data_2DGC
# 
_entry.id   2DGC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DGC         
RCSB  PDT029       
WWPDB D_1000177993 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1DGC 
_pdbx_database_related.details        '2DGC IS A HIGH RESOLUTION, FULLY REFINED VERSION OF 1DGC THAT INCLUDES 46 WATER MOLECULES.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DGC 
_pdbx_database_status.recvd_initial_deposition_date   1995-09-28 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Keller, W.'     1 
'Koenig, P.'     2 
'Richmond, T.J.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of a bZIP/DNA complex at 2.2 A: determinants of DNA specific recognition.' J.Mol.Biol.             254 
657  667 1995 JMOBAK UK 0022-2836 0070 ? 7500340 10.1006/jmbi.1995.0645 
1       'The X-Ray Structure of the GCN4-bZIP Bound to ATF/CREB Site DNA Shows the Complex Depends on DNA Flexibility' J.Mol.Biol. 
233 139  ?   1993 JMOBAK UK 0022-2836 0070 ? ?       ?                      
2       
;The GCN4 Basic Region Leucine Zipper Binds DNA as a Dimer of Uninterrupted Alpha Helices: Crystal Structure of the Protein-DNA Complex
;
'Cell(Cambridge,Mass.)' 71  1223 ?   1992 CELLB5 US 0092-8674 0998 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Keller, W.'        1 
primary 'Konig, P.'         2 
primary 'Richmond, T.J.'    3 
1       'Koenig, P.'        4 
1       'Richmond, T.J.'    5 
2       'Ellenberger, T.E.' 6 
2       'Brandl, C.J.'      7 
2       'Struhl, K.'        8 
2       'Harrison, S.C.'    9 
# 
_cell.entry_id           2DGC 
_cell.length_a           58.660 
_cell.length_b           58.660 
_cell.length_c           86.880 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2DGC 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*GP*GP*AP*GP*AP*TP*GP*AP*CP*GP*TP*CP*AP*TP*CP*T P*CP*C)-3')
;
5820.771 1  ? ? ? ? 
2 polymer nat 'PROTEIN (GCN4)'                                                           7375.564 1  ? ? ? ? 
3 water   nat water                                                                      18.015   46 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DG)(DA)(DG)(DA)(DT)(DG)(DA)(DC)(DG)(DT)(DC)(DA)(DT)(DC)(DT)(DC)(DC)' TGGAGATGACGTCATCTCC 
B ? 
2 'polypeptide(L)'        no no MIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER                
MIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DG  n 
1 3  DG  n 
1 4  DA  n 
1 5  DG  n 
1 6  DA  n 
1 7  DT  n 
1 8  DG  n 
1 9  DA  n 
1 10 DC  n 
1 11 DG  n 
1 12 DT  n 
1 13 DC  n 
1 14 DA  n 
1 15 DT  n 
1 16 DC  n 
1 17 DT  n 
1 18 DC  n 
1 19 DC  n 
2 1  MET n 
2 2  ILE n 
2 3  VAL n 
2 4  PRO n 
2 5  GLU n 
2 6  SER n 
2 7  SER n 
2 8  ASP n 
2 9  PRO n 
2 10 ALA n 
2 11 ALA n 
2 12 LEU n 
2 13 LYS n 
2 14 ARG n 
2 15 ALA n 
2 16 ARG n 
2 17 ASN n 
2 18 THR n 
2 19 GLU n 
2 20 ALA n 
2 21 ALA n 
2 22 ARG n 
2 23 ARG n 
2 24 SER n 
2 25 ARG n 
2 26 ALA n 
2 27 ARG n 
2 28 LYS n 
2 29 LEU n 
2 30 GLN n 
2 31 ARG n 
2 32 MET n 
2 33 LYS n 
2 34 GLN n 
2 35 LEU n 
2 36 GLU n 
2 37 ASP n 
2 38 LYS n 
2 39 VAL n 
2 40 GLU n 
2 41 GLU n 
2 42 LEU n 
2 43 LEU n 
2 44 SER n 
2 45 LYS n 
2 46 ASN n 
2 47 TYR n 
2 48 HIS n 
2 49 LEU n 
2 50 GLU n 
2 51 ASN n 
2 52 GLU n 
2 53 VAL n 
2 54 ALA n 
2 55 ARG n 
2 56 LEU n 
2 57 LYS n 
2 58 LYS n 
2 59 LEU n 
2 60 VAL n 
2 61 GLY n 
2 62 GLU n 
2 63 ARG n 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                
;baker's yeast
;
_entity_src_nat.pdbx_organism_scientific   'Saccharomyces cerevisiae' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      4932 
_entity_src_nat.genus                      Saccharomyces 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP GCN4_YEAST 2 P03069 ? ? ? 
2 PDB 2DGC       1 2DGC   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2DGC A 2 ? 63 ? P03069 220 ? 281 ? 220 281 
2 2 2DGC B 1 ? 19 ? 2DGC   -10 ? 9   ? -10 9   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2DGC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_percent_sol   55.82 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_details    'pH 4.60, VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 WATER        ? ? ? 
1 2 1 'PEG 6000'   ? ? ? 
1 3 1 MGCL2        ? ? ? 
1 4 1 'NA CITRATE' ? ? ? 
1 5 1 'NA AZIDE'   ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           277.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.92 
# 
_reflns.entry_id                     2DGC 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   3.000 
_reflns.d_resolution_low             15.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   6597 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         80.800 
_reflns.pdbx_Rmerge_I_obs            0.0900000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.000 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2DGC 
_refine.ls_number_reflns_obs                     5576 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.000 
_refine.ls_d_res_high                            2.200 
_refine.ls_percent_reflns_obs                    80.700 
_refine.ls_R_factor_obs                          0.2140000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2140000 
_refine.ls_R_factor_R_free                       0.3160000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               41.30 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2DGC 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        427 
_refine_hist.pdbx_number_atoms_nucleic_acid   386 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               859 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        6.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             0.022 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          3.64  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        1.13  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PARAM11.DNA 
_pdbx_xplor_file.topol_file       ? 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2DGC 
_struct.title                     'GCN4 BASIC DOMAIN, LEUCINE ZIPPER COMPLEXED WITH ATF/CREB SITE DNA' 
_struct.pdbx_descriptor           'GCN4/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DGC 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'BASIC DOMAIN, LEUCINE ZIPPER, DNA BINDING, EUKARYOTIC REGULATORY PROTEIN, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE ASYMMETRIC UNIT CONTAINS ONE HALF OF PROTEIN/DNA
COMPLEX PER ASYMMETRIC UNIT.

MOLECULAR DYAD AXIS OF PROTEIN DIMER AND PALINDROMIC HALF
SITES OF THE DNA COINCIDES WITH CRYSTALLOGRAPHIC TWO-FOLD
AXIS.  THE FULL PROTEIN/DNA COMPLEX CAN BE OBTAINED BY
APPLYING THE FOLLOWING TRANSFORMATION MATRIX AND
TRANSLATION VECTOR TO THE COORDINATES X Y Z:

SYMMETRY
 THE CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS PRESENTED
 BELOW GENERATE THE SUBUNITS OF THE POLYMERIC MOLECULE.

 APPLIED TO RESIDUES:  A   229 ..     277
 APPLIED TO RESIDUES:  B   -10 ..       9
 SYMMETRY1   1  0.000000 -1.000000  0.000000      117.32000
 SYMMETRY2   1 -1.000000  0.000000  0.000000      117.32000
 SYMMETRY3   1  0.000000  0.000000 -1.000000       43.44000
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       B 
_struct_conf.beg_label_seq_id        11 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       B 
_struct_conf.end_label_seq_id        58 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         229 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         276 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   48 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 A DC 19 N3 ? ? B DG -9 B DC 9  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 A DC 19 O2 ? ? B DG -9 B DC 9  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 A DC 19 N4 ? ? B DG -9 B DC 9  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 A DC 18 N3 ? ? B DG -8 B DC 8  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 A DC 18 O2 ? ? B DG -8 B DC 8  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 A DC 18 N4 ? ? B DG -8 B DC 8  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 4  N1 ? ? ? 1_555 A DT 17 N3 ? ? B DA -7 B DT 7  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 4  N6 ? ? ? 1_555 A DT 17 O4 ? ? B DA -7 B DT 7  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 5  N1 ? ? ? 1_555 A DC 16 N3 ? ? B DG -6 B DC 6  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DG 5  N2 ? ? ? 1_555 A DC 16 O2 ? ? B DG -6 B DC 6  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DG 5  O6 ? ? ? 1_555 A DC 16 N4 ? ? B DG -6 B DC 6  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 6  N1 ? ? ? 1_555 A DT 15 N3 ? ? B DA -5 B DT 5  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 6  N6 ? ? ? 1_555 A DT 15 O4 ? ? B DA -5 B DT 5  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DT 7  N3 ? ? ? 1_555 A DA 14 N1 ? ? B DT -4 B DA 4  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 7  O4 ? ? ? 1_555 A DA 14 N6 ? ? B DT -4 B DA 4  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 8  N1 ? ? ? 1_555 A DC 13 N3 ? ? B DG -3 B DC 3  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 8  N2 ? ? ? 1_555 A DC 13 O2 ? ? B DG -3 B DC 3  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 8  O6 ? ? ? 1_555 A DC 13 N4 ? ? B DG -3 B DC 3  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DA 9  N1 ? ? ? 1_555 A DT 12 N3 ? ? B DA -2 B DT 2  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DA 9  N6 ? ? ? 1_555 A DT 12 O4 ? ? B DA -2 B DT 2  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 10 N3 ? ? ? 1_555 A DG 11 N1 ? ? B DC -1 B DG 1  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 10 N4 ? ? ? 1_555 A DG 11 O6 ? ? B DC -1 B DG 1  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 10 O2 ? ? ? 1_555 A DG 11 N2 ? ? B DC -1 B DG 1  8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DG 11 N1 ? ? ? 1_555 A DC 10 N3 ? ? B DG 1  B DC -1 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DG 11 N2 ? ? ? 1_555 A DC 10 O2 ? ? B DG 1  B DC -1 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 11 O6 ? ? ? 1_555 A DC 10 N4 ? ? B DG 1  B DC -1 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DT 12 N3 ? ? ? 1_555 A DA 9  N1 ? ? B DT 2  B DA -2 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 12 O4 ? ? ? 1_555 A DA 9  N6 ? ? B DT 2  B DA -2 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DC 13 N3 ? ? ? 1_555 A DG 8  N1 ? ? B DC 3  B DG -3 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DC 13 N4 ? ? ? 1_555 A DG 8  O6 ? ? B DC 3  B DG -3 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DC 13 O2 ? ? ? 1_555 A DG 8  N2 ? ? B DC 3  B DG -3 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DA 14 N1 ? ? ? 1_555 A DT 7  N3 ? ? B DA 4  B DT -4 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DA 14 N6 ? ? ? 1_555 A DT 7  O4 ? ? B DA 4  B DT -4 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DT 15 N3 ? ? ? 1_555 A DA 6  N1 ? ? B DT 5  B DA -5 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DT 15 O4 ? ? ? 1_555 A DA 6  N6 ? ? B DT 5  B DA -5 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DC 16 N3 ? ? ? 1_555 A DG 5  N1 ? ? B DC 6  B DG -6 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DC 16 N4 ? ? ? 1_555 A DG 5  O6 ? ? B DC 6  B DG -6 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DC 16 O2 ? ? ? 1_555 A DG 5  N2 ? ? B DC 6  B DG -6 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DT 17 N3 ? ? ? 1_555 A DA 4  N1 ? ? B DT 7  B DA -7 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DT 17 O4 ? ? ? 1_555 A DA 4  N6 ? ? B DT 7  B DA -7 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DC 18 N3 ? ? ? 1_555 A DG 3  N1 ? ? B DC 8  B DG -8 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DC 18 N4 ? ? ? 1_555 A DG 3  O6 ? ? B DC 8  B DG -8 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DC 18 O2 ? ? ? 1_555 A DG 3  N2 ? ? B DC 8  B DG -8 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? A DC 19 N3 ? ? ? 1_555 A DG 2  N1 ? ? B DC 9  B DG -9 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? A DC 19 N4 ? ? ? 1_555 A DG 2  O6 ? ? B DC 9  B DG -9 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? A DC 19 O2 ? ? ? 1_555 A DG 2  N2 ? ? B DC 9  B DG -9 8_775 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2DGC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DGC 
_atom_sites.fract_transf_matrix[1][1]   0.017047 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017047 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011510 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   O "O5'" . DT  A 1 1  ? 10.064 60.706  16.438 1.00 72.59 ? -10 DT  B "O5'" 1 
ATOM   2   C "C5'" . DT  A 1 1  ? 8.898  61.256  15.717 1.00 72.19 ? -10 DT  B "C5'" 1 
ATOM   3   C "C4'" . DT  A 1 1  ? 8.006  62.336  16.427 1.00 67.77 ? -10 DT  B "C4'" 1 
ATOM   4   O "O4'" . DT  A 1 1  ? 7.931  61.940  17.822 1.00 68.06 ? -10 DT  B "O4'" 1 
ATOM   5   C "C3'" . DT  A 1 1  ? 8.547  63.738  16.477 1.00 67.68 ? -10 DT  B "C3'" 1 
ATOM   6   O "O3'" . DT  A 1 1  ? 7.543  64.601  16.971 1.00 70.61 ? -10 DT  B "O3'" 1 
ATOM   7   C "C2'" . DT  A 1 1  ? 9.487  63.563  17.633 1.00 65.65 ? -10 DT  B "C2'" 1 
ATOM   8   C "C1'" . DT  A 1 1  ? 8.780  62.739  18.689 1.00 62.53 ? -10 DT  B "C1'" 1 
ATOM   9   N N1    . DT  A 1 1  ? 9.758  62.016  19.586 1.00 56.32 ? -10 DT  B N1    1 
ATOM   10  C C2    . DT  A 1 1  ? 9.646  62.185  21.004 1.00 55.96 ? -10 DT  B C2    1 
ATOM   11  O O2    . DT  A 1 1  ? 8.790  62.857  21.587 1.00 53.10 ? -10 DT  B O2    1 
ATOM   12  N N3    . DT  A 1 1  ? 10.597 61.516  21.796 1.00 53.83 ? -10 DT  B N3    1 
ATOM   13  C C4    . DT  A 1 1  ? 11.633 60.705  21.293 1.00 53.07 ? -10 DT  B C4    1 
ATOM   14  O O4    . DT  A 1 1  ? 12.435 60.153  22.048 1.00 54.74 ? -10 DT  B O4    1 
ATOM   15  C C5    . DT  A 1 1  ? 11.659 60.588  19.846 1.00 50.67 ? -10 DT  B C5    1 
ATOM   16  C C7    . DT  A 1 1  ? 12.735 59.736  19.231 1.00 48.58 ? -10 DT  B C7    1 
ATOM   17  C C6    . DT  A 1 1  ? 10.766 61.222  19.059 1.00 51.74 ? -10 DT  B C6    1 
ATOM   18  P P     . DG  A 1 2  ? 7.165  66.046  16.314 1.00 75.51 ? -9  DG  B P     1 
ATOM   19  O OP1   . DG  A 1 2  ? 5.882  65.838  15.568 1.00 76.59 ? -9  DG  B OP1   1 
ATOM   20  O OP2   . DG  A 1 2  ? 8.362  66.631  15.607 1.00 73.39 ? -9  DG  B OP2   1 
ATOM   21  O "O5'" . DG  A 1 2  ? 6.762  66.991  17.601 1.00 72.42 ? -9  DG  B "O5'" 1 
ATOM   22  C "C5'" . DG  A 1 2  ? 6.443  66.484  18.937 1.00 69.50 ? -9  DG  B "C5'" 1 
ATOM   23  C "C4'" . DG  A 1 2  ? 7.523  66.823  20.025 1.00 66.10 ? -9  DG  B "C4'" 1 
ATOM   24  O "O4'" . DG  A 1 2  ? 8.689  65.988  19.976 1.00 60.50 ? -9  DG  B "O4'" 1 
ATOM   25  C "C3'" . DG  A 1 2  ? 7.993  68.265  19.739 1.00 65.79 ? -9  DG  B "C3'" 1 
ATOM   26  O "O3'" . DG  A 1 2  ? 7.315  69.187  20.599 1.00 70.20 ? -9  DG  B "O3'" 1 
ATOM   27  C "C2'" . DG  A 1 2  ? 9.498  68.227  19.697 1.00 58.81 ? -9  DG  B "C2'" 1 
ATOM   28  C "C1'" . DG  A 1 2  ? 9.831  66.854  20.197 1.00 55.54 ? -9  DG  B "C1'" 1 
ATOM   29  N N9    . DG  A 1 2  ? 10.851 66.216  19.403 1.00 48.04 ? -9  DG  B N9    1 
ATOM   30  C C8    . DG  A 1 2  ? 11.083 66.282  18.052 1.00 45.74 ? -9  DG  B C8    1 
ATOM   31  N N7    . DG  A 1 2  ? 12.083 65.512  17.683 1.00 45.70 ? -9  DG  B N7    1 
ATOM   32  C C5    . DG  A 1 2  ? 12.516 64.922  18.869 1.00 41.93 ? -9  DG  B C5    1 
ATOM   33  C C6    . DG  A 1 2  ? 13.553 64.021  19.101 1.00 39.71 ? -9  DG  B C6    1 
ATOM   34  O O6    . DG  A 1 2  ? 14.320 63.549  18.293 1.00 43.88 ? -9  DG  B O6    1 
ATOM   35  N N1    . DG  A 1 2  ? 13.676 63.663  20.393 1.00 35.11 ? -9  DG  B N1    1 
ATOM   36  C C2    . DG  A 1 2  ? 12.873 64.142  21.380 1.00 40.62 ? -9  DG  B C2    1 
ATOM   37  N N2    . DG  A 1 2  ? 13.077 63.716  22.620 1.00 43.21 ? -9  DG  B N2    1 
ATOM   38  N N3    . DG  A 1 2  ? 11.884 65.011  21.189 1.00 41.79 ? -9  DG  B N3    1 
ATOM   39  C C4    . DG  A 1 2  ? 11.765 65.351  19.909 1.00 43.16 ? -9  DG  B C4    1 
ATOM   40  P P     . DG  A 1 3  ? 8.077  70.120  21.666 1.00 75.00 ? -8  DG  B P     1 
ATOM   41  O OP1   . DG  A 1 3  ? 7.040  70.681  22.592 1.00 75.62 ? -8  DG  B OP1   1 
ATOM   42  O OP2   . DG  A 1 3  ? 8.974  71.059  20.907 1.00 74.14 ? -8  DG  B OP2   1 
ATOM   43  O "O5'" . DG  A 1 3  ? 8.969  68.940  22.479 1.00 71.52 ? -8  DG  B "O5'" 1 
ATOM   44  C "C5'" . DG  A 1 3  ? 9.226  68.777  23.891 1.00 65.23 ? -8  DG  B "C5'" 1 
ATOM   45  C "C4'" . DG  A 1 3  ? 10.722 68.976  24.325 1.00 62.95 ? -8  DG  B "C4'" 1 
ATOM   46  O "O4'" . DG  A 1 3  ? 11.698 68.185  23.579 1.00 60.14 ? -8  DG  B "O4'" 1 
ATOM   47  C "C3'" . DG  A 1 3  ? 11.248 70.412  24.292 1.00 62.11 ? -8  DG  B "C3'" 1 
ATOM   48  O "O3'" . DG  A 1 3  ? 12.291 70.444  25.263 1.00 66.29 ? -8  DG  B "O3'" 1 
ATOM   49  C "C2'" . DG  A 1 3  ? 11.966 70.421  22.980 1.00 58.04 ? -8  DG  B "C2'" 1 
ATOM   50  C "C1'" . DG  A 1 3  ? 12.698 69.101  23.056 1.00 53.52 ? -8  DG  B "C1'" 1 
ATOM   51  N N9    . DG  A 1 3  ? 13.253 68.685  21.770 1.00 45.40 ? -8  DG  B N9    1 
ATOM   52  C C8    . DG  A 1 3  ? 12.943 69.103  20.513 1.00 42.65 ? -8  DG  B C8    1 
ATOM   53  N N7    . DG  A 1 3  ? 13.660 68.507  19.599 1.00 40.98 ? -8  DG  B N7    1 
ATOM   54  C C5    . DG  A 1 3  ? 14.492 67.652  20.299 1.00 35.95 ? -8  DG  B C5    1 
ATOM   55  C C6    . DG  A 1 3  ? 15.465 66.762  19.834 1.00 33.35 ? -8  DG  B C6    1 
ATOM   56  O O6    . DG  A 1 3  ? 15.792 66.529  18.683 1.00 31.75 ? -8  DG  B O6    1 
ATOM   57  N N1    . DG  A 1 3  ? 16.072 66.109  20.849 1.00 31.69 ? -8  DG  B N1    1 
ATOM   58  C C2    . DG  A 1 3  ? 15.778 66.269  22.169 1.00 34.20 ? -8  DG  B C2    1 
ATOM   59  N N2    . DG  A 1 3  ? 16.440 65.541  23.045 1.00 36.41 ? -8  DG  B N2    1 
ATOM   60  N N3    . DG  A 1 3  ? 14.873 67.101  22.636 1.00 37.25 ? -8  DG  B N3    1 
ATOM   61  C C4    . DG  A 1 3  ? 14.254 67.758  21.631 1.00 40.31 ? -8  DG  B C4    1 
ATOM   62  P P     . DA  A 1 4  ? 12.311 71.480  26.485 1.00 70.84 ? -7  DA  B P     1 
ATOM   63  O OP1   . DA  A 1 4  ? 11.139 71.111  27.360 1.00 69.10 ? -7  DA  B OP1   1 
ATOM   64  O OP2   . DA  A 1 4  ? 12.469 72.875  25.909 1.00 69.24 ? -7  DA  B OP2   1 
ATOM   65  O "O5'" . DA  A 1 4  ? 13.717 71.098  27.234 1.00 63.53 ? -7  DA  B "O5'" 1 
ATOM   66  C "C5'" . DA  A 1 4  ? 14.030 69.788  27.702 1.00 58.43 ? -7  DA  B "C5'" 1 
ATOM   67  C "C4'" . DA  A 1 4  ? 15.520 69.459  27.492 1.00 55.18 ? -7  DA  B "C4'" 1 
ATOM   68  O "O4'" . DA  A 1 4  ? 15.952 68.962  26.201 1.00 51.85 ? -7  DA  B "O4'" 1 
ATOM   69  C "C3'" . DA  A 1 4  ? 16.353 70.668  27.797 1.00 53.14 ? -7  DA  B "C3'" 1 
ATOM   70  O "O3'" . DA  A 1 4  ? 17.193 70.303  28.865 1.00 55.67 ? -7  DA  B "O3'" 1 
ATOM   71  C "C2'" . DA  A 1 4  ? 17.095 70.875  26.520 1.00 49.15 ? -7  DA  B "C2'" 1 
ATOM   72  C "C1'" . DA  A 1 4  ? 17.176 69.554  25.795 1.00 43.35 ? -7  DA  B "C1'" 1 
ATOM   73  N N9    . DA  A 1 4  ? 17.005 69.838  24.380 1.00 34.95 ? -7  DA  B N9    1 
ATOM   74  C C8    . DA  A 1 4  ? 16.126 70.710  23.795 1.00 33.84 ? -7  DA  B C8    1 
ATOM   75  N N7    . DA  A 1 4  ? 16.214 70.738  22.488 1.00 34.76 ? -7  DA  B N7    1 
ATOM   76  C C5    . DA  A 1 4  ? 17.201 69.815  22.203 1.00 27.79 ? -7  DA  B C5    1 
ATOM   77  C C6    . DA  A 1 4  ? 17.740 69.378  21.004 1.00 28.28 ? -7  DA  B C6    1 
ATOM   78  N N6    . DA  A 1 4  ? 17.351 69.843  19.819 1.00 27.91 ? -7  DA  B N6    1 
ATOM   79  N N1    . DA  A 1 4  ? 18.701 68.454  21.071 1.00 28.05 ? -7  DA  B N1    1 
ATOM   80  C C2    . DA  A 1 4  ? 19.083 67.987  22.252 1.00 27.78 ? -7  DA  B C2    1 
ATOM   81  N N3    . DA  A 1 4  ? 18.642 68.325  23.450 1.00 31.14 ? -7  DA  B N3    1 
ATOM   82  C C4    . DA  A 1 4  ? 17.681 69.261  23.349 1.00 30.91 ? -7  DA  B C4    1 
ATOM   83  P P     . DG  A 1 5  ? 18.239 71.295  29.548 1.00 55.92 ? -6  DG  B P     1 
ATOM   84  O OP1   . DG  A 1 5  ? 18.379 70.795  30.944 1.00 57.50 ? -6  DG  B OP1   1 
ATOM   85  O OP2   . DG  A 1 5  ? 17.780 72.662  29.273 1.00 57.05 ? -6  DG  B OP2   1 
ATOM   86  O "O5'" . DG  A 1 5  ? 19.579 71.023  28.710 1.00 50.50 ? -6  DG  B "O5'" 1 
ATOM   87  C "C5'" . DG  A 1 5  ? 20.269 69.785  28.895 1.00 43.67 ? -6  DG  B "C5'" 1 
ATOM   88  C "C4'" . DG  A 1 5  ? 21.390 69.525  27.876 1.00 37.92 ? -6  DG  B "C4'" 1 
ATOM   89  O "O4'" . DG  A 1 5  ? 20.918 69.692  26.544 1.00 36.54 ? -6  DG  B "O4'" 1 
ATOM   90  C "C3'" . DG  A 1 5  ? 22.589 70.437  28.025 1.00 36.69 ? -6  DG  B "C3'" 1 
ATOM   91  O "O3'" . DG  A 1 5  ? 23.769 69.619  27.951 1.00 37.67 ? -6  DG  B "O3'" 1 
ATOM   92  C "C2'" . DG  A 1 5  ? 22.401 71.376  26.860 1.00 36.04 ? -6  DG  B "C2'" 1 
ATOM   93  C "C1'" . DG  A 1 5  ? 21.832 70.490  25.796 1.00 32.72 ? -6  DG  B "C1'" 1 
ATOM   94  N N9    . DG  A 1 5  ? 21.079 71.184  24.777 1.00 28.09 ? -6  DG  B N9    1 
ATOM   95  C C8    . DG  A 1 5  ? 20.061 72.122  24.889 1.00 25.03 ? -6  DG  B C8    1 
ATOM   96  N N7    . DG  A 1 5  ? 19.561 72.497  23.718 1.00 28.31 ? -6  DG  B N7    1 
ATOM   97  C C5    . DG  A 1 5  ? 20.325 71.751  22.791 1.00 29.36 ? -6  DG  B C5    1 
ATOM   98  C C6    . DG  A 1 5  ? 20.274 71.727  21.346 1.00 31.49 ? -6  DG  B C6    1 
ATOM   99  O O6    . DG  A 1 5  ? 19.528 72.376  20.594 1.00 30.35 ? -6  DG  B O6    1 
ATOM   100 N N1    . DG  A 1 5  ? 21.211 70.812  20.808 1.00 28.07 ? -6  DG  B N1    1 
ATOM   101 C C2    . DG  A 1 5  ? 22.067 70.051  21.563 1.00 27.04 ? -6  DG  B C2    1 
ATOM   102 N N2    . DG  A 1 5  ? 22.860 69.268  20.867 1.00 24.45 ? -6  DG  B N2    1 
ATOM   103 N N3    . DG  A 1 5  ? 22.134 70.094  22.916 1.00 26.34 ? -6  DG  B N3    1 
ATOM   104 C C4    . DG  A 1 5  ? 21.238 70.948  23.449 1.00 26.76 ? -6  DG  B C4    1 
ATOM   105 P P     . DA  A 1 6  ? 25.194 70.302  28.050 1.00 37.88 ? -5  DA  B P     1 
ATOM   106 O OP1   . DA  A 1 6  ? 26.136 69.457  28.782 1.00 40.74 ? -5  DA  B OP1   1 
ATOM   107 O OP2   . DA  A 1 6  ? 25.001 71.712  28.444 1.00 36.58 ? -5  DA  B OP2   1 
ATOM   108 O "O5'" . DA  A 1 6  ? 25.590 70.159  26.541 1.00 39.43 ? -5  DA  B "O5'" 1 
ATOM   109 C "C5'" . DA  A 1 6  ? 26.142 68.957  26.005 1.00 34.15 ? -5  DA  B "C5'" 1 
ATOM   110 C "C4'" . DA  A 1 6  ? 26.825 69.266  24.662 1.00 30.41 ? -5  DA  B "C4'" 1 
ATOM   111 O "O4'" . DA  A 1 6  ? 25.931 69.898  23.731 1.00 27.09 ? -5  DA  B "O4'" 1 
ATOM   112 C "C3'" . DA  A 1 6  ? 27.928 70.219  24.830 1.00 29.13 ? -5  DA  B "C3'" 1 
ATOM   113 O "O3'" . DA  A 1 6  ? 29.036 69.606  24.218 1.00 33.87 ? -5  DA  B "O3'" 1 
ATOM   114 C "C2'" . DA  A 1 6  ? 27.421 71.473  24.125 1.00 26.25 ? -5  DA  B "C2'" 1 
ATOM   115 C "C1'" . DA  A 1 6  ? 26.406 71.080  23.132 1.00 22.99 ? -5  DA  B "C1'" 1 
ATOM   116 N N9    . DA  A 1 6  ? 25.264 72.001  23.099 1.00 20.86 ? -5  DA  B N9    1 
ATOM   117 C C8    . DA  A 1 6  ? 24.551 72.503  24.131 1.00 20.80 ? -5  DA  B C8    1 
ATOM   118 N N7    . DA  A 1 6  ? 23.569 73.265  23.767 1.00 22.53 ? -5  DA  B N7    1 
ATOM   119 C C5    . DA  A 1 6  ? 23.623 73.279  22.381 1.00 17.47 ? -5  DA  B C5    1 
ATOM   120 C C6    . DA  A 1 6  ? 22.851 73.915  21.398 1.00 18.29 ? -5  DA  B C6    1 
ATOM   121 N N6    . DA  A 1 6  ? 21.814 74.723  21.632 1.00 18.45 ? -5  DA  B N6    1 
ATOM   122 N N1    . DA  A 1 6  ? 23.174 73.708  20.127 1.00 19.12 ? -5  DA  B N1    1 
ATOM   123 C C2    . DA  A 1 6  ? 24.211 72.906  19.863 1.00 22.47 ? -5  DA  B C2    1 
ATOM   124 N N3    . DA  A 1 6  ? 25.027 72.274  20.691 1.00 23.17 ? -5  DA  B N3    1 
ATOM   125 C C4    . DA  A 1 6  ? 24.657 72.501  21.971 1.00 21.35 ? -5  DA  B C4    1 
ATOM   126 P P     . DT  A 1 7  ? 30.443 70.323  24.193 1.00 37.08 ? -4  DT  B P     1 
ATOM   127 O OP1   . DT  A 1 7  ? 31.486 69.287  24.147 1.00 39.23 ? -4  DT  B OP1   1 
ATOM   128 O OP2   . DT  A 1 7  ? 30.561 71.395  25.218 1.00 39.08 ? -4  DT  B OP2   1 
ATOM   129 O "O5'" . DT  A 1 7  ? 30.357 71.104  22.790 1.00 37.55 ? -4  DT  B "O5'" 1 
ATOM   130 C "C5'" . DT  A 1 7  ? 30.272 70.496  21.505 1.00 34.07 ? -4  DT  B "C5'" 1 
ATOM   131 C "C4'" . DT  A 1 7  ? 30.017 71.592  20.496 1.00 32.60 ? -4  DT  B "C4'" 1 
ATOM   132 O "O4'" . DT  A 1 7  ? 28.751 72.257  20.707 1.00 29.62 ? -4  DT  B "O4'" 1 
ATOM   133 C "C3'" . DT  A 1 7  ? 31.119 72.606  20.590 1.00 35.19 ? -4  DT  B "C3'" 1 
ATOM   134 O "O3'" . DT  A 1 7  ? 31.822 72.452  19.331 1.00 44.23 ? -4  DT  B "O3'" 1 
ATOM   135 C "C2'" . DT  A 1 7  ? 30.304 73.871  20.776 1.00 31.17 ? -4  DT  B "C2'" 1 
ATOM   136 C "C1'" . DT  A 1 7  ? 28.916 73.567  20.275 1.00 26.00 ? -4  DT  B "C1'" 1 
ATOM   137 N N1    . DT  A 1 7  ? 27.878 74.430  20.828 1.00 25.36 ? -4  DT  B N1    1 
ATOM   138 C C2    . DT  A 1 7  ? 27.045 75.077  19.943 1.00 26.33 ? -4  DT  B C2    1 
ATOM   139 O O2    . DT  A 1 7  ? 27.104 74.969  18.720 1.00 27.90 ? -4  DT  B O2    1 
ATOM   140 N N3    . DT  A 1 7  ? 26.096 75.905  20.510 1.00 26.03 ? -4  DT  B N3    1 
ATOM   141 C C4    . DT  A 1 7  ? 25.886 76.149  21.843 1.00 22.82 ? -4  DT  B C4    1 
ATOM   142 O O4    . DT  A 1 7  ? 24.985 76.912  22.155 1.00 29.07 ? -4  DT  B O4    1 
ATOM   143 C C5    . DT  A 1 7  ? 26.774 75.456  22.717 1.00 22.68 ? -4  DT  B C5    1 
ATOM   144 C C7    . DT  A 1 7  ? 26.661 75.621  24.233 1.00 21.35 ? -4  DT  B C7    1 
ATOM   145 C C6    . DT  A 1 7  ? 27.726 74.629  22.192 1.00 25.56 ? -4  DT  B C6    1 
ATOM   146 P P     . DG  A 1 8  ? 33.371 72.815  18.869 1.00 49.86 ? -3  DG  B P     1 
ATOM   147 O OP1   . DG  A 1 8  ? 34.018 71.576  18.326 1.00 51.18 ? -3  DG  B OP1   1 
ATOM   148 O OP2   . DG  A 1 8  ? 34.125 73.600  19.881 1.00 51.54 ? -3  DG  B OP2   1 
ATOM   149 O "O5'" . DG  A 1 8  ? 32.938 73.898  17.749 1.00 47.23 ? -3  DG  B "O5'" 1 
ATOM   150 C "C5'" . DG  A 1 8  ? 32.394 73.533  16.492 1.00 42.95 ? -3  DG  B "C5'" 1 
ATOM   151 C "C4'" . DG  A 1 8  ? 32.020 74.740  15.678 1.00 39.94 ? -3  DG  B "C4'" 1 
ATOM   152 O "O4'" . DG  A 1 8  ? 30.772 75.304  16.105 1.00 37.07 ? -3  DG  B "O4'" 1 
ATOM   153 C "C3'" . DG  A 1 8  ? 33.119 75.805  15.644 1.00 39.96 ? -3  DG  B "C3'" 1 
ATOM   154 O "O3'" . DG  A 1 8  ? 33.198 76.316  14.288 1.00 47.94 ? -3  DG  B "O3'" 1 
ATOM   155 C "C2'" . DG  A 1 8  ? 32.460 76.837  16.526 1.00 37.78 ? -3  DG  B "C2'" 1 
ATOM   156 C "C1'" . DG  A 1 8  ? 30.949 76.724  16.279 1.00 32.41 ? -3  DG  B "C1'" 1 
ATOM   157 N N9    . DG  A 1 8  ? 30.258 77.110  17.536 1.00 28.39 ? -3  DG  B N9    1 
ATOM   158 C C8    . DG  A 1 8  ? 30.624 76.740  18.821 1.00 20.81 ? -3  DG  B C8    1 
ATOM   159 N N7    . DG  A 1 8  ? 29.855 77.231  19.734 1.00 22.44 ? -3  DG  B N7    1 
ATOM   160 C C5    . DG  A 1 8  ? 28.892 77.957  19.014 1.00 22.55 ? -3  DG  B C5    1 
ATOM   161 C C6    . DG  A 1 8  ? 27.779 78.702  19.470 1.00 20.66 ? -3  DG  B C6    1 
ATOM   162 O O6    . DG  A 1 8  ? 27.422 78.864  20.618 1.00 23.05 ? -3  DG  B O6    1 
ATOM   163 N N1    . DG  A 1 8  ? 27.066 79.295  18.454 1.00 18.98 ? -3  DG  B N1    1 
ATOM   164 C C2    . DG  A 1 8  ? 27.374 79.191  17.123 1.00 16.47 ? -3  DG  B C2    1 
ATOM   165 N N2    . DG  A 1 8  ? 26.586 79.826  16.259 1.00 18.60 ? -3  DG  B N2    1 
ATOM   166 N N3    . DG  A 1 8  ? 28.412 78.511  16.685 1.00 15.52 ? -3  DG  B N3    1 
ATOM   167 C C4    . DG  A 1 8  ? 29.124 77.895  17.664 1.00 21.47 ? -3  DG  B C4    1 
ATOM   168 P P     . DA  A 1 9  ? 34.309 77.326  13.582 1.00 49.40 ? -2  DA  B P     1 
ATOM   169 O OP1   . DA  A 1 9  ? 34.280 76.983  12.133 1.00 51.49 ? -2  DA  B OP1   1 
ATOM   170 O OP2   . DA  A 1 9  ? 35.563 77.225  14.386 1.00 46.83 ? -2  DA  B OP2   1 
ATOM   171 O "O5'" . DA  A 1 9  ? 33.735 78.836  13.694 1.00 43.65 ? -2  DA  B "O5'" 1 
ATOM   172 C "C5'" . DA  A 1 9  ? 32.758 79.183  12.726 1.00 39.97 ? -2  DA  B "C5'" 1 
ATOM   173 C "C4'" . DA  A 1 9  ? 32.045 80.486  13.006 1.00 38.42 ? -2  DA  B "C4'" 1 
ATOM   174 O "O4'" . DA  A 1 9  ? 31.211 80.370  14.177 1.00 36.33 ? -2  DA  B "O4'" 1 
ATOM   175 C "C3'" . DA  A 1 9  ? 33.003 81.653  13.157 1.00 38.65 ? -2  DA  B "C3'" 1 
ATOM   176 O "O3'" . DA  A 1 9  ? 32.685 82.677  12.169 1.00 39.94 ? -2  DA  B "O3'" 1 
ATOM   177 C "C2'" . DA  A 1 9  ? 32.707 82.030  14.614 1.00 35.76 ? -2  DA  B "C2'" 1 
ATOM   178 C "C1'" . DA  A 1 9  ? 31.272 81.580  14.892 1.00 33.88 ? -2  DA  B "C1'" 1 
ATOM   179 N N9    . DA  A 1 9  ? 31.070 81.293  16.320 1.00 30.09 ? -2  DA  B N9    1 
ATOM   180 C C8    . DA  A 1 9  ? 31.891 80.546  17.099 1.00 28.10 ? -2  DA  B C8    1 
ATOM   181 N N7    . DA  A 1 9  ? 31.474 80.442  18.325 1.00 28.61 ? -2  DA  B N7    1 
ATOM   182 C C5    . DA  A 1 9  ? 30.291 81.186  18.392 1.00 25.44 ? -2  DA  B C5    1 
ATOM   183 C C6    . DA  A 1 9  ? 29.386 81.459  19.452 1.00 23.76 ? -2  DA  B C6    1 
ATOM   184 N N6    . DA  A 1 9  ? 29.585 80.975  20.671 1.00 17.26 ? -2  DA  B N6    1 
ATOM   185 N N1    . DA  A 1 9  ? 28.301 82.199  19.201 1.00 23.27 ? -2  DA  B N1    1 
ATOM   186 C C2    . DA  A 1 9  ? 28.138 82.648  17.962 1.00 25.20 ? -2  DA  B C2    1 
ATOM   187 N N3    . DA  A 1 9  ? 28.908 82.479  16.877 1.00 24.13 ? -2  DA  B N3    1 
ATOM   188 C C4    . DA  A 1 9  ? 30.005 81.709  17.160 1.00 27.52 ? -2  DA  B C4    1 
ATOM   189 P P     . DC  A 1 10 ? 33.328 84.190  12.033 1.00 40.87 ? -1  DC  B P     1 
ATOM   190 O OP1   . DC  A 1 10 ? 33.253 84.509  10.582 1.00 43.73 ? -1  DC  B OP1   1 
ATOM   191 O OP2   . DC  A 1 10 ? 34.634 84.269  12.734 1.00 42.20 ? -1  DC  B OP2   1 
ATOM   192 O "O5'" . DC  A 1 10 ? 32.366 85.117  12.795 1.00 35.14 ? -1  DC  B "O5'" 1 
ATOM   193 C "C5'" . DC  A 1 10 ? 30.994 85.097  12.509 1.00 32.57 ? -1  DC  B "C5'" 1 
ATOM   194 C "C4'" . DC  A 1 10 ? 30.261 85.793  13.632 1.00 30.36 ? -1  DC  B "C4'" 1 
ATOM   195 O "O4'" . DC  A 1 10 ? 30.262 85.034  14.839 1.00 26.71 ? -1  DC  B "O4'" 1 
ATOM   196 C "C3'" . DC  A 1 10 ? 30.955 87.116  13.945 1.00 27.62 ? -1  DC  B "C3'" 1 
ATOM   197 O "O3'" . DC  A 1 10 ? 30.438 88.095  13.019 1.00 26.47 ? -1  DC  B "O3'" 1 
ATOM   198 C "C2'" . DC  A 1 10 ? 30.492 87.332  15.363 1.00 26.65 ? -1  DC  B "C2'" 1 
ATOM   199 C "C1'" . DC  A 1 10 ? 30.096 86.006  15.865 1.00 23.74 ? -1  DC  B "C1'" 1 
ATOM   200 N N1    . DC  A 1 10 ? 30.799 85.420  16.991 1.00 22.77 ? -1  DC  B N1    1 
ATOM   201 C C2    . DC  A 1 10 ? 30.182 85.559  18.240 1.00 22.63 ? -1  DC  B C2    1 
ATOM   202 O O2    . DC  A 1 10 ? 29.145 86.217  18.381 1.00 22.04 ? -1  DC  B O2    1 
ATOM   203 N N3    . DC  A 1 10 ? 30.782 84.936  19.321 1.00 23.17 ? -1  DC  B N3    1 
ATOM   204 C C4    . DC  A 1 10 ? 31.927 84.206  19.176 1.00 19.24 ? -1  DC  B C4    1 
ATOM   205 N N4    . DC  A 1 10 ? 32.441 83.640  20.258 1.00 15.84 ? -1  DC  B N4    1 
ATOM   206 C C5    . DC  A 1 10 ? 32.566 84.047  17.878 1.00 19.62 ? -1  DC  B C5    1 
ATOM   207 C C6    . DC  A 1 10 ? 31.964 84.669  16.831 1.00 20.89 ? -1  DC  B C6    1 
ATOM   208 P P     . DG  A 1 11 ? 31.093 89.483  12.867 1.00 28.75 ? 1   DG  B P     1 
ATOM   209 O OP1   . DG  A 1 11 ? 30.494 90.192  11.700 1.00 32.35 ? 1   DG  B OP1   1 
ATOM   210 O OP2   . DG  A 1 11 ? 32.549 89.207  12.940 1.00 27.19 ? 1   DG  B OP2   1 
ATOM   211 O "O5'" . DG  A 1 11 ? 30.698 90.417  14.082 1.00 31.16 ? 1   DG  B "O5'" 1 
ATOM   212 C "C5'" . DG  A 1 11 ? 29.426 90.976  14.391 1.00 29.21 ? 1   DG  B "C5'" 1 
ATOM   213 C "C4'" . DG  A 1 11 ? 29.491 91.499  15.844 1.00 30.37 ? 1   DG  B "C4'" 1 
ATOM   214 O "O4'" . DG  A 1 11 ? 29.855 90.364  16.732 1.00 30.64 ? 1   DG  B "O4'" 1 
ATOM   215 C "C3'" . DG  A 1 11 ? 30.519 92.677  16.067 1.00 31.19 ? 1   DG  B "C3'" 1 
ATOM   216 O "O3'" . DG  A 1 11 ? 29.803 93.813  16.671 1.00 31.90 ? 1   DG  B "O3'" 1 
ATOM   217 C "C2'" . DG  A 1 11 ? 31.577 91.984  16.955 1.00 27.05 ? 1   DG  B "C2'" 1 
ATOM   218 C "C1'" . DG  A 1 11 ? 30.807 90.872  17.651 1.00 24.90 ? 1   DG  B "C1'" 1 
ATOM   219 N N9    . DG  A 1 11 ? 31.626 89.791  18.097 1.00 21.55 ? 1   DG  B N9    1 
ATOM   220 C C8    . DG  A 1 11 ? 32.591 89.132  17.445 1.00 19.42 ? 1   DG  B C8    1 
ATOM   221 N N7    . DG  A 1 11 ? 33.168 88.212  18.156 1.00 20.16 ? 1   DG  B N7    1 
ATOM   222 C C5    . DG  A 1 11 ? 32.548 88.273  19.386 1.00 19.17 ? 1   DG  B C5    1 
ATOM   223 C C6    . DG  A 1 11 ? 32.771 87.517  20.532 1.00 18.55 ? 1   DG  B C6    1 
ATOM   224 O O6    . DG  A 1 11 ? 33.561 86.602  20.703 1.00 22.22 ? 1   DG  B O6    1 
ATOM   225 N N1    . DG  A 1 11 ? 31.962 87.895  21.531 1.00 18.19 ? 1   DG  B N1    1 
ATOM   226 C C2    . DG  A 1 11 ? 31.026 88.881  21.436 1.00 19.17 ? 1   DG  B C2    1 
ATOM   227 N N2    . DG  A 1 11 ? 30.319 89.125  22.519 1.00 21.72 ? 1   DG  B N2    1 
ATOM   228 N N3    . DG  A 1 11 ? 30.783 89.609  20.362 1.00 19.54 ? 1   DG  B N3    1 
ATOM   229 C C4    . DG  A 1 11 ? 31.596 89.248  19.366 1.00 22.13 ? 1   DG  B C4    1 
ATOM   230 P P     . DT  A 1 12 ? 30.224 95.327  17.064 1.00 38.07 ? 2   DT  B P     1 
ATOM   231 O OP1   . DT  A 1 12 ? 28.952 96.084  17.066 1.00 38.06 ? 2   DT  B OP1   1 
ATOM   232 O OP2   . DT  A 1 12 ? 31.335 95.813  16.217 1.00 35.11 ? 2   DT  B OP2   1 
ATOM   233 O "O5'" . DT  A 1 12 ? 30.725 95.317  18.596 1.00 36.75 ? 2   DT  B "O5'" 1 
ATOM   234 C "C5'" . DT  A 1 12 ? 29.730 95.076  19.607 1.00 35.17 ? 2   DT  B "C5'" 1 
ATOM   235 C "C4'" . DT  A 1 12 ? 30.230 94.620  20.957 1.00 34.38 ? 2   DT  B "C4'" 1 
ATOM   236 O "O4'" . DT  A 1 12 ? 30.866 93.349  20.917 1.00 34.01 ? 2   DT  B "O4'" 1 
ATOM   237 C "C3'" . DT  A 1 12 ? 31.252 95.606  21.348 1.00 36.90 ? 2   DT  B "C3'" 1 
ATOM   238 O "O3'" . DT  A 1 12 ? 30.653 96.542  22.211 1.00 44.64 ? 2   DT  B "O3'" 1 
ATOM   239 C "C2'" . DT  A 1 12 ? 32.370 94.803  21.976 1.00 36.67 ? 2   DT  B "C2'" 1 
ATOM   240 C "C1'" . DT  A 1 12 ? 31.935 93.366  21.906 1.00 32.98 ? 2   DT  B "C1'" 1 
ATOM   241 N N1    . DT  A 1 12 ? 32.992 92.405  21.515 1.00 29.28 ? 2   DT  B N1    1 
ATOM   242 C C2    . DT  A 1 12 ? 33.396 91.478  22.446 1.00 27.33 ? 2   DT  B C2    1 
ATOM   243 O O2    . DT  A 1 12 ? 32.976 91.425  23.575 1.00 29.71 ? 2   DT  B O2    1 
ATOM   244 N N3    . DT  A 1 12 ? 34.336 90.559  22.076 1.00 27.10 ? 2   DT  B N3    1 
ATOM   245 C C4    . DT  A 1 12 ? 34.942 90.478  20.834 1.00 26.04 ? 2   DT  B C4    1 
ATOM   246 O O4    . DT  A 1 12 ? 35.784 89.592  20.639 1.00 28.37 ? 2   DT  B O4    1 
ATOM   247 C C5    . DT  A 1 12 ? 34.487 91.496  19.879 1.00 27.05 ? 2   DT  B C5    1 
ATOM   248 C C7    . DT  A 1 12 ? 35.088 91.531  18.440 1.00 20.03 ? 2   DT  B C7    1 
ATOM   249 C C6    . DT  A 1 12 ? 33.532 92.402  20.249 1.00 27.37 ? 2   DT  B C6    1 
ATOM   250 P P     . DC  A 1 13 ? 31.437 97.899  22.683 1.00 50.37 ? 3   DC  B P     1 
ATOM   251 O OP1   . DC  A 1 13 ? 30.435 98.988  22.834 1.00 52.71 ? 3   DC  B OP1   1 
ATOM   252 O OP2   . DC  A 1 13 ? 32.653 98.167  21.860 1.00 52.26 ? 3   DC  B OP2   1 
ATOM   253 O "O5'" . DC  A 1 13 ? 32.028 97.425  24.128 1.00 49.39 ? 3   DC  B "O5'" 1 
ATOM   254 C "C5'" . DC  A 1 13 ? 31.350 96.808  25.228 1.00 41.05 ? 3   DC  B "C5'" 1 
ATOM   255 C "C4'" . DC  A 1 13 ? 32.364 96.246  26.196 1.00 36.75 ? 3   DC  B "C4'" 1 
ATOM   256 O "O4'" . DC  A 1 13 ? 32.995 95.143  25.620 1.00 32.97 ? 3   DC  B "O4'" 1 
ATOM   257 C "C3'" . DC  A 1 13 ? 33.494 97.202  26.532 1.00 40.79 ? 3   DC  B "C3'" 1 
ATOM   258 O "O3'" . DC  A 1 13 ? 33.628 97.235  27.955 1.00 50.66 ? 3   DC  B "O3'" 1 
ATOM   259 C "C2'" . DC  A 1 13 ? 34.725 96.548  25.938 1.00 36.17 ? 3   DC  B "C2'" 1 
ATOM   260 C "C1'" . DC  A 1 13 ? 34.391 95.082  25.963 1.00 33.01 ? 3   DC  B "C1'" 1 
ATOM   261 N N1    . DC  A 1 13 ? 35.184 94.358  24.929 1.00 31.42 ? 3   DC  B N1    1 
ATOM   262 C C2    . DC  A 1 13 ? 35.859 93.154  25.237 1.00 34.11 ? 3   DC  B C2    1 
ATOM   263 O O2    . DC  A 1 13 ? 35.878 92.632  26.358 1.00 36.41 ? 3   DC  B O2    1 
ATOM   264 N N3    . DC  A 1 13 ? 36.567 92.529  24.223 1.00 31.93 ? 3   DC  B N3    1 
ATOM   265 C C4    . DC  A 1 13 ? 36.635 93.046  23.000 1.00 23.62 ? 3   DC  B C4    1 
ATOM   266 N N4    . DC  A 1 13 ? 37.346 92.421  22.090 1.00 22.49 ? 3   DC  B N4    1 
ATOM   267 C C5    . DC  A 1 13 ? 35.950 94.238  22.671 1.00 25.13 ? 3   DC  B C5    1 
ATOM   268 C C6    . DC  A 1 13 ? 35.256 94.862  23.652 1.00 29.29 ? 3   DC  B C6    1 
ATOM   269 P P     . DA  A 1 14 ? 34.526 98.317  28.803 1.00 53.15 ? 4   DA  B P     1 
ATOM   270 O OP1   . DA  A 1 14 ? 33.602 98.855  29.828 1.00 53.27 ? 4   DA  B OP1   1 
ATOM   271 O OP2   . DA  A 1 14 ? 35.208 99.242  27.858 1.00 53.08 ? 4   DA  B OP2   1 
ATOM   272 O "O5'" . DA  A 1 14 ? 35.678 97.477  29.513 1.00 48.98 ? 4   DA  B "O5'" 1 
ATOM   273 C "C5'" . DA  A 1 14 ? 35.392 96.316  30.263 1.00 47.78 ? 4   DA  B "C5'" 1 
ATOM   274 C "C4'" . DA  A 1 14 ? 36.675 95.529  30.406 1.00 48.68 ? 4   DA  B "C4'" 1 
ATOM   275 O "O4'" . DA  A 1 14 ? 37.048 94.916  29.185 1.00 48.62 ? 4   DA  B "O4'" 1 
ATOM   276 C "C3'" . DA  A 1 14 ? 37.846 96.453  30.768 1.00 50.36 ? 4   DA  B "C3'" 1 
ATOM   277 O "O3'" . DA  A 1 14 ? 38.116 96.132  32.133 1.00 53.85 ? 4   DA  B "O3'" 1 
ATOM   278 C "C2'" . DA  A 1 14 ? 38.939 96.159  29.758 1.00 46.97 ? 4   DA  B "C2'" 1 
ATOM   279 C "C1'" . DA  A 1 14 ? 38.487 94.920  29.014 1.00 42.77 ? 4   DA  B "C1'" 1 
ATOM   280 N N9    . DA  A 1 14 ? 38.664 95.042  27.557 1.00 32.37 ? 4   DA  B N9    1 
ATOM   281 C C8    . DA  A 1 14 ? 38.116 95.989  26.742 1.00 33.65 ? 4   DA  B C8    1 
ATOM   282 N N7    . DA  A 1 14 ? 38.419 95.836  25.478 1.00 32.95 ? 4   DA  B N7    1 
ATOM   283 C C5    . DA  A 1 14 ? 39.213 94.692  25.478 1.00 28.45 ? 4   DA  B C5    1 
ATOM   284 C C6    . DA  A 1 14 ? 39.867 94.011  24.449 1.00 27.01 ? 4   DA  B C6    1 
ATOM   285 N N6    . DA  A 1 14 ? 39.790 94.396  23.180 1.00 28.28 ? 4   DA  B N6    1 
ATOM   286 N N1    . DA  A 1 14 ? 40.574 92.931  24.788 1.00 25.73 ? 4   DA  B N1    1 
ATOM   287 C C2    . DA  A 1 14 ? 40.626 92.589  26.068 1.00 26.37 ? 4   DA  B C2    1 
ATOM   288 N N3    . DA  A 1 14 ? 40.057 93.160  27.112 1.00 23.99 ? 4   DA  B N3    1 
ATOM   289 C C4    . DA  A 1 14 ? 39.350 94.207  26.744 1.00 26.88 ? 4   DA  B C4    1 
ATOM   290 P P     . DT  A 1 15 ? 39.412 96.375  33.014 1.00 54.54 ? 5   DT  B P     1 
ATOM   291 O OP1   . DT  A 1 15 ? 38.899 96.290  34.399 1.00 58.30 ? 5   DT  B OP1   1 
ATOM   292 O OP2   . DT  A 1 15 ? 40.185 97.575  32.575 1.00 52.85 ? 5   DT  B OP2   1 
ATOM   293 O "O5'" . DT  A 1 15 ? 40.263 95.050  32.710 1.00 53.16 ? 5   DT  B "O5'" 1 
ATOM   294 C "C5'" . DT  A 1 15 ? 41.663 95.237  32.595 1.00 50.26 ? 5   DT  B "C5'" 1 
ATOM   295 C "C4'" . DT  A 1 15 ? 42.280 94.489  31.449 1.00 48.93 ? 5   DT  B "C4'" 1 
ATOM   296 O "O4'" . DT  A 1 15 ? 41.785 94.794  30.147 1.00 42.74 ? 5   DT  B "O4'" 1 
ATOM   297 C "C3'" . DT  A 1 15 ? 43.663 94.996  31.464 1.00 49.30 ? 5   DT  B "C3'" 1 
ATOM   298 O "O3'" . DT  A 1 15 ? 44.355 94.098  32.289 1.00 55.87 ? 5   DT  B "O3'" 1 
ATOM   299 C "C2'" . DT  A 1 15 ? 44.131 94.945  30.056 1.00 45.33 ? 5   DT  B "C2'" 1 
ATOM   300 C "C1'" . DT  A 1 15 ? 42.921 94.556  29.305 1.00 40.50 ? 5   DT  B "C1'" 1 
ATOM   301 N N1    . DT  A 1 15 ? 42.744 95.248  28.014 1.00 35.46 ? 5   DT  B N1    1 
ATOM   302 C C2    . DT  A 1 15 ? 43.192 94.584  26.850 1.00 34.47 ? 5   DT  B C2    1 
ATOM   303 O O2    . DT  A 1 15 ? 43.759 93.472  26.884 1.00 33.42 ? 5   DT  B O2    1 
ATOM   304 N N3    . DT  A 1 15 ? 42.957 95.270  25.652 1.00 31.80 ? 5   DT  B N3    1 
ATOM   305 C C4    . DT  A 1 15 ? 42.326 96.499  25.551 1.00 32.21 ? 5   DT  B C4    1 
ATOM   306 O O4    . DT  A 1 15 ? 42.152 97.019  24.458 1.00 33.26 ? 5   DT  B O4    1 
ATOM   307 C C5    . DT  A 1 15 ? 41.912 97.072  26.814 1.00 32.51 ? 5   DT  B C5    1 
ATOM   308 C C7    . DT  A 1 15 ? 41.200 98.399  26.831 1.00 33.08 ? 5   DT  B C7    1 
ATOM   309 C C6    . DT  A 1 15 ? 42.126 96.456  27.970 1.00 29.72 ? 5   DT  B C6    1 
ATOM   310 P P     . DC  A 1 16 ? 45.851 94.498  32.703 1.00 63.20 ? 6   DC  B P     1 
ATOM   311 O OP1   . DC  A 1 16 ? 46.170 93.753  33.974 1.00 60.92 ? 6   DC  B OP1   1 
ATOM   312 O OP2   . DC  A 1 16 ? 45.927 96.004  32.679 1.00 60.54 ? 6   DC  B OP2   1 
ATOM   313 O "O5'" . DC  A 1 16 ? 46.755 93.930  31.400 1.00 61.51 ? 6   DC  B "O5'" 1 
ATOM   314 C "C5'" . DC  A 1 16 ? 47.071 92.545  31.143 1.00 62.41 ? 6   DC  B "C5'" 1 
ATOM   315 C "C4'" . DC  A 1 16 ? 47.887 92.262  29.860 1.00 63.49 ? 6   DC  B "C4'" 1 
ATOM   316 O "O4'" . DC  A 1 16 ? 47.240 92.727  28.635 1.00 61.56 ? 6   DC  B "O4'" 1 
ATOM   317 C "C3'" . DC  A 1 16 ? 49.232 92.924  29.958 1.00 66.91 ? 6   DC  B "C3'" 1 
ATOM   318 O "O3'" . DC  A 1 16 ? 50.353 92.000  29.703 1.00 76.49 ? 6   DC  B "O3'" 1 
ATOM   319 C "C2'" . DC  A 1 16 ? 49.066 94.068  28.952 1.00 63.03 ? 6   DC  B "C2'" 1 
ATOM   320 C "C1'" . DC  A 1 16 ? 48.094 93.596  27.866 1.00 56.94 ? 6   DC  B "C1'" 1 
ATOM   321 N N1    . DC  A 1 16 ? 47.339 94.761  27.266 1.00 50.41 ? 6   DC  B N1    1 
ATOM   322 C C2    . DC  A 1 16 ? 47.125 94.837  25.873 1.00 46.88 ? 6   DC  B C2    1 
ATOM   323 O O2    . DC  A 1 16 ? 47.544 93.996  25.085 1.00 46.11 ? 6   DC  B O2    1 
ATOM   324 N N3    . DC  A 1 16 ? 46.440 95.905  25.362 1.00 43.11 ? 6   DC  B N3    1 
ATOM   325 C C4    . DC  A 1 16 ? 45.982 96.871  26.167 1.00 41.29 ? 6   DC  B C4    1 
ATOM   326 N N4    . DC  A 1 16 ? 45.327 97.887  25.640 1.00 38.57 ? 6   DC  B N4    1 
ATOM   327 C C5    . DC  A 1 16 ? 46.183 96.821  27.584 1.00 43.24 ? 6   DC  B C5    1 
ATOM   328 C C6    . DC  A 1 16 ? 46.863 95.762  28.081 1.00 46.68 ? 6   DC  B C6    1 
ATOM   329 P P     . DT  A 1 17 ? 51.972 92.557  29.501 1.00 83.48 ? 7   DT  B P     1 
ATOM   330 O OP1   . DT  A 1 17 ? 52.956 91.440  29.716 1.00 81.80 ? 7   DT  B OP1   1 
ATOM   331 O OP2   . DT  A 1 17 ? 52.163 93.914  30.152 1.00 81.39 ? 7   DT  B OP2   1 
ATOM   332 O "O5'" . DT  A 1 17 ? 51.918 92.800  27.943 1.00 80.19 ? 7   DT  B "O5'" 1 
ATOM   333 C "C5'" . DT  A 1 17 ? 51.564 91.744  27.026 1.00 76.72 ? 7   DT  B "C5'" 1 
ATOM   334 C "C4'" . DT  A 1 17 ? 51.842 92.283  25.672 1.00 72.71 ? 7   DT  B "C4'" 1 
ATOM   335 O "O4'" . DT  A 1 17 ? 51.050 93.464  25.446 1.00 68.29 ? 7   DT  B "O4'" 1 
ATOM   336 C "C3'" . DT  A 1 17 ? 53.278 92.768  25.786 1.00 74.09 ? 7   DT  B "C3'" 1 
ATOM   337 O "O3'" . DT  A 1 17 ? 53.915 92.065  24.729 1.00 80.55 ? 7   DT  B "O3'" 1 
ATOM   338 C "C2'" . DT  A 1 17 ? 53.170 94.326  25.806 1.00 67.92 ? 7   DT  B "C2'" 1 
ATOM   339 C "C1'" . DT  A 1 17 ? 51.887 94.568  25.043 1.00 60.72 ? 7   DT  B "C1'" 1 
ATOM   340 N N1    . DT  A 1 17 ? 51.078 95.773  25.275 1.00 50.97 ? 7   DT  B N1    1 
ATOM   341 C C2    . DT  A 1 17 ? 50.520 96.399  24.174 1.00 47.37 ? 7   DT  B C2    1 
ATOM   342 O O2    . DT  A 1 17 ? 50.682 96.067  23.012 1.00 47.82 ? 7   DT  B O2    1 
ATOM   343 N N3    . DT  A 1 17 ? 49.735 97.480  24.400 1.00 44.00 ? 7   DT  B N3    1 
ATOM   344 C C4    . DT  A 1 17 ? 49.430 98.027  25.596 1.00 44.90 ? 7   DT  B C4    1 
ATOM   345 O O4    . DT  A 1 17 ? 48.705 99.012  25.643 1.00 44.57 ? 7   DT  B O4    1 
ATOM   346 C C5    . DT  A 1 17 ? 50.026 97.334  26.707 1.00 47.27 ? 7   DT  B C5    1 
ATOM   347 C C7    . DT  A 1 17 ? 49.764 97.849  28.115 1.00 47.02 ? 7   DT  B C7    1 
ATOM   348 C C6    . DT  A 1 17 ? 50.809 96.235  26.520 1.00 49.30 ? 7   DT  B C6    1 
ATOM   349 P P     . DC  A 1 18 ? 55.534 92.114  24.522 1.00 87.23 ? 8   DC  B P     1 
ATOM   350 O OP1   . DC  A 1 18 ? 56.059 90.713  24.722 1.00 84.79 ? 8   DC  B OP1   1 
ATOM   351 O OP2   . DC  A 1 18 ? 56.121 93.276  25.288 1.00 84.97 ? 8   DC  B OP2   1 
ATOM   352 O "O5'" . DC  A 1 18 ? 55.468 92.509  22.896 1.00 84.40 ? 8   DC  B "O5'" 1 
ATOM   353 C "C5'" . DC  A 1 18 ? 54.595 93.597  22.498 1.00 79.72 ? 8   DC  B "C5'" 1 
ATOM   354 C "C4'" . DC  A 1 18 ? 55.258 94.733  21.715 1.00 76.89 ? 8   DC  B "C4'" 1 
ATOM   355 O "O4'" . DC  A 1 18 ? 54.370 95.887  21.793 1.00 72.95 ? 8   DC  B "O4'" 1 
ATOM   356 C "C3'" . DC  A 1 18 ? 56.657 95.183  22.195 1.00 76.38 ? 8   DC  B "C3'" 1 
ATOM   357 O "O3'" . DC  A 1 18 ? 57.426 95.569  21.015 1.00 78.97 ? 8   DC  B "O3'" 1 
ATOM   358 C "C2'" . DC  A 1 18 ? 56.256 96.380  23.014 1.00 72.53 ? 8   DC  B "C2'" 1 
ATOM   359 C "C1'" . DC  A 1 18 ? 55.058 97.020  22.299 1.00 67.02 ? 8   DC  B "C1'" 1 
ATOM   360 N N1    . DC  A 1 18 ? 54.248 97.799  23.257 1.00 61.49 ? 8   DC  B N1    1 
ATOM   361 C C2    . DC  A 1 18 ? 53.426 98.853  22.832 1.00 58.43 ? 8   DC  B C2    1 
ATOM   362 O O2    . DC  A 1 18 ? 53.308 99.190  21.663 1.00 54.68 ? 8   DC  B O2    1 
ATOM   363 N N3    . DC  A 1 18 ? 52.721 99.559  23.770 1.00 56.59 ? 8   DC  B N3    1 
ATOM   364 C C4    . DC  A 1 18 ? 52.807 99.247  25.082 1.00 57.43 ? 8   DC  B C4    1 
ATOM   365 N N4    . DC  A 1 18 ? 52.121 99.920  26.004 1.00 55.22 ? 8   DC  B N4    1 
ATOM   366 C C5    . DC  A 1 18 ? 53.639 98.171  25.530 1.00 59.02 ? 8   DC  B C5    1 
ATOM   367 C C6    . DC  A 1 18 ? 54.320 97.484  24.587 1.00 60.69 ? 8   DC  B C6    1 
ATOM   368 P P     . DC  A 1 19 ? 58.858 96.421  20.898 1.00 80.32 ? 9   DC  B P     1 
ATOM   369 O OP1   . DC  A 1 19 ? 59.996 95.473  21.146 1.00 79.72 ? 9   DC  B OP1   1 
ATOM   370 O OP2   . DC  A 1 19 ? 58.770 97.671  21.716 1.00 76.16 ? 9   DC  B OP2   1 
ATOM   371 O "O5'" . DC  A 1 19 ? 58.810 96.773  19.254 1.00 77.46 ? 9   DC  B "O5'" 1 
ATOM   372 C "C5'" . DC  A 1 19 ? 59.352 97.982  18.686 1.00 74.74 ? 9   DC  B "C5'" 1 
ATOM   373 C "C4'" . DC  A 1 19 ? 58.315 99.099  18.463 1.00 73.26 ? 9   DC  B "C4'" 1 
ATOM   374 O "O4'" . DC  A 1 19 ? 57.240 99.043  19.416 1.00 72.11 ? 9   DC  B "O4'" 1 
ATOM   375 C "C3'" . DC  A 1 19 ? 58.982 100.475 18.690 1.00 73.77 ? 9   DC  B "C3'" 1 
ATOM   376 O "O3'" . DC  A 1 19 ? 59.648 100.985 17.525 1.00 75.33 ? 9   DC  B "O3'" 1 
ATOM   377 C "C2'" . DC  A 1 19 ? 57.840 101.354 19.131 1.00 72.62 ? 9   DC  B "C2'" 1 
ATOM   378 C "C1'" . DC  A 1 19 ? 56.777 100.389 19.662 1.00 71.37 ? 9   DC  B "C1'" 1 
ATOM   379 N N1    . DC  A 1 19 ? 56.488 100.617 21.114 1.00 70.64 ? 9   DC  B N1    1 
ATOM   380 C C2    . DC  A 1 19 ? 55.539 101.592 21.468 1.00 67.74 ? 9   DC  B C2    1 
ATOM   381 O O2    . DC  A 1 19 ? 54.956 102.255 20.623 1.00 64.30 ? 9   DC  B O2    1 
ATOM   382 N N3    . DC  A 1 19 ? 55.261 101.806 22.781 1.00 64.61 ? 9   DC  B N3    1 
ATOM   383 C C4    . DC  A 1 19 ? 55.907 101.086 23.717 1.00 67.72 ? 9   DC  B C4    1 
ATOM   384 N N4    . DC  A 1 19 ? 55.631 101.303 24.997 1.00 69.09 ? 9   DC  B N4    1 
ATOM   385 C C5    . DC  A 1 19 ? 56.883 100.077 23.393 1.00 67.79 ? 9   DC  B C5    1 
ATOM   386 C C6    . DC  A 1 19 ? 57.137 99.884  22.084 1.00 69.53 ? 9   DC  B C6    1 
ATOM   387 N N     . ALA B 2 11 ? 31.102 102.332 14.706 1.00 61.77 ? 229 ALA A N     1 
ATOM   388 C CA    . ALA B 2 11 ? 32.361 103.092 14.947 1.00 61.06 ? 229 ALA A CA    1 
ATOM   389 C C     . ALA B 2 11 ? 33.518 102.392 14.237 1.00 59.88 ? 229 ALA A C     1 
ATOM   390 O O     . ALA B 2 11 ? 33.406 101.224 13.867 1.00 59.19 ? 229 ALA A O     1 
ATOM   391 C CB    . ALA B 2 11 ? 32.642 103.207 16.451 1.00 58.74 ? 229 ALA A CB    1 
ATOM   392 N N     . LEU B 2 12 ? 34.628 103.112 14.085 1.00 58.68 ? 230 LEU A N     1 
ATOM   393 C CA    . LEU B 2 12 ? 35.824 102.612 13.415 1.00 56.53 ? 230 LEU A CA    1 
ATOM   394 C C     . LEU B 2 12 ? 36.711 101.675 14.232 1.00 53.67 ? 230 LEU A C     1 
ATOM   395 O O     . LEU B 2 12 ? 37.188 100.665 13.706 1.00 55.13 ? 230 LEU A O     1 
ATOM   396 C CB    . LEU B 2 12 ? 36.642 103.789 12.880 1.00 59.17 ? 230 LEU A CB    1 
ATOM   397 C CG    . LEU B 2 12 ? 36.280 104.302 11.480 1.00 60.56 ? 230 LEU A CG    1 
ATOM   398 C CD1   . LEU B 2 12 ? 34.776 104.318 11.257 1.00 56.68 ? 230 LEU A CD1   1 
ATOM   399 C CD2   . LEU B 2 12 ? 36.889 105.686 11.281 1.00 63.15 ? 230 LEU A CD2   1 
ATOM   400 N N     . LYS B 2 13 ? 36.968 102.014 15.494 1.00 50.96 ? 231 LYS A N     1 
ATOM   401 C CA    . LYS B 2 13 ? 37.791 101.154 16.349 1.00 45.92 ? 231 LYS A CA    1 
ATOM   402 C C     . LYS B 2 13 ? 37.091 99.810  16.534 1.00 38.45 ? 231 LYS A C     1 
ATOM   403 O O     . LYS B 2 13 ? 37.735 98.783  16.650 1.00 37.77 ? 231 LYS A O     1 
ATOM   404 C CB    . LYS B 2 13 ? 38.050 101.801 17.715 1.00 47.59 ? 231 LYS A CB    1 
ATOM   405 C CG    . LYS B 2 13 ? 36.790 102.155 18.488 0.50 49.61 ? 231 LYS A CG    1 
ATOM   406 C CD    . LYS B 2 13 ? 37.060 102.282 19.979 0.50 48.66 ? 231 LYS A CD    1 
ATOM   407 C CE    . LYS B 2 13 ? 35.791 102.657 20.734 0.50 48.60 ? 231 LYS A CE    1 
ATOM   408 N NZ    . LYS B 2 13 ? 34.658 101.721 20.470 0.50 43.12 ? 231 LYS A NZ    1 
ATOM   409 N N     . ARG B 2 14 ? 35.766 99.822  16.548 1.00 35.56 ? 232 ARG A N     1 
ATOM   410 C CA    . ARG B 2 14 ? 35.017 98.588  16.693 1.00 39.96 ? 232 ARG A CA    1 
ATOM   411 C C     . ARG B 2 14 ? 35.206 97.711  15.450 1.00 41.71 ? 232 ARG A C     1 
ATOM   412 O O     . ARG B 2 14 ? 35.486 96.511  15.558 1.00 43.88 ? 232 ARG A O     1 
ATOM   413 C CB    . ARG B 2 14 ? 33.535 98.884  16.932 1.00 42.42 ? 232 ARG A CB    1 
ATOM   414 C CG    . ARG B 2 14 ? 33.272 99.676  18.205 1.00 47.65 ? 232 ARG A CG    1 
ATOM   415 C CD    . ARG B 2 14 ? 31.834 99.560  18.668 1.00 53.76 ? 232 ARG A CD    1 
ATOM   416 N NE    . ARG B 2 14 ? 30.891 99.911  17.611 1.00 65.47 ? 232 ARG A NE    1 
ATOM   417 C CZ    . ARG B 2 14 ? 29.714 99.313  17.431 1.00 72.34 ? 232 ARG A CZ    1 
ATOM   418 N NH1   . ARG B 2 14 ? 29.334 98.331  18.244 1.00 73.64 ? 232 ARG A NH1   1 
ATOM   419 N NH2   . ARG B 2 14 ? 28.918 99.688  16.431 1.00 72.78 ? 232 ARG A NH2   1 
ATOM   420 N N     . ALA B 2 15 ? 35.107 98.329  14.274 1.00 40.97 ? 233 ALA A N     1 
ATOM   421 C CA    . ALA B 2 15 ? 35.265 97.630  13.005 1.00 34.50 ? 233 ALA A CA    1 
ATOM   422 C C     . ALA B 2 15 ? 36.605 96.929  12.935 1.00 31.37 ? 233 ALA A C     1 
ATOM   423 O O     . ALA B 2 15 ? 36.679 95.768  12.536 1.00 32.87 ? 233 ALA A O     1 
ATOM   424 C CB    . ALA B 2 15 ? 35.124 98.599  11.850 1.00 36.69 ? 233 ALA A CB    1 
ATOM   425 N N     . ARG B 2 16 ? 37.662 97.636  13.318 1.00 28.78 ? 234 ARG A N     1 
ATOM   426 C CA    . ARG B 2 16 ? 39.005 97.063  13.309 1.00 32.08 ? 234 ARG A CA    1 
ATOM   427 C C     . ARG B 2 16 ? 39.137 95.906  14.301 1.00 32.05 ? 234 ARG A C     1 
ATOM   428 O O     . ARG B 2 16 ? 39.730 94.867  13.974 1.00 34.03 ? 234 ARG A O     1 
ATOM   429 C CB    . ARG B 2 16 ? 40.064 98.126  13.625 1.00 33.37 ? 234 ARG A CB    1 
ATOM   430 C CG    . ARG B 2 16 ? 40.145 99.252  12.610 1.00 45.36 ? 234 ARG A CG    1 
ATOM   431 C CD    . ARG B 2 16 ? 41.480 99.993  12.675 1.00 48.37 ? 234 ARG A CD    1 
ATOM   432 N NE    . ARG B 2 16 ? 42.624 99.115  12.420 1.00 50.34 ? 234 ARG A NE    1 
ATOM   433 C CZ    . ARG B 2 16 ? 43.013 98.709  11.216 1.00 54.49 ? 234 ARG A CZ    1 
ATOM   434 N NH1   . ARG B 2 16 ? 42.355 99.094  10.133 1.00 57.96 ? 234 ARG A NH1   1 
ATOM   435 N NH2   . ARG B 2 16 ? 44.066 97.908  11.095 1.00 56.58 ? 234 ARG A NH2   1 
ATOM   436 N N     . ASN B 2 17 ? 38.562 96.072  15.496 1.00 30.84 ? 235 ASN A N     1 
ATOM   437 C CA    . ASN B 2 17 ? 38.630 95.043  16.532 1.00 29.17 ? 235 ASN A CA    1 
ATOM   438 C C     . ASN B 2 17 ? 37.872 93.802  16.113 1.00 24.29 ? 235 ASN A C     1 
ATOM   439 O O     . ASN B 2 17 ? 38.297 92.687  16.404 1.00 29.82 ? 235 ASN A O     1 
ATOM   440 C CB    . ASN B 2 17 ? 38.121 95.559  17.885 1.00 28.69 ? 235 ASN A CB    1 
ATOM   441 C CG    . ASN B 2 17 ? 38.282 94.531  19.003 1.00 26.68 ? 235 ASN A CG    1 
ATOM   442 O OD1   . ASN B 2 17 ? 37.295 94.037  19.559 1.00 28.43 ? 235 ASN A OD1   1 
ATOM   443 N ND2   . ASN B 2 17 ? 39.523 94.198  19.329 1.00 22.08 ? 235 ASN A ND2   1 
ATOM   444 N N     . THR B 2 18 ? 36.775 93.982  15.389 1.00 24.56 ? 236 THR A N     1 
ATOM   445 C CA    . THR B 2 18 ? 35.989 92.846  14.908 1.00 25.51 ? 236 THR A CA    1 
ATOM   446 C C     . THR B 2 18 ? 36.812 91.956  13.956 1.00 25.72 ? 236 THR A C     1 
ATOM   447 O O     . THR B 2 18 ? 36.664 90.729  13.945 1.00 24.25 ? 236 THR A O     1 
ATOM   448 C CB    . THR B 2 18 ? 34.696 93.326  14.251 1.00 21.98 ? 236 THR A CB    1 
ATOM   449 O OG1   . THR B 2 18 ? 33.946 94.054  15.219 1.00 29.98 ? 236 THR A OG1   1 
ATOM   450 C CG2   . THR B 2 18 ? 33.848 92.166  13.771 1.00 27.12 ? 236 THR A CG2   1 
ATOM   451 N N     . GLU B 2 19 ? 37.724 92.577  13.211 1.00 27.78 ? 237 GLU A N     1 
ATOM   452 C CA    . GLU B 2 19 ? 38.577 91.836  12.291 1.00 25.16 ? 237 GLU A CA    1 
ATOM   453 C C     . GLU B 2 19 ? 39.767 91.272  13.028 1.00 20.89 ? 237 GLU A C     1 
ATOM   454 O O     . GLU B 2 19 ? 40.217 90.171  12.723 1.00 23.91 ? 237 GLU A O     1 
ATOM   455 C CB    . GLU B 2 19 ? 39.038 92.714  11.122 1.00 27.59 ? 237 GLU A CB    1 
ATOM   456 C CG    . GLU B 2 19 ? 37.952 92.991  10.101 1.00 24.60 ? 237 GLU A CG    1 
ATOM   457 C CD    . GLU B 2 19 ? 37.186 91.741  9.718  1.00 25.05 ? 237 GLU A CD    1 
ATOM   458 O OE1   . GLU B 2 19 ? 37.803 90.773  9.240  1.00 29.46 ? 237 GLU A OE1   1 
ATOM   459 O OE2   . GLU B 2 19 ? 35.962 91.712  9.924  1.00 29.88 ? 237 GLU A OE2   1 
ATOM   460 N N     . ALA B 2 20 ? 40.277 92.018  14.003 1.00 21.91 ? 238 ALA A N     1 
ATOM   461 C CA    . ALA B 2 20 ? 41.416 91.539  14.786 1.00 24.70 ? 238 ALA A CA    1 
ATOM   462 C C     . ALA B 2 20 ? 41.002 90.271  15.537 1.00 24.10 ? 238 ALA A C     1 
ATOM   463 O O     . ALA B 2 20 ? 41.812 89.354  15.704 1.00 26.21 ? 238 ALA A O     1 
ATOM   464 C CB    . ALA B 2 20 ? 41.899 92.609  15.754 1.00 22.64 ? 238 ALA A CB    1 
ATOM   465 N N     . ALA B 2 21 ? 39.741 90.229  15.978 1.00 20.94 ? 239 ALA A N     1 
ATOM   466 C CA    . ALA B 2 21 ? 39.190 89.066  16.679 1.00 20.86 ? 239 ALA A CA    1 
ATOM   467 C C     . ALA B 2 21 ? 39.071 87.898  15.705 1.00 17.91 ? 239 ALA A C     1 
ATOM   468 O O     . ALA B 2 21 ? 39.429 86.777  16.038 1.00 23.27 ? 239 ALA A O     1 
ATOM   469 C CB    . ALA B 2 21 ? 37.832 89.387  17.283 1.00 16.11 ? 239 ALA A CB    1 
ATOM   470 N N     . ARG B 2 22 ? 38.618 88.172  14.484 1.00 22.62 ? 240 ARG A N     1 
ATOM   471 C CA    . ARG B 2 22 ? 38.473 87.139  13.447 1.00 21.48 ? 240 ARG A CA    1 
ATOM   472 C C     . ARG B 2 22 ? 39.830 86.467  13.145 1.00 19.54 ? 240 ARG A C     1 
ATOM   473 O O     . ARG B 2 22 ? 39.938 85.234  13.100 1.00 21.32 ? 240 ARG A O     1 
ATOM   474 C CB    . ARG B 2 22 ? 37.889 87.762  12.172 1.00 22.15 ? 240 ARG A CB    1 
ATOM   475 C CG    . ARG B 2 22 ? 37.144 86.787  11.280 1.00 25.38 ? 240 ARG A CG    1 
ATOM   476 C CD    . ARG B 2 22 ? 36.789 87.382  9.898  1.00 24.63 ? 240 ARG A CD    1 
ATOM   477 N NE    . ARG B 2 22 ? 35.966 88.581  9.986  1.00 27.69 ? 240 ARG A NE    1 
ATOM   478 C CZ    . ARG B 2 22 ? 34.719 88.606  10.445 1.00 29.10 ? 240 ARG A CZ    1 
ATOM   479 N NH1   . ARG B 2 22 ? 34.131 87.489  10.851 1.00 29.02 ? 240 ARG A NH1   1 
ATOM   480 N NH2   . ARG B 2 22 ? 34.074 89.759  10.546 1.00 27.44 ? 240 ARG A NH2   1 
ATOM   481 N N     . ARG B 2 23 ? 40.867 87.282  12.966 1.00 22.10 ? 241 ARG A N     1 
ATOM   482 C CA    . ARG B 2 23 ? 42.213 86.776  12.693 1.00 22.19 ? 241 ARG A CA    1 
ATOM   483 C C     . ARG B 2 23 ? 42.765 85.982  13.871 1.00 24.03 ? 241 ARG A C     1 
ATOM   484 O O     . ARG B 2 23 ? 43.412 84.951  13.675 1.00 25.44 ? 241 ARG A O     1 
ATOM   485 C CB    . ARG B 2 23 ? 43.161 87.929  12.367 1.00 20.10 ? 241 ARG A CB    1 
ATOM   486 C CG    . ARG B 2 23 ? 42.712 88.747  11.178 1.00 26.46 ? 241 ARG A CG    1 
ATOM   487 C CD    . ARG B 2 23 ? 43.814 89.654  10.672 1.00 30.41 ? 241 ARG A CD    1 
ATOM   488 N NE    . ARG B 2 23 ? 44.136 90.731  11.606 1.00 33.12 ? 241 ARG A NE    1 
ATOM   489 C CZ    . ARG B 2 23 ? 43.615 91.954  11.544 1.00 32.79 ? 241 ARG A CZ    1 
ATOM   490 N NH1   . ARG B 2 23 ? 42.731 92.266  10.596 1.00 27.64 ? 241 ARG A NH1   1 
ATOM   491 N NH2   . ARG B 2 23 ? 44.012 92.883  12.403 1.00 32.60 ? 241 ARG A NH2   1 
ATOM   492 N N     . SER B 2 24 ? 42.507 86.471  15.088 1.00 27.23 ? 242 SER A N     1 
ATOM   493 C CA    . SER B 2 24 ? 42.958 85.825  16.325 1.00 24.50 ? 242 SER A CA    1 
ATOM   494 C C     . SER B 2 24 ? 42.319 84.443  16.498 1.00 25.77 ? 242 SER A C     1 
ATOM   495 O O     . SER B 2 24 ? 43.016 83.474  16.832 1.00 30.22 ? 242 SER A O     1 
ATOM   496 C CB    . SER B 2 24 ? 42.647 86.714  17.535 1.00 29.54 ? 242 SER A CB    1 
ATOM   497 O OG    . SER B 2 24 ? 43.349 86.296  18.693 1.00 27.15 ? 242 SER A OG    1 
ATOM   498 N N     . ARG B 2 25 ? 41.008 84.340  16.265 1.00 21.30 ? 243 ARG A N     1 
ATOM   499 C CA    . ARG B 2 25 ? 40.314 83.055  16.375 1.00 21.49 ? 243 ARG A CA    1 
ATOM   500 C C     . ARG B 2 25 ? 40.889 82.050  15.383 1.00 23.33 ? 243 ARG A C     1 
ATOM   501 O O     . ARG B 2 25 ? 41.065 80.867  15.688 1.00 21.40 ? 243 ARG A O     1 
ATOM   502 C CB    A ARG B 2 25 ? 38.832 83.199  16.047 0.50 24.39 ? 243 ARG A CB    1 
ATOM   503 C CB    B ARG B 2 25 ? 38.814 83.231  16.151 0.50 21.46 ? 243 ARG A CB    1 
ATOM   504 C CG    A ARG B 2 25 ? 38.024 84.126  16.917 0.50 27.08 ? 243 ARG A CG    1 
ATOM   505 C CG    B ARG B 2 25 ? 38.114 84.006  17.258 0.50 17.97 ? 243 ARG A CG    1 
ATOM   506 C CD    A ARG B 2 25 ? 36.575 84.048  16.465 0.50 29.72 ? 243 ARG A CD    1 
ATOM   507 C CD    B ARG B 2 25 ? 36.597 83.890  17.148 0.50 20.57 ? 243 ARG A CD    1 
ATOM   508 N NE    A ARG B 2 25 ? 35.806 85.231  16.827 0.50 34.37 ? 243 ARG A NE    1 
ATOM   509 N NE    B ARG B 2 25 ? 36.044 84.538  15.960 0.50 19.21 ? 243 ARG A NE    1 
ATOM   510 C CZ    A ARG B 2 25 ? 35.264 86.073  15.952 0.50 38.16 ? 243 ARG A CZ    1 
ATOM   511 C CZ    B ARG B 2 25 ? 35.548 85.773  15.938 0.50 22.85 ? 243 ARG A CZ    1 
ATOM   512 N NH1   A ARG B 2 25 ? 35.396 85.882  14.644 0.50 36.69 ? 243 ARG A NH1   1 
ATOM   513 N NH1   B ARG B 2 25 ? 35.539 86.508  17.044 0.50 17.31 ? 243 ARG A NH1   1 
ATOM   514 N NH2   A ARG B 2 25 ? 34.587 87.117  16.391 0.50 37.75 ? 243 ARG A NH2   1 
ATOM   515 N NH2   B ARG B 2 25 ? 35.035 86.264  14.812 0.50 17.70 ? 243 ARG A NH2   1 
ATOM   516 N N     . ALA B 2 26 ? 41.141 82.527  14.173 1.00 28.41 ? 244 ALA A N     1 
ATOM   517 C CA    . ALA B 2 26 ? 41.693 81.697  13.117 1.00 28.14 ? 244 ALA A CA    1 
ATOM   518 C C     . ALA B 2 26 ? 43.045 81.106  13.522 1.00 30.36 ? 244 ALA A C     1 
ATOM   519 O O     . ALA B 2 26 ? 43.330 79.940  13.231 1.00 32.38 ? 244 ALA A O     1 
ATOM   520 C CB    . ALA B 2 26 ? 41.821 82.508  11.835 1.00 26.54 ? 244 ALA A CB    1 
ATOM   521 N N     . ARG B 2 27 ? 43.883 81.912  14.170 1.00 30.83 ? 245 ARG A N     1 
ATOM   522 C CA    . ARG B 2 27 ? 45.189 81.440  14.620 1.00 29.36 ? 245 ARG A CA    1 
ATOM   523 C C     . ARG B 2 27 ? 45.030 80.372  15.700 1.00 29.79 ? 245 ARG A C     1 
ATOM   524 O O     . ARG B 2 27 ? 45.744 79.371  15.696 1.00 29.58 ? 245 ARG A O     1 
ATOM   525 C CB    . ARG B 2 27 ? 46.032 82.593  15.153 1.00 30.82 ? 245 ARG A CB    1 
ATOM   526 C CG    . ARG B 2 27 ? 46.380 83.641  14.121 1.00 32.79 ? 245 ARG A CG    1 
ATOM   527 C CD    . ARG B 2 27 ? 47.240 84.742  14.720 1.00 33.45 ? 245 ARG A CD    1 
ATOM   528 N NE    . ARG B 2 27 ? 47.091 85.978  13.962 1.00 40.06 ? 245 ARG A NE    1 
ATOM   529 C CZ    . ARG B 2 27 ? 46.634 87.119  14.471 1.00 44.74 ? 245 ARG A CZ    1 
ATOM   530 N NH1   . ARG B 2 27 ? 46.289 87.195  15.750 1.00 37.62 ? 245 ARG A NH1   1 
ATOM   531 N NH2   . ARG B 2 27 ? 46.475 88.177  13.686 1.00 53.16 ? 245 ARG A NH2   1 
ATOM   532 N N     . LYS B 2 28 ? 44.082 80.574  16.612 1.00 32.38 ? 246 LYS A N     1 
ATOM   533 C CA    . LYS B 2 28 ? 43.830 79.614  17.684 1.00 33.08 ? 246 LYS A CA    1 
ATOM   534 C C     . LYS B 2 28 ? 43.311 78.273  17.151 1.00 32.93 ? 246 LYS A C     1 
ATOM   535 O O     . LYS B 2 28 ? 43.555 77.227  17.759 1.00 32.93 ? 246 LYS A O     1 
ATOM   536 C CB    . LYS B 2 28 ? 42.842 80.177  18.717 1.00 33.25 ? 246 LYS A CB    1 
ATOM   537 C CG    . LYS B 2 28 ? 43.359 81.375  19.489 1.00 44.64 ? 246 LYS A CG    1 
ATOM   538 C CD    . LYS B 2 28 ? 42.406 81.784  20.612 1.00 53.26 ? 246 LYS A CD    1 
ATOM   539 C CE    . LYS B 2 28 ? 41.292 82.734  20.146 1.00 58.39 ? 246 LYS A CE    1 
ATOM   540 N NZ    . LYS B 2 28 ? 41.772 84.143  19.966 1.00 57.74 ? 246 LYS A NZ    1 
ATOM   541 N N     . LEU B 2 29 ? 42.579 78.301  16.040 1.00 28.91 ? 247 LEU A N     1 
ATOM   542 C CA    . LEU B 2 29 ? 42.052 77.073  15.449 1.00 29.11 ? 247 LEU A CA    1 
ATOM   543 C C     . LEU B 2 29 ? 43.161 76.259  14.777 1.00 31.82 ? 247 LEU A C     1 
ATOM   544 O O     . LEU B 2 29 ? 43.165 75.027  14.840 1.00 34.13 ? 247 LEU A O     1 
ATOM   545 C CB    . LEU B 2 29 ? 40.963 77.392  14.430 1.00 33.43 ? 247 LEU A CB    1 
ATOM   546 C CG    . LEU B 2 29 ? 39.801 76.405  14.308 1.00 33.28 ? 247 LEU A CG    1 
ATOM   547 C CD1   . LEU B 2 29 ? 38.913 76.851  13.172 1.00 41.52 ? 247 LEU A CD1   1 
ATOM   548 C CD2   . LEU B 2 29 ? 40.285 74.996  14.065 1.00 32.76 ? 247 LEU A CD2   1 
ATOM   549 N N     . GLN B 2 30 ? 44.101 76.944  14.134 1.00 32.96 ? 248 GLN A N     1 
ATOM   550 C CA    . GLN B 2 30 ? 45.206 76.267  13.476 1.00 36.66 ? 248 GLN A CA    1 
ATOM   551 C C     . GLN B 2 30 ? 46.211 75.741  14.505 1.00 35.00 ? 248 GLN A C     1 
ATOM   552 O O     . GLN B 2 30 ? 46.793 74.667  14.324 1.00 34.38 ? 248 GLN A O     1 
ATOM   553 C CB    . GLN B 2 30 ? 45.899 77.188  12.468 1.00 47.93 ? 248 GLN A CB    1 
ATOM   554 C CG    . GLN B 2 30 ? 46.685 78.329  13.094 1.00 61.64 ? 248 GLN A CG    1 
ATOM   555 C CD    . GLN B 2 30 ? 47.589 79.047  12.105 1.00 67.40 ? 248 GLN A CD    1 
ATOM   556 O OE1   . GLN B 2 30 ? 48.753 79.326  12.408 1.00 71.39 ? 248 GLN A OE1   1 
ATOM   557 N NE2   . GLN B 2 30 ? 47.058 79.362  10.924 1.00 64.32 ? 248 GLN A NE2   1 
ATOM   558 N N     . ARG B 2 31 ? 46.429 76.506  15.572 1.00 31.49 ? 249 ARG A N     1 
ATOM   559 C CA    . ARG B 2 31 ? 47.347 76.089  16.631 1.00 31.89 ? 249 ARG A CA    1 
ATOM   560 C C     . ARG B 2 31 ? 46.862 74.785  17.259 1.00 27.88 ? 249 ARG A C     1 
ATOM   561 O O     . ARG B 2 31 ? 47.653 73.875  17.479 1.00 28.65 ? 249 ARG A O     1 
ATOM   562 C CB    . ARG B 2 31 ? 47.482 77.180  17.699 1.00 34.39 ? 249 ARG A CB    1 
ATOM   563 C CG    . ARG B 2 31 ? 48.275 78.403  17.242 1.00 46.52 ? 249 ARG A CG    1 
ATOM   564 C CD    . ARG B 2 31 ? 48.392 79.462  18.349 1.00 56.14 ? 249 ARG A CD    1 
ATOM   565 N NE    . ARG B 2 31 ? 47.542 80.633  18.116 1.00 59.60 ? 249 ARG A NE    1 
ATOM   566 C CZ    . ARG B 2 31 ? 46.973 81.361  19.076 1.00 58.69 ? 249 ARG A CZ    1 
ATOM   567 N NH1   . ARG B 2 31 ? 47.144 81.050  20.353 1.00 58.53 ? 249 ARG A NH1   1 
ATOM   568 N NH2   . ARG B 2 31 ? 46.239 82.419  18.755 1.00 63.15 ? 249 ARG A NH2   1 
ATOM   569 N N     . MET B 2 32 ? 45.557 74.690  17.500 1.00 24.94 ? 250 MET A N     1 
ATOM   570 C CA    . MET B 2 32 ? 44.950 73.503  18.077 1.00 24.54 ? 250 MET A CA    1 
ATOM   571 C C     . MET B 2 32 ? 45.197 72.290  17.183 1.00 31.22 ? 250 MET A C     1 
ATOM   572 O O     . MET B 2 32 ? 45.632 71.236  17.661 1.00 30.50 ? 250 MET A O     1 
ATOM   573 C CB    A MET B 2 32 ? 43.446 73.700  18.261 0.50 26.40 ? 250 MET A CB    1 
ATOM   574 C CB    B MET B 2 32 ? 43.452 73.728  18.219 0.50 29.12 ? 250 MET A CB    1 
ATOM   575 C CG    A MET B 2 32 ? 42.760 72.581  19.021 0.50 27.79 ? 250 MET A CG    1 
ATOM   576 C CG    B MET B 2 32 ? 42.718 72.570  18.833 0.50 33.16 ? 250 MET A CG    1 
ATOM   577 S SD    A MET B 2 32 ? 43.327 72.407  20.730 0.50 35.90 ? 250 MET A SD    1 
ATOM   578 S SD    B MET B 2 32 ? 40.998 72.558  18.315 0.50 47.85 ? 250 MET A SD    1 
ATOM   579 C CE    A MET B 2 32 ? 42.272 71.112  21.307 0.50 31.87 ? 250 MET A CE    1 
ATOM   580 C CE    B MET B 2 32 ? 40.482 74.207  18.795 0.50 38.70 ? 250 MET A CE    1 
ATOM   581 N N     . LYS B 2 33 ? 44.909 72.436  15.887 1.00 33.62 ? 251 LYS A N     1 
ATOM   582 C CA    . LYS B 2 33 ? 45.100 71.353  14.909 1.00 33.31 ? 251 LYS A CA    1 
ATOM   583 C C     . LYS B 2 33 ? 46.556 70.926  14.798 1.00 27.11 ? 251 LYS A C     1 
ATOM   584 O O     . LYS B 2 33 ? 46.861 69.737  14.766 1.00 25.20 ? 251 LYS A O     1 
ATOM   585 C CB    . LYS B 2 33 ? 44.537 71.761  13.539 1.00 43.00 ? 251 LYS A CB    1 
ATOM   586 C CG    . LYS B 2 33 ? 43.010 71.824  13.513 1.00 49.89 ? 251 LYS A CG    1 
ATOM   587 C CD    . LYS B 2 33 ? 42.457 72.083  12.122 1.00 57.43 ? 251 LYS A CD    1 
ATOM   588 C CE    . LYS B 2 33 ? 42.803 73.482  11.638 1.00 65.63 ? 251 LYS A CE    1 
ATOM   589 N NZ    . LYS B 2 33 ? 42.070 73.852  10.389 1.00 72.28 ? 251 LYS A NZ    1 
ATOM   590 N N     . GLN B 2 34 ? 47.444 71.910  14.760 1.00 26.17 ? 252 GLN A N     1 
ATOM   591 C CA    . GLN B 2 34 ? 48.873 71.686  14.702 1.00 29.65 ? 252 GLN A CA    1 
ATOM   592 C C     . GLN B 2 34 ? 49.257 70.801  15.887 1.00 34.67 ? 252 GLN A C     1 
ATOM   593 O O     . GLN B 2 34 ? 49.905 69.757  15.728 1.00 35.26 ? 252 GLN A O     1 
ATOM   594 C CB    . GLN B 2 34 ? 49.583 73.036  14.806 1.00 40.22 ? 252 GLN A CB    1 
ATOM   595 C CG    . GLN B 2 34 ? 51.084 72.988  15.090 1.00 55.81 ? 252 GLN A CG    1 
ATOM   596 C CD    . GLN B 2 34 ? 51.577 74.250  15.795 1.00 65.21 ? 252 GLN A CD    1 
ATOM   597 O OE1   . GLN B 2 34 ? 51.911 74.222  16.982 1.00 71.27 ? 252 GLN A OE1   1 
ATOM   598 N NE2   . GLN B 2 34 ? 51.600 75.366  15.073 1.00 68.43 ? 252 GLN A NE2   1 
ATOM   599 N N     . LEU B 2 35 ? 48.814 71.217  17.070 1.00 37.96 ? 253 LEU A N     1 
ATOM   600 C CA    . LEU B 2 35 ? 49.070 70.513  18.326 1.00 32.95 ? 253 LEU A CA    1 
ATOM   601 C C     . LEU B 2 35 ? 48.505 69.092  18.299 1.00 30.53 ? 253 LEU A C     1 
ATOM   602 O O     . LEU B 2 35 ? 49.181 68.149  18.691 1.00 30.83 ? 253 LEU A O     1 
ATOM   603 C CB    . LEU B 2 35 ? 48.452 71.301  19.484 1.00 34.41 ? 253 LEU A CB    1 
ATOM   604 C CG    . LEU B 2 35 ? 48.851 70.922  20.904 1.00 40.51 ? 253 LEU A CG    1 
ATOM   605 C CD1   . LEU B 2 35 ? 50.350 71.056  21.032 1.00 41.41 ? 253 LEU A CD1   1 
ATOM   606 C CD2   . LEU B 2 35 ? 48.146 71.819  21.910 1.00 38.34 ? 253 LEU A CD2   1 
ATOM   607 N N     . GLU B 2 36 ? 47.278 68.933  17.814 1.00 29.41 ? 254 GLU A N     1 
ATOM   608 C CA    . GLU B 2 36 ? 46.665 67.613  17.743 1.00 31.13 ? 254 GLU A CA    1 
ATOM   609 C C     . GLU B 2 36 ? 47.447 66.664  16.838 1.00 33.27 ? 254 GLU A C     1 
ATOM   610 O O     . GLU B 2 36 ? 47.565 65.477  17.147 1.00 32.31 ? 254 GLU A O     1 
ATOM   611 C CB    . GLU B 2 36 ? 45.218 67.715  17.276 1.00 34.52 ? 254 GLU A CB    1 
ATOM   612 C CG    . GLU B 2 36 ? 44.360 68.567  18.181 1.00 44.41 ? 254 GLU A CG    1 
ATOM   613 C CD    . GLU B 2 36 ? 42.922 68.611  17.737 1.00 49.62 ? 254 GLU A CD    1 
ATOM   614 O OE1   . GLU B 2 36 ? 42.151 67.741  18.190 1.00 57.49 ? 254 GLU A OE1   1 
ATOM   615 O OE2   . GLU B 2 36 ? 42.562 69.507  16.940 1.00 53.94 ? 254 GLU A OE2   1 
ATOM   616 N N     . ASP B 2 37 ? 47.983 67.191  15.733 1.00 33.34 ? 255 ASP A N     1 
ATOM   617 C CA    . ASP B 2 37 ? 48.772 66.398  14.786 1.00 32.54 ? 255 ASP A CA    1 
ATOM   618 C C     . ASP B 2 37 ? 50.071 65.927  15.432 1.00 33.65 ? 255 ASP A C     1 
ATOM   619 O O     . ASP B 2 37 ? 50.511 64.791  15.215 1.00 33.89 ? 255 ASP A O     1 
ATOM   620 C CB    . ASP B 2 37 ? 49.127 67.212  13.531 1.00 32.78 ? 255 ASP A CB    1 
ATOM   621 C CG    . ASP B 2 37 ? 47.977 67.311  12.529 1.00 29.75 ? 255 ASP A CG    1 
ATOM   622 O OD1   . ASP B 2 37 ? 47.093 66.428  12.492 1.00 25.92 ? 255 ASP A OD1   1 
ATOM   623 O OD2   . ASP B 2 37 ? 47.983 68.287  11.758 1.00 27.62 ? 255 ASP A OD2   1 
ATOM   624 N N     . LYS B 2 38 ? 50.687 66.819  16.207 1.00 32.91 ? 256 LYS A N     1 
ATOM   625 C CA    . LYS B 2 38 ? 51.943 66.533  16.896 1.00 30.58 ? 256 LYS A CA    1 
ATOM   626 C C     . LYS B 2 38 ? 51.821 65.354  17.856 1.00 28.93 ? 256 LYS A C     1 
ATOM   627 O O     . LYS B 2 38 ? 52.703 64.495  17.914 1.00 29.34 ? 256 LYS A O     1 
ATOM   628 C CB    . LYS B 2 38 ? 52.418 67.771  17.652 1.00 30.23 ? 256 LYS A CB    1 
ATOM   629 C CG    . LYS B 2 38 ? 53.820 67.661  18.215 1.00 37.76 ? 256 LYS A CG    1 
ATOM   630 C CD    . LYS B 2 38 ? 54.852 67.481  17.113 1.00 46.30 ? 256 LYS A CD    1 
ATOM   631 C CE    . LYS B 2 38 ? 56.262 67.541  17.671 1.00 51.02 ? 256 LYS A CE    1 
ATOM   632 N NZ    . LYS B 2 38 ? 56.487 68.816  18.424 1.00 55.52 ? 256 LYS A NZ    1 
ATOM   633 N N     . VAL B 2 39 ? 50.721 65.311  18.597 1.00 28.55 ? 257 VAL A N     1 
ATOM   634 C CA    . VAL B 2 39 ? 50.480 64.228  19.542 1.00 31.77 ? 257 VAL A CA    1 
ATOM   635 C C     . VAL B 2 39 ? 50.363 62.921  18.768 1.00 31.72 ? 257 VAL A C     1 
ATOM   636 O O     . VAL B 2 39 ? 50.835 61.875  19.216 1.00 35.79 ? 257 VAL A O     1 
ATOM   637 C CB    . VAL B 2 39 ? 49.173 64.461  20.369 1.00 29.18 ? 257 VAL A CB    1 
ATOM   638 C CG1   . VAL B 2 39 ? 48.868 63.246  21.238 1.00 26.30 ? 257 VAL A CG1   1 
ATOM   639 C CG2   . VAL B 2 39 ? 49.317 65.693  21.252 1.00 29.43 ? 257 VAL A CG2   1 
ATOM   640 N N     . GLU B 2 40 ? 49.766 62.995  17.584 1.00 31.42 ? 258 GLU A N     1 
ATOM   641 C CA    . GLU B 2 40 ? 49.572 61.826  16.735 1.00 30.17 ? 258 GLU A CA    1 
ATOM   642 C C     . GLU B 2 40 ? 50.923 61.343  16.213 1.00 26.46 ? 258 GLU A C     1 
ATOM   643 O O     . GLU B 2 40 ? 51.217 60.148  16.224 1.00 26.98 ? 258 GLU A O     1 
ATOM   644 C CB    . GLU B 2 40 ? 48.639 62.186  15.572 1.00 35.61 ? 258 GLU A CB    1 
ATOM   645 C CG    . GLU B 2 40 ? 48.004 60.991  14.872 1.00 48.69 ? 258 GLU A CG    1 
ATOM   646 C CD    . GLU B 2 40 ? 47.147 61.385  13.673 1.00 54.21 ? 258 GLU A CD    1 
ATOM   647 O OE1   . GLU B 2 40 ? 46.134 62.091  13.876 1.00 53.51 ? 258 GLU A OE1   1 
ATOM   648 O OE2   . GLU B 2 40 ? 47.483 60.978  12.534 1.00 50.36 ? 258 GLU A OE2   1 
ATOM   649 N N     . GLU B 2 41 ? 51.749 62.296  15.792 1.00 25.32 ? 259 GLU A N     1 
ATOM   650 C CA    . GLU B 2 41 ? 53.077 62.028  15.266 1.00 22.89 ? 259 GLU A CA    1 
ATOM   651 C C     . GLU B 2 41 ? 53.983 61.413  16.333 1.00 24.99 ? 259 GLU A C     1 
ATOM   652 O O     . GLU B 2 41 ? 54.662 60.416  16.071 1.00 23.16 ? 259 GLU A O     1 
ATOM   653 C CB    . GLU B 2 41 ? 53.668 63.334  14.734 1.00 25.70 ? 259 GLU A CB    1 
ATOM   654 C CG    . GLU B 2 41 ? 54.949 63.195  13.944 1.00 38.83 ? 259 GLU A CG    1 
ATOM   655 C CD    . GLU B 2 41 ? 56.183 63.142  14.817 1.00 48.96 ? 259 GLU A CD    1 
ATOM   656 O OE1   . GLU B 2 41 ? 56.603 64.201  15.339 1.00 54.33 ? 259 GLU A OE1   1 
ATOM   657 O OE2   . GLU B 2 41 ? 56.739 62.036  14.979 1.00 57.46 ? 259 GLU A OE2   1 
ATOM   658 N N     . LEU B 2 42 ? 53.989 62.003  17.531 1.00 23.86 ? 260 LEU A N     1 
ATOM   659 C CA    . LEU B 2 42 ? 54.810 61.516  18.646 1.00 22.30 ? 260 LEU A CA    1 
ATOM   660 C C     . LEU B 2 42 ? 54.350 60.159  19.169 1.00 21.23 ? 260 LEU A C     1 
ATOM   661 O O     . LEU B 2 42 ? 55.166 59.321  19.537 1.00 23.46 ? 260 LEU A O     1 
ATOM   662 C CB    . LEU B 2 42 ? 54.869 62.550  19.782 1.00 19.89 ? 260 LEU A CB    1 
ATOM   663 C CG    . LEU B 2 42 ? 55.704 63.800  19.494 1.00 16.31 ? 260 LEU A CG    1 
ATOM   664 C CD1   . LEU B 2 42 ? 55.458 64.872  20.528 1.00 21.80 ? 260 LEU A CD1   1 
ATOM   665 C CD2   . LEU B 2 42 ? 57.163 63.431  19.445 1.00 21.10 ? 260 LEU A CD2   1 
ATOM   666 N N     . LEU B 2 43 ? 53.050 59.919  19.178 1.00 19.06 ? 261 LEU A N     1 
ATOM   667 C CA    . LEU B 2 43 ? 52.545 58.635  19.627 1.00 24.28 ? 261 LEU A CA    1 
ATOM   668 C C     . LEU B 2 43 ? 53.105 57.517  18.733 1.00 28.50 ? 261 LEU A C     1 
ATOM   669 O O     . LEU B 2 43 ? 53.548 56.473  19.232 1.00 30.49 ? 261 LEU A O     1 
ATOM   670 C CB    . LEU B 2 43 ? 51.014 58.648  19.602 1.00 28.55 ? 261 LEU A CB    1 
ATOM   671 C CG    . LEU B 2 43 ? 50.193 58.495  20.892 1.00 26.74 ? 261 LEU A CG    1 
ATOM   672 C CD1   . LEU B 2 43 ? 50.957 58.888  22.111 1.00 28.17 ? 261 LEU A CD1   1 
ATOM   673 C CD2   . LEU B 2 43 ? 48.950 59.327  20.787 1.00 25.87 ? 261 LEU A CD2   1 
ATOM   674 N N     . SER B 2 44 ? 53.135 57.758  17.418 1.00 30.64 ? 262 SER A N     1 
ATOM   675 C CA    . SER B 2 44 ? 53.646 56.779  16.448 1.00 28.69 ? 262 SER A CA    1 
ATOM   676 C C     . SER B 2 44 ? 55.163 56.621  16.520 1.00 25.06 ? 262 SER A C     1 
ATOM   677 O O     . SER B 2 44 ? 55.688 55.505  16.461 1.00 24.35 ? 262 SER A O     1 
ATOM   678 C CB    . SER B 2 44 ? 53.221 57.139  15.011 1.00 35.33 ? 262 SER A CB    1 
ATOM   679 O OG    . SER B 2 44 ? 54.061 58.126  14.420 1.00 46.49 ? 262 SER A OG    1 
ATOM   680 N N     . LYS B 2 45 ? 55.876 57.736  16.606 1.00 21.08 ? 263 LYS A N     1 
ATOM   681 C CA    . LYS B 2 45 ? 57.319 57.682  16.706 1.00 24.40 ? 263 LYS A CA    1 
ATOM   682 C C     . LYS B 2 45 ? 57.671 56.910  17.981 1.00 24.13 ? 263 LYS A C     1 
ATOM   683 O O     . LYS B 2 45 ? 58.563 56.069  17.982 1.00 28.50 ? 263 LYS A O     1 
ATOM   684 C CB    . LYS B 2 45 ? 57.900 59.092  16.742 1.00 26.61 ? 263 LYS A CB    1 
ATOM   685 C CG    . LYS B 2 45 ? 59.404 59.127  16.526 1.00 39.77 ? 263 LYS A CG    1 
ATOM   686 C CD    . LYS B 2 45 ? 59.906 60.545  16.247 1.00 49.71 ? 263 LYS A CD    1 
ATOM   687 C CE    . LYS B 2 45 ? 59.578 61.008  14.826 1.00 48.01 ? 263 LYS A CE    1 
ATOM   688 N NZ    . LYS B 2 45 ? 59.807 62.471  14.651 1.00 44.29 ? 263 LYS A NZ    1 
ATOM   689 N N     . ASN B 2 46 ? 56.915 57.160  19.045 1.00 25.53 ? 264 ASN A N     1 
ATOM   690 C CA    . ASN B 2 46 ? 57.105 56.504  20.341 1.00 26.95 ? 264 ASN A CA    1 
ATOM   691 C C     . ASN B 2 46 ? 56.980 54.992  20.206 1.00 28.04 ? 264 ASN A C     1 
ATOM   692 O O     . ASN B 2 46 ? 57.843 54.256  20.688 1.00 29.57 ? 264 ASN A O     1 
ATOM   693 C CB    A ASN B 2 46 ? 56.093 57.054  21.367 0.50 30.94 ? 264 ASN A CB    1 
ATOM   694 C CB    B ASN B 2 46 ? 56.057 57.005  21.333 0.50 25.93 ? 264 ASN A CB    1 
ATOM   695 C CG    A ASN B 2 46 ? 56.220 56.406  22.748 0.50 34.18 ? 264 ASN A CG    1 
ATOM   696 C CG    B ASN B 2 46 ? 56.659 57.786  22.470 0.50 27.01 ? 264 ASN A CG    1 
ATOM   697 O OD1   A ASN B 2 46 ? 55.268 55.815  23.253 0.50 35.05 ? 264 ASN A OD1   1 
ATOM   698 O OD1   B ASN B 2 46 ? 57.588 58.580  22.277 0.50 19.70 ? 264 ASN A OD1   1 
ATOM   699 N ND2   A ASN B 2 46 ? 57.373 56.564  23.383 0.50 38.12 ? 264 ASN A ND2   1 
ATOM   700 N ND2   B ASN B 2 46 ? 56.134 57.567  23.674 0.50 23.58 ? 264 ASN A ND2   1 
ATOM   701 N N     . TYR B 2 47 ? 55.923 54.535  19.529 1.00 29.39 ? 265 TYR A N     1 
ATOM   702 C CA    . TYR B 2 47 ? 55.667 53.105  19.328 1.00 26.09 ? 265 TYR A CA    1 
ATOM   703 C C     . TYR B 2 47 ? 56.795 52.398  18.591 1.00 26.52 ? 265 TYR A C     1 
ATOM   704 O O     . TYR B 2 47 ? 57.200 51.294  18.958 1.00 28.03 ? 265 TYR A O     1 
ATOM   705 C CB    . TYR B 2 47 ? 54.351 52.887  18.574 1.00 37.11 ? 265 TYR A CB    1 
ATOM   706 C CG    . TYR B 2 47 ? 53.897 51.430  18.525 1.00 51.63 ? 265 TYR A CG    1 
ATOM   707 C CD1   . TYR B 2 47 ? 54.478 50.513  17.637 1.00 55.84 ? 265 TYR A CD1   1 
ATOM   708 C CD2   . TYR B 2 47 ? 52.885 50.969  19.370 1.00 53.51 ? 265 TYR A CD2   1 
ATOM   709 C CE1   . TYR B 2 47 ? 54.067 49.174  17.604 1.00 59.04 ? 265 TYR A CE1   1 
ATOM   710 C CE2   . TYR B 2 47 ? 52.468 49.637  19.342 1.00 58.33 ? 265 TYR A CE2   1 
ATOM   711 C CZ    . TYR B 2 47 ? 53.057 48.745  18.458 1.00 60.61 ? 265 TYR A CZ    1 
ATOM   712 O OH    . TYR B 2 47 ? 52.627 47.429  18.435 1.00 60.82 ? 265 TYR A OH    1 
ATOM   713 N N     . HIS B 2 48 ? 57.281 53.010  17.523 1.00 31.26 ? 266 HIS A N     1 
ATOM   714 C CA    . HIS B 2 48 ? 58.364 52.431  16.758 1.00 32.16 ? 266 HIS A CA    1 
ATOM   715 C C     . HIS B 2 48 ? 59.649 52.318  17.591 1.00 31.04 ? 266 HIS A C     1 
ATOM   716 O O     . HIS B 2 48 ? 60.368 51.323  17.486 1.00 31.74 ? 266 HIS A O     1 
ATOM   717 C CB    . HIS B 2 48 ? 58.592 53.227  15.469 1.00 38.78 ? 266 HIS A CB    1 
ATOM   718 C CG    . HIS B 2 48 ? 57.430 53.189  14.520 1.00 54.37 ? 266 HIS A CG    1 
ATOM   719 N ND1   . HIS B 2 48 ? 56.579 52.109  14.411 1.00 56.84 ? 266 HIS A ND1   1 
ATOM   720 C CD2   . HIS B 2 48 ? 56.978 54.104  13.617 1.00 57.33 ? 266 HIS A CD2   1 
ATOM   721 C CE1   . HIS B 2 48 ? 55.662 52.352  13.490 1.00 53.73 ? 266 HIS A CE1   1 
ATOM   722 N NE2   . HIS B 2 48 ? 55.886 53.556  12.997 1.00 53.96 ? 266 HIS A NE2   1 
ATOM   723 N N     . LEU B 2 49 ? 59.936 53.314  18.428 1.00 27.49 ? 267 LEU A N     1 
ATOM   724 C CA    . LEU B 2 49 ? 61.131 53.270  19.274 1.00 26.39 ? 267 LEU A CA    1 
ATOM   725 C C     . LEU B 2 49 ? 60.974 52.232  20.383 1.00 28.71 ? 267 LEU A C     1 
ATOM   726 O O     . LEU B 2 49 ? 61.901 51.486  20.689 1.00 30.67 ? 267 LEU A O     1 
ATOM   727 C CB    . LEU B 2 49 ? 61.420 54.632  19.900 1.00 26.61 ? 267 LEU A CB    1 
ATOM   728 C CG    . LEU B 2 49 ? 61.887 55.799  19.032 1.00 26.77 ? 267 LEU A CG    1 
ATOM   729 C CD1   . LEU B 2 49 ? 62.065 57.017  19.912 1.00 29.06 ? 267 LEU A CD1   1 
ATOM   730 C CD2   . LEU B 2 49 ? 63.187 55.473  18.327 1.00 25.55 ? 267 LEU A CD2   1 
ATOM   731 N N     . GLU B 2 50 ? 59.788 52.170  20.976 1.00 33.97 ? 268 GLU A N     1 
ATOM   732 C CA    . GLU B 2 50 ? 59.514 51.212  22.039 1.00 35.68 ? 268 GLU A CA    1 
ATOM   733 C C     . GLU B 2 50 ? 59.675 49.796  21.501 1.00 39.18 ? 268 GLU A C     1 
ATOM   734 O O     . GLU B 2 50 ? 60.242 48.920  22.159 1.00 41.44 ? 268 GLU A O     1 
ATOM   735 C CB    . GLU B 2 50 ? 58.099 51.413  22.578 1.00 35.45 ? 268 GLU A CB    1 
ATOM   736 C CG    . GLU B 2 50 ? 57.901 50.872  23.974 1.00 42.76 ? 268 GLU A CG    1 
ATOM   737 C CD    . GLU B 2 50 ? 58.685 51.641  25.024 1.00 45.94 ? 268 GLU A CD    1 
ATOM   738 O OE1   . GLU B 2 50 ? 58.200 52.704  25.461 1.00 44.88 ? 268 GLU A OE1   1 
ATOM   739 O OE2   . GLU B 2 50 ? 59.781 51.185  25.419 1.00 48.77 ? 268 GLU A OE2   1 
ATOM   740 N N     . ASN B 2 51 ? 59.209 49.582  20.279 1.00 41.77 ? 269 ASN A N     1 
ATOM   741 C CA    . ASN B 2 51 ? 59.304 48.277  19.641 1.00 45.21 ? 269 ASN A CA    1 
ATOM   742 C C     . ASN B 2 51 ? 60.767 47.999  19.285 1.00 46.57 ? 269 ASN A C     1 
ATOM   743 O O     . ASN B 2 51 ? 61.268 46.881  19.454 1.00 44.72 ? 269 ASN A O     1 
ATOM   744 C CB    . ASN B 2 51 ? 58.426 48.265  18.387 1.00 53.13 ? 269 ASN A CB    1 
ATOM   745 C CG    . ASN B 2 51 ? 57.796 46.913  18.132 1.00 57.13 ? 269 ASN A CG    1 
ATOM   746 O OD1   . ASN B 2 51 ? 58.241 46.165  17.255 1.00 63.82 ? 269 ASN A OD1   1 
ATOM   747 N ND2   . ASN B 2 51 ? 56.741 46.598  18.879 1.00 52.89 ? 269 ASN A ND2   1 
ATOM   748 N N     . GLU B 2 52 ? 61.450 49.041  18.817 1.00 46.90 ? 270 GLU A N     1 
ATOM   749 C CA    . GLU B 2 52 ? 62.859 48.966  18.451 1.00 42.88 ? 270 GLU A CA    1 
ATOM   750 C C     . GLU B 2 52 ? 63.711 48.574  19.655 1.00 40.45 ? 270 GLU A C     1 
ATOM   751 O O     . GLU B 2 52 ? 64.615 47.741  19.540 1.00 37.38 ? 270 GLU A O     1 
ATOM   752 C CB    . GLU B 2 52 ? 63.320 50.314  17.879 1.00 43.74 ? 270 GLU A CB    1 
ATOM   753 C CG    . GLU B 2 52 ? 64.805 50.588  18.031 1.00 48.79 ? 270 GLU A CG    1 
ATOM   754 C CD    . GLU B 2 52 ? 65.537 50.684  16.713 1.00 51.86 ? 270 GLU A CD    1 
ATOM   755 O OE1   . GLU B 2 52 ? 66.010 49.636  16.211 1.00 53.99 ? 270 GLU A OE1   1 
ATOM   756 O OE2   . GLU B 2 52 ? 65.661 51.815  16.194 1.00 52.60 ? 270 GLU A OE2   1 
ATOM   757 N N     . VAL B 2 53 ? 63.407 49.164  20.810 1.00 36.95 ? 271 VAL A N     1 
ATOM   758 C CA    . VAL B 2 53 ? 64.141 48.878  22.040 1.00 38.04 ? 271 VAL A CA    1 
ATOM   759 C C     . VAL B 2 53 ? 64.014 47.401  22.406 1.00 40.72 ? 271 VAL A C     1 
ATOM   760 O O     . VAL B 2 53 ? 65.010 46.743  22.699 1.00 41.03 ? 271 VAL A O     1 
ATOM   761 C CB    . VAL B 2 53 ? 63.680 49.802  23.213 1.00 33.65 ? 271 VAL A CB    1 
ATOM   762 C CG1   . VAL B 2 53 ? 63.959 49.163  24.562 1.00 28.90 ? 271 VAL A CG1   1 
ATOM   763 C CG2   . VAL B 2 53 ? 64.412 51.126  23.134 1.00 29.92 ? 271 VAL A CG2   1 
ATOM   764 N N     . ALA B 2 54 ? 62.796 46.872  22.331 1.00 44.61 ? 272 ALA A N     1 
ATOM   765 C CA    . ALA B 2 54 ? 62.547 45.469  22.642 1.00 42.60 ? 272 ALA A CA    1 
ATOM   766 C C     . ALA B 2 54 ? 63.393 44.559  21.748 1.00 44.30 ? 272 ALA A C     1 
ATOM   767 O O     . ALA B 2 54 ? 64.004 43.597  22.223 1.00 44.19 ? 272 ALA A O     1 
ATOM   768 C CB    . ALA B 2 54 ? 61.070 45.156  22.467 1.00 42.92 ? 272 ALA A CB    1 
ATOM   769 N N     . ARG B 2 55 ? 63.457 44.901  20.463 1.00 45.26 ? 273 ARG A N     1 
ATOM   770 C CA    . ARG B 2 55 ? 64.214 44.133  19.482 1.00 44.32 ? 273 ARG A CA    1 
ATOM   771 C C     . ARG B 2 55 ? 65.713 44.131  19.792 1.00 48.67 ? 273 ARG A C     1 
ATOM   772 O O     . ARG B 2 55 ? 66.316 43.063  19.958 1.00 49.80 ? 273 ARG A O     1 
ATOM   773 C CB    A ARG B 2 55 ? 63.984 44.717  18.084 0.50 41.27 ? 273 ARG A CB    1 
ATOM   774 C CB    B ARG B 2 55 ? 63.935 44.646  18.066 0.50 44.10 ? 273 ARG A CB    1 
ATOM   775 C CG    A ARG B 2 55 ? 64.484 43.848  16.936 0.50 41.02 ? 273 ARG A CG    1 
ATOM   776 C CG    B ARG B 2 55 ? 62.447 44.634  17.704 0.50 46.46 ? 273 ARG A CG    1 
ATOM   777 C CD    A ARG B 2 55 ? 64.292 44.527  15.573 0.50 36.12 ? 273 ARG A CD    1 
ATOM   778 C CD    B ARG B 2 55 ? 62.192 44.740  16.200 0.50 47.84 ? 273 ARG A CD    1 
ATOM   779 N NE    A ARG B 2 55 ? 65.396 45.424  15.242 0.50 32.09 ? 273 ARG A NE    1 
ATOM   780 N NE    B ARG B 2 55 ? 62.667 45.993  15.611 0.50 45.61 ? 273 ARG A NE    1 
ATOM   781 C CZ    A ARG B 2 55 ? 66.380 45.121  14.398 0.50 30.95 ? 273 ARG A CZ    1 
ATOM   782 C CZ    B ARG B 2 55 ? 61.925 47.088  15.472 0.50 44.72 ? 273 ARG A CZ    1 
ATOM   783 N NH1   A ARG B 2 55 ? 66.405 43.945  13.782 0.50 27.45 ? 273 ARG A NH1   1 
ATOM   784 N NH1   B ARG B 2 55 ? 60.663 47.103  15.884 0.50 43.36 ? 273 ARG A NH1   1 
ATOM   785 N NH2   A ARG B 2 55 ? 67.367 45.983  14.200 0.50 31.44 ? 273 ARG A NH2   1 
ATOM   786 N NH2   B ARG B 2 55 ? 62.445 48.169  14.906 0.50 39.65 ? 273 ARG A NH2   1 
ATOM   787 N N     . LEU B 2 56 ? 66.307 45.319  19.901 1.00 51.46 ? 274 LEU A N     1 
ATOM   788 C CA    . LEU B 2 56 ? 67.735 45.450  20.200 1.00 51.82 ? 274 LEU A CA    1 
ATOM   789 C C     . LEU B 2 56 ? 68.073 44.815  21.538 1.00 55.45 ? 274 LEU A C     1 
ATOM   790 O O     . LEU B 2 56 ? 69.156 44.269  21.713 1.00 57.15 ? 274 LEU A O     1 
ATOM   791 C CB    . LEU B 2 56 ? 68.160 46.916  20.217 1.00 51.30 ? 274 LEU A CB    1 
ATOM   792 C CG    . LEU B 2 56 ? 68.442 47.602  18.878 1.00 52.76 ? 274 LEU A CG    1 
ATOM   793 C CD1   . LEU B 2 56 ? 68.440 49.111  19.071 1.00 51.66 ? 274 LEU A CD1   1 
ATOM   794 C CD2   . LEU B 2 56 ? 69.768 47.129  18.314 1.00 48.66 ? 274 LEU A CD2   1 
ATOM   795 N N     . LYS B 2 57 ? 67.146 44.906  22.484 1.00 58.31 ? 275 LYS A N     1 
ATOM   796 C CA    . LYS B 2 57 ? 67.341 44.321  23.799 1.00 58.92 ? 275 LYS A CA    1 
ATOM   797 C C     . LYS B 2 57 ? 67.615 42.837  23.594 1.00 62.70 ? 275 LYS A C     1 
ATOM   798 O O     . LYS B 2 57 ? 68.628 42.323  24.064 1.00 66.23 ? 275 LYS A O     1 
ATOM   799 C CB    . LYS B 2 57 ? 66.081 44.494  24.646 1.00 59.02 ? 275 LYS A CB    1 
ATOM   800 C CG    . LYS B 2 57 ? 66.338 44.939  26.067 1.00 63.27 ? 275 LYS A CG    1 
ATOM   801 C CD    . LYS B 2 57 ? 66.877 46.356  26.103 1.00 67.14 ? 275 LYS A CD    1 
ATOM   802 C CE    . LYS B 2 57 ? 67.163 46.812  27.531 1.00 76.24 ? 275 LYS A CE    1 
ATOM   803 N NZ    . LYS B 2 57 ? 67.682 48.219  27.610 1.00 78.46 ? 275 LYS A NZ    1 
ATOM   804 N N     . LYS B 2 58 ? 66.732 42.167  22.851 1.00 64.79 ? 276 LYS A N     1 
ATOM   805 C CA    . LYS B 2 58 ? 66.871 40.734  22.575 1.00 65.76 ? 276 LYS A CA    1 
ATOM   806 C C     . LYS B 2 58 ? 68.200 40.411  21.885 1.00 66.59 ? 276 LYS A C     1 
ATOM   807 O O     . LYS B 2 58 ? 68.998 39.607  22.387 1.00 65.36 ? 276 LYS A O     1 
ATOM   808 C CB    . LYS B 2 58 ? 65.698 40.237  21.728 1.00 62.50 ? 276 LYS A CB    1 
ATOM   809 N N     . LEU B 2 59 ? 68.417 41.020  20.723 1.00 66.99 ? 277 LEU A N     1 
ATOM   810 C CA    . LEU B 2 59 ? 69.643 40.812  19.967 1.00 66.22 ? 277 LEU A CA    1 
ATOM   811 C C     . LEU B 2 59 ? 70.787 41.566  20.645 1.00 68.17 ? 277 LEU A C     1 
ATOM   812 O O     . LEU B 2 59 ? 71.175 41.256  21.774 1.00 69.45 ? 277 LEU A O     1 
ATOM   813 C CB    . LEU B 2 59 ? 69.467 41.292  18.532 1.00 62.84 ? 277 LEU A CB    1 
HETATM 814 O O     . HOH C 3 .  ? 34.994 82.355  19.501 1.00 49.83 ? 10  HOH B O     1 
HETATM 815 O O     . HOH C 3 .  ? 26.431 72.666  16.705 1.00 72.16 ? 11  HOH B O     1 
HETATM 816 O O     . HOH C 3 .  ? 48.001 100.342 27.919 1.00 58.53 ? 12  HOH B O     1 
HETATM 817 O O     . HOH C 3 .  ? 18.053 91.147  11.274 1.00 64.62 ? 13  HOH B O     1 
HETATM 818 O O     . HOH C 3 .  ? 28.240 82.538  13.880 1.00 40.66 ? 14  HOH B O     1 
HETATM 819 O O     . HOH C 3 .  ? 35.684 80.729  15.343 1.00 69.32 ? 15  HOH B O     1 
HETATM 820 O O     . HOH C 3 .  ? 14.000 58.797  12.895 1.00 58.59 ? 16  HOH B O     1 
HETATM 821 O O     . HOH C 3 .  ? 42.161 98.516  30.978 1.00 59.49 ? 17  HOH B O     1 
HETATM 822 O O     . HOH C 3 .  ? 44.219 100.752 26.909 1.00 56.20 ? 18  HOH B O     1 
HETATM 823 O O     . HOH C 3 .  ? 41.135 99.354  23.346 1.00 53.99 ? 19  HOH B O     1 
HETATM 824 O O     . HOH C 3 .  ? 25.423 68.279  20.445 1.00 51.52 ? 20  HOH B O     1 
HETATM 825 O O     . HOH C 3 .  ? 54.049 104.089 18.042 1.00 56.02 ? 21  HOH B O     1 
HETATM 826 O O     . HOH C 3 .  ? 17.797 73.905  21.692 1.00 45.97 ? 22  HOH B O     1 
HETATM 827 O O     . HOH C 3 .  ? 27.969 88.274  17.371 1.00 69.46 ? 23  HOH B O     1 
HETATM 828 O O     . HOH C 3 .  ? 30.372 92.924  11.516 1.00 53.44 ? 24  HOH B O     1 
HETATM 829 O O     . HOH C 3 .  ? 34.589 89.048  14.459 1.00 22.47 ? 25  HOH B O     1 
HETATM 830 O O     . HOH C 3 .  ? 35.902 85.970  19.723 1.00 40.17 ? 26  HOH B O     1 
HETATM 831 O O     . HOH C 3 .  ? 57.064 101.960 16.076 1.00 58.73 ? 27  HOH B O     1 
HETATM 832 O O     . HOH C 3 .  ? 40.428 92.027  29.606 1.00 51.70 ? 28  HOH B O     1 
HETATM 833 O O     . HOH C 3 .  ? 31.698 96.593  13.623 1.00 46.51 ? 29  HOH B O     1 
HETATM 834 O O     . HOH C 3 .  ? 37.432 84.152  21.070 1.00 59.50 ? 30  HOH B O     1 
HETATM 835 O O     . HOH C 3 .  ? 38.531 88.954  20.249 1.00 22.27 ? 31  HOH B O     1 
HETATM 836 O O     . HOH C 3 .  ? 26.632 70.645  19.615 1.00 33.59 ? 32  HOH B O     1 
HETATM 837 O O     . HOH C 3 .  ? 30.862 89.627  9.031  1.00 45.53 ? 33  HOH B O     1 
HETATM 838 O O     . HOH D 3 .  ? 50.295 70.822  11.179 1.00 52.68 ? 5   HOH A O     1 
HETATM 839 O O     . HOH D 3 .  ? 34.860 95.023  18.729 1.00 41.44 ? 9   HOH A O     1 
HETATM 840 O O     . HOH D 3 .  ? 44.307 76.657  20.310 1.00 39.79 ? 14  HOH A O     1 
HETATM 841 O O     . HOH D 3 .  ? 43.917 84.683  10.506 1.00 45.65 ? 16  HOH A O     1 
HETATM 842 O O     . HOH D 3 .  ? 29.463 100.976 13.357 1.00 73.22 ? 18  HOH A O     1 
HETATM 843 O O     . HOH D 3 .  ? 41.900 95.066  12.025 1.00 29.47 ? 19  HOH A O     1 
HETATM 844 O O     . HOH D 3 .  ? 39.674 72.494  9.733  1.00 64.06 ? 20  HOH A O     1 
HETATM 845 O O     . HOH D 3 .  ? 44.437 89.465  15.371 1.00 35.50 ? 21  HOH A O     1 
HETATM 846 O O     . HOH D 3 .  ? 56.136 57.829  12.659 1.00 32.16 ? 23  HOH A O     1 
HETATM 847 O O     . HOH D 3 .  ? 39.046 79.362  17.731 1.00 35.73 ? 25  HOH A O     1 
HETATM 848 O O     . HOH D 3 .  ? 42.178 95.314  18.530 1.00 28.11 ? 26  HOH A O     1 
HETATM 849 O O     . HOH D 3 .  ? 42.133 78.146  11.107 1.00 42.60 ? 27  HOH A O     1 
HETATM 850 O O     . HOH D 3 .  ? 45.534 64.760  14.124 1.00 54.72 ? 30  HOH A O     1 
HETATM 851 O O     . HOH D 3 .  ? 60.433 48.022  24.653 1.00 45.59 ? 32  HOH A O     1 
HETATM 852 O O     . HOH D 3 .  ? 40.899 97.281  20.026 1.00 40.45 ? 33  HOH A O     1 
HETATM 853 O O     . HOH D 3 .  ? 40.191 86.738  20.710 1.00 36.28 ? 37  HOH A O     1 
HETATM 854 O O     . HOH D 3 .  ? 51.467 69.070  13.771 1.00 36.30 ? 38  HOH A O     1 
HETATM 855 O O     . HOH D 3 .  ? 49.492 57.946  16.214 1.00 31.19 ? 39  HOH A O     1 
HETATM 856 O O     . HOH D 3 .  ? 51.175 54.000  21.050 1.00 51.45 ? 42  HOH A O     1 
HETATM 857 O O     . HOH D 3 .  ? 32.291 97.011  8.113  1.00 56.92 ? 43  HOH A O     1 
HETATM 858 O O     . HOH D 3 .  ? 34.854 94.562  10.621 1.00 46.29 ? 44  HOH A O     1 
HETATM 859 O O     . HOH D 3 .  ? 34.865 96.265  8.218  1.00 45.93 ? 46  HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  -10 -10 DT  T   B . n 
A 1 2  DG  2  -9  -9  DG  G   B . n 
A 1 3  DG  3  -8  -8  DG  G   B . n 
A 1 4  DA  4  -7  -7  DA  A   B . n 
A 1 5  DG  5  -6  -6  DG  G   B . n 
A 1 6  DA  6  -5  -5  DA  A   B . n 
A 1 7  DT  7  -4  -4  DT  T   B . n 
A 1 8  DG  8  -3  -3  DG  G   B . n 
A 1 9  DA  9  -2  -2  DA  A   B . n 
A 1 10 DC  10 -1  -1  DC  C   B . n 
A 1 11 DG  11 1   1   DG  G   B . n 
A 1 12 DT  12 2   2   DT  T   B . n 
A 1 13 DC  13 3   3   DC  C   B . n 
A 1 14 DA  14 4   4   DA  A   B . n 
A 1 15 DT  15 5   5   DT  T   B . n 
A 1 16 DC  16 6   6   DC  C   B . n 
A 1 17 DT  17 7   7   DT  T   B . n 
A 1 18 DC  18 8   8   DC  C   B . n 
A 1 19 DC  19 9   9   DC  C   B . n 
B 2 1  MET 1  219 ?   ?   ?   A . n 
B 2 2  ILE 2  220 ?   ?   ?   A . n 
B 2 3  VAL 3  221 ?   ?   ?   A . n 
B 2 4  PRO 4  222 ?   ?   ?   A . n 
B 2 5  GLU 5  223 ?   ?   ?   A . n 
B 2 6  SER 6  224 ?   ?   ?   A . n 
B 2 7  SER 7  225 ?   ?   ?   A . n 
B 2 8  ASP 8  226 ?   ?   ?   A . n 
B 2 9  PRO 9  227 ?   ?   ?   A . n 
B 2 10 ALA 10 228 ?   ?   ?   A . n 
B 2 11 ALA 11 229 229 ALA ALA A . n 
B 2 12 LEU 12 230 230 LEU LEU A . n 
B 2 13 LYS 13 231 231 LYS LYS A . n 
B 2 14 ARG 14 232 232 ARG ARG A . n 
B 2 15 ALA 15 233 233 ALA ALA A . n 
B 2 16 ARG 16 234 234 ARG ARG A . n 
B 2 17 ASN 17 235 235 ASN ASN A . n 
B 2 18 THR 18 236 236 THR THR A . n 
B 2 19 GLU 19 237 237 GLU GLU A . n 
B 2 20 ALA 20 238 238 ALA ALA A . n 
B 2 21 ALA 21 239 239 ALA ALA A . n 
B 2 22 ARG 22 240 240 ARG ARG A . n 
B 2 23 ARG 23 241 241 ARG ARG A . n 
B 2 24 SER 24 242 242 SER SER A . n 
B 2 25 ARG 25 243 243 ARG ARG A . n 
B 2 26 ALA 26 244 244 ALA ALA A . n 
B 2 27 ARG 27 245 245 ARG ARG A . n 
B 2 28 LYS 28 246 246 LYS LYS A . n 
B 2 29 LEU 29 247 247 LEU LEU A . n 
B 2 30 GLN 30 248 248 GLN GLN A . n 
B 2 31 ARG 31 249 249 ARG ARG A . n 
B 2 32 MET 32 250 250 MET MET A . n 
B 2 33 LYS 33 251 251 LYS LYS A . n 
B 2 34 GLN 34 252 252 GLN GLN A . n 
B 2 35 LEU 35 253 253 LEU LEU A . n 
B 2 36 GLU 36 254 254 GLU GLU A . n 
B 2 37 ASP 37 255 255 ASP ASP A . n 
B 2 38 LYS 38 256 256 LYS LYS A . n 
B 2 39 VAL 39 257 257 VAL VAL A . n 
B 2 40 GLU 40 258 258 GLU GLU A . n 
B 2 41 GLU 41 259 259 GLU GLU A . n 
B 2 42 LEU 42 260 260 LEU LEU A . n 
B 2 43 LEU 43 261 261 LEU LEU A . n 
B 2 44 SER 44 262 262 SER SER A . n 
B 2 45 LYS 45 263 263 LYS LYS A . n 
B 2 46 ASN 46 264 264 ASN ASN A . n 
B 2 47 TYR 47 265 265 TYR TYR A . n 
B 2 48 HIS 48 266 266 HIS HIS A . n 
B 2 49 LEU 49 267 267 LEU LEU A . n 
B 2 50 GLU 50 268 268 GLU GLU A . n 
B 2 51 ASN 51 269 269 ASN ASN A . n 
B 2 52 GLU 52 270 270 GLU GLU A . n 
B 2 53 VAL 53 271 271 VAL VAL A . n 
B 2 54 ALA 54 272 272 ALA ALA A . n 
B 2 55 ARG 55 273 273 ARG ARG A . n 
B 2 56 LEU 56 274 274 LEU LEU A . n 
B 2 57 LYS 57 275 275 LYS LYS A . n 
B 2 58 LYS 58 276 276 LYS LYS A . n 
B 2 59 LEU 59 277 277 LEU LEU A . n 
B 2 60 VAL 60 278 ?   ?   ?   A . n 
B 2 61 GLY 61 279 ?   ?   ?   A . n 
B 2 62 GLU 62 280 ?   ?   ?   A . n 
B 2 63 ARG 63 281 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  10 1  HOH HOH B . 
C 3 HOH 2  11 2  HOH HOH B . 
C 3 HOH 3  12 3  HOH HOH B . 
C 3 HOH 4  13 4  HOH HOH B . 
C 3 HOH 5  14 6  HOH HOH B . 
C 3 HOH 6  15 7  HOH HOH B . 
C 3 HOH 7  16 8  HOH HOH B . 
C 3 HOH 8  17 10 HOH HOH B . 
C 3 HOH 9  18 11 HOH HOH B . 
C 3 HOH 10 19 12 HOH HOH B . 
C 3 HOH 11 20 13 HOH HOH B . 
C 3 HOH 12 21 15 HOH HOH B . 
C 3 HOH 13 22 17 HOH HOH B . 
C 3 HOH 14 23 22 HOH HOH B . 
C 3 HOH 15 24 24 HOH HOH B . 
C 3 HOH 16 25 28 HOH HOH B . 
C 3 HOH 17 26 29 HOH HOH B . 
C 3 HOH 18 27 31 HOH HOH B . 
C 3 HOH 19 28 34 HOH HOH B . 
C 3 HOH 20 29 35 HOH HOH B . 
C 3 HOH 21 30 36 HOH HOH B . 
C 3 HOH 22 31 40 HOH HOH B . 
C 3 HOH 23 32 41 HOH HOH B . 
C 3 HOH 24 33 45 HOH HOH B . 
D 3 HOH 1  5  5  HOH HOH A . 
D 3 HOH 2  9  9  HOH HOH A . 
D 3 HOH 3  14 14 HOH HOH A . 
D 3 HOH 4  16 16 HOH HOH A . 
D 3 HOH 5  18 18 HOH HOH A . 
D 3 HOH 6  19 19 HOH HOH A . 
D 3 HOH 7  20 20 HOH HOH A . 
D 3 HOH 8  21 21 HOH HOH A . 
D 3 HOH 9  23 23 HOH HOH A . 
D 3 HOH 10 25 25 HOH HOH A . 
D 3 HOH 11 26 26 HOH HOH A . 
D 3 HOH 12 27 27 HOH HOH A . 
D 3 HOH 13 30 30 HOH HOH A . 
D 3 HOH 14 32 32 HOH HOH A . 
D 3 HOH 15 33 33 HOH HOH A . 
D 3 HOH 16 37 37 HOH HOH A . 
D 3 HOH 17 38 38 HOH HOH A . 
D 3 HOH 18 39 39 HOH HOH A . 
D 3 HOH 19 42 42 HOH HOH A . 
D 3 HOH 20 43 43 HOH HOH A . 
D 3 HOH 21 44 44 HOH HOH A . 
D 3 HOH 22 46 46 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_775 -y+2,-x+2,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 117.3200000000 -1.0000000000 
0.0000000000 0.0000000000 117.3200000000 0.0000000000 0.0000000000 -1.0000000000 43.4400000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-03-08 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       . ? 1 
OSCREF    'data reduction' . ? 2 
OSCKRUNCH 'data reduction' . ? 3 
# 
_pdbx_entry_details.entry_id             2DGC 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;AMINO ACID NUMBERING (RESIDUE NUMBER) CORRESPONDS TO THE
281 AMINO ACIDS OF INTACT GCN4.

RESIDUE NUMBERING OF NUCLEOTIDES:
 5'  T  G  G  A  G  A  T  G  A  C  G  T  C  A  T  C  T
   -10 -9 -8 -7 -6 -5 -4 -3 -2 -1  1  2  3  4  5  6  7

  C  C  3'
  8  9
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "C5'" B DT -10 ? ? "C4'" B DT -10 ? ? 1.570 1.512 0.058  0.007 N 
2  1 N1    B DT -10 ? ? C2    B DT -10 ? ? 1.432 1.376 0.056  0.008 N 
3  1 "C5'" B DG -9  ? ? "C4'" B DG -9  ? ? 1.570 1.512 0.058  0.007 N 
4  1 C6    B DG -9  ? ? N1    B DG -9  ? ? 1.346 1.391 -0.045 0.007 N 
5  1 P     B DG -8  ? ? "O5'" B DG -8  ? ? 1.688 1.593 0.095  0.010 N 
6  1 "C5'" B DG -8  ? ? "C4'" B DG -8  ? ? 1.570 1.512 0.058  0.007 N 
7  1 N9    B DA -2  ? ? C4    B DA -2  ? ? 1.419 1.374 0.045  0.006 N 
8  1 C6    B DG 1   ? ? N1    B DG 1   ? ? 1.340 1.391 -0.051 0.007 N 
9  1 C5    B DT 2   ? ? C7    B DT 2   ? ? 1.560 1.496 0.064  0.006 N 
10 1 P     B DC 6   ? ? "O5'" B DC 6   ? ? 1.685 1.593 0.092  0.010 N 
11 1 "O3'" B DC 6   ? ? P     B DT 7   ? ? 1.724 1.607 0.117  0.012 Y 
12 1 P     B DC 8   ? ? "O5'" B DC 8   ? ? 1.675 1.593 0.082  0.010 N 
13 1 P     B DC 9   ? ? "O5'" B DC 9   ? ? 1.682 1.593 0.089  0.010 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DT -10 ? ? "C1'" B DT -10 ? ? "C2'" B DT -10 ? ? 98.97  105.90 -6.93  0.80 N 
2  1 "O4'" B DT -10 ? ? "C1'" B DT -10 ? ? N1    B DT -10 ? ? 117.99 108.30 9.69   0.30 N 
3  1 C4    B DT -10 ? ? C5    B DT -10 ? ? C6    B DT -10 ? ? 122.13 118.00 4.13   0.60 N 
4  1 N3    B DT -10 ? ? C2    B DT -10 ? ? O2    B DT -10 ? ? 117.50 122.30 -4.80  0.60 N 
5  1 "O4'" B DG -9  ? ? "C1'" B DG -9  ? ? N9    B DG -9  ? ? 102.06 108.00 -5.94  0.70 N 
6  1 "O4'" B DG -8  ? ? "C1'" B DG -8  ? ? N9    B DG -8  ? ? 113.49 108.30 5.19   0.30 N 
7  1 "C5'" B DA -7  ? ? "C4'" B DA -7  ? ? "O4'" B DA -7  ? ? 118.89 109.80 9.09   1.10 N 
8  1 "O4'" B DA -7  ? ? "C1'" B DA -7  ? ? "C2'" B DA -7  ? ? 100.45 105.90 -5.45  0.80 N 
9  1 "C1'" B DA -5  ? ? "O4'" B DA -5  ? ? "C4'" B DA -5  ? ? 115.79 110.30 5.49   0.70 N 
10 1 "O4'" B DA -5  ? ? "C1'" B DA -5  ? ? "C2'" B DA -5  ? ? 99.77  105.90 -6.13  0.80 N 
11 1 "O4'" B DT -4  ? ? "C1'" B DT -4  ? ? N1    B DT -4  ? ? 110.82 108.30 2.52   0.30 N 
12 1 "C3'" B DT -4  ? ? "O3'" B DT -4  ? ? P     B DG -3  ? ? 132.23 119.70 12.53  1.20 Y 
13 1 "O4'" B DG -3  ? ? "C4'" B DG -3  ? ? "C3'" B DG -3  ? ? 110.96 106.00 4.96   0.60 N 
14 1 "C3'" B DG -3  ? ? "O3'" B DG -3  ? ? P     B DA -2  ? ? 130.42 119.70 10.72  1.20 Y 
15 1 "O4'" B DA -2  ? ? "C4'" B DA -2  ? ? "C3'" B DA -2  ? ? 110.25 106.00 4.25   0.60 N 
16 1 "C3'" B DA -2  ? ? "O3'" B DA -2  ? ? P     B DC -1  ? ? 127.95 119.70 8.25   1.20 Y 
17 1 "O4'" B DC -1  ? ? "C1'" B DC -1  ? ? N1    B DC -1  ? ? 103.13 108.00 -4.87  0.70 N 
18 1 "C3'" B DG 1   ? ? "O3'" B DG 1   ? ? P     B DT 2   ? ? 133.97 119.70 14.27  1.20 Y 
19 1 N1    B DT 2   ? ? C2    B DT 2   ? ? N3    B DT 2   ? ? 118.21 114.60 3.61   0.60 N 
20 1 N3    B DT 2   ? ? C2    B DT 2   ? ? O2    B DT 2   ? ? 117.64 122.30 -4.66  0.60 N 
21 1 "O4'" B DC 3   ? ? "C1'" B DC 3   ? ? "C2'" B DC 3   ? ? 99.80  105.90 -6.10  0.80 N 
22 1 "O4'" B DC 3   ? ? "C1'" B DC 3   ? ? N1    B DC 3   ? ? 111.80 108.30 3.50   0.30 N 
23 1 N1    B DC 3   ? ? C2    B DC 3   ? ? O2    B DC 3   ? ? 124.34 118.90 5.44   0.60 N 
24 1 "O4'" B DA 4   ? ? "C1'" B DA 4   ? ? N9    B DA 4   ? ? 103.67 108.00 -4.33  0.70 N 
25 1 "C3'" B DA 4   ? ? "O3'" B DA 4   ? ? P     B DT 5   ? ? 130.63 119.70 10.93  1.20 Y 
26 1 "C5'" B DT 5   ? ? "C4'" B DT 5   ? ? "C3'" B DT 5   ? ? 101.92 114.10 -12.18 1.80 N 
27 1 "C5'" B DT 5   ? ? "C4'" B DT 5   ? ? "O4'" B DT 5   ? ? 116.60 109.80 6.80   1.10 N 
28 1 "C1'" B DT 5   ? ? "O4'" B DT 5   ? ? "C4'" B DT 5   ? ? 103.04 110.10 -7.06  1.00 N 
29 1 C4    B DT 5   ? ? C5    B DT 5   ? ? C6    B DT 5   ? ? 122.02 118.00 4.02   0.60 N 
30 1 C6    B DT 5   ? ? C5    B DT 5   ? ? C7    B DT 5   ? ? 118.38 122.90 -4.52  0.60 N 
31 1 "O4'" B DC 6   ? ? "C1'" B DC 6   ? ? "C2'" B DC 6   ? ? 100.58 105.90 -5.32  0.80 N 
32 1 "O4'" B DC 6   ? ? "C1'" B DC 6   ? ? N1    B DC 6   ? ? 112.36 108.30 4.06   0.30 N 
33 1 N1    B DC 6   ? ? C2    B DC 6   ? ? O2    B DC 6   ? ? 123.06 118.90 4.16   0.60 N 
34 1 "C5'" B DT 7   ? ? "C4'" B DT 7   ? ? "C3'" B DT 7   ? ? 102.97 114.10 -11.13 1.80 N 
35 1 N3    B DT 7   ? ? C2    B DT 7   ? ? O2    B DT 7   ? ? 116.95 122.30 -5.35  0.60 N 
36 1 "O4'" B DC 8   ? ? "C1'" B DC 8   ? ? N1    B DC 8   ? ? 112.75 108.30 4.45   0.30 N 
37 1 N1    B DC 8   ? ? C2    B DC 8   ? ? O2    B DC 8   ? ? 123.61 118.90 4.71   0.60 N 
38 1 N3    B DC 8   ? ? C2    B DC 8   ? ? O2    B DC 8   ? ? 117.60 121.90 -4.30  0.70 N 
39 1 "C3'" B DC 8   ? ? "O3'" B DC 8   ? ? P     B DC 9   ? ? 130.00 119.70 10.30  1.20 Y 
40 1 "O4'" B DC 9   ? ? "C1'" B DC 9   ? ? N1    B DC 9   ? ? 111.64 108.30 3.34   0.30 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 276 ? CG  ? B LYS 58 CG  
2 1 Y 1 A LYS 276 ? CD  ? B LYS 58 CD  
3 1 Y 1 A LYS 276 ? CE  ? B LYS 58 CE  
4 1 Y 1 A LYS 276 ? NZ  ? B LYS 58 NZ  
5 1 Y 1 A LEU 277 ? CG  ? B LEU 59 CG  
6 1 Y 1 A LEU 277 ? CD1 ? B LEU 59 CD1 
7 1 Y 1 A LEU 277 ? CD2 ? B LEU 59 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 219 ? B MET 1  
2  1 Y 1 A ILE 220 ? B ILE 2  
3  1 Y 1 A VAL 221 ? B VAL 3  
4  1 Y 1 A PRO 222 ? B PRO 4  
5  1 Y 1 A GLU 223 ? B GLU 5  
6  1 Y 1 A SER 224 ? B SER 6  
7  1 Y 1 A SER 225 ? B SER 7  
8  1 Y 1 A ASP 226 ? B ASP 8  
9  1 Y 1 A PRO 227 ? B PRO 9  
10 1 Y 1 A ALA 228 ? B ALA 10 
11 1 Y 1 A VAL 278 ? B VAL 60 
12 1 Y 1 A GLY 279 ? B GLY 61 
13 1 Y 1 A GLU 280 ? B GLU 62 
14 1 Y 1 A ARG 281 ? B ARG 63 
# 
_ndb_struct_conf_na.entry_id   2DGC 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 A DC 19 8_775 -0.412 -0.637 0.001  -1.072 -7.222  -0.816 1  B_DG-9:DC9_B B -9 ? B 9  ? 19 1 
1 A DG 3  1_555 A DC 18 8_775 -0.503 -0.656 0.155  4.147  1.692   -5.297 2  B_DG-8:DC8_B B -8 ? B 8  ? 19 1 
1 A DA 4  1_555 A DT 17 8_775 0.064  -0.506 0.010  0.148  -9.951  0.184  3  B_DA-7:DT7_B B -7 ? B 7  ? 20 1 
1 A DG 5  1_555 A DC 16 8_775 -0.245 -0.270 -0.258 -0.393 -13.066 1.894  4  B_DG-6:DC6_B B -6 ? B 6  ? 19 1 
1 A DA 6  1_555 A DT 15 8_775 0.300  -0.175 0.236  -2.346 -10.316 6.510  5  B_DA-5:DT5_B B -5 ? B 5  ? 20 1 
1 A DT 7  1_555 A DA 14 8_775 0.098  -0.367 0.516  1.580  -10.495 1.592  6  B_DT-4:DA4_B B -4 ? B 4  ? 20 1 
1 A DG 8  1_555 A DC 13 8_775 -0.184 -0.231 -0.008 -3.513 -10.423 -0.715 7  B_DG-3:DC3_B B -3 ? B 3  ? 19 1 
1 A DA 9  1_555 A DT 12 8_775 -0.260 -0.201 -0.182 3.660  -8.678  0.658  8  B_DA-2:DT2_B B -2 ? B 2  ? 20 1 
1 A DC 10 1_555 A DG 11 8_775 0.295  -0.093 0.072  -4.747 -12.407 1.330  9  B_DC-1:DG1_B B -1 ? B 1  ? 19 1 
1 A DG 11 1_555 A DC 10 8_775 -0.295 -0.093 0.072  4.747  -12.407 1.330  10 B_DG1:DC-1_B B 1  ? B -1 ? 19 1 
1 A DT 12 1_555 A DA 9  8_775 0.260  -0.201 -0.182 -3.660 -8.678  0.658  11 B_DT2:DA-2_B B 2  ? B -2 ? 20 1 
1 A DC 13 1_555 A DG 8  8_775 0.184  -0.231 -0.008 3.513  -10.423 -0.715 12 B_DC3:DG-3_B B 3  ? B -3 ? 19 1 
1 A DA 14 1_555 A DT 7  8_775 -0.098 -0.367 0.516  -1.580 -10.495 1.592  13 B_DA4:DT-4_B B 4  ? B -4 ? 20 1 
1 A DT 15 1_555 A DA 6  8_775 -0.300 -0.175 0.236  2.346  -10.316 6.510  14 B_DT5:DA-5_B B 5  ? B -5 ? 20 1 
1 A DC 16 1_555 A DG 5  8_775 0.245  -0.270 -0.258 0.393  -13.066 1.894  15 B_DC6:DG-6_B B 6  ? B -6 ? 19 1 
1 A DT 17 1_555 A DA 4  8_775 -0.064 -0.506 0.010  -0.148 -9.951  0.184  16 B_DT7:DA-7_B B 7  ? B -7 ? 20 1 
1 A DC 18 1_555 A DG 3  8_775 0.503  -0.656 0.155  -4.147 1.692   -5.297 17 B_DC8:DG-8_B B 8  ? B -8 ? 19 1 
1 A DC 19 1_555 A DG 2  8_775 0.412  -0.637 0.001  1.072  -7.222  -0.816 18 B_DC9:DG-9_B B 9  ? B -9 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 A DC 19 8_775 A DG 3  1_555 A DC 18 8_775 0.070  0.251  3.278 -0.381 0.536  30.346 0.372  -0.210 3.281 1.023  
0.727  30.353 1  BB_DG-9DG-8:DC8DC9_BB B -9 ? B 9  ? B -8 ? B 8  ? 
1 A DG 3  1_555 A DC 18 8_775 A DA 4  1_555 A DT 17 8_775 -0.308 0.217  3.595 1.081  4.914  40.082 -0.294 0.580  3.586 7.136  
-1.570 40.384 2  BB_DG-8DA-7:DT7DC8_BB B -8 ? B 8  ? B -7 ? B 7  ? 
1 A DA 4  1_555 A DT 17 8_775 A DG 5  1_555 A DC 16 8_775 0.014  -0.143 3.497 1.915  5.290  28.312 -1.542 0.427  3.408 10.682 
-3.867 28.855 3  BB_DA-7DG-6:DC6DT7_BB B -7 ? B 7  ? B -6 ? B 6  ? 
1 A DG 5  1_555 A DC 16 8_775 A DA 6  1_555 A DT 15 8_775 -0.022 -0.074 3.245 -6.943 5.045  43.921 -0.554 -0.601 3.186 6.670  
9.178  44.711 4  BB_DG-6DA-5:DT5DC6_BB B -6 ? B 6  ? B -5 ? B 5  ? 
1 A DA 6  1_555 A DT 15 8_775 A DT 7  1_555 A DA 14 8_775 -0.366 -0.677 3.387 -2.923 -4.370 25.326 -0.226 -0.044 3.471 -9.832 
6.576  25.857 5  BB_DA-5DT-4:DA4DT5_BB B -5 ? B 5  ? B -4 ? B 4  ? 
1 A DT 7  1_555 A DA 14 8_775 A DG 8  1_555 A DC 13 8_775 -0.590 0.199  3.380 1.684  7.565  40.123 -0.576 1.037  3.335 10.904 
-2.427 40.835 6  BB_DT-4DG-3:DC3DA4_BB B -4 ? B 4  ? B -3 ? B 3  ? 
1 A DG 8  1_555 A DC 13 8_775 A DA 9  1_555 A DT 12 8_775 0.091  -0.072 3.119 0.321  6.942  33.019 -1.197 -0.107 3.042 12.048 
-0.558 33.722 7  BB_DG-3DA-2:DT2DC3_BB B -3 ? B 3  ? B -2 ? B 2  ? 
1 A DA 9  1_555 A DT 12 8_775 A DC 10 1_555 A DG 11 8_775 0.086  -0.619 3.627 -3.048 1.147  34.856 -1.221 -0.650 3.585 1.910  
5.075  35.003 8  BB_DA-2DC-1:DG1DT2_BB B -2 ? B 2  ? B -1 ? B 1  ? 
1 A DC 10 1_555 A DG 11 8_775 A DG 11 1_555 A DC 10 8_775 0.000  0.449  3.209 0.000  11.432 28.629 -1.410 0.000  3.152 22.041 
0.000  30.783 9  BB_DC-1DG1:DC-1DG1_BB B -1 ? B 1  ? B 1  ? B -1 ? 
1 A DG 11 1_555 A DC 10 8_775 A DT 12 1_555 A DA 9  8_775 -0.086 -0.619 3.627 3.048  1.147  34.856 -1.221 0.650  3.585 1.910  
-5.075 35.003 10 BB_DG1DT2:DA-2DC-1_BB B 1  ? B -1 ? B 2  ? B -2 ? 
1 A DT 12 1_555 A DA 9  8_775 A DC 13 1_555 A DG 8  8_775 -0.091 -0.072 3.119 -0.322 6.942  33.019 -1.197 0.107  3.042 12.048 
0.558  33.722 11 BB_DT2DC3:DG-3DA-2_BB B 2  ? B -2 ? B 3  ? B -3 ? 
1 A DC 13 1_555 A DG 8  8_775 A DA 14 1_555 A DT 7  8_775 0.590  0.199  3.380 -1.684 7.565  40.123 -0.576 -1.037 3.335 10.904 
2.427  40.835 12 BB_DC3DA4:DT-4DG-3_BB B 3  ? B -3 ? B 4  ? B -4 ? 
1 A DA 14 1_555 A DT 7  8_775 A DT 15 1_555 A DA 6  8_775 0.366  -0.677 3.387 2.923  -4.370 25.326 -0.226 0.044  3.471 -9.832 
-6.576 25.857 13 BB_DA4DT5:DA-5DT-4_BB B 4  ? B -4 ? B 5  ? B -5 ? 
1 A DT 15 1_555 A DA 6  8_775 A DC 16 1_555 A DG 5  8_775 0.022  -0.074 3.245 6.943  5.045  43.921 -0.554 0.601  3.186 6.670  
-9.178 44.711 14 BB_DT5DC6:DG-6DA-5_BB B 5  ? B -5 ? B 6  ? B -6 ? 
1 A DC 16 1_555 A DG 5  8_775 A DT 17 1_555 A DA 4  8_775 -0.014 -0.143 3.497 -1.915 5.290  28.312 -1.542 -0.427 3.408 10.682 
3.867  28.855 15 BB_DC6DT7:DA-7DG-6_BB B 6  ? B -6 ? B 7  ? B -7 ? 
1 A DT 17 1_555 A DA 4  8_775 A DC 18 1_555 A DG 3  8_775 0.308  0.217  3.595 -1.081 4.914  40.082 -0.294 -0.580 3.586 7.136  
1.570  40.384 16 BB_DT7DC8:DG-8DA-7_BB B 7  ? B -7 ? B 8  ? B -8 ? 
1 A DC 18 1_555 A DG 3  8_775 A DC 19 1_555 A DG 2  8_775 -0.070 0.251  3.278 0.381  0.536  30.346 0.372  0.210  3.281 1.023  
-0.727 30.353 17 BB_DC8DC9:DG-9DG-8_BB B 8  ? B -8 ? B 9  ? B -9 ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#