'" 1 
ATOM   46    C  "C5'" . U   A 1 4   ? 25.208  72.243  52.016  1.00 26.01 ? 4    U   E "C5'" 1 
ATOM   47    C  "C4'" . U   A 1 4   ? 25.774  71.686  50.736  1.00 25.58 ? 4    U   E "C4'" 1 
ATOM   48    O  "O4'" . U   A 1 4   ? 25.671  70.236  50.758  1.00 27.00 ? 4    U   E "O4'" 1 
ATOM   49    C  "C3'" . U   A 1 4   ? 25.029  72.114  49.482  1.00 25.68 ? 4    U   E "C3'" 1 
ATOM   50    O  "O3'" . U   A 1 4   ? 25.589  73.327  48.992  1.00 24.93 ? 4    U   E "O3'" 1 
ATOM   51    C  "C2'" . U   A 1 4   ? 25.280  70.943  48.538  1.00 25.49 ? 4    U   E "C2'" 1 
ATOM   52    O  "O2'" . U   A 1 4   ? 26.569  70.988  47.961  1.00 24.24 ? 4    U   E "O2'" 1 
ATOM   53    C  "C1'" . U   A 1 4   ? 25.221  69.765  49.508  1.00 25.98 ? 4    U   E "C1'" 1 
ATOM   54    N  N1    . U   A 1 4   ? 23.881  69.202  49.716  1.00 28.02 ? 4    U   E N1    1 
ATOM   55    C  C2    . U   A 1 4   ? 23.275  68.579  48.651  1.00 28.34 ? 4    U   E C2    1 
ATOM   56    O  O2    . U   A 1 4   ? 23.787  68.523  47.551  1.00 29.62 ? 4    U   E O2    1 
ATOM   57    N  N3    . U   A 1 4   ? 22.052  68.016  48.923  1.00 29.99 ? 4    U   E N3    1 
ATOM   58    C  C4    . U   A 1 4   ? 21.388  68.015  50.135  1.00 31.95 ? 4    U   E C4    1 
ATOM   59    O  O4    . U   A 1 4   ? 20.329  67.394  50.244  1.00 34.63 ? 4    U   E O4    1 
ATOM   60    C  C5    . U   A 1 4   ? 22.067  68.709  51.187  1.00 31.04 ? 4    U   E C5    1 
ATOM   61    C  C6    . U   A 1 4   ? 23.263  69.270  50.944  1.00 29.28 ? 4    U   E C6    1 
ATOM   62    P  P     . U   A 1 5   ? 24.655  74.625  48.833  1.00 25.20 ? 5    U   E P     1 
ATOM   63    O  OP1   . U   A 1 5   ? 25.527  75.738  48.395  1.00 27.95 ? 5    U   E OP1   1 
ATOM   64    O  OP2   . U   A 1 5   ? 23.880  74.769  50.072  1.00 26.98 ? 5    U   E OP2   1 
ATOM   65    O  "O5'" . U   A 1 5   ? 23.686  74.232  47.635  1.00 26.30 ? 5    U   E "O5'" 1 
ATOM   66    C  "C5'" . U   A 1 5   ? 24.239  73.928  46.361  1.00 28.12 ? 5    U   E "C5'" 1 
ATOM   67    C  "C4'" . U   A 1 5   ? 23.292  73.087  45.544  1.00 30.97 ? 5    U   E "C4'" 1 
ATOM   68    O  "O4'" . U   A 1 5   ? 23.082  71.791  46.160  1.00 30.89 ? 5    U   E "O4'" 1 
ATOM   69    C  "C3'" . U   A 1 5   ? 21.881  73.616  45.366  1.00 32.00 ? 5    U   E "C3'" 1 
ATOM   70    O  "O3'" . U   A 1 5   ? 21.861  74.612  44.367  1.00 34.39 ? 5    U   E "O3'" 1 
ATOM   71    C  "C2'" . U   A 1 5   ? 21.154  72.370  44.895  1.00 31.90 ? 5    U   E "C2'" 1 
ATOM   72    O  "O2'" . U   A 1 5   ? 21.448  72.087  43.545  1.00 32.81 ? 5    U   E "O2'" 1 
ATOM   73    C  "C1'" . U   A 1 5   ? 21.800  71.303  45.779  1.00 31.75 ? 5    U   E "C1'" 1 
ATOM   74    N  N1    . U   A 1 5   ? 21.013  71.064  46.992  1.00 31.33 ? 5    U   E N1    1 
ATOM   75    C  C2    . U   A 1 5   ? 20.028  70.103  46.927  1.00 31.73 ? 5    U   E C2    1 
ATOM   76    O  O2    . U   A 1 5   ? 19.793  69.480  45.924  1.00 31.20 ? 5    U   E O2    1 
ATOM   77    N  N3    . U   A 1 5   ? 19.333  69.903  48.088  1.00 32.88 ? 5    U   E N3    1 
ATOM   78    C  C4    . U   A 1 5   ? 19.525  70.560  49.284  1.00 33.27 ? 5    U   E C4    1 
ATOM   79    O  O4    . U   A 1 5   ? 18.897  70.199  50.274  1.00 35.66 ? 5    U   E O4    1 
ATOM   80    C  C5    . U   A 1 5   ? 20.554  71.552  49.262  1.00 32.63 ? 5    U   E C5    1 
ATOM   81    C  C6    . U   A 1 5   ? 21.246  71.762  48.140  1.00 31.14 ? 5    U   E C6    1 
ATOM   82    P  P     . U   A 1 6   ? 20.788  75.800  44.455  1.00 36.00 ? 6    U   E P     1 
ATOM   83    O  OP1   . U   A 1 6   ? 20.917  76.534  43.178  1.00 37.93 ? 6    U   E OP1   1 
ATOM   84    O  OP2   . U   A 1 6   ? 20.936  76.536  45.728  1.00 36.13 ? 6    U   E OP2   1 
ATOM   85    O  "O5'" . U   A 1 6   ? 19.402  75.015  44.485  1.00 39.02 ? 6    U   E "O5'" 1 
ATOM   86    C  "C5'" . U   A 1 6   ? 18.241  75.619  45.041  1.00 41.93 ? 6    U   E "C5'" 1 
ATOM   87    C  "C4'" . U   A 1 6   ? 17.432  76.275  43.948  1.00 44.24 ? 6    U   E "C4'" 1 
ATOM   88    O  "O4'" . U   A 1 6   ? 17.025  75.262  42.998  1.00 44.34 ? 6    U   E "O4'" 1 
ATOM   89    C  "C3'" . U   A 1 6   ? 16.132  76.940  44.378  1.00 44.89 ? 6    U   E "C3'" 1 
ATOM   90    O  "O3'" . U   A 1 6   ? 16.393  78.272  44.818  1.00 46.52 ? 6    U   E "O3'" 1 
ATOM   91    C  "C2'" . U   A 1 6   ? 15.342  76.941  43.074  1.00 44.80 ? 6    U   E "C2'" 1 
ATOM   92    O  "O2'" . U   A 1 6   ? 15.758  77.989  42.223  1.00 42.41 ? 6    U   E "O2'" 1 
ATOM   93    C  "C1'" . U   A 1 6   ? 15.763  75.602  42.460  1.00 45.80 ? 6    U   E "C1'" 1 
ATOM   94    N  N1    . U   A 1 6   ? 14.848  74.480  42.705  1.00 47.53 ? 6    U   E N1    1 
ATOM   95    C  C2    . U   A 1 6   ? 13.689  74.412  41.945  1.00 48.73 ? 6    U   E C2    1 
ATOM   96    O  O2    . U   A 1 6   ? 13.384  75.261  41.132  1.00 49.63 ? 6    U   E O2    1 
ATOM   97    N  N3    . U   A 1 6   ? 12.900  73.314  42.179  1.00 48.93 ? 6    U   E N3    1 
ATOM   98    C  C4    . U   A 1 6   ? 13.139  72.303  43.087  1.00 50.38 ? 6    U   E C4    1 
ATOM   99    O  O4    . U   A 1 6   ? 12.391  71.321  43.108  1.00 52.27 ? 6    U   E O4    1 
ATOM   100   C  C5    . U   A 1 6   ? 14.340  72.463  43.858  1.00 49.39 ? 6    U   E C5    1 
ATOM   101   C  C6    . U   A 1 6   ? 15.134  73.520  43.642  1.00 48.01 ? 6    U   E C6    1 
ATOM   102   P  P     . U   A 1 7   ? 15.692  78.834  46.157  1.00 48.52 ? 7    U   E P     1 
ATOM   103   O  OP1   . U   A 1 7   ? 16.133  78.031  47.324  1.00 48.24 ? 7    U   E OP1   1 
ATOM   104   O  OP2   . U   A 1 7   ? 14.232  78.964  45.872  1.00 49.38 ? 7    U   E OP2   1 
ATOM   105   O  "O5'" . U   A 1 7   ? 16.313  80.294  46.311  1.00 45.98 ? 7    U   E "O5'" 1 
ATOM   106   O  "O5'" . U   B 1 1   ? -15.429 63.231  69.805  1.00 65.55 ? 1    U   F "O5'" 1 
ATOM   107   C  "C5'" . U   B 1 1   ? -15.931 62.706  71.041  1.00 64.76 ? 1    U   F "C5'" 1 
ATOM   108   C  "C4'" . U   B 1 1   ? -17.020 63.569  71.636  1.00 63.75 ? 1    U   F "C4'" 1 
ATOM   109   O  "O4'" . U   B 1 1   ? -17.358 63.057  72.954  1.00 64.15 ? 1    U   F "O4'" 1 
ATOM   110   C  "C3'" . U   B 1 1   ? -16.630 65.019  71.881  1.00 62.85 ? 1    U   F "C3'" 1 
ATOM   111   O  "O3'" . U   B 1 1   ? -16.833 65.816  70.717  1.00 60.21 ? 1    U   F "O3'" 1 
ATOM   112   C  "C2'" . U   B 1 1   ? -17.571 65.426  73.010  1.00 63.51 ? 1    U   F "C2'" 1 
ATOM   113   O  "O2'" . U   B 1 1   ? -18.863 65.777  72.553  1.00 64.26 ? 1    U   F "O2'" 1 
ATOM   114   C  "C1'" . U   B 1 1   ? -17.632 64.137  73.833  1.00 63.85 ? 1    U   F "C1'" 1 
ATOM   115   P  P     . U   B 1 2   ? -15.892 67.098  70.460  1.00 58.93 ? 2    U   F P     1 
ATOM   116   O  OP1   . U   B 1 2   ? -16.539 67.933  69.412  1.00 58.37 ? 2    U   F OP1   1 
ATOM   117   O  OP2   . U   B 1 2   ? -14.496 66.627  70.260  1.00 59.56 ? 2    U   F OP2   1 
ATOM   118   O  "O5'" . U   B 1 2   ? -15.954 67.890  71.845  1.00 54.12 ? 2    U   F "O5'" 1 
ATOM   119   C  "C5'" . U   B 1 2   ? -17.096 68.667  72.179  1.00 46.49 ? 2    U   F "C5'" 1 
ATOM   120   C  "C4'" . U   B 1 2   ? -16.920 69.318  73.523  1.00 41.25 ? 2    U   F "C4'" 1 
ATOM   121   O  "O4'" . U   B 1 2   ? -16.826 68.308  74.556  1.00 40.41 ? 2    U   F "O4'" 1 
ATOM   122   C  "C3'" . U   B 1 2   ? -15.657 70.133  73.717  1.00 38.62 ? 2    U   F "C3'" 1 
ATOM   123   O  "O3'" . U   B 1 2   ? -15.807 71.415  73.137  1.00 33.54 ? 2    U   F "O3'" 1 
ATOM   124   C  "C2'" . U   B 1 2   ? -15.589 70.213  75.236  1.00 38.92 ? 2    U   F "C2'" 1 
ATOM   125   O  "O2'" . U   B 1 2   ? -16.503 71.166  75.745  1.00 39.13 ? 2    U   F "O2'" 1 
ATOM   126   C  "C1'" . U   B 1 2   ? -16.037 68.802  75.627  1.00 39.34 ? 2    U   F "C1'" 1 
ATOM   127   N  N1    . U   B 1 2   ? -14.913 67.878  75.840  1.00 40.02 ? 2    U   F N1    1 
ATOM   128   C  C2    . U   B 1 2   ? -14.192 68.000  77.019  1.00 40.62 ? 2    U   F C2    1 
ATOM   129   O  O2    . U   B 1 2   ? -14.475 68.803  77.893  1.00 41.34 ? 2    U   F O2    1 
ATOM   130   N  N3    . U   B 1 2   ? -13.133 67.141  77.143  1.00 41.20 ? 2    U   F N3    1 
ATOM   131   C  C4    . U   B 1 2   ? -12.737 66.176  76.243  1.00 41.72 ? 2    U   F C4    1 
ATOM   132   O  O4    . U   B 1 2   ? -11.746 65.486  76.495  1.00 42.22 ? 2    U   F O4    1 
ATOM   133   C  C5    . U   B 1 2   ? -13.545 66.095  75.060  1.00 40.92 ? 2    U   F C5    1 
ATOM   134   C  C6    . U   B 1 2   ? -14.577 66.932  74.903  1.00 39.94 ? 2    U   F C6    1 
ATOM   135   P  P     . U   B 1 3   ? -14.556 72.118  72.442  1.00 31.28 ? 3    U   F P     1 
ATOM   136   O  OP1   . U   B 1 3   ? -14.969 73.444  71.916  1.00 29.69 ? 3    U   F OP1   1 
ATOM   137   O  OP2   . U   B 1 3   ? -13.953 71.127  71.524  1.00 30.78 ? 3    U   F OP2   1 
ATOM   138   O  "O5'" . U   B 1 3   ? -13.529 72.324  73.646  1.00 31.24 ? 3    U   F "O5'" 1 
ATOM   139   C  "C5'" . U   B 1 3   ? -13.819 73.210  74.712  1.00 29.27 ? 3    U   F "C5'" 1 
ATOM   140   C  "C4'" . U   B 1 3   ? -12.710 73.176  75.740  1.00 28.70 ? 3    U   F "C4'" 1 
ATOM   141   O  "O4'" . U   B 1 3   ? -12.708 71.903  76.442  1.00 29.44 ? 3    U   F "O4'" 1 
ATOM   142   C  "C3'" . U   B 1 3   ? -11.294 73.294  75.210  1.00 28.19 ? 3    U   F "C3'" 1 
ATOM   143   O  "O3'" . U   B 1 3   ? -10.975 74.646  74.925  1.00 25.59 ? 3    U   F "O3'" 1 
ATOM   144   C  "C2'" . U   B 1 3   ? -10.485 72.729  76.370  1.00 28.58 ? 3    U   F "C2'" 1 
ATOM   145   O  "O2'" . U   B 1 3   ? -10.368 73.660  77.434  1.00 28.94 ? 3    U   F "O2'" 1 
ATOM   146   C  "C1'" . U   B 1 3   ? -11.379 71.568  76.818  1.00 28.75 ? 3    U   F "C1'" 1 
ATOM   147   N  N1    . U   B 1 3   ? -11.035 70.300  76.164  1.00 30.05 ? 3    U   F N1    1 
ATOM   148   C  C2    . U   B 1 3   ? -10.026 69.542  76.714  1.00 30.67 ? 3    U   F C2    1 
ATOM   149   O  O2    . U   B 1 3   ? -9.411  69.884  77.707  1.00 32.18 ? 3    U   F O2    1 
ATOM   150   N  N3    . U   B 1 3   ? -9.753  68.370  76.055  1.00 31.53 ? 3    U   F N3    1 
ATOM   151   C  C4    . U   B 1 3   ? -10.369 67.898  74.912  1.00 31.96 ? 3    U   F C4    1 
ATOM   152   O  O4    . U   B 1 3   ? -9.983  66.841  74.406  1.00 32.51 ? 3    U   F O4    1 
ATOM   153   C  C5    . U   B 1 3   ? -11.405 68.746  74.401  1.00 31.44 ? 3    U   F C5    1 
ATOM   154   C  C6    . U   B 1 3   ? -11.697 69.886  75.032  1.00 30.97 ? 3    U   F C6    1 
ATOM   155   P  P     . U   B 1 4   ? -9.742  74.969  73.963  1.00 25.66 ? 4    U   F P     1 
ATOM   156   O  OP1   . U   B 1 4   ? -9.807  76.406  73.622  1.00 27.40 ? 4    U   F OP1   1 
ATOM   157   O  OP2   . U   B 1 4   ? -9.709  73.973  72.880  1.00 25.22 ? 4    U   F OP2   1 
ATOM   158   O  "O5'" . U   B 1 4   ? -8.503  74.698  74.927  1.00 27.03 ? 4    U   F "O5'" 1 
ATOM   159   C  "C5'" . U   B 1 4   ? -7.244  74.279  74.416  1.00 26.21 ? 4    U   F "C5'" 1 
ATOM   160   C  "C4'" . U   B 1 4   ? -6.485  73.504  75.471  1.00 24.96 ? 4    U   F "C4'" 1 
ATOM   161   O  "O4'" . U   B 1 4   ? -7.270  72.361  75.889  1.00 24.66 ? 4    U   F "O4'" 1 
ATOM   162   C  "C3'" . U   B 1 4   ? -5.161  72.933  74.980  1.00 25.01 ? 4    U   F "C3'" 1 
ATOM   163   O  "O3'" . U   B 1 4   ? -4.128  73.887  75.194  1.00 21.85 ? 4    U   F "O3'" 1 
ATOM   164   C  "C2'" . U   B 1 4   ? -4.982  71.697  75.851  1.00 23.96 ? 4    U   F "C2'" 1 
ATOM   165   O  "O2'" . U   B 1 4   ? -4.457  72.020  77.120  1.00 24.75 ? 4    U   F "O2'" 1 
ATOM   166   C  "C1'" . U   B 1 4   ? -6.430  71.219  75.998  1.00 25.89 ? 4    U   F "C1'" 1 
ATOM   167   N  N1    . U   B 1 4   ? -6.833  70.255  74.964  1.00 26.34 ? 4    U   F N1    1 
ATOM   168   C  C2    . U   B 1 4   ? -6.222  69.025  74.964  1.00 26.68 ? 4    U   F C2    1 
ATOM   169   O  O2    . U   B 1 4   ? -5.390  68.702  75.787  1.00 26.59 ? 4    U   F O2    1 
ATOM   170   N  N3    . U   B 1 4   ? -6.628  68.177  73.967  1.00 28.34 ? 4    U   F N3    1 
ATOM   171   C  C4    . U   B 1 4   ? -7.581  68.429  72.999  1.00 29.57 ? 4    U   F C4    1 
ATOM   172   O  O4    . U   B 1 4   ? -7.853  67.554  72.181  1.00 31.02 ? 4    U   F O4    1 
ATOM   173   C  C5    . U   B 1 4   ? -8.178  69.726  73.072  1.00 28.26 ? 4    U   F C5    1 
ATOM   174   C  C6    . U   B 1 4   ? -7.790  70.572  74.028  1.00 27.58 ? 4    U   F C6    1 
ATOM   175   P  P     . U   B 1 5   ? -3.236  74.384  73.966  1.00 22.32 ? 5    U   F P     1 
ATOM   176   O  OP1   . U   B 1 5   ? -2.315  75.416  74.507  1.00 20.69 ? 5    U   F OP1   1 
ATOM   177   O  OP2   . U   B 1 5   ? -4.116  74.727  72.815  1.00 20.58 ? 5    U   F OP2   1 
ATOM   178   O  "O5'" . U   B 1 5   ? -2.387  73.083  73.591  1.00 22.24 ? 5    U   F "O5'" 1 
ATOM   179   C  "C5'" . U   B 1 5   ? -1.427  72.583  74.514  1.00 22.84 ? 5    U   F "C5'" 1 
ATOM   180   C  "C4'" . U   B 1 5   ? -1.117  71.131  74.246  1.00 22.69 ? 5    U   F "C4'" 1 
ATOM   181   O  "O4'" . U   B 1 5   ? -2.313  70.327  74.369  1.00 24.77 ? 5    U   F "O4'" 1 
ATOM   182   C  "C3'" . U   B 1 5   ? -0.618  70.806  72.858  1.00 24.07 ? 5    U   F "C3'" 1 
ATOM   183   O  "O3'" . U   B 1 5   ? 0.757   71.124  72.746  1.00 22.29 ? 5    U   F "O3'" 1 
ATOM   184   C  "C2'" . U   B 1 5   ? -0.877  69.309  72.771  1.00 23.82 ? 5    U   F "C2'" 1 
ATOM   185   O  "O2'" . U   B 1 5   ? 0.113   68.574  73.448  1.00 25.13 ? 5    U   F "O2'" 1 
ATOM   186   C  "C1'" . U   B 1 5   ? -2.212  69.198  73.510  1.00 25.53 ? 5    U   F "C1'" 1 
ATOM   187   N  N1    . U   B 1 5   ? -3.348  69.202  72.576  1.00 25.96 ? 5    U   F N1    1 
ATOM   188   C  C2    . U   B 1 5   ? -3.701  67.987  72.013  1.00 26.52 ? 5    U   F C2    1 
ATOM   189   O  O2    . U   B 1 5   ? -3.138  66.945  72.293  1.00 27.36 ? 5    U   F O2    1 
ATOM   190   N  N3    . U   B 1 5   ? -4.735  68.039  71.117  1.00 27.43 ? 5    U   F N3    1 
ATOM   191   C  C4    . U   B 1 5   ? -5.437  69.159  70.736  1.00 28.25 ? 5    U   F C4    1 
ATOM   192   O  O4    . U   B 1 5   ? -6.311  69.052  69.892  1.00 31.13 ? 5    U   F O4    1 
ATOM   193   C  C5    . U   B 1 5   ? -5.024  70.378  71.374  1.00 28.44 ? 5    U   F C5    1 
ATOM   194   C  C6    . U   B 1 5   ? -4.017  70.353  72.256  1.00 26.18 ? 5    U   F C6    1 
ATOM   195   P  P     . U   B 1 6   ? 1.317   71.636  71.347  1.00 24.53 ? 6    U   F P     1 
ATOM   196   O  OP1   . U   B 1 6   ? 2.785   71.754  71.471  1.00 24.44 ? 6    U   F OP1   1 
ATOM   197   O  OP2   . U   B 1 6   ? 0.523   72.815  70.939  1.00 22.72 ? 6    U   F OP2   1 
ATOM   198   O  "O5'" . U   B 1 6   ? 0.975   70.425  70.370  1.00 27.39 ? 6    U   F "O5'" 1 
ATOM   199   C  "C5'" . U   B 1 6   ? 0.964   70.600  68.956  1.00 30.32 ? 6    U   F "C5'" 1 
ATOM   200   C  "C4'" . U   B 1 6   ? 2.301   70.211  68.370  1.00 32.30 ? 6    U   F "C4'" 1 
ATOM   201   O  "O4'" . U   B 1 6   ? 2.579   68.821  68.657  1.00 33.48 ? 6    U   F "O4'" 1 
ATOM   202   C  "C3'" . U   B 1 6   ? 2.389   70.297  66.856  1.00 33.88 ? 6    U   F "C3'" 1 
ATOM   203   O  "O3'" . U   B 1 6   ? 2.714   71.625  66.485  1.00 35.34 ? 6    U   F "O3'" 1 
ATOM   204   C  "C2'" . U   B 1 6   ? 3.539   69.346  66.538  1.00 34.40 ? 6    U   F "C2'" 1 
ATOM   205   O  "O2'" . U   B 1 6   ? 4.825   69.916  66.680  1.00 34.83 ? 6    U   F "O2'" 1 
ATOM   206   C  "C1'" . U   B 1 6   ? 3.351   68.269  67.602  1.00 34.82 ? 6    U   F "C1'" 1 
ATOM   207   N  N1    . U   B 1 6   ? 2.650   67.095  67.079  1.00 36.98 ? 6    U   F N1    1 
ATOM   208   C  C2    . U   B 1 6   ? 3.340   66.276  66.213  1.00 37.84 ? 6    U   F C2    1 
ATOM   209   O  O2    . U   B 1 6   ? 4.493   66.495  65.865  1.00 37.50 ? 6    U   F O2    1 
ATOM   210   N  N3    . U   B 1 6   ? 2.634   65.193  65.764  1.00 39.23 ? 6    U   F N3    1 
ATOM   211   C  C4    . U   B 1 6   ? 1.335   64.860  66.082  1.00 40.71 ? 6    U   F C4    1 
ATOM   212   O  O4    . U   B 1 6   ? 0.828   63.863  65.576  1.00 42.06 ? 6    U   F O4    1 
ATOM   213   C  C5    . U   B 1 6   ? 0.689   65.761  66.983  1.00 40.09 ? 6    U   F C5    1 
ATOM   214   C  C6    . U   B 1 6   ? 1.353   66.821  67.439  1.00 39.19 ? 6    U   F C6    1 
ATOM   215   P  P     . U   B 1 7   ? 1.860   72.371  65.358  1.00 37.88 ? 7    U   F P     1 
ATOM   216   O  OP1   . U   B 1 7   ? 2.509   73.692  65.132  1.00 37.48 ? 7    U   F OP1   1 
ATOM   217   O  OP2   . U   B 1 7   ? 0.438   72.310  65.756  1.00 36.83 ? 7    U   F OP2   1 
ATOM   218   O  "O5'" . U   B 1 7   ? 2.065   71.488  64.052  1.00 42.20 ? 7    U   F "O5'" 1 
ATOM   219   C  "C5'" . U   B 1 7   ? 3.343   71.421  63.413  1.00 50.63 ? 7    U   F "C5'" 1 
ATOM   220   C  "C4'" . U   B 1 7   ? 3.361   70.315  62.379  1.00 55.26 ? 7    U   F "C4'" 1 
ATOM   221   O  "O4'" . U   B 1 7   ? 3.187   69.029  63.030  1.00 58.31 ? 7    U   F "O4'" 1 
ATOM   222   C  "C3'" . U   B 1 7   ? 2.235   70.362  61.364  1.00 57.33 ? 7    U   F "C3'" 1 
ATOM   223   O  "O3'" . U   B 1 7   ? 2.477   71.363  60.379  1.00 57.79 ? 7    U   F "O3'" 1 
ATOM   224   C  "C2'" . U   B 1 7   ? 2.178   68.918  60.871  1.00 59.45 ? 7    U   F "C2'" 1 
ATOM   225   O  "O2'" . U   B 1 7   ? 3.145   68.629  59.878  1.00 59.69 ? 7    U   F "O2'" 1 
ATOM   226   C  "C1'" . U   B 1 7   ? 2.498   68.142  62.157  1.00 60.67 ? 7    U   F "C1'" 1 
ATOM   227   N  N1    . U   B 1 7   ? 1.312   67.619  62.859  1.00 62.91 ? 7    U   F N1    1 
ATOM   228   C  C2    . U   B 1 7   ? 0.958   66.300  62.627  1.00 63.64 ? 7    U   F C2    1 
ATOM   229   O  O2    . U   B 1 7   ? 1.582   65.571  61.878  1.00 64.26 ? 7    U   F O2    1 
ATOM   230   N  N3    . U   B 1 7   ? -0.153  65.867  63.309  1.00 64.60 ? 7    U   F N3    1 
ATOM   231   C  C4    . U   B 1 7   ? -0.935  66.601  64.181  1.00 64.98 ? 7    U   F C4    1 
ATOM   232   O  O4    . U   B 1 7   ? -1.909  66.064  64.719  1.00 65.47 ? 7    U   F O4    1 
ATOM   233   C  C5    . U   B 1 7   ? -0.508  67.957  64.370  1.00 64.14 ? 7    U   F C5    1 
ATOM   234   C  C6    . U   B 1 7   ? 0.573   68.409  63.720  1.00 63.71 ? 7    U   F C6    1 
ATOM   235   O  "O5'" . U   C 1 1   ? 16.453  124.025 123.207 1.00 66.03 ? 1    U   G "O5'" 1 
ATOM   236   C  "C5'" . U   C 1 1   ? 15.684  123.323 124.199 1.00 66.19 ? 1    U   G "C5'" 1 
ATOM   237   C  "C4'" . U   C 1 1   ? 14.767  122.294 123.583 1.00 65.47 ? 1    U   G "C4'" 1 
ATOM   238   O  "O4'" . U   C 1 1   ? 14.407  122.751 122.252 1.00 66.99 ? 1    U   G "O4'" 1 
ATOM   239   C  "C3'" . U   C 1 1   ? 15.359  120.906 123.364 1.00 64.58 ? 1    U   G "C3'" 1 
ATOM   240   O  "O3'" . U   C 1 1   ? 15.205  120.096 124.536 1.00 60.31 ? 1    U   G "O3'" 1 
ATOM   241   C  "C2'" . U   C 1 1   ? 14.508  120.374 122.214 1.00 66.19 ? 1    U   G "C2'" 1 
ATOM   242   O  "O2'" . U   C 1 1   ? 13.259  119.873 122.653 1.00 66.60 ? 1    U   G "O2'" 1 
ATOM   243   C  "C1'" . U   C 1 1   ? 14.287  121.640 121.379 1.00 67.81 ? 1    U   G "C1'" 1 
ATOM   244   N  N1    . U   C 1 1   ? 15.237  121.819 120.268 1.00 69.35 ? 1    U   G N1    1 
ATOM   245   C  C2    . U   C 1 1   ? 15.020  121.086 119.112 1.00 70.19 ? 1    U   G C2    1 
ATOM   246   O  O2    . U   C 1 1   ? 14.079  120.318 118.980 1.00 70.83 ? 1    U   G O2    1 
ATOM   247   N  N3    . U   C 1 1   ? 15.947  121.286 118.115 1.00 70.63 ? 1    U   G N3    1 
ATOM   248   C  C4    . U   C 1 1   ? 17.043  122.128 118.153 1.00 70.49 ? 1    U   G C4    1 
ATOM   249   O  O4    . U   C 1 1   ? 17.820  122.152 117.194 1.00 70.52 ? 1    U   G O4    1 
ATOM   250   C  C5    . U   C 1 1   ? 17.192  122.862 119.377 1.00 70.35 ? 1    U   G C5    1 
ATOM   251   C  C6    . U   C 1 1   ? 16.308  122.685 120.369 1.00 69.91 ? 1    U   G C6    1 
ATOM   252   P  P     . U   C 1 2   ? 16.225  118.871 124.815 1.00 57.27 ? 2    U   G P     1 
ATOM   253   O  OP1   . U   C 1 2   ? 15.741  118.129 126.016 1.00 56.40 ? 2    U   G OP1   1 
ATOM   254   O  OP2   . U   C 1 2   ? 17.615  119.415 124.797 1.00 57.42 ? 2    U   G OP2   1 
ATOM   255   O  "O5'" . U   C 1 2   ? 16.066  117.926 123.539 1.00 51.81 ? 2    U   G "O5'" 1 
ATOM   256   C  "C5'" . U   C 1 2   ? 14.889  117.149 123.345 1.00 43.25 ? 2    U   G "C5'" 1 
ATOM   257   C  "C4'" . U   C 1 2   ? 14.956  116.417 122.028 1.00 37.07 ? 2    U   G "C4'" 1 
ATOM   258   O  "O4'" . U   C 1 2   ? 15.025  117.378 120.949 1.00 35.64 ? 2    U   G "O4'" 1 
ATOM   259   C  "C3'" . U   C 1 2   ? 16.183  115.548 121.808 1.00 34.11 ? 2    U   G "C3'" 1 
ATOM   260   O  "O3'" . U   C 1 2   ? 16.017  114.278 122.421 1.00 29.35 ? 2    U   G "O3'" 1 
ATOM   261   C  "C2'" . U   C 1 2   ? 16.208  115.429 120.292 1.00 34.13 ? 2    U   G "C2'" 1 
ATOM   262   O  "O2'" . U   C 1 2   ? 15.269  114.496 119.816 1.00 33.28 ? 2    U   G "O2'" 1 
ATOM   263   C  "C1'" . U   C 1 2   ? 15.769  116.830 119.875 1.00 35.17 ? 2    U   G "C1'" 1 
ATOM   264   N  N1    . U   C 1 2   ? 16.912  117.709 119.614 1.00 36.39 ? 2    U   G N1    1 
ATOM   265   C  C2    . U   C 1 2   ? 17.637  117.474 118.470 1.00 37.06 ? 2    U   G C2    1 
ATOM   266   O  O2    . U   C 1 2   ? 17.381  116.562 117.699 1.00 36.82 ? 2    U   G O2    1 
ATOM   267   N  N3    . U   C 1 2   ? 18.679  118.341 118.264 1.00 37.96 ? 2    U   G N3    1 
ATOM   268   C  C4    . U   C 1 2   ? 19.059  119.389 119.075 1.00 37.84 ? 2    U   G C4    1 
ATOM   269   O  O4    . U   C 1 2   ? 19.994  120.111 118.728 1.00 39.83 ? 2    U   G O4    1 
ATOM   270   C  C5    . U   C 1 2   ? 18.270  119.550 120.250 1.00 36.64 ? 2    U   G C5    1 
ATOM   271   C  C6    . U   C 1 2   ? 17.246  118.728 120.474 1.00 36.49 ? 2    U   G C6    1 
ATOM   272   P  P     . U   C 1 3   ? 17.269  113.567 123.130 1.00 26.57 ? 3    U   G P     1 
ATOM   273   O  OP1   . U   C 1 3   ? 16.791  112.292 123.687 1.00 28.02 ? 3    U   G OP1   1 
ATOM   274   O  OP2   . U   C 1 3   ? 17.933  114.550 124.011 1.00 29.04 ? 3    U   G OP2   1 
ATOM   275   O  "O5'" . U   C 1 3   ? 18.313  113.289 121.955 1.00 26.65 ? 3    U   G "O5'" 1 
ATOM   276   C  "C5'" . U   C 1 3   ? 18.019  112.390 120.906 1.00 25.13 ? 3    U   G "C5'" 1 
ATOM   277   C  "C4'" . U   C 1 3   ? 19.136  112.388 119.893 1.00 25.61 ? 3    U   G "C4'" 1 
ATOM   278   O  "O4'" . U   C 1 3   ? 19.159  113.648 119.175 1.00 27.11 ? 3    U   G "O4'" 1 
ATOM   279   C  "C3'" . U   C 1 3   ? 20.551  112.279 120.431 1.00 25.08 ? 3    U   G "C3'" 1 
ATOM   280   O  "O3'" . U   C 1 3   ? 20.856  110.949 120.773 1.00 24.39 ? 3    U   G "O3'" 1 
ATOM   281   C  "C2'" . U   C 1 3   ? 21.363  112.777 119.242 1.00 26.64 ? 3    U   G "C2'" 1 
ATOM   282   O  "O2'" . U   C 1 3   ? 21.460  111.822 118.193 1.00 27.51 ? 3    U   G "O2'" 1 
ATOM   283   C  "C1'" . U   C 1 3   ? 20.493  113.942 118.769 1.00 26.95 ? 3    U   G "C1'" 1 
ATOM   284   N  N1    . U   C 1 3   ? 20.891  115.219 119.381 1.00 28.09 ? 3    U   G N1    1 
ATOM   285   C  C2    . U   C 1 3   ? 21.925  115.921 118.783 1.00 28.28 ? 3    U   G C2    1 
ATOM   286   O  O2    . U   C 1 3   ? 22.534  115.506 117.817 1.00 29.06 ? 3    U   G O2    1 
ATOM   287   N  N3    . U   C 1 3   ? 22.227  117.122 119.366 1.00 29.16 ? 3    U   G N3    1 
ATOM   288   C  C4    . U   C 1 3   ? 21.635  117.673 120.485 1.00 28.88 ? 3    U   G C4    1 
ATOM   289   O  O4    . U   C 1 3   ? 22.045  118.750 120.908 1.00 29.41 ? 3    U   G O4    1 
ATOM   290   C  C5    . U   C 1 3   ? 20.589  116.877 121.065 1.00 28.65 ? 3    U   G C5    1 
ATOM   291   C  C6    . U   C 1 3   ? 20.258  115.708 120.503 1.00 27.10 ? 3    U   G C6    1 
ATOM   292   P  P     . U   C 1 4   ? 22.114  110.641 121.723 1.00 23.19 ? 4    U   G P     1 
ATOM   293   O  OP1   . U   C 1 4   ? 22.032  109.207 122.074 1.00 22.57 ? 4    U   G OP1   1 
ATOM   294   O  OP2   . U   C 1 4   ? 22.134  111.649 122.803 1.00 22.97 ? 4    U   G OP2   1 
ATOM   295   O  "O5'" . U   C 1 4   ? 23.349  110.895 120.754 1.00 23.84 ? 4    U   G "O5'" 1 
ATOM   296   C  "C5'" . U   C 1 4   ? 24.622  111.297 121.260 1.00 23.43 ? 4    U   G "C5'" 1 
ATOM   297   C  "C4'" . U   C 1 4   ? 25.411  111.986 120.172 1.00 23.41 ? 4    U   G "C4'" 1 
ATOM   298   O  "O4'" . U   C 1 4   ? 24.675  113.145 119.701 1.00 24.99 ? 4    U   G "O4'" 1 
ATOM   299   C  "C3'" . U   C 1 4   ? 26.767  112.512 120.599 1.00 23.35 ? 4    U   G "C3'" 1 
ATOM   300   O  "O3'" . U   C 1 4   ? 27.739  111.485 120.405 1.00 21.44 ? 4    U   G "O3'" 1 
ATOM   301   C  "C2'" . U   C 1 4   ? 26.973  113.696 119.664 1.00 23.53 ? 4    U   G "C2'" 1 
ATOM   302   O  "O2'" . U   C 1 4   ? 27.390  113.284 118.383 1.00 24.81 ? 4    U   G "O2'" 1 
ATOM   303   C  "C1'" . U   C 1 4   ? 25.552  114.249 119.549 1.00 25.87 ? 4    U   G "C1'" 1 
ATOM   304   N  N1    . U   C 1 4   ? 25.186  115.252 120.565 1.00 28.36 ? 4    U   G N1    1 
ATOM   305   C  C2    . U   C 1 4   ? 25.783  116.500 120.510 1.00 29.36 ? 4    U   G C2    1 
ATOM   306   O  O2    . U   C 1 4   ? 26.601  116.803 119.666 1.00 29.44 ? 4    U   G O2    1 
ATOM   307   N  N3    . U   C 1 4   ? 25.385  117.379 121.492 1.00 30.82 ? 4    U   G N3    1 
ATOM   308   C  C4    . U   C 1 4   ? 24.469  117.139 122.504 1.00 31.63 ? 4    U   G C4    1 
ATOM   309   O  O4    . U   C 1 4   ? 24.234  118.020 123.336 1.00 32.97 ? 4    U   G O4    1 
ATOM   310   C  C5    . U   C 1 4   ? 23.899  115.829 122.489 1.00 30.85 ? 4    U   G C5    1 
ATOM   311   C  C6    . U   C 1 4   ? 24.267  114.953 121.545 1.00 28.92 ? 4    U   G C6    1 
ATOM   312   P  P     . U   C 1 5   ? 28.617  110.976 121.653 1.00 20.50 ? 5    U   G P     1 
ATOM   313   O  OP1   . U   C 1 5   ? 29.514  109.893 121.183 1.00 19.74 ? 5    U   G OP1   1 
ATOM   314   O  OP2   . U   C 1 5   ? 27.723  110.727 122.808 1.00 19.29 ? 5    U   G OP2   1 
ATOM   315   O  "O5'" . U   C 1 5   ? 29.501  112.256 121.985 1.00 20.96 ? 5    U   G "O5'" 1 
ATOM   316   C  "C5'" . U   C 1 5   ? 30.457  112.711 121.048 1.00 22.59 ? 5    U   G "C5'" 1 
ATOM   317   C  "C4'" . U   C 1 5   ? 30.746  114.163 121.262 1.00 22.98 ? 5    U   G "C4'" 1 
ATOM   318   O  "O4'" . U   C 1 5   ? 29.535  114.940 121.132 1.00 23.57 ? 5    U   G "O4'" 1 
ATOM   319   C  "C3'" . U   C 1 5   ? 31.234  114.544 122.639 1.00 23.62 ? 5    U   G "C3'" 1 
ATOM   320   O  "O3'" . U   C 1 5   ? 32.609  114.236 122.735 1.00 23.49 ? 5    U   G "O3'" 1 
ATOM   321   C  "C2'" . U   C 1 5   ? 31.000  116.047 122.627 1.00 23.23 ? 5    U   G "C2'" 1 
ATOM   322   O  "O2'" . U   C 1 5   ? 31.988  116.696 121.857 1.00 23.41 ? 5    U   G "O2'" 1 
ATOM   323   C  "C1'" . U   C 1 5   ? 29.658  116.129 121.892 1.00 24.10 ? 5    U   G "C1'" 1 
ATOM   324   N  N1    . U   C 1 5   ? 28.537  116.181 122.835 1.00 24.86 ? 5    U   G N1    1 
ATOM   325   C  C2    . U   C 1 5   ? 28.206  117.412 123.364 1.00 26.79 ? 5    U   G C2    1 
ATOM   326   O  O2    . U   C 1 5   ? 28.776  118.446 123.038 1.00 29.53 ? 5    U   G O2    1 
ATOM   327   N  N3    . U   C 1 5   ? 27.186  117.394 124.278 1.00 26.60 ? 5    U   G N3    1 
ATOM   328   C  C4    . U   C 1 5   ? 26.478  116.298 124.686 1.00 27.62 ? 5    U   G C4    1 
ATOM   329   O  O4    . U   C 1 5   ? 25.529  116.449 125.443 1.00 31.19 ? 5    U   G O4    1 
ATOM   330   C  C5    . U   C 1 5   ? 26.877  115.062 124.075 1.00 27.75 ? 5    U   G C5    1 
ATOM   331   C  C6    . U   C 1 5   ? 27.868  115.054 123.192 1.00 24.72 ? 5    U   G C6    1 
ATOM   332   P  P     . U   C 1 6   ? 33.189  113.713 124.117 1.00 24.03 ? 6    U   G P     1 
ATOM   333   O  OP1   . U   C 1 6   ? 34.651  113.549 123.922 1.00 23.01 ? 6    U   G OP1   1 
ATOM   334   O  OP2   . U   C 1 6   ? 32.364  112.554 124.565 1.00 21.47 ? 6    U   G OP2   1 
ATOM   335   O  "O5'" . U   C 1 6   ? 32.906  114.942 125.097 1.00 24.81 ? 6    U   G "O5'" 1 
ATOM   336   C  "C5'" . U   C 1 6   ? 32.886  114.770 126.506 1.00 24.98 ? 6    U   G "C5'" 1 
ATOM   337   C  "C4'" . U   C 1 6   ? 34.237  115.118 127.092 1.00 26.55 ? 6    U   G "C4'" 1 
ATOM   338   O  "O4'" . U   C 1 6   ? 34.579  116.497 126.789 1.00 27.33 ? 6    U   G "O4'" 1 
ATOM   339   C  "C3'" . U   C 1 6   ? 34.316  115.042 128.605 1.00 27.63 ? 6    U   G "C3'" 1 
ATOM   340   O  "O3'" . U   C 1 6   ? 34.573  113.704 129.001 1.00 30.90 ? 6    U   G "O3'" 1 
ATOM   341   C  "C2'" . U   C 1 6   ? 35.501  115.947 128.912 1.00 27.66 ? 6    U   G "C2'" 1 
ATOM   342   O  "O2'" . U   C 1 6   ? 36.737  115.283 128.722 1.00 28.28 ? 6    U   G "O2'" 1 
ATOM   343   C  "C1'" . U   C 1 6   ? 35.330  117.046 127.859 1.00 28.59 ? 6    U   G "C1'" 1 
ATOM   344   N  N1    . U   C 1 6   ? 34.624  118.237 128.354 1.00 30.55 ? 6    U   G N1    1 
ATOM   345   C  C2    . U   C 1 6   ? 35.330  119.129 129.149 1.00 31.34 ? 6    U   G C2    1 
ATOM   346   O  O2    . U   C 1 6   ? 36.488  118.943 129.487 1.00 31.20 ? 6    U   G O2    1 
ATOM   347   N  N3    . U   C 1 6   ? 34.624  120.239 129.543 1.00 32.19 ? 6    U   G N3    1 
ATOM   348   C  C4    . U   C 1 6   ? 33.307  120.539 129.241 1.00 34.29 ? 6    U   G C4    1 
ATOM   349   O  O4    . U   C 1 6   ? 32.828  121.617 129.610 1.00 34.60 ? 6    U   G O4    1 
ATOM   350   C  C5    . U   C 1 6   ? 32.635  119.550 128.436 1.00 32.72 ? 6    U   G C5    1 
ATOM   351   C  C6    . U   C 1 6   ? 33.301  118.464 128.033 1.00 32.39 ? 6    U   G C6    1 
ATOM   352   P  P     . U   C 1 7   ? 33.681  113.033 130.148 1.00 32.36 ? 7    U   G P     1 
ATOM   353   O  OP1   . U   C 1 7   ? 34.301  111.751 130.512 1.00 32.46 ? 7    U   G OP1   1 
ATOM   354   O  OP2   . U   C 1 7   ? 32.260  113.062 129.715 1.00 33.93 ? 7    U   G OP2   1 
ATOM   355   O  "O5'" . U   C 1 7   ? 33.851  114.030 131.370 1.00 38.96 ? 7    U   G "O5'" 1 
ATOM   356   C  "C5'" . U   C 1 7   ? 35.113  114.183 132.019 1.00 46.80 ? 7    U   G "C5'" 1 
ATOM   357   C  "C4'" . U   C 1 7   ? 35.044  115.303 133.031 1.00 52.47 ? 7    U   G "C4'" 1 
ATOM   358   O  "O4'" . U   C 1 7   ? 34.895  116.577 132.341 1.00 55.06 ? 7    U   G "O4'" 1 
ATOM   359   C  "C3'" . U   C 1 7   ? 33.845  115.247 133.963 1.00 54.26 ? 7    U   G "C3'" 1 
ATOM   360   O  "O3'" . U   C 1 7   ? 33.983  114.257 134.989 1.00 54.46 ? 7    U   G "O3'" 1 
ATOM   361   C  "C2'" . U   C 1 7   ? 33.721  116.702 134.408 1.00 56.40 ? 7    U   G "C2'" 1 
ATOM   362   O  "O2'" . U   C 1 7   ? 34.651  117.052 135.414 1.00 57.89 ? 7    U   G "O2'" 1 
ATOM   363   C  "C1'" . U   C 1 7   ? 34.077  117.445 133.114 1.00 57.06 ? 7    U   G "C1'" 1 
ATOM   364   N  N1    . U   C 1 7   ? 32.897  117.800 132.313 1.00 58.47 ? 7    U   G N1    1 
ATOM   365   C  C2    . U   C 1 7   ? 32.308  119.029 132.547 1.00 59.60 ? 7    U   G C2    1 
ATOM   366   O  O2    . U   C 1 7   ? 32.743  119.822 133.359 1.00 59.11 ? 7    U   G O2    1 
ATOM   367   N  N3    . U   C 1 7   ? 31.189  119.291 131.790 1.00 60.75 ? 7    U   G N3    1 
ATOM   368   C  C4    . U   C 1 7   ? 30.613  118.459 130.841 1.00 61.20 ? 7    U   G C4    1 
ATOM   369   O  O4    . U   C 1 7   ? 29.564  118.801 130.285 1.00 61.88 ? 7    U   G O4    1 
ATOM   370   C  C5    . U   C 1 7   ? 31.297  117.214 130.647 1.00 60.83 ? 7    U   G C5    1 
ATOM   371   C  C6    . U   C 1 7   ? 32.388  116.936 131.372 1.00 59.61 ? 7    U   G C6    1 
ATOM   372   O  "O5'" . U   D 1 2   ? 85.950  49.637  121.958 1.00 41.18 ? 2    U   H "O5'" 1 
ATOM   373   C  "C5'" . U   D 1 2   ? 85.537  49.804  123.322 1.00 39.46 ? 2    U   H "C5'" 1 
ATOM   374   C  "C4'" . U   D 1 2   ? 84.033  49.799  123.413 1.00 38.71 ? 2    U   H "C4'" 1 
ATOM   375   O  "O4'" . U   D 1 2   ? 83.513  50.947  122.692 1.00 40.09 ? 2    U   H "O4'" 1 
ATOM   376   C  "C3'" . U   D 1 2   ? 83.365  48.605  122.752 1.00 36.67 ? 2    U   H "C3'" 1 
ATOM   377   O  "O3'" . U   D 1 2   ? 83.290  47.516  123.651 1.00 32.73 ? 2    U   H "O3'" 1 
ATOM   378   C  "C2'" . U   D 1 2   ? 81.986  49.150  122.422 1.00 38.13 ? 2    U   H "C2'" 1 
ATOM   379   O  "O2'" . U   D 1 2   ? 81.126  49.157  123.535 1.00 38.06 ? 2    U   H "O2'" 1 
ATOM   380   C  "C1'" . U   D 1 2   ? 82.319  50.587  122.020 1.00 40.87 ? 2    U   H "C1'" 1 
ATOM   381   N  N1    . U   D 1 2   ? 82.551  50.736  120.577 1.00 44.04 ? 2    U   H N1    1 
ATOM   382   C  C2    . U   D 1 2   ? 81.448  50.716  119.741 1.00 45.49 ? 2    U   H C2    1 
ATOM   383   O  O2    . U   D 1 2   ? 80.303  50.592  120.151 1.00 45.41 ? 2    U   H O2    1 
ATOM   384   N  N3    . U   D 1 2   ? 81.737  50.855  118.404 1.00 47.15 ? 2    U   H N3    1 
ATOM   385   C  C4    . U   D 1 2   ? 82.986  51.021  117.834 1.00 47.60 ? 2    U   H C4    1 
ATOM   386   O  O4    . U   D 1 2   ? 83.081  51.164  116.609 1.00 49.54 ? 2    U   H O4    1 
ATOM   387   C  C5    . U   D 1 2   ? 84.072  51.030  118.768 1.00 46.49 ? 2    U   H C5    1 
ATOM   388   C  C6    . U   D 1 2   ? 83.823  50.888  120.075 1.00 44.89 ? 2    U   H C6    1 
ATOM   389   P  P     . U   D 1 3   ? 83.618  46.040  123.136 1.00 29.34 ? 3    U   H P     1 
ATOM   390   O  OP1   . U   D 1 3   ? 83.343  45.083  124.241 1.00 31.45 ? 3    U   H OP1   1 
ATOM   391   O  OP2   . U   D 1 3   ? 84.948  46.053  122.496 1.00 32.19 ? 3    U   H OP2   1 
ATOM   392   O  "O5'" . U   D 1 3   ? 82.558  45.801  121.981 1.00 29.79 ? 3    U   H "O5'" 1 
ATOM   393   C  "C5'" . U   D 1 3   ? 81.179  45.786  122.274 1.00 27.45 ? 3    U   H "C5'" 1 
ATOM   394   C  "C4'" . U   D 1 3   ? 80.399  45.584  121.015 1.00 27.61 ? 3    U   H "C4'" 1 
ATOM   395   O  "O4'" . U   D 1 3   ? 80.411  46.790  120.216 1.00 28.69 ? 3    U   H "O4'" 1 
ATOM   396   C  "C3'" . U   D 1 3   ? 80.974  44.557  120.072 1.00 26.57 ? 3    U   H "C3'" 1 
ATOM   397   O  "O3'" . U   D 1 3   ? 80.666  43.258  120.507 1.00 27.65 ? 3    U   H "O3'" 1 
ATOM   398   C  "C2'" . U   D 1 3   ? 80.271  44.926  118.778 1.00 27.49 ? 3    U   H "C2'" 1 
ATOM   399   O  "O2'" . U   D 1 3   ? 78.895  44.577  118.780 1.00 26.76 ? 3    U   H "O2'" 1 
ATOM   400   C  "C1'" . U   D 1 3   ? 80.365  46.445  118.841 1.00 28.20 ? 3    U   H "C1'" 1 
ATOM   401   N  N1    . U   D 1 3   ? 81.570  46.976  118.194 1.00 30.68 ? 3    U   H N1    1 
ATOM   402   C  C2    . U   D 1 3   ? 81.515  47.167  116.840 1.00 31.05 ? 3    U   H C2    1 
ATOM   403   O  O2    . U   D 1 3   ? 80.533  46.884  116.177 1.00 32.66 ? 3    U   H O2    1 
ATOM   404   N  N3    . U   D 1 3   ? 82.644  47.703  116.285 1.00 32.39 ? 3    U   H N3    1 
ATOM   405   C  C4    . U   D 1 3   ? 83.809  48.054  116.940 1.00 33.72 ? 3    U   H C4    1 
ATOM   406   O  O4    . U   D 1 3   ? 84.740  48.549  116.296 1.00 34.34 ? 3    U   H O4    1 
ATOM   407   C  C5    . U   D 1 3   ? 83.799  47.799  118.352 1.00 32.46 ? 3    U   H C5    1 
ATOM   408   C  C6    . U   D 1 3   ? 82.706  47.282  118.917 1.00 31.62 ? 3    U   H C6    1 
ATOM   409   P  P     . U   D 1 4   ? 81.440  42.019  119.863 1.00 26.78 ? 4    U   H P     1 
ATOM   410   O  OP1   . U   D 1 4   ? 81.123  40.823  120.682 1.00 26.50 ? 4    U   H OP1   1 
ATOM   411   O  OP2   . U   D 1 4   ? 82.852  42.447  119.707 1.00 27.34 ? 4    U   H OP2   1 
ATOM   412   O  "O5'" . U   D 1 4   ? 80.765  41.916  118.431 1.00 25.93 ? 4    U   H "O5'" 1 
ATOM   413   C  "C5'" . U   D 1 4   ? 81.452  41.338  117.335 1.00 27.95 ? 4    U   H "C5'" 1 
ATOM   414   C  "C4'" . U   D 1 4   ? 80.949  41.926  116.045 1.00 26.91 ? 4    U   H "C4'" 1 
ATOM   415   O  "O4'" . U   D 1 4   ? 81.124  43.372  116.082 1.00 29.05 ? 4    U   H "O4'" 1 
ATOM   416   C  "C3'" . U   D 1 4   ? 81.734  41.467  114.826 1.00 27.02 ? 4    U   H "C3'" 1 
ATOM   417   O  "O3'" . U   D 1 4   ? 81.158  40.268  114.334 1.00 26.49 ? 4    U   H "O3'" 1 
ATOM   418   C  "C2'" . U   D 1 4   ? 81.572  42.642  113.865 1.00 27.28 ? 4    U   H "C2'" 1 
ATOM   419   O  "O2'" . U   D 1 4   ? 80.332  42.670  113.206 1.00 26.48 ? 4    U   H "O2'" 1 
ATOM   420   C  "C1'" . U   D 1 4   ? 81.603  43.827  114.825 1.00 29.26 ? 4    U   H "C1'" 1 
ATOM   421   N  N1    . U   D 1 4   ? 82.950  44.375  115.020 1.00 31.69 ? 4    U   H N1    1 
ATOM   422   C  C2    . U   D 1 4   ? 83.617  44.859  113.912 1.00 32.60 ? 4    U   H C2    1 
ATOM   423   O  O2    . U   D 1 4   ? 83.128  44.849  112.792 1.00 32.80 ? 4    U   H O2    1 
ATOM   424   N  N3    . U   D 1 4   ? 84.869  45.366  114.166 1.00 33.05 ? 4    U   H N3    1 
ATOM   425   C  C4    . U   D 1 4   ? 85.500  45.452  115.400 1.00 34.73 ? 4    U   H C4    1 
ATOM   426   O  O4    . U   D 1 4   ? 86.628  45.935  115.474 1.00 35.88 ? 4    U   H O4    1 
ATOM   427   C  C5    . U   D 1 4   ? 84.745  44.930  116.493 1.00 34.21 ? 4    U   H C5    1 
ATOM   428   C  C6    . U   D 1 4   ? 83.524  44.415  116.269 1.00 33.82 ? 4    U   H C6    1 
ATOM   429   P  P     . U   D 1 5   ? 82.067  38.949  114.185 1.00 25.85 ? 5    U   H P     1 
ATOM   430   O  OP1   . U   D 1 5   ? 81.212  37.824  113.734 1.00 23.12 ? 5    U   H OP1   1 
ATOM   431   O  OP2   . U   D 1 5   ? 82.880  38.801  115.411 1.00 25.39 ? 5    U   H OP2   1 
ATOM   432   O  "O5'" . U   D 1 5   ? 83.055  39.328  112.994 1.00 27.15 ? 5    U   H "O5'" 1 
ATOM   433   C  "C5'" . U   D 1 5   ? 82.562  39.524  111.681 1.00 25.78 ? 5    U   H "C5'" 1 
ATOM   434   C  "C4'" . U   D 1 5   ? 83.532  40.347  110.883 1.00 28.42 ? 5    U   H "C4'" 1 
ATOM   435   O  "O4'" . U   D 1 5   ? 83.754  41.617  111.547 1.00 28.96 ? 5    U   H "O4'" 1 
ATOM   436   C  "C3'" . U   D 1 5   ? 84.939  39.784  110.762 1.00 29.37 ? 5    U   H "C3'" 1 
ATOM   437   O  "O3'" . U   D 1 5   ? 84.978  38.795  109.743 1.00 33.08 ? 5    U   H "O3'" 1 
ATOM   438   C  "C2'" . U   D 1 5   ? 85.736  41.027  110.376 1.00 28.12 ? 5    U   H "C2'" 1 
ATOM   439   O  "O2'" . U   D 1 5   ? 85.580  41.372  109.024 1.00 26.37 ? 5    U   H "O2'" 1 
ATOM   440   C  "C1'" . U   D 1 5   ? 85.054  42.095  111.228 1.00 28.53 ? 5    U   H "C1'" 1 
ATOM   441   N  N1    . U   D 1 5   ? 85.783  42.355  112.471 1.00 28.85 ? 5    U   H N1    1 
ATOM   442   C  C2    . U   D 1 5   ? 86.732  43.358  112.444 1.00 30.84 ? 5    U   H C2    1 
ATOM   443   O  O2    . U   D 1 5   ? 86.945  44.035  111.457 1.00 31.79 ? 5    U   H O2    1 
ATOM   444   N  N3    . U   D 1 5   ? 87.421  43.541  113.614 1.00 30.56 ? 5    U   H N3    1 
ATOM   445   C  C4    . U   D 1 5   ? 87.259  42.838  114.786 1.00 31.18 ? 5    U   H C4    1 
ATOM   446   O  O4    . U   D 1 5   ? 88.006  43.077  115.733 1.00 32.91 ? 5    U   H O4    1 
ATOM   447   C  C5    . U   D 1 5   ? 86.238  41.831  114.746 1.00 29.59 ? 5    U   H C5    1 
ATOM   448   C  C6    . U   D 1 5   ? 85.553  41.630  113.613 1.00 29.42 ? 5    U   H C6    1 
ATOM   449   P  P     . U   D 1 6   ? 85.989  37.557  109.876 1.00 34.07 ? 6    U   H P     1 
ATOM   450   O  OP1   . U   D 1 6   ? 85.882  36.786  108.623 1.00 33.34 ? 6    U   H OP1   1 
ATOM   451   O  OP2   . U   D 1 6   ? 85.739  36.882  111.170 1.00 35.41 ? 6    U   H OP2   1 
ATOM   452   O  "O5'" . U   D 1 6   ? 87.409  38.268  109.959 1.00 35.67 ? 6    U   H "O5'" 1 
ATOM   453   C  "C5'" . U   D 1 6   ? 88.527  37.610  110.538 1.00 39.67 ? 6    U   H "C5'" 1 
ATOM   454   C  "C4'" . U   D 1 6   ? 89.383  37.001  109.452 1.00 43.76 ? 6    U   H "C4'" 1 
ATOM   455   O  "O4'" . U   D 1 6   ? 89.808  38.026  108.517 1.00 43.90 ? 6    U   H "O4'" 1 
ATOM   456   C  "C3'" . U   D 1 6   ? 90.683  36.367  109.912 1.00 45.16 ? 6    U   H "C3'" 1 
ATOM   457   O  "O3'" . U   D 1 6   ? 90.424  35.051  110.372 1.00 48.23 ? 6    U   H "O3'" 1 
ATOM   458   C  "C2'" . U   D 1 6   ? 91.498  36.356  108.625 1.00 44.46 ? 6    U   H "C2'" 1 
ATOM   459   O  "O2'" . U   D 1 6   ? 91.114  35.292  107.777 1.00 43.74 ? 6    U   H "O2'" 1 
ATOM   460   C  "C1'" . U   D 1 6   ? 91.073  37.680  107.984 1.00 45.13 ? 6    U   H "C1'" 1 
ATOM   461   N  N1    . U   D 1 6   ? 91.994  38.796  108.230 1.00 45.74 ? 6    U   H N1    1 
ATOM   462   C  C2    . U   D 1 6   ? 93.149  38.828  107.495 1.00 46.06 ? 6    U   H C2    1 
ATOM   463   O  O2    . U   D 1 6   ? 93.422  37.972  106.682 1.00 47.12 ? 6    U   H O2    1 
ATOM   464   N  N3    . U   D 1 6   ? 93.971  39.898  107.743 1.00 46.53 ? 6    U   H N3    1 
ATOM   465   C  C4    . U   D 1 6   ? 93.749  40.922  108.643 1.00 47.42 ? 6    U   H C4    1 
ATOM   466   O  O4    . U   D 1 6   ? 94.565  41.843  108.733 1.00 47.64 ? 6    U   H O4    1 
ATOM   467   C  C5    . U   D 1 6   ? 92.523  40.809  109.379 1.00 47.17 ? 6    U   H C5    1 
ATOM   468   C  C6    . U   D 1 6   ? 91.709  39.773  109.151 1.00 46.60 ? 6    U   H C6    1 
ATOM   469   P  P     . U   D 1 7   ? 91.026  34.572  111.770 1.00 51.14 ? 7    U   H P     1 
ATOM   470   O  OP1   . U   D 1 7   ? 90.515  33.206  112.013 1.00 51.35 ? 7    U   H OP1   1 
ATOM   471   O  OP2   . U   D 1 7   ? 90.795  35.641  112.776 1.00 51.79 ? 7    U   H OP2   1 
ATOM   472   O  "O5'" . U   D 1 7   ? 92.592  34.510  111.502 1.00 57.06 ? 7    U   H "O5'" 1 
ATOM   473   C  "C5'" . U   D 1 7   ? 93.112  33.747  110.413 1.00 63.92 ? 7    U   H "C5'" 1 
ATOM   474   C  "C4'" . U   D 1 7   ? 94.601  33.959  110.290 1.00 68.27 ? 7    U   H "C4'" 1 
ATOM   475   O  "O4'" . U   D 1 7   ? 94.885  35.300  109.817 1.00 70.60 ? 7    U   H "O4'" 1 
ATOM   476   C  "C3'" . U   D 1 7   ? 95.374  33.873  111.591 1.00 70.26 ? 7    U   H "C3'" 1 
ATOM   477   O  "O3'" . U   D 1 7   ? 95.535  32.522  112.038 1.00 70.75 ? 7    U   H "O3'" 1 
ATOM   478   C  "C2'" . U   D 1 7   ? 96.666  34.603  111.243 1.00 72.24 ? 7    U   H "C2'" 1 
ATOM   479   O  "O2'" . U   D 1 7   ? 97.580  33.776  110.547 1.00 73.32 ? 7    U   H "O2'" 1 
ATOM   480   C  "C1'" . U   D 1 7   ? 96.156  35.704  110.303 1.00 73.33 ? 7    U   H "C1'" 1 
ATOM   481   N  N1    . U   D 1 7   ? 96.032  37.038  110.914 1.00 75.97 ? 7    U   H N1    1 
ATOM   482   C  C2    . U   D 1 7   ? 97.182  37.630  111.431 1.00 77.49 ? 7    U   H C2    1 
ATOM   483   O  O2    . U   D 1 7   ? 98.280  37.089  111.408 1.00 77.82 ? 7    U   H O2    1 
ATOM   484   N  N3    . U   D 1 7   ? 96.997  38.880  111.974 1.00 78.45 ? 7    U   H N3    1 
ATOM   485   C  C4    . U   D 1 7   ? 95.811  39.588  112.052 1.00 78.76 ? 7    U   H C4    1 
ATOM   486   O  O4    . U   D 1 7   ? 95.811  40.721  112.546 1.00 79.45 ? 7    U   H O4    1 
ATOM   487   C  C5    . U   D 1 7   ? 94.673  38.909  111.503 1.00 78.23 ? 7    U   H C5    1 
ATOM   488   C  C6    . U   D 1 7   ? 94.819  37.688  110.967 1.00 77.08 ? 7    U   H C6    1 
ATOM   489   N  N     . TYR E 2 13  ? 16.892  87.743  48.516  1.00 63.48 ? 202  TYR A N     1 
ATOM   490   C  CA    . TYR E 2 13  ? 18.020  88.348  49.280  1.00 63.54 ? 202  TYR A CA    1 
ATOM   491   C  C     . TYR E 2 13  ? 18.731  89.453  48.498  1.00 64.58 ? 202  TYR A C     1 
ATOM   492   O  O     . TYR E 2 13  ? 19.078  90.489  49.066  1.00 64.94 ? 202  TYR A O     1 
ATOM   493   C  CB    . TYR E 2 13  ? 19.009  87.241  49.703  1.00 61.63 ? 202  TYR A CB    1 
ATOM   494   C  CG    . TYR E 2 13  ? 20.475  87.642  49.817  1.00 59.98 ? 202  TYR A CG    1 
ATOM   495   C  CD1   . TYR E 2 13  ? 20.875  88.754  50.562  1.00 58.71 ? 202  TYR A CD1   1 
ATOM   496   C  CD2   . TYR E 2 13  ? 21.466  86.884  49.187  1.00 59.19 ? 202  TYR A CD2   1 
ATOM   497   C  CE1   . TYR E 2 13  ? 22.224  89.097  50.669  1.00 58.33 ? 202  TYR A CE1   1 
ATOM   498   C  CE2   . TYR E 2 13  ? 22.811  87.214  49.293  1.00 58.10 ? 202  TYR A CE2   1 
ATOM   499   C  CZ    . TYR E 2 13  ? 23.187  88.319  50.032  1.00 58.40 ? 202  TYR A CZ    1 
ATOM   500   O  OH    . TYR E 2 13  ? 24.524  88.641  50.137  1.00 57.69 ? 202  TYR A OH    1 
ATOM   501   N  N     . ILE E 2 14  ? 18.939  89.250  47.202  1.00 65.68 ? 203  ILE A N     1 
ATOM   502   C  CA    . ILE E 2 14  ? 19.620  90.258  46.391  1.00 67.45 ? 203  ILE A CA    1 
ATOM   503   C  C     . ILE E 2 14  ? 21.005  90.539  46.978  1.00 68.38 ? 203  ILE A C     1 
ATOM   504   O  O     . ILE E 2 14  ? 21.176  91.472  47.768  1.00 68.05 ? 203  ILE A O     1 
ATOM   505   C  CB    . ILE E 2 14  ? 18.834  91.602  46.360  1.00 67.82 ? 203  ILE A CB    1 
ATOM   506   C  CG1   . ILE E 2 14  ? 17.430  91.389  45.785  1.00 68.21 ? 203  ILE A CG1   1 
ATOM   507   C  CG2   . ILE E 2 14  ? 19.596  92.631  45.530  1.00 67.49 ? 203  ILE A CG2   1 
ATOM   508   C  CD1   . ILE E 2 14  ? 16.548  92.633  45.831  1.00 67.64 ? 203  ILE A CD1   1 
ATOM   509   N  N     . PRO E 2 15  ? 22.012  89.731  46.602  1.00 69.49 ? 204  PRO A N     1 
ATOM   510   C  CA    . PRO E 2 15  ? 23.382  89.905  47.099  1.00 70.57 ? 204  PRO A CA    1 
ATOM   511   C  C     . PRO E 2 15  ? 24.077  91.150  46.542  1.00 71.77 ? 204  PRO A C     1 
ATOM   512   O  O     . PRO E 2 15  ? 23.737  91.630  45.457  1.00 71.40 ? 204  PRO A O     1 
ATOM   513   C  CB    . PRO E 2 15  ? 24.068  88.611  46.666  1.00 70.28 ? 204  PRO A CB    1 
ATOM   514   C  CG    . PRO E 2 15  ? 23.368  88.281  45.390  1.00 69.99 ? 204  PRO A CG    1 
ATOM   515   C  CD    . PRO E 2 15  ? 21.917  88.540  45.740  1.00 69.78 ? 204  PRO A CD    1 
ATOM   516   N  N     . PRO E 2 16  ? 25.059  91.691  47.286  1.00 73.14 ? 205  PRO A N     1 
ATOM   517   C  CA    . PRO E 2 16  ? 25.799  92.884  46.857  1.00 74.55 ? 205  PRO A CA    1 
ATOM   518   C  C     . PRO E 2 16  ? 26.485  92.738  45.493  1.00 76.18 ? 205  PRO A C     1 
ATOM   519   O  O     . PRO E 2 16  ? 27.131  91.723  45.206  1.00 76.21 ? 205  PRO A O     1 
ATOM   520   C  CB    . PRO E 2 16  ? 26.788  93.113  48.006  1.00 74.16 ? 205  PRO A CB    1 
ATOM   521   C  CG    . PRO E 2 16  ? 26.951  91.745  48.613  1.00 73.61 ? 205  PRO A CG    1 
ATOM   522   C  CD    . PRO E 2 16  ? 25.545  91.217  48.594  1.00 73.26 ? 205  PRO A CD    1 
ATOM   523   N  N     . GLU E 2 17  ? 26.332  93.763  44.656  1.00 77.77 ? 206  GLU A N     1 
ATOM   524   C  CA    . GLU E 2 17  ? 26.909  93.773  43.315  1.00 79.11 ? 206  GLU A CA    1 
ATOM   525   C  C     . GLU E 2 17  ? 28.428  93.921  43.391  1.00 79.51 ? 206  GLU A C     1 
ATOM   526   O  O     . GLU E 2 17  ? 28.950  94.641  44.244  1.00 79.29 ? 206  GLU A O     1 
ATOM   527   C  CB    . GLU E 2 17  ? 26.319  94.930  42.503  1.00 79.89 ? 206  GLU A CB    1 
ATOM   528   C  CG    . GLU E 2 17  ? 26.188  94.668  41.003  1.00 81.80 ? 206  GLU A CG    1 
ATOM   529   C  CD    . GLU E 2 17  ? 24.817  94.122  40.618  1.00 82.94 ? 206  GLU A CD    1 
ATOM   530   O  OE1   . GLU E 2 17  ? 23.803  94.749  40.997  1.00 83.43 ? 206  GLU A OE1   1 
ATOM   531   O  OE2   . GLU E 2 17  ? 24.750  93.075  39.933  1.00 83.73 ? 206  GLU A OE2   1 
ATOM   532   N  N     . PRO E 2 18  ? 29.158  93.235  42.495  1.00 80.02 ? 207  PRO A N     1 
ATOM   533   C  CA    . PRO E 2 18  ? 30.622  93.293  42.466  1.00 80.48 ? 207  PRO A CA    1 
ATOM   534   C  C     . PRO E 2 18  ? 31.167  94.609  41.910  1.00 81.00 ? 207  PRO A C     1 
ATOM   535   O  O     . PRO E 2 18  ? 30.754  95.061  40.839  1.00 80.96 ? 207  PRO A O     1 
ATOM   536   C  CB    . PRO E 2 18  ? 30.990  92.101  41.593  1.00 80.54 ? 207  PRO A CB    1 
ATOM   537   C  CG    . PRO E 2 18  ? 29.861  92.070  40.603  1.00 80.31 ? 207  PRO A CG    1 
ATOM   538   C  CD    . PRO E 2 18  ? 28.650  92.286  41.485  1.00 79.97 ? 207  PRO A CD    1 
ATOM   539   N  N     . SER E 2 19  ? 32.095  95.212  42.648  1.00 81.59 ? 208  SER A N     1 
ATOM   540   C  CA    . SER E 2 19  ? 32.717  96.470  42.244  1.00 82.12 ? 208  SER A CA    1 
ATOM   541   C  C     . SER E 2 19  ? 33.565  96.304  40.987  1.00 82.48 ? 208  SER A C     1 
ATOM   542   O  O     . SER E 2 19  ? 33.904  95.185  40.600  1.00 82.61 ? 208  SER A O     1 
ATOM   543   C  CB    . SER E 2 19  ? 33.593  97.002  43.374  1.00 82.22 ? 208  SER A CB    1 
ATOM   544   O  OG    . SER E 2 19  ? 34.853  97.421  42.877  1.00 82.29 ? 208  SER A OG    1 
ATOM   545   N  N     . ASN E 2 20  ? 33.920  97.423  40.363  1.00 83.03 ? 209  ASN A N     1 
ATOM   546   C  CA    . ASN E 2 20  ? 34.716  97.397  39.140  1.00 83.47 ? 209  ASN A CA    1 
ATOM   547   C  C     . ASN E 2 20  ? 36.104  98.008  39.324  1.00 83.66 ? 209  ASN A C     1 
ATOM   548   O  O     . ASN E 2 20  ? 36.886  98.091  38.377  1.00 83.50 ? 209  ASN A O     1 
ATOM   549   C  CB    . ASN E 2 20  ? 33.969  98.133  38.026  1.00 83.72 ? 209  ASN A CB    1 
ATOM   550   C  CG    . ASN E 2 20  ? 32.541  97.637  37.856  1.00 84.08 ? 209  ASN A CG    1 
ATOM   551   O  OD1   . ASN E 2 20  ? 32.305  96.508  37.419  1.00 84.05 ? 209  ASN A OD1   1 
ATOM   552   N  ND2   . ASN E 2 20  ? 31.580  98.483  38.211  1.00 84.32 ? 209  ASN A ND2   1 
ATOM   553   N  N     . ASP E 2 21  ? 36.404  98.440  40.544  1.00 84.11 ? 210  ASP A N     1 
ATOM   554   C  CA    . ASP E 2 21  ? 37.704  99.030  40.839  1.00 84.41 ? 210  ASP A CA    1 
ATOM   555   C  C     . ASP E 2 21  ? 38.753  97.921  40.838  1.00 84.12 ? 210  ASP A C     1 
ATOM   556   O  O     . ASP E 2 21  ? 38.622  96.928  41.556  1.00 84.03 ? 210  ASP A O     1 
ATOM   557   C  CB    . ASP E 2 21  ? 37.672  99.734  42.201  1.00 85.22 ? 210  ASP A CB    1 
ATOM   558   C  CG    . ASP E 2 21  ? 36.599  100.814 42.275  1.00 86.16 ? 210  ASP A CG    1 
ATOM   559   O  OD1   . ASP E 2 21  ? 36.606  101.718 41.411  1.00 86.29 ? 210  ASP A OD1   1 
ATOM   560   O  OD2   . ASP E 2 21  ? 35.751  100.760 43.196  1.00 86.48 ? 210  ASP A OD2   1 
ATOM   561   N  N     . ALA E 2 22  ? 39.788  98.097  40.023  1.00 83.70 ? 211  ALA A N     1 
ATOM   562   C  CA    . ALA E 2 22  ? 40.858  97.115  39.898  1.00 83.31 ? 211  ALA A CA    1 
ATOM   563   C  C     . ALA E 2 22  ? 41.517  96.734  41.224  1.00 82.96 ? 211  ALA A C     1 
ATOM   564   O  O     . ALA E 2 22  ? 42.209  95.716  41.304  1.00 82.70 ? 211  ALA A O     1 
ATOM   565   C  CB    . ALA E 2 22  ? 41.914  97.622  38.919  1.00 83.50 ? 211  ALA A CB    1 
ATOM   566   N  N     . ILE E 2 23  ? 41.309  97.543  42.260  1.00 82.43 ? 212  ILE A N     1 
ATOM   567   C  CA    . ILE E 2 23  ? 41.899  97.250  43.562  1.00 82.05 ? 212  ILE A CA    1 
ATOM   568   C  C     . ILE E 2 23  ? 41.125  96.126  44.251  1.00 81.62 ? 212  ILE A C     1 
ATOM   569   O  O     . ILE E 2 23  ? 41.709  95.284  44.934  1.00 81.29 ? 212  ILE A O     1 
ATOM   570   C  CB    . ILE E 2 23  ? 41.910  98.503  44.479  1.00 82.14 ? 212  ILE A CB    1 
ATOM   571   C  CG1   . ILE E 2 23  ? 42.642  98.180  45.786  1.00 82.13 ? 212  ILE A CG1   1 
ATOM   572   C  CG2   . ILE E 2 23  ? 40.485  98.967  44.757  1.00 82.05 ? 212  ILE A CG2   1 
ATOM   573   C  CD1   . ILE E 2 23  ? 42.760  99.351  46.741  1.00 82.15 ? 212  ILE A CD1   1 
ATOM   574   N  N     . GLU E 2 24  ? 39.810  96.119  44.053  1.00 81.35 ? 213  GLU A N     1 
ATOM   575   C  CA    . GLU E 2 24  ? 38.936  95.110  44.640  1.00 81.09 ? 213  GLU A CA    1 
ATOM   576   C  C     . GLU E 2 24  ? 38.933  93.846  43.783  1.00 80.31 ? 213  GLU A C     1 
ATOM   577   O  O     . GLU E 2 24  ? 39.038  92.731  44.296  1.00 80.15 ? 213  GLU A O     1 
ATOM   578   C  CB    . GLU E 2 24  ? 37.510  95.659  44.754  1.00 81.85 ? 213  GLU A CB    1 
ATOM   579   C  CG    . GLU E 2 24  ? 37.391  96.917  45.609  1.00 83.30 ? 213  GLU A CG    1 
ATOM   580   C  CD    . GLU E 2 24  ? 35.999  97.533  45.552  1.00 84.12 ? 213  GLU A CD    1 
ATOM   581   O  OE1   . GLU E 2 24  ? 35.019  96.814  45.850  1.00 84.81 ? 213  GLU A OE1   1 
ATOM   582   O  OE2   . GLU E 2 24  ? 35.884  98.733  45.210  1.00 83.89 ? 213  GLU A OE2   1 
ATOM   583   N  N     . ILE E 2 25  ? 38.808  94.032  42.474  1.00 79.42 ? 214  ILE A N     1 
ATOM   584   C  CA    . ILE E 2 25  ? 38.794  92.921  41.534  1.00 78.35 ? 214  ILE A CA    1 
ATOM   585   C  C     . ILE E 2 25  ? 40.047  92.061  41.696  1.00 78.07 ? 214  ILE A C     1 
ATOM   586   O  O     . ILE E 2 25  ? 40.020  90.856  41.450  1.00 77.83 ? 214  ILE A O     1 
ATOM   587   C  CB    . ILE E 2 25  ? 38.696  93.444  40.078  1.00 77.95 ? 214  ILE A CB    1 
ATOM   588   C  CG1   . ILE E 2 25  ? 37.325  94.088  39.863  1.00 77.60 ? 214  ILE A CG1   1 
ATOM   589   C  CG2   . ILE E 2 25  ? 38.936  92.314  39.084  1.00 77.55 ? 214  ILE A CG2   1 
ATOM   590   C  CD1   . ILE E 2 25  ? 37.088  94.588  38.464  1.00 77.38 ? 214  ILE A CD1   1 
ATOM   591   N  N     . PHE E 2 26  ? 41.140  92.683  42.127  1.00 77.72 ? 215  PHE A N     1 
ATOM   592   C  CA    . PHE E 2 26  ? 42.394  91.965  42.317  1.00 77.68 ? 215  PHE A CA    1 
ATOM   593   C  C     . PHE E 2 26  ? 42.783  91.767  43.782  1.00 77.84 ? 215  PHE A C     1 
ATOM   594   O  O     . PHE E 2 26  ? 43.942  91.475  44.088  1.00 77.81 ? 215  PHE A O     1 
ATOM   595   C  CB    . PHE E 2 26  ? 43.533  92.680  41.580  1.00 77.17 ? 215  PHE A CB    1 
ATOM   596   C  CG    . PHE E 2 26  ? 43.465  92.548  40.086  1.00 76.79 ? 215  PHE A CG    1 
ATOM   597   C  CD1   . PHE E 2 26  ? 42.544  93.283  39.348  1.00 76.65 ? 215  PHE A CD1   1 
ATOM   598   C  CD2   . PHE E 2 26  ? 44.306  91.665  39.419  1.00 76.59 ? 215  PHE A CD2   1 
ATOM   599   C  CE1   . PHE E 2 26  ? 42.461  93.140  37.965  1.00 76.53 ? 215  PHE A CE1   1 
ATOM   600   C  CE2   . PHE E 2 26  ? 44.230  91.513  38.039  1.00 76.57 ? 215  PHE A CE2   1 
ATOM   601   C  CZ    . PHE E 2 26  ? 43.306  92.253  37.310  1.00 76.46 ? 215  PHE A CZ    1 
ATOM   602   N  N     . SER E 2 27  ? 41.821  91.917  44.685  1.00 78.07 ? 216  SER A N     1 
ATOM   603   C  CA    . SER E 2 27  ? 42.096  91.742  46.109  1.00 78.51 ? 216  SER A CA    1 
ATOM   604   C  C     . SER E 2 27  ? 41.974  90.272  46.512  1.00 78.61 ? 216  SER A C     1 
ATOM   605   O  O     . SER E 2 27  ? 42.424  89.872  47.586  1.00 78.28 ? 216  SER A O     1 
ATOM   606   C  CB    . SER E 2 27  ? 41.131  92.590  46.947  1.00 78.51 ? 216  SER A CB    1 
ATOM   607   O  OG    . SER E 2 27  ? 39.785  92.205  46.729  1.00 78.48 ? 216  SER A OG    1 
ATOM   608   N  N     . SER E 2 28  ? 41.373  89.475  45.633  1.00 79.01 ? 217  SER A N     1 
ATOM   609   C  CA    . SER E 2 28  ? 41.167  88.051  45.882  1.00 79.39 ? 217  SER A CA    1 
ATOM   610   C  C     . SER E 2 28  ? 42.292  87.188  45.319  1.00 79.19 ? 217  SER A C     1 
ATOM   611   O  O     . SER E 2 28  ? 42.561  87.216  44.118  1.00 79.57 ? 217  SER A O     1 
ATOM   612   C  CB    . SER E 2 28  ? 39.840  87.611  45.263  1.00 79.90 ? 217  SER A CB    1 
ATOM   613   O  OG    . SER E 2 28  ? 39.819  87.895  43.873  1.00 80.49 ? 217  SER A OG    1 
ATOM   614   N  N     . GLY E 2 29  ? 42.938  86.417  46.190  1.00 78.78 ? 218  GLY A N     1 
ATOM   615   C  CA    . GLY E 2 29  ? 44.016  85.549  45.754  1.00 78.45 ? 218  GLY A CA    1 
ATOM   616   C  C     . GLY E 2 29  ? 45.082  85.338  46.810  1.00 78.22 ? 218  GLY A C     1 
ATOM   617   O  O     . GLY E 2 29  ? 45.260  86.173  47.695  1.00 78.60 ? 218  GLY A O     1 
ATOM   618   N  N     . ILE E 2 30  ? 45.787  84.214  46.722  1.00 77.86 ? 219  ILE A N     1 
ATOM   619   C  CA    . ILE E 2 30  ? 46.857  83.895  47.666  1.00 77.35 ? 219  ILE A CA    1 
ATOM   620   C  C     . ILE E 2 30  ? 48.207  83.960  46.950  1.00 77.32 ? 219  ILE A C     1 
ATOM   621   O  O     . ILE E 2 30  ? 48.336  83.512  45.806  1.00 77.16 ? 219  ILE A O     1 
ATOM   622   C  CB    . ILE E 2 30  ? 46.686  82.474  48.282  1.00 76.94 ? 219  ILE A CB    1 
ATOM   623   C  CG1   . ILE E 2 30  ? 45.387  82.397  49.095  1.00 76.77 ? 219  ILE A CG1   1 
ATOM   624   C  CG2   . ILE E 2 30  ? 47.873  82.146  49.186  1.00 76.64 ? 219  ILE A CG2   1 
ATOM   625   C  CD1   . ILE E 2 30  ? 45.123  81.033  49.729  1.00 75.49 ? 219  ILE A CD1   1 
ATOM   626   N  N     . ALA E 2 31  ? 49.206  84.522  47.627  1.00 77.10 ? 220  ALA A N     1 
ATOM   627   C  CA    . ALA E 2 31  ? 50.549  84.646  47.069  1.00 77.29 ? 220  ALA A CA    1 
ATOM   628   C  C     . ALA E 2 31  ? 51.298  83.312  47.128  1.00 77.40 ? 220  ALA A C     1 
ATOM   629   O  O     . ALA E 2 31  ? 51.273  82.624  48.151  1.00 77.28 ? 220  ALA A O     1 
ATOM   630   C  CB    . ALA E 2 31  ? 51.324  85.715  47.825  1.00 76.99 ? 220  ALA A CB    1 
ATOM   631   N  N     . SER E 2 32  ? 51.968  82.959  46.031  1.00 77.56 ? 221  SER A N     1 
ATOM   632   C  CA    . SER E 2 32  ? 52.719  81.706  45.942  1.00 77.87 ? 221  SER A CA    1 
ATOM   633   C  C     . SER E 2 32  ? 53.692  81.520  47.104  1.00 77.97 ? 221  SER A C     1 
ATOM   634   O  O     . SER E 2 32  ? 54.357  82.464  47.527  1.00 77.90 ? 221  SER A O     1 
ATOM   635   C  CB    . SER E 2 32  ? 53.491  81.641  44.621  1.00 77.98 ? 221  SER A CB    1 
ATOM   636   O  OG    . SER E 2 32  ? 54.594  82.530  44.630  1.00 78.07 ? 221  SER A OG    1 
ATOM   637   N  N     . GLY E 2 33  ? 53.780  80.290  47.602  1.00 78.26 ? 222  GLY A N     1 
ATOM   638   C  CA    . GLY E 2 33  ? 54.656  79.993  48.721  1.00 78.45 ? 222  GLY A CA    1 
ATOM   639   C  C     . GLY E 2 33  ? 56.099  79.651  48.387  1.00 78.66 ? 222  GLY A C     1 
ATOM   640   O  O     . GLY E 2 33  ? 56.495  79.565  47.221  1.00 78.38 ? 222  GLY A O     1 
ATOM   641   N  N     . ILE E 2 34  ? 56.884  79.449  49.439  1.00 78.79 ? 223  ILE A N     1 
ATOM   642   C  CA    . ILE E 2 34  ? 58.294  79.117  49.321  1.00 79.21 ? 223  ILE A CA    1 
ATOM   643   C  C     . ILE E 2 34  ? 58.515  77.772  48.630  1.00 79.18 ? 223  ILE A C     1 
ATOM   644   O  O     . ILE E 2 34  ? 59.578  77.536  48.052  1.00 79.45 ? 223  ILE A O     1 
ATOM   645   C  CB    . ILE E 2 34  ? 58.958  79.103  50.720  1.00 79.79 ? 223  ILE A CB    1 
ATOM   646   C  CG1   . ILE E 2 34  ? 58.876  80.505  51.335  1.00 80.48 ? 223  ILE A CG1   1 
ATOM   647   C  CG2   . ILE E 2 34  ? 60.412  78.658  50.620  1.00 80.21 ? 223  ILE A CG2   1 
ATOM   648   C  CD1   . ILE E 2 34  ? 59.490  80.617  52.721  1.00 81.06 ? 223  ILE A CD1   1 
ATOM   649   N  N     . HIS E 2 35  ? 57.515  76.895  48.684  1.00 78.85 ? 224  HIS A N     1 
ATOM   650   C  CA    . HIS E 2 35  ? 57.615  75.576  48.053  1.00 78.16 ? 224  HIS A CA    1 
ATOM   651   C  C     . HIS E 2 35  ? 57.044  75.557  46.633  1.00 77.14 ? 224  HIS A C     1 
ATOM   652   O  O     . HIS E 2 35  ? 56.894  74.488  46.039  1.00 76.61 ? 224  HIS A O     1 
ATOM   653   C  CB    . HIS E 2 35  ? 56.881  74.517  48.887  1.00 79.07 ? 224  HIS A CB    1 
ATOM   654   C  CG    . HIS E 2 35  ? 57.466  74.299  50.248  1.00 80.24 ? 224  HIS A CG    1 
ATOM   655   N  ND1   . HIS E 2 35  ? 58.789  73.966  50.446  1.00 80.79 ? 224  HIS A ND1   1 
ATOM   656   C  CD2   . HIS E 2 35  ? 56.903  74.353  51.478  1.00 80.69 ? 224  HIS A CD2   1 
ATOM   657   C  CE1   . HIS E 2 35  ? 59.017  73.826  51.740  1.00 81.03 ? 224  HIS A CE1   1 
ATOM   658   N  NE2   . HIS E 2 35  ? 57.889  74.055  52.389  1.00 81.30 ? 224  HIS A NE2   1 
ATOM   659   N  N     . PHE E 2 36  ? 56.723  76.731  46.093  1.00 76.09 ? 225  PHE A N     1 
ATOM   660   C  CA    . PHE E 2 36  ? 56.156  76.812  44.750  1.00 75.42 ? 225  PHE A CA    1 
ATOM   661   C  C     . PHE E 2 36  ? 57.012  76.013  43.775  1.00 74.92 ? 225  PHE A C     1 
ATOM   662   O  O     . PHE E 2 36  ? 56.498  75.253  42.957  1.00 74.77 ? 225  PHE A O     1 
ATOM   663   C  CB    . PHE E 2 36  ? 56.076  78.267  44.277  1.00 75.23 ? 225  PHE A CB    1 
ATOM   664   C  CG    . PHE E 2 36  ? 55.153  78.471  43.106  1.00 74.92 ? 225  PHE A CG    1 
ATOM   665   C  CD1   . PHE E 2 36  ? 53.780  78.569  43.296  1.00 74.90 ? 225  PHE A CD1   1 
ATOM   666   C  CD2   . PHE E 2 36  ? 55.652  78.538  41.811  1.00 74.97 ? 225  PHE A CD2   1 
ATOM   667   C  CE1   . PHE E 2 36  ? 52.918  78.729  42.214  1.00 74.71 ? 225  PHE A CE1   1 
ATOM   668   C  CE2   . PHE E 2 36  ? 54.794  78.698  40.722  1.00 74.61 ? 225  PHE A CE2   1 
ATOM   669   C  CZ    . PHE E 2 36  ? 53.427  78.794  40.927  1.00 74.42 ? 225  PHE A CZ    1 
ATOM   670   N  N     . SER E 2 37  ? 58.324  76.191  43.876  1.00 74.28 ? 226  SER A N     1 
ATOM   671   C  CA    . SER E 2 37  ? 59.270  75.492  43.016  1.00 73.64 ? 226  SER A CA    1 
ATOM   672   C  C     . SER E 2 37  ? 59.115  73.966  43.076  1.00 72.77 ? 226  SER A C     1 
ATOM   673   O  O     . SER E 2 37  ? 59.389  73.270  42.095  1.00 72.44 ? 226  SER A O     1 
ATOM   674   C  CB    . SER E 2 37  ? 60.696  75.884  43.405  1.00 73.87 ? 226  SER A CB    1 
ATOM   675   O  OG    . SER E 2 37  ? 60.949  75.573  44.764  1.00 74.79 ? 226  SER A OG    1 
ATOM   676   N  N     . LYS E 2 38  ? 58.677  73.451  44.224  1.00 71.84 ? 227  LYS A N     1 
ATOM   677   C  CA    . LYS E 2 38  ? 58.487  72.010  44.400  1.00 71.02 ? 227  LYS A CA    1 
ATOM   678   C  C     . LYS E 2 38  ? 57.496  71.392  43.414  1.00 69.88 ? 227  LYS A C     1 
ATOM   679   O  O     . LYS E 2 38  ? 57.464  70.174  43.252  1.00 69.33 ? 227  LYS A O     1 
ATOM   680   C  CB    . LYS E 2 38  ? 58.017  71.694  45.825  1.00 71.94 ? 227  LYS A CB    1 
ATOM   681   C  CG    . LYS E 2 38  ? 59.126  71.434  46.834  1.00 72.75 ? 227  LYS A CG    1 
ATOM   682   C  CD    . LYS E 2 38  ? 58.553  70.939  48.169  1.00 73.58 ? 227  LYS A CD    1 
ATOM   683   C  CE    . LYS E 2 38  ? 59.662  70.652  49.186  1.00 74.22 ? 227  LYS A CE    1 
ATOM   684   N  NZ    . LYS E 2 38  ? 59.146  70.256  50.530  1.00 74.65 ? 227  LYS A NZ    1 
ATOM   685   N  N     . TYR E 2 39  ? 56.690  72.226  42.761  1.00 69.06 ? 228  TYR A N     1 
ATOM   686   C  CA    . TYR E 2 39  ? 55.697  71.738  41.802  1.00 68.21 ? 228  TYR A CA    1 
ATOM   687   C  C     . TYR E 2 39  ? 56.233  70.832  40.692  1.00 67.51 ? 228  TYR A C     1 
ATOM   688   O  O     . TYR E 2 39  ? 55.648  69.780  40.422  1.00 66.79 ? 228  TYR A O     1 
ATOM   689   C  CB    . TYR E 2 39  ? 54.929  72.907  41.170  1.00 68.15 ? 228  TYR A CB    1 
ATOM   690   C  CG    . TYR E 2 39  ? 53.750  73.379  41.994  1.00 68.26 ? 228  TYR A CG    1 
ATOM   691   C  CD1   . TYR E 2 39  ? 52.815  72.470  42.495  1.00 68.32 ? 228  TYR A CD1   1 
ATOM   692   C  CD2   . TYR E 2 39  ? 53.567  74.734  42.273  1.00 68.66 ? 228  TYR A CD2   1 
ATOM   693   C  CE1   . TYR E 2 39  ? 51.730  72.896  43.258  1.00 68.43 ? 228  TYR A CE1   1 
ATOM   694   C  CE2   . TYR E 2 39  ? 52.485  75.174  43.034  1.00 68.73 ? 228  TYR A CE2   1 
ATOM   695   C  CZ    . TYR E 2 39  ? 51.572  74.249  43.525  1.00 68.81 ? 228  TYR A CZ    1 
ATOM   696   O  OH    . TYR E 2 39  ? 50.520  74.680  44.299  1.00 68.70 ? 228  TYR A OH    1 
ATOM   697   N  N     . ASN E 2 40  ? 57.333  71.224  40.048  1.00 66.87 ? 229  ASN A N     1 
ATOM   698   C  CA    . ASN E 2 40  ? 57.882  70.398  38.972  1.00 66.15 ? 229  ASN A CA    1 
ATOM   699   C  C     . ASN E 2 40  ? 58.457  69.053  39.424  1.00 65.17 ? 229  ASN A C     1 
ATOM   700   O  O     . ASN E 2 40  ? 58.721  68.185  38.590  1.00 65.23 ? 229  ASN A O     1 
ATOM   701   C  CB    . ASN E 2 40  ? 58.932  71.166  38.146  1.00 67.02 ? 229  ASN A CB    1 
ATOM   702   C  CG    . ASN E 2 40  ? 59.648  72.237  38.939  1.00 67.04 ? 229  ASN A CG    1 
ATOM   703   O  OD1   . ASN E 2 40  ? 59.298  73.417  38.864  1.00 67.39 ? 229  ASN A OD1   1 
ATOM   704   N  ND2   . ASN E 2 40  ? 60.655  71.833  39.706  1.00 67.12 ? 229  ASN A ND2   1 
ATOM   705   N  N     . ASN E 2 41  ? 58.653  68.870  40.729  1.00 63.46 ? 230  ASN A N     1 
ATOM   706   C  CA    . ASN E 2 41  ? 59.164  67.594  41.232  1.00 61.88 ? 230  ASN A CA    1 
ATOM   707   C  C     . ASN E 2 41  ? 58.032  66.571  41.285  1.00 59.93 ? 230  ASN A C     1 
ATOM   708   O  O     . ASN E 2 41  ? 58.248  65.411  41.640  1.00 60.05 ? 230  ASN A O     1 
ATOM   709   C  CB    . ASN E 2 41  ? 59.763  67.740  42.638  1.00 63.17 ? 230  ASN A CB    1 
ATOM   710   C  CG    . ASN E 2 41  ? 61.145  68.375  42.629  1.00 64.84 ? 230  ASN A CG    1 
ATOM   711   O  OD1   . ASN E 2 41  ? 61.281  69.604  42.667  1.00 65.81 ? 230  ASN A OD1   1 
ATOM   712   N  ND2   . ASN E 2 41  ? 62.181  67.538  42.568  1.00 64.65 ? 230  ASN A ND2   1 
ATOM   713   N  N     . ILE E 2 42  ? 56.825  67.011  40.938  1.00 57.47 ? 231  ILE A N     1 
ATOM   714   C  CA    . ILE E 2 42  ? 55.652  66.140  40.953  1.00 54.24 ? 231  ILE A CA    1 
ATOM   715   C  C     . ILE E 2 42  ? 55.431  65.456  39.608  1.00 51.77 ? 231  ILE A C     1 
ATOM   716   O  O     . ILE E 2 42  ? 55.361  66.106  38.566  1.00 50.83 ? 231  ILE A O     1 
ATOM   717   C  CB    . ILE E 2 42  ? 54.375  66.929  41.327  1.00 54.82 ? 231  ILE A CB    1 
ATOM   718   C  CG1   . ILE E 2 42  ? 54.541  67.565  42.708  1.00 54.78 ? 231  ILE A CG1   1 
ATOM   719   C  CG2   . ILE E 2 42  ? 53.171  66.006  41.343  1.00 54.07 ? 231  ILE A CG2   1 
ATOM   720   C  CD1   . ILE E 2 42  ? 53.413  68.515  43.085  1.00 55.59 ? 231  ILE A CD1   1 
ATOM   721   N  N     . PRO E 2 43  ? 55.324  64.121  39.624  1.00 49.90 ? 232  PRO A N     1 
ATOM   722   C  CA    . PRO E 2 43  ? 55.107  63.278  38.446  1.00 47.94 ? 232  PRO A CA    1 
ATOM   723   C  C     . PRO E 2 43  ? 53.851  63.699  37.684  1.00 46.59 ? 232  PRO A C     1 
ATOM   724   O  O     . PRO E 2 43  ? 52.820  63.987  38.291  1.00 46.46 ? 232  PRO A O     1 
ATOM   725   C  CB    . PRO E 2 43  ? 54.956  61.884  39.048  1.00 48.22 ? 232  PRO A CB    1 
ATOM   726   C  CG    . PRO E 2 43  ? 55.796  61.953  40.275  1.00 48.69 ? 232  PRO A CG    1 
ATOM   727   C  CD    . PRO E 2 43  ? 55.431  63.295  40.840  1.00 49.54 ? 232  PRO A CD    1 
ATOM   728   N  N     . VAL E 2 44  ? 53.938  63.731  36.359  1.00 44.28 ? 233  VAL A N     1 
ATOM   729   C  CA    . VAL E 2 44  ? 52.798  64.104  35.530  1.00 42.66 ? 233  VAL A CA    1 
ATOM   730   C  C     . VAL E 2 44  ? 52.357  62.942  34.648  1.00 41.40 ? 233  VAL A C     1 
ATOM   731   O  O     . VAL E 2 44  ? 53.183  62.243  34.067  1.00 42.38 ? 233  VAL A O     1 
ATOM   732   C  CB    . VAL E 2 44  ? 53.128  65.295  34.608  1.00 41.95 ? 233  VAL A CB    1 
ATOM   733   C  CG1   . VAL E 2 44  ? 51.967  65.554  33.673  1.00 42.26 ? 233  VAL A CG1   1 
ATOM   734   C  CG2   . VAL E 2 44  ? 53.415  66.526  35.428  1.00 42.29 ? 233  VAL A CG2   1 
ATOM   735   N  N     . LYS E 2 45  ? 51.053  62.737  34.546  1.00 39.65 ? 234  LYS A N     1 
ATOM   736   C  CA    . LYS E 2 45  ? 50.527  61.673  33.712  1.00 37.59 ? 234  LYS A CA    1 
ATOM   737   C  C     . LYS E 2 45  ? 49.501  62.242  32.752  1.00 36.75 ? 234  LYS A C     1 
ATOM   738   O  O     . LYS E 2 45  ? 48.614  62.990  33.152  1.00 35.20 ? 234  LYS A O     1 
ATOM   739   C  CB    . LYS E 2 45  ? 49.882  60.590  34.570  1.00 37.79 ? 234  LYS A CB    1 
ATOM   740   C  CG    . LYS E 2 45  ? 49.191  59.500  33.768  1.00 38.50 ? 234  LYS A CG    1 
ATOM   741   C  CD    . LYS E 2 45  ? 48.610  58.441  34.697  1.00 40.09 ? 234  LYS A CD    1 
ATOM   742   C  CE    . LYS E 2 45  ? 47.795  57.393  33.942  1.00 39.95 ? 234  LYS A CE    1 
ATOM   743   N  NZ    . LYS E 2 45  ? 47.066  56.463  34.875  1.00 40.72 ? 234  LYS A NZ    1 
ATOM   744   N  N     . VAL E 2 46  ? 49.645  61.901  31.476  1.00 36.68 ? 235  VAL A N     1 
ATOM   745   C  CA    . VAL E 2 46  ? 48.721  62.353  30.443  1.00 37.36 ? 235  VAL A CA    1 
ATOM   746   C  C     . VAL E 2 46  ? 48.301  61.155  29.584  1.00 38.83 ? 235  VAL A C     1 
ATOM   747   O  O     . VAL E 2 46  ? 49.132  60.332  29.202  1.00 38.50 ? 235  VAL A O     1 
ATOM   748   C  CB    . VAL E 2 46  ? 49.364  63.427  29.536  1.00 36.23 ? 235  VAL A CB    1 
ATOM   749   C  CG1   . VAL E 2 46  ? 48.437  63.754  28.385  1.00 35.54 ? 235  VAL A CG1   1 
ATOM   750   C  CG2   . VAL E 2 46  ? 49.645  64.681  30.332  1.00 35.16 ? 235  VAL A CG2   1 
ATOM   751   N  N     . THR E 2 47  ? 47.010  61.068  29.286  1.00 39.73 ? 236  THR A N     1 
ATOM   752   C  CA    . THR E 2 47  ? 46.462  59.977  28.481  1.00 41.14 ? 236  THR A CA    1 
ATOM   753   C  C     . THR E 2 47  ? 45.571  60.570  27.383  1.00 42.32 ? 236  THR A C     1 
ATOM   754   O  O     . THR E 2 47  ? 44.894  61.571  27.602  1.00 42.50 ? 236  THR A O     1 
ATOM   755   C  CB    . THR E 2 47  ? 45.611  59.031  29.368  1.00 41.30 ? 236  THR A CB    1 
ATOM   756   O  OG1   . THR E 2 47  ? 46.406  58.578  30.466  1.00 42.73 ? 236  THR A OG1   1 
ATOM   757   C  CG2   . THR E 2 47  ? 45.133  57.824  28.600  1.00 41.37 ? 236  THR A CG2   1 
ATOM   758   N  N     . GLY E 2 48  ? 45.576  59.961  26.202  1.00 43.12 ? 237  GLY A N     1 
ATOM   759   C  CA    . GLY E 2 48  ? 44.747  60.461  25.120  1.00 44.60 ? 237  GLY A CA    1 
ATOM   760   C  C     . GLY E 2 48  ? 45.472  60.485  23.789  1.00 45.86 ? 237  GLY A C     1 
ATOM   761   O  O     . GLY E 2 48  ? 46.674  60.239  23.735  1.00 45.74 ? 237  GLY A O     1 
ATOM   762   N  N     . SER E 2 49  ? 44.742  60.781  22.718  1.00 47.56 ? 238  SER A N     1 
ATOM   763   C  CA    . SER E 2 49  ? 45.318  60.828  21.378  1.00 49.51 ? 238  SER A CA    1 
ATOM   764   C  C     . SER E 2 49  ? 45.819  62.225  21.032  1.00 50.46 ? 238  SER A C     1 
ATOM   765   O  O     . SER E 2 49  ? 45.193  63.216  21.393  1.00 50.67 ? 238  SER A O     1 
ATOM   766   C  CB    . SER E 2 49  ? 44.275  60.400  20.353  1.00 50.21 ? 238  SER A CB    1 
ATOM   767   O  OG    . SER E 2 49  ? 43.829  59.084  20.621  1.00 52.68 ? 238  SER A OG    1 
ATOM   768   N  N     . ASP E 2 50  ? 46.942  62.292  20.323  1.00 51.21 ? 239  ASP A N     1 
ATOM   769   C  CA    . ASP E 2 50  ? 47.545  63.560  19.917  1.00 52.28 ? 239  ASP A CA    1 
ATOM   770   C  C     . ASP E 2 50  ? 47.201  64.714  20.857  1.00 51.61 ? 239  ASP A C     1 
ATOM   771   O  O     . ASP E 2 50  ? 46.411  65.603  20.533  1.00 51.31 ? 239  ASP A O     1 
ATOM   772   C  CB    . ASP E 2 50  ? 47.152  63.910  18.470  1.00 54.48 ? 239  ASP A CB    1 
ATOM   773   C  CG    . ASP E 2 50  ? 45.675  64.207  18.314  1.00 57.29 ? 239  ASP A CG    1 
ATOM   774   O  OD1   . ASP E 2 50  ? 44.853  63.320  18.646  1.00 58.94 ? 239  ASP A OD1   1 
ATOM   775   O  OD2   . ASP E 2 50  ? 45.335  65.329  17.855  1.00 59.00 ? 239  ASP A OD2   1 
ATOM   776   N  N     . VAL E 2 51  ? 47.812  64.676  22.033  1.00 50.83 ? 240  VAL A N     1 
ATOM   777   C  CA    . VAL E 2 51  ? 47.609  65.690  23.050  1.00 50.28 ? 240  VAL A CA    1 
ATOM   778   C  C     . VAL E 2 51  ? 48.633  66.798  22.860  1.00 50.30 ? 240  VAL A C     1 
ATOM   779   O  O     . VAL E 2 51  ? 49.839  66.560  22.954  1.00 50.32 ? 240  VAL A O     1 
ATOM   780   C  CB    . VAL E 2 51  ? 47.819  65.116  24.459  1.00 50.00 ? 240  VAL A CB    1 
ATOM   781   C  CG1   . VAL E 2 51  ? 47.447  66.160  25.490  1.00 49.65 ? 240  VAL A CG1   1 
ATOM   782   C  CG2   . VAL E 2 51  ? 47.020  63.827  24.632  1.00 49.26 ? 240  VAL A CG2   1 
ATOM   783   N  N     . PRO E 2 52  ? 48.167  68.024  22.587  1.00 49.81 ? 241  PRO A N     1 
ATOM   784   C  CA    . PRO E 2 52  ? 49.092  69.140  22.398  1.00 49.52 ? 241  PRO A CA    1 
ATOM   785   C  C     . PRO E 2 52  ? 50.116  69.225  23.528  1.00 49.66 ? 241  PRO A C     1 
ATOM   786   O  O     . PRO E 2 52  ? 49.831  68.854  24.666  1.00 49.17 ? 241  PRO A O     1 
ATOM   787   C  CB    . PRO E 2 52  ? 48.160  70.351  22.342  1.00 49.79 ? 241  PRO A CB    1 
ATOM   788   C  CG    . PRO E 2 52  ? 46.882  69.868  22.983  1.00 49.39 ? 241  PRO A CG    1 
ATOM   789   C  CD    . PRO E 2 52  ? 46.773  68.477  22.476  1.00 49.47 ? 241  PRO A CD    1 
ATOM   790   N  N     . GLN E 2 53  ? 51.311  69.702  23.203  1.00 49.56 ? 242  GLN A N     1 
ATOM   791   C  CA    . GLN E 2 53  ? 52.386  69.826  24.178  1.00 50.30 ? 242  GLN A CA    1 
ATOM   792   C  C     . GLN E 2 53  ? 52.080  70.858  25.262  1.00 49.54 ? 242  GLN A C     1 
ATOM   793   O  O     . GLN E 2 53  ? 51.315  71.788  25.049  1.00 49.23 ? 242  GLN A O     1 
ATOM   794   C  CB    . GLN E 2 53  ? 53.685  70.205  23.463  1.00 52.01 ? 242  GLN A CB    1 
ATOM   795   C  CG    . GLN E 2 53  ? 54.139  69.196  22.411  1.00 54.80 ? 242  GLN A CG    1 
ATOM   796   C  CD    . GLN E 2 53  ? 54.797  67.969  23.021  1.00 56.61 ? 242  GLN A CD    1 
ATOM   797   O  OE1   . GLN E 2 53  ? 55.936  68.029  23.498  1.00 57.87 ? 242  GLN A OE1   1 
ATOM   798   N  NE2   . GLN E 2 53  ? 54.080  66.849  23.017  1.00 57.94 ? 242  GLN A NE2   1 
ATOM   799   N  N     . PRO E 2 54  ? 52.681  70.696  26.446  1.00 49.49 ? 243  PRO A N     1 
ATOM   800   C  CA    . PRO E 2 54  ? 52.485  71.608  27.581  1.00 49.58 ? 243  PRO A CA    1 
ATOM   801   C  C     . PRO E 2 54  ? 53.213  72.940  27.412  1.00 49.73 ? 243  PRO A C     1 
ATOM   802   O  O     . PRO E 2 54  ? 54.414  72.961  27.133  1.00 50.32 ? 243  PRO A O     1 
ATOM   803   C  CB    . PRO E 2 54  ? 53.040  70.816  28.761  1.00 49.46 ? 243  PRO A CB    1 
ATOM   804   C  CG    . PRO E 2 54  ? 52.909  69.380  28.317  1.00 49.63 ? 243  PRO A CG    1 
ATOM   805   C  CD    . PRO E 2 54  ? 53.334  69.452  26.887  1.00 49.38 ? 243  PRO A CD    1 
ATOM   806   N  N     . ILE E 2 55  ? 52.497  74.050  27.580  1.00 49.07 ? 244  ILE A N     1 
ATOM   807   C  CA    . ILE E 2 55  ? 53.124  75.363  27.457  1.00 47.91 ? 244  ILE A CA    1 
ATOM   808   C  C     . ILE E 2 55  ? 53.979  75.590  28.704  1.00 47.80 ? 244  ILE A C     1 
ATOM   809   O  O     . ILE E 2 55  ? 53.725  74.985  29.744  1.00 47.90 ? 244  ILE A O     1 
ATOM   810   C  CB    . ILE E 2 55  ? 52.058  76.488  27.278  1.00 47.77 ? 244  ILE A CB    1 
ATOM   811   C  CG1   . ILE E 2 55  ? 51.066  76.501  28.441  1.00 47.00 ? 244  ILE A CG1   1 
ATOM   812   C  CG2   . ILE E 2 55  ? 51.294  76.274  25.985  1.00 47.31 ? 244  ILE A CG2   1 
ATOM   813   C  CD1   . ILE E 2 55  ? 51.446  77.452  29.544  1.00 46.94 ? 244  ILE A CD1   1 
ATOM   814   N  N     . GLN E 2 56  ? 55.009  76.427  28.599  1.00 47.85 ? 245  GLN A N     1 
ATOM   815   C  CA    . GLN E 2 56  ? 55.892  76.682  29.739  1.00 47.83 ? 245  GLN A CA    1 
ATOM   816   C  C     . GLN E 2 56  ? 55.806  78.110  30.247  1.00 47.52 ? 245  GLN A C     1 
ATOM   817   O  O     . GLN E 2 56  ? 56.373  78.430  31.289  1.00 46.84 ? 245  GLN A O     1 
ATOM   818   C  CB    . GLN E 2 56  ? 57.357  76.398  29.386  1.00 48.29 ? 245  GLN A CB    1 
ATOM   819   C  CG    . GLN E 2 56  ? 57.709  74.952  29.081  1.00 49.65 ? 245  GLN A CG    1 
ATOM   820   C  CD    . GLN E 2 56  ? 57.422  74.009  30.229  1.00 50.12 ? 245  GLN A CD    1 
ATOM   821   O  OE1   . GLN E 2 56  ? 57.757  74.287  31.383  1.00 51.18 ? 245  GLN A OE1   1 
ATOM   822   N  NE2   . GLN E 2 56  ? 56.811  72.874  29.915  1.00 50.18 ? 245  GLN A NE2   1 
ATOM   823   N  N     . HIS E 2 57  ? 55.109  78.967  29.514  1.00 47.68 ? 246  HIS A N     1 
ATOM   824   C  CA    . HIS E 2 57  ? 54.984  80.362  29.917  1.00 49.14 ? 246  HIS A CA    1 
ATOM   825   C  C     . HIS E 2 57  ? 53.634  80.904  29.506  1.00 49.50 ? 246  HIS A C     1 
ATOM   826   O  O     . HIS E 2 57  ? 53.059  80.470  28.513  1.00 48.83 ? 246  HIS A O     1 
ATOM   827   C  CB    . HIS E 2 57  ? 56.095  81.206  29.272  1.00 49.74 ? 246  HIS A CB    1 
ATOM   828   C  CG    . HIS E 2 57  ? 57.473  80.785  29.669  1.00 50.07 ? 246  HIS A CG    1 
ATOM   829   N  ND1   . HIS E 2 57  ? 58.012  81.078  30.905  1.00 51.28 ? 246  HIS A ND1   1 
ATOM   830   C  CD2   . HIS E 2 57  ? 58.393  80.026  29.028  1.00 50.77 ? 246  HIS A CD2   1 
ATOM   831   C  CE1   . HIS E 2 57  ? 59.202  80.513  31.010  1.00 51.49 ? 246  HIS A CE1   1 
ATOM   832   N  NE2   . HIS E 2 57  ? 59.457  79.867  29.884  1.00 51.70 ? 246  HIS A NE2   1 
ATOM   833   N  N     . PHE E 2 58  ? 53.135  81.862  30.275  1.00 50.64 ? 247  PHE A N     1 
ATOM   834   C  CA    . PHE E 2 58  ? 51.840  82.459  29.985  1.00 52.00 ? 247  PHE A CA    1 
ATOM   835   C  C     . PHE E 2 58  ? 51.915  83.275  28.705  1.00 53.49 ? 247  PHE A C     1 
ATOM   836   O  O     . PHE E 2 58  ? 50.913  83.452  28.007  1.00 53.96 ? 247  PHE A O     1 
ATOM   837   C  CB    . PHE E 2 58  ? 51.393  83.344  31.154  1.00 50.97 ? 247  PHE A CB    1 
ATOM   838   C  CG    . PHE E 2 58  ? 50.988  82.571  32.387  1.00 49.50 ? 247  PHE A CG    1 
ATOM   839   C  CD1   . PHE E 2 58  ? 49.907  81.696  32.350  1.00 48.62 ? 247  PHE A CD1   1 
ATOM   840   C  CD2   . PHE E 2 58  ? 51.675  82.736  33.587  1.00 48.53 ? 247  PHE A CD2   1 
ATOM   841   C  CE1   . PHE E 2 58  ? 49.516  81.000  33.486  1.00 47.41 ? 247  PHE A CE1   1 
ATOM   842   C  CE2   . PHE E 2 58  ? 51.289  82.041  34.731  1.00 47.96 ? 247  PHE A CE2   1 
ATOM   843   C  CZ    . PHE E 2 58  ? 50.209  81.176  34.678  1.00 47.97 ? 247  PHE A CZ    1 
ATOM   844   N  N     . THR E 2 59  ? 53.116  83.758  28.401  1.00 55.09 ? 248  THR A N     1 
ATOM   845   C  CA    . THR E 2 59  ? 53.347  84.563  27.207  1.00 56.40 ? 248  THR A CA    1 
ATOM   846   C  C     . THR E 2 59  ? 53.698  83.704  25.984  1.00 57.20 ? 248  THR A C     1 
ATOM   847   O  O     . THR E 2 59  ? 54.165  84.216  24.965  1.00 57.48 ? 248  THR A O     1 
ATOM   848   C  CB    . THR E 2 59  ? 54.468  85.624  27.456  1.00 56.09 ? 248  THR A CB    1 
ATOM   849   O  OG1   . THR E 2 59  ? 55.576  85.017  28.134  1.00 55.83 ? 248  THR A OG1   1 
ATOM   850   C  CG2   . THR E 2 59  ? 53.938  86.775  28.303  1.00 55.24 ? 248  THR A CG2   1 
ATOM   851   N  N     . SER E 2 60  ? 53.455  82.399  26.088  1.00 57.79 ? 249  SER A N     1 
ATOM   852   C  CA    . SER E 2 60  ? 53.730  81.474  24.994  1.00 58.09 ? 249  SER A CA    1 
ATOM   853   C  C     . SER E 2 60  ? 52.708  80.337  24.957  1.00 58.28 ? 249  SER A C     1 
ATOM   854   O  O     . SER E 2 60  ? 53.018  79.213  24.559  1.00 58.50 ? 249  SER A O     1 
ATOM   855   C  CB    . SER E 2 60  ? 55.144  80.906  25.134  1.00 58.30 ? 249  SER A CB    1 
ATOM   856   O  OG    . SER E 2 60  ? 55.339  80.337  26.414  1.00 58.94 ? 249  SER A OG    1 
ATOM   857   N  N     . ALA E 2 61  ? 51.482  80.643  25.369  1.00 58.37 ? 250  ALA A N     1 
ATOM   858   C  CA    . ALA E 2 61  ? 50.410  79.653  25.390  1.00 58.51 ? 250  ALA A CA    1 
ATOM   859   C  C     . ALA E 2 61  ? 49.238  80.086  24.513  1.00 58.49 ? 250  ALA A C     1 
ATOM   860   O  O     . ALA E 2 61  ? 48.094  79.687  24.742  1.00 58.64 ? 250  ALA A O     1 
ATOM   861   C  CB    . ALA E 2 61  ? 49.937  79.430  26.823  1.00 58.17 ? 250  ALA A CB    1 
ATOM   862   N  N     . ASP E 2 62  ? 49.530  80.898  23.504  1.00 58.17 ? 251  ASP A N     1 
ATOM   863   C  CA    . ASP E 2 62  ? 48.501  81.389  22.597  1.00 58.44 ? 251  ASP A CA    1 
ATOM   864   C  C     . ASP E 2 62  ? 47.347  82.081  23.326  1.00 57.78 ? 251  ASP A C     1 
ATOM   865   O  O     . ASP E 2 62  ? 46.182  81.871  22.989  1.00 57.88 ? 251  ASP A O     1 
ATOM   866   C  CB    . ASP E 2 62  ? 47.936  80.241  21.743  1.00 59.82 ? 251  ASP A CB    1 
ATOM   867   C  CG    . ASP E 2 62  ? 48.940  79.700  20.732  1.00 60.72 ? 251  ASP A CG    1 
ATOM   868   O  OD1   . ASP E 2 62  ? 49.549  80.508  19.996  1.00 61.43 ? 251  ASP A OD1   1 
ATOM   869   O  OD2   . ASP E 2 62  ? 49.107  78.463  20.662  1.00 60.82 ? 251  ASP A OD2   1 
ATOM   870   N  N     . LEU E 2 63  ? 47.664  82.901  24.322  1.00 56.92 ? 252  LEU A N     1 
ATOM   871   C  CA    . LEU E 2 63  ? 46.625  83.617  25.059  1.00 56.50 ? 252  LEU A CA    1 
ATOM   872   C  C     . LEU E 2 63  ? 46.574  85.078  24.628  1.00 56.41 ? 252  LEU A C     1 
ATOM   873   O  O     . LEU E 2 63  ? 47.612  85.699  24.414  1.00 56.08 ? 252  LEU A O     1 
ATOM   874   C  CB    . LEU E 2 63  ? 46.881  83.552  26.569  1.00 56.12 ? 252  LEU A CB    1 
ATOM   875   C  CG    . LEU E 2 63  ? 46.658  82.235  27.310  1.00 55.67 ? 252  LEU A CG    1 
ATOM   876   C  CD1   . LEU E 2 63  ? 46.988  82.444  28.781  1.00 55.16 ? 252  LEU A CD1   1 
ATOM   877   C  CD2   . LEU E 2 63  ? 45.218  81.771  27.142  1.00 54.88 ? 252  LEU A CD2   1 
ATOM   878   N  N     . ARG E 2 64  ? 45.366  85.619  24.499  1.00 56.51 ? 253  ARG A N     1 
ATOM   879   C  CA    . ARG E 2 64  ? 45.190  87.015  24.106  1.00 56.63 ? 253  ARG A CA    1 
ATOM   880   C  C     . ARG E 2 64  ? 45.888  87.904  25.129  1.00 56.09 ? 253  ARG A C     1 
ATOM   881   O  O     . ARG E 2 64  ? 45.891  87.607  26.329  1.00 55.86 ? 253  ARG A O     1 
ATOM   882   C  CB    . ARG E 2 64  ? 43.703  87.363  24.038  1.00 57.68 ? 253  ARG A CB    1 
ATOM   883   C  CG    . ARG E 2 64  ? 42.905  86.519  23.050  1.00 59.87 ? 253  ARG A CG    1 
ATOM   884   C  CD    . ARG E 2 64  ? 43.060  86.999  21.611  1.00 62.56 ? 253  ARG A CD    1 
ATOM   885   N  NE    . ARG E 2 64  ? 42.553  88.363  21.422  1.00 64.45 ? 253  ARG A NE    1 
ATOM   886   C  CZ    . ARG E 2 64  ? 42.211  88.887  20.245  1.00 64.64 ? 253  ARG A CZ    1 
ATOM   887   N  NH1   . ARG E 2 64  ? 42.316  88.168  19.132  1.00 64.58 ? 253  ARG A NH1   1 
ATOM   888   N  NH2   . ARG E 2 64  ? 41.760  90.134  20.181  1.00 65.21 ? 253  ARG A NH2   1 
ATOM   889   N  N     . ASP E 2 65  ? 46.479  88.995  24.652  1.00 55.45 ? 254  ASP A N     1 
ATOM   890   C  CA    . ASP E 2 65  ? 47.200  89.912  25.525  1.00 54.93 ? 254  ASP A CA    1 
ATOM   891   C  C     . ASP E 2 65  ? 46.405  90.418  26.730  1.00 53.71 ? 254  ASP A C     1 
ATOM   892   O  O     . ASP E 2 65  ? 46.967  90.546  27.822  1.00 53.21 ? 254  ASP A O     1 
ATOM   893   C  CB    . ASP E 2 65  ? 47.749  91.088  24.710  1.00 56.58 ? 254  ASP A CB    1 
ATOM   894   C  CG    . ASP E 2 65  ? 48.848  90.660  23.740  1.00 58.71 ? 254  ASP A CG    1 
ATOM   895   O  OD1   . ASP E 2 65  ? 49.861  90.074  24.200  1.00 59.15 ? 254  ASP A OD1   1 
ATOM   896   O  OD2   . ASP E 2 65  ? 48.700  90.905  22.519  1.00 59.63 ? 254  ASP A OD2   1 
ATOM   897   N  N     . ILE E 2 66  ? 45.113  90.698  26.549  1.00 52.17 ? 255  ILE A N     1 
ATOM   898   C  CA    . ILE E 2 66  ? 44.283  91.173  27.664  1.00 51.44 ? 255  ILE A CA    1 
ATOM   899   C  C     . ILE E 2 66  ? 44.399  90.192  28.814  1.00 50.33 ? 255  ILE A C     1 
ATOM   900   O  O     . ILE E 2 66  ? 44.667  90.568  29.959  1.00 49.67 ? 255  ILE A O     1 
ATOM   901   C  CB    . ILE E 2 66  ? 42.777  91.218  27.333  1.00 51.76 ? 255  ILE A CB    1 
ATOM   902   C  CG1   . ILE E 2 66  ? 42.538  90.825  25.880  1.00 52.40 ? 255  ILE A CG1   1 
ATOM   903   C  CG2   . ILE E 2 66  ? 42.215  92.585  27.675  1.00 52.02 ? 255  ILE A CG2   1 
ATOM   904   C  CD1   . ILE E 2 66  ? 41.077  90.817  25.504  1.00 53.33 ? 255  ILE A CD1   1 
ATOM   905   N  N     . ILE E 2 67  ? 44.178  88.927  28.478  1.00 48.96 ? 256  ILE A N     1 
ATOM   906   C  CA    . ILE E 2 67  ? 44.225  87.857  29.444  1.00 48.14 ? 256  ILE A CA    1 
ATOM   907   C  C     . ILE E 2 67  ? 45.569  87.786  30.142  1.00 48.03 ? 256  ILE A C     1 
ATOM   908   O  O     . ILE E 2 67  ? 45.629  87.721  31.372  1.00 48.10 ? 256  ILE A O     1 
ATOM   909   C  CB    . ILE E 2 67  ? 43.919  86.513  28.771  1.00 47.99 ? 256  ILE A CB    1 
ATOM   910   C  CG1   . ILE E 2 67  ? 42.642  86.641  27.942  1.00 47.31 ? 256  ILE A CG1   1 
ATOM   911   C  CG2   . ILE E 2 67  ? 43.742  85.431  29.825  1.00 48.02 ? 256  ILE A CG2   1 
ATOM   912   C  CD1   . ILE E 2 67  ? 41.477  87.229  28.705  1.00 45.82 ? 256  ILE A CD1   1 
ATOM   913   N  N     . ILE E 2 68  ? 46.649  87.810  29.368  1.00 47.73 ? 257  ILE A N     1 
ATOM   914   C  CA    . ILE E 2 68  ? 47.981  87.744  29.953  1.00 47.96 ? 257  ILE A CA    1 
ATOM   915   C  C     . ILE E 2 68  ? 48.240  88.925  30.897  1.00 48.44 ? 257  ILE A C     1 
ATOM   916   O  O     . ILE E 2 68  ? 48.910  88.783  31.932  1.00 47.97 ? 257  ILE A O     1 
ATOM   917   C  CB    . ILE E 2 68  ? 49.076  87.718  28.855  1.00 48.10 ? 257  ILE A CB    1 
ATOM   918   C  CG1   . ILE E 2 68  ? 48.802  86.578  27.868  1.00 47.88 ? 257  ILE A CG1   1 
ATOM   919   C  CG2   . ILE E 2 68  ? 50.456  87.519  29.490  1.00 47.14 ? 257  ILE A CG2   1 
ATOM   920   C  CD1   . ILE E 2 68  ? 49.771  86.541  26.692  1.00 48.77 ? 257  ILE A CD1   1 
ATOM   921   N  N     . ASP E 2 69  ? 47.698  90.086  30.541  1.00 48.58 ? 258  ASP A N     1 
ATOM   922   C  CA    . ASP E 2 69  ? 47.871  91.292  31.345  1.00 48.59 ? 258  ASP A CA    1 
ATOM   923   C  C     . ASP E 2 69  ? 47.242  91.074  32.713  1.00 46.81 ? 258  ASP A C     1 
ATOM   924   O  O     . ASP E 2 69  ? 47.846  91.368  33.746  1.00 46.31 ? 258  ASP A O     1 
ATOM   925   C  CB    . ASP E 2 69  ? 47.204  92.485  30.646  1.00 51.15 ? 258  ASP A CB    1 
ATOM   926   C  CG    . ASP E 2 69  ? 47.690  93.840  31.174  1.00 53.24 ? 258  ASP A CG    1 
ATOM   927   O  OD1   . ASP E 2 69  ? 47.227  94.879  30.648  1.00 54.26 ? 258  ASP A OD1   1 
ATOM   928   O  OD2   . ASP E 2 69  ? 48.530  93.872  32.104  1.00 54.39 ? 258  ASP A OD2   1 
ATOM   929   N  N     . ASN E 2 70  ? 46.021  90.555  32.712  1.00 45.32 ? 259  ASN A N     1 
ATOM   930   C  CA    . ASN E 2 70  ? 45.324  90.291  33.961  1.00 44.38 ? 259  ASN A CA    1 
ATOM   931   C  C     . ASN E 2 70  ? 46.046  89.260  34.822  1.00 43.85 ? 259  ASN A C     1 
ATOM   932   O  O     . ASN E 2 70  ? 46.002  89.329  36.057  1.00 44.07 ? 259  ASN A O     1 
ATOM   933   C  CB    . ASN E 2 70  ? 43.882  89.881  33.679  1.00 43.09 ? 259  ASN A CB    1 
ATOM   934   C  CG    . ASN E 2 70  ? 43.041  91.060  33.252  1.00 43.12 ? 259  ASN A CG    1 
ATOM   935   O  OD1   . ASN E 2 70  ? 43.226  92.169  33.760  1.00 43.08 ? 259  ASN A OD1   1 
ATOM   936   N  ND2   . ASN E 2 70  ? 42.115  90.841  32.329  1.00 42.06 ? 259  ASN A ND2   1 
ATOM   937   N  N     . VAL E 2 71  ? 46.738  88.330  34.171  1.00 43.31 ? 260  VAL A N     1 
ATOM   938   C  CA    . VAL E 2 71  ? 47.502  87.312  34.877  1.00 42.40 ? 260  VAL A CA    1 
ATOM   939   C  C     . VAL E 2 71  ? 48.678  87.970  35.597  1.00 43.29 ? 260  VAL A C     1 
ATOM   940   O  O     . VAL E 2 71  ? 48.981  87.644  36.755  1.00 43.03 ? 260  VAL A O     1 
ATOM   941   C  CB    . VAL E 2 71  ? 48.066  86.255  33.904  1.00 41.79 ? 260  VAL A CB    1 
ATOM   942   C  CG1   . VAL E 2 71  ? 48.950  85.275  34.665  1.00 40.47 ? 260  VAL A CG1   1 
ATOM   943   C  CG2   . VAL E 2 71  ? 46.927  85.534  33.186  1.00 40.03 ? 260  VAL A CG2   1 
ATOM   944   N  N     . ASN E 2 72  ? 49.349  88.892  34.904  1.00 43.72 ? 261  ASN A N     1 
ATOM   945   C  CA    . ASN E 2 72  ? 50.488  89.589  35.493  1.00 43.87 ? 261  ASN A CA    1 
ATOM   946   C  C     . ASN E 2 72  ? 50.015  90.440  36.665  1.00 42.99 ? 261  ASN A C     1 
ATOM   947   O  O     . ASN E 2 72  ? 50.686  90.521  37.699  1.00 42.45 ? 261  ASN A O     1 
ATOM   948   C  CB    . ASN E 2 72  ? 51.184  90.486  34.466  1.00 44.76 ? 261  ASN A CB    1 
ATOM   949   C  CG    . ASN E 2 72  ? 51.857  89.704  33.356  1.00 45.72 ? 261  ASN A CG    1 
ATOM   950   O  OD1   . ASN E 2 72  ? 52.529  88.701  33.604  1.00 46.50 ? 261  ASN A OD1   1 
ATOM   951   N  ND2   . ASN E 2 72  ? 51.694  90.173  32.122  1.00 45.31 ? 261  ASN A ND2   1 
ATOM   952   N  N     . LYS E 2 73  ? 48.861  91.074  36.498  1.00 43.08 ? 262  LYS A N     1 
ATOM   953   C  CA    . LYS E 2 73  ? 48.302  91.906  37.560  1.00 44.00 ? 262  LYS A CA    1 
ATOM   954   C  C     . LYS E 2 73  ? 47.819  91.024  38.708  1.00 43.77 ? 262  LYS A C     1 
ATOM   955   O  O     . LYS E 2 73  ? 47.655  91.492  39.833  1.00 43.40 ? 262  LYS A O     1 
ATOM   956   C  CB    . LYS E 2 73  ? 47.134  92.754  37.038  1.00 44.92 ? 262  LYS A CB    1 
ATOM   957   C  CG    . LYS E 2 73  ? 47.552  94.070  36.394  1.00 46.50 ? 262  LYS A CG    1 
ATOM   958   C  CD    . LYS E 2 73  ? 46.365  95.005  36.204  1.00 46.80 ? 262  LYS A CD    1 
ATOM   959   C  CE    . LYS E 2 73  ? 45.347  94.427  35.249  1.00 47.66 ? 262  LYS A CE    1 
ATOM   960   N  NZ    . LYS E 2 73  ? 45.947  94.216  33.905  1.00 49.53 ? 262  LYS A NZ    1 
ATOM   961   N  N     . SER E 2 74  ? 47.587  89.749  38.411  1.00 43.25 ? 263  SER A N     1 
ATOM   962   C  CA    . SER E 2 74  ? 47.136  88.811  39.424  1.00 43.53 ? 263  SER A CA    1 
ATOM   963   C  C     . SER E 2 74  ? 48.355  88.283  40.165  1.00 43.73 ? 263  SER A C     1 
ATOM   964   O  O     . SER E 2 74  ? 48.240  87.567  41.159  1.00 43.66 ? 263  SER A O     1 
ATOM   965   C  CB    . SER E 2 74  ? 46.350  87.674  38.779  1.00 43.28 ? 263  SER A CB    1 
ATOM   966   O  OG    . SER E 2 74  ? 45.142  88.166  38.214  1.00 43.64 ? 263  SER A OG    1 
ATOM   967   N  N     . GLY E 2 75  ? 49.530  88.640  39.659  1.00 43.87 ? 264  GLY A N     1 
ATOM   968   C  CA    . GLY E 2 75  ? 50.767  88.244  40.301  1.00 43.72 ? 264  GLY A CA    1 
ATOM   969   C  C     . GLY E 2 75  ? 51.370  86.908  39.936  1.00 43.83 ? 264  GLY A C     1 
ATOM   970   O  O     . GLY E 2 75  ? 52.274  86.443  40.633  1.00 43.75 ? 264  GLY A O     1 
ATOM   971   N  N     . TYR E 2 76  ? 50.894  86.287  38.859  1.00 44.50 ? 265  TYR A N     1 
ATOM   972   C  CA    . TYR E 2 76  ? 51.433  84.988  38.455  1.00 45.84 ? 265  TYR A CA    1 
ATOM   973   C  C     . TYR E 2 76  ? 52.679  85.143  37.591  1.00 46.46 ? 265  TYR A C     1 
ATOM   974   O  O     . TYR E 2 76  ? 52.710  85.936  36.647  1.00 46.79 ? 265  TYR A O     1 
ATOM   975   C  CB    . TYR E 2 76  ? 50.407  84.158  37.664  1.00 45.63 ? 265  TYR A CB    1 
ATOM   976   C  CG    . TYR E 2 76  ? 49.071  83.918  38.334  1.00 45.29 ? 265  TYR A CG    1 
ATOM   977   C  CD1   . TYR E 2 76  ? 48.827  84.321  39.648  1.00 44.67 ? 265  TYR A CD1   1 
ATOM   978   C  CD2   . TYR E 2 76  ? 48.034  83.307  37.630  1.00 45.28 ? 265  TYR A CD2   1 
ATOM   979   C  CE1   . TYR E 2 76  ? 47.578  84.125  40.237  1.00 44.69 ? 265  TYR A CE1   1 
ATOM   980   C  CE2   . TYR E 2 76  ? 46.789  83.105  38.208  1.00 45.21 ? 265  TYR A CE2   1 
ATOM   981   C  CZ    . TYR E 2 76  ? 46.564  83.517  39.510  1.00 44.54 ? 265  TYR A CZ    1 
ATOM   982   O  OH    . TYR E 2 76  ? 45.322  83.318  40.068  1.00 44.35 ? 265  TYR A OH    1 
ATOM   983   N  N     . LYS E 2 77  ? 53.696  84.355  37.912  1.00 46.67 ? 266  LYS A N     1 
ATOM   984   C  CA    . LYS E 2 77  ? 54.945  84.384  37.175  1.00 46.98 ? 266  LYS A CA    1 
ATOM   985   C  C     . LYS E 2 77  ? 55.047  83.157  36.266  1.00 45.92 ? 266  LYS A C     1 
ATOM   986   O  O     . LYS E 2 77  ? 55.349  83.268  35.080  1.00 46.09 ? 266  LYS A O     1 
ATOM   987   C  CB    . LYS E 2 77  ? 56.120  84.381  38.155  1.00 48.25 ? 266  LYS A CB    1 
ATOM   988   C  CG    . LYS E 2 77  ? 56.114  85.514  39.163  1.00 49.93 ? 266  LYS A CG    1 
ATOM   989   C  CD    . LYS E 2 77  ? 56.968  86.685  38.695  1.00 52.19 ? 266  LYS A CD    1 
ATOM   990   C  CE    . LYS E 2 77  ? 56.121  87.879  38.306  1.00 53.07 ? 266  LYS A CE    1 
ATOM   991   N  NZ    . LYS E 2 77  ? 55.222  88.295  39.423  1.00 53.63 ? 266  LYS A NZ    1 
ATOM   992   N  N     . ILE E 2 78  ? 54.772  81.991  36.833  1.00 44.22 ? 267  ILE A N     1 
ATOM   993   C  CA    . ILE E 2 78  ? 54.878  80.738  36.105  1.00 43.53 ? 267  ILE A CA    1 
ATOM   994   C  C     . ILE E 2 78  ? 53.586  79.939  36.180  1.00 42.53 ? 267  ILE A C     1 
ATOM   995   O  O     . ILE E 2 78  ? 52.946  79.896  37.220  1.00 42.88 ? 267  ILE A O     1 
ATOM   996   C  CB    . ILE E 2 78  ? 56.004  79.873  36.722  1.00 44.20 ? 267  ILE A CB    1 
ATOM   997   C  CG1   . ILE E 2 78  ? 57.269  80.719  36.881  1.00 45.25 ? 267  ILE A CG1   1 
ATOM   998   C  CG2   . ILE E 2 78  ? 56.270  78.643  35.860  1.00 43.17 ? 267  ILE A CG2   1 
ATOM   999   C  CD1   . ILE E 2 78  ? 58.149  80.276  38.030  1.00 45.67 ? 267  ILE A CD1   1 
ATOM   1000  N  N     . PRO E 2 79  ? 53.180  79.297  35.075  1.00 41.69 ? 268  PRO A N     1 
ATOM   1001  C  CA    . PRO E 2 79  ? 51.941  78.514  35.150  1.00 40.40 ? 268  PRO A CA    1 
ATOM   1002  C  C     . PRO E 2 79  ? 52.221  77.324  36.073  1.00 39.64 ? 268  PRO A C     1 
ATOM   1003  O  O     . PRO E 2 79  ? 53.378  76.914  36.226  1.00 39.28 ? 268  PRO A O     1 
ATOM   1004  C  CB    . PRO E 2 79  ? 51.716  78.059  33.705  1.00 40.29 ? 268  PRO A CB    1 
ATOM   1005  C  CG    . PRO E 2 79  ? 52.534  79.028  32.872  1.00 41.98 ? 268  PRO A CG    1 
ATOM   1006  C  CD    . PRO E 2 79  ? 53.757  79.256  33.722  1.00 40.92 ? 268  PRO A CD    1 
ATOM   1007  N  N     . THR E 2 80  ? 51.182  76.785  36.704  1.00 38.19 ? 269  THR A N     1 
ATOM   1008  C  CA    . THR E 2 80  ? 51.365  75.626  37.577  1.00 36.61 ? 269  THR A CA    1 
ATOM   1009  C  C     . THR E 2 80  ? 51.291  74.392  36.689  1.00 36.14 ? 269  THR A C     1 
ATOM   1010  O  O     . THR E 2 80  ? 50.895  74.482  35.524  1.00 35.59 ? 269  THR A O     1 
ATOM   1011  C  CB    . THR E 2 80  ? 50.253  75.518  38.633  1.00 36.31 ? 269  THR A CB    1 
ATOM   1012  O  OG1   . THR E 2 80  ? 48.986  75.390  37.977  1.00 34.01 ? 269  THR A OG1   1 
ATOM   1013  C  CG2   . THR E 2 80  ? 50.244  76.751  39.527  1.00 36.37 ? 269  THR A CG2   1 
ATOM   1014  N  N     . PRO E 2 81  ? 51.664  73.220  37.226  1.00 35.61 ? 270  PRO A N     1 
ATOM   1015  C  CA    . PRO E 2 81  ? 51.617  71.993  36.433  1.00 35.46 ? 270  PRO A CA    1 
ATOM   1016  C  C     . PRO E 2 81  ? 50.333  71.768  35.615  1.00 35.51 ? 270  PRO A C     1 
ATOM   1017  O  O     . PRO E 2 81  ? 50.436  71.527  34.408  1.00 34.57 ? 270  PRO A O     1 
ATOM   1018  C  CB    . PRO E 2 81  ? 51.859  70.915  37.476  1.00 36.20 ? 270  PRO A CB    1 
ATOM   1019  C  CG    . PRO E 2 81  ? 52.848  71.582  38.377  1.00 35.96 ? 270  PRO A CG    1 
ATOM   1020  C  CD    . PRO E 2 81  ? 52.255  72.961  38.551  1.00 35.68 ? 270  PRO A CD    1 
ATOM   1021  N  N     . ILE E 2 82  ? 49.141  71.845  36.233  1.00 35.47 ? 271  ILE A N     1 
ATOM   1022  C  CA    . ILE E 2 82  ? 47.901  71.628  35.462  1.00 35.47 ? 271  ILE A CA    1 
ATOM   1023  C  C     . ILE E 2 82  ? 47.651  72.702  34.447  1.00 35.00 ? 271  ILE A C     1 
ATOM   1024  O  O     . ILE E 2 82  ? 47.010  72.447  33.445  1.00 36.29 ? 271  ILE A O     1 
ATOM   1025  C  CB    . ILE E 2 82  ? 46.567  71.591  36.286  1.00 35.84 ? 271  ILE A CB    1 
ATOM   1026  C  CG1   . ILE E 2 82  ? 46.795  72.103  37.693  1.00 36.53 ? 271  ILE A CG1   1 
ATOM   1027  C  CG2   . ILE E 2 82  ? 45.885  70.233  36.139  1.00 34.77 ? 271  ILE A CG2   1 
ATOM   1028  C  CD1   . ILE E 2 82  ? 46.690  73.594  37.768  1.00 36.77 ? 271  ILE A CD1   1 
ATOM   1029  N  N     . GLN E 2 83  ? 48.090  73.917  34.725  1.00 35.23 ? 272  GLN A N     1 
ATOM   1030  C  CA    . GLN E 2 83  ? 47.879  75.000  33.765  1.00 35.80 ? 272  GLN A CA    1 
ATOM   1031  C  C     . GLN E 2 83  ? 48.742  74.727  32.532  1.00 35.35 ? 272  GLN A C     1 
ATOM   1032  O  O     . GLN E 2 83  ? 48.306  74.925  31.402  1.00 33.97 ? 272  GLN A O     1 
ATOM   1033  C  CB    . GLN E 2 83  ? 48.223  76.352  34.407  1.00 35.68 ? 272  GLN A CB    1 
ATOM   1034  C  CG    . GLN E 2 83  ? 47.250  76.726  35.534  1.00 35.39 ? 272  GLN A CG    1 
ATOM   1035  C  CD    . GLN E 2 83  ? 47.739  77.873  36.397  1.00 35.55 ? 272  GLN A CD    1 
ATOM   1036  O  OE1   . GLN E 2 83  ? 48.914  78.249  36.346  1.00 35.98 ? 272  GLN A OE1   1 
ATOM   1037  N  NE2   . GLN E 2 83  ? 46.842  78.423  37.220  1.00 34.10 ? 272  GLN A NE2   1 
ATOM   1038  N  N     . LYS E 2 84  ? 49.957  74.242  32.771  1.00 36.35 ? 273  LYS A N     1 
ATOM   1039  C  CA    . LYS E 2 84  ? 50.882  73.909  31.696  1.00 37.00 ? 273  LYS A CA    1 
ATOM   1040  C  C     . LYS E 2 84  ? 50.294  72.840  30.796  1.00 37.00 ? 273  LYS A C     1 
ATOM   1041  O  O     . LYS E 2 84  ? 50.436  72.918  29.579  1.00 37.39 ? 273  LYS A O     1 
ATOM   1042  C  CB    . LYS E 2 84  ? 52.215  73.418  32.257  1.00 36.53 ? 273  LYS A CB    1 
ATOM   1043  C  CG    . LYS E 2 84  ? 53.067  74.505  32.848  1.00 37.26 ? 273  LYS A CG    1 
ATOM   1044  C  CD    . LYS E 2 84  ? 54.407  73.966  33.305  1.00 38.44 ? 273  LYS A CD    1 
ATOM   1045  C  CE    . LYS E 2 84  ? 55.316  75.084  33.810  1.00 38.93 ? 273  LYS A CE    1 
ATOM   1046  N  NZ    . LYS E 2 84  ? 56.661  74.571  34.223  1.00 39.96 ? 273  LYS A NZ    1 
ATOM   1047  N  N     . CYS E 2 85  ? 49.625  71.848  31.383  1.00 37.28 ? 274  CYS A N     1 
ATOM   1048  C  CA    . CYS E 2 85  ? 49.030  70.776  30.581  1.00 38.00 ? 274  CYS A CA    1 
ATOM   1049  C  C     . CYS E 2 85  ? 47.634  71.070  30.049  1.00 38.10 ? 274  CYS A C     1 
ATOM   1050  O  O     . CYS E 2 85  ? 47.306  70.741  28.902  1.00 38.42 ? 274  CYS A O     1 
ATOM   1051  C  CB    . CYS E 2 85  ? 48.972  69.477  31.379  1.00 38.25 ? 274  CYS A CB    1 
ATOM   1052  S  SG    . CYS E 2 85  ? 50.566  68.910  31.979  1.00 40.89 ? 274  CYS A SG    1 
ATOM   1053  N  N     . SER E 2 86  ? 46.812  71.692  30.880  1.00 37.63 ? 275  SER A N     1 
ATOM   1054  C  CA    . SER E 2 86  ? 45.438  71.985  30.505  1.00 37.48 ? 275  SER A CA    1 
ATOM   1055  C  C     . SER E 2 86  ? 45.203  73.070  29.468  1.00 36.94 ? 275  SER A C     1 
ATOM   1056  O  O     . SER E 2 86  ? 44.369  72.901  28.579  1.00 36.18 ? 275  SER A O     1 
ATOM   1057  C  CB    . SER E 2 86  ? 44.613  72.329  31.760  1.00 38.74 ? 275  SER A CB    1 
ATOM   1058  O  OG    . SER E 2 86  ? 44.471  71.203  32.612  1.00 38.97 ? 275  SER A OG    1 
ATOM   1059  N  N     . ILE E 2 87  ? 45.922  74.182  29.576  1.00 37.48 ? 276  ILE A N     1 
ATOM   1060  C  CA    . ILE E 2 87  ? 45.693  75.293  28.659  1.00 38.31 ? 276  ILE A CA    1 
ATOM   1061  C  C     . ILE E 2 87  ? 45.746  74.948  27.174  1.00 38.08 ? 276  ILE A C     1 
ATOM   1062  O  O     . ILE E 2 87  ? 44.815  75.271  26.438  1.00 38.54 ? 276  ILE A O     1 
ATOM   1063  C  CB    . ILE E 2 87  ? 46.621  76.481  28.994  1.00 38.46 ? 276  ILE A CB    1 
ATOM   1064  C  CG1   . ILE E 2 87  ? 46.271  76.996  30.399  1.00 38.40 ? 276  ILE A CG1   1 
ATOM   1065  C  CG2   . ILE E 2 87  ? 46.429  77.601  27.973  1.00 37.21 ? 276  ILE A CG2   1 
ATOM   1066  C  CD1   . ILE E 2 87  ? 47.234  78.016  30.972  1.00 39.10 ? 276  ILE A CD1   1 
ATOM   1067  N  N     . PRO E 2 88  ? 46.813  74.274  26.714  1.00 38.46 ? 277  PRO A N     1 
ATOM   1068  C  CA    . PRO E 2 88  ? 46.891  73.919  25.289  1.00 38.73 ? 277  PRO A CA    1 
ATOM   1069  C  C     . PRO E 2 88  ? 45.770  72.950  24.870  1.00 39.30 ? 277  PRO A C     1 
ATOM   1070  O  O     . PRO E 2 88  ? 45.223  73.055  23.772  1.00 39.81 ? 277  PRO A O     1 
ATOM   1071  C  CB    . PRO E 2 88  ? 48.271  73.271  25.162  1.00 39.35 ? 277  PRO A CB    1 
ATOM   1072  C  CG    . PRO E 2 88  ? 49.049  73.840  26.305  1.00 39.22 ? 277  PRO A CG    1 
ATOM   1073  C  CD    . PRO E 2 88  ? 48.038  73.875  27.424  1.00 38.80 ? 277  PRO A CD    1 
ATOM   1074  N  N     . VAL E 2 89  ? 45.435  72.001  25.746  1.00 39.22 ? 278  VAL A N     1 
ATOM   1075  C  CA    . VAL E 2 89  ? 44.378  71.031  25.452  1.00 38.35 ? 278  VAL A CA    1 
ATOM   1076  C  C     . VAL E 2 89  ? 43.029  71.723  25.234  1.00 38.41 ? 278  VAL A C     1 
ATOM   1077  O  O     . VAL E 2 89  ? 42.305  71.415  24.286  1.00 38.14 ? 278  VAL A O     1 
ATOM   1078  C  CB    . VAL E 2 89  ? 44.216  70.000  26.604  1.00 38.52 ? 278  VAL A CB    1 
ATOM   1079  C  CG1   . VAL E 2 89  ? 43.015  69.100  26.327  1.00 36.81 ? 278  VAL A CG1   1 
ATOM   1080  C  CG2   . VAL E 2 89  ? 45.497  69.172  26.763  1.00 37.24 ? 278  VAL A CG2   1 
ATOM   1081  N  N     . ILE E 2 90  ? 42.690  72.652  26.121  1.00 38.07 ? 279  ILE A N     1 
ATOM   1082  C  CA    . ILE E 2 90  ? 41.429  73.371  26.013  1.00 38.18 ? 279  ILE A CA    1 
ATOM   1083  C  C     . ILE E 2 90  ? 41.455  74.271  24.780  1.00 38.51 ? 279  ILE A C     1 
ATOM   1084  O  O     . ILE E 2 90  ? 40.479  74.334  24.037  1.00 37.61 ? 279  ILE A O     1 
ATOM   1085  C  CB    . ILE E 2 90  ? 41.168  74.224  27.279  1.00 37.88 ? 279  ILE A CB    1 
ATOM   1086  C  CG1   . ILE E 2 90  ? 41.070  73.308  28.505  1.00 38.88 ? 279  ILE A CG1   1 
ATOM   1087  C  CG2   . ILE E 2 90  ? 39.879  75.018  27.122  1.00 38.39 ? 279  ILE A CG2   1 
ATOM   1088  C  CD1   . ILE E 2 90  ? 40.946  74.030  29.836  1.00 37.01 ? 279  ILE A CD1   1 
ATOM   1089  N  N     . SER E 2 91  ? 42.580  74.955  24.568  1.00 39.66 ? 280  SER A N     1 
ATOM   1090  C  CA    . SER E 2 91  ? 42.739  75.851  23.420  1.00 41.64 ? 280  SER A CA    1 
ATOM   1091  C  C     . SER E 2 91  ? 42.543  75.118  22.106  1.00 42.11 ? 280  SER A C     1 
ATOM   1092  O  O     . SER E 2 91  ? 42.119  75.713  21.121  1.00 42.42 ? 280  SER A O     1 
ATOM   1093  C  CB    . SER E 2 91  ? 44.130  76.486  23.407  1.00 41.92 ? 280  SER A CB    1 
ATOM   1094  O  OG    . SER E 2 91  ? 44.254  77.492  24.390  1.00 44.60 ? 280  SER A OG    1 
ATOM   1095  N  N     . SER E 2 92  ? 42.852  73.824  22.109  1.00 42.52 ? 281  SER A N     1 
ATOM   1096  C  CA    . SER E 2 92  ? 42.746  72.981  20.925  1.00 42.90 ? 281  SER A CA    1 
ATOM   1097  C  C     . SER E 2 92  ? 41.336  72.504  20.633  1.00 41.77 ? 281  SER A C     1 
ATOM   1098  O  O     . SER E 2 92  ? 41.104  71.854  19.618  1.00 42.35 ? 281  SER A O     1 
ATOM   1099  C  CB    . SER E 2 92  ? 43.655  71.757  21.083  1.00 44.67 ? 281  SER A CB    1 
ATOM   1100  O  OG    . SER E 2 92  ? 44.967  72.150  21.456  1.00 47.54 ? 281  SER A OG    1 
ATOM   1101  N  N     . GLY E 2 93  ? 40.398  72.807  21.522  1.00 40.71 ? 282  GLY A N     1 
ATOM   1102  C  CA    . GLY E 2 93  ? 39.029  72.371  21.308  1.00 38.97 ? 282  GLY A CA    1 
ATOM   1103  C  C     . GLY E 2 93  ? 38.776  70.955  21.809  1.00 38.47 ? 282  GLY A C     1 
ATOM   1104  O  O     . GLY E 2 93  ? 37.772  70.327  21.460  1.00 37.57 ? 282  GLY A O     1 
ATOM   1105  N  N     . ARG E 2 94  ? 39.677  70.458  22.650  1.00 37.99 ? 283  ARG A N     1 
ATOM   1106  C  CA    . ARG E 2 94  ? 39.568  69.102  23.196  1.00 37.41 ? 283  ARG A CA    1 
ATOM   1107  C  C     . ARG E 2 94  ? 38.828  69.007  24.536  1.00 36.92 ? 283  ARG A C     1 
ATOM   1108  O  O     . ARG E 2 94  ? 38.761  69.977  25.294  1.00 37.41 ? 283  ARG A O     1 
ATOM   1109  C  CB    . ARG E 2 94  ? 40.973  68.521  23.365  1.00 37.83 ? 283  ARG A CB    1 
ATOM   1110  C  CG    . ARG E 2 94  ? 41.739  68.377  22.060  1.00 37.97 ? 283  ARG A CG    1 
ATOM   1111  C  CD    . ARG E 2 94  ? 41.366  67.082  21.370  1.00 38.62 ? 283  ARG A CD    1 
ATOM   1112  N  NE    . ARG E 2 94  ? 42.394  66.062  21.579  1.00 40.60 ? 283  ARG A NE    1 
ATOM   1113  C  CZ    . ARG E 2 94  ? 42.127  64.780  21.759  1.00 40.47 ? 283  ARG A CZ    1 
ATOM   1114  N  NH1   . ARG E 2 94  ? 40.874  64.373  21.760  1.00 42.42 ? 283  ARG A NH1   1 
ATOM   1115  N  NH2   . ARG E 2 94  ? 43.099  63.908  21.937  1.00 41.88 ? 283  ARG A NH2   1 
ATOM   1116  N  N     . ASP E 2 95  ? 38.273  67.831  24.821  1.00 35.76 ? 284  ASP A N     1 
ATOM   1117  C  CA    . ASP E 2 95  ? 37.588  67.594  26.085  1.00 34.05 ? 284  ASP A CA    1 
ATOM   1118  C  C     . ASP E 2 95  ? 38.695  67.258  27.093  1.00 34.09 ? 284  ASP A C     1 
ATOM   1119  O  O     . ASP E 2 95  ? 39.765  66.753  26.710  1.00 34.00 ? 284  ASP A O     1 
ATOM   1120  C  CB    . ASP E 2 95  ? 36.572  66.466  25.938  1.00 32.75 ? 284  ASP A CB    1 
ATOM   1121  C  CG    . ASP E 2 95  ? 35.245  66.956  25.375  1.00 33.88 ? 284  ASP A CG    1 
ATOM   1122  O  OD1   . ASP E 2 95  ? 35.159  68.121  24.960  1.00 35.16 ? 284  ASP A OD1   1 
ATOM   1123  O  OD2   . ASP E 2 95  ? 34.269  66.191  25.336  1.00 36.01 ? 284  ASP A OD2   1 
ATOM   1124  N  N     . LEU E 2 96  ? 38.459  67.547  28.371  1.00 33.30 ? 285  LEU A N     1 
ATOM   1125  C  CA    . LEU E 2 96  ? 39.492  67.328  29.380  1.00 32.49 ? 285  LEU A CA    1 
ATOM   1126  C  C     . LEU E 2 96  ? 38.999  66.851  30.743  1.00 32.33 ? 285  LEU A C     1 
ATOM   1127  O  O     . LEU E 2 96  ? 37.932  67.254  31.203  1.00 32.11 ? 285  LEU A O     1 
ATOM   1128  C  CB    . LEU E 2 96  ? 40.241  68.632  29.598  1.00 32.15 ? 285  LEU A CB    1 
ATOM   1129  C  CG    . LEU E 2 96  ? 41.707  68.694  30.021  1.00 34.20 ? 285  LEU A CG    1 
ATOM   1130  C  CD1   . LEU E 2 96  ? 41.881  69.969  30.843  1.00 34.86 ? 285  LEU A CD1   1 
ATOM   1131  C  CD2   . LEU E 2 96  ? 42.142  67.490  30.803  1.00 33.62 ? 285  LEU A CD2   1 
ATOM   1132  N  N     . MET E 2 97  ? 39.790  65.977  31.367  1.00 31.81 ? 286  MET A N     1 
ATOM   1133  C  CA    . MET E 2 97  ? 39.524  65.496  32.712  1.00 31.09 ? 286  MET A CA    1 
ATOM   1134  C  C     . MET E 2 97  ? 40.849  65.809  33.388  1.00 31.03 ? 286  MET A C     1 
ATOM   1135  O  O     . MET E 2 97  ? 41.872  65.202  33.071  1.00 30.43 ? 286  MET A O     1 
ATOM   1136  C  CB    . MET E 2 97  ? 39.258  63.992  32.767  1.00 31.22 ? 286  MET A CB    1 
ATOM   1137  C  CG    . MET E 2 97  ? 38.912  63.528  34.194  1.00 30.45 ? 286  MET A CG    1 
ATOM   1138  S  SD    . MET E 2 97  ? 38.622  61.750  34.402  1.00 31.01 ? 286  MET A SD    1 
ATOM   1139  C  CE    . MET E 2 97  ? 37.061  61.550  33.488  1.00 29.13 ? 286  MET A CE    1 
ATOM   1140  N  N     . ALA E 2 98  ? 40.831  66.774  34.299  1.00 30.20 ? 287  ALA A N     1 
ATOM   1141  C  CA    . ALA E 2 98  ? 42.048  67.199  34.967  1.00 30.35 ? 287  ALA A CA    1 
ATOM   1142  C  C     . ALA E 2 98  ? 42.045  66.991  36.481  1.00 30.52 ? 287  ALA A C     1 
ATOM   1143  O  O     . ALA E 2 98  ? 41.123  67.420  37.179  1.00 30.46 ? 287  ALA A O     1 
ATOM   1144  C  CB    . ALA E 2 98  ? 42.304  68.667  34.637  1.00 29.02 ? 287  ALA A CB    1 
ATOM   1145  N  N     . CYS E 2 99  ? 43.094  66.336  36.968  1.00 30.35 ? 288  CYS A N     1 
ATOM   1146  C  CA    . CYS E 2 99  ? 43.265  66.053  38.385  1.00 31.23 ? 288  CYS A CA    1 
ATOM   1147  C  C     . CYS E 2 99  ? 44.582  66.650  38.885  1.00 30.70 ? 288  CYS A C     1 
ATOM   1148  O  O     . CYS E 2 99  ? 45.660  66.388  38.344  1.00 29.55 ? 288  CYS A O     1 
ATOM   1149  C  CB    . CYS E 2 99  ? 43.260  64.544  38.615  1.00 32.41 ? 288  CYS A CB    1 
ATOM   1150  S  SG    . CYS E 2 99  ? 41.918  63.734  37.724  1.00 39.06 ? 288  CYS A SG    1 
ATOM   1151  N  N     . ALA E 2 100 ? 44.479  67.468  39.920  1.00 29.96 ? 289  ALA A N     1 
ATOM   1152  C  CA    . ALA E 2 100 ? 45.644  68.116  40.496  1.00 30.22 ? 289  ALA A CA    1 
ATOM   1153  C  C     . ALA E 2 100 ? 45.283  68.464  41.939  1.00 29.53 ? 289  ALA A C     1 
ATOM   1154  O  O     . ALA E 2 100 ? 44.128  68.799  42.224  1.00 29.71 ? 289  ALA A O     1 
ATOM   1155  C  CB    . ALA E 2 100 ? 45.984  69.380  39.689  1.00 29.03 ? 289  ALA A CB    1 
ATOM   1156  N  N     . GLN E 2 101 ? 46.260  68.377  42.835  1.00 28.91 ? 290  GLN A N     1 
ATOM   1157  C  CA    . GLN E 2 101 ? 46.040  68.648  44.251  1.00 28.50 ? 290  GLN A CA    1 
ATOM   1158  C  C     . GLN E 2 101 ? 45.399  70.003  44.540  1.00 28.25 ? 290  GLN A C     1 
ATOM   1159  O  O     . GLN E 2 101 ? 45.419  70.914  43.717  1.00 26.84 ? 290  GLN A O     1 
ATOM   1160  C  CB    . GLN E 2 101 ? 47.350  68.521  45.029  1.00 30.48 ? 290  GLN A CB    1 
ATOM   1161  C  CG    . GLN E 2 101 ? 48.457  69.472  44.600  1.00 34.55 ? 290  GLN A CG    1 
ATOM   1162  C  CD    . GLN E 2 101 ? 49.776  69.217  45.341  1.00 37.88 ? 290  GLN A CD    1 
ATOM   1163  O  OE1   . GLN E 2 101 ? 50.216  68.070  45.474  1.00 41.02 ? 290  GLN A OE1   1 
ATOM   1164  N  NE2   . GLN E 2 101 ? 50.418  70.285  45.806  1.00 37.93 ? 290  GLN A NE2   1 
ATOM   1165  N  N     . THR E 2 102 ? 44.805  70.111  45.719  1.00 27.96 ? 291  THR A N     1 
ATOM   1166  C  CA    . THR E 2 102 ? 44.149  71.331  46.120  1.00 29.26 ? 291  THR A CA    1 
ATOM   1167  C  C     . THR E 2 102 ? 45.139  72.491  46.128  1.00 29.78 ? 291  THR A C     1 
ATOM   1168  O  O     . THR E 2 102 ? 46.326  72.308  46.414  1.00 30.02 ? 291  THR A O     1 
ATOM   1169  C  CB    . THR E 2 102 ? 43.546  71.198  47.524  1.00 28.77 ? 291  THR A CB    1 
ATOM   1170  O  OG1   . THR E 2 102 ? 44.571  70.806  48.444  1.00 29.35 ? 291  THR A OG1   1 
ATOM   1171  C  CG2   . THR E 2 102 ? 42.435  70.150  47.532  1.00 29.83 ? 291  THR A CG2   1 
ATOM   1172  N  N     . GLY E 2 103 ? 44.630  73.678  45.813  1.00 30.22 ? 292  GLY A N     1 
ATOM   1173  C  CA    . GLY E 2 103 ? 45.446  74.873  45.810  1.00 30.75 ? 292  GLY A CA    1 
ATOM   1174  C  C     . GLY E 2 103 ? 46.544  74.889  44.768  1.00 31.94 ? 292  GLY A C     1 
ATOM   1175  O  O     . GLY E 2 103 ? 47.540  75.583  44.954  1.00 32.98 ? 292  GLY A O     1 
ATOM   1176  N  N     . SER E 2 104 ? 46.380  74.148  43.672  1.00 31.27 ? 293  SER A N     1 
ATOM   1177  C  CA    . SER E 2 104 ? 47.414  74.131  42.657  1.00 31.14 ? 293  SER A CA    1 
ATOM   1178  C  C     . SER E 2 104 ? 47.042  74.835  41.353  1.00 30.76 ? 293  SER A C     1 
ATOM   1179  O  O     . SER E 2 104 ? 47.615  74.536  40.309  1.00 30.96 ? 293  SER A O     1 
ATOM   1180  C  CB    . SER E 2 104 ? 47.875  72.689  42.372  1.00 30.55 ? 293  SER A CB    1 
ATOM   1181  O  OG    . SER E 2 104 ? 46.863  71.932  41.738  1.00 30.35 ? 293  SER A OG    1 
ATOM   1182  N  N     . GLY E 2 105 ? 46.074  75.750  41.406  1.00 29.56 ? 294  GLY A N     1 
ATOM   1183  C  CA    . GLY E 2 105 ? 45.722  76.517  40.216  1.00 28.16 ? 294  GLY A CA    1 
ATOM   1184  C  C     . GLY E 2 105 ? 44.732  76.020  39.182  1.00 28.45 ? 294  GLY A C     1 
ATOM   1185  O  O     . GLY E 2 105 ? 44.736  76.504  38.048  1.00 29.02 ? 294  GLY A O     1 
ATOM   1186  N  N     . LYS E 2 106 ? 43.852  75.095  39.549  1.00 28.00 ? 295  LYS A N     1 
ATOM   1187  C  CA    . LYS E 2 106 ? 42.893  74.576  38.581  1.00 27.11 ? 295  LYS A CA    1 
ATOM   1188  C  C     . LYS E 2 106 ? 41.886  75.567  38.010  1.00 26.96 ? 295  LYS A C     1 
ATOM   1189  O  O     . LYS E 2 106 ? 41.467  75.404  36.862  1.00 27.47 ? 295  LYS A O     1 
ATOM   1190  C  CB    . LYS E 2 106 ? 42.167  73.352  39.161  1.00 26.40 ? 295  LYS A CB    1 
ATOM   1191  C  CG    . LYS E 2 106 ? 43.098  72.113  39.310  1.00 25.60 ? 295  LYS A CG    1 
ATOM   1192  C  CD    . LYS E 2 106 ? 42.353  70.853  39.745  1.00 25.77 ? 295  LYS A CD    1 
ATOM   1193  C  CE    . LYS E 2 106 ? 41.723  71.001  41.130  1.00 25.78 ? 295  LYS A CE    1 
ATOM   1194  N  NZ    . LYS E 2 106 ? 42.744  71.010  42.227  1.00 26.29 ? 295  LYS A NZ    1 
ATOM   1195  N  N     . THR E 2 107 ? 41.502  76.596  38.767  1.00 26.44 ? 296  THR A N     1 
ATOM   1196  C  CA    . THR E 2 107 ? 40.514  77.557  38.253  1.00 26.53 ? 296  THR A CA    1 
ATOM   1197  C  C     . THR E 2 107 ? 41.037  78.318  37.033  1.00 27.14 ? 296  THR A C     1 
ATOM   1198  O  O     . THR E 2 107 ? 40.343  78.450  36.015  1.00 26.68 ? 296  THR A O     1 
ATOM   1199  C  CB    . THR E 2 107 ? 40.084  78.626  39.305  1.00 25.48 ? 296  THR A CB    1 
ATOM   1200  O  OG1   . THR E 2 107 ? 40.077  78.069  40.617  1.00 26.75 ? 296  THR A OG1   1 
ATOM   1201  C  CG2   . THR E 2 107 ? 38.670  79.117  39.008  1.00 24.87 ? 296  THR A CG2   1 
ATOM   1202  N  N     . ALA E 2 108 ? 42.250  78.845  37.148  1.00 28.62 ? 297  ALA A N     1 
ATOM   1203  C  CA    . ALA E 2 108 ? 42.844  79.584  36.036  1.00 29.95 ? 297  ALA A CA    1 
ATOM   1204  C  C     . ALA E 2 108 ? 43.111  78.593  34.908  1.00 31.42 ? 297  ALA A C     1 
ATOM   1205  O  O     . ALA E 2 108 ? 43.013  78.935  33.724  1.00 32.46 ? 297  ALA A O     1 
ATOM   1206  C  CB    . ALA E 2 108 ? 44.131  80.260  36.471  1.00 28.14 ? 297  ALA A CB    1 
ATOM   1207  N  N     . ALA E 2 109 ? 43.426  77.355  35.280  1.00 31.90 ? 298  ALA A N     1 
ATOM   1208  C  CA    . ALA E 2 109 ? 43.681  76.320  34.288  1.00 32.48 ? 298  ALA A CA    1 
ATOM   1209  C  C     . ALA E 2 109 ? 42.546  76.214  33.265  1.00 33.41 ? 298  ALA A C     1 
ATOM   1210  O  O     . ALA E 2 109 ? 42.786  75.819  32.124  1.00 34.35 ? 298  ALA A O     1 
ATOM   1211  C  CB    . ALA E 2 109 ? 43.906  74.972  34.969  1.00 31.86 ? 298  ALA A CB    1 
ATOM   1212  N  N     . PHE E 2 110 ? 41.310  76.547  33.642  1.00 33.51 ? 299  PHE A N     1 
ATOM   1213  C  CA    . PHE E 2 110 ? 40.245  76.478  32.652  1.00 33.46 ? 299  PHE A CA    1 
ATOM   1214  C  C     . PHE E 2 110 ? 39.669  77.822  32.236  1.00 34.82 ? 299  PHE A C     1 
ATOM   1215  O  O     . PHE E 2 110 ? 39.124  77.937  31.143  1.00 36.08 ? 299  PHE A O     1 
ATOM   1216  C  CB    . PHE E 2 110 ? 39.122  75.509  33.069  1.00 32.83 ? 299  PHE A CB    1 
ATOM   1217  C  CG    . PHE E 2 110 ? 38.372  75.900  34.312  1.00 32.70 ? 299  PHE A CG    1 
ATOM   1218  C  CD1   . PHE E 2 110 ? 37.406  76.903  34.280  1.00 31.35 ? 299  PHE A CD1   1 
ATOM   1219  C  CD2   . PHE E 2 110 ? 38.591  75.214  35.515  1.00 32.85 ? 299  PHE A CD2   1 
ATOM   1220  C  CE1   . PHE E 2 110 ? 36.664  77.219  35.422  1.00 30.86 ? 299  PHE A CE1   1 
ATOM   1221  C  CE2   . PHE E 2 110 ? 37.851  75.525  36.668  1.00 33.27 ? 299  PHE A CE2   1 
ATOM   1222  C  CZ    . PHE E 2 110 ? 36.884  76.532  36.618  1.00 31.75 ? 299  PHE A CZ    1 
ATOM   1223  N  N     . LEU E 2 111 ? 39.806  78.847  33.075  1.00 35.33 ? 300  LEU A N     1 
ATOM   1224  C  CA    . LEU E 2 111 ? 39.281  80.163  32.720  1.00 34.91 ? 300  LEU A CA    1 
ATOM   1225  C  C     . LEU E 2 111 ? 40.153  80.866  31.672  1.00 35.06 ? 300  LEU A C     1 
ATOM   1226  O  O     . LEU E 2 111 ? 39.644  81.368  30.668  1.00 34.50 ? 300  LEU A O     1 
ATOM   1227  C  CB    . LEU E 2 111 ? 39.147  81.055  33.965  1.00 34.29 ? 300  LEU A CB    1 
ATOM   1228  C  CG    . LEU E 2 111 ? 37.984  80.788  34.935  1.00 35.04 ? 300  LEU A CG    1 
ATOM   1229  C  CD1   . LEU E 2 111 ? 38.163  81.627  36.192  1.00 32.77 ? 300  LEU A CD1   1 
ATOM   1230  C  CD2   . LEU E 2 111 ? 36.651  81.109  34.269  1.00 32.56 ? 300  LEU A CD2   1 
ATOM   1231  N  N     . LEU E 2 112 ? 41.464  80.902  31.892  1.00 35.35 ? 301  LEU A N     1 
ATOM   1232  C  CA    . LEU E 2 112 ? 42.347  81.572  30.936  1.00 35.74 ? 301  LEU A CA    1 
ATOM   1233  C  C     . LEU E 2 112 ? 42.151  81.100  29.498  1.00 35.87 ? 301  LEU A C     1 
ATOM   1234  O  O     . LEU E 2 112 ? 41.861  81.900  28.620  1.00 36.71 ? 301  LEU A O     1 
ATOM   1235  C  CB    . LEU E 2 112 ? 43.813  81.392  31.322  1.00 34.02 ? 301  LEU A CB    1 
ATOM   1236  C  CG    . LEU E 2 112 ? 44.158  81.875  32.726  1.00 35.16 ? 301  LEU A CG    1 
ATOM   1237  C  CD1   . LEU E 2 112 ? 45.665  81.848  32.908  1.00 34.82 ? 301  LEU A CD1   1 
ATOM   1238  C  CD2   . LEU E 2 112 ? 43.616  83.284  32.942  1.00 35.20 ? 301  LEU A CD2   1 
ATOM   1239  N  N     . PRO E 2 113 ? 42.303  79.794  29.234  1.00 36.06 ? 302  PRO A N     1 
ATOM   1240  C  CA    . PRO E 2 113 ? 42.114  79.385  27.842  1.00 36.19 ? 302  PRO A CA    1 
ATOM   1241  C  C     . PRO E 2 113 ? 40.708  79.599  27.334  1.00 36.49 ? 302  PRO A C     1 
ATOM   1242  O  O     . PRO E 2 113 ? 40.526  79.941  26.171  1.00 36.81 ? 302  PRO A O     1 
ATOM   1243  C  CB    . PRO E 2 113 ? 42.530  77.918  27.844  1.00 36.04 ? 302  PRO A CB    1 
ATOM   1244  C  CG    . PRO E 2 113 ? 42.187  77.474  29.243  1.00 35.75 ? 302  PRO A CG    1 
ATOM   1245  C  CD    . PRO E 2 113 ? 42.649  78.643  30.085  1.00 35.55 ? 302  PRO A CD    1 
ATOM   1246  N  N     . ILE E 2 114 ? 39.711  79.408  28.195  1.00 37.43 ? 303  ILE A N     1 
ATOM   1247  C  CA    . ILE E 2 114 ? 38.330  79.604  27.771  1.00 38.16 ? 303  ILE A CA    1 
ATOM   1248  C  C     . ILE E 2 114 ? 38.061  81.084  27.483  1.00 39.16 ? 303  ILE A C     1 
ATOM   1249  O  O     . ILE E 2 114 ? 37.520  81.431  26.432  1.00 39.19 ? 303  ILE A O     1 
ATOM   1250  C  CB    . ILE E 2 114 ? 37.325  79.115  28.832  1.00 37.89 ? 303  ILE A CB    1 
ATOM   1251  C  CG1   . ILE E 2 114 ? 37.365  77.585  28.919  1.00 37.67 ? 303  ILE A CG1   1 
ATOM   1252  C  CG2   . ILE E 2 114 ? 35.918  79.592  28.469  1.00 37.36 ? 303  ILE A CG2   1 
ATOM   1253  C  CD1   . ILE E 2 114 ? 36.456  76.997  29.989  1.00 36.97 ? 303  ILE A CD1   1 
ATOM   1254  N  N     . LEU E 2 115 ? 38.440  81.948  28.419  1.00 39.68 ? 304  LEU A N     1 
ATOM   1255  C  CA    . LEU E 2 115 ? 38.243  83.380  28.248  1.00 40.98 ? 304  LEU A CA    1 
ATOM   1256  C  C     . LEU E 2 115 ? 38.962  83.855  26.999  1.00 42.35 ? 304  LEU A C     1 
ATOM   1257  O  O     . LEU E 2 115 ? 38.417  84.638  26.224  1.00 41.74 ? 304  LEU A O     1 
ATOM   1258  C  CB    . LEU E 2 115 ? 38.774  84.154  29.453  1.00 38.60 ? 304  LEU A CB    1 
ATOM   1259  C  CG    . LEU E 2 115 ? 37.969  84.025  30.736  1.00 37.85 ? 304  LEU A CG    1 
ATOM   1260  C  CD1   . LEU E 2 115 ? 38.633  84.862  31.804  1.00 37.29 ? 304  LEU A CD1   1 
ATOM   1261  C  CD2   . LEU E 2 115 ? 36.533  84.475  30.501  1.00 37.37 ? 304  LEU A CD2   1 
ATOM   1262  N  N     . SER E 2 116 ? 40.187  83.372  26.813  1.00 44.14 ? 305  SER A N     1 
ATOM   1263  C  CA    . SER E 2 116 ? 40.993  83.744  25.656  1.00 46.73 ? 305  SER A CA    1 
ATOM   1264  C  C     . SER E 2 116 ? 40.323  83.320  24.352  1.00 47.67 ? 305  SER A C     1 
ATOM   1265  O  O     . SER E 2 116 ? 40.375  84.046  23.365  1.00 47.87 ? 305  SER A O     1 
ATOM   1266  C  CB    . SER E 2 116 ? 42.390  83.119  25.758  1.00 47.07 ? 305  SER A CB    1 
ATOM   1267  O  OG    . SER E 2 116 ? 43.182  83.438  24.624  1.00 47.75 ? 305  SER A OG    1 
ATOM   1268  N  N     . LYS E 2 117 ? 39.682  82.155  24.359  1.00 48.83 ? 306  LYS A N     1 
ATOM   1269  C  CA    . LYS E 2 117 ? 39.006  81.652  23.173  1.00 50.31 ? 306  LYS A CA    1 
ATOM   1270  C  C     . LYS E 2 117 ? 37.787  82.488  22.806  1.00 51.16 ? 306  LYS A C     1 
ATOM   1271  O  O     . LYS E 2 117 ? 37.396  82.551  21.641  1.00 51.58 ? 306  LYS A O     1 
ATOM   1272  C  CB    . LYS E 2 117 ? 38.577  80.198  23.384  1.00 51.00 ? 306  LYS A CB    1 
ATOM   1273  C  CG    . LYS E 2 117 ? 39.349  79.192  22.540  1.00 52.21 ? 306  LYS A CG    1 
ATOM   1274  C  CD    . LYS E 2 117 ? 39.094  79.404  21.051  1.00 52.79 ? 306  LYS A CD    1 
ATOM   1275  C  CE    . LYS E 2 117 ? 39.896  78.422  20.197  1.00 53.16 ? 306  LYS A CE    1 
ATOM   1276  N  NZ    . LYS E 2 117 ? 41.362  78.578  20.400  1.00 53.64 ? 306  LYS A NZ    1 
ATOM   1277  N  N     . LEU E 2 118 ? 37.182  83.127  23.797  1.00 51.62 ? 307  LEU A N     1 
ATOM   1278  C  CA    . LEU E 2 118 ? 36.001  83.940  23.546  1.00 52.80 ? 307  LEU A CA    1 
ATOM   1279  C  C     . LEU E 2 118 ? 36.328  85.214  22.768  1.00 54.04 ? 307  LEU A C     1 
ATOM   1280  O  O     . LEU E 2 118 ? 35.514  85.686  21.970  1.00 54.09 ? 307  LEU A O     1 
ATOM   1281  C  CB    . LEU E 2 118 ? 35.310  84.289  24.867  1.00 51.96 ? 307  LEU A CB    1 
ATOM   1282  C  CG    . LEU E 2 118 ? 34.554  83.141  25.548  1.00 51.91 ? 307  LEU A CG    1 
ATOM   1283  C  CD1   . LEU E 2 118 ? 34.003  83.619  26.881  1.00 50.94 ? 307  LEU A CD1   1 
ATOM   1284  C  CD2   . LEU E 2 118 ? 33.424  82.650  24.644  1.00 51.06 ? 307  LEU A CD2   1 
ATOM   1285  N  N     . LEU E 2 119 ? 37.514  85.767  23.005  1.00 55.13 ? 308  LEU A N     1 
ATOM   1286  C  CA    . LEU E 2 119 ? 37.950  86.972  22.313  1.00 56.44 ? 308  LEU A CA    1 
ATOM   1287  C  C     . LEU E 2 119 ? 38.584  86.618  20.967  1.00 58.22 ? 308  LEU A C     1 
ATOM   1288  O  O     . LEU E 2 119 ? 38.420  87.340  19.981  1.00 58.34 ? 308  LEU A O     1 
ATOM   1289  C  CB    . LEU E 2 119 ? 38.968  87.733  23.167  1.00 55.29 ? 308  LEU A CB    1 
ATOM   1290  C  CG    . LEU E 2 119 ? 38.506  88.571  24.363  1.00 54.39 ? 308  LEU A CG    1 
ATOM   1291  C  CD1   . LEU E 2 119 ? 37.000  88.509  24.506  1.00 54.56 ? 308  LEU A CD1   1 
ATOM   1292  C  CD2   . LEU E 2 119 ? 39.195  88.077  25.616  1.00 54.24 ? 308  LEU A CD2   1 
ATOM   1293  N  N     . GLU E 2 120 ? 39.297  85.494  20.939  1.00 60.35 ? 309  GLU A N     1 
ATOM   1294  C  CA    . GLU E 2 120 ? 39.989  85.023  19.743  1.00 62.28 ? 309  GLU A CA    1 
ATOM   1295  C  C     . GLU E 2 120 ? 39.060  84.542  18.626  1.00 63.23 ? 309  GLU A C     1 
ATOM   1296  O  O     . GLU E 2 120 ? 39.400  84.632  17.447  1.00 63.97 ? 309  GLU A O     1 
ATOM   1297  C  CB    . GLU E 2 120 ? 40.947  83.895  20.115  1.00 63.09 ? 309  GLU A CB    1 
ATOM   1298  C  CG    . GLU E 2 120 ? 42.015  83.632  19.082  1.00 64.98 ? 309  GLU A CG    1 
ATOM   1299  C  CD    . GLU E 2 120 ? 42.384  82.167  18.995  1.00 66.86 ? 309  GLU A CD    1 
ATOM   1300  O  OE1   . GLU E 2 120 ? 41.620  81.404  18.360  1.00 67.49 ? 309  GLU A OE1   1 
ATOM   1301  O  OE2   . GLU E 2 120 ? 43.428  81.775  19.568  1.00 67.80 ? 309  GLU A OE2   1 
ATOM   1302  N  N     . ASP E 2 121 ? 37.896  84.019  18.987  1.00 63.97 ? 310  ASP A N     1 
ATOM   1303  C  CA    . ASP E 2 121 ? 36.952  83.542  17.986  1.00 64.93 ? 310  ASP A CA    1 
ATOM   1304  C  C     . ASP E 2 121 ? 35.524  83.879  18.407  1.00 65.79 ? 310  ASP A C     1 
ATOM   1305  O  O     . ASP E 2 121 ? 34.712  82.992  18.669  1.00 65.94 ? 310  ASP A O     1 
ATOM   1306  C  CB    . ASP E 2 121 ? 37.124  82.035  17.801  1.00 65.27 ? 310  ASP A CB    1 
ATOM   1307  C  CG    . ASP E 2 121 ? 36.070  81.437  16.902  1.00 65.67 ? 310  ASP A CG    1 
ATOM   1308  O  OD1   . ASP E 2 121 ? 35.654  82.121  15.940  1.00 65.99 ? 310  ASP A OD1   1 
ATOM   1309  O  OD2   . ASP E 2 121 ? 35.668  80.279  17.152  1.00 66.03 ? 310  ASP A OD2   1 
ATOM   1310  N  N     . PRO E 2 122 ? 35.200  85.181  18.457  1.00 66.42 ? 311  PRO A N     1 
ATOM   1311  C  CA    . PRO E 2 122 ? 33.895  85.721  18.845  1.00 67.07 ? 311  PRO A CA    1 
ATOM   1312  C  C     . PRO E 2 122 ? 32.673  85.269  18.064  1.00 67.80 ? 311  PRO A C     1 
ATOM   1313  O  O     . PRO E 2 122 ? 32.733  85.039  16.861  1.00 68.00 ? 311  PRO A O     1 
ATOM   1314  C  CB    . PRO E 2 122 ? 34.099  87.231  18.732  1.00 67.19 ? 311  PRO A CB    1 
ATOM   1315  C  CG    . PRO E 2 122 ? 35.554  87.404  18.992  1.00 67.32 ? 311  PRO A CG    1 
ATOM   1316  C  CD    . PRO E 2 122 ? 36.144  86.278  18.185  1.00 66.81 ? 311  PRO A CD    1 
ATOM   1317  N  N     . HIS E 2 123 ? 31.565  85.141  18.785  1.00 68.79 ? 312  HIS A N     1 
ATOM   1318  C  CA    . HIS E 2 123 ? 30.274  84.776  18.219  1.00 70.13 ? 312  HIS A CA    1 
ATOM   1319  C  C     . HIS E 2 123 ? 29.284  85.745  18.874  1.00 71.13 ? 312  HIS A C     1 
ATOM   1320  O  O     . HIS E 2 123 ? 29.505  86.201  20.000  1.00 71.17 ? 312  HIS A O     1 
ATOM   1321  C  CB    . HIS E 2 123 ? 29.885  83.333  18.562  1.00 70.10 ? 312  HIS A CB    1 
ATOM   1322  C  CG    . HIS E 2 123 ? 30.816  82.294  18.015  1.00 71.00 ? 312  HIS A CG    1 
ATOM   1323  N  ND1   . HIS E 2 123 ? 30.410  81.003  17.748  1.00 71.29 ? 312  HIS A ND1   1 
ATOM   1324  C  CD2   . HIS E 2 123 ? 32.139  82.336  17.732  1.00 70.96 ? 312  HIS A CD2   1 
ATOM   1325  C  CE1   . HIS E 2 123 ? 31.443  80.295  17.326  1.00 71.27 ? 312  HIS A CE1   1 
ATOM   1326  N  NE2   . HIS E 2 123 ? 32.505  81.081  17.308  1.00 71.29 ? 312  HIS A NE2   1 
ATOM   1327  N  N     . GLU E 2 124 ? 28.203  86.063  18.171  1.00 72.18 ? 313  GLU A N     1 
ATOM   1328  C  CA    . GLU E 2 124 ? 27.202  86.996  18.683  1.00 73.38 ? 313  GLU A CA    1 
ATOM   1329  C  C     . GLU E 2 124 ? 26.517  86.509  19.955  1.00 72.88 ? 313  GLU A C     1 
ATOM   1330  O  O     . GLU E 2 124 ? 26.013  85.387  20.017  1.00 72.76 ? 313  GLU A O     1 
ATOM   1331  C  CB    . GLU E 2 124 ? 26.145  87.279  17.604  1.00 75.17 ? 313  GLU A CB    1 
ATOM   1332  C  CG    . GLU E 2 124 ? 25.011  88.218  18.034  1.00 77.35 ? 313  GLU A CG    1 
ATOM   1333  C  CD    . GLU E 2 124 ? 25.497  89.614  18.404  1.00 78.78 ? 313  GLU A CD    1 
ATOM   1334  O  OE1   . GLU E 2 124 ? 26.257  89.744  19.394  1.00 79.65 ? 313  GLU A OE1   1 
ATOM   1335  O  OE2   . GLU E 2 124 ? 25.117  90.581  17.703  1.00 79.28 ? 313  GLU A OE2   1 
ATOM   1336  N  N     . LEU E 2 125 ? 26.493  87.375  20.961  1.00 72.49 ? 314  LEU A N     1 
ATOM   1337  C  CA    . LEU E 2 125 ? 25.871  87.050  22.233  1.00 72.37 ? 314  LEU A CA    1 
ATOM   1338  C  C     . LEU E 2 125 ? 24.353  87.176  22.135  1.00 72.51 ? 314  LEU A C     1 
ATOM   1339  O  O     . LEU E 2 125 ? 23.812  88.276  22.027  1.00 72.75 ? 314  LEU A O     1 
ATOM   1340  C  CB    . LEU E 2 125 ? 26.409  87.973  23.330  1.00 71.64 ? 314  LEU A CB    1 
ATOM   1341  C  CG    . LEU E 2 125 ? 26.078  87.591  24.774  1.00 71.48 ? 314  LEU A CG    1 
ATOM   1342  C  CD1   . LEU E 2 125 ? 26.620  86.204  25.088  1.00 71.44 ? 314  LEU A CD1   1 
ATOM   1343  C  CD2   . LEU E 2 125 ? 26.680  88.616  25.714  1.00 71.68 ? 314  LEU A CD2   1 
ATOM   1344  N  N     . GLU E 2 126 ? 23.678  86.032  22.162  1.00 72.91 ? 315  GLU A N     1 
ATOM   1345  C  CA    . GLU E 2 126 ? 22.221  85.965  22.087  1.00 73.08 ? 315  GLU A CA    1 
ATOM   1346  C  C     . GLU E 2 126 ? 21.673  86.137  23.505  1.00 72.75 ? 315  GLU A C     1 
ATOM   1347  O  O     . GLU E 2 126 ? 22.438  86.198  24.465  1.00 72.83 ? 315  GLU A O     1 
ATOM   1348  C  CB    . GLU E 2 126 ? 21.799  84.594  21.553  1.00 74.14 ? 315  GLU A CB    1 
ATOM   1349  C  CG    . GLU E 2 126 ? 20.626  84.605  20.593  1.00 75.56 ? 315  GLU A CG    1 
ATOM   1350  C  CD    . GLU E 2 126 ? 21.066  84.711  19.147  1.00 76.06 ? 315  GLU A CD    1 
ATOM   1351  O  OE1   . GLU E 2 126 ? 21.781  83.799  18.680  1.00 75.93 ? 315  GLU A OE1   1 
ATOM   1352  O  OE2   . GLU E 2 126 ? 20.698  85.703  18.481  1.00 76.82 ? 315  GLU A OE2   1 
ATOM   1353  N  N     . LEU E 2 127 ? 20.353  86.206  23.644  1.00 72.23 ? 316  LEU A N     1 
ATOM   1354  C  CA    . LEU E 2 127 ? 19.752  86.348  24.967  1.00 71.44 ? 316  LEU A CA    1 
ATOM   1355  C  C     . LEU E 2 127 ? 19.396  84.991  25.580  1.00 70.11 ? 316  LEU A C     1 
ATOM   1356  O  O     . LEU E 2 127 ? 18.815  84.125  24.914  1.00 69.55 ? 316  LEU A O     1 
ATOM   1357  C  CB    . LEU E 2 127 ? 18.490  87.216  24.903  1.00 72.53 ? 316  LEU A CB    1 
ATOM   1358  C  CG    . LEU E 2 127 ? 17.601  87.146  26.155  1.00 73.00 ? 316  LEU A CG    1 
ATOM   1359  C  CD1   . LEU E 2 127 ? 18.399  87.584  27.381  1.00 73.54 ? 316  LEU A CD1   1 
ATOM   1360  C  CD2   . LEU E 2 127 ? 16.361  88.015  25.971  1.00 73.15 ? 316  LEU A CD2   1 
ATOM   1361  N  N     . GLY E 2 128 ? 19.748  84.823  26.854  1.00 68.35 ? 317  GLY A N     1 
ATOM   1362  C  CA    . GLY E 2 128 ? 19.458  83.586  27.555  1.00 66.04 ? 317  GLY A CA    1 
ATOM   1363  C  C     . GLY E 2 128 ? 20.173  82.392  26.956  1.00 64.50 ? 317  GLY A C     1 
ATOM   1364  O  O     . GLY E 2 128 ? 19.717  81.253  27.076  1.00 63.94 ? 317  GLY A O     1 
ATOM   1365  N  N     . ARG E 2 129 ? 21.296  82.657  26.299  1.00 63.12 ? 318  ARG A N     1 
ATOM   1366  C  CA    . ARG E 2 129 ? 22.085  81.598  25.679  1.00 61.26 ? 318  ARG A CA    1 
ATOM   1367  C  C     . ARG E 2 129 ? 23.560  81.857  25.950  1.00 59.50 ? 318  ARG A C     1 
ATOM   1368  O  O     . ARG E 2 129 ? 24.221  82.601  25.223  1.00 59.42 ? 318  ARG A O     1 
ATOM   1369  C  CB    . ARG E 2 129 ? 21.810  81.546  24.178  1.00 61.62 ? 318  ARG A CB    1 
ATOM   1370  C  CG    . ARG E 2 129 ? 20.356  81.261  23.863  1.00 62.36 ? 318  ARG A CG    1 
ATOM   1371  C  CD    . ARG E 2 129 ? 20.123  81.028  22.384  1.00 63.07 ? 318  ARG A CD    1 
ATOM   1372  N  NE    . ARG E 2 129 ? 18.751  80.600  22.132  1.00 63.65 ? 318  ARG A NE    1 
ATOM   1373  C  CZ    . ARG E 2 129 ? 18.314  80.138  20.966  1.00 64.06 ? 318  ARG A CZ    1 
ATOM   1374  N  NH1   . ARG E 2 129 ? 19.146  80.046  19.935  1.00 63.58 ? 318  ARG A NH1   1 
ATOM   1375  N  NH2   . ARG E 2 129 ? 17.049  79.755  20.838  1.00 64.24 ? 318  ARG A NH2   1 
ATOM   1376  N  N     . PRO E 2 130 ? 24.087  81.250  27.025  1.00 57.67 ? 319  PRO A N     1 
ATOM   1377  C  CA    . PRO E 2 130 ? 25.483  81.376  27.458  1.00 55.52 ? 319  PRO A CA    1 
ATOM   1378  C  C     . PRO E 2 130 ? 26.439  80.605  26.555  1.00 53.39 ? 319  PRO A C     1 
ATOM   1379  O  O     . PRO E 2 130 ? 26.097  79.540  26.050  1.00 52.57 ? 319  PRO A O     1 
ATOM   1380  C  CB    . PRO E 2 130 ? 25.463  80.794  28.876  1.00 56.17 ? 319  PRO A CB    1 
ATOM   1381  C  CG    . PRO E 2 130 ? 24.002  80.800  29.267  1.00 56.51 ? 319  PRO A CG    1 
ATOM   1382  C  CD    . PRO E 2 130 ? 23.317  80.452  27.993  1.00 56.70 ? 319  PRO A CD    1 
ATOM   1383  N  N     . GLN E 2 131 ? 27.638  81.142  26.364  1.00 51.51 ? 320  GLN A N     1 
ATOM   1384  C  CA    . GLN E 2 131 ? 28.634  80.474  25.536  1.00 49.91 ? 320  GLN A CA    1 
ATOM   1385  C  C     . GLN E 2 131 ? 29.521  79.579  26.409  1.00 47.88 ? 320  GLN A C     1 
ATOM   1386  O  O     . GLN E 2 131 ? 30.260  78.740  25.906  1.00 47.83 ? 320  GLN A O     1 
ATOM   1387  C  CB    . GLN E 2 131 ? 29.480  81.512  24.799  1.00 50.75 ? 320  GLN A CB    1 
ATOM   1388  C  CG    . GLN E 2 131 ? 28.646  82.664  24.261  1.00 52.84 ? 320  GLN A CG    1 
ATOM   1389  C  CD    . GLN E 2 131 ? 29.168  83.241  22.952  1.00 53.81 ? 320  GLN A CD    1 
ATOM   1390  O  OE1   . GLN E 2 131 ? 30.361  83.527  22.815  1.00 54.28 ? 320  GLN A OE1   1 
ATOM   1391  N  NE2   . GLN E 2 131 ? 28.266  83.429  21.985  1.00 53.87 ? 320  GLN A NE2   1 
ATOM   1392  N  N     . VAL E 2 132 ? 29.428  79.766  27.722  1.00 45.41 ? 321  VAL A N     1 
ATOM   1393  C  CA    . VAL E 2 132 ? 30.196  78.989  28.691  1.00 42.41 ? 321  VAL A CA    1 
ATOM   1394  C  C     . VAL E 2 132 ? 29.374  78.823  29.975  1.00 40.46 ? 321  VAL A C     1 
ATOM   1395  O  O     . VAL E 2 132 ? 28.897  79.813  30.546  1.00 39.09 ? 321  VAL A O     1 
ATOM   1396  C  CB    . VAL E 2 132 ? 31.526  79.695  29.085  1.00 42.17 ? 321  VAL A CB    1 
ATOM   1397  C  CG1   . VAL E 2 132 ? 32.308  78.819  30.047  1.00 41.62 ? 321  VAL A CG1   1 
ATOM   1398  C  CG2   . VAL E 2 132 ? 32.363  79.995  27.859  1.00 41.81 ? 321  VAL A CG2   1 
ATOM   1399  N  N     . VAL E 2 133 ? 29.206  77.572  30.411  1.00 37.51 ? 322  VAL A N     1 
ATOM   1400  C  CA    . VAL E 2 133 ? 28.479  77.257  31.643  1.00 34.33 ? 322  VAL A CA    1 
ATOM   1401  C  C     . VAL E 2 133 ? 29.416  76.503  32.566  1.00 33.52 ? 322  VAL A C     1 
ATOM   1402  O  O     . VAL E 2 133 ? 29.858  75.396  32.246  1.00 32.91 ? 322  VAL A O     1 
ATOM   1403  C  CB    . VAL E 2 133 ? 27.271  76.346  31.401  1.00 32.89 ? 322  VAL A CB    1 
ATOM   1404  C  CG1   . VAL E 2 133 ? 26.579  76.067  32.715  1.00 31.59 ? 322  VAL A CG1   1 
ATOM   1405  C  CG2   . VAL E 2 133 ? 26.315  76.990  30.415  1.00 32.72 ? 322  VAL A CG2   1 
ATOM   1406  N  N     . ILE E 2 134 ? 29.717  77.108  33.709  1.00 32.01 ? 323  ILE A N     1 
ATOM   1407  C  CA    . ILE E 2 134 ? 30.594  76.501  34.700  1.00 30.51 ? 323  ILE A CA    1 
ATOM   1408  C  C     . ILE E 2 134 ? 29.727  76.176  35.910  1.00 30.74 ? 323  ILE A C     1 
ATOM   1409  O  O     . ILE E 2 134 ? 29.090  77.055  36.485  1.00 30.75 ? 323  ILE A O     1 
ATOM   1410  C  CB    . ILE E 2 134 ? 31.716  77.475  35.084  1.00 30.52 ? 323  ILE A CB    1 
ATOM   1411  C  CG1   . ILE E 2 134 ? 32.538  77.811  33.831  1.00 29.59 ? 323  ILE A CG1   1 
ATOM   1412  C  CG2   . ILE E 2 134 ? 32.578  76.888  36.174  1.00 28.96 ? 323  ILE A CG2   1 
ATOM   1413  C  CD1   . ILE E 2 134 ? 33.474  78.991  34.015  1.00 29.26 ? 323  ILE A CD1   1 
ATOM   1414  N  N     . VAL E 2 135 ? 29.691  74.903  36.281  1.00 30.56 ? 324  VAL A N     1 
ATOM   1415  C  CA    . VAL E 2 135 ? 28.879  74.455  37.400  1.00 30.38 ? 324  VAL A CA    1 
ATOM   1416  C  C     . VAL E 2 135 ? 29.709  74.164  38.649  1.00 29.28 ? 324  VAL A C     1 
ATOM   1417  O  O     . VAL E 2 135 ? 30.847  73.703  38.569  1.00 28.96 ? 324  VAL A O     1 
ATOM   1418  C  CB    . VAL E 2 135 ? 28.044  73.223  36.996  1.00 30.53 ? 324  VAL A CB    1 
ATOM   1419  C  CG1   . VAL E 2 135 ? 27.216  72.756  38.151  1.00 33.36 ? 324  VAL A CG1   1 
ATOM   1420  C  CG2   . VAL E 2 135 ? 27.118  73.588  35.851  1.00 31.23 ? 324  VAL A CG2   1 
ATOM   1421  N  N     . SER E 2 136 ? 29.110  74.451  39.798  1.00 28.98 ? 325  SER A N     1 
ATOM   1422  C  CA    . SER E 2 136 ? 29.737  74.293  41.106  1.00 27.82 ? 325  SER A CA    1 
ATOM   1423  C  C     . SER E 2 136 ? 28.825  73.565  42.074  1.00 26.97 ? 325  SER A C     1 
ATOM   1424  O  O     . SER E 2 136 ? 27.607  73.662  41.975  1.00 28.82 ? 325  SER A O     1 
ATOM   1425  C  CB    . SER E 2 136 ? 30.069  75.678  41.673  1.00 27.82 ? 325  SER A CB    1 
ATOM   1426  O  OG    . SER E 2 136 ? 30.289  75.651  43.072  1.00 27.80 ? 325  SER A OG    1 
ATOM   1427  N  N     . PRO E 2 137 ? 29.405  72.811  43.021  1.00 26.37 ? 326  PRO A N     1 
ATOM   1428  C  CA    . PRO E 2 137 ? 28.632  72.065  44.021  1.00 25.27 ? 326  PRO A CA    1 
ATOM   1429  C  C     . PRO E 2 137 ? 28.102  72.963  45.156  1.00 25.29 ? 326  PRO A C     1 
ATOM   1430  O  O     . PRO E 2 137 ? 27.148  72.589  45.861  1.00 25.01 ? 326  PRO A O     1 
ATOM   1431  C  CB    . PRO E 2 137 ? 29.626  71.012  44.505  1.00 23.98 ? 326  PRO A CB    1 
ATOM   1432  C  CG    . PRO E 2 137 ? 30.920  71.718  44.400  1.00 24.59 ? 326  PRO A CG    1 
ATOM   1433  C  CD    . PRO E 2 137 ? 30.827  72.428  43.069  1.00 24.50 ? 326  PRO A CD    1 
ATOM   1434  N  N     . THR E 2 138 ? 28.716  74.131  45.354  1.00 24.49 ? 327  THR A N     1 
ATOM   1435  C  CA    . THR E 2 138 ? 28.229  75.051  46.390  1.00 24.21 ? 327  THR A CA    1 
ATOM   1436  C  C     . THR E 2 138 ? 28.153  76.485  45.905  1.00 25.49 ? 327  THR A C     1 
ATOM   1437  O  O     . THR E 2 138 ? 28.872  76.890  44.985  1.00 25.87 ? 327  THR A O     1 
ATOM   1438  C  CB    . THR E 2 138 ? 29.090  75.052  47.678  1.00 24.18 ? 327  THR A CB    1 
ATOM   1439  O  OG1   . THR E 2 138 ? 30.347  75.706  47.424  1.00 23.98 ? 327  THR A OG1   1 
ATOM   1440  C  CG2   . THR E 2 138 ? 29.303  73.599  48.205  1.00 22.38 ? 327  THR A CG2   1 
ATOM   1441  N  N     . ARG E 2 139 ? 27.280  77.255  46.549  1.00 26.79 ? 328  ARG A N     1 
ATOM   1442  C  CA    . ARG E 2 139 ? 27.053  78.653  46.209  1.00 26.28 ? 328  ARG A CA    1 
ATOM   1443  C  C     . ARG E 2 139 ? 28.271  79.531  46.376  1.00 26.93 ? 328  ARG A C     1 
ATOM   1444  O  O     . ARG E 2 139 ? 28.618  80.277  45.470  1.00 28.18 ? 328  ARG A O     1 
ATOM   1445  C  CB    . ARG E 2 139 ? 25.916  79.197  47.058  1.00 26.36 ? 328  ARG A CB    1 
ATOM   1446  C  CG    . ARG E 2 139 ? 24.634  78.437  46.858  1.00 27.19 ? 328  ARG A CG    1 
ATOM   1447  C  CD    . ARG E 2 139 ? 23.578  78.831  47.875  1.00 26.87 ? 328  ARG A CD    1 
ATOM   1448  N  NE    . ARG E 2 139 ? 22.353  78.077  47.663  1.00 26.24 ? 328  ARG A NE    1 
ATOM   1449  C  CZ    . ARG E 2 139 ? 21.282  78.157  48.442  1.00 27.82 ? 328  ARG A CZ    1 
ATOM   1450  N  NH1   . ARG E 2 139 ? 21.280  78.971  49.490  1.00 27.98 ? 328  ARG A NH1   1 
ATOM   1451  N  NH2   . ARG E 2 139 ? 20.220  77.409  48.181  1.00 27.21 ? 328  ARG A NH2   1 
ATOM   1452  N  N     . GLU E 2 140 ? 28.931  79.452  47.523  1.00 27.25 ? 329  GLU A N     1 
ATOM   1453  C  CA    . GLU E 2 140 ? 30.102  80.296  47.742  1.00 28.79 ? 329  GLU A CA    1 
ATOM   1454  C  C     . GLU E 2 140 ? 31.212  79.987  46.739  1.00 28.96 ? 329  GLU A C     1 
ATOM   1455  O  O     . GLU E 2 140 ? 31.992  80.866  46.372  1.00 29.26 ? 329  GLU A O     1 
ATOM   1456  C  CB    . GLU E 2 140 ? 30.643  80.142  49.168  1.00 29.72 ? 329  GLU A CB    1 
ATOM   1457  C  CG    . GLU E 2 140 ? 29.686  80.580  50.298  1.00 32.64 ? 329  GLU A CG    1 
ATOM   1458  C  CD    . GLU E 2 140 ? 28.402  79.744  50.392  1.00 33.58 ? 329  GLU A CD    1 
ATOM   1459  O  OE1   . GLU E 2 140 ? 28.432  78.528  50.095  1.00 32.76 ? 329  GLU A OE1   1 
ATOM   1460  O  OE2   . GLU E 2 140 ? 27.359  80.308  50.783  1.00 34.11 ? 329  GLU A OE2   1 
ATOM   1461  N  N     . LEU E 2 141 ? 31.304  78.738  46.296  1.00 28.40 ? 330  LEU A N     1 
ATOM   1462  C  CA    . LEU E 2 141 ? 32.341  78.408  45.332  1.00 27.28 ? 330  LEU A CA    1 
ATOM   1463  C  C     . LEU E 2 141 ? 31.961  79.016  43.994  1.00 26.73 ? 330  LEU A C     1 
ATOM   1464  O  O     . LEU E 2 141 ? 32.815  79.472  43.236  1.00 26.46 ? 330  LEU A O     1 
ATOM   1465  C  CB    . LEU E 2 141 ? 32.512  76.897  45.199  1.00 26.24 ? 330  LEU A CB    1 
ATOM   1466  C  CG    . LEU E 2 141 ? 33.604  76.495  44.209  1.00 25.93 ? 330  LEU A CG    1 
ATOM   1467  C  CD1   . LEU E 2 141 ? 34.912  77.171  44.599  1.00 27.18 ? 330  LEU A CD1   1 
ATOM   1468  C  CD2   . LEU E 2 141 ? 33.757  74.971  44.202  1.00 25.87 ? 330  LEU A CD2   1 
ATOM   1469  N  N     . ALA E 2 142 ? 30.672  79.016  43.697  1.00 27.42 ? 331  ALA A N     1 
ATOM   1470  C  CA    . ALA E 2 142 ? 30.215  79.604  42.453  1.00 28.39 ? 331  ALA A CA    1 
ATOM   1471  C  C     . ALA E 2 142 ? 30.637  81.079  42.431  1.00 29.61 ? 331  ALA A C     1 
ATOM   1472  O  O     . ALA E 2 142 ? 31.305  81.527  41.487  1.00 29.56 ? 331  ALA A O     1 
ATOM   1473  C  CB    . ALA E 2 142 ? 28.700  79.485  42.344  1.00 28.00 ? 331  ALA A CB    1 
ATOM   1474  N  N     . ILE E 2 143 ? 30.293  81.842  43.472  1.00 30.45 ? 332  ILE A N     1 
ATOM   1475  C  CA    . ILE E 2 143 ? 30.671  83.249  43.431  1.00 31.93 ? 332  ILE A CA    1 
ATOM   1476  C  C     . ILE E 2 143 ? 32.185  83.451  43.417  1.00 31.80 ? 332  ILE A C     1 
ATOM   1477  O  O     . ILE E 2 143 ? 32.657  84.414  42.815  1.00 32.38 ? 332  ILE A O     1 
ATOM   1478  C  CB    . ILE E 2 143 ? 30.026  84.110  44.576  1.00 33.21 ? 332  ILE A CB    1 
ATOM   1479  C  CG1   . ILE E 2 143 ? 31.019  84.343  45.707  1.00 34.58 ? 332  ILE A CG1   1 
ATOM   1480  C  CG2   . ILE E 2 143 ? 28.741  83.457  45.082  1.00 33.02 ? 332  ILE A CG2   1 
ATOM   1481  C  CD1   . ILE E 2 143 ? 30.922  83.322  46.849  1.00 37.39 ? 332  ILE A CD1   1 
ATOM   1482  N  N     . GLN E 2 144 ? 32.955  82.563  44.051  1.00 30.06 ? 333  GLN A N     1 
ATOM   1483  C  CA    . GLN E 2 144 ? 34.412  82.722  44.030  1.00 30.34 ? 333  GLN A CA    1 
ATOM   1484  C  C     . GLN E 2 144 ? 34.918  82.590  42.606  1.00 31.00 ? 333  GLN A C     1 
ATOM   1485  O  O     . GLN E 2 144 ? 35.737  83.391  42.155  1.00 30.48 ? 333  GLN A O     1 
ATOM   1486  C  CB    . GLN E 2 144 ? 35.116  81.678  44.915  1.00 31.41 ? 333  GLN A CB    1 
ATOM   1487  C  CG    . GLN E 2 144 ? 36.645  81.625  44.746  1.00 28.56 ? 333  GLN A CG    1 
ATOM   1488  C  CD    . GLN E 2 144 ? 37.299  80.573  45.635  1.00 30.15 ? 333  GLN A CD    1 
ATOM   1489  O  OE1   . GLN E 2 144 ? 37.419  80.751  46.851  1.00 29.54 ? 333  GLN A OE1   1 
ATOM   1490  N  NE2   . GLN E 2 144 ? 37.710  79.459  45.032  1.00 28.10 ? 333  GLN A NE2   1 
ATOM   1491  N  N     . ILE E 2 145 ? 34.426  81.571  41.905  1.00 31.93 ? 334  ILE A N     1 
ATOM   1492  C  CA    . ILE E 2 145 ? 34.806  81.328  40.519  1.00 33.47 ? 334  ILE A CA    1 
ATOM   1493  C  C     . ILE E 2 145 ? 34.374  82.543  39.701  1.00 34.69 ? 334  ILE A C     1 
ATOM   1494  O  O     . ILE E 2 145 ? 35.099  83.029  38.837  1.00 34.20 ? 334  ILE A O     1 
ATOM   1495  C  CB    . ILE E 2 145 ? 34.104  80.071  39.974  1.00 33.82 ? 334  ILE A CB    1 
ATOM   1496  C  CG1   . ILE E 2 145 ? 34.646  78.826  40.690  1.00 33.52 ? 334  ILE A CG1   1 
ATOM   1497  C  CG2   . ILE E 2 145 ? 34.293  79.971  38.463  1.00 33.46 ? 334  ILE A CG2   1 
ATOM   1498  C  CD1   . ILE E 2 145 ? 33.920  77.540  40.320  1.00 32.71 ? 334  ILE A CD1   1 
ATOM   1499  N  N     . PHE E 2 146 ? 33.171  83.012  39.992  1.00 35.90 ? 335  PHE A N     1 
ATOM   1500  C  CA    . PHE E 2 146 ? 32.596  84.175  39.343  1.00 37.54 ? 335  PHE A CA    1 
ATOM   1501  C  C     . PHE E 2 146 ? 33.540  85.392  39.418  1.00 38.44 ? 335  PHE A C     1 
ATOM   1502  O  O     . PHE E 2 146 ? 33.754  86.088  38.428  1.00 38.06 ? 335  PHE A O     1 
ATOM   1503  C  CB    . PHE E 2 146 ? 31.271  84.474  40.024  1.00 37.99 ? 335  PHE A CB    1 
ATOM   1504  C  CG    . PHE E 2 146 ? 30.683  85.792  39.664  1.00 39.63 ? 335  PHE A CG    1 
ATOM   1505  C  CD1   . PHE E 2 146 ? 30.059  85.978  38.434  1.00 40.00 ? 335  PHE A CD1   1 
ATOM   1506  C  CD2   . PHE E 2 146 ? 30.713  86.845  40.574  1.00 40.01 ? 335  PHE A CD2   1 
ATOM   1507  C  CE1   . PHE E 2 146 ? 29.467  87.189  38.118  1.00 39.48 ? 335  PHE A CE1   1 
ATOM   1508  C  CE2   . PHE E 2 146 ? 30.123  88.066  40.266  1.00 40.38 ? 335  PHE A CE2   1 
ATOM   1509  C  CZ    . PHE E 2 146 ? 29.498  88.236  39.038  1.00 39.67 ? 335  PHE A CZ    1 
ATOM   1510  N  N     . ASN E 2 147 ? 34.117  85.630  40.590  1.00 39.50 ? 336  ASN A N     1 
ATOM   1511  C  CA    . ASN E 2 147 ? 35.026  86.756  40.773  1.00 40.61 ? 336  ASN A CA    1 
ATOM   1512  C  C     . ASN E 2 147 ? 36.382  86.557  40.127  1.00 40.91 ? 336  ASN A C     1 
ATOM   1513  O  O     . ASN E 2 147 ? 36.989  87.524  39.673  1.00 42.14 ? 336  ASN A O     1 
ATOM   1514  C  CB    . ASN E 2 147 ? 35.197  87.080  42.259  1.00 41.18 ? 336  ASN A CB    1 
ATOM   1515  C  CG    . ASN E 2 147 ? 34.077  87.967  42.794  1.00 43.01 ? 336  ASN A CG    1 
ATOM   1516  O  OD1   . ASN E 2 147 ? 33.558  87.737  43.881  1.00 45.18 ? 336  ASN A OD1   1 
ATOM   1517  N  ND2   . ASN E 2 147 ? 33.709  88.989  42.030  1.00 43.73 ? 336  ASN A ND2   1 
ATOM   1518  N  N     . GLU E 2 148 ? 36.877  85.323  40.085  1.00 40.99 ? 337  GLU A N     1 
ATOM   1519  C  CA    . GLU E 2 148 ? 38.157  85.084  39.429  1.00 40.26 ? 337  GLU A CA    1 
ATOM   1520  C  C     . GLU E 2 148 ? 37.956  85.309  37.929  1.00 39.89 ? 337  GLU A C     1 
ATOM   1521  O  O     . GLU E 2 148 ? 38.851  85.805  37.245  1.00 39.83 ? 337  GLU A O     1 
ATOM   1522  C  CB    . GLU E 2 148 ? 38.658  83.662  39.686  1.00 40.32 ? 337  GLU A CB    1 
ATOM   1523  C  CG    . GLU E 2 148 ? 39.185  83.447  41.087  1.00 41.77 ? 337  GLU A CG    1 
ATOM   1524  C  CD    . GLU E 2 148 ? 40.401  84.309  41.402  1.00 42.83 ? 337  GLU A CD    1 
ATOM   1525  O  OE1   . GLU E 2 148 ? 41.496  84.017  40.872  1.00 44.30 ? 337  GLU A OE1   1 
ATOM   1526  O  OE2   . GLU E 2 148 ? 40.261  85.281  42.179  1.00 44.14 ? 337  GLU A OE2   1 
ATOM   1527  N  N     . ALA E 2 149 ? 36.774  84.948  37.433  1.00 39.01 ? 338  ALA A N     1 
ATOM   1528  C  CA    . ALA E 2 149 ? 36.435  85.135  36.029  1.00 39.56 ? 338  ALA A CA    1 
ATOM   1529  C  C     . ALA E 2 149 ? 36.462  86.631  35.717  1.00 40.87 ? 338  ALA A C     1 
ATOM   1530  O  O     . ALA E 2 149 ? 37.065  87.057  34.729  1.00 41.42 ? 338  ALA A O     1 
ATOM   1531  C  CB    . ALA E 2 149 ? 35.056  84.573  35.745  1.00 38.65 ? 338  ALA A CB    1 
ATOM   1532  N  N     . ARG E 2 150 ? 35.802  87.426  36.558  1.00 41.71 ? 339  ARG A N     1 
ATOM   1533  C  CA    . ARG E 2 150 ? 35.776  88.876  36.376  1.00 42.35 ? 339  ARG A CA    1 
ATOM   1534  C  C     . ARG E 2 150 ? 37.194  89.419  36.436  1.00 42.03 ? 339  ARG A C     1 
ATOM   1535  O  O     . ARG E 2 150 ? 37.522  90.382  35.743  1.00 42.52 ? 339  ARG A O     1 
ATOM   1536  C  CB    . ARG E 2 150 ? 34.942  89.557  37.465  1.00 43.32 ? 339  ARG A CB    1 
ATOM   1537  C  CG    . ARG E 2 150 ? 33.446  89.422  37.305  1.00 45.53 ? 339  ARG A CG    1 
ATOM   1538  C  CD    . ARG E 2 150 ? 32.717  90.012  38.518  1.00 47.98 ? 339  ARG A CD    1 
ATOM   1539  N  NE    . ARG E 2 150 ? 32.142  91.335  38.270  1.00 50.31 ? 339  ARG A NE    1 
ATOM   1540  C  CZ    . ARG E 2 150 ? 32.811  92.484  38.326  1.00 51.38 ? 339  ARG A CZ    1 
ATOM   1541  N  NH1   . ARG E 2 150 ? 34.105  92.504  38.625  1.00 52.44 ? 339  ARG A NH1   1 
ATOM   1542  N  NH2   . ARG E 2 150 ? 32.176  93.624  38.094  1.00 52.16 ? 339  ARG A NH2   1 
ATOM   1543  N  N     . LYS E 2 151 ? 38.030  88.807  37.270  1.00 41.64 ? 340  LYS A N     1 
ATOM   1544  C  CA    . LYS E 2 151 ? 39.418  89.241  37.406  1.00 41.44 ? 340  LYS A CA    1 
ATOM   1545  C  C     . LYS E 2 151 ? 40.215  88.999  36.123  1.00 41.65 ? 340  LYS A C     1 
ATOM   1546  O  O     . LYS E 2 151 ? 40.938  89.881  35.649  1.00 41.35 ? 340  LYS A O     1 
ATOM   1547  C  CB    . LYS E 2 151 ? 40.097  88.512  38.561  1.00 41.69 ? 340  LYS A CB    1 
ATOM   1548  C  CG    . LYS E 2 151 ? 41.527  88.955  38.777  1.00 42.94 ? 340  LYS A CG    1 
ATOM   1549  C  CD    . LYS E 2 151 ? 42.142  88.345  40.022  1.00 43.84 ? 340  LYS A CD    1 
ATOM   1550  C  CE    . LYS E 2 151 ? 42.399  86.862  39.860  1.00 43.75 ? 340  LYS A CE    1 
ATOM   1551  N  NZ    . LYS E 2 151 ? 43.040  86.348  41.098  1.00 44.21 ? 340  LYS A NZ    1 
ATOM   1552  N  N     . PHE E 2 152 ? 40.078  87.807  35.557  1.00 41.29 ? 341  PHE A N     1 
ATOM   1553  C  CA    . PHE E 2 152 ? 40.801  87.477  34.346  1.00 41.71 ? 341  PHE A CA    1 
ATOM   1554  C  C     . PHE E 2 152 ? 40.228  88.162  33.104  1.00 42.21 ? 341  PHE A C     1 
ATOM   1555  O  O     . PHE E 2 152 ? 40.947  88.374  32.133  1.00 42.40 ? 341  PHE A O     1 
ATOM   1556  C  CB    . PHE E 2 152 ? 40.841  85.953  34.146  1.00 40.62 ? 341  PHE A CB    1 
ATOM   1557  C  CG    . PHE E 2 152 ? 41.635  85.223  35.194  1.00 39.55 ? 341  PHE A CG    1 
ATOM   1558  C  CD1   . PHE E 2 152 ? 42.926  85.625  35.513  1.00 38.73 ? 341  PHE A CD1   1 
ATOM   1559  C  CD2   . PHE E 2 152 ? 41.085  84.140  35.877  1.00 39.27 ? 341  PHE A CD2   1 
ATOM   1560  C  CE1   . PHE E 2 152 ? 43.663  84.964  36.502  1.00 39.51 ? 341  PHE A CE1   1 
ATOM   1561  C  CE2   . PHE E 2 152 ? 41.814  83.470  36.869  1.00 38.76 ? 341  PHE A CE2   1 
ATOM   1562  C  CZ    . PHE E 2 152 ? 43.104  83.883  37.183  1.00 38.83 ? 341  PHE A CZ    1 
ATOM   1563  N  N     . ALA E 2 153 ? 38.945  88.510  33.138  1.00 43.15 ? 342  ALA A N     1 
ATOM   1564  C  CA    . ALA E 2 153 ? 38.292  89.172  32.009  1.00 44.00 ? 342  ALA A CA    1 
ATOM   1565  C  C     . ALA E 2 153 ? 38.182  90.683  32.230  1.00 45.50 ? 342  ALA A C     1 
ATOM   1566  O  O     . ALA E 2 153 ? 37.453  91.377  31.523  1.00 45.39 ? 342  ALA A O     1 
ATOM   1567  C  CB    . ALA E 2 153 ? 36.910  88.582  31.793  1.00 42.85 ? 342  ALA A CB    1 
ATOM   1568  N  N     . PHE E 2 154 ? 38.910  91.181  33.219  1.00 48.15 ? 343  PHE A N     1 
ATOM   1569  C  CA    . PHE E 2 154 ? 38.913  92.600  33.560  1.00 50.99 ? 343  PHE A CA    1 
ATOM   1570  C  C     . PHE E 2 154 ? 39.290  93.455  32.359  1.00 53.24 ? 343  PHE A C     1 
ATOM   1571  O  O     . PHE E 2 154 ? 40.272  93.180  31.658  1.00 52.93 ? 343  PHE A O     1 
ATOM   1572  C  CB    . PHE E 2 154 ? 39.903  92.858  34.697  1.00 51.45 ? 343  PHE A CB    1 
ATOM   1573  C  CG    . PHE E 2 154 ? 39.999  94.299  35.110  1.00 52.28 ? 343  PHE A CG    1 
ATOM   1574  C  CD1   . PHE E 2 154 ? 38.893  94.966  35.629  1.00 52.29 ? 343  PHE A CD1   1 
ATOM   1575  C  CD2   . PHE E 2 154 ? 41.206  94.984  35.008  1.00 52.25 ? 343  PHE A CD2   1 
ATOM   1576  C  CE1   . PHE E 2 154 ? 38.990  96.297  36.048  1.00 52.30 ? 343  PHE A CE1   1 
ATOM   1577  C  CE2   . PHE E 2 154 ? 41.312  96.317  35.425  1.00 52.72 ? 343  PHE A CE2   1 
ATOM   1578  C  CZ    . PHE E 2 154 ? 40.202  96.973  35.946  1.00 51.77 ? 343  PHE A CZ    1 
ATOM   1579  N  N     . GLU E 2 155 ? 38.496  94.495  32.132  1.00 55.70 ? 344  GLU A N     1 
ATOM   1580  C  CA    . GLU E 2 155 ? 38.713  95.427  31.024  1.00 57.56 ? 344  GLU A CA    1 
ATOM   1581  C  C     . GLU E 2 155 ? 38.595  94.807  29.641  1.00 57.77 ? 344  GLU A C     1 
ATOM   1582  O  O     . GLU E 2 155 ? 39.459  94.994  28.787  1.00 57.76 ? 344  GLU A O     1 
ATOM   1583  C  CB    . GLU E 2 155 ? 40.073  96.126  31.159  1.00 58.45 ? 344  GLU A CB    1 
ATOM   1584  C  CG    . GLU E 2 155 ? 40.118  97.165  32.266  1.00 59.87 ? 344  GLU A CG    1 
ATOM   1585  C  CD    . GLU E 2 155 ? 41.171  98.226  32.015  1.00 61.53 ? 344  GLU A CD    1 
ATOM   1586  O  OE1   . GLU E 2 155 ? 42.379  97.931  32.165  1.00 61.60 ? 344  GLU A OE1   1 
ATOM   1587  O  OE2   . GLU E 2 155 ? 40.779  99.358  31.650  1.00 62.89 ? 344  GLU A OE2   1 
ATOM   1588  N  N     . SER E 2 156 ? 37.513  94.074  29.427  1.00 58.32 ? 345  SER A N     1 
ATOM   1589  C  CA    . SER E 2 156 ? 37.248  93.447  28.142  1.00 58.86 ? 345  SER A CA    1 
ATOM   1590  C  C     . SER E 2 156 ? 35.756  93.604  27.911  1.00 58.74 ? 345  SER A C     1 
ATOM   1591  O  O     . SER E 2 156 ? 35.049  94.129  28.766  1.00 59.08 ? 345  SER A O     1 
ATOM   1592  C  CB    . SER E 2 156 ? 37.624  91.966  28.176  1.00 59.62 ? 345  SER A CB    1 
ATOM   1593  O  OG    . SER E 2 156 ? 37.329  91.358  26.930  1.00 61.23 ? 345  SER A OG    1 
ATOM   1594  N  N     . TYR E 2 157 ? 35.264  93.153  26.768  1.00 58.97 ? 346  TYR A N     1 
ATOM   1595  C  CA    . TYR E 2 157 ? 33.842  93.286  26.499  1.00 59.08 ? 346  TYR A CA    1 
ATOM   1596  C  C     . TYR E 2 157 ? 33.065  92.095  27.029  1.00 58.05 ? 346  TYR A C     1 
ATOM   1597  O  O     . TYR E 2 157 ? 31.836  92.083  26.975  1.00 58.29 ? 346  TYR A O     1 
ATOM   1598  C  CB    . TYR E 2 157 ? 33.580  93.432  24.994  1.00 61.16 ? 346  TYR A CB    1 
ATOM   1599  C  CG    . TYR E 2 157 ? 33.921  92.207  24.164  1.00 62.80 ? 346  TYR A CG    1 
ATOM   1600  C  CD1   . TYR E 2 157 ? 35.162  92.086  23.529  1.00 63.34 ? 346  TYR A CD1   1 
ATOM   1601  C  CD2   . TYR E 2 157 ? 32.998  91.169  24.015  1.00 63.52 ? 346  TYR A CD2   1 
ATOM   1602  C  CE1   . TYR E 2 157 ? 35.474  90.957  22.758  1.00 64.36 ? 346  TYR A CE1   1 
ATOM   1603  C  CE2   . TYR E 2 157 ? 33.296  90.037  23.256  1.00 64.80 ? 346  TYR A CE2   1 
ATOM   1604  C  CZ    . TYR E 2 157 ? 34.535  89.933  22.628  1.00 64.95 ? 346  TYR A CZ    1 
ATOM   1605  O  OH    . TYR E 2 157 ? 34.821  88.805  21.882  1.00 64.86 ? 346  TYR A OH    1 
ATOM   1606  N  N     . LEU E 2 158 ? 33.781  91.099  27.543  1.00 56.53 ? 347  LEU A N     1 
ATOM   1607  C  CA    . LEU E 2 158 ? 33.151  89.887  28.068  1.00 55.45 ? 347  LEU A CA    1 
ATOM   1608  C  C     . LEU E 2 158 ? 32.278  90.092  29.307  1.00 54.68 ? 347  LEU A C     1 
ATOM   1609  O  O     . LEU E 2 158 ? 32.699  90.705  30.289  1.00 54.13 ? 347  LEU A O     1 
ATOM   1610  C  CB    . LEU E 2 158 ? 34.217  88.840  28.372  1.00 54.78 ? 347  LEU A CB    1 
ATOM   1611  C  CG    . LEU E 2 158 ? 35.018  88.359  27.166  1.00 53.88 ? 347  LEU A CG    1 
ATOM   1612  C  CD1   . LEU E 2 158 ? 36.171  87.499  27.655  1.00 53.18 ? 347  LEU A CD1   1 
ATOM   1613  C  CD2   . LEU E 2 158 ? 34.117  87.588  26.214  1.00 52.98 ? 347  LEU A CD2   1 
ATOM   1614  N  N     . LYS E 2 159 ? 31.064  89.556  29.249  1.00 54.12 ? 348  LYS A N     1 
ATOM   1615  C  CA    . LYS E 2 159 ? 30.099  89.663  30.339  1.00 54.56 ? 348  LYS A CA    1 
ATOM   1616  C  C     . LYS E 2 159 ? 29.908  88.317  31.059  1.00 53.70 ? 348  LYS A C     1 
ATOM   1617  O  O     . LYS E 2 159 ? 29.437  87.338  30.473  1.00 53.32 ? 348  LYS A O     1 
ATOM   1618  C  CB    . LYS E 2 159 ? 28.760  90.177  29.790  1.00 55.77 ? 348  LYS A CB    1 
ATOM   1619  C  CG    . LYS E 2 159 ? 28.788  91.659  29.407  1.00 57.37 ? 348  LYS A CG    1 
ATOM   1620  C  CD    . LYS E 2 159 ? 27.486  92.126  28.749  1.00 58.50 ? 348  LYS A CD    1 
ATOM   1621  C  CE    . LYS E 2 159 ? 27.437  93.660  28.630  1.00 59.15 ? 348  LYS A CE    1 
ATOM   1622  N  NZ    . LYS E 2 159 ? 27.456  94.352  29.967  1.00 59.36 ? 348  LYS A NZ    1 
ATOM   1623  N  N     . ILE E 2 160 ? 30.257  88.289  32.343  1.00 52.74 ? 349  ILE A N     1 
ATOM   1624  C  CA    . ILE E 2 160 ? 30.165  87.071  33.132  1.00 51.88 ? 349  ILE A CA    1 
ATOM   1625  C  C     . ILE E 2 160 ? 28.781  86.731  33.696  1.00 51.48 ? 349  ILE A C     1 
ATOM   1626  O  O     . ILE E 2 160 ? 27.926  86.208  32.985  1.00 52.49 ? 349  ILE A O     1 
ATOM   1627  C  CB    . ILE E 2 160 ? 31.202  87.096  34.274  1.00 51.20 ? 349  ILE A CB    1 
ATOM   1628  C  CG1   . ILE E 2 160 ? 32.566  87.513  33.721  1.00 50.82 ? 349  ILE A CG1   1 
ATOM   1629  C  CG2   . ILE E 2 160 ? 31.317  85.719  34.906  1.00 50.96 ? 349  ILE A CG2   1 
ATOM   1630  C  CD1   . ILE E 2 160 ? 33.008  86.733  32.490  1.00 50.27 ? 349  ILE A CD1   1 
ATOM   1631  N  N     . GLY E 2 161 ? 28.544  87.015  34.967  1.00 50.71 ? 350  GLY A N     1 
ATOM   1632  C  CA    . GLY E 2 161 ? 27.253  86.665  35.533  1.00 49.42 ? 350  GLY A CA    1 
ATOM   1633  C  C     . GLY E 2 161 ? 27.263  85.330  36.276  1.00 48.17 ? 350  GLY A C     1 
ATOM   1634  O  O     . GLY E 2 161 ? 28.054  84.427  35.977  1.00 47.20 ? 350  GLY A O     1 
ATOM   1635  N  N     . ILE E 2 162 ? 26.352  85.203  37.235  1.00 46.84 ? 351  ILE A N     1 
ATOM   1636  C  CA    . ILE E 2 162 ? 26.251  84.012  38.065  1.00 45.19 ? 351  ILE A CA    1 
ATOM   1637  C  C     . ILE E 2 162 ? 24.814  83.769  38.516  1.00 44.40 ? 351  ILE A C     1 
ATOM   1638  O  O     . ILE E 2 162 ? 24.028  84.699  38.708  1.00 44.41 ? 351  ILE A O     1 
ATOM   1639  C  CB    . ILE E 2 162 ? 27.160  84.174  39.293  1.00 45.23 ? 351  ILE A CB    1 
ATOM   1640  C  CG1   . ILE E 2 162 ? 26.949  83.037  40.287  1.00 44.89 ? 351  ILE A CG1   1 
ATOM   1641  C  CG2   . ILE E 2 162 ? 26.891  85.527  39.947  1.00 45.25 ? 351  ILE A CG2   1 
ATOM   1642  C  CD1   . ILE E 2 162 ? 27.867  83.144  41.490  1.00 44.86 ? 351  ILE A CD1   1 
ATOM   1643  N  N     . VAL E 2 163 ? 24.482  82.503  38.700  1.00 43.46 ? 352  VAL A N     1 
ATOM   1644  C  CA    . VAL E 2 163 ? 23.146  82.113  39.102  1.00 42.32 ? 352  VAL A CA    1 
ATOM   1645  C  C     . VAL E 2 163 ? 23.217  81.063  40.215  1.00 41.58 ? 352  VAL A C     1 
ATOM   1646  O  O     . VAL E 2 163 ? 23.860  80.032  40.044  1.00 41.55 ? 352  VAL A O     1 
ATOM   1647  C  CB    . VAL E 2 163 ? 22.399  81.549  37.872  1.00 42.41 ? 352  VAL A CB    1 
ATOM   1648  C  CG1   . VAL E 2 163 ? 21.438  80.474  38.282  1.00 43.24 ? 352  VAL A CG1   1 
ATOM   1649  C  CG2   . VAL E 2 163 ? 21.668  82.672  37.156  1.00 41.96 ? 352  VAL A CG2   1 
ATOM   1650  N  N     . TYR E 2 164 ? 22.567  81.322  41.351  1.00 40.16 ? 353  TYR A N     1 
ATOM   1651  C  CA    . TYR E 2 164 ? 22.577  80.368  42.460  1.00 38.66 ? 353  TYR A CA    1 
ATOM   1652  C  C     . TYR E 2 164 ? 21.450  80.592  43.459  1.00 39.28 ? 353  TYR A C     1 
ATOM   1653  O  O     . TYR E 2 164 ? 20.985  81.716  43.645  1.00 37.86 ? 353  TYR A O     1 
ATOM   1654  C  CB    . TYR E 2 164 ? 23.910  80.426  43.194  1.00 37.30 ? 353  TYR A CB    1 
ATOM   1655  C  CG    . TYR E 2 164 ? 24.185  81.739  43.884  1.00 36.55 ? 353  TYR A CG    1 
ATOM   1656  C  CD1   . TYR E 2 164 ? 23.928  81.904  45.246  1.00 36.36 ? 353  TYR A CD1   1 
ATOM   1657  C  CD2   . TYR E 2 164 ? 24.751  82.805  43.187  1.00 35.82 ? 353  TYR A CD2   1 
ATOM   1658  C  CE1   . TYR E 2 164 ? 24.242  83.111  45.896  1.00 36.84 ? 353  TYR A CE1   1 
ATOM   1659  C  CE2   . TYR E 2 164 ? 25.067  83.998  43.823  1.00 35.40 ? 353  TYR A CE2   1 
ATOM   1660  C  CZ    . TYR E 2 164 ? 24.816  84.151  45.175  1.00 35.61 ? 353  TYR A CZ    1 
ATOM   1661  O  OH    . TYR E 2 164 ? 25.163  85.328  45.802  1.00 34.33 ? 353  TYR A OH    1 
ATOM   1662  N  N     . GLY E 2 165 ? 21.038  79.509  44.114  1.00 39.51 ? 354  GLY A N     1 
ATOM   1663  C  CA    . GLY E 2 165 ? 19.961  79.580  45.082  1.00 39.77 ? 354  GLY A CA    1 
ATOM   1664  C  C     . GLY E 2 165 ? 20.165  80.509  46.264  1.00 40.06 ? 354  GLY A C     1 
ATOM   1665  O  O     . GLY E 2 165 ? 21.249  81.059  46.477  1.00 39.52 ? 354  GLY A O     1 
ATOM   1666  N  N     . GLY E 2 166 ? 19.090  80.687  47.030  1.00 41.71 ? 355  GLY A N     1 
ATOM   1667  C  CA    . GLY E 2 166 ? 19.120  81.532  48.210  1.00 42.58 ? 355  GLY A CA    1 
ATOM   1668  C  C     . GLY E 2 166 ? 19.041  83.008  47.898  1.00 43.81 ? 355  GLY A C     1 
ATOM   1669  O  O     . GLY E 2 166 ? 19.062  83.828  48.809  1.00 43.46 ? 355  GLY A O     1 
ATOM   1670  N  N     . THR E 2 167 ? 18.950  83.346  46.615  1.00 45.33 ? 356  THR A N     1 
ATOM   1671  C  CA    . THR E 2 167 ? 18.886  84.746  46.186  1.00 47.09 ? 356  THR A CA    1 
ATOM   1672  C  C     . THR E 2 167 ? 17.593  85.042  45.433  1.00 48.14 ? 356  THR A C     1 
ATOM   1673  O  O     . THR E 2 167 ? 16.909  84.127  44.975  1.00 47.03 ? 356  THR A O     1 
ATOM   1674  C  CB    . THR E 2 167 ? 20.045  85.092  45.237  1.00 47.26 ? 356  THR A CB    1 
ATOM   1675  O  OG1   . THR E 2 167 ? 19.914  84.311  44.044  1.00 48.09 ? 356  THR A OG1   1 
ATOM   1676  C  CG2   . THR E 2 167 ? 21.388  84.803  45.885  1.00 47.49 ? 356  THR A CG2   1 
ATOM   1677  N  N     . SER E 2 168 ? 17.266  86.325  45.292  1.00 49.84 ? 357  SER A N     1 
ATOM   1678  C  CA    . SER E 2 168 ? 16.054  86.698  44.569  1.00 52.11 ? 357  SER A CA    1 
ATOM   1679  C  C     . SER E 2 168 ? 16.199  86.322  43.095  1.00 52.79 ? 357  SER A C     1 
ATOM   1680  O  O     . SER E 2 168 ? 17.125  86.766  42.422  1.00 51.83 ? 357  SER A O     1 
ATOM   1681  C  CB    . SER E 2 168 ? 15.781  88.207  44.699  1.00 52.45 ? 357  SER A CB    1 
ATOM   1682  O  OG    . SER E 2 168 ? 16.756  88.977  44.018  1.00 53.06 ? 357  SER A OG    1 
ATOM   1683  N  N     . PHE E 2 169 ? 15.277  85.501  42.605  1.00 55.24 ? 358  PHE A N     1 
ATOM   1684  C  CA    . PHE E 2 169 ? 15.297  85.060  41.214  1.00 58.56 ? 358  PHE A CA    1 
ATOM   1685  C  C     . PHE E 2 169 ? 15.271  86.250  40.256  1.00 60.18 ? 358  PHE A C     1 
ATOM   1686  O  O     . PHE E 2 169 ? 15.787  86.167  39.143  1.00 60.10 ? 358  PHE A O     1 
ATOM   1687  C  CB    . PHE E 2 169 ? 14.093  84.155  40.928  1.00 59.90 ? 358  PHE A CB    1 
ATOM   1688  C  CG    . PHE E 2 169 ? 14.260  83.281  39.710  1.00 61.78 ? 358  PHE A CG    1 
ATOM   1689  C  CD1   . PHE E 2 169 ? 14.359  81.896  39.840  1.00 62.05 ? 358  PHE A CD1   1 
ATOM   1690  C  CD2   . PHE E 2 169 ? 14.349  83.840  38.435  1.00 62.14 ? 358  PHE A CD2   1 
ATOM   1691  C  CE1   . PHE E 2 169 ? 14.546  81.082  38.716  1.00 62.51 ? 358  PHE A CE1   1 
ATOM   1692  C  CE2   . PHE E 2 169 ? 14.536  83.035  37.307  1.00 62.64 ? 358  PHE A CE2   1 
ATOM   1693  C  CZ    . PHE E 2 169 ? 14.636  81.652  37.448  1.00 62.61 ? 358  PHE A CZ    1 
ATOM   1694  N  N     . ARG E 2 170 ? 14.679  87.357  40.698  1.00 62.41 ? 359  ARG A N     1 
ATOM   1695  C  CA    . ARG E 2 170 ? 14.574  88.555  39.868  1.00 64.63 ? 359  ARG A CA    1 
ATOM   1696  C  C     . ARG E 2 170 ? 15.889  89.283  39.620  1.00 65.73 ? 359  ARG A C     1 
ATOM   1697  O  O     . ARG E 2 170 ? 16.191  89.651  38.486  1.00 65.77 ? 359  ARG A O     1 
ATOM   1698  C  CB    . ARG E 2 170 ? 13.569  89.541  40.475  1.00 65.32 ? 359  ARG A CB    1 
ATOM   1699  C  CG    . ARG E 2 170 ? 13.547  90.903  39.783  1.00 66.23 ? 359  ARG A CG    1 
ATOM   1700  C  CD    . ARG E 2 170 ? 12.423  91.809  40.277  1.00 66.87 ? 359  ARG A CD    1 
ATOM   1701  N  NE    . ARG E 2 170 ? 11.149  91.573  39.597  1.00 67.11 ? 359  ARG A NE    1 
ATOM   1702  C  CZ    . ARG E 2 170 ? 10.401  90.480  39.736  1.00 67.56 ? 359  ARG A CZ    1 
ATOM   1703  N  NH1   . ARG E 2 170 ? 10.788  89.495  40.533  1.00 68.01 ? 359  ARG A NH1   1 
ATOM   1704  N  NH2   . ARG E 2 170 ? 9.248   90.377  39.091  1.00 67.67 ? 359  ARG A NH2   1 
ATOM   1705  N  N     . HIS E 2 171 ? 16.657  89.508  40.679  1.00 67.30 ? 360  HIS A N     1 
ATOM   1706  C  CA    . HIS E 2 171 ? 17.930  90.209  40.557  1.00 68.86 ? 360  HIS A CA    1 
ATOM   1707  C  C     . HIS E 2 171 ? 18.964  89.429  39.754  1.00 68.93 ? 360  HIS A C     1 
ATOM   1708  O  O     . HIS E 2 171 ? 19.868  90.017  39.166  1.00 69.14 ? 360  HIS A O     1 
ATOM   1709  C  CB    . HIS E 2 171 ? 18.488  90.530  41.942  1.00 70.67 ? 360  HIS A CB    1 
ATOM   1710  C  CG    . HIS E 2 171 ? 19.918  90.972  41.929  1.00 72.54 ? 360  HIS A CG    1 
ATOM   1711  N  ND1   . HIS E 2 171 ? 20.321  92.185  41.410  1.00 73.35 ? 360  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS E 2 171 ? 21.045  90.349  42.352  1.00 73.13 ? 360  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS E 2 171 ? 21.635  92.291  41.515  1.00 73.94 ? 360  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS E 2 171 ? 22.098  91.191  42.083  1.00 73.97 ? 360  HIS A NE2   1 
ATOM   1715  N  N     . GLN E 2 172 ? 18.849  88.109  39.735  1.00 69.31 ? 361  GLN A N     1 
ATOM   1716  C  CA    . GLN E 2 172 ? 19.797  87.314  38.966  1.00 69.99 ? 361  GLN A CA    1 
ATOM   1717  C  C     . GLN E 2 172 ? 19.305  87.212  37.529  1.00 70.80 ? 361  GLN A C     1 
ATOM   1718  O  O     . GLN E 2 172 ? 20.085  87.350  36.592  1.00 70.85 ? 361  GLN A O     1 
ATOM   1719  C  CB    . GLN E 2 172 ? 19.966  85.913  39.563  1.00 69.14 ? 361  GLN A CB    1 
ATOM   1720  C  CG    . GLN E 2 172 ? 20.563  85.897  40.960  1.00 67.93 ? 361  GLN A CG    1 
ATOM   1721  C  CD    . GLN E 2 172 ? 21.053  84.520  41.364  1.00 67.23 ? 361  GLN A CD    1 
ATOM   1722  O  OE1   . GLN E 2 172 ? 20.448  83.505  41.015  1.00 66.53 ? 361  GLN A OE1   1 
ATOM   1723  N  NE2   . GLN E 2 172 ? 22.146  84.478  42.115  1.00 66.58 ? 361  GLN A NE2   1 
ATOM   1724  N  N     . ASN E 2 173 ? 18.010  86.969  37.355  1.00 71.94 ? 362  ASN A N     1 
ATOM   1725  C  CA    . ASN E 2 173 ? 17.446  86.883  36.013  1.00 73.12 ? 362  ASN A CA    1 
ATOM   1726  C  C     . ASN E 2 173 ? 17.741  88.199  35.317  1.00 73.66 ? 362  ASN A C     1 
ATOM   1727  O  O     . ASN E 2 173 ? 17.983  88.249  34.111  1.00 73.57 ? 362  ASN A O     1 
ATOM   1728  C  CB    . ASN E 2 173 ? 15.934  86.672  36.068  1.00 73.12 ? 362  ASN A CB    1 
ATOM   1729  C  CG    . ASN E 2 173 ? 15.291  86.768  34.700  1.00 73.68 ? 362  ASN A CG    1 
ATOM   1730  O  OD1   . ASN E 2 173 ? 15.479  85.897  33.846  1.00 73.88 ? 362  ASN A OD1   1 
ATOM   1731  N  ND2   . ASN E 2 173 ? 14.538  87.841  34.477  1.00 73.58 ? 362  ASN A ND2   1 
ATOM   1732  N  N     . GLU E 2 174 ? 17.718  89.264  36.105  1.00 74.46 ? 363  GLU A N     1 
ATOM   1733  C  CA    . GLU E 2 174 ? 17.985  90.599  35.610  1.00 75.82 ? 363  GLU A CA    1 
ATOM   1734  C  C     . GLU E 2 174 ? 19.378  90.589  34.994  1.00 76.27 ? 363  GLU A C     1 
ATOM   1735  O  O     . GLU E 2 174 ? 19.532  90.589  33.768  1.00 76.47 ? 363  GLU A O     1 
ATOM   1736  C  CB    . GLU E 2 174 ? 17.928  91.593  36.773  1.00 76.34 ? 363  GLU A CB    1 
ATOM   1737  C  CG    . GLU E 2 174 ? 17.512  93.002  36.391  1.00 77.87 ? 363  GLU A CG    1 
ATOM   1738  C  CD    . GLU E 2 174 ? 17.315  93.902  37.607  1.00 78.75 ? 363  GLU A CD    1 
ATOM   1739  O  OE1   . GLU E 2 174 ? 18.323  94.222  38.276  1.00 79.37 ? 363  GLU A OE1   1 
ATOM   1740  O  OE2   . GLU E 2 174 ? 16.154  94.281  37.894  1.00 78.68 ? 363  GLU A OE2   1 
ATOM   1741  N  N     . CYS E 2 175 ? 20.384  90.557  35.863  1.00 76.66 ? 364  CYS A N     1 
ATOM   1742  C  CA    . CYS E 2 175 ? 21.789  90.549  35.463  1.00 76.56 ? 364  CYS A CA    1 
ATOM   1743  C  C     . CYS E 2 175 ? 22.078  89.654  34.255  1.00 76.16 ? 364  CYS A C     1 
ATOM   1744  O  O     . CYS E 2 175 ? 22.941  89.966  33.439  1.00 75.95 ? 364  CYS A O     1 
ATOM   1745  C  CB    . CYS E 2 175 ? 22.657  90.117  36.654  1.00 76.85 ? 364  CYS A CB    1 
ATOM   1746  S  SG    . CYS E 2 175 ? 22.451  91.139  38.159  1.00 77.61 ? 364  CYS A SG    1 
ATOM   1747  N  N     . ILE E 2 176 ? 21.339  88.554  34.140  1.00 76.31 ? 365  ILE A N     1 
ATOM   1748  C  CA    . ILE E 2 176 ? 21.520  87.600  33.047  1.00 76.27 ? 365  ILE A CA    1 
ATOM   1749  C  C     . ILE E 2 176 ? 20.905  88.009  31.708  1.00 76.49 ? 365  ILE A C     1 
ATOM   1750  O  O     . ILE E 2 176 ? 21.544  87.853  30.666  1.00 76.88 ? 365  ILE A O     1 
ATOM   1751  C  CB    . ILE E 2 176 ? 20.973  86.192  33.444  1.00 76.08 ? 365  ILE A CB    1 
ATOM   1752  C  CG1   . ILE E 2 176 ? 22.121  85.296  33.926  1.00 75.93 ? 365  ILE A CG1   1 
ATOM   1753  C  CG2   . ILE E 2 176 ? 20.260  85.540  32.266  1.00 75.90 ? 365  ILE A CG2   1 
ATOM   1754  C  CD1   . ILE E 2 176 ? 22.878  85.827  35.123  1.00 75.40 ? 365  ILE A CD1   1 
ATOM   1755  N  N     . THR E 2 177 ? 19.673  88.519  31.729  1.00 76.50 ? 366  THR A N     1 
ATOM   1756  C  CA    . THR E 2 177 ? 18.997  88.921  30.493  1.00 76.10 ? 366  THR A CA    1 
ATOM   1757  C  C     . THR E 2 177 ? 19.586  90.179  29.862  1.00 75.49 ? 366  THR A C     1 
ATOM   1758  O  O     . THR E 2 177 ? 19.001  90.769  28.954  1.00 75.19 ? 366  THR A O     1 
ATOM   1759  C  CB    . THR E 2 177 ? 17.486  89.125  30.708  1.00 76.53 ? 366  THR A CB    1 
ATOM   1760  O  OG1   . THR E 2 177 ? 17.270  90.184  31.651  1.00 77.17 ? 366  THR A OG1   1 
ATOM   1761  C  CG2   . THR E 2 177 ? 16.846  87.828  31.212  1.00 76.55 ? 366  THR A CG2   1 
ATOM   1762  N  N     . ARG E 2 178 ? 20.742  90.591  30.370  1.00 74.79 ? 367  ARG A N     1 
ATOM   1763  C  CA    . ARG E 2 178 ? 21.464  91.732  29.828  1.00 73.66 ? 367  ARG A CA    1 
ATOM   1764  C  C     . ARG E 2 178 ? 22.457  91.055  28.884  1.00 72.33 ? 367  ARG A C     1 
ATOM   1765  O  O     . ARG E 2 178 ? 23.157  91.712  28.115  1.00 72.61 ? 367  ARG A O     1 
ATOM   1766  C  CB    . ARG E 2 178 ? 22.234  92.459  30.929  1.00 74.65 ? 367  ARG A CB    1 
ATOM   1767  C  CG    . ARG E 2 178 ? 21.391  92.901  32.105  1.00 76.39 ? 367  ARG A CG    1 
ATOM   1768  C  CD    . ARG E 2 178 ? 22.274  93.196  33.314  1.00 78.16 ? 367  ARG A CD    1 
ATOM   1769  N  NE    . ARG E 2 178 ? 21.508  93.669  34.466  1.00 79.37 ? 367  ARG A NE    1 
ATOM   1770  C  CZ    . ARG E 2 178 ? 22.009  93.810  35.691  1.00 80.00 ? 367  ARG A CZ    1 
ATOM   1771  N  NH1   . ARG E 2 178 ? 23.282  93.509  35.926  1.00 80.16 ? 367  ARG A NH1   1 
ATOM   1772  N  NH2   . ARG E 2 178 ? 21.237  94.253  36.679  1.00 80.28 ? 367  ARG A NH2   1 
ATOM   1773  N  N     . GLY E 2 179 ? 22.504  89.724  28.972  1.00 70.41 ? 368  GLY A N     1 
ATOM   1774  C  CA    . GLY E 2 179 ? 23.394  88.925  28.148  1.00 67.43 ? 368  GLY A CA    1 
ATOM   1775  C  C     . GLY E 2 179 ? 24.711  88.622  28.839  1.00 65.54 ? 368  GLY A C     1 
ATOM   1776  O  O     . GLY E 2 179 ? 25.379  89.529  29.340  1.00 65.59 ? 368  GLY A O     1 
ATOM   1777  N  N     . CYS E 2 180 ? 25.091  87.347  28.869  1.00 63.30 ? 369  CYS A N     1 
ATOM   1778  C  CA    . CYS E 2 180 ? 26.344  86.933  29.503  1.00 60.85 ? 369  CYS A CA    1 
ATOM   1779  C  C     . CYS E 2 180 ? 27.033  85.874  28.654  1.00 58.02 ? 369  CYS A C     1 
ATOM   1780  O  O     . CYS E 2 180 ? 26.389  84.947  28.162  1.00 57.80 ? 369  CYS A O     1 
ATOM   1781  C  CB    . CYS E 2 180 ? 26.072  86.338  30.883  1.00 61.84 ? 369  CYS A CB    1 
ATOM   1782  S  SG    . CYS E 2 180 ? 24.766  87.158  31.825  1.00 65.47 ? 369  CYS A SG    1 
ATOM   1783  N  N     . HIS E 2 181 ? 28.340  86.005  28.480  1.00 54.74 ? 370  HIS A N     1 
ATOM   1784  C  CA    . HIS E 2 181 ? 29.075  85.019  27.704  1.00 51.95 ? 370  HIS A CA    1 
ATOM   1785  C  C     . HIS E 2 181 ? 29.293  83.821  28.623  1.00 49.42 ? 370  HIS A C     1 
ATOM   1786  O  O     . HIS E 2 181 ? 29.046  82.674  28.259  1.00 48.13 ? 370  HIS A O     1 
ATOM   1787  C  CB    . HIS E 2 181 ? 30.436  85.571  27.276  1.00 52.61 ? 370  HIS A CB    1 
ATOM   1788  C  CG    . HIS E 2 181 ? 30.366  86.883  26.560  1.00 53.67 ? 370  HIS A CG    1 
ATOM   1789  N  ND1   . HIS E 2 181 ? 29.796  87.025  25.313  1.00 53.97 ? 370  HIS A ND1   1 
ATOM   1790  C  CD2   . HIS E 2 181 ? 30.802  88.112  26.917  1.00 53.37 ? 370  HIS A CD2   1 
ATOM   1791  C  CE1   . HIS E 2 181 ? 29.886  88.287  24.934  1.00 54.25 ? 370  HIS A CE1   1 
ATOM   1792  N  NE2   . HIS E 2 181 ? 30.493  88.968  25.890  1.00 54.27 ? 370  HIS A NE2   1 
ATOM   1793  N  N     . VAL E 2 182 ? 29.748  84.113  29.830  1.00 47.25 ? 371  VAL A N     1 
ATOM   1794  C  CA    . VAL E 2 182 ? 30.032  83.088  30.817  1.00 45.66 ? 371  VAL A CA    1 
ATOM   1795  C  C     . VAL E 2 182 ? 29.028  83.081  31.970  1.00 45.00 ? 371  VAL A C     1 
ATOM   1796  O  O     . VAL E 2 182 ? 28.734  84.118  32.560  1.00 45.32 ? 371  VAL A O     1 
ATOM   1797  C  CB    . VAL E 2 182 ? 31.452  83.287  31.398  1.00 45.37 ? 371  VAL A CB    1 
ATOM   1798  C  CG1   . VAL E 2 182 ? 31.784  82.169  32.380  1.00 44.73 ? 371  VAL A CG1   1 
ATOM   1799  C  CG2   . VAL E 2 182 ? 32.471  83.340  30.264  1.00 44.40 ? 371  VAL A CG2   1 
ATOM   1800  N  N     . VAL E 2 183 ? 28.500  81.908  32.287  1.00 43.40 ? 372  VAL A N     1 
ATOM   1801  C  CA    . VAL E 2 183 ? 27.562  81.786  33.393  1.00 42.34 ? 372  VAL A CA    1 
ATOM   1802  C  C     . VAL E 2 183 ? 28.055  80.749  34.406  1.00 40.60 ? 372  VAL A C     1 
ATOM   1803  O  O     . VAL E 2 183 ? 28.236  79.577  34.068  1.00 39.48 ? 372  VAL A O     1 
ATOM   1804  C  CB    . VAL E 2 183 ? 26.166  81.368  32.904  1.00 42.71 ? 372  VAL A CB    1 
ATOM   1805  C  CG1   . VAL E 2 183 ? 25.212  81.312  34.077  1.00 43.70 ? 372  VAL A CG1   1 
ATOM   1806  C  CG2   . VAL E 2 183 ? 25.664  82.358  31.870  1.00 44.36 ? 372  VAL A CG2   1 
ATOM   1807  N  N     . ILE E 2 184 ? 28.294  81.200  35.635  1.00 38.65 ? 373  ILE A N     1 
ATOM   1808  C  CA    . ILE E 2 184 ? 28.744  80.327  36.720  1.00 37.01 ? 373  ILE A CA    1 
ATOM   1809  C  C     . ILE E 2 184 ? 27.486  79.978  37.493  1.00 36.19 ? 373  ILE A C     1 
ATOM   1810  O  O     . ILE E 2 184 ? 26.669  80.856  37.758  1.00 36.35 ? 373  ILE A O     1 
ATOM   1811  C  CB    . ILE E 2 184 ? 29.738  81.052  37.662  1.00 36.88 ? 373  ILE A CB    1 
ATOM   1812  C  CG1   . ILE E 2 184 ? 31.067  81.308  36.943  1.00 36.67 ? 373  ILE A CG1   1 
ATOM   1813  C  CG2   . ILE E 2 184 ? 30.018  80.194  38.880  1.00 36.22 ? 373  ILE A CG2   1 
ATOM   1814  C  CD1   . ILE E 2 184 ? 30.992  82.218  35.754  1.00 37.47 ? 373  ILE A CD1   1 
ATOM   1815  N  N     . ALA E 2 185 ? 27.313  78.717  37.869  1.00 35.43 ? 374  ALA A N     1 
ATOM   1816  C  CA    . ALA E 2 185 ? 26.085  78.364  38.575  1.00 34.60 ? 374  ALA A CA    1 
ATOM   1817  C  C     . ALA E 2 185 ? 26.039  77.065  39.374  1.00 34.41 ? 374  ALA A C     1 
ATOM   1818  O  O     . ALA E 2 185 ? 26.798  76.130  39.121  1.00 34.38 ? 374  ALA A O     1 
ATOM   1819  C  CB    . ALA E 2 185 ? 24.934  78.360  37.575  1.00 33.31 ? 374  ALA A CB    1 
ATOM   1820  N  N     . THR E 2 186 ? 25.132  77.029  40.349  1.00 33.93 ? 375  THR A N     1 
ATOM   1821  C  CA    . THR E 2 186 ? 24.902  75.828  41.140  1.00 33.77 ? 375  THR A CA    1 
ATOM   1822  C  C     . THR E 2 186 ? 23.744  75.170  40.398  1.00 33.29 ? 375  THR A C     1 
ATOM   1823  O  O     . THR E 2 186 ? 22.897  75.857  39.834  1.00 32.93 ? 375  THR A O     1 
ATOM   1824  C  CB    . THR E 2 186 ? 24.537  76.164  42.590  1.00 33.67 ? 375  THR A CB    1 
ATOM   1825  O  OG1   . THR E 2 186 ? 23.662  77.293  42.615  1.00 34.12 ? 375  THR A OG1   1 
ATOM   1826  C  CG2   . THR E 2 186 ? 25.799  76.487  43.382  1.00 32.52 ? 375  THR A CG2   1 
ATOM   1827  N  N     . PRO E 2 187 ? 23.703  73.833  40.372  1.00 33.40 ? 376  PRO A N     1 
ATOM   1828  C  CA    . PRO E 2 187 ? 22.668  73.064  39.675  1.00 34.00 ? 376  PRO A CA    1 
ATOM   1829  C  C     . PRO E 2 187 ? 21.215  73.468  39.796  1.00 35.47 ? 376  PRO A C     1 
ATOM   1830  O  O     . PRO E 2 187 ? 20.568  73.743  38.786  1.00 35.05 ? 376  PRO A O     1 
ATOM   1831  C  CB    . PRO E 2 187 ? 22.918  71.638  40.153  1.00 33.10 ? 376  PRO A CB    1 
ATOM   1832  C  CG    . PRO E 2 187 ? 24.387  71.625  40.319  1.00 33.41 ? 376  PRO A CG    1 
ATOM   1833  C  CD    . PRO E 2 187 ? 24.637  72.928  41.056  1.00 32.03 ? 376  PRO A CD    1 
ATOM   1834  N  N     . GLY E 2 188 ? 20.701  73.483  41.023  1.00 36.94 ? 377  GLY A N     1 
ATOM   1835  C  CA    . GLY E 2 188 ? 19.310  73.831  41.258  1.00 38.16 ? 377  GLY A CA    1 
ATOM   1836  C  C     . GLY E 2 188 ? 18.812  75.102  40.594  1.00 38.80 ? 377  GLY A C     1 
ATOM   1837  O  O     . GLY E 2 188 ? 17.907  75.061  39.764  1.00 38.98 ? 377  GLY A O     1 
ATOM   1838  N  N     . ARG E 2 189 ? 19.390  76.235  40.969  1.00 40.22 ? 378  ARG A N     1 
ATOM   1839  C  CA    . ARG E 2 189 ? 18.992  77.524  40.407  1.00 41.42 ? 378  ARG A CA    1 
ATOM   1840  C  C     . ARG E 2 189 ? 19.233  77.631  38.900  1.00 42.83 ? 378  ARG A C     1 
ATOM   1841  O  O     . ARG E 2 189 ? 18.768  78.576  38.268  1.00 43.05 ? 378  ARG A O     1 
ATOM   1842  C  CB    . ARG E 2 189 ? 19.719  78.667  41.129  1.00 40.75 ? 378  ARG A CB    1 
ATOM   1843  C  CG    . ARG E 2 189 ? 19.416  80.067  40.592  1.00 40.61 ? 378  ARG A CG    1 
ATOM   1844  C  CD    . ARG E 2 189 ? 17.920  80.341  40.582  1.00 40.77 ? 378  ARG A CD    1 
ATOM   1845  N  NE    . ARG E 2 189 ? 17.379  80.480  41.930  1.00 39.73 ? 378  ARG A NE    1 
ATOM   1846  C  CZ    . ARG E 2 189 ? 17.495  81.576  42.669  1.00 39.49 ? 378  ARG A CZ    1 
ATOM   1847  N  NH1   . ARG E 2 189 ? 18.127  82.641  42.197  1.00 39.84 ? 378  ARG A NH1   1 
ATOM   1848  N  NH2   . ARG E 2 189 ? 16.988  81.602  43.888  1.00 40.53 ? 378  ARG A NH2   1 
ATOM   1849  N  N     . LEU E 2 190 ? 19.960  76.679  38.319  1.00 44.10 ? 379  LEU A N     1 
ATOM   1850  C  CA    . LEU E 2 190 ? 20.203  76.724  36.878  1.00 45.37 ? 379  LEU A CA    1 
ATOM   1851  C  C     . LEU E 2 190 ? 19.088  75.953  36.195  1.00 46.39 ? 379  LEU A C     1 
ATOM   1852  O  O     . LEU E 2 190 ? 18.577  76.375  35.164  1.00 46.25 ? 379  LEU A O     1 
ATOM   1853  C  CB    . LEU E 2 190 ? 21.563  76.112  36.505  1.00 44.14 ? 379  LEU A CB    1 
ATOM   1854  C  CG    . LEU E 2 190 ? 21.823  75.930  34.998  1.00 43.40 ? 379  LEU A CG    1 
ATOM   1855  C  CD1   . LEU E 2 190 ? 21.821  77.270  34.308  1.00 42.98 ? 379  LEU A CD1   1 
ATOM   1856  C  CD2   . LEU E 2 190 ? 23.152  75.236  34.778  1.00 43.13 ? 379  LEU A CD2   1 
ATOM   1857  N  N     . LEU E 2 191 ? 18.714  74.820  36.776  1.00 47.70 ? 380  LEU A N     1 
ATOM   1858  C  CA    . LEU E 2 191 ? 17.646  74.018  36.214  1.00 49.53 ? 380  LEU A CA    1 
ATOM   1859  C  C     . LEU E 2 191 ? 16.334  74.787  36.332  1.00 50.96 ? 380  LEU A C     1 
ATOM   1860  O  O     . LEU E 2 191 ? 15.362  74.489  35.641  1.00 51.02 ? 380  LEU A O     1 
ATOM   1861  C  CB    . LEU E 2 191 ? 17.534  72.673  36.942  1.00 49.66 ? 380  LEU A CB    1 
ATOM   1862  C  CG    . LEU E 2 191 ? 18.223  71.437  36.344  1.00 50.49 ? 380  LEU A CG    1 
ATOM   1863  C  CD1   . LEU E 2 191 ? 18.759  71.742  34.954  1.00 50.25 ? 380  LEU A CD1   1 
ATOM   1864  C  CD2   . LEU E 2 191 ? 19.339  70.969  37.257  1.00 49.81 ? 380  LEU A CD2   1 
ATOM   1865  N  N     . ASP E 2 192 ? 16.314  75.784  37.211  1.00 52.71 ? 381  ASP A N     1 
ATOM   1866  C  CA    . ASP E 2 192 ? 15.120  76.595  37.399  1.00 54.19 ? 381  ASP A CA    1 
ATOM   1867  C  C     . ASP E 2 192 ? 15.044  77.615  36.266  1.00 54.66 ? 381  ASP A C     1 
ATOM   1868  O  O     . ASP E 2 192 ? 14.006  77.767  35.628  1.00 54.75 ? 381  ASP A O     1 
ATOM   1869  C  CB    . ASP E 2 192 ? 15.163  77.299  38.757  1.00 55.00 ? 381  ASP A CB    1 
ATOM   1870  C  CG    . ASP E 2 192 ? 13.796  77.811  39.196  1.00 56.54 ? 381  ASP A CG    1 
ATOM   1871  O  OD1   . ASP E 2 192 ? 12.773  77.322  38.664  1.00 57.21 ? 381  ASP A OD1   1 
ATOM   1872  O  OD2   . ASP E 2 192 ? 13.742  78.690  40.085  1.00 56.94 ? 381  ASP A OD2   1 
ATOM   1873  N  N     . PHE E 2 193 ? 16.151  78.310  36.026  1.00 55.21 ? 382  PHE A N     1 
ATOM   1874  C  CA    . PHE E 2 193 ? 16.233  79.295  34.952  1.00 55.66 ? 382  PHE A CA    1 
ATOM   1875  C  C     . PHE E 2 193 ? 15.987  78.584  33.626  1.00 56.08 ? 382  PHE A C     1 
ATOM   1876  O  O     . PHE E 2 193 ? 15.453  79.168  32.687  1.00 55.75 ? 382  PHE A O     1 
ATOM   1877  C  CB    . PHE E 2 193 ? 17.623  79.923  34.918  1.00 55.45 ? 382  PHE A CB    1 
ATOM   1878  C  CG    . PHE E 2 193 ? 17.730  81.224  35.649  1.00 55.64 ? 382  PHE A CG    1 
ATOM   1879  C  CD1   . PHE E 2 193 ? 17.581  82.424  34.972  1.00 55.66 ? 382  PHE A CD1   1 
ATOM   1880  C  CD2   . PHE E 2 193 ? 18.030  81.254  37.004  1.00 56.13 ? 382  PHE A CD2   1 
ATOM   1881  C  CE1   . PHE E 2 193 ? 17.735  83.639  35.629  1.00 56.22 ? 382  PHE A CE1   1 
ATOM   1882  C  CE2   . PHE E 2 193 ? 18.186  82.463  37.676  1.00 56.59 ? 382  PHE A CE2   1 
ATOM   1883  C  CZ    . PHE E 2 193 ? 18.039  83.662  36.985  1.00 56.70 ? 382  PHE A CZ    1 
ATOM   1884  N  N     . VAL E 2 194 ? 16.380  77.316  33.567  1.00 56.93 ? 383  VAL A N     1 
ATOM   1885  C  CA    . VAL E 2 194 ? 16.225  76.505  32.362  1.00 58.40 ? 383  VAL A CA    1 
ATOM   1886  C  C     . VAL E 2 194 ? 14.808  75.968  32.152  1.00 59.09 ? 383  VAL A C     1 
ATOM   1887  O  O     . VAL E 2 194 ? 14.270  76.070  31.057  1.00 59.24 ? 383  VAL A O     1 
ATOM   1888  C  CB    . VAL E 2 194 ? 17.221  75.312  32.358  1.00 57.77 ? 383  VAL A CB    1 
ATOM   1889  C  CG1   . VAL E 2 194 ? 16.885  74.339  31.232  1.00 57.59 ? 383  VAL A CG1   1 
ATOM   1890  C  CG2   . VAL E 2 194 ? 18.638  75.828  32.187  1.00 57.73 ? 383  VAL A CG2   1 
ATOM   1891  N  N     . ASP E 2 195 ? 14.208  75.388  33.186  1.00 60.10 ? 384  ASP A N     1 
ATOM   1892  C  CA    . ASP E 2 195 ? 12.855  74.860  33.043  1.00 61.26 ? 384  ASP A CA    1 
ATOM   1893  C  C     . ASP E 2 195 ? 11.889  76.011  32.747  1.00 62.02 ? 384  ASP A C     1 
ATOM   1894  O  O     . ASP E 2 195 ? 10.796  75.795  32.228  1.00 62.16 ? 384  ASP A O     1 
ATOM   1895  C  CB    . ASP E 2 195 ? 12.416  74.116  34.315  1.00 61.55 ? 384  ASP A CB    1 
ATOM   1896  C  CG    . ASP E 2 195 ? 13.205  72.831  34.554  1.00 61.93 ? 384  ASP A CG    1 
ATOM   1897  O  OD1   . ASP E 2 195 ? 14.070  72.487  33.722  1.00 61.93 ? 384  ASP A OD1   1 
ATOM   1898  O  OD2   . ASP E 2 195 ? 12.959  72.159  35.580  1.00 62.10 ? 384  ASP A OD2   1 
ATOM   1899  N  N     . ARG E 2 196 ? 12.302  77.232  33.076  1.00 62.31 ? 385  ARG A N     1 
ATOM   1900  C  CA    . ARG E 2 196 ? 11.479  78.412  32.829  1.00 62.91 ? 385  ARG A CA    1 
ATOM   1901  C  C     . ARG E 2 196 ? 11.891  79.076  31.522  1.00 63.18 ? 385  ARG A C     1 
ATOM   1902  O  O     . ARG E 2 196 ? 11.493  80.200  31.228  1.00 63.53 ? 385  ARG A O     1 
ATOM   1903  C  CB    . ARG E 2 196 ? 11.606  79.404  33.986  1.00 63.11 ? 385  ARG A CB    1 
ATOM   1904  C  CG    . ARG E 2 196 ? 10.947  78.922  35.266  1.00 63.87 ? 385  ARG A CG    1 
ATOM   1905  C  CD    . ARG E 2 196 ? 11.200  79.864  36.428  1.00 63.97 ? 385  ARG A CD    1 
ATOM   1906  N  NE    . ARG E 2 196 ? 10.474  79.431  37.619  1.00 65.23 ? 385  ARG A NE    1 
ATOM   1907  C  CZ    . ARG E 2 196 ? 10.584  80.005  38.813  1.00 66.32 ? 385  ARG A CZ    1 
ATOM   1908  N  NH1   . ARG E 2 196 ? 11.399  81.041  38.984  1.00 66.85 ? 385  ARG A NH1   1 
ATOM   1909  N  NH2   . ARG E 2 196 ? 9.877   79.546  39.837  1.00 66.32 ? 385  ARG A NH2   1 
ATOM   1910  N  N     . THR E 2 197 ? 12.703  78.359  30.755  1.00 63.70 ? 386  THR A N     1 
ATOM   1911  C  CA    . THR E 2 197 ? 13.202  78.789  29.448  1.00 63.93 ? 386  THR A CA    1 
ATOM   1912  C  C     . THR E 2 197 ? 13.868  80.157  29.320  1.00 64.11 ? 386  THR A C     1 
ATOM   1913  O  O     . THR E 2 197 ? 13.892  80.726  28.226  1.00 64.51 ? 386  THR A O     1 
ATOM   1914  C  CB    . THR E 2 197 ? 12.092  78.714  28.391  1.00 63.77 ? 386  THR A CB    1 
ATOM   1915  O  OG1   . THR E 2 197 ? 11.018  79.583  28.765  1.00 63.44 ? 386  THR A OG1   1 
ATOM   1916  C  CG2   . THR E 2 197 ? 11.578  77.291  28.270  1.00 64.02 ? 386  THR A CG2   1 
ATOM   1917  N  N     . PHE E 2 198 ? 14.411  80.681  30.415  1.00 63.91 ? 387  PHE A N     1 
ATOM   1918  C  CA    . PHE E 2 198 ? 15.097  81.973  30.377  1.00 63.61 ? 387  PHE A CA    1 
ATOM   1919  C  C     . PHE E 2 198 ? 16.555  81.721  29.995  1.00 62.82 ? 387  PHE A C     1 
ATOM   1920  O  O     . PHE E 2 198 ? 17.281  82.636  29.604  1.00 62.83 ? 387  PHE A O     1 
ATOM   1921  C  CB    . PHE E 2 198 ? 15.041  82.652  31.748  1.00 64.99 ? 387  PHE A CB    1 
ATOM   1922  C  CG    . PHE E 2 198 ? 13.650  82.816  32.289  1.00 66.50 ? 387  PHE A CG    1 
ATOM   1923  C  CD1   . PHE E 2 198 ? 13.420  82.771  33.662  1.00 66.91 ? 387  PHE A CD1   1 
ATOM   1924  C  CD2   . PHE E 2 198 ? 12.567  83.002  31.433  1.00 66.84 ? 387  PHE A CD2   1 
ATOM   1925  C  CE1   . PHE E 2 198 ? 12.134  82.905  34.178  1.00 67.14 ? 387  PHE A CE1   1 
ATOM   1926  C  CE2   . PHE E 2 198 ? 11.278  83.137  31.939  1.00 67.45 ? 387  PHE A CE2   1 
ATOM   1927  C  CZ    . PHE E 2 198 ? 11.062  83.088  33.316  1.00 67.39 ? 387  PHE A CZ    1 
ATOM   1928  N  N     . ILE E 2 199 ? 16.973  80.464  30.131  1.00 61.62 ? 388  ILE A N     1 
ATOM   1929  C  CA    . ILE E 2 199 ? 18.327  80.041  29.803  1.00 60.13 ? 388  ILE A CA    1 
ATOM   1930  C  C     . ILE E 2 199 ? 18.284  78.790  28.931  1.00 59.87 ? 388  ILE A C     1 
ATOM   1931  O  O     . ILE E 2 199 ? 17.562  77.835  29.216  1.00 59.64 ? 388  ILE A O     1 
ATOM   1932  C  CB    . ILE E 2 199 ? 19.143  79.758  31.075  1.00 59.39 ? 388  ILE A CB    1 
ATOM   1933  C  CG1   . ILE E 2 199 ? 19.764  81.063  31.580  1.00 59.52 ? 388  ILE A CG1   1 
ATOM   1934  C  CG2   . ILE E 2 199 ? 20.207  78.715  30.798  1.00 59.22 ? 388  ILE A CG2   1 
ATOM   1935  C  CD1   . ILE E 2 199 ? 20.554  80.920  32.880  1.00 59.56 ? 388  ILE A CD1   1 
ATOM   1936  N  N     . THR E 2 200 ? 19.065  78.807  27.859  1.00 59.55 ? 389  THR A N     1 
ATOM   1937  C  CA    . THR E 2 200 ? 19.108  77.686  26.937  1.00 59.36 ? 389  THR A CA    1 
ATOM   1938  C  C     . THR E 2 200 ? 20.560  77.507  26.452  1.00 58.48 ? 389  THR A C     1 
ATOM   1939  O  O     . THR E 2 200 ? 21.329  78.473  26.401  1.00 58.69 ? 389  THR A O     1 
ATOM   1940  C  CB    . THR E 2 200 ? 18.104  77.946  25.780  1.00 60.16 ? 389  THR A CB    1 
ATOM   1941  O  OG1   . THR E 2 200 ? 17.362  76.749  25.507  1.00 60.06 ? 389  THR A OG1   1 
ATOM   1942  C  CG2   . THR E 2 200 ? 18.823  78.427  24.540  1.00 59.97 ? 389  THR A CG2   1 
ATOM   1943  N  N     . PHE E 2 201 ? 20.936  76.281  26.094  1.00 57.41 ? 390  PHE A N     1 
ATOM   1944  C  CA    . PHE E 2 201 ? 22.320  76.004  25.702  1.00 56.79 ? 390  PHE A CA    1 
ATOM   1945  C  C     . PHE E 2 201 ? 22.695  75.831  24.226  1.00 56.57 ? 390  PHE A C     1 
ATOM   1946  O  O     . PHE E 2 201 ? 23.662  75.125  23.921  1.00 55.91 ? 390  PHE A O     1 
ATOM   1947  C  CB    . PHE E 2 201 ? 22.814  74.776  26.479  1.00 55.88 ? 390  PHE A CB    1 
ATOM   1948  C  CG    . PHE E 2 201 ? 22.377  74.758  27.915  1.00 55.43 ? 390  PHE A CG    1 
ATOM   1949  C  CD1   . PHE E 2 201 ? 21.336  73.937  28.328  1.00 55.45 ? 390  PHE A CD1   1 
ATOM   1950  C  CD2   . PHE E 2 201 ? 22.978  75.593  28.849  1.00 55.14 ? 390  PHE A CD2   1 
ATOM   1951  C  CE1   . PHE E 2 201 ? 20.899  73.946  29.648  1.00 54.73 ? 390  PHE A CE1   1 
ATOM   1952  C  CE2   . PHE E 2 201 ? 22.548  75.610  30.170  1.00 55.00 ? 390  PHE A CE2   1 
ATOM   1953  C  CZ    . PHE E 2 201 ? 21.506  74.785  30.569  1.00 54.81 ? 390  PHE A CZ    1 
ATOM   1954  N  N     . GLU E 2 202 ? 21.972  76.471  23.310  1.00 55.90 ? 391  GLU A N     1 
ATOM   1955  C  CA    . GLU E 2 202 ? 22.307  76.322  21.898  1.00 55.09 ? 391  GLU A CA    1 
ATOM   1956  C  C     . GLU E 2 202 ? 23.640  76.961  21.567  1.00 53.96 ? 391  GLU A C     1 
ATOM   1957  O  O     . GLU E 2 202 ? 24.309  76.550  20.629  1.00 53.83 ? 391  GLU A O     1 
ATOM   1958  C  CB    . GLU E 2 202 ? 21.231  76.934  20.999  1.00 56.36 ? 391  GLU A CB    1 
ATOM   1959  C  CG    . GLU E 2 202 ? 19.991  76.075  20.810  1.00 57.61 ? 391  GLU A CG    1 
ATOM   1960  C  CD    . GLU E 2 202 ? 18.861  76.474  21.735  1.00 58.91 ? 391  GLU A CD    1 
ATOM   1961  O  OE1   . GLU E 2 202 ? 18.798  77.671  22.087  1.00 58.64 ? 391  GLU A OE1   1 
ATOM   1962  O  OE2   . GLU E 2 202 ? 18.028  75.606  22.093  1.00 59.36 ? 391  GLU A OE2   1 
ATOM   1963  N  N     . ASP E 2 203 ? 24.029  77.968  22.339  1.00 53.34 ? 392  ASP A N     1 
ATOM   1964  C  CA    . ASP E 2 203 ? 25.293  78.661  22.097  1.00 52.36 ? 392  ASP A CA    1 
ATOM   1965  C  C     . ASP E 2 203 ? 26.384  78.275  23.103  1.00 51.36 ? 392  ASP A C     1 
ATOM   1966  O  O     . ASP E 2 203 ? 27.450  78.902  23.149  1.00 51.08 ? 392  ASP A O     1 
ATOM   1967  C  CB    . ASP E 2 203 ? 25.080  80.183  22.136  1.00 52.95 ? 392  ASP A CB    1 
ATOM   1968  C  CG    . ASP E 2 203 ? 24.034  80.663  21.128  1.00 54.10 ? 392  ASP A CG    1 
ATOM   1969  O  OD1   . ASP E 2 203 ? 23.490  79.825  20.369  1.00 53.95 ? 392  ASP A OD1   1 
ATOM   1970  O  OD2   . ASP E 2 203 ? 23.756  81.886  21.099  1.00 54.47 ? 392  ASP A OD2   1 
ATOM   1971  N  N     . THR E 2 204 ? 26.122  77.251  23.910  1.00 49.39 ? 393  THR A N     1 
ATOM   1972  C  CA    . THR E 2 204 ? 27.106  76.823  24.893  1.00 47.80 ? 393  THR A CA    1 
ATOM   1973  C  C     . THR E 2 204 ? 28.159  75.955  24.216  1.00 46.93 ? 393  THR A C     1 
ATOM   1974  O  O     . THR E 2 204 ? 27.881  74.833  23.787  1.00 45.93 ? 393  THR A O     1 
ATOM   1975  C  CB    . THR E 2 204 ? 26.448  76.027  26.055  1.00 48.17 ? 393  THR A CB    1 
ATOM   1976  O  OG1   . THR E 2 204 ? 25.430  76.826  26.675  1.00 46.79 ? 393  THR A OG1   1 
ATOM   1977  C  CG2   . THR E 2 204 ? 27.497  75.655  27.106  1.00 47.50 ? 393  THR A CG2   1 
ATOM   1978  N  N     . ARG E 2 205 ? 29.369  76.492  24.121  1.00 46.43 ? 394  ARG A N     1 
ATOM   1979  C  CA    . ARG E 2 205 ? 30.480  75.786  23.503  1.00 46.22 ? 394  ARG A CA    1 
ATOM   1980  C  C     . ARG E 2 205 ? 31.472  75.258  24.537  1.00 45.15 ? 394  ARG A C     1 
ATOM   1981  O  O     . ARG E 2 205 ? 32.382  74.497  24.207  1.00 44.80 ? 394  ARG A O     1 
ATOM   1982  C  CB    . ARG E 2 205 ? 31.175  76.703  22.490  1.00 48.06 ? 394  ARG A CB    1 
ATOM   1983  C  CG    . ARG E 2 205 ? 30.482  76.696  21.116  1.00 50.87 ? 394  ARG A CG    1 
ATOM   1984  C  CD    . ARG E 2 205 ? 30.955  77.817  20.194  1.00 52.71 ? 394  ARG A CD    1 
ATOM   1985  N  NE    . ARG E 2 205 ? 30.236  79.057  20.464  1.00 54.16 ? 394  ARG A NE    1 
ATOM   1986  C  CZ    . ARG E 2 205 ? 30.791  80.168  20.942  1.00 55.10 ? 394  ARG A CZ    1 
ATOM   1987  N  NH1   . ARG E 2 205 ? 32.097  80.214  21.207  1.00 55.08 ? 394  ARG A NH1   1 
ATOM   1988  N  NH2   . ARG E 2 205 ? 30.029  81.234  21.171  1.00 54.55 ? 394  ARG A NH2   1 
ATOM   1989  N  N     . PHE E 2 206 ? 31.292  75.665  25.789  1.00 43.81 ? 395  PHE A N     1 
ATOM   1990  C  CA    . PHE E 2 206 ? 32.142  75.197  26.879  1.00 42.67 ? 395  PHE A CA    1 
ATOM   1991  C  C     . PHE E 2 206 ? 31.299  74.860  28.105  1.00 41.45 ? 395  PHE A C     1 
ATOM   1992  O  O     . PHE E 2 206 ? 30.577  75.717  28.633  1.00 41.17 ? 395  PHE A O     1 
ATOM   1993  C  CB    . PHE E 2 206 ? 33.162  76.252  27.297  1.00 43.97 ? 395  PHE A CB    1 
ATOM   1994  C  CG    . PHE E 2 206 ? 34.102  76.655  26.217  1.00 45.01 ? 395  PHE A CG    1 
ATOM   1995  C  CD1   . PHE E 2 206 ? 33.750  77.646  25.312  1.00 44.35 ? 395  PHE A CD1   1 
ATOM   1996  C  CD2   . PHE E 2 206 ? 35.353  76.056  26.111  1.00 44.95 ? 395  PHE A CD2   1 
ATOM   1997  C  CE1   . PHE E 2 206 ? 34.628  78.041  24.321  1.00 44.70 ? 395  PHE A CE1   1 
ATOM   1998  C  CE2   . PHE E 2 206 ? 36.242  76.446  25.116  1.00 45.60 ? 395  PHE A CE2   1 
ATOM   1999  C  CZ    . PHE E 2 206 ? 35.878  77.441  24.221  1.00 45.41 ? 395  PHE A CZ    1 
ATOM   2000  N  N     . VAL E 2 207 ? 31.380  73.608  28.539  1.00 39.40 ? 396  VAL A N     1 
ATOM   2001  C  CA    . VAL E 2 207 ? 30.680  73.158  29.734  1.00 36.39 ? 396  VAL A CA    1 
ATOM   2002  C  C     . VAL E 2 207 ? 31.777  72.710  30.686  1.00 35.00 ? 396  VAL A C     1 
ATOM   2003  O  O     . VAL E 2 207 ? 32.527  71.782  30.384  1.00 35.04 ? 396  VAL A O     1 
ATOM   2004  C  CB    . VAL E 2 207 ? 29.754  71.976  29.457  1.00 36.18 ? 396  VAL A CB    1 
ATOM   2005  C  CG1   . VAL E 2 207 ? 29.174  71.473  30.762  1.00 36.78 ? 396  VAL A CG1   1 
ATOM   2006  C  CG2   . VAL E 2 207 ? 28.634  72.401  28.533  1.00 35.03 ? 396  VAL A CG2   1 
ATOM   2007  N  N     . VAL E 2 208 ? 31.888  73.394  31.819  1.00 32.96 ? 397  VAL A N     1 
ATOM   2008  C  CA    . VAL E 2 208 ? 32.905  73.065  32.809  1.00 31.48 ? 397  VAL A CA    1 
ATOM   2009  C  C     . VAL E 2 208 ? 32.278  72.592  34.114  1.00 30.97 ? 397  VAL A C     1 
ATOM   2010  O  O     . VAL E 2 208 ? 31.375  73.234  34.631  1.00 31.51 ? 397  VAL A O     1 
ATOM   2011  C  CB    . VAL E 2 208 ? 33.804  74.296  33.137  1.00 30.87 ? 397  VAL A CB    1 
ATOM   2012  C  CG1   . VAL E 2 208 ? 34.903  73.907  34.122  1.00 30.29 ? 397  VAL A CG1   1 
ATOM   2013  C  CG2   . VAL E 2 208 ? 34.414  74.852  31.876  1.00 30.80 ? 397  VAL A CG2   1 
ATOM   2014  N  N     . LEU E 2 209 ? 32.740  71.461  34.634  1.00 29.80 ? 398  LEU A N     1 
ATOM   2015  C  CA    . LEU E 2 209 ? 32.248  70.971  35.910  1.00 29.30 ? 398  LEU A CA    1 
ATOM   2016  C  C     . LEU E 2 209 ? 33.414  71.080  36.878  1.00 28.75 ? 398  LEU A C     1 
ATOM   2017  O  O     . LEU E 2 209 ? 34.347  70.277  36.808  1.00 29.23 ? 398  LEU A O     1 
ATOM   2018  C  CB    . LEU E 2 209 ? 31.807  69.507  35.820  1.00 30.86 ? 398  LEU A CB    1 
ATOM   2019  C  CG    . LEU E 2 209 ? 30.700  69.118  34.828  1.00 32.91 ? 398  LEU A CG    1 
ATOM   2020  C  CD1   . LEU E 2 209 ? 30.270  67.676  35.069  1.00 32.59 ? 398  LEU A CD1   1 
ATOM   2021  C  CD2   . LEU E 2 209 ? 29.522  70.037  35.018  1.00 33.71 ? 398  LEU A CD2   1 
ATOM   2022  N  N     . ASP E 2 210 ? 33.398  72.085  37.753  1.00 28.30 ? 399  ASP A N     1 
ATOM   2023  C  CA    . ASP E 2 210 ? 34.480  72.212  38.735  1.00 28.08 ? 399  ASP A CA    1 
ATOM   2024  C  C     . ASP E 2 210 ? 34.101  71.231  39.846  1.00 26.54 ? 399  ASP A C     1 
ATOM   2025  O  O     . ASP E 2 210 ? 32.930  70.981  40.051  1.00 26.38 ? 399  ASP A O     1 
ATOM   2026  C  CB    . ASP E 2 210 ? 34.580  73.643  39.295  1.00 28.88 ? 399  ASP A CB    1 
ATOM   2027  C  CG    . ASP E 2 210 ? 35.885  73.877  40.059  1.00 30.48 ? 399  ASP A CG    1 
ATOM   2028  O  OD1   . ASP E 2 210 ? 36.745  72.970  40.052  1.00 32.10 ? 399  ASP A OD1   1 
ATOM   2029  O  OD2   . ASP E 2 210 ? 36.072  74.961  40.658  1.00 31.96 ? 399  ASP A OD2   1 
ATOM   2030  N  N     . GLU E 2 211 ? 35.069  70.680  40.569  1.00 25.55 ? 400  GLU A N     1 
ATOM   2031  C  CA    . GLU E 2 211 ? 34.727  69.708  41.598  1.00 24.27 ? 400  GLU A CA    1 
ATOM   2032  C  C     . GLU E 2 211 ? 33.863  68.658  40.881  1.00 23.77 ? 400  GLU A C     1 
ATOM   2033  O  O     . GLU E 2 211 ? 32.868  68.166  41.409  1.00 22.90 ? 400  GLU A O     1 
ATOM   2034  C  CB    . GLU E 2 211 ? 33.920  70.378  42.722  1.00 25.71 ? 400  GLU A CB    1 
ATOM   2035  C  CG    . GLU E 2 211 ? 34.639  71.515  43.455  1.00 25.62 ? 400  GLU A CG    1 
ATOM   2036  C  CD    . GLU E 2 211 ? 35.988  71.100  44.040  1.00 28.02 ? 400  GLU A CD    1 
ATOM   2037  O  OE1   . GLU E 2 211 ? 36.187  69.883  44.317  1.00 29.29 ? 400  GLU A OE1   1 
ATOM   2038  O  OE2   . GLU E 2 211 ? 36.844  71.990  44.235  1.00 24.21 ? 400  GLU A OE2   1 
ATOM   2039  N  N     . ALA E 2 212 ? 34.246  68.326  39.656  1.00 23.63 ? 401  ALA A N     1 
ATOM   2040  C  CA    . ALA E 2 212 ? 33.488  67.379  38.859  1.00 24.09 ? 401  ALA A CA    1 
ATOM   2041  C  C     . ALA E 2 212 ? 33.095  66.054  39.537  1.00 24.38 ? 401  ALA A C     1 
ATOM   2042  O  O     . ALA E 2 212 ? 31.960  65.611  39.393  1.00 24.81 ? 401  ALA A O     1 
ATOM   2043  C  CB    . ALA E 2 212 ? 34.229  67.106  37.556  1.00 22.55 ? 401  ALA A CB    1 
ATOM   2044  N  N     . ASP E 2 213 ? 34.005  65.424  40.273  1.00 25.17 ? 402  ASP A N     1 
ATOM   2045  C  CA    . ASP E 2 213 ? 33.679  64.149  40.923  1.00 27.35 ? 402  ASP A CA    1 
ATOM   2046  C  C     . ASP E 2 213 ? 32.444  64.266  41.829  1.00 28.11 ? 402  ASP A C     1 
ATOM   2047  O  O     . ASP E 2 213 ? 31.646  63.336  41.954  1.00 28.64 ? 402  ASP A O     1 
ATOM   2048  C  CB    . ASP E 2 213 ? 34.876  63.620  41.731  1.00 27.75 ? 402  ASP A CB    1 
ATOM   2049  C  CG    . ASP E 2 213 ? 35.322  64.584  42.829  1.00 29.34 ? 402  ASP A CG    1 
ATOM   2050  O  OD1   . ASP E 2 213 ? 35.553  64.125  43.962  1.00 29.98 ? 402  ASP A OD1   1 
ATOM   2051  O  OD2   . ASP E 2 213 ? 35.456  65.794  42.555  1.00 28.87 ? 402  ASP A OD2   1 
ATOM   2052  N  N     . ARG E 2 214 ? 32.288  65.417  42.459  1.00 27.61 ? 403  ARG A N     1 
ATOM   2053  C  CA    . ARG E 2 214 ? 31.148  65.645  43.318  1.00 26.99 ? 403  ARG A CA    1 
ATOM   2054  C  C     . ARG E 2 214 ? 29.887  65.901  42.479  1.00 27.36 ? 403  ARG A C     1 
ATOM   2055  O  O     . ARG E 2 214 ? 28.793  65.470  42.838  1.00 26.94 ? 403  ARG A O     1 
ATOM   2056  C  CB    . ARG E 2 214 ? 31.431  66.838  44.231  1.00 26.26 ? 403  ARG A CB    1 
ATOM   2057  C  CG    . ARG E 2 214 ? 30.354  67.119  45.254  1.00 27.05 ? 403  ARG A CG    1 
ATOM   2058  C  CD    . ARG E 2 214 ? 30.164  65.919  46.181  1.00 27.76 ? 403  ARG A CD    1 
ATOM   2059  N  NE    . ARG E 2 214 ? 29.306  66.239  47.315  1.00 29.99 ? 403  ARG A NE    1 
ATOM   2060  C  CZ    . ARG E 2 214 ? 28.900  65.361  48.229  1.00 31.52 ? 403  ARG A CZ    1 
ATOM   2061  N  NH1   . ARG E 2 214 ? 29.276  64.091  48.159  1.00 31.70 ? 403  ARG A NH1   1 
ATOM   2062  N  NH2   . ARG E 2 214 ? 28.092  65.749  49.205  1.00 32.78 ? 403  ARG A NH2   1 
ATOM   2063  N  N     . MET E 2 215 ? 30.036  66.606  41.365  1.00 27.45 ? 404  MET A N     1 
ATOM   2064  C  CA    . MET E 2 215 ? 28.889  66.909  40.517  1.00 28.85 ? 404  MET A CA    1 
ATOM   2065  C  C     . MET E 2 215 ? 28.311  65.632  39.903  1.00 30.58 ? 404  MET A C     1 
ATOM   2066  O  O     . MET E 2 215 ? 27.124  65.557  39.610  1.00 31.14 ? 404  MET A O     1 
ATOM   2067  C  CB    . MET E 2 215 ? 29.293  67.882  39.398  1.00 29.63 ? 404  MET A CB    1 
ATOM   2068  C  CG    . MET E 2 215 ? 29.867  69.224  39.886  1.00 30.63 ? 404  MET A CG    1 
ATOM   2069  S  SD    . MET E 2 215 ? 28.876  70.002  41.223  1.00 32.73 ? 404  MET A SD    1 
ATOM   2070  C  CE    . MET E 2 215 ? 27.245  70.068  40.416  1.00 28.57 ? 404  MET A CE    1 
ATOM   2071  N  N     . LEU E 2 216 ? 29.155  64.625  39.719  1.00 31.75 ? 405  LEU A N     1 
ATOM   2072  C  CA    . LEU E 2 216 ? 28.721  63.376  39.133  1.00 33.53 ? 405  LEU A CA    1 
ATOM   2073  C  C     . LEU E 2 216 ? 28.385  62.265  40.142  1.00 35.27 ? 405  LEU A C     1 
ATOM   2074  O  O     . LEU E 2 216 ? 28.011  61.167  39.735  1.00 35.18 ? 405  LEU A O     1 
ATOM   2075  C  CB    . LEU E 2 216 ? 29.792  62.881  38.159  1.00 33.73 ? 405  LEU A CB    1 
ATOM   2076  C  CG    . LEU E 2 216 ? 30.173  63.837  37.027  1.00 33.37 ? 405  LEU A CG    1 
ATOM   2077  C  CD1   . LEU E 2 216 ? 31.442  63.361  36.366  1.00 32.86 ? 405  LEU A CD1   1 
ATOM   2078  C  CD2   . LEU E 2 216 ? 29.031  63.924  36.026  1.00 33.87 ? 405  LEU A CD2   1 
ATOM   2079  N  N     . ASP E 2 217 ? 28.515  62.533  41.441  1.00 37.01 ? 406  ASP A N     1 
ATOM   2080  C  CA    . ASP E 2 217 ? 28.211  61.510  42.447  1.00 39.04 ? 406  ASP A CA    1 
ATOM   2081  C  C     . ASP E 2 217 ? 26.708  61.446  42.636  1.00 39.78 ? 406  ASP A C     1 
ATOM   2082  O  O     . ASP E 2 217 ? 25.980  62.303  42.139  1.00 39.33 ? 406  ASP A O     1 
ATOM   2083  C  CB    . ASP E 2 217 ? 28.877  61.829  43.792  1.00 41.01 ? 406  ASP A CB    1 
ATOM   2084  C  CG    . ASP E 2 217 ? 29.073  60.581  44.671  1.00 42.72 ? 406  ASP A CG    1 
ATOM   2085  O  OD1   . ASP E 2 217 ? 28.454  59.523  44.394  1.00 43.73 ? 406  ASP A OD1   1 
ATOM   2086  O  OD2   . ASP E 2 217 ? 29.846  60.667  45.654  1.00 43.26 ? 406  ASP A OD2   1 
ATOM   2087  N  N     . MET E 2 218 ? 26.251  60.436  43.367  1.00 40.92 ? 407  MET A N     1 
ATOM   2088  C  CA    . MET E 2 218 ? 24.825  60.222  43.604  1.00 42.21 ? 407  MET A CA    1 
ATOM   2089  C  C     . MET E 2 218 ? 24.018  61.481  43.900  1.00 41.18 ? 407  MET A C     1 
ATOM   2090  O  O     . MET E 2 218 ? 22.915  61.657  43.385  1.00 40.43 ? 407  MET A O     1 
ATOM   2091  C  CB    . MET E 2 218 ? 24.637  59.216  44.741  1.00 45.22 ? 407  MET A CB    1 
ATOM   2092  C  CG    . MET E 2 218 ? 25.213  57.841  44.438  1.00 50.36 ? 407  MET A CG    1 
ATOM   2093  S  SD    . MET E 2 218 ? 25.433  56.843  45.943  1.00 56.28 ? 407  MET A SD    1 
ATOM   2094  C  CE    . MET E 2 218 ? 26.698  57.894  46.887  1.00 55.98 ? 407  MET A CE    1 
ATOM   2095  N  N     . GLY E 2 219 ? 24.569  62.357  44.729  1.00 40.36 ? 408  GLY A N     1 
ATOM   2096  C  CA    . GLY E 2 219 ? 23.857  63.569  45.081  1.00 39.52 ? 408  GLY A CA    1 
ATOM   2097  C  C     . GLY E 2 219 ? 23.413  64.409  43.900  1.00 39.22 ? 408  GLY A C     1 
ATOM   2098  O  O     . GLY E 2 219 ? 22.236  64.736  43.772  1.00 40.20 ? 408  GLY A O     1 
ATOM   2099  N  N     . PHE E 2 220 ? 24.348  64.734  43.021  1.00 37.40 ? 409  PHE A N     1 
ATOM   2100  C  CA    . PHE E 2 220 ? 24.058  65.579  41.872  1.00 36.70 ? 409  PHE A CA    1 
ATOM   2101  C  C     . PHE E 2 220 ? 23.838  64.925  40.494  1.00 36.80 ? 409  PHE A C     1 
ATOM   2102  O  O     . PHE E 2 220 ? 23.381  65.602  39.582  1.00 37.45 ? 409  PHE A O     1 
ATOM   2103  C  CB    . PHE E 2 220 ? 25.184  66.613  41.705  1.00 33.73 ? 409  PHE A CB    1 
ATOM   2104  C  CG    . PHE E 2 220 ? 25.139  67.753  42.676  1.00 30.18 ? 409  PHE A CG    1 
ATOM   2105  C  CD1   . PHE E 2 220 ? 26.135  67.907  43.627  1.00 30.34 ? 409  PHE A CD1   1 
ATOM   2106  C  CD2   . PHE E 2 220 ? 24.148  68.714  42.592  1.00 30.33 ? 409  PHE A CD2   1 
ATOM   2107  C  CE1   . PHE E 2 220 ? 26.151  69.004  44.479  1.00 29.85 ? 409  PHE A CE1   1 
ATOM   2108  C  CE2   . PHE E 2 220 ? 24.147  69.815  43.436  1.00 29.71 ? 409  PHE A CE2   1 
ATOM   2109  C  CZ    . PHE E 2 220 ? 25.157  69.961  44.386  1.00 30.29 ? 409  PHE A CZ    1 
ATOM   2110  N  N     . SER E 2 221 ? 24.145  63.645  40.323  1.00 38.04 ? 410  SER A N     1 
ATOM   2111  C  CA    . SER E 2 221 ? 24.027  63.043  38.992  1.00 40.61 ? 410  SER A CA    1 
ATOM   2112  C  C     . SER E 2 221 ? 22.753  63.307  38.191  1.00 42.03 ? 410  SER A C     1 
ATOM   2113  O  O     . SER E 2 221 ? 22.843  63.671  37.022  1.00 42.44 ? 410  SER A O     1 
ATOM   2114  C  CB    . SER E 2 221 ? 24.309  61.537  39.031  1.00 39.53 ? 410  SER A CB    1 
ATOM   2115  O  OG    . SER E 2 221 ? 23.395  60.853  39.854  1.00 43.25 ? 410  SER A OG    1 
ATOM   2116  N  N     . GLU E 2 222 ? 21.578  63.138  38.783  1.00 43.56 ? 411  GLU A N     1 
ATOM   2117  C  CA    . GLU E 2 222 ? 20.355  63.398  38.033  1.00 46.51 ? 411  GLU A CA    1 
ATOM   2118  C  C     . GLU E 2 222 ? 20.307  64.812  37.468  1.00 47.00 ? 411  GLU A C     1 
ATOM   2119  O  O     . GLU E 2 222 ? 20.088  65.006  36.271  1.00 47.40 ? 411  GLU A O     1 
ATOM   2120  C  CB    . GLU E 2 222 ? 19.124  63.173  38.897  1.00 48.42 ? 411  GLU A CB    1 
ATOM   2121  C  CG    . GLU E 2 222 ? 18.486  61.823  38.682  1.00 53.13 ? 411  GLU A CG    1 
ATOM   2122  C  CD    . GLU E 2 222 ? 17.209  61.650  39.486  1.00 56.01 ? 411  GLU A CD    1 
ATOM   2123  O  OE1   . GLU E 2 222 ? 16.264  62.454  39.282  1.00 56.99 ? 411  GLU A OE1   1 
ATOM   2124  O  OE2   . GLU E 2 222 ? 17.159  60.712  40.321  1.00 57.30 ? 411  GLU A OE2   1 
ATOM   2125  N  N     . ASP E 2 223 ? 20.494  65.802  38.331  1.00 47.02 ? 412  ASP A N     1 
ATOM   2126  C  CA    . ASP E 2 223 ? 20.474  67.182  37.890  1.00 47.77 ? 412  ASP A CA    1 
ATOM   2127  C  C     . ASP E 2 223 ? 21.578  67.449  36.891  1.00 47.68 ? 412  ASP A C     1 
ATOM   2128  O  O     . ASP E 2 223 ? 21.394  68.192  35.931  1.00 47.29 ? 412  ASP A O     1 
ATOM   2129  C  CB    . ASP E 2 223 ? 20.628  68.116  39.085  1.00 49.03 ? 412  ASP A CB    1 
ATOM   2130  C  CG    . ASP E 2 223 ? 19.311  68.406  39.761  1.00 50.76 ? 412  ASP A CG    1 
ATOM   2131  O  OD1   . ASP E 2 223 ? 18.482  67.473  39.874  1.00 50.91 ? 412  ASP A OD1   1 
ATOM   2132  O  OD2   . ASP E 2 223 ? 19.108  69.568  40.184  1.00 52.54 ? 412  ASP A OD2   1 
ATOM   2133  N  N     . MET E 2 224 ? 22.731  66.837  37.118  1.00 48.03 ? 413  MET A N     1 
ATOM   2134  C  CA    . MET E 2 224 ? 23.863  67.032  36.228  1.00 48.76 ? 413  MET A CA    1 
ATOM   2135  C  C     . MET E 2 224 ? 23.595  66.400  34.865  1.00 48.57 ? 413  MET A C     1 
ATOM   2136  O  O     . MET E 2 224 ? 23.959  66.961  33.833  1.00 48.50 ? 413  MET A O     1 
ATOM   2137  C  CB    . MET E 2 224 ? 25.130  66.445  36.860  1.00 48.82 ? 413  MET A CB    1 
ATOM   2138  C  CG    . MET E 2 224 ? 26.418  67.123  36.416  1.00 49.46 ? 413  MET A CG    1 
ATOM   2139  S  SD    . MET E 2 224 ? 26.414  68.943  36.601  1.00 50.51 ? 413  MET A SD    1 
ATOM   2140  C  CE    . MET E 2 224 ? 25.388  69.173  37.991  1.00 50.06 ? 413  MET A CE    1 
ATOM   2141  N  N     . ARG E 2 225 ? 22.956  65.235  34.862  1.00 48.62 ? 414  ARG A N     1 
ATOM   2142  C  CA    . ARG E 2 225 ? 22.639  64.562  33.614  1.00 49.74 ? 414  ARG A CA    1 
ATOM   2143  C  C     . ARG E 2 225 ? 21.689  65.452  32.826  1.00 49.72 ? 414  ARG A C     1 
ATOM   2144  O  O     . ARG E 2 225 ? 21.884  65.687  31.637  1.00 49.49 ? 414  ARG A O     1 
ATOM   2145  C  CB    . ARG E 2 225 ? 21.994  63.195  33.884  1.00 49.94 ? 414  ARG A CB    1 
ATOM   2146  C  CG    . ARG E 2 225 ? 21.536  62.447  32.631  1.00 51.32 ? 414  ARG A CG    1 
ATOM   2147  C  CD    . ARG E 2 225 ? 20.982  61.063  32.968  1.00 52.40 ? 414  ARG A CD    1 
ATOM   2148  N  NE    . ARG E 2 225 ? 22.035  60.123  33.354  1.00 53.40 ? 414  ARG A NE    1 
ATOM   2149  C  CZ    . ARG E 2 225 ? 22.910  59.589  32.504  1.00 53.97 ? 414  ARG A CZ    1 
ATOM   2150  N  NH1   . ARG E 2 225 ? 22.860  59.897  31.210  1.00 54.33 ? 414  ARG A NH1   1 
ATOM   2151  N  NH2   . ARG E 2 225 ? 23.840  58.750  32.946  1.00 54.50 ? 414  ARG A NH2   1 
ATOM   2152  N  N     . ARG E 2 226 ? 20.678  65.975  33.507  1.00 50.86 ? 415  ARG A N     1 
ATOM   2153  C  CA    . ARG E 2 226 ? 19.698  66.838  32.861  1.00 52.33 ? 415  ARG A CA    1 
ATOM   2154  C  C     . ARG E 2 226 ? 20.321  68.064  32.224  1.00 52.84 ? 415  ARG A C     1 
ATOM   2155  O  O     . ARG E 2 226 ? 19.948  68.449  31.117  1.00 52.96 ? 415  ARG A O     1 
ATOM   2156  C  CB    . ARG E 2 226 ? 18.631  67.283  33.863  1.00 52.90 ? 415  ARG A CB    1 
ATOM   2157  C  CG    . ARG E 2 226 ? 17.498  66.298  34.061  1.00 54.40 ? 415  ARG A CG    1 
ATOM   2158  C  CD    . ARG E 2 226 ? 16.478  66.866  35.032  1.00 55.86 ? 415  ARG A CD    1 
ATOM   2159  N  NE    . ARG E 2 226 ? 15.897  68.116  34.548  1.00 56.96 ? 415  ARG A NE    1 
ATOM   2160  C  CZ    . ARG E 2 226 ? 15.354  69.040  35.337  1.00 58.00 ? 415  ARG A CZ    1 
ATOM   2161  N  NH1   . ARG E 2 226 ? 15.322  68.852  36.652  1.00 58.67 ? 415  ARG A NH1   1 
ATOM   2162  N  NH2   . ARG E 2 226 ? 14.840  70.149  34.816  1.00 58.14 ? 415  ARG A NH2   1 
ATOM   2163  N  N     . ILE E 2 227 ? 21.263  68.682  32.923  1.00 53.66 ? 416  ILE A N     1 
ATOM   2164  C  CA    . ILE E 2 227 ? 21.910  69.876  32.403  1.00 54.78 ? 416  ILE A CA    1 
ATOM   2165  C  C     . ILE E 2 227 ? 22.706  69.579  31.142  1.00 55.97 ? 416  ILE A C     1 
ATOM   2166  O  O     . ILE E 2 227 ? 22.522  70.228  30.114  1.00 56.21 ? 416  ILE A O     1 
ATOM   2167  C  CB    . ILE E 2 227 ? 22.867  70.496  33.435  1.00 54.75 ? 416  ILE A CB    1 
ATOM   2168  C  CG1   . ILE E 2 227 ? 22.084  70.953  34.666  1.00 54.39 ? 416  ILE A CG1   1 
ATOM   2169  C  CG2   . ILE E 2 227 ? 23.612  71.671  32.813  1.00 54.31 ? 416  ILE A CG2   1 
ATOM   2170  C  CD1   . ILE E 2 227 ? 22.954  71.566  35.739  1.00 53.68 ? 416  ILE A CD1   1 
ATOM   2171  N  N     . MET E 2 228 ? 23.588  68.590  31.224  1.00 57.14 ? 417  MET A N     1 
ATOM   2172  C  CA    . MET E 2 228 ? 24.432  68.229  30.092  1.00 57.64 ? 417  MET A CA    1 
ATOM   2173  C  C     . MET E 2 228 ? 23.723  67.464  28.990  1.00 58.16 ? 417  MET A C     1 
ATOM   2174  O  O     . MET E 2 228 ? 24.185  67.451  27.847  1.00 58.67 ? 417  MET A O     1 
ATOM   2175  C  CB    . MET E 2 228 ? 25.617  67.399  30.570  1.00 57.04 ? 417  MET A CB    1 
ATOM   2176  C  CG    . MET E 2 228 ? 26.511  68.118  31.531  1.00 57.15 ? 417  MET A CG    1 
ATOM   2177  S  SD    . MET E 2 228 ? 27.861  67.056  32.019  1.00 58.91 ? 417  MET A SD    1 
ATOM   2178  C  CE    . MET E 2 228 ? 26.962  65.747  32.934  1.00 57.85 ? 417  MET A CE    1 
ATOM   2179  N  N     . THR E 2 229 ? 22.604  66.830  29.321  1.00 58.41 ? 418  THR A N     1 
ATOM   2180  C  CA    . THR E 2 229 ? 21.884  66.040  28.333  1.00 58.82 ? 418  THR A CA    1 
ATOM   2181  C  C     . THR E 2 229 ? 20.679  66.764  27.739  1.00 59.11 ? 418  THR A C     1 
ATOM   2182  O  O     . THR E 2 229 ? 19.949  66.203  26.926  1.00 59.03 ? 418  THR A O     1 
ATOM   2183  C  CB    . THR E 2 229 ? 21.424  64.712  28.950  1.00 58.52 ? 418  THR A CB    1 
ATOM   2184  O  OG1   . THR E 2 229 ? 21.400  63.704  27.936  1.00 59.41 ? 418  THR A OG1   1 
ATOM   2185  C  CG2   . THR E 2 229 ? 20.032  64.851  29.554  1.00 58.76 ? 418  THR A CG2   1 
ATOM   2186  N  N     . HIS E 2 230 ? 20.485  68.013  28.145  1.00 59.84 ? 419  HIS A N     1 
ATOM   2187  C  CA    . HIS E 2 230 ? 19.365  68.825  27.672  1.00 60.63 ? 419  HIS A CA    1 
ATOM   2188  C  C     . HIS E 2 230 ? 19.237  68.835  26.141  1.00 60.69 ? 419  HIS A C     1 
ATOM   2189  O  O     . HIS E 2 230 ? 20.241  68.874  25.417  1.00 60.20 ? 419  HIS A O     1 
ATOM   2190  C  CB    . HIS E 2 230 ? 19.523  70.260  28.192  1.00 60.92 ? 419  HIS A CB    1 
ATOM   2191  C  CG    . HIS E 2 230 ? 18.234  71.012  28.303  1.00 61.73 ? 419  HIS A CG    1 
ATOM   2192  N  ND1   . HIS E 2 230 ? 17.187  70.582  29.093  1.00 61.79 ? 419  HIS A ND1   1 
ATOM   2193  C  CD2   . HIS E 2 230 ? 17.826  72.172  27.736  1.00 61.31 ? 419  HIS A CD2   1 
ATOM   2194  C  CE1   . HIS E 2 230 ? 16.192  71.447  29.007  1.00 61.65 ? 419  HIS A CE1   1 
ATOM   2195  N  NE2   . HIS E 2 230 ? 16.555  72.421  28.192  1.00 61.28 ? 419  HIS A NE2   1 
ATOM   2196  N  N     . VAL E 2 231 ? 17.998  68.802  25.655  1.00 60.78 ? 420  VAL A N     1 
ATOM   2197  C  CA    . VAL E 2 231 ? 17.740  68.811  24.214  1.00 60.61 ? 420  VAL A CA    1 
ATOM   2198  C  C     . VAL E 2 231 ? 18.231  70.113  23.579  1.00 60.44 ? 420  VAL A C     1 
ATOM   2199  O  O     . VAL E 2 231 ? 18.387  70.204  22.363  1.00 61.07 ? 420  VAL A O     1 
ATOM   2200  C  CB    . VAL E 2 231 ? 16.236  68.665  23.911  1.00 60.81 ? 420  VAL A CB    1 
ATOM   2201  C  CG1   . VAL E 2 231 ? 16.020  68.549  22.403  1.00 60.57 ? 420  VAL A CG1   1 
ATOM   2202  C  CG2   . VAL E 2 231 ? 15.674  67.446  24.634  1.00 60.31 ? 420  VAL A CG2   1 
ATOM   2203  N  N     . THR E 2 232 ? 18.488  71.109  24.417  1.00 59.70 ? 421  THR A N     1 
ATOM   2204  C  CA    . THR E 2 232 ? 18.954  72.412  23.962  1.00 58.75 ? 421  THR A CA    1 
ATOM   2205  C  C     . THR E 2 232 ? 20.473  72.522  23.844  1.00 57.90 ? 421  THR A C     1 
ATOM   2206  O  O     . THR E 2 232 ? 20.988  73.485  23.280  1.00 57.55 ? 421  THR A O     1 
ATOM   2207  C  CB    . THR E 2 232 ? 18.451  73.508  24.922  1.00 59.32 ? 421  THR A CB    1 
ATOM   2208  O  OG1   . THR E 2 232 ? 17.037  73.674  24.753  1.00 60.39 ? 421  THR A OG1   1 
ATOM   2209  C  CG2   . THR E 2 232 ? 19.154  74.821  24.667  1.00 59.79 ? 421  THR A CG2   1 
ATOM   2210  N  N     . MET E 2 233 ? 21.189  71.534  24.367  1.00 57.44 ? 422  MET A N     1 
ATOM   2211  C  CA    . MET E 2 233 ? 22.650  71.554  24.339  1.00 57.05 ? 422  MET A CA    1 
ATOM   2212  C  C     . MET E 2 233 ? 23.253  71.515  22.932  1.00 56.72 ? 422  MET A C     1 
ATOM   2213  O  O     . MET E 2 233 ? 22.951  70.625  22.143  1.00 56.49 ? 422  MET A O     1 
ATOM   2214  C  CB    . MET E 2 233 ? 23.194  70.389  25.174  1.00 56.79 ? 422  MET A CB    1 
ATOM   2215  C  CG    . MET E 2 233 ? 24.694  70.434  25.414  1.00 57.86 ? 422  MET A CG    1 
ATOM   2216  S  SD    . MET E 2 233 ? 25.301  72.005  26.111  1.00 58.55 ? 422  MET A SD    1 
ATOM   2217  C  CE    . MET E 2 233 ? 24.701  71.895  27.806  1.00 57.43 ? 422  MET A CE    1 
ATOM   2218  N  N     . ARG E 2 234 ? 24.103  72.493  22.625  1.00 56.53 ? 423  ARG A N     1 
ATOM   2219  C  CA    . ARG E 2 234 ? 24.758  72.554  21.324  1.00 56.82 ? 423  ARG A CA    1 
ATOM   2220  C  C     . ARG E 2 234 ? 25.577  71.277  21.148  1.00 56.68 ? 423  ARG A C     1 
ATOM   2221  O  O     . ARG E 2 234 ? 26.577  71.083  21.828  1.00 56.78 ? 423  ARG A O     1 
ATOM   2222  C  CB    . ARG E 2 234 ? 25.683  73.777  21.238  1.00 57.08 ? 423  ARG A CB    1 
ATOM   2223  C  CG    . ARG E 2 234 ? 26.538  73.812  19.969  1.00 58.51 ? 423  ARG A CG    1 
ATOM   2224  C  CD    . ARG E 2 234 ? 27.428  75.053  19.860  1.00 59.78 ? 423  ARG A CD    1 
ATOM   2225  N  NE    . ARG E 2 234 ? 26.747  76.196  19.256  1.00 62.44 ? 423  ARG A NE    1 
ATOM   2226  C  CZ    . ARG E 2 234 ? 27.280  76.991  18.326  1.00 63.47 ? 423  ARG A CZ    1 
ATOM   2227  N  NH1   . ARG E 2 234 ? 28.511  76.773  17.874  1.00 63.63 ? 423  ARG A NH1   1 
ATOM   2228  N  NH2   . ARG E 2 234 ? 26.582  78.021  17.851  1.00 64.17 ? 423  ARG A NH2   1 
ATOM   2229  N  N     . PRO E 2 235 ? 25.163  70.391  20.227  1.00 56.35 ? 424  PRO A N     1 
ATOM   2230  C  CA    . PRO E 2 235 ? 25.878  69.133  19.986  1.00 55.81 ? 424  PRO A CA    1 
ATOM   2231  C  C     . PRO E 2 235 ? 27.402  69.278  19.997  1.00 55.47 ? 424  PRO A C     1 
ATOM   2232  O  O     . PRO E 2 235 ? 28.112  68.428  20.531  1.00 55.98 ? 424  PRO A O     1 
ATOM   2233  C  CB    . PRO E 2 235 ? 25.332  68.693  18.635  1.00 56.14 ? 424  PRO A CB    1 
ATOM   2234  C  CG    . PRO E 2 235 ? 23.897  69.146  18.723  1.00 56.36 ? 424  PRO A CG    1 
ATOM   2235  C  CD    . PRO E 2 235 ? 24.059  70.554  19.264  1.00 56.10 ? 424  PRO A CD    1 
ATOM   2236  N  N     . GLU E 2 236 ? 27.896  70.364  19.414  1.00 54.46 ? 425  GLU A N     1 
ATOM   2237  C  CA    . GLU E 2 236 ? 29.327  70.623  19.367  1.00 53.35 ? 425  GLU A CA    1 
ATOM   2238  C  C     . GLU E 2 236 ? 29.756  71.469  20.550  1.00 51.53 ? 425  GLU A C     1 
ATOM   2239  O  O     . GLU E 2 236 ? 29.553  72.680  20.554  1.00 51.40 ? 425  GLU A O     1 
ATOM   2240  C  CB    . GLU E 2 236 ? 29.689  71.355  18.073  1.00 54.83 ? 425  GLU A CB    1 
ATOM   2241  C  CG    . GLU E 2 236 ? 29.533  70.495  16.853  1.00 56.96 ? 425  GLU A CG    1 
ATOM   2242  C  CD    . GLU E 2 236 ? 30.290  69.205  17.009  1.00 58.61 ? 425  GLU A CD    1 
ATOM   2243  O  OE1   . GLU E 2 236 ? 31.529  69.281  17.161  1.00 59.68 ? 425  GLU A OE1   1 
ATOM   2244  O  OE2   . GLU E 2 236 ? 29.651  68.126  16.993  1.00 58.77 ? 425  GLU A OE2   1 
ATOM   2245  N  N     . HIS E 2 237 ? 30.359  70.844  21.553  1.00 49.38 ? 426  HIS A N     1 
ATOM   2246  C  CA    . HIS E 2 237 ? 30.796  71.602  22.716  1.00 47.09 ? 426  HIS A CA    1 
ATOM   2247  C  C     . HIS E 2 237 ? 31.875  70.885  23.504  1.00 44.80 ? 426  HIS A C     1 
ATOM   2248  O  O     . HIS E 2 237 ? 31.881  69.660  23.606  1.00 44.35 ? 426  HIS A O     1 
ATOM   2249  C  CB    . HIS E 2 237 ? 29.594  71.902  23.623  1.00 47.39 ? 426  HIS A CB    1 
ATOM   2250  C  CG    . HIS E 2 237 ? 29.000  70.685  24.266  1.00 48.16 ? 426  HIS A CG    1 
ATOM   2251  N  ND1   . HIS E 2 237 ? 29.525  70.113  25.405  1.00 48.58 ? 426  HIS A ND1   1 
ATOM   2252  C  CD2   . HIS E 2 237 ? 27.947  69.913  23.910  1.00 48.23 ? 426  HIS A CD2   1 
ATOM   2253  C  CE1   . HIS E 2 237 ? 28.822  69.040  25.721  1.00 47.82 ? 426  HIS A CE1   1 
ATOM   2254  N  NE2   . HIS E 2 237 ? 27.859  68.897  24.831  1.00 48.32 ? 426  HIS A NE2   1 
ATOM   2255  N  N     . GLN E 2 238 ? 32.806  71.649  24.051  1.00 42.29 ? 427  GLN A N     1 
ATOM   2256  C  CA    . GLN E 2 238 ? 33.849  71.041  24.853  1.00 40.50 ? 427  GLN A CA    1 
ATOM   2257  C  C     . GLN E 2 238 ? 33.337  70.852  26.276  1.00 39.16 ? 427  GLN A C     1 
ATOM   2258  O  O     . GLN E 2 238 ? 32.590  71.684  26.807  1.00 38.52 ? 427  GLN A O     1 
ATOM   2259  C  CB    . GLN E 2 238 ? 35.103  71.912  24.873  1.00 40.53 ? 427  GLN A CB    1 
ATOM   2260  C  CG    . GLN E 2 238 ? 35.801  72.045  23.539  1.00 38.54 ? 427  GLN A CG    1 
ATOM   2261  C  CD    . GLN E 2 238 ? 36.932  73.028  23.617  1.00 38.91 ? 427  GLN A CD    1 
ATOM   2262  O  OE1   . GLN E 2 238 ? 37.988  72.744  24.193  1.00 38.54 ? 427  GLN A OE1   1 
ATOM   2263  N  NE2   . GLN E 2 238 ? 36.716  74.210  23.058  1.00 39.38 ? 427  GLN A NE2   1 
ATOM   2264  N  N     . THR E 2 239 ? 33.729  69.738  26.879  1.00 37.83 ? 428  THR A N     1 
ATOM   2265  C  CA    . THR E 2 239 ? 33.349  69.419  28.240  1.00 36.57 ? 428  THR A CA    1 
ATOM   2266  C  C     . THR E 2 239 ? 34.629  69.298  29.052  1.00 36.08 ? 428  THR A C     1 
ATOM   2267  O  O     . THR E 2 239 ? 35.510  68.499  28.726  1.00 35.23 ? 428  THR A O     1 
ATOM   2268  C  CB    . THR E 2 239 ? 32.561  68.107  28.286  1.00 37.37 ? 428  THR A CB    1 
ATOM   2269  O  OG1   . THR E 2 239 ? 31.333  68.282  27.563  1.00 36.92 ? 428  THR A OG1   1 
ATOM   2270  C  CG2   . THR E 2 239 ? 32.243  67.711  29.737  1.00 36.57 ? 428  THR A CG2   1 
ATOM   2271  N  N     . LEU E 2 240 ? 34.736  70.106  30.103  1.00 34.88 ? 429  LEU A N     1 
ATOM   2272  C  CA    . LEU E 2 240 ? 35.925  70.094  30.944  1.00 34.33 ? 429  LEU A CA    1 
ATOM   2273  C  C     . LEU E 2 240 ? 35.568  69.747  32.388  1.00 33.82 ? 429  LEU A C     1 
ATOM   2274  O  O     . LEU E 2 240 ? 34.622  70.292  32.962  1.00 33.68 ? 429  LEU A O     1 
ATOM   2275  C  CB    . LEU E 2 240 ? 36.619  71.456  30.878  1.00 34.23 ? 429  LEU A CB    1 
ATOM   2276  C  CG    . LEU E 2 240 ? 36.710  72.018  29.454  1.00 35.74 ? 429  LEU A CG    1 
ATOM   2277  C  CD1   . LEU E 2 240 ? 37.290  73.441  29.473  1.00 35.09 ? 429  LEU A CD1   1 
ATOM   2278  C  CD2   . LEU E 2 240 ? 37.553  71.086  28.598  1.00 34.82 ? 429  LEU A CD2   1 
ATOM   2279  N  N     . MET E 2 241 ? 36.339  68.839  32.973  1.00 32.76 ? 430  MET A N     1 
ATOM   2280  C  CA    . MET E 2 241 ? 36.099  68.398  34.340  1.00 30.88 ? 430  MET A CA    1 
ATOM   2281  C  C     . MET E 2 241 ? 37.379  68.504  35.157  1.00 30.60 ? 430  MET A C     1 
ATOM   2282  O  O     . MET E 2 241 ? 38.421  68.003  34.752  1.00 31.08 ? 430  MET A O     1 
ATOM   2283  C  CB    . MET E 2 241 ? 35.598  66.959  34.322  1.00 29.31 ? 430  MET A CB    1 
ATOM   2284  C  CG    . MET E 2 241 ? 34.251  66.792  33.642  1.00 27.99 ? 430  MET A CG    1 
ATOM   2285  S  SD    . MET E 2 241 ? 33.668  65.091  33.738  1.00 28.26 ? 430  MET A SD    1 
ATOM   2286  C  CE    . MET E 2 241 ? 32.327  65.064  32.534  1.00 24.74 ? 430  MET A CE    1 
ATOM   2287  N  N     . PHE E 2 242 ? 37.293  69.166  36.306  1.00 29.63 ? 431  PHE A N     1 
ATOM   2288  C  CA    . PHE E 2 242 ? 38.448  69.355  37.172  1.00 28.54 ? 431  PHE A CA    1 
ATOM   2289  C  C     . PHE E 2 242 ? 38.127  68.980  38.597  1.00 27.70 ? 431  PHE A C     1 
ATOM   2290  O  O     . PHE E 2 242 ? 37.006  69.160  39.046  1.00 27.56 ? 431  PHE A O     1 
ATOM   2291  C  CB    . PHE E 2 242 ? 38.886  70.825  37.182  1.00 29.13 ? 431  PHE A CB    1 
ATOM   2292  C  CG    . PHE E 2 242 ? 39.513  71.286  35.902  1.00 29.40 ? 431  PHE A CG    1 
ATOM   2293  C  CD1   . PHE E 2 242 ? 40.877  71.549  35.840  1.00 28.81 ? 431  PHE A CD1   1 
ATOM   2294  C  CD2   . PHE E 2 242 ? 38.746  71.452  34.764  1.00 29.02 ? 431  PHE A CD2   1 
ATOM   2295  C  CE1   . PHE E 2 242 ? 41.471  71.971  34.654  1.00 29.22 ? 431  PHE A CE1   1 
ATOM   2296  C  CE2   . PHE E 2 242 ? 39.329  71.873  33.575  1.00 30.16 ? 431  PHE A CE2   1 
ATOM   2297  C  CZ    . PHE E 2 242 ? 40.696  72.133  33.520  1.00 28.13 ? 431  PHE A CZ    1 
ATOM   2298  N  N     . SER E 2 243 ? 39.127  68.475  39.304  1.00 27.25 ? 432  SER A N     1 
ATOM   2299  C  CA    . SER E 2 243 ? 38.974  68.143  40.705  1.00 27.40 ? 432  SER A CA    1 
ATOM   2300  C  C     . SER E 2 243 ? 40.270  67.653  41.318  1.00 26.63 ? 432  SER A C     1 
ATOM   2301  O  O     . SER E 2 243 ? 41.160  67.192  40.607  1.00 27.55 ? 432  SER A O     1 
ATOM   2302  C  CB    . SER E 2 243 ? 37.905  67.073  40.906  1.00 27.18 ? 432  SER A CB    1 
ATOM   2303  O  OG    . SER E 2 243 ? 37.770  66.814  42.290  1.00 26.42 ? 432  SER A OG    1 
ATOM   2304  N  N     . ALA E 2 244 ? 40.372  67.751  42.642  1.00 25.84 ? 433  ALA A N     1 
ATOM   2305  C  CA    . ALA E 2 244 ? 41.558  67.266  43.347  1.00 25.57 ? 433  ALA A CA    1 
ATOM   2306  C  C     . ALA E 2 244 ? 41.353  65.777  43.670  1.00 25.99 ? 433  ALA A C     1 
ATOM   2307  O  O     . ALA E 2 244 ? 42.302  65.073  44.007  1.00 26.90 ? 433  ALA A O     1 
ATOM   2308  C  CB    . ALA E 2 244 ? 41.796  68.064  44.634  1.00 22.23 ? 433  ALA A CB    1 
ATOM   2309  N  N     . THR E 2 245 ? 40.108  65.312  43.594  1.00 25.33 ? 434  THR A N     1 
ATOM   2310  C  CA    . THR E 2 245 ? 39.829  63.905  43.826  1.00 25.97 ? 434  THR A CA    1 
ATOM   2311  C  C     . THR E 2 245 ? 38.994  63.411  42.660  1.00 26.71 ? 434  THR A C     1 
ATOM   2312  O  O     . THR E 2 245 ? 38.298  64.193  42.008  1.00 26.44 ? 434  THR A O     1 
ATOM   2313  C  CB    . THR E 2 245 ? 39.056  63.638  45.138  1.00 24.78 ? 434  THR A CB    1 
ATOM   2314  O  OG1   . THR E 2 245 ? 37.863  64.431  45.178  1.00 24.73 ? 434  THR A OG1   1 
ATOM   2315  C  CG2   . THR E 2 245 ? 39.923  63.942  46.324  1.00 24.46 ? 434  THR A CG2   1 
ATOM   2316  N  N     . PHE E 2 246 ? 39.075  62.113  42.393  1.00 26.93 ? 435  PHE A N     1 
ATOM   2317  C  CA    . PHE E 2 246 ? 38.315  61.524  41.304  1.00 27.54 ? 435  PHE A CA    1 
ATOM   2318  C  C     . PHE E 2 246 ? 38.337  60.003  41.372  1.00 28.81 ? 435  PHE A C     1 
ATOM   2319  O  O     . PHE E 2 246 ? 39.142  59.356  40.707  1.00 28.91 ? 435  PHE A O     1 
ATOM   2320  C  CB    . PHE E 2 246 ? 38.875  61.977  39.950  1.00 25.79 ? 435  PHE A CB    1 
ATOM   2321  C  CG    . PHE E 2 246 ? 37.820  62.481  38.999  1.00 23.38 ? 435  PHE A CG    1 
ATOM   2322  C  CD1   . PHE E 2 246 ? 36.677  61.736  38.758  1.00 21.86 ? 435  PHE A CD1   1 
ATOM   2323  C  CD2   . PHE E 2 246 ? 37.989  63.691  38.337  1.00 21.59 ? 435  PHE A CD2   1 
ATOM   2324  C  CE1   . PHE E 2 246 ? 35.704  62.193  37.858  1.00 24.53 ? 435  PHE A CE1   1 
ATOM   2325  C  CE2   . PHE E 2 246 ? 37.035  64.163  37.436  1.00 22.35 ? 435  PHE A CE2   1 
ATOM   2326  C  CZ    . PHE E 2 246 ? 35.888  63.423  37.189  1.00 22.95 ? 435  PHE A CZ    1 
ATOM   2327  N  N     . PRO E 2 247 ? 37.457  59.417  42.197  1.00 30.16 ? 436  PRO A N     1 
ATOM   2328  C  CA    . PRO E 2 247 ? 37.365  57.961  42.353  1.00 31.63 ? 436  PRO A CA    1 
ATOM   2329  C  C     . PRO E 2 247 ? 37.103  57.337  40.986  1.00 32.58 ? 436  PRO A C     1 
ATOM   2330  O  O     . PRO E 2 247 ? 36.232  57.796  40.240  1.00 31.56 ? 436  PRO A O     1 
ATOM   2331  C  CB    . PRO E 2 247 ? 36.174  57.783  43.292  1.00 31.00 ? 436  PRO A CB    1 
ATOM   2332  C  CG    . PRO E 2 247 ? 36.196  59.030  44.106  1.00 30.93 ? 436  PRO A CG    1 
ATOM   2333  C  CD    . PRO E 2 247 ? 36.497  60.100  43.076  1.00 29.41 ? 436  PRO A CD    1 
ATOM   2334  N  N     . GLU E 2 248 ? 37.871  56.298  40.675  1.00 34.99 ? 437  GLU A N     1 
ATOM   2335  C  CA    . GLU E 2 248 ? 37.778  55.573  39.406  1.00 37.30 ? 437  GLU A CA    1 
ATOM   2336  C  C     . GLU E 2 248 ? 36.342  55.369  38.931  1.00 36.57 ? 437  GLU A C     1 
ATOM   2337  O  O     . GLU E 2 248 ? 36.033  55.580  37.758  1.00 36.25 ? 437  GLU A O     1 
ATOM   2338  C  CB    . GLU E 2 248 ? 38.464  54.215  39.551  1.00 40.53 ? 437  GLU A CB    1 
ATOM   2339  C  CG    . GLU E 2 248 ? 39.427  53.868  38.426  1.00 45.26 ? 437  GLU A CG    1 
ATOM   2340  C  CD    . GLU E 2 248 ? 40.863  53.669  38.918  1.00 48.08 ? 437  GLU A CD    1 
ATOM   2341  O  OE1   . GLU E 2 248 ? 41.616  54.670  39.014  1.00 48.64 ? 437  GLU A OE1   1 
ATOM   2342  O  OE2   . GLU E 2 248 ? 41.227  52.503  39.219  1.00 49.70 ? 437  GLU A OE2   1 
ATOM   2343  N  N     . GLU E 2 249 ? 35.469  54.956  39.844  1.00 36.06 ? 438  GLU A N     1 
ATOM   2344  C  CA    . GLU E 2 249 ? 34.073  54.727  39.508  1.00 36.59 ? 438  GLU A CA    1 
ATOM   2345  C  C     . GLU E 2 249 ? 33.395  55.982  38.959  1.00 35.18 ? 438  GLU A C     1 
ATOM   2346  O  O     . GLU E 2 249 ? 32.536  55.913  38.067  1.00 34.88 ? 438  GLU A O     1 
ATOM   2347  C  CB    . GLU E 2 249 ? 33.309  54.199  40.729  1.00 38.99 ? 438  GLU A CB    1 
ATOM   2348  C  CG    . GLU E 2 249 ? 33.457  55.005  42.010  1.00 43.76 ? 438  GLU A CG    1 
ATOM   2349  C  CD    . GLU E 2 249 ? 34.725  54.678  42.832  1.00 46.21 ? 438  GLU A CD    1 
ATOM   2350  O  OE1   . GLU E 2 249 ? 34.727  54.999  44.052  1.00 47.35 ? 438  GLU A OE1   1 
ATOM   2351  O  OE2   . GLU E 2 249 ? 35.708  54.124  42.279  1.00 46.21 ? 438  GLU A OE2   1 
ATOM   2352  N  N     . ILE E 2 250 ? 33.787  57.135  39.482  1.00 33.15 ? 439  ILE A N     1 
ATOM   2353  C  CA    . ILE E 2 250 ? 33.222  58.386  39.014  1.00 31.08 ? 439  ILE A CA    1 
ATOM   2354  C  C     . ILE E 2 250 ? 33.900  58.799  37.699  1.00 29.66 ? 439  ILE A C     1 
ATOM   2355  O  O     . ILE E 2 250 ? 33.283  59.438  36.855  1.00 27.58 ? 439  ILE A O     1 
ATOM   2356  C  CB    . ILE E 2 250 ? 33.375  59.480  40.076  1.00 30.93 ? 439  ILE A CB    1 
ATOM   2357  C  CG1   . ILE E 2 250 ? 32.446  59.170  41.247  1.00 31.96 ? 439  ILE A CG1   1 
ATOM   2358  C  CG2   . ILE E 2 250 ? 33.061  60.823  39.484  1.00 30.52 ? 439  ILE A CG2   1 
ATOM   2359  C  CD1   . ILE E 2 250 ? 32.482  60.211  42.354  1.00 33.16 ? 439  ILE A CD1   1 
ATOM   2360  N  N     . GLN E 2 251 ? 35.167  58.431  37.528  1.00 28.31 ? 440  GLN A N     1 
ATOM   2361  C  CA    . GLN E 2 251 ? 35.855  58.747  36.282  1.00 28.53 ? 440  GLN A CA    1 
ATOM   2362  C  C     . GLN E 2 251 ? 35.156  57.991  35.137  1.00 28.25 ? 440  GLN A C     1 
ATOM   2363  O  O     . GLN E 2 251 ? 35.103  58.471  34.003  1.00 27.76 ? 440  GLN A O     1 
ATOM   2364  C  CB    . GLN E 2 251 ? 37.327  58.315  36.326  1.00 28.92 ? 440  GLN A CB    1 
ATOM   2365  C  CG    . GLN E 2 251 ? 38.259  59.163  37.169  1.00 29.21 ? 440  GLN A CG    1 
ATOM   2366  C  CD    . GLN E 2 251 ? 39.713  58.710  37.038  1.00 30.09 ? 440  GLN A CD    1 
ATOM   2367  O  OE1   . GLN E 2 251 ? 40.205  58.477  35.929  1.00 30.83 ? 440  GLN A OE1   1 
ATOM   2368  N  NE2   . GLN E 2 251 ? 40.406  58.589  38.165  1.00 29.44 ? 440  GLN A NE2   1 
ATOM   2369  N  N     . ARG E 2 252 ? 34.614  56.810  35.434  1.00 28.10 ? 441  ARG A N     1 
ATOM   2370  C  CA    . ARG E 2 252 ? 33.935  56.022  34.400  1.00 28.19 ? 441  ARG A CA    1 
ATOM   2371  C  C     . ARG E 2 252 ? 32.614  56.674  34.020  1.00 28.84 ? 441  ARG A C     1 
ATOM   2372  O  O     . ARG E 2 252 ? 32.257  56.724  32.853  1.00 28.55 ? 441  ARG A O     1 
ATOM   2373  C  CB    . ARG E 2 252 ? 33.709  54.579  34.869  1.00 27.18 ? 441  ARG A CB    1 
ATOM   2374  C  CG    . ARG E 2 252 ? 35.005  53.810  35.118  1.00 26.01 ? 441  ARG A CG    1 
ATOM   2375  C  CD    . ARG E 2 252 ? 34.736  52.351  35.514  1.00 26.82 ? 441  ARG A CD    1 
ATOM   2376  N  NE    . ARG E 2 252 ? 35.977  51.608  35.705  1.00 26.68 ? 441  ARG A NE    1 
ATOM   2377  C  CZ    . ARG E 2 252 ? 36.729  51.134  34.719  1.00 27.08 ? 441  ARG A CZ    1 
ATOM   2378  N  NH1   . ARG E 2 252 ? 36.367  51.310  33.458  1.00 26.20 ? 441  ARG A NH1   1 
ATOM   2379  N  NH2   . ARG E 2 252 ? 37.860  50.508  35.000  1.00 27.82 ? 441  ARG A NH2   1 
ATOM   2380  N  N     . MET E 2 253 ? 31.899  57.200  35.009  1.00 30.87 ? 442  MET A N     1 
ATOM   2381  C  CA    . MET E 2 253 ? 30.637  57.869  34.744  1.00 32.38 ? 442  MET A CA    1 
ATOM   2382  C  C     . MET E 2 253 ? 30.870  59.139  33.941  1.00 32.23 ? 442  MET A C     1 
ATOM   2383  O  O     . MET E 2 253 ? 30.070  59.483  33.082  1.00 33.00 ? 442  MET A O     1 
ATOM   2384  C  CB    . MET E 2 253 ? 29.932  58.241  36.046  1.00 35.40 ? 442  MET A CB    1 
ATOM   2385  C  CG    . MET E 2 253 ? 29.519  57.064  36.900  1.00 39.22 ? 442  MET A CG    1 
ATOM   2386  S  SD    . MET E 2 253 ? 28.524  57.625  38.299  1.00 43.40 ? 442  MET A SD    1 
ATOM   2387  C  CE    . MET E 2 253 ? 29.771  57.862  39.597  1.00 42.81 ? 442  MET A CE    1 
ATOM   2388  N  N     . ALA E 2 254 ? 31.959  59.840  34.229  1.00 32.07 ? 443  ALA A N     1 
ATOM   2389  C  CA    . ALA E 2 254 ? 32.278  61.086  33.531  1.00 32.53 ? 443  ALA A CA    1 
ATOM   2390  C  C     . ALA E 2 254 ? 32.441  60.862  32.033  1.00 33.14 ? 443  ALA A C     1 
ATOM   2391  O  O     . ALA E 2 254 ? 31.929  61.633  31.224  1.00 32.90 ? 443  ALA A O     1 
ATOM   2392  C  CB    . ALA E 2 254 ? 33.566  61.698  34.102  1.00 30.84 ? 443  ALA A CB    1 
ATOM   2393  N  N     . GLY E 2 255 ? 33.164  59.798  31.685  1.00 34.06 ? 444  GLY A N     1 
ATOM   2394  C  CA    . GLY E 2 255 ? 33.434  59.460  30.297  1.00 35.33 ? 444  GLY A CA    1 
ATOM   2395  C  C     . GLY E 2 255 ? 32.245  59.469  29.364  1.00 36.06 ? 444  GLY A C     1 
ATOM   2396  O  O     . GLY E 2 255 ? 32.387  59.751  28.182  1.00 35.92 ? 444  GLY A O     1 
ATOM   2397  N  N     . GLU E 2 256 ? 31.071  59.150  29.890  1.00 37.60 ? 445  GLU A N     1 
ATOM   2398  C  CA    . GLU E 2 256 ? 29.869  59.152  29.079  1.00 38.78 ? 445  GLU A CA    1 
ATOM   2399  C  C     . GLU E 2 256 ? 29.612  60.557  28.533  1.00 39.77 ? 445  GLU A C     1 
ATOM   2400  O  O     . GLU E 2 256 ? 29.057  60.717  27.448  1.00 40.72 ? 445  GLU A O     1 
ATOM   2401  C  CB    . GLU E 2 256 ? 28.654  58.714  29.910  1.00 39.24 ? 445  GLU A CB    1 
ATOM   2402  C  CG    . GLU E 2 256 ? 27.381  58.584  29.086  1.00 40.40 ? 445  GLU A CG    1 
ATOM   2403  C  CD    . GLU E 2 256 ? 26.122  58.382  29.913  1.00 41.70 ? 445  GLU A CD    1 
ATOM   2404  O  OE1   . GLU E 2 256 ? 26.200  57.817  31.031  1.00 42.95 ? 445  GLU A OE1   1 
ATOM   2405  O  OE2   . GLU E 2 256 ? 25.040  58.777  29.426  1.00 42.14 ? 445  GLU A OE2   1 
ATOM   2406  N  N     . PHE E 2 257 ? 30.023  61.577  29.280  1.00 39.82 ? 446  PHE A N     1 
ATOM   2407  C  CA    . PHE E 2 257 ? 29.782  62.952  28.863  1.00 39.75 ? 446  PHE A CA    1 
ATOM   2408  C  C     . PHE E 2 257 ? 30.972  63.649  28.226  1.00 40.04 ? 446  PHE A C     1 
ATOM   2409  O  O     . PHE E 2 257 ? 30.922  64.851  27.971  1.00 40.45 ? 446  PHE A O     1 
ATOM   2410  C  CB    . PHE E 2 257 ? 29.275  63.757  30.061  1.00 39.52 ? 446  PHE A CB    1 
ATOM   2411  C  CG    . PHE E 2 257 ? 28.161  63.074  30.805  1.00 39.99 ? 446  PHE A CG    1 
ATOM   2412  C  CD1   . PHE E 2 257 ? 28.383  62.513  32.060  1.00 39.55 ? 446  PHE A CD1   1 
ATOM   2413  C  CD2   . PHE E 2 257 ? 26.907  62.923  30.219  1.00 39.72 ? 446  PHE A CD2   1 
ATOM   2414  C  CE1   . PHE E 2 257 ? 27.372  61.805  32.720  1.00 40.05 ? 446  PHE A CE1   1 
ATOM   2415  C  CE2   . PHE E 2 257 ? 25.888  62.216  30.870  1.00 40.02 ? 446  PHE A CE2   1 
ATOM   2416  C  CZ    . PHE E 2 257 ? 26.123  61.654  32.123  1.00 39.91 ? 446  PHE A CZ    1 
ATOM   2417  N  N     . LEU E 2 258 ? 32.034  62.893  27.961  1.00 40.23 ? 447  LEU A N     1 
ATOM   2418  C  CA    . LEU E 2 258 ? 33.252  63.432  27.342  1.00 40.45 ? 447  LEU A CA    1 
ATOM   2419  C  C     . LEU E 2 258 ? 33.461  62.768  25.972  1.00 40.95 ? 447  LEU A C     1 
ATOM   2420  O  O     . LEU E 2 258 ? 33.075  61.612  25.782  1.00 41.23 ? 447  LEU A O     1 
ATOM   2421  C  CB    . LEU E 2 258 ? 34.457  63.141  28.242  1.00 39.83 ? 447  LEU A CB    1 
ATOM   2422  C  CG    . LEU E 2 258 ? 34.435  63.713  29.660  1.00 39.71 ? 447  LEU A CG    1 
ATOM   2423  C  CD1   . LEU E 2 258 ? 35.507  63.050  30.533  1.00 38.11 ? 447  LEU A CD1   1 
ATOM   2424  C  CD2   . LEU E 2 258 ? 34.644  65.224  29.578  1.00 40.13 ? 447  LEU A CD2   1 
ATOM   2425  N  N     . LYS E 2 259 ? 34.062  63.487  25.025  1.00 41.29 ? 448  LYS A N     1 
ATOM   2426  C  CA    . LYS E 2 259 ? 34.309  62.944  23.680  1.00 41.70 ? 448  LYS A CA    1 
ATOM   2427  C  C     . LYS E 2 259 ? 35.802  62.960  23.389  1.00 41.24 ? 448  LYS A C     1 
ATOM   2428  O  O     . LYS E 2 259 ? 36.407  64.034  23.374  1.00 42.38 ? 448  LYS A O     1 
ATOM   2429  C  CB    . LYS E 2 259 ? 33.617  63.790  22.598  1.00 42.63 ? 448  LYS A CB    1 
ATOM   2430  C  CG    . LYS E 2 259 ? 32.117  64.014  22.769  1.00 44.24 ? 448  LYS A CG    1 
ATOM   2431  C  CD    . LYS E 2 259 ? 31.322  62.742  22.540  1.00 45.92 ? 448  LYS A CD    1 
ATOM   2432  C  CE    . LYS E 2 259 ? 29.824  62.995  22.675  1.00 46.89 ? 448  LYS A CE    1 
ATOM   2433  N  NZ    . LYS E 2 259 ? 29.306  63.861  21.565  1.00 48.18 ? 448  LYS A NZ    1 
ATOM   2434  N  N     . ASN E 2 260 ? 36.393  61.789  23.143  1.00 40.18 ? 449  ASN A N     1 
ATOM   2435  C  CA    . ASN E 2 260 ? 37.829  61.702  22.846  1.00 38.71 ? 449  ASN A CA    1 
ATOM   2436  C  C     . ASN E 2 260 ? 38.583  62.636  23.782  1.00 37.47 ? 449  ASN A C     1 
ATOM   2437  O  O     . ASN E 2 260 ? 39.365  63.480  23.344  1.00 37.13 ? 449  ASN A O     1 
ATOM   2438  C  CB    . ASN E 2 260 ? 38.089  62.122  21.394  1.00 39.50 ? 449  ASN A CB    1 
ATOM   2439  C  CG    . ASN E 2 260 ? 39.555  62.031  21.006  1.00 40.26 ? 449  ASN A CG    1 
ATOM   2440  O  OD1   . ASN E 2 260 ? 40.007  62.725  20.094  1.00 40.11 ? 449  ASN A OD1   1 
ATOM   2441  N  ND2   . ASN E 2 260 ? 40.304  61.168  21.690  1.00 40.52 ? 449  ASN A ND2   1 
ATOM   2442  N  N     . TYR E 2 261 ? 38.357  62.465  25.078  1.00 35.49 ? 450  TYR A N     1 
ATOM   2443  C  CA    . TYR E 2 261 ? 38.959  63.334  26.079  1.00 33.37 ? 450  TYR A CA    1 
ATOM   2444  C  C     . TYR E 2 261 ? 40.377  63.019  26.528  1.00 33.10 ? 450  TYR A C     1 
ATOM   2445  O  O     . TYR E 2 261 ? 40.810  61.867  26.512  1.00 32.75 ? 450  TYR A O     1 
ATOM   2446  C  CB    . TYR E 2 261 ? 38.050  63.374  27.305  1.00 31.94 ? 450  TYR A CB    1 
ATOM   2447  C  CG    . TYR E 2 261 ? 38.199  62.200  28.260  1.00 29.63 ? 450  TYR A CG    1 
ATOM   2448  C  CD1   . TYR E 2 261 ? 39.176  62.211  29.260  1.00 29.52 ? 450  TYR A CD1   1 
ATOM   2449  C  CD2   . TYR E 2 261 ? 37.306  61.124  28.223  1.00 28.61 ? 450  TYR A CD2   1 
ATOM   2450  C  CE1   . TYR E 2 261 ? 39.247  61.187  30.212  1.00 29.24 ? 450  TYR A CE1   1 
ATOM   2451  C  CE2   . TYR E 2 261 ? 37.370  60.095  29.167  1.00 28.44 ? 450  TYR A CE2   1 
ATOM   2452  C  CZ    . TYR E 2 261 ? 38.336  60.139  30.160  1.00 28.37 ? 450  TYR A CZ    1 
ATOM   2453  O  OH    . TYR E 2 261 ? 38.366  59.170  31.128  1.00 28.97 ? 450  TYR A OH    1 
ATOM   2454  N  N     . VAL E 2 262 ? 41.088  64.071  26.941  1.00 32.33 ? 451  VAL A N     1 
ATOM   2455  C  CA    . VAL E 2 262 ? 42.445  63.946  27.445  1.00 31.04 ? 451  VAL A CA    1 
ATOM   2456  C  C     . VAL E 2 262 ? 42.378  63.851  28.964  1.00 31.22 ? 451  VAL A C     1 
ATOM   2457  O  O     . VAL E 2 262 ? 41.604  64.569  29.603  1.00 31.64 ? 451  VAL A O     1 
ATOM   2458  C  CB    . VAL E 2 262 ? 43.306  65.169  27.123  1.00 30.51 ? 451  VAL A CB    1 
ATOM   2459  C  CG1   . VAL E 2 262 ? 44.718  64.948  27.631  1.00 29.83 ? 451  VAL A CG1   1 
ATOM   2460  C  CG2   . VAL E 2 262 ? 43.302  65.437  25.634  1.00 31.89 ? 451  VAL A CG2   1 
ATOM   2461  N  N     . PHE E 2 263 ? 43.187  62.960  29.527  1.00 30.15 ? 452  PHE A N     1 
ATOM   2462  C  CA    . PHE E 2 263 ? 43.264  62.777  30.965  1.00 30.18 ? 452  PHE A CA    1 
ATOM   2463  C  C     . PHE E 2 263 ? 44.619  63.277  31.436  1.00 30.17 ? 452  PHE A C     1 
ATOM   2464  O  O     . PHE E 2 263 ? 45.658  62.907  30.869  1.00 29.89 ? 452  PHE A O     1 
ATOM   2465  C  CB    . PHE E 2 263 ? 43.141  61.299  31.336  1.00 30.23 ? 452  PHE A CB    1 
ATOM   2466  C  CG    . PHE E 2 263 ? 43.303  61.033  32.802  1.00 29.95 ? 452  PHE A CG    1 
ATOM   2467  C  CD1   . PHE E 2 263 ? 42.230  61.197  33.677  1.00 28.81 ? 452  PHE A CD1   1 
ATOM   2468  C  CD2   . PHE E 2 263 ? 44.538  60.631  33.318  1.00 29.91 ? 452  PHE A CD2   1 
ATOM   2469  C  CE1   . PHE E 2 263 ? 42.376  60.963  35.037  1.00 27.75 ? 452  PHE A CE1   1 
ATOM   2470  C  CE2   . PHE E 2 263 ? 44.694  60.397  34.682  1.00 29.09 ? 452  PHE A CE2   1 
ATOM   2471  C  CZ    . PHE E 2 263 ? 43.609  60.562  35.544  1.00 28.35 ? 452  PHE A CZ    1 
ATOM   2472  N  N     . VAL E 2 264 ? 44.610  64.137  32.451  1.00 29.53 ? 453  VAL A N     1 
ATOM   2473  C  CA    . VAL E 2 264 ? 45.851  64.642  32.998  1.00 29.01 ? 453  VAL A CA    1 
ATOM   2474  C  C     . VAL E 2 264 ? 45.774  64.548  34.518  1.00 28.93 ? 453  VAL A C     1 
ATOM   2475  O  O     . VAL E 2 264 ? 44.764  64.896  35.132  1.00 27.81 ? 453  VAL A O     1 
ATOM   2476  C  CB    . VAL E 2 264 ? 46.139  66.124  32.577  1.00 29.96 ? 453  VAL A CB    1 
ATOM   2477  C  CG1   . VAL E 2 264 ? 45.677  66.371  31.163  1.00 28.62 ? 453  VAL A CG1   1 
ATOM   2478  C  CG2   . VAL E 2 264 ? 45.462  67.087  33.517  1.00 30.58 ? 453  VAL A CG2   1 
ATOM   2479  N  N     . ALA E 2 265 ? 46.851  64.053  35.112  1.00 29.11 ? 454  ALA A N     1 
ATOM   2480  C  CA    . ALA E 2 265 ? 46.936  63.910  36.550  1.00 29.87 ? 454  ALA A CA    1 
ATOM   2481  C  C     . ALA E 2 265 ? 48.314  64.364  37.010  1.00 30.06 ? 454  ALA A C     1 
ATOM   2482  O  O     . ALA E 2 265 ? 49.338  63.914  36.496  1.00 29.50 ? 454  ALA A O     1 
ATOM   2483  C  CB    . ALA E 2 265 ? 46.691  62.435  36.960  1.00 28.14 ? 454  ALA A CB    1 
ATOM   2484  N  N     . ILE E 2 266 ? 48.335  65.288  37.960  1.00 31.29 ? 455  ILE A N     1 
ATOM   2485  C  CA    . ILE E 2 266 ? 49.595  65.758  38.515  1.00 31.56 ? 455  ILE A CA    1 
ATOM   2486  C  C     . ILE E 2 266 ? 49.660  65.140  39.890  1.00 31.58 ? 455  ILE A C     1 
ATOM   2487  O  O     . ILE E 2 266 ? 48.839  65.456  40.748  1.00 32.25 ? 455  ILE A O     1 
ATOM   2488  C  CB    . ILE E 2 266 ? 49.648  67.277  38.696  1.00 31.35 ? 455  ILE A CB    1 
ATOM   2489  C  CG1   . ILE E 2 266 ? 49.464  67.987  37.357  1.00 33.41 ? 455  ILE A CG1   1 
ATOM   2490  C  CG2   . ILE E 2 266 ? 50.995  67.659  39.272  1.00 30.20 ? 455  ILE A CG2   1 
ATOM   2491  C  CD1   . ILE E 2 266 ? 48.070  67.954  36.833  1.00 35.15 ? 455  ILE A CD1   1 
ATOM   2492  N  N     . GLY E 2 267 ? 50.620  64.250  40.099  1.00 32.31 ? 456  GLY A N     1 
ATOM   2493  C  CA    . GLY E 2 267 ? 50.750  63.608  41.390  1.00 32.23 ? 456  GLY A CA    1 
ATOM   2494  C  C     . GLY E 2 267 ? 49.784  62.453  41.492  1.00 33.36 ? 456  GLY A C     1 
ATOM   2495  O  O     . GLY E 2 267 ? 49.294  61.945  40.492  1.00 33.37 ? 456  GLY A O     1 
ATOM   2496  N  N     . ILE E 2 268 ? 49.501  62.045  42.719  1.00 34.96 ? 457  ILE A N     1 
ATOM   2497  C  CA    . ILE E 2 268 ? 48.589  60.944  42.989  1.00 35.72 ? 457  ILE A CA    1 
ATOM   2498  C  C     . ILE E 2 268 ? 47.145  61.466  42.986  1.00 35.46 ? 457  ILE A C     1 
ATOM   2499  O  O     . ILE E 2 268 ? 46.824  62.397  43.725  1.00 36.78 ? 457  ILE A O     1 
ATOM   2500  C  CB    . ILE E 2 268 ? 48.942  60.343  44.359  1.00 36.66 ? 457  ILE A CB    1 
ATOM   2501  C  CG1   . ILE E 2 268 ? 50.408  59.902  44.333  1.00 37.81 ? 457  ILE A CG1   1 
ATOM   2502  C  CG2   . ILE E 2 268 ? 48.019  59.186  44.709  1.00 35.99 ? 457  ILE A CG2   1 
ATOM   2503  C  CD1   . ILE E 2 268 ? 50.982  59.637  45.721  1.00 40.38 ? 457  ILE A CD1   1 
ATOM   2504  N  N     . VAL E 2 269 ? 46.288  60.895  42.139  1.00 34.32 ? 458  VAL A N     1 
ATOM   2505  C  CA    . VAL E 2 269 ? 44.889  61.313  42.078  1.00 33.87 ? 458  VAL A CA    1 
ATOM   2506  C  C     . VAL E 2 269 ? 44.264  61.169  43.475  1.00 34.25 ? 458  VAL A C     1 
ATOM   2507  O  O     . VAL E 2 269 ? 44.412  60.139  44.124  1.00 33.82 ? 458  VAL A O     1 
ATOM   2508  C  CB    . VAL E 2 269 ? 44.078  60.443  41.076  1.00 34.02 ? 458  VAL A CB    1 
ATOM   2509  C  CG1   . VAL E 2 269 ? 42.596  60.765  41.181  1.00 32.31 ? 458  VAL A CG1   1 
ATOM   2510  C  CG2   . VAL E 2 269 ? 44.561  60.688  39.659  1.00 33.37 ? 458  VAL A CG2   1 
ATOM   2511  N  N     . GLY E 2 270 ? 43.573  62.204  43.933  1.00 34.46 ? 459  GLY A N     1 
ATOM   2512  C  CA    . GLY E 2 270 ? 42.956  62.145  45.243  1.00 35.26 ? 459  GLY A CA    1 
ATOM   2513  C  C     . GLY E 2 270 ? 43.979  62.227  46.358  1.00 35.90 ? 459  GLY A C     1 
ATOM   2514  O  O     . GLY E 2 270 ? 43.645  62.065  47.533  1.00 35.39 ? 459  GLY A O     1 
ATOM   2515  N  N     . GLY E 2 271 ? 45.237  62.470  45.999  1.00 36.09 ? 460  GLY A N     1 
ATOM   2516  C  CA    . GLY E 2 271 ? 46.270  62.571  47.016  1.00 36.60 ? 460  GLY A CA    1 
ATOM   2517  C  C     . GLY E 2 271 ? 46.233  63.906  47.740  1.00 37.26 ? 460  GLY A C     1 
ATOM   2518  O  O     . GLY E 2 271 ? 45.895  64.941  47.146  1.00 36.30 ? 460  GLY A O     1 
ATOM   2519  N  N     . ALA E 2 272 ? 46.580  63.890  49.025  1.00 37.60 ? 461  ALA A N     1 
ATOM   2520  C  CA    . ALA E 2 272 ? 46.584  65.115  49.819  1.00 38.89 ? 461  ALA A CA    1 
ATOM   2521  C  C     . ALA E 2 272 ? 47.781  65.980  49.469  1.00 39.55 ? 461  ALA A C     1 
ATOM   2522  O  O     . ALA E 2 272 ? 48.822  65.485  49.051  1.00 39.91 ? 461  ALA A O     1 
ATOM   2523  C  CB    . ALA E 2 272 ? 46.608  64.785  51.312  1.00 38.73 ? 461  ALA A CB    1 
ATOM   2524  N  N     . CYS E 2 273 ? 47.628  67.281  49.647  1.00 41.13 ? 462  CYS A N     1 
ATOM   2525  C  CA    . CYS E 2 273 ? 48.704  68.221  49.367  1.00 42.93 ? 462  CYS A CA    1 
ATOM   2526  C  C     . CYS E 2 273 ? 49.835  68.081  50.395  1.00 43.57 ? 462  CYS A C     1 
ATOM   2527  O  O     . CYS E 2 273 ? 49.612  68.220  51.598  1.00 43.67 ? 462  CYS A O     1 
ATOM   2528  C  CB    . CYS E 2 273 ? 48.150  69.641  49.387  1.00 43.05 ? 462  CYS A CB    1 
ATOM   2529  S  SG    . CYS E 2 273 ? 49.426  70.879  49.435  1.00 47.15 ? 462  CYS A SG    1 
ATOM   2530  N  N     . SER E 2 274 ? 51.050  67.820  49.924  1.00 44.71 ? 463  SER A N     1 
ATOM   2531  C  CA    . SER E 2 274 ? 52.195  67.642  50.825  1.00 45.57 ? 463  SER A CA    1 
ATOM   2532  C  C     . SER E 2 274 ? 52.652  68.890  51.599  1.00 45.44 ? 463  SER A C     1 
ATOM   2533  O  O     . SER E 2 274 ? 53.505  68.794  52.477  1.00 45.58 ? 463  SER A O     1 
ATOM   2534  C  CB    . SER E 2 274 ? 53.379  67.050  50.049  1.00 45.52 ? 463  SER A CB    1 
ATOM   2535  O  OG    . SER E 2 274 ? 53.613  67.774  48.848  1.00 47.63 ? 463  SER A OG    1 
ATOM   2536  N  N     . ASP E 2 275 ? 52.093  70.056  51.292  1.00 46.07 ? 464  ASP A N     1 
ATOM   2537  C  CA    . ASP E 2 275 ? 52.478  71.272  52.012  1.00 46.17 ? 464  ASP A CA    1 
ATOM   2538  C  C     . ASP E 2 275 ? 51.697  71.475  53.307  1.00 45.83 ? 464  ASP A C     1 
ATOM   2539  O  O     . ASP E 2 275 ? 52.001  72.386  54.075  1.00 46.24 ? 464  ASP A O     1 
ATOM   2540  C  CB    . ASP E 2 275 ? 52.298  72.510  51.137  1.00 47.44 ? 464  ASP A CB    1 
ATOM   2541  C  CG    . ASP E 2 275 ? 53.183  72.487  49.907  1.00 49.15 ? 464  ASP A CG    1 
ATOM   2542  O  OD1   . ASP E 2 275 ? 54.425  72.411  50.055  1.00 50.03 ? 464  ASP A OD1   1 
ATOM   2543  O  OD2   . ASP E 2 275 ? 52.629  72.547  48.789  1.00 50.10 ? 464  ASP A OD2   1 
ATOM   2544  N  N     . VAL E 2 276 ? 50.683  70.645  53.545  1.00 44.96 ? 465  VAL A N     1 
ATOM   2545  C  CA    . VAL E 2 276 ? 49.899  70.766  54.770  1.00 44.35 ? 465  VAL A CA    1 
ATOM   2546  C  C     . VAL E 2 276 ? 50.364  69.740  55.792  1.00 43.78 ? 465  VAL A C     1 
ATOM   2547  O  O     . VAL E 2 276 ? 50.249  68.532  55.580  1.00 42.94 ? 465  VAL A O     1 
ATOM   2548  C  CB    . VAL E 2 276 ? 48.381  70.567  54.516  1.00 44.96 ? 465  VAL A CB    1 
ATOM   2549  C  CG1   . VAL E 2 276 ? 47.850  71.662  53.584  1.00 45.00 ? 465  VAL A CG1   1 
ATOM   2550  C  CG2   . VAL E 2 276 ? 48.131  69.199  53.910  1.00 46.50 ? 465  VAL A CG2   1 
ATOM   2551  N  N     . LYS E 2 277 ? 50.918  70.228  56.896  1.00 43.26 ? 466  LYS A N     1 
ATOM   2552  C  CA    . LYS E 2 277 ? 51.382  69.338  57.942  1.00 43.53 ? 466  LYS A CA    1 
ATOM   2553  C  C     . LYS E 2 277 ? 50.115  68.824  58.626  1.00 42.88 ? 466  LYS A C     1 
ATOM   2554  O  O     . LYS E 2 277 ? 49.332  69.591  59.179  1.00 42.11 ? 466  LYS A O     1 
ATOM   2555  C  CB    . LYS E 2 277 ? 52.275  70.102  58.921  1.00 44.70 ? 466  LYS A CB    1 
ATOM   2556  C  CG    . LYS E 2 277 ? 53.292  69.240  59.661  1.00 47.14 ? 466  LYS A CG    1 
ATOM   2557  C  CD    . LYS E 2 277 ? 52.920  69.065  61.123  1.00 49.63 ? 466  LYS A CD    1 
ATOM   2558  C  CE    . LYS E 2 277 ? 54.057  68.429  61.927  1.00 50.96 ? 466  LYS A CE    1 
ATOM   2559  N  NZ    . LYS E 2 277 ? 54.387  67.038  61.491  1.00 51.43 ? 466  LYS A NZ    1 
ATOM   2560  N  N     . GLN E 2 278 ? 49.909  67.520  58.559  1.00 42.09 ? 467  GLN A N     1 
ATOM   2561  C  CA    . GLN E 2 278 ? 48.731  66.919  59.145  1.00 42.48 ? 467  GLN A CA    1 
ATOM   2562  C  C     . GLN E 2 278 ? 49.032  66.202  60.450  1.00 43.23 ? 467  GLN A C     1 
ATOM   2563  O  O     . GLN E 2 278 ? 50.001  65.447  60.557  1.00 43.21 ? 467  GLN A O     1 
ATOM   2564  C  CB    . GLN E 2 278 ? 48.124  65.930  58.157  1.00 40.77 ? 467  GLN A CB    1 
ATOM   2565  C  CG    . GLN E 2 278 ? 47.818  66.548  56.821  1.00 40.18 ? 467  GLN A CG    1 
ATOM   2566  C  CD    . GLN E 2 278 ? 47.631  65.513  55.741  1.00 39.15 ? 467  GLN A CD    1 
ATOM   2567  O  OE1   . GLN E 2 278 ? 46.787  64.625  55.852  1.00 39.81 ? 467  GLN A OE1   1 
ATOM   2568  N  NE2   . GLN E 2 278 ? 48.421  65.619  54.687  1.00 37.56 ? 467  GLN A NE2   1 
ATOM   2569  N  N     . THR E 2 279 ? 48.188  66.437  61.442  1.00 43.38 ? 468  THR A N     1 
ATOM   2570  C  CA    . THR E 2 279 ? 48.361  65.791  62.724  1.00 43.99 ? 468  THR A CA    1 
ATOM   2571  C  C     . THR E 2 279 ? 47.012  65.187  63.082  1.00 44.21 ? 468  THR A C     1 
ATOM   2572  O  O     . THR E 2 279 ? 45.981  65.831  62.923  1.00 44.02 ? 468  THR A O     1 
ATOM   2573  C  CB    . THR E 2 279 ? 48.809  66.819  63.794  1.00 44.25 ? 468  THR A CB    1 
ATOM   2574  O  OG1   . THR E 2 279 ? 49.992  67.490  63.337  1.00 43.90 ? 468  THR A OG1   1 
ATOM   2575  C  CG2   . THR E 2 279 ? 49.106  66.126  65.119  1.00 43.76 ? 468  THR A CG2   1 
ATOM   2576  N  N     . ILE E 2 280 ? 47.026  63.944  63.547  1.00 44.81 ? 469  ILE A N     1 
ATOM   2577  C  CA    . ILE E 2 280 ? 45.807  63.237  63.920  1.00 45.54 ? 469  ILE A CA    1 
ATOM   2578  C  C     . ILE E 2 280 ? 45.849  62.842  65.399  1.00 46.40 ? 469  ILE A C     1 
ATOM   2579  O  O     . ILE E 2 280 ? 46.746  62.108  65.824  1.00 46.03 ? 469  ILE A O     1 
ATOM   2580  C  CB    . ILE E 2 280 ? 45.651  61.949  63.082  1.00 45.86 ? 469  ILE A CB    1 
ATOM   2581  C  CG1   . ILE E 2 280 ? 45.806  62.269  61.594  1.00 45.50 ? 469  ILE A CG1   1 
ATOM   2582  C  CG2   . ILE E 2 280 ? 44.306  61.303  63.361  1.00 45.55 ? 469  ILE A CG2   1 
ATOM   2583  C  CD1   . ILE E 2 280 ? 44.824  63.283  61.082  1.00 44.68 ? 469  ILE A CD1   1 
ATOM   2584  N  N     . TYR E 2 281 ? 44.874  63.327  66.167  1.00 46.87 ? 470  TYR A N     1 
ATOM   2585  C  CA    . TYR E 2 281 ? 44.759  63.048  67.597  1.00 47.83 ? 470  TYR A CA    1 
ATOM   2586  C  C     . TYR E 2 281 ? 43.642  62.068  67.878  1.00 49.17 ? 470  TYR A C     1 
ATOM   2587  O  O     . TYR E 2 281 ? 42.562  62.182  67.303  1.00 49.46 ? 470  TYR A O     1 
ATOM   2588  C  CB    . TYR E 2 281 ? 44.429  64.322  68.363  1.00 48.52 ? 470  TYR A CB    1 
ATOM   2589  C  CG    . TYR E 2 281 ? 45.554  65.301  68.473  1.00 49.18 ? 470  TYR A CG    1 
ATOM   2590  C  CD1   . TYR E 2 281 ? 45.312  66.669  68.423  1.00 49.12 ? 470  TYR A CD1   1 
ATOM   2591  C  CD2   . TYR E 2 281 ? 46.863  64.864  68.661  1.00 49.99 ? 470  TYR A CD2   1 
ATOM   2592  C  CE1   . TYR E 2 281 ? 46.346  67.584  68.559  1.00 50.16 ? 470  TYR A CE1   1 
ATOM   2593  C  CE2   . TYR E 2 281 ? 47.907  65.769  68.800  1.00 50.62 ? 470  TYR A CE2   1 
ATOM   2594  C  CZ    . TYR E 2 281 ? 47.643  67.126  68.748  1.00 50.51 ? 470  TYR A CZ    1 
ATOM   2595  O  OH    . TYR E 2 281 ? 48.679  68.020  68.887  1.00 51.46 ? 470  TYR A OH    1 
ATOM   2596  N  N     . GLU E 2 282 ? 43.882  61.117  68.773  1.00 50.65 ? 471  GLU A N     1 
ATOM   2597  C  CA    . GLU E 2 282 ? 42.835  60.164  69.121  1.00 51.93 ? 471  GLU A CA    1 
ATOM   2598  C  C     . GLU E 2 282 ? 41.993  60.797  70.222  1.00 52.48 ? 471  GLU A C     1 
ATOM   2599  O  O     . GLU E 2 282 ? 42.375  60.787  71.385  1.00 53.00 ? 471  GLU A O     1 
ATOM   2600  C  CB    . GLU E 2 282 ? 43.426  58.849  69.623  1.00 51.84 ? 471  GLU A CB    1 
ATOM   2601  C  CG    . GLU E 2 282 ? 42.406  57.727  69.607  1.00 52.80 ? 471  GLU A CG    1 
ATOM   2602  C  CD    . GLU E 2 282 ? 42.930  56.437  70.191  1.00 53.36 ? 471  GLU A CD    1 
ATOM   2603  O  OE1   . GLU E 2 282 ? 43.104  56.376  71.426  1.00 53.53 ? 471  GLU A OE1   1 
ATOM   2604  O  OE2   . GLU E 2 282 ? 43.170  55.484  69.415  1.00 54.45 ? 471  GLU A OE2   1 
ATOM   2605  N  N     . VAL E 2 283 ? 40.848  61.356  69.852  1.00 53.48 ? 472  VAL A N     1 
ATOM   2606  C  CA    . VAL E 2 283 ? 39.984  62.013  70.825  1.00 54.06 ? 472  VAL A CA    1 
ATOM   2607  C  C     . VAL E 2 283 ? 38.588  61.403  70.886  1.00 55.35 ? 472  VAL A C     1 
ATOM   2608  O  O     . VAL E 2 283 ? 38.035  60.968  69.870  1.00 55.43 ? 472  VAL A O     1 
ATOM   2609  C  CB    . VAL E 2 283 ? 39.833  63.514  70.508  1.00 53.24 ? 472  VAL A CB    1 
ATOM   2610  C  CG1   . VAL E 2 283 ? 39.134  64.215  71.663  1.00 52.42 ? 472  VAL A CG1   1 
ATOM   2611  C  CG2   . VAL E 2 283 ? 41.195  64.130  70.225  1.00 51.46 ? 472  VAL A CG2   1 
ATOM   2612  N  N     . ASN E 2 284 ? 38.021  61.370  72.087  1.00 56.54 ? 473  ASN A N     1 
ATOM   2613  C  CA    . ASN E 2 284 ? 36.687  60.829  72.261  1.00 57.40 ? 473  ASN A CA    1 
ATOM   2614  C  C     . ASN E 2 284 ? 35.687  61.959  72.183  1.00 56.79 ? 473  ASN A C     1 
ATOM   2615  O  O     . ASN E 2 284 ? 36.010  63.110  72.483  1.00 56.52 ? 473  ASN A O     1 
ATOM   2616  C  CB    . ASN E 2 284 ? 36.568  60.104  73.598  1.00 59.49 ? 473  ASN A CB    1 
ATOM   2617  C  CG    . ASN E 2 284 ? 37.412  58.844  73.649  1.00 61.76 ? 473  ASN A CG    1 
ATOM   2618  O  OD1   . ASN E 2 284 ? 37.310  57.967  72.774  1.00 62.28 ? 473  ASN A OD1   1 
ATOM   2619  N  ND2   . ASN E 2 284 ? 38.255  58.743  74.679  1.00 62.58 ? 473  ASN A ND2   1 
ATOM   2620  N  N     . LYS E 2 285 ? 34.470  61.615  71.784  1.00 56.57 ? 474  LYS A N     1 
ATOM   2621  C  CA    . LYS E 2 285 ? 33.389  62.580  71.614  1.00 56.76 ? 474  LYS A CA    1 
ATOM   2622  C  C     . LYS E 2 285 ? 33.295  63.710  72.632  1.00 55.88 ? 474  LYS A C     1 
ATOM   2623  O  O     . LYS E 2 285 ? 33.205  64.876  72.259  1.00 55.64 ? 474  LYS A O     1 
ATOM   2624  C  CB    . LYS E 2 285 ? 32.046  61.850  71.549  1.00 57.59 ? 474  LYS A CB    1 
ATOM   2625  C  CG    . LYS E 2 285 ? 30.854  62.774  71.361  1.00 59.59 ? 474  LYS A CG    1 
ATOM   2626  C  CD    . LYS E 2 285 ? 29.603  61.975  71.045  1.00 61.71 ? 474  LYS A CD    1 
ATOM   2627  C  CE    . LYS E 2 285 ? 28.371  62.860  70.963  1.00 62.23 ? 474  LYS A CE    1 
ATOM   2628  N  NZ    . LYS E 2 285 ? 27.170  62.043  70.628  1.00 63.44 ? 474  LYS A NZ    1 
ATOM   2629  N  N     . TYR E 2 286 ? 33.319  63.382  73.915  1.00 55.47 ? 475  TYR A N     1 
ATOM   2630  C  CA    . TYR E 2 286 ? 33.191  64.423  74.920  1.00 54.74 ? 475  TYR A CA    1 
ATOM   2631  C  C     . TYR E 2 286 ? 34.498  65.072  75.326  1.00 53.11 ? 475  TYR A C     1 
ATOM   2632  O  O     . TYR E 2 286 ? 34.520  66.001  76.132  1.00 53.05 ? 475  TYR A O     1 
ATOM   2633  C  CB    . TYR E 2 286 ? 32.431  63.872  76.128  1.00 56.77 ? 475  TYR A CB    1 
ATOM   2634  C  CG    . TYR E 2 286 ? 31.059  63.383  75.722  1.00 58.82 ? 475  TYR A CG    1 
ATOM   2635  C  CD1   . TYR E 2 286 ? 30.870  62.076  75.266  1.00 60.07 ? 475  TYR A CD1   1 
ATOM   2636  C  CD2   . TYR E 2 286 ? 29.971  64.260  75.678  1.00 59.62 ? 475  TYR A CD2   1 
ATOM   2637  C  CE1   . TYR E 2 286 ? 29.635  61.653  74.768  1.00 61.16 ? 475  TYR A CE1   1 
ATOM   2638  C  CE2   . TYR E 2 286 ? 28.731  63.850  75.182  1.00 60.90 ? 475  TYR A CE2   1 
ATOM   2639  C  CZ    . TYR E 2 286 ? 28.572  62.549  74.727  1.00 61.65 ? 475  TYR A CZ    1 
ATOM   2640  O  OH    . TYR E 2 286 ? 27.359  62.147  74.211  1.00 62.63 ? 475  TYR A OH    1 
ATOM   2641  N  N     . ALA E 2 287 ? 35.591  64.599  74.740  1.00 51.43 ? 476  ALA A N     1 
ATOM   2642  C  CA    . ALA E 2 287 ? 36.902  65.166  75.038  1.00 49.11 ? 476  ALA A CA    1 
ATOM   2643  C  C     . ALA E 2 287 ? 37.281  66.162  73.945  1.00 47.12 ? 476  ALA A C     1 
ATOM   2644  O  O     . ALA E 2 287 ? 38.257  66.895  74.080  1.00 45.73 ? 476  ALA A O     1 
ATOM   2645  C  CB    . ALA E 2 287 ? 37.956  64.048  75.132  1.00 49.06 ? 476  ALA A CB    1 
ATOM   2646  N  N     . LYS E 2 288 ? 36.487  66.189  72.874  1.00 45.73 ? 477  LYS A N     1 
ATOM   2647  C  CA    . LYS E 2 288 ? 36.736  67.069  71.730  1.00 44.13 ? 477  LYS A CA    1 
ATOM   2648  C  C     . LYS E 2 288 ? 36.664  68.565  71.975  1.00 43.74 ? 477  LYS A C     1 
ATOM   2649  O  O     . LYS E 2 288 ? 37.515  69.305  71.490  1.00 43.62 ? 477  LYS A O     1 
ATOM   2650  C  CB    . LYS E 2 288 ? 35.789  66.742  70.573  1.00 42.75 ? 477  LYS A CB    1 
ATOM   2651  C  CG    . LYS E 2 288 ? 36.088  65.461  69.835  1.00 41.84 ? 477  LYS A CG    1 
ATOM   2652  C  CD    . LYS E 2 288 ? 35.196  65.342  68.606  1.00 41.65 ? 477  LYS A CD    1 
ATOM   2653  C  CE    . LYS E 2 288 ? 35.383  64.006  67.898  1.00 41.13 ? 477  LYS A CE    1 
ATOM   2654  N  NZ    . LYS E 2 288 ? 34.448  63.842  66.743  1.00 40.95 ? 477  LYS A NZ    1 
ATOM   2655  N  N     . ARG E 2 289 ? 35.664  69.030  72.715  1.00 43.87 ? 478  ARG A N     1 
ATOM   2656  C  CA    . ARG E 2 289 ? 35.553  70.467  72.912  1.00 44.69 ? 478  ARG A CA    1 
ATOM   2657  C  C     . ARG E 2 289 ? 36.680  71.084  73.734  1.00 43.87 ? 478  ARG A C     1 
ATOM   2658  O  O     . ARG E 2 289 ? 37.122  72.187  73.436  1.00 42.58 ? 478  ARG A O     1 
ATOM   2659  C  CB    . ARG E 2 289 ? 34.192  70.842  73.511  1.00 46.31 ? 478  ARG A CB    1 
ATOM   2660  C  CG    . ARG E 2 289 ? 33.785  72.258  73.132  1.00 47.47 ? 478  ARG A CG    1 
ATOM   2661  C  CD    . ARG E 2 289 ? 32.475  72.680  73.757  1.00 49.85 ? 478  ARG A CD    1 
ATOM   2662  N  NE    . ARG E 2 289 ? 31.381  71.761  73.496  1.00 51.34 ? 478  ARG A NE    1 
ATOM   2663  C  CZ    . ARG E 2 289 ? 30.818  71.001  74.428  1.00 51.80 ? 478  ARG A CZ    1 
ATOM   2664  N  NH1   . ARG E 2 289 ? 31.251  71.052  75.680  1.00 52.45 ? 478  ARG A NH1   1 
ATOM   2665  N  NH2   . ARG E 2 289 ? 29.817  70.197  74.111  1.00 52.09 ? 478  ARG A NH2   1 
ATOM   2666  N  N     . SER E 2 290 ? 37.158  70.393  74.763  1.00 44.12 ? 479  SER A N     1 
ATOM   2667  C  CA    . SER E 2 290 ? 38.248  70.978  75.531  1.00 45.02 ? 479  SER A CA    1 
ATOM   2668  C  C     . SER E 2 290 ? 39.478  70.979  74.635  1.00 44.20 ? 479  SER A C     1 
ATOM   2669  O  O     . SER E 2 290 ? 40.203  71.980  74.572  1.00 44.69 ? 479  SER A O     1 
ATOM   2670  C  CB    . SER E 2 290 ? 38.509  70.211  76.836  1.00 46.14 ? 479  SER A CB    1 
ATOM   2671  O  OG    . SER E 2 290 ? 38.897  68.874  76.604  1.00 48.43 ? 479  SER A OG    1 
ATOM   2672  N  N     . LYS E 2 291 ? 39.697  69.879  73.913  1.00 43.29 ? 480  LYS A N     1 
ATOM   2673  C  CA    . LYS E 2 291 ? 40.836  69.807  72.997  1.00 43.01 ? 480  LYS A CA    1 
ATOM   2674  C  C     . LYS E 2 291 ? 40.807  71.005  72.041  1.00 41.60 ? 480  LYS A C     1 
ATOM   2675  O  O     . LYS E 2 291 ? 41.827  71.636  71.806  1.00 40.48 ? 480  LYS A O     1 
ATOM   2676  C  CB    . LYS E 2 291 ? 40.802  68.521  72.176  1.00 44.41 ? 480  LYS A CB    1 
ATOM   2677  C  CG    . LYS E 2 291 ? 42.170  67.867  72.006  1.00 47.24 ? 480  LYS A CG    1 
ATOM   2678  C  CD    . LYS E 2 291 ? 43.238  68.886  71.659  1.00 48.87 ? 480  LYS A CD    1 
ATOM   2679  C  CE    . LYS E 2 291 ? 44.650  68.300  71.803  1.00 51.33 ? 480  LYS A CE    1 
ATOM   2680  N  NZ    . LYS E 2 291 ? 45.023  67.933  73.215  1.00 52.15 ? 480  LYS A NZ    1 
ATOM   2681  N  N     . LEU E 2 292 ? 39.626  71.306  71.505  1.00 40.85 ? 481  LEU A N     1 
ATOM   2682  C  CA    . LEU E 2 292 ? 39.435  72.418  70.576  1.00 40.42 ? 481  LEU A CA    1 
ATOM   2683  C  C     . LEU E 2 292 ? 39.833  73.753  71.198  1.00 40.78 ? 481  LEU A C     1 
ATOM   2684  O  O     . LEU E 2 292 ? 40.606  74.497  70.600  1.00 40.94 ? 481  LEU A O     1 
ATOM   2685  C  CB    . LEU E 2 292 ? 37.977  72.498  70.128  1.00 39.65 ? 481  LEU A CB    1 
ATOM   2686  C  CG    . LEU E 2 292 ? 37.659  73.070  68.744  1.00 40.01 ? 481  LEU A CG    1 
ATOM   2687  C  CD1   . LEU E 2 292 ? 36.217  73.568  68.725  1.00 39.06 ? 481  LEU A CD1   1 
ATOM   2688  C  CD2   . LEU E 2 292 ? 38.595  74.198  68.394  1.00 39.89 ? 481  LEU A CD2   1 
ATOM   2689  N  N     . ILE E 2 293 ? 39.296  74.073  72.378  1.00 41.13 ? 482  ILE A N     1 
ATOM   2690  C  CA    . ILE E 2 293 ? 39.652  75.333  73.042  1.00 41.84 ? 482  ILE A CA    1 
ATOM   2691  C  C     . ILE E 2 293 ? 41.145  75.301  73.389  1.00 41.27 ? 482  ILE A C     1 
ATOM   2692  O  O     . ILE E 2 293 ? 41.827  76.317  73.303  1.00 40.15 ? 482  ILE A O     1 
ATOM   2693  C  CB    . ILE E 2 293 ? 38.833  75.579  74.347  1.00 42.61 ? 482  ILE A CB    1 
ATOM   2694  C  CG1   . ILE E 2 293 ? 37.406  76.021  74.011  1.00 43.64 ? 482  ILE A CG1   1 
ATOM   2695  C  CG2   . ILE E 2 293 ? 39.481  76.675  75.176  1.00 43.15 ? 482  ILE A CG2   1 
ATOM   2696  C  CD1   . ILE E 2 293 ? 36.540  74.923  73.461  1.00 43.79 ? 482  ILE A CD1   1 
ATOM   2697  N  N     . GLU E 2 294 ? 41.637  74.126  73.780  1.00 41.53 ? 483  GLU A N     1 
ATOM   2698  C  CA    . GLU E 2 294 ? 43.055  73.949  74.105  1.00 42.68 ? 483  GLU A CA    1 
ATOM   2699  C  C     . GLU E 2 294 ? 43.846  74.476  72.904  1.00 41.51 ? 483  GLU A C     1 
ATOM   2700  O  O     . GLU E 2 294 ? 44.720  75.343  73.034  1.00 40.90 ? 483  GLU A O     1 
ATOM   2701  C  CB    . GLU E 2 294 ? 43.373  72.458  74.295  1.00 45.59 ? 483  GLU A CB    1 
ATOM   2702  C  CG    . GLU E 2 294 ? 44.478  72.144  75.306  1.00 49.77 ? 483  GLU A CG    1 
ATOM   2703  C  CD    . GLU E 2 294 ? 45.206  70.833  74.994  1.00 52.33 ? 483  GLU A CD    1 
ATOM   2704  O  OE1   . GLU E 2 294 ? 46.086  70.848  74.101  1.00 53.72 ? 483  GLU A OE1   1 
ATOM   2705  O  OE2   . GLU E 2 294 ? 44.896  69.791  75.625  1.00 53.12 ? 483  GLU A OE2   1 
ATOM   2706  N  N     . ILE E 2 295 ? 43.510  73.949  71.727  1.00 39.66 ? 484  ILE A N     1 
ATOM   2707  C  CA    . ILE E 2 295 ? 44.162  74.342  70.487  1.00 38.16 ? 484  ILE A CA    1 
ATOM   2708  C  C     . ILE E 2 295 ? 43.910  75.809  70.152  1.00 38.46 ? 484  ILE A C     1 
ATOM   2709  O  O     . ILE E 2 295 ? 44.853  76.566  69.940  1.00 39.28 ? 484  ILE A O     1 
ATOM   2710  C  CB    . ILE E 2 295 ? 43.688  73.442  69.315  1.00 37.12 ? 484  ILE A CB    1 
ATOM   2711  C  CG1   . ILE E 2 295 ? 44.260  72.031  69.499  1.00 35.88 ? 484  ILE A CG1   1 
ATOM   2712  C  CG2   . ILE E 2 295 ? 44.089  74.053  67.984  1.00 36.22 ? 484  ILE A CG2   1 
ATOM   2713  C  CD1   . ILE E 2 295 ? 43.629  70.984  68.648  1.00 35.11 ? 484  ILE A CD1   1 
ATOM   2714  N  N     . LEU E 2 296 ? 42.648  76.219  70.116  1.00 38.41 ? 485  LEU A N     1 
ATOM   2715  C  CA    . LEU E 2 296 ? 42.328  77.603  69.790  1.00 39.50 ? 485  LEU A CA    1 
ATOM   2716  C  C     . LEU E 2 296 ? 42.953  78.582  70.782  1.00 40.68 ? 485  LEU A C     1 
ATOM   2717  O  O     . LEU E 2 296 ? 43.381  79.669  70.388  1.00 40.05 ? 485  LEU A O     1 
ATOM   2718  C  CB    . LEU E 2 296 ? 40.804  77.821  69.741  1.00 38.58 ? 485  LEU A CB    1 
ATOM   2719  C  CG    . LEU E 2 296 ? 39.972  77.219  68.601  1.00 38.17 ? 485  LEU A CG    1 
ATOM   2720  C  CD1   . LEU E 2 296 ? 38.523  77.690  68.728  1.00 36.10 ? 485  LEU A CD1   1 
ATOM   2721  C  CD2   . LEU E 2 296 ? 40.538  77.661  67.248  1.00 37.70 ? 485  LEU A CD2   1 
ATOM   2722  N  N     . SER E 2 297 ? 42.992  78.210  72.063  1.00 41.98 ? 486  SER A N     1 
ATOM   2723  C  CA    . SER E 2 297 ? 43.579  79.083  73.083  1.00 44.30 ? 486  SER A CA    1 
ATOM   2724  C  C     . SER E 2 297 ? 45.056  79.297  72.788  1.00 45.86 ? 486  SER A C     1 
ATOM   2725  O  O     . SER E 2 297 ? 45.577  80.402  72.940  1.00 46.36 ? 486  SER A O     1 
ATOM   2726  C  CB    . SER E 2 297 ? 43.408  78.489  74.480  1.00 43.64 ? 486  SER A CB    1 
ATOM   2727  O  OG    . SER E 2 297 ? 42.087  78.680  74.948  1.00 43.72 ? 486  SER A OG    1 
ATOM   2728  N  N     . GLU E 2 298 ? 45.723  78.229  72.360  1.00 47.94 ? 487  GLU A N     1 
ATOM   2729  C  CA    . GLU E 2 298 ? 47.134  78.294  71.996  1.00 49.40 ? 487  GLU A CA    1 
ATOM   2730  C  C     . GLU E 2 298 ? 47.292  79.265  70.821  1.00 50.11 ? 487  GLU A C     1 
ATOM   2731  O  O     . GLU E 2 298 ? 48.265  80.012  70.753  1.00 49.99 ? 487  GLU A O     1 
ATOM   2732  C  CB    . GLU E 2 298 ? 47.628  76.898  71.605  1.00 50.63 ? 487  GLU A CB    1 
ATOM   2733  C  CG    . GLU E 2 298 ? 48.967  76.854  70.892  1.00 51.65 ? 487  GLU A CG    1 
ATOM   2734  C  CD    . GLU E 2 298 ? 49.366  75.433  70.495  1.00 53.16 ? 487  GLU A CD    1 
ATOM   2735  O  OE1   . GLU E 2 298 ? 48.570  74.734  69.822  1.00 53.78 ? 487  GLU A OE1   1 
ATOM   2736  O  OE2   . GLU E 2 298 ? 50.483  75.013  70.853  1.00 53.37 ? 487  GLU A OE2   1 
ATOM   2737  N  N     . GLN E 2 299 ? 46.320  79.258  69.909  1.00 50.82 ? 488  GLN A N     1 
ATOM   2738  C  CA    . GLN E 2 299 ? 46.333  80.137  68.732  1.00 51.68 ? 488  GLN A CA    1 
ATOM   2739  C  C     . GLN E 2 299 ? 45.018  79.980  67.956  1.00 51.67 ? 488  GLN A C     1 
ATOM   2740  O  O     . GLN E 2 299 ? 44.708  78.882  67.488  1.00 52.07 ? 488  GLN A O     1 
ATOM   2741  C  CB    . GLN E 2 299 ? 47.507  79.775  67.831  1.00 52.49 ? 488  GLN A CB    1 
ATOM   2742  C  CG    . GLN E 2 299 ? 47.753  80.765  66.717  1.00 54.88 ? 488  GLN A CG    1 
ATOM   2743  C  CD    . GLN E 2 299 ? 49.159  80.649  66.170  1.00 55.90 ? 488  GLN A CD    1 
ATOM   2744  O  OE1   . GLN E 2 299 ? 49.538  79.618  65.611  1.00 56.36 ? 488  GLN A OE1   1 
ATOM   2745  N  NE2   . GLN E 2 299 ? 49.951  81.706  66.346  1.00 57.53 ? 488  GLN A NE2   1 
ATOM   2746  N  N     . ALA E 2 300 ? 44.270  81.076  67.797  1.00 50.75 ? 489  ALA A N     1 
ATOM   2747  C  CA    . ALA E 2 300 ? 42.967  81.028  67.129  1.00 49.73 ? 489  ALA A CA    1 
ATOM   2748  C  C     . ALA E 2 300 ? 42.802  81.722  65.778  1.00 49.50 ? 489  ALA A C     1 
ATOM   2749  O  O     . ALA E 2 300 ? 41.888  81.397  65.031  1.00 49.35 ? 489  ALA A O     1 
ATOM   2750  C  CB    . ALA E 2 300 ? 41.903  81.544  68.082  1.00 48.86 ? 489  ALA A CB    1 
ATOM   2751  N  N     . ASP E 2 301 ? 43.658  82.682  65.458  1.00 49.35 ? 490  ASP A N     1 
ATOM   2752  C  CA    . ASP E 2 301 ? 43.536  83.389  64.184  1.00 48.86 ? 490  ASP A CA    1 
ATOM   2753  C  C     . ASP E 2 301 ? 43.620  82.495  62.945  1.00 47.07 ? 490  ASP A C     1 
ATOM   2754  O  O     . ASP E 2 301 ? 44.407  81.550  62.891  1.00 47.23 ? 490  ASP A O     1 
ATOM   2755  C  CB    . ASP E 2 301 ? 44.595  84.490  64.104  1.00 51.47 ? 490  ASP A CB    1 
ATOM   2756  C  CG    . ASP E 2 301 ? 44.218  85.713  64.919  1.00 53.74 ? 490  ASP A CG    1 
ATOM   2757  O  OD1   . ASP E 2 301 ? 43.658  85.533  66.033  1.00 54.35 ? 490  ASP A OD1   1 
ATOM   2758  O  OD2   . ASP E 2 301 ? 44.486  86.849  64.442  1.00 55.16 ? 490  ASP A OD2   1 
ATOM   2759  N  N     . GLY E 2 302 ? 42.789  82.803  61.954  1.00 44.87 ? 491  GLY A N     1 
ATOM   2760  C  CA    . GLY E 2 302 ? 42.771  82.044  60.714  1.00 42.32 ? 491  GLY A CA    1 
ATOM   2761  C  C     . GLY E 2 302 ? 42.509  80.550  60.815  1.00 40.41 ? 491  GLY A C     1 
ATOM   2762  O  O     . GLY E 2 302 ? 43.187  79.750  60.169  1.00 40.67 ? 491  GLY A O     1 
ATOM   2763  N  N     . THR E 2 303 ? 41.526  80.152  61.610  1.00 38.56 ? 492  THR A N     1 
ATOM   2764  C  CA    . THR E 2 303 ? 41.232  78.732  61.740  1.00 37.18 ? 492  THR A CA    1 
ATOM   2765  C  C     . THR E 2 303 ? 39.791  78.396  61.342  1.00 35.50 ? 492  THR A C     1 
ATOM   2766  O  O     . THR E 2 303 ? 38.851  79.141  61.637  1.00 35.20 ? 492  THR A O     1 
ATOM   2767  C  CB    . THR E 2 303 ? 41.511  78.243  63.186  1.00 38.06 ? 492  THR A CB    1 
ATOM   2768  O  OG1   . THR E 2 303 ? 41.066  76.880  63.350  1.00 38.57 ? 492  THR A OG1   1 
ATOM   2769  C  CG2   . THR E 2 303 ? 40.812  79.128  64.171  1.00 39.35 ? 492  THR A CG2   1 
ATOM   2770  N  N     . ILE E 2 304 ? 39.638  77.285  60.631  1.00 33.01 ? 493  ILE A N     1 
ATOM   2771  C  CA    . ILE E 2 304 ? 38.330  76.822  60.208  1.00 30.28 ? 493  ILE A CA    1 
ATOM   2772  C  C     . ILE E 2 304 ? 38.149  75.442  60.832  1.00 29.26 ? 493  ILE A C     1 
ATOM   2773  O  O     . ILE E 2 304 ? 39.008  74.573  60.702  1.00 28.35 ? 493  ILE A O     1 
ATOM   2774  C  CB    . ILE E 2 304 ? 38.213  76.751  58.650  1.00 30.26 ? 493  ILE A CB    1 
ATOM   2775  C  CG1   . ILE E 2 304 ? 36.771  76.427  58.247  1.00 29.39 ? 493  ILE A CG1   1 
ATOM   2776  C  CG2   . ILE E 2 304 ? 39.167  75.704  58.085  1.00 29.47 ? 493  ILE A CG2   1 
ATOM   2777  C  CD1   . ILE E 2 304 ? 36.559  76.321  56.749  1.00 29.11 ? 493  ILE A CD1   1 
ATOM   2778  N  N     . VAL E 2 305 ? 37.037  75.267  61.542  1.00 28.01 ? 494  VAL A N     1 
ATOM   2779  C  CA    . VAL E 2 305 ? 36.728  74.006  62.196  1.00 26.63 ? 494  VAL A CA    1 
ATOM   2780  C  C     . VAL E 2 305 ? 35.576  73.373  61.436  1.00 26.70 ? 494  VAL A C     1 
ATOM   2781  O  O     . VAL E 2 305 ? 34.526  74.001  61.268  1.00 26.20 ? 494  VAL A O     1 
ATOM   2782  C  CB    . VAL E 2 305 ? 36.300  74.230  63.658  1.00 25.58 ? 494  VAL A CB    1 
ATOM   2783  C  CG1   . VAL E 2 305 ? 36.079  72.904  64.342  1.00 24.37 ? 494  VAL A CG1   1 
ATOM   2784  C  CG2   . VAL E 2 305 ? 37.362  75.043  64.385  1.00 25.44 ? 494  VAL A CG2   1 
ATOM   2785  N  N     . PHE E 2 306 ? 35.803  72.148  60.962  1.00 25.33 ? 495  PHE A N     1 
ATOM   2786  C  CA    . PHE E 2 306 ? 34.824  71.375  60.205  1.00 25.69 ? 495  PHE A CA    1 
ATOM   2787  C  C     . PHE E 2 306 ? 34.080  70.430  61.150  1.00 26.60 ? 495  PHE A C     1 
ATOM   2788  O  O     . PHE E 2 306 ? 34.702  69.675  61.903  1.00 27.64 ? 495  PHE A O     1 
ATOM   2789  C  CB    . PHE E 2 306 ? 35.525  70.563  59.086  1.00 22.28 ? 495  PHE A CB    1 
ATOM   2790  C  CG    . PHE E 2 306 ? 35.871  71.385  57.858  1.00 22.09 ? 495  PHE A CG    1 
ATOM   2791  C  CD1   . PHE E 2 306 ? 34.867  71.865  57.011  1.00 22.73 ? 495  PHE A CD1   1 
ATOM   2792  C  CD2   . PHE E 2 306 ? 37.197  71.715  57.561  1.00 21.32 ? 495  PHE A CD2   1 
ATOM   2793  C  CE1   . PHE E 2 306 ? 35.181  72.670  55.886  1.00 21.19 ? 495  PHE A CE1   1 
ATOM   2794  C  CE2   . PHE E 2 306 ? 37.519  72.517  56.441  1.00 19.94 ? 495  PHE A CE2   1 
ATOM   2795  C  CZ    . PHE E 2 306 ? 36.510  72.989  55.613  1.00 21.53 ? 495  PHE A CZ    1 
ATOM   2796  N  N     . VAL E 2 307 ? 32.754  70.491  61.113  1.00 26.62 ? 496  VAL A N     1 
ATOM   2797  C  CA    . VAL E 2 307 ? 31.912  69.644  61.945  1.00 28.63 ? 496  VAL A CA    1 
ATOM   2798  C  C     . VAL E 2 307 ? 31.000  68.843  61.021  1.00 28.93 ? 496  VAL A C     1 
ATOM   2799  O  O     . VAL E 2 307 ? 30.851  69.179  59.849  1.00 28.43 ? 496  VAL A O     1 
ATOM   2800  C  CB    . VAL E 2 307 ? 31.043  70.469  62.927  1.00 29.48 ? 496  VAL A CB    1 
ATOM   2801  C  CG1   . VAL E 2 307 ? 31.929  71.297  63.838  1.00 30.64 ? 496  VAL A CG1   1 
ATOM   2802  C  CG2   . VAL E 2 307 ? 30.092  71.381  62.156  1.00 31.21 ? 496  VAL A CG2   1 
ATOM   2803  N  N     . GLU E 2 308 ? 30.380  67.796  61.558  1.00 29.67 ? 497  GLU A N     1 
ATOM   2804  C  CA    . GLU E 2 308 ? 29.528  66.926  60.759  1.00 30.16 ? 497  GLU A CA    1 
ATOM   2805  C  C     . GLU E 2 308 ? 28.158  67.443  60.354  1.00 29.86 ? 497  GLU A C     1 
ATOM   2806  O  O     . GLU E 2 308 ? 27.761  67.285  59.195  1.00 30.80 ? 497  GLU A O     1 
ATOM   2807  C  CB    . GLU E 2 308 ? 29.348  65.588  61.466  1.00 31.09 ? 497  GLU A CB    1 
ATOM   2808  C  CG    . GLU E 2 308 ? 28.431  64.607  60.745  1.00 35.18 ? 497  GLU A CG    1 
ATOM   2809  C  CD    . GLU E 2 308 ? 28.873  64.303  59.318  1.00 38.63 ? 497  GLU A CD    1 
ATOM   2810  O  OE1   . GLU E 2 308 ? 30.051  63.932  59.108  1.00 40.50 ? 497  GLU A OE1   1 
ATOM   2811  O  OE2   . GLU E 2 308 ? 28.040  64.428  58.392  1.00 40.39 ? 497  GLU A OE2   1 
ATOM   2812  N  N     . THR E 2 309 ? 27.434  68.058  61.282  1.00 27.80 ? 498  THR A N     1 
ATOM   2813  C  CA    . THR E 2 309 ? 26.078  68.516  60.984  1.00 27.01 ? 498  THR A CA    1 
ATOM   2814  C  C     . THR E 2 309 ? 25.886  70.012  61.101  1.00 26.10 ? 498  THR A C     1 
ATOM   2815  O  O     . THR E 2 309 ? 26.650  70.697  61.778  1.00 25.55 ? 498  THR A O     1 
ATOM   2816  C  CB    . THR E 2 309 ? 25.040  67.910  61.956  1.00 27.77 ? 498  THR A CB    1 
ATOM   2817  O  OG1   . THR E 2 309 ? 25.196  68.536  63.238  1.00 28.12 ? 498  THR A OG1   1 
ATOM   2818  C  CG2   . THR E 2 309 ? 25.224  66.399  62.114  1.00 27.42 ? 498  THR A CG2   1 
ATOM   2819  N  N     . LYS E 2 310 ? 24.819  70.493  60.472  1.00 24.87 ? 499  LYS A N     1 
ATOM   2820  C  CA    . LYS E 2 310 ? 24.467  71.901  60.518  1.00 25.19 ? 499  LYS A CA    1 
ATOM   2821  C  C     . LYS E 2 310 ? 24.199  72.325  61.964  1.00 25.04 ? 499  LYS A C     1 
ATOM   2822  O  O     . LYS E 2 310 ? 24.720  73.340  62.422  1.00 25.18 ? 499  LYS A O     1 
ATOM   2823  C  CB    . LYS E 2 310 ? 23.235  72.160  59.654  1.00 25.02 ? 499  LYS A CB    1 
ATOM   2824  C  CG    . LYS E 2 310 ? 23.510  72.074  58.157  1.00 26.84 ? 499  LYS A CG    1 
ATOM   2825  C  CD    . LYS E 2 310 ? 22.245  72.298  57.326  1.00 27.71 ? 499  LYS A CD    1 
ATOM   2826  C  CE    . LYS E 2 310 ? 21.206  71.222  57.623  1.00 28.91 ? 499  LYS A CE    1 
ATOM   2827  N  NZ    . LYS E 2 310 ? 20.115  71.218  56.609  1.00 30.36 ? 499  LYS A NZ    1 
ATOM   2828  N  N     . ARG E 2 311 ? 23.389  71.549  62.677  1.00 24.80 ? 500  ARG A N     1 
ATOM   2829  C  CA    . ARG E 2 311 ? 23.087  71.857  64.073  1.00 26.46 ? 500  ARG A CA    1 
ATOM   2830  C  C     . ARG E 2 311 ? 24.371  71.882  64.892  1.00 26.26 ? 500  ARG A C     1 
ATOM   2831  O  O     . ARG E 2 311 ? 24.530  72.718  65.779  1.00 27.17 ? 500  ARG A O     1 
ATOM   2832  C  CB    . ARG E 2 311 ? 22.098  70.833  64.642  1.00 27.28 ? 500  ARG A CB    1 
ATOM   2833  C  CG    . ARG E 2 311 ? 20.674  71.059  64.149  1.00 29.46 ? 500  ARG A CG    1 
ATOM   2834  C  CD    . ARG E 2 311 ? 19.748  69.926  64.543  1.00 32.49 ? 500  ARG A CD    1 
ATOM   2835  N  NE    . ARG E 2 311 ? 19.657  69.740  65.995  1.00 34.59 ? 500  ARG A NE    1 
ATOM   2836  C  CZ    . ARG E 2 311 ? 20.088  68.656  66.636  1.00 34.50 ? 500  ARG A CZ    1 
ATOM   2837  N  NH1   . ARG E 2 311 ? 20.649  67.660  65.957  1.00 35.45 ? 500  ARG A NH1   1 
ATOM   2838  N  NH2   . ARG E 2 311 ? 19.934  68.556  67.949  1.00 35.48 ? 500  ARG A NH2   1 
ATOM   2839  N  N     . GLY E 2 312 ? 25.287  70.966  64.589  1.00 26.56 ? 501  GLY A N     1 
ATOM   2840  C  CA    . GLY E 2 312 ? 26.567  70.940  65.282  1.00 27.10 ? 501  GLY A CA    1 
ATOM   2841  C  C     . GLY E 2 312 ? 27.384  72.209  65.053  1.00 27.50 ? 501  GLY A C     1 
ATOM   2842  O  O     . GLY E 2 312 ? 27.998  72.748  65.981  1.00 28.04 ? 501  GLY A O     1 
ATOM   2843  N  N     . ALA E 2 313 ? 27.404  72.705  63.822  1.00 27.96 ? 502  ALA A N     1 
ATOM   2844  C  CA    . ALA E 2 313 ? 28.166  73.917  63.532  1.00 29.15 ? 502  ALA A CA    1 
ATOM   2845  C  C     . ALA E 2 313 ? 27.605  75.096  64.310  1.00 30.42 ? 502  ALA A C     1 
ATOM   2846  O  O     . ALA E 2 313 ? 28.354  75.882  64.902  1.00 31.83 ? 502  ALA A O     1 
ATOM   2847  C  CB    . ALA E 2 313 ? 28.141  74.229  62.032  1.00 28.14 ? 502  ALA A CB    1 
ATOM   2848  N  N     . ASP E 2 314 ? 26.285  75.226  64.316  1.00 31.68 ? 503  ASP A N     1 
ATOM   2849  C  CA    . ASP E 2 314 ? 25.672  76.332  65.027  1.00 33.66 ? 503  ASP A CA    1 
ATOM   2850  C  C     . ASP E 2 314 ? 25.893  76.250  66.536  1.00 31.76 ? 503  ASP A C     1 
ATOM   2851  O  O     . ASP E 2 314 ? 26.223  77.251  67.171  1.00 31.85 ? 503  ASP A O     1 
ATOM   2852  C  CB    . ASP E 2 314 ? 24.183  76.416  64.712  1.00 37.54 ? 503  ASP A CB    1 
ATOM   2853  C  CG    . ASP E 2 314 ? 23.781  77.800  64.256  1.00 42.50 ? 503  ASP A CG    1 
ATOM   2854  O  OD1   . ASP E 2 314 ? 24.031  78.146  63.075  1.00 43.63 ? 503  ASP A OD1   1 
ATOM   2855  O  OD2   . ASP E 2 314 ? 23.243  78.563  65.096  1.00 46.77 ? 503  ASP A OD2   1 
ATOM   2856  N  N     . PHE E 2 315 ? 25.729  75.062  67.103  1.00 30.31 ? 504  PHE A N     1 
ATOM   2857  C  CA    . PHE E 2 315 ? 25.945  74.878  68.532  1.00 29.26 ? 504  PHE A CA    1 
ATOM   2858  C  C     . PHE E 2 315 ? 27.379  75.246  68.914  1.00 27.77 ? 504  PHE A C     1 
ATOM   2859  O  O     . PHE E 2 315 ? 27.598  75.977  69.871  1.00 27.27 ? 504  PHE A O     1 
ATOM   2860  C  CB    . PHE E 2 315 ? 25.695  73.417  68.933  1.00 30.19 ? 504  PHE A CB    1 
ATOM   2861  C  CG    . PHE E 2 315 ? 26.008  73.123  70.379  1.00 32.03 ? 504  PHE A CG    1 
ATOM   2862  C  CD1   . PHE E 2 315 ? 25.054  73.331  71.371  1.00 31.96 ? 504  PHE A CD1   1 
ATOM   2863  C  CD2   . PHE E 2 315 ? 27.270  72.664  70.751  1.00 32.11 ? 504  PHE A CD2   1 
ATOM   2864  C  CE1   . PHE E 2 315 ? 25.349  73.084  72.717  1.00 33.76 ? 504  PHE A CE1   1 
ATOM   2865  C  CE2   . PHE E 2 315 ? 27.576  72.417  72.093  1.00 33.54 ? 504  PHE A CE2   1 
ATOM   2866  C  CZ    . PHE E 2 315 ? 26.614  72.627  73.080  1.00 33.12 ? 504  PHE A CZ    1 
ATOM   2867  N  N     . LEU E 2 316 ? 28.351  74.742  68.163  1.00 26.71 ? 505  LEU A N     1 
ATOM   2868  C  CA    . LEU E 2 316 ? 29.755  75.002  68.480  1.00 27.45 ? 505  LEU A CA    1 
ATOM   2869  C  C     . LEU E 2 316 ? 30.141  76.460  68.297  1.00 27.90 ? 505  LEU A C     1 
ATOM   2870  O  O     . LEU E 2 316 ? 30.907  77.001  69.087  1.00 26.96 ? 505  LEU A O     1 
ATOM   2871  C  CB    . LEU E 2 316 ? 30.677  74.089  67.649  1.00 27.35 ? 505  LEU A CB    1 
ATOM   2872  C  CG    . LEU E 2 316 ? 32.201  74.249  67.755  1.00 28.40 ? 505  LEU A CG    1 
ATOM   2873  C  CD1   . LEU E 2 316 ? 32.629  74.180  69.216  1.00 28.46 ? 505  LEU A CD1   1 
ATOM   2874  C  CD2   . LEU E 2 316 ? 32.899  73.145  66.968  1.00 27.44 ? 505  LEU A CD2   1 
ATOM   2875  N  N     . ALA E 2 317 ? 29.610  77.103  67.265  1.00 29.07 ? 506  ALA A N     1 
ATOM   2876  C  CA    . ALA E 2 317 ? 29.924  78.505  67.043  1.00 31.23 ? 506  ALA A CA    1 
ATOM   2877  C  C     . ALA E 2 317 ? 29.414  79.338  68.217  1.00 32.98 ? 506  ALA A C     1 
ATOM   2878  O  O     . ALA E 2 317 ? 30.117  80.212  68.723  1.00 33.67 ? 506  ALA A O     1 
ATOM   2879  C  CB    . ALA E 2 317 ? 29.288  78.989  65.745  1.00 31.23 ? 506  ALA A CB    1 
ATOM   2880  N  N     . SER E 2 318 ? 28.188  79.060  68.650  1.00 34.86 ? 507  SER A N     1 
ATOM   2881  C  CA    . SER E 2 318 ? 27.589  79.804  69.755  1.00 37.72 ? 507  SER A CA    1 
ATOM   2882  C  C     . SER E 2 318 ? 28.430  79.629  71.021  1.00 38.59 ? 507  SER A C     1 
ATOM   2883  O  O     . SER E 2 318 ? 28.745  80.596  71.731  1.00 38.32 ? 507  SER A O     1 
ATOM   2884  C  CB    . SER E 2 318 ? 26.161  79.316  69.995  1.00 38.30 ? 507  SER A CB    1 
ATOM   2885  O  OG    . SER E 2 318 ? 25.581  80.000  71.087  1.00 41.63 ? 507  SER A OG    1 
ATOM   2886  N  N     . PHE E 2 319 ? 28.791  78.381  71.287  1.00 39.27 ? 508  PHE A N     1 
ATOM   2887  C  CA    . PHE E 2 319 ? 29.621  78.029  72.429  1.00 40.92 ? 508  PHE A CA    1 
ATOM   2888  C  C     . PHE E 2 319 ? 30.927  78.833  72.399  1.00 41.24 ? 508  PHE A C     1 
ATOM   2889  O  O     . PHE E 2 319 ? 31.241  79.595  73.319  1.00 41.36 ? 508  PHE A O     1 
ATOM   2890  C  CB    . PHE E 2 319 ? 29.950  76.539  72.376  1.00 41.83 ? 508  PHE A CB    1 
ATOM   2891  C  CG    . PHE E 2 319 ? 30.953  76.106  73.397  1.00 44.85 ? 508  PHE A CG    1 
ATOM   2892  C  CD1   . PHE E 2 319 ? 30.556  75.789  74.692  1.00 45.54 ? 508  PHE A CD1   1 
ATOM   2893  C  CD2   . PHE E 2 319 ? 32.305  76.032  73.070  1.00 45.48 ? 508  PHE A CD2   1 
ATOM   2894  C  CE1   . PHE E 2 319 ? 31.490  75.402  75.655  1.00 46.03 ? 508  PHE A CE1   1 
ATOM   2895  C  CE2   . PHE E 2 319 ? 33.250  75.649  74.020  1.00 46.73 ? 508  PHE A CE2   1 
ATOM   2896  C  CZ    . PHE E 2 319 ? 32.840  75.331  75.321  1.00 46.44 ? 508  PHE A CZ    1 
ATOM   2897  N  N     . LEU E 2 320 ? 31.684  78.660  71.326  1.00 40.73 ? 509  LEU A N     1 
ATOM   2898  C  CA    . LEU E 2 320 ? 32.945  79.347  71.195  1.00 40.44 ? 509  LEU A CA    1 
ATOM   2899  C  C     . LEU E 2 320 ? 32.841  80.843  71.407  1.00 41.42 ? 509  LEU A C     1 
ATOM   2900  O  O     . LEU E 2 320 ? 33.630  81.401  72.166  1.00 41.68 ? 509  LEU A O     1 
ATOM   2901  C  CB    . LEU E 2 320 ? 33.577  79.052  69.831  1.00 39.01 ? 509  LEU A CB    1 
ATOM   2902  C  CG    . LEU E 2 320 ? 34.089  77.622  69.653  1.00 37.66 ? 509  LEU A CG    1 
ATOM   2903  C  CD1   . LEU E 2 320 ? 34.734  77.475  68.295  1.00 36.59 ? 509  LEU A CD1   1 
ATOM   2904  C  CD2   . LEU E 2 320 ? 35.090  77.297  70.747  1.00 37.92 ? 509  LEU A CD2   1 
ATOM   2905  N  N     . SER E 2 321 ? 31.883  81.505  70.765  1.00 41.86 ? 510  SER A N     1 
ATOM   2906  C  CA    . SER E 2 321 ? 31.794  82.947  70.936  1.00 43.88 ? 510  SER A CA    1 
ATOM   2907  C  C     . SER E 2 321 ? 31.466  83.370  72.373  1.00 44.97 ? 510  SER A C     1 
ATOM   2908  O  O     . SER E 2 321 ? 31.871  84.446  72.810  1.00 43.86 ? 510  SER A O     1 
ATOM   2909  C  CB    . SER E 2 321 ? 30.798  83.562  69.943  1.00 43.36 ? 510  SER A CB    1 
ATOM   2910  O  OG    . SER E 2 321 ? 29.486  83.118  70.179  1.00 46.56 ? 510  SER A OG    1 
ATOM   2911  N  N     . GLU E 2 322 ? 30.749  82.532  73.114  1.00 47.41 ? 511  GLU A N     1 
ATOM   2912  C  CA    . GLU E 2 322 ? 30.439  82.867  74.502  1.00 50.33 ? 511  GLU A CA    1 
ATOM   2913  C  C     . GLU E 2 322 ? 31.713  82.772  75.337  1.00 51.39 ? 511  GLU A C     1 
ATOM   2914  O  O     . GLU E 2 322 ? 31.743  83.188  76.501  1.00 51.97 ? 511  GLU A O     1 
ATOM   2915  C  CB    . GLU E 2 322 ? 29.408  81.913  75.090  1.00 52.61 ? 511  GLU A CB    1 
ATOM   2916  C  CG    . GLU E 2 322 ? 27.971  82.372  74.977  1.00 56.55 ? 511  GLU A CG    1 
ATOM   2917  C  CD    . GLU E 2 322 ? 27.136  81.883  76.146  1.00 58.99 ? 511  GLU A CD    1 
ATOM   2918  O  OE1   . GLU E 2 322 ? 27.412  82.311  77.293  1.00 60.39 ? 511  GLU A OE1   1 
ATOM   2919  O  OE2   . GLU E 2 322 ? 26.213  81.065  75.923  1.00 61.64 ? 511  GLU A OE2   1 
ATOM   2920  N  N     . LYS E 2 323 ? 32.761  82.210  74.740  1.00 51.19 ? 512  LYS A N     1 
ATOM   2921  C  CA    . LYS E 2 323 ? 34.029  82.066  75.423  1.00 50.25 ? 512  LYS A CA    1 
ATOM   2922  C  C     . LYS E 2 323 ? 35.111  82.975  74.872  1.00 50.19 ? 512  LYS A C     1 
ATOM   2923  O  O     . LYS E 2 323 ? 36.296  82.657  74.917  1.00 50.27 ? 512  LYS A O     1 
ATOM   2924  C  CB    . LYS E 2 323 ? 34.484  80.610  75.386  1.00 50.83 ? 512  LYS A CB    1 
ATOM   2925  C  CG    . LYS E 2 323 ? 33.813  79.777  76.445  1.00 51.82 ? 512  LYS A CG    1 
ATOM   2926  C  CD    . LYS E 2 323 ? 34.470  78.429  76.602  1.00 52.63 ? 512  LYS A CD    1 
ATOM   2927  C  CE    . LYS E 2 323 ? 34.022  77.791  77.913  1.00 53.70 ? 512  LYS A CE    1 
ATOM   2928  N  NZ    . LYS E 2 323 ? 32.534  77.793  78.032  1.00 53.04 ? 512  LYS A NZ    1 
ATOM   2929  N  N     . GLU E 2 324 ? 34.701  84.112  74.335  1.00 50.26 ? 513  GLU A N     1 
ATOM   2930  C  CA    . GLU E 2 324 ? 35.663  85.071  73.833  1.00 50.76 ? 513  GLU A CA    1 
ATOM   2931  C  C     . GLU E 2 324 ? 36.523  84.647  72.657  1.00 49.90 ? 513  GLU A C     1 
ATOM   2932  O  O     . GLU E 2 324 ? 37.742  84.829  72.659  1.00 49.87 ? 513  GLU A O     1 
ATOM   2933  C  CB    . GLU E 2 324 ? 36.564  85.522  74.971  1.00 52.97 ? 513  GLU A CB    1 
ATOM   2934  C  CG    . GLU E 2 324 ? 35.822  86.296  76.023  1.00 56.50 ? 513  GLU A CG    1 
ATOM   2935  C  CD    . GLU E 2 324 ? 36.729  86.746  77.132  1.00 59.01 ? 513  GLU A CD    1 
ATOM   2936  O  OE1   . GLU E 2 324 ? 37.132  85.884  77.951  1.00 60.46 ? 513  GLU A OE1   1 
ATOM   2937  O  OE2   . GLU E 2 324 ? 37.046  87.958  77.173  1.00 60.11 ? 513  GLU A OE2   1 
ATOM   2938  N  N     . PHE E 2 325 ? 35.876  84.072  71.656  1.00 48.11 ? 514  PHE A N     1 
ATOM   2939  C  CA    . PHE E 2 325 ? 36.540  83.686  70.433  1.00 45.36 ? 514  PHE A CA    1 
ATOM   2940  C  C     . PHE E 2 325 ? 35.629  84.287  69.392  1.00 44.31 ? 514  PHE A C     1 
ATOM   2941  O  O     . PHE E 2 325 ? 34.458  83.918  69.314  1.00 44.53 ? 514  PHE A O     1 
ATOM   2942  C  CB    . PHE E 2 325 ? 36.591  82.173  70.285  1.00 44.90 ? 514  PHE A CB    1 
ATOM   2943  C  CG    . PHE E 2 325 ? 37.624  81.521  71.149  1.00 44.42 ? 514  PHE A CG    1 
ATOM   2944  C  CD1   . PHE E 2 325 ? 37.250  80.729  72.227  1.00 44.75 ? 514  PHE A CD1   1 
ATOM   2945  C  CD2   . PHE E 2 325 ? 38.976  81.700  70.884  1.00 44.06 ? 514  PHE A CD2   1 
ATOM   2946  C  CE1   . PHE E 2 325 ? 38.212  80.120  73.031  1.00 45.19 ? 514  PHE A CE1   1 
ATOM   2947  C  CE2   . PHE E 2 325 ? 39.947  81.099  71.678  1.00 43.94 ? 514  PHE A CE2   1 
ATOM   2948  C  CZ    . PHE E 2 325 ? 39.568  80.308  72.751  1.00 44.90 ? 514  PHE A CZ    1 
ATOM   2949  N  N     . PRO E 2 326 ? 36.128  85.274  68.622  1.00 43.38 ? 515  PRO A N     1 
ATOM   2950  C  CA    . PRO E 2 326 ? 35.310  85.908  67.581  1.00 41.91 ? 515  PRO A CA    1 
ATOM   2951  C  C     . PRO E 2 326 ? 34.991  84.799  66.582  1.00 40.95 ? 515  PRO A C     1 
ATOM   2952  O  O     . PRO E 2 326 ? 35.801  84.481  65.716  1.00 39.38 ? 515  PRO A O     1 
ATOM   2953  C  CB    . PRO E 2 326 ? 36.248  86.958  66.994  1.00 42.51 ? 515  PRO A CB    1 
ATOM   2954  C  CG    . PRO E 2 326 ? 37.191  87.250  68.120  1.00 43.18 ? 515  PRO A CG    1 
ATOM   2955  C  CD    . PRO E 2 326 ? 37.464  85.888  68.680  1.00 43.02 ? 515  PRO A CD    1 
ATOM   2956  N  N     . THR E 2 327 ? 33.799  84.225  66.705  1.00 40.21 ? 516  THR A N     1 
ATOM   2957  C  CA    . THR E 2 327 ? 33.401  83.113  65.858  1.00 39.79 ? 516  THR A CA    1 
ATOM   2958  C  C     . THR E 2 327 ? 32.108  83.317  65.084  1.00 38.98 ? 516  THR A C     1 
ATOM   2959  O  O     . THR E 2 327 ? 31.158  83.928  65.573  1.00 39.27 ? 516  THR A O     1 
ATOM   2960  C  CB    . THR E 2 327 ? 33.249  81.835  66.712  1.00 39.11 ? 516  THR A CB    1 
ATOM   2961  O  OG1   . THR E 2 327 ? 34.387  81.710  67.571  1.00 38.44 ? 516  THR A OG1   1 
ATOM   2962  C  CG2   . THR E 2 327 ? 33.167  80.610  65.844  1.00 39.02 ? 516  THR A CG2   1 
ATOM   2963  N  N     . THR E 2 328 ? 32.096  82.802  63.862  1.00 37.54 ? 517  THR A N     1 
ATOM   2964  C  CA    . THR E 2 328 ? 30.924  82.861  63.014  1.00 36.97 ? 517  THR A CA    1 
ATOM   2965  C  C     . THR E 2 328 ? 30.839  81.479  62.350  1.00 36.20 ? 517  THR A C     1 
ATOM   2966  O  O     . THR E 2 328 ? 31.708  80.639  62.558  1.00 35.77 ? 517  THR A O     1 
ATOM   2967  C  CB    . THR E 2 328 ? 31.039  83.982  61.969  1.00 36.87 ? 517  THR A CB    1 
ATOM   2968  O  OG1   . THR E 2 328 ? 29.813  84.072  61.239  1.00 37.69 ? 517  THR A OG1   1 
ATOM   2969  C  CG2   . THR E 2 328 ? 32.168  83.718  61.011  1.00 37.10 ? 517  THR A CG2   1 
ATOM   2970  N  N     . SER E 2 329 ? 29.801  81.222  61.567  1.00 35.26 ? 518  SER A N     1 
ATOM   2971  C  CA    . SER E 2 329 ? 29.691  79.905  60.956  1.00 34.55 ? 518  SER A CA    1 
ATOM   2972  C  C     . SER E 2 329 ? 29.064  79.920  59.575  1.00 33.07 ? 518  SER A C     1 
ATOM   2973  O  O     . SER E 2 329 ? 28.504  80.920  59.147  1.00 33.45 ? 518  SER A O     1 
ATOM   2974  C  CB    . SER E 2 329 ? 28.869  78.986  61.857  1.00 34.82 ? 518  SER A CB    1 
ATOM   2975  O  OG    . SER E 2 329 ? 27.545  79.477  61.974  1.00 35.89 ? 518  SER A OG    1 
ATOM   2976  N  N     . ILE E 2 330 ? 29.168  78.794  58.883  1.00 31.33 ? 519  ILE A N     1 
ATOM   2977  C  CA    . ILE E 2 330 ? 28.595  78.665  57.561  1.00 30.75 ? 519  ILE A CA    1 
ATOM   2978  C  C     . ILE E 2 330 ? 28.108  77.227  57.335  1.00 31.00 ? 519  ILE A C     1 
ATOM   2979  O  O     . ILE E 2 330 ? 28.848  76.260  57.520  1.00 31.32 ? 519  ILE A O     1 
ATOM   2980  C  CB    . ILE E 2 330 ? 29.623  79.090  56.458  1.00 29.51 ? 519  ILE A CB    1 
ATOM   2981  C  CG1   . ILE E 2 330 ? 28.991  78.958  55.080  1.00 28.38 ? 519  ILE A CG1   1 
ATOM   2982  C  CG2   . ILE E 2 330 ? 30.883  78.236  56.533  1.00 29.21 ? 519  ILE A CG2   1 
ATOM   2983  C  CD1   . ILE E 2 330 ? 29.791  79.652  53.975  1.00 29.44 ? 519  ILE A CD1   1 
ATOM   2984  N  N     . HIS E 2 331 ? 26.841  77.104  56.970  1.00 30.13 ? 520  HIS A N     1 
ATOM   2985  C  CA    . HIS E 2 331 ? 26.236  75.815  56.700  1.00 30.97 ? 520  HIS A CA    1 
ATOM   2986  C  C     . HIS E 2 331 ? 24.864  76.089  56.094  1.00 31.36 ? 520  HIS A C     1 
ATOM   2987  O  O     . HIS E 2 331 ? 24.410  77.233  56.056  1.00 30.53 ? 520  HIS A O     1 
ATOM   2988  C  CB    . HIS E 2 331 ? 26.085  75.000  57.981  1.00 30.98 ? 520  HIS A CB    1 
ATOM   2989  C  CG    . HIS E 2 331 ? 25.149  75.618  58.966  1.00 32.55 ? 520  HIS A CG    1 
ATOM   2990  N  ND1   . HIS E 2 331 ? 25.568  76.501  59.939  1.00 33.22 ? 520  HIS A ND1   1 
ATOM   2991  C  CD2   . HIS E 2 331 ? 23.802  75.548  59.072  1.00 32.27 ? 520  HIS A CD2   1 
ATOM   2992  C  CE1   . HIS E 2 331 ? 24.516  76.949  60.600  1.00 33.90 ? 520  HIS A CE1   1 
ATOM   2993  N  NE2   . HIS E 2 331 ? 23.432  76.388  60.091  1.00 33.60 ? 520  HIS A NE2   1 
ATOM   2994  N  N     . GLY E 2 332 ? 24.208  75.027  55.647  1.00 32.09 ? 521  GLY A N     1 
ATOM   2995  C  CA    . GLY E 2 332 ? 22.914  75.138  55.000  1.00 33.42 ? 521  GLY A CA    1 
ATOM   2996  C  C     . GLY E 2 332 ? 21.725  75.678  55.762  1.00 34.38 ? 521  GLY A C     1 
ATOM   2997  O  O     . GLY E 2 332 ? 20.733  76.027  55.139  1.00 35.12 ? 521  GLY A O     1 
ATOM   2998  N  N     . ASP E 2 333 ? 21.791  75.732  57.087  1.00 36.13 ? 522  ASP A N     1 
ATOM   2999  C  CA    . ASP E 2 333 ? 20.672  76.256  57.873  1.00 37.27 ? 522  ASP A CA    1 
ATOM   3000  C  C     . ASP E 2 333 ? 20.747  77.759  58.113  1.00 37.19 ? 522  ASP A C     1 
ATOM   3001  O  O     . ASP E 2 333 ? 19.883  78.323  58.781  1.00 37.65 ? 522  ASP A O     1 
ATOM   3002  C  CB    . ASP E 2 333 ? 20.563  75.547  59.231  1.00 39.01 ? 522  ASP A CB    1 
ATOM   3003  C  CG    . ASP E 2 333 ? 19.776  74.245  59.151  1.00 41.75 ? 522  ASP A CG    1 
ATOM   3004  O  OD1   . ASP E 2 333 ? 19.107  74.026  58.116  1.00 42.68 ? 522  ASP A OD1   1 
ATOM   3005  O  OD2   . ASP E 2 333 ? 19.812  73.451  60.126  1.00 43.18 ? 522  ASP A OD2   1 
ATOM   3006  N  N     . ARG E 2 334 ? 21.774  78.413  57.590  1.00 36.16 ? 523  ARG A N     1 
ATOM   3007  C  CA    . ARG E 2 334 ? 21.886  79.852  57.774  1.00 36.82 ? 523  ARG A CA    1 
ATOM   3008  C  C     . ARG E 2 334 ? 21.300  80.511  56.536  1.00 37.02 ? 523  ARG A C     1 
ATOM   3009  O  O     . ARG E 2 334 ? 21.183  79.870  55.493  1.00 36.75 ? 523  ARG A O     1 
ATOM   3010  C  CB    . ARG E 2 334 ? 23.354  80.285  57.929  1.00 36.23 ? 523  ARG A CB    1 
ATOM   3011  C  CG    . ARG E 2 334 ? 24.119  79.588  59.033  1.00 36.80 ? 523  ARG A CG    1 
ATOM   3012  C  CD    . ARG E 2 334 ? 25.248  80.448  59.565  1.00 37.68 ? 523  ARG A CD    1 
ATOM   3013  N  NE    . ARG E 2 334 ? 24.725  81.550  60.367  1.00 38.61 ? 523  ARG A NE    1 
ATOM   3014  C  CZ    . ARG E 2 334 ? 25.386  82.674  60.637  1.00 39.24 ? 523  ARG A CZ    1 
ATOM   3015  N  NH1   . ARG E 2 334 ? 26.615  82.866  60.172  1.00 38.26 ? 523  ARG A NH1   1 
ATOM   3016  N  NH2   . ARG E 2 334 ? 24.800  83.623  61.361  1.00 39.42 ? 523  ARG A NH2   1 
ATOM   3017  N  N     . LEU E 2 335 ? 20.917  81.778  56.649  1.00 37.02 ? 524  LEU A N     1 
ATOM   3018  C  CA    . LEU E 2 335 ? 20.380  82.507  55.497  1.00 37.01 ? 524  LEU A CA    1 
ATOM   3019  C  C     . LEU E 2 335 ? 21.540  82.707  54.523  1.00 36.06 ? 524  LEU A C     1 
ATOM   3020  O  O     . LEU E 2 335 ? 22.677  82.903  54.942  1.00 36.14 ? 524  LEU A O     1 
ATOM   3021  C  CB    . LEU E 2 335 ? 19.841  83.883  55.923  1.00 38.48 ? 524  LEU A CB    1 
ATOM   3022  C  CG    . LEU E 2 335 ? 18.483  84.096  56.614  1.00 40.02 ? 524  LEU A CG    1 
ATOM   3023  C  CD1   . LEU E 2 335 ? 17.863  82.785  57.043  1.00 40.66 ? 524  LEU A CD1   1 
ATOM   3024  C  CD2   . LEU E 2 335 ? 18.681  85.027  57.813  1.00 40.15 ? 524  LEU A CD2   1 
ATOM   3025  N  N     . GLN E 2 336 ? 21.259  82.669  53.228  1.00 35.55 ? 525  GLN A N     1 
ATOM   3026  C  CA    . GLN E 2 336 ? 22.307  82.851  52.233  1.00 34.78 ? 525  GLN A CA    1 
ATOM   3027  C  C     . GLN E 2 336 ? 23.107  84.113  52.521  1.00 34.79 ? 525  GLN A C     1 
ATOM   3028  O  O     . GLN E 2 336 ? 24.317  84.158  52.297  1.00 35.07 ? 525  GLN A O     1 
ATOM   3029  C  CB    . GLN E 2 336 ? 21.696  82.927  50.834  1.00 34.33 ? 525  GLN A CB    1 
ATOM   3030  C  CG    . GLN E 2 336 ? 22.689  82.736  49.703  1.00 35.13 ? 525  GLN A CG    1 
ATOM   3031  C  CD    . GLN E 2 336 ? 23.679  81.604  49.966  1.00 34.87 ? 525  GLN A CD    1 
ATOM   3032  O  OE1   . GLN E 2 336 ? 23.306  80.496  50.364  1.00 34.43 ? 525  GLN A OE1   1 
ATOM   3033  N  NE2   . GLN E 2 336 ? 24.949  81.887  49.743  1.00 34.17 ? 525  GLN A NE2   1 
ATOM   3034  N  N     . SER E 2 337 ? 22.444  85.138  53.039  1.00 34.30 ? 526  SER A N     1 
ATOM   3035  C  CA    . SER E 2 337 ? 23.142  86.377  53.334  1.00 34.02 ? 526  SER A CA    1 
ATOM   3036  C  C     . SER E 2 337 ? 24.104  86.198  54.503  1.00 33.32 ? 526  SER A C     1 
ATOM   3037  O  O     . SER E 2 337 ? 25.166  86.813  54.538  1.00 34.13 ? 526  SER A O     1 
ATOM   3038  C  CB    . SER E 2 337 ? 22.141  87.488  53.641  1.00 34.33 ? 526  SER A CB    1 
ATOM   3039  O  OG    . SER E 2 337 ? 21.271  87.085  54.680  1.00 36.51 ? 526  SER A OG    1 
ATOM   3040  N  N     . GLN E 2 338 ? 23.743  85.360  55.462  1.00 32.75 ? 527  GLN A N     1 
ATOM   3041  C  CA    . GLN E 2 338 ? 24.624  85.139  56.597  1.00 33.37 ? 527  GLN A CA    1 
ATOM   3042  C  C     . GLN E 2 338 ? 25.829  84.323  56.130  1.00 32.59 ? 527  GLN A C     1 
ATOM   3043  O  O     . GLN E 2 338 ? 26.943  84.526  56.600  1.00 31.20 ? 527  GLN A O     1 
ATOM   3044  C  CB    . GLN E 2 338 ? 23.878  84.397  57.714  1.00 35.41 ? 527  GLN A CB    1 
ATOM   3045  C  CG    . GLN E 2 338 ? 22.620  85.103  58.195  1.00 37.62 ? 527  GLN A CG    1 
ATOM   3046  C  CD    . GLN E 2 338 ? 21.915  84.361  59.320  1.00 38.98 ? 527  GLN A CD    1 
ATOM   3047  O  OE1   . GLN E 2 338 ? 21.434  83.235  59.149  1.00 39.69 ? 527  GLN A OE1   1 
ATOM   3048  N  NE2   . GLN E 2 338 ? 21.852  84.995  60.481  1.00 39.63 ? 527  GLN A NE2   1 
ATOM   3049  N  N     . ARG E 2 339 ? 25.593  83.401  55.196  1.00 33.21 ? 528  ARG A N     1 
ATOM   3050  C  CA    . ARG E 2 339 ? 26.659  82.558  54.646  1.00 32.92 ? 528  ARG A CA    1 
ATOM   3051  C  C     . ARG E 2 339 ? 27.691  83.460  53.982  1.00 33.88 ? 528  ARG A C     1 
ATOM   3052  O  O     . ARG E 2 339 ? 28.890  83.346  54.231  1.00 35.03 ? 528  ARG A O     1 
ATOM   3053  C  CB    . ARG E 2 339 ? 26.089  81.551  53.629  1.00 31.73 ? 528  ARG A CB    1 
ATOM   3054  C  CG    . ARG E 2 339 ? 25.275  80.408  54.282  1.00 30.36 ? 528  ARG A CG    1 
ATOM   3055  C  CD    . ARG E 2 339 ? 24.557  79.499  53.282  1.00 29.42 ? 528  ARG A CD    1 
ATOM   3056  N  NE    . ARG E 2 339 ? 25.460  78.991  52.255  1.00 29.38 ? 528  ARG A NE    1 
ATOM   3057  C  CZ    . ARG E 2 339 ? 25.178  77.981  51.436  1.00 29.71 ? 528  ARG A CZ    1 
ATOM   3058  N  NH1   . ARG E 2 339 ? 24.009  77.350  51.516  1.00 28.07 ? 528  ARG A NH1   1 
ATOM   3059  N  NH2   . ARG E 2 339 ? 26.070  77.609  50.525  1.00 29.44 ? 528  ARG A NH2   1 
ATOM   3060  N  N     . GLU E 2 340 ? 27.233  84.388  53.161  1.00 34.65 ? 529  GLU A N     1 
ATOM   3061  C  CA    . GLU E 2 340 ? 28.174  85.271  52.501  1.00 35.61 ? 529  GLU A CA    1 
ATOM   3062  C  C     . GLU E 2 340 ? 28.882  86.202  53.481  1.00 35.93 ? 529  GLU A C     1 
ATOM   3063  O  O     . GLU E 2 340 ? 30.110  86.315  53.455  1.00 35.03 ? 529  GLU A O     1 
ATOM   3064  C  CB    . GLU E 2 340 ? 27.459  86.030  51.382  1.00 36.08 ? 529  GLU A CB    1 
ATOM   3065  C  CG    . GLU E 2 340 ? 27.289  85.143  50.143  1.00 38.17 ? 529  GLU A CG    1 
ATOM   3066  C  CD    . GLU E 2 340 ? 26.330  85.686  49.091  1.00 39.14 ? 529  GLU A CD    1 
ATOM   3067  O  OE1   . GLU E 2 340 ? 26.438  86.873  48.713  1.00 41.55 ? 529  GLU A OE1   1 
ATOM   3068  O  OE2   . GLU E 2 340 ? 25.477  84.905  48.623  1.00 39.12 ? 529  GLU A OE2   1 
ATOM   3069  N  N     . GLN E 2 341 ? 28.120  86.832  54.369  1.00 36.71 ? 530  GLN A N     1 
ATOM   3070  C  CA    . GLN E 2 341 ? 28.690  87.747  55.359  1.00 37.45 ? 530  GLN A CA    1 
ATOM   3071  C  C     . GLN E 2 341 ? 29.715  87.054  56.262  1.00 37.47 ? 530  GLN A C     1 
ATOM   3072  O  O     . GLN E 2 341 ? 30.729  87.650  56.650  1.00 37.37 ? 530  GLN A O     1 
ATOM   3073  C  CB    . GLN E 2 341 ? 27.574  88.352  56.219  1.00 39.07 ? 530  GLN A CB    1 
ATOM   3074  C  CG    . GLN E 2 341 ? 28.041  89.345  57.304  1.00 42.02 ? 530  GLN A CG    1 
ATOM   3075  C  CD    . GLN E 2 341 ? 28.659  90.620  56.742  1.00 44.59 ? 530  GLN A CD    1 
ATOM   3076  O  OE1   . GLN E 2 341 ? 28.168  91.186  55.759  1.00 46.10 ? 530  GLN A OE1   1 
ATOM   3077  N  NE2   . GLN E 2 341 ? 29.735  91.086  57.372  1.00 45.32 ? 530  GLN A NE2   1 
ATOM   3078  N  N     . ALA E 2 342 ? 29.453  85.800  56.602  1.00 36.04 ? 531  ALA A N     1 
ATOM   3079  C  CA    . ALA E 2 342 ? 30.364  85.070  57.454  1.00 36.44 ? 531  ALA A CA    1 
ATOM   3080  C  C     . ALA E 2 342 ? 31.728  84.918  56.770  1.00 37.05 ? 531  ALA A C     1 
ATOM   3081  O  O     . ALA E 2 342 ? 32.768  85.010  57.424  1.00 36.14 ? 531  ALA A O     1 
ATOM   3082  C  CB    . ALA E 2 342 ? 29.769  83.697  57.810  1.00 36.92 ? 531  ALA A CB    1 
ATOM   3083  N  N     . LEU E 2 343 ? 31.732  84.690  55.457  1.00 38.58 ? 532  LEU A N     1 
ATOM   3084  C  CA    . LEU E 2 343 ? 32.996  84.559  54.735  1.00 40.08 ? 532  LEU A CA    1 
ATOM   3085  C  C     . LEU E 2 343 ? 33.659  85.925  54.691  1.00 41.32 ? 532  LEU A C     1 
ATOM   3086  O  O     . LEU E 2 343 ? 34.866  86.050  54.890  1.00 41.04 ? 532  LEU A O     1 
ATOM   3087  C  CB    . LEU E 2 343 ? 32.774  84.032  53.312  1.00 39.81 ? 532  LEU A CB    1 
ATOM   3088  C  CG    . LEU E 2 343 ? 32.439  82.543  53.178  1.00 39.97 ? 532  LEU A CG    1 
ATOM   3089  C  CD1   . LEU E 2 343 ? 32.512  82.135  51.719  1.00 39.95 ? 532  LEU A CD1   1 
ATOM   3090  C  CD2   . LEU E 2 343 ? 33.432  81.711  53.975  1.00 39.02 ? 532  LEU A CD2   1 
ATOM   3091  N  N     . ARG E 2 344 ? 32.855  86.953  54.447  1.00 43.59 ? 533  ARG A N     1 
ATOM   3092  C  CA    . ARG E 2 344 ? 33.354  88.324  54.400  1.00 46.09 ? 533  ARG A CA    1 
ATOM   3093  C  C     . ARG E 2 344 ? 34.154  88.593  55.677  1.00 46.44 ? 533  ARG A C     1 
ATOM   3094  O  O     . ARG E 2 344 ? 35.344  88.920  55.613  1.00 46.73 ? 533  ARG A O     1 
ATOM   3095  C  CB    . ARG E 2 344 ? 32.177  89.304  54.310  1.00 48.76 ? 533  ARG A CB    1 
ATOM   3096  C  CG    . ARG E 2 344 ? 32.499  90.682  53.731  1.00 53.05 ? 533  ARG A CG    1 
ATOM   3097  C  CD    . ARG E 2 344 ? 33.747  91.295  54.370  1.00 58.00 ? 533  ARG A CD    1 
ATOM   3098  N  NE    . ARG E 2 344 ? 33.872  92.732  54.122  1.00 61.03 ? 533  ARG A NE    1 
ATOM   3099  C  CZ    . ARG E 2 344 ? 33.104  93.658  54.692  1.00 62.42 ? 533  ARG A CZ    1 
ATOM   3100  N  NH1   . ARG E 2 344 ? 32.149  93.307  55.550  1.00 63.11 ? 533  ARG A NH1   1 
ATOM   3101  N  NH2   . ARG E 2 344 ? 33.291  94.939  54.403  1.00 63.21 ? 533  ARG A NH2   1 
ATOM   3102  N  N     . ASP E 2 345 ? 33.496  88.445  56.831  1.00 46.26 ? 534  ASP A N     1 
ATOM   3103  C  CA    . ASP E 2 345 ? 34.124  88.678  58.133  1.00 46.00 ? 534  ASP A CA    1 
ATOM   3104  C  C     . ASP E 2 345 ? 35.390  87.859  58.383  1.00 45.99 ? 534  ASP A C     1 
ATOM   3105  O  O     . ASP E 2 345 ? 36.307  88.318  59.057  1.00 45.51 ? 534  ASP A O     1 
ATOM   3106  C  CB    . ASP E 2 345 ? 33.142  88.384  59.264  1.00 46.72 ? 534  ASP A CB    1 
ATOM   3107  C  CG    . ASP E 2 345 ? 31.874  89.198  59.164  1.00 47.78 ? 534  ASP A CG    1 
ATOM   3108  O  OD1   . ASP E 2 345 ? 31.942  90.361  58.712  1.00 48.29 ? 534  ASP A OD1   1 
ATOM   3109  O  OD2   . ASP E 2 345 ? 30.807  88.679  59.557  1.00 48.84 ? 534  ASP A OD2   1 
ATOM   3110  N  N     . PHE E 2 346 ? 35.432  86.638  57.864  1.00 45.83 ? 535  PHE A N     1 
ATOM   3111  C  CA    . PHE E 2 346 ? 36.605  85.800  58.054  1.00 45.89 ? 535  PHE A CA    1 
ATOM   3112  C  C     . PHE E 2 346 ? 37.745  86.298  57.173  1.00 46.04 ? 535  PHE A C     1 
ATOM   3113  O  O     . PHE E 2 346 ? 38.902  86.292  57.585  1.00 46.16 ? 535  PHE A O     1 
ATOM   3114  C  CB    . PHE E 2 346 ? 36.286  84.332  57.733  1.00 44.69 ? 535  PHE A CB    1 
ATOM   3115  C  CG    . PHE E 2 346 ? 37.351  83.369  58.181  1.00 43.68 ? 535  PHE A CG    1 
ATOM   3116  C  CD1   . PHE E 2 346 ? 38.357  82.968  57.316  1.00 44.05 ? 535  PHE A CD1   1 
ATOM   3117  C  CD2   . PHE E 2 346 ? 37.372  82.897  59.489  1.00 42.42 ? 535  PHE A CD2   1 
ATOM   3118  C  CE1   . PHE E 2 346 ? 39.378  82.105  57.754  1.00 43.66 ? 535  PHE A CE1   1 
ATOM   3119  C  CE2   . PHE E 2 346 ? 38.383  82.039  59.932  1.00 41.73 ? 535  PHE A CE2   1 
ATOM   3120  C  CZ    . PHE E 2 346 ? 39.384  81.644  59.066  1.00 41.79 ? 535  PHE A CZ    1 
ATOM   3121  N  N     . LYS E 2 347 ? 37.415  86.749  55.969  1.00 46.38 ? 536  LYS A N     1 
ATOM   3122  C  CA    . LYS E 2 347 ? 38.435  87.245  55.054  1.00 47.30 ? 536  LYS A CA    1 
ATOM   3123  C  C     . LYS E 2 347 ? 39.099  88.516  55.549  1.00 47.32 ? 536  LYS A C     1 
ATOM   3124  O  O     . LYS E 2 347 ? 40.310  88.656  55.428  1.00 47.36 ? 536  LYS A O     1 
ATOM   3125  C  CB    . LYS E 2 347 ? 37.845  87.509  53.669  1.00 47.87 ? 536  LYS A CB    1 
ATOM   3126  C  CG    . LYS E 2 347 ? 37.468  86.261  52.891  1.00 49.03 ? 536  LYS A CG    1 
ATOM   3127  C  CD    . LYS E 2 347 ? 36.805  86.658  51.580  1.00 51.01 ? 536  LYS A CD    1 
ATOM   3128  C  CE    . LYS E 2 347 ? 36.254  85.456  50.835  1.00 52.01 ? 536  LYS A CE    1 
ATOM   3129  N  NZ    . LYS E 2 347 ? 35.469  85.891  49.646  1.00 52.91 ? 536  LYS A NZ    1 
ATOM   3130  N  N     . ASN E 2 348 ? 38.317  89.436  56.110  1.00 47.75 ? 537  ASN A N     1 
ATOM   3131  C  CA    . ASN E 2 348 ? 38.879  90.692  56.592  1.00 47.81 ? 537  ASN A CA    1 
ATOM   3132  C  C     . ASN E 2 348 ? 39.237  90.698  58.070  1.00 48.66 ? 537  ASN A C     1 
ATOM   3133  O  O     . ASN E 2 348 ? 39.397  91.764  58.667  1.00 49.71 ? 537  ASN A O     1 
ATOM   3134  C  CB    . ASN E 2 348 ? 37.935  91.861  56.298  1.00 46.93 ? 537  ASN A CB    1 
ATOM   3135  C  CG    . ASN E 2 348 ? 36.699  91.851  57.169  1.00 47.02 ? 537  ASN A CG    1 
ATOM   3136  O  OD1   . ASN E 2 348 ? 36.754  91.473  58.350  1.00 45.30 ? 537  ASN A OD1   1 
ATOM   3137  N  ND2   . ASN E 2 348 ? 35.574  92.287  56.601  1.00 45.63 ? 537  ASN A ND2   1 
ATOM   3138  N  N     . GLY E 2 349 ? 39.348  89.519  58.670  1.00 48.72 ? 538  GLY A N     1 
ATOM   3139  C  CA    . GLY E 2 349 ? 39.722  89.449  60.072  1.00 48.37 ? 538  GLY A CA    1 
ATOM   3140  C  C     . GLY E 2 349 ? 38.671  89.689  61.143  1.00 48.66 ? 538  GLY A C     1 
ATOM   3141  O  O     . GLY E 2 349 ? 38.928  89.388  62.307  1.00 49.33 ? 538  GLY A O     1 
ATOM   3142  N  N     . SER E 2 350 ? 37.505  90.225  60.788  1.00 49.10 ? 539  SER A N     1 
ATOM   3143  C  CA    . SER E 2 350 ? 36.454  90.470  61.786  1.00 49.05 ? 539  SER A CA    1 
ATOM   3144  C  C     . SER E 2 350 ? 36.302  89.242  62.679  1.00 49.05 ? 539  SER A C     1 
ATOM   3145  O  O     . SER E 2 350 ? 36.283  89.349  63.902  1.00 49.54 ? 539  SER A O     1 
ATOM   3146  C  CB    . SER E 2 350 ? 35.101  90.737  61.118  1.00 49.26 ? 539  SER A CB    1 
ATOM   3147  O  OG    . SER E 2 350 ? 35.169  91.797  60.191  1.00 50.68 ? 539  SER A OG    1 
ATOM   3148  N  N     . MET E 2 351 ? 36.174  88.077  62.050  1.00 48.39 ? 540  MET A N     1 
ATOM   3149  C  CA    . MET E 2 351 ? 36.025  86.823  62.775  1.00 46.94 ? 540  MET A CA    1 
ATOM   3150  C  C     . MET E 2 351 ? 37.320  86.040  62.634  1.00 45.45 ? 540  MET A C     1 
ATOM   3151  O  O     . MET E 2 351 ? 37.906  85.980  61.551  1.00 45.49 ? 540  MET A O     1 
ATOM   3152  C  CB    . MET E 2 351 ? 34.854  86.029  62.198  1.00 49.27 ? 540  MET A CB    1 
ATOM   3153  C  CG    . MET E 2 351 ? 33.555  86.826  62.113  1.00 50.12 ? 540  MET A CG    1 
ATOM   3154  S  SD    . MET E 2 351 ? 32.526  86.883  63.618  1.00 54.72 ? 540  MET A SD    1 
ATOM   3155  C  CE    . MET E 2 351 ? 33.616  86.504  64.839  1.00 51.58 ? 540  MET A CE    1 
ATOM   3156  N  N     . LYS E 2 352 ? 37.767  85.439  63.727  1.00 43.36 ? 541  LYS A N     1 
ATOM   3157  C  CA    . LYS E 2 352 ? 39.010  84.685  63.718  1.00 42.05 ? 541  LYS A CA    1 
ATOM   3158  C  C     . LYS E 2 352 ? 38.816  83.192  63.535  1.00 40.02 ? 541  LYS A C     1 
ATOM   3159  O  O     . LYS E 2 352 ? 39.729  82.484  63.107  1.00 39.51 ? 541  LYS A O     1 
ATOM   3160  C  CB    . LYS E 2 352 ? 39.774  84.928  65.024  1.00 43.72 ? 541  LYS A CB    1 
ATOM   3161  C  CG    . LYS E 2 352 ? 40.153  86.384  65.257  1.00 46.55 ? 541  LYS A CG    1 
ATOM   3162  C  CD    . LYS E 2 352 ? 41.041  86.903  64.133  1.00 47.13 ? 541  LYS A CD    1 
ATOM   3163  C  CE    . LYS E 2 352 ? 41.536  88.318  64.419  1.00 48.95 ? 541  LYS A CE    1 
ATOM   3164  N  NZ    . LYS E 2 352 ? 42.512  88.766  63.376  1.00 49.58 ? 541  LYS A NZ    1 
ATOM   3165  N  N     . VAL E 2 353 ? 37.629  82.714  63.877  1.00 37.87 ? 542  VAL A N     1 
ATOM   3166  C  CA    . VAL E 2 353 ? 37.320  81.302  63.778  1.00 35.57 ? 542  VAL A CA    1 
ATOM   3167  C  C     . VAL E 2 353 ? 36.058  81.098  62.956  1.00 35.09 ? 542  VAL A C     1 
ATOM   3168  O  O     . VAL E 2 353 ? 35.061  81.784  63.169  1.00 34.69 ? 542  VAL A O     1 
ATOM   3169  C  CB    . VAL E 2 353 ? 37.131  80.717  65.180  1.00 35.71 ? 542  VAL A CB    1 
ATOM   3170  C  CG1   . VAL E 2 353 ? 36.762  79.245  65.106  1.00 34.62 ? 542  VAL A CG1   1 
ATOM   3171  C  CG2   . VAL E 2 353 ? 38.412  80.915  65.985  1.00 35.37 ? 542  VAL A CG2   1 
ATOM   3172  N  N     . LEU E 2 354 ? 36.116  80.170  62.002  1.00 33.87 ? 543  LEU A N     1 
ATOM   3173  C  CA    . LEU E 2 354 ? 34.966  79.847  61.154  1.00 32.38 ? 543  LEU A CA    1 
ATOM   3174  C  C     . LEU E 2 354 ? 34.556  78.386  61.403  1.00 30.74 ? 543  LEU A C     1 
ATOM   3175  O  O     . LEU E 2 354 ? 35.355  77.471  61.203  1.00 30.23 ? 543  LEU A O     1 
ATOM   3176  C  CB    . LEU E 2 354 ? 35.341  80.005  59.681  1.00 32.83 ? 543  LEU A CB    1 
ATOM   3177  C  CG    . LEU E 2 354 ? 34.319  80.544  58.672  1.00 33.97 ? 543  LEU A CG    1 
ATOM   3178  C  CD1   . LEU E 2 354 ? 34.759  80.095  57.267  1.00 32.56 ? 543  LEU A CD1   1 
ATOM   3179  C  CD2   . LEU E 2 354 ? 32.922  80.047  58.961  1.00 33.16 ? 543  LEU A CD2   1 
ATOM   3180  N  N     . ILE E 2 355 ? 33.328  78.158  61.858  1.00 29.49 ? 544  ILE A N     1 
ATOM   3181  C  CA    . ILE E 2 355 ? 32.869  76.788  62.084  1.00 27.88 ? 544  ILE A CA    1 
ATOM   3182  C  C     . ILE E 2 355 ? 32.069  76.423  60.845  1.00 27.16 ? 544  ILE A C     1 
ATOM   3183  O  O     . ILE E 2 355 ? 31.240  77.212  60.397  1.00 27.43 ? 544  ILE A O     1 
ATOM   3184  C  CB    . ILE E 2 355 ? 31.970  76.674  63.338  1.00 27.74 ? 544  ILE A CB    1 
ATOM   3185  C  CG1   . ILE E 2 355 ? 32.698  77.249  64.556  1.00 25.87 ? 544  ILE A CG1   1 
ATOM   3186  C  CG2   . ILE E 2 355 ? 31.609  75.211  63.580  1.00 25.99 ? 544  ILE A CG2   1 
ATOM   3187  C  CD1   . ILE E 2 355 ? 34.058  76.601  64.836  1.00 22.88 ? 544  ILE A CD1   1 
ATOM   3188  N  N     . ALA E 2 356 ? 32.312  75.245  60.285  1.00 25.26 ? 545  ALA A N     1 
ATOM   3189  C  CA    . ALA E 2 356 ? 31.607  74.861  59.070  1.00 24.81 ? 545  ALA A CA    1 
ATOM   3190  C  C     . ALA E 2 356 ? 31.353  73.380  58.863  1.00 24.51 ? 545  ALA A C     1 
ATOM   3191  O  O     . ALA E 2 356 ? 32.041  72.537  59.443  1.00 25.39 ? 545  ALA A O     1 
ATOM   3192  C  CB    . ALA E 2 356 ? 32.377  75.381  57.867  1.00 24.39 ? 545  ALA A CB    1 
ATOM   3193  N  N     . THR E 2 357 ? 30.361  73.084  58.018  1.00 23.66 ? 546  THR A N     1 
ATOM   3194  C  CA    . THR E 2 357 ? 30.040  71.715  57.608  1.00 23.16 ? 546  THR A CA    1 
ATOM   3195  C  C     . THR E 2 357 ? 30.808  71.602  56.279  1.00 23.83 ? 546  THR A C     1 
ATOM   3196  O  O     . THR E 2 357 ? 31.460  72.565  55.850  1.00 23.50 ? 546  THR A O     1 
ATOM   3197  C  CB    . THR E 2 357 ? 28.523  71.515  57.294  1.00 23.05 ? 546  THR A CB    1 
ATOM   3198  O  OG1   . THR E 2 357 ? 28.126  72.455  56.294  1.00 22.32 ? 546  THR A OG1   1 
ATOM   3199  C  CG2   . THR E 2 357 ? 27.654  71.698  58.551  1.00 22.13 ? 546  THR A CG2   1 
ATOM   3200  N  N     . SER E 2 358 ? 30.728  70.462  55.604  1.00 24.00 ? 547  SER A N     1 
ATOM   3201  C  CA    . SER E 2 358 ? 31.451  70.330  54.344  1.00 25.16 ? 547  SER A CA    1 
ATOM   3202  C  C     . SER E 2 358 ? 30.988  71.272  53.224  1.00 25.32 ? 547  SER A C     1 
ATOM   3203  O  O     . SER E 2 358 ? 31.434  71.146  52.071  1.00 25.96 ? 547  SER A O     1 
ATOM   3204  C  CB    . SER E 2 358 ? 31.425  68.883  53.850  1.00 24.95 ? 547  SER A CB    1 
ATOM   3205  O  OG    . SER E 2 358 ? 32.161  68.060  54.731  1.00 25.45 ? 547  SER A OG    1 
ATOM   3206  N  N     . VAL E 2 359 ? 30.117  72.226  53.543  1.00 24.75 ? 548  VAL A N     1 
ATOM   3207  C  CA    . VAL E 2 359 ? 29.685  73.165  52.519  1.00 23.32 ? 548  VAL A CA    1 
ATOM   3208  C  C     . VAL E 2 359 ? 30.902  73.989  52.143  1.00 23.01 ? 548  VAL A C     1 
ATOM   3209  O  O     . VAL E 2 359 ? 30.976  74.551  51.074  1.00 23.67 ? 548  VAL A O     1 
ATOM   3210  C  CB    . VAL E 2 359 ? 28.567  74.122  53.023  1.00 23.85 ? 548  VAL A CB    1 
ATOM   3211  C  CG1   . VAL E 2 359 ? 29.097  75.040  54.102  1.00 22.26 ? 548  VAL A CG1   1 
ATOM   3212  C  CG2   . VAL E 2 359 ? 28.027  74.943  51.854  1.00 23.49 ? 548  VAL A CG2   1 
ATOM   3213  N  N     . ALA E 2 360 ? 31.876  74.051  53.035  1.00 24.75 ? 549  ALA A N     1 
ATOM   3214  C  CA    . ALA E 2 360 ? 33.077  74.830  52.769  1.00 25.22 ? 549  ALA A CA    1 
ATOM   3215  C  C     . ALA E 2 360 ? 34.319  73.958  52.565  1.00 26.01 ? 549  ALA A C     1 
ATOM   3216  O  O     . ALA E 2 360 ? 35.448  74.450  52.603  1.00 25.69 ? 549  ALA A O     1 
ATOM   3217  C  CB    . ALA E 2 360 ? 33.307  75.793  53.918  1.00 24.23 ? 549  ALA A CB    1 
ATOM   3218  N  N     . SER E 2 361 ? 34.129  72.666  52.335  1.00 26.50 ? 550  SER A N     1 
ATOM   3219  C  CA    . SER E 2 361 ? 35.287  71.808  52.180  1.00 27.64 ? 550  SER A CA    1 
ATOM   3220  C  C     . SER E 2 361 ? 35.930  71.867  50.817  1.00 26.69 ? 550  SER A C     1 
ATOM   3221  O  O     . SER E 2 361 ? 37.134  71.665  50.704  1.00 27.27 ? 550  SER A O     1 
ATOM   3222  C  CB    . SER E 2 361 ? 34.927  70.361  52.510  1.00 28.85 ? 550  SER A CB    1 
ATOM   3223  O  OG    . SER E 2 361 ? 33.926  69.883  51.638  1.00 32.91 ? 550  SER A OG    1 
ATOM   3224  N  N     . ARG E 2 362 ? 35.152  72.173  49.785  1.00 26.02 ? 551  ARG A N     1 
ATOM   3225  C  CA    . ARG E 2 362 ? 35.704  72.192  48.437  1.00 26.03 ? 551  ARG A CA    1 
ATOM   3226  C  C     . ARG E 2 362 ? 35.912  73.541  47.757  1.00 27.38 ? 551  ARG A C     1 
ATOM   3227  O  O     . ARG E 2 362 ? 35.070  74.442  47.832  1.00 27.24 ? 551  ARG A O     1 
ATOM   3228  C  CB    . ARG E 2 362 ? 34.854  71.279  47.541  1.00 25.57 ? 551  ARG A CB    1 
ATOM   3229  C  CG    . ARG E 2 362 ? 34.781  69.848  48.107  1.00 29.98 ? 551  ARG A CG    1 
ATOM   3230  C  CD    . ARG E 2 362 ? 33.857  68.898  47.358  1.00 29.97 ? 551  ARG A CD    1 
ATOM   3231  N  NE    . ARG E 2 362 ? 34.433  68.536  46.080  1.00 34.26 ? 551  ARG A NE    1 
ATOM   3232  C  CZ    . ARG E 2 362 ? 34.703  67.298  45.686  1.00 33.11 ? 551  ARG A CZ    1 
ATOM   3233  N  NH1   . ARG E 2 362 ? 34.454  66.254  46.465  1.00 32.49 ? 551  ARG A NH1   1 
ATOM   3234  N  NH2   . ARG E 2 362 ? 35.233  67.119  44.496  1.00 33.61 ? 551  ARG A NH2   1 
ATOM   3235  N  N     . GLY E 2 363 ? 37.077  73.666  47.129  1.00 28.38 ? 552  GLY A N     1 
ATOM   3236  C  CA    . GLY E 2 363 ? 37.435  74.848  46.369  1.00 30.23 ? 552  GLY A CA    1 
ATOM   3237  C  C     . GLY E 2 363 ? 37.619  76.225  46.980  1.00 30.72 ? 552  GLY A C     1 
ATOM   3238  O  O     . GLY E 2 363 ? 38.318  77.043  46.390  1.00 31.53 ? 552  GLY A O     1 
ATOM   3239  N  N     . LEU E 2 364 ? 37.017  76.517  48.126  1.00 30.89 ? 553  LEU A N     1 
ATOM   3240  C  CA    . LEU E 2 364 ? 37.178  77.861  48.673  1.00 31.66 ? 553  LEU A CA    1 
ATOM   3241  C  C     . LEU E 2 364 ? 38.651  78.220  48.851  1.00 32.36 ? 553  LEU A C     1 
ATOM   3242  O  O     . LEU E 2 364 ? 39.440  77.446  49.395  1.00 32.42 ? 553  LEU A O     1 
ATOM   3243  C  CB    . LEU E 2 364 ? 36.423  78.010  49.995  1.00 30.91 ? 553  LEU A CB    1 
ATOM   3244  C  CG    . LEU E 2 364 ? 34.899  77.855  49.940  1.00 31.14 ? 553  LEU A CG    1 
ATOM   3245  C  CD1   . LEU E 2 364 ? 34.298  78.354  51.250  1.00 30.38 ? 553  LEU A CD1   1 
ATOM   3246  C  CD2   . LEU E 2 364 ? 34.327  78.642  48.777  1.00 29.73 ? 553  LEU A CD2   1 
ATOM   3247  N  N     . ASP E 2 365 ? 38.998  79.408  48.375  1.00 33.36 ? 554  ASP A N     1 
ATOM   3248  C  CA    . ASP E 2 365 ? 40.354  79.932  48.411  1.00 34.49 ? 554  ASP A CA    1 
ATOM   3249  C  C     . ASP E 2 365 ? 40.425  81.152  49.338  1.00 35.41 ? 554  ASP A C     1 
ATOM   3250  O  O     . ASP E 2 365 ? 40.189  82.275  48.908  1.00 34.20 ? 554  ASP A O     1 
ATOM   3251  C  CB    . ASP E 2 365 ? 40.753  80.327  46.988  1.00 35.82 ? 554  ASP A CB    1 
ATOM   3252  C  CG    . ASP E 2 365 ? 42.183  80.792  46.890  1.00 37.33 ? 554  ASP A CG    1 
ATOM   3253  O  OD1   . ASP E 2 365 ? 43.090  79.984  47.162  1.00 38.87 ? 554  ASP A OD1   1 
ATOM   3254  O  OD2   . ASP E 2 365 ? 42.402  81.968  46.542  1.00 37.92 ? 554  ASP A OD2   1 
ATOM   3255  N  N     . ILE E 2 366 ? 40.741  80.927  50.611  1.00 36.68 ? 555  ILE A N     1 
ATOM   3256  C  CA    . ILE E 2 366 ? 40.818  82.011  51.573  1.00 37.65 ? 555  ILE A CA    1 
ATOM   3257  C  C     . ILE E 2 366 ? 42.218  82.185  52.137  1.00 38.87 ? 555  ILE A C     1 
ATOM   3258  O  O     . ILE E 2 366 ? 42.765  81.296  52.791  1.00 38.60 ? 555  ILE A O     1 
ATOM   3259  C  CB    . ILE E 2 366 ? 39.815  81.800  52.725  1.00 38.25 ? 555  ILE A CB    1 
ATOM   3260  C  CG1   . ILE E 2 366 ? 38.383  81.897  52.192  1.00 38.44 ? 555  ILE A CG1   1 
ATOM   3261  C  CG2   . ILE E 2 366 ? 39.999  82.863  53.796  1.00 38.64 ? 555  ILE A CG2   1 
ATOM   3262  C  CD1   . ILE E 2 366 ? 37.957  80.714  51.398  1.00 39.52 ? 555  ILE A CD1   1 
ATOM   3263  N  N     . LYS E 2 367 ? 42.785  83.358  51.882  1.00 40.87 ? 556  LYS A N     1 
ATOM   3264  C  CA    . LYS E 2 367 ? 44.128  83.686  52.331  1.00 42.59 ? 556  LYS A CA    1 
ATOM   3265  C  C     . LYS E 2 367 ? 44.328  83.574  53.847  1.00 42.60 ? 556  LYS A C     1 
ATOM   3266  O  O     . LYS E 2 367 ? 45.379  83.117  54.304  1.00 43.11 ? 556  LYS A O     1 
ATOM   3267  C  CB    . LYS E 2 367 ? 44.490  85.092  51.848  1.00 44.66 ? 556  LYS A CB    1 
ATOM   3268  C  CG    . LYS E 2 367 ? 45.964  85.424  52.004  1.00 48.98 ? 556  LYS A CG    1 
ATOM   3269  C  CD    . LYS E 2 367 ? 46.326  86.770  51.363  1.00 50.62 ? 556  LYS A CD    1 
ATOM   3270  C  CE    . LYS E 2 367 ? 47.855  86.920  51.202  1.00 52.25 ? 556  LYS A CE    1 
ATOM   3271  N  NZ    . LYS E 2 367 ? 48.441  85.905  50.262  1.00 51.25 ? 556  LYS A NZ    1 
ATOM   3272  N  N     . ASN E 2 368 ? 43.328  83.973  54.628  1.00 42.12 ? 557  ASN A N     1 
ATOM   3273  C  CA    . ASN E 2 368 ? 43.440  83.910  56.086  1.00 41.87 ? 557  ASN A CA    1 
ATOM   3274  C  C     . ASN E 2 368 ? 43.408  82.533  56.740  1.00 41.92 ? 557  ASN A C     1 
ATOM   3275  O  O     . ASN E 2 368 ? 43.728  82.410  57.924  1.00 42.75 ? 557  ASN A O     1 
ATOM   3276  C  CB    . ASN E 2 368 ? 42.356  84.761  56.740  1.00 41.25 ? 557  ASN A CB    1 
ATOM   3277  C  CG    . ASN E 2 368 ? 42.766  86.206  56.887  1.00 40.56 ? 557  ASN A CG    1 
ATOM   3278  O  OD1   . ASN E 2 368 ? 43.863  86.596  56.483  1.00 39.51 ? 557  ASN A OD1   1 
ATOM   3279  N  ND2   . ASN E 2 368 ? 41.888  87.011  57.472  1.00 39.30 ? 557  ASN A ND2   1 
ATOM   3280  N  N     . ILE E 2 369 ? 43.028  81.501  55.997  1.00 40.75 ? 558  ILE A N     1 
ATOM   3281  C  CA    . ILE E 2 369 ? 42.943  80.178  56.584  1.00 40.16 ? 558  ILE A CA    1 
ATOM   3282  C  C     . ILE E 2 369 ? 44.313  79.580  56.866  1.00 40.57 ? 558  ILE A C     1 
ATOM   3283  O  O     . ILE E 2 369 ? 44.940  78.992  55.995  1.00 41.57 ? 558  ILE A O     1 
ATOM   3284  C  CB    . ILE E 2 369 ? 42.133  79.222  55.679  1.00 39.67 ? 558  ILE A CB    1 
ATOM   3285  C  CG1   . ILE E 2 369 ? 40.680  79.686  55.613  1.00 38.91 ? 558  ILE A CG1   1 
ATOM   3286  C  CG2   . ILE E 2 369 ? 42.198  77.806  56.213  1.00 38.37 ? 558  ILE A CG2   1 
ATOM   3287  C  CD1   . ILE E 2 369 ? 39.795  78.818  54.735  1.00 38.20 ? 558  ILE A CD1   1 
ATOM   3288  N  N     . LYS E 2 370 ? 44.765  79.717  58.102  1.00 40.32 ? 559  LYS A N     1 
ATOM   3289  C  CA    . LYS E 2 370 ? 46.061  79.193  58.484  1.00 40.31 ? 559  LYS A CA    1 
ATOM   3290  C  C     . LYS E 2 370 ? 45.978  77.858  59.192  1.00 38.91 ? 559  LYS A C     1 
ATOM   3291  O  O     . LYS E 2 370 ? 46.999  77.228  59.429  1.00 39.95 ? 559  LYS A O     1 
ATOM   3292  C  CB    . LYS E 2 370 ? 46.799  80.185  59.386  1.00 42.11 ? 559  LYS A CB    1 
ATOM   3293  C  CG    . LYS E 2 370 ? 47.223  81.460  58.687  1.00 44.53 ? 559  LYS A CG    1 
ATOM   3294  C  CD    . LYS E 2 370 ? 48.212  82.239  59.547  1.00 47.11 ? 559  LYS A CD    1 
ATOM   3295  C  CE    . LYS E 2 370 ? 47.591  82.697  60.872  1.00 49.01 ? 559  LYS A CE    1 
ATOM   3296  N  NZ    . LYS E 2 370 ? 48.592  83.415  61.734  1.00 49.57 ? 559  LYS A NZ    1 
ATOM   3297  N  N     . HIS E 2 371 ? 44.776  77.419  59.538  1.00 37.31 ? 560  HIS A N     1 
ATOM   3298  C  CA    . HIS E 2 371 ? 44.644  76.137  60.233  1.00 35.41 ? 560  HIS A CA    1 
ATOM   3299  C  C     . HIS E 2 371 ? 43.282  75.492  59.992  1.00 34.35 ? 560  HIS A C     1 
ATOM   3300  O  O     . HIS E 2 371 ? 42.249  76.149  60.083  1.00 33.70 ? 560  HIS A O     1 
ATOM   3301  C  CB    . HIS E 2 371 ? 44.855  76.321  61.738  1.00 33.74 ? 560  HIS A CB    1 
ATOM   3302  C  CG    . HIS E 2 371 ? 44.992  75.034  62.485  1.00 33.08 ? 560  HIS A CG    1 
ATOM   3303  N  ND1   . HIS E 2 371 ? 44.954  74.961  63.860  1.00 32.87 ? 560  HIS A ND1   1 
ATOM   3304  C  CD2   . HIS E 2 371 ? 45.173  73.765  62.046  1.00 33.10 ? 560  HIS A CD2   1 
ATOM   3305  C  CE1   . HIS E 2 371 ? 45.105  73.702  64.237  1.00 33.04 ? 560  HIS A CE1   1 
ATOM   3306  N  NE2   . HIS E 2 371 ? 45.240  72.956  63.154  1.00 32.44 ? 560  HIS A NE2   1 
ATOM   3307  N  N     . VAL E 2 372 ? 43.298  74.202  59.678  1.00 33.01 ? 561  VAL A N     1 
ATOM   3308  C  CA    . VAL E 2 372 ? 42.075  73.474  59.425  1.00 31.16 ? 561  VAL A CA    1 
ATOM   3309  C  C     . VAL E 2 372 ? 41.933  72.420  60.481  1.00 31.50 ? 561  VAL A C     1 
ATOM   3310  O  O     . VAL E 2 372 ? 42.824  71.586  60.683  1.00 31.56 ? 561  VAL A O     1 
ATOM   3311  C  CB    . VAL E 2 372 ? 42.080  72.782  58.051  1.00 30.44 ? 561  VAL A CB    1 
ATOM   3312  C  CG1   . VAL E 2 372 ? 40.873  71.884  57.937  1.00 28.95 ? 561  VAL A CG1   1 
ATOM   3313  C  CG2   . VAL E 2 372 ? 42.069  73.826  56.928  1.00 29.11 ? 561  VAL A CG2   1 
ATOM   3314  N  N     . ILE E 2 373 ? 40.809  72.465  61.178  1.00 30.77 ? 562  ILE A N     1 
ATOM   3315  C  CA    . ILE E 2 373 ? 40.569  71.484  62.208  1.00 30.28 ? 562  ILE A CA    1 
ATOM   3316  C  C     . ILE E 2 373 ? 39.359  70.633  61.875  1.00 29.81 ? 562  ILE A C     1 
ATOM   3317  O  O     . ILE E 2 373 ? 38.271  71.147  61.633  1.00 28.96 ? 562  ILE A O     1 
ATOM   3318  C  CB    . ILE E 2 373 ? 40.329  72.142  63.588  1.00 29.58 ? 562  ILE A CB    1 
ATOM   3319  C  CG1   . ILE E 2 373 ? 41.496  73.074  63.931  1.00 29.97 ? 562  ILE A CG1   1 
ATOM   3320  C  CG2   . ILE E 2 373 ? 40.185  71.059  64.655  1.00 29.21 ? 562  ILE A CG2   1 
ATOM   3321  C  CD1   . ILE E 2 373 ? 41.398  73.745  65.306  1.00 27.07 ? 562  ILE A CD1   1 
ATOM   3322  N  N     . ASN E 2 374 ? 39.572  69.326  61.826  1.00 30.02 ? 563  ASN A N     1 
ATOM   3323  C  CA    . ASN E 2 374 ? 38.473  68.414  61.606  1.00 30.23 ? 563  ASN A CA    1 
ATOM   3324  C  C     . ASN E 2 374 ? 38.000  68.040  63.009  1.00 31.41 ? 563  ASN A C     1 
ATOM   3325  O  O     . ASN E 2 374 ? 38.539  67.121  63.640  1.00 31.95 ? 563  ASN A O     1 
ATOM   3326  C  CB    . ASN E 2 374 ? 38.925  67.172  60.847  1.00 30.08 ? 563  ASN A CB    1 
ATOM   3327  C  CG    . ASN E 2 374 ? 39.147  67.444  59.365  1.00 29.69 ? 563  ASN A CG    1 
ATOM   3328  O  OD1   . ASN E 2 374 ? 38.233  67.869  58.663  1.00 30.24 ? 563  ASN A OD1   1 
ATOM   3329  N  ND2   . ASN E 2 374 ? 40.360  67.198  58.889  1.00 28.58 ? 563  ASN A ND2   1 
ATOM   3330  N  N     . TYR E 2 375 ? 37.026  68.799  63.503  1.00 30.93 ? 564  TYR A N     1 
ATOM   3331  C  CA    . TYR E 2 375 ? 36.445  68.558  64.814  1.00 31.95 ? 564  TYR A CA    1 
ATOM   3332  C  C     . TYR E 2 375 ? 35.769  67.194  64.713  1.00 32.48 ? 564  TYR A C     1 
ATOM   3333  O  O     . TYR E 2 375 ? 35.826  66.379  65.635  1.00 31.71 ? 564  TYR A O     1 
ATOM   3334  C  CB    . TYR E 2 375 ? 35.437  69.665  65.127  1.00 31.17 ? 564  TYR A CB    1 
ATOM   3335  C  CG    . TYR E 2 375 ? 34.793  69.559  66.485  1.00 32.09 ? 564  TYR A CG    1 
ATOM   3336  C  CD1   . TYR E 2 375 ? 33.677  68.753  66.679  1.00 31.72 ? 564  TYR A CD1   1 
ATOM   3337  C  CD2   . TYR E 2 375 ? 35.302  70.263  67.578  1.00 31.04 ? 564  TYR A CD2   1 
ATOM   3338  C  CE1   . TYR E 2 375 ? 33.081  68.650  67.924  1.00 32.79 ? 564  TYR A CE1   1 
ATOM   3339  C  CE2   . TYR E 2 375 ? 34.714  70.163  68.833  1.00 32.05 ? 564  TYR A CE2   1 
ATOM   3340  C  CZ    . TYR E 2 375 ? 33.605  69.354  68.997  1.00 32.45 ? 564  TYR A CZ    1 
ATOM   3341  O  OH    . TYR E 2 375 ? 33.013  69.224  70.230  1.00 34.03 ? 564  TYR A OH    1 
ATOM   3342  N  N     . ASP E 2 376 ? 35.116  66.969  63.575  1.00 33.30 ? 565  ASP A N     1 
ATOM   3343  C  CA    . ASP E 2 376 ? 34.476  65.697  63.275  1.00 33.95 ? 565  ASP A CA    1 
ATOM   3344  C  C     . ASP E 2 376 ? 35.142  65.240  61.973  1.00 35.08 ? 565  ASP A C     1 
ATOM   3345  O  O     . ASP E 2 376 ? 35.219  66.020  61.006  1.00 35.35 ? 565  ASP A O     1 
ATOM   3346  C  CB    . ASP E 2 376 ? 32.969  65.856  63.012  1.00 34.26 ? 565  ASP A CB    1 
ATOM   3347  C  CG    . ASP E 2 376 ? 32.181  66.233  64.250  1.00 33.90 ? 565  ASP A CG    1 
ATOM   3348  O  OD1   . ASP E 2 376 ? 32.509  65.729  65.346  1.00 35.18 ? 565  ASP A OD1   1 
ATOM   3349  O  OD2   . ASP E 2 376 ? 31.220  67.018  64.115  1.00 32.01 ? 565  ASP A OD2   1 
ATOM   3350  N  N     . MET E 2 377 ? 35.643  64.006  61.942  1.00 35.13 ? 566  MET A N     1 
ATOM   3351  C  CA    . MET E 2 377 ? 36.248  63.495  60.719  1.00 35.08 ? 566  MET A CA    1 
ATOM   3352  C  C     . MET E 2 377 ? 35.090  63.280  59.757  1.00 34.72 ? 566  MET A C     1 
ATOM   3353  O  O     . MET E 2 377 ? 33.965  63.032  60.182  1.00 34.60 ? 566  MET A O     1 
ATOM   3354  C  CB    . MET E 2 377 ? 36.937  62.145  60.957  1.00 36.12 ? 566  MET A CB    1 
ATOM   3355  C  CG    . MET E 2 377 ? 38.311  62.193  61.626  1.00 38.96 ? 566  MET A CG    1 
ATOM   3356  S  SD    . MET E 2 377 ? 39.651  62.829  60.575  1.00 40.47 ? 566  MET A SD    1 
ATOM   3357  C  CE    . MET E 2 377 ? 39.783  61.529  59.396  1.00 39.69 ? 566  MET A CE    1 
ATOM   3358  N  N     . PRO E 2 378 ? 35.334  63.404  58.447  1.00 34.79 ? 567  PRO A N     1 
ATOM   3359  C  CA    . PRO E 2 378 ? 34.246  63.188  57.491  1.00 34.15 ? 567  PRO A CA    1 
ATOM   3360  C  C     . PRO E 2 378 ? 34.134  61.675  57.325  1.00 34.12 ? 567  PRO A C     1 
ATOM   3361  O  O     . PRO E 2 378 ? 35.004  60.939  57.784  1.00 33.49 ? 567  PRO A O     1 
ATOM   3362  C  CB    . PRO E 2 378 ? 34.771  63.851  56.230  1.00 34.38 ? 567  PRO A CB    1 
ATOM   3363  C  CG    . PRO E 2 378 ? 36.220  63.504  56.294  1.00 33.87 ? 567  PRO A CG    1 
ATOM   3364  C  CD    . PRO E 2 378 ? 36.563  63.817  57.751  1.00 34.93 ? 567  PRO A CD    1 
ATOM   3365  N  N     . SER E 2 379 ? 33.084  61.208  56.666  1.00 34.83 ? 568  SER A N     1 
ATOM   3366  C  CA    . SER E 2 379 ? 32.922  59.773  56.461  1.00 35.84 ? 568  SER A CA    1 
ATOM   3367  C  C     . SER E 2 379 ? 33.655  59.261  55.223  1.00 36.04 ? 568  SER A C     1 
ATOM   3368  O  O     . SER E 2 379 ? 33.837  58.056  55.060  1.00 37.37 ? 568  SER A O     1 
ATOM   3369  C  CB    . SER E 2 379 ? 31.440  59.423  56.353  1.00 36.36 ? 568  SER A CB    1 
ATOM   3370  O  OG    . SER E 2 379 ? 30.838  60.110  55.276  1.00 39.08 ? 568  SER A OG    1 
ATOM   3371  N  N     . LYS E 2 380 ? 34.075  60.167  54.349  1.00 35.06 ? 569  LYS A N     1 
ATOM   3372  C  CA    . LYS E 2 380 ? 34.784  59.772  53.135  1.00 34.83 ? 569  LYS A CA    1 
ATOM   3373  C  C     . LYS E 2 380 ? 36.156  60.426  53.108  1.00 33.18 ? 569  LYS A C     1 
ATOM   3374  O  O     . LYS E 2 380 ? 36.294  61.601  53.439  1.00 33.71 ? 569  LYS A O     1 
ATOM   3375  C  CB    . LYS E 2 380 ? 33.972  60.171  51.894  1.00 36.43 ? 569  LYS A CB    1 
ATOM   3376  C  CG    . LYS E 2 380 ? 32.538  59.654  51.938  1.00 39.87 ? 569  LYS A CG    1 
ATOM   3377  C  CD    . LYS E 2 380 ? 31.751  59.969  50.677  1.00 42.95 ? 569  LYS A CD    1 
ATOM   3378  C  CE    . LYS E 2 380 ? 32.287  59.166  49.493  1.00 44.99 ? 569  LYS A CE    1 
ATOM   3379  N  NZ    . LYS E 2 380 ? 31.543  59.425  48.218  1.00 46.30 ? 569  LYS A NZ    1 
ATOM   3380  N  N     . ILE E 2 381 ? 37.171  59.673  52.704  1.00 30.74 ? 570  ILE A N     1 
ATOM   3381  C  CA    . ILE E 2 381 ? 38.518  60.208  52.682  1.00 29.10 ? 570  ILE A CA    1 
ATOM   3382  C  C     . ILE E 2 381 ? 38.699  61.360  51.691  1.00 28.52 ? 570  ILE A C     1 
ATOM   3383  O  O     . ILE E 2 381 ? 39.560  62.218  51.892  1.00 26.75 ? 570  ILE A O     1 
ATOM   3384  C  CB    . ILE E 2 381 ? 39.562  59.097  52.401  1.00 29.21 ? 570  ILE A CB    1 
ATOM   3385  C  CG1   . ILE E 2 381 ? 40.959  59.599  52.770  1.00 29.25 ? 570  ILE A CG1   1 
ATOM   3386  C  CG2   . ILE E 2 381 ? 39.540  58.684  50.940  1.00 29.30 ? 570  ILE A CG2   1 
ATOM   3387  C  CD1   . ILE E 2 381 ? 41.134  59.879  54.251  1.00 29.56 ? 570  ILE A CD1   1 
ATOM   3388  N  N     . ASP E 2 382 ? 37.901  61.380  50.625  1.00 28.21 ? 571  ASP A N     1 
ATOM   3389  C  CA    . ASP E 2 382 ? 38.003  62.465  49.653  1.00 29.79 ? 571  ASP A CA    1 
ATOM   3390  C  C     . ASP E 2 382 ? 37.606  63.791  50.300  1.00 28.81 ? 571  ASP A C     1 
ATOM   3391  O  O     . ASP E 2 382 ? 38.219  64.817  50.046  1.00 30.60 ? 571  ASP A O     1 
ATOM   3392  C  CB    . ASP E 2 382 ? 37.121  62.206  48.424  1.00 29.70 ? 571  ASP A CB    1 
ATOM   3393  C  CG    . ASP E 2 382 ? 37.770  61.256  47.431  1.00 32.46 ? 571  ASP A CG    1 
ATOM   3394  O  OD1   . ASP E 2 382 ? 38.965  60.924  47.602  1.00 33.50 ? 571  ASP A OD1   1 
ATOM   3395  O  OD2   . ASP E 2 382 ? 37.091  60.844  46.467  1.00 34.10 ? 571  ASP A OD2   1 
ATOM   3396  N  N     . ASP E 2 383 ? 36.582  63.767  51.134  1.00 28.14 ? 572  ASP A N     1 
ATOM   3397  C  CA    . ASP E 2 383 ? 36.141  64.976  51.810  1.00 28.31 ? 572  ASP A CA    1 
ATOM   3398  C  C     . ASP E 2 383 ? 37.276  65.451  52.726  1.00 27.42 ? 572  ASP A C     1 
ATOM   3399  O  O     . ASP E 2 383 ? 37.504  66.648  52.867  1.00 26.67 ? 572  ASP A O     1 
ATOM   3400  C  CB    . ASP E 2 383 ? 34.861  64.695  52.601  1.00 30.37 ? 572  ASP A CB    1 
ATOM   3401  C  CG    . ASP E 2 383 ? 34.130  65.968  53.017  1.00 34.06 ? 572  ASP A CG    1 
ATOM   3402  O  OD1   . ASP E 2 383 ? 34.121  66.948  52.241  1.00 35.72 ? 572  ASP A OD1   1 
ATOM   3403  O  OD2   . ASP E 2 383 ? 33.543  65.984  54.120  1.00 36.26 ? 572  ASP A OD2   1 
ATOM   3404  N  N     . TYR E 2 384 ? 37.999  64.508  53.329  1.00 26.26 ? 573  TYR A N     1 
ATOM   3405  C  CA    . TYR E 2 384 ? 39.127  64.846  54.192  1.00 25.95 ? 573  TYR A CA    1 
ATOM   3406  C  C     . TYR E 2 384 ? 40.178  65.588  53.372  1.00 24.79 ? 573  TYR A C     1 
ATOM   3407  O  O     . TYR E 2 384 ? 40.695  66.606  53.804  1.00 24.22 ? 573  TYR A O     1 
ATOM   3408  C  CB    . TYR E 2 384 ? 39.771  63.590  54.775  1.00 26.94 ? 573  TYR A CB    1 
ATOM   3409  C  CG    . TYR E 2 384 ? 41.075  63.857  55.498  1.00 29.67 ? 573  TYR A CG    1 
ATOM   3410  C  CD1   . TYR E 2 384 ? 41.091  64.275  56.829  1.00 31.19 ? 573  TYR A CD1   1 
ATOM   3411  C  CD2   . TYR E 2 384 ? 42.299  63.667  54.858  1.00 31.17 ? 573  TYR A CD2   1 
ATOM   3412  C  CE1   . TYR E 2 384 ? 42.293  64.488  57.510  1.00 31.10 ? 573  TYR A CE1   1 
ATOM   3413  C  CE2   . TYR E 2 384 ? 43.506  63.880  55.532  1.00 31.85 ? 573  TYR A CE2   1 
ATOM   3414  C  CZ    . TYR E 2 384 ? 43.490  64.287  56.857  1.00 31.51 ? 573  TYR A CZ    1 
ATOM   3415  O  OH    . TYR E 2 384 ? 44.678  64.475  57.525  1.00 32.24 ? 573  TYR A OH    1 
ATOM   3416  N  N     . VAL E 2 385 ? 40.476  65.073  52.184  1.00 24.71 ? 574  VAL A N     1 
ATOM   3417  C  CA    . VAL E 2 385 ? 41.472  65.684  51.322  1.00 25.50 ? 574  VAL A CA    1 
ATOM   3418  C  C     . VAL E 2 385 ? 41.119  67.122  50.938  1.00 26.33 ? 574  VAL A C     1 
ATOM   3419  O  O     . VAL E 2 385 ? 41.982  67.998  51.005  1.00 26.68 ? 574  VAL A O     1 
ATOM   3420  C  CB    . VAL E 2 385 ? 41.721  64.822  50.055  1.00 25.99 ? 574  VAL A CB    1 
ATOM   3421  C  CG1   . VAL E 2 385 ? 42.582  65.583  49.059  1.00 25.60 ? 574  VAL A CG1   1 
ATOM   3422  C  CG2   . VAL E 2 385 ? 42.445  63.503  50.449  1.00 25.22 ? 574  VAL A CG2   1 
ATOM   3423  N  N     . HIS E 2 386 ? 39.869  67.382  50.551  1.00 26.07 ? 575  HIS A N     1 
ATOM   3424  C  CA    . HIS E 2 386 ? 39.488  68.751  50.195  1.00 26.53 ? 575  HIS A CA    1 
ATOM   3425  C  C     . HIS E 2 386 ? 39.548  69.662  51.421  1.00 26.25 ? 575  HIS A C     1 
ATOM   3426  O  O     . HIS E 2 386 ? 40.110  70.748  51.355  1.00 27.40 ? 575  HIS A O     1 
ATOM   3427  C  CB    . HIS E 2 386 ? 38.076  68.808  49.583  1.00 26.63 ? 575  HIS A CB    1 
ATOM   3428  C  CG    . HIS E 2 386 ? 37.972  68.141  48.248  1.00 27.89 ? 575  HIS A CG    1 
ATOM   3429  N  ND1   . HIS E 2 386 ? 38.349  68.760  47.076  1.00 28.05 ? 575  HIS A ND1   1 
ATOM   3430  C  CD2   . HIS E 2 386 ? 37.617  66.878  47.910  1.00 28.16 ? 575  HIS A CD2   1 
ATOM   3431  C  CE1   . HIS E 2 386 ? 38.239  67.906  46.074  1.00 28.89 ? 575  HIS A CE1   1 
ATOM   3432  N  NE2   . HIS E 2 386 ? 37.800  66.756  46.553  1.00 27.87 ? 575  HIS A NE2   1 
ATOM   3433  N  N     . ARG E 2 387 ? 38.969  69.226  52.536  1.00 26.44 ? 576  ARG A N     1 
ATOM   3434  C  CA    . ARG E 2 387 ? 38.979  70.031  53.758  1.00 27.37 ? 576  ARG A CA    1 
ATOM   3435  C  C     . ARG E 2 387 ? 40.352  70.526  54.189  1.00 27.27 ? 576  ARG A C     1 
ATOM   3436  O  O     . ARG E 2 387 ? 40.536  71.710  54.415  1.00 27.95 ? 576  ARG A O     1 
ATOM   3437  C  CB    . ARG E 2 387 ? 38.400  69.260  54.941  1.00 27.51 ? 576  ARG A CB    1 
ATOM   3438  C  CG    . ARG E 2 387 ? 36.915  69.048  54.926  1.00 26.00 ? 576  ARG A CG    1 
ATOM   3439  C  CD    . ARG E 2 387 ? 36.560  68.342  56.193  1.00 25.30 ? 576  ARG A CD    1 
ATOM   3440  N  NE    . ARG E 2 387 ? 35.136  68.128  56.326  1.00 27.08 ? 576  ARG A NE    1 
ATOM   3441  C  CZ    . ARG E 2 387 ? 34.574  67.587  57.397  1.00 27.70 ? 576  ARG A CZ    1 
ATOM   3442  N  NH1   . ARG E 2 387 ? 35.331  67.207  58.423  1.00 28.10 ? 576  ARG A NH1   1 
ATOM   3443  N  NH2   . ARG E 2 387 ? 33.256  67.438  57.443  1.00 28.08 ? 576  ARG A NH2   1 
ATOM   3444  N  N     . ILE E 2 388 ? 41.314  69.624  54.322  1.00 27.50 ? 577  ILE A N     1 
ATOM   3445  C  CA    . ILE E 2 388 ? 42.622  70.062  54.758  1.00 27.82 ? 577  ILE A CA    1 
ATOM   3446  C  C     . ILE E 2 388 ? 43.258  70.884  53.659  1.00 27.53 ? 577  ILE A C     1 
ATOM   3447  O  O     . ILE E 2 388 ? 44.217  71.610  53.888  1.00 27.98 ? 577  ILE A O     1 
ATOM   3448  C  CB    . ILE E 2 388 ? 43.535  68.882  55.152  1.00 28.33 ? 577  ILE A CB    1 
ATOM   3449  C  CG1   . ILE E 2 388 ? 44.017  68.123  53.919  1.00 29.71 ? 577  ILE A CG1   1 
ATOM   3450  C  CG2   . ILE E 2 388 ? 42.789  67.949  56.090  1.00 28.21 ? 577  ILE A CG2   1 
ATOM   3451  C  CD1   . ILE E 2 388 ? 45.160  67.168  54.243  1.00 31.22 ? 577  ILE A CD1   1 
ATOM   3452  N  N     . GLY E 2 389 ? 42.692  70.787  52.466  1.00 26.83 ? 578  GLY A N     1 
ATOM   3453  C  CA    . GLY E 2 389 ? 43.204  71.554  51.353  1.00 26.41 ? 578  GLY A CA    1 
ATOM   3454  C  C     . GLY E 2 389 ? 42.816  73.022  51.414  1.00 27.34 ? 578  GLY A C     1 
ATOM   3455  O  O     . GLY E 2 389 ? 43.252  73.785  50.566  1.00 27.96 ? 578  GLY A O     1 
ATOM   3456  N  N     . ARG E 2 390 ? 42.008  73.439  52.390  1.00 28.44 ? 579  ARG A N     1 
ATOM   3457  C  CA    . ARG E 2 390 ? 41.642  74.862  52.480  1.00 31.68 ? 579  ARG A CA    1 
ATOM   3458  C  C     . ARG E 2 390 ? 42.848  75.687  52.966  1.00 33.37 ? 579  ARG A C     1 
ATOM   3459  O  O     . ARG E 2 390 ? 42.810  76.913  52.969  1.00 32.91 ? 579  ARG A O     1 
ATOM   3460  C  CB    . ARG E 2 390 ? 40.468  75.099  53.450  1.00 30.84 ? 579  ARG A CB    1 
ATOM   3461  C  CG    . ARG E 2 390 ? 39.100  74.521  53.048  1.00 30.89 ? 579  ARG A CG    1 
ATOM   3462  C  CD    . ARG E 2 390 ? 38.788  74.733  51.579  1.00 29.76 ? 579  ARG A CD    1 
ATOM   3463  N  NE    . ARG E 2 390 ? 39.389  73.673  50.783  1.00 29.75 ? 579  ARG A NE    1 
ATOM   3464  C  CZ    . ARG E 2 390 ? 39.691  73.776  49.494  1.00 30.13 ? 579  ARG A CZ    1 
ATOM   3465  N  NH1   . ARG E 2 390 ? 39.463  74.894  48.834  1.00 29.36 ? 579  ARG A NH1   1 
ATOM   3466  N  NH2   . ARG E 2 390 ? 40.197  72.735  48.857  1.00 32.19 ? 579  ARG A NH2   1 
ATOM   3467  N  N     . THR E 2 391 ? 43.898  74.988  53.396  1.00 35.38 ? 580  THR A N     1 
ATOM   3468  C  CA    . THR E 2 391 ? 45.138  75.594  53.882  1.00 38.10 ? 580  THR A CA    1 
ATOM   3469  C  C     . THR E 2 391 ? 46.341  75.066  53.079  1.00 39.37 ? 580  THR A C     1 
ATOM   3470  O  O     . THR E 2 391 ? 46.238  74.072  52.355  1.00 38.34 ? 580  THR A O     1 
ATOM   3471  C  CB    . THR E 2 391 ? 45.371  75.255  55.381  1.00 38.08 ? 580  THR A CB    1 
ATOM   3472  O  OG1   . THR E 2 391 ? 44.492  76.040  56.188  1.00 41.36 ? 580  THR A OG1   1 
ATOM   3473  C  CG2   . THR E 2 391 ? 46.772  75.562  55.800  1.00 39.03 ? 580  THR A CG2   1 
ATOM   3474  N  N     . GLY E 2 392 ? 47.478  75.740  53.219  1.00 41.04 ? 581  GLY A N     1 
ATOM   3475  C  CA    . GLY E 2 392 ? 48.688  75.323  52.532  1.00 43.50 ? 581  GLY A CA    1 
ATOM   3476  C  C     . GLY E 2 392 ? 48.526  75.246  51.031  1.00 45.02 ? 581  GLY A C     1 
ATOM   3477  O  O     . GLY E 2 392 ? 48.797  74.207  50.422  1.00 45.73 ? 581  GLY A O     1 
ATOM   3478  N  N     . ARG E 2 393 ? 48.091  76.350  50.438  1.00 46.08 ? 582  ARG A N     1 
ATOM   3479  C  CA    . ARG E 2 393 ? 47.874  76.417  49.003  1.00 47.57 ? 582  ARG A CA    1 
ATOM   3480  C  C     . ARG E 2 393 ? 48.991  77.216  48.337  1.00 48.41 ? 582  ARG A C     1 
ATOM   3481  O  O     . ARG E 2 393 ? 49.713  77.964  48.998  1.00 48.60 ? 582  ARG A O     1 
ATOM   3482  C  CB    . ARG E 2 393 ? 46.528  77.093  48.711  1.00 48.32 ? 582  ARG A CB    1 
ATOM   3483  C  CG    . ARG E 2 393 ? 45.413  76.792  49.726  1.00 48.97 ? 582  ARG A CG    1 
ATOM   3484  C  CD    . ARG E 2 393 ? 44.063  77.270  49.201  1.00 49.88 ? 582  ARG A CD    1 
ATOM   3485  N  NE    . ARG E 2 393 ? 43.605  76.426  48.099  1.00 52.61 ? 582  ARG A NE    1 
ATOM   3486  C  CZ    . ARG E 2 393 ? 42.556  76.691  47.326  1.00 53.24 ? 582  ARG A CZ    1 
ATOM   3487  N  NH1   . ARG E 2 393 ? 41.846  77.786  47.528  1.00 55.34 ? 582  ARG A NH1   1 
ATOM   3488  N  NH2   . ARG E 2 393 ? 42.211  75.861  46.353  1.00 53.14 ? 582  ARG A NH2   1 
ATOM   3489  N  N     . VAL E 2 394 ? 49.121  77.051  47.024  1.00 49.12 ? 583  VAL A N     1 
ATOM   3490  C  CA    . VAL E 2 394 ? 50.122  77.761  46.230  1.00 50.03 ? 583  VAL A CA    1 
ATOM   3491  C  C     . VAL E 2 394 ? 51.553  77.613  46.742  1.00 50.61 ? 583  VAL A C     1 
ATOM   3492  O  O     . VAL E 2 394 ? 52.329  78.568  46.700  1.00 50.09 ? 583  VAL A O     1 
ATOM   3493  C  CB    . VAL E 2 394 ? 49.817  79.278  46.145  1.00 50.22 ? 583  VAL A CB    1 
ATOM   3494  C  CG1   . VAL E 2 394 ? 50.230  79.798  44.779  1.00 50.51 ? 583  VAL A CG1   1 
ATOM   3495  C  CG2   . VAL E 2 394 ? 48.337  79.550  46.414  1.00 50.44 ? 583  VAL A CG2   1 
ATOM   3496  N  N     . GLY E 2 395 ? 51.895  76.421  47.221  1.00 51.29 ? 584  GLY A N     1 
ATOM   3497  C  CA    . GLY E 2 395 ? 53.236  76.180  47.718  1.00 52.51 ? 584  GLY A CA    1 
ATOM   3498  C  C     . GLY E 2 395 ? 53.497  76.625  49.148  1.00 53.50 ? 584  GLY A C     1 
ATOM   3499  O  O     . GLY E 2 395 ? 54.593  76.415  49.671  1.00 54.51 ? 584  GLY A O     1 
ATOM   3500  N  N     . ASN E 2 396 ? 52.511  77.246  49.788  1.00 53.24 ? 585  ASN A N     1 
ATOM   3501  C  CA    . ASN E 2 396 ? 52.678  77.693  51.168  1.00 53.10 ? 585  ASN A CA    1 
ATOM   3502  C  C     . ASN E 2 396 ? 52.497  76.543  52.157  1.00 52.78 ? 585  ASN A C     1 
ATOM   3503  O  O     . ASN E 2 396 ? 51.972  75.480  51.810  1.00 52.66 ? 585  ASN A O     1 
ATOM   3504  C  CB    . ASN E 2 396 ? 51.675  78.803  51.480  1.00 52.70 ? 585  ASN A CB    1 
ATOM   3505  C  CG    . ASN E 2 396 ? 52.085  80.135  50.888  1.00 52.93 ? 585  ASN A CG    1 
ATOM   3506  O  OD1   . ASN E 2 396 ? 52.987  80.799  51.402  1.00 52.54 ? 585  ASN A OD1   1 
ATOM   3507  N  ND2   . ASN E 2 396 ? 51.433  80.530  49.796  1.00 52.60 ? 585  ASN A ND2   1 
ATOM   3508  N  N     . ASN E 2 397 ? 52.957  76.745  53.385  1.00 52.24 ? 586  ASN A N     1 
ATOM   3509  C  CA    . ASN E 2 397 ? 52.798  75.721  54.410  1.00 52.07 ? 586  ASN A CA    1 
ATOM   3510  C  C     . ASN E 2 397 ? 51.417  75.875  55.039  1.00 50.81 ? 586  ASN A C     1 
ATOM   3511  O  O     . ASN E 2 397 ? 50.725  76.879  54.840  1.00 50.76 ? 586  ASN A O     1 
ATOM   3512  C  CB    . ASN E 2 397 ? 53.860  75.861  55.511  1.00 53.38 ? 586  ASN A CB    1 
ATOM   3513  C  CG    . ASN E 2 397 ? 55.216  75.333  55.090  1.00 54.36 ? 586  ASN A CG    1 
ATOM   3514  O  OD1   . ASN E 2 397 ? 55.380  74.132  54.834  1.00 53.53 ? 586  ASN A OD1   1 
ATOM   3515  N  ND2   . ASN E 2 397 ? 56.201  76.230  55.015  1.00 54.45 ? 586  ASN A ND2   1 
ATOM   3516  N  N     . GLY E 2 398 ? 51.023  74.872  55.810  1.00 48.92 ? 587  GLY A N     1 
ATOM   3517  C  CA    . GLY E 2 398 ? 49.741  74.926  56.471  1.00 46.23 ? 587  GLY A CA    1 
ATOM   3518  C  C     . GLY E 2 398 ? 49.642  73.748  57.400  1.00 44.33 ? 587  GLY A C     1 
ATOM   3519  O  O     . GLY E 2 398 ? 50.368  72.767  57.242  1.00 44.34 ? 587  GLY A O     1 
ATOM   3520  N  N     . ARG E 2 399 ? 48.757  73.841  58.379  1.00 42.04 ? 588  ARG A N     1 
ATOM   3521  C  CA    . ARG E 2 399 ? 48.588  72.747  59.313  1.00 40.43 ? 588  ARG A CA    1 
ATOM   3522  C  C     . ARG E 2 399 ? 47.133  72.305  59.388  1.00 38.02 ? 588  ARG A C     1 
ATOM   3523  O  O     . ARG E 2 399 ? 46.213  73.099  59.269  1.00 37.19 ? 588  ARG A O     1 
ATOM   3524  C  CB    . ARG E 2 399 ? 49.120  73.145  60.699  1.00 41.05 ? 588  ARG A CB    1 
ATOM   3525  C  CG    . ARG E 2 399 ? 48.765  74.557  61.135  1.00 43.12 ? 588  ARG A CG    1 
ATOM   3526  C  CD    . ARG E 2 399 ? 49.495  74.940  62.423  1.00 43.74 ? 588  ARG A CD    1 
ATOM   3527  N  NE    . ARG E 2 399 ? 49.067  74.134  63.564  1.00 45.41 ? 588  ARG A NE    1 
ATOM   3528  C  CZ    . ARG E 2 399 ? 48.363  74.596  64.594  1.00 45.04 ? 588  ARG A CZ    1 
ATOM   3529  N  NH1   . ARG E 2 399 ? 47.995  75.871  64.644  1.00 46.05 ? 588  ARG A NH1   1 
ATOM   3530  N  NH2   . ARG E 2 399 ? 48.030  73.778  65.579  1.00 44.99 ? 588  ARG A NH2   1 
ATOM   3531  N  N     . ALA E 2 400 ? 46.941  71.014  59.562  1.00 36.92 ? 589  ALA A N     1 
ATOM   3532  C  CA    . ALA E 2 400 ? 45.617  70.458  59.657  1.00 36.42 ? 589  ALA A CA    1 
ATOM   3533  C  C     . ALA E 2 400 ? 45.635  69.510  60.834  1.00 36.01 ? 589  ALA A C     1 
ATOM   3534  O  O     . ALA E 2 400 ? 46.481  68.618  60.926  1.00 36.72 ? 589  ALA A O     1 
ATOM   3535  C  CB    . ALA E 2 400 ? 45.261  69.717  58.375  1.00 36.33 ? 589  ALA A CB    1 
ATOM   3536  N  N     . THR E 2 401 ? 44.699  69.726  61.742  1.00 35.46 ? 590  THR A N     1 
ATOM   3537  C  CA    . THR E 2 401 ? 44.575  68.919  62.933  1.00 34.58 ? 590  THR A CA    1 
ATOM   3538  C  C     . THR E 2 401 ? 43.236  68.221  62.870  1.00 34.41 ? 590  THR A C     1 
ATOM   3539  O  O     . THR E 2 401 ? 42.205  68.854  62.635  1.00 35.22 ? 590  THR A O     1 
ATOM   3540  C  CB    . THR E 2 401 ? 44.641  69.819  64.180  1.00 34.74 ? 590  THR A CB    1 
ATOM   3541  O  OG1   . THR E 2 401 ? 45.841  70.593  64.121  1.00 34.58 ? 590  THR A OG1   1 
ATOM   3542  C  CG2   . THR E 2 401 ? 44.640  68.991  65.456  1.00 33.91 ? 590  THR A CG2   1 
ATOM   3543  N  N     . SER E 2 402 ? 43.245  66.918  63.083  1.00 33.77 ? 591  SER A N     1 
ATOM   3544  C  CA    . SER E 2 402 ? 42.010  66.161  63.026  1.00 34.62 ? 591  SER A CA    1 
ATOM   3545  C  C     . SER E 2 402 ? 41.789  65.364  64.302  1.00 35.38 ? 591  SER A C     1 
ATOM   3546  O  O     . SER E 2 402 ? 42.720  64.782  64.847  1.00 34.78 ? 591  SER A O     1 
ATOM   3547  C  CB    . SER E 2 402 ? 42.032  65.222  61.818  1.00 33.34 ? 591  SER A CB    1 
ATOM   3548  O  OG    . SER E 2 402 ? 42.287  65.962  60.638  1.00 33.32 ? 591  SER A OG    1 
ATOM   3549  N  N     . PHE E 2 403 ? 40.547  65.362  64.775  1.00 36.21 ? 592  PHE A N     1 
ATOM   3550  C  CA    . PHE E 2 403 ? 40.179  64.631  65.972  1.00 37.15 ? 592  PHE A CA    1 
ATOM   3551  C  C     . PHE E 2 403 ? 39.602  63.313  65.498  1.00 38.84 ? 592  PHE A C     1 
ATOM   3552  O  O     . PHE E 2 403 ? 38.530  63.268  64.888  1.00 38.73 ? 592  PHE A O     1 
ATOM   3553  C  CB    . PHE E 2 403 ? 39.137  65.409  66.779  1.00 36.33 ? 592  PHE A CB    1 
ATOM   3554  C  CG    . PHE E 2 403 ? 39.632  66.730  67.302  1.00 36.42 ? 592  PHE A CG    1 
ATOM   3555  C  CD1   . PHE E 2 403 ? 38.765  67.599  67.958  1.00 36.38 ? 592  PHE A CD1   1 
ATOM   3556  C  CD2   . PHE E 2 403 ? 40.960  67.108  67.146  1.00 35.49 ? 592  PHE A CD2   1 
ATOM   3557  C  CE1   . PHE E 2 403 ? 39.212  68.819  68.448  1.00 35.05 ? 592  PHE A CE1   1 
ATOM   3558  C  CE2   . PHE E 2 403 ? 41.415  68.327  67.632  1.00 34.97 ? 592  PHE A CE2   1 
ATOM   3559  C  CZ    . PHE E 2 403 ? 40.539  69.183  68.285  1.00 35.41 ? 592  PHE A CZ    1 
ATOM   3560  N  N     . PHE E 2 404 ? 40.334  62.242  65.768  1.00 40.42 ? 593  PHE A N     1 
ATOM   3561  C  CA    . PHE E 2 404 ? 39.925  60.911  65.366  1.00 42.94 ? 593  PHE A CA    1 
ATOM   3562  C  C     . PHE E 2 404 ? 39.270  60.205  66.550  1.00 44.95 ? 593  PHE A C     1 
ATOM   3563  O  O     . PHE E 2 404 ? 39.889  60.015  67.595  1.00 45.84 ? 593  PHE A O     1 
ATOM   3564  C  CB    . PHE E 2 404 ? 41.146  60.123  64.895  1.00 42.24 ? 593  PHE A CB    1 
ATOM   3565  C  CG    . PHE E 2 404 ? 40.821  58.760  64.378  1.00 43.14 ? 593  PHE A CG    1 
ATOM   3566  C  CD1   . PHE E 2 404 ? 40.636  58.545  63.015  1.00 43.48 ? 593  PHE A CD1   1 
ATOM   3567  C  CD2   . PHE E 2 404 ? 40.700  57.683  65.254  1.00 44.41 ? 593  PHE A CD2   1 
ATOM   3568  C  CE1   . PHE E 2 404 ? 40.333  57.273  62.524  1.00 43.94 ? 593  PHE A CE1   1 
ATOM   3569  C  CE2   . PHE E 2 404 ? 40.399  56.404  64.778  1.00 44.62 ? 593  PHE A CE2   1 
ATOM   3570  C  CZ    . PHE E 2 404 ? 40.215  56.200  63.408  1.00 44.59 ? 593  PHE A CZ    1 
ATOM   3571  N  N     . ASP E 2 405 ? 38.015  59.817  66.379  1.00 46.65 ? 594  ASP A N     1 
ATOM   3572  C  CA    . ASP E 2 405 ? 37.282  59.146  67.434  1.00 48.82 ? 594  ASP A CA    1 
ATOM   3573  C  C     . ASP E 2 405 ? 37.176  57.657  67.137  1.00 50.44 ? 594  ASP A C     1 
ATOM   3574  O  O     . ASP E 2 405 ? 36.572  57.260  66.147  1.00 49.79 ? 594  ASP A O     1 
ATOM   3575  C  CB    . ASP E 2 405 ? 35.881  59.745  67.549  1.00 49.34 ? 594  ASP A CB    1 
ATOM   3576  C  CG    . ASP E 2 405 ? 35.092  59.161  68.702  1.00 50.35 ? 594  ASP A CG    1 
ATOM   3577  O  OD1   . ASP E 2 405 ? 35.360  57.999  69.084  1.00 50.90 ? 594  ASP A OD1   1 
ATOM   3578  O  OD2   . ASP E 2 405 ? 34.192  59.859  69.216  1.00 50.20 ? 594  ASP A OD2   1 
ATOM   3579  N  N     . PRO E 2 406 ? 37.769  56.813  67.996  1.00 52.55 ? 595  PRO A N     1 
ATOM   3580  C  CA    . PRO E 2 406 ? 37.736  55.356  67.821  1.00 54.31 ? 595  PRO A CA    1 
ATOM   3581  C  C     . PRO E 2 406 ? 36.312  54.808  67.887  1.00 55.80 ? 595  PRO A C     1 
ATOM   3582  O  O     . PRO E 2 406 ? 36.014  53.748  67.337  1.00 56.03 ? 595  PRO A O     1 
ATOM   3583  C  CB    . PRO E 2 406 ? 38.594  54.853  68.974  1.00 53.87 ? 595  PRO A CB    1 
ATOM   3584  C  CG    . PRO E 2 406 ? 39.572  55.960  69.166  1.00 53.75 ? 595  PRO A CG    1 
ATOM   3585  C  CD    . PRO E 2 406 ? 38.688  57.183  69.084  1.00 53.25 ? 595  PRO A CD    1 
ATOM   3586  N  N     . GLU E 2 407 ? 35.441  55.550  68.561  1.00 57.52 ? 596  GLU A N     1 
ATOM   3587  C  CA    . GLU E 2 407 ? 34.035  55.174  68.727  1.00 59.38 ? 596  GLU A CA    1 
ATOM   3588  C  C     . GLU E 2 407 ? 33.230  55.221  67.426  1.00 58.85 ? 596  GLU A C     1 
ATOM   3589  O  O     . GLU E 2 407 ? 32.139  54.645  67.354  1.00 59.34 ? 596  GLU A O     1 
ATOM   3590  C  CB    . GLU E 2 407 ? 33.355  56.116  69.732  1.00 61.69 ? 596  GLU A CB    1 
ATOM   3591  C  CG    . GLU E 2 407 ? 32.793  55.471  70.992  1.00 65.10 ? 596  GLU A CG    1 
ATOM   3592  C  CD    . GLU E 2 407 ? 31.908  56.437  71.789  1.00 67.16 ? 596  GLU A CD    1 
ATOM   3593  O  OE1   . GLU E 2 407 ? 32.354  57.579  72.054  1.00 68.25 ? 596  GLU A OE1   1 
ATOM   3594  O  OE2   . GLU E 2 407 ? 30.770  56.056  72.152  1.00 67.92 ? 596  GLU A OE2   1 
ATOM   3595  N  N     . LYS E 2 408 ? 33.750  55.904  66.406  1.00 57.68 ? 597  LYS A N     1 
ATOM   3596  C  CA    . LYS E 2 408 ? 33.005  56.026  65.156  1.00 56.29 ? 597  LYS A CA    1 
ATOM   3597  C  C     . LYS E 2 408 ? 33.777  56.243  63.857  1.00 54.92 ? 597  LYS A C     1 
ATOM   3598  O  O     . LYS E 2 408 ? 33.188  56.163  62.784  1.00 55.02 ? 597  LYS A O     1 
ATOM   3599  C  CB    . LYS E 2 408 ? 31.992  57.150  65.309  1.00 56.87 ? 597  LYS A CB    1 
ATOM   3600  C  CG    . LYS E 2 408 ? 32.630  58.452  65.744  1.00 57.66 ? 597  LYS A CG    1 
ATOM   3601  C  CD    . LYS E 2 408 ? 31.588  59.483  66.123  1.00 58.39 ? 597  LYS A CD    1 
ATOM   3602  C  CE    . LYS E 2 408 ? 30.636  59.762  64.974  1.00 58.87 ? 597  LYS A CE    1 
ATOM   3603  N  NZ    . LYS E 2 408 ? 29.644  60.808  65.346  1.00 59.08 ? 597  LYS A NZ    1 
ATOM   3604  N  N     . ASP E 2 409 ? 35.075  56.512  63.932  1.00 53.35 ? 598  ASP A N     1 
ATOM   3605  C  CA    . ASP E 2 409 ? 35.851  56.752  62.721  1.00 52.35 ? 598  ASP A CA    1 
ATOM   3606  C  C     . ASP E 2 409 ? 36.787  55.618  62.327  1.00 52.12 ? 598  ASP A C     1 
ATOM   3607  O  O     . ASP E 2 409 ? 37.760  55.843  61.609  1.00 51.24 ? 598  ASP A O     1 
ATOM   3608  C  CB    . ASP E 2 409 ? 36.660  58.038  62.867  1.00 52.14 ? 598  ASP A CB    1 
ATOM   3609  C  CG    . ASP E 2 409 ? 35.803  59.220  63.275  1.00 52.86 ? 598  ASP A CG    1 
ATOM   3610  O  OD1   . ASP E 2 409 ? 34.732  59.419  62.661  1.00 53.51 ? 598  ASP A OD1   1 
ATOM   3611  O  OD2   . ASP E 2 409 ? 36.199  59.959  64.202  1.00 52.55 ? 598  ASP A OD2   1 
ATOM   3612  N  N     . ARG E 2 410 ? 36.497  54.403  62.788  1.00 51.94 ? 599  ARG A N     1 
ATOM   3613  C  CA    . ARG E 2 410 ? 37.341  53.257  62.459  1.00 51.41 ? 599  ARG A CA    1 
ATOM   3614  C  C     . ARG E 2 410 ? 37.380  52.994  60.958  1.00 49.90 ? 599  ARG A C     1 
ATOM   3615  O  O     . ARG E 2 410 ? 38.431  52.685  60.403  1.00 50.10 ? 599  ARG A O     1 
ATOM   3616  C  CB    . ARG E 2 410 ? 36.855  51.991  63.182  1.00 52.95 ? 599  ARG A CB    1 
ATOM   3617  C  CG    . ARG E 2 410 ? 37.654  51.644  64.439  1.00 56.56 ? 599  ARG A CG    1 
ATOM   3618  C  CD    . ARG E 2 410 ? 37.238  50.294  65.041  1.00 59.08 ? 599  ARG A CD    1 
ATOM   3619  N  NE    . ARG E 2 410 ? 36.715  50.427  66.404  1.00 61.69 ? 599  ARG A NE    1 
ATOM   3620  C  CZ    . ARG E 2 410 ? 35.539  50.973  66.716  1.00 62.61 ? 599  ARG A CZ    1 
ATOM   3621  N  NH1   . ARG E 2 410 ? 34.741  51.446  65.764  1.00 63.47 ? 599  ARG A NH1   1 
ATOM   3622  N  NH2   . ARG E 2 410 ? 35.158  51.051  67.986  1.00 63.34 ? 599  ARG A NH2   1 
ATOM   3623  N  N     . ALA E 2 411 ? 36.232  53.132  60.306  1.00 47.89 ? 600  ALA A N     1 
ATOM   3624  C  CA    . ALA E 2 411 ? 36.119  52.884  58.872  1.00 46.34 ? 600  ALA A CA    1 
ATOM   3625  C  C     . ALA E 2 411 ? 37.041  53.708  57.957  1.00 45.02 ? 600  ALA A C     1 
ATOM   3626  O  O     . ALA E 2 411 ? 37.379  53.273  56.856  1.00 44.89 ? 600  ALA A O     1 
ATOM   3627  C  CB    . ALA E 2 411 ? 34.664  53.068  58.443  1.00 45.56 ? 600  ALA A CB    1 
ATOM   3628  N  N     . ILE E 2 412 ? 37.449  54.888  58.402  1.00 43.81 ? 601  ILE A N     1 
ATOM   3629  C  CA    . ILE E 2 412 ? 38.299  55.735  57.578  1.00 43.22 ? 601  ILE A CA    1 
ATOM   3630  C  C     . ILE E 2 412 ? 39.760  55.711  58.026  1.00 43.78 ? 601  ILE A C     1 
ATOM   3631  O  O     . ILE E 2 412 ? 40.593  56.457  57.500  1.00 44.37 ? 601  ILE A O     1 
ATOM   3632  C  CB    . ILE E 2 412 ? 37.796  57.187  57.600  1.00 42.18 ? 601  ILE A CB    1 
ATOM   3633  C  CG1   . ILE E 2 412 ? 38.371  57.954  56.404  1.00 42.48 ? 601  ILE A CG1   1 
ATOM   3634  C  CG2   . ILE E 2 412 ? 38.202  57.855  58.909  1.00 40.77 ? 601  ILE A CG2   1 
ATOM   3635  C  CD1   . ILE E 2 412 ? 37.724  59.320  56.163  1.00 41.60 ? 601  ILE A CD1   1 
ATOM   3636  N  N     . ALA E 2 413 ? 40.067  54.863  59.004  1.00 42.62 ? 602  ALA A N     1 
ATOM   3637  C  CA    . ALA E 2 413 ? 41.430  54.749  59.500  1.00 42.30 ? 602  ALA A CA    1 
ATOM   3638  C  C     . ALA E 2 413 ? 42.368  54.275  58.383  1.00 42.07 ? 602  ALA A C     1 
ATOM   3639  O  O     . ALA E 2 413 ? 43.457  54.818  58.194  1.00 41.44 ? 602  ALA A O     1 
ATOM   3640  C  CB    . ALA E 2 413 ? 41.472  53.775  60.679  1.00 42.17 ? 602  ALA A CB    1 
ATOM   3641  N  N     . ALA E 2 414 ? 41.929  53.266  57.639  1.00 42.25 ? 603  ALA A N     1 
ATOM   3642  C  CA    . ALA E 2 414 ? 42.722  52.705  56.548  1.00 43.17 ? 603  ALA A CA    1 
ATOM   3643  C  C     . ALA E 2 414 ? 43.082  53.725  55.454  1.00 43.14 ? 603  ALA A C     1 
ATOM   3644  O  O     . ALA E 2 414 ? 44.259  53.871  55.104  1.00 43.48 ? 603  ALA A O     1 
ATOM   3645  C  CB    . ALA E 2 414 ? 41.981  51.505  55.938  1.00 43.30 ? 603  ALA A CB    1 
ATOM   3646  N  N     . ASP E 2 415 ? 42.080  54.421  54.911  1.00 42.82 ? 604  ASP A N     1 
ATOM   3647  C  CA    . ASP E 2 415 ? 42.339  55.413  53.869  1.00 42.64 ? 604  ASP A CA    1 
ATOM   3648  C  C     . ASP E 2 415 ? 43.143  56.584  54.433  1.00 42.00 ? 604  ASP A C     1 
ATOM   3649  O  O     . ASP E 2 415 ? 44.001  57.133  53.752  1.00 41.70 ? 604  ASP A O     1 
ATOM   3650  C  CB    . ASP E 2 415 ? 41.033  55.940  53.255  1.00 43.46 ? 604  ASP A CB    1 
ATOM   3651  C  CG    . ASP E 2 415 ? 40.252  54.871  52.490  1.00 45.66 ? 604  ASP A CG    1 
ATOM   3652  O  OD1   . ASP E 2 415 ? 40.868  54.014  51.816  1.00 46.49 ? 604  ASP A OD1   1 
ATOM   3653  O  OD2   . ASP E 2 415 ? 39.002  54.900  52.542  1.00 46.83 ? 604  ASP A OD2   1 
ATOM   3654  N  N     . LEU E 2 416 ? 42.873  56.966  55.677  1.00 41.82 ? 605  LEU A N     1 
ATOM   3655  C  CA    . LEU E 2 416 ? 43.609  58.073  56.271  1.00 42.07 ? 605  LEU A CA    1 
ATOM   3656  C  C     . LEU E 2 416 ? 45.103  57.767  56.338  1.00 42.66 ? 605  LEU A C     1 
ATOM   3657  O  O     . LEU E 2 416 ? 45.930  58.649  56.090  1.00 42.83 ? 605  LEU A O     1 
ATOM   3658  C  CB    . LEU E 2 416 ? 43.080  58.392  57.670  1.00 41.51 ? 605  LEU A CB    1 
ATOM   3659  C  CG    . LEU E 2 416 ? 43.819  59.539  58.375  1.00 41.92 ? 605  LEU A CG    1 
ATOM   3660  C  CD1   . LEU E 2 416 ? 43.841  60.781  57.488  1.00 41.55 ? 605  LEU A CD1   1 
ATOM   3661  C  CD2   . LEU E 2 416 ? 43.144  59.839  59.705  1.00 41.16 ? 605  LEU A CD2   1 
ATOM   3662  N  N     . VAL E 2 417 ? 45.444  56.522  56.678  1.00 42.96 ? 606  VAL A N     1 
ATOM   3663  C  CA    . VAL E 2 417 ? 46.847  56.095  56.757  1.00 43.43 ? 606  VAL A CA    1 
ATOM   3664  C  C     . VAL E 2 417 ? 47.527  56.254  55.393  1.00 43.31 ? 606  VAL A C     1 
ATOM   3665  O  O     . VAL E 2 417 ? 48.596  56.864  55.280  1.00 42.71 ? 606  VAL A O     1 
ATOM   3666  C  CB    . VAL E 2 417 ? 46.955  54.613  57.215  1.00 43.89 ? 606  VAL A CB    1 
ATOM   3667  C  CG1   . VAL E 2 417 ? 48.331  54.045  56.865  1.00 43.96 ? 606  VAL A CG1   1 
ATOM   3668  C  CG2   . VAL E 2 417 ? 46.722  54.519  58.725  1.00 43.10 ? 606  VAL A CG2   1 
ATOM   3669  N  N     . LYS E 2 418 ? 46.895  55.702  54.360  1.00 43.96 ? 607  LYS A N     1 
ATOM   3670  C  CA    . LYS E 2 418 ? 47.418  55.801  53.001  1.00 44.03 ? 607  LYS A CA    1 
ATOM   3671  C  C     . LYS E 2 418 ? 47.633  57.258  52.595  1.00 43.30 ? 607  LYS A C     1 
ATOM   3672  O  O     . LYS E 2 418 ? 48.667  57.600  52.024  1.00 42.96 ? 607  LYS A O     1 
ATOM   3673  C  CB    . LYS E 2 418 ? 46.460  55.140  52.007  1.00 45.40 ? 607  LYS A CB    1 
ATOM   3674  C  CG    . LYS E 2 418 ? 46.353  53.629  52.148  1.00 47.93 ? 607  LYS A CG    1 
ATOM   3675  C  CD    . LYS E 2 418 ? 45.588  53.018  50.977  1.00 50.02 ? 607  LYS A CD    1 
ATOM   3676  C  CE    . LYS E 2 418 ? 45.391  51.508  51.156  1.00 51.00 ? 607  LYS A CE    1 
ATOM   3677  N  NZ    . LYS E 2 418 ? 44.842  50.872  49.917  1.00 51.90 ? 607  LYS A NZ    1 
ATOM   3678  N  N     . ILE E 2 419 ? 46.657  58.116  52.889  1.00 42.35 ? 608  ILE A N     1 
ATOM   3679  C  CA    . ILE E 2 419 ? 46.772  59.526  52.536  1.00 41.63 ? 608  ILE A CA    1 
ATOM   3680  C  C     . ILE E 2 419 ? 47.923  60.143  53.296  1.00 42.10 ? 608  ILE A C     1 
ATOM   3681  O  O     . ILE E 2 419 ? 48.663  60.972  52.754  1.00 41.76 ? 608  ILE A O     1 
ATOM   3682  C  CB    . ILE E 2 419 ? 45.466  60.317  52.848  1.00 40.95 ? 608  ILE A CB    1 
ATOM   3683  C  CG1   . ILE E 2 419 ? 44.361  59.921  51.858  1.00 41.30 ? 608  ILE A CG1   1 
ATOM   3684  C  CG2   . ILE E 2 419 ? 45.717  61.803  52.755  1.00 39.63 ? 608  ILE A CG2   1 
ATOM   3685  C  CD1   . ILE E 2 419 ? 44.728  60.118  50.387  1.00 40.08 ? 608  ILE A CD1   1 
ATOM   3686  N  N     . LEU E 2 420 ? 48.079  59.731  54.552  1.00 42.75 ? 609  LEU A N     1 
ATOM   3687  C  CA    . LEU E 2 420 ? 49.154  60.246  55.384  1.00 44.02 ? 609  LEU A CA    1 
ATOM   3688  C  C     . LEU E 2 420 ? 50.506  59.842  54.811  1.00 45.22 ? 609  LEU A C     1 
ATOM   3689  O  O     . LEU E 2 420 ? 51.364  60.695  54.572  1.00 45.20 ? 609  LEU A O     1 
ATOM   3690  C  CB    . LEU E 2 420 ? 49.016  59.730  56.815  1.00 44.11 ? 609  LEU A CB    1 
ATOM   3691  C  CG    . LEU E 2 420 ? 47.856  60.324  57.612  1.00 43.67 ? 609  LEU A CG    1 
ATOM   3692  C  CD1   . LEU E 2 420 ? 47.801  59.679  58.987  1.00 43.64 ? 609  LEU A CD1   1 
ATOM   3693  C  CD2   . LEU E 2 420 ? 48.033  61.838  57.726  1.00 42.28 ? 609  LEU A CD2   1 
ATOM   3694  N  N     . GLU E 2 421 ? 50.698  58.543  54.585  1.00 46.06 ? 610  GLU A N     1 
ATOM   3695  C  CA    . GLU E 2 421 ? 51.958  58.071  54.023  1.00 47.02 ? 610  GLU A CA    1 
ATOM   3696  C  C     . GLU E 2 421 ? 52.171  58.743  52.676  1.00 46.64 ? 610  GLU A C     1 
ATOM   3697  O  O     . GLU E 2 421 ? 53.235  59.290  52.399  1.00 47.04 ? 610  GLU A O     1 
ATOM   3698  C  CB    . GLU E 2 421 ? 51.932  56.555  53.831  1.00 47.75 ? 610  GLU A CB    1 
ATOM   3699  C  CG    . GLU E 2 421 ? 51.754  55.795  55.115  1.00 50.87 ? 610  GLU A CG    1 
ATOM   3700  C  CD    . GLU E 2 421 ? 51.819  54.288  54.927  1.00 52.79 ? 610  GLU A CD    1 
ATOM   3701  O  OE1   . GLU E 2 421 ? 50.997  53.731  54.161  1.00 53.30 ? 610  GLU A OE1   1 
ATOM   3702  O  OE2   . GLU E 2 421 ? 52.698  53.661  55.559  1.00 54.55 ? 610  GLU A OE2   1 
ATOM   3703  N  N     . GLY E 2 422 ? 51.131  58.709  51.852  1.00 46.65 ? 611  GLY A N     1 
ATOM   3704  C  CA    . GLY E 2 422 ? 51.199  59.291  50.526  1.00 45.84 ? 611  GLY A CA    1 
ATOM   3705  C  C     . GLY E 2 422 ? 51.601  60.746  50.456  1.00 45.54 ? 611  GLY A C     1 
ATOM   3706  O  O     . GLY E 2 422 ? 52.053  61.204  49.412  1.00 45.45 ? 611  GLY A O     1 
ATOM   3707  N  N     . SER E 2 423 ? 51.436  61.490  51.543  1.00 45.70 ? 612  SER A N     1 
ATOM   3708  C  CA    . SER E 2 423 ? 51.808  62.899  51.510  1.00 46.35 ? 612  SER A CA    1 
ATOM   3709  C  C     . SER E 2 423 ? 53.026  63.186  52.374  1.00 47.04 ? 612  SER A C     1 
ATOM   3710  O  O     . SER E 2 423 ? 53.373  64.346  52.620  1.00 47.06 ? 612  SER A O     1 
ATOM   3711  C  CB    . SER E 2 423 ? 50.622  63.787  51.918  1.00 45.46 ? 612  SER A CB    1 
ATOM   3712  O  OG    . SER E 2 423 ? 49.991  63.332  53.097  1.00 45.87 ? 612  SER A OG    1 
ATOM   3713  N  N     . GLY E 2 424 ? 53.679  62.112  52.813  1.00 47.47 ? 613  GLY A N     1 
ATOM   3714  C  CA    . GLY E 2 424 ? 54.871  62.238  53.629  1.00 48.39 ? 613  GLY A CA    1 
ATOM   3715  C  C     . GLY E 2 424 ? 54.653  62.784  55.026  1.00 49.18 ? 613  GLY A C     1 
ATOM   3716  O  O     . GLY E 2 424 ? 55.427  63.622  55.480  1.00 49.43 ? 613  GLY A O     1 
ATOM   3717  N  N     . GLN E 2 425 ? 53.599  62.318  55.698  1.00 50.03 ? 614  GLN A N     1 
ATOM   3718  C  CA    . GLN E 2 425 ? 53.272  62.737  57.068  1.00 50.23 ? 614  GLN A CA    1 
ATOM   3719  C  C     . GLN E 2 425 ? 53.470  61.508  57.947  1.00 51.20 ? 614  GLN A C     1 
ATOM   3720  O  O     . GLN E 2 425 ? 53.538  60.391  57.438  1.00 51.04 ? 614  GLN A O     1 
ATOM   3721  C  CB    . GLN E 2 425 ? 51.802  63.161  57.180  1.00 49.66 ? 614  GLN A CB    1 
ATOM   3722  C  CG    . GLN E 2 425 ? 51.339  64.179  56.171  1.00 48.47 ? 614  GLN A CG    1 
ATOM   3723  C  CD    . GLN E 2 425 ? 52.080  65.481  56.301  1.00 47.68 ? 614  GLN A CD    1 
ATOM   3724  O  OE1   . GLN E 2 425 ? 52.048  66.129  57.347  1.00 47.22 ? 614  GLN A OE1   1 
ATOM   3725  N  NE2   . GLN E 2 425 ? 52.760  65.874  55.238  1.00 47.82 ? 614  GLN A NE2   1 
ATOM   3726  N  N     . THR E 2 426 ? 53.534  61.696  59.262  1.00 52.48 ? 615  THR A N     1 
ATOM   3727  C  CA    . THR E 2 426 ? 53.710  60.551  60.150  1.00 53.74 ? 615  THR A CA    1 
ATOM   3728  C  C     . THR E 2 426 ? 52.376  59.924  60.535  1.00 54.33 ? 615  THR A C     1 
ATOM   3729  O  O     . THR E 2 426 ? 51.382  60.624  60.720  1.00 55.11 ? 615  THR A O     1 
ATOM   3730  C  CB    . THR E 2 426 ? 54.460  60.936  61.439  1.00 53.84 ? 615  THR A CB    1 
ATOM   3731  O  OG1   . THR E 2 426 ? 53.664  61.845  62.203  1.00 54.01 ? 615  THR A OG1   1 
ATOM   3732  C  CG2   . THR E 2 426 ? 55.789  61.591  61.104  1.00 54.19 ? 615  THR A CG2   1 
ATOM   3733  N  N     . VAL E 2 427 ? 52.368  58.600  60.647  1.00 54.89 ? 616  VAL A N     1 
ATOM   3734  C  CA    . VAL E 2 427 ? 51.181  57.843  61.018  1.00 55.94 ? 616  VAL A CA    1 
ATOM   3735  C  C     . VAL E 2 427 ? 51.266  57.414  62.480  1.00 57.70 ? 616  VAL A C     1 
ATOM   3736  O  O     . VAL E 2 427 ? 52.213  56.732  62.872  1.00 58.19 ? 616  VAL A O     1 
ATOM   3737  C  CB    . VAL E 2 427 ? 51.051  56.569  60.174  1.00 55.48 ? 616  VAL A CB    1 
ATOM   3738  C  CG1   . VAL E 2 427 ? 49.851  55.761  60.630  1.00 54.51 ? 616  VAL A CG1   1 
ATOM   3739  C  CG2   . VAL E 2 427 ? 50.946  56.928  58.704  1.00 55.98 ? 616  VAL A CG2   1 
ATOM   3740  N  N     . PRO E 2 428 ? 50.280  57.812  63.306  1.00 59.03 ? 617  PRO A N     1 
ATOM   3741  C  CA    . PRO E 2 428 ? 50.242  57.463  64.732  1.00 59.62 ? 617  PRO A CA    1 
ATOM   3742  C  C     . PRO E 2 428 ? 49.790  56.017  64.852  1.00 60.29 ? 617  PRO A C     1 
ATOM   3743  O  O     . PRO E 2 428 ? 48.921  55.581  64.094  1.00 60.57 ? 617  PRO A O     1 
ATOM   3744  C  CB    . PRO E 2 428 ? 49.202  58.427  65.305  1.00 60.08 ? 617  PRO A CB    1 
ATOM   3745  C  CG    . PRO E 2 428 ? 49.134  59.550  64.282  1.00 60.24 ? 617  PRO A CG    1 
ATOM   3746  C  CD    . PRO E 2 428 ? 49.229  58.793  62.992  1.00 59.62 ? 617  PRO A CD    1 
ATOM   3747  N  N     . ASP E 2 429 ? 50.362  55.282  65.803  1.00 60.88 ? 618  ASP A N     1 
ATOM   3748  C  CA    . ASP E 2 429 ? 50.022  53.871  65.981  1.00 61.55 ? 618  ASP A CA    1 
ATOM   3749  C  C     . ASP E 2 429 ? 48.541  53.558  66.098  1.00 61.33 ? 618  ASP A C     1 
ATOM   3750  O  O     . ASP E 2 429 ? 48.068  52.576  65.525  1.00 61.44 ? 618  ASP A O     1 
ATOM   3751  C  CB    . ASP E 2 429 ? 50.735  53.286  67.207  1.00 62.88 ? 618  ASP A CB    1 
ATOM   3752  C  CG    . ASP E 2 429 ? 52.231  53.126  66.996  1.00 64.28 ? 618  ASP A CG    1 
ATOM   3753  O  OD1   . ASP E 2 429 ? 53.002  53.904  67.603  1.00 65.43 ? 618  ASP A OD1   1 
ATOM   3754  O  OD2   . ASP E 2 429 ? 52.633  52.226  66.220  1.00 64.69 ? 618  ASP A OD2   1 
ATOM   3755  N  N     . PHE E 2 430 ? 47.804  54.389  66.827  1.00 61.00 ? 619  PHE A N     1 
ATOM   3756  C  CA    . PHE E 2 430 ? 46.385  54.132  67.022  1.00 60.73 ? 619  PHE A CA    1 
ATOM   3757  C  C     . PHE E 2 430 ? 45.578  53.948  65.735  1.00 61.27 ? 619  PHE A C     1 
ATOM   3758  O  O     . PHE E 2 430 ? 44.563  53.253  65.740  1.00 61.94 ? 619  PHE A O     1 
ATOM   3759  C  CB    . PHE E 2 430 ? 45.763  55.214  67.924  1.00 59.78 ? 619  PHE A CB    1 
ATOM   3760  C  CG    . PHE E 2 430 ? 45.618  56.562  67.275  1.00 58.79 ? 619  PHE A CG    1 
ATOM   3761  C  CD1   . PHE E 2 430 ? 44.531  56.841  66.453  1.00 57.84 ? 619  PHE A CD1   1 
ATOM   3762  C  CD2   . PHE E 2 430 ? 46.542  57.567  67.522  1.00 58.05 ? 619  PHE A CD2   1 
ATOM   3763  C  CE1   . PHE E 2 430 ? 44.365  58.100  65.892  1.00 57.40 ? 619  PHE A CE1   1 
ATOM   3764  C  CE2   . PHE E 2 430 ? 46.380  58.830  66.962  1.00 57.89 ? 619  PHE A CE2   1 
ATOM   3765  C  CZ    . PHE E 2 430 ? 45.288  59.095  66.147  1.00 56.99 ? 619  PHE A CZ    1 
ATOM   3766  N  N     . LEU E 2 431 ? 46.018  54.548  64.632  1.00 61.66 ? 620  LEU A N     1 
ATOM   3767  C  CA    . LEU E 2 431 ? 45.297  54.384  63.369  1.00 61.61 ? 620  LEU A CA    1 
ATOM   3768  C  C     . LEU E 2 431 ? 45.526  52.968  62.839  1.00 62.21 ? 620  LEU A C     1 
ATOM   3769  O  O     . LEU E 2 431 ? 44.647  52.376  62.208  1.00 61.68 ? 620  LEU A O     1 
ATOM   3770  C  CB    . LEU E 2 431 ? 45.771  55.408  62.331  1.00 60.89 ? 620  LEU A CB    1 
ATOM   3771  C  CG    . LEU E 2 431 ? 45.337  56.869  62.493  1.00 60.21 ? 620  LEU A CG    1 
ATOM   3772  C  CD1   . LEU E 2 431 ? 45.882  57.694  61.340  1.00 59.44 ? 620  LEU A CD1   1 
ATOM   3773  C  CD2   . LEU E 2 431 ? 43.826  56.954  62.525  1.00 59.18 ? 620  LEU A CD2   1 
ATOM   3774  N  N     . ARG E 2 432 ? 46.716  52.434  63.112  1.00 62.80 ? 621  ARG A N     1 
ATOM   3775  C  CA    . ARG E 2 432 ? 47.095  51.089  62.679  1.00 63.33 ? 621  ARG A CA    1 
ATOM   3776  C  C     . ARG E 2 432 ? 46.476  49.972  63.518  1.00 64.13 ? 621  ARG A C     1 
ATOM   3777  O  O     . ARG E 2 432 ? 46.052  48.957  62.918  1.00 64.75 ? 621  ARG A O     1 
ATOM   3778  C  CB    . ARG E 2 432 ? 48.619  50.956  62.679  1.00 62.65 ? 621  ARG A CB    1 
ATOM   3779  C  CG    . ARG E 2 432 ? 49.212  51.084  61.297  1.00 61.92 ? 621  ARG A CG    1 
ATOM   3780  C  CD    . ARG E 2 432 ? 50.525  51.828  61.296  1.00 60.76 ? 621  ARG A CD    1 
ATOM   3781  N  NE    . ARG E 2 432 ? 50.922  52.111  59.922  1.00 60.19 ? 621  ARG A NE    1 
ATOM   3782  C  CZ    . ARG E 2 432 ? 51.942  52.887  59.579  1.00 59.98 ? 621  ARG A CZ    1 
ATOM   3783  N  NH1   . ARG E 2 432 ? 52.684  53.468  60.513  1.00 59.84 ? 621  ARG A NH1   1 
ATOM   3784  N  NH2   . ARG E 2 432 ? 52.214  53.086  58.297  1.00 59.80 ? 621  ARG A NH2   1 
ATOM   3785  N  N     . TYR F 2 13  ? 4.270   81.070  61.787  1.00 39.15 ? 202  TYR B N     1 
ATOM   3786  C  CA    . TYR F 2 13  ? 4.252   82.106  62.861  1.00 39.46 ? 202  TYR B CA    1 
ATOM   3787  C  C     . TYR F 2 13  ? 5.510   82.100  63.721  1.00 40.23 ? 202  TYR B C     1 
ATOM   3788  O  O     . TYR F 2 13  ? 5.893   81.070  64.293  1.00 39.49 ? 202  TYR B O     1 
ATOM   3789  C  CB    . TYR F 2 13  ? 3.033   81.929  63.774  1.00 39.44 ? 202  TYR B CB    1 
ATOM   3790  C  CG    . TYR F 2 13  ? 3.043   82.838  64.997  1.00 38.67 ? 202  TYR B CG    1 
ATOM   3791  C  CD1   . TYR F 2 13  ? 3.214   84.218  64.867  1.00 37.70 ? 202  TYR B CD1   1 
ATOM   3792  C  CD2   . TYR F 2 13  ? 2.861   82.316  66.284  1.00 38.22 ? 202  TYR B CD2   1 
ATOM   3793  C  CE1   . TYR F 2 13  ? 3.200   85.056  65.983  1.00 36.94 ? 202  TYR B CE1   1 
ATOM   3794  C  CE2   . TYR F 2 13  ? 2.844   83.144  67.405  1.00 36.53 ? 202  TYR B CE2   1 
ATOM   3795  C  CZ    . TYR F 2 13  ? 3.013   84.513  67.245  1.00 37.54 ? 202  TYR B CZ    1 
ATOM   3796  O  OH    . TYR F 2 13  ? 2.977   85.344  68.344  1.00 37.82 ? 202  TYR B OH    1 
ATOM   3797  N  N     . ILE F 2 14  ? 6.139   83.270  63.795  1.00 40.55 ? 203  ILE B N     1 
ATOM   3798  C  CA    . ILE F 2 14  ? 7.347   83.478  64.575  1.00 41.06 ? 203  ILE B CA    1 
ATOM   3799  C  C     . ILE F 2 14  ? 7.029   84.505  65.646  1.00 42.18 ? 203  ILE B C     1 
ATOM   3800  O  O     . ILE F 2 14  ? 6.979   85.709  65.376  1.00 41.30 ? 203  ILE B O     1 
ATOM   3801  C  CB    . ILE F 2 14  ? 8.507   84.013  63.699  1.00 40.09 ? 203  ILE B CB    1 
ATOM   3802  C  CG1   . ILE F 2 14  ? 8.922   82.933  62.695  1.00 39.49 ? 203  ILE B CG1   1 
ATOM   3803  C  CG2   . ILE F 2 14  ? 9.677   84.454  64.583  1.00 38.74 ? 203  ILE B CG2   1 
ATOM   3804  C  CD1   . ILE F 2 14  ? 10.048  83.317  61.794  1.00 38.22 ? 203  ILE B CD1   1 
ATOM   3805  N  N     . PRO F 2 15  ? 6.804   84.040  66.881  1.00 43.90 ? 204  PRO B N     1 
ATOM   3806  C  CA    . PRO F 2 15  ? 6.488   84.950  67.987  1.00 45.15 ? 204  PRO B CA    1 
ATOM   3807  C  C     . PRO F 2 15  ? 7.571   86.008  68.200  1.00 46.03 ? 204  PRO B C     1 
ATOM   3808  O  O     . PRO F 2 15  ? 8.731   85.805  67.851  1.00 45.11 ? 204  PRO B O     1 
ATOM   3809  C  CB    . PRO F 2 15  ? 6.328   84.005  69.182  1.00 45.25 ? 204  PRO B CB    1 
ATOM   3810  C  CG    . PRO F 2 15  ? 7.209   82.832  68.822  1.00 45.00 ? 204  PRO B CG    1 
ATOM   3811  C  CD    . PRO F 2 15  ? 6.918   82.648  67.351  1.00 44.31 ? 204  PRO B CD    1 
ATOM   3812  N  N     . PRO F 2 16  ? 7.192   87.163  68.764  1.00 47.76 ? 205  PRO B N     1 
ATOM   3813  C  CA    . PRO F 2 16  ? 8.130   88.260  69.022  1.00 49.05 ? 205  PRO B CA    1 
ATOM   3814  C  C     . PRO F 2 16  ? 9.125   87.861  70.098  1.00 50.77 ? 205  PRO B C     1 
ATOM   3815  O  O     . PRO F 2 16  ? 8.734   87.451  71.190  1.00 51.24 ? 205  PRO B O     1 
ATOM   3816  C  CB    . PRO F 2 16  ? 7.213   89.392  69.463  1.00 48.89 ? 205  PRO B CB    1 
ATOM   3817  C  CG    . PRO F 2 16  ? 6.121   88.657  70.184  1.00 48.93 ? 205  PRO B CG    1 
ATOM   3818  C  CD    . PRO F 2 16  ? 5.848   87.479  69.279  1.00 47.70 ? 205  PRO B CD    1 
ATOM   3819  N  N     . GLU F 2 17  ? 10.414  87.976  69.803  1.00 52.53 ? 206  GLU B N     1 
ATOM   3820  C  CA    . GLU F 2 17  ? 11.402  87.576  70.790  1.00 54.09 ? 206  GLU B CA    1 
ATOM   3821  C  C     . GLU F 2 17  ? 11.350  88.403  72.064  1.00 53.89 ? 206  GLU B C     1 
ATOM   3822  O  O     . GLU F 2 17  ? 10.958  89.571  72.049  1.00 53.84 ? 206  GLU B O     1 
ATOM   3823  C  CB    . GLU F 2 17  ? 12.817  87.577  70.194  1.00 55.45 ? 206  GLU B CB    1 
ATOM   3824  C  CG    . GLU F 2 17  ? 13.408  86.157  70.160  1.00 58.46 ? 206  GLU B CG    1 
ATOM   3825  C  CD    . GLU F 2 17  ? 14.907  86.108  69.880  1.00 60.74 ? 206  GLU B CD    1 
ATOM   3826  O  OE1   . GLU F 2 17  ? 15.688  86.794  70.586  1.00 61.45 ? 206  GLU B OE1   1 
ATOM   3827  O  OE2   . GLU F 2 17  ? 15.305  85.361  68.957  1.00 61.98 ? 206  GLU B OE2   1 
ATOM   3828  N  N     . PRO F 2 18  ? 11.721  87.785  73.199  1.00 53.94 ? 207  PRO B N     1 
ATOM   3829  C  CA    . PRO F 2 18  ? 11.715  88.467  74.496  1.00 53.82 ? 207  PRO B CA    1 
ATOM   3830  C  C     . PRO F 2 18  ? 12.738  89.598  74.575  1.00 54.01 ? 207  PRO B C     1 
ATOM   3831  O  O     . PRO F 2 18  ? 13.816  89.528  73.981  1.00 52.74 ? 207  PRO B O     1 
ATOM   3832  C  CB    . PRO F 2 18  ? 12.020  87.336  75.478  1.00 53.19 ? 207  PRO B CB    1 
ATOM   3833  C  CG    . PRO F 2 18  ? 12.915  86.432  74.666  1.00 53.22 ? 207  PRO B CG    1 
ATOM   3834  C  CD    . PRO F 2 18  ? 12.204  86.397  73.335  1.00 52.92 ? 207  PRO B CD    1 
ATOM   3835  N  N     . SER F 2 19  ? 12.384  90.643  75.313  1.00 55.20 ? 208  SER B N     1 
ATOM   3836  C  CA    . SER F 2 19  ? 13.272  91.781  75.489  1.00 56.59 ? 208  SER B CA    1 
ATOM   3837  C  C     . SER F 2 19  ? 14.391  91.425  76.459  1.00 57.40 ? 208  SER B C     1 
ATOM   3838  O  O     . SER F 2 19  ? 14.164  90.721  77.448  1.00 57.49 ? 208  SER B O     1 
ATOM   3839  C  CB    . SER F 2 19  ? 12.491  92.976  76.038  1.00 56.87 ? 208  SER B CB    1 
ATOM   3840  O  OG    . SER F 2 19  ? 13.359  94.046  76.368  1.00 57.16 ? 208  SER B OG    1 
ATOM   3841  N  N     . ASN F 2 20  ? 15.599  91.893  76.159  1.00 58.23 ? 209  ASN B N     1 
ATOM   3842  C  CA    . ASN F 2 20  ? 16.755  91.663  77.026  1.00 59.18 ? 209  ASN B CA    1 
ATOM   3843  C  C     . ASN F 2 20  ? 16.912  92.888  77.926  1.00 59.10 ? 209  ASN B C     1 
ATOM   3844  O  O     . ASN F 2 20  ? 17.853  92.990  78.708  1.00 58.61 ? 209  ASN B O     1 
ATOM   3845  C  CB    . ASN F 2 20  ? 18.028  91.462  76.197  1.00 59.86 ? 209  ASN B CB    1 
ATOM   3846  C  CG    . ASN F 2 20  ? 18.092  90.089  75.546  1.00 61.17 ? 209  ASN B CG    1 
ATOM   3847  O  OD1   . ASN F 2 20  ? 17.960  89.059  76.218  1.00 61.42 ? 209  ASN B OD1   1 
ATOM   3848  N  ND2   . ASN F 2 20  ? 18.304  90.066  74.234  1.00 60.96 ? 209  ASN B ND2   1 
ATOM   3849  N  N     . ASP F 2 21  ? 15.958  93.805  77.800  1.00 59.76 ? 210  ASP B N     1 
ATOM   3850  C  CA    . ASP F 2 21  ? 15.924  95.050  78.560  1.00 60.33 ? 210  ASP B CA    1 
ATOM   3851  C  C     . ASP F 2 21  ? 15.385  94.797  79.962  1.00 59.86 ? 210  ASP B C     1 
ATOM   3852  O  O     . ASP F 2 21  ? 14.177  94.666  80.160  1.00 59.98 ? 210  ASP B O     1 
ATOM   3853  C  CB    . ASP F 2 21  ? 15.044  96.068  77.811  1.00 61.93 ? 210  ASP B CB    1 
ATOM   3854  C  CG    . ASP F 2 21  ? 15.036  97.447  78.459  1.00 63.54 ? 210  ASP B CG    1 
ATOM   3855  O  OD1   . ASP F 2 21  ? 14.175  97.696  79.341  1.00 63.61 ? 210  ASP B OD1   1 
ATOM   3856  O  OD2   . ASP F 2 21  ? 15.896  98.280  78.077  1.00 64.12 ? 210  ASP B OD2   1 
ATOM   3857  N  N     . ALA F 2 22  ? 16.293  94.734  80.928  1.00 59.31 ? 211  ALA B N     1 
ATOM   3858  C  CA    . ALA F 2 22  ? 15.950  94.492  82.326  1.00 59.51 ? 211  ALA B CA    1 
ATOM   3859  C  C     . ALA F 2 22  ? 14.535  94.917  82.730  1.00 59.44 ? 211  ALA B C     1 
ATOM   3860  O  O     . ALA F 2 22  ? 13.758  94.100  83.221  1.00 59.44 ? 211  ALA B O     1 
ATOM   3861  C  CB    . ALA F 2 22  ? 16.975  95.169  83.229  1.00 59.17 ? 211  ALA B CB    1 
ATOM   3862  N  N     . ILE F 2 23  ? 14.205  96.189  82.523  1.00 59.69 ? 212  ILE B N     1 
ATOM   3863  C  CA    . ILE F 2 23  ? 12.882  96.710  82.874  1.00 59.97 ? 212  ILE B CA    1 
ATOM   3864  C  C     . ILE F 2 23  ? 11.751  95.868  82.294  1.00 59.80 ? 212  ILE B C     1 
ATOM   3865  O  O     . ILE F 2 23  ? 10.743  95.635  82.954  1.00 59.83 ? 212  ILE B O     1 
ATOM   3866  C  CB    . ILE F 2 23  ? 12.701  98.174  82.393  1.00 60.02 ? 212  ILE B CB    1 
ATOM   3867  C  CG1   . ILE F 2 23  ? 13.658  99.095  83.154  1.00 60.46 ? 212  ILE B CG1   1 
ATOM   3868  C  CG2   . ILE F 2 23  ? 11.265  98.623  82.613  1.00 59.89 ? 212  ILE B CG2   1 
ATOM   3869  C  CD1   . ILE F 2 23  ? 13.598  100.548 82.718  1.00 60.94 ? 212  ILE B CD1   1 
ATOM   3870  N  N     . GLU F 2 24  ? 11.915  95.425  81.053  1.00 60.13 ? 213  GLU B N     1 
ATOM   3871  C  CA    . GLU F 2 24  ? 10.902  94.599  80.408  1.00 60.94 ? 213  GLU B CA    1 
ATOM   3872  C  C     . GLU F 2 24  ? 10.918  93.199  81.009  1.00 60.35 ? 213  GLU B C     1 
ATOM   3873  O  O     . GLU F 2 24  ? 9.869   92.597  81.226  1.00 60.13 ? 213  GLU B O     1 
ATOM   3874  C  CB    . GLU F 2 24  ? 11.154  94.522  78.901  1.00 61.99 ? 213  GLU B CB    1 
ATOM   3875  C  CG    . GLU F 2 24  ? 10.681  95.748  78.136  1.00 64.19 ? 213  GLU B CG    1 
ATOM   3876  C  CD    . GLU F 2 24  ? 9.395   95.492  77.362  1.00 65.80 ? 213  GLU B CD    1 
ATOM   3877  O  OE1   . GLU F 2 24  ? 8.381   95.114  77.993  1.00 66.13 ? 213  GLU B OE1   1 
ATOM   3878  O  OE2   . GLU F 2 24  ? 9.401   95.669  76.120  1.00 66.41 ? 213  GLU B OE2   1 
ATOM   3879  N  N     . ILE F 2 25  ? 12.113  92.688  81.282  1.00 59.60 ? 214  ILE B N     1 
ATOM   3880  C  CA    . ILE F 2 25  ? 12.248  91.366  81.869  1.00 59.15 ? 214  ILE B CA    1 
ATOM   3881  C  C     . ILE F 2 25  ? 11.570  91.304  83.238  1.00 58.64 ? 214  ILE B C     1 
ATOM   3882  O  O     . ILE F 2 25  ? 10.844  90.353  83.534  1.00 58.65 ? 214  ILE B O     1 
ATOM   3883  C  CB    . ILE F 2 25  ? 13.727  90.977  82.014  1.00 59.44 ? 214  ILE B CB    1 
ATOM   3884  C  CG1   . ILE F 2 25  ? 14.363  90.872  80.627  1.00 59.35 ? 214  ILE B CG1   1 
ATOM   3885  C  CG2   . ILE F 2 25  ? 13.852  89.649  82.754  1.00 59.35 ? 214  ILE B CG2   1 
ATOM   3886  C  CD1   . ILE F 2 25  ? 15.848  90.577  80.658  1.00 59.69 ? 214  ILE B CD1   1 
ATOM   3887  N  N     . PHE F 2 26  ? 11.798  92.317  84.068  1.00 57.41 ? 215  PHE B N     1 
ATOM   3888  C  CA    . PHE F 2 26  ? 11.191  92.342  85.393  1.00 56.96 ? 215  PHE B CA    1 
ATOM   3889  C  C     . PHE F 2 26  ? 9.856   93.081  85.405  1.00 57.71 ? 215  PHE B C     1 
ATOM   3890  O  O     . PHE F 2 26  ? 9.466   93.644  86.424  1.00 57.83 ? 215  PHE B O     1 
ATOM   3891  C  CB    . PHE F 2 26  ? 12.143  92.980  86.417  1.00 54.67 ? 215  PHE B CB    1 
ATOM   3892  C  CG    . PHE F 2 26  ? 13.357  92.143  86.723  1.00 53.08 ? 215  PHE B CG    1 
ATOM   3893  C  CD1   . PHE F 2 26  ? 14.515  92.253  85.953  1.00 52.47 ? 215  PHE B CD1   1 
ATOM   3894  C  CD2   . PHE F 2 26  ? 13.332  91.217  87.763  1.00 51.62 ? 215  PHE B CD2   1 
ATOM   3895  C  CE1   . PHE F 2 26  ? 15.631  91.452  86.214  1.00 51.69 ? 215  PHE B CE1   1 
ATOM   3896  C  CE2   . PHE F 2 26  ? 14.438  90.412  88.032  1.00 51.26 ? 215  PHE B CE2   1 
ATOM   3897  C  CZ    . PHE F 2 26  ? 15.591  90.527  87.257  1.00 51.52 ? 215  PHE B CZ    1 
ATOM   3898  N  N     . SER F 2 27  ? 9.152   93.068  84.275  1.00 58.47 ? 216  SER B N     1 
ATOM   3899  C  CA    . SER F 2 27  ? 7.860   93.749  84.170  1.00 59.18 ? 216  SER B CA    1 
ATOM   3900  C  C     . SER F 2 27  ? 6.693   92.881  84.651  1.00 58.67 ? 216  SER B C     1 
ATOM   3901  O  O     . SER F 2 27  ? 5.809   93.356  85.358  1.00 58.85 ? 216  SER B O     1 
ATOM   3902  C  CB    . SER F 2 27  ? 7.604   94.179  82.720  1.00 60.22 ? 216  SER B CB    1 
ATOM   3903  O  OG    . SER F 2 27  ? 7.419   93.054  81.871  1.00 61.71 ? 216  SER B OG    1 
ATOM   3904  N  N     . SER F 2 28  ? 6.699   91.610  84.260  1.00 58.19 ? 217  SER B N     1 
ATOM   3905  C  CA    . SER F 2 28  ? 5.650   90.668  84.646  1.00 57.45 ? 217  SER B CA    1 
ATOM   3906  C  C     . SER F 2 28  ? 5.465   90.608  86.157  1.00 56.40 ? 217  SER B C     1 
ATOM   3907  O  O     . SER F 2 28  ? 6.292   91.115  86.917  1.00 56.41 ? 217  SER B O     1 
ATOM   3908  C  CB    . SER F 2 28  ? 6.002   89.269  84.154  1.00 57.97 ? 217  SER B CB    1 
ATOM   3909  O  OG    . SER F 2 28  ? 7.164   88.800  84.823  1.00 59.05 ? 217  SER B OG    1 
ATOM   3910  N  N     . GLY F 2 29  ? 4.375   89.980  86.588  1.00 55.11 ? 218  GLY B N     1 
ATOM   3911  C  CA    . GLY F 2 29  ? 4.123   89.835  88.010  1.00 53.81 ? 218  GLY B CA    1 
ATOM   3912  C  C     . GLY F 2 29  ? 3.024   90.693  88.607  1.00 52.57 ? 218  GLY B C     1 
ATOM   3913  O  O     . GLY F 2 29  ? 2.688   91.759  88.090  1.00 53.05 ? 218  GLY B O     1 
ATOM   3914  N  N     . ILE F 2 30  ? 2.471   90.215  89.715  1.00 51.14 ? 219  ILE B N     1 
ATOM   3915  C  CA    . ILE F 2 30  ? 1.408   90.910  90.430  1.00 50.01 ? 219  ILE B CA    1 
ATOM   3916  C  C     . ILE F 2 30  ? 1.930   91.285  91.817  1.00 49.96 ? 219  ILE B C     1 
ATOM   3917  O  O     . ILE F 2 30  ? 2.263   90.406  92.622  1.00 49.73 ? 219  ILE B O     1 
ATOM   3918  C  CB    . ILE F 2 30  ? 0.167   90.001  90.589  1.00 49.62 ? 219  ILE B CB    1 
ATOM   3919  C  CG1   . ILE F 2 30  ? -0.351  89.574  89.208  1.00 49.18 ? 219  ILE B CG1   1 
ATOM   3920  C  CG2   . ILE F 2 30  ? -0.914  90.722  91.382  1.00 48.99 ? 219  ILE B CG2   1 
ATOM   3921  C  CD1   . ILE F 2 30  ? -1.476  88.560  89.265  1.00 47.96 ? 219  ILE B CD1   1 
ATOM   3922  N  N     . ALA F 2 31  ? 2.000   92.586  92.095  1.00 49.27 ? 220  ALA B N     1 
ATOM   3923  C  CA    . ALA F 2 31  ? 2.493   93.065  93.385  1.00 48.16 ? 220  ALA B CA    1 
ATOM   3924  C  C     . ALA F 2 31  ? 1.755   92.417  94.542  1.00 47.91 ? 220  ALA B C     1 
ATOM   3925  O  O     . ALA F 2 31  ? 0.547   92.209  94.487  1.00 47.21 ? 220  ALA B O     1 
ATOM   3926  C  CB    . ALA F 2 31  ? 2.359   94.577  93.475  1.00 47.73 ? 220  ALA B CB    1 
ATOM   3927  N  N     . SER F 2 32  ? 2.498   92.088  95.589  1.00 48.18 ? 221  SER B N     1 
ATOM   3928  C  CA    . SER F 2 32  ? 1.917   91.480  96.776  1.00 48.53 ? 221  SER B CA    1 
ATOM   3929  C  C     . SER F 2 32  ? 0.695   92.286  97.221  1.00 48.50 ? 221  SER B C     1 
ATOM   3930  O  O     . SER F 2 32  ? 0.686   93.512  97.133  1.00 49.10 ? 221  SER B O     1 
ATOM   3931  C  CB    . SER F 2 32  ? 2.953   91.452  97.898  1.00 48.45 ? 221  SER B CB    1 
ATOM   3932  O  OG    . SER F 2 32  ? 2.367   90.967  99.085  1.00 50.43 ? 221  SER B OG    1 
ATOM   3933  N  N     . GLY F 2 33  ? -0.326  91.594  97.710  1.00 48.54 ? 222  GLY B N     1 
ATOM   3934  C  CA    . GLY F 2 33  ? -1.534  92.264  98.144  1.00 48.21 ? 222  GLY B CA    1 
ATOM   3935  C  C     . GLY F 2 33  ? -1.639  92.563  99.627  1.00 48.96 ? 222  GLY B C     1 
ATOM   3936  O  O     . GLY F 2 33  ? -0.753  92.248  100.428 1.00 48.60 ? 222  GLY B O     1 
ATOM   3937  N  N     . ILE F 2 34  ? -2.754  93.187  99.984  1.00 49.14 ? 223  ILE B N     1 
ATOM   3938  C  CA    . ILE F 2 34  ? -3.045  93.571  101.354 1.00 49.36 ? 223  ILE B CA    1 
ATOM   3939  C  C     . ILE F 2 34  ? -3.068  92.395  102.320 1.00 49.17 ? 223  ILE B C     1 
ATOM   3940  O  O     . ILE F 2 34  ? -2.598  92.500  103.451 1.00 49.10 ? 223  ILE B O     1 
ATOM   3941  C  CB    . ILE F 2 34  ? -4.406  94.314  101.412 1.00 49.96 ? 223  ILE B CB    1 
ATOM   3942  C  CG1   . ILE F 2 34  ? -4.181  95.827  101.287 1.00 50.72 ? 223  ILE B CG1   1 
ATOM   3943  C  CG2   . ILE F 2 34  ? -5.153  93.974  102.701 1.00 50.78 ? 223  ILE B CG2   1 
ATOM   3944  C  CD1   . ILE F 2 34  ? -3.520  96.278  99.983  1.00 50.85 ? 223  ILE B CD1   1 
ATOM   3945  N  N     . HIS F 2 35  ? -3.608  91.272  101.867 1.00 49.18 ? 224  HIS B N     1 
ATOM   3946  C  CA    . HIS F 2 35  ? -3.726  90.077  102.701 1.00 49.08 ? 224  HIS B CA    1 
ATOM   3947  C  C     . HIS F 2 35  ? -2.544  89.108  102.659 1.00 48.20 ? 224  HIS B C     1 
ATOM   3948  O  O     . HIS F 2 35  ? -2.670  87.971  103.117 1.00 48.26 ? 224  HIS B O     1 
ATOM   3949  C  CB    . HIS F 2 35  ? -5.002  89.324  102.319 1.00 49.90 ? 224  HIS B CB    1 
ATOM   3950  C  CG    . HIS F 2 35  ? -6.243  90.151  102.445 1.00 51.64 ? 224  HIS B CG    1 
ATOM   3951  N  ND1   . HIS F 2 35  ? -6.791  90.489  103.664 1.00 52.25 ? 224  HIS B ND1   1 
ATOM   3952  C  CD2   . HIS F 2 35  ? -7.020  90.740  101.506 1.00 51.59 ? 224  HIS B CD2   1 
ATOM   3953  C  CE1   . HIS F 2 35  ? -7.852  91.251  103.471 1.00 51.86 ? 224  HIS B CE1   1 
ATOM   3954  N  NE2   . HIS F 2 35  ? -8.013  91.419  102.170 1.00 52.26 ? 224  HIS B NE2   1 
ATOM   3955  N  N     . PHE F 2 36  ? -1.404  89.549  102.128 1.00 47.48 ? 225  PHE B N     1 
ATOM   3956  C  CA    . PHE F 2 36  ? -0.228  88.683  102.028 1.00 47.34 ? 225  PHE B CA    1 
ATOM   3957  C  C     . PHE F 2 36  ? 0.200   88.024  103.346 1.00 47.35 ? 225  PHE B C     1 
ATOM   3958  O  O     . PHE F 2 36  ? 0.673   86.886  103.353 1.00 47.61 ? 225  PHE B O     1 
ATOM   3959  C  CB    . PHE F 2 36  ? 0.957   89.455  101.456 1.00 46.90 ? 225  PHE B CB    1 
ATOM   3960  C  CG    . PHE F 2 36  ? 2.109   88.575  101.066 1.00 47.18 ? 225  PHE B CG    1 
ATOM   3961  C  CD1   . PHE F 2 36  ? 2.174   88.018  99.792  1.00 46.03 ? 225  PHE B CD1   1 
ATOM   3962  C  CD2   . PHE F 2 36  ? 3.112   88.268  101.984 1.00 47.18 ? 225  PHE B CD2   1 
ATOM   3963  C  CE1   . PHE F 2 36  ? 3.220   87.170  99.437  1.00 46.11 ? 225  PHE B CE1   1 
ATOM   3964  C  CE2   . PHE F 2 36  ? 4.165   87.413  101.635 1.00 47.09 ? 225  PHE B CE2   1 
ATOM   3965  C  CZ    . PHE F 2 36  ? 4.216   86.865  100.359 1.00 45.48 ? 225  PHE B CZ    1 
ATOM   3966  N  N     . SER F 2 37  ? 0.039   88.731  104.459 1.00 47.20 ? 226  SER B N     1 
ATOM   3967  C  CA    . SER F 2 37  ? 0.425   88.183  105.754 1.00 47.50 ? 226  SER B CA    1 
ATOM   3968  C  C     . SER F 2 37  ? -0.509  87.045  106.168 1.00 46.82 ? 226  SER B C     1 
ATOM   3969  O  O     . SER F 2 37  ? -0.174  86.241  107.030 1.00 46.12 ? 226  SER B O     1 
ATOM   3970  C  CB    . SER F 2 37  ? 0.401   89.279  106.825 1.00 47.90 ? 226  SER B CB    1 
ATOM   3971  O  OG    . SER F 2 37  ? -0.932  89.686  107.103 1.00 50.02 ? 226  SER B OG    1 
ATOM   3972  N  N     . LYS F 2 38  ? -1.684  86.982  105.556 1.00 47.19 ? 227  LYS B N     1 
ATOM   3973  C  CA    . LYS F 2 38  ? -2.632  85.935  105.888 1.00 47.90 ? 227  LYS B CA    1 
ATOM   3974  C  C     . LYS F 2 38  ? -2.120  84.542  105.530 1.00 47.32 ? 227  LYS B C     1 
ATOM   3975  O  O     . LYS F 2 38  ? -2.654  83.545  106.015 1.00 47.04 ? 227  LYS B O     1 
ATOM   3976  C  CB    . LYS F 2 38  ? -3.972  86.194  105.206 1.00 49.99 ? 227  LYS B CB    1 
ATOM   3977  C  CG    . LYS F 2 38  ? -4.730  87.371  105.791 1.00 52.81 ? 227  LYS B CG    1 
ATOM   3978  C  CD    . LYS F 2 38  ? -6.207  87.321  105.396 1.00 54.96 ? 227  LYS B CD    1 
ATOM   3979  C  CE    . LYS F 2 38  ? -7.017  88.326  106.207 1.00 56.23 ? 227  LYS B CE    1 
ATOM   3980  N  NZ    . LYS F 2 38  ? -8.489  88.175  106.006 1.00 58.06 ? 227  LYS B NZ    1 
ATOM   3981  N  N     . TYR F 2 39  ? -1.088  84.472  104.687 1.00 46.55 ? 228  TYR B N     1 
ATOM   3982  C  CA    . TYR F 2 39  ? -0.509  83.186  104.310 1.00 46.17 ? 228  TYR B CA    1 
ATOM   3983  C  C     . TYR F 2 39  ? 0.001   82.414  105.531 1.00 45.98 ? 228  TYR B C     1 
ATOM   3984  O  O     . TYR F 2 39  ? -0.089  81.187  105.563 1.00 46.00 ? 228  TYR B O     1 
ATOM   3985  C  CB    . TYR F 2 39  ? 0.654   83.366  103.333 1.00 46.18 ? 228  TYR B CB    1 
ATOM   3986  C  CG    . TYR F 2 39  ? 0.254   83.578  101.891 1.00 46.82 ? 228  TYR B CG    1 
ATOM   3987  C  CD1   . TYR F 2 39  ? -0.676  82.740  101.266 1.00 47.08 ? 228  TYR B CD1   1 
ATOM   3988  C  CD2   . TYR F 2 39  ? 0.832   84.599  101.136 1.00 46.85 ? 228  TYR B CD2   1 
ATOM   3989  C  CE1   . TYR F 2 39  ? -1.019  82.916  99.922  1.00 46.28 ? 228  TYR B CE1   1 
ATOM   3990  C  CE2   . TYR F 2 39  ? 0.498   84.783  99.798  1.00 46.63 ? 228  TYR B CE2   1 
ATOM   3991  C  CZ    . TYR F 2 39  ? -0.426  83.939  99.199  1.00 46.40 ? 228  TYR B CZ    1 
ATOM   3992  O  OH    . TYR F 2 39  ? -0.744  84.130  97.877  1.00 45.82 ? 228  TYR B OH    1 
ATOM   3993  N  N     . ASN F 2 40  ? 0.526   83.132  106.527 1.00 45.26 ? 229  ASN B N     1 
ATOM   3994  C  CA    . ASN F 2 40  ? 1.066   82.520  107.751 1.00 45.09 ? 229  ASN B CA    1 
ATOM   3995  C  C     . ASN F 2 40  ? 0.036   81.726  108.559 1.00 44.83 ? 229  ASN B C     1 
ATOM   3996  O  O     . ASN F 2 40  ? 0.404   80.972  109.470 1.00 45.29 ? 229  ASN B O     1 
ATOM   3997  C  CB    . ASN F 2 40  ? 1.653   83.594  108.682 1.00 45.08 ? 229  ASN B CB    1 
ATOM   3998  C  CG    . ASN F 2 40  ? 2.800   84.369  108.057 1.00 46.81 ? 229  ASN B CG    1 
ATOM   3999  O  OD1   . ASN F 2 40  ? 3.011   85.541  108.377 1.00 47.89 ? 229  ASN B OD1   1 
ATOM   4000  N  ND2   . ASN F 2 40  ? 3.553   83.724  107.178 1.00 46.84 ? 229  ASN B ND2   1 
ATOM   4001  N  N     . ASN F 2 41  ? -1.246  81.900  108.246 1.00 43.84 ? 230  ASN B N     1 
ATOM   4002  C  CA    . ASN F 2 41  ? -2.303  81.218  108.993 1.00 43.12 ? 230  ASN B CA    1 
ATOM   4003  C  C     . ASN F 2 41  ? -2.779  79.910  108.399 1.00 42.02 ? 230  ASN B C     1 
ATOM   4004  O  O     . ASN F 2 41  ? -3.471  79.139  109.055 1.00 42.19 ? 230  ASN B O     1 
ATOM   4005  C  CB    . ASN F 2 41  ? -3.521  82.129  109.141 1.00 44.10 ? 230  ASN B CB    1 
ATOM   4006  C  CG    . ASN F 2 41  ? -3.186  83.441  109.795 1.00 45.52 ? 230  ASN B CG    1 
ATOM   4007  O  OD1   . ASN F 2 41  ? -2.549  83.474  110.847 1.00 48.14 ? 230  ASN B OD1   1 
ATOM   4008  N  ND2   . ASN F 2 41  ? -3.616  84.535  109.182 1.00 45.93 ? 230  ASN B ND2   1 
ATOM   4009  N  N     . ILE F 2 42  ? -2.425  79.653  107.152 1.00 41.00 ? 231  ILE B N     1 
ATOM   4010  C  CA    . ILE F 2 42  ? -2.885  78.432  106.522 1.00 39.18 ? 231  ILE B CA    1 
ATOM   4011  C  C     . ILE F 2 42  ? -2.163  77.211  107.068 1.00 38.25 ? 231  ILE B C     1 
ATOM   4012  O  O     . ILE F 2 42  ? -0.939  77.194  107.167 1.00 38.04 ? 231  ILE B O     1 
ATOM   4013  C  CB    . ILE F 2 42  ? -2.691  78.503  105.004 1.00 39.23 ? 231  ILE B CB    1 
ATOM   4014  C  CG1   . ILE F 2 42  ? -3.301  79.802  104.479 1.00 38.35 ? 231  ILE B CG1   1 
ATOM   4015  C  CG2   . ILE F 2 42  ? -3.337  77.284  104.334 1.00 38.57 ? 231  ILE B CG2   1 
ATOM   4016  C  CD1   . ILE F 2 42  ? -2.991  80.077  103.030 1.00 39.19 ? 231  ILE B CD1   1 
ATOM   4017  N  N     . PRO F 2 43  ? -2.922  76.184  107.467 1.00 37.19 ? 232  PRO B N     1 
ATOM   4018  C  CA    . PRO F 2 43  ? -2.319  74.956  107.996 1.00 37.41 ? 232  PRO B CA    1 
ATOM   4019  C  C     . PRO F 2 43  ? -1.378  74.349  106.946 1.00 36.62 ? 232  PRO B C     1 
ATOM   4020  O  O     . PRO F 2 43  ? -1.700  74.305  105.753 1.00 37.02 ? 232  PRO B O     1 
ATOM   4021  C  CB    . PRO F 2 43  ? -3.531  74.072  108.275 1.00 37.44 ? 232  PRO B CB    1 
ATOM   4022  C  CG    . PRO F 2 43  ? -4.584  75.084  108.648 1.00 38.55 ? 232  PRO B CG    1 
ATOM   4023  C  CD    . PRO F 2 43  ? -4.386  76.152  107.592 1.00 37.57 ? 232  PRO B CD    1 
ATOM   4024  N  N     . VAL F 2 44  ? -0.216  73.901  107.398 1.00 36.03 ? 233  VAL B N     1 
ATOM   4025  C  CA    . VAL F 2 44  ? 0.802   73.320  106.529 1.00 35.91 ? 233  VAL B CA    1 
ATOM   4026  C  C     . VAL F 2 44  ? 1.012   71.845  106.851 1.00 35.90 ? 233  VAL B C     1 
ATOM   4027  O  O     . VAL F 2 44  ? 1.189   71.471  107.995 1.00 36.47 ? 233  VAL B O     1 
ATOM   4028  C  CB    . VAL F 2 44  ? 2.144   74.049  106.713 1.00 35.19 ? 233  VAL B CB    1 
ATOM   4029  C  CG1   . VAL F 2 44  ? 3.240   73.314  105.987 1.00 35.10 ? 233  VAL B CG1   1 
ATOM   4030  C  CG2   . VAL F 2 44  ? 2.036   75.476  106.203 1.00 34.84 ? 233  VAL B CG2   1 
ATOM   4031  N  N     . LYS F 2 45  ? 0.994   71.003  105.836 1.00 36.46 ? 234  LYS B N     1 
ATOM   4032  C  CA    . LYS F 2 45  ? 1.196   69.579  106.050 1.00 36.28 ? 234  LYS B CA    1 
ATOM   4033  C  C     . LYS F 2 45  ? 2.314   69.085  105.151 1.00 35.15 ? 234  LYS B C     1 
ATOM   4034  O  O     . LYS F 2 45  ? 2.276   69.302  103.945 1.00 36.33 ? 234  LYS B O     1 
ATOM   4035  C  CB    . LYS F 2 45  ? -0.082  68.828  105.725 1.00 37.65 ? 234  LYS B CB    1 
ATOM   4036  C  CG    . LYS F 2 45  ? 0.083   67.331  105.600 1.00 39.40 ? 234  LYS B CG    1 
ATOM   4037  C  CD    . LYS F 2 45  ? -1.212  66.778  105.080 1.00 42.63 ? 234  LYS B CD    1 
ATOM   4038  C  CE    . LYS F 2 45  ? -1.143  65.305  104.802 1.00 44.57 ? 234  LYS B CE    1 
ATOM   4039  N  NZ    . LYS F 2 45  ? -2.398  64.911  104.114 1.00 46.93 ? 234  LYS B NZ    1 
ATOM   4040  N  N     . VAL F 2 46  ? 3.306   68.429  105.737 1.00 34.48 ? 235  VAL B N     1 
ATOM   4041  C  CA    . VAL F 2 46  ? 4.432   67.898  104.975 1.00 34.15 ? 235  VAL B CA    1 
ATOM   4042  C  C     . VAL F 2 46  ? 4.728   66.473  105.412 1.00 34.46 ? 235  VAL B C     1 
ATOM   4043  O  O     . VAL F 2 46  ? 4.910   66.224  106.591 1.00 34.37 ? 235  VAL B O     1 
ATOM   4044  C  CB    . VAL F 2 46  ? 5.722   68.708  105.204 1.00 34.15 ? 235  VAL B CB    1 
ATOM   4045  C  CG1   . VAL F 2 46  ? 6.872   68.067  104.409 1.00 33.97 ? 235  VAL B CG1   1 
ATOM   4046  C  CG2   . VAL F 2 46  ? 5.521   70.166  104.798 1.00 33.77 ? 235  VAL B CG2   1 
ATOM   4047  N  N     . THR F 2 47  ? 4.794   65.543  104.464 1.00 34.91 ? 236  THR B N     1 
ATOM   4048  C  CA    . THR F 2 47  ? 5.085   64.158  104.802 1.00 35.35 ? 236  THR B CA    1 
ATOM   4049  C  C     . THR F 2 47  ? 6.157   63.535  103.903 1.00 35.13 ? 236  THR B C     1 
ATOM   4050  O  O     . THR F 2 47  ? 6.334   63.947  102.752 1.00 35.10 ? 236  THR B O     1 
ATOM   4051  C  CB    . THR F 2 47  ? 3.804   63.290  104.751 1.00 36.08 ? 236  THR B CB    1 
ATOM   4052  O  OG1   . THR F 2 47  ? 3.311   63.219  103.410 1.00 37.00 ? 236  THR B OG1   1 
ATOM   4053  C  CG2   . THR F 2 47  ? 2.726   63.890  105.635 1.00 36.69 ? 236  THR B CG2   1 
ATOM   4054  N  N     . GLY F 2 48  ? 6.865   62.546  104.454 1.00 34.59 ? 237  GLY B N     1 
ATOM   4055  C  CA    . GLY F 2 48  ? 7.921   61.842  103.747 1.00 35.17 ? 237  GLY B CA    1 
ATOM   4056  C  C     . GLY F 2 48  ? 9.052   61.482  104.699 1.00 36.14 ? 237  GLY B C     1 
ATOM   4057  O  O     . GLY F 2 48  ? 9.075   61.958  105.833 1.00 35.96 ? 237  GLY B O     1 
ATOM   4058  N  N     . SER F 2 49  ? 9.989   60.646  104.265 1.00 37.21 ? 238  SER B N     1 
ATOM   4059  C  CA    . SER F 2 49  ? 11.113  60.275  105.129 1.00 39.62 ? 238  SER B CA    1 
ATOM   4060  C  C     . SER F 2 49  ? 12.111  61.413  105.186 1.00 40.32 ? 238  SER B C     1 
ATOM   4061  O  O     . SER F 2 49  ? 12.321  62.080  104.195 1.00 40.38 ? 238  SER B O     1 
ATOM   4062  C  CB    . SER F 2 49  ? 11.809  59.026  104.605 1.00 39.86 ? 238  SER B CB    1 
ATOM   4063  O  OG    . SER F 2 49  ? 10.912  57.937  104.640 1.00 44.06 ? 238  SER B OG    1 
ATOM   4064  N  N     . ASP F 2 50  ? 12.726  61.605  106.349 1.00 41.19 ? 239  ASP B N     1 
ATOM   4065  C  CA    . ASP F 2 50  ? 13.691  62.668  106.613 1.00 41.80 ? 239  ASP B CA    1 
ATOM   4066  C  C     . ASP F 2 50  ? 13.655  63.847  105.642 1.00 41.35 ? 239  ASP B C     1 
ATOM   4067  O  O     . ASP F 2 50  ? 14.532  64.034  104.790 1.00 40.47 ? 239  ASP B O     1 
ATOM   4068  C  CB    . ASP F 2 50  ? 15.110  62.085  106.775 1.00 45.88 ? 239  ASP B CB    1 
ATOM   4069  C  CG    . ASP F 2 50  ? 15.873  61.960  105.473 1.00 48.98 ? 239  ASP B CG    1 
ATOM   4070  O  OD1   . ASP F 2 50  ? 15.400  61.252  104.557 1.00 52.22 ? 239  ASP B OD1   1 
ATOM   4071  O  OD2   . ASP F 2 50  ? 16.971  62.564  105.379 1.00 51.24 ? 239  ASP B OD2   1 
ATOM   4072  N  N     . VAL F 2 51  ? 12.612  64.654  105.822 1.00 39.98 ? 240  VAL B N     1 
ATOM   4073  C  CA    . VAL F 2 51  ? 12.351  65.833  105.014 1.00 38.90 ? 240  VAL B CA    1 
ATOM   4074  C  C     . VAL F 2 51  ? 13.113  67.029  105.548 1.00 38.37 ? 240  VAL B C     1 
ATOM   4075  O  O     . VAL F 2 51  ? 13.120  67.273  106.747 1.00 38.08 ? 240  VAL B O     1 
ATOM   4076  C  CB    . VAL F 2 51  ? 10.852  66.181  105.030 1.00 38.83 ? 240  VAL B CB    1 
ATOM   4077  C  CG1   . VAL F 2 51  ? 10.576  67.329  104.072 1.00 38.37 ? 240  VAL B CG1   1 
ATOM   4078  C  CG2   . VAL F 2 51  ? 10.022  64.942  104.671 1.00 37.93 ? 240  VAL B CG2   1 
ATOM   4079  N  N     . PRO F 2 52  ? 13.755  67.800  104.658 1.00 38.18 ? 241  PRO B N     1 
ATOM   4080  C  CA    . PRO F 2 52  ? 14.523  68.983  105.061 1.00 37.84 ? 241  PRO B CA    1 
ATOM   4081  C  C     . PRO F 2 52  ? 13.635  70.035  105.712 1.00 37.95 ? 241  PRO B C     1 
ATOM   4082  O  O     . PRO F 2 52  ? 12.470  70.194  105.345 1.00 38.02 ? 241  PRO B O     1 
ATOM   4083  C  CB    . PRO F 2 52  ? 15.115  69.479  103.744 1.00 37.79 ? 241  PRO B CB    1 
ATOM   4084  C  CG    . PRO F 2 52  ? 15.198  68.224  102.901 1.00 37.27 ? 241  PRO B CG    1 
ATOM   4085  C  CD    . PRO F 2 52  ? 13.897  67.549  103.213 1.00 37.97 ? 241  PRO B CD    1 
ATOM   4086  N  N     . GLN F 2 53  ? 14.185  70.745  106.687 1.00 37.85 ? 242  GLN B N     1 
ATOM   4087  C  CA    . GLN F 2 53  ? 13.439  71.784  107.370 1.00 38.40 ? 242  GLN B CA    1 
ATOM   4088  C  C     . GLN F 2 53  ? 13.105  72.886  106.375 1.00 36.50 ? 242  GLN B C     1 
ATOM   4089  O  O     . GLN F 2 53  ? 13.845  73.120  105.425 1.00 36.02 ? 242  GLN B O     1 
ATOM   4090  C  CB    . GLN F 2 53  ? 14.267  72.389  108.509 1.00 40.94 ? 242  GLN B CB    1 
ATOM   4091  C  CG    . GLN F 2 53  ? 14.536  71.459  109.688 1.00 46.11 ? 242  GLN B CG    1 
ATOM   4092  C  CD    . GLN F 2 53  ? 13.260  70.991  110.376 1.00 48.53 ? 242  GLN B CD    1 
ATOM   4093  O  OE1   . GLN F 2 53  ? 12.835  69.838  110.215 1.00 50.21 ? 242  GLN B OE1   1 
ATOM   4094  N  NE2   . GLN F 2 53  ? 12.637  71.888  111.143 1.00 49.54 ? 242  GLN B NE2   1 
ATOM   4095  N  N     . PRO F 2 54  ? 11.987  73.580  106.589 1.00 34.95 ? 243  PRO B N     1 
ATOM   4096  C  CA    . PRO F 2 54  ? 11.558  74.671  105.711 1.00 35.10 ? 243  PRO B CA    1 
ATOM   4097  C  C     . PRO F 2 54  ? 12.484  75.866  105.922 1.00 33.96 ? 243  PRO B C     1 
ATOM   4098  O  O     . PRO F 2 54  ? 12.952  76.080  107.038 1.00 34.55 ? 243  PRO B O     1 
ATOM   4099  C  CB    . PRO F 2 54  ? 10.151  75.004  106.222 1.00 34.29 ? 243  PRO B CB    1 
ATOM   4100  C  CG    . PRO F 2 54  ? 9.747   73.814  107.036 1.00 34.84 ? 243  PRO B CG    1 
ATOM   4101  C  CD    . PRO F 2 54  ? 11.014  73.367  107.670 1.00 35.44 ? 243  PRO B CD    1 
ATOM   4102  N  N     . ILE F 2 55  ? 12.760  76.636  104.872 1.00 33.24 ? 244  ILE B N     1 
ATOM   4103  C  CA    . ILE F 2 55  ? 13.578  77.838  105.043 1.00 32.02 ? 244  ILE B CA    1 
ATOM   4104  C  C     . ILE F 2 55  ? 12.570  78.931  105.398 1.00 31.47 ? 244  ILE B C     1 
ATOM   4105  O  O     . ILE F 2 55  ? 11.377  78.737  105.199 1.00 32.09 ? 244  ILE B O     1 
ATOM   4106  C  CB    . ILE F 2 55  ? 14.374  78.196  103.752 1.00 32.12 ? 244  ILE B CB    1 
ATOM   4107  C  CG1   . ILE F 2 55  ? 13.443  78.328  102.538 1.00 31.87 ? 244  ILE B CG1   1 
ATOM   4108  C  CG2   . ILE F 2 55  ? 15.419  77.135  103.489 1.00 30.74 ? 244  ILE B CG2   1 
ATOM   4109  C  CD1   . ILE F 2 55  ? 12.772  79.698  102.395 1.00 30.75 ? 244  ILE B CD1   1 
ATOM   4110  N  N     . GLN F 2 56  ? 13.018  80.060  105.937 1.00 31.36 ? 245  GLN B N     1 
ATOM   4111  C  CA    . GLN F 2 56  ? 12.091  81.132  106.319 1.00 31.20 ? 245  GLN B CA    1 
ATOM   4112  C  C     . GLN F 2 56  ? 12.353  82.443  105.588 1.00 31.37 ? 245  GLN B C     1 
ATOM   4113  O  O     . GLN F 2 56  ? 11.517  83.336  105.583 1.00 31.26 ? 245  GLN B O     1 
ATOM   4114  C  CB    . GLN F 2 56  ? 12.167  81.399  107.825 1.00 32.83 ? 245  GLN B CB    1 
ATOM   4115  C  CG    . GLN F 2 56  ? 11.788  80.240  108.727 1.00 33.90 ? 245  GLN B CG    1 
ATOM   4116  C  CD    . GLN F 2 56  ? 10.318  79.858  108.632 1.00 36.39 ? 245  GLN B CD    1 
ATOM   4117  O  OE1   . GLN F 2 56  ? 9.426   80.719  108.667 1.00 36.76 ? 245  GLN B OE1   1 
ATOM   4118  N  NE2   . GLN F 2 56  ? 10.054  78.551  108.533 1.00 36.06 ? 245  GLN B NE2   1 
ATOM   4119  N  N     . HIS F 2 57  ? 13.516  82.565  104.972 1.00 32.08 ? 246  HIS B N     1 
ATOM   4120  C  CA    . HIS F 2 57  ? 13.843  83.785  104.257 1.00 33.47 ? 246  HIS B CA    1 
ATOM   4121  C  C     . HIS F 2 57  ? 14.618  83.415  103.006 1.00 35.08 ? 246  HIS B C     1 
ATOM   4122  O  O     . HIS F 2 57  ? 15.291  82.380  102.956 1.00 34.99 ? 246  HIS B O     1 
ATOM   4123  C  CB    . HIS F 2 57  ? 14.722  84.679  105.132 1.00 33.72 ? 246  HIS B CB    1 
ATOM   4124  C  CG    . HIS F 2 57  ? 14.313  84.705  106.572 1.00 33.17 ? 246  HIS B CG    1 
ATOM   4125  N  ND1   . HIS F 2 57  ? 13.184  85.359  107.015 1.00 33.20 ? 246  HIS B ND1   1 
ATOM   4126  C  CD2   . HIS F 2 57  ? 14.877  84.141  107.665 1.00 32.67 ? 246  HIS B CD2   1 
ATOM   4127  C  CE1   . HIS F 2 57  ? 13.071  85.198  108.321 1.00 32.47 ? 246  HIS B CE1   1 
ATOM   4128  N  NE2   . HIS F 2 57  ? 14.086  84.462  108.738 1.00 32.57 ? 246  HIS B NE2   1 
ATOM   4129  N  N     . PHE F 2 58  ? 14.528  84.261  101.992 1.00 36.52 ? 247  PHE B N     1 
ATOM   4130  C  CA    . PHE F 2 58  ? 15.255  84.014  100.760 1.00 37.87 ? 247  PHE B CA    1 
ATOM   4131  C  C     . PHE F 2 58  ? 16.743  84.091  101.081 1.00 40.21 ? 247  PHE B C     1 
ATOM   4132  O  O     . PHE F 2 58  ? 17.560  83.405  100.469 1.00 41.30 ? 247  PHE B O     1 
ATOM   4133  C  CB    . PHE F 2 58  ? 14.890  85.057  99.702  1.00 35.95 ? 247  PHE B CB    1 
ATOM   4134  C  CG    . PHE F 2 58  ? 13.506  84.896  99.143  1.00 34.44 ? 247  PHE B CG    1 
ATOM   4135  C  CD1   . PHE F 2 58  ? 12.537  85.872  99.352  1.00 33.33 ? 247  PHE B CD1   1 
ATOM   4136  C  CD2   . PHE F 2 58  ? 13.168  83.755  98.408  1.00 33.17 ? 247  PHE B CD2   1 
ATOM   4137  C  CE1   . PHE F 2 58  ? 11.250  85.715  98.837  1.00 33.48 ? 247  PHE B CE1   1 
ATOM   4138  C  CE2   . PHE F 2 58  ? 11.895  83.591  97.895  1.00 31.73 ? 247  PHE B CE2   1 
ATOM   4139  C  CZ    . PHE F 2 58  ? 10.932  84.566  98.106  1.00 32.66 ? 247  PHE B CZ    1 
ATOM   4140  N  N     . THR F 2 59  ? 17.081  84.911  102.067 1.00 42.33 ? 248  THR B N     1 
ATOM   4141  C  CA    . THR F 2 59  ? 18.473  85.091  102.473 1.00 45.24 ? 248  THR B CA    1 
ATOM   4142  C  C     . THR F 2 59  ? 19.117  83.807  102.985 1.00 45.15 ? 248  THR B C     1 
ATOM   4143  O  O     . THR F 2 59  ? 20.281  83.544  102.709 1.00 45.89 ? 248  THR B O     1 
ATOM   4144  C  CB    . THR F 2 59  ? 18.617  86.140  103.613 1.00 46.30 ? 248  THR B CB    1 
ATOM   4145  O  OG1   . THR F 2 59  ? 17.816  87.300  103.334 1.00 48.10 ? 248  THR B OG1   1 
ATOM   4146  C  CG2   . THR F 2 59  ? 20.070  86.564  103.733 1.00 48.22 ? 248  THR B CG2   1 
ATOM   4147  N  N     . SER F 2 60  ? 18.359  83.023  103.743 1.00 45.08 ? 249  SER B N     1 
ATOM   4148  C  CA    . SER F 2 60  ? 18.875  81.789  104.323 1.00 45.73 ? 249  SER B CA    1 
ATOM   4149  C  C     . SER F 2 60  ? 18.275  80.535  103.694 1.00 45.56 ? 249  SER B C     1 
ATOM   4150  O  O     . SER F 2 60  ? 17.696  79.694  104.388 1.00 45.20 ? 249  SER B O     1 
ATOM   4151  C  CB    . SER F 2 60  ? 18.599  81.779  105.829 1.00 46.10 ? 249  SER B CB    1 
ATOM   4152  O  OG    . SER F 2 60  ? 17.202  81.783  106.087 1.00 46.73 ? 249  SER B OG    1 
ATOM   4153  N  N     . ALA F 2 61  ? 18.433  80.406  102.384 1.00 45.67 ? 250  ALA B N     1 
ATOM   4154  C  CA    . ALA F 2 61  ? 17.896  79.262  101.665 1.00 45.89 ? 250  ALA B CA    1 
ATOM   4155  C  C     . ALA F 2 61  ? 18.956  78.588  100.816 1.00 45.89 ? 250  ALA B C     1 
ATOM   4156  O  O     . ALA F 2 61  ? 18.632  77.836  99.903  1.00 46.72 ? 250  ALA B O     1 
ATOM   4157  C  CB    . ALA F 2 61  ? 16.738  79.708  100.787 1.00 45.09 ? 250  ALA B CB    1 
ATOM   4158  N  N     . ASP F 2 62  ? 20.221  78.861  101.108 1.00 46.10 ? 251  ASP B N     1 
ATOM   4159  C  CA    . ASP F 2 62  ? 21.317  78.273  100.346 1.00 46.44 ? 251  ASP B CA    1 
ATOM   4160  C  C     . ASP F 2 62  ? 21.145  78.511  98.849  1.00 45.06 ? 251  ASP B C     1 
ATOM   4161  O  O     . ASP F 2 62  ? 21.467  77.647  98.042  1.00 45.23 ? 251  ASP B O     1 
ATOM   4162  C  CB    . ASP F 2 62  ? 21.412  76.761  100.603 1.00 49.47 ? 251  ASP B CB    1 
ATOM   4163  C  CG    . ASP F 2 62  ? 21.660  76.423  102.068 1.00 52.22 ? 251  ASP B CG    1 
ATOM   4164  O  OD1   . ASP F 2 62  ? 22.783  76.687  102.570 1.00 53.73 ? 251  ASP B OD1   1 
ATOM   4165  O  OD2   . ASP F 2 62  ? 20.724  75.897  102.718 1.00 53.53 ? 251  ASP B OD2   1 
ATOM   4166  N  N     . LEU F 2 63  ? 20.625  79.673  98.477  1.00 43.19 ? 252  LEU B N     1 
ATOM   4167  C  CA    . LEU F 2 63  ? 20.460  80.002  97.067  1.00 42.27 ? 252  LEU B CA    1 
ATOM   4168  C  C     . LEU F 2 63  ? 21.662  80.809  96.572  1.00 41.28 ? 252  LEU B C     1 
ATOM   4169  O  O     . LEU F 2 63  ? 22.149  81.683  97.284  1.00 41.43 ? 252  LEU B O     1 
ATOM   4170  C  CB    . LEU F 2 63  ? 19.180  80.819  96.846  1.00 41.18 ? 252  LEU B CB    1 
ATOM   4171  C  CG    . LEU F 2 63  ? 17.824  80.131  97.056  1.00 41.07 ? 252  LEU B CG    1 
ATOM   4172  C  CD1   . LEU F 2 63  ? 16.710  81.122  96.747  1.00 39.70 ? 252  LEU B CD1   1 
ATOM   4173  C  CD2   . LEU F 2 63  ? 17.711  78.902  96.153  1.00 39.34 ? 252  LEU B CD2   1 
ATOM   4174  N  N     . ARG F 2 64  ? 22.139  80.506  95.362  1.00 40.83 ? 253  ARG B N     1 
ATOM   4175  C  CA    . ARG F 2 64  ? 23.263  81.226  94.763  1.00 40.39 ? 253  ARG B CA    1 
ATOM   4176  C  C     . ARG F 2 64  ? 22.928  82.713  94.792  1.00 39.47 ? 253  ARG B C     1 
ATOM   4177  O  O     . ARG F 2 64  ? 21.762  83.093  94.693  1.00 38.65 ? 253  ARG B O     1 
ATOM   4178  C  CB    . ARG F 2 64  ? 23.499  80.759  93.322  1.00 41.57 ? 253  ARG B CB    1 
ATOM   4179  C  CG    . ARG F 2 64  ? 24.556  79.663  93.161  1.00 44.68 ? 253  ARG B CG    1 
ATOM   4180  C  CD    . ARG F 2 64  ? 25.954  80.184  93.503  1.00 47.65 ? 253  ARG B CD    1 
ATOM   4181  N  NE    . ARG F 2 64  ? 27.010  79.223  93.194  1.00 50.62 ? 253  ARG B NE    1 
ATOM   4182  C  CZ    . ARG F 2 64  ? 27.997  79.436  92.321  1.00 52.29 ? 253  ARG B CZ    1 
ATOM   4183  N  NH1   . ARG F 2 64  ? 28.079  80.586  91.660  1.00 52.42 ? 253  ARG B NH1   1 
ATOM   4184  N  NH2   . ARG F 2 64  ? 28.907  78.492  92.099  1.00 52.68 ? 253  ARG B NH2   1 
ATOM   4185  N  N     . ASP F 2 65  ? 23.945  83.562  94.912  1.00 39.76 ? 254  ASP B N     1 
ATOM   4186  C  CA    . ASP F 2 65  ? 23.688  84.992  95.009  1.00 39.39 ? 254  ASP B CA    1 
ATOM   4187  C  C     . ASP F 2 65  ? 23.064  85.715  93.827  1.00 37.57 ? 254  ASP B C     1 
ATOM   4188  O  O     . ASP F 2 65  ? 22.309  86.655  94.046  1.00 37.02 ? 254  ASP B O     1 
ATOM   4189  C  CB    . ASP F 2 65  ? 24.938  85.736  95.470  1.00 43.11 ? 254  ASP B CB    1 
ATOM   4190  C  CG    . ASP F 2 65  ? 24.627  86.728  96.606  1.00 48.03 ? 254  ASP B CG    1 
ATOM   4191  O  OD1   . ASP F 2 65  ? 23.831  87.688  96.378  1.00 49.27 ? 254  ASP B OD1   1 
ATOM   4192  O  OD2   . ASP F 2 65  ? 25.160  86.536  97.731  1.00 48.84 ? 254  ASP B OD2   1 
ATOM   4193  N  N     . ILE F 2 66  ? 23.354  85.315  92.589  1.00 36.38 ? 255  ILE B N     1 
ATOM   4194  C  CA    . ILE F 2 66  ? 22.719  85.989  91.451  1.00 35.59 ? 255  ILE B CA    1 
ATOM   4195  C  C     . ILE F 2 66  ? 21.225  85.713  91.503  1.00 34.24 ? 255  ILE B C     1 
ATOM   4196  O  O     . ILE F 2 66  ? 20.411  86.575  91.177  1.00 34.28 ? 255  ILE B O     1 
ATOM   4197  C  CB    . ILE F 2 66  ? 23.244  85.510  90.085  1.00 36.76 ? 255  ILE B CB    1 
ATOM   4198  C  CG1   . ILE F 2 66  ? 23.371  83.994  90.077  1.00 38.67 ? 255  ILE B CG1   1 
ATOM   4199  C  CG2   . ILE F 2 66  ? 24.573  86.159  89.771  1.00 38.48 ? 255  ILE B CG2   1 
ATOM   4200  C  CD1   . ILE F 2 66  ? 24.312  83.493  88.995  1.00 40.54 ? 255  ILE B CD1   1 
ATOM   4201  N  N     . ILE F 2 67  ? 20.860  84.510  91.924  1.00 32.99 ? 256  ILE B N     1 
ATOM   4202  C  CA    . ILE F 2 67  ? 19.452  84.166  92.029  1.00 32.13 ? 256  ILE B CA    1 
ATOM   4203  C  C     . ILE F 2 67  ? 18.824  85.001  93.130  1.00 31.60 ? 256  ILE B C     1 
ATOM   4204  O  O     . ILE F 2 67  ? 17.751  85.570  92.941  1.00 31.93 ? 256  ILE B O     1 
ATOM   4205  C  CB    . ILE F 2 67  ? 19.240  82.663  92.335  1.00 31.46 ? 256  ILE B CB    1 
ATOM   4206  C  CG1   . ILE F 2 67  ? 19.778  81.816  91.186  1.00 31.15 ? 256  ILE B CG1   1 
ATOM   4207  C  CG2   . ILE F 2 67  ? 17.757  82.367  92.494  1.00 32.19 ? 256  ILE B CG2   1 
ATOM   4208  C  CD1   . ILE F 2 67  ? 19.175  82.188  89.833  1.00 31.38 ? 256  ILE B CD1   1 
ATOM   4209  N  N     . ILE F 2 68  ? 19.489  85.090  94.279  1.00 32.00 ? 257  ILE B N     1 
ATOM   4210  C  CA    . ILE F 2 68  ? 18.936  85.884  95.366  1.00 33.02 ? 257  ILE B CA    1 
ATOM   4211  C  C     . ILE F 2 68  ? 18.792  87.328  94.907  1.00 32.92 ? 257  ILE B C     1 
ATOM   4212  O  O     . ILE F 2 68  ? 17.809  87.981  95.231  1.00 34.19 ? 257  ILE B O     1 
ATOM   4213  C  CB    . ILE F 2 68  ? 19.825  85.828  96.622  1.00 34.97 ? 257  ILE B CB    1 
ATOM   4214  C  CG1   . ILE F 2 68  ? 19.802  84.414  97.207  1.00 36.20 ? 257  ILE B CG1   1 
ATOM   4215  C  CG2   . ILE F 2 68  ? 19.325  86.806  97.666  1.00 33.93 ? 257  ILE B CG2   1 
ATOM   4216  C  CD1   . ILE F 2 68  ? 20.913  84.149  98.201  1.00 37.10 ? 257  ILE B CD1   1 
ATOM   4217  N  N     . ASP F 2 69  ? 19.758  87.825  94.138  1.00 32.41 ? 258  ASP B N     1 
ATOM   4218  C  CA    . ASP F 2 69  ? 19.679  89.196  93.654  1.00 32.59 ? 258  ASP B CA    1 
ATOM   4219  C  C     . ASP F 2 69  ? 18.532  89.371  92.651  1.00 30.98 ? 258  ASP B C     1 
ATOM   4220  O  O     . ASP F 2 69  ? 17.901  90.423  92.586  1.00 30.66 ? 258  ASP B O     1 
ATOM   4221  C  CB    . ASP F 2 69  ? 20.991  89.626  92.994  1.00 33.99 ? 258  ASP B CB    1 
ATOM   4222  C  CG    . ASP F 2 69  ? 21.046  91.131  92.757  1.00 36.53 ? 258  ASP B CG    1 
ATOM   4223  O  OD1   . ASP F 2 69  ? 21.569  91.555  91.700  1.00 38.58 ? 258  ASP B OD1   1 
ATOM   4224  O  OD2   . ASP F 2 69  ? 20.560  91.891  93.631  1.00 35.75 ? 258  ASP B OD2   1 
ATOM   4225  N  N     . ASN F 2 70  ? 18.255  88.349  91.857  1.00 30.55 ? 259  ASN B N     1 
ATOM   4226  C  CA    . ASN F 2 70  ? 17.149  88.481  90.918  1.00 30.45 ? 259  ASN B CA    1 
ATOM   4227  C  C     . ASN F 2 70  ? 15.832  88.408  91.671  1.00 29.59 ? 259  ASN B C     1 
ATOM   4228  O  O     . ASN F 2 70  ? 14.844  88.939  91.211  1.00 30.11 ? 259  ASN B O     1 
ATOM   4229  C  CB    . ASN F 2 70  ? 17.233  87.432  89.808  1.00 30.15 ? 259  ASN B CB    1 
ATOM   4230  C  CG    . ASN F 2 70  ? 18.306  87.767  88.795  1.00 30.30 ? 259  ASN B CG    1 
ATOM   4231  O  OD1   . ASN F 2 70  ? 18.566  88.938  88.542  1.00 30.29 ? 259  ASN B OD1   1 
ATOM   4232  N  ND2   . ASN F 2 70  ? 18.930  86.745  88.204  1.00 29.61 ? 259  ASN B ND2   1 
ATOM   4233  N  N     . VAL F 2 71  ? 15.823  87.770  92.842  1.00 30.26 ? 260  VAL B N     1 
ATOM   4234  C  CA    . VAL F 2 71  ? 14.608  87.715  93.655  1.00 30.43 ? 260  VAL B CA    1 
ATOM   4235  C  C     . VAL F 2 71  ? 14.362  89.131  94.186  1.00 31.88 ? 260  VAL B C     1 
ATOM   4236  O  O     . VAL F 2 71  ? 13.223  89.579  94.318  1.00 31.69 ? 260  VAL B O     1 
ATOM   4237  C  CB    . VAL F 2 71  ? 14.746  86.730  94.848  1.00 30.40 ? 260  VAL B CB    1 
ATOM   4238  C  CG1   . VAL F 2 71  ? 13.607  86.934  95.826  1.00 28.92 ? 260  VAL B CG1   1 
ATOM   4239  C  CG2   . VAL F 2 71  ? 14.742  85.273  94.342  1.00 30.39 ? 260  VAL B CG2   1 
ATOM   4240  N  N     . ASN F 2 72  ? 15.442  89.843  94.488  1.00 34.36 ? 261  ASN B N     1 
ATOM   4241  C  CA    . ASN F 2 72  ? 15.323  91.219  94.964  1.00 35.46 ? 261  ASN B CA    1 
ATOM   4242  C  C     . ASN F 2 72  ? 14.702  92.087  93.876  1.00 34.77 ? 261  ASN B C     1 
ATOM   4243  O  O     . ASN F 2 72  ? 13.725  92.794  94.114  1.00 34.45 ? 261  ASN B O     1 
ATOM   4244  C  CB    . ASN F 2 72  ? 16.692  91.797  95.320  1.00 37.36 ? 261  ASN B CB    1 
ATOM   4245  C  CG    . ASN F 2 72  ? 16.604  93.251  95.767  1.00 38.55 ? 261  ASN B CG    1 
ATOM   4246  O  OD1   . ASN F 2 72  ? 16.054  93.546  96.824  1.00 39.95 ? 261  ASN B OD1   1 
ATOM   4247  N  ND2   . ASN F 2 72  ? 17.127  94.165  94.949  1.00 39.75 ? 261  ASN B ND2   1 
ATOM   4248  N  N     . LYS F 2 73  ? 15.280  92.024  92.677  1.00 34.93 ? 262  LYS B N     1 
ATOM   4249  C  CA    . LYS F 2 73  ? 14.792  92.802  91.540  1.00 34.47 ? 262  LYS B CA    1 
ATOM   4250  C  C     . LYS F 2 73  ? 13.332  92.520  91.186  1.00 34.14 ? 262  LYS B C     1 
ATOM   4251  O  O     . LYS F 2 73  ? 12.646  93.382  90.637  1.00 34.04 ? 262  LYS B O     1 
ATOM   4252  C  CB    . LYS F 2 73  ? 15.679  92.548  90.324  1.00 35.16 ? 262  LYS B CB    1 
ATOM   4253  C  CG    . LYS F 2 73  ? 17.142  92.891  90.577  1.00 37.29 ? 262  LYS B CG    1 
ATOM   4254  C  CD    . LYS F 2 73  ? 18.002  92.728  89.329  1.00 39.10 ? 262  LYS B CD    1 
ATOM   4255  C  CE    . LYS F 2 73  ? 19.433  93.161  89.631  1.00 40.33 ? 262  LYS B CE    1 
ATOM   4256  N  NZ    . LYS F 2 73  ? 20.265  93.283  88.403  1.00 41.25 ? 262  LYS B NZ    1 
ATOM   4257  N  N     . SER F 2 74  ? 12.858  91.313  91.485  1.00 33.25 ? 263  SER B N     1 
ATOM   4258  C  CA    . SER F 2 74  ? 11.466  90.950  91.205  1.00 32.87 ? 263  SER B CA    1 
ATOM   4259  C  C     . SER F 2 74  ? 10.561  91.568  92.275  1.00 31.89 ? 263  SER B C     1 
ATOM   4260  O  O     . SER F 2 74  ? 9.333   91.574  92.149  1.00 31.14 ? 263  SER B O     1 
ATOM   4261  C  CB    . SER F 2 74  ? 11.297  89.427  91.222  1.00 33.17 ? 263  SER B CB    1 
ATOM   4262  O  OG    . SER F 2 74  ? 12.203  88.808  90.325  1.00 33.91 ? 263  SER B OG    1 
ATOM   4263  N  N     . GLY F 2 75  ? 11.179  92.072  93.337  1.00 31.14 ? 264  GLY B N     1 
ATOM   4264  C  CA    . GLY F 2 75  ? 10.412  92.686  94.407  1.00 31.81 ? 264  GLY B CA    1 
ATOM   4265  C  C     . GLY F 2 75  ? 9.879   91.763  95.493  1.00 31.82 ? 264  GLY B C     1 
ATOM   4266  O  O     . GLY F 2 75  ? 9.069   92.194  96.312  1.00 31.93 ? 264  GLY B O     1 
ATOM   4267  N  N     . TYR F 2 76  ? 10.323  90.508  95.527  1.00 32.16 ? 265  TYR B N     1 
ATOM   4268  C  CA    . TYR F 2 76  ? 9.829   89.575  96.552  1.00 32.84 ? 265  TYR B CA    1 
ATOM   4269  C  C     . TYR F 2 76  ? 10.515  89.842  97.889  1.00 32.54 ? 265  TYR B C     1 
ATOM   4270  O  O     . TYR F 2 76  ? 11.730  89.993  97.942  1.00 32.44 ? 265  TYR B O     1 
ATOM   4271  C  CB    . TYR F 2 76  ? 10.107  88.113  96.167  1.00 32.94 ? 265  TYR B CB    1 
ATOM   4272  C  CG    . TYR F 2 76  ? 9.497   87.603  94.875  1.00 33.12 ? 265  TYR B CG    1 
ATOM   4273  C  CD1   . TYR F 2 76  ? 8.626   88.385  94.103  1.00 32.66 ? 265  TYR B CD1   1 
ATOM   4274  C  CD2   . TYR F 2 76  ? 9.791   86.313  94.428  1.00 33.75 ? 265  TYR B CD2   1 
ATOM   4275  C  CE1   . TYR F 2 76  ? 8.067   87.886  92.921  1.00 31.35 ? 265  TYR B CE1   1 
ATOM   4276  C  CE2   . TYR F 2 76  ? 9.239   85.811  93.252  1.00 33.63 ? 265  TYR B CE2   1 
ATOM   4277  C  CZ    . TYR F 2 76  ? 8.384   86.593  92.507  1.00 32.51 ? 265  TYR B CZ    1 
ATOM   4278  O  OH    . TYR F 2 76  ? 7.865   86.058  91.356  1.00 32.90 ? 265  TYR B OH    1 
ATOM   4279  N  N     . LYS F 2 77  ? 9.748   89.844  98.972  1.00 33.07 ? 266  LYS B N     1 
ATOM   4280  C  CA    . LYS F 2 77  ? 10.317  90.104  100.297 1.00 34.29 ? 266  LYS B CA    1 
ATOM   4281  C  C     . LYS F 2 77  ? 10.362  88.904  101.239 1.00 33.50 ? 266  LYS B C     1 
ATOM   4282  O  O     . LYS F 2 77  ? 11.332  88.714  101.958 1.00 34.29 ? 266  LYS B O     1 
ATOM   4283  C  CB    . LYS F 2 77  ? 9.539   91.231  100.981 1.00 34.96 ? 266  LYS B CB    1 
ATOM   4284  C  CG    . LYS F 2 77  ? 9.783   92.590  100.363 1.00 38.15 ? 266  LYS B CG    1 
ATOM   4285  C  CD    . LYS F 2 77  ? 8.923   93.656  101.024 1.00 40.92 ? 266  LYS B CD    1 
ATOM   4286  C  CE    . LYS F 2 77  ? 9.348   95.042  100.558 1.00 43.36 ? 266  LYS B CE    1 
ATOM   4287  N  NZ    . LYS F 2 77  ? 8.553   96.141  101.194 1.00 45.57 ? 266  LYS B NZ    1 
ATOM   4288  N  N     . ILE F 2 78  ? 9.305   88.106  101.233 1.00 32.94 ? 267  ILE B N     1 
ATOM   4289  C  CA    . ILE F 2 78  ? 9.196   86.951  102.112 1.00 32.16 ? 267  ILE B CA    1 
ATOM   4290  C  C     . ILE F 2 78  ? 8.765   85.714  101.332 1.00 31.98 ? 267  ILE B C     1 
ATOM   4291  O  O     . ILE F 2 78  ? 7.833   85.773  100.517 1.00 31.74 ? 267  ILE B O     1 
ATOM   4292  C  CB    . ILE F 2 78  ? 8.128   87.187  103.184 1.00 32.17 ? 267  ILE B CB    1 
ATOM   4293  C  CG1   . ILE F 2 78  ? 8.389   88.516  103.908 1.00 31.74 ? 267  ILE B CG1   1 
ATOM   4294  C  CG2   . ILE F 2 78  ? 8.088   86.000  104.140 1.00 31.16 ? 267  ILE B CG2   1 
ATOM   4295  C  CD1   . ILE F 2 78  ? 7.219   88.977  104.795 1.00 29.85 ? 267  ILE B CD1   1 
ATOM   4296  N  N     . PRO F 2 79  ? 9.420   84.573  101.586 1.00 31.05 ? 268  PRO B N     1 
ATOM   4297  C  CA    . PRO F 2 79  ? 9.023   83.370  100.857 1.00 29.80 ? 268  PRO B CA    1 
ATOM   4298  C  C     . PRO F 2 79  ? 7.566   83.055  101.167 1.00 28.94 ? 268  PRO B C     1 
ATOM   4299  O  O     . PRO F 2 79  ? 7.067   83.272  102.265 1.00 28.35 ? 268  PRO B O     1 
ATOM   4300  C  CB    . PRO F 2 79  ? 9.952   82.294  101.409 1.00 29.49 ? 268  PRO B CB    1 
ATOM   4301  C  CG    . PRO F 2 79  ? 11.117  83.072  101.947 1.00 30.46 ? 268  PRO B CG    1 
ATOM   4302  C  CD    . PRO F 2 79  ? 10.460  84.258  102.574 1.00 30.37 ? 268  PRO B CD    1 
ATOM   4303  N  N     . THR F 2 80  ? 6.896   82.547  100.159 1.00 28.12 ? 269  THR B N     1 
ATOM   4304  C  CA    . THR F 2 80  ? 5.514   82.157  100.241 1.00 27.88 ? 269  THR B CA    1 
ATOM   4305  C  C     . THR F 2 80  ? 5.532   80.787  100.977 1.00 27.35 ? 269  THR B C     1 
ATOM   4306  O  O     . THR F 2 80  ? 6.561   80.113  100.993 1.00 27.79 ? 269  THR B O     1 
ATOM   4307  C  CB    . THR F 2 80  ? 5.026   82.085  98.783  1.00 28.73 ? 269  THR B CB    1 
ATOM   4308  O  OG1   . THR F 2 80  ? 4.037   83.093  98.565  1.00 31.83 ? 269  THR B OG1   1 
ATOM   4309  C  CG2   . THR F 2 80  ? 4.558   80.733  98.430  1.00 27.84 ? 269  THR B CG2   1 
ATOM   4310  N  N     . PRO F 2 81  ? 4.426   80.381  101.625 1.00 25.95 ? 270  PRO B N     1 
ATOM   4311  C  CA    . PRO F 2 81  ? 4.473   79.078  102.310 1.00 26.32 ? 270  PRO B CA    1 
ATOM   4312  C  C     . PRO F 2 81  ? 5.007   77.906  101.455 1.00 26.35 ? 270  PRO B C     1 
ATOM   4313  O  O     . PRO F 2 81  ? 5.933   77.213  101.863 1.00 26.68 ? 270  PRO B O     1 
ATOM   4314  C  CB    . PRO F 2 81  ? 3.025   78.864  102.754 1.00 25.41 ? 270  PRO B CB    1 
ATOM   4315  C  CG    . PRO F 2 81  ? 2.554   80.271  103.042 1.00 25.42 ? 270  PRO B CG    1 
ATOM   4316  C  CD    . PRO F 2 81  ? 3.161   81.088  101.904 1.00 25.54 ? 270  PRO B CD    1 
ATOM   4317  N  N     . ILE F 2 82  ? 4.430   77.688  100.277 1.00 25.22 ? 271  ILE B N     1 
ATOM   4318  C  CA    . ILE F 2 82  ? 4.885   76.599  99.418  1.00 24.48 ? 271  ILE B CA    1 
ATOM   4319  C  C     . ILE F 2 82  ? 6.372   76.772  99.090  1.00 24.75 ? 271  ILE B C     1 
ATOM   4320  O  O     . ILE F 2 82  ? 7.098   75.794  98.891  1.00 24.79 ? 271  ILE B O     1 
ATOM   4321  C  CB    . ILE F 2 82  ? 4.056   76.527  98.099  1.00 23.97 ? 271  ILE B CB    1 
ATOM   4322  C  CG1   . ILE F 2 82  ? 4.397   75.243  97.338  1.00 23.99 ? 271  ILE B CG1   1 
ATOM   4323  C  CG2   . ILE F 2 82  ? 4.329   77.743  97.220  1.00 22.58 ? 271  ILE B CG2   1 
ATOM   4324  C  CD1   . ILE F 2 82  ? 3.904   73.989  98.028  1.00 23.27 ? 271  ILE B CD1   1 
ATOM   4325  N  N     . GLN F 2 83  ? 6.827   78.020  99.029  1.00 23.87 ? 272  GLN B N     1 
ATOM   4326  C  CA    . GLN F 2 83  ? 8.231   78.295  98.754  1.00 23.68 ? 272  GLN B CA    1 
ATOM   4327  C  C     . GLN F 2 83  ? 9.107   77.893  99.952  1.00 24.33 ? 272  GLN B C     1 
ATOM   4328  O  O     . GLN F 2 83  ? 10.195  77.344  99.784  1.00 23.24 ? 272  GLN B O     1 
ATOM   4329  C  CB    . GLN F 2 83  ? 8.412   79.775  98.440  1.00 23.38 ? 272  GLN B CB    1 
ATOM   4330  C  CG    . GLN F 2 83  ? 7.950   80.121  97.035  1.00 23.32 ? 272  GLN B CG    1 
ATOM   4331  C  CD    . GLN F 2 83  ? 7.682   81.590  96.852  1.00 23.54 ? 272  GLN B CD    1 
ATOM   4332  O  OE1   . GLN F 2 83  ? 7.983   82.401  97.727  1.00 24.75 ? 272  GLN B OE1   1 
ATOM   4333  N  NE2   . GLN F 2 83  ? 7.108   81.950  95.709  1.00 22.63 ? 272  GLN B NE2   1 
ATOM   4334  N  N     . LYS F 2 84  ? 8.616   78.137  101.160 1.00 24.45 ? 273  LYS B N     1 
ATOM   4335  C  CA    . LYS F 2 84  ? 9.382   77.799  102.355 1.00 25.32 ? 273  LYS B CA    1 
ATOM   4336  C  C     . LYS F 2 84  ? 9.622   76.302  102.448 1.00 25.44 ? 273  LYS B C     1 
ATOM   4337  O  O     . LYS F 2 84  ? 10.707  75.862  102.815 1.00 25.56 ? 273  LYS B O     1 
ATOM   4338  C  CB    . LYS F 2 84  ? 8.653   78.276  103.612 1.00 24.75 ? 273  LYS B CB    1 
ATOM   4339  C  CG    . LYS F 2 84  ? 8.589   79.781  103.743 1.00 24.96 ? 273  LYS B CG    1 
ATOM   4340  C  CD    . LYS F 2 84  ? 7.845   80.189  104.999 1.00 25.12 ? 273  LYS B CD    1 
ATOM   4341  C  CE    . LYS F 2 84  ? 8.052   81.671  105.282 1.00 26.57 ? 273  LYS B CE    1 
ATOM   4342  N  NZ    . LYS F 2 84  ? 7.300   82.104  106.492 1.00 28.09 ? 273  LYS B NZ    1 
ATOM   4343  N  N     . CYS F 2 85  ? 8.611   75.519  102.099 1.00 25.46 ? 274  CYS B N     1 
ATOM   4344  C  CA    . CYS F 2 85  ? 8.729   74.077  102.175 1.00 26.86 ? 274  CYS B CA    1 
ATOM   4345  C  C     . CYS F 2 85  ? 9.433   73.479  100.978 1.00 27.05 ? 274  CYS B C     1 
ATOM   4346  O  O     . CYS F 2 85  ? 10.291  72.614  101.131 1.00 27.24 ? 274  CYS B O     1 
ATOM   4347  C  CB    . CYS F 2 85  ? 7.349   73.433  102.298 1.00 26.25 ? 274  CYS B CB    1 
ATOM   4348  S  SG    . CYS F 2 85  ? 6.407   73.946  103.737 1.00 31.80 ? 274  CYS B SG    1 
ATOM   4349  N  N     . SER F 2 86  ? 9.089   73.957  99.786  1.00 27.05 ? 275  SER B N     1 
ATOM   4350  C  CA    . SER F 2 86  ? 9.639   73.396  98.558  1.00 26.82 ? 275  SER B CA    1 
ATOM   4351  C  C     . SER F 2 86  ? 11.099  73.630  98.233  1.00 26.86 ? 275  SER B C     1 
ATOM   4352  O  O     . SER F 2 86  ? 11.801  72.691  97.836  1.00 27.27 ? 275  SER B O     1 
ATOM   4353  C  CB    . SER F 2 86  ? 8.787   73.835  97.359  1.00 26.38 ? 275  SER B CB    1 
ATOM   4354  O  OG    . SER F 2 86  ? 7.422   73.456  97.547  1.00 25.87 ? 275  SER B OG    1 
ATOM   4355  N  N     . ILE F 2 87  ? 11.559  74.867  98.390  1.00 26.25 ? 276  ILE B N     1 
ATOM   4356  C  CA    . ILE F 2 87  ? 12.941  75.211  98.057  1.00 26.25 ? 276  ILE B CA    1 
ATOM   4357  C  C     . ILE F 2 87  ? 13.974  74.250  98.646  1.00 26.00 ? 276  ILE B C     1 
ATOM   4358  O  O     . ILE F 2 87  ? 14.719  73.621  97.892  1.00 25.73 ? 276  ILE B O     1 
ATOM   4359  C  CB    . ILE F 2 87  ? 13.260  76.698  98.449  1.00 26.31 ? 276  ILE B CB    1 
ATOM   4360  C  CG1   . ILE F 2 87  ? 12.539  77.640  97.476  1.00 26.49 ? 276  ILE B CG1   1 
ATOM   4361  C  CG2   . ILE F 2 87  ? 14.754  76.969  98.387  1.00 26.97 ? 276  ILE B CG2   1 
ATOM   4362  C  CD1   . ILE F 2 87  ? 12.667  79.116  97.799  1.00 26.56 ? 276  ILE B CD1   1 
ATOM   4363  N  N     . PRO F 2 88  ? 14.015  74.097  99.989  1.00 25.63 ? 277  PRO B N     1 
ATOM   4364  C  CA    . PRO F 2 88  ? 14.996  73.181  100.583 1.00 25.98 ? 277  PRO B CA    1 
ATOM   4365  C  C     . PRO F 2 88  ? 14.835  71.736  100.115 1.00 25.94 ? 277  PRO B C     1 
ATOM   4366  O  O     . PRO F 2 88  ? 15.827  71.037  99.881  1.00 26.64 ? 277  PRO B O     1 
ATOM   4367  C  CB    . PRO F 2 88  ? 14.778  73.368  102.084 1.00 25.75 ? 277  PRO B CB    1 
ATOM   4368  C  CG    . PRO F 2 88  ? 13.345  73.771  102.170 1.00 26.04 ? 277  PRO B CG    1 
ATOM   4369  C  CD    . PRO F 2 88  ? 13.205  74.735  101.038 1.00 25.27 ? 277  PRO B CD    1 
ATOM   4370  N  N     . VAL F 2 89  ? 13.590  71.295  99.959  1.00 25.51 ? 278  VAL B N     1 
ATOM   4371  C  CA    . VAL F 2 89  ? 13.324  69.937  99.486  1.00 23.84 ? 278  VAL B CA    1 
ATOM   4372  C  C     . VAL F 2 89  ? 13.943  69.702  98.121  1.00 23.34 ? 278  VAL B C     1 
ATOM   4373  O  O     . VAL F 2 89  ? 14.507  68.636  97.858  1.00 23.92 ? 278  VAL B O     1 
ATOM   4374  C  CB    . VAL F 2 89  ? 11.821  69.671  99.371  1.00 23.17 ? 278  VAL B CB    1 
ATOM   4375  C  CG1   . VAL F 2 89  ? 11.561  68.393  98.582  1.00 21.87 ? 278  VAL B CG1   1 
ATOM   4376  C  CG2   . VAL F 2 89  ? 11.230  69.565  100.754 1.00 24.58 ? 278  VAL B CG2   1 
ATOM   4377  N  N     . ILE F 2 90  ? 13.826  70.698  97.249  1.00 22.92 ? 279  ILE B N     1 
ATOM   4378  C  CA    . ILE F 2 90  ? 14.371  70.593  95.906  1.00 22.53 ? 279  ILE B CA    1 
ATOM   4379  C  C     . ILE F 2 90  ? 15.887  70.700  95.902  1.00 23.63 ? 279  ILE B C     1 
ATOM   4380  O  O     . ILE F 2 90  ? 16.565  69.965  95.175  1.00 24.97 ? 279  ILE B O     1 
ATOM   4381  C  CB    . ILE F 2 90  ? 13.747  71.652  94.973  1.00 21.03 ? 279  ILE B CB    1 
ATOM   4382  C  CG1   . ILE F 2 90  ? 12.242  71.368  94.852  1.00 18.92 ? 279  ILE B CG1   1 
ATOM   4383  C  CG2   . ILE F 2 90  ? 14.461  71.634  93.589  1.00 18.02 ? 279  ILE B CG2   1 
ATOM   4384  C  CD1   . ILE F 2 90  ? 11.452  72.386  94.053  1.00 17.50 ? 279  ILE B CD1   1 
ATOM   4385  N  N     . SER F 2 91  ? 16.420  71.588  96.731  1.00 25.33 ? 280  SER B N     1 
ATOM   4386  C  CA    . SER F 2 91  ? 17.872  71.760  96.838  1.00 27.32 ? 280  SER B CA    1 
ATOM   4387  C  C     . SER F 2 91  ? 18.556  70.498  97.359  1.00 29.13 ? 280  SER B C     1 
ATOM   4388  O  O     . SER F 2 91  ? 19.713  70.240  97.030  1.00 30.95 ? 280  SER B O     1 
ATOM   4389  C  CB    . SER F 2 91  ? 18.214  72.911  97.774  1.00 25.69 ? 280  SER B CB    1 
ATOM   4390  O  OG    . SER F 2 91  ? 17.826  74.151  97.210  1.00 28.32 ? 280  SER B OG    1 
ATOM   4391  N  N     . SER F 2 92  ? 17.843  69.721  98.172  1.00 29.45 ? 281  SER B N     1 
ATOM   4392  C  CA    . SER F 2 92  ? 18.386  68.489  98.728  1.00 31.14 ? 281  SER B CA    1 
ATOM   4393  C  C     . SER F 2 92  ? 18.413  67.354  97.719  1.00 30.89 ? 281  SER B C     1 
ATOM   4394  O  O     . SER F 2 92  ? 18.977  66.299  98.005  1.00 31.69 ? 281  SER B O     1 
ATOM   4395  C  CB    . SER F 2 92  ? 17.553  68.023  99.924  1.00 32.82 ? 281  SER B CB    1 
ATOM   4396  O  OG    . SER F 2 92  ? 17.686  68.917  101.012 1.00 37.77 ? 281  SER B OG    1 
ATOM   4397  N  N     . GLY F 2 93  ? 17.774  67.542  96.566  1.00 29.51 ? 282  GLY B N     1 
ATOM   4398  C  CA    . GLY F 2 93  ? 17.750  66.485  95.569  1.00 28.26 ? 282  GLY B CA    1 
ATOM   4399  C  C     . GLY F 2 93  ? 16.581  65.509  95.660  1.00 27.59 ? 282  GLY B C     1 
ATOM   4400  O  O     . GLY F 2 93  ? 16.637  64.425  95.098  1.00 28.08 ? 282  GLY B O     1 
ATOM   4401  N  N     . ARG F 2 94  ? 15.515  65.892  96.351  1.00 27.67 ? 283  ARG B N     1 
ATOM   4402  C  CA    . ARG F 2 94  ? 14.332  65.040  96.512  1.00 27.24 ? 283  ARG B CA    1 
ATOM   4403  C  C     . ARG F 2 94  ? 13.217  65.257  95.499  1.00 26.58 ? 283  ARG B C     1 
ATOM   4404  O  O     . ARG F 2 94  ? 13.087  66.329  94.926  1.00 26.87 ? 283  ARG B O     1 
ATOM   4405  C  CB    . ARG F 2 94  ? 13.735  65.277  97.885  1.00 28.55 ? 283  ARG B CB    1 
ATOM   4406  C  CG    . ARG F 2 94  ? 14.662  64.923  98.986  1.00 30.73 ? 283  ARG B CG    1 
ATOM   4407  C  CD    . ARG F 2 94  ? 14.622  63.439  99.253  1.00 32.06 ? 283  ARG B CD    1 
ATOM   4408  N  NE    . ARG F 2 94  ? 14.481  63.339  100.683 1.00 33.61 ? 283  ARG B NE    1 
ATOM   4409  C  CZ    . ARG F 2 94  ? 13.494  62.731  101.308 1.00 32.00 ? 283  ARG B CZ    1 
ATOM   4410  N  NH1   . ARG F 2 94  ? 12.521  62.122  100.649 1.00 31.26 ? 283  ARG B NH1   1 
ATOM   4411  N  NH2   . ARG F 2 94  ? 13.487  62.780  102.620 1.00 33.76 ? 283  ARG B NH2   1 
ATOM   4412  N  N     . ASP F 2 95  ? 12.406  64.228  95.292  1.00 26.14 ? 284  ASP B N     1 
ATOM   4413  C  CA    . ASP F 2 95  ? 11.260  64.329  94.405  1.00 25.25 ? 284  ASP B CA    1 
ATOM   4414  C  C     . ASP F 2 95  ? 10.168  65.015  95.225  1.00 24.72 ? 284  ASP B C     1 
ATOM   4415  O  O     . ASP F 2 95  ? 10.179  64.966  96.457  1.00 23.93 ? 284  ASP B O     1 
ATOM   4416  C  CB    . ASP F 2 95  ? 10.846  62.951  93.914  1.00 25.61 ? 284  ASP B CB    1 
ATOM   4417  C  CG    . ASP F 2 95  ? 11.639  62.517  92.673  1.00 27.57 ? 284  ASP B CG    1 
ATOM   4418  O  OD1   . ASP F 2 95  ? 12.732  63.071  92.421  1.00 27.28 ? 284  ASP B OD1   1 
ATOM   4419  O  OD2   . ASP F 2 95  ? 11.169  61.622  91.945  1.00 28.81 ? 284  ASP B OD2   1 
ATOM   4420  N  N     . LEU F 2 96  ? 9.217   65.649  94.555  1.00 24.91 ? 285  LEU B N     1 
ATOM   4421  C  CA    . LEU F 2 96  ? 8.230   66.426  95.279  1.00 23.36 ? 285  LEU B CA    1 
ATOM   4422  C  C     . LEU F 2 96  ? 6.850   66.546  94.644  1.00 23.28 ? 285  LEU B C     1 
ATOM   4423  O  O     . LEU F 2 96  ? 6.721   66.649  93.429  1.00 22.91 ? 285  LEU B O     1 
ATOM   4424  C  CB    . LEU F 2 96  ? 8.802   67.832  95.444  1.00 22.31 ? 285  LEU B CB    1 
ATOM   4425  C  CG    . LEU F 2 96  ? 8.393   68.887  96.478  1.00 23.97 ? 285  LEU B CG    1 
ATOM   4426  C  CD1   . LEU F 2 96  ? 8.170   70.176  95.751  1.00 23.83 ? 285  LEU B CD1   1 
ATOM   4427  C  CD2   . LEU F 2 96  ? 7.196   68.512  97.275  1.00 23.78 ? 285  LEU B CD2   1 
ATOM   4428  N  N     . MET F 2 97  ? 5.827   66.524  95.498  1.00 23.05 ? 286  MET B N     1 
ATOM   4429  C  CA    . MET F 2 97  ? 4.453   66.730  95.077  1.00 23.72 ? 286  MET B CA    1 
ATOM   4430  C  C     . MET F 2 97  ? 4.030   67.903  95.968  1.00 24.20 ? 286  MET B C     1 
ATOM   4431  O  O     . MET F 2 97  ? 3.986   67.792  97.185  1.00 25.64 ? 286  MET B O     1 
ATOM   4432  C  CB    . MET F 2 97  ? 3.570   65.517  95.342  1.00 22.24 ? 286  MET B CB    1 
ATOM   4433  C  CG    . MET F 2 97  ? 2.197   65.703  94.734  1.00 23.40 ? 286  MET B CG    1 
ATOM   4434  S  SD    . MET F 2 97  ? 0.956   64.461  95.139  1.00 25.91 ? 286  MET B SD    1 
ATOM   4435  C  CE    . MET F 2 97  ? 1.513   63.131  94.024  1.00 21.64 ? 286  MET B CE    1 
ATOM   4436  N  N     . ALA F 2 98  ? 3.749   69.040  95.365  1.00 25.26 ? 287  ALA B N     1 
ATOM   4437  C  CA    . ALA F 2 98  ? 3.389   70.218  96.139  1.00 25.66 ? 287  ALA B CA    1 
ATOM   4438  C  C     . ALA F 2 98  ? 2.015   70.787  95.766  1.00 25.91 ? 287  ALA B C     1 
ATOM   4439  O  O     . ALA F 2 98  ? 1.726   71.016  94.598  1.00 24.77 ? 287  ALA B O     1 
ATOM   4440  C  CB    . ALA F 2 98  ? 4.468   71.279  95.946  1.00 26.61 ? 287  ALA B CB    1 
ATOM   4441  N  N     . CYS F 2 99  ? 1.186   71.030  96.775  1.00 26.03 ? 288  CYS B N     1 
ATOM   4442  C  CA    . CYS F 2 99  ? -0.142  71.561  96.557  1.00 26.68 ? 288  CYS B CA    1 
ATOM   4443  C  C     . CYS F 2 99  ? -0.324  72.860  97.321  1.00 24.70 ? 288  CYS B C     1 
ATOM   4444  O  O     . CYS F 2 99  ? -0.049  72.920  98.509  1.00 24.90 ? 288  CYS B O     1 
ATOM   4445  C  CB    . CYS F 2 99  ? -1.174  70.535  97.011  1.00 29.37 ? 288  CYS B CB    1 
ATOM   4446  S  SG    . CYS F 2 99  ? -0.945  68.929  96.209  1.00 35.36 ? 288  CYS B SG    1 
ATOM   4447  N  N     . ALA F 2 100 ? -0.793  73.893  96.636  1.00 23.65 ? 289  ALA B N     1 
ATOM   4448  C  CA    . ALA F 2 100 ? -1.012  75.206  97.257  1.00 23.76 ? 289  ALA B CA    1 
ATOM   4449  C  C     . ALA F 2 100 ? -2.017  75.998  96.423  1.00 23.04 ? 289  ALA B C     1 
ATOM   4450  O  O     . ALA F 2 100 ? -1.999  75.932  95.200  1.00 23.44 ? 289  ALA B O     1 
ATOM   4451  C  CB    . ALA F 2 100 ? 0.323   75.973  97.353  1.00 23.23 ? 289  ALA B CB    1 
ATOM   4452  N  N     . GLN F 2 101 ? -2.891  76.745  97.083  1.00 22.85 ? 290  GLN B N     1 
ATOM   4453  C  CA    . GLN F 2 101 ? -3.914  77.526  96.397  1.00 22.93 ? 290  GLN B CA    1 
ATOM   4454  C  C     . GLN F 2 101 ? -3.386  78.391  95.258  1.00 23.55 ? 290  GLN B C     1 
ATOM   4455  O  O     . GLN F 2 101 ? -2.202  78.718  95.200  1.00 23.35 ? 290  GLN B O     1 
ATOM   4456  C  CB    . GLN F 2 101 ? -4.616  78.429  97.397  1.00 24.32 ? 290  GLN B CB    1 
ATOM   4457  C  CG    . GLN F 2 101 ? -3.744  79.573  97.879  1.00 25.56 ? 290  GLN B CG    1 
ATOM   4458  C  CD    . GLN F 2 101 ? -4.442  80.424  98.927  1.00 27.53 ? 290  GLN B CD    1 
ATOM   4459  O  OE1   . GLN F 2 101 ? -5.010  79.897  99.880  1.00 28.59 ? 290  GLN B OE1   1 
ATOM   4460  N  NE2   . GLN F 2 101 ? -4.397  81.748  98.758  1.00 27.53 ? 290  GLN B NE2   1 
ATOM   4461  N  N     . THR F 2 102 ? -4.281  78.780  94.358  1.00 23.79 ? 291  THR B N     1 
ATOM   4462  C  CA    . THR F 2 102 ? -3.906  79.619  93.229  1.00 25.13 ? 291  THR B CA    1 
ATOM   4463  C  C     . THR F 2 102 ? -3.232  80.920  93.675  1.00 25.25 ? 291  THR B C     1 
ATOM   4464  O  O     . THR F 2 102 ? -3.508  81.435  94.756  1.00 26.71 ? 291  THR B O     1 
ATOM   4465  C  CB    . THR F 2 102 ? -5.145  79.980  92.367  1.00 24.91 ? 291  THR B CB    1 
ATOM   4466  O  OG1   . THR F 2 102 ? -6.194  80.470  93.210  1.00 26.04 ? 291  THR B OG1   1 
ATOM   4467  C  CG2   . THR F 2 102 ? -5.649  78.747  91.612  1.00 26.89 ? 291  THR B CG2   1 
ATOM   4468  N  N     . GLY F 2 103 ? -2.347  81.434  92.831  1.00 25.85 ? 292  GLY B N     1 
ATOM   4469  C  CA    . GLY F 2 103 ? -1.653  82.679  93.111  1.00 25.88 ? 292  GLY B CA    1 
ATOM   4470  C  C     . GLY F 2 103 ? -0.736  82.748  94.324  1.00 26.19 ? 292  GLY B C     1 
ATOM   4471  O  O     . GLY F 2 103 ? -0.427  83.844  94.776  1.00 25.62 ? 292  GLY B O     1 
ATOM   4472  N  N     . SER F 2 104 ? -0.271  81.613  94.836  1.00 24.94 ? 293  SER B N     1 
ATOM   4473  C  CA    . SER F 2 104 ? 0.587   81.650  96.002  1.00 24.43 ? 293  SER B CA    1 
ATOM   4474  C  C     . SER F 2 104 ? 2.072   81.355  95.777  1.00 24.35 ? 293  SER B C     1 
ATOM   4475  O  O     . SER F 2 104 ? 2.735   80.854  96.660  1.00 24.17 ? 293  SER B O     1 
ATOM   4476  C  CB    . SER F 2 104 ? 0.022   80.732  97.089  1.00 24.91 ? 293  SER B CB    1 
ATOM   4477  O  OG    . SER F 2 104 ? -0.060  79.390  96.651  1.00 27.61 ? 293  SER B OG    1 
ATOM   4478  N  N     . GLY F 2 105 ? 2.583   81.660  94.588  1.00 23.81 ? 294  GLY B N     1 
ATOM   4479  C  CA    . GLY F 2 105 ? 3.996   81.463  94.308  1.00 24.17 ? 294  GLY B CA    1 
ATOM   4480  C  C     . GLY F 2 105 ? 4.573   80.096  93.943  1.00 24.03 ? 294  GLY B C     1 
ATOM   4481  O  O     . GLY F 2 105 ? 5.775   79.891  94.123  1.00 24.01 ? 294  GLY B O     1 
ATOM   4482  N  N     . LYS F 2 106 ? 3.770   79.164  93.429  1.00 22.66 ? 295  LYS B N     1 
ATOM   4483  C  CA    . LYS F 2 106 ? 4.328   77.851  93.074  1.00 21.47 ? 295  LYS B CA    1 
ATOM   4484  C  C     . LYS F 2 106 ? 5.409   77.900  91.997  1.00 20.88 ? 295  LYS B C     1 
ATOM   4485  O  O     . LYS F 2 106 ? 6.356   77.128  92.062  1.00 20.86 ? 295  LYS B O     1 
ATOM   4486  C  CB    . LYS F 2 106 ? 3.223   76.871  92.659  1.00 21.51 ? 295  LYS B CB    1 
ATOM   4487  C  CG    . LYS F 2 106 ? 2.297   76.475  93.818  1.00 20.01 ? 295  LYS B CG    1 
ATOM   4488  C  CD    . LYS F 2 106 ? 1.246   75.455  93.359  1.00 22.74 ? 295  LYS B CD    1 
ATOM   4489  C  CE    . LYS F 2 106 ? 0.294   76.055  92.320  1.00 21.33 ? 295  LYS B CE    1 
ATOM   4490  N  NZ    . LYS F 2 106 ? -0.657  77.009  92.974  1.00 20.54 ? 295  LYS B NZ    1 
ATOM   4491  N  N     . THR F 2 107 ? 5.292   78.805  91.022  1.00 20.55 ? 296  THR B N     1 
ATOM   4492  C  CA    . THR F 2 107 ? 6.307   78.909  89.967  1.00 20.36 ? 296  THR B CA    1 
ATOM   4493  C  C     . THR F 2 107 ? 7.735   79.147  90.513  1.00 20.60 ? 296  THR B C     1 
ATOM   4494  O  O     . THR F 2 107 ? 8.690   78.467  90.124  1.00 20.63 ? 296  THR B O     1 
ATOM   4495  C  CB    . THR F 2 107 ? 6.002   80.064  88.978  1.00 20.95 ? 296  THR B CB    1 
ATOM   4496  O  OG1   . THR F 2 107 ? 4.648   79.976  88.500  1.00 20.76 ? 296  THR B OG1   1 
ATOM   4497  C  CG2   . THR F 2 107 ? 6.960   79.993  87.794  1.00 19.44 ? 296  THR B CG2   1 
ATOM   4498  N  N     . ALA F 2 108 ? 7.884   80.123  91.397  1.00 19.96 ? 297  ALA B N     1 
ATOM   4499  C  CA    . ALA F 2 108 ? 9.204   80.423  91.955  1.00 20.52 ? 297  ALA B CA    1 
ATOM   4500  C  C     . ALA F 2 108 ? 9.595   79.309  92.911  1.00 19.12 ? 297  ALA B C     1 
ATOM   4501  O  O     . ALA F 2 108 ? 10.763  79.020  93.070  1.00 19.33 ? 297  ALA B O     1 
ATOM   4502  C  CB    . ALA F 2 108 ? 9.200   81.782  92.674  1.00 19.28 ? 297  ALA B CB    1 
ATOM   4503  N  N     . ALA F 2 109 ? 8.615   78.682  93.545  1.00 19.80 ? 298  ALA B N     1 
ATOM   4504  C  CA    . ALA F 2 109 ? 8.913   77.568  94.438  1.00 20.00 ? 298  ALA B CA    1 
ATOM   4505  C  C     . ALA F 2 109 ? 9.798   76.557  93.713  1.00 21.82 ? 298  ALA B C     1 
ATOM   4506  O  O     . ALA F 2 109 ? 10.655  75.923  94.348  1.00 23.74 ? 298  ALA B O     1 
ATOM   4507  C  CB    . ALA F 2 109 ? 7.655   76.899  94.883  1.00 20.43 ? 298  ALA B CB    1 
ATOM   4508  N  N     . PHE F 2 110 ? 9.602   76.369  92.407  1.00 20.89 ? 299  PHE B N     1 
ATOM   4509  C  CA    . PHE F 2 110 ? 10.478  75.441  91.707  1.00 22.22 ? 299  PHE B CA    1 
ATOM   4510  C  C     . PHE F 2 110 ? 11.587  76.094  90.890  1.00 22.09 ? 299  PHE B C     1 
ATOM   4511  O  O     . PHE F 2 110 ? 12.676  75.549  90.800  1.00 21.91 ? 299  PHE B O     1 
ATOM   4512  C  CB    . PHE F 2 110 ? 9.700   74.410  90.852  1.00 21.05 ? 299  PHE B CB    1 
ATOM   4513  C  CG    . PHE F 2 110 ? 8.848   74.986  89.741  1.00 20.28 ? 299  PHE B CG    1 
ATOM   4514  C  CD1   . PHE F 2 110 ? 9.416   75.380  88.529  1.00 20.26 ? 299  PHE B CD1   1 
ATOM   4515  C  CD2   . PHE F 2 110 ? 7.463   75.012  89.869  1.00 19.91 ? 299  PHE B CD2   1 
ATOM   4516  C  CE1   . PHE F 2 110 ? 8.611   75.788  87.450  1.00 21.67 ? 299  PHE B CE1   1 
ATOM   4517  C  CE2   . PHE F 2 110 ? 6.638   75.419  88.800  1.00 21.75 ? 299  PHE B CE2   1 
ATOM   4518  C  CZ    . PHE F 2 110 ? 7.217   75.807  87.582  1.00 21.06 ? 299  PHE B CZ    1 
ATOM   4519  N  N     . LEU F 2 111 ? 11.340  77.263  90.315  1.00 21.90 ? 300  LEU B N     1 
ATOM   4520  C  CA    . LEU F 2 111 ? 12.383  77.906  89.529  1.00 21.16 ? 300  LEU B CA    1 
ATOM   4521  C  C     . LEU F 2 111 ? 13.615  78.323  90.358  1.00 21.22 ? 300  LEU B C     1 
ATOM   4522  O  O     . LEU F 2 111 ? 14.736  78.018  89.992  1.00 21.97 ? 300  LEU B O     1 
ATOM   4523  C  CB    . LEU F 2 111 ? 11.809  79.106  88.780  1.00 20.75 ? 300  LEU B CB    1 
ATOM   4524  C  CG    . LEU F 2 111 ? 10.978  78.801  87.528  1.00 21.42 ? 300  LEU B CG    1 
ATOM   4525  C  CD1   . LEU F 2 111 ? 10.444  80.121  86.920  1.00 20.40 ? 300  LEU B CD1   1 
ATOM   4526  C  CD2   . LEU F 2 111 ? 11.842  78.076  86.511  1.00 19.98 ? 300  LEU B CD2   1 
ATOM   4527  N  N     . LEU F 2 112 ? 13.425  78.997  91.482  1.00 21.66 ? 301  LEU B N     1 
ATOM   4528  C  CA    . LEU F 2 112 ? 14.584  79.411  92.284  1.00 21.88 ? 301  LEU B CA    1 
ATOM   4529  C  C     . LEU F 2 112 ? 15.552  78.280  92.674  1.00 22.79 ? 301  LEU B C     1 
ATOM   4530  O  O     . LEU F 2 112 ? 16.738  78.307  92.329  1.00 21.83 ? 301  LEU B O     1 
ATOM   4531  C  CB    . LEU F 2 112 ? 14.123  80.126  93.545  1.00 21.05 ? 301  LEU B CB    1 
ATOM   4532  C  CG    . LEU F 2 112 ? 13.200  81.329  93.328  1.00 21.73 ? 301  LEU B CG    1 
ATOM   4533  C  CD1   . LEU F 2 112 ? 12.969  82.046  94.651  1.00 22.30 ? 301  LEU B CD1   1 
ATOM   4534  C  CD2   . LEU F 2 112 ? 13.810  82.269  92.309  1.00 20.58 ? 301  LEU B CD2   1 
ATOM   4535  N  N     . PRO F 2 113 ? 15.062  77.256  93.386  1.00 23.32 ? 302  PRO B N     1 
ATOM   4536  C  CA    . PRO F 2 113 ? 16.022  76.213  93.742  1.00 22.98 ? 302  PRO B CA    1 
ATOM   4537  C  C     . PRO F 2 113 ? 16.704  75.522  92.573  1.00 23.45 ? 302  PRO B C     1 
ATOM   4538  O  O     . PRO F 2 113 ? 17.878  75.170  92.656  1.00 23.67 ? 302  PRO B O     1 
ATOM   4539  C  CB    . PRO F 2 113 ? 15.192  75.253  94.584  1.00 23.00 ? 302  PRO B CB    1 
ATOM   4540  C  CG    . PRO F 2 113 ? 13.839  75.379  93.987  1.00 23.35 ? 302  PRO B CG    1 
ATOM   4541  C  CD    . PRO F 2 113 ? 13.702  76.887  93.814  1.00 22.39 ? 302  PRO B CD    1 
ATOM   4542  N  N     . ILE F 2 114 ? 15.981  75.332  91.479  1.00 23.64 ? 303  ILE B N     1 
ATOM   4543  C  CA    . ILE F 2 114 ? 16.560  74.648  90.332  1.00 24.02 ? 303  ILE B CA    1 
ATOM   4544  C  C     . ILE F 2 114 ? 17.630  75.467  89.607  1.00 23.62 ? 303  ILE B C     1 
ATOM   4545  O  O     . ILE F 2 114 ? 18.711  74.963  89.310  1.00 22.05 ? 303  ILE B O     1 
ATOM   4546  C  CB    . ILE F 2 114 ? 15.469  74.248  89.327  1.00 23.90 ? 303  ILE B CB    1 
ATOM   4547  C  CG1   . ILE F 2 114 ? 14.610  73.126  89.931  1.00 24.52 ? 303  ILE B CG1   1 
ATOM   4548  C  CG2   . ILE F 2 114 ? 16.097  73.812  88.012  1.00 20.19 ? 303  ILE B CG2   1 
ATOM   4549  C  CD1   . ILE F 2 114 ? 13.372  72.783  89.090  1.00 22.88 ? 303  ILE B CD1   1 
ATOM   4550  N  N     . LEU F 2 115 ? 17.316  76.722  89.307  1.00 24.28 ? 304  LEU B N     1 
ATOM   4551  C  CA    . LEU F 2 115 ? 18.265  77.583  88.621  1.00 25.28 ? 304  LEU B CA    1 
ATOM   4552  C  C     . LEU F 2 115 ? 19.490  77.758  89.508  1.00 26.82 ? 304  LEU B C     1 
ATOM   4553  O  O     . LEU F 2 115 ? 20.607  77.896  89.024  1.00 26.86 ? 304  LEU B O     1 
ATOM   4554  C  CB    . LEU F 2 115 ? 17.623  78.940  88.328  1.00 24.14 ? 304  LEU B CB    1 
ATOM   4555  C  CG    . LEU F 2 115 ? 16.495  78.896  87.299  1.00 22.33 ? 304  LEU B CG    1 
ATOM   4556  C  CD1   . LEU F 2 115 ? 15.719  80.165  87.361  1.00 22.01 ? 304  LEU B CD1   1 
ATOM   4557  C  CD2   . LEU F 2 115 ? 17.061  78.671  85.902  1.00 22.75 ? 304  LEU B CD2   1 
ATOM   4558  N  N     . SER F 2 116 ? 19.271  77.750  90.815  1.00 28.27 ? 305  SER B N     1 
ATOM   4559  C  CA    . SER F 2 116 ? 20.369  77.894  91.748  1.00 30.04 ? 305  SER B CA    1 
ATOM   4560  C  C     . SER F 2 116 ? 21.248  76.664  91.696  1.00 30.35 ? 305  SER B C     1 
ATOM   4561  O  O     . SER F 2 116 ? 22.469  76.770  91.676  1.00 31.69 ? 305  SER B O     1 
ATOM   4562  C  CB    . SER F 2 116 ? 19.842  78.096  93.163  1.00 31.29 ? 305  SER B CB    1 
ATOM   4563  O  OG    . SER F 2 116 ? 20.905  78.376  94.059  1.00 32.32 ? 305  SER B OG    1 
ATOM   4564  N  N     . LYS F 2 117 ? 20.631  75.494  91.655  1.00 29.93 ? 306  LYS B N     1 
ATOM   4565  C  CA    . LYS F 2 117 ? 21.393  74.260  91.612  1.00 30.47 ? 306  LYS B CA    1 
ATOM   4566  C  C     . LYS F 2 117 ? 22.212  74.171  90.323  1.00 31.09 ? 306  LYS B C     1 
ATOM   4567  O  O     . LYS F 2 117 ? 23.324  73.644  90.330  1.00 31.13 ? 306  LYS B O     1 
ATOM   4568  C  CB    . LYS F 2 117 ? 20.450  73.059  91.744  1.00 30.33 ? 306  LYS B CB    1 
ATOM   4569  C  CG    . LYS F 2 117 ? 21.134  71.685  91.808  1.00 32.48 ? 306  LYS B CG    1 
ATOM   4570  C  CD    . LYS F 2 117 ? 22.061  71.545  93.022  1.00 33.22 ? 306  LYS B CD    1 
ATOM   4571  C  CE    . LYS F 2 117 ? 21.301  71.722  94.338  1.00 35.40 ? 306  LYS B CE    1 
ATOM   4572  N  NZ    . LYS F 2 117 ? 22.209  71.675  95.535  1.00 35.48 ? 306  LYS B NZ    1 
ATOM   4573  N  N     . LEU F 2 118 ? 21.672  74.679  89.216  1.00 31.20 ? 307  LEU B N     1 
ATOM   4574  C  CA    . LEU F 2 118 ? 22.406  74.653  87.950  1.00 31.63 ? 307  LEU B CA    1 
ATOM   4575  C  C     . LEU F 2 118 ? 23.678  75.509  88.041  1.00 32.50 ? 307  LEU B C     1 
ATOM   4576  O  O     . LEU F 2 118 ? 24.705  75.180  87.452  1.00 32.94 ? 307  LEU B O     1 
ATOM   4577  C  CB    . LEU F 2 118 ? 21.533  75.159  86.801  1.00 29.95 ? 307  LEU B CB    1 
ATOM   4578  C  CG    . LEU F 2 118 ? 20.278  74.364  86.436  1.00 29.88 ? 307  LEU B CG    1 
ATOM   4579  C  CD1   . LEU F 2 118 ? 19.594  75.020  85.230  1.00 27.69 ? 307  LEU B CD1   1 
ATOM   4580  C  CD2   . LEU F 2 118 ? 20.654  72.917  86.127  1.00 29.72 ? 307  LEU B CD2   1 
ATOM   4581  N  N     . LEU F 2 119 ? 23.601  76.604  88.783  1.00 33.27 ? 308  LEU B N     1 
ATOM   4582  C  CA    . LEU F 2 119 ? 24.738  77.492  88.972  1.00 35.70 ? 308  LEU B CA    1 
ATOM   4583  C  C     . LEU F 2 119 ? 25.745  76.918  89.979  1.00 38.23 ? 308  LEU B C     1 
ATOM   4584  O  O     . LEU F 2 119 ? 26.957  77.109  89.852  1.00 38.88 ? 308  LEU B O     1 
ATOM   4585  C  CB    . LEU F 2 119 ? 24.247  78.844  89.479  1.00 34.07 ? 308  LEU B CB    1 
ATOM   4586  C  CG    . LEU F 2 119 ? 24.013  79.999  88.507  1.00 35.42 ? 308  LEU B CG    1 
ATOM   4587  C  CD1   . LEU F 2 119 ? 23.980  79.518  87.062  1.00 34.29 ? 308  LEU B CD1   1 
ATOM   4588  C  CD2   . LEU F 2 119 ? 22.730  80.710  88.907  1.00 34.26 ? 308  LEU B CD2   1 
ATOM   4589  N  N     . GLU F 2 120 ? 25.232  76.218  90.983  1.00 40.39 ? 309  GLU B N     1 
ATOM   4590  C  CA    . GLU F 2 120 ? 26.067  75.643  92.023  1.00 42.08 ? 309  GLU B CA    1 
ATOM   4591  C  C     . GLU F 2 120 ? 26.788  74.371  91.606  1.00 42.82 ? 309  GLU B C     1 
ATOM   4592  O  O     . GLU F 2 120 ? 27.945  74.148  91.961  1.00 43.11 ? 309  GLU B O     1 
ATOM   4593  C  CB    . GLU F 2 120 ? 25.215  75.360  93.250  1.00 43.85 ? 309  GLU B CB    1 
ATOM   4594  C  CG    . GLU F 2 120 ? 25.923  74.555  94.304  1.00 47.03 ? 309  GLU B CG    1 
ATOM   4595  C  CD    . GLU F 2 120 ? 25.067  74.367  95.527  1.00 50.23 ? 309  GLU B CD    1 
ATOM   4596  O  OE1   . GLU F 2 120 ? 24.873  75.358  96.271  1.00 52.76 ? 309  GLU B OE1   1 
ATOM   4597  O  OE2   . GLU F 2 120 ? 24.580  73.236  95.736  1.00 51.62 ? 309  GLU B OE2   1 
ATOM   4598  N  N     . ASP F 2 121 ? 26.097  73.525  90.864  1.00 43.28 ? 310  ASP B N     1 
ATOM   4599  C  CA    . ASP F 2 121 ? 26.685  72.282  90.416  1.00 43.79 ? 310  ASP B CA    1 
ATOM   4600  C  C     . ASP F 2 121 ? 26.578  72.231  88.893  1.00 43.57 ? 310  ASP B C     1 
ATOM   4601  O  O     . ASP F 2 121 ? 25.865  71.409  88.334  1.00 43.37 ? 310  ASP B O     1 
ATOM   4602  C  CB    . ASP F 2 121 ? 25.946  71.123  91.079  1.00 44.46 ? 310  ASP B CB    1 
ATOM   4603  C  CG    . ASP F 2 121 ? 26.533  69.783  90.728  1.00 45.80 ? 310  ASP B CG    1 
ATOM   4604  O  OD1   . ASP F 2 121 ? 27.769  69.709  90.529  1.00 46.49 ? 310  ASP B OD1   1 
ATOM   4605  O  OD2   . ASP F 2 121 ? 25.760  68.802  90.665  1.00 46.58 ? 310  ASP B OD2   1 
ATOM   4606  N  N     . PRO F 2 122 ? 27.306  73.124  88.207  1.00 44.10 ? 311  PRO B N     1 
ATOM   4607  C  CA    . PRO F 2 122 ? 27.348  73.259  86.747  1.00 44.11 ? 311  PRO B CA    1 
ATOM   4608  C  C     . PRO F 2 122 ? 27.842  72.074  85.942  1.00 44.70 ? 311  PRO B C     1 
ATOM   4609  O  O     . PRO F 2 122 ? 28.715  71.325  86.364  1.00 45.04 ? 311  PRO B O     1 
ATOM   4610  C  CB    . PRO F 2 122 ? 28.237  74.473  86.542  1.00 44.19 ? 311  PRO B CB    1 
ATOM   4611  C  CG    . PRO F 2 122 ? 29.209  74.342  87.676  1.00 44.52 ? 311  PRO B CG    1 
ATOM   4612  C  CD    . PRO F 2 122 ? 28.281  74.036  88.832  1.00 44.36 ? 311  PRO B CD    1 
ATOM   4613  N  N     . HIS F 2 123 ? 27.244  71.909  84.775  1.00 45.13 ? 312  HIS B N     1 
ATOM   4614  C  CA    . HIS F 2 123 ? 27.629  70.865  83.855  1.00 46.40 ? 312  HIS B CA    1 
ATOM   4615  C  C     . HIS F 2 123 ? 27.595  71.544  82.503  1.00 46.20 ? 312  HIS B C     1 
ATOM   4616  O  O     . HIS F 2 123 ? 26.717  72.364  82.235  1.00 46.59 ? 312  HIS B O     1 
ATOM   4617  C  CB    . HIS F 2 123 ? 26.648  69.696  83.875  1.00 48.76 ? 312  HIS B CB    1 
ATOM   4618  C  CG    . HIS F 2 123 ? 26.601  68.967  85.180  1.00 51.80 ? 312  HIS B CG    1 
ATOM   4619  N  ND1   . HIS F 2 123 ? 25.840  69.396  86.247  1.00 52.96 ? 312  HIS B ND1   1 
ATOM   4620  C  CD2   . HIS F 2 123 ? 27.231  67.842  85.596  1.00 53.31 ? 312  HIS B CD2   1 
ATOM   4621  C  CE1   . HIS F 2 123 ? 26.001  68.567  87.263  1.00 53.66 ? 312  HIS B CE1   1 
ATOM   4622  N  NE2   . HIS F 2 123 ? 26.841  67.616  86.895  1.00 54.45 ? 312  HIS B NE2   1 
ATOM   4623  N  N     . GLU F 2 124 ? 28.563  71.222  81.660  1.00 45.73 ? 313  GLU B N     1 
ATOM   4624  C  CA    . GLU F 2 124 ? 28.634  71.812  80.338  1.00 45.51 ? 313  GLU B CA    1 
ATOM   4625  C  C     . GLU F 2 124 ? 27.475  71.360  79.466  1.00 43.49 ? 313  GLU B C     1 
ATOM   4626  O  O     . GLU F 2 124 ? 27.145  70.183  79.427  1.00 43.07 ? 313  GLU B O     1 
ATOM   4627  C  CB    . GLU F 2 124 ? 29.961  71.433  79.686  1.00 48.63 ? 313  GLU B CB    1 
ATOM   4628  C  CG    . GLU F 2 124 ? 31.134  72.262  80.172  1.00 51.67 ? 313  GLU B CG    1 
ATOM   4629  C  CD    . GLU F 2 124 ? 31.553  73.297  79.150  1.00 53.95 ? 313  GLU B CD    1 
ATOM   4630  O  OE1   . GLU F 2 124 ? 32.139  72.889  78.118  1.00 54.65 ? 313  GLU B OE1   1 
ATOM   4631  O  OE2   . GLU F 2 124 ? 31.288  74.506  79.372  1.00 54.47 ? 313  GLU B OE2   1 
ATOM   4632  N  N     . LEU F 2 125 ? 26.855  72.308  78.778  1.00 42.38 ? 314  LEU B N     1 
ATOM   4633  C  CA    . LEU F 2 125 ? 25.737  72.003  77.892  1.00 41.72 ? 314  LEU B CA    1 
ATOM   4634  C  C     . LEU F 2 125 ? 26.132  71.166  76.692  1.00 40.73 ? 314  LEU B C     1 
ATOM   4635  O  O     . LEU F 2 125 ? 27.193  71.353  76.103  1.00 40.24 ? 314  LEU B O     1 
ATOM   4636  C  CB    . LEU F 2 125 ? 25.091  73.283  77.374  1.00 41.81 ? 314  LEU B CB    1 
ATOM   4637  C  CG    . LEU F 2 125 ? 23.939  73.860  78.177  1.00 42.22 ? 314  LEU B CG    1 
ATOM   4638  C  CD1   . LEU F 2 125 ? 23.333  75.017  77.399  1.00 42.41 ? 314  LEU B CD1   1 
ATOM   4639  C  CD2   . LEU F 2 125 ? 22.896  72.777  78.425  1.00 43.07 ? 314  LEU B CD2   1 
ATOM   4640  N  N     . GLU F 2 126 ? 25.251  70.247  76.332  1.00 40.59 ? 315  GLU B N     1 
ATOM   4641  C  CA    . GLU F 2 126 ? 25.456  69.379  75.193  1.00 40.64 ? 315  GLU B CA    1 
ATOM   4642  C  C     . GLU F 2 126 ? 24.336  69.690  74.212  1.00 39.11 ? 315  GLU B C     1 
ATOM   4643  O  O     . GLU F 2 126 ? 23.236  70.068  74.620  1.00 38.23 ? 315  GLU B O     1 
ATOM   4644  C  CB    . GLU F 2 126 ? 25.369  67.921  75.614  1.00 43.68 ? 315  GLU B CB    1 
ATOM   4645  C  CG    . GLU F 2 126 ? 26.532  67.095  75.158  1.00 48.30 ? 315  GLU B CG    1 
ATOM   4646  C  CD    . GLU F 2 126 ? 27.829  67.660  75.673  1.00 50.99 ? 315  GLU B CD    1 
ATOM   4647  O  OE1   . GLU F 2 126 ? 27.921  67.882  76.900  1.00 53.33 ? 315  GLU B OE1   1 
ATOM   4648  O  OE2   . GLU F 2 126 ? 28.748  67.885  74.858  1.00 52.07 ? 315  GLU B OE2   1 
ATOM   4649  N  N     . LEU F 2 127 ? 24.630  69.535  72.927  1.00 37.41 ? 316  LEU B N     1 
ATOM   4650  C  CA    . LEU F 2 127 ? 23.669  69.799  71.869  1.00 35.53 ? 316  LEU B CA    1 
ATOM   4651  C  C     . LEU F 2 127 ? 22.396  68.972  72.026  1.00 33.86 ? 316  LEU B C     1 
ATOM   4652  O  O     . LEU F 2 127 ? 22.439  67.746  72.125  1.00 33.13 ? 316  LEU B O     1 
ATOM   4653  C  CB    . LEU F 2 127 ? 24.307  69.525  70.499  1.00 35.47 ? 316  LEU B CB    1 
ATOM   4654  C  CG    . LEU F 2 127 ? 23.383  69.538  69.270  1.00 37.25 ? 316  LEU B CG    1 
ATOM   4655  C  CD1   . LEU F 2 127 ? 22.660  70.867  69.186  1.00 37.54 ? 316  LEU B CD1   1 
ATOM   4656  C  CD2   . LEU F 2 127 ? 24.184  69.281  67.990  1.00 36.96 ? 316  LEU B CD2   1 
ATOM   4657  N  N     . GLY F 2 128 ? 21.268  69.672  72.047  1.00 32.39 ? 317  GLY B N     1 
ATOM   4658  C  CA    . GLY F 2 128 ? 19.971  69.036  72.170  1.00 31.35 ? 317  GLY B CA    1 
ATOM   4659  C  C     . GLY F 2 128 ? 19.698  68.353  73.490  1.00 30.28 ? 317  GLY B C     1 
ATOM   4660  O  O     . GLY F 2 128 ? 18.740  67.588  73.595  1.00 30.14 ? 317  GLY B O     1 
ATOM   4661  N  N     . ARG F 2 129 ? 20.501  68.654  74.508  1.00 29.69 ? 318  ARG B N     1 
ATOM   4662  C  CA    . ARG F 2 129 ? 20.345  68.007  75.806  1.00 29.32 ? 318  ARG B CA    1 
ATOM   4663  C  C     . ARG F 2 129 ? 20.087  68.960  76.974  1.00 28.09 ? 318  ARG B C     1 
ATOM   4664  O  O     . ARG F 2 129 ? 20.996  69.355  77.695  1.00 28.24 ? 318  ARG B O     1 
ATOM   4665  C  CB    . ARG F 2 129 ? 21.568  67.113  76.053  1.00 29.83 ? 318  ARG B CB    1 
ATOM   4666  C  CG    . ARG F 2 129 ? 21.586  65.912  75.095  1.00 32.60 ? 318  ARG B CG    1 
ATOM   4667  C  CD    . ARG F 2 129 ? 22.963  65.296  74.802  1.00 34.81 ? 318  ARG B CD    1 
ATOM   4668  N  NE    . ARG F 2 129 ? 23.736  65.013  76.009  1.00 39.67 ? 318  ARG B NE    1 
ATOM   4669  C  CZ    . ARG F 2 129 ? 24.388  63.874  76.238  1.00 41.47 ? 318  ARG B CZ    1 
ATOM   4670  N  NH1   . ARG F 2 129 ? 24.361  62.895  75.338  1.00 41.23 ? 318  ARG B NH1   1 
ATOM   4671  N  NH2   . ARG F 2 129 ? 25.065  63.715  77.372  1.00 40.90 ? 318  ARG B NH2   1 
ATOM   4672  N  N     . PRO F 2 130 ? 18.818  69.336  77.175  1.00 26.71 ? 319  PRO B N     1 
ATOM   4673  C  CA    . PRO F 2 130 ? 18.498  70.248  78.274  1.00 26.47 ? 319  PRO B CA    1 
ATOM   4674  C  C     . PRO F 2 130 ? 18.753  69.622  79.640  1.00 25.94 ? 319  PRO B C     1 
ATOM   4675  O  O     . PRO F 2 130 ? 18.632  68.400  79.825  1.00 25.51 ? 319  PRO B O     1 
ATOM   4676  C  CB    . PRO F 2 130 ? 17.017  70.574  78.041  1.00 25.47 ? 319  PRO B CB    1 
ATOM   4677  C  CG    . PRO F 2 130 ? 16.494  69.309  77.413  1.00 28.18 ? 319  PRO B CG    1 
ATOM   4678  C  CD    . PRO F 2 130 ? 17.603  68.903  76.454  1.00 26.45 ? 319  PRO B CD    1 
ATOM   4679  N  N     . GLN F 2 131 ? 19.095  70.461  80.606  1.00 24.78 ? 320  GLN B N     1 
ATOM   4680  C  CA    . GLN F 2 131 ? 19.362  69.957  81.942  1.00 25.16 ? 320  GLN B CA    1 
ATOM   4681  C  C     . GLN F 2 131 ? 18.092  70.003  82.775  1.00 24.31 ? 320  GLN B C     1 
ATOM   4682  O  O     . GLN F 2 131 ? 17.985  69.338  83.795  1.00 23.96 ? 320  GLN B O     1 
ATOM   4683  C  CB    . GLN F 2 131 ? 20.490  70.774  82.583  1.00 26.53 ? 320  GLN B CB    1 
ATOM   4684  C  CG    . GLN F 2 131 ? 21.823  70.548  81.862  1.00 28.77 ? 320  GLN B CG    1 
ATOM   4685  C  CD    . GLN F 2 131 ? 22.948  71.445  82.331  1.00 29.39 ? 320  GLN B CD    1 
ATOM   4686  O  OE1   . GLN F 2 131 ? 24.099  71.270  81.918  1.00 31.12 ? 320  GLN B OE1   1 
ATOM   4687  N  NE2   . GLN F 2 131 ? 22.631  72.413  83.181  1.00 28.98 ? 320  GLN B NE2   1 
ATOM   4688  N  N     . VAL F 2 132 ? 17.124  70.778  82.301  1.00 23.27 ? 321  VAL B N     1 
ATOM   4689  C  CA    . VAL F 2 132 ? 15.854  70.951  82.981  1.00 23.11 ? 321  VAL B CA    1 
ATOM   4690  C  C     . VAL F 2 132 ? 14.718  70.971  81.946  1.00 21.85 ? 321  VAL B C     1 
ATOM   4691  O  O     . VAL F 2 132 ? 14.830  71.624  80.905  1.00 20.32 ? 321  VAL B O     1 
ATOM   4692  C  CB    . VAL F 2 132 ? 15.833  72.288  83.792  1.00 23.27 ? 321  VAL B CB    1 
ATOM   4693  C  CG1   . VAL F 2 132 ? 14.493  72.460  84.488  1.00 22.80 ? 321  VAL B CG1   1 
ATOM   4694  C  CG2   . VAL F 2 132 ? 16.968  72.307  84.812  1.00 23.22 ? 321  VAL B CG2   1 
ATOM   4695  N  N     . VAL F 2 133 ? 13.645  70.238  82.239  1.00 20.41 ? 322  VAL B N     1 
ATOM   4696  C  CA    . VAL F 2 133 ? 12.483  70.176  81.369  1.00 19.65 ? 322  VAL B CA    1 
ATOM   4697  C  C     . VAL F 2 133 ? 11.253  70.520  82.196  1.00 19.79 ? 322  VAL B C     1 
ATOM   4698  O  O     . VAL F 2 133 ? 10.955  69.867  83.188  1.00 20.03 ? 322  VAL B O     1 
ATOM   4699  C  CB    . VAL F 2 133 ? 12.303  68.770  80.764  1.00 20.33 ? 322  VAL B CB    1 
ATOM   4700  C  CG1   . VAL F 2 133 ? 11.023  68.717  79.926  1.00 19.74 ? 322  VAL B CG1   1 
ATOM   4701  C  CG2   . VAL F 2 133 ? 13.498  68.433  79.895  1.00 19.11 ? 322  VAL B CG2   1 
ATOM   4702  N  N     . ILE F 2 134 ? 10.553  71.572  81.797  1.00 20.07 ? 323  ILE B N     1 
ATOM   4703  C  CA    . ILE F 2 134 ? 9.356   71.992  82.501  1.00 18.62 ? 323  ILE B CA    1 
ATOM   4704  C  C     . ILE F 2 134 ? 8.202   71.906  81.522  1.00 19.37 ? 323  ILE B C     1 
ATOM   4705  O  O     . ILE F 2 134 ? 8.223   72.495  80.466  1.00 20.13 ? 323  ILE B O     1 
ATOM   4706  C  CB    . ILE F 2 134 ? 9.501   73.426  83.049  1.00 18.29 ? 323  ILE B CB    1 
ATOM   4707  C  CG1   . ILE F 2 134 ? 10.783  73.517  83.896  1.00 16.53 ? 323  ILE B CG1   1 
ATOM   4708  C  CG2   . ILE F 2 134 ? 8.267   73.787  83.890  1.00 17.42 ? 323  ILE B CG2   1 
ATOM   4709  C  CD1   . ILE F 2 134 ? 11.072  74.860  84.497  1.00 15.60 ? 323  ILE B CD1   1 
ATOM   4710  N  N     . VAL F 2 135 ? 7.195   71.136  81.887  1.00 21.10 ? 324  VAL B N     1 
ATOM   4711  C  CA    . VAL F 2 135 ? 6.035   70.912  81.045  1.00 21.01 ? 324  VAL B CA    1 
ATOM   4712  C  C     . VAL F 2 135 ? 4.803   71.679  81.515  1.00 20.54 ? 324  VAL B C     1 
ATOM   4713  O  O     . VAL F 2 135 ? 4.549   71.805  82.709  1.00 20.54 ? 324  VAL B O     1 
ATOM   4714  C  CB    . VAL F 2 135 ? 5.746   69.410  81.014  1.00 22.21 ? 324  VAL B CB    1 
ATOM   4715  C  CG1   . VAL F 2 135 ? 4.395   69.157  80.515  1.00 24.03 ? 324  VAL B CG1   1 
ATOM   4716  C  CG2   . VAL F 2 135 ? 6.777   68.724  80.132  1.00 23.63 ? 324  VAL B CG2   1 
ATOM   4717  N  N     . SER F 2 136 ? 4.048   72.186  80.552  1.00 20.73 ? 325  SER B N     1 
ATOM   4718  C  CA    . SER F 2 136 ? 2.847   72.957  80.809  1.00 21.57 ? 325  SER B CA    1 
ATOM   4719  C  C     . SER F 2 136 ? 1.699   72.467  79.942  1.00 21.31 ? 325  SER B C     1 
ATOM   4720  O  O     . SER F 2 136 ? 1.882   72.136  78.787  1.00 21.52 ? 325  SER B O     1 
ATOM   4721  C  CB    . SER F 2 136 ? 3.121   74.434  80.513  1.00 22.18 ? 325  SER B CB    1 
ATOM   4722  O  OG    . SER F 2 136 ? 1.920   75.147  80.297  1.00 25.09 ? 325  SER B OG    1 
ATOM   4723  N  N     . PRO F 2 137 ? 0.483   72.457  80.482  1.00 21.79 ? 326  PRO B N     1 
ATOM   4724  C  CA    . PRO F 2 137 ? -0.687  71.996  79.720  1.00 22.98 ? 326  PRO B CA    1 
ATOM   4725  C  C     . PRO F 2 137 ? -1.161  72.971  78.651  1.00 23.25 ? 326  PRO B C     1 
ATOM   4726  O  O     . PRO F 2 137 ? -1.937  72.619  77.766  1.00 23.92 ? 326  PRO B O     1 
ATOM   4727  C  CB    . PRO F 2 137 ? -1.743  71.805  80.807  1.00 23.05 ? 326  PRO B CB    1 
ATOM   4728  C  CG    . PRO F 2 137 ? -1.399  72.916  81.778  1.00 23.94 ? 326  PRO B CG    1 
ATOM   4729  C  CD    . PRO F 2 137 ? 0.117   72.829  81.856  1.00 22.61 ? 326  PRO B CD    1 
ATOM   4730  N  N     . THR F 2 138 ? -0.654  74.189  78.715  1.00 22.42 ? 327  THR B N     1 
ATOM   4731  C  CA    . THR F 2 138 ? -1.097  75.223  77.822  1.00 22.40 ? 327  THR B CA    1 
ATOM   4732  C  C     . THR F 2 138 ? 0.026   76.094  77.244  1.00 21.86 ? 327  THR B C     1 
ATOM   4733  O  O     . THR F 2 138 ? 1.010   76.380  77.913  1.00 20.77 ? 327  THR B O     1 
ATOM   4734  C  CB    . THR F 2 138 ? -2.125  76.050  78.622  1.00 24.40 ? 327  THR B CB    1 
ATOM   4735  O  OG1   . THR F 2 138 ? -3.456  75.629  78.263  1.00 27.55 ? 327  THR B OG1   1 
ATOM   4736  C  CG2   . THR F 2 138 ? -1.910  77.503  78.459  1.00 24.08 ? 327  THR B CG2   1 
ATOM   4737  N  N     . ARG F 2 139 ? -0.127  76.513  75.996  1.00 21.89 ? 328  ARG B N     1 
ATOM   4738  C  CA    . ARG F 2 139 ? 0.894   77.334  75.359  1.00 24.24 ? 328  ARG B CA    1 
ATOM   4739  C  C     . ARG F 2 139 ? 1.187   78.666  76.062  1.00 24.36 ? 328  ARG B C     1 
ATOM   4740  O  O     . ARG F 2 139 ? 2.341   78.991  76.331  1.00 24.60 ? 328  ARG B O     1 
ATOM   4741  C  CB    . ARG F 2 139 ? 0.522   77.616  73.906  1.00 23.43 ? 328  ARG B CB    1 
ATOM   4742  C  CG    . ARG F 2 139 ? 0.381   76.377  73.076  1.00 25.14 ? 328  ARG B CG    1 
ATOM   4743  C  CD    . ARG F 2 139 ? -0.177  76.686  71.700  1.00 24.30 ? 328  ARG B CD    1 
ATOM   4744  N  NE    . ARG F 2 139 ? -0.365  75.465  70.936  1.00 25.54 ? 328  ARG B NE    1 
ATOM   4745  C  CZ    . ARG F 2 139 ? -0.859  75.419  69.702  1.00 25.66 ? 328  ARG B CZ    1 
ATOM   4746  N  NH1   . ARG F 2 139 ? -1.225  76.535  69.081  1.00 26.41 ? 328  ARG B NH1   1 
ATOM   4747  N  NH2   . ARG F 2 139 ? -0.973  74.257  69.083  1.00 24.19 ? 328  ARG B NH2   1 
ATOM   4748  N  N     . GLU F 2 140 ? 0.155   79.436  76.370  1.00 23.53 ? 329  GLU B N     1 
ATOM   4749  C  CA    . GLU F 2 140 ? 0.415   80.718  77.002  1.00 23.30 ? 329  GLU B CA    1 
ATOM   4750  C  C     . GLU F 2 140 ? 1.040   80.544  78.385  1.00 23.25 ? 329  GLU B C     1 
ATOM   4751  O  O     . GLU F 2 140 ? 1.826   81.394  78.819  1.00 23.28 ? 329  GLU B O     1 
ATOM   4752  C  CB    . GLU F 2 140 ? -0.868  81.548  77.082  1.00 23.42 ? 329  GLU B CB    1 
ATOM   4753  C  CG    . GLU F 2 140 ? -1.462  81.954  75.704  1.00 24.25 ? 329  GLU B CG    1 
ATOM   4754  C  CD    . GLU F 2 140 ? -2.005  80.777  74.875  1.00 24.02 ? 329  GLU B CD    1 
ATOM   4755  O  OE1   . GLU F 2 140 ? -2.527  79.806  75.459  1.00 25.19 ? 329  GLU B OE1   1 
ATOM   4756  O  OE2   . GLU F 2 140 ? -1.924  80.832  73.632  1.00 25.57 ? 329  GLU B OE2   1 
ATOM   4757  N  N     . LEU F 2 141 ? 0.690   79.460  79.079  1.00 21.56 ? 330  LEU B N     1 
ATOM   4758  C  CA    . LEU F 2 141 ? 1.269   79.208  80.388  1.00 20.54 ? 330  LEU B CA    1 
ATOM   4759  C  C     . LEU F 2 141 ? 2.758   78.926  80.238  1.00 21.28 ? 330  LEU B C     1 
ATOM   4760  O  O     . LEU F 2 141 ? 3.559   79.369  81.068  1.00 22.23 ? 330  LEU B O     1 
ATOM   4761  C  CB    . LEU F 2 141 ? 0.597   78.022  81.092  1.00 19.42 ? 330  LEU B CB    1 
ATOM   4762  C  CG    . LEU F 2 141 ? 1.143   77.761  82.509  1.00 18.66 ? 330  LEU B CG    1 
ATOM   4763  C  CD1   . LEU F 2 141 ? 1.064   79.058  83.365  1.00 16.06 ? 330  LEU B CD1   1 
ATOM   4764  C  CD2   . LEU F 2 141 ? 0.348   76.636  83.161  1.00 18.71 ? 330  LEU B CD2   1 
ATOM   4765  N  N     . ALA F 2 142 ? 3.130   78.192  79.183  1.00 20.65 ? 331  ALA B N     1 
ATOM   4766  C  CA    . ALA F 2 142 ? 4.536   77.889  78.933  1.00 19.90 ? 331  ALA B CA    1 
ATOM   4767  C  C     . ALA F 2 142 ? 5.296   79.203  78.717  1.00 20.06 ? 331  ALA B C     1 
ATOM   4768  O  O     . ALA F 2 142 ? 6.367   79.427  79.302  1.00 19.50 ? 331  ALA B O     1 
ATOM   4769  C  CB    . ALA F 2 142 ? 4.690   76.982  77.703  1.00 16.35 ? 331  ALA B CB    1 
ATOM   4770  N  N     . ILE F 2 143 ? 4.754   80.056  77.860  1.00 20.24 ? 332  ILE B N     1 
ATOM   4771  C  CA    . ILE F 2 143 ? 5.373   81.359  77.580  1.00 22.50 ? 332  ILE B CA    1 
ATOM   4772  C  C     . ILE F 2 143 ? 5.562   82.145  78.890  1.00 22.56 ? 332  ILE B C     1 
ATOM   4773  O  O     . ILE F 2 143 ? 6.598   82.762  79.116  1.00 22.10 ? 332  ILE B O     1 
ATOM   4774  C  CB    . ILE F 2 143 ? 4.485   82.211  76.639  1.00 23.08 ? 332  ILE B CB    1 
ATOM   4775  C  CG1   . ILE F 2 143 ? 4.468   81.609  75.236  1.00 22.78 ? 332  ILE B CG1   1 
ATOM   4776  C  CG2   . ILE F 2 143 ? 4.993   83.643  76.601  1.00 23.74 ? 332  ILE B CG2   1 
ATOM   4777  C  CD1   . ILE F 2 143 ? 3.302   82.127  74.366  1.00 22.91 ? 332  ILE B CD1   1 
ATOM   4778  N  N     . GLN F 2 144 ? 4.557   82.101  79.758  1.00 22.94 ? 333  GLN B N     1 
ATOM   4779  C  CA    . GLN F 2 144 ? 4.631   82.816  81.020  1.00 23.01 ? 333  GLN B CA    1 
ATOM   4780  C  C     . GLN F 2 144 ? 5.740   82.271  81.936  1.00 24.13 ? 333  GLN B C     1 
ATOM   4781  O  O     . GLN F 2 144 ? 6.520   83.038  82.533  1.00 23.44 ? 333  GLN B O     1 
ATOM   4782  C  CB    . GLN F 2 144 ? 3.283   82.749  81.721  1.00 22.47 ? 333  GLN B CB    1 
ATOM   4783  C  CG    . GLN F 2 144 ? 3.298   83.331  83.129  1.00 24.24 ? 333  GLN B CG    1 
ATOM   4784  C  CD    . GLN F 2 144 ? 1.948   83.247  83.792  1.00 24.97 ? 333  GLN B CD    1 
ATOM   4785  O  OE1   . GLN F 2 144 ? 1.004   83.932  83.380  1.00 25.74 ? 333  GLN B OE1   1 
ATOM   4786  N  NE2   . GLN F 2 144 ? 1.834   82.397  84.818  1.00 22.47 ? 333  GLN B NE2   1 
ATOM   4787  N  N     . ILE F 2 145 ? 5.810   80.949  82.047  1.00 22.40 ? 334  ILE B N     1 
ATOM   4788  C  CA    . ILE F 2 145 ? 6.820   80.336  82.883  1.00 23.09 ? 334  ILE B CA    1 
ATOM   4789  C  C     . ILE F 2 145 ? 8.183   80.674  82.289  1.00 22.44 ? 334  ILE B C     1 
ATOM   4790  O  O     . ILE F 2 145 ? 9.145   80.962  83.009  1.00 22.54 ? 334  ILE B O     1 
ATOM   4791  C  CB    . ILE F 2 145 ? 6.633   78.792  82.952  1.00 22.49 ? 334  ILE B CB    1 
ATOM   4792  C  CG1   . ILE F 2 145 ? 5.360   78.449  83.724  1.00 23.25 ? 334  ILE B CG1   1 
ATOM   4793  C  CG2   . ILE F 2 145 ? 7.809   78.154  83.624  1.00 23.14 ? 334  ILE B CG2   1 
ATOM   4794  C  CD1   . ILE F 2 145 ? 4.999   76.944  83.682  1.00 23.96 ? 334  ILE B CD1   1 
ATOM   4795  N  N     . PHE F 2 146 ? 8.249   80.635  80.967  1.00 21.77 ? 335  PHE B N     1 
ATOM   4796  C  CA    . PHE F 2 146 ? 9.465   80.943  80.248  1.00 22.45 ? 335  PHE B CA    1 
ATOM   4797  C  C     . PHE F 2 146 ? 9.948   82.333  80.658  1.00 22.94 ? 335  PHE B C     1 
ATOM   4798  O  O     . PHE F 2 146 ? 11.123  82.527  80.978  1.00 23.38 ? 335  PHE B O     1 
ATOM   4799  C  CB    . PHE F 2 146 ? 9.179   80.878  78.741  1.00 21.46 ? 335  PHE B CB    1 
ATOM   4800  C  CG    . PHE F 2 146 ? 10.275  81.436  77.870  1.00 21.80 ? 335  PHE B CG    1 
ATOM   4801  C  CD1   . PHE F 2 146 ? 11.447  80.703  77.627  1.00 21.28 ? 335  PHE B CD1   1 
ATOM   4802  C  CD2   . PHE F 2 146 ? 10.111  82.676  77.238  1.00 20.83 ? 335  PHE B CD2   1 
ATOM   4803  C  CE1   . PHE F 2 146 ? 12.442  81.195  76.761  1.00 21.45 ? 335  PHE B CE1   1 
ATOM   4804  C  CE2   . PHE F 2 146 ? 11.101  83.180  76.368  1.00 22.75 ? 335  PHE B CE2   1 
ATOM   4805  C  CZ    . PHE F 2 146 ? 12.269  82.433  76.130  1.00 22.27 ? 335  PHE B CZ    1 
ATOM   4806  N  N     . ASN F 2 147 ? 9.048   83.306  80.660  1.00 22.88 ? 336  ASN B N     1 
ATOM   4807  C  CA    . ASN F 2 147 ? 9.470   84.641  81.030  1.00 24.18 ? 336  ASN B CA    1 
ATOM   4808  C  C     . ASN F 2 147 ? 9.868   84.722  82.500  1.00 25.03 ? 336  ASN B C     1 
ATOM   4809  O  O     . ASN F 2 147 ? 10.754  85.497  82.848  1.00 24.66 ? 336  ASN B O     1 
ATOM   4810  C  CB    . ASN F 2 147 ? 8.383   85.663  80.680  1.00 23.41 ? 336  ASN B CB    1 
ATOM   4811  C  CG    . ASN F 2 147 ? 8.278   85.898  79.174  1.00 24.85 ? 336  ASN B CG    1 
ATOM   4812  O  OD1   . ASN F 2 147 ? 7.200   85.774  78.588  1.00 27.50 ? 336  ASN B OD1   1 
ATOM   4813  N  ND2   . ASN F 2 147 ? 9.398   86.238  78.542  1.00 22.13 ? 336  ASN B ND2   1 
ATOM   4814  N  N     . GLU F 2 148 ? 9.233   83.932  83.367  1.00 24.73 ? 337  GLU B N     1 
ATOM   4815  C  CA    . GLU F 2 148 ? 9.617   83.975  84.765  1.00 25.93 ? 337  GLU B CA    1 
ATOM   4816  C  C     . GLU F 2 148 ? 11.031  83.403  84.895  1.00 25.79 ? 337  GLU B C     1 
ATOM   4817  O  O     . GLU F 2 148 ? 11.858  83.926  85.635  1.00 24.47 ? 337  GLU B O     1 
ATOM   4818  C  CB    . GLU F 2 148 ? 8.628   83.198  85.635  1.00 27.36 ? 337  GLU B CB    1 
ATOM   4819  C  CG    . GLU F 2 148 ? 7.258   83.870  85.748  1.00 32.05 ? 337  GLU B CG    1 
ATOM   4820  C  CD    . GLU F 2 148 ? 7.345   85.308  86.292  1.00 34.77 ? 337  GLU B CD    1 
ATOM   4821  O  OE1   . GLU F 2 148 ? 7.610   85.486  87.496  1.00 35.44 ? 337  GLU B OE1   1 
ATOM   4822  O  OE2   . GLU F 2 148 ? 7.157   86.266  85.509  1.00 36.96 ? 337  GLU B OE2   1 
ATOM   4823  N  N     . ALA F 2 149 ? 11.312  82.336  84.156  1.00 25.61 ? 338  ALA B N     1 
ATOM   4824  C  CA    . ALA F 2 149 ? 12.633  81.732  84.191  1.00 26.06 ? 338  ALA B CA    1 
ATOM   4825  C  C     . ALA F 2 149 ? 13.704  82.731  83.732  1.00 26.81 ? 338  ALA B C     1 
ATOM   4826  O  O     . ALA F 2 149 ? 14.803  82.763  84.289  1.00 25.87 ? 338  ALA B O     1 
ATOM   4827  C  CB    . ALA F 2 149 ? 12.666  80.501  83.322  1.00 23.22 ? 338  ALA B CB    1 
ATOM   4828  N  N     . ARG F 2 150 ? 13.382  83.529  82.714  1.00 27.33 ? 339  ARG B N     1 
ATOM   4829  C  CA    . ARG F 2 150 ? 14.322  84.519  82.198  1.00 28.37 ? 339  ARG B CA    1 
ATOM   4830  C  C     . ARG F 2 150 ? 14.577  85.582  83.252  1.00 28.97 ? 339  ARG B C     1 
ATOM   4831  O  O     . ARG F 2 150 ? 15.687  86.112  83.368  1.00 30.23 ? 339  ARG B O     1 
ATOM   4832  C  CB    . ARG F 2 150 ? 13.780  85.184  80.930  1.00 28.76 ? 339  ARG B CB    1 
ATOM   4833  C  CG    . ARG F 2 150 ? 13.892  84.343  79.671  1.00 31.08 ? 339  ARG B CG    1 
ATOM   4834  C  CD    . ARG F 2 150 ? 13.518  85.161  78.426  1.00 33.89 ? 339  ARG B CD    1 
ATOM   4835  N  NE    . ARG F 2 150 ? 14.685  85.767  77.771  1.00 38.02 ? 339  ARG B NE    1 
ATOM   4836  C  CZ    . ARG F 2 150 ? 14.955  87.072  77.751  1.00 39.28 ? 339  ARG B CZ    1 
ATOM   4837  N  NH1   . ARG F 2 150 ? 14.150  87.937  78.355  1.00 39.82 ? 339  ARG B NH1   1 
ATOM   4838  N  NH2   . ARG F 2 150 ? 16.029  87.518  77.108  1.00 40.77 ? 339  ARG B NH2   1 
ATOM   4839  N  N     . LYS F 2 151 ? 13.537  85.890  84.010  1.00 27.64 ? 340  LYS B N     1 
ATOM   4840  C  CA    . LYS F 2 151 ? 13.609  86.874  85.066  1.00 29.29 ? 340  LYS B CA    1 
ATOM   4841  C  C     . LYS F 2 151 ? 14.593  86.443  86.172  1.00 30.36 ? 340  LYS B C     1 
ATOM   4842  O  O     . LYS F 2 151 ? 15.526  87.176  86.519  1.00 31.71 ? 340  LYS B O     1 
ATOM   4843  C  CB    . LYS F 2 151 ? 12.204  87.069  85.650  1.00 29.72 ? 340  LYS B CB    1 
ATOM   4844  C  CG    . LYS F 2 151 ? 12.036  88.294  86.505  1.00 31.76 ? 340  LYS B CG    1 
ATOM   4845  C  CD    . LYS F 2 151 ? 10.582  88.538  86.858  1.00 32.47 ? 340  LYS B CD    1 
ATOM   4846  C  CE    . LYS F 2 151 ? 10.073  87.536  87.881  1.00 33.97 ? 340  LYS B CE    1 
ATOM   4847  N  NZ    . LYS F 2 151 ? 8.729   87.932  88.392  1.00 34.52 ? 340  LYS B NZ    1 
ATOM   4848  N  N     . PHE F 2 152 ? 14.409  85.243  86.710  1.00 29.16 ? 341  PHE B N     1 
ATOM   4849  C  CA    . PHE F 2 152 ? 15.279  84.777  87.782  1.00 28.56 ? 341  PHE B CA    1 
ATOM   4850  C  C     . PHE F 2 152 ? 16.683  84.430  87.344  1.00 28.42 ? 341  PHE B C     1 
ATOM   4851  O  O     . PHE F 2 152 ? 17.585  84.380  88.161  1.00 28.60 ? 341  PHE B O     1 
ATOM   4852  C  CB    . PHE F 2 152 ? 14.632  83.582  88.491  1.00 27.31 ? 341  PHE B CB    1 
ATOM   4853  C  CG    . PHE F 2 152 ? 13.322  83.916  89.130  1.00 27.04 ? 341  PHE B CG    1 
ATOM   4854  C  CD1   . PHE F 2 152 ? 13.202  85.046  89.932  1.00 27.48 ? 341  PHE B CD1   1 
ATOM   4855  C  CD2   . PHE F 2 152 ? 12.194  83.131  88.905  1.00 28.76 ? 341  PHE B CD2   1 
ATOM   4856  C  CE1   . PHE F 2 152 ? 11.982  85.406  90.500  1.00 27.91 ? 341  PHE B CE1   1 
ATOM   4857  C  CE2   . PHE F 2 152 ? 10.954  83.477  89.470  1.00 28.96 ? 341  PHE B CE2   1 
ATOM   4858  C  CZ    . PHE F 2 152 ? 10.850  84.622  90.269  1.00 29.34 ? 341  PHE B CZ    1 
ATOM   4859  N  N     . ALA F 2 153 ? 16.876  84.196  86.055  1.00 28.68 ? 342  ALA B N     1 
ATOM   4860  C  CA    . ALA F 2 153 ? 18.202  83.852  85.551  1.00 30.01 ? 342  ALA B CA    1 
ATOM   4861  C  C     . ALA F 2 153 ? 18.873  85.067  84.904  1.00 30.70 ? 342  ALA B C     1 
ATOM   4862  O  O     . ALA F 2 153 ? 19.923  84.944  84.265  1.00 29.38 ? 342  ALA B O     1 
ATOM   4863  C  CB    . ALA F 2 153 ? 18.102  82.709  84.526  1.00 28.98 ? 342  ALA B CB    1 
ATOM   4864  N  N     . PHE F 2 154 ? 18.250  86.229  85.062  1.00 31.70 ? 343  PHE B N     1 
ATOM   4865  C  CA    . PHE F 2 154 ? 18.778  87.459  84.502  1.00 34.32 ? 343  PHE B CA    1 
ATOM   4866  C  C     . PHE F 2 154 ? 20.276  87.615  84.766  1.00 35.76 ? 343  PHE B C     1 
ATOM   4867  O  O     . PHE F 2 154 ? 20.746  87.486  85.896  1.00 35.17 ? 343  PHE B O     1 
ATOM   4868  C  CB    . PHE F 2 154 ? 18.043  88.653  85.100  1.00 35.01 ? 343  PHE B CB    1 
ATOM   4869  C  CG    . PHE F 2 154 ? 18.425  89.960  84.484  1.00 36.24 ? 343  PHE B CG    1 
ATOM   4870  C  CD1   . PHE F 2 154 ? 18.101  90.237  83.157  1.00 36.77 ? 343  PHE B CD1   1 
ATOM   4871  C  CD2   . PHE F 2 154 ? 19.126  90.908  85.218  1.00 36.61 ? 343  PHE B CD2   1 
ATOM   4872  C  CE1   . PHE F 2 154 ? 18.473  91.448  82.566  1.00 36.79 ? 343  PHE B CE1   1 
ATOM   4873  C  CE2   . PHE F 2 154 ? 19.505  92.120  84.643  1.00 36.80 ? 343  PHE B CE2   1 
ATOM   4874  C  CZ    . PHE F 2 154 ? 19.178  92.391  83.313  1.00 37.46 ? 343  PHE B CZ    1 
ATOM   4875  N  N     . GLU F 2 155 ? 21.022  87.888  83.706  1.00 38.76 ? 344  GLU B N     1 
ATOM   4876  C  CA    . GLU F 2 155 ? 22.463  88.093  83.795  1.00 40.61 ? 344  GLU B CA    1 
ATOM   4877  C  C     . GLU F 2 155 ? 23.295  86.949  84.352  1.00 41.11 ? 344  GLU B C     1 
ATOM   4878  O  O     . GLU F 2 155 ? 24.425  87.154  84.800  1.00 41.17 ? 344  GLU B O     1 
ATOM   4879  C  CB    . GLU F 2 155 ? 22.758  89.385  84.558  1.00 43.01 ? 344  GLU B CB    1 
ATOM   4880  C  CG    . GLU F 2 155 ? 23.047  90.545  83.615  1.00 47.89 ? 344  GLU B CG    1 
ATOM   4881  C  CD    . GLU F 2 155 ? 22.981  91.901  84.292  1.00 50.49 ? 344  GLU B CD    1 
ATOM   4882  O  OE1   . GLU F 2 155 ? 23.544  92.043  85.402  1.00 52.46 ? 344  GLU B OE1   1 
ATOM   4883  O  OE2   . GLU F 2 155 ? 22.372  92.829  83.704  1.00 51.82 ? 344  GLU B OE2   1 
ATOM   4884  N  N     . SER F 2 156 ? 22.723  85.752  84.348  1.00 40.99 ? 345  SER B N     1 
ATOM   4885  C  CA    . SER F 2 156 ? 23.445  84.564  84.761  1.00 41.41 ? 345  SER B CA    1 
ATOM   4886  C  C     . SER F 2 156 ? 23.754  84.069  83.354  1.00 42.35 ? 345  SER B C     1 
ATOM   4887  O  O     . SER F 2 156 ? 23.311  84.682  82.377  1.00 43.66 ? 345  SER B O     1 
ATOM   4888  C  CB    . SER F 2 156 ? 22.528  83.574  85.488  1.00 42.01 ? 345  SER B CB    1 
ATOM   4889  O  OG    . SER F 2 156 ? 21.768  82.796  84.576  1.00 41.84 ? 345  SER B OG    1 
ATOM   4890  N  N     . TYR F 2 157 ? 24.495  82.990  83.196  1.00 42.40 ? 346  TYR B N     1 
ATOM   4891  C  CA    . TYR F 2 157 ? 24.752  82.583  81.832  1.00 41.68 ? 346  TYR B CA    1 
ATOM   4892  C  C     . TYR F 2 157 ? 23.877  81.418  81.427  1.00 39.72 ? 346  TYR B C     1 
ATOM   4893  O  O     . TYR F 2 157 ? 24.118  80.763  80.411  1.00 39.16 ? 346  TYR B O     1 
ATOM   4894  C  CB    . TYR F 2 157 ? 26.242  82.291  81.641  1.00 46.34 ? 346  TYR B CB    1 
ATOM   4895  C  CG    . TYR F 2 157 ? 27.067  83.569  81.668  1.00 50.89 ? 346  TYR B CG    1 
ATOM   4896  C  CD1   . TYR F 2 157 ? 27.323  84.234  82.872  1.00 52.05 ? 346  TYR B CD1   1 
ATOM   4897  C  CD2   . TYR F 2 157 ? 27.506  84.168  80.479  1.00 52.77 ? 346  TYR B CD2   1 
ATOM   4898  C  CE1   . TYR F 2 157 ? 27.981  85.461  82.894  1.00 54.17 ? 346  TYR B CE1   1 
ATOM   4899  C  CE2   . TYR F 2 157 ? 28.169  85.398  80.491  1.00 54.55 ? 346  TYR B CE2   1 
ATOM   4900  C  CZ    . TYR F 2 157 ? 28.397  86.040  81.700  1.00 54.88 ? 346  TYR B CZ    1 
ATOM   4901  O  OH    . TYR F 2 157 ? 29.005  87.277  81.716  1.00 56.61 ? 346  TYR B OH    1 
ATOM   4902  N  N     . LEU F 2 158 ? 22.842  81.190  82.231  1.00 36.64 ? 347  LEU B N     1 
ATOM   4903  C  CA    . LEU F 2 158 ? 21.878  80.132  81.985  1.00 33.94 ? 347  LEU B CA    1 
ATOM   4904  C  C     . LEU F 2 158 ? 21.024  80.528  80.792  1.00 33.64 ? 347  LEU B C     1 
ATOM   4905  O  O     . LEU F 2 158 ? 20.553  81.664  80.693  1.00 32.86 ? 347  LEU B O     1 
ATOM   4906  C  CB    . LEU F 2 158 ? 20.969  79.935  83.198  1.00 31.17 ? 347  LEU B CB    1 
ATOM   4907  C  CG    . LEU F 2 158 ? 21.630  79.431  84.479  1.00 30.05 ? 347  LEU B CG    1 
ATOM   4908  C  CD1   . LEU F 2 158 ? 20.560  79.223  85.539  1.00 29.04 ? 347  LEU B CD1   1 
ATOM   4909  C  CD2   . LEU F 2 158 ? 22.389  78.134  84.201  1.00 28.85 ? 347  LEU B CD2   1 
ATOM   4910  N  N     . LYS F 2 159 ? 20.820  79.584  79.889  1.00 32.94 ? 348  LYS B N     1 
ATOM   4911  C  CA    . LYS F 2 159 ? 20.025  79.857  78.716  1.00 32.92 ? 348  LYS B CA    1 
ATOM   4912  C  C     . LYS F 2 159 ? 18.670  79.155  78.820  1.00 31.71 ? 348  LYS B C     1 
ATOM   4913  O  O     . LYS F 2 159 ? 18.593  77.951  79.079  1.00 29.75 ? 348  LYS B O     1 
ATOM   4914  C  CB    . LYS F 2 159 ? 20.815  79.436  77.469  1.00 35.08 ? 348  LYS B CB    1 
ATOM   4915  C  CG    . LYS F 2 159 ? 22.110  80.273  77.311  1.00 38.19 ? 348  LYS B CG    1 
ATOM   4916  C  CD    . LYS F 2 159 ? 22.884  80.008  76.022  1.00 40.56 ? 348  LYS B CD    1 
ATOM   4917  C  CE    . LYS F 2 159 ? 23.502  78.618  75.990  1.00 43.39 ? 348  LYS B CE    1 
ATOM   4918  N  NZ    . LYS F 2 159 ? 24.437  78.454  74.820  1.00 44.48 ? 348  LYS B NZ    1 
ATOM   4919  N  N     . ILE F 2 160 ? 17.608  79.942  78.657  1.00 29.97 ? 349  ILE B N     1 
ATOM   4920  C  CA    . ILE F 2 160 ? 16.249  79.437  78.727  1.00 27.76 ? 349  ILE B CA    1 
ATOM   4921  C  C     . ILE F 2 160 ? 15.680  79.355  77.327  1.00 27.42 ? 349  ILE B C     1 
ATOM   4922  O  O     . ILE F 2 160 ? 15.828  80.280  76.525  1.00 27.03 ? 349  ILE B O     1 
ATOM   4923  C  CB    . ILE F 2 160 ? 15.341  80.354  79.557  1.00 27.14 ? 349  ILE B CB    1 
ATOM   4924  C  CG1   . ILE F 2 160 ? 16.103  80.882  80.779  1.00 25.74 ? 349  ILE B CG1   1 
ATOM   4925  C  CG2   . ILE F 2 160 ? 14.079  79.592  79.952  1.00 26.50 ? 349  ILE B CG2   1 
ATOM   4926  C  CD1   . ILE F 2 160 ? 16.818  79.808  81.608  1.00 25.22 ? 349  ILE B CD1   1 
ATOM   4927  N  N     . GLY F 2 161 ? 15.044  78.228  77.035  1.00 26.25 ? 350  GLY B N     1 
ATOM   4928  C  CA    . GLY F 2 161 ? 14.458  78.021  75.737  1.00 25.41 ? 350  GLY B CA    1 
ATOM   4929  C  C     . GLY F 2 161 ? 13.026  77.601  75.941  1.00 26.47 ? 350  GLY B C     1 
ATOM   4930  O  O     . GLY F 2 161 ? 12.643  77.175  77.037  1.00 27.09 ? 350  GLY B O     1 
ATOM   4931  N  N     . ILE F 2 162 ? 12.227  77.719  74.889  1.00 26.34 ? 351  ILE B N     1 
ATOM   4932  C  CA    . ILE F 2 162 ? 10.832  77.356  74.973  1.00 26.90 ? 351  ILE B CA    1 
ATOM   4933  C  C     . ILE F 2 162 ? 10.418  76.624  73.707  1.00 26.94 ? 351  ILE B C     1 
ATOM   4934  O  O     . ILE F 2 162 ? 10.923  76.883  72.625  1.00 27.70 ? 351  ILE B O     1 
ATOM   4935  C  CB    . ILE F 2 162 ? 9.953   78.599  75.171  1.00 26.07 ? 351  ILE B CB    1 
ATOM   4936  C  CG1   . ILE F 2 162 ? 8.483   78.175  75.317  1.00 26.10 ? 351  ILE B CG1   1 
ATOM   4937  C  CG2   . ILE F 2 162 ? 10.164  79.556  74.024  1.00 25.82 ? 351  ILE B CG2   1 
ATOM   4938  C  CD1   . ILE F 2 162 ? 7.535   79.290  75.731  1.00 24.83 ? 351  ILE B CD1   1 
ATOM   4939  N  N     . VAL F 2 163 ? 9.484   75.705  73.847  1.00 27.28 ? 352  VAL B N     1 
ATOM   4940  C  CA    . VAL F 2 163 ? 9.049   74.930  72.708  1.00 27.79 ? 352  VAL B CA    1 
ATOM   4941  C  C     . VAL F 2 163 ? 7.531   74.657  72.812  1.00 26.88 ? 352  VAL B C     1 
ATOM   4942  O  O     . VAL F 2 163 ? 7.059   74.061  73.795  1.00 28.23 ? 352  VAL B O     1 
ATOM   4943  C  CB    . VAL F 2 163 ? 9.945   73.651  72.671  1.00 29.30 ? 352  VAL B CB    1 
ATOM   4944  C  CG1   . VAL F 2 163 ? 9.134   72.394  72.704  1.00 30.59 ? 352  VAL B CG1   1 
ATOM   4945  C  CG2   . VAL F 2 163 ? 10.859  73.716  71.480  1.00 28.88 ? 352  VAL B CG2   1 
ATOM   4946  N  N     . TYR F 2 164 ? 6.768   75.146  71.833  1.00 24.84 ? 353  TYR B N     1 
ATOM   4947  C  CA    . TYR F 2 164 ? 5.311   74.959  71.820  1.00 23.58 ? 353  TYR B CA    1 
ATOM   4948  C  C     . TYR F 2 164 ? 4.680   75.075  70.419  1.00 23.09 ? 353  TYR B C     1 
ATOM   4949  O  O     . TYR F 2 164 ? 5.263   75.656  69.501  1.00 22.95 ? 353  TYR B O     1 
ATOM   4950  C  CB    . TYR F 2 164 ? 4.640   75.938  72.795  1.00 23.87 ? 353  TYR B CB    1 
ATOM   4951  C  CG    . TYR F 2 164 ? 4.706   77.388  72.382  1.00 23.91 ? 353  TYR B CG    1 
ATOM   4952  C  CD1   . TYR F 2 164 ? 3.597   78.028  71.844  1.00 23.74 ? 353  TYR B CD1   1 
ATOM   4953  C  CD2   . TYR F 2 164 ? 5.882   78.122  72.535  1.00 26.33 ? 353  TYR B CD2   1 
ATOM   4954  C  CE1   . TYR F 2 164 ? 3.651   79.360  71.468  1.00 25.43 ? 353  TYR B CE1   1 
ATOM   4955  C  CE2   . TYR F 2 164 ? 5.947   79.468  72.162  1.00 25.63 ? 353  TYR B CE2   1 
ATOM   4956  C  CZ    . TYR F 2 164 ? 4.828   80.074  71.633  1.00 25.57 ? 353  TYR B CZ    1 
ATOM   4957  O  OH    . TYR F 2 164 ? 4.875   81.400  71.293  1.00 26.86 ? 353  TYR B OH    1 
ATOM   4958  N  N     . GLY F 2 165 ? 3.485   74.509  70.269  1.00 23.26 ? 354  GLY B N     1 
ATOM   4959  C  CA    . GLY F 2 165 ? 2.790   74.490  68.987  1.00 23.89 ? 354  GLY B CA    1 
ATOM   4960  C  C     . GLY F 2 165 ? 2.246   75.793  68.434  1.00 25.12 ? 354  GLY B C     1 
ATOM   4961  O  O     . GLY F 2 165 ? 2.174   76.806  69.136  1.00 26.65 ? 354  GLY B O     1 
ATOM   4962  N  N     . GLY F 2 166 ? 1.869   75.771  67.158  1.00 26.38 ? 355  GLY B N     1 
ATOM   4963  C  CA    . GLY F 2 166 ? 1.333   76.964  66.520  1.00 27.87 ? 355  GLY B CA    1 
ATOM   4964  C  C     . GLY F 2 166 ? 2.413   77.948  66.105  1.00 28.68 ? 355  GLY B C     1 
ATOM   4965  O  O     . GLY F 2 166 ? 2.143   79.117  65.843  1.00 30.25 ? 355  GLY B O     1 
ATOM   4966  N  N     . THR F 2 167 ? 3.646   77.473  66.040  1.00 29.19 ? 356  THR B N     1 
ATOM   4967  C  CA    . THR F 2 167 ? 4.764   78.325  65.669  1.00 30.59 ? 356  THR B CA    1 
ATOM   4968  C  C     . THR F 2 167 ? 5.670   77.633  64.655  1.00 30.71 ? 356  THR B C     1 
ATOM   4969  O  O     . THR F 2 167 ? 5.541   76.444  64.371  1.00 30.69 ? 356  THR B O     1 
ATOM   4970  C  CB    . THR F 2 167 ? 5.654   78.647  66.887  1.00 30.88 ? 356  THR B CB    1 
ATOM   4971  O  OG1   . THR F 2 167 ? 6.161   77.419  67.420  1.00 33.67 ? 356  THR B OG1   1 
ATOM   4972  C  CG2   . THR F 2 167 ? 4.875   79.349  67.969  1.00 31.07 ? 356  THR B CG2   1 
ATOM   4973  N  N     . SER F 2 168 ? 6.591   78.404  64.105  1.00 30.70 ? 357  SER B N     1 
ATOM   4974  C  CA    . SER F 2 168 ? 7.563   77.864  63.182  1.00 30.83 ? 357  SER B CA    1 
ATOM   4975  C  C     . SER F 2 168 ? 8.480   76.910  63.964  1.00 30.94 ? 357  SER B C     1 
ATOM   4976  O  O     . SER F 2 168 ? 9.185   77.328  64.890  1.00 30.52 ? 357  SER B O     1 
ATOM   4977  C  CB    . SER F 2 168 ? 8.392   79.003  62.587  1.00 29.57 ? 357  SER B CB    1 
ATOM   4978  O  OG    . SER F 2 168 ? 9.639   78.522  62.145  1.00 30.75 ? 357  SER B OG    1 
ATOM   4979  N  N     . PHE F 2 169 ? 8.448   75.629  63.608  1.00 31.68 ? 358  PHE B N     1 
ATOM   4980  C  CA    . PHE F 2 169 ? 9.297   74.636  64.254  1.00 31.84 ? 358  PHE B CA    1 
ATOM   4981  C  C     . PHE F 2 169 ? 10.751  75.044  63.997  1.00 33.91 ? 358  PHE B C     1 
ATOM   4982  O  O     . PHE F 2 169 ? 11.589  74.978  64.887  1.00 33.83 ? 358  PHE B O     1 
ATOM   4983  C  CB    . PHE F 2 169 ? 9.044   73.246  63.651  1.00 30.68 ? 358  PHE B CB    1 
ATOM   4984  C  CG    . PHE F 2 169 ? 9.867   72.147  64.277  1.00 29.11 ? 358  PHE B CG    1 
ATOM   4985  C  CD1   . PHE F 2 169 ? 9.335   71.346  65.283  1.00 27.41 ? 358  PHE B CD1   1 
ATOM   4986  C  CD2   . PHE F 2 169 ? 11.192  71.937  63.881  1.00 28.68 ? 358  PHE B CD2   1 
ATOM   4987  C  CE1   . PHE F 2 169 ? 10.114  70.341  65.893  1.00 28.24 ? 358  PHE B CE1   1 
ATOM   4988  C  CE2   . PHE F 2 169 ? 11.978  70.945  64.480  1.00 28.66 ? 358  PHE B CE2   1 
ATOM   4989  C  CZ    . PHE F 2 169 ? 11.441  70.142  65.488  1.00 27.91 ? 358  PHE B CZ    1 
ATOM   4990  N  N     . ARG F 2 170 ? 11.034  75.479  62.770  1.00 36.19 ? 359  ARG B N     1 
ATOM   4991  C  CA    . ARG F 2 170 ? 12.386  75.878  62.385  1.00 38.37 ? 359  ARG B CA    1 
ATOM   4992  C  C     . ARG F 2 170 ? 12.903  77.008  63.273  1.00 38.37 ? 359  ARG B C     1 
ATOM   4993  O  O     . ARG F 2 170 ? 14.029  76.959  63.752  1.00 38.61 ? 359  ARG B O     1 
ATOM   4994  C  CB    . ARG F 2 170 ? 12.420  76.286  60.901  1.00 40.38 ? 359  ARG B CB    1 
ATOM   4995  C  CG    . ARG F 2 170 ? 13.816  76.619  60.379  1.00 45.35 ? 359  ARG B CG    1 
ATOM   4996  C  CD    . ARG F 2 170 ? 13.902  76.705  58.836  1.00 48.54 ? 359  ARG B CD    1 
ATOM   4997  N  NE    . ARG F 2 170 ? 14.604  77.921  58.405  1.00 52.82 ? 359  ARG B NE    1 
ATOM   4998  C  CZ    . ARG F 2 170 ? 15.092  78.144  57.179  1.00 54.74 ? 359  ARG B CZ    1 
ATOM   4999  N  NH1   . ARG F 2 170 ? 14.974  77.229  56.220  1.00 55.33 ? 359  ARG B NH1   1 
ATOM   5000  N  NH2   . ARG F 2 170 ? 15.692  79.299  56.905  1.00 54.98 ? 359  ARG B NH2   1 
ATOM   5001  N  N     . HIS F 2 171 ? 12.087  78.019  63.515  1.00 37.95 ? 360  HIS B N     1 
ATOM   5002  C  CA    . HIS F 2 171 ? 12.527  79.111  64.363  1.00 38.46 ? 360  HIS B CA    1 
ATOM   5003  C  C     . HIS F 2 171 ? 12.782  78.625  65.802  1.00 38.19 ? 360  HIS B C     1 
ATOM   5004  O  O     . HIS F 2 171 ? 13.743  79.048  66.455  1.00 38.50 ? 360  HIS B O     1 
ATOM   5005  C  CB    . HIS F 2 171 ? 11.483  80.227  64.366  1.00 40.00 ? 360  HIS B CB    1 
ATOM   5006  C  CG    . HIS F 2 171 ? 11.731  81.277  65.401  1.00 43.04 ? 360  HIS B CG    1 
ATOM   5007  N  ND1   . HIS F 2 171 ? 12.712  82.238  65.268  1.00 44.33 ? 360  HIS B ND1   1 
ATOM   5008  C  CD2   . HIS F 2 171 ? 11.157  81.490  66.610  1.00 43.96 ? 360  HIS B CD2   1 
ATOM   5009  C  CE1   . HIS F 2 171 ? 12.730  82.999  66.350  1.00 44.67 ? 360  HIS B CE1   1 
ATOM   5010  N  NE2   . HIS F 2 171 ? 11.796  82.566  67.179  1.00 45.61 ? 360  HIS B NE2   1 
ATOM   5011  N  N     . GLN F 2 172 ? 11.933  77.735  66.305  1.00 36.94 ? 361  GLN B N     1 
ATOM   5012  C  CA    . GLN F 2 172 ? 12.125  77.243  67.663  1.00 35.67 ? 361  GLN B CA    1 
ATOM   5013  C  C     . GLN F 2 172 ? 13.364  76.357  67.737  1.00 35.24 ? 361  GLN B C     1 
ATOM   5014  O  O     . GLN F 2 172 ? 14.098  76.385  68.722  1.00 35.01 ? 361  GLN B O     1 
ATOM   5015  C  CB    . GLN F 2 172 ? 10.892  76.460  68.159  1.00 34.88 ? 361  GLN B CB    1 
ATOM   5016  C  CG    . GLN F 2 172 ? 9.627   77.301  68.348  1.00 33.75 ? 361  GLN B CG    1 
ATOM   5017  C  CD    . GLN F 2 172 ? 8.651   76.691  69.341  1.00 32.15 ? 361  GLN B CD    1 
ATOM   5018  O  OE1   . GLN F 2 172 ? 8.507   75.474  69.429  1.00 30.46 ? 361  GLN B OE1   1 
ATOM   5019  N  NE2   . GLN F 2 172 ? 7.964   77.543  70.084  1.00 31.60 ? 361  GLN B NE2   1 
ATOM   5020  N  N     . ASN F 2 173 ? 13.595  75.565  66.698  1.00 35.16 ? 362  ASN B N     1 
ATOM   5021  C  CA    . ASN F 2 173 ? 14.754  74.684  66.677  1.00 35.28 ? 362  ASN B CA    1 
ATOM   5022  C  C     . ASN F 2 173 ? 16.053  75.512  66.649  1.00 36.54 ? 362  ASN B C     1 
ATOM   5023  O  O     . ASN F 2 173 ? 17.035  75.153  67.285  1.00 36.28 ? 362  ASN B O     1 
ATOM   5024  C  CB    . ASN F 2 173 ? 14.660  73.744  65.472  1.00 34.54 ? 362  ASN B CB    1 
ATOM   5025  C  CG    . ASN F 2 173 ? 15.676  72.622  65.526  1.00 35.23 ? 362  ASN B CG    1 
ATOM   5026  O  OD1   . ASN F 2 173 ? 15.976  72.109  66.598  1.00 37.67 ? 362  ASN B OD1   1 
ATOM   5027  N  ND2   . ASN F 2 173 ? 16.200  72.227  64.374  1.00 34.00 ? 362  ASN B ND2   1 
ATOM   5028  N  N     . GLU F 2 174 ? 16.059  76.626  65.927  1.00 38.37 ? 363  GLU B N     1 
ATOM   5029  C  CA    . GLU F 2 174 ? 17.252  77.465  65.883  1.00 41.69 ? 363  GLU B CA    1 
ATOM   5030  C  C     . GLU F 2 174 ? 17.605  77.905  67.303  1.00 41.81 ? 363  GLU B C     1 
ATOM   5031  O  O     . GLU F 2 174 ? 18.756  77.830  67.731  1.00 42.34 ? 363  GLU B O     1 
ATOM   5032  C  CB    . GLU F 2 174 ? 17.018  78.716  65.019  1.00 43.69 ? 363  GLU B CB    1 
ATOM   5033  C  CG    . GLU F 2 174 ? 16.591  78.432  63.581  1.00 46.50 ? 363  GLU B CG    1 
ATOM   5034  C  CD    . GLU F 2 174 ? 16.313  79.704  62.781  1.00 48.57 ? 363  GLU B CD    1 
ATOM   5035  O  OE1   . GLU F 2 174 ? 15.790  80.680  63.370  1.00 50.32 ? 363  GLU B OE1   1 
ATOM   5036  O  OE2   . GLU F 2 174 ? 16.600  79.722  61.560  1.00 49.90 ? 363  GLU B OE2   1 
ATOM   5037  N  N     . CYS F 2 175 ? 16.601  78.356  68.039  1.00 42.23 ? 364  CYS B N     1 
ATOM   5038  C  CA    . CYS F 2 175 ? 16.818  78.825  69.399  1.00 42.56 ? 364  CYS B CA    1 
ATOM   5039  C  C     . CYS F 2 175 ? 17.305  77.699  70.306  1.00 41.54 ? 364  CYS B C     1 
ATOM   5040  O  O     . CYS F 2 175 ? 18.144  77.921  71.176  1.00 42.26 ? 364  CYS B O     1 
ATOM   5041  C  CB    . CYS F 2 175 ? 15.525  79.467  69.925  1.00 43.91 ? 364  CYS B CB    1 
ATOM   5042  S  SG    . CYS F 2 175 ? 14.838  80.769  68.779  1.00 49.07 ? 364  CYS B SG    1 
ATOM   5043  N  N     . ILE F 2 176 ? 16.801  76.487  70.092  1.00 40.59 ? 365  ILE B N     1 
ATOM   5044  C  CA    . ILE F 2 176 ? 17.212  75.333  70.889  1.00 39.45 ? 365  ILE B CA    1 
ATOM   5045  C  C     . ILE F 2 176 ? 18.649  74.951  70.545  1.00 39.66 ? 365  ILE B C     1 
ATOM   5046  O  O     . ILE F 2 176 ? 19.481  74.752  71.423  1.00 39.37 ? 365  ILE B O     1 
ATOM   5047  C  CB    . ILE F 2 176 ? 16.297  74.099  70.617  1.00 39.58 ? 365  ILE B CB    1 
ATOM   5048  C  CG1   . ILE F 2 176 ? 14.983  74.232  71.391  1.00 40.22 ? 365  ILE B CG1   1 
ATOM   5049  C  CG2   . ILE F 2 176 ? 17.006  72.802  71.011  1.00 39.62 ? 365  ILE B CG2   1 
ATOM   5050  C  CD1   . ILE F 2 176 ? 15.138  74.169  72.913  1.00 39.43 ? 365  ILE B CD1   1 
ATOM   5051  N  N     . THR F 2 177 ? 18.921  74.847  69.250  1.00 39.08 ? 366  THR B N     1 
ATOM   5052  C  CA    . THR F 2 177 ? 20.229  74.472  68.744  1.00 38.53 ? 366  THR B CA    1 
ATOM   5053  C  C     . THR F 2 177 ? 21.408  75.216  69.382  1.00 38.63 ? 366  THR B C     1 
ATOM   5054  O  O     . THR F 2 177 ? 22.501  74.662  69.505  1.00 37.27 ? 366  THR B O     1 
ATOM   5055  C  CB    . THR F 2 177 ? 20.258  74.652  67.226  1.00 38.75 ? 366  THR B CB    1 
ATOM   5056  O  OG1   . THR F 2 177 ? 19.348  73.710  66.631  1.00 38.79 ? 366  THR B OG1   1 
ATOM   5057  C  CG2   . THR F 2 177 ? 21.667  74.444  66.682  1.00 38.65 ? 366  THR B CG2   1 
ATOM   5058  N  N     . ARG F 2 178 ? 21.188  76.462  69.784  1.00 38.59 ? 367  ARG B N     1 
ATOM   5059  C  CA    . ARG F 2 178 ? 22.234  77.232  70.422  1.00 39.15 ? 367  ARG B CA    1 
ATOM   5060  C  C     . ARG F 2 178 ? 22.519  76.643  71.791  1.00 38.53 ? 367  ARG B C     1 
ATOM   5061  O  O     . ARG F 2 178 ? 23.502  77.001  72.442  1.00 39.67 ? 367  ARG B O     1 
ATOM   5062  C  CB    . ARG F 2 178 ? 21.806  78.678  70.597  1.00 41.00 ? 367  ARG B CB    1 
ATOM   5063  C  CG    . ARG F 2 178 ? 21.480  79.385  69.307  1.00 45.48 ? 367  ARG B CG    1 
ATOM   5064  C  CD    . ARG F 2 178 ? 20.933  80.759  69.616  1.00 48.51 ? 367  ARG B CD    1 
ATOM   5065  N  NE    . ARG F 2 178 ? 20.250  81.332  68.465  1.00 51.27 ? 367  ARG B NE    1 
ATOM   5066  C  CZ    . ARG F 2 178 ? 19.077  81.951  68.533  1.00 52.18 ? 367  ARG B CZ    1 
ATOM   5067  N  NH1   . ARG F 2 178 ? 18.454  82.078  69.702  1.00 52.10 ? 367  ARG B NH1   1 
ATOM   5068  N  NH2   . ARG F 2 178 ? 18.525  82.434  67.428  1.00 53.76 ? 367  ARG B NH2   1 
ATOM   5069  N  N     . GLY F 2 179 ? 21.652  75.744  72.235  1.00 37.04 ? 368  GLY B N     1 
ATOM   5070  C  CA    . GLY F 2 179 ? 21.841  75.133  73.536  1.00 35.96 ? 368  GLY B CA    1 
ATOM   5071  C  C     . GLY F 2 179 ? 21.041  75.810  74.638  1.00 34.96 ? 368  GLY B C     1 
ATOM   5072  O  O     . GLY F 2 179 ? 21.117  77.018  74.849  1.00 35.21 ? 368  GLY B O     1 
ATOM   5073  N  N     . CYS F 2 180 ? 20.266  75.014  75.350  1.00 34.38 ? 369  CYS B N     1 
ATOM   5074  C  CA    . CYS F 2 180 ? 19.456  75.519  76.436  1.00 34.14 ? 369  CYS B CA    1 
ATOM   5075  C  C     . CYS F 2 180 ? 19.676  74.657  77.655  1.00 31.57 ? 369  CYS B C     1 
ATOM   5076  O  O     . CYS F 2 180 ? 19.745  73.436  77.556  1.00 30.96 ? 369  CYS B O     1 
ATOM   5077  C  CB    . CYS F 2 180 ? 17.977  75.506  76.039  1.00 36.76 ? 369  CYS B CB    1 
ATOM   5078  S  SG    . CYS F 2 180 ? 17.618  76.709  74.704  1.00 46.53 ? 369  CYS B SG    1 
ATOM   5079  N  N     . HIS F 2 181 ? 19.811  75.314  78.797  1.00 29.35 ? 370  HIS B N     1 
ATOM   5080  C  CA    . HIS F 2 181 ? 19.991  74.642  80.071  1.00 27.74 ? 370  HIS B CA    1 
ATOM   5081  C  C     . HIS F 2 181 ? 18.599  74.223  80.530  1.00 26.27 ? 370  HIS B C     1 
ATOM   5082  O  O     . HIS F 2 181 ? 18.400  73.152  81.115  1.00 25.44 ? 370  HIS B O     1 
ATOM   5083  C  CB    . HIS F 2 181 ? 20.536  75.617  81.116  1.00 28.13 ? 370  HIS B CB    1 
ATOM   5084  C  CG    . HIS F 2 181 ? 21.960  76.012  80.910  1.00 29.21 ? 370  HIS B CG    1 
ATOM   5085  N  ND1   . HIS F 2 181 ? 23.016  75.247  81.359  1.00 29.82 ? 370  HIS B ND1   1 
ATOM   5086  C  CD2   . HIS F 2 181 ? 22.504  77.115  80.345  1.00 29.00 ? 370  HIS B CD2   1 
ATOM   5087  C  CE1   . HIS F 2 181 ? 24.150  75.865  81.082  1.00 30.28 ? 370  HIS B CE1   1 
ATOM   5088  N  NE2   . HIS F 2 181 ? 23.867  76.999  80.467  1.00 30.14 ? 370  HIS B NE2   1 
ATOM   5089  N  N     . VAL F 2 182 ? 17.650  75.119  80.275  1.00 24.28 ? 371  VAL B N     1 
ATOM   5090  C  CA    . VAL F 2 182 ? 16.270  74.940  80.664  1.00 23.32 ? 371  VAL B CA    1 
ATOM   5091  C  C     . VAL F 2 182 ? 15.328  75.075  79.476  1.00 23.63 ? 371  VAL B C     1 
ATOM   5092  O  O     . VAL F 2 182 ? 15.411  76.042  78.720  1.00 24.27 ? 371  VAL B O     1 
ATOM   5093  C  CB    . VAL F 2 182 ? 15.877  75.998  81.736  1.00 21.48 ? 371  VAL B CB    1 
ATOM   5094  C  CG1   . VAL F 2 182 ? 14.441  75.808  82.172  1.00 20.22 ? 371  VAL B CG1   1 
ATOM   5095  C  CG2   . VAL F 2 182 ? 16.804  75.907  82.930  1.00 20.22 ? 371  VAL B CG2   1 
ATOM   5096  N  N     . VAL F 2 183 ? 14.434  74.105  79.315  1.00 23.05 ? 372  VAL B N     1 
ATOM   5097  C  CA    . VAL F 2 183 ? 13.451  74.159  78.239  1.00 23.38 ? 372  VAL B CA    1 
ATOM   5098  C  C     . VAL F 2 183 ? 12.041  74.055  78.815  1.00 22.95 ? 372  VAL B C     1 
ATOM   5099  O  O     . VAL F 2 183 ? 11.720  73.112  79.552  1.00 23.75 ? 372  VAL B O     1 
ATOM   5100  C  CB    . VAL F 2 183 ? 13.633  73.008  77.212  1.00 23.82 ? 372  VAL B CB    1 
ATOM   5101  C  CG1   . VAL F 2 183 ? 12.612  73.162  76.063  1.00 24.26 ? 372  VAL B CG1   1 
ATOM   5102  C  CG2   . VAL F 2 183 ? 15.022  73.040  76.643  1.00 22.94 ? 372  VAL B CG2   1 
ATOM   5103  N  N     . ILE F 2 184 ? 11.209  75.039  78.498  1.00 21.92 ? 373  ILE B N     1 
ATOM   5104  C  CA    . ILE F 2 184 ? 9.830   75.048  78.945  1.00 20.72 ? 373  ILE B CA    1 
ATOM   5105  C  C     . ILE F 2 184 ? 9.064   74.522  77.731  1.00 20.75 ? 373  ILE B C     1 
ATOM   5106  O  O     . ILE F 2 184 ? 9.431   74.829  76.602  1.00 19.94 ? 373  ILE B O     1 
ATOM   5107  C  CB    . ILE F 2 184 ? 9.360   76.487  79.312  1.00 21.44 ? 373  ILE B CB    1 
ATOM   5108  C  CG1   . ILE F 2 184 ? 10.009  76.971  80.626  1.00 22.21 ? 373  ILE B CG1   1 
ATOM   5109  C  CG2   . ILE F 2 184 ? 7.863   76.482  79.559  1.00 21.78 ? 373  ILE B CG2   1 
ATOM   5110  C  CD1   . ILE F 2 184 ? 11.489  76.971  80.654  1.00 23.89 ? 373  ILE B CD1   1 
ATOM   5111  N  N     . ALA F 2 185 ? 8.006   73.745  77.943  1.00 20.39 ? 374  ALA B N     1 
ATOM   5112  C  CA    . ALA F 2 185 ? 7.302   73.191  76.799  1.00 20.81 ? 374  ALA B CA    1 
ATOM   5113  C  C     . ALA F 2 185 ? 5.914   72.618  77.027  1.00 20.23 ? 374  ALA B C     1 
ATOM   5114  O  O     . ALA F 2 185 ? 5.525   72.314  78.159  1.00 20.28 ? 374  ALA B O     1 
ATOM   5115  C  CB    . ALA F 2 185 ? 8.174   72.105  76.160  1.00 19.53 ? 374  ALA B CB    1 
ATOM   5116  N  N     . THR F 2 186 ? 5.179   72.488  75.923  1.00 18.98 ? 375  THR B N     1 
ATOM   5117  C  CA    . THR F 2 186 ? 3.864   71.857  75.917  1.00 20.06 ? 375  THR B CA    1 
ATOM   5118  C  C     . THR F 2 186 ? 4.190   70.447  75.374  1.00 20.24 ? 375  THR B C     1 
ATOM   5119  O  O     . THR F 2 186 ? 5.066   70.281  74.541  1.00 19.77 ? 375  THR B O     1 
ATOM   5120  C  CB    . THR F 2 186 ? 2.880   72.612  75.031  1.00 19.22 ? 375  THR B CB    1 
ATOM   5121  O  OG1   . THR F 2 186 ? 3.556   73.084  73.869  1.00 20.71 ? 375  THR B OG1   1 
ATOM   5122  C  CG2   . THR F 2 186 ? 2.299   73.810  75.799  1.00 19.69 ? 375  THR B CG2   1 
ATOM   5123  N  N     . PRO F 2 187 ? 3.495   69.416  75.850  1.00 20.28 ? 376  PRO B N     1 
ATOM   5124  C  CA    . PRO F 2 187 ? 3.812   68.065  75.378  1.00 21.25 ? 376  PRO B CA    1 
ATOM   5125  C  C     . PRO F 2 187 ? 3.981   67.804  73.885  1.00 21.42 ? 376  PRO B C     1 
ATOM   5126  O  O     . PRO F 2 187 ? 4.988   67.240  73.485  1.00 21.63 ? 376  PRO B O     1 
ATOM   5127  C  CB    . PRO F 2 187 ? 2.714   67.208  76.017  1.00 21.35 ? 376  PRO B CB    1 
ATOM   5128  C  CG    . PRO F 2 187 ? 2.327   68.003  77.246  1.00 21.19 ? 376  PRO B CG    1 
ATOM   5129  C  CD    . PRO F 2 187 ? 2.291   69.408  76.693  1.00 19.93 ? 376  PRO B CD    1 
ATOM   5130  N  N     . GLY F 2 188 ? 3.008   68.206  73.069  1.00 21.71 ? 377  GLY B N     1 
ATOM   5131  C  CA    . GLY F 2 188 ? 3.101   67.969  71.642  1.00 22.48 ? 377  GLY B CA    1 
ATOM   5132  C  C     . GLY F 2 188 ? 4.376   68.395  70.920  1.00 23.66 ? 377  GLY B C     1 
ATOM   5133  O  O     . GLY F 2 188 ? 5.063   67.566  70.305  1.00 24.55 ? 377  GLY B O     1 
ATOM   5134  N  N     . ARG F 2 189 ? 4.702   69.682  70.971  1.00 24.16 ? 378  ARG B N     1 
ATOM   5135  C  CA    . ARG F 2 189 ? 5.880   70.171  70.281  1.00 24.47 ? 378  ARG B CA    1 
ATOM   5136  C  C     . ARG F 2 189 ? 7.158   69.557  70.831  1.00 25.87 ? 378  ARG B C     1 
ATOM   5137  O  O     . ARG F 2 189 ? 8.091   69.309  70.083  1.00 25.62 ? 378  ARG B O     1 
ATOM   5138  C  CB    . ARG F 2 189 ? 5.971   71.688  70.373  1.00 25.64 ? 378  ARG B CB    1 
ATOM   5139  C  CG    . ARG F 2 189 ? 7.053   72.242  69.478  1.00 26.38 ? 378  ARG B CG    1 
ATOM   5140  C  CD    . ARG F 2 189 ? 6.650   72.109  68.012  1.00 28.33 ? 378  ARG B CD    1 
ATOM   5141  N  NE    . ARG F 2 189 ? 6.890   73.403  67.415  1.00 32.55 ? 378  ARG B NE    1 
ATOM   5142  C  CZ    . ARG F 2 189 ? 6.080   74.023  66.576  1.00 33.60 ? 378  ARG B CZ    1 
ATOM   5143  N  NH1   . ARG F 2 189 ? 4.944   73.471  66.187  1.00 31.93 ? 378  ARG B NH1   1 
ATOM   5144  N  NH2   . ARG F 2 189 ? 6.396   75.247  66.183  1.00 36.49 ? 378  ARG B NH2   1 
ATOM   5145  N  N     . LEU F 2 190 ? 7.201   69.330  72.142  1.00 25.89 ? 379  LEU B N     1 
ATOM   5146  C  CA    . LEU F 2 190 ? 8.367   68.711  72.756  1.00 25.62 ? 379  LEU B CA    1 
ATOM   5147  C  C     . LEU F 2 190 ? 8.562   67.328  72.127  1.00 26.38 ? 379  LEU B C     1 
ATOM   5148  O  O     . LEU F 2 190 ? 9.658   66.978  71.665  1.00 25.68 ? 379  LEU B O     1 
ATOM   5149  C  CB    . LEU F 2 190 ? 8.159   68.554  74.273  1.00 24.15 ? 379  LEU B CB    1 
ATOM   5150  C  CG    . LEU F 2 190 ? 9.308   67.863  75.021  1.00 24.51 ? 379  LEU B CG    1 
ATOM   5151  C  CD1   . LEU F 2 190 ? 10.582  68.662  74.862  1.00 22.71 ? 379  LEU B CD1   1 
ATOM   5152  C  CD2   . LEU F 2 190 ? 8.968   67.708  76.484  1.00 22.80 ? 379  LEU B CD2   1 
ATOM   5153  N  N     . LEU F 2 191 ? 7.492   66.542  72.099  1.00 26.68 ? 380  LEU B N     1 
ATOM   5154  C  CA    . LEU F 2 191 ? 7.572   65.195  71.540  1.00 28.05 ? 380  LEU B CA    1 
ATOM   5155  C  C     . LEU F 2 191 ? 7.967   65.201  70.059  1.00 27.92 ? 380  LEU B C     1 
ATOM   5156  O  O     . LEU F 2 191 ? 8.542   64.237  69.540  1.00 26.99 ? 380  LEU B O     1 
ATOM   5157  C  CB    . LEU F 2 191 ? 6.237   64.470  71.749  1.00 28.58 ? 380  LEU B CB    1 
ATOM   5158  C  CG    . LEU F 2 191 ? 6.156   63.328  72.781  1.00 29.39 ? 380  LEU B CG    1 
ATOM   5159  C  CD1   . LEU F 2 191 ? 7.445   63.182  73.548  1.00 29.46 ? 380  LEU B CD1   1 
ATOM   5160  C  CD2   . LEU F 2 191 ? 4.989   63.574  73.720  1.00 28.91 ? 380  LEU B CD2   1 
ATOM   5161  N  N     . ASP F 2 192 ? 7.672   66.302  69.382  1.00 28.41 ? 381  ASP B N     1 
ATOM   5162  C  CA    . ASP F 2 192 ? 8.023   66.426  67.976  1.00 28.94 ? 381  ASP B CA    1 
ATOM   5163  C  C     . ASP F 2 192 ? 9.546   66.586  67.888  1.00 28.47 ? 381  ASP B C     1 
ATOM   5164  O  O     . ASP F 2 192 ? 10.187  66.011  67.023  1.00 28.55 ? 381  ASP B O     1 
ATOM   5165  C  CB    . ASP F 2 192 ? 7.298   67.630  67.372  1.00 30.16 ? 381  ASP B CB    1 
ATOM   5166  C  CG    . ASP F 2 192 ? 7.492   67.740  65.889  1.00 32.55 ? 381  ASP B CG    1 
ATOM   5167  O  OD1   . ASP F 2 192 ? 8.005   66.777  65.282  1.00 35.90 ? 381  ASP B OD1   1 
ATOM   5168  O  OD2   . ASP F 2 192 ? 7.122   68.784  65.320  1.00 34.06 ? 381  ASP B OD2   1 
ATOM   5169  N  N     . PHE F 2 193 ? 10.115  67.371  68.794  1.00 27.90 ? 382  PHE B N     1 
ATOM   5170  C  CA    . PHE F 2 193 ? 11.558  67.580  68.842  1.00 27.50 ? 382  PHE B CA    1 
ATOM   5171  C  C     . PHE F 2 193 ? 12.227  66.261  69.240  1.00 28.03 ? 382  PHE B C     1 
ATOM   5172  O  O     . PHE F 2 193 ? 13.282  65.902  68.721  1.00 28.33 ? 382  PHE B O     1 
ATOM   5173  C  CB    . PHE F 2 193 ? 11.902  68.653  69.884  1.00 26.03 ? 382  PHE B CB    1 
ATOM   5174  C  CG    . PHE F 2 193 ? 12.015  70.043  69.323  1.00 25.83 ? 382  PHE B CG    1 
ATOM   5175  C  CD1   . PHE F 2 193 ? 13.230  70.516  68.850  1.00 26.34 ? 382  PHE B CD1   1 
ATOM   5176  C  CD2   . PHE F 2 193 ? 10.911  70.876  69.273  1.00 24.72 ? 382  PHE B CD2   1 
ATOM   5177  C  CE1   . PHE F 2 193 ? 13.342  71.806  68.337  1.00 27.12 ? 382  PHE B CE1   1 
ATOM   5178  C  CE2   . PHE F 2 193 ? 11.004  72.155  68.765  1.00 25.79 ? 382  PHE B CE2   1 
ATOM   5179  C  CZ    . PHE F 2 193 ? 12.228  72.630  68.293  1.00 27.50 ? 382  PHE B CZ    1 
ATOM   5180  N  N     . VAL F 2 194 ? 11.600  65.543  70.165  1.00 27.85 ? 383  VAL B N     1 
ATOM   5181  C  CA    . VAL F 2 194 ? 12.137  64.284  70.638  1.00 28.47 ? 383  VAL B CA    1 
ATOM   5182  C  C     . VAL F 2 194 ? 12.126  63.229  69.545  1.00 30.93 ? 383  VAL B C     1 
ATOM   5183  O  O     . VAL F 2 194 ? 13.082  62.473  69.395  1.00 31.71 ? 383  VAL B O     1 
ATOM   5184  C  CB    . VAL F 2 194 ? 11.339  63.753  71.848  1.00 28.43 ? 383  VAL B CB    1 
ATOM   5185  C  CG1   . VAL F 2 194 ? 11.830  62.375  72.209  1.00 25.65 ? 383  VAL B CG1   1 
ATOM   5186  C  CG2   . VAL F 2 194 ? 11.475  64.709  73.044  1.00 24.79 ? 383  VAL B CG2   1 
ATOM   5187  N  N     . ASP F 2 195 ? 11.053  63.173  68.769  1.00 32.87 ? 384  ASP B N     1 
ATOM   5188  C  CA    . ASP F 2 195 ? 10.986  62.181  67.721  1.00 34.57 ? 384  ASP B CA    1 
ATOM   5189  C  C     . ASP F 2 195 ? 11.920  62.465  66.539  1.00 35.80 ? 384  ASP B C     1 
ATOM   5190  O  O     . ASP F 2 195 ? 12.305  61.536  65.829  1.00 36.21 ? 384  ASP B O     1 
ATOM   5191  C  CB    . ASP F 2 195 ? 9.539   61.989  67.265  1.00 36.17 ? 384  ASP B CB    1 
ATOM   5192  C  CG    . ASP F 2 195 ? 8.660   61.376  68.365  1.00 39.43 ? 384  ASP B CG    1 
ATOM   5193  O  OD1   . ASP F 2 195 ? 9.207   60.631  69.215  1.00 40.17 ? 384  ASP B OD1   1 
ATOM   5194  O  OD2   . ASP F 2 195 ? 7.426   61.629  68.380  1.00 41.39 ? 384  ASP B OD2   1 
ATOM   5195  N  N     . ARG F 2 196 ? 12.298  63.726  66.332  1.00 35.56 ? 385  ARG B N     1 
ATOM   5196  C  CA    . ARG F 2 196 ? 13.221  64.070  65.251  1.00 36.18 ? 385  ARG B CA    1 
ATOM   5197  C  C     . ARG F 2 196 ? 14.650  63.975  65.795  1.00 36.50 ? 385  ARG B C     1 
ATOM   5198  O  O     . ARG F 2 196 ? 15.616  64.240  65.080  1.00 36.86 ? 385  ARG B O     1 
ATOM   5199  C  CB    . ARG F 2 196 ? 12.970  65.494  64.744  1.00 37.61 ? 385  ARG B CB    1 
ATOM   5200  C  CG    . ARG F 2 196 ? 11.696  65.701  63.928  1.00 39.81 ? 385  ARG B CG    1 
ATOM   5201  C  CD    . ARG F 2 196 ? 11.080  67.050  64.269  1.00 43.90 ? 385  ARG B CD    1 
ATOM   5202  N  NE    . ARG F 2 196 ? 10.926  67.963  63.140  1.00 47.71 ? 385  ARG B NE    1 
ATOM   5203  C  CZ    . ARG F 2 196 ? 9.784   68.169  62.483  1.00 50.50 ? 385  ARG B CZ    1 
ATOM   5204  N  NH1   . ARG F 2 196 ? 8.677   67.523  62.831  1.00 52.01 ? 385  ARG B NH1   1 
ATOM   5205  N  NH2   . ARG F 2 196 ? 9.739   69.049  61.489  1.00 52.23 ? 385  ARG B NH2   1 
ATOM   5206  N  N     . THR F 2 197 ? 14.766  63.601  67.069  1.00 36.44 ? 386  THR B N     1 
ATOM   5207  C  CA    . THR F 2 197 ? 16.048  63.455  67.764  1.00 36.07 ? 386  THR B CA    1 
ATOM   5208  C  C     . THR F 2 197 ? 16.747  64.786  68.043  1.00 34.47 ? 386  THR B C     1 
ATOM   5209  O  O     . THR F 2 197 ? 17.941  64.822  68.256  1.00 36.31 ? 386  THR B O     1 
ATOM   5210  C  CB    . THR F 2 197 ? 17.023  62.545  66.970  1.00 37.89 ? 386  THR B CB    1 
ATOM   5211  O  OG1   . THR F 2 197 ? 16.356  61.332  66.594  1.00 40.01 ? 386  THR B OG1   1 
ATOM   5212  C  CG2   . THR F 2 197 ? 18.228  62.167  67.833  1.00 39.17 ? 386  THR B CG2   1 
ATOM   5213  N  N     . PHE F 2 198 ? 16.004  65.884  68.055  1.00 33.48 ? 387  PHE B N     1 
ATOM   5214  C  CA    . PHE F 2 198 ? 16.589  67.197  68.306  1.00 31.93 ? 387  PHE B CA    1 
ATOM   5215  C  C     . PHE F 2 198 ? 16.673  67.510  69.799  1.00 31.90 ? 387  PHE B C     1 
ATOM   5216  O  O     . PHE F 2 198 ? 17.372  68.435  70.218  1.00 33.19 ? 387  PHE B O     1 
ATOM   5217  C  CB    . PHE F 2 198 ? 15.775  68.262  67.580  1.00 31.77 ? 387  PHE B CB    1 
ATOM   5218  C  CG    . PHE F 2 198 ? 15.864  68.174  66.080  1.00 32.15 ? 387  PHE B CG    1 
ATOM   5219  C  CD1   . PHE F 2 198 ? 14.904  68.789  65.278  1.00 32.82 ? 387  PHE B CD1   1 
ATOM   5220  C  CD2   . PHE F 2 198 ? 16.927  67.498  65.464  1.00 31.81 ? 387  PHE B CD2   1 
ATOM   5221  C  CE1   . PHE F 2 198 ? 15.001  68.736  63.878  1.00 32.62 ? 387  PHE B CE1   1 
ATOM   5222  C  CE2   . PHE F 2 198 ? 17.037  67.437  64.078  1.00 31.74 ? 387  PHE B CE2   1 
ATOM   5223  C  CZ    . PHE F 2 198 ? 16.081  68.055  63.278  1.00 31.85 ? 387  PHE B CZ    1 
ATOM   5224  N  N     . ILE F 2 199 ? 15.942  66.754  70.605  1.00 29.68 ? 388  ILE B N     1 
ATOM   5225  C  CA    . ILE F 2 199 ? 15.997  66.937  72.042  1.00 28.65 ? 388  ILE B CA    1 
ATOM   5226  C  C     . ILE F 2 199 ? 16.037  65.543  72.608  1.00 28.71 ? 388  ILE B C     1 
ATOM   5227  O  O     . ILE F 2 199 ? 15.280  64.667  72.201  1.00 26.82 ? 388  ILE B O     1 
ATOM   5228  C  CB    . ILE F 2 199 ? 14.781  67.692  72.612  1.00 27.74 ? 388  ILE B CB    1 
ATOM   5229  C  CG1   . ILE F 2 199 ? 14.953  69.193  72.401  1.00 26.49 ? 388  ILE B CG1   1 
ATOM   5230  C  CG2   . ILE F 2 199 ? 14.635  67.410  74.094  1.00 26.98 ? 388  ILE B CG2   1 
ATOM   5231  C  CD1   . ILE F 2 199 ? 13.757  70.006  72.864  1.00 27.66 ? 388  ILE B CD1   1 
ATOM   5232  N  N     . THR F 2 200 ? 16.947  65.350  73.543  1.00 29.62 ? 389  THR B N     1 
ATOM   5233  C  CA    . THR F 2 200 ? 17.129  64.065  74.155  1.00 31.97 ? 389  THR B CA    1 
ATOM   5234  C  C     . THR F 2 200 ? 17.313  64.333  75.651  1.00 31.68 ? 389  THR B C     1 
ATOM   5235  O  O     . THR F 2 200 ? 17.641  65.461  76.044  1.00 31.50 ? 389  THR B O     1 
ATOM   5236  C  CB    . THR F 2 200 ? 18.323  63.367  73.469  1.00 33.21 ? 389  THR B CB    1 
ATOM   5237  O  OG1   . THR F 2 200 ? 18.473  62.049  73.983  1.00 38.21 ? 389  THR B OG1   1 
ATOM   5238  C  CG2   . THR F 2 200 ? 19.569  64.147  73.661  1.00 32.66 ? 389  THR B CG2   1 
ATOM   5239  N  N     . PHE F 2 201 ? 17.103  63.322  76.491  1.00 30.83 ? 390  PHE B N     1 
ATOM   5240  C  CA    . PHE F 2 201 ? 17.146  63.561  77.927  1.00 30.29 ? 390  PHE B CA    1 
ATOM   5241  C  C     . PHE F 2 201 ? 18.263  62.991  78.795  1.00 31.92 ? 390  PHE B C     1 
ATOM   5242  O  O     . PHE F 2 201 ? 18.086  62.879  80.002  1.00 32.31 ? 390  PHE B O     1 
ATOM   5243  C  CB    . PHE F 2 201 ? 15.798  63.139  78.539  1.00 29.04 ? 390  PHE B CB    1 
ATOM   5244  C  CG    . PHE F 2 201 ? 14.576  63.718  77.831  1.00 27.44 ? 390  PHE B CG    1 
ATOM   5245  C  CD1   . PHE F 2 201 ? 13.746  62.902  77.068  1.00 27.20 ? 390  PHE B CD1   1 
ATOM   5246  C  CD2   . PHE F 2 201 ? 14.263  65.072  77.932  1.00 26.38 ? 390  PHE B CD2   1 
ATOM   5247  C  CE1   . PHE F 2 201 ? 12.622  63.424  76.414  1.00 27.22 ? 390  PHE B CE1   1 
ATOM   5248  C  CE2   . PHE F 2 201 ? 13.149  65.603  77.289  1.00 26.64 ? 390  PHE B CE2   1 
ATOM   5249  C  CZ    . PHE F 2 201 ? 12.325  64.777  76.526  1.00 26.95 ? 390  PHE B CZ    1 
ATOM   5250  N  N     . GLU F 2 202 ? 19.417  62.653  78.238  1.00 33.35 ? 391  GLU B N     1 
ATOM   5251  C  CA    . GLU F 2 202 ? 20.451  62.098  79.102  1.00 34.86 ? 391  GLU B CA    1 
ATOM   5252  C  C     . GLU F 2 202 ? 21.050  63.081  80.117  1.00 34.33 ? 391  GLU B C     1 
ATOM   5253  O  O     . GLU F 2 202 ? 21.609  62.655  81.139  1.00 34.30 ? 391  GLU B O     1 
ATOM   5254  C  CB    . GLU F 2 202 ? 21.570  61.421  78.279  1.00 37.66 ? 391  GLU B CB    1 
ATOM   5255  C  CG    . GLU F 2 202 ? 21.963  62.105  76.996  1.00 42.93 ? 391  GLU B CG    1 
ATOM   5256  C  CD    . GLU F 2 202 ? 21.036  61.762  75.842  1.00 45.49 ? 391  GLU B CD    1 
ATOM   5257  O  OE1   . GLU F 2 202 ? 21.167  60.662  75.259  1.00 46.83 ? 391  GLU B OE1   1 
ATOM   5258  O  OE2   . GLU F 2 202 ? 20.166  62.596  75.528  1.00 46.49 ? 391  GLU B OE2   1 
ATOM   5259  N  N     . ASP F 2 203 ? 20.937  64.384  79.869  1.00 32.58 ? 392  ASP B N     1 
ATOM   5260  C  CA    . ASP F 2 203 ? 21.487  65.354  80.821  1.00 31.74 ? 392  ASP B CA    1 
ATOM   5261  C  C     . ASP F 2 203 ? 20.403  66.028  81.667  1.00 29.71 ? 392  ASP B C     1 
ATOM   5262  O  O     . ASP F 2 203 ? 20.684  66.966  82.405  1.00 28.37 ? 392  ASP B O     1 
ATOM   5263  C  CB    . ASP F 2 203 ? 22.307  66.449  80.106  1.00 32.93 ? 392  ASP B CB    1 
ATOM   5264  C  CG    . ASP F 2 203 ? 23.592  65.914  79.459  1.00 36.84 ? 392  ASP B CG    1 
ATOM   5265  O  OD1   . ASP F 2 203 ? 24.147  64.896  79.952  1.00 36.52 ? 392  ASP B OD1   1 
ATOM   5266  O  OD2   . ASP F 2 203 ? 24.060  66.531  78.461  1.00 36.93 ? 392  ASP B OD2   1 
ATOM   5267  N  N     . THR F 2 204 ? 19.170  65.545  81.568  1.00 28.65 ? 393  THR B N     1 
ATOM   5268  C  CA    . THR F 2 204 ? 18.062  66.143  82.311  1.00 27.97 ? 393  THR B CA    1 
ATOM   5269  C  C     . THR F 2 204 ? 18.087  65.792  83.798  1.00 27.17 ? 393  THR B C     1 
ATOM   5270  O  O     . THR F 2 204 ? 17.807  64.661  84.163  1.00 26.45 ? 393  THR B O     1 
ATOM   5271  C  CB    . THR F 2 204 ? 16.703  65.684  81.728  1.00 27.79 ? 393  THR B CB    1 
ATOM   5272  O  OG1   . THR F 2 204 ? 16.672  65.957  80.316  1.00 28.27 ? 393  THR B OG1   1 
ATOM   5273  C  CG2   . THR F 2 204 ? 15.547  66.414  82.424  1.00 26.25 ? 393  THR B CG2   1 
ATOM   5274  N  N     . ARG F 2 205 ? 18.412  66.757  84.651  1.00 26.07 ? 394  ARG B N     1 
ATOM   5275  C  CA    . ARG F 2 205 ? 18.456  66.494  86.086  1.00 27.20 ? 394  ARG B CA    1 
ATOM   5276  C  C     . ARG F 2 205 ? 17.149  66.869  86.786  1.00 26.55 ? 394  ARG B C     1 
ATOM   5277  O  O     . ARG F 2 205 ? 16.908  66.456  87.921  1.00 25.55 ? 394  ARG B O     1 
ATOM   5278  C  CB    . ARG F 2 205 ? 19.625  67.236  86.728  1.00 28.64 ? 394  ARG B CB    1 
ATOM   5279  C  CG    . ARG F 2 205 ? 20.972  66.866  86.128  1.00 32.56 ? 394  ARG B CG    1 
ATOM   5280  C  CD    . ARG F 2 205 ? 22.124  67.324  87.025  1.00 35.62 ? 394  ARG B CD    1 
ATOM   5281  N  NE    . ARG F 2 205 ? 22.194  68.777  87.176  1.00 38.58 ? 394  ARG B NE    1 
ATOM   5282  C  CZ    . ARG F 2 205 ? 22.839  69.393  88.170  1.00 40.76 ? 394  ARG B CZ    1 
ATOM   5283  N  NH1   . ARG F 2 205 ? 23.464  68.675  89.107  1.00 41.54 ? 394  ARG B NH1   1 
ATOM   5284  N  NH2   . ARG F 2 205 ? 22.876  70.721  88.225  1.00 39.26 ? 394  ARG B NH2   1 
ATOM   5285  N  N     . PHE F 2 206 ? 16.310  67.648  86.105  1.00 24.98 ? 395  PHE B N     1 
ATOM   5286  C  CA    . PHE F 2 206 ? 15.024  68.038  86.656  1.00 24.58 ? 395  PHE B CA    1 
ATOM   5287  C  C     . PHE F 2 206 ? 13.927  67.973  85.621  1.00 23.88 ? 395  PHE B C     1 
ATOM   5288  O  O     . PHE F 2 206 ? 14.096  68.427  84.500  1.00 23.98 ? 395  PHE B O     1 
ATOM   5289  C  CB    . PHE F 2 206 ? 15.039  69.466  87.182  1.00 25.12 ? 395  PHE B CB    1 
ATOM   5290  C  CG    . PHE F 2 206 ? 16.093  69.732  88.189  1.00 26.09 ? 395  PHE B CG    1 
ATOM   5291  C  CD1   . PHE F 2 206 ? 17.392  70.021  87.785  1.00 26.40 ? 395  PHE B CD1   1 
ATOM   5292  C  CD2   . PHE F 2 206 ? 15.779  69.729  89.547  1.00 25.96 ? 395  PHE B CD2   1 
ATOM   5293  C  CE1   . PHE F 2 206 ? 18.372  70.315  88.723  1.00 27.95 ? 395  PHE B CE1   1 
ATOM   5294  C  CE2   . PHE F 2 206 ? 16.741  70.018  90.500  1.00 28.04 ? 395  PHE B CE2   1 
ATOM   5295  C  CZ    . PHE F 2 206 ? 18.049  70.316  90.093  1.00 28.21 ? 395  PHE B CZ    1 
ATOM   5296  N  N     . VAL F 2 207 ? 12.794  67.413  86.013  1.00 23.47 ? 396  VAL B N     1 
ATOM   5297  C  CA    . VAL F 2 207 ? 11.647  67.341  85.142  1.00 23.17 ? 396  VAL B CA    1 
ATOM   5298  C  C     . VAL F 2 207 ? 10.558  67.928  86.023  1.00 22.90 ? 396  VAL B C     1 
ATOM   5299  O  O     . VAL F 2 207 ? 10.284  67.429  87.115  1.00 21.81 ? 396  VAL B O     1 
ATOM   5300  C  CB    . VAL F 2 207 ? 11.307  65.883  84.736  1.00 24.26 ? 396  VAL B CB    1 
ATOM   5301  C  CG1   . VAL F 2 207 ? 10.093  65.871  83.814  1.00 24.67 ? 396  VAL B CG1   1 
ATOM   5302  C  CG2   . VAL F 2 207 ? 12.493  65.249  84.028  1.00 22.82 ? 396  VAL B CG2   1 
ATOM   5303  N  N     . VAL F 2 208 ? 9.987   69.039  85.575  1.00 22.69 ? 397  VAL B N     1 
ATOM   5304  C  CA    . VAL F 2 208 ? 8.946   69.689  86.332  1.00 20.06 ? 397  VAL B CA    1 
ATOM   5305  C  C     . VAL F 2 208 ? 7.613   69.555  85.619  1.00 20.39 ? 397  VAL B C     1 
ATOM   5306  O  O     . VAL F 2 208 ? 7.513   69.801  84.414  1.00 19.15 ? 397  VAL B O     1 
ATOM   5307  C  CB    . VAL F 2 208 ? 9.243   71.206  86.521  1.00 20.99 ? 397  VAL B CB    1 
ATOM   5308  C  CG1   . VAL F 2 208 ? 8.108   71.880  87.298  1.00 18.26 ? 397  VAL B CG1   1 
ATOM   5309  C  CG2   . VAL F 2 208 ? 10.568  71.403  87.256  1.00 20.82 ? 397  VAL B CG2   1 
ATOM   5310  N  N     . LEU F 2 209 ? 6.590   69.140  86.361  1.00 20.47 ? 398  LEU B N     1 
ATOM   5311  C  CA    . LEU F 2 209 ? 5.257   69.093  85.795  1.00 21.28 ? 398  LEU B CA    1 
ATOM   5312  C  C     . LEU F 2 209 ? 4.473   70.201  86.497  1.00 20.81 ? 398  LEU B C     1 
ATOM   5313  O  O     . LEU F 2 209 ? 4.091   70.051  87.654  1.00 19.69 ? 398  LEU B O     1 
ATOM   5314  C  CB    . LEU F 2 209 ? 4.553   67.753  86.063  1.00 23.70 ? 398  LEU B CB    1 
ATOM   5315  C  CG    . LEU F 2 209 ? 5.218   66.441  85.653  1.00 25.57 ? 398  LEU B CG    1 
ATOM   5316  C  CD1   . LEU F 2 209 ? 4.159   65.348  85.533  1.00 25.45 ? 398  LEU B CD1   1 
ATOM   5317  C  CD2   . LEU F 2 209 ? 5.907   66.617  84.331  1.00 28.14 ? 398  LEU B CD2   1 
ATOM   5318  N  N     . ASP F 2 210 ? 4.266   71.334  85.832  1.00 21.62 ? 399  ASP B N     1 
ATOM   5319  C  CA    . ASP F 2 210 ? 3.450   72.373  86.455  1.00 21.57 ? 399  ASP B CA    1 
ATOM   5320  C  C     . ASP F 2 210 ? 2.002   71.951  86.133  1.00 21.16 ? 399  ASP B C     1 
ATOM   5321  O  O     . ASP F 2 210 ? 1.760   71.300  85.113  1.00 19.55 ? 399  ASP B O     1 
ATOM   5322  C  CB    . ASP F 2 210 ? 3.773   73.751  85.878  1.00 22.39 ? 399  ASP B CB    1 
ATOM   5323  C  CG    . ASP F 2 210 ? 3.151   74.891  86.697  1.00 23.84 ? 399  ASP B CG    1 
ATOM   5324  O  OD1   . ASP F 2 210 ? 2.618   74.624  87.801  1.00 23.88 ? 399  ASP B OD1   1 
ATOM   5325  O  OD2   . ASP F 2 210 ? 3.204   76.055  86.241  1.00 24.02 ? 399  ASP B OD2   1 
ATOM   5326  N  N     . GLU F 2 211 ? 1.050   72.315  86.987  1.00 21.23 ? 400  GLU B N     1 
ATOM   5327  C  CA    . GLU F 2 211 ? -0.345  71.903  86.794  1.00 22.12 ? 400  GLU B CA    1 
ATOM   5328  C  C     . GLU F 2 211 ? -0.324  70.371  86.640  1.00 22.16 ? 400  GLU B C     1 
ATOM   5329  O  O     . GLU F 2 211 ? -1.040  69.803  85.821  1.00 21.67 ? 400  GLU B O     1 
ATOM   5330  C  CB    . GLU F 2 211 ? -0.933  72.522  85.523  1.00 22.69 ? 400  GLU B CB    1 
ATOM   5331  C  CG    . GLU F 2 211 ? -0.928  74.042  85.477  1.00 22.49 ? 400  GLU B CG    1 
ATOM   5332  C  CD    . GLU F 2 211 ? -1.662  74.685  86.644  1.00 23.96 ? 400  GLU B CD    1 
ATOM   5333  O  OE1   . GLU F 2 211 ? -2.540  74.031  87.250  1.00 23.35 ? 400  GLU B OE1   1 
ATOM   5334  O  OE2   . GLU F 2 211 ? -1.369  75.865  86.949  1.00 26.05 ? 400  GLU B OE2   1 
ATOM   5335  N  N     . ALA F 2 212 ? 0.516   69.724  87.436  1.00 21.76 ? 401  ALA B N     1 
ATOM   5336  C  CA    . ALA F 2 212 ? 0.709   68.278  87.392  1.00 22.60 ? 401  ALA B CA    1 
ATOM   5337  C  C     . ALA F 2 212 ? -0.536  67.391  87.276  1.00 23.28 ? 401  ALA B C     1 
ATOM   5338  O  O     . ALA F 2 212 ? -0.552  66.459  86.469  1.00 24.15 ? 401  ALA B O     1 
ATOM   5339  C  CB    . ALA F 2 212 ? 1.560   67.839  88.602  1.00 21.36 ? 401  ALA B CB    1 
ATOM   5340  N  N     . ASP F 2 213 ? -1.563  67.658  88.073  1.00 23.18 ? 402  ASP B N     1 
ATOM   5341  C  CA    . ASP F 2 213 ? -2.761  66.838  88.010  1.00 25.31 ? 402  ASP B CA    1 
ATOM   5342  C  C     . ASP F 2 213 ? -3.352  66.826  86.602  1.00 25.15 ? 402  ASP B C     1 
ATOM   5343  O  O     . ASP F 2 213 ? -3.862  65.804  86.157  1.00 26.56 ? 402  ASP B O     1 
ATOM   5344  C  CB    . ASP F 2 213 ? -3.811  67.291  89.038  1.00 25.44 ? 402  ASP B CB    1 
ATOM   5345  C  CG    . ASP F 2 213 ? -4.229  68.743  88.866  1.00 27.07 ? 402  ASP B CG    1 
ATOM   5346  O  OD1   . ASP F 2 213 ? -5.441  69.019  89.003  1.00 28.72 ? 402  ASP B OD1   1 
ATOM   5347  O  OD2   . ASP F 2 213 ? -3.367  69.608  88.613  1.00 25.30 ? 402  ASP B OD2   1 
ATOM   5348  N  N     . ARG F 2 214 ? -3.270  67.943  85.895  1.00 25.14 ? 403  ARG B N     1 
ATOM   5349  C  CA    . ARG F 2 214 ? -3.774  68.001  84.522  1.00 24.93 ? 403  ARG B CA    1 
ATOM   5350  C  C     . ARG F 2 214 ? -2.810  67.264  83.575  1.00 25.02 ? 403  ARG B C     1 
ATOM   5351  O  O     . ARG F 2 214 ? -3.232  66.616  82.614  1.00 24.01 ? 403  ARG B O     1 
ATOM   5352  C  CB    . ARG F 2 214 ? -3.927  69.454  84.063  1.00 25.76 ? 403  ARG B CB    1 
ATOM   5353  C  CG    . ARG F 2 214 ? -4.542  69.611  82.687  1.00 27.02 ? 403  ARG B CG    1 
ATOM   5354  C  CD    . ARG F 2 214 ? -5.948  69.039  82.659  1.00 28.66 ? 403  ARG B CD    1 
ATOM   5355  N  NE    . ARG F 2 214 ? -6.630  69.297  81.396  1.00 31.84 ? 403  ARG B NE    1 
ATOM   5356  C  CZ    . ARG F 2 214 ? -7.895  68.955  81.144  1.00 33.98 ? 403  ARG B CZ    1 
ATOM   5357  N  NH1   . ARG F 2 214 ? -8.623  68.332  82.069  1.00 34.38 ? 403  ARG B NH1   1 
ATOM   5358  N  NH2   . ARG F 2 214 ? -8.439  69.249  79.968  1.00 33.86 ? 403  ARG B NH2   1 
ATOM   5359  N  N     . MET F 2 215 ? -1.515  67.355  83.853  1.00 24.78 ? 404  MET B N     1 
ATOM   5360  C  CA    . MET F 2 215 ? -0.535  66.683  83.017  1.00 25.10 ? 404  MET B CA    1 
ATOM   5361  C  C     . MET F 2 215 ? -0.616  65.174  83.230  1.00 25.70 ? 404  MET B C     1 
ATOM   5362  O  O     . MET F 2 215 ? -0.141  64.405  82.406  1.00 24.66 ? 404  MET B O     1 
ATOM   5363  C  CB    . MET F 2 215 ? 0.890   67.160  83.327  1.00 24.07 ? 404  MET B CB    1 
ATOM   5364  C  CG    . MET F 2 215 ? 1.099   68.657  83.241  1.00 25.49 ? 404  MET B CG    1 
ATOM   5365  S  SD    . MET F 2 215 ? 0.457   69.394  81.725  1.00 28.40 ? 404  MET B SD    1 
ATOM   5366  C  CE    . MET F 2 215 ? 1.429   68.549  80.508  1.00 26.36 ? 404  MET B CE    1 
ATOM   5367  N  N     . LEU F 2 216 ? -1.217  64.745  84.331  1.00 27.65 ? 405  LEU B N     1 
ATOM   5368  C  CA    . LEU F 2 216 ? -1.317  63.307  84.583  1.00 30.40 ? 405  LEU B CA    1 
ATOM   5369  C  C     . LEU F 2 216 ? -2.668  62.675  84.253  1.00 31.20 ? 405  LEU B C     1 
ATOM   5370  O  O     . LEU F 2 216 ? -2.810  61.461  84.350  1.00 30.56 ? 405  LEU B O     1 
ATOM   5371  C  CB    . LEU F 2 216 ? -0.947  62.997  86.035  1.00 29.44 ? 405  LEU B CB    1 
ATOM   5372  C  CG    . LEU F 2 216 ? 0.545   63.217  86.301  1.00 31.92 ? 405  LEU B CG    1 
ATOM   5373  C  CD1   . LEU F 2 216 ? 0.851   63.076  87.787  1.00 31.18 ? 405  LEU B CD1   1 
ATOM   5374  C  CD2   . LEU F 2 216 ? 1.360   62.221  85.458  1.00 30.83 ? 405  LEU B CD2   1 
ATOM   5375  N  N     . ASP F 2 217 ? -3.649  63.485  83.851  1.00 33.10 ? 406  ASP B N     1 
ATOM   5376  C  CA    . ASP F 2 217 ? -4.967  62.949  83.528  1.00 34.89 ? 406  ASP B CA    1 
ATOM   5377  C  C     . ASP F 2 217 ? -5.032  62.366  82.108  1.00 36.15 ? 406  ASP B C     1 
ATOM   5378  O  O     . ASP F 2 217 ? -4.139  62.590  81.284  1.00 35.04 ? 406  ASP B O     1 
ATOM   5379  C  CB    . ASP F 2 217 ? -6.038  64.031  83.725  1.00 36.87 ? 406  ASP B CB    1 
ATOM   5380  C  CG    . ASP F 2 217 ? -7.411  63.447  84.084  1.00 39.31 ? 406  ASP B CG    1 
ATOM   5381  O  OD1   . ASP F 2 217 ? -7.497  62.224  84.364  1.00 39.18 ? 406  ASP B OD1   1 
ATOM   5382  O  OD2   . ASP F 2 217 ? -8.403  64.212  84.096  1.00 39.87 ? 406  ASP B OD2   1 
ATOM   5383  N  N     . MET F 2 218 ? -6.104  61.626  81.831  1.00 37.80 ? 407  MET B N     1 
ATOM   5384  C  CA    . MET F 2 218 ? -6.294  60.954  80.542  1.00 39.07 ? 407  MET B CA    1 
ATOM   5385  C  C     . MET F 2 218 ? -5.819  61.726  79.326  1.00 38.13 ? 407  MET B C     1 
ATOM   5386  O  O     . MET F 2 218 ? -5.150  61.171  78.465  1.00 38.44 ? 407  MET B O     1 
ATOM   5387  C  CB    . MET F 2 218 ? -7.771  60.570  80.334  1.00 42.57 ? 407  MET B CB    1 
ATOM   5388  C  CG    . MET F 2 218 ? -8.412  59.843  81.511  1.00 47.20 ? 407  MET B CG    1 
ATOM   5389  S  SD    . MET F 2 218 ? -10.063 59.112  81.200  1.00 53.66 ? 407  MET B SD    1 
ATOM   5390  C  CE    . MET F 2 218 ? -10.794 60.233  79.875  1.00 51.18 ? 407  MET B CE    1 
ATOM   5391  N  N     . GLY F 2 219 ? -6.173  63.001  79.246  1.00 37.84 ? 408  GLY B N     1 
ATOM   5392  C  CA    . GLY F 2 219 ? -5.774  63.797  78.096  1.00 36.78 ? 408  GLY B CA    1 
ATOM   5393  C  C     . GLY F 2 219 ? -4.285  63.800  77.770  1.00 36.17 ? 408  GLY B C     1 
ATOM   5394  O  O     . GLY F 2 219 ? -3.906  63.615  76.619  1.00 37.63 ? 408  GLY B O     1 
ATOM   5395  N  N     . PHE F 2 220 ? -3.443  63.996  78.779  1.00 34.56 ? 409  PHE B N     1 
ATOM   5396  C  CA    . PHE F 2 220 ? -1.995  64.052  78.589  1.00 32.69 ? 409  PHE B CA    1 
ATOM   5397  C  C     . PHE F 2 220 ? -1.161  62.854  79.033  1.00 32.78 ? 409  PHE B C     1 
ATOM   5398  O  O     . PHE F 2 220 ? 0.008   62.774  78.667  1.00 32.00 ? 409  PHE B O     1 
ATOM   5399  C  CB    . PHE F 2 220 ? -1.426  65.273  79.323  1.00 29.98 ? 409  PHE B CB    1 
ATOM   5400  C  CG    . PHE F 2 220 ? -1.714  66.585  78.657  1.00 26.71 ? 409  PHE B CG    1 
ATOM   5401  C  CD1   . PHE F 2 220 ? -2.451  67.565  79.316  1.00 25.05 ? 409  PHE B CD1   1 
ATOM   5402  C  CD2   . PHE F 2 220 ? -1.184  66.870  77.409  1.00 23.57 ? 409  PHE B CD2   1 
ATOM   5403  C  CE1   . PHE F 2 220 ? -2.642  68.810  78.737  1.00 23.24 ? 409  PHE B CE1   1 
ATOM   5404  C  CE2   . PHE F 2 220 ? -1.368  68.108  76.825  1.00 22.36 ? 409  PHE B CE2   1 
ATOM   5405  C  CZ    . PHE F 2 220 ? -2.098  69.083  77.492  1.00 22.43 ? 409  PHE B CZ    1 
ATOM   5406  N  N     . SER F 2 221 ? -1.736  61.941  79.815  1.00 33.90 ? 410  SER B N     1 
ATOM   5407  C  CA    . SER F 2 221 ? -0.974  60.809  80.360  1.00 35.36 ? 410  SER B CA    1 
ATOM   5408  C  C     . SER F 2 221 ? -0.089  60.041  79.403  1.00 35.79 ? 410  SER B C     1 
ATOM   5409  O  O     . SER F 2 221 ? 1.050   59.727  79.731  1.00 35.83 ? 410  SER B O     1 
ATOM   5410  C  CB    . SER F 2 221 ? -1.894  59.829  81.102  1.00 35.62 ? 410  SER B CB    1 
ATOM   5411  O  OG    . SER F 2 221 ? -3.010  59.458  80.314  1.00 38.31 ? 410  SER B OG    1 
ATOM   5412  N  N     . GLU F 2 222 ? -0.594  59.727  78.224  1.00 37.48 ? 411  GLU B N     1 
ATOM   5413  C  CA    . GLU F 2 222 ? 0.224   58.995  77.269  1.00 39.19 ? 411  GLU B CA    1 
ATOM   5414  C  C     . GLU F 2 222 ? 1.481   59.750  76.832  1.00 38.45 ? 411  GLU B C     1 
ATOM   5415  O  O     . GLU F 2 222 ? 2.543   59.158  76.687  1.00 38.40 ? 411  GLU B O     1 
ATOM   5416  C  CB    . GLU F 2 222 ? -0.588  58.630  76.035  1.00 42.26 ? 411  GLU B CB    1 
ATOM   5417  C  CG    . GLU F 2 222 ? 0.297   58.206  74.873  1.00 48.20 ? 411  GLU B CG    1 
ATOM   5418  C  CD    . GLU F 2 222 ? -0.387  57.239  73.934  1.00 51.33 ? 411  GLU B CD    1 
ATOM   5419  O  OE1   . GLU F 2 222 ? -1.429  57.614  73.340  1.00 52.75 ? 411  GLU B OE1   1 
ATOM   5420  O  OE2   . GLU F 2 222 ? 0.127   56.102  73.796  1.00 53.66 ? 411  GLU B OE2   1 
ATOM   5421  N  N     . ASP F 2 223 ? 1.361   61.052  76.610  1.00 37.80 ? 412  ASP B N     1 
ATOM   5422  C  CA    . ASP F 2 223 ? 2.509   61.843  76.190  1.00 36.82 ? 412  ASP B CA    1 
ATOM   5423  C  C     . ASP F 2 223 ? 3.497   62.082  77.328  1.00 36.57 ? 412  ASP B C     1 
ATOM   5424  O  O     . ASP F 2 223 ? 4.719   62.121  77.126  1.00 35.36 ? 412  ASP B O     1 
ATOM   5425  C  CB    . ASP F 2 223 ? 2.020   63.155  75.581  1.00 37.74 ? 412  ASP B CB    1 
ATOM   5426  C  CG    . ASP F 2 223 ? 1.627   62.986  74.126  1.00 39.44 ? 412  ASP B CG    1 
ATOM   5427  O  OD1   . ASP F 2 223 ? 1.623   61.829  73.650  1.00 40.94 ? 412  ASP B OD1   1 
ATOM   5428  O  OD2   . ASP F 2 223 ? 1.334   63.988  73.449  1.00 41.00 ? 412  ASP B OD2   1 
ATOM   5429  N  N     . MET F 2 224 ? 2.962   62.203  78.533  1.00 36.10 ? 413  MET B N     1 
ATOM   5430  C  CA    . MET F 2 224 ? 3.787   62.413  79.698  1.00 37.03 ? 413  MET B CA    1 
ATOM   5431  C  C     . MET F 2 224 ? 4.599   61.139  79.948  1.00 37.58 ? 413  MET B C     1 
ATOM   5432  O  O     . MET F 2 224 ? 5.774   61.198  80.329  1.00 37.42 ? 413  MET B O     1 
ATOM   5433  C  CB    . MET F 2 224 ? 2.896   62.753  80.897  1.00 37.65 ? 413  MET B CB    1 
ATOM   5434  C  CG    . MET F 2 224 ? 3.533   63.706  81.891  1.00 38.48 ? 413  MET B CG    1 
ATOM   5435  S  SD    . MET F 2 224 ? 4.153   65.265  81.174  1.00 38.16 ? 413  MET B SD    1 
ATOM   5436  C  CE    . MET F 2 224 ? 3.089   65.492  79.790  1.00 36.84 ? 413  MET B CE    1 
ATOM   5437  N  N     . ARG F 2 225 ? 3.979   59.983  79.719  1.00 37.53 ? 414  ARG B N     1 
ATOM   5438  C  CA    . ARG F 2 225 ? 4.682   58.724  79.905  1.00 37.44 ? 414  ARG B CA    1 
ATOM   5439  C  C     . ARG F 2 225 ? 5.782   58.613  78.864  1.00 35.66 ? 414  ARG B C     1 
ATOM   5440  O  O     . ARG F 2 225 ? 6.885   58.209  79.184  1.00 35.29 ? 414  ARG B O     1 
ATOM   5441  C  CB    . ARG F 2 225 ? 3.729   57.536  79.783  1.00 39.82 ? 414  ARG B CB    1 
ATOM   5442  C  CG    . ARG F 2 225 ? 4.384   56.204  80.151  1.00 42.25 ? 414  ARG B CG    1 
ATOM   5443  C  CD    . ARG F 2 225 ? 3.356   55.092  80.164  1.00 44.97 ? 414  ARG B CD    1 
ATOM   5444  N  NE    . ARG F 2 225 ? 2.230   55.460  81.020  1.00 48.38 ? 414  ARG B NE    1 
ATOM   5445  C  CZ    . ARG F 2 225 ? 2.240   55.383  82.349  1.00 50.38 ? 414  ARG B CZ    1 
ATOM   5446  N  NH1   . ARG F 2 225 ? 3.324   54.934  82.983  1.00 50.90 ? 414  ARG B NH1   1 
ATOM   5447  N  NH2   . ARG F 2 225 ? 1.178   55.788  83.046  1.00 50.43 ? 414  ARG B NH2   1 
ATOM   5448  N  N     . ARG F 2 226 ? 5.489   58.987  77.619  1.00 35.44 ? 415  ARG B N     1 
ATOM   5449  C  CA    . ARG F 2 226 ? 6.501   58.931  76.556  1.00 36.17 ? 415  ARG B CA    1 
ATOM   5450  C  C     . ARG F 2 226 ? 7.707   59.796  76.901  1.00 36.12 ? 415  ARG B C     1 
ATOM   5451  O  O     . ARG F 2 226 ? 8.825   59.494  76.508  1.00 37.14 ? 415  ARG B O     1 
ATOM   5452  C  CB    . ARG F 2 226 ? 5.934   59.393  75.206  1.00 35.76 ? 415  ARG B CB    1 
ATOM   5453  C  CG    . ARG F 2 226 ? 5.042   58.374  74.509  1.00 37.85 ? 415  ARG B CG    1 
ATOM   5454  C  CD    . ARG F 2 226 ? 4.677   58.852  73.121  1.00 38.79 ? 415  ARG B CD    1 
ATOM   5455  N  NE    . ARG F 2 226 ? 5.872   59.004  72.301  1.00 40.45 ? 415  ARG B NE    1 
ATOM   5456  C  CZ    . ARG F 2 226 ? 5.966   59.825  71.260  1.00 41.04 ? 415  ARG B CZ    1 
ATOM   5457  N  NH1   . ARG F 2 226 ? 4.933   60.574  70.905  1.00 40.91 ? 415  ARG B NH1   1 
ATOM   5458  N  NH2   . ARG F 2 226 ? 7.101   59.904  70.579  1.00 42.12 ? 415  ARG B NH2   1 
ATOM   5459  N  N     . ILE F 2 227 ? 7.480   60.880  77.632  1.00 36.24 ? 416  ILE B N     1 
ATOM   5460  C  CA    . ILE F 2 227 ? 8.570   61.755  78.015  1.00 36.13 ? 416  ILE B CA    1 
ATOM   5461  C  C     . ILE F 2 227 ? 9.298   61.219  79.243  1.00 37.00 ? 416  ILE B C     1 
ATOM   5462  O  O     . ILE F 2 227 ? 10.511  61.013  79.211  1.00 36.34 ? 416  ILE B O     1 
ATOM   5463  C  CB    . ILE F 2 227 ? 8.047   63.173  78.312  1.00 35.89 ? 416  ILE B CB    1 
ATOM   5464  C  CG1   . ILE F 2 227 ? 7.424   63.772  77.046  1.00 36.47 ? 416  ILE B CG1   1 
ATOM   5465  C  CG2   . ILE F 2 227 ? 9.173   64.047  78.820  1.00 35.36 ? 416  ILE B CG2   1 
ATOM   5466  C  CD1   . ILE F 2 227 ? 6.589   65.040  77.307  1.00 35.92 ? 416  ILE B CD1   1 
ATOM   5467  N  N     . MET F 2 228 ? 8.552   60.992  80.323  1.00 38.77 ? 417  MET B N     1 
ATOM   5468  C  CA    . MET F 2 228 ? 9.118   60.497  81.583  1.00 40.49 ? 417  MET B CA    1 
ATOM   5469  C  C     . MET F 2 228 ? 9.864   59.180  81.437  1.00 40.64 ? 417  MET B C     1 
ATOM   5470  O  O     . MET F 2 228 ? 10.826  58.903  82.147  1.00 40.44 ? 417  MET B O     1 
ATOM   5471  C  CB    . MET F 2 228 ? 8.009   60.285  82.624  1.00 42.06 ? 417  MET B CB    1 
ATOM   5472  C  CG    . MET F 2 228 ? 7.253   61.531  83.031  1.00 44.26 ? 417  MET B CG    1 
ATOM   5473  S  SD    . MET F 2 228 ? 8.392   62.864  83.353  1.00 48.38 ? 417  MET B SD    1 
ATOM   5474  C  CE    . MET F 2 228 ? 9.575   62.072  84.506  1.00 46.52 ? 417  MET B CE    1 
ATOM   5475  N  N     . THR F 2 229 ? 9.401   58.374  80.497  1.00 40.89 ? 418  THR B N     1 
ATOM   5476  C  CA    . THR F 2 229 ? 9.945   57.052  80.257  1.00 40.71 ? 418  THR B CA    1 
ATOM   5477  C  C     . THR F 2 229 ? 10.886  56.946  79.054  1.00 40.54 ? 418  THR B C     1 
ATOM   5478  O  O     . THR F 2 229 ? 11.442  55.877  78.787  1.00 41.01 ? 418  THR B O     1 
ATOM   5479  C  CB    . THR F 2 229 ? 8.740   56.078  80.125  1.00 40.57 ? 418  THR B CB    1 
ATOM   5480  O  OG1   . THR F 2 229 ? 8.343   55.663  81.434  1.00 42.07 ? 418  THR B OG1   1 
ATOM   5481  C  CG2   . THR F 2 229 ? 9.047   54.898  79.269  1.00 41.98 ? 418  THR B CG2   1 
ATOM   5482  N  N     . HIS F 2 230 ? 11.090  58.051  78.342  1.00 39.26 ? 419  HIS B N     1 
ATOM   5483  C  CA    . HIS F 2 230 ? 11.949  58.017  77.166  1.00 38.30 ? 419  HIS B CA    1 
ATOM   5484  C  C     . HIS F 2 230 ? 13.228  57.226  77.388  1.00 37.90 ? 419  HIS B C     1 
ATOM   5485  O  O     . HIS F 2 230 ? 13.775  57.204  78.486  1.00 37.28 ? 419  HIS B O     1 
ATOM   5486  C  CB    . HIS F 2 230 ? 12.317  59.422  76.703  1.00 36.93 ? 419  HIS B CB    1 
ATOM   5487  C  CG    . HIS F 2 230 ? 12.793  59.467  75.285  1.00 36.23 ? 419  HIS B CG    1 
ATOM   5488  N  ND1   . HIS F 2 230 ? 11.943  59.299  74.213  1.00 36.19 ? 419  HIS B ND1   1 
ATOM   5489  C  CD2   . HIS F 2 230 ? 14.032  59.610  74.764  1.00 35.55 ? 419  HIS B CD2   1 
ATOM   5490  C  CE1   . HIS F 2 230 ? 12.640  59.337  73.092  1.00 35.55 ? 419  HIS B CE1   1 
ATOM   5491  N  NE2   . HIS F 2 230 ? 13.910  59.525  73.399  1.00 35.47 ? 419  HIS B NE2   1 
ATOM   5492  N  N     . VAL F 2 231 ? 13.699  56.579  76.331  1.00 38.31 ? 420  VAL B N     1 
ATOM   5493  C  CA    . VAL F 2 231 ? 14.915  55.780  76.412  1.00 39.06 ? 420  VAL B CA    1 
ATOM   5494  C  C     . VAL F 2 231 ? 16.141  56.604  76.808  1.00 38.28 ? 420  VAL B C     1 
ATOM   5495  O  O     . VAL F 2 231 ? 17.072  56.091  77.428  1.00 38.27 ? 420  VAL B O     1 
ATOM   5496  C  CB    . VAL F 2 231 ? 15.226  55.098  75.063  1.00 40.52 ? 420  VAL B CB    1 
ATOM   5497  C  CG1   . VAL F 2 231 ? 16.484  54.251  75.187  1.00 41.68 ? 420  VAL B CG1   1 
ATOM   5498  C  CG2   . VAL F 2 231 ? 14.059  54.235  74.640  1.00 41.78 ? 420  VAL B CG2   1 
ATOM   5499  N  N     . THR F 2 232 ? 16.145  57.883  76.452  1.00 37.49 ? 421  THR B N     1 
ATOM   5500  C  CA    . THR F 2 232 ? 17.287  58.732  76.767  1.00 36.03 ? 421  THR B CA    1 
ATOM   5501  C  C     . THR F 2 232 ? 17.195  59.419  78.112  1.00 35.67 ? 421  THR B C     1 
ATOM   5502  O  O     . THR F 2 232 ? 18.129  60.122  78.507  1.00 35.60 ? 421  THR B O     1 
ATOM   5503  C  CB    . THR F 2 232 ? 17.492  59.814  75.700  1.00 35.89 ? 421  THR B CB    1 
ATOM   5504  O  OG1   . THR F 2 232 ? 16.394  60.740  75.728  1.00 35.05 ? 421  THR B OG1   1 
ATOM   5505  C  CG2   . THR F 2 232 ? 17.591  59.172  74.320  1.00 35.25 ? 421  THR B CG2   1 
ATOM   5506  N  N     . MET F 2 233 ? 16.091  59.212  78.827  1.00 34.89 ? 422  MET B N     1 
ATOM   5507  C  CA    . MET F 2 233 ? 15.914  59.851  80.129  1.00 34.47 ? 422  MET B CA    1 
ATOM   5508  C  C     . MET F 2 233 ? 16.992  59.484  81.138  1.00 35.07 ? 422  MET B C     1 
ATOM   5509  O  O     . MET F 2 233 ? 17.215  58.311  81.432  1.00 35.91 ? 422  MET B O     1 
ATOM   5510  C  CB    . MET F 2 233 ? 14.543  59.513  80.717  1.00 32.82 ? 422  MET B CB    1 
ATOM   5511  C  CG    . MET F 2 233 ? 14.273  60.182  82.072  1.00 33.07 ? 422  MET B CG    1 
ATOM   5512  S  SD    . MET F 2 233 ? 14.367  62.015  82.082  1.00 32.64 ? 422  MET B SD    1 
ATOM   5513  C  CE    . MET F 2 233 ? 12.919  62.436  81.106  1.00 30.17 ? 422  MET B CE    1 
ATOM   5514  N  N     . ARG F 2 234 ? 17.657  60.497  81.675  1.00 35.08 ? 423  ARG B N     1 
ATOM   5515  C  CA    . ARG F 2 234 ? 18.696  60.277  82.665  1.00 35.32 ? 423  ARG B CA    1 
ATOM   5516  C  C     . ARG F 2 234 ? 18.084  59.468  83.804  1.00 36.19 ? 423  ARG B C     1 
ATOM   5517  O  O     . ARG F 2 234 ? 17.091  59.871  84.397  1.00 35.70 ? 423  ARG B O     1 
ATOM   5518  C  CB    . ARG F 2 234 ? 19.211  61.607  83.199  1.00 34.42 ? 423  ARG B CB    1 
ATOM   5519  C  CG    . ARG F 2 234 ? 20.469  61.484  84.024  1.00 35.40 ? 423  ARG B CG    1 
ATOM   5520  C  CD    . ARG F 2 234 ? 20.906  62.834  84.545  1.00 37.26 ? 423  ARG B CD    1 
ATOM   5521  N  NE    . ARG F 2 234 ? 22.305  62.823  84.955  1.00 40.42 ? 423  ARG B NE    1 
ATOM   5522  C  CZ    . ARG F 2 234 ? 22.725  62.971  86.207  1.00 42.24 ? 423  ARG B CZ    1 
ATOM   5523  N  NH1   . ARG F 2 234 ? 21.854  63.149  87.197  1.00 43.07 ? 423  ARG B NH1   1 
ATOM   5524  N  NH2   . ARG F 2 234 ? 24.022  62.932  86.471  1.00 43.60 ? 423  ARG B NH2   1 
ATOM   5525  N  N     . PRO F 2 235 ? 18.687  58.321  84.136  1.00 37.08 ? 424  PRO B N     1 
ATOM   5526  C  CA    . PRO F 2 235 ? 18.194  57.449  85.207  1.00 37.34 ? 424  PRO B CA    1 
ATOM   5527  C  C     . PRO F 2 235 ? 17.976  58.181  86.526  1.00 37.85 ? 424  PRO B C     1 
ATOM   5528  O  O     . PRO F 2 235 ? 16.966  57.983  87.191  1.00 38.86 ? 424  PRO B O     1 
ATOM   5529  C  CB    . PRO F 2 235 ? 19.288  56.389  85.319  1.00 36.70 ? 424  PRO B CB    1 
ATOM   5530  C  CG    . PRO F 2 235 ? 19.870  56.346  83.940  1.00 37.39 ? 424  PRO B CG    1 
ATOM   5531  C  CD    . PRO F 2 235 ? 19.957  57.810  83.591  1.00 37.40 ? 424  PRO B CD    1 
ATOM   5532  N  N     . GLU F 2 236 ? 18.934  59.020  86.901  1.00 38.39 ? 425  GLU B N     1 
ATOM   5533  C  CA    . GLU F 2 236 ? 18.851  59.775  88.141  1.00 38.73 ? 425  GLU B CA    1 
ATOM   5534  C  C     . GLU F 2 236 ? 18.465  61.222  87.847  1.00 37.44 ? 425  GLU B C     1 
ATOM   5535  O  O     . GLU F 2 236 ? 19.237  61.975  87.253  1.00 37.45 ? 425  GLU B O     1 
ATOM   5536  C  CB    . GLU F 2 236 ? 20.203  59.763  88.873  1.00 42.11 ? 425  GLU B CB    1 
ATOM   5537  C  CG    . GLU F 2 236 ? 20.176  59.170  90.288  1.00 47.68 ? 425  GLU B CG    1 
ATOM   5538  C  CD    . GLU F 2 236 ? 21.107  59.916  91.274  1.00 51.82 ? 425  GLU B CD    1 
ATOM   5539  O  OE1   . GLU F 2 236 ? 22.267  60.246  90.899  1.00 51.86 ? 425  GLU B OE1   1 
ATOM   5540  O  OE2   . GLU F 2 236 ? 20.674  60.162  92.433  1.00 53.41 ? 425  GLU B OE2   1 
ATOM   5541  N  N     . HIS F 2 237 ? 17.268  61.609  88.266  1.00 34.57 ? 426  HIS B N     1 
ATOM   5542  C  CA    . HIS F 2 237 ? 16.809  62.971  88.067  1.00 31.33 ? 426  HIS B CA    1 
ATOM   5543  C  C     . HIS F 2 237 ? 15.685  63.215  89.046  1.00 29.00 ? 426  HIS B C     1 
ATOM   5544  O  O     . HIS F 2 237 ? 15.065  62.275  89.531  1.00 26.98 ? 426  HIS B O     1 
ATOM   5545  C  CB    . HIS F 2 237 ? 16.307  63.164  86.635  1.00 31.19 ? 426  HIS B CB    1 
ATOM   5546  C  CG    . HIS F 2 237 ? 15.106  62.343  86.302  1.00 30.39 ? 426  HIS B CG    1 
ATOM   5547  N  ND1   . HIS F 2 237 ? 13.824  62.732  86.630  1.00 31.71 ? 426  HIS B ND1   1 
ATOM   5548  C  CD2   . HIS F 2 237 ? 14.993  61.130  85.712  1.00 30.71 ? 426  HIS B CD2   1 
ATOM   5549  C  CE1   . HIS F 2 237 ? 12.973  61.793  86.257  1.00 31.64 ? 426  HIS B CE1   1 
ATOM   5550  N  NE2   . HIS F 2 237 ? 13.656  60.809  85.698  1.00 31.59 ? 426  HIS B NE2   1 
ATOM   5551  N  N     . GLN F 2 238 ? 15.430  64.477  89.353  1.00 27.16 ? 427  GLN B N     1 
ATOM   5552  C  CA    . GLN F 2 238 ? 14.346  64.794  90.267  1.00 25.56 ? 427  GLN B CA    1 
ATOM   5553  C  C     . GLN F 2 238 ? 13.090  65.033  89.450  1.00 24.66 ? 427  GLN B C     1 
ATOM   5554  O  O     . GLN F 2 238 ? 13.154  65.515  88.331  1.00 24.40 ? 427  GLN B O     1 
ATOM   5555  C  CB    . GLN F 2 238 ? 14.676  66.035  91.095  1.00 24.46 ? 427  GLN B CB    1 
ATOM   5556  C  CG    . GLN F 2 238 ? 15.873  65.857  92.007  1.00 24.67 ? 427  GLN B CG    1 
ATOM   5557  C  CD    . GLN F 2 238 ? 16.259  67.137  92.716  1.00 23.50 ? 427  GLN B CD    1 
ATOM   5558  O  OE1   . GLN F 2 238 ? 15.531  67.639  93.577  1.00 24.57 ? 427  GLN B OE1   1 
ATOM   5559  N  NE2   . GLN F 2 238 ? 17.405  67.680  92.350  1.00 24.03 ? 427  GLN B NE2   1 
ATOM   5560  N  N     . THR F 2 239 ? 11.954  64.633  89.998  1.00 24.88 ? 428  THR B N     1 
ATOM   5561  C  CA    . THR F 2 239 ? 10.675  64.839  89.356  1.00 25.19 ? 428  THR B CA    1 
ATOM   5562  C  C     . THR F 2 239 ? 9.906   65.697  90.369  1.00 24.07 ? 428  THR B C     1 
ATOM   5563  O  O     . THR F 2 239 ? 9.788   65.340  91.539  1.00 23.18 ? 428  THR B O     1 
ATOM   5564  C  CB    . THR F 2 239 ? 9.965   63.498  89.103  1.00 26.49 ? 428  THR B CB    1 
ATOM   5565  O  OG1   . THR F 2 239 ? 10.771  62.706  88.226  1.00 28.83 ? 428  THR B OG1   1 
ATOM   5566  C  CG2   . THR F 2 239 ? 8.609   63.714  88.435  1.00 25.70 ? 428  THR B CG2   1 
ATOM   5567  N  N     . LEU F 2 240 ? 9.418   66.844  89.915  1.00 23.75 ? 429  LEU B N     1 
ATOM   5568  C  CA    . LEU F 2 240 ? 8.691   67.774  90.786  1.00 23.66 ? 429  LEU B CA    1 
ATOM   5569  C  C     . LEU F 2 240 ? 7.309   68.066  90.190  1.00 23.43 ? 429  LEU B C     1 
ATOM   5570  O  O     . LEU F 2 240 ? 7.177   68.336  88.994  1.00 24.07 ? 429  LEU B O     1 
ATOM   5571  C  CB    . LEU F 2 240 ? 9.499   69.066  90.927  1.00 21.86 ? 429  LEU B CB    1 
ATOM   5572  C  CG    . LEU F 2 240 ? 10.984  68.803  91.188  1.00 23.59 ? 429  LEU B CG    1 
ATOM   5573  C  CD1   . LEU F 2 240 ? 11.768  70.088  91.007  1.00 23.61 ? 429  LEU B CD1   1 
ATOM   5574  C  CD2   . LEU F 2 240 ? 11.193  68.207  92.597  1.00 21.99 ? 429  LEU B CD2   1 
ATOM   5575  N  N     . MET F 2 241 ? 6.280   67.980  91.025  1.00 23.04 ? 430  MET B N     1 
ATOM   5576  C  CA    . MET F 2 241 ? 4.919   68.219  90.582  1.00 23.01 ? 430  MET B CA    1 
ATOM   5577  C  C     . MET F 2 241 ? 4.255   69.313  91.424  1.00 23.48 ? 430  MET B C     1 
ATOM   5578  O  O     . MET F 2 241 ? 4.332   69.318  92.652  1.00 23.19 ? 430  MET B O     1 
ATOM   5579  C  CB    . MET F 2 241 ? 4.132   66.919  90.664  1.00 22.53 ? 430  MET B CB    1 
ATOM   5580  C  CG    . MET F 2 241 ? 4.685   65.839  89.739  1.00 24.74 ? 430  MET B CG    1 
ATOM   5581  S  SD    . MET F 2 241 ? 3.837   64.241  89.908  1.00 24.79 ? 430  MET B SD    1 
ATOM   5582  C  CE    . MET F 2 241 ? 4.851   63.227  88.877  1.00 23.75 ? 430  MET B CE    1 
ATOM   5583  N  N     . PHE F 2 242 ? 3.606   70.249  90.749  1.00 23.48 ? 431  PHE B N     1 
ATOM   5584  C  CA    . PHE F 2 242 ? 2.950   71.357  91.424  1.00 22.41 ? 431  PHE B CA    1 
ATOM   5585  C  C     . PHE F 2 242 ? 1.554   71.568  90.864  1.00 21.93 ? 431  PHE B C     1 
ATOM   5586  O  O     . PHE F 2 242 ? 1.318   71.346  89.681  1.00 19.73 ? 431  PHE B O     1 
ATOM   5587  C  CB    . PHE F 2 242 ? 3.746   72.649  91.196  1.00 22.23 ? 431  PHE B CB    1 
ATOM   5588  C  CG    . PHE F 2 242 ? 4.992   72.752  92.000  1.00 22.48 ? 431  PHE B CG    1 
ATOM   5589  C  CD1   . PHE F 2 242 ? 5.014   73.509  93.175  1.00 23.01 ? 431  PHE B CD1   1 
ATOM   5590  C  CD2   . PHE F 2 242 ? 6.155   72.121  91.583  1.00 22.95 ? 431  PHE B CD2   1 
ATOM   5591  C  CE1   . PHE F 2 242 ? 6.182   73.635  93.919  1.00 22.76 ? 431  PHE B CE1   1 
ATOM   5592  C  CE2   . PHE F 2 242 ? 7.337   72.238  92.319  1.00 22.60 ? 431  PHE B CE2   1 
ATOM   5593  C  CZ    . PHE F 2 242 ? 7.349   72.995  93.488  1.00 23.18 ? 431  PHE B CZ    1 
ATOM   5594  N  N     . SER F 2 243 ? 0.646   72.021  91.725  1.00 22.11 ? 432  SER B N     1 
ATOM   5595  C  CA    . SER F 2 243 ? -0.720  72.340  91.329  1.00 22.41 ? 432  SER B CA    1 
ATOM   5596  C  C     . SER F 2 243 ? -1.535  72.755  92.534  1.00 22.18 ? 432  SER B C     1 
ATOM   5597  O  O     . SER F 2 243 ? -1.163  72.471  93.671  1.00 21.92 ? 432  SER B O     1 
ATOM   5598  C  CB    . SER F 2 243 ? -1.401  71.143  90.653  1.00 23.35 ? 432  SER B CB    1 
ATOM   5599  O  OG    . SER F 2 243 ? -2.701  71.507  90.213  1.00 22.13 ? 432  SER B OG    1 
ATOM   5600  N  N     . ALA F 2 244 ? -2.657  73.418  92.276  1.00 23.77 ? 433  ALA B N     1 
ATOM   5601  C  CA    . ALA F 2 244 ? -3.569  73.847  93.338  1.00 23.74 ? 433  ALA B CA    1 
ATOM   5602  C  C     . ALA F 2 244 ? -4.663  72.809  93.527  1.00 24.42 ? 433  ALA B C     1 
ATOM   5603  O  O     . ALA F 2 244 ? -5.494  72.930  94.415  1.00 26.41 ? 433  ALA B O     1 
ATOM   5604  C  CB    . ALA F 2 244 ? -4.179  75.200  92.990  1.00 23.18 ? 433  ALA B CB    1 
ATOM   5605  N  N     . THR F 2 245 ? -4.689  71.802  92.662  1.00 25.63 ? 434  THR B N     1 
ATOM   5606  C  CA    . THR F 2 245 ? -5.669  70.721  92.776  1.00 25.94 ? 434  THR B CA    1 
ATOM   5607  C  C     . THR F 2 245 ? -4.968  69.397  92.500  1.00 26.54 ? 434  THR B C     1 
ATOM   5608  O  O     . THR F 2 245 ? -4.003  69.328  91.732  1.00 24.77 ? 434  THR B O     1 
ATOM   5609  C  CB    . THR F 2 245 ? -6.866  70.879  91.787  1.00 25.72 ? 434  THR B CB    1 
ATOM   5610  O  OG1   . THR F 2 245 ? -6.384  70.890  90.440  1.00 24.74 ? 434  THR B OG1   1 
ATOM   5611  C  CG2   . THR F 2 245 ? -7.629  72.183  92.064  1.00 24.27 ? 434  THR B CG2   1 
ATOM   5612  N  N     . PHE F 2 246 ? -5.446  68.344  93.145  1.00 26.88 ? 435  PHE B N     1 
ATOM   5613  C  CA    . PHE F 2 246 ? -4.844  67.043  92.958  1.00 26.94 ? 435  PHE B CA    1 
ATOM   5614  C  C     . PHE F 2 246 ? -5.801  65.971  93.436  1.00 27.71 ? 435  PHE B C     1 
ATOM   5615  O  O     . PHE F 2 246 ? -5.803  65.600  94.606  1.00 27.07 ? 435  PHE B O     1 
ATOM   5616  C  CB    . PHE F 2 246 ? -3.512  66.956  93.722  1.00 27.20 ? 435  PHE B CB    1 
ATOM   5617  C  CG    . PHE F 2 246 ? -2.323  66.580  92.849  1.00 28.75 ? 435  PHE B CG    1 
ATOM   5618  C  CD1   . PHE F 2 246 ? -2.332  65.396  92.102  1.00 28.52 ? 435  PHE B CD1   1 
ATOM   5619  C  CD2   . PHE F 2 246 ? -1.184  67.387  92.810  1.00 27.40 ? 435  PHE B CD2   1 
ATOM   5620  C  CE1   . PHE F 2 246 ? -1.219  65.022  91.333  1.00 29.67 ? 435  PHE B CE1   1 
ATOM   5621  C  CE2   . PHE F 2 246 ? -0.062  67.026  92.047  1.00 27.99 ? 435  PHE B CE2   1 
ATOM   5622  C  CZ    . PHE F 2 246 ? -0.072  65.845  91.307  1.00 27.66 ? 435  PHE B CZ    1 
ATOM   5623  N  N     . PRO F 2 247 ? -6.654  65.475  92.524  1.00 29.47 ? 436  PRO B N     1 
ATOM   5624  C  CA    . PRO F 2 247 ? -7.620  64.426  92.871  1.00 29.80 ? 436  PRO B CA    1 
ATOM   5625  C  C     . PRO F 2 247 ? -6.850  63.224  93.421  1.00 30.20 ? 436  PRO B C     1 
ATOM   5626  O  O     . PRO F 2 247 ? -5.704  62.987  93.037  1.00 29.68 ? 436  PRO B O     1 
ATOM   5627  C  CB    . PRO F 2 247 ? -8.296  64.117  91.534  1.00 30.18 ? 436  PRO B CB    1 
ATOM   5628  C  CG    . PRO F 2 247 ? -8.186  65.459  90.766  1.00 29.58 ? 436  PRO B CG    1 
ATOM   5629  C  CD    . PRO F 2 247 ? -6.771  65.869  91.102  1.00 29.16 ? 436  PRO B CD    1 
ATOM   5630  N  N     . GLU F 2 248 ? -7.474  62.478  94.321  1.00 30.39 ? 437  GLU B N     1 
ATOM   5631  C  CA    . GLU F 2 248 ? -6.837  61.318  94.915  1.00 32.14 ? 437  GLU B CA    1 
ATOM   5632  C  C     . GLU F 2 248 ? -6.307  60.301  93.893  1.00 32.09 ? 437  GLU B C     1 
ATOM   5633  O  O     . GLU F 2 248 ? -5.180  59.843  94.015  1.00 31.12 ? 437  GLU B O     1 
ATOM   5634  C  CB    . GLU F 2 248 ? -7.812  60.614  95.866  1.00 34.38 ? 437  GLU B CB    1 
ATOM   5635  C  CG    . GLU F 2 248 ? -7.143  59.619  96.807  1.00 39.17 ? 437  GLU B CG    1 
ATOM   5636  C  CD    . GLU F 2 248 ? -7.920  58.301  96.957  1.00 41.99 ? 437  GLU B CD    1 
ATOM   5637  O  OE1   . GLU F 2 248 ? -7.843  57.448  96.040  1.00 43.44 ? 437  GLU B OE1   1 
ATOM   5638  O  OE2   . GLU F 2 248 ? -8.609  58.124  97.988  1.00 42.44 ? 437  GLU B OE2   1 
ATOM   5639  N  N     . GLU F 2 249 ? -7.103  59.941  92.891  1.00 32.28 ? 438  GLU B N     1 
ATOM   5640  C  CA    . GLU F 2 249 ? -6.633  58.950  91.931  1.00 33.86 ? 438  GLU B CA    1 
ATOM   5641  C  C     . GLU F 2 249 ? -5.413  59.414  91.120  1.00 32.53 ? 438  GLU B C     1 
ATOM   5642  O  O     . GLU F 2 249 ? -4.565  58.599  90.743  1.00 31.42 ? 438  GLU B O     1 
ATOM   5643  C  CB    . GLU F 2 249 ? -7.763  58.510  90.991  1.00 37.72 ? 438  GLU B CB    1 
ATOM   5644  C  CG    . GLU F 2 249 ? -7.323  57.397  89.999  1.00 44.66 ? 438  GLU B CG    1 
ATOM   5645  C  CD    . GLU F 2 249 ? -6.521  56.253  90.671  1.00 48.21 ? 438  GLU B CD    1 
ATOM   5646  O  OE1   . GLU F 2 249 ? -7.061  55.591  91.591  1.00 50.80 ? 438  GLU B OE1   1 
ATOM   5647  O  OE2   . GLU F 2 249 ? -5.347  56.005  90.285  1.00 49.46 ? 438  GLU B OE2   1 
ATOM   5648  N  N     . ILE F 2 250 ? -5.309  60.712  90.851  1.00 30.00 ? 439  ILE B N     1 
ATOM   5649  C  CA    . ILE F 2 250 ? -4.148  61.181  90.120  1.00 28.47 ? 439  ILE B CA    1 
ATOM   5650  C  C     . ILE F 2 250 ? -2.945  61.205  91.069  1.00 26.98 ? 439  ILE B C     1 
ATOM   5651  O  O     . ILE F 2 250 ? -1.818  60.924  90.644  1.00 26.61 ? 439  ILE B O     1 
ATOM   5652  C  CB    . ILE F 2 250 ? -4.378  62.576  89.490  1.00 29.54 ? 439  ILE B CB    1 
ATOM   5653  C  CG1   . ILE F 2 250 ? -5.595  62.527  88.550  1.00 30.50 ? 439  ILE B CG1   1 
ATOM   5654  C  CG2   . ILE F 2 250 ? -3.157  62.981  88.687  1.00 28.07 ? 439  ILE B CG2   1 
ATOM   5655  C  CD1   . ILE F 2 250 ? -5.747  63.762  87.660  1.00 31.42 ? 439  ILE B CD1   1 
ATOM   5656  N  N     . GLN F 2 251 ? -3.177  61.511  92.346  1.00 24.59 ? 440  GLN B N     1 
ATOM   5657  C  CA    . GLN F 2 251 ? -2.079  61.516  93.312  1.00 24.91 ? 440  GLN B CA    1 
ATOM   5658  C  C     . GLN F 2 251 ? -1.460  60.125  93.386  1.00 24.81 ? 440  GLN B C     1 
ATOM   5659  O  O     . GLN F 2 251 ? -0.241  59.964  93.509  1.00 23.88 ? 440  GLN B O     1 
ATOM   5660  C  CB    . GLN F 2 251 ? -2.558  61.906  94.712  1.00 24.87 ? 440  GLN B CB    1 
ATOM   5661  C  CG    . GLN F 2 251 ? -2.848  63.375  94.901  1.00 24.68 ? 440  GLN B CG    1 
ATOM   5662  C  CD    . GLN F 2 251 ? -3.119  63.720  96.347  1.00 24.79 ? 440  GLN B CD    1 
ATOM   5663  O  OE1   . GLN F 2 251 ? -2.317  63.406  97.240  1.00 24.67 ? 440  GLN B OE1   1 
ATOM   5664  N  NE2   . GLN F 2 251 ? -4.252  64.379  96.593  1.00 23.95 ? 440  GLN B NE2   1 
ATOM   5665  N  N     . ARG F 2 252 ? -2.308  59.112  93.322  1.00 25.49 ? 441  ARG B N     1 
ATOM   5666  C  CA    . ARG F 2 252 ? -1.815  57.744  93.371  1.00 27.24 ? 441  ARG B CA    1 
ATOM   5667  C  C     . ARG F 2 252 ? -1.039  57.444  92.081  1.00 28.21 ? 441  ARG B C     1 
ATOM   5668  O  O     . ARG F 2 252 ? 0.045   56.878  92.129  1.00 28.60 ? 441  ARG B O     1 
ATOM   5669  C  CB    . ARG F 2 252 ? -2.992  56.765  93.569  1.00 27.19 ? 441  ARG B CB    1 
ATOM   5670  C  CG    . ARG F 2 252 ? -3.636  56.825  94.966  1.00 24.80 ? 441  ARG B CG    1 
ATOM   5671  C  CD    . ARG F 2 252 ? -4.733  55.778  95.113  1.00 24.30 ? 441  ARG B CD    1 
ATOM   5672  N  NE    . ARG F 2 252 ? -5.485  55.929  96.353  1.00 22.48 ? 441  ARG B NE    1 
ATOM   5673  C  CZ    . ARG F 2 252 ? -5.020  55.649  97.564  1.00 22.57 ? 441  ARG B CZ    1 
ATOM   5674  N  NH1   . ARG F 2 252 ? -3.787  55.181  97.725  1.00 22.10 ? 441  ARG B NH1   1 
ATOM   5675  N  NH2   . ARG F 2 252 ? -5.784  55.864  98.622  1.00 22.75 ? 441  ARG B NH2   1 
ATOM   5676  N  N     . MET F 2 253 ? -1.584  57.850  90.934  1.00 30.61 ? 442  MET B N     1 
ATOM   5677  C  CA    . MET F 2 253 ? -0.916  57.638  89.641  1.00 32.33 ? 442  MET B CA    1 
ATOM   5678  C  C     . MET F 2 253 ? 0.478   58.256  89.620  1.00 31.13 ? 442  MET B C     1 
ATOM   5679  O  O     . MET F 2 253 ? 1.393   57.701  89.010  1.00 31.10 ? 442  MET B O     1 
ATOM   5680  C  CB    . MET F 2 253 ? -1.733  58.237  88.479  1.00 33.90 ? 442  MET B CB    1 
ATOM   5681  C  CG    . MET F 2 253 ? -2.985  57.451  88.096  1.00 39.22 ? 442  MET B CG    1 
ATOM   5682  S  SD    . MET F 2 253 ? -3.900  58.141  86.635  1.00 45.85 ? 442  MET B SD    1 
ATOM   5683  C  CE    . MET F 2 253 ? -5.348  58.866  87.428  1.00 44.64 ? 442  MET B CE    1 
ATOM   5684  N  N     . ALA F 2 254 ? 0.623   59.405  90.278  1.00 29.86 ? 443  ALA B N     1 
ATOM   5685  C  CA    . ALA F 2 254 ? 1.894   60.136  90.340  1.00 28.92 ? 443  ALA B CA    1 
ATOM   5686  C  C     . ALA F 2 254 ? 3.048   59.300  90.876  1.00 28.06 ? 443  ALA B C     1 
ATOM   5687  O  O     . ALA F 2 254 ? 4.206   59.518  90.521  1.00 26.02 ? 443  ALA B O     1 
ATOM   5688  C  CB    . ALA F 2 254 ? 1.730   61.388  91.203  1.00 27.45 ? 443  ALA B CB    1 
ATOM   5689  N  N     . GLY F 2 255 ? 2.725   58.353  91.745  1.00 29.15 ? 444  GLY B N     1 
ATOM   5690  C  CA    . GLY F 2 255 ? 3.749   57.504  92.321  1.00 30.58 ? 444  GLY B CA    1 
ATOM   5691  C  C     . GLY F 2 255 ? 4.594   56.851  91.257  1.00 32.45 ? 444  GLY B C     1 
ATOM   5692  O  O     . GLY F 2 255 ? 5.777   56.626  91.456  1.00 34.14 ? 444  GLY B O     1 
ATOM   5693  N  N     . GLU F 2 256 ? 4.004   56.550  90.111  1.00 34.04 ? 445  GLU B N     1 
ATOM   5694  C  CA    . GLU F 2 256 ? 4.773   55.924  89.046  1.00 36.42 ? 445  GLU B CA    1 
ATOM   5695  C  C     . GLU F 2 256 ? 5.969   56.758  88.565  1.00 35.93 ? 445  GLU B C     1 
ATOM   5696  O  O     . GLU F 2 256 ? 6.913   56.217  87.973  1.00 36.69 ? 445  GLU B O     1 
ATOM   5697  C  CB    . GLU F 2 256 ? 3.849   55.597  87.868  1.00 39.57 ? 445  GLU B CB    1 
ATOM   5698  C  CG    . GLU F 2 256 ? 2.958   54.372  88.109  1.00 44.53 ? 445  GLU B CG    1 
ATOM   5699  C  CD    . GLU F 2 256 ? 1.860   54.210  87.066  1.00 47.06 ? 445  GLU B CD    1 
ATOM   5700  O  OE1   . GLU F 2 256 ? 0.784   54.832  87.223  1.00 49.23 ? 445  GLU B OE1   1 
ATOM   5701  O  OE2   . GLU F 2 256 ? 2.077   53.465  86.083  1.00 49.47 ? 445  GLU B OE2   1 
ATOM   5702  N  N     . PHE F 2 257 ? 5.950   58.064  88.820  1.00 34.45 ? 446  PHE B N     1 
ATOM   5703  C  CA    . PHE F 2 257 ? 7.044   58.923  88.372  1.00 33.17 ? 446  PHE B CA    1 
ATOM   5704  C  C     . PHE F 2 257 ? 7.818   59.552  89.503  1.00 32.56 ? 446  PHE B C     1 
ATOM   5705  O  O     . PHE F 2 257 ? 8.771   60.288  89.263  1.00 32.73 ? 446  PHE B O     1 
ATOM   5706  C  CB    . PHE F 2 257 ? 6.518   60.048  87.488  1.00 33.58 ? 446  PHE B CB    1 
ATOM   5707  C  CG    . PHE F 2 257 ? 5.719   59.576  86.328  1.00 33.58 ? 446  PHE B CG    1 
ATOM   5708  C  CD1   . PHE F 2 257 ? 4.405   59.996  86.164  1.00 34.77 ? 446  PHE B CD1   1 
ATOM   5709  C  CD2   . PHE F 2 257 ? 6.270   58.700  85.398  1.00 34.43 ? 446  PHE B CD2   1 
ATOM   5710  C  CE1   . PHE F 2 257 ? 3.639   59.551  85.090  1.00 34.83 ? 446  PHE B CE1   1 
ATOM   5711  C  CE2   . PHE F 2 257 ? 5.520   58.248  84.321  1.00 34.83 ? 446  PHE B CE2   1 
ATOM   5712  C  CZ    . PHE F 2 257 ? 4.197   58.674  84.165  1.00 35.16 ? 446  PHE B CZ    1 
ATOM   5713  N  N     . LEU F 2 258 ? 7.407   59.273  90.733  1.00 32.22 ? 447  LEU B N     1 
ATOM   5714  C  CA    . LEU F 2 258 ? 8.073   59.848  91.892  1.00 31.58 ? 447  LEU B CA    1 
ATOM   5715  C  C     . LEU F 2 258 ? 8.825   58.800  92.701  1.00 32.36 ? 447  LEU B C     1 
ATOM   5716  O  O     . LEU F 2 258 ? 8.408   57.660  92.789  1.00 33.29 ? 447  LEU B O     1 
ATOM   5717  C  CB    . LEU F 2 258 ? 7.038   60.551  92.771  1.00 29.53 ? 447  LEU B CB    1 
ATOM   5718  C  CG    . LEU F 2 258 ? 6.245   61.633  92.038  1.00 28.16 ? 447  LEU B CG    1 
ATOM   5719  C  CD1   . LEU F 2 258 ? 5.080   62.071  92.867  1.00 28.13 ? 447  LEU B CD1   1 
ATOM   5720  C  CD2   . LEU F 2 258 ? 7.148   62.798  91.734  1.00 27.27 ? 447  LEU B CD2   1 
ATOM   5721  N  N     . LYS F 2 259 ? 9.947   59.193  93.283  1.00 33.05 ? 448  LYS B N     1 
ATOM   5722  C  CA    . LYS F 2 259 ? 10.730  58.278  94.086  1.00 33.13 ? 448  LYS B CA    1 
ATOM   5723  C  C     . LYS F 2 259 ? 10.909  58.875  95.456  1.00 31.86 ? 448  LYS B C     1 
ATOM   5724  O  O     . LYS F 2 259 ? 11.352  60.020  95.570  1.00 31.58 ? 448  LYS B O     1 
ATOM   5725  C  CB    . LYS F 2 259 ? 12.100  58.077  93.467  1.00 35.63 ? 448  LYS B CB    1 
ATOM   5726  C  CG    . LYS F 2 259 ? 12.052  57.462  92.097  1.00 40.68 ? 448  LYS B CG    1 
ATOM   5727  C  CD    . LYS F 2 259 ? 13.405  57.605  91.405  1.00 44.98 ? 448  LYS B CD    1 
ATOM   5728  C  CE    . LYS F 2 259 ? 13.383  57.018  89.997  1.00 47.07 ? 448  LYS B CE    1 
ATOM   5729  N  NZ    . LYS F 2 259 ? 14.521  57.562  89.180  1.00 50.15 ? 448  LYS B NZ    1 
ATOM   5730  N  N     . ASN F 2 260 ? 10.558  58.102  96.484  1.00 30.17 ? 449  ASN B N     1 
ATOM   5731  C  CA    . ASN F 2 260 ? 10.710  58.522  97.875  1.00 29.10 ? 449  ASN B CA    1 
ATOM   5732  C  C     . ASN F 2 260 ? 10.368  60.000  97.985  1.00 27.56 ? 449  ASN B C     1 
ATOM   5733  O  O     . ASN F 2 260 ? 11.133  60.769  98.564  1.00 26.89 ? 449  ASN B O     1 
ATOM   5734  C  CB    . ASN F 2 260 ? 12.165  58.321  98.302  1.00 29.77 ? 449  ASN B CB    1 
ATOM   5735  C  CG    . ASN F 2 260 ? 12.374  58.543  99.777  1.00 31.34 ? 449  ASN B CG    1 
ATOM   5736  O  OD1   . ASN F 2 260 ? 13.457  58.946  100.215 1.00 33.59 ? 449  ASN B OD1   1 
ATOM   5737  N  ND2   . ASN F 2 260 ? 11.345  58.268  100.561 1.00 32.13 ? 449  ASN B ND2   1 
ATOM   5738  N  N     . TYR F 2 261 ? 9.212   60.392  97.465  1.00 25.72 ? 450  TYR B N     1 
ATOM   5739  C  CA    . TYR F 2 261 ? 8.867   61.807  97.445  1.00 25.43 ? 450  TYR B CA    1 
ATOM   5740  C  C     . TYR F 2 261 ? 8.330   62.479  98.693  1.00 25.42 ? 450  TYR B C     1 
ATOM   5741  O  O     . TYR F 2 261 ? 7.789   61.851  99.602  1.00 25.46 ? 450  TYR B O     1 
ATOM   5742  C  CB    . TYR F 2 261 ? 7.923   62.103  96.267  1.00 24.60 ? 450  TYR B CB    1 
ATOM   5743  C  CG    . TYR F 2 261 ? 6.469   61.731  96.481  1.00 24.21 ? 450  TYR B CG    1 
ATOM   5744  C  CD1   . TYR F 2 261 ? 5.562   62.642  97.033  1.00 22.93 ? 450  TYR B CD1   1 
ATOM   5745  C  CD2   . TYR F 2 261 ? 5.990   60.480  96.089  1.00 23.38 ? 450  TYR B CD2   1 
ATOM   5746  C  CE1   . TYR F 2 261 ? 4.206   62.306  97.174  1.00 22.21 ? 450  TYR B CE1   1 
ATOM   5747  C  CE2   . TYR F 2 261 ? 4.651   60.140  96.233  1.00 22.31 ? 450  TYR B CE2   1 
ATOM   5748  C  CZ    . TYR F 2 261 ? 3.765   61.046  96.767  1.00 22.02 ? 450  TYR B CZ    1 
ATOM   5749  O  OH    . TYR F 2 261 ? 2.432   60.687  96.854  1.00 24.20 ? 450  TYR B OH    1 
ATOM   5750  N  N     . VAL F 2 262 ? 8.522   63.789  98.717  1.00 24.30 ? 451  VAL B N     1 
ATOM   5751  C  CA    . VAL F 2 262 ? 8.043   64.607  99.793  1.00 23.03 ? 451  VAL B CA    1 
ATOM   5752  C  C     . VAL F 2 262 ? 6.732   65.190  99.296  1.00 23.66 ? 451  VAL B C     1 
ATOM   5753  O  O     . VAL F 2 262 ? 6.620   65.602  98.131  1.00 23.72 ? 451  VAL B O     1 
ATOM   5754  C  CB    . VAL F 2 262 ? 9.037   65.741  100.123 1.00 22.67 ? 451  VAL B CB    1 
ATOM   5755  C  CG1   . VAL F 2 262 ? 8.443   66.684  101.169 1.00 19.55 ? 451  VAL B CG1   1 
ATOM   5756  C  CG2   . VAL F 2 262 ? 10.339  65.129  100.636 1.00 21.82 ? 451  VAL B CG2   1 
ATOM   5757  N  N     . PHE F 2 263 ? 5.736   65.171  100.171 1.00 22.95 ? 452  PHE B N     1 
ATOM   5758  C  CA    . PHE F 2 263 ? 4.426   65.718  99.868  1.00 23.99 ? 452  PHE B CA    1 
ATOM   5759  C  C     . PHE F 2 263 ? 4.208   66.972  100.717 1.00 23.74 ? 452  PHE B C     1 
ATOM   5760  O  O     . PHE F 2 263 ? 4.429   66.961  101.932 1.00 23.20 ? 452  PHE B O     1 
ATOM   5761  C  CB    . PHE F 2 263 ? 3.318   64.702  100.211 1.00 23.94 ? 452  PHE B CB    1 
ATOM   5762  C  CG    . PHE F 2 263 ? 1.920   65.240  100.050 1.00 22.71 ? 452  PHE B CG    1 
ATOM   5763  C  CD1   . PHE F 2 263 ? 1.360   65.390  98.785  1.00 22.67 ? 452  PHE B CD1   1 
ATOM   5764  C  CD2   . PHE F 2 263 ? 1.174   65.635  101.171 1.00 23.69 ? 452  PHE B CD2   1 
ATOM   5765  C  CE1   . PHE F 2 263 ? 0.071   65.935  98.623  1.00 23.27 ? 452  PHE B CE1   1 
ATOM   5766  C  CE2   . PHE F 2 263 ? -0.115  66.179  101.030 1.00 22.54 ? 452  PHE B CE2   1 
ATOM   5767  C  CZ    . PHE F 2 263 ? -0.668  66.330  99.747  1.00 22.80 ? 452  PHE B CZ    1 
ATOM   5768  N  N     . VAL F 2 264 ? 3.807   68.063  100.087 1.00 23.85 ? 453  VAL B N     1 
ATOM   5769  C  CA    . VAL F 2 264 ? 3.505   69.239  100.873 1.00 24.43 ? 453  VAL B CA    1 
ATOM   5770  C  C     . VAL F 2 264 ? 2.184   69.824  100.410 1.00 24.65 ? 453  VAL B C     1 
ATOM   5771  O  O     . VAL F 2 264 ? 1.922   69.959  99.219  1.00 23.61 ? 453  VAL B O     1 
ATOM   5772  C  CB    . VAL F 2 264 ? 4.644   70.289  100.839 1.00 24.91 ? 453  VAL B CB    1 
ATOM   5773  C  CG1   . VAL F 2 264 ? 5.391   70.184  99.578  1.00 27.12 ? 453  VAL B CG1   1 
ATOM   5774  C  CG2   . VAL F 2 264 ? 4.080   71.709  101.037 1.00 24.02 ? 453  VAL B CG2   1 
ATOM   5775  N  N     . ALA F 2 265 ? 1.329   70.102  101.383 1.00 24.56 ? 454  ALA B N     1 
ATOM   5776  C  CA    . ALA F 2 265 ? 0.028   70.697  101.131 1.00 25.96 ? 454  ALA B CA    1 
ATOM   5777  C  C     . ALA F 2 265 ? -0.095  71.958  101.990 1.00 26.11 ? 454  ALA B C     1 
ATOM   5778  O  O     . ALA F 2 265 ? 0.035   71.912  103.214 1.00 25.59 ? 454  ALA B O     1 
ATOM   5779  C  CB    . ALA F 2 265 ? -1.106  69.701  101.485 1.00 25.14 ? 454  ALA B CB    1 
ATOM   5780  N  N     . ILE F 2 266 ? -0.313  73.088  101.333 1.00 27.21 ? 455  ILE B N     1 
ATOM   5781  C  CA    . ILE F 2 266 ? -0.493  74.340  102.035 1.00 27.31 ? 455  ILE B CA    1 
ATOM   5782  C  C     . ILE F 2 266 ? -2.001  74.520  102.059 1.00 28.65 ? 455  ILE B C     1 
ATOM   5783  O  O     . ILE F 2 266 ? -2.605  74.984  101.093 1.00 29.31 ? 455  ILE B O     1 
ATOM   5784  C  CB    . ILE F 2 266 ? 0.145   75.508  101.274 1.00 27.53 ? 455  ILE B CB    1 
ATOM   5785  C  CG1   . ILE F 2 266 ? 1.615   75.202  100.989 1.00 25.69 ? 455  ILE B CG1   1 
ATOM   5786  C  CG2   . ILE F 2 266 ? 0.009   76.782  102.091 1.00 26.80 ? 455  ILE B CG2   1 
ATOM   5787  C  CD1   . ILE F 2 266 ? 2.450   74.882  102.234 1.00 24.38 ? 455  ILE B CD1   1 
ATOM   5788  N  N     . GLY F 2 267 ? -2.618  74.124  103.163 1.00 30.63 ? 456  GLY B N     1 
ATOM   5789  C  CA    . GLY F 2 267 ? -4.055  74.240  103.260 1.00 31.36 ? 456  GLY B CA    1 
ATOM   5790  C  C     . GLY F 2 267 ? -4.695  73.003  102.680 1.00 32.59 ? 456  GLY B C     1 
ATOM   5791  O  O     . GLY F 2 267 ? -4.032  71.995  102.435 1.00 33.16 ? 456  GLY B O     1 
ATOM   5792  N  N     . ILE F 2 268 ? -5.993  73.083  102.442 1.00 34.04 ? 457  ILE B N     1 
ATOM   5793  C  CA    . ILE F 2 268 ? -6.732  71.961  101.897 1.00 34.19 ? 457  ILE B CA    1 
ATOM   5794  C  C     . ILE F 2 268 ? -6.493  71.771  100.411 1.00 33.20 ? 457  ILE B C     1 
ATOM   5795  O  O     . ILE F 2 268 ? -6.692  72.679  99.607  1.00 33.29 ? 457  ILE B O     1 
ATOM   5796  C  CB    . ILE F 2 268 ? -8.238  72.126  102.192 1.00 35.77 ? 457  ILE B CB    1 
ATOM   5797  C  CG1   . ILE F 2 268 ? -8.478  71.811  103.676 1.00 36.09 ? 457  ILE B CG1   1 
ATOM   5798  C  CG2   . ILE F 2 268 ? -9.074  71.243  101.266 1.00 34.95 ? 457  ILE B CG2   1 
ATOM   5799  C  CD1   . ILE F 2 268 ? -9.935  71.654  104.055 1.00 38.61 ? 457  ILE B CD1   1 
ATOM   5800  N  N     . VAL F 2 269 ? -6.054  70.571  100.057 1.00 32.84 ? 458  VAL B N     1 
ATOM   5801  C  CA    . VAL F 2 269 ? -5.774  70.238  98.666  1.00 32.20 ? 458  VAL B CA    1 
ATOM   5802  C  C     . VAL F 2 269 ? -7.005  70.455  97.807  1.00 31.41 ? 458  VAL B C     1 
ATOM   5803  O  O     . VAL F 2 269 ? -8.033  69.823  98.017  1.00 31.36 ? 458  VAL B O     1 
ATOM   5804  C  CB    . VAL F 2 269 ? -5.348  68.763  98.526  1.00 32.29 ? 458  VAL B CB    1 
ATOM   5805  C  CG1   . VAL F 2 269 ? -5.131  68.426  97.068  1.00 32.34 ? 458  VAL B CG1   1 
ATOM   5806  C  CG2   . VAL F 2 269 ? -4.086  68.514  99.312  1.00 32.02 ? 458  VAL B CG2   1 
ATOM   5807  N  N     . GLY F 2 270 ? -6.900  71.356  96.842  1.00 31.36 ? 459  GLY B N     1 
ATOM   5808  C  CA    . GLY F 2 270 ? -8.016  71.603  95.951  1.00 31.13 ? 459  GLY B CA    1 
ATOM   5809  C  C     . GLY F 2 270 ? -8.940  72.734  96.366  1.00 31.04 ? 459  GLY B C     1 
ATOM   5810  O  O     . GLY F 2 270 ? -9.843  73.094  95.614  1.00 31.06 ? 459  GLY B O     1 
ATOM   5811  N  N     . GLY F 2 271 ? -8.715  73.301  97.547  1.00 30.55 ? 460  GLY B N     1 
ATOM   5812  C  CA    . GLY F 2 271 ? -9.569  74.375  98.021  1.00 29.88 ? 460  GLY B CA    1 
ATOM   5813  C  C     . GLY F 2 271 ? -9.375  75.656  97.245  1.00 30.07 ? 460  GLY B C     1 
ATOM   5814  O  O     . GLY F 2 271 ? -8.305  75.900  96.686  1.00 30.12 ? 460  GLY B O     1 
ATOM   5815  N  N     . ALA F 2 272 ? -10.418 76.474  97.202  1.00 30.71 ? 461  ALA B N     1 
ATOM   5816  C  CA    . ALA F 2 272 ? -10.371 77.753  96.505  1.00 31.89 ? 461  ALA B CA    1 
ATOM   5817  C  C     . ALA F 2 272 ? -9.606  78.817  97.304  1.00 32.89 ? 461  ALA B C     1 
ATOM   5818  O  O     . ALA F 2 272 ? -9.471  78.726  98.518  1.00 33.21 ? 461  ALA B O     1 
ATOM   5819  C  CB    . ALA F 2 272 ? -11.787 78.236  96.225  1.00 30.40 ? 461  ALA B CB    1 
ATOM   5820  N  N     . CYS F 2 273 ? -9.113  79.829  96.605  1.00 34.87 ? 462  CYS B N     1 
ATOM   5821  C  CA    . CYS F 2 273 ? -8.381  80.922  97.233  1.00 37.43 ? 462  CYS B CA    1 
ATOM   5822  C  C     . CYS F 2 273 ? -9.388  81.800  97.974  1.00 38.47 ? 462  CYS B C     1 
ATOM   5823  O  O     . CYS F 2 273 ? -10.295 82.364  97.363  1.00 38.91 ? 462  CYS B O     1 
ATOM   5824  C  CB    . CYS F 2 273 ? -7.671  81.730  96.150  1.00 38.32 ? 462  CYS B CB    1 
ATOM   5825  S  SG    . CYS F 2 273 ? -6.840  83.239  96.696  1.00 40.87 ? 462  CYS B SG    1 
ATOM   5826  N  N     . SER F 2 274 ? -9.233  81.928  99.287  1.00 39.90 ? 463  SER B N     1 
ATOM   5827  C  CA    . SER F 2 274 ? -10.176 82.725  100.071 1.00 40.66 ? 463  SER B CA    1 
ATOM   5828  C  C     . SER F 2 274 ? -10.159 84.218  99.751  1.00 41.89 ? 463  SER B C     1 
ATOM   5829  O  O     . SER F 2 274 ? -11.071 84.934  100.145 1.00 42.12 ? 463  SER B O     1 
ATOM   5830  C  CB    . SER F 2 274 ? -9.926  82.532  101.564 1.00 39.39 ? 463  SER B CB    1 
ATOM   5831  O  OG    . SER F 2 274 ? -8.708  83.137  101.951 1.00 39.59 ? 463  SER B OG    1 
ATOM   5832  N  N     . ASP F 2 275 ? -9.139  84.692  99.042  1.00 43.00 ? 464  ASP B N     1 
ATOM   5833  C  CA    . ASP F 2 275 ? -9.065  86.113  98.712  1.00 44.50 ? 464  ASP B CA    1 
ATOM   5834  C  C     . ASP F 2 275 ? -9.958  86.528  97.551  1.00 45.01 ? 464  ASP B C     1 
ATOM   5835  O  O     . ASP F 2 275 ? -9.921  87.677  97.097  1.00 45.10 ? 464  ASP B O     1 
ATOM   5836  C  CB    . ASP F 2 275 ? -7.628  86.522  98.404  1.00 45.57 ? 464  ASP B CB    1 
ATOM   5837  C  CG    . ASP F 2 275 ? -6.707  86.313  99.581  1.00 46.45 ? 464  ASP B CG    1 
ATOM   5838  O  OD1   . ASP F 2 275 ? -7.139  86.592  100.724 1.00 45.83 ? 464  ASP B OD1   1 
ATOM   5839  O  OD2   . ASP F 2 275 ? -5.554  85.876  99.355  1.00 47.85 ? 464  ASP B OD2   1 
ATOM   5840  N  N     . VAL F 2 276 ? -10.755 85.591  97.057  1.00 45.49 ? 465  VAL B N     1 
ATOM   5841  C  CA    . VAL F 2 276 ? -11.664 85.905  95.965  1.00 45.49 ? 465  VAL B CA    1 
ATOM   5842  C  C     . VAL F 2 276 ? -13.087 85.699  96.457  1.00 44.77 ? 465  VAL B C     1 
ATOM   5843  O  O     . VAL F 2 276 ? -13.457 84.593  96.872  1.00 43.97 ? 465  VAL B O     1 
ATOM   5844  C  CB    . VAL F 2 276 ? -11.387 85.021  94.714  1.00 45.62 ? 465  VAL B CB    1 
ATOM   5845  C  CG1   . VAL F 2 276 ? -11.470 83.553  95.081  1.00 46.18 ? 465  VAL B CG1   1 
ATOM   5846  C  CG2   . VAL F 2 276 ? -12.385 85.362  93.604  1.00 45.46 ? 465  VAL B CG2   1 
ATOM   5847  N  N     . LYS F 2 277 ? -13.870 86.777  96.442  1.00 45.10 ? 466  LYS B N     1 
ATOM   5848  C  CA    . LYS F 2 277 ? -15.260 86.715  96.890  1.00 45.77 ? 466  LYS B CA    1 
ATOM   5849  C  C     . LYS F 2 277 ? -16.076 86.040  95.793  1.00 45.34 ? 466  LYS B C     1 
ATOM   5850  O  O     . LYS F 2 277 ? -16.120 86.507  94.656  1.00 45.41 ? 466  LYS B O     1 
ATOM   5851  C  CB    . LYS F 2 277 ? -15.803 88.121  97.165  1.00 47.10 ? 466  LYS B CB    1 
ATOM   5852  C  CG    . LYS F 2 277 ? -16.740 88.209  98.381  1.00 49.64 ? 466  LYS B CG    1 
ATOM   5853  C  CD    . LYS F 2 277 ? -17.885 87.194  98.325  1.00 50.73 ? 466  LYS B CD    1 
ATOM   5854  C  CE    . LYS F 2 277 ? -18.797 87.279  99.552  1.00 51.73 ? 466  LYS B CE    1 
ATOM   5855  N  NZ    . LYS F 2 277 ? -18.128 86.894  100.836 1.00 52.36 ? 466  LYS B NZ    1 
ATOM   5856  N  N     . GLN F 2 278 ? -16.721 84.939  96.144  1.00 44.91 ? 467  GLN B N     1 
ATOM   5857  C  CA    . GLN F 2 278 ? -17.498 84.174  95.189  1.00 45.51 ? 467  GLN B CA    1 
ATOM   5858  C  C     . GLN F 2 278 ? -19.004 84.383  95.269  1.00 46.13 ? 467  GLN B C     1 
ATOM   5859  O  O     . GLN F 2 278 ? -19.608 84.254  96.331  1.00 46.16 ? 467  GLN B O     1 
ATOM   5860  C  CB    . GLN F 2 278 ? -17.168 82.688  95.367  1.00 45.12 ? 467  GLN B CB    1 
ATOM   5861  C  CG    . GLN F 2 278 ? -15.708 82.361  95.077  1.00 43.55 ? 467  GLN B CG    1 
ATOM   5862  C  CD    . GLN F 2 278 ? -15.250 81.087  95.743  1.00 42.85 ? 467  GLN B CD    1 
ATOM   5863  O  OE1   . GLN F 2 278 ? -15.817 80.014  95.524  1.00 42.63 ? 467  GLN B OE1   1 
ATOM   5864  N  NE2   . GLN F 2 278 ? -14.215 81.196  96.569  1.00 42.11 ? 467  GLN B NE2   1 
ATOM   5865  N  N     . THR F 2 279 ? -19.601 84.688  94.122  1.00 47.04 ? 468  THR B N     1 
ATOM   5866  C  CA    . THR F 2 279 ? -21.039 84.899  94.017  1.00 47.63 ? 468  THR B CA    1 
ATOM   5867  C  C     . THR F 2 279 ? -21.615 83.926  92.991  1.00 48.22 ? 468  THR B C     1 
ATOM   5868  O  O     . THR F 2 279 ? -21.169 83.896  91.847  1.00 47.97 ? 468  THR B O     1 
ATOM   5869  C  CB    . THR F 2 279 ? -21.353 86.322  93.552  1.00 47.76 ? 468  THR B CB    1 
ATOM   5870  O  OG1   . THR F 2 279 ? -20.771 87.260  94.459  1.00 48.58 ? 468  THR B OG1   1 
ATOM   5871  C  CG2   . THR F 2 279 ? -22.848 86.546  93.503  1.00 48.62 ? 468  THR B CG2   1 
ATOM   5872  N  N     . ILE F 2 280 ? -22.603 83.140  93.405  1.00 49.25 ? 469  ILE B N     1 
ATOM   5873  C  CA    . ILE F 2 280 ? -23.249 82.167  92.527  1.00 50.89 ? 469  ILE B CA    1 
ATOM   5874  C  C     . ILE F 2 280 ? -24.726 82.512  92.278  1.00 51.95 ? 469  ILE B C     1 
ATOM   5875  O  O     . ILE F 2 280 ? -25.547 82.452  93.193  1.00 51.70 ? 469  ILE B O     1 
ATOM   5876  C  CB    . ILE F 2 280 ? -23.203 80.741  93.129  1.00 50.78 ? 469  ILE B CB    1 
ATOM   5877  C  CG1   . ILE F 2 280 ? -21.796 80.430  93.653  1.00 51.30 ? 469  ILE B CG1   1 
ATOM   5878  C  CG2   . ILE F 2 280 ? -23.632 79.720  92.076  1.00 50.33 ? 469  ILE B CG2   1 
ATOM   5879  C  CD1   . ILE F 2 280 ? -20.695 80.556  92.616  1.00 51.01 ? 469  ILE B CD1   1 
ATOM   5880  N  N     . TYR F 2 281 ? -25.054 82.872  91.041  1.00 52.83 ? 470  TYR B N     1 
ATOM   5881  C  CA    . TYR F 2 281 ? -26.426 83.204  90.675  1.00 53.51 ? 470  TYR B CA    1 
ATOM   5882  C  C     . TYR F 2 281 ? -27.081 81.984  90.052  1.00 54.59 ? 470  TYR B C     1 
ATOM   5883  O  O     . TYR F 2 281 ? -26.401 81.135  89.477  1.00 54.88 ? 470  TYR B O     1 
ATOM   5884  C  CB    . TYR F 2 281 ? -26.451 84.333  89.652  1.00 53.36 ? 470  TYR B CB    1 
ATOM   5885  C  CG    . TYR F 2 281 ? -26.019 85.673  90.183  1.00 54.77 ? 470  TYR B CG    1 
ATOM   5886  C  CD1   . TYR F 2 281 ? -25.156 86.483  89.452  1.00 55.27 ? 470  TYR B CD1   1 
ATOM   5887  C  CD2   . TYR F 2 281 ? -26.487 86.147  91.410  1.00 55.36 ? 470  TYR B CD2   1 
ATOM   5888  C  CE1   . TYR F 2 281 ? -24.764 87.737  89.928  1.00 56.03 ? 470  TYR B CE1   1 
ATOM   5889  C  CE2   . TYR F 2 281 ? -26.104 87.400  91.895  1.00 55.07 ? 470  TYR B CE2   1 
ATOM   5890  C  CZ    . TYR F 2 281 ? -25.244 88.188  91.148  1.00 55.70 ? 470  TYR B CZ    1 
ATOM   5891  O  OH    . TYR F 2 281 ? -24.869 89.431  91.609  1.00 56.00 ? 470  TYR B OH    1 
ATOM   5892  N  N     . GLU F 2 282 ? -28.399 81.884  90.175  1.00 55.19 ? 471  GLU B N     1 
ATOM   5893  C  CA    . GLU F 2 282 ? -29.117 80.775  89.563  1.00 55.88 ? 471  GLU B CA    1 
ATOM   5894  C  C     . GLU F 2 282 ? -29.580 81.348  88.222  1.00 55.98 ? 471  GLU B C     1 
ATOM   5895  O  O     . GLU F 2 282 ? -30.190 82.418  88.179  1.00 55.74 ? 471  GLU B O     1 
ATOM   5896  C  CB    . GLU F 2 282 ? -30.309 80.366  90.427  1.00 56.13 ? 471  GLU B CB    1 
ATOM   5897  C  CG    . GLU F 2 282 ? -30.990 79.084  89.976  1.00 56.99 ? 471  GLU B CG    1 
ATOM   5898  C  CD    . GLU F 2 282 ? -32.167 78.697  90.862  1.00 57.19 ? 471  GLU B CD    1 
ATOM   5899  O  OE1   . GLU F 2 282 ? -33.127 79.491  90.952  1.00 57.53 ? 471  GLU B OE1   1 
ATOM   5900  O  OE2   . GLU F 2 282 ? -32.133 77.601  91.468  1.00 57.45 ? 471  GLU B OE2   1 
ATOM   5901  N  N     . VAL F 2 283 ? -29.258 80.668  87.126  1.00 55.83 ? 472  VAL B N     1 
ATOM   5902  C  CA    . VAL F 2 283 ? -29.638 81.163  85.809  1.00 55.90 ? 472  VAL B CA    1 
ATOM   5903  C  C     . VAL F 2 283 ? -29.849 80.040  84.808  1.00 56.41 ? 472  VAL B C     1 
ATOM   5904  O  O     . VAL F 2 283 ? -29.030 79.125  84.710  1.00 56.53 ? 472  VAL B O     1 
ATOM   5905  C  CB    . VAL F 2 283 ? -28.558 82.086  85.219  1.00 55.71 ? 472  VAL B CB    1 
ATOM   5906  C  CG1   . VAL F 2 283 ? -29.072 82.711  83.934  1.00 56.07 ? 472  VAL B CG1   1 
ATOM   5907  C  CG2   . VAL F 2 283 ? -28.156 83.153  86.218  1.00 55.20 ? 472  VAL B CG2   1 
ATOM   5908  N  N     . ASN F 2 284 ? -30.940 80.121  84.052  1.00 56.51 ? 473  ASN B N     1 
ATOM   5909  C  CA    . ASN F 2 284 ? -31.231 79.107  83.048  1.00 56.43 ? 473  ASN B CA    1 
ATOM   5910  C  C     . ASN F 2 284 ? -30.430 79.416  81.798  1.00 55.92 ? 473  ASN B C     1 
ATOM   5911  O  O     . ASN F 2 284 ? -30.070 80.573  81.553  1.00 55.90 ? 473  ASN B O     1 
ATOM   5912  C  CB    . ASN F 2 284 ? -32.724 79.074  82.727  1.00 57.03 ? 473  ASN B CB    1 
ATOM   5913  C  CG    . ASN F 2 284 ? -33.567 78.734  83.942  1.00 57.74 ? 473  ASN B CG    1 
ATOM   5914  O  OD1   . ASN F 2 284 ? -34.203 79.611  84.538  1.00 58.25 ? 473  ASN B OD1   1 
ATOM   5915  N  ND2   . ASN F 2 284 ? -33.561 77.460  84.329  1.00 57.01 ? 473  ASN B ND2   1 
ATOM   5916  N  N     . LYS F 2 285 ? -30.164 78.378  81.010  1.00 55.35 ? 474  LYS B N     1 
ATOM   5917  C  CA    . LYS F 2 285 ? -29.364 78.499  79.794  1.00 54.82 ? 474  LYS B CA    1 
ATOM   5918  C  C     . LYS F 2 285 ? -29.669 79.686  78.883  1.00 54.22 ? 474  LYS B C     1 
ATOM   5919  O  O     . LYS F 2 285 ? -28.758 80.407  78.480  1.00 53.86 ? 474  LYS B O     1 
ATOM   5920  C  CB    . LYS F 2 285 ? -29.450 77.196  78.994  1.00 55.69 ? 474  LYS B CB    1 
ATOM   5921  C  CG    . LYS F 2 285 ? -28.250 76.946  78.092  1.00 56.22 ? 474  LYS B CG    1 
ATOM   5922  C  CD    . LYS F 2 285 ? -27.887 75.464  78.100  1.00 56.98 ? 474  LYS B CD    1 
ATOM   5923  C  CE    . LYS F 2 285 ? -26.451 75.234  77.643  1.00 57.29 ? 474  LYS B CE    1 
ATOM   5924  N  NZ    . LYS F 2 285 ? -25.991 73.854  77.967  1.00 57.73 ? 474  LYS B NZ    1 
ATOM   5925  N  N     . TYR F 2 286 ? -30.941 79.903  78.564  1.00 54.16 ? 475  TYR B N     1 
ATOM   5926  C  CA    . TYR F 2 286 ? -31.321 81.006  77.679  1.00 53.59 ? 475  TYR B CA    1 
ATOM   5927  C  C     . TYR F 2 286 ? -31.177 82.382  78.336  1.00 52.73 ? 475  TYR B C     1 
ATOM   5928  O  O     . TYR F 2 286 ? -31.075 83.405  77.654  1.00 52.35 ? 475  TYR B O     1 
ATOM   5929  C  CB    . TYR F 2 286 ? -32.770 80.807  77.205  1.00 54.83 ? 475  TYR B CB    1 
ATOM   5930  C  CG    . TYR F 2 286 ? -33.823 81.298  78.177  1.00 54.77 ? 475  TYR B CG    1 
ATOM   5931  C  CD1   . TYR F 2 286 ? -34.182 82.648  78.218  1.00 55.46 ? 475  TYR B CD1   1 
ATOM   5932  C  CD2   . TYR F 2 286 ? -34.428 80.427  79.079  1.00 55.08 ? 475  TYR B CD2   1 
ATOM   5933  C  CE1   . TYR F 2 286 ? -35.115 83.124  79.135  1.00 56.11 ? 475  TYR B CE1   1 
ATOM   5934  C  CE2   . TYR F 2 286 ? -35.368 80.887  80.008  1.00 56.18 ? 475  TYR B CE2   1 
ATOM   5935  C  CZ    . TYR F 2 286 ? -35.706 82.241  80.029  1.00 56.88 ? 475  TYR B CZ    1 
ATOM   5936  O  OH    . TYR F 2 286 ? -36.637 82.714  80.935  1.00 57.72 ? 475  TYR B OH    1 
ATOM   5937  N  N     . ALA F 2 287 ? -31.159 82.397  79.664  1.00 52.62 ? 476  ALA B N     1 
ATOM   5938  C  CA    . ALA F 2 287 ? -31.068 83.641  80.429  1.00 52.64 ? 476  ALA B CA    1 
ATOM   5939  C  C     . ALA F 2 287 ? -29.660 84.213  80.606  1.00 52.35 ? 476  ALA B C     1 
ATOM   5940  O  O     . ALA F 2 287 ? -29.500 85.413  80.884  1.00 52.80 ? 476  ALA B O     1 
ATOM   5941  C  CB    . ALA F 2 287 ? -31.707 83.435  81.793  1.00 51.99 ? 476  ALA B CB    1 
ATOM   5942  N  N     . LYS F 2 288 ? -28.651 83.361  80.439  1.00 51.22 ? 477  LYS B N     1 
ATOM   5943  C  CA    . LYS F 2 288 ? -27.255 83.763  80.611  1.00 49.91 ? 477  LYS B CA    1 
ATOM   5944  C  C     . LYS F 2 288 ? -26.823 84.993  79.830  1.00 50.60 ? 477  LYS B C     1 
ATOM   5945  O  O     . LYS F 2 288 ? -26.128 85.855  80.362  1.00 50.54 ? 477  LYS B O     1 
ATOM   5946  C  CB    . LYS F 2 288 ? -26.322 82.600  80.270  1.00 48.13 ? 477  LYS B CB    1 
ATOM   5947  C  CG    . LYS F 2 288 ? -26.480 81.391  81.178  1.00 45.78 ? 477  LYS B CG    1 
ATOM   5948  C  CD    . LYS F 2 288 ? -25.402 80.358  80.908  1.00 45.11 ? 477  LYS B CD    1 
ATOM   5949  C  CE    . LYS F 2 288 ? -25.531 79.178  81.850  1.00 44.20 ? 477  LYS B CE    1 
ATOM   5950  N  NZ    . LYS F 2 288 ? -24.448 78.188  81.647  1.00 43.86 ? 477  LYS B NZ    1 
ATOM   5951  N  N     . ARG F 2 289 ? -27.229 85.085  78.572  1.00 51.66 ? 478  ARG B N     1 
ATOM   5952  C  CA    . ARG F 2 289 ? -26.833 86.222  77.761  1.00 53.52 ? 478  ARG B CA    1 
ATOM   5953  C  C     . ARG F 2 289 ? -27.333 87.544  78.351  1.00 55.04 ? 478  ARG B C     1 
ATOM   5954  O  O     . ARG F 2 289 ? -26.741 88.607  78.111  1.00 55.20 ? 478  ARG B O     1 
ATOM   5955  C  CB    . ARG F 2 289 ? -27.344 86.045  76.328  1.00 54.40 ? 478  ARG B CB    1 
ATOM   5956  C  CG    . ARG F 2 289 ? -26.933 84.718  75.678  1.00 55.61 ? 478  ARG B CG    1 
ATOM   5957  C  CD    . ARG F 2 289 ? -28.155 83.860  75.319  1.00 56.35 ? 478  ARG B CD    1 
ATOM   5958  N  NE    . ARG F 2 289 ? -28.884 84.405  74.172  1.00 56.43 ? 478  ARG B NE    1 
ATOM   5959  C  CZ    . ARG F 2 289 ? -30.164 84.165  73.896  1.00 55.63 ? 478  ARG B CZ    1 
ATOM   5960  N  NH1   . ARG F 2 289 ? -30.894 83.381  74.682  1.00 54.67 ? 478  ARG B NH1   1 
ATOM   5961  N  NH2   . ARG F 2 289 ? -30.715 84.720  72.825  1.00 55.10 ? 478  ARG B NH2   1 
ATOM   5962  N  N     . SER F 2 290 ? -28.412 87.478  79.133  1.00 55.78 ? 479  SER B N     1 
ATOM   5963  C  CA    . SER F 2 290 ? -28.980 88.678  79.745  1.00 56.20 ? 479  SER B CA    1 
ATOM   5964  C  C     . SER F 2 290 ? -28.179 89.115  80.965  1.00 55.97 ? 479  SER B C     1 
ATOM   5965  O  O     . SER F 2 290 ? -27.774 90.278  81.073  1.00 54.94 ? 479  SER B O     1 
ATOM   5966  C  CB    . SER F 2 290 ? -30.440 88.437  80.148  1.00 57.16 ? 479  SER B CB    1 
ATOM   5967  O  OG    . SER F 2 290 ? -31.295 88.463  79.018  1.00 57.58 ? 479  SER B OG    1 
ATOM   5968  N  N     . LYS F 2 291 ? -27.965 88.172  81.881  1.00 56.17 ? 480  LYS B N     1 
ATOM   5969  C  CA    . LYS F 2 291 ? -27.201 88.427  83.100  1.00 55.98 ? 480  LYS B CA    1 
ATOM   5970  C  C     . LYS F 2 291 ? -25.846 89.046  82.788  1.00 55.09 ? 480  LYS B C     1 
ATOM   5971  O  O     . LYS F 2 291 ? -25.460 90.043  83.390  1.00 54.79 ? 480  LYS B O     1 
ATOM   5972  C  CB    . LYS F 2 291 ? -26.987 87.125  83.871  1.00 56.59 ? 480  LYS B CB    1 
ATOM   5973  C  CG    . LYS F 2 291 ? -28.098 86.761  84.843  1.00 58.62 ? 480  LYS B CG    1 
ATOM   5974  C  CD    . LYS F 2 291 ? -28.068 87.638  86.097  1.00 59.68 ? 480  LYS B CD    1 
ATOM   5975  C  CE    . LYS F 2 291 ? -29.076 87.146  87.134  1.00 61.22 ? 480  LYS B CE    1 
ATOM   5976  N  NZ    . LYS F 2 291 ? -28.954 87.844  88.454  1.00 62.52 ? 480  LYS B NZ    1 
ATOM   5977  N  N     . LEU F 2 292 ? -25.134 88.451  81.837  1.00 54.18 ? 481  LEU B N     1 
ATOM   5978  C  CA    . LEU F 2 292 ? -23.809 88.931  81.466  1.00 53.55 ? 481  LEU B CA    1 
ATOM   5979  C  C     . LEU F 2 292 ? -23.841 90.393  81.052  1.00 53.57 ? 481  LEU B C     1 
ATOM   5980  O  O     . LEU F 2 292 ? -22.927 91.151  81.374  1.00 53.21 ? 481  LEU B O     1 
ATOM   5981  C  CB    . LEU F 2 292 ? -23.230 88.082  80.329  1.00 52.21 ? 481  LEU B CB    1 
ATOM   5982  C  CG    . LEU F 2 292 ? -21.710 87.868  80.290  1.00 52.03 ? 481  LEU B CG    1 
ATOM   5983  C  CD1   . LEU F 2 292 ? -21.353 87.214  78.967  1.00 51.31 ? 481  LEU B CD1   1 
ATOM   5984  C  CD2   . LEU F 2 292 ? -20.958 89.180  80.438  1.00 51.07 ? 481  LEU B CD2   1 
ATOM   5985  N  N     . ILE F 2 293 ? -24.885 90.790  80.331  1.00 54.26 ? 482  ILE B N     1 
ATOM   5986  C  CA    . ILE F 2 293 ? -25.007 92.174  79.894  1.00 54.44 ? 482  ILE B CA    1 
ATOM   5987  C  C     . ILE F 2 293 ? -25.190 93.110  81.082  1.00 54.55 ? 482  ILE B C     1 
ATOM   5988  O  O     . ILE F 2 293 ? -24.600 94.190  81.124  1.00 54.30 ? 482  ILE B O     1 
ATOM   5989  C  CB    . ILE F 2 293 ? -26.177 92.353  78.921  1.00 54.73 ? 482  ILE B CB    1 
ATOM   5990  C  CG1   . ILE F 2 293 ? -25.863 91.629  77.612  1.00 55.24 ? 482  ILE B CG1   1 
ATOM   5991  C  CG2   . ILE F 2 293 ? -26.408 93.841  78.643  1.00 54.51 ? 482  ILE B CG2   1 
ATOM   5992  C  CD1   . ILE F 2 293 ? -24.683 92.225  76.855  1.00 55.18 ? 482  ILE B CD1   1 
ATOM   5993  N  N     . GLU F 2 294 ? -26.008 92.701  82.046  1.00 55.14 ? 483  GLU B N     1 
ATOM   5994  C  CA    . GLU F 2 294 ? -26.213 93.518  83.240  1.00 56.90 ? 483  GLU B CA    1 
ATOM   5995  C  C     . GLU F 2 294 ? -24.824 93.812  83.787  1.00 56.72 ? 483  GLU B C     1 
ATOM   5996  O  O     . GLU F 2 294 ? -24.304 94.930  83.685  1.00 56.64 ? 483  GLU B O     1 
ATOM   5997  C  CB    . GLU F 2 294 ? -26.973 92.741  84.315  1.00 58.39 ? 483  GLU B CB    1 
ATOM   5998  C  CG    . GLU F 2 294 ? -28.293 92.135  83.888  1.00 61.40 ? 483  GLU B CG    1 
ATOM   5999  C  CD    . GLU F 2 294 ? -28.894 91.255  84.979  1.00 63.24 ? 483  GLU B CD    1 
ATOM   6000  O  OE1   . GLU F 2 294 ? -29.072 91.749  86.117  1.00 63.68 ? 483  GLU B OE1   1 
ATOM   6001  O  OE2   . GLU F 2 294 ? -29.187 90.068  84.699  1.00 65.13 ? 483  GLU B OE2   1 
ATOM   6002  N  N     . ILE F 2 295 ? -24.242 92.756  84.353  1.00 56.49 ? 484  ILE B N     1 
ATOM   6003  C  CA    . ILE F 2 295 ? -22.921 92.762  84.960  1.00 55.62 ? 484  ILE B CA    1 
ATOM   6004  C  C     . ILE F 2 295 ? -21.887 93.620  84.260  1.00 55.75 ? 484  ILE B C     1 
ATOM   6005  O  O     . ILE F 2 295 ? -21.191 94.397  84.908  1.00 56.03 ? 484  ILE B O     1 
ATOM   6006  C  CB    . ILE F 2 295 ? -22.388 91.338  85.046  1.00 55.19 ? 484  ILE B CB    1 
ATOM   6007  C  CG1   . ILE F 2 295 ? -23.356 90.491  85.867  1.00 54.36 ? 484  ILE B CG1   1 
ATOM   6008  C  CG2   . ILE F 2 295 ? -21.005 91.330  85.658  1.00 54.71 ? 484  ILE B CG2   1 
ATOM   6009  C  CD1   . ILE F 2 295 ? -23.074 89.012  85.812  1.00 54.47 ? 484  ILE B CD1   1 
ATOM   6010  N  N     . LEU F 2 296 ? -21.785 93.495  82.943  1.00 55.89 ? 485  LEU B N     1 
ATOM   6011  C  CA    . LEU F 2 296 ? -20.791 94.262  82.204  1.00 56.47 ? 485  LEU B CA    1 
ATOM   6012  C  C     . LEU F 2 296 ? -21.077 95.750  82.026  1.00 56.86 ? 485  LEU B C     1 
ATOM   6013  O  O     . LEU F 2 296 ? -20.147 96.545  81.860  1.00 56.34 ? 485  LEU B O     1 
ATOM   6014  C  CB    . LEU F 2 296 ? -20.540 93.623  80.834  1.00 56.68 ? 485  LEU B CB    1 
ATOM   6015  C  CG    . LEU F 2 296 ? -19.621 92.394  80.774  1.00 56.76 ? 485  LEU B CG    1 
ATOM   6016  C  CD1   . LEU F 2 296 ? -19.531 91.918  79.335  1.00 56.35 ? 485  LEU B CD1   1 
ATOM   6017  C  CD2   . LEU F 2 296 ? -18.223 92.740  81.297  1.00 56.55 ? 485  LEU B CD2   1 
ATOM   6018  N  N     . SER F 2 297 ? -22.349 96.136  82.056  1.00 57.75 ? 486  SER B N     1 
ATOM   6019  C  CA    . SER F 2 297 ? -22.705 97.550  81.886  1.00 58.42 ? 486  SER B CA    1 
ATOM   6020  C  C     . SER F 2 297 ? -22.280 98.368  83.103  1.00 58.41 ? 486  SER B C     1 
ATOM   6021  O  O     . SER F 2 297 ? -22.020 99.569  83.003  1.00 57.78 ? 486  SER B O     1 
ATOM   6022  C  CB    . SER F 2 297 ? -24.207 97.685  81.652  1.00 58.58 ? 486  SER B CB    1 
ATOM   6023  O  OG    . SER F 2 297 ? -24.583 96.929  80.516  1.00 59.61 ? 486  SER B OG    1 
ATOM   6024  N  N     . GLU F 2 298 ? -22.226 97.696  84.250  1.00 58.89 ? 487  GLU B N     1 
ATOM   6025  C  CA    . GLU F 2 298 ? -21.797 98.302  85.504  1.00 59.06 ? 487  GLU B CA    1 
ATOM   6026  C  C     . GLU F 2 298 ? -20.277 98.449  85.444  1.00 58.83 ? 487  GLU B C     1 
ATOM   6027  O  O     . GLU F 2 298 ? -19.740 99.553  85.340  1.00 58.46 ? 487  GLU B O     1 
ATOM   6028  C  CB    . GLU F 2 298 ? -22.145 97.384  86.670  1.00 59.78 ? 487  GLU B CB    1 
ATOM   6029  C  CG    . GLU F 2 298 ? -21.613 97.872  88.009  1.00 62.05 ? 487  GLU B CG    1 
ATOM   6030  C  CD    . GLU F 2 298 ? -21.486 96.754  89.028  1.00 63.80 ? 487  GLU B CD    1 
ATOM   6031  O  OE1   . GLU F 2 298 ? -20.442 96.052  89.025  1.00 65.33 ? 487  GLU B OE1   1 
ATOM   6032  O  OE2   . GLU F 2 298 ? -22.433 96.566  89.821  1.00 63.32 ? 487  GLU B OE2   1 
ATOM   6033  N  N     . GLN F 2 299 ? -19.606 97.300  85.516  1.00 58.76 ? 488  GLN B N     1 
ATOM   6034  C  CA    . GLN F 2 299 ? -18.148 97.191  85.478  1.00 57.85 ? 488  GLN B CA    1 
ATOM   6035  C  C     . GLN F 2 299 ? -17.755 96.187  84.389  1.00 56.21 ? 488  GLN B C     1 
ATOM   6036  O  O     . GLN F 2 299 ? -18.162 95.025  84.435  1.00 55.22 ? 488  GLN B O     1 
ATOM   6037  C  CB    . GLN F 2 299 ? -17.615 96.679  86.825  1.00 59.15 ? 488  GLN B CB    1 
ATOM   6038  C  CG    . GLN F 2 299 ? -17.273 97.746  87.863  1.00 62.10 ? 488  GLN B CG    1 
ATOM   6039  C  CD    . GLN F 2 299 ? -16.889 97.146  89.224  1.00 63.38 ? 488  GLN B CD    1 
ATOM   6040  O  OE1   . GLN F 2 299 ? -16.058 96.234  89.303  1.00 65.06 ? 488  GLN B OE1   1 
ATOM   6041  N  NE2   . GLN F 2 299 ? -17.489 97.662  90.296  1.00 63.03 ? 488  GLN B NE2   1 
ATOM   6042  N  N     . ALA F 2 300 ? -16.977 96.637  83.410  1.00 54.30 ? 489  ALA B N     1 
ATOM   6043  C  CA    . ALA F 2 300 ? -16.529 95.755  82.341  1.00 53.11 ? 489  ALA B CA    1 
ATOM   6044  C  C     . ALA F 2 300 ? -15.032 95.510  82.505  1.00 52.14 ? 489  ALA B C     1 
ATOM   6045  O  O     . ALA F 2 300 ? -14.574 94.372  82.529  1.00 51.56 ? 489  ALA B O     1 
ATOM   6046  C  CB    . ALA F 2 300 ? -16.812 96.379  80.986  1.00 52.36 ? 489  ALA B CB    1 
ATOM   6047  N  N     . ASP F 2 301 ? -14.282 96.597  82.641  1.00 51.36 ? 490  ASP B N     1 
ATOM   6048  C  CA    . ASP F 2 301 ? -12.835 96.539  82.801  1.00 50.79 ? 490  ASP B CA    1 
ATOM   6049  C  C     . ASP F 2 301 ? -12.231 95.330  83.523  1.00 48.48 ? 490  ASP B C     1 
ATOM   6050  O  O     . ASP F 2 301 ? -12.724 94.888  84.567  1.00 48.24 ? 490  ASP B O     1 
ATOM   6051  C  CB    . ASP F 2 301 ? -12.344 97.813  83.486  1.00 52.74 ? 490  ASP B CB    1 
ATOM   6052  C  CG    . ASP F 2 301 ? -11.693 98.767  82.518  1.00 55.34 ? 490  ASP B CG    1 
ATOM   6053  O  OD1   . ASP F 2 301 ? -12.235 99.884  82.338  1.00 56.11 ? 490  ASP B OD1   1 
ATOM   6054  O  OD2   . ASP F 2 301 ? -10.643 98.390  81.935  1.00 56.11 ? 490  ASP B OD2   1 
ATOM   6055  N  N     . GLY F 2 302 ? -11.142 94.826  82.944  1.00 46.23 ? 491  GLY B N     1 
ATOM   6056  C  CA    . GLY F 2 302 ? -10.410 93.694  83.490  1.00 43.06 ? 491  GLY B CA    1 
ATOM   6057  C  C     . GLY F 2 302 ? -11.242 92.503  83.893  1.00 41.18 ? 491  GLY B C     1 
ATOM   6058  O  O     . GLY F 2 302 ? -11.095 91.996  84.997  1.00 41.31 ? 491  GLY B O     1 
ATOM   6059  N  N     . THR F 2 303 ? -12.109 92.048  82.996  1.00 39.38 ? 492  THR B N     1 
ATOM   6060  C  CA    . THR F 2 303 ? -12.954 90.902  83.279  1.00 37.99 ? 492  THR B CA    1 
ATOM   6061  C  C     . THR F 2 303 ? -12.684 89.766  82.282  1.00 36.30 ? 492  THR B C     1 
ATOM   6062  O  O     . THR F 2 303 ? -12.529 90.007  81.089  1.00 36.23 ? 492  THR B O     1 
ATOM   6063  C  CB    . THR F 2 303 ? -14.446 91.296  83.205  1.00 38.36 ? 492  THR B CB    1 
ATOM   6064  O  OG1   . THR F 2 303 ? -15.265 90.155  83.485  1.00 39.31 ? 492  THR B OG1   1 
ATOM   6065  C  CG2   . THR F 2 303 ? -14.784 91.794  81.832  1.00 39.95 ? 492  THR B CG2   1 
ATOM   6066  N  N     . ILE F 2 304 ? -12.595 88.536  82.783  1.00 34.85 ? 493  ILE B N     1 
ATOM   6067  C  CA    . ILE F 2 304 ? -12.382 87.379  81.921  1.00 32.37 ? 493  ILE B CA    1 
ATOM   6068  C  C     . ILE F 2 304 ? -13.643 86.547  82.052  1.00 31.78 ? 493  ILE B C     1 
ATOM   6069  O  O     . ILE F 2 304 ? -14.096 86.298  83.171  1.00 31.25 ? 493  ILE B O     1 
ATOM   6070  C  CB    . ILE F 2 304 ? -11.169 86.530  82.354  1.00 31.90 ? 493  ILE B CB    1 
ATOM   6071  C  CG1   . ILE F 2 304 ? -11.019 85.341  81.410  1.00 31.14 ? 493  ILE B CG1   1 
ATOM   6072  C  CG2   . ILE F 2 304 ? -11.346 86.020  83.778  1.00 31.82 ? 493  ILE B CG2   1 
ATOM   6073  C  CD1   . ILE F 2 304 ? -9.585  84.958  81.123  1.00 30.91 ? 493  ILE B CD1   1 
ATOM   6074  N  N     . VAL F 2 305 ? -14.227 86.150  80.918  1.00 29.85 ? 494  VAL B N     1 
ATOM   6075  C  CA    . VAL F 2 305 ? -15.451 85.351  80.941  1.00 29.47 ? 494  VAL B CA    1 
ATOM   6076  C  C     . VAL F 2 305 ? -15.169 83.943  80.446  1.00 28.65 ? 494  VAL B C     1 
ATOM   6077  O  O     . VAL F 2 305 ? -14.644 83.754  79.352  1.00 29.38 ? 494  VAL B O     1 
ATOM   6078  C  CB    . VAL F 2 305 ? -16.559 85.978  80.049  1.00 29.34 ? 494  VAL B CB    1 
ATOM   6079  C  CG1   . VAL F 2 305 ? -17.893 85.284  80.322  1.00 27.97 ? 494  VAL B CG1   1 
ATOM   6080  C  CG2   . VAL F 2 305 ? -16.667 87.482  80.330  1.00 29.16 ? 494  VAL B CG2   1 
ATOM   6081  N  N     . PHE F 2 306 ? -15.531 82.955  81.245  1.00 28.18 ? 495  PHE B N     1 
ATOM   6082  C  CA    . PHE F 2 306 ? -15.278 81.574  80.871  1.00 28.09 ? 495  PHE B CA    1 
ATOM   6083  C  C     . PHE F 2 306 ? -16.494 80.884  80.280  1.00 28.99 ? 495  PHE B C     1 
ATOM   6084  O  O     . PHE F 2 306 ? -17.569 80.895  80.876  1.00 28.43 ? 495  PHE B O     1 
ATOM   6085  C  CB    . PHE F 2 306 ? -14.788 80.774  82.084  1.00 26.78 ? 495  PHE B CB    1 
ATOM   6086  C  CG    . PHE F 2 306 ? -13.344 81.010  82.430  1.00 26.12 ? 495  PHE B CG    1 
ATOM   6087  C  CD1   . PHE F 2 306 ? -12.338 80.636  81.552  1.00 25.20 ? 495  PHE B CD1   1 
ATOM   6088  C  CD2   . PHE F 2 306 ? -12.992 81.605  83.643  1.00 26.26 ? 495  PHE B CD2   1 
ATOM   6089  C  CE1   . PHE F 2 306 ? -10.990 80.848  81.870  1.00 25.66 ? 495  PHE B CE1   1 
ATOM   6090  C  CE2   . PHE F 2 306 ? -11.645 81.823  83.974  1.00 25.25 ? 495  PHE B CE2   1 
ATOM   6091  C  CZ    . PHE F 2 306 ? -10.646 81.441  83.080  1.00 25.17 ? 495  PHE B CZ    1 
ATOM   6092  N  N     . VAL F 2 307 ? -16.306 80.273  79.109  1.00 29.09 ? 496  VAL B N     1 
ATOM   6093  C  CA    . VAL F 2 307 ? -17.377 79.550  78.431  1.00 28.80 ? 496  VAL B CA    1 
ATOM   6094  C  C     . VAL F 2 307 ? -16.924 78.108  78.207  1.00 29.18 ? 496  VAL B C     1 
ATOM   6095  O  O     . VAL F 2 307 ? -15.741 77.800  78.295  1.00 28.34 ? 496  VAL B O     1 
ATOM   6096  C  CB    . VAL F 2 307 ? -17.736 80.208  77.091  1.00 27.90 ? 496  VAL B CB    1 
ATOM   6097  C  CG1   . VAL F 2 307 ? -18.054 81.672  77.319  1.00 29.28 ? 496  VAL B CG1   1 
ATOM   6098  C  CG2   . VAL F 2 307 ? -16.593 80.071  76.115  1.00 27.19 ? 496  VAL B CG2   1 
ATOM   6099  N  N     . GLU F 2 308 ? -17.868 77.231  77.902  1.00 29.98 ? 497  GLU B N     1 
ATOM   6100  C  CA    . GLU F 2 308 ? -17.560 75.822  77.730  1.00 31.73 ? 497  GLU B CA    1 
ATOM   6101  C  C     . GLU F 2 308 ? -16.847 75.420  76.436  1.00 31.10 ? 497  GLU B C     1 
ATOM   6102  O  O     . GLU F 2 308 ? -15.840 74.702  76.474  1.00 31.59 ? 497  GLU B O     1 
ATOM   6103  C  CB    . GLU F 2 308 ? -18.855 75.022  77.899  1.00 34.02 ? 497  GLU B CB    1 
ATOM   6104  C  CG    . GLU F 2 308 ? -18.749 73.524  77.691  1.00 38.76 ? 497  GLU B CG    1 
ATOM   6105  C  CD    . GLU F 2 308 ? -17.721 72.856  78.586  1.00 42.16 ? 497  GLU B CD    1 
ATOM   6106  O  OE1   . GLU F 2 308 ? -17.493 73.327  79.730  1.00 43.92 ? 497  GLU B OE1   1 
ATOM   6107  O  OE2   . GLU F 2 308 ? -17.146 71.834  78.147  1.00 44.08 ? 497  GLU B OE2   1 
ATOM   6108  N  N     . THR F 2 309 ? -17.340 75.912  75.305  1.00 28.84 ? 498  THR B N     1 
ATOM   6109  C  CA    . THR F 2 309 ? -16.798 75.539  74.008  1.00 26.47 ? 498  THR B CA    1 
ATOM   6110  C  C     . THR F 2 309 ? -16.120 76.647  73.227  1.00 25.60 ? 498  THR B C     1 
ATOM   6111  O  O     . THR F 2 309 ? -16.404 77.810  73.418  1.00 24.86 ? 498  THR B O     1 
ATOM   6112  C  CB    . THR F 2 309 ? -17.916 74.977  73.124  1.00 26.63 ? 498  THR B CB    1 
ATOM   6113  O  OG1   . THR F 2 309 ? -18.811 76.046  72.766  1.00 24.65 ? 498  THR B OG1   1 
ATOM   6114  C  CG2   . THR F 2 309 ? -18.695 73.889  73.870  1.00 25.07 ? 498  THR B CG2   1 
ATOM   6115  N  N     . LYS F 2 310 ? -15.227 76.258  72.324  1.00 26.58 ? 499  LYS B N     1 
ATOM   6116  C  CA    . LYS F 2 310 ? -14.509 77.204  71.485  1.00 26.93 ? 499  LYS B CA    1 
ATOM   6117  C  C     . LYS F 2 310 ? -15.510 78.018  70.667  1.00 28.30 ? 499  LYS B C     1 
ATOM   6118  O  O     . LYS F 2 310 ? -15.347 79.226  70.492  1.00 27.70 ? 499  LYS B O     1 
ATOM   6119  C  CB    . LYS F 2 310 ? -13.566 76.456  70.542  1.00 26.38 ? 499  LYS B CB    1 
ATOM   6120  C  CG    . LYS F 2 310 ? -12.484 75.656  71.247  1.00 27.53 ? 499  LYS B CG    1 
ATOM   6121  C  CD    . LYS F 2 310 ? -11.575 74.921  70.273  1.00 26.97 ? 499  LYS B CD    1 
ATOM   6122  C  CE    . LYS F 2 310 ? -12.311 73.768  69.570  1.00 27.84 ? 499  LYS B CE    1 
ATOM   6123  N  NZ    . LYS F 2 310 ? -11.375 72.979  68.726  1.00 26.95 ? 499  LYS B NZ    1 
ATOM   6124  N  N     . ARG F 2 311 ? -16.537 77.344  70.150  1.00 29.02 ? 500  ARG B N     1 
ATOM   6125  C  CA    . ARG F 2 311 ? -17.567 78.019  69.355  1.00 30.65 ? 500  ARG B CA    1 
ATOM   6126  C  C     . ARG F 2 311 ? -18.337 79.000  70.245  1.00 30.79 ? 500  ARG B C     1 
ATOM   6127  O  O     . ARG F 2 311 ? -18.615 80.136  69.850  1.00 29.53 ? 500  ARG B O     1 
ATOM   6128  C  CB    . ARG F 2 311 ? -18.534 76.994  68.757  1.00 31.87 ? 500  ARG B CB    1 
ATOM   6129  C  CG    . ARG F 2 311 ? -19.522 77.586  67.773  1.00 33.28 ? 500  ARG B CG    1 
ATOM   6130  C  CD    . ARG F 2 311 ? -20.505 76.536  67.310  1.00 34.46 ? 500  ARG B CD    1 
ATOM   6131  N  NE    . ARG F 2 311 ? -19.883 75.566  66.417  1.00 36.12 ? 500  ARG B NE    1 
ATOM   6132  C  CZ    . ARG F 2 311 ? -19.498 75.853  65.179  1.00 37.56 ? 500  ARG B CZ    1 
ATOM   6133  N  NH1   . ARG F 2 311 ? -19.677 77.085  64.705  1.00 36.26 ? 500  ARG B NH1   1 
ATOM   6134  N  NH2   . ARG F 2 311 ? -18.954 74.905  64.416  1.00 37.81 ? 500  ARG B NH2   1 
ATOM   6135  N  N     . GLY F 2 312 ? -18.674 78.552  71.453  1.00 30.99 ? 501  GLY B N     1 
ATOM   6136  C  CA    . GLY F 2 312 ? -19.368 79.425  72.374  1.00 32.18 ? 501  GLY B CA    1 
ATOM   6137  C  C     . GLY F 2 312 ? -18.528 80.667  72.644  1.00 32.84 ? 501  GLY B C     1 
ATOM   6138  O  O     . GLY F 2 312 ? -19.051 81.781  72.737  1.00 32.78 ? 501  GLY B O     1 
ATOM   6139  N  N     . ALA F 2 313 ? -17.216 80.475  72.758  1.00 32.89 ? 502  ALA B N     1 
ATOM   6140  C  CA    . ALA F 2 313 ? -16.301 81.579  73.020  1.00 34.18 ? 502  ALA B CA    1 
ATOM   6141  C  C     . ALA F 2 313 ? -16.263 82.577  71.874  1.00 34.58 ? 502  ALA B C     1 
ATOM   6142  O  O     . ALA F 2 313 ? -16.352 83.773  72.095  1.00 34.04 ? 502  ALA B O     1 
ATOM   6143  C  CB    . ALA F 2 313 ? -14.901 81.048  73.288  1.00 33.35 ? 502  ALA B CB    1 
ATOM   6144  N  N     . ASP F 2 314 ? -16.108 82.084  70.651  1.00 36.38 ? 503  ASP B N     1 
ATOM   6145  C  CA    . ASP F 2 314 ? -16.072 82.959  69.484  1.00 39.00 ? 503  ASP B CA    1 
ATOM   6146  C  C     . ASP F 2 314 ? -17.391 83.728  69.347  1.00 39.32 ? 503  ASP B C     1 
ATOM   6147  O  O     . ASP F 2 314 ? -17.409 84.889  68.947  1.00 39.06 ? 503  ASP B O     1 
ATOM   6148  C  CB    . ASP F 2 314 ? -15.839 82.149  68.210  1.00 41.04 ? 503  ASP B CB    1 
ATOM   6149  C  CG    . ASP F 2 314 ? -15.788 83.024  66.976  1.00 44.57 ? 503  ASP B CG    1 
ATOM   6150  O  OD1   . ASP F 2 314 ? -14.672 83.438  66.592  1.00 46.86 ? 503  ASP B OD1   1 
ATOM   6151  O  OD2   . ASP F 2 314 ? -16.863 83.320  66.398  1.00 46.64 ? 503  ASP B OD2   1 
ATOM   6152  N  N     . PHE F 2 315 ? -18.490 83.064  69.677  1.00 39.84 ? 504  PHE B N     1 
ATOM   6153  C  CA    . PHE F 2 315 ? -19.799 83.678  69.601  1.00 41.50 ? 504  PHE B CA    1 
ATOM   6154  C  C     . PHE F 2 315 ? -19.969 84.834  70.586  1.00 41.33 ? 504  PHE B C     1 
ATOM   6155  O  O     . PHE F 2 315 ? -20.238 85.965  70.190  1.00 40.62 ? 504  PHE B O     1 
ATOM   6156  C  CB    . PHE F 2 315 ? -20.891 82.644  69.874  1.00 43.76 ? 504  PHE B CB    1 
ATOM   6157  C  CG    . PHE F 2 315 ? -22.249 83.255  70.085  1.00 47.34 ? 504  PHE B CG    1 
ATOM   6158  C  CD1   . PHE F 2 315 ? -22.973 83.764  69.010  1.00 48.67 ? 504  PHE B CD1   1 
ATOM   6159  C  CD2   . PHE F 2 315 ? -22.774 83.388  71.373  1.00 48.89 ? 504  PHE B CD2   1 
ATOM   6160  C  CE1   . PHE F 2 315 ? -24.203 84.405  69.216  1.00 50.35 ? 504  PHE B CE1   1 
ATOM   6161  C  CE2   . PHE F 2 315 ? -24.004 84.029  71.593  1.00 49.79 ? 504  PHE B CE2   1 
ATOM   6162  C  CZ    . PHE F 2 315 ? -24.716 84.536  70.515  1.00 50.05 ? 504  PHE B CZ    1 
ATOM   6163  N  N     . LEU F 2 316 ? -19.827 84.534  71.873  1.00 40.90 ? 505  LEU B N     1 
ATOM   6164  C  CA    . LEU F 2 316 ? -19.999 85.542  72.905  1.00 40.95 ? 505  LEU B CA    1 
ATOM   6165  C  C     . LEU F 2 316 ? -19.095 86.746  72.707  1.00 41.52 ? 505  LEU B C     1 
ATOM   6166  O  O     . LEU F 2 316 ? -19.482 87.865  73.000  1.00 42.22 ? 505  LEU B O     1 
ATOM   6167  C  CB    . LEU F 2 316 ? -19.770 84.926  74.285  1.00 39.90 ? 505  LEU B CB    1 
ATOM   6168  C  CG    . LEU F 2 316 ? -20.383 85.681  75.468  1.00 40.13 ? 505  LEU B CG    1 
ATOM   6169  C  CD1   . LEU F 2 316 ? -21.854 85.985  75.174  1.00 39.05 ? 505  LEU B CD1   1 
ATOM   6170  C  CD2   . LEU F 2 316 ? -20.262 84.848  76.731  1.00 38.72 ? 505  LEU B CD2   1 
ATOM   6171  N  N     . ALA F 2 317 ? -17.898 86.529  72.189  1.00 42.56 ? 506  ALA B N     1 
ATOM   6172  C  CA    . ALA F 2 317 ? -16.990 87.641  71.986  1.00 43.95 ? 506  ALA B CA    1 
ATOM   6173  C  C     . ALA F 2 317 ? -17.524 88.645  70.973  1.00 45.68 ? 506  ALA B C     1 
ATOM   6174  O  O     . ALA F 2 317 ? -17.515 89.849  71.236  1.00 46.31 ? 506  ALA B O     1 
ATOM   6175  C  CB    . ALA F 2 317 ? -15.627 87.138  71.552  1.00 43.09 ? 506  ALA B CB    1 
ATOM   6176  N  N     . SER F 2 318 ? -17.987 88.170  69.819  1.00 46.67 ? 507  SER B N     1 
ATOM   6177  C  CA    . SER F 2 318 ? -18.493 89.097  68.810  1.00 48.75 ? 507  SER B CA    1 
ATOM   6178  C  C     . SER F 2 318 ? -19.836 89.654  69.253  1.00 49.09 ? 507  SER B C     1 
ATOM   6179  O  O     . SER F 2 318 ? -20.229 90.741  68.850  1.00 49.72 ? 507  SER B O     1 
ATOM   6180  C  CB    . SER F 2 318 ? -18.616 88.413  67.446  1.00 48.52 ? 507  SER B CB    1 
ATOM   6181  O  OG    . SER F 2 318 ? -19.587 87.387  67.485  1.00 50.18 ? 507  SER B OG    1 
ATOM   6182  N  N     . PHE F 2 319 ? -20.531 88.899  70.092  1.00 50.72 ? 508  PHE B N     1 
ATOM   6183  C  CA    . PHE F 2 319 ? -21.817 89.326  70.629  1.00 52.66 ? 508  PHE B CA    1 
ATOM   6184  C  C     . PHE F 2 319 ? -21.586 90.616  71.415  1.00 53.59 ? 508  PHE B C     1 
ATOM   6185  O  O     . PHE F 2 319 ? -22.282 91.613  71.217  1.00 54.22 ? 508  PHE B O     1 
ATOM   6186  C  CB    . PHE F 2 319 ? -22.381 88.232  71.543  1.00 53.85 ? 508  PHE B CB    1 
ATOM   6187  C  CG    . PHE F 2 319 ? -23.646 88.615  72.270  1.00 55.91 ? 508  PHE B CG    1 
ATOM   6188  C  CD1   . PHE F 2 319 ? -24.636 89.369  71.645  1.00 57.01 ? 508  PHE B CD1   1 
ATOM   6189  C  CD2   . PHE F 2 319 ? -23.878 88.156  73.567  1.00 56.63 ? 508  PHE B CD2   1 
ATOM   6190  C  CE1   . PHE F 2 319 ? -25.842 89.656  72.303  1.00 57.36 ? 508  PHE B CE1   1 
ATOM   6191  C  CE2   . PHE F 2 319 ? -25.077 88.435  74.230  1.00 57.70 ? 508  PHE B CE2   1 
ATOM   6192  C  CZ    . PHE F 2 319 ? -26.059 89.186  73.597  1.00 57.43 ? 508  PHE B CZ    1 
ATOM   6193  N  N     . LEU F 2 320 ? -20.585 90.598  72.289  1.00 53.56 ? 509  LEU B N     1 
ATOM   6194  C  CA    . LEU F 2 320 ? -20.268 91.764  73.099  1.00 53.69 ? 509  LEU B CA    1 
ATOM   6195  C  C     . LEU F 2 320 ? -19.598 92.873  72.293  1.00 54.27 ? 509  LEU B C     1 
ATOM   6196  O  O     . LEU F 2 320 ? -19.723 94.050  72.627  1.00 54.49 ? 509  LEU B O     1 
ATOM   6197  C  CB    . LEU F 2 320 ? -19.363 91.362  74.268  1.00 52.81 ? 509  LEU B CB    1 
ATOM   6198  C  CG    . LEU F 2 320 ? -19.890 90.291  75.224  1.00 52.14 ? 509  LEU B CG    1 
ATOM   6199  C  CD1   . LEU F 2 320 ? -18.816 89.956  76.244  1.00 52.20 ? 509  LEU B CD1   1 
ATOM   6200  C  CD2   . LEU F 2 320 ? -21.138 90.783  75.925  1.00 51.50 ? 509  LEU B CD2   1 
ATOM   6201  N  N     . SER F 2 321 ? -18.890 92.508  71.233  1.00 55.07 ? 510  SER B N     1 
ATOM   6202  C  CA    . SER F 2 321 ? -18.205 93.506  70.424  1.00 56.29 ? 510  SER B CA    1 
ATOM   6203  C  C     . SER F 2 321 ? -19.129 94.382  69.577  1.00 57.38 ? 510  SER B C     1 
ATOM   6204  O  O     . SER F 2 321 ? -18.749 95.487  69.172  1.00 56.73 ? 510  SER B O     1 
ATOM   6205  C  CB    . SER F 2 321 ? -17.163 92.836  69.532  1.00 56.60 ? 510  SER B CB    1 
ATOM   6206  O  OG    . SER F 2 321 ? -15.981 92.554  70.266  1.00 58.42 ? 510  SER B OG    1 
ATOM   6207  N  N     . GLU F 2 322 ? -20.337 93.895  69.305  1.00 58.40 ? 511  GLU B N     1 
ATOM   6208  C  CA    . GLU F 2 322 ? -21.284 94.666  68.512  1.00 59.27 ? 511  GLU B CA    1 
ATOM   6209  C  C     . GLU F 2 322 ? -22.079 95.573  69.442  1.00 58.69 ? 511  GLU B C     1 
ATOM   6210  O  O     . GLU F 2 322 ? -22.769 96.487  68.992  1.00 58.86 ? 511  GLU B O     1 
ATOM   6211  C  CB    . GLU F 2 322 ? -22.235 93.748  67.744  1.00 60.99 ? 511  GLU B CB    1 
ATOM   6212  C  CG    . GLU F 2 322 ? -23.152 92.941  68.631  1.00 63.38 ? 511  GLU B CG    1 
ATOM   6213  C  CD    . GLU F 2 322 ? -24.361 92.443  67.881  1.00 65.29 ? 511  GLU B CD    1 
ATOM   6214  O  OE1   . GLU F 2 322 ? -25.103 93.293  67.335  1.00 65.88 ? 511  GLU B OE1   1 
ATOM   6215  O  OE2   . GLU F 2 322 ? -24.568 91.210  67.835  1.00 66.60 ? 511  GLU B OE2   1 
ATOM   6216  N  N     . LYS F 2 323 ? -21.990 95.299  70.741  1.00 57.50 ? 512  LYS B N     1 
ATOM   6217  C  CA    . LYS F 2 323 ? -22.664 96.116  71.738  1.00 56.45 ? 512  LYS B CA    1 
ATOM   6218  C  C     . LYS F 2 323 ? -21.628 97.114  72.245  1.00 56.20 ? 512  LYS B C     1 
ATOM   6219  O  O     . LYS F 2 323 ? -21.806 97.782  73.258  1.00 56.24 ? 512  LYS B O     1 
ATOM   6220  C  CB    . LYS F 2 323 ? -23.197 95.250  72.875  1.00 55.59 ? 512  LYS B CB    1 
ATOM   6221  C  CG    . LYS F 2 323 ? -24.275 94.286  72.433  1.00 54.65 ? 512  LYS B CG    1 
ATOM   6222  C  CD    . LYS F 2 323 ? -25.018 93.738  73.626  1.00 55.62 ? 512  LYS B CD    1 
ATOM   6223  C  CE    . LYS F 2 323 ? -26.130 92.789  73.216  1.00 56.62 ? 512  LYS B CE    1 
ATOM   6224  N  NZ    . LYS F 2 323 ? -27.034 92.484  74.371  1.00 57.06 ? 512  LYS B NZ    1 
ATOM   6225  N  N     . GLU F 2 324 ? -20.530 97.176  71.505  1.00 56.37 ? 513  GLU B N     1 
ATOM   6226  C  CA    . GLU F 2 324 ? -19.414 98.070  71.758  1.00 56.86 ? 513  GLU B CA    1 
ATOM   6227  C  C     . GLU F 2 324 ? -18.519 97.870  72.985  1.00 55.97 ? 513  GLU B C     1 
ATOM   6228  O  O     . GLU F 2 324 ? -17.753 98.769  73.349  1.00 55.58 ? 513  GLU B O     1 
ATOM   6229  C  CB    . GLU F 2 324 ? -19.899 99.517  71.663  1.00 58.83 ? 513  GLU B CB    1 
ATOM   6230  C  CG    . GLU F 2 324 ? -20.364 99.850  70.239  1.00 61.78 ? 513  GLU B CG    1 
ATOM   6231  C  CD    . GLU F 2 324 ? -20.401 101.335 69.941  1.00 63.55 ? 513  GLU B CD    1 
ATOM   6232  O  OE1   . GLU F 2 324 ? -19.356 102.004 70.121  1.00 64.43 ? 513  GLU B OE1   1 
ATOM   6233  O  OE2   . GLU F 2 324 ? -21.471 101.829 69.515  1.00 64.59 ? 513  GLU B OE2   1 
ATOM   6234  N  N     . PHE F 2 325 ? -18.597 96.699  73.612  1.00 54.38 ? 514  PHE B N     1 
ATOM   6235  C  CA    . PHE F 2 325 ? -17.711 96.398  74.735  1.00 52.64 ? 514  PHE B CA    1 
ATOM   6236  C  C     . PHE F 2 325 ? -16.401 95.927  74.110  1.00 51.64 ? 514  PHE B C     1 
ATOM   6237  O  O     . PHE F 2 325 ? -16.399 94.968  73.336  1.00 51.57 ? 514  PHE B O     1 
ATOM   6238  C  CB    . PHE F 2 325 ? -18.233 95.250  75.582  1.00 51.56 ? 514  PHE B CB    1 
ATOM   6239  C  CG    . PHE F 2 325 ? -19.487 95.555  76.316  1.00 52.01 ? 514  PHE B CG    1 
ATOM   6240  C  CD1   . PHE F 2 325 ? -20.721 95.278  75.748  1.00 52.23 ? 514  PHE B CD1   1 
ATOM   6241  C  CD2   . PHE F 2 325 ? -19.439 96.081  77.598  1.00 51.83 ? 514  PHE B CD2   1 
ATOM   6242  C  CE1   . PHE F 2 325 ? -21.891 95.513  76.448  1.00 51.94 ? 514  PHE B CE1   1 
ATOM   6243  C  CE2   . PHE F 2 325 ? -20.601 96.321  78.307  1.00 51.80 ? 514  PHE B CE2   1 
ATOM   6244  C  CZ    . PHE F 2 325 ? -21.834 96.034  77.729  1.00 51.80 ? 514  PHE B CZ    1 
ATOM   6245  N  N     . PRO F 2 326 ? -15.276 96.592  74.422  1.00 50.62 ? 515  PRO B N     1 
ATOM   6246  C  CA    . PRO F 2 326 ? -13.979 96.183  73.858  1.00 49.33 ? 515  PRO B CA    1 
ATOM   6247  C  C     . PRO F 2 326 ? -13.705 94.743  74.299  1.00 47.77 ? 515  PRO B C     1 
ATOM   6248  O  O     . PRO F 2 326 ? -13.318 94.493  75.436  1.00 46.66 ? 515  PRO B O     1 
ATOM   6249  C  CB    . PRO F 2 326 ? -12.998 97.173  74.481  1.00 50.01 ? 515  PRO B CB    1 
ATOM   6250  C  CG    . PRO F 2 326 ? -13.851 98.385  74.715  1.00 51.12 ? 515  PRO B CG    1 
ATOM   6251  C  CD    . PRO F 2 326 ? -15.128 97.791  75.260  1.00 50.55 ? 515  PRO B CD    1 
ATOM   6252  N  N     . THR F 2 327 ? -13.907 93.805  73.384  1.00 46.17 ? 516  THR B N     1 
ATOM   6253  C  CA    . THR F 2 327 ? -13.742 92.405  73.695  1.00 44.76 ? 516  THR B CA    1 
ATOM   6254  C  C     . THR F 2 327 ? -12.856 91.628  72.727  1.00 43.82 ? 516  THR B C     1 
ATOM   6255  O  O     . THR F 2 327 ? -12.787 91.918  71.530  1.00 44.29 ? 516  THR B O     1 
ATOM   6256  C  CB    . THR F 2 327 ? -15.121 91.724  73.747  1.00 45.39 ? 516  THR B CB    1 
ATOM   6257  O  OG1   . THR F 2 327 ? -15.930 92.370  74.731  1.00 45.33 ? 516  THR B OG1   1 
ATOM   6258  C  CG2   . THR F 2 327 ? -14.989 90.243  74.093  1.00 46.16 ? 516  THR B CG2   1 
ATOM   6259  N  N     . THR F 2 328 ? -12.167 90.637  73.274  1.00 41.73 ? 517  THR B N     1 
ATOM   6260  C  CA    . THR F 2 328 ? -11.310 89.774  72.490  1.00 39.50 ? 517  THR B CA    1 
ATOM   6261  C  C     . THR F 2 328 ? -11.542 88.397  73.074  1.00 37.69 ? 517  THR B C     1 
ATOM   6262  O  O     . THR F 2 328 ? -12.338 88.239  73.999  1.00 37.78 ? 517  THR B O     1 
ATOM   6263  C  CB    . THR F 2 328 ? -9.811  90.174  72.582  1.00 40.04 ? 517  THR B CB    1 
ATOM   6264  O  OG1   . THR F 2 328 ? -9.089  89.518  71.534  1.00 40.73 ? 517  THR B OG1   1 
ATOM   6265  C  CG2   . THR F 2 328 ? -9.206  89.779  73.930  1.00 40.09 ? 517  THR B CG2   1 
ATOM   6266  N  N     . SER F 2 329 ? -10.852 87.396  72.557  1.00 35.77 ? 518  SER B N     1 
ATOM   6267  C  CA    . SER F 2 329 ? -11.082 86.051  73.045  1.00 33.09 ? 518  SER B CA    1 
ATOM   6268  C  C     . SER F 2 329 ? -9.868  85.154  72.887  1.00 31.35 ? 518  SER B C     1 
ATOM   6269  O  O     . SER F 2 329 ? -8.975  85.423  72.087  1.00 30.76 ? 518  SER B O     1 
ATOM   6270  C  CB    . SER F 2 329 ? -12.242 85.452  72.273  1.00 33.01 ? 518  SER B CB    1 
ATOM   6271  O  OG    . SER F 2 329 ? -11.984 85.601  70.888  1.00 34.64 ? 518  SER B OG    1 
ATOM   6272  N  N     . ILE F 2 330 ? -9.837  84.083  73.665  1.00 29.23 ? 519  ILE B N     1 
ATOM   6273  C  CA    . ILE F 2 330 ? -8.745  83.147  73.551  1.00 27.27 ? 519  ILE B CA    1 
ATOM   6274  C  C     . ILE F 2 330 ? -9.307  81.752  73.676  1.00 26.43 ? 519  ILE B C     1 
ATOM   6275  O  O     . ILE F 2 330 ? -10.029 81.453  74.628  1.00 25.80 ? 519  ILE B O     1 
ATOM   6276  C  CB    . ILE F 2 330 ? -7.644  83.403  74.622  1.00 25.54 ? 519  ILE B CB    1 
ATOM   6277  C  CG1   . ILE F 2 330 ? -6.511  82.387  74.455  1.00 24.59 ? 519  ILE B CG1   1 
ATOM   6278  C  CG2   . ILE F 2 330 ? -8.242  83.368  76.012  1.00 23.88 ? 519  ILE B CG2   1 
ATOM   6279  C  CD1   . ILE F 2 330 ? -5.209  82.778  75.161  1.00 23.17 ? 519  ILE B CD1   1 
ATOM   6280  N  N     . HIS F 2 331 ? -9.009  80.928  72.672  1.00 26.42 ? 520  HIS B N     1 
ATOM   6281  C  CA    . HIS F 2 331 ? -9.423  79.521  72.633  1.00 26.73 ? 520  HIS B CA    1 
ATOM   6282  C  C     . HIS F 2 331 ? -8.693  78.802  71.494  1.00 25.96 ? 520  HIS B C     1 
ATOM   6283  O  O     . HIS F 2 331 ? -8.079  79.432  70.638  1.00 24.75 ? 520  HIS B O     1 
ATOM   6284  C  CB    . HIS F 2 331 ? -10.951 79.381  72.468  1.00 27.52 ? 520  HIS B CB    1 
ATOM   6285  C  CG    . HIS F 2 331 ? -11.475 79.935  71.183  1.00 27.29 ? 520  HIS B CG    1 
ATOM   6286  N  ND1   . HIS F 2 331 ? -11.938 81.226  71.065  1.00 27.94 ? 520  HIS B ND1   1 
ATOM   6287  C  CD2   . HIS F 2 331 ? -11.530 79.401  69.942  1.00 26.99 ? 520  HIS B CD2   1 
ATOM   6288  C  CE1   . HIS F 2 331 ? -12.249 81.468  69.805  1.00 29.07 ? 520  HIS B CE1   1 
ATOM   6289  N  NE2   . HIS F 2 331 ? -12.007 80.375  69.102  1.00 29.50 ? 520  HIS B NE2   1 
ATOM   6290  N  N     . GLY F 2 332 ? -8.774  77.477  71.498  1.00 27.04 ? 521  GLY B N     1 
ATOM   6291  C  CA    . GLY F 2 332 ? -8.101  76.659  70.503  1.00 27.46 ? 521  GLY B CA    1 
ATOM   6292  C  C     . GLY F 2 332 ? -8.316  76.902  69.018  1.00 29.06 ? 521  GLY B C     1 
ATOM   6293  O  O     . GLY F 2 332 ? -7.411  76.632  68.223  1.00 30.40 ? 521  GLY B O     1 
ATOM   6294  N  N     . ASP F 2 333 ? -9.481  77.390  68.615  1.00 28.69 ? 522  ASP B N     1 
ATOM   6295  C  CA    . ASP F 2 333 ? -9.706  77.629  67.195  1.00 30.35 ? 522  ASP B CA    1 
ATOM   6296  C  C     . ASP F 2 333 ? -9.158  78.948  66.684  1.00 31.26 ? 522  ASP B C     1 
ATOM   6297  O  O     . ASP F 2 333 ? -9.371  79.281  65.527  1.00 32.54 ? 522  ASP B O     1 
ATOM   6298  C  CB    . ASP F 2 333 ? -11.193 77.567  66.831  1.00 31.50 ? 522  ASP B CB    1 
ATOM   6299  C  CG    . ASP F 2 333 ? -11.735 76.157  66.837  1.00 33.62 ? 522  ASP B CG    1 
ATOM   6300  O  OD1   . ASP F 2 333 ? -10.932 75.192  66.776  1.00 33.47 ? 522  ASP B OD1   1 
ATOM   6301  O  OD2   . ASP F 2 333 ? -12.977 76.016  66.896  1.00 36.90 ? 522  ASP B OD2   1 
ATOM   6302  N  N     . ARG F 2 334 ? -8.480  79.719  67.521  1.00 30.83 ? 523  ARG B N     1 
ATOM   6303  C  CA    . ARG F 2 334 ? -7.915  80.969  67.031  1.00 31.38 ? 523  ARG B CA    1 
ATOM   6304  C  C     . ARG F 2 334 ? -6.471  80.676  66.644  1.00 31.32 ? 523  ARG B C     1 
ATOM   6305  O  O     . ARG F 2 334 ? -5.906  79.688  67.119  1.00 31.39 ? 523  ARG B O     1 
ATOM   6306  C  CB    . ARG F 2 334 ? -7.951  82.043  68.119  1.00 31.52 ? 523  ARG B CB    1 
ATOM   6307  C  CG    . ARG F 2 334 ? -9.323  82.315  68.681  1.00 32.77 ? 523  ARG B CG    1 
ATOM   6308  C  CD    . ARG F 2 334 ? -9.398  83.741  69.189  1.00 32.84 ? 523  ARG B CD    1 
ATOM   6309  N  NE    . ARG F 2 334 ? -9.258  84.675  68.077  1.00 32.97 ? 523  ARG B NE    1 
ATOM   6310  C  CZ    . ARG F 2 334 ? -8.933  85.960  68.209  1.00 34.13 ? 523  ARG B CZ    1 
ATOM   6311  N  NH1   . ARG F 2 334 ? -8.711  86.473  69.417  1.00 34.59 ? 523  ARG B NH1   1 
ATOM   6312  N  NH2   . ARG F 2 334 ? -8.816  86.729  67.131  1.00 32.57 ? 523  ARG B NH2   1 
ATOM   6313  N  N     . LEU F 2 335 ? -5.881  81.496  65.771  1.00 31.40 ? 524  LEU B N     1 
ATOM   6314  C  CA    . LEU F 2 335 ? -4.481  81.291  65.387  1.00 31.46 ? 524  LEU B CA    1 
ATOM   6315  C  C     . LEU F 2 335 ? -3.640  81.616  66.621  1.00 30.92 ? 524  LEU B C     1 
ATOM   6316  O  O     . LEU F 2 335 ? -4.006  82.498  67.402  1.00 30.26 ? 524  LEU B O     1 
ATOM   6317  C  CB    . LEU F 2 335 ? -4.045  82.232  64.250  1.00 32.81 ? 524  LEU B CB    1 
ATOM   6318  C  CG    . LEU F 2 335 ? -4.467  82.088  62.773  1.00 33.81 ? 524  LEU B CG    1 
ATOM   6319  C  CD1   . LEU F 2 335 ? -4.181  80.682  62.264  1.00 31.99 ? 524  LEU B CD1   1 
ATOM   6320  C  CD2   . LEU F 2 335 ? -5.942  82.424  62.637  1.00 34.98 ? 524  LEU B CD2   1 
ATOM   6321  N  N     . GLN F 2 336 ? -2.519  80.913  66.790  1.00 30.28 ? 525  GLN B N     1 
ATOM   6322  C  CA    . GLN F 2 336 ? -1.641  81.145  67.936  1.00 30.11 ? 525  GLN B CA    1 
ATOM   6323  C  C     . GLN F 2 336 ? -1.227  82.605  68.041  1.00 30.43 ? 525  GLN B C     1 
ATOM   6324  O  O     . GLN F 2 336 ? -1.137  83.157  69.142  1.00 30.77 ? 525  GLN B O     1 
ATOM   6325  C  CB    . GLN F 2 336 ? -0.390  80.266  67.854  1.00 29.79 ? 525  GLN B CB    1 
ATOM   6326  C  CG    . GLN F 2 336 ? 0.496   80.351  69.086  1.00 28.52 ? 525  GLN B CG    1 
ATOM   6327  C  CD    . GLN F 2 336 ? -0.276  80.111  70.369  1.00 28.26 ? 525  GLN B CD    1 
ATOM   6328  O  OE1   . GLN F 2 336 ? -1.095  79.202  70.446  1.00 29.30 ? 525  GLN B OE1   1 
ATOM   6329  N  NE2   . GLN F 2 336 ? -0.015  80.920  71.381  1.00 27.70 ? 525  GLN B NE2   1 
ATOM   6330  N  N     . SER F 2 337 ? -0.967  83.234  66.903  1.00 30.74 ? 526  SER B N     1 
ATOM   6331  C  CA    . SER F 2 337 ? -0.591  84.640  66.923  1.00 32.20 ? 526  SER B CA    1 
ATOM   6332  C  C     . SER F 2 337 ? -1.752  85.471  67.493  1.00 32.43 ? 526  SER B C     1 
ATOM   6333  O  O     . SER F 2 337 ? -1.536  86.502  68.128  1.00 33.37 ? 526  SER B O     1 
ATOM   6334  C  CB    . SER F 2 337 ? -0.239  85.118  65.510  1.00 32.47 ? 526  SER B CB    1 
ATOM   6335  O  OG    . SER F 2 337 ? -1.360  85.032  64.654  1.00 33.12 ? 526  SER B OG    1 
ATOM   6336  N  N     . GLN F 2 338 ? -2.979  85.005  67.275  1.00 32.36 ? 527  GLN B N     1 
ATOM   6337  C  CA    . GLN F 2 338 ? -4.172  85.694  67.760  1.00 31.92 ? 527  GLN B CA    1 
ATOM   6338  C  C     . GLN F 2 338 ? -4.379  85.435  69.247  1.00 31.37 ? 527  GLN B C     1 
ATOM   6339  O  O     . GLN F 2 338 ? -4.838  86.309  69.988  1.00 30.37 ? 527  GLN B O     1 
ATOM   6340  C  CB    . GLN F 2 338 ? -5.417  85.232  66.988  1.00 33.95 ? 527  GLN B CB    1 
ATOM   6341  C  CG    . GLN F 2 338 ? -5.379  85.516  65.481  1.00 37.58 ? 527  GLN B CG    1 
ATOM   6342  C  CD    . GLN F 2 338 ? -6.686  85.139  64.778  1.00 40.35 ? 527  GLN B CD    1 
ATOM   6343  O  OE1   . GLN F 2 338 ? -7.142  83.987  64.840  1.00 40.92 ? 527  GLN B OE1   1 
ATOM   6344  N  NE2   . GLN F 2 338 ? -7.293  86.113  64.106  1.00 40.86 ? 527  GLN B NE2   1 
ATOM   6345  N  N     . ARG F 2 339 ? -4.068  84.222  69.686  1.00 29.84 ? 528  ARG B N     1 
ATOM   6346  C  CA    . ARG F 2 339 ? -4.211  83.910  71.095  1.00 29.20 ? 528  ARG B CA    1 
ATOM   6347  C  C     . ARG F 2 339 ? -3.243  84.789  71.872  1.00 28.85 ? 528  ARG B C     1 
ATOM   6348  O  O     . ARG F 2 339 ? -3.586  85.357  72.907  1.00 27.81 ? 528  ARG B O     1 
ATOM   6349  C  CB    . ARG F 2 339 ? -3.896  82.436  71.356  1.00 28.84 ? 528  ARG B CB    1 
ATOM   6350  C  CG    . ARG F 2 339 ? -4.937  81.488  70.801  1.00 27.60 ? 528  ARG B CG    1 
ATOM   6351  C  CD    . ARG F 2 339 ? -4.440  80.061  70.748  1.00 26.04 ? 528  ARG B CD    1 
ATOM   6352  N  NE    . ARG F 2 339 ? -4.024  79.588  72.064  1.00 25.77 ? 528  ARG B NE    1 
ATOM   6353  C  CZ    . ARG F 2 339 ? -3.887  78.306  72.396  1.00 25.54 ? 528  ARG B CZ    1 
ATOM   6354  N  NH1   . ARG F 2 339 ? -4.133  77.343  71.507  1.00 22.66 ? 528  ARG B NH1   1 
ATOM   6355  N  NH2   . ARG F 2 339 ? -3.516  77.989  73.628  1.00 24.14 ? 528  ARG B NH2   1 
ATOM   6356  N  N     . GLU F 2 340 ? -2.028  84.906  71.358  1.00 29.86 ? 529  GLU B N     1 
ATOM   6357  C  CA    . GLU F 2 340 ? -1.017  85.699  72.031  1.00 31.52 ? 529  GLU B CA    1 
ATOM   6358  C  C     . GLU F 2 340 ? -1.313  87.197  72.004  1.00 33.01 ? 529  GLU B C     1 
ATOM   6359  O  O     . GLU F 2 340 ? -1.036  87.904  72.977  1.00 33.05 ? 529  GLU B O     1 
ATOM   6360  C  CB    . GLU F 2 340 ? 0.356   85.376  71.439  1.00 31.00 ? 529  GLU B CB    1 
ATOM   6361  C  CG    . GLU F 2 340 ? 0.910   84.055  71.988  1.00 32.11 ? 529  GLU B CG    1 
ATOM   6362  C  CD    . GLU F 2 340 ? 2.099   83.508  71.215  1.00 32.64 ? 529  GLU B CD    1 
ATOM   6363  O  OE1   . GLU F 2 340 ? 2.976   84.301  70.813  1.00 32.81 ? 529  GLU B OE1   1 
ATOM   6364  O  OE2   . GLU F 2 340 ? 2.162   82.271  71.024  1.00 32.60 ? 529  GLU B OE2   1 
ATOM   6365  N  N     . GLN F 2 341 ? -1.908  87.676  70.913  1.00 34.34 ? 530  GLN B N     1 
ATOM   6366  C  CA    . GLN F 2 341 ? -2.249  89.100  70.789  1.00 35.26 ? 530  GLN B CA    1 
ATOM   6367  C  C     . GLN F 2 341 ? -3.420  89.454  71.714  1.00 34.95 ? 530  GLN B C     1 
ATOM   6368  O  O     . GLN F 2 341 ? -3.511  90.569  72.225  1.00 34.06 ? 530  GLN B O     1 
ATOM   6369  C  CB    . GLN F 2 341 ? -2.609  89.420  69.328  1.00 37.48 ? 530  GLN B CB    1 
ATOM   6370  C  CG    . GLN F 2 341 ? -2.863  90.897  69.017  1.00 39.98 ? 530  GLN B CG    1 
ATOM   6371  C  CD    . GLN F 2 341 ? -1.685  91.791  69.368  1.00 42.30 ? 530  GLN B CD    1 
ATOM   6372  O  OE1   . GLN F 2 341 ? -0.571  91.598  68.876  1.00 45.28 ? 530  GLN B OE1   1 
ATOM   6373  N  NE2   . GLN F 2 341 ? -1.926  92.779  70.222  1.00 43.30 ? 530  GLN B NE2   1 
ATOM   6374  N  N     . ALA F 2 342 ? -4.310  88.492  71.932  1.00 34.75 ? 531  ALA B N     1 
ATOM   6375  C  CA    . ALA F 2 342 ? -5.475  88.697  72.786  1.00 35.09 ? 531  ALA B CA    1 
ATOM   6376  C  C     . ALA F 2 342 ? -5.097  88.938  74.247  1.00 35.98 ? 531  ALA B C     1 
ATOM   6377  O  O     . ALA F 2 342 ? -5.798  89.655  74.968  1.00 35.68 ? 531  ALA B O     1 
ATOM   6378  C  CB    . ALA F 2 342 ? -6.412  87.503  72.676  1.00 34.12 ? 531  ALA B CB    1 
ATOM   6379  N  N     . LEU F 2 343 ? -4.009  88.319  74.701  1.00 37.19 ? 532  LEU B N     1 
ATOM   6380  C  CA    . LEU F 2 343 ? -3.569  88.529  76.079  1.00 37.89 ? 532  LEU B CA    1 
ATOM   6381  C  C     . LEU F 2 343 ? -2.776  89.820  76.082  1.00 38.40 ? 532  LEU B C     1 
ATOM   6382  O  O     . LEU F 2 343 ? -2.860  90.622  77.006  1.00 37.87 ? 532  LEU B O     1 
ATOM   6383  C  CB    . LEU F 2 343 ? -2.665  87.396  76.565  1.00 36.83 ? 532  LEU B CB    1 
ATOM   6384  C  CG    . LEU F 2 343 ? -3.246  86.005  76.787  1.00 36.36 ? 532  LEU B CG    1 
ATOM   6385  C  CD1   . LEU F 2 343 ? -2.171  85.159  77.473  1.00 35.41 ? 532  LEU B CD1   1 
ATOM   6386  C  CD2   . LEU F 2 343 ? -4.517  86.072  77.647  1.00 35.42 ? 532  LEU B CD2   1 
ATOM   6387  N  N     . ARG F 2 344 ? -1.990  90.005  75.033  1.00 40.32 ? 533  ARG B N     1 
ATOM   6388  C  CA    . ARG F 2 344 ? -1.192  91.205  74.907  1.00 42.78 ? 533  ARG B CA    1 
ATOM   6389  C  C     . ARG F 2 344 ? -2.099  92.441  74.932  1.00 43.45 ? 533  ARG B C     1 
ATOM   6390  O  O     . ARG F 2 344 ? -1.741  93.460  75.518  1.00 44.15 ? 533  ARG B O     1 
ATOM   6391  C  CB    . ARG F 2 344 ? -0.381  91.156  73.611  1.00 44.70 ? 533  ARG B CB    1 
ATOM   6392  C  CG    . ARG F 2 344 ? 0.464   92.388  73.366  1.00 48.51 ? 533  ARG B CG    1 
ATOM   6393  C  CD    . ARG F 2 344 ? 1.510   92.134  72.286  1.00 52.65 ? 533  ARG B CD    1 
ATOM   6394  N  NE    . ARG F 2 344 ? 2.864   92.169  72.843  1.00 57.27 ? 533  ARG B NE    1 
ATOM   6395  C  CZ    . ARG F 2 344 ? 3.986   92.169  72.125  1.00 58.90 ? 533  ARG B CZ    1 
ATOM   6396  N  NH1   . ARG F 2 344 ? 3.938   92.134  70.795  1.00 59.70 ? 533  ARG B NH1   1 
ATOM   6397  N  NH2   . ARG F 2 344 ? 5.163   92.219  72.744  1.00 60.06 ? 533  ARG B NH2   1 
ATOM   6398  N  N     . ASP F 2 345 ? -3.271  92.349  74.299  1.00 43.35 ? 534  ASP B N     1 
ATOM   6399  C  CA    . ASP F 2 345 ? -4.219  93.465  74.272  1.00 43.47 ? 534  ASP B CA    1 
ATOM   6400  C  C     . ASP F 2 345 ? -4.956  93.573  75.603  1.00 43.33 ? 534  ASP B C     1 
ATOM   6401  O  O     . ASP F 2 345 ? -5.327  94.668  76.024  1.00 43.40 ? 534  ASP B O     1 
ATOM   6402  C  CB    . ASP F 2 345 ? -5.286  93.303  73.171  1.00 43.05 ? 534  ASP B CB    1 
ATOM   6403  C  CG    . ASP F 2 345 ? -4.720  93.381  71.769  1.00 43.14 ? 534  ASP B CG    1 
ATOM   6404  O  OD1   . ASP F 2 345 ? -3.709  94.074  71.551  1.00 42.92 ? 534  ASP B OD1   1 
ATOM   6405  O  OD2   . ASP F 2 345 ? -5.317  92.753  70.868  1.00 44.97 ? 534  ASP B OD2   1 
ATOM   6406  N  N     . PHE F 2 346 ? -5.196  92.436  76.250  1.00 42.72 ? 535  PHE B N     1 
ATOM   6407  C  CA    . PHE F 2 346 ? -5.907  92.444  77.522  1.00 42.98 ? 535  PHE B CA    1 
ATOM   6408  C  C     . PHE F 2 346 ? -4.983  92.924  78.630  1.00 43.41 ? 535  PHE B C     1 
ATOM   6409  O  O     . PHE F 2 346 ? -5.433  93.475  79.627  1.00 43.05 ? 535  PHE B O     1 
ATOM   6410  C  CB    . PHE F 2 346 ? -6.450  91.050  77.841  1.00 42.01 ? 535  PHE B CB    1 
ATOM   6411  C  CG    . PHE F 2 346 ? -7.340  91.008  79.046  1.00 42.37 ? 535  PHE B CG    1 
ATOM   6412  C  CD1   . PHE F 2 346 ? -6.819  90.754  80.309  1.00 43.25 ? 535  PHE B CD1   1 
ATOM   6413  C  CD2   . PHE F 2 346 ? -8.707  91.240  78.924  1.00 42.74 ? 535  PHE B CD2   1 
ATOM   6414  C  CE1   . PHE F 2 346 ? -7.653  90.731  81.437  1.00 44.16 ? 535  PHE B CE1   1 
ATOM   6415  C  CE2   . PHE F 2 346 ? -9.548  91.221  80.044  1.00 42.53 ? 535  PHE B CE2   1 
ATOM   6416  C  CZ    . PHE F 2 346 ? -9.021  90.965  81.299  1.00 43.44 ? 535  PHE B CZ    1 
ATOM   6417  N  N     . LYS F 2 347 ? -3.685  92.730  78.442  1.00 44.53 ? 536  LYS B N     1 
ATOM   6418  C  CA    . LYS F 2 347 ? -2.721  93.153  79.444  1.00 45.76 ? 536  LYS B CA    1 
ATOM   6419  C  C     . LYS F 2 347 ? -2.424  94.643  79.368  1.00 46.98 ? 536  LYS B C     1 
ATOM   6420  O  O     . LYS F 2 347 ? -2.292  95.310  80.400  1.00 47.43 ? 536  LYS B O     1 
ATOM   6421  C  CB    . LYS F 2 347 ? -1.417  92.381  79.293  1.00 45.00 ? 536  LYS B CB    1 
ATOM   6422  C  CG    . LYS F 2 347 ? -1.445  90.985  79.845  1.00 43.89 ? 536  LYS B CG    1 
ATOM   6423  C  CD    . LYS F 2 347 ? -0.145  90.288  79.504  1.00 44.35 ? 536  LYS B CD    1 
ATOM   6424  C  CE    . LYS F 2 347 ? -0.167  88.832  79.904  1.00 44.34 ? 536  LYS B CE    1 
ATOM   6425  N  NZ    . LYS F 2 347 ? 1.157   88.221  79.645  1.00 45.72 ? 536  LYS B NZ    1 
ATOM   6426  N  N     . ASN F 2 348 ? -2.306  95.168  78.152  1.00 47.95 ? 537  ASN B N     1 
ATOM   6427  C  CA    . ASN F 2 348 ? -2.015  96.584  77.995  1.00 48.70 ? 537  ASN B CA    1 
ATOM   6428  C  C     . ASN F 2 348 ? -3.263  97.463  78.140  1.00 49.51 ? 537  ASN B C     1 
ATOM   6429  O  O     . ASN F 2 348 ? -3.217  98.653  77.841  1.00 50.53 ? 537  ASN B O     1 
ATOM   6430  C  CB    . ASN F 2 348 ? -1.344  96.854  76.640  1.00 48.66 ? 537  ASN B CB    1 
ATOM   6431  C  CG    . ASN F 2 348 ? -2.302  96.710  75.471  1.00 48.28 ? 537  ASN B CG    1 
ATOM   6432  O  OD1   . ASN F 2 348 ? -3.488  96.991  75.598  1.00 48.29 ? 537  ASN B OD1   1 
ATOM   6433  N  ND2   . ASN F 2 348 ? -1.784  96.294  74.319  1.00 47.74 ? 537  ASN B ND2   1 
ATOM   6434  N  N     . GLY F 2 349 ? -4.376  96.880  78.584  1.00 49.88 ? 538  GLY B N     1 
ATOM   6435  C  CA    . GLY F 2 349 ? -5.600  97.650  78.760  1.00 49.64 ? 538  GLY B CA    1 
ATOM   6436  C  C     . GLY F 2 349 ? -6.434  97.879  77.507  1.00 49.94 ? 538  GLY B C     1 
ATOM   6437  O  O     . GLY F 2 349 ? -7.617  98.203  77.599  1.00 50.22 ? 538  GLY B O     1 
ATOM   6438  N  N     . SER F 2 350 ? -5.819  97.708  76.340  1.00 49.62 ? 539  SER B N     1 
ATOM   6439  C  CA    . SER F 2 350 ? -6.476  97.892  75.046  1.00 49.47 ? 539  SER B CA    1 
ATOM   6440  C  C     . SER F 2 350 ? -7.865  97.256  74.962  1.00 49.57 ? 539  SER B C     1 
ATOM   6441  O  O     . SER F 2 350 ? -8.758  97.793  74.319  1.00 50.19 ? 539  SER B O     1 
ATOM   6442  C  CB    . SER F 2 350 ? -5.578  97.322  73.944  1.00 50.37 ? 539  SER B CB    1 
ATOM   6443  O  OG    . SER F 2 350 ? -6.104  97.560  72.654  1.00 52.12 ? 539  SER B OG    1 
ATOM   6444  N  N     . MET F 2 351 ? -8.033  96.102  75.597  1.00 49.31 ? 540  MET B N     1 
ATOM   6445  C  CA    . MET F 2 351 ? -9.306  95.387  75.616  1.00 48.73 ? 540  MET B CA    1 
ATOM   6446  C  C     . MET F 2 351 ? -9.726  95.320  77.073  1.00 48.08 ? 540  MET B C     1 
ATOM   6447  O  O     . MET F 2 351 ? -8.878  95.372  77.961  1.00 48.99 ? 540  MET B O     1 
ATOM   6448  C  CB    . MET F 2 351 ? -9.130  93.966  75.078  1.00 49.79 ? 540  MET B CB    1 
ATOM   6449  C  CG    . MET F 2 351 ? -8.749  93.882  73.613  1.00 50.92 ? 540  MET B CG    1 
ATOM   6450  S  SD    . MET F 2 351 ? -10.163 94.137  72.521  1.00 52.99 ? 540  MET B SD    1 
ATOM   6451  C  CE    . MET F 2 351 ? -10.138 95.935  72.361  1.00 53.89 ? 540  MET B CE    1 
ATOM   6452  N  N     . LYS F 2 352 ? -11.022 95.195  77.326  1.00 46.84 ? 541  LYS B N     1 
ATOM   6453  C  CA    . LYS F 2 352 ? -11.512 95.136  78.697  1.00 45.33 ? 541  LYS B CA    1 
ATOM   6454  C  C     . LYS F 2 352 ? -12.108 93.794  79.064  1.00 43.86 ? 541  LYS B C     1 
ATOM   6455  O  O     . LYS F 2 352 ? -12.047 93.386  80.216  1.00 43.33 ? 541  LYS B O     1 
ATOM   6456  C  CB    . LYS F 2 352 ? -12.577 96.201  78.939  1.00 47.27 ? 541  LYS B CB    1 
ATOM   6457  C  CG    . LYS F 2 352 ? -12.120 97.644  78.807  1.00 49.64 ? 541  LYS B CG    1 
ATOM   6458  C  CD    . LYS F 2 352 ? -13.266 98.538  79.261  1.00 51.71 ? 541  LYS B CD    1 
ATOM   6459  C  CE    . LYS F 2 352 ? -13.231 99.920  78.629  1.00 52.64 ? 541  LYS B CE    1 
ATOM   6460  N  NZ    . LYS F 2 352 ? -14.508 100.631 78.955  1.00 54.36 ? 541  LYS B NZ    1 
ATOM   6461  N  N     . VAL F 2 353 ? -12.715 93.117  78.093  1.00 42.18 ? 542  VAL B N     1 
ATOM   6462  C  CA    . VAL F 2 353 ? -13.318 91.825  78.366  1.00 39.95 ? 542  VAL B CA    1 
ATOM   6463  C  C     . VAL F 2 353 ? -12.627 90.739  77.558  1.00 39.24 ? 542  VAL B C     1 
ATOM   6464  O  O     . VAL F 2 353 ? -12.352 90.912  76.370  1.00 39.01 ? 542  VAL B O     1 
ATOM   6465  C  CB    . VAL F 2 353 ? -14.808 91.831  78.022  1.00 40.57 ? 542  VAL B CB    1 
ATOM   6466  C  CG1   . VAL F 2 353 ? -15.448 90.527  78.478  1.00 39.30 ? 542  VAL B CG1   1 
ATOM   6467  C  CG2   . VAL F 2 353 ? -15.489 93.040  78.671  1.00 40.12 ? 542  VAL B CG2   1 
ATOM   6468  N  N     . LEU F 2 354 ? -12.337 89.620  78.215  1.00 37.21 ? 543  LEU B N     1 
ATOM   6469  C  CA    . LEU F 2 354 ? -11.672 88.502  77.565  1.00 35.10 ? 543  LEU B CA    1 
ATOM   6470  C  C     . LEU F 2 354 ? -12.583 87.294  77.669  1.00 33.09 ? 543  LEU B C     1 
ATOM   6471  O  O     . LEU F 2 354 ? -12.985 86.906  78.764  1.00 32.19 ? 543  LEU B O     1 
ATOM   6472  C  CB    . LEU F 2 354 ? -10.336 88.196  78.258  1.00 35.25 ? 543  LEU B CB    1 
ATOM   6473  C  CG    . LEU F 2 354 ? -9.197  87.487  77.497  1.00 35.83 ? 543  LEU B CG    1 
ATOM   6474  C  CD1   . LEU F 2 354 ? -8.554  86.480  78.420  1.00 34.21 ? 543  LEU B CD1   1 
ATOM   6475  C  CD2   . LEU F 2 354 ? -9.692  86.794  76.240  1.00 35.26 ? 543  LEU B CD2   1 
ATOM   6476  N  N     . ILE F 2 355 ? -12.924 86.714  76.526  1.00 31.77 ? 544  ILE B N     1 
ATOM   6477  C  CA    . ILE F 2 355 ? -13.782 85.535  76.506  1.00 31.61 ? 544  ILE B CA    1 
ATOM   6478  C  C     . ILE F 2 355 ? -12.864 84.334  76.369  1.00 30.72 ? 544  ILE B C     1 
ATOM   6479  O  O     . ILE F 2 355 ? -12.032 84.272  75.457  1.00 29.78 ? 544  ILE B O     1 
ATOM   6480  C  CB    . ILE F 2 355 ? -14.755 85.564  75.321  1.00 32.07 ? 544  ILE B CB    1 
ATOM   6481  C  CG1   . ILE F 2 355 ? -15.540 86.885  75.324  1.00 32.94 ? 544  ILE B CG1   1 
ATOM   6482  C  CG2   . ILE F 2 355 ? -15.729 84.408  75.440  1.00 32.35 ? 544  ILE B CG2   1 
ATOM   6483  C  CD1   . ILE F 2 355 ? -16.344 87.143  76.620  1.00 29.77 ? 544  ILE B CD1   1 
ATOM   6484  N  N     . ALA F 2 356 ? -13.008 83.372  77.266  1.00 29.17 ? 545  ALA B N     1 
ATOM   6485  C  CA    . ALA F 2 356 ? -12.118 82.234  77.197  1.00 28.51 ? 545  ALA B CA    1 
ATOM   6486  C  C     . ALA F 2 356 ? -12.708 80.885  77.516  1.00 27.49 ? 545  ALA B C     1 
ATOM   6487  O  O     . ALA F 2 356 ? -13.666 80.770  78.282  1.00 27.96 ? 545  ALA B O     1 
ATOM   6488  C  CB    . ALA F 2 356 ? -10.915 82.475  78.119  1.00 28.94 ? 545  ALA B CB    1 
ATOM   6489  N  N     . THR F 2 357 ? -12.118 79.872  76.894  1.00 26.33 ? 546  THR B N     1 
ATOM   6490  C  CA    . THR F 2 357 ? -12.460 78.488  77.147  1.00 26.00 ? 546  THR B CA    1 
ATOM   6491  C  C     . THR F 2 357 ? -11.528 78.186  78.316  1.00 26.63 ? 546  THR B C     1 
ATOM   6492  O  O     . THR F 2 357 ? -10.741 79.057  78.727  1.00 25.16 ? 546  THR B O     1 
ATOM   6493  C  CB    . THR F 2 357 ? -12.064 77.563  75.970  1.00 25.82 ? 546  THR B CB    1 
ATOM   6494  O  OG1   . THR F 2 357 ? -10.672 77.738  75.659  1.00 23.37 ? 546  THR B OG1   1 
ATOM   6495  C  CG2   . THR F 2 357 ? -12.920 77.875  74.730  1.00 24.34 ? 546  THR B CG2   1 
ATOM   6496  N  N     . SER F 2 358 ? -11.586 76.972  78.844  1.00 26.14 ? 547  SER B N     1 
ATOM   6497  C  CA    . SER F 2 358 ? -10.705 76.635  79.947  1.00 26.95 ? 547  SER B CA    1 
ATOM   6498  C  C     . SER F 2 358 ? -9.232  76.662  79.535  1.00 26.44 ? 547  SER B C     1 
ATOM   6499  O  O     . SER F 2 358 ? -8.360  76.370  80.346  1.00 27.52 ? 547  SER B O     1 
ATOM   6500  C  CB    . SER F 2 358 ? -11.054 75.264  80.523  1.00 27.49 ? 547  SER B CB    1 
ATOM   6501  O  OG    . SER F 2 358 ? -12.214 75.340  81.323  1.00 28.96 ? 547  SER B OG    1 
ATOM   6502  N  N     . VAL F 2 359 ? -8.938  77.003  78.286  1.00 25.85 ? 548  VAL B N     1 
ATOM   6503  C  CA    . VAL F 2 359 ? -7.541  77.066  77.880  1.00 24.94 ? 548  VAL B CA    1 
ATOM   6504  C  C     . VAL F 2 359 ? -6.797  78.056  78.790  1.00 25.78 ? 548  VAL B C     1 
ATOM   6505  O  O     . VAL F 2 359 ? -5.592  77.927  79.017  1.00 24.71 ? 548  VAL B O     1 
ATOM   6506  C  CB    . VAL F 2 359 ? -7.368  77.532  76.413  1.00 23.53 ? 548  VAL B CB    1 
ATOM   6507  C  CG1   . VAL F 2 359 ? -7.856  78.964  76.239  1.00 23.91 ? 548  VAL B CG1   1 
ATOM   6508  C  CG2   . VAL F 2 359 ? -5.904  77.474  76.036  1.00 22.68 ? 548  VAL B CG2   1 
ATOM   6509  N  N     . ALA F 2 360 ? -7.528  79.040  79.306  1.00 26.03 ? 549  ALA B N     1 
ATOM   6510  C  CA    . ALA F 2 360 ? -6.951  80.057  80.173  1.00 27.32 ? 549  ALA B CA    1 
ATOM   6511  C  C     . ALA F 2 360 ? -7.345  79.898  81.628  1.00 28.04 ? 549  ALA B C     1 
ATOM   6512  O  O     . ALA F 2 360 ? -7.236  80.846  82.401  1.00 29.45 ? 549  ALA B O     1 
ATOM   6513  C  CB    . ALA F 2 360 ? -7.360  81.441  79.692  1.00 27.57 ? 549  ALA B CB    1 
ATOM   6514  N  N     . SER F 2 361 ? -7.778  78.709  82.023  1.00 27.71 ? 550  SER B N     1 
ATOM   6515  C  CA    . SER F 2 361 ? -8.203  78.511  83.396  1.00 27.57 ? 550  SER B CA    1 
ATOM   6516  C  C     . SER F 2 361 ? -7.067  78.249  84.376  1.00 27.04 ? 550  SER B C     1 
ATOM   6517  O  O     . SER F 2 361 ? -7.214  78.515  85.568  1.00 26.68 ? 550  SER B O     1 
ATOM   6518  C  CB    . SER F 2 361 ? -9.216  77.364  83.475  1.00 28.68 ? 550  SER B CB    1 
ATOM   6519  O  OG    . SER F 2 361 ? -8.633  76.139  83.074  1.00 31.14 ? 550  SER B OG    1 
ATOM   6520  N  N     . ARG F 2 362 ? -5.939  77.742  83.886  1.00 25.73 ? 551  ARG B N     1 
ATOM   6521  C  CA    . ARG F 2 362 ? -4.815  77.425  84.767  1.00 24.73 ? 551  ARG B CA    1 
ATOM   6522  C  C     . ARG F 2 362 ? -3.578  78.323  84.699  1.00 24.38 ? 551  ARG B C     1 
ATOM   6523  O  O     . ARG F 2 362 ? -3.158  78.757  83.639  1.00 24.90 ? 551  ARG B O     1 
ATOM   6524  C  CB    . ARG F 2 362 ? -4.362  75.963  84.548  1.00 24.67 ? 551  ARG B CB    1 
ATOM   6525  C  CG    . ARG F 2 362 ? -5.272  74.899  85.182  1.00 24.73 ? 551  ARG B CG    1 
ATOM   6526  C  CD    . ARG F 2 362 ? -4.875  73.484  84.798  1.00 23.40 ? 551  ARG B CD    1 
ATOM   6527  N  NE    . ARG F 2 362 ? -5.781  72.490  85.382  1.00 25.00 ? 551  ARG B NE    1 
ATOM   6528  C  CZ    . ARG F 2 362 ? -5.450  71.681  86.388  1.00 24.28 ? 551  ARG B CZ    1 
ATOM   6529  N  NH1   . ARG F 2 362 ? -4.238  71.740  86.925  1.00 24.37 ? 551  ARG B NH1   1 
ATOM   6530  N  NH2   . ARG F 2 362 ? -6.324  70.811  86.863  1.00 25.66 ? 551  ARG B NH2   1 
ATOM   6531  N  N     . GLY F 2 363 ? -3.011  78.580  85.871  1.00 24.91 ? 552  GLY B N     1 
ATOM   6532  C  CA    . GLY F 2 363 ? -1.780  79.331  86.011  1.00 25.03 ? 552  GLY B CA    1 
ATOM   6533  C  C     . GLY F 2 363 ? -1.490  80.682  85.401  1.00 25.54 ? 552  GLY B C     1 
ATOM   6534  O  O     . GLY F 2 363 ? -0.497  81.305  85.802  1.00 25.36 ? 552  GLY B O     1 
ATOM   6535  N  N     . LEU F 2 364 ? -2.294  81.142  84.450  1.00 25.91 ? 553  LEU B N     1 
ATOM   6536  C  CA    . LEU F 2 364 ? -2.031  82.443  83.843  1.00 27.77 ? 553  LEU B CA    1 
ATOM   6537  C  C     . LEU F 2 364 ? -2.050  83.494  84.952  1.00 28.82 ? 553  LEU B C     1 
ATOM   6538  O  O     . LEU F 2 364 ? -2.950  83.509  85.785  1.00 28.85 ? 553  LEU B O     1 
ATOM   6539  C  CB    . LEU F 2 364 ? -3.078  82.765  82.769  1.00 27.97 ? 553  LEU B CB    1 
ATOM   6540  C  CG    . LEU F 2 364 ? -3.112  81.848  81.536  1.00 28.78 ? 553  LEU B CG    1 
ATOM   6541  C  CD1   . LEU F 2 364 ? -4.029  82.460  80.466  1.00 28.78 ? 553  LEU B CD1   1 
ATOM   6542  C  CD2   . LEU F 2 364 ? -1.708  81.687  80.971  1.00 27.93 ? 553  LEU B CD2   1 
ATOM   6543  N  N     . ASP F 2 365 ? -1.044  84.360  84.951  1.00 29.96 ? 554  ASP B N     1 
ATOM   6544  C  CA    . ASP F 2 365 ? -0.882  85.396  85.968  1.00 32.21 ? 554  ASP B CA    1 
ATOM   6545  C  C     . ASP F 2 365 ? -1.017  86.776  85.316  1.00 32.94 ? 554  ASP B C     1 
ATOM   6546  O  O     . ASP F 2 365 ? -0.047  87.315  84.783  1.00 33.33 ? 554  ASP B O     1 
ATOM   6547  C  CB    . ASP F 2 365 ? 0.509   85.222  86.592  1.00 33.43 ? 554  ASP B CB    1 
ATOM   6548  C  CG    . ASP F 2 365 ? 0.754   86.137  87.772  1.00 33.71 ? 554  ASP B CG    1 
ATOM   6549  O  OD1   . ASP F 2 365 ? 0.010   86.061  88.768  1.00 34.63 ? 554  ASP B OD1   1 
ATOM   6550  O  OD2   . ASP F 2 365 ? 1.706   86.933  87.696  1.00 35.58 ? 554  ASP B OD2   1 
ATOM   6551  N  N     . ILE F 2 366 ? -2.220  87.342  85.367  1.00 34.18 ? 555  ILE B N     1 
ATOM   6552  C  CA    . ILE F 2 366 ? -2.504  88.631  84.737  1.00 35.18 ? 555  ILE B CA    1 
ATOM   6553  C  C     . ILE F 2 366 ? -3.024  89.677  85.732  1.00 36.25 ? 555  ILE B C     1 
ATOM   6554  O  O     . ILE F 2 366 ? -4.057  89.490  86.369  1.00 35.44 ? 555  ILE B O     1 
ATOM   6555  C  CB    . ILE F 2 366 ? -3.519  88.423  83.589  1.00 35.82 ? 555  ILE B CB    1 
ATOM   6556  C  CG1   . ILE F 2 366 ? -2.938  87.408  82.596  1.00 36.00 ? 555  ILE B CG1   1 
ATOM   6557  C  CG2   . ILE F 2 366 ? -3.832  89.744  82.888  1.00 34.94 ? 555  ILE B CG2   1 
ATOM   6558  C  CD1   . ILE F 2 366 ? -3.892  86.990  81.516  1.00 36.97 ? 555  ILE B CD1   1 
ATOM   6559  N  N     . LYS F 2 367 ? -2.281  90.775  85.853  1.00 38.04 ? 556  LYS B N     1 
ATOM   6560  C  CA    . LYS F 2 367 ? -2.596  91.869  86.772  1.00 40.08 ? 556  LYS B CA    1 
ATOM   6561  C  C     . LYS F 2 367 ? -3.956  92.507  86.509  1.00 39.84 ? 556  LYS B C     1 
ATOM   6562  O  O     . LYS F 2 367 ? -4.686  92.803  87.443  1.00 40.51 ? 556  LYS B O     1 
ATOM   6563  C  CB    . LYS F 2 367 ? -1.491  92.929  86.686  1.00 42.16 ? 556  LYS B CB    1 
ATOM   6564  C  CG    . LYS F 2 367 ? -1.203  93.661  87.983  1.00 44.99 ? 556  LYS B CG    1 
ATOM   6565  C  CD    . LYS F 2 367 ? 0.237   94.181  87.995  1.00 47.14 ? 556  LYS B CD    1 
ATOM   6566  C  CE    . LYS F 2 367 ? 0.684   94.565  89.421  1.00 48.93 ? 556  LYS B CE    1 
ATOM   6567  N  NZ    . LYS F 2 367 ? 2.165   94.809  89.532  1.00 49.34 ? 556  LYS B NZ    1 
ATOM   6568  N  N     . ASN F 2 368 ? -4.301  92.692  85.237  1.00 40.81 ? 557  ASN B N     1 
ATOM   6569  C  CA    . ASN F 2 368 ? -5.578  93.308  84.853  1.00 40.85 ? 557  ASN B CA    1 
ATOM   6570  C  C     . ASN F 2 368 ? -6.830  92.500  85.147  1.00 40.71 ? 557  ASN B C     1 
ATOM   6571  O  O     . ASN F 2 368 ? -7.936  93.043  85.107  1.00 41.47 ? 557  ASN B O     1 
ATOM   6572  C  CB    . ASN F 2 368 ? -5.580  93.671  83.364  1.00 41.36 ? 557  ASN B CB    1 
ATOM   6573  C  CG    . ASN F 2 368 ? -4.636  94.809  83.045  1.00 42.70 ? 557  ASN B CG    1 
ATOM   6574  O  OD1   . ASN F 2 368 ? -4.134  95.485  83.948  1.00 43.63 ? 557  ASN B OD1   1 
ATOM   6575  N  ND2   . ASN F 2 368 ? -4.397  95.041  81.759  1.00 41.98 ? 557  ASN B ND2   1 
ATOM   6576  N  N     . ILE F 2 369 ? -6.684  91.212  85.433  1.00 39.77 ? 558  ILE B N     1 
ATOM   6577  C  CA    . ILE F 2 369 ? -7.863  90.419  85.717  1.00 38.65 ? 558  ILE B CA    1 
ATOM   6578  C  C     . ILE F 2 369 ? -8.405  90.794  87.087  1.00 39.72 ? 558  ILE B C     1 
ATOM   6579  O  O     . ILE F 2 369 ? -7.848  90.421  88.126  1.00 39.87 ? 558  ILE B O     1 
ATOM   6580  C  CB    . ILE F 2 369 ? -7.577  88.914  85.684  1.00 37.52 ? 558  ILE B CB    1 
ATOM   6581  C  CG1   . ILE F 2 369 ? -7.046  88.510  84.313  1.00 37.75 ? 558  ILE B CG1   1 
ATOM   6582  C  CG2   . ILE F 2 369 ? -8.845  88.145  85.990  1.00 36.48 ? 558  ILE B CG2   1 
ATOM   6583  C  CD1   . ILE F 2 369 ? -6.800  87.016  84.165  1.00 37.15 ? 558  ILE B CD1   1 
ATOM   6584  N  N     . LYS F 2 370 ? -9.507  91.536  87.076  1.00 40.40 ? 559  LYS B N     1 
ATOM   6585  C  CA    . LYS F 2 370 ? -10.148 91.982  88.302  1.00 40.20 ? 559  LYS B CA    1 
ATOM   6586  C  C     . LYS F 2 370 ? -11.406 91.200  88.590  1.00 39.21 ? 559  LYS B C     1 
ATOM   6587  O  O     . LYS F 2 370 ? -11.788 91.039  89.747  1.00 39.53 ? 559  LYS B O     1 
ATOM   6588  C  CB    . LYS F 2 370 ? -10.503 93.460  88.198  1.00 42.16 ? 559  LYS B CB    1 
ATOM   6589  C  CG    . LYS F 2 370 ? -9.331  94.337  87.822  1.00 45.77 ? 559  LYS B CG    1 
ATOM   6590  C  CD    . LYS F 2 370 ? -9.614  95.824  88.091  1.00 48.38 ? 559  LYS B CD    1 
ATOM   6591  C  CE    . LYS F 2 370 ? -10.831 96.318  87.321  1.00 49.69 ? 559  LYS B CE    1 
ATOM   6592  N  NZ    . LYS F 2 370 ? -10.564 97.643  86.679  1.00 51.09 ? 559  LYS B NZ    1 
ATOM   6593  N  N     . HIS F 2 371 ? -12.060 90.720  87.535  1.00 38.03 ? 560  HIS B N     1 
ATOM   6594  C  CA    . HIS F 2 371 ? -13.303 89.964  87.693  1.00 37.04 ? 560  HIS B CA    1 
ATOM   6595  C  C     . HIS F 2 371 ? -13.305 88.660  86.865  1.00 36.49 ? 560  HIS B C     1 
ATOM   6596  O  O     . HIS F 2 371 ? -12.958 88.666  85.675  1.00 36.77 ? 560  HIS B O     1 
ATOM   6597  C  CB    . HIS F 2 371 ? -14.487 90.855  87.274  1.00 35.68 ? 560  HIS B CB    1 
ATOM   6598  C  CG    . HIS F 2 371 ? -15.828 90.318  87.673  1.00 34.75 ? 560  HIS B CG    1 
ATOM   6599  N  ND1   . HIS F 2 371 ? -17.012 90.888  87.250  1.00 34.44 ? 560  HIS B ND1   1 
ATOM   6600  C  CD2   . HIS F 2 371 ? -16.174 89.267  88.453  1.00 34.55 ? 560  HIS B CD2   1 
ATOM   6601  C  CE1   . HIS F 2 371 ? -18.029 90.208  87.750  1.00 35.10 ? 560  HIS B CE1   1 
ATOM   6602  N  NE2   . HIS F 2 371 ? -17.548 89.219  88.484  1.00 35.95 ? 560  HIS B NE2   1 
ATOM   6603  N  N     . VAL F 2 372 ? -13.683 87.552  87.496  1.00 34.81 ? 561  VAL B N     1 
ATOM   6604  C  CA    . VAL F 2 372 ? -13.752 86.276  86.802  1.00 34.44 ? 561  VAL B CA    1 
ATOM   6605  C  C     . VAL F 2 372 ? -15.212 85.841  86.716  1.00 34.69 ? 561  VAL B C     1 
ATOM   6606  O  O     . VAL F 2 372 ? -15.885 85.725  87.739  1.00 34.99 ? 561  VAL B O     1 
ATOM   6607  C  CB    . VAL F 2 372 ? -12.948 85.168  87.537  1.00 34.70 ? 561  VAL B CB    1 
ATOM   6608  C  CG1   . VAL F 2 372 ? -13.361 83.773  87.004  1.00 33.05 ? 561  VAL B CG1   1 
ATOM   6609  C  CG2   . VAL F 2 372 ? -11.447 85.378  87.316  1.00 33.64 ? 561  VAL B CG2   1 
ATOM   6610  N  N     . ILE F 2 373 ? -15.701 85.594  85.502  1.00 33.98 ? 562  ILE B N     1 
ATOM   6611  C  CA    . ILE F 2 373 ? -17.093 85.174  85.328  1.00 34.14 ? 562  ILE B CA    1 
ATOM   6612  C  C     . ILE F 2 373 ? -17.258 83.788  84.714  1.00 33.34 ? 562  ILE B C     1 
ATOM   6613  O  O     . ILE F 2 373 ? -16.883 83.565  83.567  1.00 34.20 ? 562  ILE B O     1 
ATOM   6614  C  CB    . ILE F 2 373 ? -17.880 86.180  84.437  1.00 33.57 ? 562  ILE B CB    1 
ATOM   6615  C  CG1   . ILE F 2 373 ? -18.011 87.524  85.152  1.00 33.96 ? 562  ILE B CG1   1 
ATOM   6616  C  CG2   . ILE F 2 373 ? -19.260 85.639  84.131  1.00 34.08 ? 562  ILE B CG2   1 
ATOM   6617  C  CD1   . ILE F 2 373 ? -18.410 88.663  84.248  1.00 34.21 ? 562  ILE B CD1   1 
ATOM   6618  N  N     . ASN F 2 374 ? -17.809 82.851  85.471  1.00 33.02 ? 563  ASN B N     1 
ATOM   6619  C  CA    . ASN F 2 374 ? -18.051 81.519  84.918  1.00 33.29 ? 563  ASN B CA    1 
ATOM   6620  C  C     . ASN F 2 374 ? -19.410 81.547  84.213  1.00 33.72 ? 563  ASN B C     1 
ATOM   6621  O  O     . ASN F 2 374 ? -20.430 81.181  84.804  1.00 31.59 ? 563  ASN B O     1 
ATOM   6622  C  CB    . ASN F 2 374 ? -18.099 80.447  86.004  1.00 32.97 ? 563  ASN B CB    1 
ATOM   6623  C  CG    . ASN F 2 374 ? -16.717 80.022  86.489  1.00 34.44 ? 563  ASN B CG    1 
ATOM   6624  O  OD1   . ASN F 2 374 ? -15.871 79.570  85.704  1.00 35.54 ? 563  ASN B OD1   1 
ATOM   6625  N  ND2   . ASN F 2 374 ? -16.492 80.141  87.789  1.00 32.32 ? 563  ASN B ND2   1 
ATOM   6626  N  N     . TYR F 2 375 ? -19.416 82.012  82.967  1.00 34.02 ? 564  TYR B N     1 
ATOM   6627  C  CA    . TYR F 2 375 ? -20.632 82.071  82.162  1.00 36.03 ? 564  TYR B CA    1 
ATOM   6628  C  C     . TYR F 2 375 ? -21.247 80.672  82.106  1.00 36.61 ? 564  TYR B C     1 
ATOM   6629  O  O     . TYR F 2 375 ? -22.462 80.522  82.079  1.00 36.81 ? 564  TYR B O     1 
ATOM   6630  C  CB    . TYR F 2 375 ? -20.284 82.571  80.762  1.00 37.18 ? 564  TYR B CB    1 
ATOM   6631  C  CG    . TYR F 2 375 ? -21.461 82.792  79.842  1.00 39.69 ? 564  TYR B CG    1 
ATOM   6632  C  CD1   . TYR F 2 375 ? -22.012 81.734  79.106  1.00 40.70 ? 564  TYR B CD1   1 
ATOM   6633  C  CD2   . TYR F 2 375 ? -21.999 84.072  79.666  1.00 39.86 ? 564  TYR B CD2   1 
ATOM   6634  C  CE1   . TYR F 2 375 ? -23.063 81.951  78.211  1.00 41.17 ? 564  TYR B CE1   1 
ATOM   6635  C  CE2   . TYR F 2 375 ? -23.046 84.300  78.781  1.00 40.59 ? 564  TYR B CE2   1 
ATOM   6636  C  CZ    . TYR F 2 375 ? -23.571 83.239  78.056  1.00 41.34 ? 564  TYR B CZ    1 
ATOM   6637  O  OH    . TYR F 2 375 ? -24.588 83.474  77.162  1.00 42.05 ? 564  TYR B OH    1 
ATOM   6638  N  N     . ASP F 2 376 ? -20.391 79.654  82.087  1.00 37.65 ? 565  ASP B N     1 
ATOM   6639  C  CA    . ASP F 2 376 ? -20.816 78.259  82.081  1.00 38.31 ? 565  ASP B CA    1 
ATOM   6640  C  C     . ASP F 2 376 ? -20.032 77.544  83.183  1.00 39.25 ? 565  ASP B C     1 
ATOM   6641  O  O     . ASP F 2 376 ? -18.807 77.658  83.249  1.00 39.94 ? 565  ASP B O     1 
ATOM   6642  C  CB    . ASP F 2 376 ? -20.490 77.571  80.743  1.00 38.85 ? 565  ASP B CB    1 
ATOM   6643  C  CG    . ASP F 2 376 ? -21.306 78.114  79.565  1.00 40.44 ? 565  ASP B CG    1 
ATOM   6644  O  OD1   . ASP F 2 376 ? -22.496 78.444  79.756  1.00 42.56 ? 565  ASP B OD1   1 
ATOM   6645  O  OD2   . ASP F 2 376 ? -20.770 78.188  78.435  1.00 38.68 ? 565  ASP B OD2   1 
ATOM   6646  N  N     . MET F 2 377 ? -20.719 76.817  84.055  1.00 39.22 ? 566  MET B N     1 
ATOM   6647  C  CA    . MET F 2 377 ? -20.027 76.081  85.101  1.00 39.78 ? 566  MET B CA    1 
ATOM   6648  C  C     . MET F 2 377 ? -19.248 74.934  84.466  1.00 40.75 ? 566  MET B C     1 
ATOM   6649  O  O     . MET F 2 377 ? -19.752 74.266  83.562  1.00 40.42 ? 566  MET B O     1 
ATOM   6650  C  CB    . MET F 2 377 ? -21.025 75.503  86.100  1.00 40.19 ? 566  MET B CB    1 
ATOM   6651  C  CG    . MET F 2 377 ? -21.557 76.517  87.096  1.00 41.88 ? 566  MET B CG    1 
ATOM   6652  S  SD    . MET F 2 377 ? -20.205 77.143  88.102  1.00 43.39 ? 566  MET B SD    1 
ATOM   6653  C  CE    . MET F 2 377 ? -19.984 75.746  89.218  1.00 39.84 ? 566  MET B CE    1 
ATOM   6654  N  N     . PRO F 2 378 ? -18.006 74.690  84.926  1.00 40.70 ? 567  PRO B N     1 
ATOM   6655  C  CA    . PRO F 2 378 ? -17.222 73.596  84.352  1.00 40.88 ? 567  PRO B CA    1 
ATOM   6656  C  C     . PRO F 2 378 ? -17.780 72.275  84.837  1.00 40.86 ? 567  PRO B C     1 
ATOM   6657  O  O     . PRO F 2 378 ? -18.494 72.230  85.827  1.00 41.16 ? 567  PRO B O     1 
ATOM   6658  C  CB    . PRO F 2 378 ? -15.821 73.858  84.893  1.00 40.97 ? 567  PRO B CB    1 
ATOM   6659  C  CG    . PRO F 2 378 ? -16.109 74.421  86.250  1.00 40.07 ? 567  PRO B CG    1 
ATOM   6660  C  CD    . PRO F 2 378 ? -17.230 75.401  85.958  1.00 40.43 ? 567  PRO B CD    1 
ATOM   6661  N  N     . SER F 2 379 ? -17.442 71.202  84.144  1.00 41.61 ? 568  SER B N     1 
ATOM   6662  C  CA    . SER F 2 379 ? -17.910 69.875  84.512  1.00 42.35 ? 568  SER B CA    1 
ATOM   6663  C  C     . SER F 2 379 ? -17.284 69.367  85.805  1.00 42.30 ? 568  SER B C     1 
ATOM   6664  O  O     . SER F 2 379 ? -17.866 68.535  86.496  1.00 43.29 ? 568  SER B O     1 
ATOM   6665  C  CB    . SER F 2 379 ? -17.621 68.891  83.368  1.00 43.35 ? 568  SER B CB    1 
ATOM   6666  O  OG    . SER F 2 379 ? -16.374 69.179  82.737  1.00 45.63 ? 568  SER B OG    1 
ATOM   6667  N  N     . LYS F 2 380 ? -16.099 69.860  86.142  1.00 41.39 ? 569  LYS B N     1 
ATOM   6668  C  CA    . LYS F 2 380 ? -15.440 69.417  87.367  1.00 40.47 ? 569  LYS B CA    1 
ATOM   6669  C  C     . LYS F 2 380 ? -15.133 70.562  88.335  1.00 38.22 ? 569  LYS B C     1 
ATOM   6670  O  O     . LYS F 2 380 ? -14.866 71.684  87.917  1.00 37.64 ? 569  LYS B O     1 
ATOM   6671  C  CB    . LYS F 2 380 ? -14.176 68.629  87.002  1.00 43.22 ? 569  LYS B CB    1 
ATOM   6672  C  CG    . LYS F 2 380 ? -14.529 67.236  86.470  1.00 46.37 ? 569  LYS B CG    1 
ATOM   6673  C  CD    . LYS F 2 380 ? -13.365 66.475  85.840  1.00 49.01 ? 569  LYS B CD    1 
ATOM   6674  C  CE    . LYS F 2 380 ? -13.870 65.122  85.304  1.00 50.05 ? 569  LYS B CE    1 
ATOM   6675  N  NZ    . LYS F 2 380 ? -12.837 64.314  84.581  1.00 52.15 ? 569  LYS B NZ    1 
ATOM   6676  N  N     . ILE F 2 381 ? -15.193 70.278  89.634  1.00 35.61 ? 570  ILE B N     1 
ATOM   6677  C  CA    . ILE F 2 381 ? -14.945 71.310  90.632  1.00 33.63 ? 570  ILE B CA    1 
ATOM   6678  C  C     . ILE F 2 381 ? -13.513 71.880  90.565  1.00 32.03 ? 570  ILE B C     1 
ATOM   6679  O  O     . ILE F 2 381 ? -13.312 73.085  90.734  1.00 31.18 ? 570  ILE B O     1 
ATOM   6680  C  CB    . ILE F 2 381 ? -15.299 70.789  92.078  1.00 33.54 ? 570  ILE B CB    1 
ATOM   6681  C  CG1   . ILE F 2 381 ? -15.330 71.962  93.062  1.00 32.87 ? 570  ILE B CG1   1 
ATOM   6682  C  CG2   . ILE F 2 381 ? -14.338 69.695  92.518  1.00 32.27 ? 570  ILE B CG2   1 
ATOM   6683  C  CD1   . ILE F 2 381 ? -16.440 72.967  92.766  1.00 31.78 ? 570  ILE B CD1   1 
ATOM   6684  N  N     . ASP F 2 382 ? -12.523 71.036  90.293  1.00 30.31 ? 571  ASP B N     1 
ATOM   6685  C  CA    . ASP F 2 382 ? -11.157 71.545  90.199  1.00 30.37 ? 571  ASP B CA    1 
ATOM   6686  C  C     . ASP F 2 382 ? -11.036 72.670  89.170  1.00 29.46 ? 571  ASP B C     1 
ATOM   6687  O  O     . ASP F 2 382 ? -10.321 73.654  89.392  1.00 28.69 ? 571  ASP B O     1 
ATOM   6688  C  CB    . ASP F 2 382 ? -10.170 70.444  89.826  1.00 30.54 ? 571  ASP B CB    1 
ATOM   6689  C  CG    . ASP F 2 382 ? -10.091 69.351  90.870  1.00 31.55 ? 571  ASP B CG    1 
ATOM   6690  O  OD1   . ASP F 2 382 ? -10.116 69.657  92.079  1.00 32.49 ? 571  ASP B OD1   1 
ATOM   6691  O  OD2   . ASP F 2 382 ? -9.995  68.171  90.476  1.00 34.94 ? 571  ASP B OD2   1 
ATOM   6692  N  N     . ASP F 2 383 ? -11.750 72.547  88.056  1.00 28.67 ? 572  ASP B N     1 
ATOM   6693  C  CA    . ASP F 2 383 ? -11.654 73.569  87.026  1.00 28.59 ? 572  ASP B CA    1 
ATOM   6694  C  C     . ASP F 2 383 ? -12.277 74.864  87.510  1.00 27.19 ? 572  ASP B C     1 
ATOM   6695  O  O     . ASP F 2 383 ? -11.863 75.943  87.108  1.00 27.67 ? 572  ASP B O     1 
ATOM   6696  C  CB    . ASP F 2 383 ? -12.290 73.091  85.710  1.00 29.82 ? 572  ASP B CB    1 
ATOM   6697  C  CG    . ASP F 2 383 ? -11.792 73.887  84.499  1.00 32.84 ? 572  ASP B CG    1 
ATOM   6698  O  OD1   . ASP F 2 383 ? -10.602 74.303  84.488  1.00 35.26 ? 572  ASP B OD1   1 
ATOM   6699  O  OD2   . ASP F 2 383 ? -12.573 74.092  83.546  1.00 35.15 ? 572  ASP B OD2   1 
ATOM   6700  N  N     . TYR F 2 384 ? -13.267 74.756  88.382  1.00 26.88 ? 573  TYR B N     1 
ATOM   6701  C  CA    . TYR F 2 384 ? -13.897 75.946  88.948  1.00 27.52 ? 573  TYR B CA    1 
ATOM   6702  C  C     . TYR F 2 384 ? -12.835 76.681  89.791  1.00 26.01 ? 573  TYR B C     1 
ATOM   6703  O  O     . TYR F 2 384 ? -12.655 77.897  89.685  1.00 25.96 ? 573  TYR B O     1 
ATOM   6704  C  CB    . TYR F 2 384 ? -15.082 75.539  89.844  1.00 28.33 ? 573  TYR B CB    1 
ATOM   6705  C  CG    . TYR F 2 384 ? -15.637 76.678  90.665  1.00 31.32 ? 573  TYR B CG    1 
ATOM   6706  C  CD1   . TYR F 2 384 ? -16.432 77.665  90.079  1.00 32.44 ? 573  TYR B CD1   1 
ATOM   6707  C  CD2   . TYR F 2 384 ? -15.304 76.812  92.016  1.00 31.96 ? 573  TYR B CD2   1 
ATOM   6708  C  CE1   . TYR F 2 384 ? -16.881 78.766  90.819  1.00 33.78 ? 573  TYR B CE1   1 
ATOM   6709  C  CE2   . TYR F 2 384 ? -15.737 77.909  92.759  1.00 33.55 ? 573  TYR B CE2   1 
ATOM   6710  C  CZ    . TYR F 2 384 ? -16.523 78.882  92.154  1.00 34.08 ? 573  TYR B CZ    1 
ATOM   6711  O  OH    . TYR F 2 384 ? -16.908 79.990  92.875  1.00 35.44 ? 573  TYR B OH    1 
ATOM   6712  N  N     . VAL F 2 385 ? -12.124 75.919  90.618  1.00 25.97 ? 574  VAL B N     1 
ATOM   6713  C  CA    . VAL F 2 385 ? -11.091 76.471  91.491  1.00 25.44 ? 574  VAL B CA    1 
ATOM   6714  C  C     . VAL F 2 385 ? -9.966  77.174  90.732  1.00 25.07 ? 574  VAL B C     1 
ATOM   6715  O  O     . VAL F 2 385 ? -9.487  78.214  91.157  1.00 25.30 ? 574  VAL B O     1 
ATOM   6716  C  CB    . VAL F 2 385 ? -10.513 75.359  92.389  1.00 25.94 ? 574  VAL B CB    1 
ATOM   6717  C  CG1   . VAL F 2 385 ? -9.302  75.860  93.145  1.00 26.23 ? 574  VAL B CG1   1 
ATOM   6718  C  CG2   . VAL F 2 385 ? -11.597 74.883  93.360  1.00 26.11 ? 574  VAL B CG2   1 
ATOM   6719  N  N     . HIS F 2 386 ? -9.555  76.627  89.596  1.00 24.90 ? 575  HIS B N     1 
ATOM   6720  C  CA    . HIS F 2 386 ? -8.494  77.249  88.825  1.00 24.68 ? 575  HIS B CA    1 
ATOM   6721  C  C     . HIS F 2 386 ? -8.972  78.517  88.144  1.00 25.21 ? 575  HIS B C     1 
ATOM   6722  O  O     . HIS F 2 386 ? -8.256  79.515  88.092  1.00 24.71 ? 575  HIS B O     1 
ATOM   6723  C  CB    . HIS F 2 386 ? -7.952  76.273  87.782  1.00 23.13 ? 575  HIS B CB    1 
ATOM   6724  C  CG    . HIS F 2 386 ? -7.028  75.249  88.355  1.00 25.12 ? 575  HIS B CG    1 
ATOM   6725  N  ND1   . HIS F 2 386 ? -5.697  75.509  88.611  1.00 24.55 ? 575  HIS B ND1   1 
ATOM   6726  C  CD2   . HIS F 2 386 ? -7.249  73.977  88.761  1.00 23.51 ? 575  HIS B CD2   1 
ATOM   6727  C  CE1   . HIS F 2 386 ? -5.139  74.438  89.149  1.00 24.25 ? 575  HIS B CE1   1 
ATOM   6728  N  NE2   . HIS F 2 386 ? -6.059  73.496  89.251  1.00 24.00 ? 575  HIS B NE2   1 
ATOM   6729  N  N     . ARG F 2 387 ? -10.189 78.465  87.624  1.00 26.62 ? 576  ARG B N     1 
ATOM   6730  C  CA    . ARG F 2 387 ? -10.771 79.598  86.936  1.00 27.57 ? 576  ARG B CA    1 
ATOM   6731  C  C     . ARG F 2 387 ? -10.907 80.804  87.846  1.00 26.75 ? 576  ARG B C     1 
ATOM   6732  O  O     . ARG F 2 387 ? -10.433 81.881  87.514  1.00 27.53 ? 576  ARG B O     1 
ATOM   6733  C  CB    . ARG F 2 387 ? -12.144 79.236  86.375  1.00 28.29 ? 576  ARG B CB    1 
ATOM   6734  C  CG    . ARG F 2 387 ? -12.130 78.454  85.078  1.00 30.31 ? 576  ARG B CG    1 
ATOM   6735  C  CD    . ARG F 2 387 ? -13.561 78.094  84.706  1.00 33.34 ? 576  ARG B CD    1 
ATOM   6736  N  NE    . ARG F 2 387 ? -13.689 77.435  83.415  1.00 35.83 ? 576  ARG B NE    1 
ATOM   6737  C  CZ    . ARG F 2 387 ? -14.858 77.153  82.837  1.00 37.49 ? 576  ARG B CZ    1 
ATOM   6738  N  NH1   . ARG F 2 387 ? -15.997 77.473  83.443  1.00 37.34 ? 576  ARG B NH1   1 
ATOM   6739  N  NH2   . ARG F 2 387 ? -14.895 76.571  81.642  1.00 37.05 ? 576  ARG B NH2   1 
ATOM   6740  N  N     . ILE F 2 388 ? -11.540 80.637  88.999  1.00 27.66 ? 577  ILE B N     1 
ATOM   6741  C  CA    . ILE F 2 388 ? -11.724 81.797  89.868  1.00 27.86 ? 577  ILE B CA    1 
ATOM   6742  C  C     . ILE F 2 388 ? -10.385 82.299  90.386  1.00 28.39 ? 577  ILE B C     1 
ATOM   6743  O  O     . ILE F 2 388 ? -10.254 83.473  90.746  1.00 28.58 ? 577  ILE B O     1 
ATOM   6744  C  CB    . ILE F 2 388 ? -12.688 81.498  91.034  1.00 27.77 ? 577  ILE B CB    1 
ATOM   6745  C  CG1   . ILE F 2 388 ? -12.051 80.545  92.027  1.00 27.11 ? 577  ILE B CG1   1 
ATOM   6746  C  CG2   . ILE F 2 388 ? -13.971 80.920  90.488  1.00 26.64 ? 577  ILE B CG2   1 
ATOM   6747  C  CD1   . ILE F 2 388 ? -12.895 80.335  93.251  1.00 26.93 ? 577  ILE B CD1   1 
ATOM   6748  N  N     . GLY F 2 389 ? -9.386  81.409  90.364  1.00 28.01 ? 578  GLY B N     1 
ATOM   6749  C  CA    . GLY F 2 389 ? -8.037  81.743  90.790  1.00 25.77 ? 578  GLY B CA    1 
ATOM   6750  C  C     . GLY F 2 389 ? -7.306  82.667  89.825  1.00 25.92 ? 578  GLY B C     1 
ATOM   6751  O  O     . GLY F 2 389 ? -6.176  83.056  90.092  1.00 24.22 ? 578  GLY B O     1 
ATOM   6752  N  N     . ARG F 2 390 ? -7.916  83.011  88.690  1.00 25.65 ? 579  ARG B N     1 
ATOM   6753  C  CA    . ARG F 2 390 ? -7.252  83.930  87.768  1.00 26.43 ? 579  ARG B CA    1 
ATOM   6754  C  C     . ARG F 2 390 ? -7.224  85.338  88.389  1.00 27.80 ? 579  ARG B C     1 
ATOM   6755  O  O     . ARG F 2 390 ? -6.511  86.225  87.932  1.00 27.19 ? 579  ARG B O     1 
ATOM   6756  C  CB    . ARG F 2 390 ? -7.958  83.981  86.397  1.00 25.34 ? 579  ARG B CB    1 
ATOM   6757  C  CG    . ARG F 2 390 ? -7.636  82.825  85.433  1.00 24.76 ? 579  ARG B CG    1 
ATOM   6758  C  CD    . ARG F 2 390 ? -6.241  82.232  85.649  1.00 22.99 ? 579  ARG B CD    1 
ATOM   6759  N  NE    . ARG F 2 390 ? -6.279  81.173  86.652  1.00 21.66 ? 579  ARG B NE    1 
ATOM   6760  C  CZ    . ARG F 2 390 ? -5.257  80.823  87.424  1.00 20.94 ? 579  ARG B CZ    1 
ATOM   6761  N  NH1   . ARG F 2 390 ? -4.099  81.451  87.314  1.00 21.56 ? 579  ARG B NH1   1 
ATOM   6762  N  NH2   . ARG F 2 390 ? -5.399  79.842  88.314  1.00 20.90 ? 579  ARG B NH2   1 
ATOM   6763  N  N     . THR F 2 391 ? -8.011  85.533  89.439  1.00 30.29 ? 580  THR B N     1 
ATOM   6764  C  CA    . THR F 2 391 ? -8.057  86.815  90.137  1.00 32.62 ? 580  THR B CA    1 
ATOM   6765  C  C     . THR F 2 391 ? -7.678  86.562  91.598  1.00 32.79 ? 580  THR B C     1 
ATOM   6766  O  O     . THR F 2 391 ? -7.491  85.412  92.001  1.00 31.95 ? 580  THR B O     1 
ATOM   6767  C  CB    . THR F 2 391 ? -9.486  87.453  90.072  1.00 33.38 ? 580  THR B CB    1 
ATOM   6768  O  OG1   . THR F 2 391 ? -9.446  88.776  90.627  1.00 36.39 ? 580  THR B OG1   1 
ATOM   6769  C  CG2   . THR F 2 391 ? -10.490 86.629  90.872  1.00 32.77 ? 580  THR B CG2   1 
ATOM   6770  N  N     . GLY F 2 392 ? -7.574  87.629  92.386  1.00 33.94 ? 581  GLY B N     1 
ATOM   6771  C  CA    . GLY F 2 392 ? -7.224  87.483  93.795  1.00 35.30 ? 581  GLY B CA    1 
ATOM   6772  C  C     . GLY F 2 392 ? -5.899  86.775  94.043  1.00 35.98 ? 581  GLY B C     1 
ATOM   6773  O  O     . GLY F 2 392 ? -5.808  85.876  94.880  1.00 35.52 ? 581  GLY B O     1 
ATOM   6774  N  N     . ARG F 2 393 ? -4.860  87.183  93.327  1.00 36.97 ? 582  ARG B N     1 
ATOM   6775  C  CA    . ARG F 2 393 ? -3.558  86.554  93.480  1.00 38.51 ? 582  ARG B CA    1 
ATOM   6776  C  C     . ARG F 2 393 ? -2.624  87.328  94.406  1.00 39.57 ? 582  ARG B C     1 
ATOM   6777  O  O     . ARG F 2 393 ? -2.740  88.548  94.542  1.00 39.59 ? 582  ARG B O     1 
ATOM   6778  C  CB    . ARG F 2 393 ? -2.883  86.412  92.116  1.00 38.48 ? 582  ARG B CB    1 
ATOM   6779  C  CG    . ARG F 2 393 ? -3.802  85.940  90.996  1.00 39.35 ? 582  ARG B CG    1 
ATOM   6780  C  CD    . ARG F 2 393 ? -2.987  85.370  89.857  1.00 40.22 ? 582  ARG B CD    1 
ATOM   6781  N  NE    . ARG F 2 393 ? -2.808  83.933  90.026  1.00 41.89 ? 582  ARG B NE    1 
ATOM   6782  C  CZ    . ARG F 2 393 ? -1.816  83.231  89.502  1.00 42.65 ? 582  ARG B CZ    1 
ATOM   6783  N  NH1   . ARG F 2 393 ? -0.887  83.819  88.774  1.00 44.89 ? 582  ARG B NH1   1 
ATOM   6784  N  NH2   . ARG F 2 393 ? -1.767  81.926  89.681  1.00 45.45 ? 582  ARG B NH2   1 
ATOM   6785  N  N     . VAL F 2 394 ? -1.697  86.601  95.029  1.00 40.02 ? 583  VAL B N     1 
ATOM   6786  C  CA    . VAL F 2 394 ? -0.683  87.179  95.913  1.00 41.15 ? 583  VAL B CA    1 
ATOM   6787  C  C     . VAL F 2 394 ? -1.228  87.992  97.082  1.00 41.89 ? 583  VAL B C     1 
ATOM   6788  O  O     . VAL F 2 394 ? -0.637  89.004  97.473  1.00 41.45 ? 583  VAL B O     1 
ATOM   6789  C  CB    . VAL F 2 394 ? 0.285   88.095  95.120  1.00 41.58 ? 583  VAL B CB    1 
ATOM   6790  C  CG1   . VAL F 2 394 ? 1.680   88.056  95.743  1.00 41.52 ? 583  VAL B CG1   1 
ATOM   6791  C  CG2   . VAL F 2 394 ? 0.324   87.677  93.663  1.00 40.92 ? 583  VAL B CG2   1 
ATOM   6792  N  N     . GLY F 2 395 ? -2.347  87.557  97.642  1.00 42.38 ? 584  GLY B N     1 
ATOM   6793  C  CA    . GLY F 2 395 ? -2.908  88.281  98.764  1.00 43.66 ? 584  GLY B CA    1 
ATOM   6794  C  C     . GLY F 2 395 ? -3.806  89.435  98.360  1.00 44.14 ? 584  GLY B C     1 
ATOM   6795  O  O     . GLY F 2 395 ? -4.337  90.128  99.222  1.00 44.94 ? 584  GLY B O     1 
ATOM   6796  N  N     . ASN F 2 396 ? -3.969  89.660  97.061  1.00 43.95 ? 585  ASN B N     1 
ATOM   6797  C  CA    . ASN F 2 396 ? -4.845  90.729  96.583  1.00 43.77 ? 585  ASN B CA    1 
ATOM   6798  C  C     . ASN F 2 396 ? -6.282  90.206  96.541  1.00 43.86 ? 585  ASN B C     1 
ATOM   6799  O  O     . ASN F 2 396 ? -6.505  88.993  96.421  1.00 44.29 ? 585  ASN B O     1 
ATOM   6800  C  CB    . ASN F 2 396 ? -4.430  91.166  95.179  1.00 43.64 ? 585  ASN B CB    1 
ATOM   6801  C  CG    . ASN F 2 396 ? -3.166  91.997  95.175  1.00 43.96 ? 585  ASN B CG    1 
ATOM   6802  O  OD1   . ASN F 2 396 ? -3.165  93.137  95.625  1.00 44.67 ? 585  ASN B OD1   1 
ATOM   6803  N  ND2   . ASN F 2 396 ? -2.081  91.429  94.665  1.00 44.09 ? 585  ASN B ND2   1 
ATOM   6804  N  N     . ASN F 2 397 ? -7.257  91.103  96.665  1.00 43.44 ? 586  ASN B N     1 
ATOM   6805  C  CA    . ASN F 2 397 ? -8.661  90.690  96.596  1.00 43.47 ? 586  ASN B CA    1 
ATOM   6806  C  C     . ASN F 2 397 ? -9.044  90.562  95.130  1.00 42.24 ? 586  ASN B C     1 
ATOM   6807  O  O     . ASN F 2 397 ? -8.385  91.116  94.261  1.00 42.03 ? 586  ASN B O     1 
ATOM   6808  C  CB    . ASN F 2 397 ? -9.591  91.731  97.227  1.00 44.69 ? 586  ASN B CB    1 
ATOM   6809  C  CG    . ASN F 2 397 ? -9.487  91.783  98.730  1.00 46.35 ? 586  ASN B CG    1 
ATOM   6810  O  OD1   . ASN F 2 397 ? -9.843  90.824  99.430  1.00 46.23 ? 586  ASN B OD1   1 
ATOM   6811  N  ND2   . ASN F 2 397 ? -9.001  92.913  99.245  1.00 46.29 ? 586  ASN B ND2   1 
ATOM   6812  N  N     . GLY F 2 398 ? -10.116 89.830  94.869  1.00 41.89 ? 587  GLY B N     1 
ATOM   6813  C  CA    . GLY F 2 398 ? -10.603 89.666  93.513  1.00 40.57 ? 587  GLY B CA    1 
ATOM   6814  C  C     . GLY F 2 398 ? -12.026 89.181  93.649  1.00 40.31 ? 587  GLY B C     1 
ATOM   6815  O  O     . GLY F 2 398 ? -12.426 88.795  94.748  1.00 39.23 ? 587  GLY B O     1 
ATOM   6816  N  N     . ARG F 2 399 ? -12.797 89.208  92.564  1.00 40.13 ? 588  ARG B N     1 
ATOM   6817  C  CA    . ARG F 2 399 ? -14.177 88.726  92.615  1.00 40.46 ? 588  ARG B CA    1 
ATOM   6818  C  C     . ARG F 2 399 ? -14.513 87.751  91.479  1.00 38.95 ? 588  ARG B C     1 
ATOM   6819  O  O     . ARG F 2 399 ? -14.005 87.870  90.358  1.00 37.42 ? 588  ARG B O     1 
ATOM   6820  C  CB    . ARG F 2 399 ? -15.167 89.906  92.616  1.00 42.34 ? 588  ARG B CB    1 
ATOM   6821  C  CG    . ARG F 2 399 ? -14.823 91.042  91.664  1.00 46.49 ? 588  ARG B CG    1 
ATOM   6822  C  CD    . ARG F 2 399 ? -15.721 92.270  91.905  1.00 49.40 ? 588  ARG B CD    1 
ATOM   6823  N  NE    . ARG F 2 399 ? -17.061 92.134  91.326  1.00 50.96 ? 588  ARG B NE    1 
ATOM   6824  C  CZ    . ARG F 2 399 ? -17.426 92.647  90.151  1.00 51.70 ? 588  ARG B CZ    1 
ATOM   6825  N  NH1   . ARG F 2 399 ? -16.551 93.334  89.419  1.00 52.23 ? 588  ARG B NH1   1 
ATOM   6826  N  NH2   . ARG F 2 399 ? -18.672 92.489  89.717  1.00 51.05 ? 588  ARG B NH2   1 
ATOM   6827  N  N     . ALA F 2 400 ? -15.368 86.783  91.792  1.00 37.95 ? 589  ALA B N     1 
ATOM   6828  C  CA    . ALA F 2 400 ? -15.780 85.782  90.827  1.00 38.42 ? 589  ALA B CA    1 
ATOM   6829  C  C     . ALA F 2 400 ? -17.295 85.637  90.791  1.00 38.37 ? 589  ALA B C     1 
ATOM   6830  O  O     . ALA F 2 400 ? -17.938 85.502  91.826  1.00 39.42 ? 589  ALA B O     1 
ATOM   6831  C  CB    . ALA F 2 400 ? -15.140 84.443  91.163  1.00 37.58 ? 589  ALA B CB    1 
ATOM   6832  N  N     . THR F 2 401 ? -17.853 85.653  89.588  1.00 38.26 ? 590  THR B N     1 
ATOM   6833  C  CA    . THR F 2 401 ? -19.297 85.517  89.392  1.00 38.93 ? 590  THR B CA    1 
ATOM   6834  C  C     . THR F 2 401 ? -19.560 84.266  88.552  1.00 38.01 ? 590  THR B C     1 
ATOM   6835  O  O     . THR F 2 401 ? -19.081 84.161  87.431  1.00 37.77 ? 590  THR B O     1 
ATOM   6836  C  CB    . THR F 2 401 ? -19.873 86.756  88.636  1.00 39.23 ? 590  THR B CB    1 
ATOM   6837  O  OG1   . THR F 2 401 ? -19.418 87.962  89.269  1.00 39.68 ? 590  THR B OG1   1 
ATOM   6838  C  CG2   . THR F 2 401 ? -21.389 86.730  88.633  1.00 38.57 ? 590  THR B CG2   1 
ATOM   6839  N  N     . SER F 2 402 ? -20.317 83.324  89.093  1.00 38.17 ? 591  SER B N     1 
ATOM   6840  C  CA    . SER F 2 402 ? -20.622 82.096  88.366  1.00 40.42 ? 591  SER B CA    1 
ATOM   6841  C  C     . SER F 2 402 ? -22.116 81.949  88.067  1.00 41.09 ? 591  SER B C     1 
ATOM   6842  O  O     . SER F 2 402 ? -22.956 82.233  88.927  1.00 41.62 ? 591  SER B O     1 
ATOM   6843  C  CB    . SER F 2 402 ? -20.154 80.870  89.170  1.00 40.65 ? 591  SER B CB    1 
ATOM   6844  O  OG    . SER F 2 402 ? -18.755 80.901  89.407  1.00 41.40 ? 591  SER B OG    1 
ATOM   6845  N  N     . PHE F 2 403 ? -22.443 81.509  86.853  1.00 41.12 ? 592  PHE B N     1 
ATOM   6846  C  CA    . PHE F 2 403 ? -23.839 81.290  86.461  1.00 41.24 ? 592  PHE B CA    1 
ATOM   6847  C  C     . PHE F 2 403 ? -24.148 79.815  86.625  1.00 42.23 ? 592  PHE B C     1 
ATOM   6848  O  O     . PHE F 2 403 ? -23.677 78.985  85.854  1.00 43.35 ? 592  PHE B O     1 
ATOM   6849  C  CB    . PHE F 2 403 ? -24.080 81.682  85.000  1.00 40.10 ? 592  PHE B CB    1 
ATOM   6850  C  CG    . PHE F 2 403 ? -23.955 83.153  84.728  1.00 40.16 ? 592  PHE B CG    1 
ATOM   6851  C  CD1   . PHE F 2 403 ? -23.989 83.627  83.424  1.00 39.98 ? 592  PHE B CD1   1 
ATOM   6852  C  CD2   . PHE F 2 403 ? -23.814 84.066  85.769  1.00 40.09 ? 592  PHE B CD2   1 
ATOM   6853  C  CE1   . PHE F 2 403 ? -23.885 84.985  83.155  1.00 40.30 ? 592  PHE B CE1   1 
ATOM   6854  C  CE2   . PHE F 2 403 ? -23.707 85.431  85.512  1.00 39.69 ? 592  PHE B CE2   1 
ATOM   6855  C  CZ    . PHE F 2 403 ? -23.743 85.891  84.204  1.00 40.70 ? 592  PHE B CZ    1 
ATOM   6856  N  N     . PHE F 2 404 ? -24.936 79.488  87.634  1.00 43.35 ? 593  PHE B N     1 
ATOM   6857  C  CA    . PHE F 2 404 ? -25.308 78.113  87.899  1.00 45.33 ? 593  PHE B CA    1 
ATOM   6858  C  C     . PHE F 2 404 ? -26.586 77.746  87.132  1.00 47.78 ? 593  PHE B C     1 
ATOM   6859  O  O     . PHE F 2 404 ? -27.608 78.420  87.270  1.00 48.41 ? 593  PHE B O     1 
ATOM   6860  C  CB    . PHE F 2 404 ? -25.533 77.947  89.399  1.00 45.16 ? 593  PHE B CB    1 
ATOM   6861  C  CG    . PHE F 2 404 ? -25.836 76.547  89.812  1.00 44.30 ? 593  PHE B CG    1 
ATOM   6862  C  CD1   . PHE F 2 404 ? -24.842 75.588  89.822  1.00 44.51 ? 593  PHE B CD1   1 
ATOM   6863  C  CD2   . PHE F 2 404 ? -27.126 76.184  90.164  1.00 44.97 ? 593  PHE B CD2   1 
ATOM   6864  C  CE1   . PHE F 2 404 ? -25.126 74.269  90.176  1.00 45.15 ? 593  PHE B CE1   1 
ATOM   6865  C  CE2   . PHE F 2 404 ? -27.424 74.875  90.520  1.00 46.17 ? 593  PHE B CE2   1 
ATOM   6866  C  CZ    . PHE F 2 404 ? -26.413 73.910  90.524  1.00 45.82 ? 593  PHE B CZ    1 
ATOM   6867  N  N     . ASP F 2 405 ? -26.527 76.684  86.329  1.00 49.81 ? 594  ASP B N     1 
ATOM   6868  C  CA    . ASP F 2 405 ? -27.679 76.230  85.555  1.00 51.64 ? 594  ASP B CA    1 
ATOM   6869  C  C     . ASP F 2 405 ? -28.364 75.078  86.282  1.00 53.22 ? 594  ASP B C     1 
ATOM   6870  O  O     . ASP F 2 405 ? -27.913 73.937  86.222  1.00 52.57 ? 594  ASP B O     1 
ATOM   6871  C  CB    . ASP F 2 405 ? -27.246 75.760  84.169  1.00 52.22 ? 594  ASP B CB    1 
ATOM   6872  C  CG    . ASP F 2 405 ? -28.431 75.414  83.272  1.00 53.18 ? 594  ASP B CG    1 
ATOM   6873  O  OD1   . ASP F 2 405 ? -29.265 74.572  83.670  1.00 53.49 ? 594  ASP B OD1   1 
ATOM   6874  O  OD2   . ASP F 2 405 ? -28.528 75.984  82.167  1.00 52.67 ? 594  ASP B OD2   1 
ATOM   6875  N  N     . PRO F 2 406 ? -29.483 75.357  86.964  1.00 55.17 ? 595  PRO B N     1 
ATOM   6876  C  CA    . PRO F 2 406 ? -30.194 74.304  87.695  1.00 56.65 ? 595  PRO B CA    1 
ATOM   6877  C  C     . PRO F 2 406 ? -30.449 73.051  86.871  1.00 57.88 ? 595  PRO B C     1 
ATOM   6878  O  O     . PRO F 2 406 ? -30.473 71.941  87.401  1.00 58.27 ? 595  PRO B O     1 
ATOM   6879  C  CB    . PRO F 2 406 ? -31.484 74.995  88.119  1.00 56.54 ? 595  PRO B CB    1 
ATOM   6880  C  CG    . PRO F 2 406 ? -31.048 76.421  88.292  1.00 56.26 ? 595  PRO B CG    1 
ATOM   6881  C  CD    . PRO F 2 406 ? -30.210 76.635  87.056  1.00 55.32 ? 595  PRO B CD    1 
ATOM   6882  N  N     . GLU F 2 407 ? -30.627 73.234  85.571  1.00 59.39 ? 596  GLU B N     1 
ATOM   6883  C  CA    . GLU F 2 407 ? -30.890 72.119  84.675  1.00 61.69 ? 596  GLU B CA    1 
ATOM   6884  C  C     . GLU F 2 407 ? -29.635 71.300  84.358  1.00 62.33 ? 596  GLU B C     1 
ATOM   6885  O  O     . GLU F 2 407 ? -29.645 70.070  84.463  1.00 62.94 ? 596  GLU B O     1 
ATOM   6886  C  CB    . GLU F 2 407 ? -31.479 72.645  83.368  1.00 63.35 ? 596  GLU B CB    1 
ATOM   6887  C  CG    . GLU F 2 407 ? -32.588 73.677  83.544  1.00 66.39 ? 596  GLU B CG    1 
ATOM   6888  C  CD    . GLU F 2 407 ? -32.753 74.572  82.316  1.00 68.16 ? 596  GLU B CD    1 
ATOM   6889  O  OE1   . GLU F 2 407 ? -31.807 75.338  82.006  1.00 68.78 ? 596  GLU B OE1   1 
ATOM   6890  O  OE2   . GLU F 2 407 ? -33.823 74.507  81.663  1.00 68.83 ? 596  GLU B OE2   1 
ATOM   6891  N  N     . LYS F 2 408 ? -28.556 71.989  83.986  1.00 62.06 ? 597  LYS B N     1 
ATOM   6892  C  CA    . LYS F 2 408 ? -27.311 71.335  83.588  1.00 61.82 ? 597  LYS B CA    1 
ATOM   6893  C  C     . LYS F 2 408 ? -26.245 71.092  84.662  1.00 61.26 ? 597  LYS B C     1 
ATOM   6894  O  O     . LYS F 2 408 ? -25.553 70.069  84.640  1.00 61.58 ? 597  LYS B O     1 
ATOM   6895  C  CB    . LYS F 2 408 ? -26.679 72.138  82.443  1.00 62.47 ? 597  LYS B CB    1 
ATOM   6896  C  CG    . LYS F 2 408 ? -25.598 71.409  81.646  1.00 63.50 ? 597  LYS B CG    1 
ATOM   6897  C  CD    . LYS F 2 408 ? -24.760 72.391  80.803  1.00 64.56 ? 597  LYS B CD    1 
ATOM   6898  C  CE    . LYS F 2 408 ? -23.853 73.269  81.683  1.00 65.40 ? 597  LYS B CE    1 
ATOM   6899  N  NZ    . LYS F 2 408 ? -23.164 74.379  80.955  1.00 64.86 ? 597  LYS B NZ    1 
ATOM   6900  N  N     . ASP F 2 409 ? -26.116 72.019  85.602  1.00 59.92 ? 598  ASP B N     1 
ATOM   6901  C  CA    . ASP F 2 409 ? -25.084 71.924  86.623  1.00 58.68 ? 598  ASP B CA    1 
ATOM   6902  C  C     . ASP F 2 409 ? -25.431 71.225  87.924  1.00 58.99 ? 598  ASP B C     1 
ATOM   6903  O  O     . ASP F 2 409 ? -24.816 71.488  88.951  1.00 59.33 ? 598  ASP B O     1 
ATOM   6904  C  CB    . ASP F 2 409 ? -24.565 73.329  86.916  1.00 57.48 ? 598  ASP B CB    1 
ATOM   6905  C  CG    . ASP F 2 409 ? -24.159 74.062  85.653  1.00 55.86 ? 598  ASP B CG    1 
ATOM   6906  O  OD1   . ASP F 2 409 ? -23.408 73.476  84.842  1.00 55.38 ? 598  ASP B OD1   1 
ATOM   6907  O  OD2   . ASP F 2 409 ? -24.587 75.216  85.469  1.00 54.67 ? 598  ASP B OD2   1 
ATOM   6908  N  N     . ARG F 2 410 ? -26.383 70.305  87.874  1.00 59.47 ? 599  ARG B N     1 
ATOM   6909  C  CA    . ARG F 2 410 ? -26.814 69.579  89.064  1.00 59.79 ? 599  ARG B CA    1 
ATOM   6910  C  C     . ARG F 2 410 ? -25.737 68.771  89.789  1.00 58.66 ? 599  ARG B C     1 
ATOM   6911  O  O     . ARG F 2 410 ? -25.605 68.855  91.009  1.00 58.37 ? 599  ARG B O     1 
ATOM   6912  C  CB    . ARG F 2 410 ? -27.987 68.652  88.702  1.00 62.39 ? 599  ARG B CB    1 
ATOM   6913  C  CG    . ARG F 2 410 ? -27.746 67.763  87.467  1.00 64.88 ? 599  ARG B CG    1 
ATOM   6914  C  CD    . ARG F 2 410 ? -29.013 67.004  87.072  1.00 67.39 ? 599  ARG B CD    1 
ATOM   6915  N  NE    . ARG F 2 410 ? -30.137 67.916  86.845  1.00 69.32 ? 599  ARG B NE    1 
ATOM   6916  C  CZ    . ARG F 2 410 ? -31.380 67.531  86.562  1.00 70.36 ? 599  ARG B CZ    1 
ATOM   6917  N  NH1   . ARG F 2 410 ? -31.681 66.239  86.467  1.00 70.36 ? 599  ARG B NH1   1 
ATOM   6918  N  NH2   . ARG F 2 410 ? -32.327 68.446  86.371  1.00 70.55 ? 599  ARG B NH2   1 
ATOM   6919  N  N     . ALA F 2 411 ? -24.970 67.988  89.042  1.00 57.42 ? 600  ALA B N     1 
ATOM   6920  C  CA    . ALA F 2 411 ? -23.941 67.147  89.637  1.00 56.30 ? 600  ALA B CA    1 
ATOM   6921  C  C     . ALA F 2 411 ? -22.771 67.871  90.305  1.00 55.68 ? 600  ALA B C     1 
ATOM   6922  O  O     . ALA F 2 411 ? -22.003 67.250  91.038  1.00 56.00 ? 600  ALA B O     1 
ATOM   6923  C  CB    . ALA F 2 411 ? -23.415 66.179  88.595  1.00 56.68 ? 600  ALA B CB    1 
ATOM   6924  N  N     . ILE F 2 412 ? -22.625 69.171  90.076  1.00 54.43 ? 601  ILE B N     1 
ATOM   6925  C  CA    . ILE F 2 412 ? -21.514 69.895  90.685  1.00 53.40 ? 601  ILE B CA    1 
ATOM   6926  C  C     . ILE F 2 412 ? -21.887 70.769  91.884  1.00 52.99 ? 601  ILE B C     1 
ATOM   6927  O  O     . ILE F 2 412 ? -21.015 71.400  92.479  1.00 53.73 ? 601  ILE B O     1 
ATOM   6928  C  CB    . ILE F 2 412 ? -20.802 70.793  89.649  1.00 53.31 ? 601  ILE B CB    1 
ATOM   6929  C  CG1   . ILE F 2 412 ? -19.384 71.117  90.133  1.00 53.92 ? 601  ILE B CG1   1 
ATOM   6930  C  CG2   . ILE F 2 412 ? -21.581 72.090  89.451  1.00 52.44 ? 601  ILE B CG2   1 
ATOM   6931  C  CD1   . ILE F 2 412 ? -18.588 72.009  89.181  1.00 53.70 ? 601  ILE B CD1   1 
ATOM   6932  N  N     . ALA F 2 413 ? -23.166 70.812  92.246  1.00 51.78 ? 602  ALA B N     1 
ATOM   6933  C  CA    . ALA F 2 413 ? -23.612 71.646  93.366  1.00 50.33 ? 602  ALA B CA    1 
ATOM   6934  C  C     . ALA F 2 413 ? -22.991 71.247  94.703  1.00 49.17 ? 602  ALA B C     1 
ATOM   6935  O  O     . ALA F 2 413 ? -22.477 72.097  95.433  1.00 48.11 ? 602  ALA B O     1 
ATOM   6936  C  CB    . ALA F 2 413 ? -25.134 71.617  93.470  1.00 50.42 ? 602  ALA B CB    1 
ATOM   6937  N  N     . ALA F 2 414 ? -23.048 69.959  95.024  1.00 48.07 ? 603  ALA B N     1 
ATOM   6938  C  CA    . ALA F 2 414 ? -22.480 69.473  96.273  1.00 47.85 ? 603  ALA B CA    1 
ATOM   6939  C  C     . ALA F 2 414 ? -21.052 69.989  96.467  1.00 47.78 ? 603  ALA B C     1 
ATOM   6940  O  O     . ALA F 2 414 ? -20.721 70.562  97.515  1.00 47.43 ? 603  ALA B O     1 
ATOM   6941  C  CB    . ALA F 2 414 ? -22.486 67.953  96.292  1.00 48.31 ? 603  ALA B CB    1 
ATOM   6942  N  N     . ASP F 2 415 ? -20.212 69.794  95.452  1.00 46.83 ? 604  ASP B N     1 
ATOM   6943  C  CA    . ASP F 2 415 ? -18.826 70.235  95.527  1.00 45.59 ? 604  ASP B CA    1 
ATOM   6944  C  C     . ASP F 2 415 ? -18.693 71.749  95.577  1.00 44.20 ? 604  ASP B C     1 
ATOM   6945  O  O     . ASP F 2 415 ? -17.766 72.268  96.193  1.00 42.86 ? 604  ASP B O     1 
ATOM   6946  C  CB    . ASP F 2 415 ? -18.025 69.682  94.350  1.00 46.83 ? 604  ASP B CB    1 
ATOM   6947  C  CG    . ASP F 2 415 ? -17.810 68.190  94.448  1.00 48.51 ? 604  ASP B CG    1 
ATOM   6948  O  OD1   . ASP F 2 415 ? -17.661 67.698  95.587  1.00 50.83 ? 604  ASP B OD1   1 
ATOM   6949  O  OD2   . ASP F 2 415 ? -17.770 67.509  93.400  1.00 49.41 ? 604  ASP B OD2   1 
ATOM   6950  N  N     . LEU F 2 416 ? -19.609 72.459  94.927  1.00 43.32 ? 605  LEU B N     1 
ATOM   6951  C  CA    . LEU F 2 416 ? -19.550 73.912  94.941  1.00 43.27 ? 605  LEU B CA    1 
ATOM   6952  C  C     . LEU F 2 416 ? -19.836 74.402  96.358  1.00 43.71 ? 605  LEU B C     1 
ATOM   6953  O  O     . LEU F 2 416 ? -19.305 75.423  96.792  1.00 43.39 ? 605  LEU B O     1 
ATOM   6954  C  CB    . LEU F 2 416 ? -20.560 74.511  93.964  1.00 42.23 ? 605  LEU B CB    1 
ATOM   6955  C  CG    . LEU F 2 416 ? -20.567 76.042  93.933  1.00 42.81 ? 605  LEU B CG    1 
ATOM   6956  C  CD1   . LEU F 2 416 ? -19.174 76.572  93.601  1.00 43.26 ? 605  LEU B CD1   1 
ATOM   6957  C  CD2   . LEU F 2 416 ? -21.574 76.529  92.908  1.00 42.52 ? 605  LEU B CD2   1 
ATOM   6958  N  N     . VAL F 2 417 ? -20.674 73.661  97.077  1.00 44.08 ? 606  VAL B N     1 
ATOM   6959  C  CA    . VAL F 2 417 ? -21.015 74.009  98.447  1.00 45.05 ? 606  VAL B CA    1 
ATOM   6960  C  C     . VAL F 2 417 ? -19.760 73.920  99.317  1.00 46.03 ? 606  VAL B C     1 
ATOM   6961  O  O     . VAL F 2 417 ? -19.376 74.896  99.984  1.00 45.74 ? 606  VAL B O     1 
ATOM   6962  C  CB    . VAL F 2 417 ? -22.130 73.065  98.986  1.00 45.62 ? 606  VAL B CB    1 
ATOM   6963  C  CG1   . VAL F 2 417 ? -22.144 73.042  100.513 1.00 44.88 ? 606  VAL B CG1   1 
ATOM   6964  C  CG2   . VAL F 2 417 ? -23.479 73.540  98.467  1.00 44.52 ? 606  VAL B CG2   1 
ATOM   6965  N  N     . LYS F 2 418 ? -19.110 72.758  99.288  1.00 46.65 ? 607  LYS B N     1 
ATOM   6966  C  CA    . LYS F 2 418 ? -17.896 72.551  100.066 1.00 47.16 ? 607  LYS B CA    1 
ATOM   6967  C  C     . LYS F 2 418 ? -16.801 73.559  99.693  1.00 47.37 ? 607  LYS B C     1 
ATOM   6968  O  O     . LYS F 2 418 ? -16.125 74.092  100.575 1.00 48.10 ? 607  LYS B O     1 
ATOM   6969  C  CB    . LYS F 2 418 ? -17.392 71.120  99.884  1.00 47.39 ? 607  LYS B CB    1 
ATOM   6970  C  CG    . LYS F 2 418 ? -18.442 70.068  100.242 1.00 48.61 ? 607  LYS B CG    1 
ATOM   6971  C  CD    . LYS F 2 418 ? -17.837 68.682  100.450 1.00 49.66 ? 607  LYS B CD    1 
ATOM   6972  C  CE    . LYS F 2 418 ? -17.069 68.206  99.230  1.00 51.03 ? 607  LYS B CE    1 
ATOM   6973  N  NZ    . LYS F 2 418 ? -16.245 66.992  99.523  1.00 51.64 ? 607  LYS B NZ    1 
ATOM   6974  N  N     . ILE F 2 419 ? -16.624 73.838  98.404  1.00 46.22 ? 608  ILE B N     1 
ATOM   6975  C  CA    . ILE F 2 419 ? -15.601 74.801  98.018  1.00 45.69 ? 608  ILE B CA    1 
ATOM   6976  C  C     . ILE F 2 419 ? -15.933 76.176  98.616  1.00 46.20 ? 608  ILE B C     1 
ATOM   6977  O  O     . ILE F 2 419 ? -15.046 76.870  99.118  1.00 45.59 ? 608  ILE B O     1 
ATOM   6978  C  CB    . ILE F 2 419 ? -15.452 74.911  96.456  1.00 44.39 ? 608  ILE B CB    1 
ATOM   6979  C  CG1   . ILE F 2 419 ? -14.132 74.287  95.995  1.00 44.39 ? 608  ILE B CG1   1 
ATOM   6980  C  CG2   . ILE F 2 419 ? -15.391 76.356  96.025  1.00 43.96 ? 608  ILE B CG2   1 
ATOM   6981  C  CD1   . ILE F 2 419 ? -13.960 72.827  96.332  1.00 46.31 ? 608  ILE B CD1   1 
ATOM   6982  N  N     . LEU F 2 420 ? -17.207 76.564  98.570  1.00 46.63 ? 609  LEU B N     1 
ATOM   6983  C  CA    . LEU F 2 420 ? -17.626 77.861  99.108  1.00 47.32 ? 609  LEU B CA    1 
ATOM   6984  C  C     . LEU F 2 420 ? -17.367 77.939  100.605 1.00 47.87 ? 609  LEU B C     1 
ATOM   6985  O  O     . LEU F 2 420 ? -16.780 78.905  101.090 1.00 47.11 ? 609  LEU B O     1 
ATOM   6986  C  CB    . LEU F 2 420 ? -19.115 78.111  98.837  1.00 46.30 ? 609  LEU B CB    1 
ATOM   6987  C  CG    . LEU F 2 420 ? -19.538 78.324  97.383  1.00 45.71 ? 609  LEU B CG    1 
ATOM   6988  C  CD1   . LEU F 2 420 ? -21.047 78.324  97.297  1.00 46.36 ? 609  LEU B CD1   1 
ATOM   6989  C  CD2   . LEU F 2 420 ? -18.967 79.625  96.850  1.00 45.29 ? 609  LEU B CD2   1 
ATOM   6990  N  N     . GLU F 2 421 ? -17.808 76.916  101.330 1.00 48.93 ? 610  GLU B N     1 
ATOM   6991  C  CA    . GLU F 2 421 ? -17.616 76.875  102.772 1.00 50.80 ? 610  GLU B CA    1 
ATOM   6992  C  C     . GLU F 2 421 ? -16.129 76.908  103.119 1.00 51.10 ? 610  GLU B C     1 
ATOM   6993  O  O     . GLU F 2 421 ? -15.677 77.779  103.864 1.00 51.50 ? 610  GLU B O     1 
ATOM   6994  C  CB    . GLU F 2 421 ? -18.252 75.610  103.352 1.00 51.56 ? 610  GLU B CB    1 
ATOM   6995  C  CG    . GLU F 2 421 ? -19.737 75.501  103.070 1.00 53.62 ? 610  GLU B CG    1 
ATOM   6996  C  CD    . GLU F 2 421 ? -20.399 74.344  103.802 1.00 54.69 ? 610  GLU B CD    1 
ATOM   6997  O  OE1   . GLU F 2 421 ? -19.900 73.203  103.690 1.00 56.10 ? 610  GLU B OE1   1 
ATOM   6998  O  OE2   . GLU F 2 421 ? -21.427 74.576  104.480 1.00 55.70 ? 610  GLU B OE2   1 
ATOM   6999  N  N     . GLY F 2 422 ? -15.380 75.956  102.564 1.00 50.85 ? 611  GLY B N     1 
ATOM   7000  C  CA    . GLY F 2 422 ? -13.953 75.864  102.817 1.00 49.59 ? 611  GLY B CA    1 
ATOM   7001  C  C     . GLY F 2 422 ? -13.170 77.137  102.571 1.00 49.61 ? 611  GLY B C     1 
ATOM   7002  O  O     . GLY F 2 422 ? -12.021 77.243  102.989 1.00 49.94 ? 611  GLY B O     1 
ATOM   7003  N  N     . SER F 2 423 ? -13.773 78.109  101.896 1.00 49.43 ? 612  SER B N     1 
ATOM   7004  C  CA    . SER F 2 423 ? -13.077 79.364  101.626 1.00 50.01 ? 612  SER B CA    1 
ATOM   7005  C  C     . SER F 2 423 ? -13.801 80.588  102.196 1.00 50.45 ? 612  SER B C     1 
ATOM   7006  O  O     . SER F 2 423 ? -13.540 81.723  101.788 1.00 49.63 ? 612  SER B O     1 
ATOM   7007  C  CB    . SER F 2 423 ? -12.838 79.533  100.117 1.00 49.40 ? 612  SER B CB    1 
ATOM   7008  O  OG    . SER F 2 423 ? -14.024 79.339  99.364  1.00 48.49 ? 612  SER B OG    1 
ATOM   7009  N  N     . GLY F 2 424 ? -14.696 80.342  103.151 1.00 51.83 ? 613  GLY B N     1 
ATOM   7010  C  CA    . GLY F 2 424 ? -15.442 81.415  103.793 1.00 53.39 ? 613  GLY B CA    1 
ATOM   7011  C  C     . GLY F 2 424 ? -16.270 82.250  102.834 1.00 54.01 ? 613  GLY B C     1 
ATOM   7012  O  O     . GLY F 2 424 ? -15.989 83.427  102.608 1.00 54.59 ? 613  GLY B O     1 
ATOM   7013  N  N     . GLN F 2 425 ? -17.298 81.636  102.264 1.00 54.20 ? 614  GLN B N     1 
ATOM   7014  C  CA    . GLN F 2 425 ? -18.160 82.325  101.319 1.00 54.03 ? 614  GLN B CA    1 
ATOM   7015  C  C     . GLN F 2 425 ? -19.577 81.903  101.639 1.00 55.28 ? 614  GLN B C     1 
ATOM   7016  O  O     . GLN F 2 425 ? -19.806 80.765  102.063 1.00 54.59 ? 614  GLN B O     1 
ATOM   7017  C  CB    . GLN F 2 425 ? -17.822 81.904  99.891  1.00 52.47 ? 614  GLN B CB    1 
ATOM   7018  C  CG    . GLN F 2 425 ? -16.363 82.043  99.521  1.00 50.43 ? 614  GLN B CG    1 
ATOM   7019  C  CD    . GLN F 2 425 ? -15.930 83.478  99.397  1.00 48.97 ? 614  GLN B CD    1 
ATOM   7020  O  OE1   . GLN F 2 425 ? -16.569 84.264  98.704  1.00 48.23 ? 614  GLN B OE1   1 
ATOM   7021  N  NE2   . GLN F 2 425 ? -14.832 83.827  100.051 1.00 48.11 ? 614  GLN B NE2   1 
ATOM   7022  N  N     . THR F 2 426 ? -20.525 82.815  101.439 1.00 56.64 ? 615  THR B N     1 
ATOM   7023  C  CA    . THR F 2 426 ? -21.922 82.515  101.709 1.00 58.30 ? 615  THR B CA    1 
ATOM   7024  C  C     . THR F 2 426 ? -22.380 81.482  100.689 1.00 59.14 ? 615  THR B C     1 
ATOM   7025  O  O     . THR F 2 426 ? -21.989 81.530  99.521  1.00 59.08 ? 615  THR B O     1 
ATOM   7026  C  CB    . THR F 2 426 ? -22.809 83.778  101.598 1.00 58.70 ? 615  THR B CB    1 
ATOM   7027  O  OG1   . THR F 2 426 ? -23.048 84.087  100.219 1.00 59.73 ? 615  THR B OG1   1 
ATOM   7028  C  CG2   . THR F 2 426 ? -22.120 84.967  102.254 1.00 58.72 ? 615  THR B CG2   1 
ATOM   7029  N  N     . VAL F 2 427 ? -23.195 80.539  101.140 1.00 60.16 ? 616  VAL B N     1 
ATOM   7030  C  CA    . VAL F 2 427 ? -23.702 79.495  100.271 1.00 61.33 ? 616  VAL B CA    1 
ATOM   7031  C  C     . VAL F 2 427 ? -25.143 79.773  99.877  1.00 62.67 ? 616  VAL B C     1 
ATOM   7032  O  O     . VAL F 2 427 ? -26.055 79.617  100.690 1.00 63.03 ? 616  VAL B O     1 
ATOM   7033  C  CB    . VAL F 2 427 ? -23.664 78.124  100.969 1.00 61.24 ? 616  VAL B CB    1 
ATOM   7034  C  CG1   . VAL F 2 427 ? -24.203 77.048  100.036 1.00 60.63 ? 616  VAL B CG1   1 
ATOM   7035  C  CG2   . VAL F 2 427 ? -22.244 77.804  101.406 1.00 61.72 ? 616  VAL B CG2   1 
ATOM   7036  N  N     . PRO F 2 428 ? -25.373 80.203  98.626  1.00 63.80 ? 617  PRO B N     1 
ATOM   7037  C  CA    . PRO F 2 428 ? -26.751 80.468  98.212  1.00 64.48 ? 617  PRO B CA    1 
ATOM   7038  C  C     . PRO F 2 428 ? -27.621 79.263  98.580  1.00 64.94 ? 617  PRO B C     1 
ATOM   7039  O  O     . PRO F 2 428 ? -27.155 78.120  98.576  1.00 65.10 ? 617  PRO B O     1 
ATOM   7040  C  CB    . PRO F 2 428 ? -26.618 80.663  96.705  1.00 64.43 ? 617  PRO B CB    1 
ATOM   7041  C  CG    . PRO F 2 428 ? -25.293 81.349  96.590  1.00 63.84 ? 617  PRO B CG    1 
ATOM   7042  C  CD    . PRO F 2 428 ? -24.427 80.538  97.545  1.00 64.12 ? 617  PRO B CD    1 
ATOM   7043  N  N     . ASP F 2 429 ? -28.880 79.531  98.900  1.00 65.29 ? 618  ASP B N     1 
ATOM   7044  C  CA    . ASP F 2 429 ? -29.829 78.500  99.304  1.00 65.17 ? 618  ASP B CA    1 
ATOM   7045  C  C     . ASP F 2 429 ? -30.133 77.461  98.231  1.00 64.60 ? 618  ASP B C     1 
ATOM   7046  O  O     . ASP F 2 429 ? -30.213 76.262  98.521  1.00 64.63 ? 618  ASP B O     1 
ATOM   7047  C  CB    . ASP F 2 429 ? -31.139 79.160  99.741  1.00 66.29 ? 618  ASP B CB    1 
ATOM   7048  C  CG    . ASP F 2 429 ? -30.918 80.501  100.426 1.00 67.59 ? 618  ASP B CG    1 
ATOM   7049  O  OD1   . ASP F 2 429 ? -30.442 81.447  99.750  1.00 67.72 ? 618  ASP B OD1   1 
ATOM   7050  O  OD2   . ASP F 2 429 ? -31.217 80.607  101.638 1.00 68.09 ? 618  ASP B OD2   1 
ATOM   7051  N  N     . PHE F 2 430 ? -30.304 77.920  96.995  1.00 63.63 ? 619  PHE B N     1 
ATOM   7052  C  CA    . PHE F 2 430 ? -30.637 77.028  95.890  1.00 63.22 ? 619  PHE B CA    1 
ATOM   7053  C  C     . PHE F 2 430 ? -29.641 75.908  95.611  1.00 63.19 ? 619  PHE B C     1 
ATOM   7054  O  O     . PHE F 2 430 ? -30.001 74.902  95.002  1.00 63.00 ? 619  PHE B O     1 
ATOM   7055  C  CB    . PHE F 2 430 ? -30.868 77.845  94.616  1.00 63.07 ? 619  PHE B CB    1 
ATOM   7056  C  CG    . PHE F 2 430 ? -29.639 78.523  94.087  1.00 62.39 ? 619  PHE B CG    1 
ATOM   7057  C  CD1   . PHE F 2 430 ? -28.706 77.817  93.336  1.00 62.62 ? 619  PHE B CD1   1 
ATOM   7058  C  CD2   . PHE F 2 430 ? -29.424 79.875  94.319  1.00 62.29 ? 619  PHE B CD2   1 
ATOM   7059  C  CE1   . PHE F 2 430 ? -27.579 78.451  92.819  1.00 62.37 ? 619  PHE B CE1   1 
ATOM   7060  C  CE2   . PHE F 2 430 ? -28.298 80.523  93.807  1.00 62.14 ? 619  PHE B CE2   1 
ATOM   7061  C  CZ    . PHE F 2 430 ? -27.375 79.811  93.056  1.00 62.29 ? 619  PHE B CZ    1 
ATOM   7062  N  N     . LEU F 2 431 ? -28.398 76.073  96.053  1.00 63.20 ? 620  LEU B N     1 
ATOM   7063  C  CA    . LEU F 2 431 ? -27.376 75.051  95.828  1.00 63.45 ? 620  LEU B CA    1 
ATOM   7064  C  C     . LEU F 2 431 ? -27.579 73.834  96.710  1.00 63.25 ? 620  LEU B C     1 
ATOM   7065  O  O     . LEU F 2 431 ? -27.077 72.751  96.410  1.00 62.65 ? 620  LEU B O     1 
ATOM   7066  C  CB    . LEU F 2 431 ? -25.977 75.622  96.076  1.00 63.54 ? 620  LEU B CB    1 
ATOM   7067  C  CG    . LEU F 2 431 ? -25.492 76.671  95.074  1.00 63.75 ? 620  LEU B CG    1 
ATOM   7068  C  CD1   . LEU F 2 431 ? -24.172 77.254  95.547  1.00 63.58 ? 620  LEU B CD1   1 
ATOM   7069  C  CD2   . LEU F 2 431 ? -25.348 76.035  93.695  1.00 63.44 ? 620  LEU B CD2   1 
ATOM   7070  N  N     . ARG F 2 432 ? -28.312 74.018  97.801  1.00 63.65 ? 621  ARG B N     1 
ATOM   7071  C  CA    . ARG F 2 432 ? -28.576 72.928  98.735  1.00 63.98 ? 621  ARG B CA    1 
ATOM   7072  C  C     . ARG F 2 432 ? -29.828 72.144  98.353  1.00 64.32 ? 621  ARG B C     1 
ATOM   7073  O  O     . ARG F 2 432 ? -29.858 70.919  98.627  1.00 64.26 ? 621  ARG B O     1 
ATOM   7074  C  CB    . ARG F 2 432 ? -28.723 73.467  100.159 1.00 63.85 ? 621  ARG B CB    1 
ATOM   7075  C  CG    . ARG F 2 432 ? -27.477 74.145  100.710 1.00 63.33 ? 621  ARG B CG    1 
ATOM   7076  C  CD    . ARG F 2 432 ? -27.474 74.083  102.229 1.00 62.33 ? 621  ARG B CD    1 
ATOM   7077  N  NE    . ARG F 2 432 ? -26.167 74.392  102.798 1.00 61.27 ? 621  ARG B NE    1 
ATOM   7078  C  CZ    . ARG F 2 432 ? -25.746 75.619  103.078 1.00 60.91 ? 621  ARG B CZ    1 
ATOM   7079  N  NH1   . ARG F 2 432 ? -26.537 76.658  102.842 1.00 60.42 ? 621  ARG B NH1   1 
ATOM   7080  N  NH2   . ARG F 2 432 ? -24.538 75.802  103.593 1.00 60.17 ? 621  ARG B NH2   1 
ATOM   7081  N  N     . TYR G 2 13  ? 35.911  104.366 134.102 1.00 34.02 ? 202  TYR C N     1 
ATOM   7082  C  CA    . TYR G 2 13  ? 35.811  103.307 133.050 1.00 32.75 ? 202  TYR C CA    1 
ATOM   7083  C  C     . TYR G 2 13  ? 37.023  103.280 132.154 1.00 32.67 ? 202  TYR C C     1 
ATOM   7084  O  O     . TYR G 2 13  ? 37.382  104.283 131.538 1.00 32.50 ? 202  TYR C O     1 
ATOM   7085  C  CB    . TYR G 2 13  ? 34.571  103.500 132.167 1.00 31.47 ? 202  TYR C CB    1 
ATOM   7086  C  CG    . TYR G 2 13  ? 34.566  102.598 130.936 1.00 30.92 ? 202  TYR C CG    1 
ATOM   7087  C  CD1   . TYR G 2 13  ? 34.610  101.206 131.062 1.00 31.17 ? 202  TYR C CD1   1 
ATOM   7088  C  CD2   . TYR G 2 13  ? 34.525  103.137 129.657 1.00 29.64 ? 202  TYR C CD2   1 
ATOM   7089  C  CE1   . TYR G 2 13  ? 34.613  100.378 129.938 1.00 31.71 ? 202  TYR C CE1   1 
ATOM   7090  C  CE2   . TYR G 2 13  ? 34.523  102.332 128.529 1.00 30.32 ? 202  TYR C CE2   1 
ATOM   7091  C  CZ    . TYR G 2 13  ? 34.568  100.952 128.666 1.00 32.22 ? 202  TYR C CZ    1 
ATOM   7092  O  OH    . TYR G 2 13  ? 34.575  100.151 127.533 1.00 30.61 ? 202  TYR C OH    1 
ATOM   7093  N  N     . ILE G 2 14  ? 37.636  102.112 132.080 1.00 33.84 ? 203  ILE C N     1 
ATOM   7094  C  CA    . ILE G 2 14  ? 38.806  101.893 131.259 1.00 36.26 ? 203  ILE C CA    1 
ATOM   7095  C  C     . ILE G 2 14  ? 38.418  100.800 130.281 1.00 38.23 ? 203  ILE C C     1 
ATOM   7096  O  O     . ILE G 2 14  ? 38.162  99.666  130.677 1.00 38.18 ? 203  ILE C O     1 
ATOM   7097  C  CB    . ILE G 2 14  ? 39.998  101.443 132.133 1.00 36.73 ? 203  ILE C CB    1 
ATOM   7098  C  CG1   . ILE G 2 14  ? 40.307  102.551 133.150 1.00 35.84 ? 203  ILE C CG1   1 
ATOM   7099  C  CG2   . ILE G 2 14  ? 41.214  101.100 131.251 1.00 34.73 ? 203  ILE C CG2   1 
ATOM   7100  C  CD1   . ILE G 2 14  ? 41.244  102.143 134.269 1.00 38.42 ? 203  ILE C CD1   1 
ATOM   7101  N  N     . PRO G 2 15  ? 38.345  101.137 128.986 1.00 39.92 ? 204  PRO C N     1 
ATOM   7102  C  CA    . PRO G 2 15  ? 37.976  100.162 127.957 1.00 41.21 ? 204  PRO C CA    1 
ATOM   7103  C  C     . PRO G 2 15  ? 39.055  99.127  127.677 1.00 42.46 ? 204  PRO C C     1 
ATOM   7104  O  O     . PRO G 2 15  ? 40.237  99.368  127.898 1.00 41.40 ? 204  PRO C O     1 
ATOM   7105  C  CB    . PRO G 2 15  ? 37.671  101.042 126.749 1.00 41.05 ? 204  PRO C CB    1 
ATOM   7106  C  CG    . PRO G 2 15  ? 38.619  102.184 126.931 1.00 41.27 ? 204  PRO C CG    1 
ATOM   7107  C  CD    . PRO G 2 15  ? 38.501  102.483 128.407 1.00 40.47 ? 204  PRO C CD    1 
ATOM   7108  N  N     . PRO G 2 16  ? 38.651  97.950  127.188 1.00 44.44 ? 205  PRO C N     1 
ATOM   7109  C  CA    . PRO G 2 16  ? 39.584  96.867  126.872 1.00 46.71 ? 205  PRO C CA    1 
ATOM   7110  C  C     . PRO G 2 16  ? 40.661  97.374  125.926 1.00 49.00 ? 205  PRO C C     1 
ATOM   7111  O  O     . PRO G 2 16  ? 40.387  98.167  125.023 1.00 49.43 ? 205  PRO C O     1 
ATOM   7112  C  CB    . PRO G 2 16  ? 38.697  95.826  126.188 1.00 45.90 ? 205  PRO C CB    1 
ATOM   7113  C  CG    . PRO G 2 16  ? 37.356  96.063  126.797 1.00 46.78 ? 205  PRO C CG    1 
ATOM   7114  C  CD    . PRO G 2 16  ? 37.268  97.571  126.854 1.00 45.37 ? 205  PRO C CD    1 
ATOM   7115  N  N     . GLU G 2 17  ? 41.892  96.933  126.127 1.00 51.25 ? 206  GLU C N     1 
ATOM   7116  C  CA    . GLU G 2 17  ? 42.941  97.366  125.228 1.00 53.51 ? 206  GLU C CA    1 
ATOM   7117  C  C     . GLU G 2 17  ? 42.826  96.549  123.948 1.00 53.37 ? 206  GLU C C     1 
ATOM   7118  O  O     . GLU G 2 17  ? 42.386  95.395  123.971 1.00 53.94 ? 206  GLU C O     1 
ATOM   7119  C  CB    . GLU G 2 17  ? 44.312  97.190  125.876 1.00 55.24 ? 206  GLU C CB    1 
ATOM   7120  C  CG    . GLU G 2 17  ? 44.767  98.435  126.618 1.00 58.31 ? 206  GLU C CG    1 
ATOM   7121  C  CD    . GLU G 2 17  ? 46.201  98.328  127.093 1.00 60.52 ? 206  GLU C CD    1 
ATOM   7122  O  OE1   . GLU G 2 17  ? 47.066  97.920  126.282 1.00 61.50 ? 206  GLU C OE1   1 
ATOM   7123  O  OE2   . GLU G 2 17  ? 46.464  98.657  128.274 1.00 61.88 ? 206  GLU C OE2   1 
ATOM   7124  N  N     . PRO G 2 18  ? 43.185  97.145  122.804 1.00 52.97 ? 207  PRO C N     1 
ATOM   7125  C  CA    . PRO G 2 18  ? 43.071  96.353  121.580 1.00 52.96 ? 207  PRO C CA    1 
ATOM   7126  C  C     . PRO G 2 18  ? 44.139  95.264  121.535 1.00 52.69 ? 207  PRO C C     1 
ATOM   7127  O  O     . PRO G 2 18  ? 45.261  95.454  122.014 1.00 51.76 ? 207  PRO C O     1 
ATOM   7128  C  CB    . PRO G 2 18  ? 43.234  97.399  120.482 1.00 52.56 ? 207  PRO C CB    1 
ATOM   7129  C  CG    . PRO G 2 18  ? 44.211  98.359  121.097 1.00 52.40 ? 207  PRO C CG    1 
ATOM   7130  C  CD    . PRO G 2 18  ? 43.684  98.502  122.518 1.00 52.88 ? 207  PRO C CD    1 
ATOM   7131  N  N     . SER G 2 19  ? 43.768  94.121  120.973 1.00 53.31 ? 208  SER C N     1 
ATOM   7132  C  CA    . SER G 2 19  ? 44.668  92.987  120.848 1.00 54.23 ? 208  SER C CA    1 
ATOM   7133  C  C     . SER G 2 19  ? 45.692  93.197  119.744 1.00 54.68 ? 208  SER C C     1 
ATOM   7134  O  O     . SER G 2 19  ? 45.463  93.957  118.800 1.00 54.84 ? 208  SER C O     1 
ATOM   7135  C  CB    . SER G 2 19  ? 43.870  91.718  120.549 1.00 55.11 ? 208  SER C CB    1 
ATOM   7136  O  OG    . SER G 2 19  ? 44.709  90.702  120.012 1.00 56.36 ? 208  SER C OG    1 
ATOM   7137  N  N     . ASN G 2 20  ? 46.820  92.508  119.865 1.00 54.97 ? 209  ASN C N     1 
ATOM   7138  C  CA    . ASN G 2 20  ? 47.876  92.594  118.870 1.00 55.61 ? 209  ASN C CA    1 
ATOM   7139  C  C     . ASN G 2 20  ? 47.846  91.357  117.977 1.00 56.19 ? 209  ASN C C     1 
ATOM   7140  O  O     . ASN G 2 20  ? 48.643  91.231  117.046 1.00 56.06 ? 209  ASN C O     1 
ATOM   7141  C  CB    . ASN G 2 20  ? 49.230  92.730  119.563 1.00 55.98 ? 209  ASN C CB    1 
ATOM   7142  C  CG    . ASN G 2 20  ? 49.307  93.971  120.433 1.00 56.24 ? 209  ASN C CG    1 
ATOM   7143  O  OD1   . ASN G 2 20  ? 49.133  95.089  119.949 1.00 56.29 ? 209  ASN C OD1   1 
ATOM   7144  N  ND2   . ASN G 2 20  ? 49.561  93.780  121.723 1.00 56.15 ? 209  ASN C ND2   1 
ATOM   7145  N  N     . ASP G 2 21  ? 46.917  90.447  118.263 1.00 56.60 ? 210  ASP C N     1 
ATOM   7146  C  CA    . ASP G 2 21  ? 46.778  89.234  117.467 1.00 57.35 ? 210  ASP C CA    1 
ATOM   7147  C  C     . ASP G 2 21  ? 46.311  89.590  116.071 1.00 56.87 ? 210  ASP C C     1 
ATOM   7148  O  O     . ASP G 2 21  ? 45.247  90.188  115.900 1.00 56.96 ? 210  ASP C O     1 
ATOM   7149  C  CB    . ASP G 2 21  ? 45.764  88.272  118.092 1.00 59.29 ? 210  ASP C CB    1 
ATOM   7150  C  CG    . ASP G 2 21  ? 46.306  87.573  119.320 1.00 61.52 ? 210  ASP C CG    1 
ATOM   7151  O  OD1   . ASP G 2 21  ? 47.483  87.144  119.280 1.00 62.11 ? 210  ASP C OD1   1 
ATOM   7152  O  OD2   . ASP G 2 21  ? 45.554  87.442  120.315 1.00 63.28 ? 210  ASP C OD2   1 
ATOM   7153  N  N     . ALA G 2 22  ? 47.104  89.208  115.077 1.00 55.90 ? 211  ALA C N     1 
ATOM   7154  C  CA    . ALA G 2 22  ? 46.782  89.488  113.688 1.00 55.21 ? 211  ALA C CA    1 
ATOM   7155  C  C     . ALA G 2 22  ? 45.364  89.059  113.318 1.00 55.05 ? 211  ALA C C     1 
ATOM   7156  O  O     . ALA G 2 22  ? 44.680  89.746  112.556 1.00 54.89 ? 211  ALA C O     1 
ATOM   7157  C  CB    . ALA G 2 22  ? 47.792  88.801  112.773 1.00 55.37 ? 211  ALA C CB    1 
ATOM   7158  N  N     . ILE G 2 23  ? 44.915  87.931  113.858 1.00 54.48 ? 212  ILE C N     1 
ATOM   7159  C  CA    . ILE G 2 23  ? 43.582  87.452  113.538 1.00 54.41 ? 212  ILE C CA    1 
ATOM   7160  C  C     . ILE G 2 23  ? 42.498  88.434  113.988 1.00 54.02 ? 212  ILE C C     1 
ATOM   7161  O  O     . ILE G 2 23  ? 41.554  88.698  113.249 1.00 54.39 ? 212  ILE C O     1 
ATOM   7162  C  CB    . ILE G 2 23  ? 43.316  86.064  114.160 1.00 55.19 ? 212  ILE C CB    1 
ATOM   7163  C  CG1   . ILE G 2 23  ? 41.979  85.530  113.645 1.00 56.66 ? 212  ILE C CG1   1 
ATOM   7164  C  CG2   . ILE G 2 23  ? 43.317  86.149  115.685 1.00 55.29 ? 212  ILE C CG2   1 
ATOM   7165  C  CD1   . ILE G 2 23  ? 41.606  84.143  114.166 1.00 58.20 ? 212  ILE C CD1   1 
ATOM   7166  N  N     . GLU G 2 24  ? 42.643  88.980  115.190 1.00 53.18 ? 213  GLU C N     1 
ATOM   7167  C  CA    . GLU G 2 24  ? 41.679  89.931  115.733 1.00 53.30 ? 213  GLU C CA    1 
ATOM   7168  C  C     . GLU G 2 24  ? 41.787  91.287  115.031 1.00 52.51 ? 213  GLU C C     1 
ATOM   7169  O  O     . GLU G 2 24  ? 40.777  91.921  114.703 1.00 52.33 ? 213  GLU C O     1 
ATOM   7170  C  CB    . GLU G 2 24  ? 41.920  90.118  117.233 1.00 55.01 ? 213  GLU C CB    1 
ATOM   7171  C  CG    . GLU G 2 24  ? 40.771  89.683  118.144 1.00 58.57 ? 213  GLU C CG    1 
ATOM   7172  C  CD    . GLU G 2 24  ? 40.509  88.173  118.128 1.00 60.69 ? 213  GLU C CD    1 
ATOM   7173  O  OE1   . GLU G 2 24  ? 39.836  87.680  119.069 1.00 61.33 ? 213  GLU C OE1   1 
ATOM   7174  O  OE2   . GLU G 2 24  ? 40.961  87.484  117.181 1.00 61.44 ? 213  GLU C OE2   1 
ATOM   7175  N  N     . ILE G 2 25  ? 43.016  91.736  114.804 1.00 50.40 ? 214  ILE C N     1 
ATOM   7176  C  CA    . ILE G 2 25  ? 43.224  93.009  114.144 1.00 48.57 ? 214  ILE C CA    1 
ATOM   7177  C  C     . ILE G 2 25  ? 42.566  93.030  112.765 1.00 47.86 ? 214  ILE C C     1 
ATOM   7178  O  O     . ILE G 2 25  ? 41.967  94.035  112.373 1.00 47.41 ? 214  ILE C O     1 
ATOM   7179  C  CB    . ILE G 2 25  ? 44.732  93.333  114.044 1.00 48.77 ? 214  ILE C CB    1 
ATOM   7180  C  CG1   . ILE G 2 25  ? 45.188  93.986  115.356 1.00 48.16 ? 214  ILE C CG1   1 
ATOM   7181  C  CG2   . ILE G 2 25  ? 45.015  94.219  112.833 1.00 48.19 ? 214  ILE C CG2   1 
ATOM   7182  C  CD1   . ILE G 2 25  ? 46.629  94.424  115.379 1.00 49.05 ? 214  ILE C CD1   1 
ATOM   7183  N  N     . PHE G 2 26  ? 42.661  91.928  112.031 1.00 46.18 ? 215  PHE C N     1 
ATOM   7184  C  CA    . PHE G 2 26  ? 42.037  91.878  110.719 1.00 45.95 ? 215  PHE C CA    1 
ATOM   7185  C  C     . PHE G 2 26  ? 40.637  91.283  110.772 1.00 46.13 ? 215  PHE C C     1 
ATOM   7186  O  O     . PHE G 2 26  ? 40.139  90.802  109.759 1.00 46.52 ? 215  PHE C O     1 
ATOM   7187  C  CB    . PHE G 2 26  ? 42.896  91.084  109.719 1.00 44.29 ? 215  PHE C CB    1 
ATOM   7188  C  CG    . PHE G 2 26  ? 44.136  91.809  109.294 1.00 42.81 ? 215  PHE C CG    1 
ATOM   7189  C  CD1   . PHE G 2 26  ? 45.310  91.706  110.035 1.00 42.80 ? 215  PHE C CD1   1 
ATOM   7190  C  CD2   . PHE G 2 26  ? 44.101  92.683  108.223 1.00 41.53 ? 215  PHE C CD2   1 
ATOM   7191  C  CE1   . PHE G 2 26  ? 46.430  92.472  109.718 1.00 41.53 ? 215  PHE C CE1   1 
ATOM   7192  C  CE2   . PHE G 2 26  ? 45.209  93.453  107.899 1.00 41.33 ? 215  PHE C CE2   1 
ATOM   7193  C  CZ    . PHE G 2 26  ? 46.378  93.347  108.652 1.00 41.88 ? 215  PHE C CZ    1 
ATOM   7194  N  N     . SER G 2 27  ? 40.000  91.329  111.943 1.00 46.02 ? 216  SER C N     1 
ATOM   7195  C  CA    . SER G 2 27  ? 38.652  90.771  112.099 1.00 46.07 ? 216  SER C CA    1 
ATOM   7196  C  C     . SER G 2 27  ? 37.491  91.663  111.623 1.00 45.54 ? 216  SER C C     1 
ATOM   7197  O  O     . SER G 2 27  ? 36.418  91.160  111.293 1.00 45.45 ? 216  SER C O     1 
ATOM   7198  C  CB    . SER G 2 27  ? 38.402  90.381  113.563 1.00 46.52 ? 216  SER C CB    1 
ATOM   7199  O  OG    . SER G 2 27  ? 38.128  91.520  114.366 1.00 47.95 ? 216  SER C OG    1 
ATOM   7200  N  N     . SER G 2 28  ? 37.692  92.977  111.593 1.00 44.83 ? 217  SER C N     1 
ATOM   7201  C  CA    . SER G 2 28  ? 36.624  93.880  111.172 1.00 43.78 ? 217  SER C CA    1 
ATOM   7202  C  C     . SER G 2 28  ? 36.436  93.850  109.657 1.00 42.16 ? 217  SER C C     1 
ATOM   7203  O  O     . SER G 2 28  ? 37.120  93.114  108.954 1.00 42.95 ? 217  SER C O     1 
ATOM   7204  C  CB    . SER G 2 28  ? 36.935  95.312  111.631 1.00 44.99 ? 217  SER C CB    1 
ATOM   7205  O  OG    . SER G 2 28  ? 38.147  95.796  111.063 1.00 45.74 ? 217  SER C OG    1 
ATOM   7206  N  N     . GLY G 2 29  ? 35.493  94.634  109.158 1.00 39.85 ? 218  GLY C N     1 
ATOM   7207  C  CA    . GLY G 2 29  ? 35.279  94.682  107.728 1.00 37.46 ? 218  GLY C CA    1 
ATOM   7208  C  C     . GLY G 2 29  ? 34.112  93.886  107.186 1.00 36.16 ? 218  GLY C C     1 
ATOM   7209  O  O     . GLY G 2 29  ? 33.602  92.965  107.826 1.00 36.41 ? 218  GLY C O     1 
ATOM   7210  N  N     . ILE G 2 30  ? 33.706  94.256  105.980 1.00 34.38 ? 219  ILE C N     1 
ATOM   7211  C  CA    . ILE G 2 30  ? 32.598  93.632  105.286 1.00 33.15 ? 219  ILE C CA    1 
ATOM   7212  C  C     . ILE G 2 30  ? 33.108  93.232  103.909 1.00 33.28 ? 219  ILE C C     1 
ATOM   7213  O  O     . ILE G 2 30  ? 33.583  94.080  103.150 1.00 34.13 ? 219  ILE C O     1 
ATOM   7214  C  CB    . ILE G 2 30  ? 31.414  94.634  105.144 1.00 32.28 ? 219  ILE C CB    1 
ATOM   7215  C  CG1   . ILE G 2 30  ? 30.958  95.083  106.543 1.00 31.53 ? 219  ILE C CG1   1 
ATOM   7216  C  CG2   . ILE G 2 30  ? 30.269  94.002  104.349 1.00 30.96 ? 219  ILE C CG2   1 
ATOM   7217  C  CD1   . ILE G 2 30  ? 29.873  96.141  106.551 1.00 30.13 ? 219  ILE C CD1   1 
ATOM   7218  N  N     . ALA G 2 31  ? 33.023  91.938  103.605 1.00 32.72 ? 220  ALA C N     1 
ATOM   7219  C  CA    . ALA G 2 31  ? 33.472  91.400  102.319 1.00 32.03 ? 220  ALA C CA    1 
ATOM   7220  C  C     . ALA G 2 31  ? 32.734  92.100  101.192 1.00 30.97 ? 220  ALA C C     1 
ATOM   7221  O  O     . ALA G 2 31  ? 31.549  92.350  101.301 1.00 30.68 ? 220  ALA C O     1 
ATOM   7222  C  CB    . ALA G 2 31  ? 33.205  89.900  102.264 1.00 30.93 ? 220  ALA C CB    1 
ATOM   7223  N  N     . SER G 2 32  ? 33.430  92.416  100.108 1.00 31.22 ? 221  SER C N     1 
ATOM   7224  C  CA    . SER G 2 32  ? 32.778  93.091  99.004  1.00 31.16 ? 221  SER C CA    1 
ATOM   7225  C  C     . SER G 2 32  ? 31.629  92.224  98.475  1.00 30.99 ? 221  SER C C     1 
ATOM   7226  O  O     . SER G 2 32  ? 31.673  90.994  98.535  1.00 30.43 ? 221  SER C O     1 
ATOM   7227  C  CB    . SER G 2 32  ? 33.785  93.405  97.898  1.00 31.99 ? 221  SER C CB    1 
ATOM   7228  O  OG    . SER G 2 32  ? 34.309  92.221  97.323  1.00 33.67 ? 221  SER C OG    1 
ATOM   7229  N  N     . GLY G 2 33  ? 30.597  92.876  97.960  1.00 30.74 ? 222  GLY C N     1 
ATOM   7230  C  CA    . GLY G 2 33  ? 29.446  92.149  97.466  1.00 31.13 ? 222  GLY C CA    1 
ATOM   7231  C  C     . GLY G 2 33  ? 29.311  92.012  95.961  1.00 31.45 ? 222  GLY C C     1 
ATOM   7232  O  O     . GLY G 2 33  ? 30.138  92.483  95.184  1.00 30.31 ? 222  GLY C O     1 
ATOM   7233  N  N     . ILE G 2 34  ? 28.221  91.365  95.569  1.00 32.49 ? 223  ILE C N     1 
ATOM   7234  C  CA    . ILE G 2 34  ? 27.899  91.092  94.176  1.00 34.11 ? 223  ILE C CA    1 
ATOM   7235  C  C     . ILE G 2 34  ? 27.850  92.327  93.293  1.00 34.11 ? 223  ILE C C     1 
ATOM   7236  O  O     . ILE G 2 34  ? 28.060  92.226  92.083  1.00 34.42 ? 223  ILE C O     1 
ATOM   7237  C  CB    . ILE G 2 34  ? 26.538  90.331  94.089  1.00 35.12 ? 223  ILE C CB    1 
ATOM   7238  C  CG1   . ILE G 2 34  ? 26.286  89.838  92.666  1.00 36.35 ? 223  ILE C CG1   1 
ATOM   7239  C  CG2   . ILE G 2 34  ? 25.403  91.233  94.538  1.00 35.23 ? 223  ILE C CG2   1 
ATOM   7240  C  CD1   . ILE G 2 34  ? 25.129  88.826  92.560  1.00 36.40 ? 223  ILE C CD1   1 
ATOM   7241  N  N     . HIS G 2 35  ? 27.593  93.490  93.887  1.00 33.81 ? 224  HIS C N     1 
ATOM   7242  C  CA    . HIS G 2 35  ? 27.509  94.726  93.108  1.00 33.67 ? 224  HIS C CA    1 
ATOM   7243  C  C     . HIS G 2 35  ? 28.741  95.617  93.125  1.00 33.30 ? 224  HIS C C     1 
ATOM   7244  O  O     . HIS G 2 35  ? 28.711  96.717  92.571  1.00 33.46 ? 224  HIS C O     1 
ATOM   7245  C  CB    . HIS G 2 35  ? 26.300  95.562  93.549  1.00 34.33 ? 224  HIS C CB    1 
ATOM   7246  C  CG    . HIS G 2 35  ? 24.983  94.900  93.296  1.00 35.48 ? 224  HIS C CG    1 
ATOM   7247  N  ND1   . HIS G 2 35  ? 24.755  94.090  92.203  1.00 35.54 ? 224  HIS C ND1   1 
ATOM   7248  C  CD2   . HIS G 2 35  ? 23.818  94.944  93.981  1.00 36.07 ? 224  HIS C CD2   1 
ATOM   7249  C  CE1   . HIS G 2 35  ? 23.509  93.660  92.229  1.00 35.19 ? 224  HIS C CE1   1 
ATOM   7250  N  NE2   . HIS G 2 35  ? 22.918  94.163  93.297  1.00 36.67 ? 224  HIS C NE2   1 
ATOM   7251  N  N     . PHE G 2 36  ? 29.821  95.147  93.739  1.00 32.77 ? 225  PHE C N     1 
ATOM   7252  C  CA    . PHE G 2 36  ? 31.051  95.929  93.828  1.00 33.08 ? 225  PHE C CA    1 
ATOM   7253  C  C     . PHE G 2 36  ? 31.522  96.537  92.493  1.00 33.40 ? 225  PHE C C     1 
ATOM   7254  O  O     . PHE G 2 36  ? 31.925  97.707  92.440  1.00 33.10 ? 225  PHE C O     1 
ATOM   7255  C  CB    . PHE G 2 36  ? 32.174  95.077  94.415  1.00 32.47 ? 225  PHE C CB    1 
ATOM   7256  C  CG    . PHE G 2 36  ? 33.393  95.861  94.788  1.00 32.78 ? 225  PHE C CG    1 
ATOM   7257  C  CD1   . PHE G 2 36  ? 33.478  96.490  96.022  1.00 32.13 ? 225  PHE C CD1   1 
ATOM   7258  C  CD2   . PHE G 2 36  ? 34.454  95.994  93.894  1.00 32.82 ? 225  PHE C CD2   1 
ATOM   7259  C  CE1   . PHE G 2 36  ? 34.610  97.246  96.368  1.00 31.33 ? 225  PHE C CE1   1 
ATOM   7260  C  CE2   . PHE G 2 36  ? 35.589  96.748  94.230  1.00 33.08 ? 225  PHE C CE2   1 
ATOM   7261  C  CZ    . PHE G 2 36  ? 35.661  97.374  95.473  1.00 31.63 ? 225  PHE C CZ    1 
ATOM   7262  N  N     . SER G 2 37  ? 31.464  95.762  91.417  1.00 33.38 ? 226  SER C N     1 
ATOM   7263  C  CA    . SER G 2 37  ? 31.914  96.266  90.120  1.00 34.67 ? 226  SER C CA    1 
ATOM   7264  C  C     . SER G 2 37  ? 31.045  97.404  89.587  1.00 35.39 ? 226  SER C C     1 
ATOM   7265  O  O     . SER G 2 37  ? 31.474  98.169  88.726  1.00 35.13 ? 226  SER C O     1 
ATOM   7266  C  CB    . SER G 2 37  ? 31.930  95.151  89.083  1.00 34.85 ? 226  SER C CB    1 
ATOM   7267  O  OG    . SER G 2 37  ? 30.631  94.982  88.554  1.00 37.01 ? 226  SER C OG    1 
ATOM   7268  N  N     . LYS G 2 38  ? 29.820  97.519  90.085  1.00 36.48 ? 227  LYS C N     1 
ATOM   7269  C  CA    . LYS G 2 38  ? 28.947  98.581  89.610  1.00 37.19 ? 227  LYS C CA    1 
ATOM   7270  C  C     . LYS G 2 38  ? 29.402  99.958  90.081  1.00 36.69 ? 227  LYS C C     1 
ATOM   7271  O  O     . LYS G 2 38  ? 28.860  100.966 89.637  1.00 37.02 ? 227  LYS C O     1 
ATOM   7272  C  CB    . LYS G 2 38  ? 27.494  98.304  90.021  1.00 39.16 ? 227  LYS C CB    1 
ATOM   7273  C  CG    . LYS G 2 38  ? 26.852  97.148  89.242  1.00 41.73 ? 227  LYS C CG    1 
ATOM   7274  C  CD    . LYS G 2 38  ? 25.408  96.890  89.697  1.00 45.37 ? 227  LYS C CD    1 
ATOM   7275  C  CE    . LYS G 2 38  ? 24.714  95.807  88.852  1.00 46.54 ? 227  LYS C CE    1 
ATOM   7276  N  NZ    . LYS G 2 38  ? 23.265  95.587  89.234  1.00 47.54 ? 227  LYS C NZ    1 
ATOM   7277  N  N     . TYR G 2 39  ? 30.395  100.003 90.977  1.00 36.63 ? 228  TYR C N     1 
ATOM   7278  C  CA    . TYR G 2 39  ? 30.946  101.284 91.459  1.00 35.79 ? 228  TYR C CA    1 
ATOM   7279  C  C     . TYR G 2 39  ? 31.549  102.033 90.282  1.00 36.21 ? 228  TYR C C     1 
ATOM   7280  O  O     . TYR G 2 39  ? 31.622  103.262 90.282  1.00 35.73 ? 228  TYR C O     1 
ATOM   7281  C  CB    . TYR G 2 39  ? 32.070  101.071 92.471  1.00 34.32 ? 228  TYR C CB    1 
ATOM   7282  C  CG    . TYR G 2 39  ? 31.638  100.867 93.894  1.00 33.31 ? 228  TYR C CG    1 
ATOM   7283  C  CD1   . TYR G 2 39  ? 30.803  101.780 94.527  1.00 33.54 ? 228  TYR C CD1   1 
ATOM   7284  C  CD2   . TYR G 2 39  ? 32.104  99.779  94.628  1.00 33.80 ? 228  TYR C CD2   1 
ATOM   7285  C  CE1   . TYR G 2 39  ? 30.440  101.617 95.862  1.00 33.88 ? 228  TYR C CE1   1 
ATOM   7286  C  CE2   . TYR G 2 39  ? 31.748  99.605  95.959  1.00 33.89 ? 228  TYR C CE2   1 
ATOM   7287  C  CZ    . TYR G 2 39  ? 30.917  100.529 96.571  1.00 33.04 ? 228  TYR C CZ    1 
ATOM   7288  O  OH    . TYR G 2 39  ? 30.566  100.359 97.881  1.00 31.08 ? 228  TYR C OH    1 
ATOM   7289  N  N     . ASN G 2 40  ? 31.998  101.268 89.288  1.00 36.98 ? 229  ASN C N     1 
ATOM   7290  C  CA    . ASN G 2 40  ? 32.618  101.819 88.087  1.00 37.85 ? 229  ASN C CA    1 
ATOM   7291  C  C     . ASN G 2 40  ? 31.665  102.641 87.258  1.00 37.33 ? 229  ASN C C     1 
ATOM   7292  O  O     . ASN G 2 40  ? 32.091  103.488 86.474  1.00 37.74 ? 229  ASN C O     1 
ATOM   7293  C  CB    . ASN G 2 40  ? 33.136  100.701 87.192  1.00 40.32 ? 229  ASN C CB    1 
ATOM   7294  C  CG    . ASN G 2 40  ? 34.325  100.009 87.765  1.00 42.60 ? 229  ASN C CG    1 
ATOM   7295  O  OD1   . ASN G 2 40  ? 34.388  98.777  87.782  1.00 45.45 ? 229  ASN C OD1   1 
ATOM   7296  N  ND2   . ASN G 2 40  ? 35.294  100.786 88.229  1.00 44.25 ? 229  ASN C ND2   1 
ATOM   7297  N  N     . ASN G 2 41  ? 30.376  102.392 87.415  1.00 36.30 ? 230  ASN C N     1 
ATOM   7298  C  CA    . ASN G 2 41  ? 29.409  103.116 86.618  1.00 36.16 ? 230  ASN C CA    1 
ATOM   7299  C  C     . ASN G 2 41  ? 28.925  104.411 87.230  1.00 35.36 ? 230  ASN C C     1 
ATOM   7300  O  O     . ASN G 2 41  ? 28.150  105.129 86.610  1.00 35.79 ? 230  ASN C O     1 
ATOM   7301  C  CB    . ASN G 2 41  ? 28.221  102.209 86.315  1.00 37.56 ? 230  ASN C CB    1 
ATOM   7302  C  CG    . ASN G 2 41  ? 28.653  100.856 85.794  1.00 38.91 ? 230  ASN C CG    1 
ATOM   7303  O  OD1   . ASN G 2 41  ? 29.589  100.755 84.995  1.00 39.68 ? 230  ASN C OD1   1 
ATOM   7304  N  ND2   . ASN G 2 41  ? 27.972  99.807  86.236  1.00 39.94 ? 230  ASN C ND2   1 
ATOM   7305  N  N     . ILE G 2 42  ? 29.379  104.729 88.437  1.00 34.15 ? 231  ILE C N     1 
ATOM   7306  C  CA    . ILE G 2 42  ? 28.925  105.959 89.075  1.00 32.97 ? 231  ILE C CA    1 
ATOM   7307  C  C     . ILE G 2 42  ? 29.661  107.184 88.551  1.00 32.97 ? 231  ILE C C     1 
ATOM   7308  O  O     . ILE G 2 42  ? 30.892  107.239 88.569  1.00 34.12 ? 231  ILE C O     1 
ATOM   7309  C  CB    . ILE G 2 42  ? 29.116  105.913 90.602  1.00 31.80 ? 231  ILE C CB    1 
ATOM   7310  C  CG1   . ILE G 2 42  ? 28.553  104.611 91.165  1.00 32.99 ? 231  ILE C CG1   1 
ATOM   7311  C  CG2   . ILE G 2 42  ? 28.409  107.087 91.238  1.00 30.50 ? 231  ILE C CG2   1 
ATOM   7312  C  CD1   . ILE G 2 42  ? 28.788  104.432 92.655  1.00 31.13 ? 231  ILE C CD1   1 
ATOM   7313  N  N     . PRO G 2 43  ? 28.916  108.183 88.066  1.00 32.07 ? 232  PRO C N     1 
ATOM   7314  C  CA    . PRO G 2 43  ? 29.533  109.406 87.551  1.00 32.34 ? 232  PRO C CA    1 
ATOM   7315  C  C     . PRO G 2 43  ? 30.489  109.998 88.601  1.00 32.25 ? 232  PRO C C     1 
ATOM   7316  O  O     . PRO G 2 43  ? 30.169  110.015 89.789  1.00 32.40 ? 232  PRO C O     1 
ATOM   7317  C  CB    . PRO G 2 43  ? 28.332  110.315 87.308  1.00 31.90 ? 232  PRO C CB    1 
ATOM   7318  C  CG    . PRO G 2 43  ? 27.281  109.373 86.919  1.00 32.68 ? 232  PRO C CG    1 
ATOM   7319  C  CD    . PRO G 2 43  ? 27.456  108.221 87.900  1.00 31.78 ? 232  PRO C CD    1 
ATOM   7320  N  N     . VAL G 2 44  ? 31.654  110.460 88.160  1.00 32.23 ? 233  VAL C N     1 
ATOM   7321  C  CA    . VAL G 2 44  ? 32.647  111.060 89.054  1.00 32.40 ? 233  VAL C CA    1 
ATOM   7322  C  C     . VAL G 2 44  ? 32.916  112.512 88.648  1.00 33.12 ? 233  VAL C C     1 
ATOM   7323  O  O     . VAL G 2 44  ? 33.187  112.801 87.482  1.00 33.46 ? 233  VAL C O     1 
ATOM   7324  C  CB    . VAL G 2 44  ? 34.017  110.323 89.002  1.00 31.97 ? 233  VAL C CB    1 
ATOM   7325  C  CG1   . VAL G 2 44  ? 35.029  111.070 89.852  1.00 32.94 ? 233  VAL C CG1   1 
ATOM   7326  C  CG2   . VAL G 2 44  ? 33.893  108.897 89.496  1.00 31.81 ? 233  VAL C CG2   1 
ATOM   7327  N  N     . LYS G 2 45  ? 32.851  113.416 89.618  1.00 33.02 ? 234  LYS C N     1 
ATOM   7328  C  CA    . LYS G 2 45  ? 33.115  114.827 89.389  1.00 32.89 ? 234  LYS C CA    1 
ATOM   7329  C  C     . LYS G 2 45  ? 34.317  115.243 90.238  1.00 33.67 ? 234  LYS C C     1 
ATOM   7330  O  O     . LYS G 2 45  ? 34.355  114.970 91.433  1.00 33.13 ? 234  LYS C O     1 
ATOM   7331  C  CB    . LYS G 2 45  ? 31.906  115.636 89.812  1.00 33.70 ? 234  LYS C CB    1 
ATOM   7332  C  CG    . LYS G 2 45  ? 32.017  117.131 89.654  1.00 33.55 ? 234  LYS C CG    1 
ATOM   7333  C  CD    . LYS G 2 45  ? 30.861  117.756 90.420  1.00 36.30 ? 234  LYS C CD    1 
ATOM   7334  C  CE    . LYS G 2 45  ? 30.515  119.152 89.927  1.00 38.37 ? 234  LYS C CE    1 
ATOM   7335  N  NZ    . LYS G 2 45  ? 29.380  119.712 90.708  1.00 39.78 ? 234  LYS C NZ    1 
ATOM   7336  N  N     . VAL G 2 46  ? 35.302  115.882 89.618  1.00 34.71 ? 235  VAL C N     1 
ATOM   7337  C  CA    . VAL G 2 46  ? 36.486  116.356 90.334  1.00 36.09 ? 235  VAL C CA    1 
ATOM   7338  C  C     . VAL G 2 46  ? 36.702  117.832 89.984  1.00 38.25 ? 235  VAL C C     1 
ATOM   7339  O  O     . VAL G 2 46  ? 36.612  118.216 88.822  1.00 38.69 ? 235  VAL C O     1 
ATOM   7340  C  CB    . VAL G 2 46  ? 37.746  115.568 89.947  1.00 34.73 ? 235  VAL C CB    1 
ATOM   7341  C  CG1   . VAL G 2 46  ? 38.950  116.122 90.698  1.00 33.70 ? 235  VAL C CG1   1 
ATOM   7342  C  CG2   . VAL G 2 46  ? 37.558  114.098 90.257  1.00 33.15 ? 235  VAL C CG2   1 
ATOM   7343  N  N     . THR G 2 47  ? 36.981  118.655 90.986  1.00 39.51 ? 236  THR C N     1 
ATOM   7344  C  CA    . THR G 2 47  ? 37.186  120.075 90.755  1.00 41.47 ? 236  THR C CA    1 
ATOM   7345  C  C     . THR G 2 47  ? 38.401  120.603 91.509  1.00 41.95 ? 236  THR C C     1 
ATOM   7346  O  O     . THR G 2 47  ? 38.695  120.156 92.620  1.00 41.22 ? 236  THR C O     1 
ATOM   7347  C  CB    . THR G 2 47  ? 35.959  120.890 91.202  1.00 42.69 ? 236  THR C CB    1 
ATOM   7348  O  OG1   . THR G 2 47  ? 34.790  120.415 90.525  1.00 44.21 ? 236  THR C OG1   1 
ATOM   7349  C  CG2   . THR G 2 47  ? 36.148  122.348 90.868  1.00 43.93 ? 236  THR C CG2   1 
ATOM   7350  N  N     . GLY G 2 48  ? 39.091  121.565 90.900  1.00 42.28 ? 237  GLY C N     1 
ATOM   7351  C  CA    . GLY G 2 48  ? 40.266  122.158 91.512  1.00 42.59 ? 237  GLY C CA    1 
ATOM   7352  C  C     . GLY G 2 48  ? 41.357  122.428 90.489  1.00 43.31 ? 237  GLY C C     1 
ATOM   7353  O  O     . GLY G 2 48  ? 41.245  122.012 89.340  1.00 42.39 ? 237  GLY C O     1 
ATOM   7354  N  N     . SER G 2 49  ? 42.408  123.129 90.911  1.00 44.30 ? 238  SER C N     1 
ATOM   7355  C  CA    . SER G 2 49  ? 43.533  123.442 90.038  1.00 45.32 ? 238  SER C CA    1 
ATOM   7356  C  C     . SER G 2 49  ? 44.477  122.244 89.935  1.00 45.37 ? 238  SER C C     1 
ATOM   7357  O  O     . SER G 2 49  ? 44.833  121.645 90.940  1.00 44.66 ? 238  SER C O     1 
ATOM   7358  C  CB    . SER G 2 49  ? 44.288  124.667 90.564  1.00 45.56 ? 238  SER C CB    1 
ATOM   7359  O  OG    . SER G 2 49  ? 43.516  125.844 90.375  1.00 47.06 ? 238  SER C OG    1 
ATOM   7360  N  N     . ASP G 2 50  ? 44.876  121.921 88.705  1.00 45.71 ? 239  ASP C N     1 
ATOM   7361  C  CA    . ASP G 2 50  ? 45.749  120.791 88.396  1.00 45.69 ? 239  ASP C CA    1 
ATOM   7362  C  C     . ASP G 2 50  ? 45.647  119.702 89.446  1.00 44.45 ? 239  ASP C C     1 
ATOM   7363  O  O     . ASP G 2 50  ? 46.439  119.622 90.385  1.00 44.02 ? 239  ASP C O     1 
ATOM   7364  C  CB    . ASP G 2 50  ? 47.195  121.240 88.259  1.00 48.52 ? 239  ASP C CB    1 
ATOM   7365  C  CG    . ASP G 2 50  ? 47.798  121.613 89.573  1.00 50.59 ? 239  ASP C CG    1 
ATOM   7366  O  OD1   . ASP G 2 50  ? 47.338  122.618 90.156  1.00 52.07 ? 239  ASP C OD1   1 
ATOM   7367  O  OD2   . ASP G 2 50  ? 48.717  120.888 90.024  1.00 52.13 ? 239  ASP C OD2   1 
ATOM   7368  N  N     . VAL G 2 51  ? 44.650  118.856 89.268  1.00 43.01 ? 240  VAL C N     1 
ATOM   7369  C  CA    . VAL G 2 51  ? 44.409  117.775 90.187  1.00 41.56 ? 240  VAL C CA    1 
ATOM   7370  C  C     . VAL G 2 51  ? 45.213  116.556 89.795  1.00 40.92 ? 240  VAL C C     1 
ATOM   7371  O  O     . VAL G 2 51  ? 45.263  116.195 88.626  1.00 40.66 ? 240  VAL C O     1 
ATOM   7372  C  CB    . VAL G 2 51  ? 42.915  117.397 90.194  1.00 40.95 ? 240  VAL C CB    1 
ATOM   7373  C  CG1   . VAL G 2 51  ? 42.663  116.243 91.166  1.00 39.93 ? 240  VAL C CG1   1 
ATOM   7374  C  CG2   . VAL G 2 51  ? 42.087  118.607 90.562  1.00 39.78 ? 240  VAL C CG2   1 
ATOM   7375  N  N     . PRO G 2 52  ? 45.878  115.920 90.771  1.00 40.57 ? 241  PRO C N     1 
ATOM   7376  C  CA    . PRO G 2 52  ? 46.665  114.720 90.480  1.00 40.71 ? 241  PRO C CA    1 
ATOM   7377  C  C     . PRO G 2 52  ? 45.696  113.698 89.887  1.00 41.34 ? 241  PRO C C     1 
ATOM   7378  O  O     . PRO G 2 52  ? 44.537  113.625 90.297  1.00 41.55 ? 241  PRO C O     1 
ATOM   7379  C  CB    . PRO G 2 52  ? 47.166  114.298 91.857  1.00 40.46 ? 241  PRO C CB    1 
ATOM   7380  C  CG    . PRO G 2 52  ? 47.330  115.604 92.564  1.00 39.59 ? 241  PRO C CG    1 
ATOM   7381  C  CD    . PRO G 2 52  ? 46.083  116.361 92.162  1.00 39.89 ? 241  PRO C CD    1 
ATOM   7382  N  N     . GLN G 2 53  ? 46.156  112.920 88.920  1.00 41.93 ? 242  GLN C N     1 
ATOM   7383  C  CA    . GLN G 2 53  ? 45.293  111.929 88.293  1.00 41.61 ? 242  GLN C CA    1 
ATOM   7384  C  C     . GLN G 2 53  ? 44.958  110.777 89.221  1.00 39.59 ? 242  GLN C C     1 
ATOM   7385  O  O     . GLN G 2 53  ? 45.748  110.415 90.082  1.00 38.30 ? 242  GLN C O     1 
ATOM   7386  C  CB    . GLN G 2 53  ? 45.940  111.376 87.023  1.00 44.12 ? 242  GLN C CB    1 
ATOM   7387  C  CG    . GLN G 2 53  ? 45.660  112.201 85.778  1.00 48.66 ? 242  GLN C CG    1 
ATOM   7388  C  CD    . GLN G 2 53  ? 46.006  111.443 84.500  1.00 51.43 ? 242  GLN C CD    1 
ATOM   7389  O  OE1   . GLN G 2 53  ? 47.180  111.143 84.235  1.00 52.63 ? 242  GLN C OE1   1 
ATOM   7390  N  NE2   . GLN G 2 53  ? 44.982  111.121 83.703  1.00 52.22 ? 242  GLN C NE2   1 
ATOM   7391  N  N     . PRO G 2 54  ? 43.771  110.180 89.038  1.00 38.39 ? 243  PRO C N     1 
ATOM   7392  C  CA    . PRO G 2 54  ? 43.272  109.053 89.830  1.00 37.97 ? 243  PRO C CA    1 
ATOM   7393  C  C     . PRO G 2 54  ? 44.176  107.855 89.682  1.00 36.59 ? 243  PRO C C     1 
ATOM   7394  O  O     . PRO G 2 54  ? 44.716  107.633 88.610  1.00 37.78 ? 243  PRO C O     1 
ATOM   7395  C  CB    . PRO G 2 54  ? 41.909  108.762 89.209  1.00 37.92 ? 243  PRO C CB    1 
ATOM   7396  C  CG    . PRO G 2 54  ? 41.514  110.077 88.619  1.00 39.74 ? 243  PRO C CG    1 
ATOM   7397  C  CD    . PRO G 2 54  ? 42.786  110.575 88.021  1.00 37.99 ? 243  PRO C CD    1 
ATOM   7398  N  N     . ILE G 2 55  ? 44.363  107.087 90.741  1.00 35.41 ? 244  ILE C N     1 
ATOM   7399  C  CA    . ILE G 2 55  ? 45.164  105.892 90.598  1.00 35.57 ? 244  ILE C CA    1 
ATOM   7400  C  C     . ILE G 2 55  ? 44.143  104.819 90.273  1.00 36.58 ? 244  ILE C C     1 
ATOM   7401  O  O     . ILE G 2 55  ? 42.940  105.045 90.434  1.00 36.99 ? 244  ILE C O     1 
ATOM   7402  C  CB    . ILE G 2 55  ? 45.945  105.548 91.884  1.00 35.68 ? 244  ILE C CB    1 
ATOM   7403  C  CG1   . ILE G 2 55  ? 45.035  105.617 93.109  1.00 35.42 ? 244  ILE C CG1   1 
ATOM   7404  C  CG2   . ILE G 2 55  ? 47.139  106.489 92.021  1.00 34.82 ? 244  ILE C CG2   1 
ATOM   7405  C  CD1   . ILE G 2 55  ? 44.605  104.266 93.612  1.00 35.66 ? 244  ILE C CD1   1 
ATOM   7406  N  N     . GLN G 2 56  ? 44.598  103.669 89.784  1.00 37.33 ? 245  GLN C N     1 
ATOM   7407  C  CA    . GLN G 2 56  ? 43.678  102.589 89.433  1.00 36.80 ? 245  GLN C CA    1 
ATOM   7408  C  C     . GLN G 2 56  ? 43.936  101.318 90.232  1.00 36.52 ? 245  GLN C C     1 
ATOM   7409  O  O     . GLN G 2 56  ? 43.085  100.433 90.272  1.00 36.53 ? 245  GLN C O     1 
ATOM   7410  C  CB    . GLN G 2 56  ? 43.773  102.259 87.936  1.00 38.17 ? 245  GLN C CB    1 
ATOM   7411  C  CG    . GLN G 2 56  ? 43.382  103.386 86.964  1.00 38.28 ? 245  GLN C CG    1 
ATOM   7412  C  CD    . GLN G 2 56  ? 41.932  103.809 87.102  1.00 38.69 ? 245  GLN C CD    1 
ATOM   7413  O  OE1   . GLN G 2 56  ? 41.037  102.972 87.247  1.00 39.37 ? 245  GLN C OE1   1 
ATOM   7414  N  NE2   . GLN G 2 56  ? 41.688  105.112 87.043  1.00 38.09 ? 245  GLN C NE2   1 
ATOM   7415  N  N     . HIS G 2 57  ? 45.103  101.223 90.860  1.00 35.54 ? 246  HIS C N     1 
ATOM   7416  C  CA    . HIS G 2 57  ? 45.449  100.039 91.633  1.00 36.20 ? 246  HIS C CA    1 
ATOM   7417  C  C     . HIS G 2 57  ? 46.210  100.452 92.868  1.00 36.29 ? 246  HIS C C     1 
ATOM   7418  O  O     . HIS G 2 57  ? 46.856  101.490 92.885  1.00 36.13 ? 246  HIS C O     1 
ATOM   7419  C  CB    . HIS G 2 57  ? 46.340  99.097  90.808  1.00 36.30 ? 246  HIS C CB    1 
ATOM   7420  C  CG    . HIS G 2 57  ? 45.759  98.719  89.483  1.00 36.63 ? 246  HIS C CG    1 
ATOM   7421  N  ND1   . HIS G 2 57  ? 44.864  97.681  89.329  1.00 36.77 ? 246  HIS C ND1   1 
ATOM   7422  C  CD2   . HIS G 2 57  ? 45.923  99.262  88.253  1.00 37.18 ? 246  HIS C CD2   1 
ATOM   7423  C  CE1   . HIS G 2 57  ? 44.502  97.601  88.061  1.00 37.05 ? 246  HIS C CE1   1 
ATOM   7424  N  NE2   . HIS G 2 57  ? 45.130  98.549  87.388  1.00 38.08 ? 246  HIS C NE2   1 
ATOM   7425  N  N     . PHE G 2 58  ? 46.147  99.621  93.897  1.00 37.52 ? 247  PHE C N     1 
ATOM   7426  C  CA    . PHE G 2 58  ? 46.849  99.904  95.133  1.00 39.42 ? 247  PHE C CA    1 
ATOM   7427  C  C     . PHE G 2 58  ? 48.368  99.821  94.947  1.00 41.66 ? 247  PHE C C     1 
ATOM   7428  O  O     . PHE G 2 58  ? 49.123  100.570 95.580  1.00 42.26 ? 247  PHE C O     1 
ATOM   7429  C  CB    . PHE G 2 58  ? 46.413  98.918  96.217  1.00 38.29 ? 247  PHE C CB    1 
ATOM   7430  C  CG    . PHE G 2 58  ? 45.022  99.151  96.719  1.00 37.27 ? 247  PHE C CG    1 
ATOM   7431  C  CD1   . PHE G 2 58  ? 44.020  98.208  96.494  1.00 36.20 ? 247  PHE C CD1   1 
ATOM   7432  C  CD2   . PHE G 2 58  ? 44.715  100.314 97.426  1.00 35.98 ? 247  PHE C CD2   1 
ATOM   7433  C  CE1   . PHE G 2 58  ? 42.725  98.418  96.968  1.00 36.90 ? 247  PHE C CE1   1 
ATOM   7434  C  CE2   . PHE G 2 58  ? 43.431  100.540 97.907  1.00 35.80 ? 247  PHE C CE2   1 
ATOM   7435  C  CZ    . PHE G 2 58  ? 42.427  99.595  97.682  1.00 36.34 ? 247  PHE C CZ    1 
ATOM   7436  N  N     . THR G 2 59  ? 48.810  98.913  94.076  1.00 42.80 ? 248  THR C N     1 
ATOM   7437  C  CA    . THR G 2 59  ? 50.236  98.721  93.825  1.00 43.99 ? 248  THR C CA    1 
ATOM   7438  C  C     . THR G 2 59  ? 50.850  99.804  92.947  1.00 44.54 ? 248  THR C C     1 
ATOM   7439  O  O     . THR G 2 59  ? 52.039  99.766  92.649  1.00 46.02 ? 248  THR C O     1 
ATOM   7440  C  CB    . THR G 2 59  ? 50.517  97.342  93.180  1.00 43.58 ? 248  THR C CB    1 
ATOM   7441  O  OG1   . THR G 2 59  ? 49.603  97.122  92.102  1.00 43.23 ? 248  THR C OG1   1 
ATOM   7442  C  CG2   . THR G 2 59  ? 50.362  96.229  94.201  1.00 43.68 ? 248  THR C CG2   1 
ATOM   7443  N  N     . SER G 2 60  ? 50.048  100.770 92.536  1.00 44.70 ? 249  SER C N     1 
ATOM   7444  C  CA    . SER G 2 60  ? 50.559  101.856 91.716  1.00 45.88 ? 249  SER C CA    1 
ATOM   7445  C  C     . SER G 2 60  ? 50.036  103.172 92.278  1.00 45.74 ? 249  SER C C     1 
ATOM   7446  O  O     . SER G 2 60  ? 49.676  104.082 91.536  1.00 45.01 ? 249  SER C O     1 
ATOM   7447  C  CB    . SER G 2 60  ? 50.097  101.680 90.271  1.00 47.24 ? 249  SER C CB    1 
ATOM   7448  O  OG    . SER G 2 60  ? 48.676  101.666 90.200  1.00 50.93 ? 249  SER C OG    1 
ATOM   7449  N  N     . ALA G 2 61  ? 50.014  103.259 93.605  1.00 46.20 ? 250  ALA C N     1 
ATOM   7450  C  CA    . ALA G 2 61  ? 49.514  104.431 94.307  1.00 45.89 ? 250  ALA C CA    1 
ATOM   7451  C  C     . ALA G 2 61  ? 50.572  105.138 95.146  1.00 46.47 ? 250  ALA C C     1 
ATOM   7452  O  O     . ALA G 2 61  ? 50.247  106.017 95.942  1.00 46.43 ? 250  ALA C O     1 
ATOM   7453  C  CB    . ALA G 2 61  ? 48.356  104.020 95.196  1.00 45.16 ? 250  ALA C CB    1 
ATOM   7454  N  N     . ASP G 2 62  ? 51.833  104.751 94.982  1.00 46.78 ? 251  ASP C N     1 
ATOM   7455  C  CA    . ASP G 2 62  ? 52.907  105.366 95.751  1.00 47.01 ? 251  ASP C CA    1 
ATOM   7456  C  C     . ASP G 2 62  ? 52.793  105.080 97.247  1.00 45.81 ? 251  ASP C C     1 
ATOM   7457  O  O     . ASP G 2 62  ? 53.315  105.831 98.070  1.00 46.11 ? 251  ASP C O     1 
ATOM   7458  C  CB    . ASP G 2 62  ? 52.928  106.887 95.540  1.00 49.03 ? 251  ASP C CB    1 
ATOM   7459  C  CG    . ASP G 2 62  ? 53.500  107.287 94.189  1.00 51.25 ? 251  ASP C CG    1 
ATOM   7460  O  OD1   . ASP G 2 62  ? 54.479  106.640 93.739  1.00 51.78 ? 251  ASP C OD1   1 
ATOM   7461  O  OD2   . ASP G 2 62  ? 52.981  108.262 93.590  1.00 52.10 ? 251  ASP C OD2   1 
ATOM   7462  N  N     . LEU G 2 63  ? 52.103  104.004 97.598  1.00 44.19 ? 252  LEU C N     1 
ATOM   7463  C  CA    . LEU G 2 63  ? 51.948  103.631 98.995  1.00 42.36 ? 252  LEU C CA    1 
ATOM   7464  C  C     . LEU G 2 63  ? 53.137  102.786 99.458  1.00 42.82 ? 252  LEU C C     1 
ATOM   7465  O  O     . LEU G 2 63  ? 53.754  102.068 98.670  1.00 42.54 ? 252  LEU C O     1 
ATOM   7466  C  CB    . LEU G 2 63  ? 50.664  102.840 99.181  1.00 40.77 ? 252  LEU C CB    1 
ATOM   7467  C  CG    . LEU G 2 63  ? 49.365  103.521 98.755  1.00 40.14 ? 252  LEU C CG    1 
ATOM   7468  C  CD1   . LEU G 2 63  ? 48.213  102.529 98.889  1.00 38.63 ? 252  LEU C CD1   1 
ATOM   7469  C  CD2   . LEU G 2 63  ? 49.124  104.758 99.613  1.00 38.04 ? 252  LEU C CD2   1 
ATOM   7470  N  N     . ARG G 2 64  ? 53.454  102.876 100.743 1.00 42.33 ? 253  ARG C N     1 
ATOM   7471  C  CA    . ARG G 2 64  ? 54.552  102.111 101.318 1.00 42.77 ? 253  ARG C CA    1 
ATOM   7472  C  C     . ARG G 2 64  ? 54.280  100.613 101.256 1.00 42.20 ? 253  ARG C C     1 
ATOM   7473  O  O     . ARG G 2 64  ? 53.131  100.179 101.340 1.00 42.43 ? 253  ARG C O     1 
ATOM   7474  C  CB    . ARG G 2 64  ? 54.759  102.530 102.769 1.00 43.99 ? 253  ARG C CB    1 
ATOM   7475  C  CG    . ARG G 2 64  ? 55.578  103.776 102.911 1.00 46.68 ? 253  ARG C CG    1 
ATOM   7476  C  CD    . ARG G 2 64  ? 57.031  103.403 102.985 1.00 49.60 ? 253  ARG C CD    1 
ATOM   7477  N  NE    . ARG G 2 64  ? 57.895  104.465 102.494 1.00 53.48 ? 253  ARG C NE    1 
ATOM   7478  C  CZ    . ARG G 2 64  ? 59.207  104.495 102.693 1.00 54.91 ? 253  ARG C CZ    1 
ATOM   7479  N  NH1   . ARG G 2 64  ? 59.789  103.520 103.380 1.00 55.65 ? 253  ARG C NH1   1 
ATOM   7480  N  NH2   . ARG G 2 64  ? 59.936  105.488 102.195 1.00 56.61 ? 253  ARG C NH2   1 
ATOM   7481  N  N     . ASP G 2 65  ? 55.340  99.826  101.126 1.00 41.27 ? 254  ASP C N     1 
ATOM   7482  C  CA    . ASP G 2 65  ? 55.197  98.375  101.052 1.00 41.56 ? 254  ASP C CA    1 
ATOM   7483  C  C     . ASP G 2 65  ? 54.407  97.780  102.217 1.00 39.73 ? 254  ASP C C     1 
ATOM   7484  O  O     . ASP G 2 65  ? 53.526  96.939  102.023 1.00 39.99 ? 254  ASP C O     1 
ATOM   7485  C  CB    . ASP G 2 65  ? 56.575  97.686  100.998 1.00 43.79 ? 254  ASP C CB    1 
ATOM   7486  C  CG    . ASP G 2 65  ? 57.271  97.848  99.645  1.00 46.03 ? 254  ASP C CG    1 
ATOM   7487  O  OD1   . ASP G 2 65  ? 56.580  97.782  98.602  1.00 46.68 ? 254  ASP C OD1   1 
ATOM   7488  O  OD2   . ASP G 2 65  ? 58.513  98.022  99.629  1.00 47.60 ? 254  ASP C OD2   1 
ATOM   7489  N  N     . ILE G 2 66  ? 54.724  98.204  103.430 1.00 37.75 ? 255  ILE C N     1 
ATOM   7490  C  CA    . ILE G 2 66  ? 54.033  97.650  104.573 1.00 36.58 ? 255  ILE C CA    1 
ATOM   7491  C  C     . ILE G 2 66  ? 52.535  97.999  104.531 1.00 35.15 ? 255  ILE C C     1 
ATOM   7492  O  O     . ILE G 2 66  ? 51.695  97.205  104.960 1.00 34.32 ? 255  ILE C O     1 
ATOM   7493  C  CB    . ILE G 2 66  ? 54.690  98.111  105.891 1.00 36.86 ? 255  ILE C CB    1 
ATOM   7494  C  CG1   . ILE G 2 66  ? 54.108  97.308  107.050 1.00 37.71 ? 255  ILE C CG1   1 
ATOM   7495  C  CG2   . ILE G 2 66  ? 54.491  99.609  106.095 1.00 36.49 ? 255  ILE C CG2   1 
ATOM   7496  C  CD1   . ILE G 2 66  ? 54.817  97.543  108.352 1.00 40.07 ? 255  ILE C CD1   1 
ATOM   7497  N  N     . ILE G 2 67  ? 52.201  99.168  103.991 1.00 33.25 ? 256  ILE C N     1 
ATOM   7498  C  CA    . ILE G 2 67  ? 50.802  99.554  103.885 1.00 31.83 ? 256  ILE C CA    1 
ATOM   7499  C  C     . ILE G 2 67  ? 50.104  98.697  102.820 1.00 31.69 ? 256  ILE C C     1 
ATOM   7500  O  O     . ILE G 2 67  ? 48.964  98.254  103.001 1.00 30.74 ? 256  ILE C O     1 
ATOM   7501  C  CB    . ILE G 2 67  ? 50.647  101.020 103.486 1.00 30.29 ? 256  ILE C CB    1 
ATOM   7502  C  CG1   . ILE G 2 67  ? 51.360  101.924 104.493 1.00 29.08 ? 256  ILE C CG1   1 
ATOM   7503  C  CG2   . ILE G 2 67  ? 49.171  101.332 103.345 1.00 30.34 ? 256  ILE C CG2   1 
ATOM   7504  C  CD1   . ILE G 2 67  ? 50.870  101.791 105.932 1.00 27.76 ? 256  ILE C CD1   1 
ATOM   7505  N  N     . ILE G 2 68  ? 50.769  98.475  101.693 1.00 31.56 ? 257  ILE C N     1 
ATOM   7506  C  CA    . ILE G 2 68  ? 50.145  97.638  100.686 1.00 33.34 ? 257  ILE C CA    1 
ATOM   7507  C  C     . ILE G 2 68  ? 49.978  96.227  101.252 1.00 33.89 ? 257  ILE C C     1 
ATOM   7508  O  O     . ILE G 2 68  ? 48.963  95.575  101.008 1.00 34.88 ? 257  ILE C O     1 
ATOM   7509  C  CB    . ILE G 2 68  ? 50.965  97.596  99.392  1.00 34.17 ? 257  ILE C CB    1 
ATOM   7510  C  CG1   . ILE G 2 68  ? 51.021  98.993  98.776  1.00 32.98 ? 257  ILE C CG1   1 
ATOM   7511  C  CG2   . ILE G 2 68  ? 50.334  96.610  98.415  1.00 32.86 ? 257  ILE C CG2   1 
ATOM   7512  C  CD1   . ILE G 2 68  ? 52.056  99.125  97.696  1.00 34.16 ? 257  ILE C CD1   1 
ATOM   7513  N  N     . ASP G 2 69  ? 50.951  95.759  102.026 1.00 34.67 ? 258  ASP C N     1 
ATOM   7514  C  CA    . ASP G 2 69  ? 50.841  94.426  102.627 1.00 36.07 ? 258  ASP C CA    1 
ATOM   7515  C  C     . ASP G 2 69  ? 49.570  94.331  103.465 1.00 35.24 ? 258  ASP C C     1 
ATOM   7516  O  O     . ASP G 2 69  ? 48.816  93.366  103.362 1.00 36.95 ? 258  ASP C O     1 
ATOM   7517  C  CB    . ASP G 2 69  ? 52.049  94.109  103.526 1.00 38.59 ? 258  ASP C CB    1 
ATOM   7518  C  CG    . ASP G 2 69  ? 53.358  93.921  102.740 1.00 43.41 ? 258  ASP C CG    1 
ATOM   7519  O  OD1   . ASP G 2 69  ? 54.430  93.814  103.391 1.00 46.09 ? 258  ASP C OD1   1 
ATOM   7520  O  OD2   . ASP G 2 69  ? 53.334  93.874  101.483 1.00 45.29 ? 258  ASP C OD2   1 
ATOM   7521  N  N     . ASN G 2 70  ? 49.325  95.327  104.303 1.00 33.73 ? 259  ASN C N     1 
ATOM   7522  C  CA    . ASN G 2 70  ? 48.131  95.297  105.146 1.00 32.65 ? 259  ASN C CA    1 
ATOM   7523  C  C     . ASN G 2 70  ? 46.838  95.446  104.343 1.00 31.83 ? 259  ASN C C     1 
ATOM   7524  O  O     . ASN G 2 70  ? 45.810  94.873  104.695 1.00 31.70 ? 259  ASN C O     1 
ATOM   7525  C  CB    . ASN G 2 70  ? 48.246  96.361  106.241 1.00 31.69 ? 259  ASN C CB    1 
ATOM   7526  C  CG    . ASN G 2 70  ? 49.377  96.061  107.198 1.00 31.99 ? 259  ASN C CG    1 
ATOM   7527  O  OD1   . ASN G 2 70  ? 49.544  94.916  107.610 1.00 34.15 ? 259  ASN C OD1   1 
ATOM   7528  N  ND2   . ASN G 2 70  ? 50.158  97.074  107.560 1.00 31.18 ? 259  ASN C ND2   1 
ATOM   7529  N  N     . VAL G 2 71  ? 46.892  96.211  103.260 1.00 31.84 ? 260  VAL C N     1 
ATOM   7530  C  CA    . VAL G 2 71  ? 45.729  96.364  102.411 1.00 32.13 ? 260  VAL C CA    1 
ATOM   7531  C  C     . VAL G 2 71  ? 45.413  94.954  101.889 1.00 33.55 ? 260  VAL C C     1 
ATOM   7532  O  O     . VAL G 2 71  ? 44.266  94.524  101.894 1.00 33.78 ? 260  VAL C O     1 
ATOM   7533  C  CB    . VAL G 2 71  ? 46.024  97.308  101.217 1.00 31.71 ? 260  VAL C CB    1 
ATOM   7534  C  CG1   . VAL G 2 71  ? 45.024  97.054  100.084 1.00 31.50 ? 260  VAL C CG1   1 
ATOM   7535  C  CG2   . VAL G 2 71  ? 45.967  98.770  101.666 1.00 30.20 ? 260  VAL C CG2   1 
ATOM   7536  N  N     . ASN G 2 72  ? 46.441  94.235  101.458 1.00 35.17 ? 261  ASN C N     1 
ATOM   7537  C  CA    . ASN G 2 72  ? 46.268  92.879  100.940 1.00 36.96 ? 261  ASN C CA    1 
ATOM   7538  C  C     . ASN G 2 72  ? 45.662  91.939  101.981 1.00 36.86 ? 261  ASN C C     1 
ATOM   7539  O  O     . ASN G 2 72  ? 44.744  91.180  101.677 1.00 37.49 ? 261  ASN C O     1 
ATOM   7540  C  CB    . ASN G 2 72  ? 47.612  92.330  100.462 1.00 39.83 ? 261  ASN C CB    1 
ATOM   7541  C  CG    . ASN G 2 72  ? 47.484  90.986  99.772  1.00 43.13 ? 261  ASN C CG    1 
ATOM   7542  O  OD1   . ASN G 2 72  ? 46.842  90.872  98.725  1.00 45.26 ? 261  ASN C OD1   1 
ATOM   7543  N  ND2   . ASN G 2 72  ? 48.103  89.954  100.352 1.00 45.45 ? 261  ASN C ND2   1 
ATOM   7544  N  N     . LYS G 2 73  ? 46.164  91.998  103.209 1.00 36.36 ? 262  LYS C N     1 
ATOM   7545  C  CA    . LYS G 2 73  ? 45.654  91.158  104.291 1.00 36.11 ? 262  LYS C CA    1 
ATOM   7546  C  C     . LYS G 2 73  ? 44.248  91.576  104.714 1.00 35.70 ? 262  LYS C C     1 
ATOM   7547  O  O     . LYS G 2 73  ? 43.578  90.856  105.452 1.00 35.51 ? 262  LYS C O     1 
ATOM   7548  C  CB    . LYS G 2 73  ? 46.573  91.239  105.514 1.00 37.31 ? 262  LYS C CB    1 
ATOM   7549  C  CG    . LYS G 2 73  ? 48.026  90.913  105.232 1.00 39.06 ? 262  LYS C CG    1 
ATOM   7550  C  CD    . LYS G 2 73  ? 48.856  90.930  106.507 1.00 40.22 ? 262  LYS C CD    1 
ATOM   7551  C  CE    . LYS G 2 73  ? 50.326  90.677  106.194 1.00 40.89 ? 262  LYS C CE    1 
ATOM   7552  N  NZ    . LYS G 2 73  ? 51.123  90.509  107.436 1.00 42.12 ? 262  LYS C NZ    1 
ATOM   7553  N  N     . SER G 2 74  ? 43.817  92.758  104.281 1.00 35.27 ? 263  SER C N     1 
ATOM   7554  C  CA    . SER G 2 74  ? 42.478  93.240  104.615 1.00 35.10 ? 263  SER C CA    1 
ATOM   7555  C  C     . SER G 2 74  ? 41.529  92.680  103.571 1.00 34.83 ? 263  SER C C     1 
ATOM   7556  O  O     . SER G 2 74  ? 40.303  92.791  103.695 1.00 34.85 ? 263  SER C O     1 
ATOM   7557  C  CB    . SER G 2 74  ? 42.422  94.774  104.609 1.00 34.65 ? 263  SER C CB    1 
ATOM   7558  O  OG    . SER G 2 74  ? 43.160  95.310  105.693 1.00 34.23 ? 263  SER C OG    1 
ATOM   7559  N  N     . GLY G 2 75  ? 42.117  92.086  102.534 1.00 34.18 ? 264  GLY C N     1 
ATOM   7560  C  CA    . GLY G 2 75  ? 41.332  91.485  101.476 1.00 33.44 ? 264  GLY C CA    1 
ATOM   7561  C  C     . GLY G 2 75  ? 40.897  92.403  100.355 1.00 33.12 ? 264  GLY C C     1 
ATOM   7562  O  O     . GLY G 2 75  ? 40.129  91.976  99.499  1.00 33.16 ? 264  GLY C O     1 
ATOM   7563  N  N     . TYR G 2 76  ? 41.374  93.646  100.342 1.00 32.60 ? 265  TYR C N     1 
ATOM   7564  C  CA    . TYR G 2 76  ? 40.992  94.576  99.278  1.00 32.78 ? 265  TYR C CA    1 
ATOM   7565  C  C     . TYR G 2 76  ? 41.755  94.220  98.007  1.00 33.73 ? 265  TYR C C     1 
ATOM   7566  O  O     . TYR G 2 76  ? 42.948  93.945  98.057  1.00 33.95 ? 265  TYR C O     1 
ATOM   7567  C  CB    . TYR G 2 76  ? 41.335  96.029  99.639  1.00 31.54 ? 265  TYR C CB    1 
ATOM   7568  C  CG    . TYR G 2 76  ? 40.724  96.588  100.906 1.00 30.19 ? 265  TYR C CG    1 
ATOM   7569  C  CD1   . TYR G 2 76  ? 39.909  95.812  101.729 1.00 30.56 ? 265  TYR C CD1   1 
ATOM   7570  C  CD2   . TYR G 2 76  ? 41.005  97.895  101.305 1.00 30.58 ? 265  TYR C CD2   1 
ATOM   7571  C  CE1   . TYR G 2 76  ? 39.391  96.327  102.923 1.00 30.38 ? 265  TYR C CE1   1 
ATOM   7572  C  CE2   . TYR G 2 76  ? 40.494  98.415  102.490 1.00 30.11 ? 265  TYR C CE2   1 
ATOM   7573  C  CZ    . TYR G 2 76  ? 39.689  97.627  103.291 1.00 29.37 ? 265  TYR C CZ    1 
ATOM   7574  O  OH    . TYR G 2 76  ? 39.166  98.143  104.445 1.00 30.11 ? 265  TYR C OH    1 
ATOM   7575  N  N     . LYS G 2 77  ? 41.072  94.243  96.871  1.00 34.21 ? 266  LYS C N     1 
ATOM   7576  C  CA    . LYS G 2 77  ? 41.713  93.931  95.601  1.00 35.44 ? 266  LYS C CA    1 
ATOM   7577  C  C     . LYS G 2 77  ? 41.711  95.126  94.663  1.00 35.01 ? 266  LYS C C     1 
ATOM   7578  O  O     . LYS G 2 77  ? 42.670  95.353  93.938  1.00 35.05 ? 266  LYS C O     1 
ATOM   7579  C  CB    . LYS G 2 77  ? 41.007  92.747  94.926  1.00 37.52 ? 266  LYS C CB    1 
ATOM   7580  C  CG    . LYS G 2 77  ? 41.317  91.380  95.548  1.00 40.27 ? 266  LYS C CG    1 
ATOM   7581  C  CD    . LYS G 2 77  ? 40.458  90.286  94.918  1.00 43.94 ? 266  LYS C CD    1 
ATOM   7582  C  CE    . LYS G 2 77  ? 40.995  88.870  95.195  1.00 45.79 ? 266  LYS C CE    1 
ATOM   7583  N  NZ    . LYS G 2 77  ? 42.232  88.530  94.402  1.00 46.64 ? 266  LYS C NZ    1 
ATOM   7584  N  N     . ILE G 2 78  ? 40.640  95.908  94.692  1.00 34.81 ? 267  ILE C N     1 
ATOM   7585  C  CA    . ILE G 2 78  ? 40.524  97.056  93.805  1.00 34.39 ? 267  ILE C CA    1 
ATOM   7586  C  C     . ILE G 2 78  ? 40.148  98.331  94.542  1.00 33.55 ? 267  ILE C C     1 
ATOM   7587  O  O     . ILE G 2 78  ? 39.263  98.329  95.391  1.00 33.57 ? 267  ILE C O     1 
ATOM   7588  C  CB    . ILE G 2 78  ? 39.452  96.802  92.733  1.00 34.64 ? 267  ILE C CB    1 
ATOM   7589  C  CG1   . ILE G 2 78  ? 39.811  95.548  91.942  1.00 36.23 ? 267  ILE C CG1   1 
ATOM   7590  C  CG2   . ILE G 2 78  ? 39.338  98.011  91.801  1.00 34.87 ? 267  ILE C CG2   1 
ATOM   7591  C  CD1   . ILE G 2 78  ? 38.683  95.041  91.073  1.00 36.95 ? 267  ILE C CD1   1 
ATOM   7592  N  N     . PRO G 2 79  ? 40.820  99.441  94.226  1.00 32.46 ? 268  PRO C N     1 
ATOM   7593  C  CA    . PRO G 2 79  ? 40.446  100.663 94.934  1.00 30.35 ? 268  PRO C CA    1 
ATOM   7594  C  C     . PRO G 2 79  ? 39.018  101.049 94.554  1.00 28.94 ? 268  PRO C C     1 
ATOM   7595  O  O     . PRO G 2 79  ? 38.561  100.883 93.420  1.00 28.08 ? 268  PRO C O     1 
ATOM   7596  C  CB    . PRO G 2 79  ? 41.462  101.699 94.441  1.00 31.59 ? 268  PRO C CB    1 
ATOM   7597  C  CG    . PRO G 2 79  ? 42.647  100.838 93.964  1.00 33.18 ? 268  PRO C CG    1 
ATOM   7598  C  CD    . PRO G 2 79  ? 41.947  99.670  93.309  1.00 32.27 ? 268  PRO C CD    1 
ATOM   7599  N  N     . THR G 2 80  ? 38.320  101.550 95.545  1.00 26.84 ? 269  THR C N     1 
ATOM   7600  C  CA    . THR G 2 80  ? 36.963  102.019 95.418  1.00 25.54 ? 269  THR C CA    1 
ATOM   7601  C  C     . THR G 2 80  ? 37.062  103.367 94.672  1.00 23.33 ? 269  THR C C     1 
ATOM   7602  O  O     . THR G 2 80  ? 38.121  103.955 94.615  1.00 21.70 ? 269  THR C O     1 
ATOM   7603  C  CB    . THR G 2 80  ? 36.439  102.163 96.849  1.00 26.51 ? 269  THR C CB    1 
ATOM   7604  O  OG1   . THR G 2 80  ? 35.316  101.295 97.027  1.00 30.14 ? 269  THR C OG1   1 
ATOM   7605  C  CG2   . THR G 2 80  ? 36.161  103.583 97.188  1.00 23.68 ? 269  THR C CG2   1 
ATOM   7606  N  N     . PRO G 2 81  ? 35.972  103.853 94.071  1.00 23.56 ? 270  PRO C N     1 
ATOM   7607  C  CA    . PRO G 2 81  ? 36.066  105.140 93.361  1.00 24.01 ? 270  PRO C CA    1 
ATOM   7608  C  C     . PRO G 2 81  ? 36.621  106.327 94.168  1.00 24.24 ? 270  PRO C C     1 
ATOM   7609  O  O     . PRO G 2 81  ? 37.431  107.124 93.656  1.00 24.95 ? 270  PRO C O     1 
ATOM   7610  C  CB    . PRO G 2 81  ? 34.630  105.382 92.901  1.00 24.35 ? 270  PRO C CB    1 
ATOM   7611  C  CG    . PRO G 2 81  ? 34.148  103.974 92.598  1.00 23.55 ? 270  PRO C CG    1 
ATOM   7612  C  CD    . PRO G 2 81  ? 34.678  103.193 93.800  1.00 23.86 ? 270  PRO C CD    1 
ATOM   7613  N  N     . ILE G 2 82  ? 36.181  106.460 95.418  1.00 23.13 ? 271  ILE C N     1 
ATOM   7614  C  CA    . ILE G 2 82  ? 36.649  107.560 96.252  1.00 21.67 ? 271  ILE C CA    1 
ATOM   7615  C  C     . ILE G 2 82  ? 38.136  107.374 96.584  1.00 21.78 ? 271  ILE C C     1 
ATOM   7616  O  O     . ILE G 2 82  ? 38.877  108.347 96.718  1.00 20.70 ? 271  ILE C O     1 
ATOM   7617  C  CB    . ILE G 2 82  ? 35.777  107.695 97.568  1.00 19.95 ? 271  ILE C CB    1 
ATOM   7618  C  CG1   . ILE G 2 82  ? 36.107  109.006 98.274  1.00 19.45 ? 271  ILE C CG1   1 
ATOM   7619  C  CG2   . ILE G 2 82  ? 36.010  106.546 98.505  1.00 17.93 ? 271  ILE C CG2   1 
ATOM   7620  C  CD1   . ILE G 2 82  ? 35.886  110.256 97.381  1.00 19.16 ? 271  ILE C CD1   1 
ATOM   7621  N  N     . GLN G 2 83  ? 38.572  106.121 96.697  1.00 21.54 ? 272  GLN C N     1 
ATOM   7622  C  CA    . GLN G 2 83  ? 39.973  105.826 96.988  1.00 22.35 ? 272  GLN C CA    1 
ATOM   7623  C  C     . GLN G 2 83  ? 40.861  106.184 95.774  1.00 23.84 ? 272  GLN C C     1 
ATOM   7624  O  O     . GLN G 2 83  ? 41.972  106.716 95.931  1.00 23.92 ? 272  GLN C O     1 
ATOM   7625  C  CB    . GLN G 2 83  ? 40.114  104.345 97.373  1.00 21.64 ? 272  GLN C CB    1 
ATOM   7626  C  CG    . GLN G 2 83  ? 39.507  104.034 98.753  1.00 21.09 ? 272  GLN C CG    1 
ATOM   7627  C  CD    . GLN G 2 83  ? 39.235  102.552 98.995  1.00 20.78 ? 272  GLN C CD    1 
ATOM   7628  O  OE1   . GLN G 2 83  ? 39.521  101.702 98.154  1.00 19.88 ? 272  GLN C OE1   1 
ATOM   7629  N  NE2   . GLN G 2 83  ? 38.670  102.242 100.154 1.00 20.97 ? 272  GLN C NE2   1 
ATOM   7630  N  N     . LYS G 2 84  ? 40.357  105.922 94.570  1.00 24.03 ? 273  LYS C N     1 
ATOM   7631  C  CA    . LYS G 2 84  ? 41.099  106.230 93.341  1.00 26.09 ? 273  LYS C CA    1 
ATOM   7632  C  C     . LYS G 2 84  ? 41.363  107.724 93.172  1.00 26.45 ? 273  LYS C C     1 
ATOM   7633  O  O     . LYS G 2 84  ? 42.461  108.122 92.804  1.00 26.61 ? 273  LYS C O     1 
ATOM   7634  C  CB    . LYS G 2 84  ? 40.334  105.734 92.114  1.00 25.67 ? 273  LYS C CB    1 
ATOM   7635  C  CG    . LYS G 2 84  ? 40.346  104.233 91.950  1.00 27.76 ? 273  LYS C CG    1 
ATOM   7636  C  CD    . LYS G 2 84  ? 39.546  103.862 90.719  1.00 28.93 ? 273  LYS C CD    1 
ATOM   7637  C  CE    . LYS G 2 84  ? 39.583  102.384 90.451  1.00 28.69 ? 273  LYS C CE    1 
ATOM   7638  N  NZ    . LYS G 2 84  ? 38.812  102.117 89.218  1.00 30.73 ? 273  LYS C NZ    1 
ATOM   7639  N  N     . CYS G 2 85  ? 40.352  108.546 93.426  1.00 27.26 ? 274  CYS C N     1 
ATOM   7640  C  CA    . CYS G 2 85  ? 40.509  109.989 93.295  1.00 29.16 ? 274  CYS C CA    1 
ATOM   7641  C  C     . CYS G 2 85  ? 41.222  110.635 94.485  1.00 28.95 ? 274  CYS C C     1 
ATOM   7642  O  O     . CYS G 2 85  ? 42.092  111.480 94.303  1.00 29.04 ? 274  CYS C O     1 
ATOM   7643  C  CB    . CYS G 2 85  ? 39.140  110.665 93.130  1.00 31.00 ? 274  CYS C CB    1 
ATOM   7644  S  SG    . CYS G 2 85  ? 38.131  110.088 91.714  1.00 36.35 ? 274  CYS C SG    1 
ATOM   7645  N  N     . SER G 2 86  ? 40.854  110.228 95.699  1.00 28.61 ? 275  SER C N     1 
ATOM   7646  C  CA    . SER G 2 86  ? 41.405  110.818 96.922  1.00 27.57 ? 275  SER C CA    1 
ATOM   7647  C  C     . SER G 2 86  ? 42.852  110.516 97.282  1.00 27.48 ? 275  SER C C     1 
ATOM   7648  O  O     . SER G 2 86  ? 43.586  111.407 97.686  1.00 25.78 ? 275  SER C O     1 
ATOM   7649  C  CB    . SER G 2 86  ? 40.530  110.441 98.125  1.00 27.28 ? 275  SER C CB    1 
ATOM   7650  O  OG    . SER G 2 86  ? 39.195  110.895 97.964  1.00 27.27 ? 275  SER C OG    1 
ATOM   7651  N  N     . ILE G 2 87  ? 43.245  109.253 97.164  1.00 27.32 ? 276  ILE C N     1 
ATOM   7652  C  CA    . ILE G 2 87  ? 44.596  108.826 97.511  1.00 27.31 ? 276  ILE C CA    1 
ATOM   7653  C  C     . ILE G 2 87  ? 45.721  109.681 96.921  1.00 27.57 ? 276  ILE C C     1 
ATOM   7654  O  O     . ILE G 2 87  ? 46.557  110.172 97.657  1.00 28.42 ? 276  ILE C O     1 
ATOM   7655  C  CB    . ILE G 2 87  ? 44.792  107.322 97.147  1.00 27.22 ? 276  ILE C CB    1 
ATOM   7656  C  CG1   . ILE G 2 87  ? 43.985  106.461 98.125  1.00 26.58 ? 276  ILE C CG1   1 
ATOM   7657  C  CG2   . ILE G 2 87  ? 46.257  106.927 97.203  1.00 27.62 ? 276  ILE C CG2   1 
ATOM   7658  C  CD1   . ILE G 2 87  ? 44.019  104.996 97.811  1.00 26.33 ? 276  ILE C CD1   1 
ATOM   7659  N  N     . PRO G 2 88  ? 45.757  109.870 95.591  1.00 26.92 ? 277  PRO C N     1 
ATOM   7660  C  CA    . PRO G 2 88  ? 46.833  110.690 95.020  1.00 26.50 ? 277  PRO C CA    1 
ATOM   7661  C  C     . PRO G 2 88  ? 46.747  112.160 95.407  1.00 26.99 ? 277  PRO C C     1 
ATOM   7662  O  O     . PRO G 2 88  ? 47.760  112.851 95.487  1.00 27.13 ? 277  PRO C O     1 
ATOM   7663  C  CB    . PRO G 2 88  ? 46.679  110.475 93.511  1.00 26.72 ? 277  PRO C CB    1 
ATOM   7664  C  CG    . PRO G 2 88  ? 45.204  110.227 93.352  1.00 27.66 ? 277  PRO C CG    1 
ATOM   7665  C  CD    . PRO G 2 88  ? 44.894  109.311 94.532  1.00 26.67 ? 277  PRO C CD    1 
ATOM   7666  N  N     . VAL G 2 89  ? 45.536  112.647 95.639  1.00 26.94 ? 278  VAL C N     1 
ATOM   7667  C  CA    . VAL G 2 89  ? 45.362  114.042 96.035  1.00 27.32 ? 278  VAL C CA    1 
ATOM   7668  C  C     . VAL G 2 89  ? 45.978  114.307 97.422  1.00 26.29 ? 278  VAL C C     1 
ATOM   7669  O  O     . VAL G 2 89  ? 46.640  115.323 97.653  1.00 25.65 ? 278  VAL C O     1 
ATOM   7670  C  CB    . VAL G 2 89  ? 43.856  114.408 96.055  1.00 28.18 ? 278  VAL C CB    1 
ATOM   7671  C  CG1   . VAL G 2 89  ? 43.640  115.725 96.766  1.00 27.16 ? 278  VAL C CG1   1 
ATOM   7672  C  CG2   . VAL G 2 89  ? 43.330  114.472 94.619  1.00 27.43 ? 278  VAL C CG2   1 
ATOM   7673  N  N     . ILE G 2 90  ? 45.763  113.377 98.341  1.00 25.87 ? 279  ILE C N     1 
ATOM   7674  C  CA    . ILE G 2 90  ? 46.285  113.525 99.686  1.00 26.81 ? 279  ILE C CA    1 
ATOM   7675  C  C     . ILE G 2 90  ? 47.803  113.353 99.687  1.00 27.33 ? 279  ILE C C     1 
ATOM   7676  O  O     . ILE G 2 90  ? 48.513  114.067 100.406 1.00 28.74 ? 279  ILE C O     1 
ATOM   7677  C  CB    . ILE G 2 90  ? 45.613  112.505 100.653 1.00 26.11 ? 279  ILE C CB    1 
ATOM   7678  C  CG1   . ILE G 2 90  ? 44.110  112.807 100.755 1.00 24.67 ? 279  ILE C CG1   1 
ATOM   7679  C  CG2   . ILE G 2 90  ? 46.257  112.581 102.023 1.00 24.08 ? 279  ILE C CG2   1 
ATOM   7680  C  CD1   . ILE G 2 90  ? 43.326  111.802 101.566 1.00 24.41 ? 279  ILE C CD1   1 
ATOM   7681  N  N     . SER G 2 91  ? 48.293  112.410 98.888  1.00 27.37 ? 280  SER C N     1 
ATOM   7682  C  CA    . SER G 2 91  ? 49.736  112.148 98.774  1.00 29.34 ? 280  SER C CA    1 
ATOM   7683  C  C     . SER G 2 91  ? 50.499  113.347 98.225  1.00 30.45 ? 280  SER C C     1 
ATOM   7684  O  O     . SER G 2 91  ? 51.641  113.605 98.619  1.00 31.32 ? 280  SER C O     1 
ATOM   7685  C  CB    . SER G 2 91  ? 49.998  110.961 97.855  1.00 27.24 ? 280  SER C CB    1 
ATOM   7686  O  OG    . SER G 2 91  ? 49.514  109.784 98.451  1.00 27.72 ? 280  SER C OG    1 
ATOM   7687  N  N     . SER G 2 92  ? 49.869  114.055 97.293  1.00 30.98 ? 281  SER C N     1 
ATOM   7688  C  CA    . SER G 2 92  ? 50.458  115.238 96.688  1.00 31.74 ? 281  SER C CA    1 
ATOM   7689  C  C     . SER G 2 92  ? 50.445  116.381 97.671  1.00 31.67 ? 281  SER C C     1 
ATOM   7690  O  O     . SER G 2 92  ? 50.959  117.447 97.373  1.00 32.77 ? 281  SER C O     1 
ATOM   7691  C  CB    . SER G 2 92  ? 49.672  115.644 95.450  1.00 33.19 ? 281  SER C CB    1 
ATOM   7692  O  OG    . SER G 2 92  ? 49.737  114.612 94.485  1.00 37.82 ? 281  SER C OG    1 
ATOM   7693  N  N     . GLY G 2 93  ? 49.814  116.174 98.824  1.00 31.45 ? 282  GLY C N     1 
ATOM   7694  C  CA    . GLY G 2 93  ? 49.781  117.206 99.847  1.00 31.59 ? 282  GLY C CA    1 
ATOM   7695  C  C     . GLY G 2 93  ? 48.714  118.278 99.743  1.00 31.77 ? 282  GLY C C     1 
ATOM   7696  O  O     . GLY G 2 93  ? 48.849  119.347 100.347 1.00 32.67 ? 282  GLY C O     1 
ATOM   7697  N  N     . ARG G 2 94  ? 47.648  117.996 99.003  1.00 30.85 ? 283  ARG C N     1 
ATOM   7698  C  CA    . ARG G 2 94  ? 46.554  118.947 98.821  1.00 30.63 ? 283  ARG C CA    1 
ATOM   7699  C  C     . ARG G 2 94  ? 45.395  118.781 99.807  1.00 30.23 ? 283  ARG C C     1 
ATOM   7700  O  O     . ARG G 2 94  ? 45.174  117.690 100.355 1.00 28.53 ? 283  ARG C O     1 
ATOM   7701  C  CB    . ARG G 2 94  ? 45.993  118.799 97.409  1.00 32.02 ? 283  ARG C CB    1 
ATOM   7702  C  CG    . ARG G 2 94  ? 47.035  118.943 96.334  1.00 33.60 ? 283  ARG C CG    1 
ATOM   7703  C  CD    . ARG G 2 94  ? 47.223  120.384 95.957  1.00 33.14 ? 283  ARG C CD    1 
ATOM   7704  N  NE    . ARG G 2 94  ? 46.579  120.600 94.670  1.00 36.96 ? 283  ARG C NE    1 
ATOM   7705  C  CZ    . ARG G 2 94  ? 45.506  121.346 94.496  1.00 35.76 ? 283  ARG C CZ    1 
ATOM   7706  N  NH1   . ARG G 2 94  ? 44.961  121.958 95.525  1.00 36.68 ? 283  ARG C NH1   1 
ATOM   7707  N  NH2   . ARG G 2 94  ? 44.975  121.456 93.298  1.00 37.54 ? 283  ARG C NH2   1 
ATOM   7708  N  N     . ASP G 2 95  ? 44.650  119.869 100.006 1.00 29.79 ? 284  ASP C N     1 
ATOM   7709  C  CA    . ASP G 2 95  ? 43.467  119.850 100.863 1.00 29.39 ? 284  ASP C CA    1 
ATOM   7710  C  C     . ASP G 2 95  ? 42.354  119.187 100.050 1.00 28.09 ? 284  ASP C C     1 
ATOM   7711  O  O     . ASP G 2 95  ? 42.342  119.272 98.824  1.00 27.54 ? 284  ASP C O     1 
ATOM   7712  C  CB    . ASP G 2 95  ? 43.079  121.259 101.271 1.00 30.40 ? 284  ASP C CB    1 
ATOM   7713  C  CG    . ASP G 2 95  ? 43.841  121.730 102.485 1.00 33.18 ? 284  ASP C CG    1 
ATOM   7714  O  OD1   . ASP G 2 95  ? 44.852  121.075 102.831 1.00 34.43 ? 284  ASP C OD1   1 
ATOM   7715  O  OD2   . ASP G 2 95  ? 43.443  122.753 103.090 1.00 34.56 ? 284  ASP C OD2   1 
ATOM   7716  N  N     . LEU G 2 96  ? 41.410  118.544 100.724 1.00 27.72 ? 285  LEU C N     1 
ATOM   7717  C  CA    . LEU G 2 96  ? 40.382  117.803 100.003 1.00 27.53 ? 285  LEU C CA    1 
ATOM   7718  C  C     . LEU G 2 96  ? 39.002  117.732 100.659 1.00 25.46 ? 285  LEU C C     1 
ATOM   7719  O  O     . LEU G 2 96  ? 38.897  117.597 101.867 1.00 24.30 ? 285  LEU C O     1 
ATOM   7720  C  CB    . LEU G 2 96  ? 40.920  116.382 99.793  1.00 27.63 ? 285  LEU C CB    1 
ATOM   7721  C  CG    . LEU G 2 96  ? 40.402  115.300 98.835  1.00 30.16 ? 285  LEU C CG    1 
ATOM   7722  C  CD1   . LEU G 2 96  ? 39.966  114.101 99.663  1.00 29.83 ? 285  LEU C CD1   1 
ATOM   7723  C  CD2   . LEU G 2 96  ? 39.309  115.806 97.927  1.00 29.11 ? 285  LEU C CD2   1 
ATOM   7724  N  N     . MET G 2 97  ? 37.958  117.834 99.839  1.00 24.74 ? 286  MET C N     1 
ATOM   7725  C  CA    . MET G 2 97  ? 36.573  117.710 100.288 1.00 24.98 ? 286  MET C CA    1 
ATOM   7726  C  C     . MET G 2 97  ? 36.081  116.566 99.421  1.00 23.74 ? 286  MET C C     1 
ATOM   7727  O  O     . MET G 2 97  ? 36.025  116.687 98.212  1.00 23.83 ? 286  MET C O     1 
ATOM   7728  C  CB    . MET G 2 97  ? 35.754  118.979 100.008 1.00 25.68 ? 286  MET C CB    1 
ATOM   7729  C  CG    . MET G 2 97  ? 34.297  118.892 100.478 1.00 25.98 ? 286  MET C CG    1 
ATOM   7730  S  SD    . MET G 2 97  ? 33.277  120.379 100.115 1.00 29.71 ? 286  MET C SD    1 
ATOM   7731  C  CE    . MET G 2 97  ? 34.024  121.563 101.167 1.00 26.03 ? 286  MET C CE    1 
ATOM   7732  N  N     . ALA G 2 98  ? 35.735  115.450 100.040 1.00 23.70 ? 287  ALA C N     1 
ATOM   7733  C  CA    . ALA G 2 98  ? 35.320  114.286 99.282  1.00 23.52 ? 287  ALA C CA    1 
ATOM   7734  C  C     . ALA G 2 98  ? 33.944  113.787 99.646  1.00 23.69 ? 287  ALA C C     1 
ATOM   7735  O  O     . ALA G 2 98  ? 33.642  113.579 100.814 1.00 22.60 ? 287  ALA C O     1 
ATOM   7736  C  CB    . ALA G 2 98  ? 36.342  113.166 99.478  1.00 24.32 ? 287  ALA C CB    1 
ATOM   7737  N  N     . CYS G 2 99  ? 33.123  113.565 98.630  1.00 23.92 ? 288  CYS C N     1 
ATOM   7738  C  CA    . CYS G 2 99  ? 31.771  113.082 98.849  1.00 25.17 ? 288  CYS C CA    1 
ATOM   7739  C  C     . CYS G 2 99  ? 31.542  111.761 98.124  1.00 23.57 ? 288  CYS C C     1 
ATOM   7740  O  O     . CYS G 2 99  ? 31.806  111.639 96.931  1.00 22.30 ? 288  CYS C O     1 
ATOM   7741  C  CB    . CYS G 2 99  ? 30.775  114.132 98.375  1.00 27.09 ? 288  CYS C CB    1 
ATOM   7742  S  SG    . CYS G 2 99  ? 31.184  115.795 99.030  1.00 33.55 ? 288  CYS C SG    1 
ATOM   7743  N  N     . ALA G 2 100 ? 31.047  110.774 98.863  1.00 22.18 ? 289  ALA C N     1 
ATOM   7744  C  CA    . ALA G 2 100 ? 30.784  109.449 98.298  1.00 21.98 ? 289  ALA C CA    1 
ATOM   7745  C  C     . ALA G 2 100 ? 29.792  108.751 99.215  1.00 21.51 ? 289  ALA C C     1 
ATOM   7746  O  O     . ALA G 2 100 ? 29.816  108.948 100.431 1.00 21.11 ? 289  ALA C O     1 
ATOM   7747  C  CB    . ALA G 2 100 ? 32.095  108.632 98.195  1.00 19.31 ? 289  ALA C CB    1 
ATOM   7748  N  N     . GLN G 2 101 ? 28.927  107.943 98.619  1.00 21.63 ? 290  GLN C N     1 
ATOM   7749  C  CA    . GLN G 2 101 ? 27.895  107.228 99.342  1.00 23.09 ? 290  GLN C CA    1 
ATOM   7750  C  C     . GLN G 2 101 ? 28.382  106.364 100.497 1.00 23.49 ? 290  GLN C C     1 
ATOM   7751  O  O     . GLN G 2 101 ? 29.542  105.950 100.551 1.00 22.98 ? 290  GLN C O     1 
ATOM   7752  C  CB    . GLN G 2 101 ? 27.122  106.346 98.381  1.00 24.61 ? 290  GLN C CB    1 
ATOM   7753  C  CG    . GLN G 2 101 ? 27.945  105.212 97.807  1.00 26.53 ? 290  GLN C CG    1 
ATOM   7754  C  CD    . GLN G 2 101 ? 27.218  104.494 96.681  1.00 29.05 ? 290  GLN C CD    1 
ATOM   7755  O  OE1   . GLN G 2 101 ? 26.548  105.128 95.859  1.00 30.04 ? 290  GLN C OE1   1 
ATOM   7756  N  NE2   . GLN G 2 101 ? 27.350  103.173 96.632  1.00 29.52 ? 290  GLN C NE2   1 
ATOM   7757  N  N     . THR G 2 102 ? 27.459  106.093 101.412 1.00 22.55 ? 291  THR C N     1 
ATOM   7758  C  CA    . THR G 2 102 ? 27.736  105.263 102.567 1.00 22.73 ? 291  THR C CA    1 
ATOM   7759  C  C     . THR G 2 102 ? 28.269  103.901 102.137 1.00 22.50 ? 291  THR C C     1 
ATOM   7760  O  O     . THR G 2 102 ? 27.878  103.367 101.094 1.00 21.34 ? 291  THR C O     1 
ATOM   7761  C  CB    . THR G 2 102 ? 26.470  105.040 103.418 1.00 21.61 ? 291  THR C CB    1 
ATOM   7762  O  OG1   . THR G 2 102 ? 25.420  104.518 102.591 1.00 22.10 ? 291  THR C OG1   1 
ATOM   7763  C  CG2   . THR G 2 102 ? 26.020  106.362 104.053 1.00 20.21 ? 291  THR C CG2   1 
ATOM   7764  N  N     . GLY G 2 103 ? 29.178  103.377 102.955 1.00 22.08 ? 292  GLY C N     1 
ATOM   7765  C  CA    . GLY G 2 103 ? 29.782  102.077 102.735 1.00 22.13 ? 292  GLY C CA    1 
ATOM   7766  C  C     . GLY G 2 103 ? 30.636  101.909 101.499 1.00 22.82 ? 292  GLY C C     1 
ATOM   7767  O  O     . GLY G 2 103 ? 30.710  100.799 100.980 1.00 23.13 ? 292  GLY C O     1 
ATOM   7768  N  N     . SER G 2 104 ? 31.295  102.972 101.040 1.00 21.72 ? 293  SER C N     1 
ATOM   7769  C  CA    . SER G 2 104 ? 32.101  102.881 99.846  1.00 21.37 ? 293  SER C CA    1 
ATOM   7770  C  C     . SER G 2 104 ? 33.588  103.161 100.001 1.00 21.79 ? 293  SER C C     1 
ATOM   7771  O  O     . SER G 2 104 ? 34.239  103.538 99.049  1.00 20.81 ? 293  SER C O     1 
ATOM   7772  C  CB    . SER G 2 104 ? 31.509  103.747 98.717  1.00 22.30 ? 293  SER C CB    1 
ATOM   7773  O  OG    . SER G 2 104 ? 31.629  105.137 98.953  1.00 24.00 ? 293  SER C OG    1 
ATOM   7774  N  N     . GLY G 2 105 ? 34.112  102.966 101.209 1.00 21.46 ? 294  GLY C N     1 
ATOM   7775  C  CA    . GLY G 2 105 ? 35.542  103.092 101.439 1.00 20.11 ? 294  GLY C CA    1 
ATOM   7776  C  C     . GLY G 2 105 ? 36.200  104.428 101.704 1.00 20.05 ? 294  GLY C C     1 
ATOM   7777  O  O     . GLY G 2 105 ? 37.373  104.585 101.392 1.00 19.02 ? 294  GLY C O     1 
ATOM   7778  N  N     . LYS G 2 106 ? 35.475  105.383 102.276 1.00 19.72 ? 295  LYS C N     1 
ATOM   7779  C  CA    . LYS G 2 106 ? 36.060  106.688 102.555 1.00 20.32 ? 295  LYS C CA    1 
ATOM   7780  C  C     . LYS G 2 106 ? 37.133  106.604 103.639 1.00 20.29 ? 295  LYS C C     1 
ATOM   7781  O  O     . LYS G 2 106 ? 38.105  107.346 103.598 1.00 20.77 ? 295  LYS C O     1 
ATOM   7782  C  CB    . LYS G 2 106 ? 34.961  107.696 102.947 1.00 21.29 ? 295  LYS C CB    1 
ATOM   7783  C  CG    . LYS G 2 106 ? 34.055  108.119 101.763 1.00 21.33 ? 295  LYS C CG    1 
ATOM   7784  C  CD    . LYS G 2 106 ? 32.973  109.125 102.184 1.00 23.22 ? 295  LYS C CD    1 
ATOM   7785  C  CE    . LYS G 2 106 ? 31.945  108.491 103.138 1.00 24.02 ? 295  LYS C CE    1 
ATOM   7786  N  NZ    . LYS G 2 106 ? 30.947  107.644 102.439 1.00 21.84 ? 295  LYS C NZ    1 
ATOM   7787  N  N     . THR G 2 107 ? 36.976  105.697 104.600 1.00 20.49 ? 296  THR C N     1 
ATOM   7788  C  CA    . THR G 2 107 ? 37.966  105.584 105.667 1.00 21.56 ? 296  THR C CA    1 
ATOM   7789  C  C     . THR G 2 107 ? 39.374  105.294 105.135 1.00 22.42 ? 296  THR C C     1 
ATOM   7790  O  O     . THR G 2 107 ? 40.316  105.996 105.480 1.00 24.20 ? 296  THR C O     1 
ATOM   7791  C  CB    . THR G 2 107 ? 37.607  104.477 106.677 1.00 21.23 ? 296  THR C CB    1 
ATOM   7792  O  OG1   . THR G 2 107 ? 36.260  104.650 107.133 1.00 23.85 ? 296  THR C OG1   1 
ATOM   7793  C  CG2   . THR G 2 107 ? 38.520  104.545 107.869 1.00 19.92 ? 296  THR C CG2   1 
ATOM   7794  N  N     . ALA G 2 108 ? 39.518  104.268 104.299 1.00 21.79 ? 297  ALA C N     1 
ATOM   7795  C  CA    . ALA G 2 108 ? 40.830  103.917 103.750 1.00 21.53 ? 297  ALA C CA    1 
ATOM   7796  C  C     . ALA G 2 108 ? 41.262  104.973 102.759 1.00 20.80 ? 297  ALA C C     1 
ATOM   7797  O  O     . ALA G 2 108 ? 42.450  105.186 102.546 1.00 19.99 ? 297  ALA C O     1 
ATOM   7798  C  CB    . ALA G 2 108 ? 40.782  102.550 103.075 1.00 19.50 ? 297  ALA C CB    1 
ATOM   7799  N  N     . ALA G 2 109 ? 40.291  105.638 102.152 1.00 20.45 ? 298  ALA C N     1 
ATOM   7800  C  CA    . ALA G 2 109 ? 40.616  106.689 101.210 1.00 21.03 ? 298  ALA C CA    1 
ATOM   7801  C  C     . ALA G 2 109 ? 41.522  107.715 101.897 1.00 22.10 ? 298  ALA C C     1 
ATOM   7802  O  O     . ALA G 2 109 ? 42.353  108.341 101.231 1.00 23.64 ? 298  ALA C O     1 
ATOM   7803  C  CB    . ALA G 2 109 ? 39.350  107.349 100.690 1.00 19.76 ? 298  ALA C CB    1 
ATOM   7804  N  N     . PHE G 2 110 ? 41.382  107.920 103.213 1.00 22.24 ? 299  PHE C N     1 
ATOM   7805  C  CA    . PHE G 2 110 ? 42.288  108.874 103.855 1.00 22.36 ? 299  PHE C CA    1 
ATOM   7806  C  C     . PHE G 2 110 ? 43.371  108.220 104.733 1.00 23.02 ? 299  PHE C C     1 
ATOM   7807  O  O     . PHE G 2 110 ? 44.481  108.746 104.856 1.00 23.38 ? 299  PHE C O     1 
ATOM   7808  C  CB    . PHE G 2 110 ? 41.516  109.973 104.634 1.00 22.30 ? 299  PHE C CB    1 
ATOM   7809  C  CG    . PHE G 2 110 ? 40.715  109.483 105.827 1.00 21.15 ? 299  PHE C CG    1 
ATOM   7810  C  CD1   . PHE G 2 110 ? 41.343  109.131 107.014 1.00 20.68 ? 299  PHE C CD1   1 
ATOM   7811  C  CD2   . PHE G 2 110 ? 39.320  109.420 105.763 1.00 21.25 ? 299  PHE C CD2   1 
ATOM   7812  C  CE1   . PHE G 2 110 ? 40.598  108.722 108.131 1.00 22.09 ? 299  PHE C CE1   1 
ATOM   7813  C  CE2   . PHE G 2 110 ? 38.559  109.011 106.867 1.00 22.04 ? 299  PHE C CE2   1 
ATOM   7814  C  CZ    . PHE G 2 110 ? 39.201  108.660 108.059 1.00 22.16 ? 299  PHE C CZ    1 
ATOM   7815  N  N     . LEU G 2 111 ? 43.081  107.061 105.313 1.00 22.76 ? 300  LEU C N     1 
ATOM   7816  C  CA    . LEU G 2 111 ? 44.085  106.403 106.151 1.00 22.23 ? 300  LEU C CA    1 
ATOM   7817  C  C     . LEU G 2 111 ? 45.311  105.893 105.397 1.00 21.86 ? 300  LEU C C     1 
ATOM   7818  O  O     . LEU G 2 111 ? 46.432  106.058 105.861 1.00 22.78 ? 300  LEU C O     1 
ATOM   7819  C  CB    . LEU G 2 111 ? 43.469  105.250 106.931 1.00 19.64 ? 300  LEU C CB    1 
ATOM   7820  C  CG    . LEU G 2 111 ? 42.575  105.601 108.117 1.00 20.86 ? 300  LEU C CG    1 
ATOM   7821  C  CD1   . LEU G 2 111 ? 42.128  104.297 108.781 1.00 18.16 ? 300  LEU C CD1   1 
ATOM   7822  C  CD2   . LEU G 2 111 ? 43.311  106.511 109.104 1.00 20.32 ? 300  LEU C CD2   1 
ATOM   7823  N  N     . LEU G 2 112 ? 45.109  105.278 104.237 1.00 23.40 ? 301  LEU C N     1 
ATOM   7824  C  CA    . LEU G 2 112 ? 46.233  104.737 103.461 1.00 22.64 ? 301  LEU C CA    1 
ATOM   7825  C  C     . LEU G 2 112 ? 47.218  105.819 103.026 1.00 22.65 ? 301  LEU C C     1 
ATOM   7826  O  O     . LEU G 2 112 ? 48.407  105.739 103.323 1.00 23.51 ? 301  LEU C O     1 
ATOM   7827  C  CB    . LEU G 2 112 ? 45.728  103.970 102.232 1.00 20.75 ? 301  LEU C CB    1 
ATOM   7828  C  CG    . LEU G 2 112 ? 44.745  102.827 102.501 1.00 20.13 ? 301  LEU C CG    1 
ATOM   7829  C  CD1   . LEU G 2 112 ? 44.404  102.086 101.196 1.00 19.30 ? 301  LEU C CD1   1 
ATOM   7830  C  CD2   . LEU G 2 112 ? 45.348  101.884 103.508 1.00 19.57 ? 301  LEU C CD2   1 
ATOM   7831  N  N     . PRO G 2 113 ? 46.740  106.852 102.317 1.00 22.42 ? 302  PRO C N     1 
ATOM   7832  C  CA    . PRO G 2 113 ? 47.735  107.854 101.931 1.00 23.02 ? 302  PRO C CA    1 
ATOM   7833  C  C     . PRO G 2 113 ? 48.436  108.524 103.111 1.00 23.13 ? 302  PRO C C     1 
ATOM   7834  O  O     . PRO G 2 113 ? 49.624  108.844 103.038 1.00 23.59 ? 302  PRO C O     1 
ATOM   7835  C  CB    . PRO G 2 113 ? 46.931  108.844 101.070 1.00 22.49 ? 302  PRO C CB    1 
ATOM   7836  C  CG    . PRO G 2 113 ? 45.505  108.657 101.555 1.00 23.01 ? 302  PRO C CG    1 
ATOM   7837  C  CD    . PRO G 2 113 ? 45.407  107.173 101.774 1.00 20.98 ? 302  PRO C CD    1 
ATOM   7838  N  N     . ILE G 2 114 ? 47.714  108.722 104.205 1.00 24.05 ? 303  ILE C N     1 
ATOM   7839  C  CA    . ILE G 2 114 ? 48.299  109.376 105.359 1.00 24.39 ? 303  ILE C CA    1 
ATOM   7840  C  C     . ILE G 2 114 ? 49.294  108.508 106.100 1.00 25.57 ? 303  ILE C C     1 
ATOM   7841  O  O     . ILE G 2 114 ? 50.412  108.932 106.349 1.00 26.33 ? 303  ILE C O     1 
ATOM   7842  C  CB    . ILE G 2 114 ? 47.222  109.846 106.333 1.00 23.80 ? 303  ILE C CB    1 
ATOM   7843  C  CG1   . ILE G 2 114 ? 46.386  110.951 105.672 1.00 22.80 ? 303  ILE C CG1   1 
ATOM   7844  C  CG2   . ILE G 2 114 ? 47.868  110.305 107.641 1.00 21.94 ? 303  ILE C CG2   1 
ATOM   7845  C  CD1   . ILE G 2 114 ? 45.181  111.367 106.486 1.00 20.40 ? 303  ILE C CD1   1 
ATOM   7846  N  N     . LEU G 2 115 ? 48.904  107.295 106.462 1.00 26.96 ? 304  LEU C N     1 
ATOM   7847  C  CA    . LEU G 2 115 ? 49.835  106.441 107.177 1.00 28.21 ? 304  LEU C CA    1 
ATOM   7848  C  C     . LEU G 2 115 ? 51.076  106.250 106.310 1.00 28.90 ? 304  LEU C C     1 
ATOM   7849  O  O     . LEU G 2 115 ? 52.197  106.176 106.818 1.00 28.48 ? 304  LEU C O     1 
ATOM   7850  C  CB    . LEU G 2 115 ? 49.181  105.096 107.502 1.00 29.12 ? 304  LEU C CB    1 
ATOM   7851  C  CG    . LEU G 2 115 ? 47.988  105.171 108.465 1.00 31.17 ? 304  LEU C CG    1 
ATOM   7852  C  CD1   . LEU G 2 115 ? 47.331  103.800 108.569 1.00 31.55 ? 304  LEU C CD1   1 
ATOM   7853  C  CD2   . LEU G 2 115 ? 48.440  105.661 109.847 1.00 29.51 ? 304  LEU C CD2   1 
ATOM   7854  N  N     . SER G 2 116 ? 50.878  106.202 104.994 1.00 29.73 ? 305  SER C N     1 
ATOM   7855  C  CA    . SER G 2 116 ? 51.996  106.026 104.068 1.00 30.34 ? 305  SER C CA    1 
ATOM   7856  C  C     . SER G 2 116 ? 52.957  107.233 104.108 1.00 30.73 ? 305  SER C C     1 
ATOM   7857  O  O     . SER G 2 116 ? 54.172  107.067 104.217 1.00 31.01 ? 305  SER C O     1 
ATOM   7858  C  CB    . SER G 2 116 ? 51.459  105.800 102.652 1.00 30.82 ? 305  SER C CB    1 
ATOM   7859  O  OG    . SER G 2 116 ? 52.510  105.602 101.728 1.00 31.16 ? 305  SER C OG    1 
ATOM   7860  N  N     . LYS G 2 117 ? 52.415  108.441 104.027 1.00 30.53 ? 306  LYS C N     1 
ATOM   7861  C  CA    . LYS G 2 117 ? 53.229  109.655 104.077 1.00 31.48 ? 306  LYS C CA    1 
ATOM   7862  C  C     . LYS G 2 117 ? 54.072  109.729 105.349 1.00 32.05 ? 306  LYS C C     1 
ATOM   7863  O  O     . LYS G 2 117 ? 55.193  110.217 105.321 1.00 31.29 ? 306  LYS C O     1 
ATOM   7864  C  CB    . LYS G 2 117 ? 52.338  110.887 104.049 1.00 32.83 ? 306  LYS C CB    1 
ATOM   7865  C  CG    . LYS G 2 117 ? 52.512  111.769 102.861 1.00 36.15 ? 306  LYS C CG    1 
ATOM   7866  C  CD    . LYS G 2 117 ? 53.875  112.385 102.793 1.00 36.83 ? 306  LYS C CD    1 
ATOM   7867  C  CE    . LYS G 2 117 ? 54.021  113.044 101.437 1.00 38.79 ? 306  LYS C CE    1 
ATOM   7868  N  NZ    . LYS G 2 117 ? 53.615  112.077 100.364 1.00 37.63 ? 306  LYS C NZ    1 
ATOM   7869  N  N     . LEU G 2 118 ? 53.505  109.283 106.468 1.00 32.43 ? 307  LEU C N     1 
ATOM   7870  C  CA    . LEU G 2 118 ? 54.202  109.310 107.746 1.00 33.37 ? 307  LEU C CA    1 
ATOM   7871  C  C     . LEU G 2 118 ? 55.434  108.427 107.707 1.00 34.61 ? 307  LEU C C     1 
ATOM   7872  O  O     . LEU G 2 118 ? 56.450  108.747 108.315 1.00 36.22 ? 307  LEU C O     1 
ATOM   7873  C  CB    . LEU G 2 118 ? 53.282  108.839 108.878 1.00 31.37 ? 307  LEU C CB    1 
ATOM   7874  C  CG    . LEU G 2 118 ? 52.059  109.704 109.174 1.00 30.50 ? 307  LEU C CG    1 
ATOM   7875  C  CD1   . LEU G 2 118 ? 51.400  109.189 110.438 1.00 28.70 ? 307  LEU C CD1   1 
ATOM   7876  C  CD2   . LEU G 2 118 ? 52.484  111.171 109.335 1.00 28.76 ? 307  LEU C CD2   1 
ATOM   7877  N  N     . LEU G 2 119 ? 55.328  107.307 107.004 1.00 35.93 ? 308  LEU C N     1 
ATOM   7878  C  CA    . LEU G 2 119 ? 56.429  106.366 106.869 1.00 36.88 ? 308  LEU C CA    1 
ATOM   7879  C  C     . LEU G 2 119 ? 57.448  106.900 105.865 1.00 38.04 ? 308  LEU C C     1 
ATOM   7880  O  O     . LEU G 2 119 ? 58.649  106.820 106.093 1.00 38.60 ? 308  LEU C O     1 
ATOM   7881  C  CB    . LEU G 2 119 ? 55.902  105.013 106.392 1.00 35.68 ? 308  LEU C CB    1 
ATOM   7882  C  CG    . LEU G 2 119 ? 55.607  103.865 107.369 1.00 36.62 ? 308  LEU C CG    1 
ATOM   7883  C  CD1   . LEU G 2 119 ? 55.857  104.272 108.808 1.00 36.36 ? 308  LEU C CD1   1 
ATOM   7884  C  CD2   . LEU G 2 119 ? 54.184  103.403 107.173 1.00 35.41 ? 308  LEU C CD2   1 
ATOM   7885  N  N     . GLU G 2 120 ? 56.954  107.457 104.765 1.00 39.14 ? 309  GLU C N     1 
ATOM   7886  C  CA    . GLU G 2 120 ? 57.804  107.992 103.700 1.00 40.63 ? 309  GLU C CA    1 
ATOM   7887  C  C     . GLU G 2 120 ? 58.557  109.278 104.048 1.00 40.37 ? 309  GLU C C     1 
ATOM   7888  O  O     . GLU G 2 120 ? 59.678  109.491 103.603 1.00 40.42 ? 309  GLU C O     1 
ATOM   7889  C  CB    . GLU G 2 120 ? 56.961  108.232 102.442 1.00 41.97 ? 309  GLU C CB    1 
ATOM   7890  C  CG    . GLU G 2 120 ? 57.686  109.023 101.365 1.00 45.50 ? 309  GLU C CG    1 
ATOM   7891  C  CD    . GLU G 2 120 ? 56.761  109.519 100.266 1.00 48.02 ? 309  GLU C CD    1 
ATOM   7892  O  OE1   . GLU G 2 120 ? 56.305  108.688 99.452  1.00 49.72 ? 309  GLU C OE1   1 
ATOM   7893  O  OE2   . GLU G 2 120 ? 56.486  110.743 100.223 1.00 49.36 ? 309  GLU C OE2   1 
ATOM   7894  N  N     . ASP G 2 121 ? 57.934  110.150 104.819 1.00 40.89 ? 310  ASP C N     1 
ATOM   7895  C  CA    . ASP G 2 121 ? 58.564  111.404 105.207 1.00 41.40 ? 310  ASP C CA    1 
ATOM   7896  C  C     . ASP G 2 121 ? 58.557  111.447 106.734 1.00 41.52 ? 310  ASP C C     1 
ATOM   7897  O  O     . ASP G 2 121 ? 57.902  112.301 107.344 1.00 41.93 ? 310  ASP C O     1 
ATOM   7898  C  CB    . ASP G 2 121 ? 57.767  112.582 104.646 1.00 42.25 ? 310  ASP C CB    1 
ATOM   7899  C  CG    . ASP G 2 121 ? 58.508  113.897 104.775 1.00 43.93 ? 310  ASP C CG    1 
ATOM   7900  O  OD1   . ASP G 2 121 ? 57.846  114.958 104.748 1.00 44.22 ? 310  ASP C OD1   1 
ATOM   7901  O  OD2   . ASP G 2 121 ? 59.757  113.863 104.901 1.00 45.52 ? 310  ASP C OD2   1 
ATOM   7902  N  N     . PRO G 2 122 ? 59.293  110.522 107.371 1.00 41.48 ? 311  PRO C N     1 
ATOM   7903  C  CA    . PRO G 2 122 ? 59.377  110.424 108.830 1.00 41.28 ? 311  PRO C CA    1 
ATOM   7904  C  C     . PRO G 2 122 ? 59.842  111.668 109.554 1.00 41.10 ? 311  PRO C C     1 
ATOM   7905  O  O     . PRO G 2 122 ? 60.653  112.438 109.047 1.00 41.15 ? 311  PRO C O     1 
ATOM   7906  C  CB    . PRO G 2 122 ? 60.351  109.266 109.059 1.00 41.87 ? 311  PRO C CB    1 
ATOM   7907  C  CG    . PRO G 2 122 ? 60.271  108.469 107.791 1.00 42.56 ? 311  PRO C CG    1 
ATOM   7908  C  CD    . PRO G 2 122 ? 60.185  109.538 106.733 1.00 41.69 ? 311  PRO C CD    1 
ATOM   7909  N  N     . HIS G 2 123 ? 59.295  111.850 110.748 1.00 40.87 ? 312  HIS C N     1 
ATOM   7910  C  CA    . HIS G 2 123 ? 59.655  112.941 111.627 1.00 41.16 ? 312  HIS C CA    1 
ATOM   7911  C  C     . HIS G 2 123 ? 59.522  112.378 113.021 1.00 40.53 ? 312  HIS C C     1 
ATOM   7912  O  O     . HIS G 2 123 ? 58.679  111.520 113.278 1.00 39.34 ? 312  HIS C O     1 
ATOM   7913  C  CB    . HIS G 2 123 ? 58.737  114.142 111.458 1.00 43.24 ? 312  HIS C CB    1 
ATOM   7914  C  CG    . HIS G 2 123 ? 58.901  114.834 110.148 1.00 45.60 ? 312  HIS C CG    1 
ATOM   7915  N  ND1   . HIS G 2 123 ? 57.994  114.703 109.118 1.00 46.96 ? 312  HIS C ND1   1 
ATOM   7916  C  CD2   . HIS G 2 123 ? 59.895  115.624 109.678 1.00 46.54 ? 312  HIS C CD2   1 
ATOM   7917  C  CE1   . HIS G 2 123 ? 58.423  115.382 108.069 1.00 47.40 ? 312  HIS C CE1   1 
ATOM   7918  N  NE2   . HIS G 2 123 ? 59.575  115.949 108.382 1.00 47.45 ? 312  HIS C NE2   1 
ATOM   7919  N  N     . GLU G 2 124 ? 60.372  112.859 113.914 1.00 40.43 ? 313  GLU C N     1 
ATOM   7920  C  CA    . GLU G 2 124 ? 60.385  112.398 115.290 1.00 40.31 ? 313  GLU C CA    1 
ATOM   7921  C  C     . GLU G 2 124 ? 59.226  112.968 116.096 1.00 39.08 ? 313  GLU C C     1 
ATOM   7922  O  O     . GLU G 2 124 ? 58.916  114.159 116.010 1.00 37.55 ? 313  GLU C O     1 
ATOM   7923  C  CB    . GLU G 2 124 ? 61.696  112.815 115.948 1.00 42.86 ? 313  GLU C CB    1 
ATOM   7924  C  CG    . GLU G 2 124 ? 62.318  111.760 116.821 1.00 46.48 ? 313  GLU C CG    1 
ATOM   7925  C  CD    . GLU G 2 124 ? 63.056  110.740 116.006 1.00 48.55 ? 313  GLU C CD    1 
ATOM   7926  O  OE1   . GLU G 2 124 ? 63.892  111.173 115.192 1.00 50.79 ? 313  GLU C OE1   1 
ATOM   7927  O  OE2   . GLU G 2 124 ? 62.811  109.523 116.174 1.00 49.50 ? 313  GLU C OE2   1 
ATOM   7928  N  N     . LEU G 2 125 ? 58.588  112.110 116.882 1.00 38.28 ? 314  LEU C N     1 
ATOM   7929  C  CA    . LEU G 2 125 ? 57.490  112.541 117.732 1.00 38.29 ? 314  LEU C CA    1 
ATOM   7930  C  C     . LEU G 2 125 ? 58.013  113.404 118.869 1.00 37.93 ? 314  LEU C C     1 
ATOM   7931  O  O     . LEU G 2 125 ? 59.150  113.252 119.318 1.00 38.45 ? 314  LEU C O     1 
ATOM   7932  C  CB    . LEU G 2 125 ? 56.782  111.339 118.353 1.00 38.52 ? 314  LEU C CB    1 
ATOM   7933  C  CG    . LEU G 2 125 ? 55.853  110.463 117.518 1.00 39.33 ? 314  LEU C CG    1 
ATOM   7934  C  CD1   . LEU G 2 125 ? 55.420  109.274 118.354 1.00 39.29 ? 314  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU G 2 125 ? 54.635  111.261 117.060 1.00 40.58 ? 314  LEU C CD2   1 
ATOM   7936  N  N     . GLU G 2 126 ? 57.168  114.313 119.326 1.00 38.05 ? 315  GLU C N     1 
ATOM   7937  C  CA    . GLU G 2 126 ? 57.482  115.178 120.454 1.00 37.76 ? 315  GLU C CA    1 
ATOM   7938  C  C     . GLU G 2 126 ? 56.337  114.925 121.433 1.00 36.14 ? 315  GLU C C     1 
ATOM   7939  O  O     . GLU G 2 126 ? 55.226  114.592 121.017 1.00 36.37 ? 315  GLU C O     1 
ATOM   7940  C  CB    . GLU G 2 126 ? 57.499  116.646 120.031 1.00 40.02 ? 315  GLU C CB    1 
ATOM   7941  C  CG    . GLU G 2 126 ? 58.643  117.049 119.111 1.00 43.43 ? 315  GLU C CG    1 
ATOM   7942  C  CD    . GLU G 2 126 ? 60.016  116.986 119.789 1.00 46.80 ? 315  GLU C CD    1 
ATOM   7943  O  OE1   . GLU G 2 126 ? 60.096  117.260 121.018 1.00 47.56 ? 315  GLU C OE1   1 
ATOM   7944  O  OE2   . GLU G 2 126 ? 61.020  116.683 119.088 1.00 46.87 ? 315  GLU C OE2   1 
ATOM   7945  N  N     . LEU G 2 127 ? 56.604  115.053 122.725 1.00 34.70 ? 316  LEU C N     1 
ATOM   7946  C  CA    . LEU G 2 127 ? 55.579  114.829 123.739 1.00 32.43 ? 316  LEU C CA    1 
ATOM   7947  C  C     . LEU G 2 127 ? 54.318  115.638 123.456 1.00 31.97 ? 316  LEU C C     1 
ATOM   7948  O  O     . LEU G 2 127 ? 54.378  116.850 123.250 1.00 31.82 ? 316  LEU C O     1 
ATOM   7949  C  CB    . LEU G 2 127 ? 56.111  115.198 125.134 1.00 32.69 ? 316  LEU C CB    1 
ATOM   7950  C  CG    . LEU G 2 127 ? 55.080  115.278 126.285 1.00 33.26 ? 316  LEU C CG    1 
ATOM   7951  C  CD1   . LEU G 2 127 ? 54.508  113.893 126.588 1.00 31.95 ? 316  LEU C CD1   1 
ATOM   7952  C  CD2   . LEU G 2 127 ? 55.741  115.855 127.525 1.00 32.13 ? 316  LEU C CD2   1 
ATOM   7953  N  N     . GLY G 2 128 ? 53.181  114.949 123.441 1.00 31.38 ? 317  GLY C N     1 
ATOM   7954  C  CA    . GLY G 2 128 ? 51.893  115.590 123.213 1.00 31.13 ? 317  GLY C CA    1 
ATOM   7955  C  C     . GLY G 2 128 ? 51.683  116.315 121.898 1.00 30.69 ? 317  GLY C C     1 
ATOM   7956  O  O     . GLY G 2 128 ? 50.891  117.256 121.826 1.00 31.01 ? 317  GLY C O     1 
ATOM   7957  N  N     . ARG G 2 129 ? 52.367  115.880 120.853 1.00 30.00 ? 318  ARG C N     1 
ATOM   7958  C  CA    . ARG G 2 129 ? 52.236  116.536 119.568 1.00 30.94 ? 318  ARG C CA    1 
ATOM   7959  C  C     . ARG G 2 129 ? 52.015  115.524 118.444 1.00 30.61 ? 318  ARG C C     1 
ATOM   7960  O  O     . ARG G 2 129 ? 52.949  115.070 117.786 1.00 30.88 ? 318  ARG C O     1 
ATOM   7961  C  CB    . ARG G 2 129 ? 53.466  117.421 119.329 1.00 30.92 ? 318  ARG C CB    1 
ATOM   7962  C  CG    . ARG G 2 129 ? 53.402  118.710 120.163 1.00 34.12 ? 318  ARG C CG    1 
ATOM   7963  C  CD    . ARG G 2 129 ? 54.765  119.345 120.489 1.00 34.88 ? 318  ARG C CD    1 
ATOM   7964  N  NE    . ARG G 2 129 ? 55.545  119.679 119.299 1.00 37.79 ? 318  ARG C NE    1 
ATOM   7965  C  CZ    . ARG G 2 129 ? 56.279  120.784 119.176 1.00 38.56 ? 318  ARG C CZ    1 
ATOM   7966  N  NH1   . ARG G 2 129 ? 56.323  121.662 120.179 1.00 37.79 ? 318  ARG C NH1   1 
ATOM   7967  N  NH2   . ARG G 2 129 ? 56.959  121.015 118.052 1.00 37.99 ? 318  ARG C NH2   1 
ATOM   7968  N  N     . PRO G 2 130 ? 50.749  115.154 118.219 1.00 29.84 ? 319  PRO C N     1 
ATOM   7969  C  CA    . PRO G 2 130 ? 50.426  114.189 117.171 1.00 28.99 ? 319  PRO C CA    1 
ATOM   7970  C  C     . PRO G 2 130 ? 50.674  114.788 115.804 1.00 28.06 ? 319  PRO C C     1 
ATOM   7971  O  O     . PRO G 2 130 ? 50.579  116.007 115.613 1.00 28.47 ? 319  PRO C O     1 
ATOM   7972  C  CB    . PRO G 2 130 ? 48.951  113.908 117.415 1.00 28.39 ? 319  PRO C CB    1 
ATOM   7973  C  CG    . PRO G 2 130 ? 48.446  115.246 117.817 1.00 29.61 ? 319  PRO C CG    1 
ATOM   7974  C  CD    . PRO G 2 130 ? 49.519  115.718 118.804 1.00 29.45 ? 319  PRO C CD    1 
ATOM   7975  N  N     . GLN G 2 131 ? 50.989  113.928 114.853 1.00 26.58 ? 320  GLN C N     1 
ATOM   7976  C  CA    . GLN G 2 131 ? 51.243  114.385 113.505 1.00 26.96 ? 320  GLN C CA    1 
ATOM   7977  C  C     . GLN G 2 131 ? 49.948  114.354 112.701 1.00 26.26 ? 320  GLN C C     1 
ATOM   7978  O  O     . GLN G 2 131 ? 49.802  115.085 111.708 1.00 26.72 ? 320  GLN C O     1 
ATOM   7979  C  CB    . GLN G 2 131 ? 52.317  113.500 112.871 1.00 27.51 ? 320  GLN C CB    1 
ATOM   7980  C  CG    . GLN G 2 131 ? 53.636  113.609 113.619 1.00 30.06 ? 320  GLN C CG    1 
ATOM   7981  C  CD    . GLN G 2 131 ? 54.735  112.690 113.104 1.00 31.72 ? 320  GLN C CD    1 
ATOM   7982  O  OE1   . GLN G 2 131 ? 55.902  112.903 113.415 1.00 34.82 ? 320  GLN C OE1   1 
ATOM   7983  N  NE2   . GLN G 2 131 ? 54.372  111.665 112.343 1.00 30.61 ? 320  GLN C NE2   1 
ATOM   7984  N  N     . VAL G 2 132 ? 49.016  113.503 113.134 1.00 23.71 ? 321  VAL C N     1 
ATOM   7985  C  CA    . VAL G 2 132 ? 47.718  113.363 112.481 1.00 23.40 ? 321  VAL C CA    1 
ATOM   7986  C  C     . VAL G 2 132 ? 46.565  113.419 113.492 1.00 22.69 ? 321  VAL C C     1 
ATOM   7987  O  O     . VAL G 2 132 ? 46.569  112.695 114.480 1.00 22.33 ? 321  VAL C O     1 
ATOM   7988  C  CB    . VAL G 2 132 ? 47.606  112.023 111.729 1.00 22.74 ? 321  VAL C CB    1 
ATOM   7989  C  CG1   . VAL G 2 132 ? 46.257  111.925 111.064 1.00 20.74 ? 321  VAL C CG1   1 
ATOM   7990  C  CG2   . VAL G 2 132 ? 48.732  111.892 110.708 1.00 22.00 ? 321  VAL C CG2   1 
ATOM   7991  N  N     . VAL G 2 133 ? 45.586  114.284 113.236 1.00 22.49 ? 322  VAL C N     1 
ATOM   7992  C  CA    . VAL G 2 133 ? 44.427  114.408 114.104 1.00 22.97 ? 322  VAL C CA    1 
ATOM   7993  C  C     . VAL G 2 133 ? 43.181  114.101 113.278 1.00 23.31 ? 322  VAL C C     1 
ATOM   7994  O  O     . VAL G 2 133 ? 42.910  114.783 112.285 1.00 24.12 ? 322  VAL C O     1 
ATOM   7995  C  CB    . VAL G 2 133 ? 44.299  115.823 114.691 1.00 23.58 ? 322  VAL C CB    1 
ATOM   7996  C  CG1   . VAL G 2 133 ? 42.953  115.966 115.440 1.00 23.47 ? 322  VAL C CG1   1 
ATOM   7997  C  CG2   . VAL G 2 133 ? 45.447  116.090 115.646 1.00 23.18 ? 322  VAL C CG2   1 
ATOM   7998  N  N     . ILE G 2 134 ? 42.448  113.059 113.676 1.00 22.58 ? 323  ILE C N     1 
ATOM   7999  C  CA    . ILE G 2 134 ? 41.223  112.647 112.984 1.00 20.81 ? 323  ILE C CA    1 
ATOM   8000  C  C     . ILE G 2 134 ? 40.071  112.797 113.955 1.00 20.78 ? 323  ILE C C     1 
ATOM   8001  O  O     . ILE G 2 134 ? 40.061  112.178 115.012 1.00 21.39 ? 323  ILE C O     1 
ATOM   8002  C  CB    . ILE G 2 134 ? 41.304  111.182 112.512 1.00 20.90 ? 323  ILE C CB    1 
ATOM   8003  C  CG1   . ILE G 2 134 ? 42.495  111.017 111.564 1.00 19.08 ? 323  ILE C CG1   1 
ATOM   8004  C  CG2   . ILE G 2 134 ? 39.997  110.777 111.795 1.00 18.88 ? 323  ILE C CG2   1 
ATOM   8005  C  CD1   . ILE G 2 134 ? 42.798  109.555 111.204 1.00 19.38 ? 323  ILE C CD1   1 
ATOM   8006  N  N     . VAL G 2 135 ? 39.105  113.628 113.586 1.00 21.72 ? 324  VAL C N     1 
ATOM   8007  C  CA    . VAL G 2 135 ? 37.956  113.927 114.426 1.00 22.34 ? 324  VAL C CA    1 
ATOM   8008  C  C     . VAL G 2 135 ? 36.656  113.260 113.973 1.00 23.14 ? 324  VAL C C     1 
ATOM   8009  O  O     . VAL G 2 135 ? 36.340  113.228 112.788 1.00 23.42 ? 324  VAL C O     1 
ATOM   8010  C  CB    . VAL G 2 135 ? 37.742  115.460 114.498 1.00 22.62 ? 324  VAL C CB    1 
ATOM   8011  C  CG1   . VAL G 2 135 ? 36.504  115.774 115.290 1.00 22.29 ? 324  VAL C CG1   1 
ATOM   8012  C  CG2   . VAL G 2 135 ? 38.956  116.123 115.159 1.00 22.57 ? 324  VAL C CG2   1 
ATOM   8013  N  N     . SER G 2 136 ? 35.905  112.742 114.941 1.00 23.38 ? 325  SER C N     1 
ATOM   8014  C  CA    . SER G 2 136 ? 34.640  112.063 114.684 1.00 22.86 ? 325  SER C CA    1 
ATOM   8015  C  C     . SER G 2 136 ? 33.536  112.647 115.551 1.00 21.33 ? 325  SER C C     1 
ATOM   8016  O  O     . SER G 2 136 ? 33.790  113.099 116.659 1.00 21.32 ? 325  SER C O     1 
ATOM   8017  C  CB    . SER G 2 136 ? 34.782  110.580 115.010 1.00 23.58 ? 325  SER C CB    1 
ATOM   8018  O  OG    . SER G 2 136 ? 33.501  109.968 115.107 1.00 27.81 ? 325  SER C OG    1 
ATOM   8019  N  N     . PRO G 2 137 ? 32.291  112.625 115.069 1.00 19.90 ? 326  PRO C N     1 
ATOM   8020  C  CA    . PRO G 2 137 ? 31.196  113.175 115.877 1.00 20.11 ? 326  PRO C CA    1 
ATOM   8021  C  C     . PRO G 2 137 ? 30.700  112.192 116.932 1.00 20.07 ? 326  PRO C C     1 
ATOM   8022  O  O     . PRO G 2 137 ? 29.916  112.548 117.818 1.00 21.34 ? 326  PRO C O     1 
ATOM   8023  C  CB    . PRO G 2 137 ? 30.115  113.471 114.836 1.00 18.87 ? 326  PRO C CB    1 
ATOM   8024  C  CG    . PRO G 2 137 ? 30.296  112.331 113.858 1.00 19.47 ? 326  PRO C CG    1 
ATOM   8025  C  CD    . PRO G 2 137 ? 31.822  112.245 113.722 1.00 20.75 ? 326  PRO C CD    1 
ATOM   8026  N  N     . THR G 2 138 ? 31.200  110.973 116.883 1.00 18.98 ? 327  THR C N     1 
ATOM   8027  C  CA    . THR G 2 138 ? 30.707  109.944 117.794 1.00 20.95 ? 327  THR C CA    1 
ATOM   8028  C  C     . THR G 2 138 ? 31.819  109.090 118.421 1.00 20.52 ? 327  THR C C     1 
ATOM   8029  O  O     . THR G 2 138 ? 32.839  108.863 117.804 1.00 20.55 ? 327  THR C O     1 
ATOM   8030  C  CB    . THR G 2 138 ? 29.678  109.095 116.976 1.00 21.57 ? 327  THR C CB    1 
ATOM   8031  O  OG1   . THR G 2 138 ? 28.347  109.556 117.262 1.00 25.09 ? 327  THR C OG1   1 
ATOM   8032  C  CG2   . THR G 2 138 ? 29.838  107.647 117.183 1.00 19.55 ? 327  THR C CG2   1 
ATOM   8033  N  N     . ARG G 2 139 ? 31.621  108.632 119.652 1.00 20.78 ? 328  ARG C N     1 
ATOM   8034  C  CA    . ARG G 2 139 ? 32.637  107.824 120.323 1.00 21.71 ? 328  ARG C CA    1 
ATOM   8035  C  C     . ARG G 2 139 ? 32.920  106.494 119.626 1.00 22.68 ? 328  ARG C C     1 
ATOM   8036  O  O     . ARG G 2 139 ? 34.062  106.189 119.285 1.00 24.41 ? 328  ARG C O     1 
ATOM   8037  C  CB    . ARG G 2 139 ? 32.223  107.561 121.764 1.00 20.34 ? 328  ARG C CB    1 
ATOM   8038  C  CG    . ARG G 2 139 ? 32.152  108.821 122.585 1.00 21.58 ? 328  ARG C CG    1 
ATOM   8039  C  CD    . ARG G 2 139 ? 31.594  108.564 123.958 1.00 19.84 ? 328  ARG C CD    1 
ATOM   8040  N  NE    . ARG G 2 139 ? 31.464  109.816 124.695 1.00 20.17 ? 328  ARG C NE    1 
ATOM   8041  C  CZ    . ARG G 2 139 ? 30.867  109.913 125.876 1.00 20.42 ? 328  ARG C CZ    1 
ATOM   8042  N  NH1   . ARG G 2 139 ? 30.349  108.830 126.441 1.00 21.49 ? 328  ARG C NH1   1 
ATOM   8043  N  NH2   . ARG G 2 139 ? 30.798  111.084 126.496 1.00 22.42 ? 328  ARG C NH2   1 
ATOM   8044  N  N     . GLU G 2 140 ? 31.881  105.710 119.395 1.00 22.45 ? 329  GLU C N     1 
ATOM   8045  C  CA    . GLU G 2 140 ? 32.070  104.430 118.750 1.00 22.63 ? 329  GLU C CA    1 
ATOM   8046  C  C     . GLU G 2 140 ? 32.642  104.573 117.357 1.00 21.82 ? 329  GLU C C     1 
ATOM   8047  O  O     . GLU G 2 140 ? 33.349  103.682 116.908 1.00 22.23 ? 329  GLU C O     1 
ATOM   8048  C  CB    . GLU G 2 140 ? 30.762  103.650 118.710 1.00 23.93 ? 329  GLU C CB    1 
ATOM   8049  C  CG    . GLU G 2 140 ? 30.213  103.364 120.093 1.00 25.74 ? 329  GLU C CG    1 
ATOM   8050  C  CD    . GLU G 2 140 ? 29.684  104.606 120.777 1.00 27.14 ? 329  GLU C CD    1 
ATOM   8051  O  OE1   . GLU G 2 140 ? 29.263  105.561 120.058 1.00 28.46 ? 329  GLU C OE1   1 
ATOM   8052  O  OE2   . GLU G 2 140 ? 29.667  104.619 122.027 1.00 27.17 ? 329  GLU C OE2   1 
ATOM   8053  N  N     . LEU G 2 141 ? 32.371  105.679 116.664 1.00 20.58 ? 330  LEU C N     1 
ATOM   8054  C  CA    . LEU G 2 141 ? 32.957  105.814 115.330 1.00 20.37 ? 330  LEU C CA    1 
ATOM   8055  C  C     . LEU G 2 141 ? 34.452  106.105 115.507 1.00 20.49 ? 330  LEU C C     1 
ATOM   8056  O  O     . LEU G 2 141 ? 35.277  105.693 114.699 1.00 20.43 ? 330  LEU C O     1 
ATOM   8057  C  CB    . LEU G 2 141 ? 32.277  106.927 114.489 1.00 19.19 ? 330  LEU C CB    1 
ATOM   8058  C  CG    . LEU G 2 141 ? 32.928  107.230 113.118 1.00 18.60 ? 330  LEU C CG    1 
ATOM   8059  C  CD1   . LEU G 2 141 ? 33.020  105.962 112.229 1.00 17.36 ? 330  LEU C CD1   1 
ATOM   8060  C  CD2   . LEU G 2 141 ? 32.127  108.291 112.403 1.00 20.27 ? 330  LEU C CD2   1 
ATOM   8061  N  N     . ALA G 2 142 ? 34.798  106.805 116.584 1.00 20.90 ? 331  ALA C N     1 
ATOM   8062  C  CA    . ALA G 2 142 ? 36.198  107.110 116.845 1.00 20.66 ? 331  ALA C CA    1 
ATOM   8063  C  C     . ALA G 2 142 ? 36.909  105.778 117.067 1.00 19.97 ? 331  ALA C C     1 
ATOM   8064  O  O     . ALA G 2 142 ? 37.941  105.505 116.464 1.00 19.34 ? 331  ALA C O     1 
ATOM   8065  C  CB    . ALA G 2 142 ? 36.331  107.999 118.090 1.00 19.80 ? 331  ALA C CB    1 
ATOM   8066  N  N     . ILE G 2 143 ? 36.338  104.942 117.924 1.00 19.88 ? 332  ILE C N     1 
ATOM   8067  C  CA    . ILE G 2 143 ? 36.950  103.653 118.216 1.00 19.93 ? 332  ILE C CA    1 
ATOM   8068  C  C     . ILE G 2 143 ? 37.138  102.849 116.932 1.00 20.36 ? 332  ILE C C     1 
ATOM   8069  O  O     . ILE G 2 143 ? 38.205  102.266 116.690 1.00 18.87 ? 332  ILE C O     1 
ATOM   8070  C  CB    . ILE G 2 143 ? 36.087  102.870 119.206 1.00 20.59 ? 332  ILE C CB    1 
ATOM   8071  C  CG1   . ILE G 2 143 ? 36.081  103.600 120.549 1.00 19.84 ? 332  ILE C CG1   1 
ATOM   8072  C  CG2   . ILE G 2 143 ? 36.603  101.419 119.334 1.00 19.27 ? 332  ILE C CG2   1 
ATOM   8073  C  CD1   . ILE G 2 143 ? 35.068  103.052 121.505 1.00 20.83 ? 332  ILE C CD1   1 
ATOM   8074  N  N     . GLN G 2 144 ? 36.105  102.847 116.095 1.00 20.57 ? 333  GLN C N     1 
ATOM   8075  C  CA    . GLN G 2 144 ? 36.159  102.129 114.834 1.00 21.05 ? 333  GLN C CA    1 
ATOM   8076  C  C     . GLN G 2 144 ? 37.312  102.610 113.933 1.00 21.23 ? 333  GLN C C     1 
ATOM   8077  O  O     . GLN G 2 144 ? 38.080  101.803 113.410 1.00 20.65 ? 333  GLN C O     1 
ATOM   8078  C  CB    . GLN G 2 144 ? 34.811  102.260 114.102 1.00 20.89 ? 333  GLN C CB    1 
ATOM   8079  C  CG    . GLN G 2 144 ? 34.801  101.628 112.707 1.00 19.43 ? 333  GLN C CG    1 
ATOM   8080  C  CD    . GLN G 2 144 ? 33.431  101.705 112.043 1.00 21.02 ? 333  GLN C CD    1 
ATOM   8081  O  OE1   . GLN G 2 144 ? 32.475  101.073 112.492 1.00 20.03 ? 333  GLN C OE1   1 
ATOM   8082  N  NE2   . GLN G 2 144 ? 33.332  102.491 110.976 1.00 19.42 ? 333  GLN C NE2   1 
ATOM   8083  N  N     . ILE G 2 145 ? 37.431  103.922 113.746 1.00 21.21 ? 334  ILE C N     1 
ATOM   8084  C  CA    . ILE G 2 145 ? 38.499  104.475 112.911 1.00 20.94 ? 334  ILE C CA    1 
ATOM   8085  C  C     . ILE G 2 145 ? 39.856  104.088 113.513 1.00 20.71 ? 334  ILE C C     1 
ATOM   8086  O  O     . ILE G 2 145 ? 40.795  103.687 112.801 1.00 20.49 ? 334  ILE C O     1 
ATOM   8087  C  CB    . ILE G 2 145 ? 38.373  106.032 112.812 1.00 20.89 ? 334  ILE C CB    1 
ATOM   8088  C  CG1   . ILE G 2 145 ? 37.118  106.396 112.017 1.00 21.71 ? 334  ILE C CG1   1 
ATOM   8089  C  CG2   . ILE G 2 145 ? 39.616  106.627 112.150 1.00 21.86 ? 334  ILE C CG2   1 
ATOM   8090  C  CD1   . ILE G 2 145 ? 36.738  107.869 112.085 1.00 23.95 ? 334  ILE C CD1   1 
ATOM   8091  N  N     . PHE G 2 146 ? 39.942  104.219 114.830 1.00 19.47 ? 335  PHE C N     1 
ATOM   8092  C  CA    . PHE G 2 146 ? 41.135  103.863 115.580 1.00 20.52 ? 335  PHE C CA    1 
ATOM   8093  C  C     . PHE G 2 146 ? 41.573  102.443 115.185 1.00 21.12 ? 335  PHE C C     1 
ATOM   8094  O  O     . PHE G 2 146 ? 42.718  102.218 114.797 1.00 20.17 ? 335  PHE C O     1 
ATOM   8095  C  CB    . PHE G 2 146 ? 40.798  103.936 117.072 1.00 20.77 ? 335  PHE C CB    1 
ATOM   8096  C  CG    . PHE G 2 146 ? 41.831  103.341 117.974 1.00 21.22 ? 335  PHE C CG    1 
ATOM   8097  C  CD1   . PHE G 2 146 ? 43.073  103.953 118.142 1.00 21.79 ? 335  PHE C CD1   1 
ATOM   8098  C  CD2   . PHE G 2 146 ? 41.553  102.173 118.687 1.00 22.12 ? 335  PHE C CD2   1 
ATOM   8099  C  CE1   . PHE G 2 146 ? 44.029  103.412 119.011 1.00 20.56 ? 335  PHE C CE1   1 
ATOM   8100  C  CE2   . PHE G 2 146 ? 42.503  101.622 119.559 1.00 22.64 ? 335  PHE C CE2   1 
ATOM   8101  C  CZ    . PHE G 2 146 ? 43.746  102.249 119.718 1.00 21.43 ? 335  PHE C CZ    1 
ATOM   8102  N  N     . ASN G 2 147 ? 40.653  101.487 115.274 1.00 22.73 ? 336  ASN C N     1 
ATOM   8103  C  CA    . ASN G 2 147 ? 40.978  100.109 114.924 1.00 24.42 ? 336  ASN C CA    1 
ATOM   8104  C  C     . ASN G 2 147 ? 41.353  99.922  113.458 1.00 24.63 ? 336  ASN C C     1 
ATOM   8105  O  O     . ASN G 2 147 ? 42.202  99.085  113.153 1.00 25.35 ? 336  ASN C O     1 
ATOM   8106  C  CB    . ASN G 2 147 ? 39.834  99.172  115.323 1.00 24.38 ? 336  ASN C CB    1 
ATOM   8107  C  CG    . ASN G 2 147 ? 39.765  98.954  116.832 1.00 25.59 ? 336  ASN C CG    1 
ATOM   8108  O  OD1   . ASN G 2 147 ? 38.691  98.995  117.423 1.00 26.40 ? 336  ASN C OD1   1 
ATOM   8109  N  ND2   . ASN G 2 147 ? 40.922  98.720  117.457 1.00 24.54 ? 336  ASN C ND2   1 
ATOM   8110  N  N     . GLU G 2 148 ? 40.746  100.694 112.552 1.00 25.41 ? 337  GLU C N     1 
ATOM   8111  C  CA    . GLU G 2 148 ? 41.097  100.588 111.132 1.00 25.99 ? 337  GLU C CA    1 
ATOM   8112  C  C     . GLU G 2 148 ? 42.530  101.085 110.932 1.00 25.23 ? 337  GLU C C     1 
ATOM   8113  O  O     . GLU G 2 148 ? 43.277  100.540 110.127 1.00 24.38 ? 337  GLU C O     1 
ATOM   8114  C  CB    . GLU G 2 148 ? 40.154  101.420 110.236 1.00 27.94 ? 337  GLU C CB    1 
ATOM   8115  C  CG    . GLU G 2 148 ? 38.785  100.810 110.016 1.00 30.50 ? 337  GLU C CG    1 
ATOM   8116  C  CD    . GLU G 2 148 ? 38.869  99.392  109.469 1.00 32.75 ? 337  GLU C CD    1 
ATOM   8117  O  OE1   . GLU G 2 148 ? 39.221  99.227  108.281 1.00 32.44 ? 337  GLU C OE1   1 
ATOM   8118  O  OE2   . GLU G 2 148 ? 38.594  98.439  110.236 1.00 34.16 ? 337  GLU C OE2   1 
ATOM   8119  N  N     . ALA G 2 149 ? 42.909  102.133 111.653 1.00 24.30 ? 338  ALA C N     1 
ATOM   8120  C  CA    . ALA G 2 149 ? 44.257  102.647 111.519 1.00 24.64 ? 338  ALA C CA    1 
ATOM   8121  C  C     . ALA G 2 149 ? 45.247  101.590 112.005 1.00 24.43 ? 338  ALA C C     1 
ATOM   8122  O  O     . ALA G 2 149 ? 46.236  101.322 111.343 1.00 24.05 ? 338  ALA C O     1 
ATOM   8123  C  CB    . ALA G 2 149 ? 44.414  103.936 112.300 1.00 22.62 ? 338  ALA C CB    1 
ATOM   8124  N  N     . ARG G 2 150 ? 44.982  101.001 113.166 1.00 25.59 ? 339  ARG C N     1 
ATOM   8125  C  CA    . ARG G 2 150 ? 45.858  99.950  113.691 1.00 26.57 ? 339  ARG C CA    1 
ATOM   8126  C  C     . ARG G 2 150 ? 45.964  98.805  112.682 1.00 26.21 ? 339  ARG C C     1 
ATOM   8127  O  O     . ARG G 2 150 ? 46.990  98.144  112.586 1.00 26.38 ? 339  ARG C O     1 
ATOM   8128  C  CB    . ARG G 2 150 ? 45.332  99.399  115.023 1.00 26.37 ? 339  ARG C CB    1 
ATOM   8129  C  CG    . ARG G 2 150 ? 45.492  100.341 116.179 1.00 27.13 ? 339  ARG C CG    1 
ATOM   8130  C  CD    . ARG G 2 150 ? 44.989  99.727  117.470 1.00 31.78 ? 339  ARG C CD    1 
ATOM   8131  N  NE    . ARG G 2 150 ? 45.956  98.787  118.033 1.00 37.15 ? 339  ARG C NE    1 
ATOM   8132  C  CZ    . ARG G 2 150 ? 45.848  97.468  117.951 1.00 39.25 ? 339  ARG C CZ    1 
ATOM   8133  N  NH1   . ARG G 2 150 ? 44.807  96.930  117.334 1.00 40.19 ? 339  ARG C NH1   1 
ATOM   8134  N  NH2   . ARG G 2 150 ? 46.791  96.686  118.471 1.00 41.22 ? 339  ARG C NH2   1 
ATOM   8135  N  N     . LYS G 2 151 ? 44.907  98.590  111.916 1.00 26.65 ? 340  LYS C N     1 
ATOM   8136  C  CA    . LYS G 2 151 ? 44.920  97.526  110.931 1.00 28.22 ? 340  LYS C CA    1 
ATOM   8137  C  C     . LYS G 2 151 ? 45.841  97.826  109.757 1.00 29.04 ? 340  LYS C C     1 
ATOM   8138  O  O     . LYS G 2 151 ? 46.612  96.965  109.345 1.00 29.24 ? 340  LYS C O     1 
ATOM   8139  C  CB    . LYS G 2 151 ? 43.512  97.253  110.409 1.00 28.41 ? 340  LYS C CB    1 
ATOM   8140  C  CG    . LYS G 2 151 ? 43.476  96.072  109.462 1.00 30.90 ? 340  LYS C CG    1 
ATOM   8141  C  CD    . LYS G 2 151 ? 42.068  95.655  109.113 1.00 31.93 ? 340  LYS C CD    1 
ATOM   8142  C  CE    . LYS G 2 151 ? 41.389  96.671  108.228 1.00 32.47 ? 340  LYS C CE    1 
ATOM   8143  N  NZ    . LYS G 2 151 ? 39.977  96.245  108.026 1.00 35.15 ? 340  LYS C NZ    1 
ATOM   8144  N  N     . PHE G 2 152 ? 45.770  99.037  109.215 1.00 28.97 ? 341  PHE C N     1 
ATOM   8145  C  CA    . PHE G 2 152 ? 46.616  99.370  108.080 1.00 29.84 ? 341  PHE C CA    1 
ATOM   8146  C  C     . PHE G 2 152 ? 48.028  99.702  108.533 1.00 30.37 ? 341  PHE C C     1 
ATOM   8147  O  O     . PHE G 2 152 ? 48.970  99.682  107.741 1.00 30.22 ? 341  PHE C O     1 
ATOM   8148  C  CB    . PHE G 2 152 ? 46.018  100.541 107.285 1.00 30.14 ? 341  PHE C CB    1 
ATOM   8149  C  CG    . PHE G 2 152 ? 44.660  100.241 106.680 1.00 30.64 ? 341  PHE C CG    1 
ATOM   8150  C  CD1   . PHE G 2 152 ? 44.443  99.064  105.964 1.00 31.75 ? 341  PHE C CD1   1 
ATOM   8151  C  CD2   . PHE G 2 152 ? 43.607  101.143 106.815 1.00 30.98 ? 341  PHE C CD2   1 
ATOM   8152  C  CE1   . PHE G 2 152 ? 43.189  98.785  105.388 1.00 31.38 ? 341  PHE C CE1   1 
ATOM   8153  C  CE2   . PHE G 2 152 ? 42.349  100.881 106.244 1.00 30.95 ? 341  PHE C CE2   1 
ATOM   8154  C  CZ    . PHE G 2 152 ? 42.145  99.693  105.528 1.00 31.84 ? 341  PHE C CZ    1 
ATOM   8155  N  N     . ALA G 2 153 ? 48.176  100.010 109.814 1.00 29.95 ? 342  ALA C N     1 
ATOM   8156  C  CA    . ALA G 2 153 ? 49.482  100.343 110.340 1.00 30.19 ? 342  ALA C CA    1 
ATOM   8157  C  C     . ALA G 2 153 ? 50.121  99.099  110.955 1.00 30.84 ? 342  ALA C C     1 
ATOM   8158  O  O     . ALA G 2 153 ? 51.208  99.172  111.511 1.00 30.40 ? 342  ALA C O     1 
ATOM   8159  C  CB    . ALA G 2 153 ? 49.352  101.435 111.386 1.00 29.09 ? 342  ALA C CB    1 
ATOM   8160  N  N     . PHE G 2 154 ? 49.438  97.965  110.845 1.00 31.90 ? 343  PHE C N     1 
ATOM   8161  C  CA    . PHE G 2 154 ? 49.928  96.712  111.402 1.00 34.06 ? 343  PHE C CA    1 
ATOM   8162  C  C     . PHE G 2 154 ? 51.391  96.420  111.098 1.00 35.16 ? 343  PHE C C     1 
ATOM   8163  O  O     . PHE G 2 154 ? 51.812  96.380  109.943 1.00 35.46 ? 343  PHE C O     1 
ATOM   8164  C  CB    . PHE G 2 154 ? 49.068  95.538  110.924 1.00 34.42 ? 343  PHE C CB    1 
ATOM   8165  C  CG    . PHE G 2 154 ? 49.447  94.223  111.542 1.00 34.22 ? 343  PHE C CG    1 
ATOM   8166  C  CD1   . PHE G 2 154 ? 49.371  94.040  112.916 1.00 35.02 ? 343  PHE C CD1   1 
ATOM   8167  C  CD2   . PHE G 2 154 ? 49.893  93.171  110.752 1.00 35.52 ? 343  PHE C CD2   1 
ATOM   8168  C  CE1   . PHE G 2 154 ? 49.735  92.822  113.499 1.00 35.34 ? 343  PHE C CE1   1 
ATOM   8169  C  CE2   . PHE G 2 154 ? 50.261  91.943  111.322 1.00 35.40 ? 343  PHE C CE2   1 
ATOM   8170  C  CZ    . PHE G 2 154 ? 50.180  91.770  112.696 1.00 35.02 ? 343  PHE C CZ    1 
ATOM   8171  N  N     . GLU G 2 155 ? 52.147  96.225  112.171 1.00 37.49 ? 344  GLU C N     1 
ATOM   8172  C  CA    . GLU G 2 155 ? 53.572  95.920  112.138 1.00 39.29 ? 344  GLU C CA    1 
ATOM   8173  C  C     . GLU G 2 155 ? 54.467  96.985  111.546 1.00 38.96 ? 344  GLU C C     1 
ATOM   8174  O  O     . GLU G 2 155 ? 55.520  96.680  111.010 1.00 39.61 ? 344  GLU C O     1 
ATOM   8175  C  CB    . GLU G 2 155 ? 53.820  94.576  111.445 1.00 41.15 ? 344  GLU C CB    1 
ATOM   8176  C  CG    . GLU G 2 155 ? 53.179  93.412  112.181 1.00 44.52 ? 344  GLU C CG    1 
ATOM   8177  C  CD    . GLU G 2 155 ? 53.425  92.079  111.503 1.00 46.88 ? 344  GLU C CD    1 
ATOM   8178  O  OE1   . GLU G 2 155 ? 53.516  92.067  110.253 1.00 48.03 ? 344  GLU C OE1   1 
ATOM   8179  O  OE2   . GLU G 2 155 ? 53.511  91.049  112.218 1.00 47.68 ? 344  GLU C OE2   1 
ATOM   8180  N  N     . SER G 2 156 ? 54.033  98.232  111.623 1.00 38.54 ? 345  SER C N     1 
ATOM   8181  C  CA    . SER G 2 156 ? 54.850  99.344  111.167 1.00 38.97 ? 345  SER C CA    1 
ATOM   8182  C  C     . SER G 2 156 ? 55.207  99.922  112.544 1.00 39.58 ? 345  SER C C     1 
ATOM   8183  O  O     . SER G 2 156 ? 54.777  99.373  113.558 1.00 40.43 ? 345  SER C O     1 
ATOM   8184  C  CB    . SER G 2 156 ? 54.022  100.335 110.337 1.00 38.99 ? 345  SER C CB    1 
ATOM   8185  O  OG    . SER G 2 156 ? 53.060  101.016 111.131 1.00 38.58 ? 345  SER C OG    1 
ATOM   8186  N  N     . TYR G 2 157 ? 55.983  100.995 112.624 1.00 39.58 ? 346  TYR C N     1 
ATOM   8187  C  CA    . TYR G 2 157 ? 56.302  101.507 113.955 1.00 39.21 ? 346  TYR C CA    1 
ATOM   8188  C  C     . TYR G 2 157 ? 55.348  102.623 114.370 1.00 38.00 ? 346  TYR C C     1 
ATOM   8189  O  O     . TYR G 2 157 ? 55.504  103.210 115.440 1.00 38.16 ? 346  TYR C O     1 
ATOM   8190  C  CB    . TYR G 2 157 ? 57.760  102.007 114.012 1.00 40.80 ? 346  TYR C CB    1 
ATOM   8191  C  CG    . TYR G 2 157 ? 58.067  103.161 113.082 1.00 41.78 ? 346  TYR C CG    1 
ATOM   8192  C  CD1   . TYR G 2 157 ? 57.600  104.450 113.363 1.00 42.48 ? 346  TYR C CD1   1 
ATOM   8193  C  CD2   . TYR G 2 157 ? 58.780  102.959 111.895 1.00 42.07 ? 346  TYR C CD2   1 
ATOM   8194  C  CE1   . TYR G 2 157 ? 57.825  105.508 112.485 1.00 42.69 ? 346  TYR C CE1   1 
ATOM   8195  C  CE2   . TYR G 2 157 ? 59.013  104.013 111.005 1.00 43.31 ? 346  TYR C CE2   1 
ATOM   8196  C  CZ    . TYR G 2 157 ? 58.526  105.283 111.309 1.00 43.69 ? 346  TYR C CZ    1 
ATOM   8197  O  OH    . TYR G 2 157 ? 58.706  106.321 110.425 1.00 45.30 ? 346  TYR C OH    1 
ATOM   8198  N  N     . LEU G 2 158 ? 54.362  102.912 113.524 1.00 36.05 ? 347  LEU C N     1 
ATOM   8199  C  CA    . LEU G 2 158 ? 53.402  103.969 113.814 1.00 34.13 ? 347  LEU C CA    1 
ATOM   8200  C  C     . LEU G 2 158 ? 52.572  103.688 115.051 1.00 33.02 ? 347  LEU C C     1 
ATOM   8201  O  O     . LEU G 2 158 ? 52.135  102.563 115.287 1.00 33.27 ? 347  LEU C O     1 
ATOM   8202  C  CB    . LEU G 2 158 ? 52.489  104.196 112.615 1.00 34.02 ? 347  LEU C CB    1 
ATOM   8203  C  CG    . LEU G 2 158 ? 53.244  104.673 111.373 1.00 33.39 ? 347  LEU C CG    1 
ATOM   8204  C  CD1   . LEU G 2 158 ? 52.295  104.672 110.200 1.00 33.64 ? 347  LEU C CD1   1 
ATOM   8205  C  CD2   . LEU G 2 158 ? 53.838  106.070 111.608 1.00 32.90 ? 347  LEU C CD2   1 
ATOM   8206  N  N     . LYS G 2 159 ? 52.370  104.725 115.849 1.00 31.61 ? 348  LYS C N     1 
ATOM   8207  C  CA    . LYS G 2 159 ? 51.601  104.606 117.071 1.00 30.83 ? 348  LYS C CA    1 
ATOM   8208  C  C     . LYS G 2 159 ? 50.267  105.315 116.930 1.00 30.24 ? 348  LYS C C     1 
ATOM   8209  O  O     . LYS G 2 159 ? 50.212  106.533 116.655 1.00 29.56 ? 348  LYS C O     1 
ATOM   8210  C  CB    . LYS G 2 159 ? 52.406  105.184 118.232 1.00 32.47 ? 348  LYS C CB    1 
ATOM   8211  C  CG    . LYS G 2 159 ? 53.588  104.312 118.592 1.00 35.14 ? 348  LYS C CG    1 
ATOM   8212  C  CD    . LYS G 2 159 ? 54.492  104.963 119.599 1.00 37.80 ? 348  LYS C CD    1 
ATOM   8213  C  CE    . LYS G 2 159 ? 55.581  103.990 120.011 1.00 40.64 ? 348  LYS C CE    1 
ATOM   8214  N  NZ    . LYS G 2 159 ? 56.571  104.627 120.921 1.00 43.00 ? 348  LYS C NZ    1 
ATOM   8215  N  N     . ILE G 2 160 ? 49.189  104.551 117.105 1.00 28.57 ? 349  ILE C N     1 
ATOM   8216  C  CA    . ILE G 2 160 ? 47.847  105.110 116.972 1.00 27.88 ? 349  ILE C CA    1 
ATOM   8217  C  C     . ILE G 2 160 ? 47.218  105.297 118.340 1.00 26.80 ? 349  ILE C C     1 
ATOM   8218  O  O     . ILE G 2 160 ? 47.195  104.375 119.158 1.00 25.95 ? 349  ILE C O     1 
ATOM   8219  C  CB    . ILE G 2 160 ? 46.922  104.205 116.112 1.00 28.49 ? 349  ILE C CB    1 
ATOM   8220  C  CG1   . ILE G 2 160 ? 47.656  103.755 114.840 1.00 28.86 ? 349  ILE C CG1   1 
ATOM   8221  C  CG2   . ILE G 2 160 ? 45.638  104.951 115.754 1.00 26.78 ? 349  ILE C CG2   1 
ATOM   8222  C  CD1   . ILE G 2 160 ? 48.290  104.888 114.039 1.00 28.89 ? 349  ILE C CD1   1 
ATOM   8223  N  N     . GLY G 2 161 ? 46.718  106.502 118.590 1.00 24.97 ? 350  GLY C N     1 
ATOM   8224  C  CA    . GLY G 2 161 ? 46.098  106.776 119.874 1.00 25.19 ? 350  GLY C CA    1 
ATOM   8225  C  C     . GLY G 2 161 ? 44.673  107.266 119.723 1.00 25.22 ? 350  GLY C C     1 
ATOM   8226  O  O     . GLY G 2 161 ? 44.268  107.732 118.659 1.00 24.80 ? 350  GLY C O     1 
ATOM   8227  N  N     . ILE G 2 162 ? 43.901  107.156 120.792 1.00 25.51 ? 351  ILE C N     1 
ATOM   8228  C  CA    . ILE G 2 162 ? 42.531  107.600 120.746 1.00 25.95 ? 351  ILE C CA    1 
ATOM   8229  C  C     . ILE G 2 162 ? 42.174  108.363 122.023 1.00 25.74 ? 351  ILE C C     1 
ATOM   8230  O  O     . ILE G 2 162 ? 42.681  108.103 123.102 1.00 26.26 ? 351  ILE C O     1 
ATOM   8231  C  CB    . ILE G 2 162 ? 41.572  106.401 120.532 1.00 26.24 ? 351  ILE C CB    1 
ATOM   8232  C  CG1   . ILE G 2 162 ? 40.143  106.915 120.342 1.00 25.93 ? 351  ILE C CG1   1 
ATOM   8233  C  CG2   . ILE G 2 162 ? 41.674  105.442 121.691 1.00 25.40 ? 351  ILE C CG2   1 
ATOM   8234  C  CD1   . ILE G 2 162 ? 39.168  105.875 119.862 1.00 24.63 ? 351  ILE C CD1   1 
ATOM   8235  N  N     . VAL G 2 163 ? 41.275  109.310 121.871 1.00 25.45 ? 352  VAL C N     1 
ATOM   8236  C  CA    . VAL G 2 163 ? 40.853  110.146 122.960 1.00 23.99 ? 352  VAL C CA    1 
ATOM   8237  C  C     . VAL G 2 163 ? 39.353  110.409 122.780 1.00 23.02 ? 352  VAL C C     1 
ATOM   8238  O  O     . VAL G 2 163 ? 38.912  110.880 121.722 1.00 23.12 ? 352  VAL C O     1 
ATOM   8239  C  CB    . VAL G 2 163 ? 41.748  111.415 122.895 1.00 25.77 ? 352  VAL C CB    1 
ATOM   8240  C  CG1   . VAL G 2 163 ? 40.974  112.688 123.166 1.00 26.78 ? 352  VAL C CG1   1 
ATOM   8241  C  CG2   . VAL G 2 163 ? 42.929  111.225 123.857 1.00 25.38 ? 352  VAL C CG2   1 
ATOM   8242  N  N     . TYR G 2 164 ? 38.566  110.057 123.792 1.00 22.57 ? 353  TYR C N     1 
ATOM   8243  C  CA    . TYR G 2 164 ? 37.106  110.255 123.757 1.00 22.67 ? 353  TYR C CA    1 
ATOM   8244  C  C     . TYR G 2 164 ? 36.484  110.194 125.165 1.00 22.95 ? 353  TYR C C     1 
ATOM   8245  O  O     . TYR G 2 164 ? 37.047  109.582 126.085 1.00 21.12 ? 353  TYR C O     1 
ATOM   8246  C  CB    . TYR G 2 164 ? 36.440  109.216 122.825 1.00 22.27 ? 353  TYR C CB    1 
ATOM   8247  C  CG    . TYR G 2 164 ? 36.480  107.772 123.304 1.00 21.86 ? 353  TYR C CG    1 
ATOM   8248  C  CD1   . TYR G 2 164 ? 35.434  107.234 124.057 1.00 23.93 ? 353  TYR C CD1   1 
ATOM   8249  C  CD2   . TYR G 2 164 ? 37.547  106.937 122.977 1.00 21.99 ? 353  TYR C CD2   1 
ATOM   8250  C  CE1   . TYR G 2 164 ? 35.446  105.890 124.469 1.00 23.43 ? 353  TYR C CE1   1 
ATOM   8251  C  CE2   . TYR G 2 164 ? 37.577  105.593 123.384 1.00 21.66 ? 353  TYR C CE2   1 
ATOM   8252  C  CZ    . TYR G 2 164 ? 36.523  105.079 124.127 1.00 24.06 ? 353  TYR C CZ    1 
ATOM   8253  O  OH    . TYR G 2 164 ? 36.535  103.753 124.512 1.00 23.91 ? 353  TYR C OH    1 
ATOM   8254  N  N     . GLY G 2 165 ? 35.323  110.830 125.320 1.00 21.82 ? 354  GLY C N     1 
ATOM   8255  C  CA    . GLY G 2 165 ? 34.650  110.866 126.610 1.00 22.91 ? 354  GLY C CA    1 
ATOM   8256  C  C     . GLY G 2 165 ? 34.036  109.591 127.174 1.00 23.19 ? 354  GLY C C     1 
ATOM   8257  O  O     . GLY G 2 165 ? 33.890  108.589 126.477 1.00 23.16 ? 354  GLY C O     1 
ATOM   8258  N  N     . GLY G 2 166 ? 33.695  109.632 128.461 1.00 24.39 ? 355  GLY C N     1 
ATOM   8259  C  CA    . GLY G 2 166 ? 33.090  108.486 129.124 1.00 24.90 ? 355  GLY C CA    1 
ATOM   8260  C  C     . GLY G 2 166 ? 34.130  107.478 129.564 1.00 26.73 ? 355  GLY C C     1 
ATOM   8261  O  O     . GLY G 2 166 ? 33.823  106.342 129.902 1.00 28.08 ? 355  GLY C O     1 
ATOM   8262  N  N     . THR G 2 167 ? 35.382  107.894 129.548 1.00 27.96 ? 356  THR C N     1 
ATOM   8263  C  CA    . THR G 2 167 ? 36.475  107.020 129.931 1.00 28.38 ? 356  THR C CA    1 
ATOM   8264  C  C     . THR G 2 167 ? 37.400  107.714 130.915 1.00 28.71 ? 356  THR C C     1 
ATOM   8265  O  O     . THR G 2 167 ? 37.363  108.934 131.100 1.00 28.81 ? 356  THR C O     1 
ATOM   8266  C  CB    . THR G 2 167 ? 37.340  106.679 128.723 1.00 29.43 ? 356  THR C CB    1 
ATOM   8267  O  OG1   . THR G 2 167 ? 37.904  107.893 128.219 1.00 31.31 ? 356  THR C OG1   1 
ATOM   8268  C  CG2   . THR G 2 167 ? 36.531  106.027 127.630 1.00 29.14 ? 356  THR C CG2   1 
ATOM   8269  N  N     . SER G 2 168 ? 38.247  106.923 131.547 1.00 29.10 ? 357  SER C N     1 
ATOM   8270  C  CA    . SER G 2 168 ? 39.210  107.478 132.463 1.00 29.32 ? 357  SER C CA    1 
ATOM   8271  C  C     . SER G 2 168 ? 40.127  108.424 131.698 1.00 29.20 ? 357  SER C C     1 
ATOM   8272  O  O     . SER G 2 168 ? 40.830  108.017 130.771 1.00 28.06 ? 357  SER C O     1 
ATOM   8273  C  CB    . SER G 2 168 ? 40.061  106.367 133.087 1.00 29.43 ? 357  SER C CB    1 
ATOM   8274  O  OG    . SER G 2 168 ? 41.197  106.932 133.711 1.00 29.41 ? 357  SER C OG    1 
ATOM   8275  N  N     . PHE G 2 169 ? 40.120  109.689 132.083 1.00 30.02 ? 358  PHE C N     1 
ATOM   8276  C  CA    . PHE G 2 169 ? 40.997  110.657 131.440 1.00 31.27 ? 358  PHE C CA    1 
ATOM   8277  C  C     . PHE G 2 169 ? 42.467  110.246 131.667 1.00 32.38 ? 358  PHE C C     1 
ATOM   8278  O  O     . PHE G 2 169 ? 43.299  110.396 130.770 1.00 31.86 ? 358  PHE C O     1 
ATOM   8279  C  CB    . PHE G 2 169 ? 40.764  112.064 132.019 1.00 30.21 ? 358  PHE C CB    1 
ATOM   8280  C  CG    . PHE G 2 169 ? 41.641  113.112 131.407 1.00 29.23 ? 358  PHE C CG    1 
ATOM   8281  C  CD1   . PHE G 2 169 ? 41.196  113.870 130.335 1.00 28.08 ? 358  PHE C CD1   1 
ATOM   8282  C  CD2   . PHE G 2 169 ? 42.950  113.281 131.854 1.00 29.74 ? 358  PHE C CD2   1 
ATOM   8283  C  CE1   . PHE G 2 169 ? 42.045  114.781 129.707 1.00 28.43 ? 358  PHE C CE1   1 
ATOM   8284  C  CE2   . PHE G 2 169 ? 43.803  114.186 131.235 1.00 28.28 ? 358  PHE C CE2   1 
ATOM   8285  C  CZ    . PHE G 2 169 ? 43.349  114.936 130.159 1.00 28.00 ? 358  PHE C CZ    1 
ATOM   8286  N  N     . ARG G 2 170 ? 42.770  109.721 132.859 1.00 33.80 ? 359  ARG C N     1 
ATOM   8287  C  CA    . ARG G 2 170 ? 44.129  109.306 133.216 1.00 35.33 ? 359  ARG C CA    1 
ATOM   8288  C  C     . ARG G 2 170 ? 44.657  108.213 132.299 1.00 35.87 ? 359  ARG C C     1 
ATOM   8289  O  O     . ARG G 2 170 ? 45.773  108.299 131.779 1.00 36.41 ? 359  ARG C O     1 
ATOM   8290  C  CB    . ARG G 2 170 ? 44.171  108.828 134.677 1.00 37.81 ? 359  ARG C CB    1 
ATOM   8291  C  CG    . ARG G 2 170 ? 45.490  108.154 135.109 1.00 41.34 ? 359  ARG C CG    1 
ATOM   8292  C  CD    . ARG G 2 170 ? 45.541  107.901 136.626 1.00 44.45 ? 359  ARG C CD    1 
ATOM   8293  N  NE    . ARG G 2 170 ? 45.598  109.158 137.381 1.00 48.62 ? 359  ARG C NE    1 
ATOM   8294  C  CZ    . ARG G 2 170 ? 46.723  109.813 137.697 1.00 50.75 ? 359  ARG C CZ    1 
ATOM   8295  N  NH1   . ARG G 2 170 ? 47.915  109.333 137.336 1.00 50.65 ? 359  ARG C NH1   1 
ATOM   8296  N  NH2   . ARG G 2 170 ? 46.655  110.971 138.355 1.00 50.28 ? 359  ARG C NH2   1 
ATOM   8297  N  N     . HIS G 2 171 ? 43.857  107.176 132.105 1.00 35.46 ? 360  HIS C N     1 
ATOM   8298  C  CA    . HIS G 2 171 ? 44.248  106.086 131.234 1.00 36.11 ? 360  HIS C CA    1 
ATOM   8299  C  C     . HIS G 2 171 ? 44.543  106.550 129.802 1.00 35.14 ? 360  HIS C C     1 
ATOM   8300  O  O     . HIS G 2 171 ? 45.504  106.101 129.190 1.00 35.37 ? 360  HIS C O     1 
ATOM   8301  C  CB    . HIS G 2 171 ? 43.145  105.027 131.190 1.00 39.03 ? 360  HIS C CB    1 
ATOM   8302  C  CG    . HIS G 2 171 ? 43.315  104.028 130.087 1.00 42.32 ? 360  HIS C CG    1 
ATOM   8303  N  ND1   . HIS G 2 171 ? 44.205  102.975 130.163 1.00 43.52 ? 360  HIS C ND1   1 
ATOM   8304  C  CD2   . HIS G 2 171 ? 42.748  103.954 128.859 1.00 43.45 ? 360  HIS C CD2   1 
ATOM   8305  C  CE1   . HIS G 2 171 ? 44.180  102.296 129.030 1.00 44.68 ? 360  HIS C CE1   1 
ATOM   8306  N  NE2   . HIS G 2 171 ? 43.305  102.870 128.220 1.00 46.03 ? 360  HIS C NE2   1 
ATOM   8307  N  N     . GLN G 2 172 ? 43.719  107.440 129.261 1.00 33.74 ? 361  GLN C N     1 
ATOM   8308  C  CA    . GLN G 2 172 ? 43.930  107.887 127.894 1.00 33.54 ? 361  GLN C CA    1 
ATOM   8309  C  C     . GLN G 2 172 ? 45.174  108.751 127.786 1.00 34.08 ? 361  GLN C C     1 
ATOM   8310  O  O     . GLN G 2 172 ? 45.880  108.733 126.773 1.00 33.00 ? 361  GLN C O     1 
ATOM   8311  C  CB    . GLN G 2 172 ? 42.710  108.667 127.374 1.00 32.57 ? 361  GLN C CB    1 
ATOM   8312  C  CG    . GLN G 2 172 ? 41.410  107.878 127.425 1.00 31.73 ? 361  GLN C CG    1 
ATOM   8313  C  CD    . GLN G 2 172 ? 40.365  108.371 126.425 1.00 30.17 ? 361  GLN C CD    1 
ATOM   8314  O  OE1   . GLN G 2 172 ? 40.103  109.568 126.317 1.00 26.75 ? 361  GLN C OE1   1 
ATOM   8315  N  NE2   . GLN G 2 172 ? 39.753  107.432 125.700 1.00 28.09 ? 361  GLN C NE2   1 
ATOM   8316  N  N     . ASN G 2 173 ? 45.434  109.519 128.835 1.00 35.03 ? 362  ASN C N     1 
ATOM   8317  C  CA    . ASN G 2 173 ? 46.593  110.387 128.853 1.00 35.62 ? 362  ASN C CA    1 
ATOM   8318  C  C     . ASN G 2 173 ? 47.866  109.534 128.876 1.00 36.91 ? 362  ASN C C     1 
ATOM   8319  O  O     . ASN G 2 173 ? 48.867  109.883 128.257 1.00 36.09 ? 362  ASN C O     1 
ATOM   8320  C  CB    . ASN G 2 173 ? 46.514  111.307 130.068 1.00 34.65 ? 362  ASN C CB    1 
ATOM   8321  C  CG    . ASN G 2 173 ? 47.527  112.420 130.021 1.00 34.64 ? 362  ASN C CG    1 
ATOM   8322  O  OD1   . ASN G 2 173 ? 47.951  112.850 128.951 1.00 36.46 ? 362  ASN C OD1   1 
ATOM   8323  N  ND2   . ASN G 2 173 ? 47.910  112.906 131.181 1.00 35.00 ? 362  ASN C ND2   1 
ATOM   8324  N  N     . GLU G 2 174 ? 47.812  108.406 129.575 1.00 39.03 ? 363  GLU C N     1 
ATOM   8325  C  CA    . GLU G 2 174 ? 48.962  107.509 129.656 1.00 42.86 ? 363  GLU C CA    1 
ATOM   8326  C  C     . GLU G 2 174 ? 49.318  107.040 128.269 1.00 44.12 ? 363  GLU C C     1 
ATOM   8327  O  O     . GLU G 2 174 ? 50.483  107.040 127.871 1.00 45.18 ? 363  GLU C O     1 
ATOM   8328  C  CB    . GLU G 2 174 ? 48.644  106.294 130.521 1.00 44.24 ? 363  GLU C CB    1 
ATOM   8329  C  CG    . GLU G 2 174 ? 48.761  106.555 132.006 1.00 47.78 ? 363  GLU C CG    1 
ATOM   8330  C  CD    . GLU G 2 174 ? 48.074  105.489 132.828 1.00 50.46 ? 363  GLU C CD    1 
ATOM   8331  O  OE1   . GLU G 2 174 ? 48.267  104.285 132.546 1.00 52.67 ? 363  GLU C OE1   1 
ATOM   8332  O  OE2   . GLU G 2 174 ? 47.338  105.857 133.764 1.00 52.27 ? 363  GLU C OE2   1 
ATOM   8333  N  N     . CYS G 2 175 ? 48.297  106.651 127.523 1.00 45.18 ? 364  CYS C N     1 
ATOM   8334  C  CA    . CYS G 2 175 ? 48.502  106.180 126.173 1.00 46.02 ? 364  CYS C CA    1 
ATOM   8335  C  C     . CYS G 2 175 ? 48.999  107.328 125.292 1.00 45.29 ? 364  CYS C C     1 
ATOM   8336  O  O     . CYS G 2 175 ? 49.886  107.139 124.462 1.00 46.10 ? 364  CYS C O     1 
ATOM   8337  C  CB    . CYS G 2 175 ? 47.196  105.564 125.673 1.00 48.11 ? 364  CYS C CB    1 
ATOM   8338  S  SG    . CYS G 2 175 ? 46.566  104.280 126.845 1.00 52.38 ? 364  CYS C SG    1 
ATOM   8339  N  N     . ILE G 2 176 ? 48.460  108.524 125.489 1.00 43.92 ? 365  ILE C N     1 
ATOM   8340  C  CA    . ILE G 2 176 ? 48.900  109.693 124.724 1.00 43.59 ? 365  ILE C CA    1 
ATOM   8341  C  C     . ILE G 2 176 ? 50.337  110.092 125.088 1.00 44.64 ? 365  ILE C C     1 
ATOM   8342  O  O     . ILE G 2 176 ? 51.129  110.485 124.227 1.00 44.71 ? 365  ILE C O     1 
ATOM   8343  C  CB    . ILE G 2 176 ? 47.991  110.925 125.005 1.00 43.05 ? 365  ILE C CB    1 
ATOM   8344  C  CG1   . ILE G 2 176 ? 46.616  110.714 124.367 1.00 43.24 ? 365  ILE C CG1   1 
ATOM   8345  C  CG2   . ILE G 2 176 ? 48.658  112.203 124.522 1.00 41.87 ? 365  ILE C CG2   1 
ATOM   8346  C  CD1   . ILE G 2 176 ? 46.657  110.338 122.888 1.00 42.88 ? 365  ILE C CD1   1 
ATOM   8347  N  N     . THR G 2 177 ? 50.663  109.990 126.373 1.00 44.64 ? 366  THR C N     1 
ATOM   8348  C  CA    . THR G 2 177 ? 51.976  110.365 126.871 1.00 44.97 ? 366  THR C CA    1 
ATOM   8349  C  C     . THR G 2 177 ? 53.164  109.623 126.254 1.00 44.65 ? 366  THR C C     1 
ATOM   8350  O  O     . THR G 2 177 ? 54.201  110.226 126.011 1.00 44.18 ? 366  THR C O     1 
ATOM   8351  C  CB    . THR G 2 177 ? 52.010  110.253 128.413 1.00 45.46 ? 366  THR C CB    1 
ATOM   8352  O  OG1   . THR G 2 177 ? 51.322  111.381 128.977 1.00 46.41 ? 366  THR C OG1   1 
ATOM   8353  C  CG2   . THR G 2 177 ? 53.438  110.228 128.927 1.00 46.23 ? 366  THR C CG2   1 
ATOM   8354  N  N     . ARG G 2 178 ? 53.033  108.329 125.999 1.00 44.60 ? 367  ARG C N     1 
ATOM   8355  C  CA    . ARG G 2 178 ? 54.138  107.608 125.382 1.00 45.75 ? 367  ARG C CA    1 
ATOM   8356  C  C     . ARG G 2 178 ? 54.398  108.209 124.005 1.00 45.15 ? 367  ARG C C     1 
ATOM   8357  O  O     . ARG G 2 178 ? 55.458  108.006 123.418 1.00 45.77 ? 367  ARG C O     1 
ATOM   8358  C  CB    . ARG G 2 178 ? 53.797  106.132 125.218 1.00 48.32 ? 367  ARG C CB    1 
ATOM   8359  C  CG    . ARG G 2 178 ? 53.370  105.449 126.495 1.00 52.02 ? 367  ARG C CG    1 
ATOM   8360  C  CD    . ARG G 2 178 ? 52.295  104.409 126.189 1.00 55.60 ? 367  ARG C CD    1 
ATOM   8361  N  NE    . ARG G 2 178 ? 51.738  103.831 127.406 1.00 58.42 ? 367  ARG C NE    1 
ATOM   8362  C  CZ    . ARG G 2 178 ? 50.735  102.960 127.427 1.00 60.02 ? 367  ARG C CZ    1 
ATOM   8363  N  NH1   . ARG G 2 178 ? 50.176  102.565 126.288 1.00 60.97 ? 367  ARG C NH1   1 
ATOM   8364  N  NH2   . ARG G 2 178 ? 50.297  102.479 128.589 1.00 60.82 ? 367  ARG C NH2   1 
ATOM   8365  N  N     . GLY G 2 179 ? 53.415  108.937 123.484 1.00 44.04 ? 368  GLY C N     1 
ATOM   8366  C  CA    . GLY G 2 179 ? 53.573  109.552 122.179 1.00 42.78 ? 368  GLY C CA    1 
ATOM   8367  C  C     . GLY G 2 179 ? 52.784  108.831 121.109 1.00 41.96 ? 368  GLY C C     1 
ATOM   8368  O  O     . GLY G 2 179 ? 52.751  107.606 121.082 1.00 41.65 ? 368  GLY C O     1 
ATOM   8369  N  N     . CYS G 2 180 ? 52.147  109.589 120.225 1.00 41.08 ? 369  CYS C N     1 
ATOM   8370  C  CA    . CYS G 2 180 ? 51.352  108.998 119.156 1.00 40.65 ? 369  CYS C CA    1 
ATOM   8371  C  C     . CYS G 2 180 ? 51.514  109.758 117.852 1.00 37.54 ? 369  CYS C C     1 
ATOM   8372  O  O     . CYS G 2 180 ? 51.497  110.979 117.855 1.00 37.11 ? 369  CYS C O     1 
ATOM   8373  C  CB    . CYS G 2 180 ? 49.873  108.994 119.556 1.00 42.76 ? 369  CYS C CB    1 
ATOM   8374  S  SG    . CYS G 2 180 ? 49.534  108.006 121.040 1.00 50.87 ? 369  CYS C SG    1 
ATOM   8375  N  N     . HIS G 2 181 ? 51.674  109.031 116.749 1.00 35.31 ? 370  HIS C N     1 
ATOM   8376  C  CA    . HIS G 2 181 ? 51.798  109.651 115.427 1.00 33.80 ? 370  HIS C CA    1 
ATOM   8377  C  C     . HIS G 2 181 ? 50.397  110.080 114.990 1.00 33.12 ? 370  HIS C C     1 
ATOM   8378  O  O     . HIS G 2 181 ? 50.219  111.145 114.388 1.00 32.75 ? 370  HIS C O     1 
ATOM   8379  C  CB    . HIS G 2 181 ? 52.331  108.653 114.391 1.00 33.08 ? 370  HIS C CB    1 
ATOM   8380  C  CG    . HIS G 2 181 ? 53.697  108.122 114.695 1.00 33.72 ? 370  HIS C CG    1 
ATOM   8381  N  ND1   . HIS G 2 181 ? 54.852  108.805 114.376 1.00 34.11 ? 370  HIS C ND1   1 
ATOM   8382  C  CD2   . HIS G 2 181 ? 54.090  106.979 115.303 1.00 32.26 ? 370  HIS C CD2   1 
ATOM   8383  C  CE1   . HIS G 2 181 ? 55.897  108.101 114.773 1.00 32.77 ? 370  HIS C CE1   1 
ATOM   8384  N  NE2   . HIS G 2 181 ? 55.462  106.991 115.338 1.00 32.53 ? 370  HIS C NE2   1 
ATOM   8385  N  N     . VAL G 2 182 ? 49.414  109.236 115.313 1.00 31.18 ? 371  VAL C N     1 
ATOM   8386  C  CA    . VAL G 2 182 ? 48.012  109.464 114.967 1.00 29.49 ? 371  VAL C CA    1 
ATOM   8387  C  C     . VAL G 2 182 ? 47.043  109.435 116.160 1.00 28.81 ? 371  VAL C C     1 
ATOM   8388  O  O     . VAL G 2 182 ? 47.028  108.463 116.930 1.00 28.76 ? 371  VAL C O     1 
ATOM   8389  C  CB    . VAL G 2 182 ? 47.525  108.384 113.970 1.00 30.36 ? 371  VAL C CB    1 
ATOM   8390  C  CG1   . VAL G 2 182 ? 46.081  108.691 113.517 1.00 28.76 ? 371  VAL C CG1   1 
ATOM   8391  C  CG2   . VAL G 2 182 ? 48.490  108.290 112.786 1.00 27.51 ? 371  VAL C CG2   1 
ATOM   8392  N  N     . VAL G 2 183 ? 46.235  110.489 116.313 1.00 26.53 ? 372  VAL C N     1 
ATOM   8393  C  CA    . VAL G 2 183 ? 45.246  110.516 117.381 1.00 24.50 ? 372  VAL C CA    1 
ATOM   8394  C  C     . VAL G 2 183 ? 43.842  110.633 116.779 1.00 24.54 ? 372  VAL C C     1 
ATOM   8395  O  O     . VAL G 2 183 ? 43.568  111.548 115.998 1.00 26.13 ? 372  VAL C O     1 
ATOM   8396  C  CB    . VAL G 2 183 ? 45.441  111.713 118.345 1.00 24.79 ? 372  VAL C CB    1 
ATOM   8397  C  CG1   . VAL G 2 183 ? 44.397  111.641 119.462 1.00 23.97 ? 372  VAL C CG1   1 
ATOM   8398  C  CG2   . VAL G 2 183 ? 46.822  111.679 118.959 1.00 24.04 ? 372  VAL C CG2   1 
ATOM   8399  N  N     . ILE G 2 184 ? 42.962  109.691 117.107 1.00 23.95 ? 373  ILE C N     1 
ATOM   8400  C  CA    . ILE G 2 184 ? 41.584  109.748 116.639 1.00 22.80 ? 373  ILE C CA    1 
ATOM   8401  C  C     . ILE G 2 184 ? 40.827  110.310 117.838 1.00 22.06 ? 373  ILE C C     1 
ATOM   8402  O  O     . ILE G 2 184 ? 41.130  109.955 118.963 1.00 22.01 ? 373  ILE C O     1 
ATOM   8403  C  CB    . ILE G 2 184 ? 41.017  108.359 116.271 1.00 23.00 ? 373  ILE C CB    1 
ATOM   8404  C  CG1   . ILE G 2 184 ? 41.634  107.849 114.960 1.00 24.69 ? 373  ILE C CG1   1 
ATOM   8405  C  CG2   . ILE G 2 184 ? 39.524  108.468 116.018 1.00 23.89 ? 373  ILE C CG2   1 
ATOM   8406  C  CD1   . ILE G 2 184 ? 43.086  107.522 115.014 1.00 24.68 ? 373  ILE C CD1   1 
ATOM   8407  N  N     . ALA G 2 185 ? 39.861  111.195 117.617 1.00 21.80 ? 374  ALA C N     1 
ATOM   8408  C  CA    . ALA G 2 185 ? 39.175  111.763 118.761 1.00 21.50 ? 374  ALA C CA    1 
ATOM   8409  C  C     . ALA G 2 185 ? 37.807  112.356 118.521 1.00 20.79 ? 374  ALA C C     1 
ATOM   8410  O  O     . ALA G 2 185 ? 37.430  112.670 117.393 1.00 21.43 ? 374  ALA C O     1 
ATOM   8411  C  CB    . ALA G 2 185 ? 40.060  112.817 119.378 1.00 21.78 ? 374  ALA C CB    1 
ATOM   8412  N  N     . THR G 2 186 ? 37.054  112.487 119.606 1.00 20.27 ? 375  THR C N     1 
ATOM   8413  C  CA    . THR G 2 186 ? 35.762  113.153 119.543 1.00 21.06 ? 375  THR C CA    1 
ATOM   8414  C  C     . THR G 2 186 ? 36.134  114.564 120.039 1.00 20.48 ? 375  THR C C     1 
ATOM   8415  O  O     . THR G 2 186 ? 37.074  114.720 120.811 1.00 18.99 ? 375  THR C O     1 
ATOM   8416  C  CB    . THR G 2 186 ? 34.719  112.481 120.444 1.00 20.29 ? 375  THR C CB    1 
ATOM   8417  O  OG1   . THR G 2 186 ? 35.321  112.114 121.682 1.00 20.55 ? 375  THR C OG1   1 
ATOM   8418  C  CG2   . THR G 2 186 ? 34.144  111.253 119.752 1.00 19.95 ? 375  THR C CG2   1 
ATOM   8419  N  N     . PRO G 2 187 ? 35.396  115.598 119.625 1.00 20.64 ? 376  PRO C N     1 
ATOM   8420  C  CA    . PRO G 2 187 ? 35.764  116.947 120.066 1.00 22.06 ? 376  PRO C CA    1 
ATOM   8421  C  C     . PRO G 2 187 ? 35.938  117.253 121.551 1.00 23.65 ? 376  PRO C C     1 
ATOM   8422  O  O     . PRO G 2 187 ? 36.950  117.845 121.941 1.00 25.71 ? 376  PRO C O     1 
ATOM   8423  C  CB    . PRO G 2 187 ? 34.694  117.823 119.414 1.00 20.91 ? 376  PRO C CB    1 
ATOM   8424  C  CG    . PRO G 2 187 ? 34.322  117.066 118.193 1.00 20.79 ? 376  PRO C CG    1 
ATOM   8425  C  CD    . PRO G 2 187 ? 34.216  115.656 118.753 1.00 21.34 ? 376  PRO C CD    1 
ATOM   8426  N  N     . GLY G 2 188 ? 34.969  116.862 122.371 1.00 23.58 ? 377  GLY C N     1 
ATOM   8427  C  CA    . GLY G 2 188 ? 35.036  117.145 123.787 1.00 23.68 ? 377  GLY C CA    1 
ATOM   8428  C  C     . GLY G 2 188 ? 36.318  116.767 124.486 1.00 25.37 ? 377  GLY C C     1 
ATOM   8429  O  O     . GLY G 2 188 ? 37.021  117.643 125.017 1.00 26.44 ? 377  GLY C O     1 
ATOM   8430  N  N     . ARG G 2 189 ? 36.627  115.469 124.505 1.00 25.06 ? 378  ARG C N     1 
ATOM   8431  C  CA    . ARG G 2 189 ? 37.822  115.004 125.179 1.00 25.39 ? 378  ARG C CA    1 
ATOM   8432  C  C     . ARG G 2 189 ? 39.059  115.614 124.539 1.00 25.65 ? 378  ARG C C     1 
ATOM   8433  O  O     . ARG G 2 189 ? 40.021  115.923 125.242 1.00 26.24 ? 378  ARG C O     1 
ATOM   8434  C  CB    . ARG G 2 189 ? 37.906  113.466 125.170 1.00 25.39 ? 378  ARG C CB    1 
ATOM   8435  C  CG    . ARG G 2 189 ? 39.027  112.898 126.031 1.00 23.79 ? 378  ARG C CG    1 
ATOM   8436  C  CD    . ARG G 2 189 ? 38.943  113.415 127.480 1.00 23.59 ? 378  ARG C CD    1 
ATOM   8437  N  NE    . ARG G 2 189 ? 37.875  112.803 128.283 1.00 21.20 ? 378  ARG C NE    1 
ATOM   8438  C  CZ    . ARG G 2 189 ? 37.903  111.545 128.727 1.00 21.18 ? 378  ARG C CZ    1 
ATOM   8439  N  NH1   . ARG G 2 189 ? 38.936  110.764 128.453 1.00 18.06 ? 378  ARG C NH1   1 
ATOM   8440  N  NH2   . ARG G 2 189 ? 36.903  111.068 129.463 1.00 20.90 ? 378  ARG C NH2   1 
ATOM   8441  N  N     . LEU G 2 190 ? 39.038  115.800 123.219 1.00 24.96 ? 379  LEU C N     1 
ATOM   8442  C  CA    . LEU G 2 190 ? 40.187  116.390 122.549 1.00 25.32 ? 379  LEU C CA    1 
ATOM   8443  C  C     . LEU G 2 190 ? 40.472  117.782 123.139 1.00 26.30 ? 379  LEU C C     1 
ATOM   8444  O  O     . LEU G 2 190 ? 41.604  118.095 123.517 1.00 26.33 ? 379  LEU C O     1 
ATOM   8445  C  CB    . LEU G 2 190 ? 39.948  116.500 121.035 1.00 23.93 ? 379  LEU C CB    1 
ATOM   8446  C  CG    . LEU G 2 190 ? 41.102  117.149 120.253 1.00 24.21 ? 379  LEU C CG    1 
ATOM   8447  C  CD1   . LEU G 2 190 ? 42.365  116.373 120.548 1.00 24.31 ? 379  LEU C CD1   1 
ATOM   8448  C  CD2   . LEU G 2 190 ? 40.844  117.169 118.740 1.00 23.12 ? 379  LEU C CD2   1 
ATOM   8449  N  N     . LEU G 2 191 ? 39.441  118.608 123.225 1.00 26.53 ? 380  LEU C N     1 
ATOM   8450  C  CA    . LEU G 2 191 ? 39.596  119.958 123.760 1.00 28.19 ? 380  LEU C CA    1 
ATOM   8451  C  C     . LEU G 2 191 ? 40.008  119.950 125.250 1.00 28.29 ? 380  LEU C C     1 
ATOM   8452  O  O     . LEU G 2 191 ? 40.654  120.876 125.742 1.00 27.01 ? 380  LEU C O     1 
ATOM   8453  C  CB    . LEU G 2 191 ? 38.292  120.737 123.552 1.00 27.23 ? 380  LEU C CB    1 
ATOM   8454  C  CG    . LEU G 2 191 ? 38.271  121.865 122.512 1.00 29.69 ? 380  LEU C CG    1 
ATOM   8455  C  CD1   . LEU G 2 191 ? 39.538  121.853 121.646 1.00 28.65 ? 380  LEU C CD1   1 
ATOM   8456  C  CD2   . LEU G 2 191 ? 37.004  121.747 121.669 1.00 27.53 ? 380  LEU C CD2   1 
ATOM   8457  N  N     . ASP G 2 192 ? 39.637  118.888 125.953 1.00 28.50 ? 381  ASP C N     1 
ATOM   8458  C  CA    . ASP G 2 192 ? 39.980  118.744 127.355 1.00 29.12 ? 381  ASP C CA    1 
ATOM   8459  C  C     . ASP G 2 192 ? 41.511  118.583 127.426 1.00 29.57 ? 381  ASP C C     1 
ATOM   8460  O  O     . ASP G 2 192 ? 42.178  119.204 128.249 1.00 29.08 ? 381  ASP C O     1 
ATOM   8461  C  CB    . ASP G 2 192 ? 39.258  117.516 127.911 1.00 30.25 ? 381  ASP C CB    1 
ATOM   8462  C  CG    . ASP G 2 192 ? 39.318  117.426 129.414 1.00 32.83 ? 381  ASP C CG    1 
ATOM   8463  O  OD1   . ASP G 2 192 ? 39.892  118.346 130.041 1.00 34.47 ? 381  ASP C OD1   1 
ATOM   8464  O  OD2   . ASP G 2 192 ? 38.793  116.430 129.968 1.00 33.36 ? 381  ASP C OD2   1 
ATOM   8465  N  N     . PHE G 2 193 ? 42.055  117.742 126.549 1.00 29.81 ? 382  PHE C N     1 
ATOM   8466  C  CA    . PHE G 2 193 ? 43.494  117.513 126.469 1.00 29.36 ? 382  PHE C CA    1 
ATOM   8467  C  C     . PHE G 2 193 ? 44.191  118.804 126.063 1.00 30.04 ? 382  PHE C C     1 
ATOM   8468  O  O     . PHE G 2 193 ? 45.218  119.168 126.632 1.00 30.24 ? 382  PHE C O     1 
ATOM   8469  C  CB    . PHE G 2 193 ? 43.802  116.419 125.448 1.00 27.15 ? 382  PHE C CB    1 
ATOM   8470  C  CG    . PHE G 2 193 ? 43.802  115.037 126.031 1.00 26.38 ? 382  PHE C CG    1 
ATOM   8471  C  CD1   . PHE G 2 193 ? 44.956  114.513 126.609 1.00 26.27 ? 382  PHE C CD1   1 
ATOM   8472  C  CD2   . PHE G 2 193 ? 42.641  114.269 126.032 1.00 24.97 ? 382  PHE C CD2   1 
ATOM   8473  C  CE1   . PHE G 2 193 ? 44.953  113.232 127.186 1.00 26.19 ? 382  PHE C CE1   1 
ATOM   8474  C  CE2   . PHE G 2 193 ? 42.622  112.989 126.607 1.00 25.66 ? 382  PHE C CE2   1 
ATOM   8475  C  CZ    . PHE G 2 193 ? 43.781  112.469 127.186 1.00 25.34 ? 382  PHE C CZ    1 
ATOM   8476  N  N     . VAL G 2 194 ? 43.629  119.491 125.078 1.00 30.65 ? 383  VAL C N     1 
ATOM   8477  C  CA    . VAL G 2 194 ? 44.197  120.749 124.608 1.00 32.00 ? 383  VAL C CA    1 
ATOM   8478  C  C     . VAL G 2 194 ? 44.187  121.839 125.680 1.00 32.67 ? 383  VAL C C     1 
ATOM   8479  O  O     . VAL G 2 194 ? 45.177  122.533 125.851 1.00 34.49 ? 383  VAL C O     1 
ATOM   8480  C  CB    . VAL G 2 194 ? 43.448  121.286 123.379 1.00 30.27 ? 383  VAL C CB    1 
ATOM   8481  C  CG1   . VAL G 2 194 ? 43.932  122.665 123.050 1.00 31.04 ? 383  VAL C CG1   1 
ATOM   8482  C  CG2   . VAL G 2 194 ? 43.676  120.379 122.199 1.00 32.33 ? 383  VAL C CG2   1 
ATOM   8483  N  N     . ASP G 2 195 ? 43.080  121.992 126.399 1.00 33.83 ? 384  ASP C N     1 
ATOM   8484  C  CA    . ASP G 2 195 ? 42.999  123.023 127.430 1.00 35.21 ? 384  ASP C CA    1 
ATOM   8485  C  C     . ASP G 2 195 ? 43.951  122.763 128.598 1.00 35.86 ? 384  ASP C C     1 
ATOM   8486  O  O     . ASP G 2 195 ? 44.364  123.698 129.286 1.00 35.30 ? 384  ASP C O     1 
ATOM   8487  C  CB    . ASP G 2 195 ? 41.556  123.175 127.926 1.00 36.56 ? 384  ASP C CB    1 
ATOM   8488  C  CG    . ASP G 2 195 ? 40.639  123.811 126.872 1.00 39.23 ? 384  ASP C CG    1 
ATOM   8489  O  OD1   . ASP G 2 195 ? 41.143  124.582 126.013 1.00 40.67 ? 384  ASP C OD1   1 
ATOM   8490  O  OD2   . ASP G 2 195 ? 39.413  123.561 126.909 1.00 39.87 ? 384  ASP C OD2   1 
ATOM   8491  N  N     . ARG G 2 196 ? 44.303  121.498 128.814 1.00 35.54 ? 385  ARG C N     1 
ATOM   8492  C  CA    . ARG G 2 196 ? 45.238  121.132 129.870 1.00 36.21 ? 385  ARG C CA    1 
ATOM   8493  C  C     . ARG G 2 196 ? 46.661  121.216 129.315 1.00 35.84 ? 385  ARG C C     1 
ATOM   8494  O  O     . ARG G 2 196 ? 47.622  120.936 130.022 1.00 36.09 ? 385  ARG C O     1 
ATOM   8495  C  CB    . ARG G 2 196 ? 44.990  119.702 130.345 1.00 37.62 ? 385  ARG C CB    1 
ATOM   8496  C  CG    . ARG G 2 196 ? 43.744  119.484 131.190 1.00 40.30 ? 385  ARG C CG    1 
ATOM   8497  C  CD    . ARG G 2 196 ? 43.143  118.134 130.821 1.00 43.95 ? 385  ARG C CD    1 
ATOM   8498  N  NE    . ARG G 2 196 ? 42.748  117.288 131.946 1.00 46.01 ? 385  ARG C NE    1 
ATOM   8499  C  CZ    . ARG G 2 196 ? 41.673  117.479 132.705 1.00 48.40 ? 385  ARG C CZ    1 
ATOM   8500  N  NH1   . ARG G 2 196 ? 40.865  118.508 132.476 1.00 49.19 ? 385  ARG C NH1   1 
ATOM   8501  N  NH2   . ARG G 2 196 ? 41.390  116.618 133.679 1.00 49.38 ? 385  ARG C NH2   1 
ATOM   8502  N  N     . THR G 2 197 ? 46.776  121.606 128.046 1.00 34.95 ? 386  THR C N     1 
ATOM   8503  C  CA    . THR G 2 197 ? 48.056  121.709 127.347 1.00 35.21 ? 386  THR C CA    1 
ATOM   8504  C  C     . THR G 2 197 ? 48.775  120.360 127.200 1.00 34.68 ? 386  THR C C     1 
ATOM   8505  O  O     . THR G 2 197 ? 49.997  120.328 127.050 1.00 34.99 ? 386  THR C O     1 
ATOM   8506  C  CB    . THR G 2 197 ? 49.038  122.711 128.036 1.00 36.23 ? 386  THR C CB    1 
ATOM   8507  O  OG1   . THR G 2 197 ? 49.727  122.060 129.112 1.00 37.17 ? 386  THR C OG1   1 
ATOM   8508  C  CG2   . THR G 2 197 ? 48.274  123.917 128.583 1.00 36.30 ? 386  THR C CG2   1 
ATOM   8509  N  N     . PHE G 2 198 ? 48.026  119.257 127.247 1.00 32.83 ? 387  PHE C N     1 
ATOM   8510  C  CA    . PHE G 2 198 ? 48.605  117.923 127.092 1.00 31.60 ? 387  PHE C CA    1 
ATOM   8511  C  C     . PHE G 2 198 ? 48.695  117.520 125.619 1.00 31.43 ? 387  PHE C C     1 
ATOM   8512  O  O     . PHE G 2 198 ? 49.476  116.642 125.262 1.00 31.78 ? 387  PHE C O     1 
ATOM   8513  C  CB    . PHE G 2 198 ? 47.784  116.897 127.858 1.00 31.42 ? 387  PHE C CB    1 
ATOM   8514  C  CG    . PHE G 2 198 ? 47.891  117.033 129.351 1.00 31.96 ? 387  PHE C CG    1 
ATOM   8515  C  CD1   . PHE G 2 198 ? 47.012  116.360 130.185 1.00 32.13 ? 387  PHE C CD1   1 
ATOM   8516  C  CD2   . PHE G 2 198 ? 48.896  117.817 129.925 1.00 32.96 ? 387  PHE C CD2   1 
ATOM   8517  C  CE1   . PHE G 2 198 ? 47.125  116.456 131.570 1.00 32.65 ? 387  PHE C CE1   1 
ATOM   8518  C  CE2   . PHE G 2 198 ? 49.019  117.920 131.308 1.00 32.83 ? 387  PHE C CE2   1 
ATOM   8519  C  CZ    . PHE G 2 198 ? 48.130  117.237 132.131 1.00 33.15 ? 387  PHE C CZ    1 
ATOM   8520  N  N     . ILE G 2 199 ? 47.882  118.154 124.775 1.00 30.27 ? 388  ILE C N     1 
ATOM   8521  C  CA    . ILE G 2 199 ? 47.908  117.900 123.342 1.00 29.23 ? 388  ILE C CA    1 
ATOM   8522  C  C     . ILE G 2 199 ? 48.037  119.250 122.667 1.00 28.79 ? 388  ILE C C     1 
ATOM   8523  O  O     . ILE G 2 199 ? 47.329  120.194 122.997 1.00 28.81 ? 388  ILE C O     1 
ATOM   8524  C  CB    . ILE G 2 199 ? 46.648  117.159 122.829 1.00 29.00 ? 388  ILE C CB    1 
ATOM   8525  C  CG1   . ILE G 2 199 ? 46.745  115.674 123.196 1.00 29.55 ? 388  ILE C CG1   1 
ATOM   8526  C  CG2   . ILE G 2 199 ? 46.551  117.284 121.309 1.00 30.09 ? 388  ILE C CG2   1 
ATOM   8527  C  CD1   . ILE G 2 199 ? 45.631  114.808 122.652 1.00 29.96 ? 388  ILE C CD1   1 
ATOM   8528  N  N     . THR G 2 200 ? 48.967  119.330 121.732 1.00 28.31 ? 389  THR C N     1 
ATOM   8529  C  CA    . THR G 2 200 ? 49.254  120.562 121.030 1.00 29.50 ? 389  THR C CA    1 
ATOM   8530  C  C     . THR G 2 200 ? 49.426  120.213 119.554 1.00 29.28 ? 389  THR C C     1 
ATOM   8531  O  O     . THR G 2 200 ? 49.796  119.083 119.235 1.00 28.54 ? 389  THR C O     1 
ATOM   8532  C  CB    . THR G 2 200 ? 50.519  121.202 121.669 1.00 30.70 ? 389  THR C CB    1 
ATOM   8533  O  OG1   . THR G 2 200 ? 50.117  122.302 122.498 1.00 33.85 ? 389  THR C OG1   1 
ATOM   8534  C  CG2   . THR G 2 200 ? 51.490  121.661 120.635 1.00 32.70 ? 389  THR C CG2   1 
ATOM   8535  N  N     . PHE G 2 201 ? 49.177  121.169 118.660 1.00 29.18 ? 390  PHE C N     1 
ATOM   8536  C  CA    . PHE G 2 201 ? 49.228  120.874 117.232 1.00 30.63 ? 390  PHE C CA    1 
ATOM   8537  C  C     . PHE G 2 201 ? 50.381  121.389 116.373 1.00 32.01 ? 390  PHE C C     1 
ATOM   8538  O  O     . PHE G 2 201 ? 50.211  121.528 115.160 1.00 32.55 ? 390  PHE C O     1 
ATOM   8539  C  CB    . PHE G 2 201 ? 47.908  121.316 116.582 1.00 29.84 ? 390  PHE C CB    1 
ATOM   8540  C  CG    . PHE G 2 201 ? 46.676  120.805 117.287 1.00 30.00 ? 390  PHE C CG    1 
ATOM   8541  C  CD1   . PHE G 2 201 ? 45.865  121.667 118.013 1.00 30.26 ? 390  PHE C CD1   1 
ATOM   8542  C  CD2   . PHE G 2 201 ? 46.336  119.460 117.240 1.00 29.00 ? 390  PHE C CD2   1 
ATOM   8543  C  CE1   . PHE G 2 201 ? 44.736  121.191 118.679 1.00 30.09 ? 390  PHE C CE1   1 
ATOM   8544  C  CE2   . PHE G 2 201 ? 45.218  118.986 117.902 1.00 28.68 ? 390  PHE C CE2   1 
ATOM   8545  C  CZ    . PHE G 2 201 ? 44.418  119.849 118.621 1.00 29.25 ? 390  PHE C CZ    1 
ATOM   8546  N  N     . GLU G 2 202 ? 51.543  121.654 116.969 1.00 33.36 ? 391  GLU C N     1 
ATOM   8547  C  CA    . GLU G 2 202 ? 52.696  122.168 116.213 1.00 34.06 ? 391  GLU C CA    1 
ATOM   8548  C  C     . GLU G 2 202 ? 53.184  121.214 115.125 1.00 33.14 ? 391  GLU C C     1 
ATOM   8549  O  O     . GLU G 2 202 ? 53.623  121.655 114.063 1.00 33.13 ? 391  GLU C O     1 
ATOM   8550  C  CB    . GLU G 2 202 ? 53.885  122.451 117.139 1.00 36.15 ? 391  GLU C CB    1 
ATOM   8551  C  CG    . GLU G 2 202 ? 53.561  122.367 118.612 1.00 40.04 ? 391  GLU C CG    1 
ATOM   8552  C  CD    . GLU G 2 202 ? 53.326  123.726 119.194 1.00 42.36 ? 391  GLU C CD    1 
ATOM   8553  O  OE1   . GLU G 2 202 ? 53.339  124.690 118.398 1.00 44.60 ? 391  GLU C OE1   1 
ATOM   8554  O  OE2   . GLU G 2 202 ? 53.136  123.837 120.425 1.00 42.70 ? 391  GLU C OE2   1 
ATOM   8555  N  N     . ASP G 2 203 ? 53.130  119.914 115.402 1.00 32.12 ? 392  ASP C N     1 
ATOM   8556  C  CA    . ASP G 2 203 ? 53.584  118.915 114.440 1.00 30.80 ? 392  ASP C CA    1 
ATOM   8557  C  C     . ASP G 2 203 ? 52.457  118.216 113.688 1.00 29.29 ? 392  ASP C C     1 
ATOM   8558  O  O     . ASP G 2 203 ? 52.676  117.175 113.073 1.00 29.25 ? 392  ASP C O     1 
ATOM   8559  C  CB    . ASP G 2 203 ? 54.445  117.872 115.145 1.00 31.98 ? 392  ASP C CB    1 
ATOM   8560  C  CG    . ASP G 2 203 ? 55.554  118.498 115.962 1.00 33.91 ? 392  ASP C CG    1 
ATOM   8561  O  OD1   . ASP G 2 203 ? 55.957  119.634 115.626 1.00 35.02 ? 392  ASP C OD1   1 
ATOM   8562  O  OD2   . ASP G 2 203 ? 56.030  117.860 116.929 1.00 34.66 ? 392  ASP C OD2   1 
ATOM   8563  N  N     . THR G 2 204 ? 51.255  118.779 113.741 1.00 27.48 ? 393  THR C N     1 
ATOM   8564  C  CA    . THR G 2 204 ? 50.119  118.180 113.046 1.00 26.77 ? 393  THR C CA    1 
ATOM   8565  C  C     . THR G 2 204 ? 50.183  118.544 111.563 1.00 26.66 ? 393  THR C C     1 
ATOM   8566  O  O     . THR G 2 204 ? 50.016  119.700 111.188 1.00 26.08 ? 393  THR C O     1 
ATOM   8567  C  CB    . THR G 2 204 ? 48.761  118.681 113.613 1.00 26.54 ? 393  THR C CB    1 
ATOM   8568  O  OG1   . THR G 2 204 ? 48.633  118.319 114.997 1.00 25.99 ? 393  THR C OG1   1 
ATOM   8569  C  CG2   . THR G 2 204 ? 47.612  118.063 112.830 1.00 27.02 ? 393  THR C CG2   1 
ATOM   8570  N  N     . ARG G 2 205 ? 50.424  117.550 110.724 1.00 26.98 ? 394  ARG C N     1 
ATOM   8571  C  CA    . ARG G 2 205 ? 50.507  117.773 109.292 1.00 28.34 ? 394  ARG C CA    1 
ATOM   8572  C  C     . ARG G 2 205 ? 49.190  117.410 108.602 1.00 27.79 ? 394  ARG C C     1 
ATOM   8573  O  O     . ARG G 2 205 ? 48.946  117.818 107.459 1.00 28.44 ? 394  ARG C O     1 
ATOM   8574  C  CB    . ARG G 2 205 ? 51.668  116.953 108.716 1.00 31.11 ? 394  ARG C CB    1 
ATOM   8575  C  CG    . ARG G 2 205 ? 53.014  117.349 109.313 1.00 35.20 ? 394  ARG C CG    1 
ATOM   8576  C  CD    . ARG G 2 205 ? 54.184  116.631 108.676 1.00 39.31 ? 394  ARG C CD    1 
ATOM   8577  N  NE    . ARG G 2 205 ? 55.456  117.269 109.019 1.00 43.76 ? 394  ARG C NE    1 
ATOM   8578  C  CZ    . ARG G 2 205 ? 55.985  117.311 110.245 1.00 46.52 ? 394  ARG C CZ    1 
ATOM   8579  N  NH1   . ARG G 2 205 ? 55.364  116.745 111.282 1.00 46.42 ? 394  ARG C NH1   1 
ATOM   8580  N  NH2   . ARG G 2 205 ? 57.147  117.931 110.437 1.00 48.15 ? 394  ARG C NH2   1 
ATOM   8581  N  N     . PHE G 2 206 ? 48.341  116.655 109.303 1.00 26.05 ? 395  PHE C N     1 
ATOM   8582  C  CA    . PHE G 2 206 ? 47.044  116.247 108.764 1.00 25.14 ? 395  PHE C CA    1 
ATOM   8583  C  C     . PHE G 2 206 ? 45.929  116.365 109.783 1.00 24.70 ? 395  PHE C C     1 
ATOM   8584  O  O     . PHE G 2 206 ? 46.052  115.907 110.920 1.00 24.68 ? 395  PHE C O     1 
ATOM   8585  C  CB    . PHE G 2 206 ? 47.046  114.790 108.308 1.00 24.18 ? 395  PHE C CB    1 
ATOM   8586  C  CG    . PHE G 2 206 ? 48.034  114.474 107.233 1.00 24.57 ? 395  PHE C CG    1 
ATOM   8587  C  CD1   . PHE G 2 206 ? 49.361  114.207 107.549 1.00 24.94 ? 395  PHE C CD1   1 
ATOM   8588  C  CD2   . PHE G 2 206 ? 47.615  114.353 105.912 1.00 23.74 ? 395  PHE C CD2   1 
ATOM   8589  C  CE1   . PHE G 2 206 ? 50.268  113.808 106.558 1.00 26.10 ? 395  PHE C CE1   1 
ATOM   8590  C  CE2   . PHE G 2 206 ? 48.496  113.959 104.917 1.00 25.51 ? 395  PHE C CE2   1 
ATOM   8591  C  CZ    . PHE G 2 206 ? 49.834  113.680 105.240 1.00 25.90 ? 395  PHE C CZ    1 
ATOM   8592  N  N     . VAL G 2 207 ? 44.833  116.974 109.355 1.00 24.90 ? 396  VAL C N     1 
ATOM   8593  C  CA    . VAL G 2 207 ? 43.655  117.116 110.177 1.00 24.65 ? 396  VAL C CA    1 
ATOM   8594  C  C     . VAL G 2 207 ? 42.547  116.523 109.309 1.00 24.68 ? 396  VAL C C     1 
ATOM   8595  O  O     . VAL G 2 207 ? 42.302  116.964 108.199 1.00 24.74 ? 396  VAL C O     1 
ATOM   8596  C  CB    . VAL G 2 207 ? 43.357  118.588 110.499 1.00 25.32 ? 396  VAL C CB    1 
ATOM   8597  C  CG1   . VAL G 2 207 ? 42.035  118.702 111.224 1.00 24.80 ? 396  VAL C CG1   1 
ATOM   8598  C  CG2   . VAL G 2 207 ? 44.471  119.163 111.367 1.00 25.13 ? 396  VAL C CG2   1 
ATOM   8599  N  N     . VAL G 2 208 ? 41.896  115.492 109.817 1.00 25.16 ? 397  VAL C N     1 
ATOM   8600  C  CA    . VAL G 2 208 ? 40.838  114.841 109.072 1.00 24.24 ? 397  VAL C CA    1 
ATOM   8601  C  C     . VAL G 2 208 ? 39.505  114.997 109.781 1.00 24.07 ? 397  VAL C C     1 
ATOM   8602  O  O     . VAL G 2 208 ? 39.382  114.703 110.970 1.00 22.99 ? 397  VAL C O     1 
ATOM   8603  C  CB    . VAL G 2 208 ? 41.135  113.330 108.901 1.00 25.33 ? 397  VAL C CB    1 
ATOM   8604  C  CG1   . VAL G 2 208 ? 39.955  112.633 108.220 1.00 25.07 ? 397  VAL C CG1   1 
ATOM   8605  C  CG2   . VAL G 2 208 ? 42.416  113.137 108.093 1.00 24.17 ? 397  VAL C CG2   1 
ATOM   8606  N  N     . LEU G 2 209 ? 38.511  115.493 109.051 1.00 24.06 ? 398  LEU C N     1 
ATOM   8607  C  CA    . LEU G 2 209 ? 37.179  115.630 109.614 1.00 23.41 ? 398  LEU C CA    1 
ATOM   8608  C  C     . LEU G 2 209 ? 36.373  114.570 108.925 1.00 22.62 ? 398  LEU C C     1 
ATOM   8609  O  O     . LEU G 2 209 ? 36.016  114.721 107.765 1.00 22.04 ? 398  LEU C O     1 
ATOM   8610  C  CB    . LEU G 2 209 ? 36.545  117.002 109.314 1.00 24.08 ? 398  LEU C CB    1 
ATOM   8611  C  CG    . LEU G 2 209 ? 37.225  118.282 109.813 1.00 26.08 ? 398  LEU C CG    1 
ATOM   8612  C  CD1   . LEU G 2 209 ? 36.323  119.488 109.535 1.00 27.44 ? 398  LEU C CD1   1 
ATOM   8613  C  CD2   . LEU G 2 209 ? 37.489  118.170 111.290 1.00 26.15 ? 398  LEU C CD2   1 
ATOM   8614  N  N     . ASP G 2 210 ? 36.126  113.468 109.614 1.00 23.96 ? 399  ASP C N     1 
ATOM   8615  C  CA    . ASP G 2 210 ? 35.300  112.434 109.025 1.00 24.02 ? 399  ASP C CA    1 
ATOM   8616  C  C     . ASP G 2 210 ? 33.876  112.922 109.331 1.00 23.04 ? 399  ASP C C     1 
ATOM   8617  O  O     . ASP G 2 210 ? 33.691  113.714 110.261 1.00 21.39 ? 399  ASP C O     1 
ATOM   8618  C  CB    . ASP G 2 210 ? 35.584  111.090 109.675 1.00 26.26 ? 399  ASP C CB    1 
ATOM   8619  C  CG    . ASP G 2 210 ? 34.969  109.931 108.896 1.00 29.11 ? 399  ASP C CG    1 
ATOM   8620  O  OD1   . ASP G 2 210 ? 34.386  110.188 107.810 1.00 29.14 ? 399  ASP C OD1   1 
ATOM   8621  O  OD2   . ASP G 2 210 ? 35.068  108.774 109.372 1.00 30.04 ? 399  ASP C OD2   1 
ATOM   8622  N  N     . GLU G 2 211 ? 32.880  112.470 108.565 1.00 21.28 ? 400  GLU C N     1 
ATOM   8623  C  CA    . GLU G 2 211 ? 31.510  112.949 108.769 1.00 19.96 ? 400  GLU C CA    1 
ATOM   8624  C  C     . GLU G 2 211 ? 31.593  114.486 108.881 1.00 20.08 ? 400  GLU C C     1 
ATOM   8625  O  O     . GLU G 2 211 ? 30.934  115.112 109.728 1.00 17.94 ? 400  GLU C O     1 
ATOM   8626  C  CB    . GLU G 2 211 ? 30.932  112.357 110.054 1.00 19.79 ? 400  GLU C CB    1 
ATOM   8627  C  CG    . GLU G 2 211 ? 30.889  110.817 110.103 1.00 21.64 ? 400  GLU C CG    1 
ATOM   8628  C  CD    . GLU G 2 211 ? 30.177  110.194 108.906 1.00 23.54 ? 400  GLU C CD    1 
ATOM   8629  O  OE1   . GLU G 2 211 ? 29.389  110.892 108.237 1.00 24.26 ? 400  GLU C OE1   1 
ATOM   8630  O  OE2   . GLU G 2 211 ? 30.392  108.999 108.628 1.00 25.50 ? 400  GLU C OE2   1 
ATOM   8631  N  N     . ALA G 2 212 ? 32.407  115.082 108.008 1.00 20.92 ? 401  ALA C N     1 
ATOM   8632  C  CA    . ALA G 2 212 ? 32.671  116.526 108.037 1.00 21.71 ? 401  ALA C CA    1 
ATOM   8633  C  C     . ALA G 2 212 ? 31.477  117.471 108.088 1.00 22.66 ? 401  ALA C C     1 
ATOM   8634  O  O     . ALA G 2 212 ? 31.511  118.452 108.826 1.00 23.43 ? 401  ALA C O     1 
ATOM   8635  C  CB    . ALA G 2 212 ? 33.573  116.912 106.886 1.00 20.68 ? 401  ALA C CB    1 
ATOM   8636  N  N     . ASP G 2 213 ? 30.426  117.205 107.320 1.00 23.11 ? 402  ASP C N     1 
ATOM   8637  C  CA    . ASP G 2 213 ? 29.305  118.125 107.350 1.00 23.94 ? 402  ASP C CA    1 
ATOM   8638  C  C     . ASP G 2 213 ? 28.718  118.172 108.755 1.00 24.09 ? 402  ASP C C     1 
ATOM   8639  O  O     . ASP G 2 213 ? 28.266  119.219 109.199 1.00 25.04 ? 402  ASP C O     1 
ATOM   8640  C  CB    . ASP G 2 213 ? 28.236  117.754 106.323 1.00 23.81 ? 402  ASP C CB    1 
ATOM   8641  C  CG    . ASP G 2 213 ? 27.717  116.347 106.497 1.00 25.95 ? 402  ASP C CG    1 
ATOM   8642  O  OD1   . ASP G 2 213 ? 26.512  116.139 106.224 1.00 25.71 ? 402  ASP C OD1   1 
ATOM   8643  O  OD2   . ASP G 2 213 ? 28.509  115.461 106.898 1.00 24.36 ? 402  ASP C OD2   1 
ATOM   8644  N  N     . ARG G 2 214 ? 28.750  117.050 109.464 1.00 24.16 ? 403  ARG C N     1 
ATOM   8645  C  CA    . ARG G 2 214 ? 28.253  117.022 110.828 1.00 23.66 ? 403  ARG C CA    1 
ATOM   8646  C  C     . ARG G 2 214 ? 29.224  117.770 111.768 1.00 23.90 ? 403  ARG C C     1 
ATOM   8647  O  O     . ARG G 2 214 ? 28.795  118.484 112.672 1.00 24.79 ? 403  ARG C O     1 
ATOM   8648  C  CB    . ARG G 2 214 ? 28.087  115.579 111.307 1.00 24.16 ? 403  ARG C CB    1 
ATOM   8649  C  CG    . ARG G 2 214 ? 27.421  115.461 112.692 1.00 25.88 ? 403  ARG C CG    1 
ATOM   8650  C  CD    . ARG G 2 214 ? 26.019  116.064 112.678 1.00 27.30 ? 403  ARG C CD    1 
ATOM   8651  N  NE    . ARG G 2 214 ? 25.402  115.988 113.994 1.00 32.53 ? 403  ARG C NE    1 
ATOM   8652  C  CZ    . ARG G 2 214 ? 24.205  116.482 114.314 1.00 33.99 ? 403  ARG C CZ    1 
ATOM   8653  N  NH1   . ARG G 2 214 ? 23.463  117.106 113.407 1.00 33.82 ? 403  ARG C NH1   1 
ATOM   8654  N  NH2   . ARG G 2 214 ? 23.750  116.351 115.554 1.00 34.61 ? 403  ARG C NH2   1 
ATOM   8655  N  N     . MET G 2 215 ? 30.528  117.620 111.555 1.00 22.94 ? 404  MET C N     1 
ATOM   8656  C  CA    . MET G 2 215 ? 31.504  118.295 112.406 1.00 24.03 ? 404  MET C CA    1 
ATOM   8657  C  C     . MET G 2 215 ? 31.487  119.809 112.203 1.00 24.61 ? 404  MET C C     1 
ATOM   8658  O  O     . MET G 2 215 ? 32.017  120.543 113.020 1.00 24.62 ? 404  MET C O     1 
ATOM   8659  C  CB    . MET G 2 215 ? 32.925  117.796 112.117 1.00 23.57 ? 404  MET C CB    1 
ATOM   8660  C  CG    . MET G 2 215 ? 33.117  116.297 112.189 1.00 24.46 ? 404  MET C CG    1 
ATOM   8661  S  SD    . MET G 2 215 ? 32.481  115.589 113.719 1.00 26.44 ? 404  MET C SD    1 
ATOM   8662  C  CE    . MET G 2 215 ? 33.373  116.560 114.973 1.00 25.49 ? 404  MET C CE    1 
ATOM   8663  N  N     . LEU G 2 216 ? 30.899  120.267 111.106 1.00 26.32 ? 405  LEU C N     1 
ATOM   8664  C  CA    . LEU G 2 216 ? 30.855  121.695 110.800 1.00 28.33 ? 405  LEU C CA    1 
ATOM   8665  C  C     . LEU G 2 216 ? 29.496  122.337 111.020 1.00 30.23 ? 405  LEU C C     1 
ATOM   8666  O  O     . LEU G 2 216 ? 29.365  123.544 110.907 1.00 29.99 ? 405  LEU C O     1 
ATOM   8667  C  CB    . LEU G 2 216 ? 31.278  121.931 109.351 1.00 27.06 ? 405  LEU C CB    1 
ATOM   8668  C  CG    . LEU G 2 216 ? 32.731  121.613 108.995 1.00 27.76 ? 405  LEU C CG    1 
ATOM   8669  C  CD1   . LEU G 2 216 ? 32.889  121.491 107.469 1.00 26.57 ? 405  LEU C CD1   1 
ATOM   8670  C  CD2   . LEU G 2 216 ? 33.640  122.705 109.581 1.00 27.01 ? 405  LEU C CD2   1 
ATOM   8671  N  N     . ASP G 2 217 ? 28.475  121.544 111.318 1.00 32.86 ? 406  ASP C N     1 
ATOM   8672  C  CA    . ASP G 2 217 ? 27.170  122.137 111.543 1.00 35.36 ? 406  ASP C CA    1 
ATOM   8673  C  C     . ASP G 2 217 ? 27.164  122.839 112.896 1.00 36.14 ? 406  ASP C C     1 
ATOM   8674  O  O     . ASP G 2 217 ? 28.119  122.732 113.665 1.00 35.31 ? 406  ASP C O     1 
ATOM   8675  C  CB    . ASP G 2 217 ? 26.052  121.091 111.491 1.00 37.38 ? 406  ASP C CB    1 
ATOM   8676  C  CG    . ASP G 2 217 ? 24.760  121.656 110.903 1.00 40.78 ? 406  ASP C CG    1 
ATOM   8677  O  OD1   . ASP G 2 217 ? 24.490  122.867 111.105 1.00 41.40 ? 406  ASP C OD1   1 
ATOM   8678  O  OD2   . ASP G 2 217 ? 24.010  120.894 110.243 1.00 42.61 ? 406  ASP C OD2   1 
ATOM   8679  N  N     . MET G 2 218 ? 26.063  123.528 113.183 1.00 37.04 ? 407  MET C N     1 
ATOM   8680  C  CA    . MET G 2 218 ? 25.912  124.309 114.405 1.00 38.14 ? 407  MET C CA    1 
ATOM   8681  C  C     . MET G 2 218 ? 26.364  123.661 115.705 1.00 36.44 ? 407  MET C C     1 
ATOM   8682  O  O     . MET G 2 218 ? 27.078  124.278 116.489 1.00 36.66 ? 407  MET C O     1 
ATOM   8683  C  CB    . MET G 2 218 ? 24.455  124.773 114.560 1.00 41.95 ? 407  MET C CB    1 
ATOM   8684  C  CG    . MET G 2 218 ? 23.791  125.227 113.261 1.00 47.07 ? 407  MET C CG    1 
ATOM   8685  S  SD    . MET G 2 218 ? 22.169  126.058 113.495 1.00 53.73 ? 407  MET C SD    1 
ATOM   8686  C  CE    . MET G 2 218 ? 21.329  124.886 114.620 1.00 51.93 ? 407  MET C CE    1 
ATOM   8687  N  N     . GLY G 2 219 ? 25.946  122.428 115.949 1.00 35.31 ? 408  GLY C N     1 
ATOM   8688  C  CA    . GLY G 2 219 ? 26.319  121.774 117.191 1.00 33.44 ? 408  GLY C CA    1 
ATOM   8689  C  C     . GLY G 2 219 ? 27.811  121.652 117.454 1.00 33.06 ? 408  GLY C C     1 
ATOM   8690  O  O     . GLY G 2 219 ? 28.253  121.885 118.571 1.00 33.69 ? 408  GLY C O     1 
ATOM   8691  N  N     . PHE G 2 220 ? 28.589  121.296 116.435 1.00 31.80 ? 409  PHE C N     1 
ATOM   8692  C  CA    . PHE G 2 220 ? 30.027  121.125 116.592 1.00 31.27 ? 409  PHE C CA    1 
ATOM   8693  C  C     . PHE G 2 220 ? 30.901  122.284 116.116 1.00 32.33 ? 409  PHE C C     1 
ATOM   8694  O  O     . PHE G 2 220 ? 32.096  122.290 116.412 1.00 31.40 ? 409  PHE C O     1 
ATOM   8695  C  CB    . PHE G 2 220 ? 30.502  119.855 115.843 1.00 27.77 ? 409  PHE C CB    1 
ATOM   8696  C  CG    . PHE G 2 220 ? 30.237  118.566 116.577 1.00 24.92 ? 409  PHE C CG    1 
ATOM   8697  C  CD1   . PHE G 2 220 ? 29.441  117.582 116.011 1.00 23.61 ? 409  PHE C CD1   1 
ATOM   8698  C  CD2   . PHE G 2 220 ? 30.809  118.326 117.822 1.00 23.24 ? 409  PHE C CD2   1 
ATOM   8699  C  CE1   . PHE G 2 220 ? 29.215  116.376 116.667 1.00 22.96 ? 409  PHE C CE1   1 
ATOM   8700  C  CE2   . PHE G 2 220 ? 30.593  117.137 118.485 1.00 23.22 ? 409  PHE C CE2   1 
ATOM   8701  C  CZ    . PHE G 2 220 ? 29.788  116.147 117.905 1.00 22.56 ? 409  PHE C CZ    1 
ATOM   8702  N  N     . SER G 2 221 ? 30.334  123.247 115.389 1.00 33.43 ? 410  SER C N     1 
ATOM   8703  C  CA    . SER G 2 221 ? 31.150  124.333 114.829 1.00 36.04 ? 410  SER C CA    1 
ATOM   8704  C  C     . SER G 2 221 ? 32.100  125.076 115.760 1.00 36.43 ? 410  SER C C     1 
ATOM   8705  O  O     . SER G 2 221 ? 33.254  125.279 115.409 1.00 36.04 ? 410  SER C O     1 
ATOM   8706  C  CB    . SER G 2 221 ? 30.282  125.341 114.057 1.00 36.21 ? 410  SER C CB    1 
ATOM   8707  O  OG    . SER G 2 221 ? 29.269  125.893 114.871 1.00 39.96 ? 410  SER C OG    1 
ATOM   8708  N  N     . GLU G 2 222 ? 31.644  125.474 116.939 1.00 38.61 ? 411  GLU C N     1 
ATOM   8709  C  CA    . GLU G 2 222 ? 32.532  126.182 117.867 1.00 41.34 ? 411  GLU C CA    1 
ATOM   8710  C  C     . GLU G 2 222 ? 33.800  125.388 118.185 1.00 41.53 ? 411  GLU C C     1 
ATOM   8711  O  O     . GLU G 2 222 ? 34.918  125.859 117.957 1.00 42.53 ? 411  GLU C O     1 
ATOM   8712  C  CB    . GLU G 2 222 ? 31.822  126.473 119.186 1.00 42.77 ? 411  GLU C CB    1 
ATOM   8713  C  CG    . GLU G 2 222 ? 31.011  127.743 119.216 1.00 46.37 ? 411  GLU C CG    1 
ATOM   8714  C  CD    . GLU G 2 222 ? 30.351  127.953 120.573 1.00 47.61 ? 411  GLU C CD    1 
ATOM   8715  O  OE1   . GLU G 2 222 ? 31.087  127.977 121.588 1.00 47.50 ? 411  GLU C OE1   1 
ATOM   8716  O  OE2   . GLU G 2 222 ? 29.102  128.088 120.619 1.00 48.99 ? 411  GLU C OE2   1 
ATOM   8717  N  N     . ASP G 2 223 ? 33.608  124.194 118.739 1.00 41.18 ? 412  ASP C N     1 
ATOM   8718  C  CA    . ASP G 2 223 ? 34.709  123.316 119.110 1.00 41.28 ? 412  ASP C CA    1 
ATOM   8719  C  C     . ASP G 2 223 ? 35.587  123.025 117.924 1.00 40.14 ? 412  ASP C C     1 
ATOM   8720  O  O     . ASP G 2 223 ? 36.808  123.021 118.030 1.00 39.89 ? 412  ASP C O     1 
ATOM   8721  C  CB    . ASP G 2 223 ? 34.168  122.008 119.671 1.00 43.54 ? 412  ASP C CB    1 
ATOM   8722  C  CG    . ASP G 2 223 ? 33.636  122.159 121.081 1.00 46.24 ? 412  ASP C CG    1 
ATOM   8723  O  OD1   . ASP G 2 223 ? 33.371  123.311 121.504 1.00 48.68 ? 412  ASP C OD1   1 
ATOM   8724  O  OD2   . ASP G 2 223 ? 33.480  121.127 121.766 1.00 47.42 ? 412  ASP C OD2   1 
ATOM   8725  N  N     . MET G 2 224 ? 34.956  122.786 116.786 1.00 39.34 ? 413  MET C N     1 
ATOM   8726  C  CA    . MET G 2 224 ? 35.694  122.495 115.581 1.00 39.51 ? 413  MET C CA    1 
ATOM   8727  C  C     . MET G 2 224 ? 36.563  123.708 115.260 1.00 39.67 ? 413  MET C C     1 
ATOM   8728  O  O     . MET G 2 224 ? 37.729  123.571 114.904 1.00 39.12 ? 413  MET C O     1 
ATOM   8729  C  CB    . MET G 2 224 ? 34.715  122.175 114.448 1.00 39.68 ? 413  MET C CB    1 
ATOM   8730  C  CG    . MET G 2 224 ? 35.225  121.168 113.435 1.00 40.95 ? 413  MET C CG    1 
ATOM   8731  S  SD    . MET G 2 224 ? 36.066  119.711 114.153 1.00 42.31 ? 413  MET C SD    1 
ATOM   8732  C  CE    . MET G 2 224 ? 35.103  119.411 115.622 1.00 42.05 ? 413  MET C CE    1 
ATOM   8733  N  N     . ARG G 2 225 ? 36.003  124.901 115.412 1.00 39.90 ? 414  ARG C N     1 
ATOM   8734  C  CA    . ARG G 2 225 ? 36.780  126.106 115.146 1.00 40.32 ? 414  ARG C CA    1 
ATOM   8735  C  C     . ARG G 2 225 ? 37.927  126.258 116.144 1.00 38.82 ? 414  ARG C C     1 
ATOM   8736  O  O     . ARG G 2 225 ? 39.018  126.642 115.762 1.00 38.44 ? 414  ARG C O     1 
ATOM   8737  C  CB    . ARG G 2 225 ? 35.877  127.353 115.170 1.00 42.28 ? 414  ARG C CB    1 
ATOM   8738  C  CG    . ARG G 2 225 ? 36.631  128.679 115.181 1.00 44.89 ? 414  ARG C CG    1 
ATOM   8739  C  CD    . ARG G 2 225 ? 35.753  129.878 114.813 1.00 47.11 ? 414  ARG C CD    1 
ATOM   8740  N  NE    . ARG G 2 225 ? 35.936  130.261 113.418 1.00 50.44 ? 414  ARG C NE    1 
ATOM   8741  C  CZ    . ARG G 2 225 ? 35.236  129.763 112.405 1.00 52.49 ? 414  ARG C CZ    1 
ATOM   8742  N  NH1   . ARG G 2 225 ? 34.284  128.865 112.627 1.00 53.71 ? 414  ARG C NH1   1 
ATOM   8743  N  NH2   . ARG G 2 225 ? 35.511  130.133 111.164 1.00 52.74 ? 414  ARG C NH2   1 
ATOM   8744  N  N     . ARG G 2 226 ? 37.690  125.944 117.415 1.00 38.19 ? 415  ARG C N     1 
ATOM   8745  C  CA    . ARG G 2 226 ? 38.741  126.060 118.432 1.00 38.03 ? 415  ARG C CA    1 
ATOM   8746  C  C     . ARG G 2 226 ? 39.925  125.134 118.157 1.00 37.97 ? 415  ARG C C     1 
ATOM   8747  O  O     . ARG G 2 226 ? 41.054  125.433 118.530 1.00 37.37 ? 415  ARG C O     1 
ATOM   8748  C  CB    . ARG G 2 226 ? 38.198  125.730 119.825 1.00 37.51 ? 415  ARG C CB    1 
ATOM   8749  C  CG    . ARG G 2 226 ? 37.119  126.653 120.337 1.00 38.49 ? 415  ARG C CG    1 
ATOM   8750  C  CD    . ARG G 2 226 ? 36.788  126.284 121.769 1.00 39.24 ? 415  ARG C CD    1 
ATOM   8751  N  NE    . ARG G 2 226 ? 38.009  126.269 122.560 1.00 40.01 ? 415  ARG C NE    1 
ATOM   8752  C  CZ    . ARG G 2 226 ? 38.191  125.545 123.655 1.00 40.01 ? 415  ARG C CZ    1 
ATOM   8753  N  NH1   . ARG G 2 226 ? 37.226  124.758 124.113 1.00 39.74 ? 415  ARG C NH1   1 
ATOM   8754  N  NH2   . ARG G 2 226 ? 39.356  125.606 124.285 1.00 40.78 ? 415  ARG C NH2   1 
ATOM   8755  N  N     . ILE G 2 227 ? 39.654  123.993 117.535 1.00 38.45 ? 416  ILE C N     1 
ATOM   8756  C  CA    . ILE G 2 227 ? 40.702  123.035 117.216 1.00 39.19 ? 416  ILE C CA    1 
ATOM   8757  C  C     . ILE G 2 227 ? 41.497  123.507 116.009 1.00 39.43 ? 416  ILE C C     1 
ATOM   8758  O  O     . ILE G 2 227 ? 42.711  123.691 116.074 1.00 38.83 ? 416  ILE C O     1 
ATOM   8759  C  CB    . ILE G 2 227 ? 40.105  121.653 116.891 1.00 39.03 ? 416  ILE C CB    1 
ATOM   8760  C  CG1   . ILE G 2 227 ? 39.378  121.112 118.122 1.00 40.23 ? 416  ILE C CG1   1 
ATOM   8761  C  CG2   . ILE G 2 227 ? 41.207  120.690 116.443 1.00 38.89 ? 416  ILE C CG2   1 
ATOM   8762  C  CD1   . ILE G 2 227 ? 38.671  119.783 117.889 1.00 40.28 ? 416  ILE C CD1   1 
ATOM   8763  N  N     . MET G 2 228 ? 40.783  123.712 114.910 1.00 40.44 ? 417  MET C N     1 
ATOM   8764  C  CA    . MET G 2 228 ? 41.366  124.142 113.645 1.00 41.55 ? 417  MET C CA    1 
ATOM   8765  C  C     . MET G 2 228 ? 42.178  125.422 113.688 1.00 40.95 ? 417  MET C C     1 
ATOM   8766  O  O     . MET G 2 228 ? 43.239  125.530 113.085 1.00 41.20 ? 417  MET C O     1 
ATOM   8767  C  CB    . MET G 2 228 ? 40.259  124.337 112.631 1.00 43.23 ? 417  MET C CB    1 
ATOM   8768  C  CG    . MET G 2 228 ? 40.475  123.534 111.398 1.00 48.19 ? 417  MET C CG    1 
ATOM   8769  S  SD    . MET G 2 228 ? 39.939  121.868 111.703 1.00 51.31 ? 417  MET C SD    1 
ATOM   8770  C  CE    . MET G 2 228 ? 38.244  122.069 111.059 1.00 49.42 ? 417  MET C CE    1 
ATOM   8771  N  N     . THR G 2 229 ? 41.636  126.397 114.395 1.00 40.14 ? 418  THR C N     1 
ATOM   8772  C  CA    . THR G 2 229 ? 42.218  127.714 114.540 1.00 39.71 ? 418  THR C CA    1 
ATOM   8773  C  C     . THR G 2 229 ? 43.057  127.866 115.816 1.00 38.61 ? 418  THR C C     1 
ATOM   8774  O  O     . THR G 2 229 ? 43.417  128.976 116.211 1.00 38.16 ? 418  THR C O     1 
ATOM   8775  C  CB    . THR G 2 229 ? 41.056  128.739 114.501 1.00 40.58 ? 418  THR C CB    1 
ATOM   8776  O  OG1   . THR G 2 229 ? 40.665  128.939 113.133 1.00 41.74 ? 418  THR C OG1   1 
ATOM   8777  C  CG2   . THR G 2 229 ? 41.432  130.049 115.142 1.00 42.06 ? 418  THR C CG2   1 
ATOM   8778  N  N     . HIS G 2 230 ? 43.386  126.750 116.453 1.00 36.61 ? 419  HIS C N     1 
ATOM   8779  C  CA    . HIS G 2 230 ? 44.167  126.809 117.678 1.00 36.13 ? 419  HIS C CA    1 
ATOM   8780  C  C     . HIS G 2 230 ? 45.514  127.502 117.469 1.00 36.68 ? 419  HIS C C     1 
ATOM   8781  O  O     . HIS G 2 230 ? 46.104  127.432 116.389 1.00 36.05 ? 419  HIS C O     1 
ATOM   8782  C  CB    . HIS G 2 230 ? 44.405  125.417 118.231 1.00 34.69 ? 419  HIS C CB    1 
ATOM   8783  C  CG    . HIS G 2 230 ? 44.878  125.414 119.647 1.00 33.32 ? 419  HIS C CG    1 
ATOM   8784  N  ND1   . HIS G 2 230 ? 44.027  125.600 120.715 1.00 32.70 ? 419  HIS C ND1   1 
ATOM   8785  C  CD2   . HIS G 2 230 ? 46.117  125.282 120.168 1.00 32.35 ? 419  HIS C CD2   1 
ATOM   8786  C  CE1   . HIS G 2 230 ? 44.723  125.580 121.836 1.00 31.95 ? 419  HIS C CE1   1 
ATOM   8787  N  NE2   . HIS G 2 230 ? 45.994  125.389 121.531 1.00 32.44 ? 419  HIS C NE2   1 
ATOM   8788  N  N     . VAL G 2 231 ? 45.998  128.150 118.526 1.00 37.04 ? 420  VAL C N     1 
ATOM   8789  C  CA    . VAL G 2 231 ? 47.257  128.892 118.490 1.00 37.55 ? 420  VAL C CA    1 
ATOM   8790  C  C     . VAL G 2 231 ? 48.473  128.039 118.094 1.00 37.01 ? 420  VAL C C     1 
ATOM   8791  O  O     . VAL G 2 231 ? 49.348  128.491 117.352 1.00 36.66 ? 420  VAL C O     1 
ATOM   8792  C  CB    . VAL G 2 231 ? 47.527  129.579 119.864 1.00 37.66 ? 420  VAL C CB    1 
ATOM   8793  C  CG1   . VAL G 2 231 ? 47.837  128.544 120.916 1.00 38.25 ? 420  VAL C CG1   1 
ATOM   8794  C  CG2   . VAL G 2 231 ? 48.666  130.565 119.744 1.00 38.17 ? 420  VAL C CG2   1 
ATOM   8795  N  N     . THR G 2 232 ? 48.519  126.806 118.581 1.00 36.40 ? 421  THR C N     1 
ATOM   8796  C  CA    . THR G 2 232 ? 49.621  125.901 118.279 1.00 35.26 ? 421  THR C CA    1 
ATOM   8797  C  C     . THR G 2 232 ? 49.497  125.152 116.938 1.00 34.89 ? 421  THR C C     1 
ATOM   8798  O  O     . THR G 2 232 ? 50.393  124.398 116.563 1.00 35.27 ? 421  THR C O     1 
ATOM   8799  C  CB    . THR G 2 232 ? 49.745  124.863 119.371 1.00 35.61 ? 421  THR C CB    1 
ATOM   8800  O  OG1   . THR G 2 232 ? 48.518  124.127 119.448 1.00 35.33 ? 421  THR C OG1   1 
ATOM   8801  C  CG2   . THR G 2 232 ? 50.020  125.527 120.710 1.00 34.95 ? 421  THR C CG2   1 
ATOM   8802  N  N     . MET G 2 233 ? 48.402  125.354 116.216 1.00 34.67 ? 422  MET C N     1 
ATOM   8803  C  CA    . MET G 2 233 ? 48.209  124.660 114.938 1.00 35.04 ? 422  MET C CA    1 
ATOM   8804  C  C     . MET G 2 233 ? 49.283  124.967 113.889 1.00 35.75 ? 422  MET C C     1 
ATOM   8805  O  O     . MET G 2 233 ? 49.449  126.108 113.454 1.00 35.30 ? 422  MET C O     1 
ATOM   8806  C  CB    . MET G 2 233 ? 46.818  124.978 114.363 1.00 33.74 ? 422  MET C CB    1 
ATOM   8807  C  CG    . MET G 2 233 ? 46.491  124.270 113.051 1.00 33.81 ? 422  MET C CG    1 
ATOM   8808  S  SD    . MET G 2 233 ? 46.538  122.429 113.138 1.00 33.63 ? 422  MET C SD    1 
ATOM   8809  C  CE    . MET G 2 233 ? 45.034  122.097 114.164 1.00 29.17 ? 422  MET C CE    1 
ATOM   8810  N  N     . ARG G 2 234 ? 50.016  123.933 113.491 1.00 36.91 ? 423  ARG C N     1 
ATOM   8811  C  CA    . ARG G 2 234 ? 51.057  124.073 112.481 1.00 38.14 ? 423  ARG C CA    1 
ATOM   8812  C  C     . ARG G 2 234 ? 50.473  124.864 111.303 1.00 39.41 ? 423  ARG C C     1 
ATOM   8813  O  O     . ARG G 2 234 ? 49.449  124.483 110.732 1.00 39.06 ? 423  ARG C O     1 
ATOM   8814  C  CB    . ARG G 2 234 ? 51.505  122.680 112.023 1.00 38.88 ? 423  ARG C CB    1 
ATOM   8815  C  CG    . ARG G 2 234 ? 52.703  122.655 111.101 1.00 39.64 ? 423  ARG C CG    1 
ATOM   8816  C  CD    . ARG G 2 234 ? 53.209  121.226 110.936 1.00 41.54 ? 423  ARG C CD    1 
ATOM   8817  N  NE    . ARG G 2 234 ? 54.580  121.172 110.431 1.00 42.79 ? 423  ARG C NE    1 
ATOM   8818  C  CZ    . ARG G 2 234 ? 54.915  121.103 109.146 1.00 43.88 ? 423  ARG C CZ    1 
ATOM   8819  N  NH1   . ARG G 2 234 ? 53.979  121.074 108.200 1.00 43.21 ? 423  ARG C NH1   1 
ATOM   8820  N  NH2   . ARG G 2 234 ? 56.198  121.063 108.806 1.00 45.36 ? 423  ARG C NH2   1 
ATOM   8821  N  N     . PRO G 2 235 ? 51.110  125.988 110.935 1.00 40.41 ? 424  PRO C N     1 
ATOM   8822  C  CA    . PRO G 2 235 ? 50.644  126.827 109.829 1.00 40.19 ? 424  PRO C CA    1 
ATOM   8823  C  C     . PRO G 2 235 ? 50.381  126.043 108.546 1.00 40.72 ? 424  PRO C C     1 
ATOM   8824  O  O     . PRO G 2 235 ? 49.350  126.228 107.904 1.00 42.28 ? 424  PRO C O     1 
ATOM   8825  C  CB    . PRO G 2 235 ? 51.772  127.836 109.675 1.00 40.35 ? 424  PRO C CB    1 
ATOM   8826  C  CG    . PRO G 2 235 ? 52.247  127.997 111.081 1.00 40.56 ? 424  PRO C CG    1 
ATOM   8827  C  CD    . PRO G 2 235 ? 52.334  126.555 111.524 1.00 40.83 ? 424  PRO C CD    1 
ATOM   8828  N  N     . GLU G 2 236 ? 51.310  125.173 108.164 1.00 40.74 ? 425  GLU C N     1 
ATOM   8829  C  CA    . GLU G 2 236 ? 51.122  124.378 106.959 1.00 40.64 ? 425  GLU C CA    1 
ATOM   8830  C  C     . GLU G 2 236 ? 50.721  122.935 107.269 1.00 38.45 ? 425  GLU C C     1 
ATOM   8831  O  O     . GLU G 2 236 ? 51.535  122.123 107.695 1.00 38.31 ? 425  GLU C O     1 
ATOM   8832  C  CB    . GLU G 2 236 ? 52.384  124.404 106.078 1.00 43.35 ? 425  GLU C CB    1 
ATOM   8833  C  CG    . GLU G 2 236 ? 52.412  125.582 105.084 1.00 49.06 ? 425  GLU C CG    1 
ATOM   8834  C  CD    . GLU G 2 236 ? 53.453  125.424 103.968 1.00 53.79 ? 425  GLU C CD    1 
ATOM   8835  O  OE1   . GLU G 2 236 ? 53.398  124.407 103.215 1.00 55.39 ? 425  GLU C OE1   1 
ATOM   8836  O  OE2   . GLU G 2 236 ? 54.325  126.327 103.837 1.00 55.51 ? 425  GLU C OE2   1 
ATOM   8837  N  N     . HIS G 2 237 ? 49.448  122.633 107.068 1.00 35.40 ? 426  HIS C N     1 
ATOM   8838  C  CA    . HIS G 2 237 ? 48.939  121.296 107.304 1.00 33.30 ? 426  HIS C CA    1 
ATOM   8839  C  C     . HIS G 2 237 ? 47.852  121.037 106.281 1.00 32.62 ? 426  HIS C C     1 
ATOM   8840  O  O     . HIS G 2 237 ? 47.276  121.974 105.720 1.00 32.63 ? 426  HIS C O     1 
ATOM   8841  C  CB    . HIS G 2 237 ? 48.365  121.187 108.713 1.00 32.75 ? 426  HIS C CB    1 
ATOM   8842  C  CG    . HIS G 2 237 ? 47.233  122.128 108.975 1.00 33.10 ? 426  HIS C CG    1 
ATOM   8843  N  ND1   . HIS G 2 237 ? 45.917  121.793 108.736 1.00 32.87 ? 426  HIS C ND1   1 
ATOM   8844  C  CD2   . HIS G 2 237 ? 47.227  123.424 109.368 1.00 32.65 ? 426  HIS C CD2   1 
ATOM   8845  C  CE1   . HIS G 2 237 ? 45.150  122.844 108.963 1.00 33.10 ? 426  HIS C CE1   1 
ATOM   8846  N  NE2   . HIS G 2 237 ? 45.921  123.846 109.346 1.00 34.36 ? 426  HIS C NE2   1 
ATOM   8847  N  N     . GLN G 2 238 ? 47.590  119.768 106.004 1.00 30.83 ? 427  GLN C N     1 
ATOM   8848  C  CA    . GLN G 2 238 ? 46.536  119.436 105.068 1.00 29.29 ? 427  GLN C CA    1 
ATOM   8849  C  C     . GLN G 2 238 ? 45.266  119.241 105.875 1.00 27.84 ? 427  GLN C C     1 
ATOM   8850  O  O     . GLN G 2 238 ? 45.311  118.736 106.986 1.00 26.94 ? 427  GLN C O     1 
ATOM   8851  C  CB    . GLN G 2 238 ? 46.845  118.135 104.315 1.00 28.47 ? 427  GLN C CB    1 
ATOM   8852  C  CG    . GLN G 2 238 ? 47.903  118.257 103.253 1.00 28.09 ? 427  GLN C CG    1 
ATOM   8853  C  CD    . GLN G 2 238 ? 48.255  116.924 102.620 1.00 29.19 ? 427  GLN C CD    1 
ATOM   8854  O  OE1   . GLN G 2 238 ? 47.543  116.415 101.747 1.00 28.64 ? 427  GLN C OE1   1 
ATOM   8855  N  NE2   . GLN G 2 238 ? 49.356  116.343 103.071 1.00 29.44 ? 427  GLN C NE2   1 
ATOM   8856  N  N     . THR G 2 239 ? 44.138  119.663 105.318 1.00 27.15 ? 428  THR C N     1 
ATOM   8857  C  CA    . THR G 2 239 ? 42.856  119.461 105.963 1.00 26.45 ? 428  THR C CA    1 
ATOM   8858  C  C     . THR G 2 239 ? 42.063  118.599 104.993 1.00 25.53 ? 428  THR C C     1 
ATOM   8859  O  O     . THR G 2 239 ? 41.967  118.903 103.805 1.00 25.05 ? 428  THR C O     1 
ATOM   8860  C  CB    . THR G 2 239 ? 42.113  120.784 106.205 1.00 27.36 ? 428  THR C CB    1 
ATOM   8861  O  OG1   . THR G 2 239 ? 42.907  121.634 107.041 1.00 29.54 ? 428  THR C OG1   1 
ATOM   8862  C  CG2   . THR G 2 239 ? 40.802  120.527 106.912 1.00 26.18 ? 428  THR C CG2   1 
ATOM   8863  N  N     . LEU G 2 240 ? 41.517  117.503 105.494 1.00 25.26 ? 429  LEU C N     1 
ATOM   8864  C  CA    . LEU G 2 240 ? 40.730  116.610 104.656 1.00 24.48 ? 429  LEU C CA    1 
ATOM   8865  C  C     . LEU G 2 240 ? 39.338  116.431 105.285 1.00 23.95 ? 429  LEU C C     1 
ATOM   8866  O  O     . LEU G 2 240 ? 39.206  116.254 106.491 1.00 23.30 ? 429  LEU C O     1 
ATOM   8867  C  CB    . LEU G 2 240 ? 41.456  115.279 104.532 1.00 23.92 ? 429  LEU C CB    1 
ATOM   8868  C  CG    . LEU G 2 240 ? 42.968  115.442 104.333 1.00 25.19 ? 429  LEU C CG    1 
ATOM   8869  C  CD1   . LEU G 2 240 ? 43.598  114.068 104.411 1.00 24.61 ? 429  LEU C CD1   1 
ATOM   8870  C  CD2   . LEU G 2 240 ? 43.297  116.121 102.990 1.00 22.93 ? 429  LEU C CD2   1 
ATOM   8871  N  N     . MET G 2 241 ? 38.309  116.488 104.448 1.00 23.65 ? 430  MET C N     1 
ATOM   8872  C  CA    . MET G 2 241 ? 36.931  116.373 104.886 1.00 23.31 ? 430  MET C CA    1 
ATOM   8873  C  C     . MET G 2 241 ? 36.181  115.345 104.055 1.00 23.13 ? 430  MET C C     1 
ATOM   8874  O  O     . MET G 2 241 ? 36.128  115.454 102.836 1.00 23.47 ? 430  MET C O     1 
ATOM   8875  C  CB    . MET G 2 241 ? 36.246  117.728 104.756 1.00 23.01 ? 430  MET C CB    1 
ATOM   8876  C  CG    . MET G 2 241 ? 36.952  118.839 105.504 1.00 22.88 ? 430  MET C CG    1 
ATOM   8877  S  SD    . MET G 2 241 ? 35.991  120.333 105.366 1.00 24.76 ? 430  MET C SD    1 
ATOM   8878  C  CE    . MET G 2 241 ? 37.020  121.535 106.321 1.00 23.94 ? 430  MET C CE    1 
ATOM   8879  N  N     . PHE G 2 242 ? 35.586  114.368 104.731 1.00 22.26 ? 431  PHE C N     1 
ATOM   8880  C  CA    . PHE G 2 242 ? 34.854  113.286 104.076 1.00 20.87 ? 431  PHE C CA    1 
ATOM   8881  C  C     . PHE G 2 242 ? 33.468  113.137 104.663 1.00 20.69 ? 431  PHE C C     1 
ATOM   8882  O  O     . PHE G 2 242 ? 33.281  113.312 105.868 1.00 19.04 ? 431  PHE C O     1 
ATOM   8883  C  CB    . PHE G 2 242 ? 35.573  111.955 104.291 1.00 20.77 ? 431  PHE C CB    1 
ATOM   8884  C  CG    . PHE G 2 242 ? 36.845  111.816 103.519 1.00 21.40 ? 431  PHE C CG    1 
ATOM   8885  C  CD1   . PHE G 2 242 ? 36.887  111.045 102.359 1.00 22.58 ? 431  PHE C CD1   1 
ATOM   8886  C  CD2   . PHE G 2 242 ? 38.002  112.436 103.952 1.00 22.29 ? 431  PHE C CD2   1 
ATOM   8887  C  CE1   . PHE G 2 242 ? 38.068  110.895 101.651 1.00 22.92 ? 431  PHE C CE1   1 
ATOM   8888  C  CE2   . PHE G 2 242 ? 39.193  112.295 103.246 1.00 22.30 ? 431  PHE C CE2   1 
ATOM   8889  C  CZ    . PHE G 2 242 ? 39.224  111.522 102.096 1.00 22.68 ? 431  PHE C CZ    1 
ATOM   8890  N  N     . SER G 2 243 ? 32.513  112.806 103.795 1.00 20.20 ? 432  SER C N     1 
ATOM   8891  C  CA    . SER G 2 243 ? 31.139  112.553 104.182 1.00 20.36 ? 432  SER C CA    1 
ATOM   8892  C  C     . SER G 2 243 ? 30.315  112.070 103.001 1.00 21.13 ? 432  SER C C     1 
ATOM   8893  O  O     . SER G 2 243 ? 30.687  112.301 101.851 1.00 20.90 ? 432  SER C O     1 
ATOM   8894  C  CB    . SER G 2 243 ? 30.482  113.805 104.749 1.00 20.16 ? 432  SER C CB    1 
ATOM   8895  O  OG    . SER G 2 243 ? 29.187  113.495 105.217 1.00 19.39 ? 432  SER C OG    1 
ATOM   8896  N  N     . ALA G 2 244 ? 29.203  111.395 103.307 1.00 21.40 ? 433  ALA C N     1 
ATOM   8897  C  CA    . ALA G 2 244 ? 28.256  110.908 102.306 1.00 22.48 ? 433  ALA C CA    1 
ATOM   8898  C  C     . ALA G 2 244 ? 27.222  112.001 102.024 1.00 23.28 ? 433  ALA C C     1 
ATOM   8899  O  O     . ALA G 2 244 ? 26.457  111.885 101.079 1.00 24.39 ? 433  ALA C O     1 
ATOM   8900  C  CB    . ALA G 2 244 ? 27.534  109.628 102.802 1.00 21.97 ? 433  ALA C CB    1 
ATOM   8901  N  N     . THR G 2 245 ? 27.172  113.031 102.870 1.00 23.36 ? 434  THR C N     1 
ATOM   8902  C  CA    . THR G 2 245 ? 26.270  114.163 102.670 1.00 23.34 ? 434  THR C CA    1 
ATOM   8903  C  C     . THR G 2 245 ? 27.062  115.446 102.868 1.00 25.34 ? 434  THR C C     1 
ATOM   8904  O  O     . THR G 2 245 ? 28.100  115.457 103.547 1.00 26.08 ? 434  THR C O     1 
ATOM   8905  C  CB    . THR G 2 245 ? 25.031  114.177 103.634 1.00 22.44 ? 434  THR C CB    1 
ATOM   8906  O  OG1   . THR G 2 245 ? 25.454  114.174 105.000 1.00 22.42 ? 434  THR C OG1   1 
ATOM   8907  C  CG2   . THR G 2 245 ? 24.142  112.973 103.382 1.00 21.46 ? 434  THR C CG2   1 
ATOM   8908  N  N     . PHE G 2 246 ? 26.579  116.528 102.263 1.00 25.97 ? 435  PHE C N     1 
ATOM   8909  C  CA    . PHE G 2 246 ? 27.258  117.808 102.358 1.00 26.25 ? 435  PHE C CA    1 
ATOM   8910  C  C     . PHE G 2 246 ? 26.370  118.913 101.810 1.00 26.36 ? 435  PHE C C     1 
ATOM   8911  O  O     . PHE G 2 246 ? 26.396  119.204 100.626 1.00 26.89 ? 435  PHE C O     1 
ATOM   8912  C  CB    . PHE G 2 246 ? 28.566  117.775 101.555 1.00 26.42 ? 435  PHE C CB    1 
ATOM   8913  C  CG    . PHE G 2 246 ? 29.784  118.154 102.354 1.00 25.80 ? 435  PHE C CG    1 
ATOM   8914  C  CD1   . PHE G 2 246 ? 29.836  119.360 103.034 1.00 26.28 ? 435  PHE C CD1   1 
ATOM   8915  C  CD2   . PHE G 2 246 ? 30.861  117.286 102.452 1.00 25.86 ? 435  PHE C CD2   1 
ATOM   8916  C  CE1   . PHE G 2 246 ? 30.951  119.699 103.817 1.00 26.79 ? 435  PHE C CE1   1 
ATOM   8917  C  CE2   . PHE G 2 246 ? 31.980  117.607 103.229 1.00 25.21 ? 435  PHE C CE2   1 
ATOM   8918  C  CZ    . PHE G 2 246 ? 32.025  118.815 103.915 1.00 25.45 ? 435  PHE C CZ    1 
ATOM   8919  N  N     . PRO G 2 247 ? 25.550  119.520 102.668 1.00 26.71 ? 436  PRO C N     1 
ATOM   8920  C  CA    . PRO G 2 247 ? 24.657  120.610 102.252 1.00 27.25 ? 436  PRO C CA    1 
ATOM   8921  C  C     . PRO G 2 247 ? 25.517  121.774 101.727 1.00 27.76 ? 436  PRO C C     1 
ATOM   8922  O  O     . PRO G 2 247 ? 26.611  122.033 102.257 1.00 27.37 ? 436  PRO C O     1 
ATOM   8923  C  CB    . PRO G 2 247 ? 23.944  120.983 103.547 1.00 26.16 ? 436  PRO C CB    1 
ATOM   8924  C  CG    . PRO G 2 247 ? 23.958  119.687 104.336 1.00 27.01 ? 436  PRO C CG    1 
ATOM   8925  C  CD    . PRO G 2 247 ? 25.349  119.169 104.085 1.00 25.96 ? 436  PRO C CD    1 
ATOM   8926  N  N     . GLU G 2 248 ? 25.022  122.476 100.709 1.00 28.30 ? 437  GLU C N     1 
ATOM   8927  C  CA    . GLU G 2 248 ? 25.755  123.587 100.105 1.00 30.58 ? 437  GLU C CA    1 
ATOM   8928  C  C     . GLU G 2 248 ? 26.228  124.624 101.127 1.00 30.03 ? 437  GLU C C     1 
ATOM   8929  O  O     . GLU G 2 248 ? 27.353  125.115 101.027 1.00 30.38 ? 437  GLU C O     1 
ATOM   8930  C  CB    . GLU G 2 248 ? 24.906  124.269 99.022  1.00 33.71 ? 437  GLU C CB    1 
ATOM   8931  C  CG    . GLU G 2 248 ? 24.223  123.295 98.030  1.00 41.04 ? 437  GLU C CG    1 
ATOM   8932  C  CD    . GLU G 2 248 ? 25.060  122.935 96.788  1.00 44.47 ? 437  GLU C CD    1 
ATOM   8933  O  OE1   . GLU G 2 248 ? 26.245  122.548 96.936  1.00 46.84 ? 437  GLU C OE1   1 
ATOM   8934  O  OE2   . GLU G 2 248 ? 24.520  123.023 95.654  1.00 45.67 ? 437  GLU C OE2   1 
ATOM   8935  N  N     . GLU G 2 249 ? 25.400  124.955 102.114 1.00 29.54 ? 438  GLU C N     1 
ATOM   8936  C  CA    . GLU G 2 249 ? 25.825  125.949 103.099 1.00 30.78 ? 438  GLU C CA    1 
ATOM   8937  C  C     . GLU G 2 249 ? 27.005  125.461 103.941 1.00 28.46 ? 438  GLU C C     1 
ATOM   8938  O  O     . GLU G 2 249 ? 27.810  126.250 104.413 1.00 26.72 ? 438  GLU C O     1 
ATOM   8939  C  CB    . GLU G 2 249 ? 24.667  126.357 104.023 1.00 34.31 ? 438  GLU C CB    1 
ATOM   8940  C  CG    . GLU G 2 249 ? 25.107  127.246 105.233 1.00 41.67 ? 438  GLU C CG    1 
ATOM   8941  C  CD    . GLU G 2 249 ? 26.099  128.389 104.858 1.00 44.44 ? 438  GLU C CD    1 
ATOM   8942  O  OE1   . GLU G 2 249 ? 25.827  129.127 103.885 1.00 47.20 ? 438  GLU C OE1   1 
ATOM   8943  O  OE2   . GLU G 2 249 ? 27.145  128.565 105.535 1.00 44.76 ? 438  GLU C OE2   1 
ATOM   8944  N  N     . ILE G 2 250 ? 27.113  124.156 104.132 1.00 27.44 ? 439  ILE C N     1 
ATOM   8945  C  CA    . ILE G 2 250 ? 28.223  123.652 104.919 1.00 26.00 ? 439  ILE C CA    1 
ATOM   8946  C  C     . ILE G 2 250 ? 29.440  123.526 104.008 1.00 24.05 ? 439  ILE C C     1 
ATOM   8947  O  O     . ILE G 2 250 ? 30.560  123.638 104.461 1.00 23.69 ? 439  ILE C O     1 
ATOM   8948  C  CB    . ILE G 2 250 ? 27.841  122.320 105.625 1.00 26.80 ? 439  ILE C CB    1 
ATOM   8949  C  CG1   . ILE G 2 250 ? 26.574  122.565 106.450 1.00 25.79 ? 439  ILE C CG1   1 
ATOM   8950  C  CG2   . ILE G 2 250 ? 28.971  121.850 106.562 1.00 26.32 ? 439  ILE C CG2   1 
ATOM   8951  C  CD1   . ILE G 2 250 ? 26.302  121.538 107.488 1.00 28.37 ? 439  ILE C CD1   1 
ATOM   8952  N  N     . GLN G 2 251 ? 29.225  123.318 102.715 1.00 23.80 ? 440  GLN C N     1 
ATOM   8953  C  CA    . GLN G 2 251 ? 30.360  123.269 101.801 1.00 23.88 ? 440  GLN C CA    1 
ATOM   8954  C  C     . GLN G 2 251 ? 30.948  124.675 101.745 1.00 24.37 ? 440  GLN C C     1 
ATOM   8955  O  O     . GLN G 2 251 ? 32.167  124.846 101.691 1.00 23.86 ? 440  GLN C O     1 
ATOM   8956  C  CB    . GLN G 2 251 ? 29.936  122.867 100.404 1.00 23.46 ? 440  GLN C CB    1 
ATOM   8957  C  CG    . GLN G 2 251 ? 29.681  121.400 100.225 1.00 23.33 ? 440  GLN C CG    1 
ATOM   8958  C  CD    . GLN G 2 251 ? 29.439  121.079 98.784  1.00 24.16 ? 440  GLN C CD    1 
ATOM   8959  O  OE1   . GLN G 2 251 ? 30.255  121.402 97.926  1.00 24.80 ? 440  GLN C OE1   1 
ATOM   8960  N  NE2   . GLN G 2 251 ? 28.313  120.445 98.501  1.00 24.64 ? 440  GLN C NE2   1 
ATOM   8961  N  N     . ARG G 2 252 ? 30.080  125.681 101.772 1.00 24.62 ? 441  ARG C N     1 
ATOM   8962  C  CA    . ARG G 2 252 ? 30.562  127.055 101.751 1.00 27.64 ? 441  ARG C CA    1 
ATOM   8963  C  C     . ARG G 2 252 ? 31.378  127.336 103.011 1.00 28.58 ? 441  ARG C C     1 
ATOM   8964  O  O     . ARG G 2 252 ? 32.477  127.884 102.929 1.00 28.41 ? 441  ARG C O     1 
ATOM   8965  C  CB    . ARG G 2 252 ? 29.395  128.047 101.608 1.00 26.52 ? 441  ARG C CB    1 
ATOM   8966  C  CG    . ARG G 2 252 ? 28.811  128.042 100.201 1.00 26.09 ? 441  ARG C CG    1 
ATOM   8967  C  CD    . ARG G 2 252 ? 27.714  129.082 99.986  1.00 26.00 ? 441  ARG C CD    1 
ATOM   8968  N  NE    . ARG G 2 252 ? 27.051  128.885 98.697  1.00 25.30 ? 441  ARG C NE    1 
ATOM   8969  C  CZ    . ARG G 2 252 ? 27.603  129.140 97.516  1.00 25.98 ? 441  ARG C CZ    1 
ATOM   8970  N  NH1   . ARG G 2 252 ? 28.840  129.618 97.436  1.00 25.67 ? 441  ARG C NH1   1 
ATOM   8971  N  NH2   . ARG G 2 252 ? 26.920  128.901 96.409  1.00 26.34 ? 441  ARG C NH2   1 
ATOM   8972  N  N     . MET G 2 253 ? 30.864  126.912 104.162 1.00 30.54 ? 442  MET C N     1 
ATOM   8973  C  CA    . MET G 2 253 ? 31.557  127.119 105.432 1.00 33.10 ? 442  MET C CA    1 
ATOM   8974  C  C     . MET G 2 253 ? 32.896  126.400 105.519 1.00 32.48 ? 442  MET C C     1 
ATOM   8975  O  O     . MET G 2 253 ? 33.868  126.952 106.012 1.00 31.82 ? 442  MET C O     1 
ATOM   8976  C  CB    . MET G 2 253 ? 30.686  126.649 106.598 1.00 36.94 ? 442  MET C CB    1 
ATOM   8977  C  CG    . MET G 2 253 ? 29.448  127.473 106.807 1.00 41.62 ? 442  MET C CG    1 
ATOM   8978  S  SD    . MET G 2 253 ? 28.288  126.663 107.946 1.00 49.86 ? 442  MET C SD    1 
ATOM   8979  C  CE    . MET G 2 253 ? 29.180  126.870 109.538 1.00 47.61 ? 442  MET C CE    1 
ATOM   8980  N  N     . ALA G 2 254 ? 32.939  125.168 105.037 1.00 32.01 ? 443  ALA C N     1 
ATOM   8981  C  CA    . ALA G 2 254 ? 34.156  124.374 105.095 1.00 31.94 ? 443  ALA C CA    1 
ATOM   8982  C  C     . ALA G 2 254 ? 35.340  125.077 104.473 1.00 32.04 ? 443  ALA C C     1 
ATOM   8983  O  O     . ALA G 2 254 ? 36.474  124.942 104.943 1.00 30.46 ? 443  ALA C O     1 
ATOM   8984  C  CB    . ALA G 2 254 ? 33.933  123.049 104.405 1.00 32.08 ? 443  ALA C CB    1 
ATOM   8985  N  N     . GLY G 2 255 ? 35.066  125.819 103.405 1.00 33.58 ? 444  GLY C N     1 
ATOM   8986  C  CA    . GLY G 2 255 ? 36.104  126.527 102.689 1.00 34.74 ? 444  GLY C CA    1 
ATOM   8987  C  C     . GLY G 2 255 ? 36.941  127.388 103.596 1.00 36.26 ? 444  GLY C C     1 
ATOM   8988  O  O     . GLY G 2 255 ? 38.088  127.688 103.293 1.00 37.71 ? 444  GLY C O     1 
ATOM   8989  N  N     . GLU G 2 256 ? 36.382  127.785 104.726 1.00 37.63 ? 445  GLU C N     1 
ATOM   8990  C  CA    . GLU G 2 256 ? 37.135  128.618 105.638 1.00 39.32 ? 445  GLU C CA    1 
ATOM   8991  C  C     . GLU G 2 256 ? 38.277  127.855 106.294 1.00 39.13 ? 445  GLU C C     1 
ATOM   8992  O  O     . GLU G 2 256 ? 39.092  128.448 107.010 1.00 38.91 ? 445  GLU C O     1 
ATOM   8993  C  CB    . GLU G 2 256 ? 36.225  129.187 106.712 1.00 41.52 ? 445  GLU C CB    1 
ATOM   8994  C  CG    . GLU G 2 256 ? 36.855  130.336 107.440 1.00 45.41 ? 445  GLU C CG    1 
ATOM   8995  C  CD    . GLU G 2 256 ? 35.934  130.937 108.472 1.00 48.42 ? 445  GLU C CD    1 
ATOM   8996  O  OE1   . GLU G 2 256 ? 34.700  130.929 108.242 1.00 49.21 ? 445  GLU C OE1   1 
ATOM   8997  O  OE2   . GLU G 2 256 ? 36.454  131.431 109.504 1.00 50.51 ? 445  GLU C OE2   1 
ATOM   8998  N  N     . PHE G 2 257 ? 38.344  126.549 106.052 1.00 37.83 ? 446  PHE C N     1 
ATOM   8999  C  CA    . PHE G 2 257 ? 39.398  125.734 106.643 1.00 37.18 ? 446  PHE C CA    1 
ATOM   9000  C  C     . PHE G 2 257 ? 40.167  124.931 105.613 1.00 35.96 ? 446  PHE C C     1 
ATOM   9001  O  O     . PHE G 2 257 ? 40.999  124.110 105.952 1.00 36.59 ? 446  PHE C O     1 
ATOM   9002  C  CB    . PHE G 2 257 ? 38.809  124.794 107.691 1.00 37.77 ? 446  PHE C CB    1 
ATOM   9003  C  CG    . PHE G 2 257 ? 37.996  125.494 108.732 1.00 38.76 ? 446  PHE C CG    1 
ATOM   9004  C  CD1   . PHE G 2 257 ? 36.609  125.551 108.627 1.00 39.62 ? 446  PHE C CD1   1 
ATOM   9005  C  CD2   . PHE G 2 257 ? 38.616  126.114 109.817 1.00 39.94 ? 446  PHE C CD2   1 
ATOM   9006  C  CE1   . PHE G 2 257 ? 35.844  126.214 109.591 1.00 40.50 ? 446  PHE C CE1   1 
ATOM   9007  C  CE2   . PHE G 2 257 ? 37.869  126.779 110.788 1.00 40.21 ? 446  PHE C CE2   1 
ATOM   9008  C  CZ    . PHE G 2 257 ? 36.476  126.830 110.676 1.00 41.50 ? 446  PHE C CZ    1 
ATOM   9009  N  N     . LEU G 2 258 ? 39.881  125.171 104.346 1.00 35.84 ? 447  LEU C N     1 
ATOM   9010  C  CA    . LEU G 2 258 ? 40.549  124.456 103.271 1.00 35.03 ? 447  LEU C CA    1 
ATOM   9011  C  C     . LEU G 2 258 ? 41.364  125.436 102.455 1.00 35.35 ? 447  LEU C C     1 
ATOM   9012  O  O     . LEU G 2 258 ? 40.964  126.585 102.287 1.00 36.37 ? 447  LEU C O     1 
ATOM   9013  C  CB    . LEU G 2 258 ? 39.514  123.777 102.380 1.00 32.99 ? 447  LEU C CB    1 
ATOM   9014  C  CG    . LEU G 2 258 ? 38.664  122.701 103.060 1.00 32.05 ? 447  LEU C CG    1 
ATOM   9015  C  CD1   . LEU G 2 258 ? 37.462  122.350 102.201 1.00 29.81 ? 447  LEU C CD1   1 
ATOM   9016  C  CD2   . LEU G 2 258 ? 39.524  121.475 103.316 1.00 31.46 ? 447  LEU C CD2   1 
ATOM   9017  N  N     . LYS G 2 259 ? 42.513  124.991 101.958 1.00 36.20 ? 448  LYS C N     1 
ATOM   9018  C  CA    . LYS G 2 259 ? 43.368  125.854 101.140 1.00 36.55 ? 448  LYS C CA    1 
ATOM   9019  C  C     . LYS G 2 259 ? 43.458  125.313 99.721  1.00 35.08 ? 448  LYS C C     1 
ATOM   9020  O  O     . LYS G 2 259 ? 43.960  124.204 99.515  1.00 33.87 ? 448  LYS C O     1 
ATOM   9021  C  CB    . LYS G 2 259 ? 44.793  125.943 101.722 1.00 37.86 ? 448  LYS C CB    1 
ATOM   9022  C  CG    . LYS G 2 259 ? 44.940  126.799 102.980 1.00 40.95 ? 448  LYS C CG    1 
ATOM   9023  C  CD    . LYS G 2 259 ? 46.364  126.697 103.601 1.00 42.31 ? 448  LYS C CD    1 
ATOM   9024  C  CE    . LYS G 2 259 ? 46.684  125.259 104.075 1.00 44.38 ? 448  LYS C CE    1 
ATOM   9025  N  NZ    . LYS G 2 259 ? 47.822  125.140 105.064 1.00 44.51 ? 448  LYS C NZ    1 
ATOM   9026  N  N     . ASN G 2 260 ? 42.967  126.088 98.752  1.00 34.27 ? 449  ASN C N     1 
ATOM   9027  C  CA    . ASN G 2 260 ? 43.041  125.683 97.343  1.00 33.23 ? 449  ASN C CA    1 
ATOM   9028  C  C     . ASN G 2 260 ? 42.708  124.202 97.279  1.00 31.62 ? 449  ASN C C     1 
ATOM   9029  O  O     . ASN G 2 260 ? 43.489  123.406 96.766  1.00 30.70 ? 449  ASN C O     1 
ATOM   9030  C  CB    . ASN G 2 260 ? 44.470  125.897 96.842  1.00 33.50 ? 449  ASN C CB    1 
ATOM   9031  C  CG    . ASN G 2 260 ? 44.661  125.440 95.421  1.00 34.85 ? 449  ASN C CG    1 
ATOM   9032  O  OD1   . ASN G 2 260 ? 45.641  124.763 95.100  1.00 34.58 ? 449  ASN C OD1   1 
ATOM   9033  N  ND2   . ASN G 2 260 ? 43.726  125.811 94.552  1.00 34.64 ? 449  ASN C ND2   1 
ATOM   9034  N  N     . TYR G 2 261 ? 41.546  123.834 97.796  1.00 29.64 ? 450  TYR C N     1 
ATOM   9035  C  CA    . TYR G 2 261 ? 41.195  122.424 97.856  1.00 27.90 ? 450  TYR C CA    1 
ATOM   9036  C  C     . TYR G 2 261 ? 40.640  121.770 96.605  1.00 28.35 ? 450  TYR C C     1 
ATOM   9037  O  O     . TYR G 2 261 ? 40.080  122.422 95.721  1.00 27.77 ? 450  TYR C O     1 
ATOM   9038  C  CB    . TYR G 2 261 ? 40.229  122.192 99.022  1.00 25.92 ? 450  TYR C CB    1 
ATOM   9039  C  CG    . TYR G 2 261 ? 38.800  122.631 98.773  1.00 23.89 ? 450  TYR C CG    1 
ATOM   9040  C  CD1   . TYR G 2 261 ? 37.850  121.738 98.273  1.00 22.15 ? 450  TYR C CD1   1 
ATOM   9041  C  CD2   . TYR G 2 261 ? 38.382  123.922 99.111  1.00 23.65 ? 450  TYR C CD2   1 
ATOM   9042  C  CE1   . TYR G 2 261 ? 36.518  122.119 98.132  1.00 21.10 ? 450  TYR C CE1   1 
ATOM   9043  C  CE2   . TYR G 2 261 ? 37.066  124.313 98.973  1.00 22.18 ? 450  TYR C CE2   1 
ATOM   9044  C  CZ    . TYR G 2 261 ? 36.134  123.411 98.491  1.00 22.26 ? 450  TYR C CZ    1 
ATOM   9045  O  OH    . TYR G 2 261 ? 34.816  123.791 98.423  1.00 23.16 ? 450  TYR C OH    1 
ATOM   9046  N  N     . VAL G 2 262 ? 40.834  120.458 96.544  1.00 27.73 ? 451  VAL C N     1 
ATOM   9047  C  CA    . VAL G 2 262 ? 40.314  119.648 95.458  1.00 26.86 ? 451  VAL C CA    1 
ATOM   9048  C  C     . VAL G 2 262 ? 38.948  119.147 95.940  1.00 26.65 ? 451  VAL C C     1 
ATOM   9049  O  O     . VAL G 2 262 ? 38.816  118.729 97.092  1.00 27.34 ? 451  VAL C O     1 
ATOM   9050  C  CB    . VAL G 2 262 ? 41.197  118.402 95.201  1.00 26.43 ? 451  VAL C CB    1 
ATOM   9051  C  CG1   . VAL G 2 262 ? 40.576  117.549 94.120  1.00 24.46 ? 451  VAL C CG1   1 
ATOM   9052  C  CG2   . VAL G 2 262 ? 42.608  118.831 94.792  1.00 26.30 ? 451  VAL C CG2   1 
ATOM   9053  N  N     . PHE G 2 263 ? 37.942  119.196 95.071  1.00 25.37 ? 452  PHE C N     1 
ATOM   9054  C  CA    . PHE G 2 263 ? 36.613  118.707 95.409  1.00 24.26 ? 452  PHE C CA    1 
ATOM   9055  C  C     . PHE G 2 263 ? 36.303  117.431 94.632  1.00 24.66 ? 452  PHE C C     1 
ATOM   9056  O  O     . PHE G 2 263 ? 36.472  117.396 93.415  1.00 24.33 ? 452  PHE C O     1 
ATOM   9057  C  CB    . PHE G 2 263 ? 35.539  119.737 95.051  1.00 23.88 ? 452  PHE C CB    1 
ATOM   9058  C  CG    . PHE G 2 263 ? 34.124  119.262 95.317  1.00 25.12 ? 452  PHE C CG    1 
ATOM   9059  C  CD1   . PHE G 2 263 ? 33.620  119.216 96.616  1.00 24.23 ? 452  PHE C CD1   1 
ATOM   9060  C  CD2   . PHE G 2 263 ? 33.310  118.833 94.272  1.00 24.17 ? 452  PHE C CD2   1 
ATOM   9061  C  CE1   . PHE G 2 263 ? 32.321  118.746 96.869  1.00 24.48 ? 452  PHE C CE1   1 
ATOM   9062  C  CE2   . PHE G 2 263 ? 32.014  118.363 94.516  1.00 25.10 ? 452  PHE C CE2   1 
ATOM   9063  C  CZ    . PHE G 2 263 ? 31.519  118.321 95.817  1.00 23.62 ? 452  PHE C CZ    1 
ATOM   9064  N  N     . VAL G 2 264 ? 35.895  116.364 95.311  1.00 24.19 ? 453  VAL C N     1 
ATOM   9065  C  CA    . VAL G 2 264 ? 35.503  115.194 94.550  1.00 24.29 ? 453  VAL C CA    1 
ATOM   9066  C  C     . VAL G 2 264 ? 34.191  114.608 95.055  1.00 23.96 ? 453  VAL C C     1 
ATOM   9067  O  O     . VAL G 2 264 ? 33.939  114.496 96.258  1.00 23.05 ? 453  VAL C O     1 
ATOM   9068  C  CB    . VAL G 2 264 ? 36.619  114.088 94.444  1.00 25.79 ? 453  VAL C CB    1 
ATOM   9069  C  CG1   . VAL G 2 264 ? 37.909  114.554 95.063  1.00 25.88 ? 453  VAL C CG1   1 
ATOM   9070  C  CG2   . VAL G 2 264 ? 36.124  112.769 95.004  1.00 24.76 ? 453  VAL C CG2   1 
ATOM   9071  N  N     . ALA G 2 265 ? 33.341  114.275 94.097  1.00 23.43 ? 454  ALA C N     1 
ATOM   9072  C  CA    . ALA G 2 265 ? 32.042  113.705 94.381  1.00 23.13 ? 454  ALA C CA    1 
ATOM   9073  C  C     . ALA G 2 265 ? 31.809  112.490 93.516  1.00 23.16 ? 454  ALA C C     1 
ATOM   9074  O  O     . ALA G 2 265 ? 31.855  112.570 92.286  1.00 23.58 ? 454  ALA C O     1 
ATOM   9075  C  CB    . ALA G 2 265 ? 30.959  114.726 94.115  1.00 23.37 ? 454  ALA C CB    1 
ATOM   9076  N  N     . ILE G 2 266 ? 31.570  111.359 94.160  1.00 23.64 ? 455  ILE C N     1 
ATOM   9077  C  CA    . ILE G 2 266 ? 31.275  110.130 93.447  1.00 23.58 ? 455  ILE C CA    1 
ATOM   9078  C  C     . ILE G 2 266 ? 29.754  110.065 93.454  1.00 24.69 ? 455  ILE C C     1 
ATOM   9079  O  O     . ILE G 2 266 ? 29.155  109.834 94.492  1.00 25.21 ? 455  ILE C O     1 
ATOM   9080  C  CB    . ILE G 2 266 ? 31.834  108.915 94.195  1.00 23.85 ? 455  ILE C CB    1 
ATOM   9081  C  CG1   . ILE G 2 266 ? 33.301  109.170 94.577  1.00 22.23 ? 455  ILE C CG1   1 
ATOM   9082  C  CG2   . ILE G 2 266 ? 31.699  107.662 93.334  1.00 23.48 ? 455  ILE C CG2   1 
ATOM   9083  C  CD1   . ILE G 2 266 ? 34.246  109.357 93.392  1.00 23.30 ? 455  ILE C CD1   1 
ATOM   9084  N  N     . GLY G 2 267 ? 29.115  110.272 92.310  1.00 25.87 ? 456  GLY C N     1 
ATOM   9085  C  CA    . GLY G 2 267 ? 27.661  110.230 92.297  1.00 27.33 ? 456  GLY C CA    1 
ATOM   9086  C  C     . GLY G 2 267 ? 27.074  111.539 92.800  1.00 27.88 ? 456  GLY C C     1 
ATOM   9087  O  O     . GLY G 2 267 ? 27.804  112.511 93.004  1.00 28.36 ? 456  GLY C O     1 
ATOM   9088  N  N     . ILE G 2 268 ? 25.761  111.571 92.999  1.00 28.50 ? 457  ILE C N     1 
ATOM   9089  C  CA    . ILE G 2 268 ? 25.076  112.769 93.492  1.00 30.05 ? 457  ILE C CA    1 
ATOM   9090  C  C     . ILE G 2 268 ? 25.385  112.998 94.970  1.00 29.00 ? 457  ILE C C     1 
ATOM   9091  O  O     . ILE G 2 268 ? 25.211  112.099 95.786  1.00 29.84 ? 457  ILE C O     1 
ATOM   9092  C  CB    . ILE G 2 268 ? 23.541  112.633 93.385  1.00 31.82 ? 457  ILE C CB    1 
ATOM   9093  C  CG1   . ILE G 2 268 ? 23.152  112.088 92.007  1.00 33.87 ? 457  ILE C CG1   1 
ATOM   9094  C  CG2   . ILE G 2 268 ? 22.884  113.992 93.631  1.00 32.56 ? 457  ILE C CG2   1 
ATOM   9095  C  CD1   . ILE G 2 268 ? 22.047  110.987 92.065  1.00 36.01 ? 457  ILE C CD1   1 
ATOM   9096  N  N     . VAL G 2 269 ? 25.819  114.199 95.321  1.00 28.30 ? 458  VAL C N     1 
ATOM   9097  C  CA    . VAL G 2 269 ? 26.125  114.499 96.714  1.00 27.54 ? 458  VAL C CA    1 
ATOM   9098  C  C     . VAL G 2 269 ? 24.898  114.333 97.596  1.00 27.26 ? 458  VAL C C     1 
ATOM   9099  O  O     . VAL G 2 269 ? 23.812  114.817 97.277  1.00 27.09 ? 458  VAL C O     1 
ATOM   9100  C  CB    . VAL G 2 269 ? 26.679  115.930 96.871  1.00 27.35 ? 458  VAL C CB    1 
ATOM   9101  C  CG1   . VAL G 2 269 ? 26.718  116.315 98.324  1.00 25.13 ? 458  VAL C CG1   1 
ATOM   9102  C  CG2   . VAL G 2 269 ? 28.072  115.998 96.270  1.00 25.30 ? 458  VAL C CG2   1 
ATOM   9103  N  N     . GLY G 2 270 ? 25.077  113.636 98.711  1.00 27.07 ? 459  GLY C N     1 
ATOM   9104  C  CA    . GLY G 2 270 ? 23.962  113.413 99.612  1.00 26.43 ? 459  GLY C CA    1 
ATOM   9105  C  C     . GLY G 2 270 ? 23.013  112.336 99.116  1.00 26.51 ? 459  GLY C C     1 
ATOM   9106  O  O     . GLY G 2 270 ? 21.955  112.106 99.711  1.00 25.64 ? 459  GLY C O     1 
ATOM   9107  N  N     . GLY G 2 271 ? 23.379  111.673 98.021  1.00 25.29 ? 460  GLY C N     1 
ATOM   9108  C  CA    . GLY G 2 271 ? 22.519  110.626 97.497  1.00 25.15 ? 460  GLY C CA    1 
ATOM   9109  C  C     . GLY G 2 271 ? 22.523  109.343 98.329  1.00 24.55 ? 460  GLY C C     1 
ATOM   9110  O  O     . GLY G 2 271 ? 23.529  108.985 98.939  1.00 24.84 ? 460  GLY C O     1 
ATOM   9111  N  N     . ALA G 2 272 ? 21.391  108.651 98.354  1.00 23.96 ? 461  ALA C N     1 
ATOM   9112  C  CA    . ALA G 2 272 ? 21.278  107.417 99.093  1.00 24.44 ? 461  ALA C CA    1 
ATOM   9113  C  C     . ALA G 2 272 ? 21.989  106.300 98.343  1.00 25.21 ? 461  ALA C C     1 
ATOM   9114  O  O     . ALA G 2 272 ? 22.142  106.354 97.128  1.00 26.21 ? 461  ALA C O     1 
ATOM   9115  C  CB    . ALA G 2 272 ? 19.832  107.068 99.282  1.00 24.95 ? 461  ALA C CB    1 
ATOM   9116  N  N     . CYS G 2 273 ? 22.439  105.286 99.066  1.00 25.90 ? 462  CYS C N     1 
ATOM   9117  C  CA    . CYS G 2 273 ? 23.123  104.174 98.426  1.00 26.99 ? 462  CYS C CA    1 
ATOM   9118  C  C     . CYS G 2 273 ? 22.069  103.293 97.750  1.00 27.92 ? 462  CYS C C     1 
ATOM   9119  O  O     . CYS G 2 273 ? 21.180  102.760 98.413  1.00 28.03 ? 462  CYS C O     1 
ATOM   9120  C  CB    . CYS G 2 273 ? 23.898  103.380 99.471  1.00 27.16 ? 462  CYS C CB    1 
ATOM   9121  S  SG    . CYS G 2 273 ? 24.660  101.913 98.819  1.00 29.66 ? 462  CYS C SG    1 
ATOM   9122  N  N     . SER G 2 274 ? 22.165  103.126 96.435  1.00 28.74 ? 463  SER C N     1 
ATOM   9123  C  CA    . SER G 2 274 ? 21.159  102.338 95.718  1.00 29.61 ? 463  SER C CA    1 
ATOM   9124  C  C     . SER G 2 274 ? 21.081  100.850 96.075  1.00 29.22 ? 463  SER C C     1 
ATOM   9125  O  O     . SER G 2 274 ? 20.100  100.189 95.732  1.00 29.12 ? 463  SER C O     1 
ATOM   9126  C  CB    . SER G 2 274 ? 21.333  102.499 94.208  1.00 28.16 ? 463  SER C CB    1 
ATOM   9127  O  OG    . SER G 2 274 ? 22.606  102.038 93.806  1.00 31.74 ? 463  SER C OG    1 
ATOM   9128  N  N     . ASP G 2 275 ? 22.092  100.321 96.759  1.00 29.08 ? 464  ASP C N     1 
ATOM   9129  C  CA    . ASP G 2 275 ? 22.073  98.906  97.152  1.00 29.84 ? 464  ASP C CA    1 
ATOM   9130  C  C     . ASP G 2 275 ? 21.150  98.654  98.340  1.00 29.45 ? 464  ASP C C     1 
ATOM   9131  O  O     . ASP G 2 275 ? 20.926  97.512  98.744  1.00 28.97 ? 464  ASP C O     1 
ATOM   9132  C  CB    . ASP G 2 275 ? 23.471  98.418  97.513  1.00 31.70 ? 464  ASP C CB    1 
ATOM   9133  C  CG    . ASP G 2 275 ? 24.379  98.357  96.325  1.00 34.71 ? 464  ASP C CG    1 
ATOM   9134  O  OD1   . ASP G 2 275 ? 23.962  97.769  95.307  1.00 37.50 ? 464  ASP C OD1   1 
ATOM   9135  O  OD2   . ASP G 2 275 ? 25.504  98.893  96.400  1.00 36.97 ? 464  ASP C OD2   1 
ATOM   9136  N  N     . VAL G 2 276 ? 20.626  99.728  98.910  1.00 29.16 ? 465  VAL C N     1 
ATOM   9137  C  CA    . VAL G 2 276 ? 19.727  99.596  100.033 1.00 28.34 ? 465  VAL C CA    1 
ATOM   9138  C  C     . VAL G 2 276 ? 18.310  99.709  99.494  1.00 28.18 ? 465  VAL C C     1 
ATOM   9139  O  O     . VAL G 2 276 ? 17.923  100.758 98.979  1.00 27.08 ? 465  VAL C O     1 
ATOM   9140  C  CB    . VAL G 2 276 ? 19.996  100.688 101.073 1.00 27.91 ? 465  VAL C CB    1 
ATOM   9141  C  CG1   . VAL G 2 276 ? 18.984  100.588 102.202 1.00 27.51 ? 465  VAL C CG1   1 
ATOM   9142  C  CG2   . VAL G 2 276 ? 21.424  100.542 101.611 1.00 27.76 ? 465  VAL C CG2   1 
ATOM   9143  N  N     . LYS G 2 277 ? 17.565  98.604  99.579  1.00 28.50 ? 466  LYS C N     1 
ATOM   9144  C  CA    . LYS G 2 277 ? 16.176  98.538  99.115  1.00 29.44 ? 466  LYS C CA    1 
ATOM   9145  C  C     . LYS G 2 277 ? 15.346  99.331  100.127 1.00 29.02 ? 466  LYS C C     1 
ATOM   9146  O  O     . LYS G 2 277 ? 15.248  98.967  101.289 1.00 28.62 ? 466  LYS C O     1 
ATOM   9147  C  CB    . LYS G 2 277 ? 15.707  97.078  99.068  1.00 31.19 ? 466  LYS C CB    1 
ATOM   9148  C  CG    . LYS G 2 277 ? 14.981  96.690  97.792  1.00 35.77 ? 466  LYS C CG    1 
ATOM   9149  C  CD    . LYS G 2 277 ? 13.606  97.332  97.713  1.00 39.56 ? 466  LYS C CD    1 
ATOM   9150  C  CE    . LYS G 2 277 ? 13.030  97.263  96.291  1.00 42.34 ? 466  LYS C CE    1 
ATOM   9151  N  NZ    . LYS G 2 277 ? 12.916  95.869  95.736  1.00 45.00 ? 466  LYS C NZ    1 
ATOM   9152  N  N     . GLN G 2 278 ? 14.733  100.410 99.684  1.00 28.88 ? 467  GLN C N     1 
ATOM   9153  C  CA    . GLN G 2 278 ? 13.993  101.234 100.607 1.00 29.39 ? 467  GLN C CA    1 
ATOM   9154  C  C     . GLN G 2 278 ? 12.487  101.100 100.562 1.00 30.34 ? 467  GLN C C     1 
ATOM   9155  O  O     . GLN G 2 278 ? 11.858  101.278 99.520  1.00 30.99 ? 467  GLN C O     1 
ATOM   9156  C  CB    . GLN G 2 278 ? 14.395  102.692 100.398 1.00 27.58 ? 467  GLN C CB    1 
ATOM   9157  C  CG    . GLN G 2 278 ? 15.879  102.912 100.587 1.00 27.70 ? 467  GLN C CG    1 
ATOM   9158  C  CD    . GLN G 2 278 ? 16.345  104.218 99.986  1.00 28.10 ? 467  GLN C CD    1 
ATOM   9159  O  OE1   . GLN G 2 278 ? 15.899  105.297 100.378 1.00 28.11 ? 467  GLN C OE1   1 
ATOM   9160  N  NE2   . GLN G 2 278 ? 17.245  104.126 99.020  1.00 29.31 ? 467  GLN C NE2   1 
ATOM   9161  N  N     . THR G 2 279 ? 11.918  100.786 101.718 1.00 30.61 ? 468  THR C N     1 
ATOM   9162  C  CA    . THR G 2 279 ? 10.481  100.658 101.846 1.00 30.14 ? 468  THR C CA    1 
ATOM   9163  C  C     . THR G 2 279 ? 9.968   101.700 102.838 1.00 28.77 ? 468  THR C C     1 
ATOM   9164  O  O     . THR G 2 279 ? 10.515  101.866 103.930 1.00 27.77 ? 468  THR C O     1 
ATOM   9165  C  CB    . THR G 2 279 ? 10.102  99.262  102.327 1.00 30.30 ? 468  THR C CB    1 
ATOM   9166  O  OG1   . THR G 2 279 ? 10.543  98.305  101.364 1.00 32.90 ? 468  THR C OG1   1 
ATOM   9167  C  CG2   . THR G 2 279 ? 8.603   99.145  102.497 1.00 31.74 ? 468  THR C CG2   1 
ATOM   9168  N  N     . ILE G 2 280 ? 8.921   102.404 102.438 1.00 27.87 ? 469  ILE C N     1 
ATOM   9169  C  CA    . ILE G 2 280 ? 8.321   103.416 103.284 1.00 28.80 ? 469  ILE C CA    1 
ATOM   9170  C  C     . ILE G 2 280 ? 6.868   103.044 103.564 1.00 28.83 ? 469  ILE C C     1 
ATOM   9171  O  O     . ILE G 2 280 ? 6.092   102.851 102.635 1.00 27.92 ? 469  ILE C O     1 
ATOM   9172  C  CB    . ILE G 2 280 ? 8.324   104.799 102.599 1.00 29.08 ? 469  ILE C CB    1 
ATOM   9173  C  CG1   . ILE G 2 280 ? 9.693   105.085 101.968 1.00 29.33 ? 469  ILE C CG1   1 
ATOM   9174  C  CG2   . ILE G 2 280 ? 7.950   105.864 103.611 1.00 28.38 ? 469  ILE C CG2   1 
ATOM   9175  C  CD1   . ILE G 2 280 ? 10.815  105.222 102.951 1.00 26.47 ? 469  ILE C CD1   1 
ATOM   9176  N  N     . TYR G 2 281 ? 6.518   102.940 104.842 1.00 29.35 ? 470  TYR C N     1 
ATOM   9177  C  CA    . TYR G 2 281 ? 5.155   102.626 105.252 1.00 31.17 ? 470  TYR C CA    1 
ATOM   9178  C  C     . TYR G 2 281 ? 4.553   103.863 105.905 1.00 32.15 ? 470  TYR C C     1 
ATOM   9179  O  O     . TYR G 2 281 ? 5.245   104.595 106.601 1.00 33.54 ? 470  TYR C O     1 
ATOM   9180  C  CB    . TYR G 2 281 ? 5.132   101.505 106.288 1.00 31.27 ? 470  TYR C CB    1 
ATOM   9181  C  CG    . TYR G 2 281 ? 5.496   100.125 105.795 1.00 32.91 ? 470  TYR C CG    1 
ATOM   9182  C  CD1   . TYR G 2 281 ? 6.344   99.317  106.543 1.00 34.43 ? 470  TYR C CD1   1 
ATOM   9183  C  CD2   . TYR G 2 281 ? 4.974   99.610  104.607 1.00 33.23 ? 470  TYR C CD2   1 
ATOM   9184  C  CE1   . TYR G 2 281 ? 6.676   98.033  106.125 1.00 35.85 ? 470  TYR C CE1   1 
ATOM   9185  C  CE2   . TYR G 2 281 ? 5.296   98.314  104.179 1.00 33.85 ? 470  TYR C CE2   1 
ATOM   9186  C  CZ    . TYR G 2 281 ? 6.153   97.534  104.945 1.00 35.12 ? 470  TYR C CZ    1 
ATOM   9187  O  OH    . TYR G 2 281 ? 6.522   96.260  104.551 1.00 36.52 ? 470  TYR C OH    1 
ATOM   9188  N  N     . GLU G 2 282 ? 3.269   104.095 105.676 1.00 32.86 ? 471  GLU C N     1 
ATOM   9189  C  CA    . GLU G 2 282 ? 2.565   105.213 106.283 1.00 34.27 ? 471  GLU C CA    1 
ATOM   9190  C  C     . GLU G 2 282 ? 2.110   104.647 107.633 1.00 34.33 ? 471  GLU C C     1 
ATOM   9191  O  O     . GLU G 2 282 ? 1.324   103.705 107.673 1.00 34.55 ? 471  GLU C O     1 
ATOM   9192  C  CB    . GLU G 2 282 ? 1.373   105.585 105.401 1.00 36.18 ? 471  GLU C CB    1 
ATOM   9193  C  CG    . GLU G 2 282 ? 0.534   106.757 105.860 1.00 39.55 ? 471  GLU C CG    1 
ATOM   9194  C  CD    . GLU G 2 282 ? -0.464  107.194 104.782 1.00 42.14 ? 471  GLU C CD    1 
ATOM   9195  O  OE1   . GLU G 2 282 ? -1.099  106.315 104.152 1.00 43.14 ? 471  GLU C OE1   1 
ATOM   9196  O  OE2   . GLU G 2 282 ? -0.609  108.416 104.557 1.00 43.70 ? 471  GLU C OE2   1 
ATOM   9197  N  N     . VAL G 2 283 ? 2.622   105.196 108.735 1.00 33.34 ? 472  VAL C N     1 
ATOM   9198  C  CA    . VAL G 2 283 ? 2.272   104.688 110.059 1.00 32.84 ? 472  VAL C CA    1 
ATOM   9199  C  C     . VAL G 2 283 ? 2.004   105.810 111.058 1.00 33.39 ? 472  VAL C C     1 
ATOM   9200  O  O     . VAL G 2 283 ? 2.810   106.728 111.194 1.00 33.70 ? 472  VAL C O     1 
ATOM   9201  C  CB    . VAL G 2 283 ? 3.421   103.795 110.642 1.00 31.77 ? 472  VAL C CB    1 
ATOM   9202  C  CG1   . VAL G 2 283 ? 2.932   103.046 111.862 1.00 30.26 ? 472  VAL C CG1   1 
ATOM   9203  C  CG2   . VAL G 2 283 ? 3.917   102.810 109.599 1.00 30.06 ? 472  VAL C CG2   1 
ATOM   9204  N  N     . ASN G 2 284 ? 0.876   105.724 111.760 1.00 33.14 ? 473  ASN C N     1 
ATOM   9205  C  CA    . ASN G 2 284 ? 0.514   106.714 112.778 1.00 33.12 ? 473  ASN C CA    1 
ATOM   9206  C  C     . ASN G 2 284 ? 1.363   106.418 114.004 1.00 32.37 ? 473  ASN C C     1 
ATOM   9207  O  O     . ASN G 2 284 ? 1.675   105.258 114.271 1.00 32.60 ? 473  ASN C O     1 
ATOM   9208  C  CB    . ASN G 2 284 ? -0.973  106.603 113.126 1.00 34.02 ? 473  ASN C CB    1 
ATOM   9209  C  CG    . ASN G 2 284 ? -1.861  107.223 112.067 1.00 34.99 ? 473  ASN C CG    1 
ATOM   9210  O  OD1   . ASN G 2 284 ? -2.908  106.678 111.712 1.00 36.51 ? 473  ASN C OD1   1 
ATOM   9211  N  ND2   . ASN G 2 284 ? -1.451  108.376 111.564 1.00 35.08 ? 473  ASN C ND2   1 
ATOM   9212  N  N     . LYS G 2 285 ? 1.733   107.448 114.759 1.00 31.72 ? 474  LYS C N     1 
ATOM   9213  C  CA    . LYS G 2 285 ? 2.586   107.219 115.918 1.00 31.34 ? 474  LYS C CA    1 
ATOM   9214  C  C     . LYS G 2 285 ? 2.152   106.090 116.852 1.00 30.30 ? 474  LYS C C     1 
ATOM   9215  O  O     . LYS G 2 285 ? 2.965   105.251 117.223 1.00 30.16 ? 474  LYS C O     1 
ATOM   9216  C  CB    . LYS G 2 285 ? 2.787   108.503 116.745 1.00 32.46 ? 474  LYS C CB    1 
ATOM   9217  C  CG    . LYS G 2 285 ? 3.711   108.244 117.952 1.00 34.39 ? 474  LYS C CG    1 
ATOM   9218  C  CD    . LYS G 2 285 ? 4.057   109.467 118.782 1.00 36.26 ? 474  LYS C CD    1 
ATOM   9219  C  CE    . LYS G 2 285 ? 4.930   110.474 118.032 1.00 36.49 ? 474  LYS C CE    1 
ATOM   9220  N  NZ    . LYS G 2 285 ? 4.051   111.573 117.556 1.00 39.10 ? 474  LYS C NZ    1 
ATOM   9221  N  N     . TYR G 2 286 ? 0.883   106.064 117.230 1.00 30.82 ? 475  TYR C N     1 
ATOM   9222  C  CA    . TYR G 2 286 ? 0.383   105.049 118.150 1.00 31.17 ? 475  TYR C CA    1 
ATOM   9223  C  C     . TYR G 2 286 ? 0.477   103.637 117.572 1.00 30.74 ? 475  TYR C C     1 
ATOM   9224  O  O     . TYR G 2 286 ? 0.600   102.673 118.315 1.00 30.54 ? 475  TYR C O     1 
ATOM   9225  C  CB    . TYR G 2 286 ? -1.073  105.362 118.528 1.00 33.40 ? 475  TYR C CB    1 
ATOM   9226  C  CG    . TYR G 2 286 ? -2.095  104.862 117.528 1.00 34.57 ? 475  TYR C CG    1 
ATOM   9227  C  CD1   . TYR G 2 286 ? -2.472  103.524 117.513 1.00 35.12 ? 475  TYR C CD1   1 
ATOM   9228  C  CD2   . TYR G 2 286 ? -2.603  105.704 116.544 1.00 35.55 ? 475  TYR C CD2   1 
ATOM   9229  C  CE1   . TYR G 2 286 ? -3.312  103.024 116.540 1.00 37.16 ? 475  TYR C CE1   1 
ATOM   9230  C  CE2   . TYR G 2 286 ? -3.457  105.221 115.555 1.00 37.55 ? 475  TYR C CE2   1 
ATOM   9231  C  CZ    . TYR G 2 286 ? -3.800  103.868 115.557 1.00 38.27 ? 475  TYR C CZ    1 
ATOM   9232  O  OH    . TYR G 2 286 ? -4.581  103.339 114.556 1.00 39.65 ? 475  TYR C OH    1 
ATOM   9233  N  N     . ALA G 2 287 ? 0.437   103.524 116.249 1.00 29.97 ? 476  ALA C N     1 
ATOM   9234  C  CA    . ALA G 2 287 ? 0.490   102.222 115.591 1.00 29.58 ? 476  ALA C CA    1 
ATOM   9235  C  C     . ALA G 2 287 ? 1.896   101.664 115.383 1.00 29.68 ? 476  ALA C C     1 
ATOM   9236  O  O     . ALA G 2 287 ? 2.064   100.501 115.005 1.00 29.27 ? 476  ALA C O     1 
ATOM   9237  C  CB    . ALA G 2 287 ? -0.236  102.294 114.261 1.00 28.64 ? 476  ALA C CB    1 
ATOM   9238  N  N     . LYS G 2 288 ? 2.906   102.483 115.653 1.00 29.75 ? 477  LYS C N     1 
ATOM   9239  C  CA    . LYS G 2 288 ? 4.294   102.067 115.468 1.00 28.46 ? 477  LYS C CA    1 
ATOM   9240  C  C     . LYS G 2 288 ? 4.741   100.851 116.270 1.00 29.32 ? 477  LYS C C     1 
ATOM   9241  O  O     . LYS G 2 288 ? 5.419   99.986  115.731 1.00 28.54 ? 477  LYS C O     1 
ATOM   9242  C  CB    . LYS G 2 288 ? 5.231   103.249 115.733 1.00 26.52 ? 477  LYS C CB    1 
ATOM   9243  C  CG    . LYS G 2 288 ? 5.154   104.338 114.660 1.00 24.18 ? 477  LYS C CG    1 
ATOM   9244  C  CD    . LYS G 2 288 ? 6.157   105.437 114.919 1.00 23.49 ? 477  LYS C CD    1 
ATOM   9245  C  CE    . LYS G 2 288 ? 6.221   106.452 113.767 1.00 22.27 ? 477  LYS C CE    1 
ATOM   9246  N  NZ    . LYS G 2 288 ? 7.265   107.474 114.040 1.00 19.58 ? 477  LYS C NZ    1 
ATOM   9247  N  N     . ARG G 2 289 ? 4.375   100.776 117.543 1.00 29.99 ? 478  ARG C N     1 
ATOM   9248  C  CA    . ARG G 2 289 ? 4.776   99.632  118.360 1.00 32.52 ? 478  ARG C CA    1 
ATOM   9249  C  C     . ARG G 2 289 ? 4.382   98.311  117.713 1.00 32.50 ? 478  ARG C C     1 
ATOM   9250  O  O     . ARG G 2 289 ? 5.214   97.427  117.552 1.00 32.73 ? 478  ARG C O     1 
ATOM   9251  C  CB    . ARG G 2 289 ? 4.153   99.719  119.759 1.00 34.48 ? 478  ARG C CB    1 
ATOM   9252  C  CG    . ARG G 2 289 ? 4.878   100.660 120.719 1.00 38.33 ? 478  ARG C CG    1 
ATOM   9253  C  CD    . ARG G 2 289 ? 3.925   101.694 121.303 1.00 41.19 ? 478  ARG C CD    1 
ATOM   9254  N  NE    . ARG G 2 289 ? 2.991   101.099 122.247 1.00 44.14 ? 478  ARG C NE    1 
ATOM   9255  C  CZ    . ARG G 2 289 ? 1.682   101.344 122.279 1.00 45.06 ? 478  ARG C CZ    1 
ATOM   9256  N  NH1   . ARG G 2 289 ? 1.111   102.183 121.413 1.00 43.39 ? 478  ARG C NH1   1 
ATOM   9257  N  NH2   . ARG G 2 289 ? 0.943   100.735 123.193 1.00 46.10 ? 478  ARG C NH2   1 
ATOM   9258  N  N     . SER G 2 290 ? 3.106   98.190  117.346 1.00 33.41 ? 479  SER C N     1 
ATOM   9259  C  CA    . SER G 2 290 ? 2.568   96.985  116.712 1.00 33.57 ? 479  SER C CA    1 
ATOM   9260  C  C     . SER G 2 290 ? 3.202   96.661  115.362 1.00 32.71 ? 479  SER C C     1 
ATOM   9261  O  O     . SER G 2 290 ? 3.461   95.498  115.049 1.00 31.71 ? 479  SER C O     1 
ATOM   9262  C  CB    . SER G 2 290 ? 1.063   97.127  116.504 1.00 33.82 ? 479  SER C CB    1 
ATOM   9263  O  OG    . SER G 2 290 ? 0.414   97.336  117.738 1.00 38.50 ? 479  SER C OG    1 
ATOM   9264  N  N     . LYS G 2 291 ? 3.424   97.696  114.564 1.00 31.88 ? 480  LYS C N     1 
ATOM   9265  C  CA    . LYS G 2 291 ? 4.015   97.526  113.242 1.00 32.15 ? 480  LYS C CA    1 
ATOM   9266  C  C     . LYS G 2 291 ? 5.402   96.912  113.373 1.00 30.89 ? 480  LYS C C     1 
ATOM   9267  O  O     . LYS G 2 291 ? 5.764   96.005  112.624 1.00 30.09 ? 480  LYS C O     1 
ATOM   9268  C  CB    . LYS G 2 291 ? 4.125   98.881  112.535 1.00 33.51 ? 480  LYS C CB    1 
ATOM   9269  C  CG    . LYS G 2 291 ? 4.453   98.781  111.056 1.00 36.71 ? 480  LYS C CG    1 
ATOM   9270  C  CD    . LYS G 2 291 ? 3.204   98.435  110.279 1.00 39.69 ? 480  LYS C CD    1 
ATOM   9271  C  CE    . LYS G 2 291 ? 3.528   97.748  108.974 1.00 41.74 ? 480  LYS C CE    1 
ATOM   9272  N  NZ    . LYS G 2 291 ? 2.265   97.338  108.278 1.00 43.31 ? 480  LYS C NZ    1 
ATOM   9273  N  N     . LEU G 2 292 ? 6.172   97.410  114.338 1.00 30.02 ? 481  LEU C N     1 
ATOM   9274  C  CA    . LEU G 2 292 ? 7.529   96.927  114.565 1.00 29.50 ? 481  LEU C CA    1 
ATOM   9275  C  C     . LEU G 2 292 ? 7.489   95.457  114.982 1.00 29.38 ? 481  LEU C C     1 
ATOM   9276  O  O     . LEU G 2 292 ? 8.236   94.631  114.449 1.00 28.65 ? 481  LEU C O     1 
ATOM   9277  C  CB    . LEU G 2 292 ? 8.210   97.764  115.657 1.00 29.38 ? 481  LEU C CB    1 
ATOM   9278  C  CG    . LEU G 2 292 ? 9.737   97.970  115.689 1.00 29.94 ? 481  LEU C CG    1 
ATOM   9279  C  CD1   . LEU G 2 292 ? 10.204  97.844  117.131 1.00 29.38 ? 481  LEU C CD1   1 
ATOM   9280  C  CD2   . LEU G 2 292 ? 10.474  96.995  114.784 1.00 28.98 ? 481  LEU C CD2   1 
ATOM   9281  N  N     . ILE G 2 293 ? 6.625   95.135  115.944 1.00 29.40 ? 482  ILE C N     1 
ATOM   9282  C  CA    . ILE G 2 293 ? 6.505   93.756  116.395 1.00 31.04 ? 482  ILE C CA    1 
ATOM   9283  C  C     . ILE G 2 293 ? 6.120   92.864  115.218 1.00 30.84 ? 482  ILE C C     1 
ATOM   9284  O  O     . ILE G 2 293 ? 6.605   91.743  115.093 1.00 29.98 ? 482  ILE C O     1 
ATOM   9285  C  CB    . ILE G 2 293 ? 5.485   93.640  117.543 1.00 32.15 ? 482  ILE C CB    1 
ATOM   9286  C  CG1   . ILE G 2 293 ? 6.162   94.090  118.833 1.00 33.34 ? 482  ILE C CG1   1 
ATOM   9287  C  CG2   . ILE G 2 293 ? 4.987   92.193  117.703 1.00 31.62 ? 482  ILE C CG2   1 
ATOM   9288  C  CD1   . ILE G 2 293 ? 5.254   94.897  119.713 1.00 37.03 ? 482  ILE C CD1   1 
ATOM   9289  N  N     . GLU G 2 294 ? 5.284   93.382  114.332 1.00 31.60 ? 483  GLU C N     1 
ATOM   9290  C  CA    . GLU G 2 294 ? 4.882   92.622  113.163 1.00 33.73 ? 483  GLU C CA    1 
ATOM   9291  C  C     . GLU G 2 294 ? 6.111   92.298  112.316 1.00 33.51 ? 483  GLU C C     1 
ATOM   9292  O  O     . GLU G 2 294 ? 6.360   91.147  111.978 1.00 33.01 ? 483  GLU C O     1 
ATOM   9293  C  CB    . GLU G 2 294 ? 3.872   93.425  112.341 1.00 37.00 ? 483  GLU C CB    1 
ATOM   9294  C  CG    . GLU G 2 294 ? 3.536   92.819  110.989 1.00 42.48 ? 483  GLU C CG    1 
ATOM   9295  C  CD    . GLU G 2 294 ? 2.312   93.464  110.346 1.00 46.01 ? 483  GLU C CD    1 
ATOM   9296  O  OE1   . GLU G 2 294 ? 1.996   93.102  109.184 1.00 49.07 ? 483  GLU C OE1   1 
ATOM   9297  O  OE2   . GLU G 2 294 ? 1.662   94.322  110.999 1.00 46.96 ? 483  GLU C OE2   1 
ATOM   9298  N  N     . ILE G 2 295 ? 6.892   93.320  111.996 1.00 32.90 ? 484  ILE C N     1 
ATOM   9299  C  CA    . ILE G 2 295 ? 8.088   93.136  111.183 1.00 32.43 ? 484  ILE C CA    1 
ATOM   9300  C  C     . ILE G 2 295 ? 9.135   92.230  111.838 1.00 31.67 ? 484  ILE C C     1 
ATOM   9301  O  O     . ILE G 2 295 ? 9.667   91.317  111.204 1.00 30.96 ? 484  ILE C O     1 
ATOM   9302  C  CB    . ILE G 2 295 ? 8.727   94.499  110.875 1.00 32.96 ? 484  ILE C CB    1 
ATOM   9303  C  CG1   . ILE G 2 295 ? 7.793   95.301  109.974 1.00 32.63 ? 484  ILE C CG1   1 
ATOM   9304  C  CG2   . ILE G 2 295 ? 10.095  94.313  110.239 1.00 33.32 ? 484  ILE C CG2   1 
ATOM   9305  C  CD1   . ILE G 2 295 ? 8.110   96.785  109.938 1.00 32.10 ? 484  ILE C CD1   1 
ATOM   9306  N  N     . LEU G 2 296 ? 9.431   92.486  113.106 1.00 31.72 ? 485  LEU C N     1 
ATOM   9307  C  CA    . LEU G 2 296 ? 10.422  91.691  113.822 1.00 32.38 ? 485  LEU C CA    1 
ATOM   9308  C  C     . LEU G 2 296 ? 9.981   90.233  114.008 1.00 33.38 ? 485  LEU C C     1 
ATOM   9309  O  O     . LEU G 2 296 ? 10.813  89.345  114.165 1.00 33.53 ? 485  LEU C O     1 
ATOM   9310  C  CB    . LEU G 2 296 ? 10.709  92.321  115.187 1.00 31.54 ? 485  LEU C CB    1 
ATOM   9311  C  CG    . LEU G 2 296 ? 11.294  93.735  115.191 1.00 30.96 ? 485  LEU C CG    1 
ATOM   9312  C  CD1   . LEU G 2 296 ? 11.498  94.178  116.620 1.00 28.95 ? 485  LEU C CD1   1 
ATOM   9313  C  CD2   . LEU G 2 296 ? 12.622  93.751  114.437 1.00 30.68 ? 485  LEU C CD2   1 
ATOM   9314  N  N     . SER G 2 297 ? 8.676   89.988  114.011 1.00 34.52 ? 486  SER C N     1 
ATOM   9315  C  CA    . SER G 2 297 ? 8.180   88.625  114.157 1.00 36.25 ? 486  SER C CA    1 
ATOM   9316  C  C     . SER G 2 297 ? 8.534   87.893  112.875 1.00 36.70 ? 486  SER C C     1 
ATOM   9317  O  O     . SER G 2 297 ? 8.911   86.720  112.886 1.00 37.57 ? 486  SER C O     1 
ATOM   9318  C  CB    . SER G 2 297 ? 6.668   88.623  114.362 1.00 36.08 ? 486  SER C CB    1 
ATOM   9319  O  OG    . SER G 2 297 ? 6.346   89.138  115.642 1.00 37.70 ? 486  SER C OG    1 
ATOM   9320  N  N     . GLU G 2 298 ? 8.425   88.600  111.763 1.00 36.89 ? 487  GLU C N     1 
ATOM   9321  C  CA    . GLU G 2 298 ? 8.768   88.009  110.484 1.00 37.20 ? 487  GLU C CA    1 
ATOM   9322  C  C     . GLU G 2 298 ? 10.265  87.726  110.416 1.00 35.98 ? 487  GLU C C     1 
ATOM   9323  O  O     . GLU G 2 298 ? 10.681  86.632  110.035 1.00 36.37 ? 487  GLU C O     1 
ATOM   9324  C  CB    . GLU G 2 298 ? 8.363   88.931  109.345 1.00 38.34 ? 487  GLU C CB    1 
ATOM   9325  C  CG    . GLU G 2 298 ? 8.758   88.378  107.989 1.00 43.34 ? 487  GLU C CG    1 
ATOM   9326  C  CD    . GLU G 2 298 ? 8.326   86.926  107.805 1.00 45.59 ? 487  GLU C CD    1 
ATOM   9327  O  OE1   . GLU G 2 298 ? 7.126   86.631  108.036 1.00 46.27 ? 487  GLU C OE1   1 
ATOM   9328  O  OE2   . GLU G 2 298 ? 9.186   86.092  107.429 1.00 46.63 ? 487  GLU C OE2   1 
ATOM   9329  N  N     . GLN G 2 299 ? 11.078  88.711  110.792 1.00 34.50 ? 488  GLN C N     1 
ATOM   9330  C  CA    . GLN G 2 299 ? 12.534  88.547  110.775 1.00 33.21 ? 488  GLN C CA    1 
ATOM   9331  C  C     . GLN G 2 299 ? 13.169  89.589  111.686 1.00 33.08 ? 488  GLN C C     1 
ATOM   9332  O  O     . GLN G 2 299 ? 13.001  90.790  111.467 1.00 32.19 ? 488  GLN C O     1 
ATOM   9333  C  CB    . GLN G 2 299 ? 13.076  88.690  109.346 1.00 31.70 ? 488  GLN C CB    1 
ATOM   9334  C  CG    . GLN G 2 299 ? 14.562  88.477  109.246 1.00 32.06 ? 488  GLN C CG    1 
ATOM   9335  C  CD    . GLN G 2 299 ? 15.041  88.392  107.810 1.00 33.57 ? 488  GLN C CD    1 
ATOM   9336  O  OE1   . GLN G 2 299 ? 14.517  89.078  106.931 1.00 34.48 ? 488  GLN C OE1   1 
ATOM   9337  N  NE2   . GLN G 2 299 ? 16.054  87.558  107.564 1.00 33.50 ? 488  GLN C NE2   1 
ATOM   9338  N  N     . ALA G 2 300 ? 13.901  89.120  112.696 1.00 33.23 ? 489  ALA C N     1 
ATOM   9339  C  CA    . ALA G 2 300 ? 14.535  90.003  113.676 1.00 33.92 ? 489  ALA C CA    1 
ATOM   9340  C  C     . ALA G 2 300 ? 16.059  90.031  113.676 1.00 34.44 ? 489  ALA C C     1 
ATOM   9341  O  O     . ALA G 2 300 ? 16.667  91.007  114.104 1.00 34.09 ? 489  ALA C O     1 
ATOM   9342  C  CB    . ALA G 2 300 ? 14.053  89.636  115.077 1.00 32.05 ? 489  ALA C CB    1 
ATOM   9343  N  N     . ASP G 2 301 ? 16.679  88.955  113.219 1.00 34.78 ? 490  ASP C N     1 
ATOM   9344  C  CA    . ASP G 2 301 ? 18.123  88.867  113.235 1.00 34.83 ? 490  ASP C CA    1 
ATOM   9345  C  C     . ASP G 2 301 ? 18.874  89.949  112.443 1.00 33.62 ? 490  ASP C C     1 
ATOM   9346  O  O     . ASP G 2 301 ? 18.631  90.155  111.256 1.00 34.49 ? 490  ASP C O     1 
ATOM   9347  C  CB    . ASP G 2 301 ? 18.522  87.469  112.766 1.00 37.43 ? 490  ASP C CB    1 
ATOM   9348  C  CG    . ASP G 2 301 ? 19.862  87.045  113.293 1.00 39.84 ? 490  ASP C CG    1 
ATOM   9349  O  OD1   . ASP G 2 301 ? 20.296  87.612  114.318 1.00 41.91 ? 490  ASP C OD1   1 
ATOM   9350  O  OD2   . ASP G 2 301 ? 20.479  86.136  112.693 1.00 43.18 ? 490  ASP C OD2   1 
ATOM   9351  N  N     . GLY G 2 302 ? 19.793  90.638  113.115 1.00 31.70 ? 491  GLY C N     1 
ATOM   9352  C  CA    . GLY G 2 302 ? 20.574  91.671  112.459 1.00 29.23 ? 491  GLY C CA    1 
ATOM   9353  C  C     . GLY G 2 302 ? 19.847  92.963  112.118 1.00 27.56 ? 491  GLY C C     1 
ATOM   9354  O  O     . GLY G 2 302 ? 19.988  93.500  111.021 1.00 27.86 ? 491  GLY C O     1 
ATOM   9355  N  N     . THR G 2 303 ? 19.047  93.478  113.033 1.00 26.62 ? 492  THR C N     1 
ATOM   9356  C  CA    . THR G 2 303 ? 18.372  94.725  112.720 1.00 26.86 ? 492  THR C CA    1 
ATOM   9357  C  C     . THR G 2 303 ? 18.643  95.846  113.713 1.00 25.21 ? 492  THR C C     1 
ATOM   9358  O  O     . THR G 2 303 ? 18.797  95.617  114.915 1.00 25.51 ? 492  THR C O     1 
ATOM   9359  C  CB    . THR G 2 303 ? 16.848  94.510  112.484 1.00 26.93 ? 492  THR C CB    1 
ATOM   9360  O  OG1   . THR G 2 303 ? 16.086  95.466  113.210 1.00 30.58 ? 492  THR C OG1   1 
ATOM   9361  C  CG2   . THR G 2 303 ? 16.443  93.144  112.852 1.00 27.94 ? 492  THR C CG2   1 
ATOM   9362  N  N     . ILE G 2 304 ? 18.763  97.056  113.176 1.00 24.38 ? 493  ILE C N     1 
ATOM   9363  C  CA    . ILE G 2 304 ? 19.027  98.234  113.984 1.00 23.99 ? 493  ILE C CA    1 
ATOM   9364  C  C     . ILE G 2 304 ? 17.814  99.138  113.826 1.00 24.60 ? 493  ILE C C     1 
ATOM   9365  O  O     . ILE G 2 304 ? 17.369  99.408  112.704 1.00 24.38 ? 493  ILE C O     1 
ATOM   9366  C  CB    . ILE G 2 304 ? 20.345  98.951  113.537 1.00 23.78 ? 493  ILE C CB    1 
ATOM   9367  C  CG1   . ILE G 2 304 ? 20.678  100.069 114.523 1.00 23.93 ? 493  ILE C CG1   1 
ATOM   9368  C  CG2   . ILE G 2 304 ? 20.231  99.497  112.116 1.00 22.11 ? 493  ILE C CG2   1 
ATOM   9369  C  CD1   . ILE G 2 304 ? 21.922  100.826 114.150 1.00 23.96 ? 493  ILE C CD1   1 
ATOM   9370  N  N     . VAL G 2 305 ? 17.250  99.573  114.951 1.00 22.87 ? 494  VAL C N     1 
ATOM   9371  C  CA    . VAL G 2 305 ? 16.058  100.406 114.914 1.00 22.27 ? 494  VAL C CA    1 
ATOM   9372  C  C     . VAL G 2 305 ? 16.360  101.826 115.388 1.00 22.08 ? 494  VAL C C     1 
ATOM   9373  O  O     . VAL G 2 305 ? 16.818  102.038 116.511 1.00 22.62 ? 494  VAL C O     1 
ATOM   9374  C  CB    . VAL G 2 305 ? 14.923  99.784  115.798 1.00 22.04 ? 494  VAL C CB    1 
ATOM   9375  C  CG1   . VAL G 2 305 ? 13.613  100.539 115.602 1.00 20.14 ? 494  VAL C CG1   1 
ATOM   9376  C  CG2   . VAL G 2 305 ? 14.740  98.310  115.437 1.00 19.90 ? 494  VAL C CG2   1 
ATOM   9377  N  N     . PHE G 2 306 ? 16.101  102.792 114.523 1.00 20.06 ? 495  PHE C N     1 
ATOM   9378  C  CA    . PHE G 2 306 ? 16.341  104.179 114.868 1.00 19.94 ? 495  PHE C CA    1 
ATOM   9379  C  C     . PHE G 2 306 ? 15.096  104.873 115.410 1.00 20.10 ? 495  PHE C C     1 
ATOM   9380  O  O     . PHE G 2 306 ? 14.022  104.857 114.792 1.00 19.31 ? 495  PHE C O     1 
ATOM   9381  C  CB    . PHE G 2 306 ? 16.868  104.942 113.648 1.00 17.35 ? 495  PHE C CB    1 
ATOM   9382  C  CG    . PHE G 2 306 ? 18.284  104.615 113.298 1.00 17.18 ? 495  PHE C CG    1 
ATOM   9383  C  CD1   . PHE G 2 306 ? 19.333  105.066 114.102 1.00 16.26 ? 495  PHE C CD1   1 
ATOM   9384  C  CD2   . PHE G 2 306 ? 18.583  103.844 112.168 1.00 15.55 ? 495  PHE C CD2   1 
ATOM   9385  C  CE1   . PHE G 2 306 ? 20.654  104.754 113.790 1.00 16.54 ? 495  PHE C CE1   1 
ATOM   9386  C  CE2   . PHE G 2 306 ? 19.895  103.528 111.847 1.00 15.12 ? 495  PHE C CE2   1 
ATOM   9387  C  CZ    . PHE G 2 306 ? 20.937  103.977 112.653 1.00 15.93 ? 495  PHE C CZ    1 
ATOM   9388  N  N     . VAL G 2 307 ? 15.262  105.471 116.583 1.00 20.82 ? 496  VAL C N     1 
ATOM   9389  C  CA    . VAL G 2 307 ? 14.213  106.212 117.257 1.00 21.79 ? 496  VAL C CA    1 
ATOM   9390  C  C     . VAL G 2 307 ? 14.744  107.627 117.508 1.00 23.07 ? 496  VAL C C     1 
ATOM   9391  O  O     . VAL G 2 307 ? 15.961  107.869 117.497 1.00 21.97 ? 496  VAL C O     1 
ATOM   9392  C  CB    . VAL G 2 307 ? 13.828  105.565 118.608 1.00 21.48 ? 496  VAL C CB    1 
ATOM   9393  C  CG1   . VAL G 2 307 ? 13.350  104.141 118.384 1.00 22.29 ? 496  VAL C CG1   1 
ATOM   9394  C  CG2   . VAL G 2 307 ? 15.009  105.600 119.562 1.00 19.91 ? 496  VAL C CG2   1 
ATOM   9395  N  N     . GLU G 2 308 ? 13.827  108.553 117.750 1.00 24.37 ? 497  GLU C N     1 
ATOM   9396  C  CA    . GLU G 2 308 ? 14.190  109.946 117.966 1.00 26.21 ? 497  GLU C CA    1 
ATOM   9397  C  C     . GLU G 2 308 ? 14.904  110.278 119.279 1.00 25.53 ? 497  GLU C C     1 
ATOM   9398  O  O     . GLU G 2 308 ? 15.917  110.982 119.255 1.00 26.30 ? 497  GLU C O     1 
ATOM   9399  C  CB    . GLU G 2 308 ? 12.941  110.828 117.832 1.00 28.58 ? 497  GLU C CB    1 
ATOM   9400  C  CG    . GLU G 2 308 ? 13.188  112.321 118.037 1.00 32.51 ? 497  GLU C CG    1 
ATOM   9401  C  CD    . GLU G 2 308 ? 14.212  112.897 117.067 1.00 36.25 ? 497  GLU C CD    1 
ATOM   9402  O  OE1   . GLU G 2 308 ? 14.121  112.601 115.849 1.00 38.42 ? 497  GLU C OE1   1 
ATOM   9403  O  OE2   . GLU G 2 308 ? 15.108  113.655 117.514 1.00 37.61 ? 497  GLU C OE2   1 
ATOM   9404  N  N     . THR G 2 309 ? 14.409  109.756 120.402 1.00 23.03 ? 498  THR C N     1 
ATOM   9405  C  CA    . THR G 2 309 ? 14.978  110.083 121.707 1.00 23.09 ? 498  THR C CA    1 
ATOM   9406  C  C     . THR G 2 309 ? 15.665  108.983 122.515 1.00 22.93 ? 498  THR C C     1 
ATOM   9407  O  O     . THR G 2 309 ? 15.384  107.794 122.357 1.00 23.15 ? 498  THR C O     1 
ATOM   9408  C  CB    . THR G 2 309 ? 13.886  110.698 122.635 1.00 23.63 ? 498  THR C CB    1 
ATOM   9409  O  OG1   . THR G 2 309 ? 12.995  109.661 123.086 1.00 22.57 ? 498  THR C OG1   1 
ATOM   9410  C  CG2   . THR G 2 309 ? 13.089  111.771 121.892 1.00 21.55 ? 498  THR C CG2   1 
ATOM   9411  N  N     . LYS G 2 310 ? 16.558  109.404 123.404 1.00 22.48 ? 499  LYS C N     1 
ATOM   9412  C  CA    . LYS G 2 310 ? 17.266  108.475 124.272 1.00 23.51 ? 499  LYS C CA    1 
ATOM   9413  C  C     . LYS G 2 310 ? 16.260  107.711 125.114 1.00 23.71 ? 499  LYS C C     1 
ATOM   9414  O  O     . LYS G 2 310 ? 16.381  106.506 125.320 1.00 23.96 ? 499  LYS C O     1 
ATOM   9415  C  CB    . LYS G 2 310 ? 18.228  109.223 125.204 1.00 22.95 ? 499  LYS C CB    1 
ATOM   9416  C  CG    . LYS G 2 310 ? 19.362  109.929 124.493 1.00 22.78 ? 499  LYS C CG    1 
ATOM   9417  C  CD    . LYS G 2 310 ? 20.293  110.629 125.492 1.00 23.45 ? 499  LYS C CD    1 
ATOM   9418  C  CE    . LYS G 2 310 ? 19.564  111.691 126.300 1.00 23.87 ? 499  LYS C CE    1 
ATOM   9419  N  NZ    . LYS G 2 310 ? 20.532  112.641 126.878 1.00 27.13 ? 499  LYS C NZ    1 
ATOM   9420  N  N     . ARG G 2 311 ? 15.270  108.433 125.616 1.00 24.62 ? 500  ARG C N     1 
ATOM   9421  C  CA    . ARG G 2 311 ? 14.226  107.829 126.428 1.00 26.31 ? 500  ARG C CA    1 
ATOM   9422  C  C     . ARG G 2 311 ? 13.403  106.835 125.584 1.00 25.64 ? 500  ARG C C     1 
ATOM   9423  O  O     . ARG G 2 311 ? 13.014  105.769 126.067 1.00 24.93 ? 500  ARG C O     1 
ATOM   9424  C  CB    . ARG G 2 311 ? 13.354  108.933 127.019 1.00 27.77 ? 500  ARG C CB    1 
ATOM   9425  C  CG    . ARG G 2 311 ? 12.096  108.455 127.692 1.00 33.47 ? 500  ARG C CG    1 
ATOM   9426  C  CD    . ARG G 2 311 ? 11.671  109.426 128.790 1.00 35.73 ? 500  ARG C CD    1 
ATOM   9427  N  NE    . ARG G 2 311 ? 11.795  108.724 130.054 1.00 39.48 ? 500  ARG C NE    1 
ATOM   9428  C  CZ    . ARG G 2 311 ? 12.315  109.230 131.155 1.00 39.12 ? 500  ARG C CZ    1 
ATOM   9429  N  NH1   . ARG G 2 311 ? 12.766  110.478 131.177 1.00 39.70 ? 500  ARG C NH1   1 
ATOM   9430  N  NH2   . ARG G 2 311 ? 12.416  108.455 132.220 1.00 41.52 ? 500  ARG C NH2   1 
ATOM   9431  N  N     . GLY G 2 312 ? 13.168  107.176 124.317 1.00 25.51 ? 501  GLY C N     1 
ATOM   9432  C  CA    . GLY G 2 312 ? 12.441  106.274 123.448 1.00 24.73 ? 501  GLY C CA    1 
ATOM   9433  C  C     . GLY G 2 312 ? 13.246  104.999 123.231 1.00 26.09 ? 501  GLY C C     1 
ATOM   9434  O  O     . GLY G 2 312 ? 12.689  103.892 123.204 1.00 25.58 ? 501  GLY C O     1 
ATOM   9435  N  N     . ALA G 2 313 ? 14.565  105.150 123.106 1.00 25.97 ? 502  ALA C N     1 
ATOM   9436  C  CA    . ALA G 2 313 ? 15.449  104.006 122.877 1.00 27.83 ? 502  ALA C CA    1 
ATOM   9437  C  C     . ALA G 2 313 ? 15.417  103.005 124.027 1.00 28.56 ? 502  ALA C C     1 
ATOM   9438  O  O     . ALA G 2 313 ? 15.239  101.804 123.826 1.00 27.53 ? 502  ALA C O     1 
ATOM   9439  C  CB    . ALA G 2 313 ? 16.877  104.487 122.649 1.00 28.18 ? 502  ALA C CB    1 
ATOM   9440  N  N     . ASP G 2 314 ? 15.599  103.518 125.233 1.00 30.53 ? 503  ASP C N     1 
ATOM   9441  C  CA    . ASP G 2 314 ? 15.595  102.704 126.433 1.00 32.31 ? 503  ASP C CA    1 
ATOM   9442  C  C     . ASP G 2 314 ? 14.255  101.986 126.567 1.00 31.90 ? 503  ASP C C     1 
ATOM   9443  O  O     . ASP G 2 314 ? 14.201  100.790 126.825 1.00 31.57 ? 503  ASP C O     1 
ATOM   9444  C  CB    . ASP G 2 314 ? 15.831  103.599 127.647 1.00 35.32 ? 503  ASP C CB    1 
ATOM   9445  C  CG    . ASP G 2 314 ? 16.187  102.815 128.880 1.00 39.57 ? 503  ASP C CG    1 
ATOM   9446  O  OD1   . ASP G 2 314 ? 17.306  102.250 128.900 1.00 43.47 ? 503  ASP C OD1   1 
ATOM   9447  O  OD2   . ASP G 2 314 ? 15.358  102.759 129.819 1.00 41.14 ? 503  ASP C OD2   1 
ATOM   9448  N  N     . PHE G 2 315 ? 13.170  102.723 126.380 1.00 32.21 ? 504  PHE C N     1 
ATOM   9449  C  CA    . PHE G 2 315 ? 11.857  102.121 126.485 1.00 32.63 ? 504  PHE C CA    1 
ATOM   9450  C  C     . PHE G 2 315 ? 11.633  101.044 125.454 1.00 30.96 ? 504  PHE C C     1 
ATOM   9451  O  O     . PHE G 2 315 ? 11.156  99.972  125.790 1.00 30.82 ? 504  PHE C O     1 
ATOM   9452  C  CB    . PHE G 2 315 ? 10.733  103.146 126.327 1.00 35.97 ? 504  PHE C CB    1 
ATOM   9453  C  CG    . PHE G 2 315 ? 9.381   102.506 126.094 1.00 39.37 ? 504  PHE C CG    1 
ATOM   9454  C  CD1   . PHE G 2 315 ? 8.694   101.899 127.141 1.00 40.39 ? 504  PHE C CD1   1 
ATOM   9455  C  CD2   . PHE G 2 315 ? 8.849   102.421 124.802 1.00 41.47 ? 504  PHE C CD2   1 
ATOM   9456  C  CE1   . PHE G 2 315 ? 7.501   101.207 126.914 1.00 41.84 ? 504  PHE C CE1   1 
ATOM   9457  C  CE2   . PHE G 2 315 ? 7.650   101.730 124.554 1.00 43.05 ? 504  PHE C CE2   1 
ATOM   9458  C  CZ    . PHE G 2 315 ? 6.978   101.121 125.616 1.00 43.00 ? 504  PHE C CZ    1 
ATOM   9459  N  N     . LEU G 2 316 ? 11.952  101.330 124.196 1.00 30.05 ? 505  LEU C N     1 
ATOM   9460  C  CA    . LEU G 2 316 ? 11.721  100.340 123.144 1.00 29.42 ? 505  LEU C CA    1 
ATOM   9461  C  C     . LEU G 2 316 ? 12.512  99.053  123.363 1.00 29.70 ? 505  LEU C C     1 
ATOM   9462  O  O     . LEU G 2 316 ? 11.997  97.963  123.154 1.00 29.41 ? 505  LEU C O     1 
ATOM   9463  C  CB    . LEU G 2 316 ? 12.037  100.933 121.764 1.00 27.38 ? 505  LEU C CB    1 
ATOM   9464  C  CG    . LEU G 2 316 ? 11.490  100.172 120.548 1.00 25.63 ? 505  LEU C CG    1 
ATOM   9465  C  CD1   . LEU G 2 316 ? 9.996   99.912  120.730 1.00 24.69 ? 505  LEU C CD1   1 
ATOM   9466  C  CD2   . LEU G 2 316 ? 11.723  100.974 119.277 1.00 25.00 ? 505  LEU C CD2   1 
ATOM   9467  N  N     . ALA G 2 317 ? 13.758  99.175  123.805 1.00 30.83 ? 506  ALA C N     1 
ATOM   9468  C  CA    . ALA G 2 317 ? 14.584  97.998  124.035 1.00 31.42 ? 506  ALA C CA    1 
ATOM   9469  C  C     . ALA G 2 317 ? 14.003  97.143  125.151 1.00 32.25 ? 506  ALA C C     1 
ATOM   9470  O  O     . ALA G 2 317 ? 13.955  95.922  125.029 1.00 32.62 ? 506  ALA C O     1 
ATOM   9471  C  CB    . ALA G 2 317 ? 16.030  98.404  124.366 1.00 29.95 ? 506  ALA C CB    1 
ATOM   9472  N  N     . SER G 2 318 ? 13.560  97.763  126.238 1.00 32.87 ? 507  SER C N     1 
ATOM   9473  C  CA    . SER G 2 318 ? 13.004  96.961  127.306 1.00 35.48 ? 507  SER C CA    1 
ATOM   9474  C  C     . SER G 2 318 ? 11.682  96.376  126.806 1.00 35.88 ? 507  SER C C     1 
ATOM   9475  O  O     . SER G 2 318 ? 11.381  95.209  127.050 1.00 36.27 ? 507  SER C O     1 
ATOM   9476  C  CB    . SER G 2 318 ? 12.795  97.791  128.579 1.00 36.39 ? 507  SER C CB    1 
ATOM   9477  O  OG    . SER G 2 318 ? 11.513  98.382  128.600 1.00 40.39 ? 507  SER C OG    1 
ATOM   9478  N  N     . PHE G 2 319 ? 10.913  97.181  126.084 1.00 36.51 ? 508  PHE C N     1 
ATOM   9479  C  CA    . PHE G 2 319 ? 9.636   96.736  125.531 1.00 38.17 ? 508  PHE C CA    1 
ATOM   9480  C  C     . PHE G 2 319 ? 9.805   95.471  124.687 1.00 38.69 ? 508  PHE C C     1 
ATOM   9481  O  O     . PHE G 2 319 ? 9.016   94.533  124.795 1.00 39.19 ? 508  PHE C O     1 
ATOM   9482  C  CB    . PHE G 2 319 ? 9.019   97.845  124.673 1.00 39.29 ? 508  PHE C CB    1 
ATOM   9483  C  CG    . PHE G 2 319 ? 7.751   97.440  123.957 1.00 40.39 ? 508  PHE C CG    1 
ATOM   9484  C  CD1   . PHE G 2 319 ? 6.525   97.424  124.623 1.00 41.38 ? 508  PHE C CD1   1 
ATOM   9485  C  CD2   . PHE G 2 319 ? 7.780   97.105  122.604 1.00 40.25 ? 508  PHE C CD2   1 
ATOM   9486  C  CE1   . PHE G 2 319 ? 5.343   97.081  123.943 1.00 40.99 ? 508  PHE C CE1   1 
ATOM   9487  C  CE2   . PHE G 2 319 ? 6.614   96.765  121.925 1.00 40.94 ? 508  PHE C CE2   1 
ATOM   9488  C  CZ    . PHE G 2 319 ? 5.391   96.755  122.595 1.00 40.14 ? 508  PHE C CZ    1 
ATOM   9489  N  N     . LEU G 2 320 ? 10.833  95.439  123.847 1.00 38.96 ? 509  LEU C N     1 
ATOM   9490  C  CA    . LEU G 2 320 ? 11.062  94.269  123.006 1.00 40.26 ? 509  LEU C CA    1 
ATOM   9491  C  C     . LEU G 2 320 ? 11.689  93.085  123.751 1.00 41.38 ? 509  LEU C C     1 
ATOM   9492  O  O     . LEU G 2 320 ? 11.410  91.926  123.435 1.00 40.90 ? 509  LEU C O     1 
ATOM   9493  C  CB    . LEU G 2 320 ? 11.930  94.641  121.801 1.00 38.54 ? 509  LEU C CB    1 
ATOM   9494  C  CG    . LEU G 2 320 ? 11.266  95.555  120.766 1.00 39.18 ? 509  LEU C CG    1 
ATOM   9495  C  CD1   . LEU G 2 320 ? 12.306  96.039  119.766 1.00 39.04 ? 509  LEU C CD1   1 
ATOM   9496  C  CD2   . LEU G 2 320 ? 10.150  94.812  120.055 1.00 38.31 ? 509  LEU C CD2   1 
ATOM   9497  N  N     . SER G 2 321 ? 12.530  93.356  124.742 1.00 43.19 ? 510  SER C N     1 
ATOM   9498  C  CA    . SER G 2 321 ? 13.152  92.251  125.451 1.00 45.85 ? 510  SER C CA    1 
ATOM   9499  C  C     . SER G 2 321 ? 12.092  91.510  126.252 1.00 47.22 ? 510  SER C C     1 
ATOM   9500  O  O     . SER G 2 321 ? 12.207  90.304  126.477 1.00 48.21 ? 510  SER C O     1 
ATOM   9501  C  CB    . SER G 2 321 ? 14.271  92.746  126.370 1.00 46.43 ? 510  SER C CB    1 
ATOM   9502  O  OG    . SER G 2 321 ? 13.749  93.434  127.486 1.00 48.52 ? 510  SER C OG    1 
ATOM   9503  N  N     . GLU G 2 322 ? 11.054  92.233  126.666 1.00 48.34 ? 511  GLU C N     1 
ATOM   9504  C  CA    . GLU G 2 322 ? 9.956   91.643  127.428 1.00 49.67 ? 511  GLU C CA    1 
ATOM   9505  C  C     . GLU G 2 322 ? 9.219   90.642  126.550 1.00 49.19 ? 511  GLU C C     1 
ATOM   9506  O  O     . GLU G 2 322 ? 8.718   89.629  127.034 1.00 49.65 ? 511  GLU C O     1 
ATOM   9507  C  CB    . GLU G 2 322 ? 8.981   92.732  127.885 1.00 52.26 ? 511  GLU C CB    1 
ATOM   9508  C  CG    . GLU G 2 322 ? 8.931   92.949  129.388 1.00 56.10 ? 511  GLU C CG    1 
ATOM   9509  C  CD    . GLU G 2 322 ? 8.516   94.370  129.766 1.00 59.13 ? 511  GLU C CD    1 
ATOM   9510  O  OE1   . GLU G 2 322 ? 7.371   94.772  129.445 1.00 60.56 ? 511  GLU C OE1   1 
ATOM   9511  O  OE2   . GLU G 2 322 ? 9.343   95.090  130.384 1.00 60.75 ? 511  GLU C OE2   1 
ATOM   9512  N  N     . LYS G 2 323 ? 9.164   90.934  125.256 1.00 48.27 ? 512  LYS C N     1 
ATOM   9513  C  CA    . LYS G 2 323 ? 8.489   90.072  124.297 1.00 47.55 ? 512  LYS C CA    1 
ATOM   9514  C  C     . LYS G 2 323 ? 9.388   89.006  123.683 1.00 47.14 ? 512  LYS C C     1 
ATOM   9515  O  O     . LYS G 2 323 ? 9.083   88.473  122.618 1.00 47.61 ? 512  LYS C O     1 
ATOM   9516  C  CB    . LYS G 2 323 ? 7.857   90.913  123.188 1.00 47.60 ? 512  LYS C CB    1 
ATOM   9517  C  CG    . LYS G 2 323 ? 6.738   91.803  123.685 1.00 47.85 ? 512  LYS C CG    1 
ATOM   9518  C  CD    . LYS G 2 323 ? 5.986   92.438  122.538 1.00 49.13 ? 512  LYS C CD    1 
ATOM   9519  C  CE    . LYS G 2 323 ? 4.637   92.976  123.001 1.00 49.40 ? 512  LYS C CE    1 
ATOM   9520  N  NZ    . LYS G 2 323 ? 3.783   93.402  121.845 1.00 50.57 ? 512  LYS C NZ    1 
ATOM   9521  N  N     . GLU G 2 324 ? 10.497  88.706  124.352 1.00 46.58 ? 513  GLU C N     1 
ATOM   9522  C  CA    . GLU G 2 324 ? 11.430  87.677  123.903 1.00 46.08 ? 513  GLU C CA    1 
ATOM   9523  C  C     . GLU G 2 324 ? 12.307  87.986  122.691 1.00 44.10 ? 513  GLU C C     1 
ATOM   9524  O  O     . GLU G 2 324 ? 12.737  87.070  121.996 1.00 43.07 ? 513  GLU C O     1 
ATOM   9525  C  CB    . GLU G 2 324 ? 10.683  86.371  123.622 1.00 48.69 ? 513  GLU C CB    1 
ATOM   9526  C  CG    . GLU G 2 324 ? 9.522   86.099  124.548 1.00 52.04 ? 513  GLU C CG    1 
ATOM   9527  C  CD    . GLU G 2 324 ? 9.959   85.787  125.950 1.00 54.04 ? 513  GLU C CD    1 
ATOM   9528  O  OE1   . GLU G 2 324 ? 10.821  86.531  126.467 1.00 55.02 ? 513  GLU C OE1   1 
ATOM   9529  O  OE2   . GLU G 2 324 ? 9.432   84.804  126.531 1.00 55.68 ? 513  GLU C OE2   1 
ATOM   9530  N  N     . PHE G 2 325 ? 12.558  89.253  122.399 1.00 42.70 ? 514  PHE C N     1 
ATOM   9531  C  CA    . PHE G 2 325 ? 13.455  89.556  121.293 1.00 41.14 ? 514  PHE C CA    1 
ATOM   9532  C  C     . PHE G 2 325 ? 14.799  89.926  121.905 1.00 40.20 ? 514  PHE C C     1 
ATOM   9533  O  O     . PHE G 2 325 ? 14.879  90.887  122.674 1.00 41.46 ? 514  PHE C O     1 
ATOM   9534  C  CB    . PHE G 2 325 ? 12.946  90.730  120.459 1.00 40.72 ? 514  PHE C CB    1 
ATOM   9535  C  CG    . PHE G 2 325 ? 11.778  90.394  119.583 1.00 40.52 ? 514  PHE C CG    1 
ATOM   9536  C  CD1   . PHE G 2 325 ? 10.483  90.704  119.979 1.00 40.41 ? 514  PHE C CD1   1 
ATOM   9537  C  CD2   . PHE G 2 325 ? 11.972  89.762  118.357 1.00 39.53 ? 514  PHE C CD2   1 
ATOM   9538  C  CE1   . PHE G 2 325 ? 9.397   90.392  119.165 1.00 39.21 ? 514  PHE C CE1   1 
ATOM   9539  C  CE2   . PHE G 2 325 ? 10.896  89.446  117.542 1.00 38.58 ? 514  PHE C CE2   1 
ATOM   9540  C  CZ    . PHE G 2 325 ? 9.604   89.763  117.949 1.00 38.31 ? 514  PHE C CZ    1 
ATOM   9541  N  N     . PRO G 2 326 ? 15.867  89.156  121.611 1.00 39.23 ? 515  PRO C N     1 
ATOM   9542  C  CA    . PRO G 2 326 ? 17.195  89.476  122.170 1.00 37.75 ? 515  PRO C CA    1 
ATOM   9543  C  C     . PRO G 2 326 ? 17.540  90.902  121.700 1.00 36.86 ? 515  PRO C C     1 
ATOM   9544  O  O     . PRO G 2 326 ? 18.039  91.112  120.594 1.00 35.35 ? 515  PRO C O     1 
ATOM   9545  C  CB    . PRO G 2 326 ? 18.103  88.412  121.545 1.00 38.44 ? 515  PRO C CB    1 
ATOM   9546  C  CG    . PRO G 2 326 ? 17.167  87.257  121.302 1.00 38.38 ? 515  PRO C CG    1 
ATOM   9547  C  CD    . PRO G 2 326 ? 15.926  87.945  120.771 1.00 38.86 ? 515  PRO C CD    1 
ATOM   9548  N  N     . THR G 2 327 ? 17.241  91.870  122.560 1.00 35.79 ? 516  THR C N     1 
ATOM   9549  C  CA    . THR G 2 327 ? 17.428  93.274  122.246 1.00 34.37 ? 516  THR C CA    1 
ATOM   9550  C  C     . THR G 2 327 ? 18.324  94.062  123.193 1.00 34.13 ? 516  THR C C     1 
ATOM   9551  O  O     . THR G 2 327 ? 18.331  93.840  124.406 1.00 34.19 ? 516  THR C O     1 
ATOM   9552  C  CB    . THR G 2 327 ? 16.060  93.980  122.231 1.00 34.60 ? 516  THR C CB    1 
ATOM   9553  O  OG1   . THR G 2 327 ? 15.152  93.229  121.416 1.00 34.12 ? 516  THR C OG1   1 
ATOM   9554  C  CG2   . THR G 2 327 ? 16.178  95.402  121.691 1.00 33.43 ? 516  THR C CG2   1 
ATOM   9555  N  N     . THR G 2 328 ? 19.083  94.988  122.619 1.00 33.03 ? 517  THR C N     1 
ATOM   9556  C  CA    . THR G 2 328 ? 19.923  95.877  123.403 1.00 31.80 ? 517  THR C CA    1 
ATOM   9557  C  C     . THR G 2 328 ? 19.763  97.255  122.747 1.00 30.59 ? 517  THR C C     1 
ATOM   9558  O  O     . THR G 2 328 ? 19.026  97.397  121.773 1.00 29.61 ? 517  THR C O     1 
ATOM   9559  C  CB    . THR G 2 328 ? 21.404  95.405  123.432 1.00 31.94 ? 517  THR C CB    1 
ATOM   9560  O  OG1   . THR G 2 328 ? 22.164  96.300  124.247 1.00 32.68 ? 517  THR C OG1   1 
ATOM   9561  C  CG2   . THR G 2 328 ? 22.006  95.359  122.049 1.00 33.35 ? 517  THR C CG2   1 
ATOM   9562  N  N     . SER G 2 329 ? 20.414  98.275  123.284 1.00 29.24 ? 518  SER C N     1 
ATOM   9563  C  CA    . SER G 2 329 ? 20.294  99.592  122.696 1.00 28.03 ? 518  SER C CA    1 
ATOM   9564  C  C     . SER G 2 329 ? 21.551  100.422 122.924 1.00 27.70 ? 518  SER C C     1 
ATOM   9565  O  O     . SER G 2 329 ? 22.371  100.109 123.788 1.00 26.54 ? 518  SER C O     1 
ATOM   9566  C  CB    . SER G 2 329 ? 19.128  100.325 123.315 1.00 28.30 ? 518  SER C CB    1 
ATOM   9567  O  OG    . SER G 2 329 ? 19.443  100.638 124.661 1.00 30.03 ? 518  SER C OG    1 
ATOM   9568  N  N     . ILE G 2 330 ? 21.708  101.479 122.139 1.00 25.72 ? 519  ILE C N     1 
ATOM   9569  C  CA    . ILE G 2 330 ? 22.846  102.351 122.336 1.00 24.85 ? 519  ILE C CA    1 
ATOM   9570  C  C     . ILE G 2 330 ? 22.355  103.779 122.202 1.00 25.12 ? 519  ILE C C     1 
ATOM   9571  O  O     . ILE G 2 330 ? 21.652  104.129 121.243 1.00 26.33 ? 519  ILE C O     1 
ATOM   9572  C  CB    . ILE G 2 330 ? 23.994  102.045 121.334 1.00 24.55 ? 519  ILE C CB    1 
ATOM   9573  C  CG1   . ILE G 2 330 ? 25.166  102.990 121.607 1.00 24.56 ? 519  ILE C CG1   1 
ATOM   9574  C  CG2   . ILE G 2 330 ? 23.496  102.143 119.888 1.00 24.18 ? 519  ILE C CG2   1 
ATOM   9575  C  CD1   . ILE G 2 330 ? 26.396  102.695 120.767 1.00 24.11 ? 519  ILE C CD1   1 
ATOM   9576  N  N     . HIS G 2 331 ? 22.676  104.593 123.198 1.00 25.27 ? 520  HIS C N     1 
ATOM   9577  C  CA    . HIS G 2 331 ? 22.279  105.990 123.203 1.00 24.58 ? 520  HIS C CA    1 
ATOM   9578  C  C     . HIS G 2 331 ? 23.039  106.754 124.286 1.00 24.75 ? 520  HIS C C     1 
ATOM   9579  O  O     . HIS G 2 331 ? 23.676  106.155 125.147 1.00 24.04 ? 520  HIS C O     1 
ATOM   9580  C  CB    . HIS G 2 331 ? 20.763  106.120 123.409 1.00 25.04 ? 520  HIS C CB    1 
ATOM   9581  C  CG    . HIS G 2 331 ? 20.282  105.630 124.737 1.00 24.21 ? 520  HIS C CG    1 
ATOM   9582  N  ND1   . HIS G 2 331 ? 19.645  104.417 124.900 1.00 24.82 ? 520  HIS C ND1   1 
ATOM   9583  C  CD2   . HIS G 2 331 ? 20.340  106.194 125.964 1.00 23.52 ? 520  HIS C CD2   1 
ATOM   9584  C  CE1   . HIS G 2 331 ? 19.324  104.258 126.170 1.00 24.17 ? 520  HIS C CE1   1 
ATOM   9585  N  NE2   . HIS G 2 331 ? 19.737  105.321 126.838 1.00 25.27 ? 520  HIS C NE2   1 
ATOM   9586  N  N     . GLY G 2 332 ? 22.949  108.078 124.231 1.00 24.93 ? 521  GLY C N     1 
ATOM   9587  C  CA    . GLY G 2 332 ? 23.655  108.937 125.159 1.00 25.33 ? 521  GLY C CA    1 
ATOM   9588  C  C     . GLY G 2 332 ? 23.391  108.812 126.647 1.00 26.99 ? 521  GLY C C     1 
ATOM   9589  O  O     . GLY G 2 332 ? 24.190  109.305 127.442 1.00 27.25 ? 521  GLY C O     1 
ATOM   9590  N  N     . ASP G 2 333 ? 22.294  108.183 127.052 1.00 26.55 ? 522  ASP C N     1 
ATOM   9591  C  CA    . ASP G 2 333 ? 22.046  108.044 128.477 1.00 27.49 ? 522  ASP C CA    1 
ATOM   9592  C  C     . ASP G 2 333 ? 22.652  106.796 129.091 1.00 27.90 ? 522  ASP C C     1 
ATOM   9593  O  O     . ASP G 2 333 ? 22.672  106.662 130.311 1.00 28.17 ? 522  ASP C O     1 
ATOM   9594  C  CB    . ASP G 2 333 ? 20.555  108.078 128.779 1.00 28.35 ? 522  ASP C CB    1 
ATOM   9595  C  CG    . ASP G 2 333 ? 20.049  109.476 128.981 1.00 30.08 ? 522  ASP C CG    1 
ATOM   9596  O  OD1   . ASP G 2 333 ? 20.880  110.419 128.931 1.00 30.36 ? 522  ASP C OD1   1 
ATOM   9597  O  OD2   . ASP G 2 333 ? 18.824  109.635 129.187 1.00 31.73 ? 522  ASP C OD2   1 
ATOM   9598  N  N     . ARG G 2 334 ? 23.144  105.879 128.264 1.00 27.00 ? 523  ARG C N     1 
ATOM   9599  C  CA    . ARG G 2 334 ? 23.750  104.685 128.804 1.00 26.28 ? 523  ARG C CA    1 
ATOM   9600  C  C     . ARG G 2 334 ? 25.203  104.981 129.195 1.00 27.09 ? 523  ARG C C     1 
ATOM   9601  O  O     . ARG G 2 334 ? 25.804  105.946 128.721 1.00 27.09 ? 523  ARG C O     1 
ATOM   9602  C  CB    . ARG G 2 334 ? 23.716  103.560 127.774 1.00 26.67 ? 523  ARG C CB    1 
ATOM   9603  C  CG    . ARG G 2 334 ? 22.320  103.226 127.220 1.00 27.42 ? 523  ARG C CG    1 
ATOM   9604  C  CD    . ARG G 2 334 ? 22.301  101.787 126.679 1.00 27.13 ? 523  ARG C CD    1 
ATOM   9605  N  NE    . ARG G 2 334 ? 22.305  100.824 127.784 1.00 25.79 ? 523  ARG C NE    1 
ATOM   9606  C  CZ    . ARG G 2 334 ? 22.640  99.541  127.682 1.00 25.84 ? 523  ARG C CZ    1 
ATOM   9607  N  NH1   . ARG G 2 334 ? 23.010  99.028  126.521 1.00 25.44 ? 523  ARG C NH1   1 
ATOM   9608  N  NH2   . ARG G 2 334 ? 22.611  98.767  128.757 1.00 26.30 ? 523  ARG C NH2   1 
ATOM   9609  N  N     . LEU G 2 335 ? 25.751  104.160 130.083 1.00 26.94 ? 524  LEU C N     1 
ATOM   9610  C  CA    . LEU G 2 335 ? 27.146  104.286 130.504 1.00 27.08 ? 524  LEU C CA    1 
ATOM   9611  C  C     . LEU G 2 335 ? 28.011  103.953 129.283 1.00 26.80 ? 524  LEU C C     1 
ATOM   9612  O  O     . LEU G 2 335 ? 27.705  103.015 128.534 1.00 26.06 ? 524  LEU C O     1 
ATOM   9613  C  CB    . LEU G 2 335 ? 27.438  103.266 131.607 1.00 27.93 ? 524  LEU C CB    1 
ATOM   9614  C  CG    . LEU G 2 335 ? 27.611  103.668 133.081 1.00 30.17 ? 524  LEU C CG    1 
ATOM   9615  C  CD1   . LEU G 2 335 ? 26.636  104.735 133.499 1.00 28.92 ? 524  LEU C CD1   1 
ATOM   9616  C  CD2   . LEU G 2 335 ? 27.438  102.412 133.930 1.00 30.86 ? 524  LEU C CD2   1 
ATOM   9617  N  N     . GLN G 2 336 ? 29.090  104.698 129.079 1.00 26.53 ? 525  GLN C N     1 
ATOM   9618  C  CA    . GLN G 2 336 ? 29.952  104.416 127.936 1.00 26.73 ? 525  GLN C CA    1 
ATOM   9619  C  C     . GLN G 2 336 ? 30.347  102.941 127.866 1.00 26.95 ? 525  GLN C C     1 
ATOM   9620  O  O     . GLN G 2 336 ? 30.495  102.399 126.786 1.00 26.60 ? 525  GLN C O     1 
ATOM   9621  C  CB    . GLN G 2 336 ? 31.211  105.278 127.964 1.00 26.16 ? 525  GLN C CB    1 
ATOM   9622  C  CG    . GLN G 2 336 ? 32.061  105.123 126.708 1.00 25.12 ? 525  GLN C CG    1 
ATOM   9623  C  CD    . GLN G 2 336 ? 31.274  105.432 125.456 1.00 24.34 ? 525  GLN C CD    1 
ATOM   9624  O  OE1   . GLN G 2 336 ? 30.421  106.310 125.460 1.00 24.77 ? 525  GLN C OE1   1 
ATOM   9625  N  NE2   . GLN G 2 336 ? 31.566  104.721 124.372 1.00 24.16 ? 525  GLN C NE2   1 
ATOM   9626  N  N     . SER G 2 337 ? 30.532  102.281 129.004 1.00 27.98 ? 526  SER C N     1 
ATOM   9627  C  CA    . SER G 2 337 ? 30.870  100.851 128.951 1.00 28.22 ? 526  SER C CA    1 
ATOM   9628  C  C     . SER G 2 337 ? 29.696  100.048 128.367 1.00 28.30 ? 526  SER C C     1 
ATOM   9629  O  O     . SER G 2 337 ? 29.908  99.062  127.665 1.00 29.63 ? 526  SER C O     1 
ATOM   9630  C  CB    . SER G 2 337 ? 31.218  100.310 130.343 1.00 27.34 ? 526  SER C CB    1 
ATOM   9631  O  OG    . SER G 2 337 ? 30.143  100.477 131.265 1.00 27.61 ? 526  SER C OG    1 
ATOM   9632  N  N     . GLN G 2 338 ? 28.466  100.471 128.655 1.00 28.50 ? 527  GLN C N     1 
ATOM   9633  C  CA    . GLN G 2 338 ? 27.266  99.785  128.144 1.00 28.92 ? 527  GLN C CA    1 
ATOM   9634  C  C     . GLN G 2 338 ? 27.096  100.032 126.636 1.00 27.65 ? 527  GLN C C     1 
ATOM   9635  O  O     . GLN G 2 338 ? 26.657  99.151  125.895 1.00 28.10 ? 527  GLN C O     1 
ATOM   9636  C  CB    . GLN G 2 338 ? 26.005  100.261 128.888 1.00 30.04 ? 527  GLN C CB    1 
ATOM   9637  C  CG    . GLN G 2 338 ? 26.033  100.038 130.396 1.00 32.32 ? 527  GLN C CG    1 
ATOM   9638  C  CD    . GLN G 2 338 ? 24.828  100.635 131.120 1.00 34.67 ? 527  GLN C CD    1 
ATOM   9639  O  OE1   . GLN G 2 338 ? 24.516  101.826 130.982 1.00 36.47 ? 527  GLN C OE1   1 
ATOM   9640  N  NE2   . GLN G 2 338 ? 24.155  99.810  131.916 1.00 36.19 ? 527  GLN C NE2   1 
ATOM   9641  N  N     . ARG G 2 339 ? 27.445  101.231 126.183 1.00 25.98 ? 528  ARG C N     1 
ATOM   9642  C  CA    . ARG G 2 339 ? 27.343  101.543 124.760 1.00 25.22 ? 528  ARG C CA    1 
ATOM   9643  C  C     . ARG G 2 339 ? 28.274  100.630 123.974 1.00 24.19 ? 528  ARG C C     1 
ATOM   9644  O  O     . ARG G 2 339 ? 27.898  100.080 122.957 1.00 24.34 ? 528  ARG C O     1 
ATOM   9645  C  CB    . ARG G 2 339 ? 27.706  103.014 124.498 1.00 22.95 ? 528  ARG C CB    1 
ATOM   9646  C  CG    . ARG G 2 339 ? 26.658  103.959 125.021 1.00 23.84 ? 528  ARG C CG    1 
ATOM   9647  C  CD    . ARG G 2 339 ? 27.115  105.399 125.032 1.00 22.97 ? 528  ARG C CD    1 
ATOM   9648  N  NE    . ARG G 2 339 ? 27.662  105.817 123.748 1.00 21.96 ? 528  ARG C NE    1 
ATOM   9649  C  CZ    . ARG G 2 339 ? 27.771  107.086 123.381 1.00 22.12 ? 528  ARG C CZ    1 
ATOM   9650  N  NH1   . ARG G 2 339 ? 27.354  108.056 124.211 1.00 19.68 ? 528  ARG C NH1   1 
ATOM   9651  N  NH2   . ARG G 2 339 ? 28.325  107.382 122.208 1.00 19.33 ? 528  ARG C NH2   1 
ATOM   9652  N  N     . GLU G 2 340 ? 29.494  100.475 124.464 1.00 24.13 ? 529  GLU C N     1 
ATOM   9653  C  CA    . GLU G 2 340 ? 30.474  99.634  123.808 1.00 24.62 ? 529  GLU C CA    1 
ATOM   9654  C  C     . GLU G 2 340 ? 30.114  98.144  123.911 1.00 24.91 ? 529  GLU C C     1 
ATOM   9655  O  O     . GLU G 2 340 ? 30.403  97.366  122.997 1.00 25.23 ? 529  GLU C O     1 
ATOM   9656  C  CB    . GLU G 2 340 ? 31.866  99.941  124.398 1.00 24.52 ? 529  GLU C CB    1 
ATOM   9657  C  CG    . GLU G 2 340 ? 32.354  101.340 123.999 1.00 27.02 ? 529  GLU C CG    1 
ATOM   9658  C  CD    . GLU G 2 340 ? 33.665  101.775 124.638 1.00 29.28 ? 529  GLU C CD    1 
ATOM   9659  O  OE1   . GLU G 2 340 ? 34.504  100.914 124.983 1.00 31.09 ? 529  GLU C OE1   1 
ATOM   9660  O  OE2   . GLU G 2 340 ? 33.868  102.999 124.775 1.00 29.36 ? 529  GLU C OE2   1 
ATOM   9661  N  N     . GLN G 2 341 ? 29.466  97.744  124.999 1.00 25.43 ? 530  GLN C N     1 
ATOM   9662  C  CA    . GLN G 2 341 ? 29.090  96.336  125.168 1.00 27.44 ? 530  GLN C CA    1 
ATOM   9663  C  C     . GLN G 2 341 ? 27.926  96.010  124.227 1.00 26.65 ? 530  GLN C C     1 
ATOM   9664  O  O     . GLN G 2 341 ? 27.851  94.929  123.676 1.00 26.33 ? 530  GLN C O     1 
ATOM   9665  C  CB    . GLN G 2 341 ? 28.711  96.052  126.640 1.00 28.88 ? 530  GLN C CB    1 
ATOM   9666  C  CG    . GLN G 2 341 ? 28.464  94.564  127.012 1.00 30.96 ? 530  GLN C CG    1 
ATOM   9667  C  CD    . GLN G 2 341 ? 29.651  93.637  126.672 1.00 33.70 ? 530  GLN C CD    1 
ATOM   9668  O  OE1   . GLN G 2 341 ? 30.800  93.892  127.062 1.00 35.50 ? 530  GLN C OE1   1 
ATOM   9669  N  NE2   . GLN G 2 341 ? 29.371  92.559  125.948 1.00 33.35 ? 530  GLN C NE2   1 
ATOM   9670  N  N     . ALA G 2 342 ? 27.036  96.974  124.033 1.00 28.02 ? 531  ALA C N     1 
ATOM   9671  C  CA    . ALA G 2 342 ? 25.875  96.805  123.162 1.00 27.37 ? 531  ALA C CA    1 
ATOM   9672  C  C     . ALA G 2 342 ? 26.304  96.501  121.730 1.00 28.22 ? 531  ALA C C     1 
ATOM   9673  O  O     . ALA G 2 342 ? 25.761  95.588  121.082 1.00 27.95 ? 531  ALA C O     1 
ATOM   9674  C  CB    . ALA G 2 342 ? 25.008  98.058  123.202 1.00 24.81 ? 531  ALA C CB    1 
ATOM   9675  N  N     . LEU G 2 343 ? 27.268  97.265  121.228 1.00 27.69 ? 532  LEU C N     1 
ATOM   9676  C  CA    . LEU G 2 343 ? 27.751  97.028  119.878 1.00 28.77 ? 532  LEU C CA    1 
ATOM   9677  C  C     . LEU G 2 343 ? 28.491  95.697  119.832 1.00 29.56 ? 532  LEU C C     1 
ATOM   9678  O  O     . LEU G 2 343 ? 28.400  94.970  118.849 1.00 28.04 ? 532  LEU C O     1 
ATOM   9679  C  CB    . LEU G 2 343 ? 28.687  98.147  119.418 1.00 26.88 ? 532  LEU C CB    1 
ATOM   9680  C  CG    . LEU G 2 343 ? 28.032  99.483  119.043 1.00 29.12 ? 532  LEU C CG    1 
ATOM   9681  C  CD1   . LEU G 2 343 ? 29.070  100.386 118.351 1.00 24.98 ? 532  LEU C CD1   1 
ATOM   9682  C  CD2   . LEU G 2 343 ? 26.842  99.232  118.115 1.00 26.14 ? 532  LEU C CD2   1 
ATOM   9683  N  N     . ARG G 2 344 ? 29.224  95.386  120.900 1.00 31.57 ? 533  ARG C N     1 
ATOM   9684  C  CA    . ARG G 2 344 ? 29.969  94.137  120.962 1.00 34.10 ? 533  ARG C CA    1 
ATOM   9685  C  C     . ARG G 2 344 ? 29.022  92.932  120.942 1.00 34.12 ? 533  ARG C C     1 
ATOM   9686  O  O     . ARG G 2 344 ? 29.256  91.959  120.220 1.00 33.56 ? 533  ARG C O     1 
ATOM   9687  C  CB    . ARG G 2 344 ? 30.854  94.091  122.218 1.00 37.16 ? 533  ARG C CB    1 
ATOM   9688  C  CG    . ARG G 2 344 ? 31.764  92.865  122.244 1.00 41.90 ? 533  ARG C CG    1 
ATOM   9689  C  CD    . ARG G 2 344 ? 32.707  92.793  123.450 1.00 46.64 ? 533  ARG C CD    1 
ATOM   9690  N  NE    . ARG G 2 344 ? 33.416  91.506  123.444 1.00 51.94 ? 533  ARG C NE    1 
ATOM   9691  C  CZ    . ARG G 2 344 ? 34.304  91.103  124.356 1.00 54.29 ? 533  ARG C CZ    1 
ATOM   9692  N  NH1   . ARG G 2 344 ? 34.627  91.884  125.387 1.00 54.79 ? 533  ARG C NH1   1 
ATOM   9693  N  NH2   . ARG G 2 344 ? 34.869  89.902  124.238 1.00 55.33 ? 533  ARG C NH2   1 
ATOM   9694  N  N     . ASP G 2 345 ? 27.945  93.002  121.719 1.00 34.15 ? 534  ASP C N     1 
ATOM   9695  C  CA    . ASP G 2 345 ? 26.984  91.905  121.756 1.00 34.83 ? 534  ASP C CA    1 
ATOM   9696  C  C     . ASP G 2 345 ? 26.249  91.764  120.422 1.00 34.78 ? 534  ASP C C     1 
ATOM   9697  O  O     . ASP G 2 345 ? 25.902  90.658  120.001 1.00 35.04 ? 534  ASP C O     1 
ATOM   9698  C  CB    . ASP G 2 345 ? 25.977  92.112  122.890 1.00 35.37 ? 534  ASP C CB    1 
ATOM   9699  C  CG    . ASP G 2 345 ? 26.607  91.952  124.274 1.00 38.00 ? 534  ASP C CG    1 
ATOM   9700  O  OD1   . ASP G 2 345 ? 27.604  91.199  124.402 1.00 38.67 ? 534  ASP C OD1   1 
ATOM   9701  O  OD2   . ASP G 2 345 ? 26.088  92.564  125.240 1.00 39.47 ? 534  ASP C OD2   1 
ATOM   9702  N  N     . PHE G 2 346 ? 26.018  92.886  119.750 1.00 34.34 ? 535  PHE C N     1 
ATOM   9703  C  CA    . PHE G 2 346 ? 25.333  92.863  118.463 1.00 33.71 ? 535  PHE C CA    1 
ATOM   9704  C  C     . PHE G 2 346 ? 26.246  92.285  117.384 1.00 33.94 ? 535  PHE C C     1 
ATOM   9705  O  O     . PHE G 2 346 ? 25.801  91.540  116.513 1.00 33.27 ? 535  PHE C O     1 
ATOM   9706  C  CB    . PHE G 2 346 ? 24.903  94.273  118.074 1.00 31.98 ? 535  PHE C CB    1 
ATOM   9707  C  CG    . PHE G 2 346 ? 24.051  94.325  116.850 1.00 32.14 ? 535  PHE C CG    1 
ATOM   9708  C  CD1   . PHE G 2 346 ? 24.607  94.618  115.613 1.00 32.43 ? 535  PHE C CD1   1 
ATOM   9709  C  CD2   . PHE G 2 346 ? 22.677  94.106  116.935 1.00 30.91 ? 535  PHE C CD2   1 
ATOM   9710  C  CE1   . PHE G 2 346 ? 23.801  94.699  114.475 1.00 33.57 ? 535  PHE C CE1   1 
ATOM   9711  C  CE2   . PHE G 2 346 ? 21.870  94.183  115.814 1.00 30.63 ? 535  PHE C CE2   1 
ATOM   9712  C  CZ    . PHE G 2 346 ? 22.427  94.481  114.581 1.00 32.28 ? 535  PHE C CZ    1 
ATOM   9713  N  N     . LYS G 2 347 ? 27.530  92.624  117.450 1.00 34.74 ? 536  LYS C N     1 
ATOM   9714  C  CA    . LYS G 2 347 ? 28.486  92.131  116.465 1.00 35.41 ? 536  LYS C CA    1 
ATOM   9715  C  C     . LYS G 2 347 ? 28.734  90.632  116.536 1.00 35.64 ? 536  LYS C C     1 
ATOM   9716  O  O     . LYS G 2 347 ? 29.045  90.014  115.531 1.00 36.04 ? 536  LYS C O     1 
ATOM   9717  C  CB    . LYS G 2 347 ? 29.819  92.848  116.601 1.00 34.63 ? 536  LYS C CB    1 
ATOM   9718  C  CG    . LYS G 2 347 ? 29.803  94.275  116.126 1.00 35.70 ? 536  LYS C CG    1 
ATOM   9719  C  CD    . LYS G 2 347 ? 31.199  94.843  116.215 1.00 36.50 ? 536  LYS C CD    1 
ATOM   9720  C  CE    . LYS G 2 347 ? 31.187  96.346  116.144 1.00 36.24 ? 536  LYS C CE    1 
ATOM   9721  N  NZ    . LYS G 2 347 ? 32.490  96.858  116.602 1.00 37.72 ? 536  LYS C NZ    1 
ATOM   9722  N  N     . ASN G 2 348 ? 28.607  90.050  117.721 1.00 36.87 ? 537  ASN C N     1 
ATOM   9723  C  CA    . ASN G 2 348 ? 28.845  88.624  117.861 1.00 38.13 ? 537  ASN C CA    1 
ATOM   9724  C  C     . ASN G 2 348 ? 27.583  87.762  117.808 1.00 39.31 ? 537  ASN C C     1 
ATOM   9725  O  O     . ASN G 2 348 ? 27.663  86.548  117.976 1.00 40.65 ? 537  ASN C O     1 
ATOM   9726  C  CB    . ASN G 2 348 ? 29.620  88.333  119.148 1.00 36.70 ? 537  ASN C CB    1 
ATOM   9727  C  CG    . ASN G 2 348 ? 28.824  88.639  120.398 1.00 37.51 ? 537  ASN C CG    1 
ATOM   9728  O  OD1   . ASN G 2 348 ? 27.597  88.524  120.415 1.00 35.98 ? 537  ASN C OD1   1 
ATOM   9729  N  ND2   . ASN G 2 348 ? 29.526  89.014  121.469 1.00 37.05 ? 537  ASN C ND2   1 
ATOM   9730  N  N     . GLY G 2 349 ? 26.426  88.382  117.579 1.00 39.83 ? 538  GLY C N     1 
ATOM   9731  C  CA    . GLY G 2 349 ? 25.190  87.624  117.482 1.00 40.23 ? 538  GLY C CA    1 
ATOM   9732  C  C     . GLY G 2 349 ? 24.335  87.453  118.731 1.00 41.24 ? 538  GLY C C     1 
ATOM   9733  O  O     . GLY G 2 349 ? 23.141  87.154  118.612 1.00 41.53 ? 538  GLY C O     1 
ATOM   9734  N  N     . SER G 2 350 ? 24.915  87.637  119.917 1.00 41.33 ? 539  SER C N     1 
ATOM   9735  C  CA    . SER G 2 350 ? 24.162  87.486  121.167 1.00 42.24 ? 539  SER C CA    1 
ATOM   9736  C  C     . SER G 2 350 ? 22.821  88.190  121.060 1.00 42.29 ? 539  SER C C     1 
ATOM   9737  O  O     . SER G 2 350 ? 21.787  87.641  121.428 1.00 43.06 ? 539  SER C O     1 
ATOM   9738  C  CB    . SER G 2 350 ? 24.918  88.101  122.339 1.00 42.53 ? 539  SER C CB    1 
ATOM   9739  O  OG    . SER G 2 350 ? 26.312  88.024  122.129 1.00 45.42 ? 539  SER C OG    1 
ATOM   9740  N  N     . MET G 2 351 ? 22.855  89.417  120.559 1.00 41.67 ? 540  MET C N     1 
ATOM   9741  C  CA    . MET G 2 351 ? 21.652  90.216  120.409 1.00 41.23 ? 540  MET C CA    1 
ATOM   9742  C  C     . MET G 2 351 ? 21.289  90.305  118.934 1.00 40.07 ? 540  MET C C     1 
ATOM   9743  O  O     . MET G 2 351 ? 22.158  90.470  118.074 1.00 40.45 ? 540  MET C O     1 
ATOM   9744  C  CB    . MET G 2 351 ? 21.892  91.622  120.958 1.00 41.78 ? 540  MET C CB    1 
ATOM   9745  C  CG    . MET G 2 351 ? 22.330  91.659  122.411 1.00 42.52 ? 540  MET C CG    1 
ATOM   9746  S  SD    . MET G 2 351 ? 20.965  91.398  123.558 1.00 45.04 ? 540  MET C SD    1 
ATOM   9747  C  CE    . MET G 2 351 ? 21.858  91.103  125.105 1.00 44.59 ? 540  MET C CE    1 
ATOM   9748  N  N     . LYS G 2 352 ? 20.005  90.197  118.639 1.00 37.69 ? 541  LYS C N     1 
ATOM   9749  C  CA    . LYS G 2 352 ? 19.565  90.282  117.261 1.00 36.08 ? 541  LYS C CA    1 
ATOM   9750  C  C     . LYS G 2 352 ? 19.171  91.707  116.909 1.00 33.94 ? 541  LYS C C     1 
ATOM   9751  O  O     . LYS G 2 352 ? 19.365  92.150  115.780 1.00 33.13 ? 541  LYS C O     1 
ATOM   9752  C  CB    . LYS G 2 352 ? 18.351  89.386  117.025 1.00 37.47 ? 541  LYS C CB    1 
ATOM   9753  C  CG    . LYS G 2 352 ? 18.553  87.900  117.278 1.00 39.71 ? 541  LYS C CG    1 
ATOM   9754  C  CD    . LYS G 2 352 ? 17.485  87.128  116.484 1.00 41.66 ? 541  LYS C CD    1 
ATOM   9755  C  CE    . LYS G 2 352 ? 16.929  85.901  117.204 1.00 42.33 ? 541  LYS C CE    1 
ATOM   9756  N  NZ    . LYS G 2 352 ? 15.897  85.223  116.344 1.00 42.54 ? 541  LYS C NZ    1 
ATOM   9757  N  N     . VAL G 2 353 ? 18.613  92.417  117.885 1.00 31.54 ? 542  VAL C N     1 
ATOM   9758  C  CA    . VAL G 2 353 ? 18.137  93.773  117.656 1.00 30.14 ? 542  VAL C CA    1 
ATOM   9759  C  C     . VAL G 2 353 ? 18.890  94.831  118.462 1.00 29.37 ? 542  VAL C C     1 
ATOM   9760  O  O     . VAL G 2 353 ? 19.194  94.642  119.643 1.00 29.57 ? 542  VAL C O     1 
ATOM   9761  C  CB    . VAL G 2 353 ? 16.614  93.861  117.989 1.00 29.39 ? 542  VAL C CB    1 
ATOM   9762  C  CG1   . VAL G 2 353 ? 16.039  95.213  117.567 1.00 27.70 ? 542  VAL C CG1   1 
ATOM   9763  C  CG2   . VAL G 2 353 ? 15.872  92.723  117.291 1.00 27.82 ? 542  VAL C CG2   1 
ATOM   9764  N  N     . LEU G 2 354 ? 19.194  95.943  117.801 1.00 28.53 ? 543  LEU C N     1 
ATOM   9765  C  CA    . LEU G 2 354 ? 19.883  97.073  118.425 1.00 25.84 ? 543  LEU C CA    1 
ATOM   9766  C  C     . LEU G 2 354 ? 18.989  98.287  118.254 1.00 24.56 ? 543  LEU C C     1 
ATOM   9767  O  O     . LEU G 2 354 ? 18.654  98.648  117.133 1.00 23.58 ? 543  LEU C O     1 
ATOM   9768  C  CB    . LEU G 2 354 ? 21.232  97.339  117.739 1.00 25.21 ? 543  LEU C CB    1 
ATOM   9769  C  CG    . LEU G 2 354 ? 21.974  98.624  118.162 1.00 26.03 ? 543  LEU C CG    1 
ATOM   9770  C  CD1   . LEU G 2 354 ? 22.365  98.572  119.646 1.00 24.95 ? 543  LEU C CD1   1 
ATOM   9771  C  CD2   . LEU G 2 354 ? 23.208  98.798  117.301 1.00 24.30 ? 543  LEU C CD2   1 
ATOM   9772  N  N     . ILE G 2 355 ? 18.573  98.890  119.367 1.00 24.75 ? 544  ILE C N     1 
ATOM   9773  C  CA    . ILE G 2 355 ? 17.750  100.089 119.317 1.00 24.01 ? 544  ILE C CA    1 
ATOM   9774  C  C     . ILE G 2 355 ? 18.722  101.257 119.474 1.00 24.01 ? 544  ILE C C     1 
ATOM   9775  O  O     . ILE G 2 355 ? 19.573  101.248 120.360 1.00 24.60 ? 544  ILE C O     1 
ATOM   9776  C  CB    . ILE G 2 355 ? 16.714  100.135 120.460 1.00 24.42 ? 544  ILE C CB    1 
ATOM   9777  C  CG1   . ILE G 2 355 ? 15.851  98.867  120.459 1.00 24.03 ? 544  ILE C CG1   1 
ATOM   9778  C  CG2   . ILE G 2 355 ? 15.830  101.347 120.281 1.00 23.67 ? 544  ILE C CG2   1 
ATOM   9779  C  CD1   . ILE G 2 355 ? 15.090  98.638  119.141 1.00 22.61 ? 544  ILE C CD1   1 
ATOM   9780  N  N     . ALA G 2 356 ? 18.595  102.267 118.624 1.00 23.32 ? 545  ALA C N     1 
ATOM   9781  C  CA    . ALA G 2 356 ? 19.520  103.386 118.688 1.00 22.49 ? 545  ALA C CA    1 
ATOM   9782  C  C     . ALA G 2 356 ? 18.940  104.728 118.315 1.00 21.87 ? 545  ALA C C     1 
ATOM   9783  O  O     . ALA G 2 356 ? 17.921  104.816 117.633 1.00 22.00 ? 545  ALA C O     1 
ATOM   9784  C  CB    . ALA G 2 356 ? 20.719  103.102 117.772 1.00 21.92 ? 545  ALA C CB    1 
ATOM   9785  N  N     . THR G 2 357 ? 19.588  105.774 118.815 1.00 20.63 ? 546  THR C N     1 
ATOM   9786  C  CA    . THR G 2 357 ? 19.239  107.138 118.468 1.00 20.20 ? 546  THR C CA    1 
ATOM   9787  C  C     . THR G 2 357 ? 20.210  107.380 117.312 1.00 21.13 ? 546  THR C C     1 
ATOM   9788  O  O     . THR G 2 357 ? 20.960  106.473 116.920 1.00 21.05 ? 546  THR C O     1 
ATOM   9789  C  CB    . THR G 2 357 ? 19.607  108.147 119.577 1.00 19.62 ? 546  THR C CB    1 
ATOM   9790  O  OG1   . THR G 2 357 ? 20.938  107.886 120.034 1.00 18.35 ? 546  THR C OG1   1 
ATOM   9791  C  CG2   . THR G 2 357 ? 18.632  108.071 120.749 1.00 18.48 ? 546  THR C CG2   1 
ATOM   9792  N  N     . SER G 2 358 ? 20.234  108.593 116.785 1.00 20.66 ? 547  SER C N     1 
ATOM   9793  C  CA    . SER G 2 358 ? 21.162  108.895 115.694 1.00 21.44 ? 547  SER C CA    1 
ATOM   9794  C  C     . SER G 2 358 ? 22.631  108.835 116.113 1.00 20.70 ? 547  SER C C     1 
ATOM   9795  O  O     . SER G 2 358 ? 23.518  109.118 115.315 1.00 20.49 ? 547  SER C O     1 
ATOM   9796  C  CB    . SER G 2 358 ? 20.846  110.266 115.077 1.00 20.20 ? 547  SER C CB    1 
ATOM   9797  O  OG    . SER G 2 358 ? 19.695  110.164 114.250 1.00 22.25 ? 547  SER C OG    1 
ATOM   9798  N  N     . VAL G 2 359 ? 22.890  108.462 117.360 1.00 21.04 ? 548  VAL C N     1 
ATOM   9799  C  CA    . VAL G 2 359 ? 24.268  108.344 117.816 1.00 22.07 ? 548  VAL C CA    1 
ATOM   9800  C  C     . VAL G 2 359 ? 24.925  107.261 116.961 1.00 22.85 ? 548  VAL C C     1 
ATOM   9801  O  O     . VAL G 2 359 ? 26.148  107.210 116.840 1.00 24.12 ? 548  VAL C O     1 
ATOM   9802  C  CB    . VAL G 2 359 ? 24.384  107.899 119.302 1.00 21.40 ? 548  VAL C CB    1 
ATOM   9803  C  CG1   . VAL G 2 359 ? 23.929  106.428 119.456 1.00 21.37 ? 548  VAL C CG1   1 
ATOM   9804  C  CG2   . VAL G 2 359 ? 25.838  108.043 119.768 1.00 19.42 ? 548  VAL C CG2   1 
ATOM   9805  N  N     . ALA G 2 360 ? 24.104  106.398 116.374 1.00 22.17 ? 549  ALA C N     1 
ATOM   9806  C  CA    . ALA G 2 360 ? 24.608  105.326 115.531 1.00 23.21 ? 549  ALA C CA    1 
ATOM   9807  C  C     . ALA G 2 360 ? 24.267  105.484 114.048 1.00 23.99 ? 549  ALA C C     1 
ATOM   9808  O  O     . ALA G 2 360 ? 24.398  104.525 113.281 1.00 23.81 ? 549  ALA C O     1 
ATOM   9809  C  CB    . ALA G 2 360 ? 24.071  104.001 116.029 1.00 23.41 ? 549  ALA C CB    1 
ATOM   9810  N  N     . SER G 2 361 ? 23.830  106.669 113.629 1.00 23.49 ? 550  SER C N     1 
ATOM   9811  C  CA    . SER G 2 361 ? 23.465  106.843 112.226 1.00 24.64 ? 550  SER C CA    1 
ATOM   9812  C  C     . SER G 2 361 ? 24.641  107.009 111.278 1.00 24.05 ? 550  SER C C     1 
ATOM   9813  O  O     . SER G 2 361 ? 24.539  106.682 110.098 1.00 24.08 ? 550  SER C O     1 
ATOM   9814  C  CB    . SER G 2 361 ? 22.522  108.041 112.053 1.00 25.22 ? 550  SER C CB    1 
ATOM   9815  O  OG    . SER G 2 361 ? 23.075  109.195 112.648 1.00 28.62 ? 550  SER C OG    1 
ATOM   9816  N  N     . ARG G 2 362 ? 25.767  107.495 111.783 1.00 22.98 ? 551  ARG C N     1 
ATOM   9817  C  CA    . ARG G 2 362 ? 26.898  107.722 110.902 1.00 22.22 ? 551  ARG C CA    1 
ATOM   9818  C  C     . ARG G 2 362 ? 28.119  106.838 111.071 1.00 21.37 ? 551  ARG C C     1 
ATOM   9819  O  O     . ARG G 2 362 ? 28.488  106.466 112.173 1.00 22.29 ? 551  ARG C O     1 
ATOM   9820  C  CB    . ARG G 2 362 ? 27.354  109.185 111.012 1.00 23.11 ? 551  ARG C CB    1 
ATOM   9821  C  CG    . ARG G 2 362 ? 26.365  110.228 110.443 1.00 23.79 ? 551  ARG C CG    1 
ATOM   9822  C  CD    . ARG G 2 362 ? 26.793  111.638 110.823 1.00 23.32 ? 551  ARG C CD    1 
ATOM   9823  N  NE    . ARG G 2 362 ? 25.972  112.655 110.178 1.00 25.03 ? 551  ARG C NE    1 
ATOM   9824  C  CZ    . ARG G 2 362 ? 26.362  113.365 109.124 1.00 25.05 ? 551  ARG C CZ    1 
ATOM   9825  N  NH1   . ARG G 2 362 ? 27.567  113.170 108.599 1.00 25.09 ? 551  ARG C NH1   1 
ATOM   9826  N  NH2   . ARG G 2 362 ? 25.550  114.269 108.589 1.00 25.65 ? 551  ARG C NH2   1 
ATOM   9827  N  N     . GLY G 2 363 ? 28.738  106.503 109.946 1.00 21.54 ? 552  GLY C N     1 
ATOM   9828  C  CA    . GLY G 2 363 ? 29.981  105.760 109.969 1.00 21.38 ? 552  GLY C CA    1 
ATOM   9829  C  C     . GLY G 2 363 ? 30.085  104.325 110.406 1.00 21.79 ? 552  GLY C C     1 
ATOM   9830  O  O     . GLY G 2 363 ? 30.873  103.598 109.795 1.00 22.46 ? 552  GLY C O     1 
ATOM   9831  N  N     . LEU G 2 364 ? 29.337  103.915 111.433 1.00 20.84 ? 553  LEU C N     1 
ATOM   9832  C  CA    . LEU G 2 364 ? 29.401  102.536 111.921 1.00 21.17 ? 553  LEU C CA    1 
ATOM   9833  C  C     . LEU G 2 364 ? 29.291  101.549 110.766 1.00 21.50 ? 553  LEU C C     1 
ATOM   9834  O  O     . LEU G 2 364 ? 28.357  101.601 109.955 1.00 20.78 ? 553  LEU C O     1 
ATOM   9835  C  CB    . LEU G 2 364 ? 28.321  102.263 112.985 1.00 20.06 ? 553  LEU C CB    1 
ATOM   9836  C  CG    . LEU G 2 364 ? 28.439  103.056 114.305 1.00 20.48 ? 553  LEU C CG    1 
ATOM   9837  C  CD1   . LEU G 2 364 ? 27.422  102.557 115.293 1.00 18.91 ? 553  LEU C CD1   1 
ATOM   9838  C  CD2   . LEU G 2 364 ? 29.852  102.911 114.906 1.00 20.72 ? 553  LEU C CD2   1 
ATOM   9839  N  N     . ASP G 2 365 ? 30.285  100.666 110.721 1.00 21.95 ? 554  ASP C N     1 
ATOM   9840  C  CA    . ASP G 2 365 ? 30.465  99.629  109.702 1.00 24.28 ? 554  ASP C CA    1 
ATOM   9841  C  C     . ASP G 2 365 ? 30.276  98.262  110.382 1.00 25.16 ? 554  ASP C C     1 
ATOM   9842  O  O     . ASP G 2 365 ? 31.225  97.631  110.835 1.00 24.29 ? 554  ASP C O     1 
ATOM   9843  C  CB    . ASP G 2 365 ? 31.887  99.757  109.150 1.00 24.83 ? 554  ASP C CB    1 
ATOM   9844  C  CG    . ASP G 2 365 ? 32.159  98.828  107.978 1.00 26.34 ? 554  ASP C CG    1 
ATOM   9845  O  OD1   . ASP G 2 365 ? 31.511  98.989  106.909 1.00 25.15 ? 554  ASP C OD1   1 
ATOM   9846  O  OD2   . ASP G 2 365 ? 33.035  97.947  108.135 1.00 26.39 ? 554  ASP C OD2   1 
ATOM   9847  N  N     . ILE G 2 366 ? 29.038  97.814  110.461 1.00 26.17 ? 555  ILE C N     1 
ATOM   9848  C  CA    . ILE G 2 366 ? 28.770  96.565  111.131 1.00 27.24 ? 555  ILE C CA    1 
ATOM   9849  C  C     . ILE G 2 366 ? 28.129  95.557  110.201 1.00 28.25 ? 555  ILE C C     1 
ATOM   9850  O  O     . ILE G 2 366 ? 27.044  95.770  109.652 1.00 27.59 ? 555  ILE C O     1 
ATOM   9851  C  CB    . ILE G 2 366 ? 27.904  96.823  112.380 1.00 27.54 ? 555  ILE C CB    1 
ATOM   9852  C  CG1   . ILE G 2 366 ? 28.608  97.865  113.263 1.00 27.96 ? 555  ILE C CG1   1 
ATOM   9853  C  CG2   . ILE G 2 366 ? 27.703  95.552  113.149 1.00 25.15 ? 555  ILE C CG2   1 
ATOM   9854  C  CD1   . ILE G 2 366 ? 27.831  98.296  114.482 1.00 29.59 ? 555  ILE C CD1   1 
ATOM   9855  N  N     . LYS G 2 367 ? 28.869  94.469  110.025 1.00 29.33 ? 556  LYS C N     1 
ATOM   9856  C  CA    . LYS G 2 367 ? 28.542  93.318  109.192 1.00 30.16 ? 556  LYS C CA    1 
ATOM   9857  C  C     . LYS G 2 367 ? 27.146  92.767  109.472 1.00 29.09 ? 556  LYS C C     1 
ATOM   9858  O  O     . LYS G 2 367 ? 26.364  92.533  108.554 1.00 30.22 ? 556  LYS C O     1 
ATOM   9859  C  CB    . LYS G 2 367 ? 29.589  92.250  109.493 1.00 33.62 ? 556  LYS C CB    1 
ATOM   9860  C  CG    . LYS G 2 367 ? 29.858  91.207  108.460 1.00 38.57 ? 556  LYS C CG    1 
ATOM   9861  C  CD    . LYS G 2 367 ? 31.195  90.571  108.850 1.00 42.34 ? 556  LYS C CD    1 
ATOM   9862  C  CE    . LYS G 2 367 ? 31.716  89.568  107.841 1.00 45.59 ? 556  LYS C CE    1 
ATOM   9863  N  NZ    . LYS G 2 367 ? 33.102  89.117  108.229 1.00 47.62 ? 556  LYS C NZ    1 
ATOM   9864  N  N     . ASN G 2 368 ? 26.828  92.559  110.743 1.00 27.43 ? 557  ASN C N     1 
ATOM   9865  C  CA    . ASN G 2 368 ? 25.527  92.012  111.090 1.00 26.63 ? 557  ASN C CA    1 
ATOM   9866  C  C     . ASN G 2 368 ? 24.309  92.892  110.859 1.00 26.43 ? 557  ASN C C     1 
ATOM   9867  O  O     . ASN G 2 368 ? 23.186  92.450  111.116 1.00 26.12 ? 557  ASN C O     1 
ATOM   9868  C  CB    . ASN G 2 368 ? 25.529  91.511  112.531 1.00 27.24 ? 557  ASN C CB    1 
ATOM   9869  C  CG    . ASN G 2 368 ? 26.342  90.242  112.689 1.00 29.26 ? 557  ASN C CG    1 
ATOM   9870  O  OD1   . ASN G 2 368 ? 26.601  89.543  111.704 1.00 30.55 ? 557  ASN C OD1   1 
ATOM   9871  N  ND2   . ASN G 2 368 ? 26.737  89.925  113.920 1.00 28.49 ? 557  ASN C ND2   1 
ATOM   9872  N  N     . ILE G 2 369 ? 24.500  94.121  110.378 1.00 24.63 ? 558  ILE C N     1 
ATOM   9873  C  CA    . ILE G 2 369 ? 23.342  94.961  110.135 1.00 24.82 ? 558  ILE C CA    1 
ATOM   9874  C  C     . ILE G 2 369 ? 22.737  94.597  108.775 1.00 25.78 ? 558  ILE C C     1 
ATOM   9875  O  O     . ILE G 2 369 ? 23.266  94.967  107.722 1.00 26.46 ? 558  ILE C O     1 
ATOM   9876  C  CB    . ILE G 2 369 ? 23.703  96.463  110.207 1.00 24.14 ? 558  ILE C CB    1 
ATOM   9877  C  CG1   . ILE G 2 369 ? 24.195  96.796  111.619 1.00 23.64 ? 558  ILE C CG1   1 
ATOM   9878  C  CG2   . ILE G 2 369 ? 22.468  97.329  109.891 1.00 23.15 ? 558  ILE C CG2   1 
ATOM   9879  C  CD1   . ILE G 2 369 ? 24.476  98.255  111.863 1.00 22.84 ? 558  ILE C CD1   1 
ATOM   9880  N  N     . LYS G 2 370 ? 21.634  93.846  108.816 1.00 26.58 ? 559  LYS C N     1 
ATOM   9881  C  CA    . LYS G 2 370 ? 20.937  93.396  107.607 1.00 27.45 ? 559  LYS C CA    1 
ATOM   9882  C  C     . LYS G 2 370 ? 19.714  94.236  107.293 1.00 27.36 ? 559  LYS C C     1 
ATOM   9883  O  O     . LYS G 2 370 ? 19.328  94.375  106.139 1.00 28.48 ? 559  LYS C O     1 
ATOM   9884  C  CB    . LYS G 2 370 ? 20.465  91.942  107.758 1.00 28.97 ? 559  LYS C CB    1 
ATOM   9885  C  CG    . LYS G 2 370 ? 21.527  90.949  108.179 1.00 31.75 ? 559  LYS C CG    1 
ATOM   9886  C  CD    . LYS G 2 370 ? 22.709  90.947  107.215 1.00 34.27 ? 559  LYS C CD    1 
ATOM   9887  C  CE    . LYS G 2 370 ? 23.798  89.975  107.673 1.00 35.83 ? 559  LYS C CE    1 
ATOM   9888  N  NZ    . LYS G 2 370 ? 25.087  90.202  106.941 1.00 37.95 ? 559  LYS C NZ    1 
ATOM   9889  N  N     . HIS G 2 371 ? 19.093  94.786  108.327 1.00 26.42 ? 560  HIS C N     1 
ATOM   9890  C  CA    . HIS G 2 371 ? 17.885  95.572  108.148 1.00 24.61 ? 560  HIS C CA    1 
ATOM   9891  C  C     . HIS G 2 371 ? 17.937  96.845  108.999 1.00 23.67 ? 560  HIS C C     1 
ATOM   9892  O  O     . HIS G 2 371 ? 18.273  96.796  110.184 1.00 22.50 ? 560  HIS C O     1 
ATOM   9893  C  CB    . HIS G 2 371 ? 16.686  94.721  108.584 1.00 24.61 ? 560  HIS C CB    1 
ATOM   9894  C  CG    . HIS G 2 371 ? 15.354  95.309  108.243 1.00 24.55 ? 560  HIS C CG    1 
ATOM   9895  N  ND1   . HIS G 2 371 ? 14.182  94.882  108.833 1.00 24.16 ? 560  HIS C ND1   1 
ATOM   9896  C  CD2   . HIS G 2 371 ? 15.000  96.261  107.347 1.00 24.78 ? 560  HIS C CD2   1 
ATOM   9897  C  CE1   . HIS G 2 371 ? 13.163  95.544  108.314 1.00 25.08 ? 560  HIS C CE1   1 
ATOM   9898  N  NE2   . HIS G 2 371 ? 13.632  96.387  107.409 1.00 26.09 ? 560  HIS C NE2   1 
ATOM   9899  N  N     . VAL G 2 372 ? 17.628  97.977  108.381 1.00 21.90 ? 561  VAL C N     1 
ATOM   9900  C  CA    . VAL G 2 372 ? 17.578  99.246  109.092 1.00 21.35 ? 561  VAL C CA    1 
ATOM   9901  C  C     . VAL G 2 372 ? 16.121  99.667  109.122 1.00 21.92 ? 561  VAL C C     1 
ATOM   9902  O  O     . VAL G 2 372 ? 15.457  99.720  108.085 1.00 21.49 ? 561  VAL C O     1 
ATOM   9903  C  CB    . VAL G 2 372 ? 18.353  100.379 108.371 1.00 21.75 ? 561  VAL C CB    1 
ATOM   9904  C  CG1   . VAL G 2 372 ? 18.022  101.744 109.045 1.00 19.64 ? 561  VAL C CG1   1 
ATOM   9905  C  CG2   . VAL G 2 372 ? 19.854  100.098 108.400 1.00 17.13 ? 561  VAL C CG2   1 
ATOM   9906  N  N     . ILE G 2 373 ? 15.625  99.966  110.311 1.00 23.04 ? 562  ILE C N     1 
ATOM   9907  C  CA    . ILE G 2 373 ? 14.247  100.409 110.474 1.00 23.58 ? 562  ILE C CA    1 
ATOM   9908  C  C     . ILE G 2 373 ? 14.238  101.814 111.067 1.00 23.98 ? 562  ILE C C     1 
ATOM   9909  O  O     . ILE G 2 373 ? 14.811  102.047 112.127 1.00 24.56 ? 562  ILE C O     1 
ATOM   9910  C  CB    . ILE G 2 373 ? 13.461  99.466  111.424 1.00 23.11 ? 562  ILE C CB    1 
ATOM   9911  C  CG1   . ILE G 2 373 ? 13.345  98.083  110.801 1.00 23.39 ? 562  ILE C CG1   1 
ATOM   9912  C  CG2   . ILE G 2 373 ? 12.065  99.998  111.671 1.00 24.32 ? 562  ILE C CG2   1 
ATOM   9913  C  CD1   . ILE G 2 373 ? 12.678  97.072  111.707 1.00 23.09 ? 562  ILE C CD1   1 
ATOM   9914  N  N     . ASN G 2 374 ? 13.631  102.759 110.360 1.00 24.56 ? 563  ASN C N     1 
ATOM   9915  C  CA    . ASN G 2 374 ? 13.505  104.113 110.888 1.00 25.04 ? 563  ASN C CA    1 
ATOM   9916  C  C     . ASN G 2 374 ? 12.145  104.145 111.580 1.00 25.59 ? 563  ASN C C     1 
ATOM   9917  O  O     . ASN G 2 374 ? 11.135  104.455 110.958 1.00 25.56 ? 563  ASN C O     1 
ATOM   9918  C  CB    . ASN G 2 374 ? 13.547  105.164 109.767 1.00 23.49 ? 563  ASN C CB    1 
ATOM   9919  C  CG    . ASN G 2 374 ? 14.959  105.486 109.325 1.00 22.81 ? 563  ASN C CG    1 
ATOM   9920  O  OD1   . ASN G 2 374 ? 15.743  106.028 110.099 1.00 23.28 ? 563  ASN C OD1   1 
ATOM   9921  N  ND2   . ASN G 2 374 ? 15.297  105.141 108.084 1.00 20.26 ? 563  ASN C ND2   1 
ATOM   9922  N  N     . TYR G 2 375 ? 12.127  103.768 112.856 1.00 26.46 ? 564  TYR C N     1 
ATOM   9923  C  CA    . TYR G 2 375 ? 10.906  103.768 113.663 1.00 25.89 ? 564  TYR C CA    1 
ATOM   9924  C  C     . TYR G 2 375 ? 10.370  105.208 113.693 1.00 26.95 ? 564  TYR C C     1 
ATOM   9925  O  O     . TYR G 2 375 ? 9.166   105.437 113.617 1.00 27.33 ? 564  TYR C O     1 
ATOM   9926  C  CB    . TYR G 2 375 ? 11.251  103.275 115.060 1.00 26.11 ? 564  TYR C CB    1 
ATOM   9927  C  CG    . TYR G 2 375 ? 10.084  103.023 115.975 1.00 25.47 ? 564  TYR C CG    1 
ATOM   9928  C  CD1   . TYR G 2 375 ? 9.606   104.027 116.807 1.00 25.99 ? 564  TYR C CD1   1 
ATOM   9929  C  CD2   . TYR G 2 375 ? 9.498   101.758 116.055 1.00 25.28 ? 564  TYR C CD2   1 
ATOM   9930  C  CE1   . TYR G 2 375 ? 8.585   103.787 117.708 1.00 25.72 ? 564  TYR C CE1   1 
ATOM   9931  C  CE2   . TYR G 2 375 ? 8.467   101.503 116.951 1.00 25.66 ? 564  TYR C CE2   1 
ATOM   9932  C  CZ    . TYR G 2 375 ? 8.022   102.518 117.778 1.00 25.89 ? 564  TYR C CZ    1 
ATOM   9933  O  OH    . TYR G 2 375 ? 7.064   102.265 118.722 1.00 25.82 ? 564  TYR C OH    1 
ATOM   9934  N  N     . ASP G 2 376 ? 11.284  106.168 113.798 1.00 26.62 ? 565  ASP C N     1 
ATOM   9935  C  CA    . ASP G 2 376 ? 10.945  107.580 113.777 1.00 27.35 ? 565  ASP C CA    1 
ATOM   9936  C  C     . ASP G 2 376 ? 11.691  108.197 112.606 1.00 27.87 ? 565  ASP C C     1 
ATOM   9937  O  O     . ASP G 2 376 ? 12.900  108.050 112.504 1.00 28.50 ? 565  ASP C O     1 
ATOM   9938  C  CB    . ASP G 2 376 ? 11.414  108.300 115.049 1.00 28.08 ? 565  ASP C CB    1 
ATOM   9939  C  CG    . ASP G 2 376 ? 10.570  107.977 116.258 1.00 28.55 ? 565  ASP C CG    1 
ATOM   9940  O  OD1   . ASP G 2 376 ? 9.331   107.967 116.105 1.00 32.24 ? 565  ASP C OD1   1 
ATOM   9941  O  OD2   . ASP G 2 376 ? 11.132  107.750 117.359 1.00 27.15 ? 565  ASP C OD2   1 
ATOM   9942  N  N     . MET G 2 377 ? 10.998  108.880 111.709 1.00 28.25 ? 566  MET C N     1 
ATOM   9943  C  CA    . MET G 2 377 ? 11.719  109.519 110.625 1.00 28.57 ? 566  MET C CA    1 
ATOM   9944  C  C     . MET G 2 377 ? 12.514  110.635 111.287 1.00 28.87 ? 566  MET C C     1 
ATOM   9945  O  O     . MET G 2 377 ? 12.068  111.207 112.278 1.00 28.43 ? 566  MET C O     1 
ATOM   9946  C  CB    . MET G 2 377 ? 10.766  110.127 109.595 1.00 28.66 ? 566  MET C CB    1 
ATOM   9947  C  CG    . MET G 2 377 ? 10.255  109.158 108.554 1.00 30.46 ? 566  MET C CG    1 
ATOM   9948  S  SD    . MET G 2 377 ? 11.558  108.564 107.419 1.00 34.36 ? 566  MET C SD    1 
ATOM   9949  C  CE    . MET G 2 377 ? 11.778  109.952 106.415 1.00 31.34 ? 566  MET C CE    1 
ATOM   9950  N  N     . PRO G 2 378 ? 13.718  110.929 110.777 1.00 28.54 ? 567  PRO C N     1 
ATOM   9951  C  CA    . PRO G 2 378 ? 14.530  111.998 111.352 1.00 29.01 ? 567  PRO C CA    1 
ATOM   9952  C  C     . PRO G 2 378 ? 13.998  113.324 110.810 1.00 29.47 ? 567  PRO C C     1 
ATOM   9953  O  O     . PRO G 2 378 ? 13.205  113.346 109.877 1.00 29.35 ? 567  PRO C O     1 
ATOM   9954  C  CB    . PRO G 2 378 ? 15.925  111.673 110.836 1.00 28.44 ? 567  PRO C CB    1 
ATOM   9955  C  CG    . PRO G 2 378 ? 15.649  111.151 109.519 1.00 26.94 ? 567  PRO C CG    1 
ATOM   9956  C  CD    . PRO G 2 378 ? 14.482  110.213 109.746 1.00 27.96 ? 567  PRO C CD    1 
ATOM   9957  N  N     . SER G 2 379 ? 14.421  114.434 111.393 1.00 31.81 ? 568  SER C N     1 
ATOM   9958  C  CA    . SER G 2 379 ? 13.936  115.718 110.919 1.00 33.36 ? 568  SER C CA    1 
ATOM   9959  C  C     . SER G 2 379 ? 14.560  116.071 109.575 1.00 32.97 ? 568  SER C C     1 
ATOM   9960  O  O     . SER G 2 379 ? 13.867  116.567 108.693 1.00 34.77 ? 568  SER C O     1 
ATOM   9961  C  CB    . SER G 2 379 ? 14.215  116.823 111.952 1.00 34.69 ? 568  SER C CB    1 
ATOM   9962  O  OG    . SER G 2 379 ? 15.603  116.961 112.214 1.00 39.16 ? 568  SER C OG    1 
ATOM   9963  N  N     . LYS G 2 380 ? 15.850  115.789 109.405 1.00 31.63 ? 569  LYS C N     1 
ATOM   9964  C  CA    . LYS G 2 380 ? 16.540  116.103 108.151 1.00 31.39 ? 569  LYS C CA    1 
ATOM   9965  C  C     . LYS G 2 380 ? 16.856  114.903 107.239 1.00 29.76 ? 569  LYS C C     1 
ATOM   9966  O  O     . LYS G 2 380 ? 17.232  113.833 107.710 1.00 28.59 ? 569  LYS C O     1 
ATOM   9967  C  CB    . LYS G 2 380 ? 17.810  116.890 108.478 1.00 33.17 ? 569  LYS C CB    1 
ATOM   9968  C  CG    . LYS G 2 380 ? 17.503  118.193 109.233 1.00 36.93 ? 569  LYS C CG    1 
ATOM   9969  C  CD    . LYS G 2 380 ? 18.762  118.921 109.715 1.00 41.07 ? 569  LYS C CD    1 
ATOM   9970  C  CE    . LYS G 2 380 ? 18.445  120.359 110.200 1.00 42.87 ? 569  LYS C CE    1 
ATOM   9971  N  NZ    . LYS G 2 380 ? 18.843  121.435 109.207 1.00 43.73 ? 569  LYS C NZ    1 
ATOM   9972  N  N     . ILE G 2 381 ? 16.708  115.099 105.925 1.00 28.59 ? 570  ILE C N     1 
ATOM   9973  C  CA    . ILE G 2 381 ? 16.952  114.041 104.947 1.00 26.87 ? 570  ILE C CA    1 
ATOM   9974  C  C     . ILE G 2 381 ? 18.364  113.441 105.030 1.00 27.41 ? 570  ILE C C     1 
ATOM   9975  O  O     . ILE G 2 381 ? 18.528  112.222 104.956 1.00 26.75 ? 570  ILE C O     1 
ATOM   9976  C  CB    . ILE G 2 381 ? 16.671  114.547 103.497 1.00 27.00 ? 570  ILE C CB    1 
ATOM   9977  C  CG1   . ILE G 2 381 ? 16.581  113.362 102.532 1.00 25.83 ? 570  ILE C CG1   1 
ATOM   9978  C  CG2   . ILE G 2 381 ? 17.767  115.506 103.033 1.00 26.34 ? 570  ILE C CG2   1 
ATOM   9979  C  CD1   . ILE G 2 381 ? 15.377  112.473 102.784 1.00 26.87 ? 570  ILE C CD1   1 
ATOM   9980  N  N     . ASP G 2 382 ? 19.383  114.282 105.191 1.00 27.29 ? 571  ASP C N     1 
ATOM   9981  C  CA    . ASP G 2 382 ? 20.741  113.774 105.285 1.00 27.02 ? 571  ASP C CA    1 
ATOM   9982  C  C     . ASP G 2 382 ? 20.876  112.702 106.362 1.00 26.56 ? 571  ASP C C     1 
ATOM   9983  O  O     . ASP G 2 382 ? 21.656  111.763 106.201 1.00 26.37 ? 571  ASP C O     1 
ATOM   9984  C  CB    . ASP G 2 382 ? 21.740  114.886 105.595 1.00 28.44 ? 571  ASP C CB    1 
ATOM   9985  C  CG    . ASP G 2 382 ? 21.987  115.819 104.411 1.00 31.49 ? 571  ASP C CG    1 
ATOM   9986  O  OD1   . ASP G 2 382 ? 21.897  115.386 103.231 1.00 31.74 ? 571  ASP C OD1   1 
ATOM   9987  O  OD2   . ASP G 2 382 ? 22.299  117.005 104.671 1.00 33.32 ? 571  ASP C OD2   1 
ATOM   9988  N  N     . ASP G 2 383 ? 20.130  112.839 107.453 1.00 25.33 ? 572  ASP C N     1 
ATOM   9989  C  CA    . ASP G 2 383 ? 20.214  111.867 108.537 1.00 26.60 ? 572  ASP C CA    1 
ATOM   9990  C  C     . ASP G 2 383 ? 19.605  110.539 108.111 1.00 25.00 ? 572  ASP C C     1 
ATOM   9991  O  O     . ASP G 2 383 ? 20.080  109.475 108.510 1.00 24.67 ? 572  ASP C O     1 
ATOM   9992  C  CB    . ASP G 2 383 ? 19.529  112.395 109.802 1.00 30.24 ? 572  ASP C CB    1 
ATOM   9993  C  CG    . ASP G 2 383 ? 19.979  111.652 111.067 1.00 34.83 ? 572  ASP C CG    1 
ATOM   9994  O  OD1   . ASP G 2 383 ? 21.128  111.159 111.084 1.00 37.85 ? 572  ASP C OD1   1 
ATOM   9995  O  OD2   . ASP G 2 383 ? 19.205  111.575 112.053 1.00 37.32 ? 572  ASP C OD2   1 
ATOM   9996  N  N     . TYR G 2 384 ? 18.554  110.610 107.301 1.00 22.85 ? 573  TYR C N     1 
ATOM   9997  C  CA    . TYR G 2 384 ? 17.908  109.420 106.769 1.00 22.04 ? 573  TYR C CA    1 
ATOM   9998  C  C     . TYR G 2 384 ? 18.942  108.676 105.915 1.00 20.73 ? 573  TYR C C     1 
ATOM   9999  O  O     . TYR G 2 384 ? 19.132  107.473 106.072 1.00 21.61 ? 573  TYR C O     1 
ATOM   10000 C  CB    . TYR G 2 384 ? 16.712  109.835 105.893 1.00 22.94 ? 573  TYR C CB    1 
ATOM   10001 C  CG    . TYR G 2 384 ? 16.139  108.742 105.030 1.00 23.87 ? 573  TYR C CG    1 
ATOM   10002 C  CD1   . TYR G 2 384 ? 15.132  107.903 105.516 1.00 24.71 ? 573  TYR C CD1   1 
ATOM   10003 C  CD2   . TYR G 2 384 ? 16.627  108.513 103.738 1.00 23.25 ? 573  TYR C CD2   1 
ATOM   10004 C  CE1   . TYR G 2 384 ? 14.625  106.860 104.737 1.00 25.90 ? 573  TYR C CE1   1 
ATOM   10005 C  CE2   . TYR G 2 384 ? 16.128  107.470 102.954 1.00 23.68 ? 573  TYR C CE2   1 
ATOM   10006 C  CZ    . TYR G 2 384 ? 15.125  106.644 103.461 1.00 25.22 ? 573  TYR C CZ    1 
ATOM   10007 O  OH    . TYR G 2 384 ? 14.613  105.592 102.712 1.00 25.63 ? 573  TYR C OH    1 
ATOM   10008 N  N     . VAL G 2 385 ? 19.616  109.398 105.021 1.00 19.71 ? 574  VAL C N     1 
ATOM   10009 C  CA    . VAL G 2 385 ? 20.610  108.796 104.128 1.00 20.80 ? 574  VAL C CA    1 
ATOM   10010 C  C     . VAL G 2 385 ? 21.724  108.057 104.879 1.00 21.65 ? 574  VAL C C     1 
ATOM   10011 O  O     . VAL G 2 385 ? 22.132  106.941 104.481 1.00 20.56 ? 574  VAL C O     1 
ATOM   10012 C  CB    . VAL G 2 385 ? 21.229  109.860 103.182 1.00 21.45 ? 574  VAL C CB    1 
ATOM   10013 C  CG1   . VAL G 2 385 ? 22.501  109.329 102.534 1.00 19.48 ? 574  VAL C CG1   1 
ATOM   10014 C  CG2   . VAL G 2 385 ? 20.213  110.242 102.110 1.00 20.61 ? 574  VAL C CG2   1 
ATOM   10015 N  N     . HIS G 2 386 ? 22.208  108.660 105.966 1.00 20.43 ? 575  HIS C N     1 
ATOM   10016 C  CA    . HIS G 2 386 ? 23.252  108.014 106.743 1.00 20.86 ? 575  HIS C CA    1 
ATOM   10017 C  C     . HIS G 2 386 ? 22.709  106.782 107.454 1.00 21.15 ? 575  HIS C C     1 
ATOM   10018 O  O     . HIS G 2 386 ? 23.371  105.755 107.497 1.00 20.73 ? 575  HIS C O     1 
ATOM   10019 C  CB    . HIS G 2 386 ? 23.846  108.980 107.759 1.00 20.82 ? 575  HIS C CB    1 
ATOM   10020 C  CG    . HIS G 2 386 ? 24.795  109.971 107.161 1.00 23.78 ? 575  HIS C CG    1 
ATOM   10021 N  ND1   . HIS G 2 386 ? 26.093  109.648 106.819 1.00 24.39 ? 575  HIS C ND1   1 
ATOM   10022 C  CD2   . HIS G 2 386 ? 24.630  111.273 106.828 1.00 22.07 ? 575  HIS C CD2   1 
ATOM   10023 C  CE1   . HIS G 2 386 ? 26.686  110.710 106.302 1.00 23.41 ? 575  HIS C CE1   1 
ATOM   10024 N  NE2   . HIS G 2 386 ? 25.820  111.708 106.296 1.00 23.95 ? 575  HIS C NE2   1 
ATOM   10025 N  N     . ARG G 2 387 ? 21.505  106.889 108.011 1.00 21.52 ? 576  ARG C N     1 
ATOM   10026 C  CA    . ARG G 2 387 ? 20.901  105.776 108.731 1.00 22.18 ? 576  ARG C CA    1 
ATOM   10027 C  C     . ARG G 2 387 ? 20.693  104.526 107.885 1.00 22.10 ? 576  ARG C C     1 
ATOM   10028 O  O     . ARG G 2 387 ? 21.097  103.441 108.281 1.00 22.70 ? 576  ARG C O     1 
ATOM   10029 C  CB    . ARG G 2 387 ? 19.560  106.182 109.319 1.00 21.60 ? 576  ARG C CB    1 
ATOM   10030 C  CG    . ARG G 2 387 ? 19.629  107.021 110.577 1.00 22.94 ? 576  ARG C CG    1 
ATOM   10031 C  CD    . ARG G 2 387 ? 18.220  107.442 110.919 1.00 22.86 ? 576  ARG C CD    1 
ATOM   10032 N  NE    . ARG G 2 387 ? 18.130  108.206 112.150 1.00 23.79 ? 576  ARG C NE    1 
ATOM   10033 C  CZ    . ARG G 2 387 ? 16.981  108.483 112.744 1.00 24.93 ? 576  ARG C CZ    1 
ATOM   10034 N  NH1   . ARG G 2 387 ? 15.849  108.052 112.206 1.00 24.02 ? 576  ARG C NH1   1 
ATOM   10035 N  NH2   . ARG G 2 387 ? 16.963  109.171 113.876 1.00 24.90 ? 576  ARG C NH2   1 
ATOM   10036 N  N     . ILE G 2 388 ? 20.062  104.668 106.727 1.00 22.43 ? 577  ILE C N     1 
ATOM   10037 C  CA    . ILE G 2 388 ? 19.816  103.500 105.915 1.00 23.65 ? 577  ILE C CA    1 
ATOM   10038 C  C     . ILE G 2 388 ? 21.124  102.951 105.361 1.00 23.53 ? 577  ILE C C     1 
ATOM   10039 O  O     . ILE G 2 388 ? 21.191  101.795 104.961 1.00 24.53 ? 577  ILE C O     1 
ATOM   10040 C  CB    . ILE G 2 388 ? 18.804  103.789 104.784 1.00 23.12 ? 577  ILE C CB    1 
ATOM   10041 C  CG1   . ILE G 2 388 ? 19.410  104.697 103.727 1.00 24.12 ? 577  ILE C CG1   1 
ATOM   10042 C  CG2   . ILE G 2 388 ? 17.548  104.418 105.373 1.00 23.03 ? 577  ILE C CG2   1 
ATOM   10043 C  CD1   . ILE G 2 388 ? 18.555  104.816 102.461 1.00 22.29 ? 577  ILE C CD1   1 
ATOM   10044 N  N     . GLY G 2 389 ? 22.163  103.783 105.378 1.00 22.86 ? 578  GLY C N     1 
ATOM   10045 C  CA    . GLY G 2 389 ? 23.481  103.377 104.913 1.00 21.63 ? 578  GLY C CA    1 
ATOM   10046 C  C     . GLY G 2 389 ? 24.252  102.458 105.860 1.00 21.29 ? 578  GLY C C     1 
ATOM   10047 O  O     . GLY G 2 389 ? 25.383  102.076 105.560 1.00 21.19 ? 578  GLY C O     1 
ATOM   10048 N  N     . ARG G 2 390 ? 23.673  102.126 107.016 1.00 21.40 ? 579  ARG C N     1 
ATOM   10049 C  CA    . ARG G 2 390 ? 24.318  101.209 107.960 1.00 20.02 ? 579  ARG C CA    1 
ATOM   10050 C  C     . ARG G 2 390 ? 24.251  99.773  107.389 1.00 21.63 ? 579  ARG C C     1 
ATOM   10051 O  O     . ARG G 2 390 ? 24.921  98.860  107.873 1.00 20.89 ? 579  ARG C O     1 
ATOM   10052 C  CB    . ARG G 2 390 ? 23.628  101.236 109.332 1.00 21.16 ? 579  ARG C CB    1 
ATOM   10053 C  CG    . ARG G 2 390 ? 23.777  102.530 110.158 1.00 19.95 ? 579  ARG C CG    1 
ATOM   10054 C  CD    . ARG G 2 390 ? 25.167  103.125 110.041 1.00 19.90 ? 579  ARG C CD    1 
ATOM   10055 N  NE    . ARG G 2 390 ? 25.226  104.069 108.938 1.00 18.93 ? 579  ARG C NE    1 
ATOM   10056 C  CZ    . ARG G 2 390 ? 26.323  104.365 108.254 1.00 18.81 ? 579  ARG C CZ    1 
ATOM   10057 N  NH1   . ARG G 2 390 ? 27.474  103.783 108.557 1.00 17.02 ? 579  ARG C NH1   1 
ATOM   10058 N  NH2   . ARG G 2 390 ? 26.259  105.246 107.262 1.00 18.89 ? 579  ARG C NH2   1 
ATOM   10059 N  N     . THR G 2 391 ? 23.419  99.574  106.370 1.00 21.39 ? 580  THR C N     1 
ATOM   10060 C  CA    . THR G 2 391 ? 23.327  98.276  105.727 1.00 22.22 ? 580  THR C CA    1 
ATOM   10061 C  C     . THR G 2 391 ? 23.650  98.495  104.242 1.00 22.36 ? 580  THR C C     1 
ATOM   10062 O  O     . THR G 2 391 ? 23.903  99.622  103.819 1.00 21.76 ? 580  THR C O     1 
ATOM   10063 C  CB    . THR G 2 391 ? 21.900  97.632  105.890 1.00 22.25 ? 580  THR C CB    1 
ATOM   10064 O  OG1   . THR G 2 391 ? 21.954  96.276  105.448 1.00 23.47 ? 580  THR C OG1   1 
ATOM   10065 C  CG2   . THR G 2 391 ? 20.842  98.371  105.069 1.00 19.64 ? 580  THR C CG2   1 
ATOM   10066 N  N     . GLY G 2 392 ? 23.660  97.421  103.453 1.00 23.85 ? 581  GLY C N     1 
ATOM   10067 C  CA    . GLY G 2 392 ? 23.948  97.556  102.031 1.00 23.91 ? 581  GLY C CA    1 
ATOM   10068 C  C     . GLY G 2 392 ? 25.290  98.193  101.707 1.00 24.82 ? 581  GLY C C     1 
ATOM   10069 O  O     . GLY G 2 392 ? 25.398  99.002  100.778 1.00 26.39 ? 581  GLY C O     1 
ATOM   10070 N  N     . ARG G 2 393 ? 26.330  97.804  102.438 1.00 23.69 ? 582  ARG C N     1 
ATOM   10071 C  CA    . ARG G 2 393 ? 27.661  98.362  102.230 1.00 23.62 ? 582  ARG C CA    1 
ATOM   10072 C  C     . ARG G 2 393 ? 28.572  97.502  101.319 1.00 24.47 ? 582  ARG C C     1 
ATOM   10073 O  O     . ARG G 2 393 ? 28.364  96.291  101.172 1.00 23.43 ? 582  ARG C O     1 
ATOM   10074 C  CB    . ARG G 2 393 ? 28.303  98.596  103.609 1.00 21.66 ? 582  ARG C CB    1 
ATOM   10075 C  CG    . ARG G 2 393 ? 27.410  99.500  104.486 1.00 20.88 ? 582  ARG C CG    1 
ATOM   10076 C  CD    . ARG G 2 393 ? 27.754  99.466  105.957 1.00 19.89 ? 582  ARG C CD    1 
ATOM   10077 N  NE    . ARG G 2 393 ? 29.003  100.145 106.292 1.00 20.77 ? 582  ARG C NE    1 
ATOM   10078 C  CZ    . ARG G 2 393 ? 29.240  101.455 106.157 1.00 19.86 ? 582  ARG C CZ    1 
ATOM   10079 N  NH1   . ARG G 2 393 ? 28.318  102.289 105.676 1.00 17.15 ? 582  ARG C NH1   1 
ATOM   10080 N  NH2   . ARG G 2 393 ? 30.410  101.938 106.545 1.00 18.89 ? 582  ARG C NH2   1 
ATOM   10081 N  N     . VAL G 2 394 ? 29.551  98.160  100.696 1.00 24.59 ? 583  VAL C N     1 
ATOM   10082 C  CA    . VAL G 2 394 ? 30.549  97.532  99.817  1.00 25.40 ? 583  VAL C CA    1 
ATOM   10083 C  C     . VAL G 2 394 ? 30.016  96.663  98.681  1.00 25.92 ? 583  VAL C C     1 
ATOM   10084 O  O     . VAL G 2 394 ? 30.606  95.613  98.365  1.00 24.79 ? 583  VAL C O     1 
ATOM   10085 C  CB    . VAL G 2 394 ? 31.526  96.643  100.623 1.00 26.12 ? 583  VAL C CB    1 
ATOM   10086 C  CG1   . VAL G 2 394 ? 32.909  96.698  100.002 1.00 24.88 ? 583  VAL C CG1   1 
ATOM   10087 C  CG2   . VAL G 2 394 ? 31.557  97.072  102.068 1.00 26.76 ? 583  VAL C CG2   1 
ATOM   10088 N  N     . GLY G 2 395 ? 28.914  97.086  98.072  1.00 26.29 ? 584  GLY C N     1 
ATOM   10089 C  CA    . GLY G 2 395 ? 28.341  96.325  96.976  1.00 27.23 ? 584  GLY C CA    1 
ATOM   10090 C  C     . GLY G 2 395 ? 27.380  95.228  97.389  1.00 27.50 ? 584  GLY C C     1 
ATOM   10091 O  O     . GLY G 2 395 ? 26.906  94.484  96.540  1.00 28.10 ? 584  GLY C O     1 
ATOM   10092 N  N     . ASN G 2 396 ? 27.102  95.106  98.684  1.00 27.89 ? 585  ASN C N     1 
ATOM   10093 C  CA    . ASN G 2 396 ? 26.156  94.097  99.174  1.00 28.32 ? 585  ASN C CA    1 
ATOM   10094 C  C     . ASN G 2 396 ? 24.753  94.707  99.227  1.00 29.18 ? 585  ASN C C     1 
ATOM   10095 O  O     . ASN G 2 396 ? 24.605  95.923  99.420  1.00 29.03 ? 585  ASN C O     1 
ATOM   10096 C  CB    . ASN G 2 396 ? 26.543  93.639  100.582 1.00 28.64 ? 585  ASN C CB    1 
ATOM   10097 C  CG    . ASN G 2 396 ? 27.781  92.762  100.592 1.00 29.44 ? 585  ASN C CG    1 
ATOM   10098 O  OD1   . ASN G 2 396 ? 27.722  91.591  100.227 1.00 28.09 ? 585  ASN C OD1   1 
ATOM   10099 N  ND2   . ASN G 2 396 ? 28.908  93.330  101.003 1.00 28.42 ? 585  ASN C ND2   1 
ATOM   10100 N  N     . ASN G 2 397 ? 23.730  93.877  99.049  1.00 28.69 ? 586  ASN C N     1 
ATOM   10101 C  CA    . ASN G 2 397 ? 22.353  94.354  99.115  1.00 29.52 ? 586  ASN C CA    1 
ATOM   10102 C  C     . ASN G 2 397 ? 21.944  94.522  100.577 1.00 27.84 ? 586  ASN C C     1 
ATOM   10103 O  O     . ASN G 2 397 ? 22.390  93.770  101.438 1.00 27.56 ? 586  ASN C O     1 
ATOM   10104 C  CB    . ASN G 2 397 ? 21.381  93.360  98.453  1.00 32.09 ? 586  ASN C CB    1 
ATOM   10105 C  CG    . ASN G 2 397 ? 21.481  93.355  96.936  1.00 34.98 ? 586  ASN C CG    1 
ATOM   10106 O  OD1   . ASN G 2 397 ? 21.443  94.407  96.295  1.00 37.79 ? 586  ASN C OD1   1 
ATOM   10107 N  ND2   . ASN G 2 397 ? 21.596  92.166  96.353  1.00 36.73 ? 586  ASN C ND2   1 
ATOM   10108 N  N     . GLY G 2 398 ? 21.103  95.514  100.849 1.00 25.76 ? 587  GLY C N     1 
ATOM   10109 C  CA    . GLY G 2 398 ? 20.633  95.739  102.196 1.00 23.96 ? 587  GLY C CA    1 
ATOM   10110 C  C     . GLY G 2 398 ? 19.198  96.202  102.103 1.00 24.45 ? 587  GLY C C     1 
ATOM   10111 O  O     . GLY G 2 398 ? 18.719  96.526  101.015 1.00 25.04 ? 587  GLY C O     1 
ATOM   10112 N  N     . ARG G 2 399 ? 18.491  96.233  103.221 1.00 24.24 ? 588  ARG C N     1 
ATOM   10113 C  CA    . ARG G 2 399 ? 17.106  96.681  103.190 1.00 25.74 ? 588  ARG C CA    1 
ATOM   10114 C  C     . ARG G 2 399 ? 16.815  97.682  104.305 1.00 24.25 ? 588  ARG C C     1 
ATOM   10115 O  O     . ARG G 2 399 ? 17.409  97.628  105.367 1.00 23.64 ? 588  ARG C O     1 
ATOM   10116 C  CB    . ARG G 2 399 ? 16.148  95.479  103.277 1.00 27.45 ? 588  ARG C CB    1 
ATOM   10117 C  CG    . ARG G 2 399 ? 16.601  94.387  104.229 1.00 29.80 ? 588  ARG C CG    1 
ATOM   10118 C  CD    . ARG G 2 399 ? 15.590  93.237  104.283 1.00 32.77 ? 588  ARG C CD    1 
ATOM   10119 N  NE    . ARG G 2 399 ? 14.292  93.711  104.751 1.00 34.27 ? 588  ARG C NE    1 
ATOM   10120 C  CZ    . ARG G 2 399 ? 13.621  93.183  105.765 1.00 34.51 ? 588  ARG C CZ    1 
ATOM   10121 N  NH1   . ARG G 2 399 ? 14.112  92.147  106.437 1.00 34.98 ? 588  ARG C NH1   1 
ATOM   10122 N  NH2   . ARG G 2 399 ? 12.456  93.706  106.112 1.00 35.87 ? 588  ARG C NH2   1 
ATOM   10123 N  N     . ALA G 2 400 ? 15.913  98.611  104.039 1.00 23.97 ? 589  ALA C N     1 
ATOM   10124 C  CA    . ALA G 2 400 ? 15.561  99.608  105.027 1.00 25.21 ? 589  ALA C CA    1 
ATOM   10125 C  C     . ALA G 2 400 ? 14.073  99.884  104.985 1.00 25.46 ? 589  ALA C C     1 
ATOM   10126 O  O     . ALA G 2 400 ? 13.494  100.020 103.913 1.00 27.10 ? 589  ALA C O     1 
ATOM   10127 C  CB    . ALA G 2 400 ? 16.345  100.900 104.778 1.00 24.62 ? 589  ALA C CB    1 
ATOM   10128 N  N     . THR G 2 401 ? 13.464  99.952  106.163 1.00 25.60 ? 590  THR C N     1 
ATOM   10129 C  CA    . THR G 2 401 ? 12.050  100.234 106.298 1.00 25.78 ? 590  THR C CA    1 
ATOM   10130 C  C     . THR G 2 401 ? 11.931  101.490 107.152 1.00 26.43 ? 590  THR C C     1 
ATOM   10131 O  O     . THR G 2 401 ? 12.626  101.641 108.167 1.00 26.31 ? 590  THR C O     1 
ATOM   10132 C  CB    . THR G 2 401 ? 11.315  99.099  107.024 1.00 27.11 ? 590  THR C CB    1 
ATOM   10133 O  OG1   . THR G 2 401 ? 11.572  97.852  106.366 1.00 27.83 ? 590  THR C OG1   1 
ATOM   10134 C  CG2   . THR G 2 401 ? 9.814   99.378  107.050 1.00 27.83 ? 590  THR C CG2   1 
ATOM   10135 N  N     . SER G 2 402 ? 11.040  102.382 106.755 1.00 25.89 ? 591  SER C N     1 
ATOM   10136 C  CA    . SER G 2 402 ? 10.861  103.615 107.494 1.00 25.92 ? 591  SER C CA    1 
ATOM   10137 C  C     . SER G 2 402 ? 9.394   103.852 107.740 1.00 26.37 ? 591  SER C C     1 
ATOM   10138 O  O     . SER G 2 402 ? 8.583   103.764 106.809 1.00 26.04 ? 591  SER C O     1 
ATOM   10139 C  CB    . SER G 2 402 ? 11.430  104.795 106.702 1.00 25.84 ? 591  SER C CB    1 
ATOM   10140 O  OG    . SER G 2 402 ? 12.798  104.586 106.397 1.00 27.60 ? 591  SER C OG    1 
ATOM   10141 N  N     . PHE G 2 403 ? 9.055   104.149 108.993 1.00 25.66 ? 592  PHE C N     1 
ATOM   10142 C  CA    . PHE G 2 403 ? 7.679   104.438 109.357 1.00 25.04 ? 592  PHE C CA    1 
ATOM   10143 C  C     . PHE G 2 403 ? 7.458   105.934 109.084 1.00 25.29 ? 592  PHE C C     1 
ATOM   10144 O  O     . PHE G 2 403 ? 8.081   106.778 109.712 1.00 25.32 ? 592  PHE C O     1 
ATOM   10145 C  CB    . PHE G 2 403 ? 7.450   104.123 110.842 1.00 23.88 ? 592  PHE C CB    1 
ATOM   10146 C  CG    . PHE G 2 403 ? 7.547   102.649 111.195 1.00 25.35 ? 592  PHE C CG    1 
ATOM   10147 C  CD1   . PHE G 2 403 ? 7.514   102.244 112.526 1.00 24.99 ? 592  PHE C CD1   1 
ATOM   10148 C  CD2   . PHE G 2 403 ? 7.667   101.670 110.209 1.00 25.05 ? 592  PHE C CD2   1 
ATOM   10149 C  CE1   . PHE G 2 403 ? 7.598   100.900 112.876 1.00 24.93 ? 592  PHE C CE1   1 
ATOM   10150 C  CE2   . PHE G 2 403 ? 7.751   100.315 110.551 1.00 25.24 ? 592  PHE C CE2   1 
ATOM   10151 C  CZ    . PHE G 2 403 ? 7.716   99.933  111.892 1.00 25.15 ? 592  PHE C CZ    1 
ATOM   10152 N  N     . PHE G 2 404 ? 6.592   106.269 108.139 1.00 25.80 ? 593  PHE C N     1 
ATOM   10153 C  CA    . PHE G 2 404 ? 6.329   107.679 107.848 1.00 27.74 ? 593  PHE C CA    1 
ATOM   10154 C  C     . PHE G 2 404 ? 5.042   108.081 108.577 1.00 29.60 ? 593  PHE C C     1 
ATOM   10155 O  O     . PHE G 2 404 ? 3.990   107.496 108.345 1.00 29.87 ? 593  PHE C O     1 
ATOM   10156 C  CB    . PHE G 2 404 ? 6.167   107.896 106.341 1.00 27.03 ? 593  PHE C CB    1 
ATOM   10157 C  CG    . PHE G 2 404 ? 5.880   109.324 105.952 1.00 26.86 ? 593  PHE C CG    1 
ATOM   10158 C  CD1   . PHE G 2 404 ? 6.912   110.203 105.661 1.00 26.68 ? 593  PHE C CD1   1 
ATOM   10159 C  CD2   . PHE G 2 404 ? 4.571   109.789 105.877 1.00 26.89 ? 593  PHE C CD2   1 
ATOM   10160 C  CE1   . PHE G 2 404 ? 6.650   111.534 105.294 1.00 27.43 ? 593  PHE C CE1   1 
ATOM   10161 C  CE2   . PHE G 2 404 ? 4.299   111.115 105.513 1.00 27.47 ? 593  PHE C CE2   1 
ATOM   10162 C  CZ    . PHE G 2 404 ? 5.347   111.987 105.221 1.00 26.33 ? 593  PHE C CZ    1 
ATOM   10163 N  N     . ASP G 2 405 ? 5.141   109.073 109.457 1.00 30.94 ? 594  ASP C N     1 
ATOM   10164 C  CA    . ASP G 2 405 ? 3.999   109.554 110.234 1.00 32.10 ? 594  ASP C CA    1 
ATOM   10165 C  C     . ASP G 2 405 ? 3.377   110.789 109.557 1.00 32.87 ? 594  ASP C C     1 
ATOM   10166 O  O     . ASP G 2 405 ? 3.935   111.878 109.602 1.00 31.39 ? 594  ASP C O     1 
ATOM   10167 C  CB    . ASP G 2 405 ? 4.469   109.907 111.648 1.00 32.28 ? 594  ASP C CB    1 
ATOM   10168 C  CG    . ASP G 2 405 ? 3.325   110.322 112.573 1.00 32.76 ? 594  ASP C CG    1 
ATOM   10169 O  OD1   . ASP G 2 405 ? 2.216   110.624 112.088 1.00 31.89 ? 594  ASP C OD1   1 
ATOM   10170 O  OD2   . ASP G 2 405 ? 3.550   110.355 113.798 1.00 33.18 ? 594  ASP C OD2   1 
ATOM   10171 N  N     . PRO G 2 406 ? 2.198   110.626 108.939 1.00 34.48 ? 595  PRO C N     1 
ATOM   10172 C  CA    . PRO G 2 406 ? 1.461   111.687 108.236 1.00 36.92 ? 595  PRO C CA    1 
ATOM   10173 C  C     . PRO G 2 406 ? 1.263   112.942 109.076 1.00 39.12 ? 595  PRO C C     1 
ATOM   10174 O  O     . PRO G 2 406 ? 1.395   114.066 108.592 1.00 40.78 ? 595  PRO C O     1 
ATOM   10175 C  CB    . PRO G 2 406 ? 0.123   111.033 107.919 1.00 36.65 ? 595  PRO C CB    1 
ATOM   10176 C  CG    . PRO G 2 406 ? 0.434   109.574 107.918 1.00 37.19 ? 595  PRO C CG    1 
ATOM   10177 C  CD    . PRO G 2 406 ? 1.368   109.421 109.069 1.00 34.75 ? 595  PRO C CD    1 
ATOM   10178 N  N     . GLU G 2 407 ? 0.936   112.738 110.342 1.00 40.59 ? 596  GLU C N     1 
ATOM   10179 C  CA    . GLU G 2 407 ? 0.703   113.833 111.258 1.00 42.33 ? 596  GLU C CA    1 
ATOM   10180 C  C     . GLU G 2 407 ? 1.971   114.580 111.647 1.00 42.16 ? 596  GLU C C     1 
ATOM   10181 O  O     . GLU G 2 407 ? 1.891   115.692 112.167 1.00 42.82 ? 596  GLU C O     1 
ATOM   10182 C  CB    . GLU G 2 407 ? 0.021   113.301 112.523 1.00 44.93 ? 596  GLU C CB    1 
ATOM   10183 C  CG    . GLU G 2 407 ? -1.375  112.710 112.279 1.00 50.41 ? 596  GLU C CG    1 
ATOM   10184 C  CD    . GLU G 2 407 ? -1.927  111.932 113.483 1.00 53.79 ? 596  GLU C CD    1 
ATOM   10185 O  OE1   . GLU G 2 407 ? -1.789  112.415 114.639 1.00 54.94 ? 596  GLU C OE1   1 
ATOM   10186 O  OE2   . GLU G 2 407 ? -2.512  110.838 113.267 1.00 55.45 ? 596  GLU C OE2   1 
ATOM   10187 N  N     . LYS G 2 408 ? 3.139   113.999 111.387 1.00 41.22 ? 597  LYS C N     1 
ATOM   10188 C  CA    . LYS G 2 408 ? 4.382   114.648 111.797 1.00 40.84 ? 597  LYS C CA    1 
ATOM   10189 C  C     . LYS G 2 408 ? 5.533   114.774 110.796 1.00 40.30 ? 597  LYS C C     1 
ATOM   10190 O  O     . LYS G 2 408 ? 6.370   115.669 110.925 1.00 40.71 ? 597  LYS C O     1 
ATOM   10191 C  CB    . LYS G 2 408 ? 4.908   113.941 113.056 1.00 41.35 ? 597  LYS C CB    1 
ATOM   10192 C  CG    . LYS G 2 408 ? 6.266   114.418 113.563 1.00 42.76 ? 597  LYS C CG    1 
ATOM   10193 C  CD    . LYS G 2 408 ? 6.162   115.002 114.975 1.00 44.75 ? 597  LYS C CD    1 
ATOM   10194 C  CE    . LYS G 2 408 ? 7.515   115.495 115.486 1.00 46.28 ? 597  LYS C CE    1 
ATOM   10195 N  NZ    . LYS G 2 408 ? 8.532   114.383 115.526 1.00 48.17 ? 597  LYS C NZ    1 
ATOM   10196 N  N     . ASP G 2 409 ? 5.582   113.906 109.797 1.00 39.08 ? 598  ASP C N     1 
ATOM   10197 C  CA    . ASP G 2 409 ? 6.706   113.929 108.872 1.00 38.44 ? 598  ASP C CA    1 
ATOM   10198 C  C     . ASP G 2 409 ? 6.495   114.538 107.501 1.00 38.36 ? 598  ASP C C     1 
ATOM   10199 O  O     . ASP G 2 409 ? 7.331   114.371 106.613 1.00 38.10 ? 598  ASP C O     1 
ATOM   10200 C  CB    . ASP G 2 409 ? 7.231   112.504 108.706 1.00 38.14 ? 598  ASP C CB    1 
ATOM   10201 C  CG    . ASP G 2 409 ? 7.575   111.854 110.034 1.00 38.31 ? 598  ASP C CG    1 
ATOM   10202 O  OD1   . ASP G 2 409 ? 8.328   112.473 110.824 1.00 37.94 ? 598  ASP C OD1   1 
ATOM   10203 O  OD2   . ASP G 2 409 ? 7.097   110.723 110.278 1.00 38.47 ? 598  ASP C OD2   1 
ATOM   10204 N  N     . ARG G 2 410 ? 5.390   115.243 107.319 1.00 38.63 ? 599  ARG C N     1 
ATOM   10205 C  CA    . ARG G 2 410 ? 5.092   115.849 106.028 1.00 39.03 ? 599  ARG C CA    1 
ATOM   10206 C  C     . ARG G 2 410 ? 6.226   116.755 105.529 1.00 37.22 ? 599  ARG C C     1 
ATOM   10207 O  O     . ARG G 2 410 ? 6.444   116.880 104.330 1.00 36.01 ? 599  ARG C O     1 
ATOM   10208 C  CB    . ARG G 2 410 ? 3.766   116.620 106.130 1.00 42.12 ? 599  ARG C CB    1 
ATOM   10209 C  CG    . ARG G 2 410 ? 3.318   117.334 104.867 1.00 46.56 ? 599  ARG C CG    1 
ATOM   10210 C  CD    . ARG G 2 410 ? 3.456   116.456 103.612 1.00 50.83 ? 599  ARG C CD    1 
ATOM   10211 N  NE    . ARG G 2 410 ? 2.820   115.143 103.737 1.00 53.39 ? 599  ARG C NE    1 
ATOM   10212 C  CZ    . ARG G 2 410 ? 2.725   114.272 102.736 1.00 53.88 ? 599  ARG C CZ    1 
ATOM   10213 N  NH1   . ARG G 2 410 ? 3.226   114.581 101.547 1.00 54.92 ? 599  ARG C NH1   1 
ATOM   10214 N  NH2   . ARG G 2 410 ? 2.127   113.103 102.919 1.00 54.20 ? 599  ARG C NH2   1 
ATOM   10215 N  N     . ALA G 2 411 ? 6.965   117.359 106.454 1.00 35.81 ? 600  ALA C N     1 
ATOM   10216 C  CA    . ALA G 2 411 ? 8.055   118.244 106.081 1.00 35.62 ? 600  ALA C CA    1 
ATOM   10217 C  C     . ALA G 2 411 ? 9.208   117.577 105.323 1.00 35.46 ? 600  ALA C C     1 
ATOM   10218 O  O     . ALA G 2 411 ? 9.915   118.244 104.562 1.00 36.04 ? 600  ALA C O     1 
ATOM   10219 C  CB    . ALA G 2 411 ? 8.599   118.938 107.319 1.00 35.14 ? 600  ALA C CB    1 
ATOM   10220 N  N     . ILE G 2 412 ? 9.400   116.275 105.505 1.00 33.45 ? 601  ILE C N     1 
ATOM   10221 C  CA    . ILE G 2 412 ? 10.507  115.601 104.841 1.00 32.68 ? 601  ILE C CA    1 
ATOM   10222 C  C     . ILE G 2 412 ? 10.110  114.775 103.625 1.00 31.78 ? 601  ILE C C     1 
ATOM   10223 O  O     . ILE G 2 412 ? 10.956  114.175 102.982 1.00 31.51 ? 601  ILE C O     1 
ATOM   10224 C  CB    . ILE G 2 412 ? 11.285  114.698 105.853 1.00 33.07 ? 601  ILE C CB    1 
ATOM   10225 C  CG1   . ILE G 2 412 ? 12.702  114.418 105.330 1.00 33.04 ? 601  ILE C CG1   1 
ATOM   10226 C  CG2   . ILE G 2 412 ? 10.544  113.378 106.067 1.00 32.06 ? 601  ILE C CG2   1 
ATOM   10227 C  CD1   . ILE G 2 412 ? 13.598  113.649 106.315 1.00 32.09 ? 601  ILE C CD1   1 
ATOM   10228 N  N     . ALA G 2 413 ? 8.822   114.765 103.298 1.00 32.11 ? 602  ALA C N     1 
ATOM   10229 C  CA    . ALA G 2 413 ? 8.324   113.995 102.165 1.00 31.03 ? 602  ALA C CA    1 
ATOM   10230 C  C     . ALA G 2 413 ? 8.920   114.381 100.815 1.00 31.42 ? 602  ALA C C     1 
ATOM   10231 O  O     . ALA G 2 413 ? 9.333   113.510 100.046 1.00 30.25 ? 602  ALA C O     1 
ATOM   10232 C  CB    . ALA G 2 413 ? 6.816   114.086 102.101 1.00 29.95 ? 602  ALA C CB    1 
ATOM   10233 N  N     . ALA G 2 414 ? 8.958   115.674 100.516 1.00 31.15 ? 603  ALA C N     1 
ATOM   10234 C  CA    . ALA G 2 414 ? 9.499   116.108 99.239  1.00 32.12 ? 603  ALA C CA    1 
ATOM   10235 C  C     . ALA G 2 414 ? 10.943  115.616 99.093  1.00 32.65 ? 603  ALA C C     1 
ATOM   10236 O  O     . ALA G 2 414 ? 11.309  115.031 98.069  1.00 31.57 ? 603  ALA C O     1 
ATOM   10237 C  CB    . ALA G 2 414 ? 9.425   117.639 99.123  1.00 32.88 ? 603  ALA C CB    1 
ATOM   10238 N  N     . ASP G 2 415 ? 11.763  115.853 100.119 1.00 33.34 ? 604  ASP C N     1 
ATOM   10239 C  CA    . ASP G 2 415 ? 13.152  115.402 100.085 1.00 33.28 ? 604  ASP C CA    1 
ATOM   10240 C  C     . ASP G 2 415 ? 13.230  113.875 99.967  1.00 32.02 ? 604  ASP C C     1 
ATOM   10241 O  O     . ASP G 2 415 ? 14.054  113.344 99.237  1.00 31.17 ? 604  ASP C O     1 
ATOM   10242 C  CB    . ASP G 2 415 ? 13.902  115.876 101.336 1.00 35.63 ? 604  ASP C CB    1 
ATOM   10243 C  CG    . ASP G 2 415 ? 14.261  117.363 101.277 1.00 39.68 ? 604  ASP C CG    1 
ATOM   10244 O  OD1   . ASP G 2 415 ? 14.369  117.906 100.143 1.00 40.79 ? 604  ASP C OD1   1 
ATOM   10245 O  OD2   . ASP G 2 415 ? 14.450  117.988 102.359 1.00 40.22 ? 604  ASP C OD2   1 
ATOM   10246 N  N     . LEU G 2 416 ? 12.360  113.172 100.680 1.00 32.15 ? 605  LEU C N     1 
ATOM   10247 C  CA    . LEU G 2 416 ? 12.347  111.714 100.636 1.00 31.79 ? 605  LEU C CA    1 
ATOM   10248 C  C     . LEU G 2 416 ? 12.031  111.215 99.226  1.00 32.73 ? 605  LEU C C     1 
ATOM   10249 O  O     . LEU G 2 416 ? 12.653  110.261 98.742  1.00 33.79 ? 605  LEU C O     1 
ATOM   10250 C  CB    . LEU G 2 416 ? 11.342  111.175 101.651 1.00 30.75 ? 605  LEU C CB    1 
ATOM   10251 C  CG    . LEU G 2 416 ? 11.311  109.664 101.908 1.00 31.35 ? 605  LEU C CG    1 
ATOM   10252 C  CD1   . LEU G 2 416 ? 12.717  109.093 102.153 1.00 29.50 ? 605  LEU C CD1   1 
ATOM   10253 C  CD2   . LEU G 2 416 ? 10.426  109.422 103.109 1.00 31.60 ? 605  LEU C CD2   1 
ATOM   10254 N  N     . VAL G 2 417 ? 11.077  111.861 98.556  1.00 32.88 ? 606  VAL C N     1 
ATOM   10255 C  CA    . VAL G 2 417 ? 10.726  111.484 97.185  1.00 32.32 ? 606  VAL C CA    1 
ATOM   10256 C  C     . VAL G 2 417 ? 11.987  111.571 96.325  1.00 32.72 ? 606  VAL C C     1 
ATOM   10257 O  O     . VAL G 2 417 ? 12.336  110.619 95.614  1.00 33.05 ? 606  VAL C O     1 
ATOM   10258 C  CB    . VAL G 2 417 ? 9.660   112.433 96.585  1.00 32.82 ? 606  VAL C CB    1 
ATOM   10259 C  CG1   . VAL G 2 417 ? 9.422   112.101 95.101  1.00 31.09 ? 606  VAL C CG1   1 
ATOM   10260 C  CG2   . VAL G 2 417 ? 8.365   112.305 97.365  1.00 32.08 ? 606  VAL C CG2   1 
ATOM   10261 N  N     . LYS G 2 418 ? 12.659  112.719 96.389  1.00 32.33 ? 607  LYS C N     1 
ATOM   10262 C  CA    . LYS G 2 418 ? 13.894  112.930 95.634  1.00 33.89 ? 607  LYS C CA    1 
ATOM   10263 C  C     . LYS G 2 418 ? 14.961  111.865 95.902  1.00 33.39 ? 607  LYS C C     1 
ATOM   10264 O  O     . LYS G 2 418 ? 15.552  111.345 94.954  1.00 33.45 ? 607  LYS C O     1 
ATOM   10265 C  CB    . LYS G 2 418 ? 14.484  114.311 95.936  1.00 36.00 ? 607  LYS C CB    1 
ATOM   10266 C  CG    . LYS G 2 418 ? 13.707  115.477 95.333  1.00 39.83 ? 607  LYS C CG    1 
ATOM   10267 C  CD    . LYS G 2 418 ? 14.206  116.807 95.901  1.00 43.39 ? 607  LYS C CD    1 
ATOM   10268 C  CE    . LYS G 2 418 ? 13.191  117.943 95.694  1.00 44.57 ? 607  LYS C CE    1 
ATOM   10269 N  NZ    . LYS G 2 418 ? 13.506  119.126 96.562  1.00 46.13 ? 607  LYS C NZ    1 
ATOM   10270 N  N     . ILE G 2 419 ? 15.218  111.544 97.176  1.00 31.91 ? 608  ILE C N     1 
ATOM   10271 C  CA    . ILE G 2 419 ? 16.230  110.539 97.495  1.00 31.35 ? 608  ILE C CA    1 
ATOM   10272 C  C     . ILE G 2 419 ? 15.796  109.175 96.973  1.00 30.55 ? 608  ILE C C     1 
ATOM   10273 O  O     . ILE G 2 419 ? 16.626  108.399 96.495  1.00 30.51 ? 608  ILE C O     1 
ATOM   10274 C  CB    . ILE G 2 419 ? 16.516  110.421 99.034  1.00 31.23 ? 608  ILE C CB    1 
ATOM   10275 C  CG1   . ILE G 2 419 ? 17.891  111.006 99.388  1.00 32.53 ? 608  ILE C CG1   1 
ATOM   10276 C  CG2   . ILE G 2 419 ? 16.638  108.961 99.439  1.00 30.96 ? 608  ILE C CG2   1 
ATOM   10277 C  CD1   . ILE G 2 419 ? 18.047  112.480 99.171  1.00 32.73 ? 608  ILE C CD1   1 
ATOM   10278 N  N     . LEU G 2 420 ? 14.507  108.874 97.066  1.00 30.61 ? 609  LEU C N     1 
ATOM   10279 C  CA    . LEU G 2 420 ? 14.030  107.579 96.584  1.00 31.61 ? 609  LEU C CA    1 
ATOM   10280 C  C     . LEU G 2 420 ? 14.238  107.462 95.071  1.00 32.58 ? 609  LEU C C     1 
ATOM   10281 O  O     . LEU G 2 420 ? 14.759  106.450 94.590  1.00 31.97 ? 609  LEU C O     1 
ATOM   10282 C  CB    . LEU G 2 420 ? 12.543  107.362 96.934  1.00 30.34 ? 609  LEU C CB    1 
ATOM   10283 C  CG    . LEU G 2 420 ? 12.198  107.158 98.423  1.00 30.23 ? 609  LEU C CG    1 
ATOM   10284 C  CD1   . LEU G 2 420 ? 10.706  107.219 98.618  1.00 29.11 ? 609  LEU C CD1   1 
ATOM   10285 C  CD2   . LEU G 2 420 ? 12.734  105.836 98.923  1.00 28.44 ? 609  LEU C CD2   1 
ATOM   10286 N  N     . GLU G 2 421 ? 13.854  108.506 94.335  1.00 33.90 ? 610  GLU C N     1 
ATOM   10287 C  CA    . GLU G 2 421 ? 13.984  108.509 92.880  1.00 36.06 ? 610  GLU C CA    1 
ATOM   10288 C  C     . GLU G 2 421 ? 15.443  108.536 92.466  1.00 35.97 ? 610  GLU C C     1 
ATOM   10289 O  O     . GLU G 2 421 ? 15.813  107.977 91.436  1.00 37.25 ? 610  GLU C O     1 
ATOM   10290 C  CB    . GLU G 2 421 ? 13.239  109.711 92.261  1.00 37.56 ? 610  GLU C CB    1 
ATOM   10291 C  CG    . GLU G 2 421 ? 11.734  109.717 92.552  1.00 40.95 ? 610  GLU C CG    1 
ATOM   10292 C  CD    . GLU G 2 421 ? 10.993  110.912 91.958  1.00 43.66 ? 610  GLU C CD    1 
ATOM   10293 O  OE1   . GLU G 2 421 ? 11.511  112.048 92.054  1.00 45.57 ? 610  GLU C OE1   1 
ATOM   10294 O  OE2   . GLU G 2 421 ? 9.880   110.719 91.413  1.00 44.97 ? 610  GLU C OE2   1 
ATOM   10295 N  N     . GLY G 2 422 ? 16.276  109.174 93.277  1.00 35.38 ? 611  GLY C N     1 
ATOM   10296 C  CA    . GLY G 2 422 ? 17.686  109.247 92.953  1.00 34.21 ? 611  GLY C CA    1 
ATOM   10297 C  C     . GLY G 2 422 ? 18.425  107.947 93.194  1.00 34.21 ? 611  GLY C C     1 
ATOM   10298 O  O     . GLY G 2 422 ? 19.515  107.757 92.667  1.00 34.05 ? 611  GLY C O     1 
ATOM   10299 N  N     . SER G 2 423 ? 17.857  107.052 93.999  1.00 34.07 ? 612  SER C N     1 
ATOM   10300 C  CA    . SER G 2 423 ? 18.523  105.777 94.263  1.00 34.07 ? 612  SER C CA    1 
ATOM   10301 C  C     . SER G 2 423 ? 17.763  104.587 93.697  1.00 34.53 ? 612  SER C C     1 
ATOM   10302 O  O     . SER G 2 423 ? 17.955  103.456 94.147  1.00 34.16 ? 612  SER C O     1 
ATOM   10303 C  CB    . SER G 2 423 ? 18.774  105.582 95.771  1.00 33.96 ? 612  SER C CB    1 
ATOM   10304 O  OG    . SER G 2 423 ? 17.610  105.814 96.553  1.00 34.34 ? 612  SER C OG    1 
ATOM   10305 N  N     . GLY G 2 424 ? 16.891  104.861 92.724  1.00 35.27 ? 613  GLY C N     1 
ATOM   10306 C  CA    . GLY G 2 424 ? 16.115  103.824 92.051  1.00 36.66 ? 613  GLY C CA    1 
ATOM   10307 C  C     . GLY G 2 424 ? 15.016  103.068 92.787  1.00 37.85 ? 613  GLY C C     1 
ATOM   10308 O  O     . GLY G 2 424 ? 14.658  101.961 92.389  1.00 38.34 ? 613  GLY C O     1 
ATOM   10309 N  N     . GLN G 2 425 ? 14.463  103.656 93.840  1.00 38.10 ? 614  GLN C N     1 
ATOM   10310 C  CA    . GLN G 2 425 ? 13.417  102.998 94.613  1.00 38.30 ? 614  GLN C CA    1 
ATOM   10311 C  C     . GLN G 2 425 ? 12.032  103.475 94.183  1.00 38.45 ? 614  GLN C C     1 
ATOM   10312 O  O     . GLN G 2 425 ? 11.886  104.569 93.650  1.00 38.77 ? 614  GLN C O     1 
ATOM   10313 C  CB    . GLN G 2 425 ? 13.618  103.302 96.096  1.00 37.99 ? 614  GLN C CB    1 
ATOM   10314 C  CG    . GLN G 2 425 ? 15.057  103.165 96.557  1.00 38.05 ? 614  GLN C CG    1 
ATOM   10315 C  CD    . GLN G 2 425 ? 15.546  101.733 96.532  1.00 37.63 ? 614  GLN C CD    1 
ATOM   10316 O  OE1   . GLN G 2 425 ? 14.977  100.862 97.185  1.00 37.85 ? 614  GLN C OE1   1 
ATOM   10317 N  NE2   . GLN G 2 425 ? 16.608  101.482 95.780  1.00 37.48 ? 614  GLN C NE2   1 
ATOM   10318 N  N     . THR G 2 426 ? 11.011  102.664 94.424  1.00 39.09 ? 615  THR C N     1 
ATOM   10319 C  CA    . THR G 2 426 ? 9.664   103.068 94.055  1.00 40.27 ? 615  THR C CA    1 
ATOM   10320 C  C     . THR G 2 426 ? 9.154   104.073 95.088  1.00 39.70 ? 615  THR C C     1 
ATOM   10321 O  O     . THR G 2 426 ? 9.518   104.008 96.264  1.00 39.33 ? 615  THR C O     1 
ATOM   10322 C  CB    . THR G 2 426 ? 8.701   101.854 93.972  1.00 41.58 ? 615  THR C CB    1 
ATOM   10323 O  OG1   . THR G 2 426 ? 8.495   101.306 95.277  1.00 42.91 ? 615  THR C OG1   1 
ATOM   10324 C  CG2   . THR G 2 426 ? 9.288   100.775 93.076  1.00 42.37 ? 615  THR C CG2   1 
ATOM   10325 N  N     . VAL G 2 427 ? 8.333   105.011 94.627  1.00 39.59 ? 616  VAL C N     1 
ATOM   10326 C  CA    . VAL G 2 427 ? 7.757   106.058 95.466  1.00 39.23 ? 616  VAL C CA    1 
ATOM   10327 C  C     . VAL G 2 427 ? 6.282   105.788 95.768  1.00 40.69 ? 616  VAL C C     1 
ATOM   10328 O  O     . VAL G 2 427 ? 5.457   105.776 94.855  1.00 41.41 ? 616  VAL C O     1 
ATOM   10329 C  CB    . VAL G 2 427 ? 7.830   107.424 94.757  1.00 38.61 ? 616  VAL C CB    1 
ATOM   10330 C  CG1   . VAL G 2 427 ? 7.280   108.508 95.656  1.00 36.13 ? 616  VAL C CG1   1 
ATOM   10331 C  CG2   . VAL G 2 427 ? 9.266   107.725 94.331  1.00 37.23 ? 616  VAL C CG2   1 
ATOM   10332 N  N     . PRO G 2 428 ? 5.932   105.560 97.048  1.00 41.42 ? 617  PRO C N     1 
ATOM   10333 C  CA    . PRO G 2 428 ? 4.529   105.306 97.406  1.00 41.80 ? 617  PRO C CA    1 
ATOM   10334 C  C     . PRO G 2 428 ? 3.755   106.598 97.154  1.00 41.99 ? 617  PRO C C     1 
ATOM   10335 O  O     . PRO G 2 428 ? 4.297   107.689 97.330  1.00 41.44 ? 617  PRO C O     1 
ATOM   10336 C  CB    . PRO G 2 428 ? 4.597   104.975 98.899  1.00 41.94 ? 617  PRO C CB    1 
ATOM   10337 C  CG    . PRO G 2 428 ? 6.003   104.482 99.091  1.00 41.57 ? 617  PRO C CG    1 
ATOM   10338 C  CD    . PRO G 2 428 ? 6.805   105.410 98.225  1.00 41.54 ? 617  PRO C CD    1 
ATOM   10339 N  N     . ASP G 2 429 ? 2.496   106.480 96.748  1.00 42.71 ? 618  ASP C N     1 
ATOM   10340 C  CA    . ASP G 2 429 ? 1.672   107.654 96.461  1.00 43.23 ? 618  ASP C CA    1 
ATOM   10341 C  C     . ASP G 2 429 ? 1.488   108.610 97.630  1.00 41.68 ? 618  ASP C C     1 
ATOM   10342 O  O     . ASP G 2 429 ? 1.537   109.823 97.455  1.00 41.91 ? 618  ASP C O     1 
ATOM   10343 C  CB    . ASP G 2 429 ? 0.292   107.221 95.950  1.00 45.90 ? 618  ASP C CB    1 
ATOM   10344 C  CG    . ASP G 2 429 ? 0.318   106.791 94.492  1.00 49.08 ? 618  ASP C CG    1 
ATOM   10345 O  OD1   . ASP G 2 429 ? -0.369  105.795 94.147  1.00 51.08 ? 618  ASP C OD1   1 
ATOM   10346 O  OD2   . ASP G 2 429 ? 1.015   107.459 93.690  1.00 49.44 ? 618  ASP C OD2   1 
ATOM   10347 N  N     . PHE G 2 430 ? 1.290   108.078 98.829  1.00 40.88 ? 619  PHE C N     1 
ATOM   10348 C  CA    . PHE G 2 430 ? 1.075   108.956 99.966  1.00 39.32 ? 619  PHE C CA    1 
ATOM   10349 C  C     . PHE G 2 430 ? 2.182   109.986 100.214 1.00 39.23 ? 619  PHE C C     1 
ATOM   10350 O  O     . PHE G 2 430 ? 1.956   110.971 100.917 1.00 39.37 ? 619  PHE C O     1 
ATOM   10351 C  CB    . PHE G 2 430 ? 0.773   108.133 101.227 1.00 37.38 ? 619  PHE C CB    1 
ATOM   10352 C  CG    . PHE G 2 430 ? 1.935   107.357 101.758 1.00 36.90 ? 619  PHE C CG    1 
ATOM   10353 C  CD1   . PHE G 2 430 ? 2.925   107.986 102.514 1.00 36.45 ? 619  PHE C CD1   1 
ATOM   10354 C  CD2   . PHE G 2 430 ? 2.036   105.992 101.518 1.00 35.83 ? 619  PHE C CD2   1 
ATOM   10355 C  CE1   . PHE G 2 430 ? 4.003   107.267 103.026 1.00 36.28 ? 619  PHE C CE1   1 
ATOM   10356 C  CE2   . PHE G 2 430 ? 3.105   105.262 102.023 1.00 36.79 ? 619  PHE C CE2   1 
ATOM   10357 C  CZ    . PHE G 2 430 ? 4.098   105.906 102.784 1.00 35.85 ? 619  PHE C CZ    1 
ATOM   10358 N  N     . LEU G 2 431 ? 3.368   109.786 99.644  1.00 38.67 ? 620  LEU C N     1 
ATOM   10359 C  CA    . LEU G 2 431 ? 4.437   110.764 99.844  1.00 38.54 ? 620  LEU C CA    1 
ATOM   10360 C  C     . LEU G 2 431 ? 4.226   111.982 98.953  1.00 39.65 ? 620  LEU C C     1 
ATOM   10361 O  O     . LEU G 2 431 ? 4.782   113.046 99.212  1.00 38.78 ? 620  LEU C O     1 
ATOM   10362 C  CB    . LEU G 2 431 ? 5.825   110.176 99.546  1.00 35.81 ? 620  LEU C CB    1 
ATOM   10363 C  CG    . LEU G 2 431 ? 6.542   109.311 100.590 1.00 36.05 ? 620  LEU C CG    1 
ATOM   10364 C  CD1   . LEU G 2 431 ? 7.906   108.920 100.041 1.00 34.08 ? 620  LEU C CD1   1 
ATOM   10365 C  CD2   . LEU G 2 431 ? 6.698   110.051 101.922 1.00 34.07 ? 620  LEU C CD2   1 
ATOM   10366 N  N     . ARG G 2 432 ? 3.433   111.822 97.897  1.00 41.27 ? 621  ARG C N     1 
ATOM   10367 C  CA    . ARG G 2 432 ? 3.178   112.928 96.979  1.00 42.89 ? 621  ARG C CA    1 
ATOM   10368 C  C     . ARG G 2 432 ? 1.989   113.798 97.396  1.00 43.88 ? 621  ARG C C     1 
ATOM   10369 O  O     . ARG G 2 432 ? 1.901   114.933 96.876  1.00 44.81 ? 621  ARG C O     1 
ATOM   10370 C  CB    . ARG G 2 432 ? 2.971   112.400 95.561  1.00 43.15 ? 621  ARG C CB    1 
ATOM   10371 C  CG    . ARG G 2 432 ? 4.223   111.777 94.954  1.00 43.70 ? 621  ARG C CG    1 
ATOM   10372 C  CD    . ARG G 2 432 ? 4.488   112.355 93.578  1.00 44.27 ? 621  ARG C CD    1 
ATOM   10373 N  NE    . ARG G 2 432 ? 5.809   112.008 93.056  1.00 43.76 ? 621  ARG C NE    1 
ATOM   10374 C  CZ    . ARG G 2 432 ? 6.177   110.767 92.771  1.00 43.92 ? 621  ARG C CZ    1 
ATOM   10375 N  NH1   . ARG G 2 432 ? 5.318   109.773 92.969  1.00 44.13 ? 621  ARG C NH1   1 
ATOM   10376 N  NH2   . ARG G 2 432 ? 7.380   110.522 92.270  1.00 42.88 ? 621  ARG C NH2   1 
ATOM   10377 N  N     . TYR H 2 13  ? 88.798  26.292  113.430 1.00 60.99 ? 202  TYR D N     1 
ATOM   10378 C  CA    . TYR H 2 13  ? 88.769  25.313  114.550 1.00 60.73 ? 202  TYR D CA    1 
ATOM   10379 C  C     . TYR H 2 13  ? 88.068  24.086  114.005 1.00 60.89 ? 202  TYR D C     1 
ATOM   10380 O  O     . TYR H 2 13  ? 88.080  23.020  114.613 1.00 61.34 ? 202  TYR D O     1 
ATOM   10381 C  CB    . TYR H 2 13  ? 87.989  25.890  115.739 1.00 60.11 ? 202  TYR D CB    1 
ATOM   10382 C  CG    . TYR H 2 13  ? 86.474  25.757  115.650 1.00 59.66 ? 202  TYR D CG    1 
ATOM   10383 C  CD1   . TYR H 2 13  ? 85.837  24.552  115.969 1.00 59.27 ? 202  TYR D CD1   1 
ATOM   10384 C  CD2   . TYR H 2 13  ? 85.676  26.839  115.265 1.00 59.59 ? 202  TYR D CD2   1 
ATOM   10385 C  CE1   . TYR H 2 13  ? 84.450  24.429  115.914 1.00 59.07 ? 202  TYR D CE1   1 
ATOM   10386 C  CE2   . TYR H 2 13  ? 84.284  26.728  1