data_2DJ0
# 
_entry.id   2DJ0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2DJ0         pdb_00002dj0 10.2210/pdb2dj0/pdb 
RCSB  RCSB025469   ?            ?                   
WWPDB D_1000025469 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002004346.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DJ0 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-30 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tochio, N.'                                             1 
'Koshiba, S.'                                            2 
'Inoue, M.'                                              3 
'Kigawa, T.'                                             4 
'Yokoyama, S.'                                           5 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 
# 
_citation.id                        primary 
_citation.title                     
'The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tochio, N.'   1 ? 
primary 'Koshiba, S.'  2 ? 
primary 'Inoue, M.'    3 ? 
primary 'Kigawa, T.'   4 ? 
primary 'Yokoyama, S.' 5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Thioredoxin-related transmembrane protein 2' 
_entity.formula_weight             15529.339 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Thioredoxin domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVS
TSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELSGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVS
TSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELSGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002004346.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   TYR n 
1 9   ILE n 
1 10  LYS n 
1 11  TYR n 
1 12  PHE n 
1 13  ASN n 
1 14  ASP n 
1 15  LYS n 
1 16  THR n 
1 17  ILE n 
1 18  ASP n 
1 19  GLU n 
1 20  GLU n 
1 21  LEU n 
1 22  GLU n 
1 23  ARG n 
1 24  ASP n 
1 25  LYS n 
1 26  ARG n 
1 27  VAL n 
1 28  THR n 
1 29  TRP n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  PHE n 
1 34  PHE n 
1 35  ALA n 
1 36  ASN n 
1 37  TRP n 
1 38  SER n 
1 39  ASN n 
1 40  ASP n 
1 41  CYS n 
1 42  GLN n 
1 43  SER n 
1 44  PHE n 
1 45  ALA n 
1 46  PRO n 
1 47  ILE n 
1 48  TYR n 
1 49  ALA n 
1 50  ASP n 
1 51  LEU n 
1 52  SER n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  ASN n 
1 57  CYS n 
1 58  THR n 
1 59  GLY n 
1 60  LEU n 
1 61  ASN n 
1 62  PHE n 
1 63  GLY n 
1 64  LYS n 
1 65  VAL n 
1 66  ASP n 
1 67  VAL n 
1 68  GLY n 
1 69  ARG n 
1 70  TYR n 
1 71  THR n 
1 72  ASP n 
1 73  VAL n 
1 74  SER n 
1 75  THR n 
1 76  ARG n 
1 77  TYR n 
1 78  LYS n 
1 79  VAL n 
1 80  SER n 
1 81  THR n 
1 82  SER n 
1 83  PRO n 
1 84  LEU n 
1 85  THR n 
1 86  LYS n 
1 87  GLN n 
1 88  LEU n 
1 89  PRO n 
1 90  THR n 
1 91  LEU n 
1 92  ILE n 
1 93  LEU n 
1 94  PHE n 
1 95  GLN n 
1 96  GLY n 
1 97  GLY n 
1 98  LYS n 
1 99  GLU n 
1 100 ALA n 
1 101 MET n 
1 102 ARG n 
1 103 ARG n 
1 104 PRO n 
1 105 GLN n 
1 106 ILE n 
1 107 ASP n 
1 108 LYS n 
1 109 LYS n 
1 110 GLY n 
1 111 ARG n 
1 112 ALA n 
1 113 VAL n 
1 114 SER n 
1 115 TRP n 
1 116 THR n 
1 117 PHE n 
1 118 SER n 
1 119 GLU n 
1 120 GLU n 
1 121 ASN n 
1 122 VAL n 
1 123 ILE n 
1 124 ARG n 
1 125 GLU n 
1 126 PHE n 
1 127 ASN n 
1 128 LEU n 
1 129 ASN n 
1 130 GLU n 
1 131 LEU n 
1 132 SER n 
1 133 GLY n 
1 134 PRO n 
1 135 SER n 
1 136 SER n 
1 137 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TXNDC14 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050314-13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAH00666 
_struct_ref.pdbx_db_accession          12653761 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           137 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DJ0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 131 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             12653761 
_struct_ref_seq.db_align_beg                  137 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  260 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DJ0 GLY A 1   ? GB 12653761 ? ? 'cloning artifact' 1   1  
1 2DJ0 SER A 2   ? GB 12653761 ? ? 'cloning artifact' 2   2  
1 2DJ0 SER A 3   ? GB 12653761 ? ? 'cloning artifact' 3   3  
1 2DJ0 GLY A 4   ? GB 12653761 ? ? 'cloning artifact' 4   4  
1 2DJ0 SER A 5   ? GB 12653761 ? ? 'cloning artifact' 5   5  
1 2DJ0 SER A 6   ? GB 12653761 ? ? 'cloning artifact' 6   6  
1 2DJ0 GLY A 7   ? GB 12653761 ? ? 'cloning artifact' 7   7  
1 2DJ0 SER A 132 ? GB 12653761 ? ? 'cloning artifact' 132 8  
1 2DJ0 GLY A 133 ? GB 12653761 ? ? 'cloning artifact' 133 9  
1 2DJ0 PRO A 134 ? GB 12653761 ? ? 'cloning artifact' 134 10 
1 2DJ0 SER A 135 ? GB 12653761 ? ? 'cloning artifact' 135 11 
1 2DJ0 SER A 136 ? GB 12653761 ? ? 'cloning artifact' 136 12 
1 2DJ0 GLY A 137 ? GB 12653761 ? ? 'cloning artifact' 137 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;0.4mM Thioredoxin domain U-15N,13C; 20mM d-Tris HCl; 100mM NaCl; 
1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    900 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DJ0 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DJ0 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DJ0 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XwinNMR 3.5      Bruker          1 
processing           NMRPipe 20031121 'Delaglio, F.'  2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      KUJIRA  0.955    'Kobayashi, N.' 4 
'structure solution' CYANA   2.0.17   'Guntert, P.'   5 
refinement           CYANA   2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DJ0 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DJ0 
_struct.title                     
'The solution structure of the thioredoxin domain of human Thioredoxin-related transmembrane protein 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DJ0 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;AVLA237, CGI-31 protein, TXNDC14, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 15  ? ASP A 24  ? LYS A 15  ASP A 24  1 ? 10 
HELX_P HELX_P2 2 PHE A 44  ? ASN A 56  ? PHE A 44  ASN A 56  1 ? 13 
HELX_P HELX_P3 3 TYR A 70  ? TYR A 77  ? TYR A 70  TYR A 77  1 ? 8  
HELX_P HELX_P4 4 SER A 118 ? ASN A 127 ? SER A 118 ASN A 127 1 ? 10 
HELX_P HELX_P5 5 ASN A 127 ? SER A 132 ? ASN A 127 SER A 132 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 1  -0.12 
2  ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 1  -0.05 
3  LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 2  -0.14 
4  ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 2  0.05  
5  LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 3  -0.09 
6  ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 3  0.01  
7  LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 4  -0.07 
8  ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 4  -0.02 
9  LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 5  -0.14 
10 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 5  0.01  
11 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 6  -0.16 
12 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 6  0.09  
13 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 7  -0.15 
14 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 7  -0.01 
15 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 8  -0.14 
16 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 8  0.02  
17 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 9  -0.16 
18 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 9  -0.01 
19 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 10 -0.08 
20 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 10 0.09  
21 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 11 -0.12 
22 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 11 0.02  
23 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 12 -0.18 
24 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 12 -0.02 
25 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 13 -0.15 
26 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 13 -0.03 
27 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 14 -0.12 
28 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 14 0.03  
29 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 15 -0.13 
30 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 15 0.00  
31 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 16 -0.12 
32 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 16 0.02  
33 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 17 -0.04 
34 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 17 -0.09 
35 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 18 -0.11 
36 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 18 -0.03 
37 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 19 -0.12 
38 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 19 0.05  
39 LEU 88  A . ? LEU 88  A PRO 89  A ? PRO 89  A 20 -0.14 
40 ARG 103 A . ? ARG 103 A PRO 104 A ? PRO 104 A 20 0.01  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 10 ? TYR A 11  ? LYS A 10 TYR A 11  
A 2 ASN A 61 ? LYS A 64  ? ASN A 61 LYS A 64  
A 3 TRP A 29 ? PHE A 33  ? TRP A 29 PHE A 33  
A 4 THR A 90 ? PHE A 94  ? THR A 90 PHE A 94  
A 5 GLU A 99 ? ARG A 103 ? GLU A 99 ARG A 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 10 ? N LYS A 10 O PHE A 62  ? O PHE A 62  
A 2 3 O GLY A 63 ? O GLY A 63 N ILE A 30  ? N ILE A 30  
A 3 4 N PHE A 33 ? N PHE A 33 O THR A 90  ? O THR A 90  
A 4 5 N LEU A 93 ? N LEU A 93 O MET A 101 ? O MET A 101 
# 
_database_PDB_matrix.entry_id          2DJ0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DJ0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 13.379  -3.966  -24.800 1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 12.670  -5.107  -24.251 1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 12.502  -5.017  -22.748 1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 13.180  -5.718  -21.997 1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 13.711  -3.264  -24.202 1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? 11.694  -5.165  -24.709 1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? 13.221  -6.006  -24.487 1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? 11.596  -4.150  -22.306 1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? 11.345  -3.966  -20.882 1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? 12.596  -3.462  -20.170 1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? 12.927  -3.917  -19.075 1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? 10.879  -5.279  -20.251 1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? 10.601  -5.112  -18.871 1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? 11.087  -3.619  -22.954 1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? 10.563  -3.228  -20.775 1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? 9.982   -5.616  -20.747 1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? 11.654  -6.024  -20.362 1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? 10.564  -5.972  -18.445 1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? 13.289  -2.519  -20.800 1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? 14.507  -1.955  -20.230 1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? 14.444  -0.431  -20.212 1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? 14.351  0.210   -21.258 1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? 15.730  -2.417  -21.027 1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? 15.697  -1.910  -22.350 1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? 12.975  -2.197  -21.671 1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? 14.594  -2.312  -19.215 1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? 16.627  -2.064  -20.541 1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? 15.743  -3.496  -21.067 1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? 15.958  -2.601  -22.964 1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? 14.495  0.143   -19.014 1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? 14.441  1.587   -18.881 1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? 13.331  2.043   -17.955 1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? 12.411  2.745   -18.377 1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? 14.569  -0.419  -18.214 1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? 15.386  1.937   -18.492 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? 14.282  2.022   -19.857 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? 13.415  1.643   -16.690 1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? 12.406  2.011   -15.704 1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? 13.053  2.643   -14.475 1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? 14.014  2.108   -13.922 1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? 11.593  0.782   -15.292 1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? 10.969  0.184   -16.415 1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? 14.172  1.086   -16.415 1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? 11.745  2.733   -16.159 1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? 12.248  0.058   -14.832 1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? 10.831  1.078   -14.586 1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? 11.480  0.373   -17.204 1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? 12.518  3.784   -14.053 1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? 13.044  4.492   -12.892 1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? 11.911  4.984   -11.996 1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? 10.956  5.600   -12.466 1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? 13.907  5.674   -13.337 1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? 14.774  6.093   -12.297 1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? 11.752  4.160   -14.536 1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? 13.656  3.801   -12.332 1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? 14.502  5.382   -14.189 1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? 13.267  6.500   -13.611 1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? 14.963  5.350   -11.719 1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? 12.026  4.706   -10.701 1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? 11.006  5.126   -9.758  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? 9.612   5.069   -10.350 1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? 8.953   6.098   -10.507 1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? 12.811  4.211   -10.383 1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? 11.045  4.483   -8.892  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? 11.212  6.141   -9.451  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . TYR A 1 8   ? 9.160   3.864   -10.681 1.00 0.00 ? 8   TYR A N    1  
ATOM 67    C CA   . TYR A 1 8   ? 7.836   3.677   -11.263 1.00 0.00 ? 8   TYR A CA   1  
ATOM 68    C C    . TYR A 1 8   ? 6.969   2.794   -10.371 1.00 0.00 ? 8   TYR A C    1  
ATOM 69    O O    . TYR A 1 8   ? 7.375   1.700   -9.979  1.00 0.00 ? 8   TYR A O    1  
ATOM 70    C CB   . TYR A 1 8   ? 7.952   3.057   -12.656 1.00 0.00 ? 8   TYR A CB   1  
ATOM 71    C CG   . TYR A 1 8   ? 8.095   1.552   -12.639 1.00 0.00 ? 8   TYR A CG   1  
ATOM 72    C CD1  . TYR A 1 8   ? 9.250   0.950   -12.156 1.00 0.00 ? 8   TYR A CD1  1  
ATOM 73    C CD2  . TYR A 1 8   ? 7.076   0.732   -13.108 1.00 0.00 ? 8   TYR A CD2  1  
ATOM 74    C CE1  . TYR A 1 8   ? 9.386   -0.425  -12.139 1.00 0.00 ? 8   TYR A CE1  1  
ATOM 75    C CE2  . TYR A 1 8   ? 7.202   -0.643  -13.093 1.00 0.00 ? 8   TYR A CE2  1  
ATOM 76    C CZ   . TYR A 1 8   ? 8.359   -1.217  -12.608 1.00 0.00 ? 8   TYR A CZ   1  
ATOM 77    O OH   . TYR A 1 8   ? 8.489   -2.587  -12.594 1.00 0.00 ? 8   TYR A OH   1  
ATOM 78    H H    . TYR A 1 8   ? 9.731   3.082   -10.532 1.00 0.00 ? 8   TYR A H    1  
ATOM 79    H HA   . TYR A 1 8   ? 7.372   4.649   -11.349 1.00 0.00 ? 8   TYR A HA   1  
ATOM 80    H HB2  . TYR A 1 8   ? 7.067   3.299   -13.225 1.00 0.00 ? 8   TYR A HB2  1  
ATOM 81    H HB3  . TYR A 1 8   ? 8.818   3.468   -13.155 1.00 0.00 ? 8   TYR A HB3  1  
ATOM 82    H HD1  . TYR A 1 8   ? 10.053  1.573   -11.789 1.00 0.00 ? 8   TYR A HD1  1  
ATOM 83    H HD2  . TYR A 1 8   ? 6.171   1.185   -13.487 1.00 0.00 ? 8   TYR A HD2  1  
ATOM 84    H HE1  . TYR A 1 8   ? 10.291  -0.874  -11.760 1.00 0.00 ? 8   TYR A HE1  1  
ATOM 85    H HE2  . TYR A 1 8   ? 6.398   -1.264  -13.461 1.00 0.00 ? 8   TYR A HE2  1  
ATOM 86    H HH   . TYR A 1 8   ? 8.770   -2.872  -11.721 1.00 0.00 ? 8   TYR A HH   1  
ATOM 87    N N    . ILE A 1 9   ? 5.773   3.277   -10.055 1.00 0.00 ? 9   ILE A N    1  
ATOM 88    C CA   . ILE A 1 9   ? 4.847   2.532   -9.211  1.00 0.00 ? 9   ILE A CA   1  
ATOM 89    C C    . ILE A 1 9   ? 3.494   2.363   -9.895  1.00 0.00 ? 9   ILE A C    1  
ATOM 90    O O    . ILE A 1 9   ? 3.072   3.213   -10.680 1.00 0.00 ? 9   ILE A O    1  
ATOM 91    C CB   . ILE A 1 9   ? 4.639   3.227   -7.852  1.00 0.00 ? 9   ILE A CB   1  
ATOM 92    C CG1  . ILE A 1 9   ? 5.957   3.282   -7.077  1.00 0.00 ? 9   ILE A CG1  1  
ATOM 93    C CG2  . ILE A 1 9   ? 3.573   2.502   -7.045  1.00 0.00 ? 9   ILE A CG2  1  
ATOM 94    C CD1  . ILE A 1 9   ? 5.943   4.272   -5.933  1.00 0.00 ? 9   ILE A CD1  1  
ATOM 95    H H    . ILE A 1 9   ? 5.506   4.156   -10.398 1.00 0.00 ? 9   ILE A H    1  
ATOM 96    H HA   . ILE A 1 9   ? 5.272   1.555   -9.032  1.00 0.00 ? 9   ILE A HA   1  
ATOM 97    H HB   . ILE A 1 9   ? 4.295   4.233   -8.037  1.00 0.00 ? 9   ILE A HB   1  
ATOM 98    H HG12 . ILE A 1 9   ? 6.169   2.307   -6.669  1.00 0.00 ? 9   ILE A HG12 1  
ATOM 99    H HG13 . ILE A 1 9   ? 6.751   3.566   -7.752  1.00 0.00 ? 9   ILE A HG13 1  
ATOM 100   H HG21 . ILE A 1 9   ? 2.597   2.876   -7.319  1.00 0.00 ? 9   ILE A HG21 1  
ATOM 101   H HG22 . ILE A 1 9   ? 3.623   1.444   -7.251  1.00 0.00 ? 9   ILE A HG22 1  
ATOM 102   H HG23 . ILE A 1 9   ? 3.741   2.673   -5.992  1.00 0.00 ? 9   ILE A HG23 1  
ATOM 103   H HD11 . ILE A 1 9   ? 5.589   3.782   -5.038  1.00 0.00 ? 9   ILE A HD11 1  
ATOM 104   H HD12 . ILE A 1 9   ? 6.942   4.646   -5.768  1.00 0.00 ? 9   ILE A HD12 1  
ATOM 105   H HD13 . ILE A 1 9   ? 5.286   5.094   -6.176  1.00 0.00 ? 9   ILE A HD13 1  
ATOM 106   N N    . LYS A 1 10  ? 2.817   1.262   -9.591  1.00 0.00 ? 10  LYS A N    1  
ATOM 107   C CA   . LYS A 1 10  ? 1.510   0.981   -10.172 1.00 0.00 ? 10  LYS A CA   1  
ATOM 108   C C    . LYS A 1 10  ? 0.391   1.459   -9.252  1.00 0.00 ? 10  LYS A C    1  
ATOM 109   O O    . LYS A 1 10  ? 0.160   0.884   -8.189  1.00 0.00 ? 10  LYS A O    1  
ATOM 110   C CB   . LYS A 1 10  ? 1.359   -0.518  -10.440 1.00 0.00 ? 10  LYS A CB   1  
ATOM 111   C CG   . LYS A 1 10  ? 0.319   -0.845  -11.498 1.00 0.00 ? 10  LYS A CG   1  
ATOM 112   C CD   . LYS A 1 10  ? 0.536   -2.230  -12.084 1.00 0.00 ? 10  LYS A CD   1  
ATOM 113   C CE   . LYS A 1 10  ? -0.769  -2.840  -12.572 1.00 0.00 ? 10  LYS A CE   1  
ATOM 114   N NZ   . LYS A 1 10  ? -1.146  -2.337  -13.921 1.00 0.00 ? 10  LYS A NZ   1  
ATOM 115   H H    . LYS A 1 10  ? 3.205   0.621   -8.958  1.00 0.00 ? 10  LYS A H    1  
ATOM 116   H HA   . LYS A 1 10  ? 1.442   1.514   -11.109 1.00 0.00 ? 10  LYS A HA   1  
ATOM 117   H HB2  . LYS A 1 10  ? 2.310   -0.911  -10.767 1.00 0.00 ? 10  LYS A HB2  1  
ATOM 118   H HB3  . LYS A 1 10  ? 1.073   -1.009  -9.521  1.00 0.00 ? 10  LYS A HB3  1  
ATOM 119   H HG2  . LYS A 1 10  ? -0.663  -0.806  -11.050 1.00 0.00 ? 10  LYS A HG2  1  
ATOM 120   H HG3  . LYS A 1 10  ? 0.384   -0.115  -12.292 1.00 0.00 ? 10  LYS A HG3  1  
ATOM 121   H HD2  . LYS A 1 10  ? 1.219   -2.157  -12.917 1.00 0.00 ? 10  LYS A HD2  1  
ATOM 122   H HD3  . LYS A 1 10  ? 0.960   -2.871  -11.323 1.00 0.00 ? 10  LYS A HD3  1  
ATOM 123   H HE2  . LYS A 1 10  ? -0.656  -3.913  -12.615 1.00 0.00 ? 10  LYS A HE2  1  
ATOM 124   H HE3  . LYS A 1 10  ? -1.552  -2.589  -11.871 1.00 0.00 ? 10  LYS A HE3  1  
ATOM 125   H HZ1  . LYS A 1 10  ? -0.294  -2.204  -14.503 1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 126   H HZ2  . LYS A 1 10  ? -1.641  -1.426  -13.838 1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 127   H HZ3  . LYS A 1 10  ? -1.773  -3.018  -14.395 1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 128   N N    . TYR A 1 11  ? -0.302  2.513   -9.669  1.00 0.00 ? 11  TYR A N    1  
ATOM 129   C CA   . TYR A 1 11  ? -1.397  3.068   -8.882  1.00 0.00 ? 11  TYR A CA   1  
ATOM 130   C C    . TYR A 1 11  ? -2.656  2.220   -9.026  1.00 0.00 ? 11  TYR A C    1  
ATOM 131   O O    . TYR A 1 11  ? -2.783  1.428   -9.961  1.00 0.00 ? 11  TYR A O    1  
ATOM 132   C CB   . TYR A 1 11  ? -1.685  4.507   -9.315  1.00 0.00 ? 11  TYR A CB   1  
ATOM 133   C CG   . TYR A 1 11  ? -0.571  5.474   -8.983  1.00 0.00 ? 11  TYR A CG   1  
ATOM 134   C CD1  . TYR A 1 11  ? 0.532   5.606   -9.817  1.00 0.00 ? 11  TYR A CD1  1  
ATOM 135   C CD2  . TYR A 1 11  ? -0.621  6.255   -7.835  1.00 0.00 ? 11  TYR A CD2  1  
ATOM 136   C CE1  . TYR A 1 11  ? 1.553   6.487   -9.518  1.00 0.00 ? 11  TYR A CE1  1  
ATOM 137   C CE2  . TYR A 1 11  ? 0.394   7.140   -7.528  1.00 0.00 ? 11  TYR A CE2  1  
ATOM 138   C CZ   . TYR A 1 11  ? 1.479   7.252   -8.372  1.00 0.00 ? 11  TYR A CZ   1  
ATOM 139   O OH   . TYR A 1 11  ? 2.493   8.132   -8.070  1.00 0.00 ? 11  TYR A OH   1  
ATOM 140   H H    . TYR A 1 11  ? -0.072  2.928   -10.526 1.00 0.00 ? 11  TYR A H    1  
ATOM 141   H HA   . TYR A 1 11  ? -1.093  3.068   -7.846  1.00 0.00 ? 11  TYR A HA   1  
ATOM 142   H HB2  . TYR A 1 11  ? -1.837  4.531   -10.383 1.00 0.00 ? 11  TYR A HB2  1  
ATOM 143   H HB3  . TYR A 1 11  ? -2.582  4.851   -8.820  1.00 0.00 ? 11  TYR A HB3  1  
ATOM 144   H HD1  . TYR A 1 11  ? 0.587   5.005   -10.714 1.00 0.00 ? 11  TYR A HD1  1  
ATOM 145   H HD2  . TYR A 1 11  ? -1.472  6.163   -7.175  1.00 0.00 ? 11  TYR A HD2  1  
ATOM 146   H HE1  . TYR A 1 11  ? 2.402   6.576   -10.179 1.00 0.00 ? 11  TYR A HE1  1  
ATOM 147   H HE2  . TYR A 1 11  ? 0.336   7.739   -6.631  1.00 0.00 ? 11  TYR A HE2  1  
ATOM 148   H HH   . TYR A 1 11  ? 2.971   8.357   -8.871  1.00 0.00 ? 11  TYR A HH   1  
ATOM 149   N N    . PHE A 1 12  ? -3.587  2.391   -8.093  1.00 0.00 ? 12  PHE A N    1  
ATOM 150   C CA   . PHE A 1 12  ? -4.838  1.642   -8.114  1.00 0.00 ? 12  PHE A CA   1  
ATOM 151   C C    . PHE A 1 12  ? -6.012  2.532   -7.718  1.00 0.00 ? 12  PHE A C    1  
ATOM 152   O O    . PHE A 1 12  ? -5.901  3.359   -6.814  1.00 0.00 ? 12  PHE A O    1  
ATOM 153   C CB   . PHE A 1 12  ? -4.753  0.441   -7.170  1.00 0.00 ? 12  PHE A CB   1  
ATOM 154   C CG   . PHE A 1 12  ? -3.790  -0.616  -7.629  1.00 0.00 ? 12  PHE A CG   1  
ATOM 155   C CD1  . PHE A 1 12  ? -3.926  -1.201  -8.878  1.00 0.00 ? 12  PHE A CD1  1  
ATOM 156   C CD2  . PHE A 1 12  ? -2.748  -1.024  -6.812  1.00 0.00 ? 12  PHE A CD2  1  
ATOM 157   C CE1  . PHE A 1 12  ? -3.041  -2.174  -9.303  1.00 0.00 ? 12  PHE A CE1  1  
ATOM 158   C CE2  . PHE A 1 12  ? -1.860  -1.996  -7.233  1.00 0.00 ? 12  PHE A CE2  1  
ATOM 159   C CZ   . PHE A 1 12  ? -2.007  -2.572  -8.479  1.00 0.00 ? 12  PHE A CZ   1  
ATOM 160   H H    . PHE A 1 12  ? -3.428  3.037   -7.373  1.00 0.00 ? 12  PHE A H    1  
ATOM 161   H HA   . PHE A 1 12  ? -4.994  1.287   -9.121  1.00 0.00 ? 12  PHE A HA   1  
ATOM 162   H HB2  . PHE A 1 12  ? -4.434  0.779   -6.196  1.00 0.00 ? 12  PHE A HB2  1  
ATOM 163   H HB3  . PHE A 1 12  ? -5.730  -0.012  -7.087  1.00 0.00 ? 12  PHE A HB3  1  
ATOM 164   H HD1  . PHE A 1 12  ? -4.736  -0.890  -9.523  1.00 0.00 ? 12  PHE A HD1  1  
ATOM 165   H HD2  . PHE A 1 12  ? -2.632  -0.576  -5.837  1.00 0.00 ? 12  PHE A HD2  1  
ATOM 166   H HE1  . PHE A 1 12  ? -3.160  -2.622  -10.279 1.00 0.00 ? 12  PHE A HE1  1  
ATOM 167   H HE2  . PHE A 1 12  ? -1.052  -2.306  -6.586  1.00 0.00 ? 12  PHE A HE2  1  
ATOM 168   H HZ   . PHE A 1 12  ? -1.314  -3.331  -8.810  1.00 0.00 ? 12  PHE A HZ   1  
ATOM 169   N N    . ASN A 1 13  ? -7.137  2.357   -8.404  1.00 0.00 ? 13  ASN A N    1  
ATOM 170   C CA   . ASN A 1 13  ? -8.332  3.145   -8.125  1.00 0.00 ? 13  ASN A CA   1  
ATOM 171   C C    . ASN A 1 13  ? -9.067  2.606   -6.902  1.00 0.00 ? 13  ASN A C    1  
ATOM 172   O O    . ASN A 1 13  ? -8.637  1.630   -6.287  1.00 0.00 ? 13  ASN A O    1  
ATOM 173   C CB   . ASN A 1 13  ? -9.266  3.140   -9.337  1.00 0.00 ? 13  ASN A CB   1  
ATOM 174   C CG   . ASN A 1 13  ? -10.142 4.376   -9.398  1.00 0.00 ? 13  ASN A CG   1  
ATOM 175   O OD1  . ASN A 1 13  ? -9.651  5.503   -9.321  1.00 0.00 ? 13  ASN A OD1  1  
ATOM 176   N ND2  . ASN A 1 13  ? -11.447 4.170   -9.537  1.00 0.00 ? 13  ASN A ND2  1  
ATOM 177   H H    . ASN A 1 13  ? -7.165  1.682   -9.114  1.00 0.00 ? 13  ASN A H    1  
ATOM 178   H HA   . ASN A 1 13  ? -8.021  4.160   -7.926  1.00 0.00 ? 13  ASN A HA   1  
ATOM 179   H HB2  . ASN A 1 13  ? -8.674  3.098   -10.240 1.00 0.00 ? 13  ASN A HB2  1  
ATOM 180   H HB3  . ASN A 1 13  ? -9.904  2.270   -9.290  1.00 0.00 ? 13  ASN A HB3  1  
ATOM 181   H HD21 . ASN A 1 13  ? -11.766 3.246   -9.592  1.00 0.00 ? 13  ASN A HD21 1  
ATOM 182   H HD22 . ASN A 1 13  ? -12.036 4.952   -9.579  1.00 0.00 ? 13  ASN A HD22 1  
ATOM 183   N N    . ASP A 1 14  ? -10.177 3.248   -6.554  1.00 0.00 ? 14  ASP A N    1  
ATOM 184   C CA   . ASP A 1 14  ? -10.972 2.832   -5.405  1.00 0.00 ? 14  ASP A CA   1  
ATOM 185   C C    . ASP A 1 14  ? -11.774 1.574   -5.725  1.00 0.00 ? 14  ASP A C    1  
ATOM 186   O O    . ASP A 1 14  ? -12.170 0.832   -4.827  1.00 0.00 ? 14  ASP A O    1  
ATOM 187   C CB   . ASP A 1 14  ? -11.916 3.958   -4.977  1.00 0.00 ? 14  ASP A CB   1  
ATOM 188   C CG   . ASP A 1 14  ? -12.679 4.549   -6.145  1.00 0.00 ? 14  ASP A CG   1  
ATOM 189   O OD1  . ASP A 1 14  ? -13.664 3.923   -6.590  1.00 0.00 ? 14  ASP A OD1  1  
ATOM 190   O OD2  . ASP A 1 14  ? -12.292 5.640   -6.615  1.00 0.00 ? 14  ASP A OD2  1  
ATOM 191   H H    . ASP A 1 14  ? -10.468 4.020   -7.084  1.00 0.00 ? 14  ASP A H    1  
ATOM 192   H HA   . ASP A 1 14  ? -10.295 2.615   -4.593  1.00 0.00 ? 14  ASP A HA   1  
ATOM 193   H HB2  . ASP A 1 14  ? -12.629 3.569   -4.265  1.00 0.00 ? 14  ASP A HB2  1  
ATOM 194   H HB3  . ASP A 1 14  ? -11.340 4.743   -4.511  1.00 0.00 ? 14  ASP A HB3  1  
ATOM 195   N N    . LYS A 1 15  ? -12.011 1.342   -7.012  1.00 0.00 ? 15  LYS A N    1  
ATOM 196   C CA   . LYS A 1 15  ? -12.764 0.174   -7.453  1.00 0.00 ? 15  LYS A CA   1  
ATOM 197   C C    . LYS A 1 15  ? -11.831 -0.903  -7.995  1.00 0.00 ? 15  LYS A C    1  
ATOM 198   O O    . LYS A 1 15  ? -11.905 -2.065  -7.592  1.00 0.00 ? 15  LYS A O    1  
ATOM 199   C CB   . LYS A 1 15  ? -13.780 0.572   -8.526  1.00 0.00 ? 15  LYS A CB   1  
ATOM 200   C CG   . LYS A 1 15  ? -14.756 -0.536  -8.881  1.00 0.00 ? 15  LYS A CG   1  
ATOM 201   C CD   . LYS A 1 15  ? -15.795 -0.735  -7.791  1.00 0.00 ? 15  LYS A CD   1  
ATOM 202   C CE   . LYS A 1 15  ? -16.934 0.264   -7.917  1.00 0.00 ? 15  LYS A CE   1  
ATOM 203   N NZ   . LYS A 1 15  ? -16.644 1.531   -7.192  1.00 0.00 ? 15  LYS A NZ   1  
ATOM 204   H H    . LYS A 1 15  ? -11.669 1.971   -7.682  1.00 0.00 ? 15  LYS A H    1  
ATOM 205   H HA   . LYS A 1 15  ? -13.293 -0.221  -6.598  1.00 0.00 ? 15  LYS A HA   1  
ATOM 206   H HB2  . LYS A 1 15  ? -14.345 1.422   -8.172  1.00 0.00 ? 15  LYS A HB2  1  
ATOM 207   H HB3  . LYS A 1 15  ? -13.246 0.854   -9.422  1.00 0.00 ? 15  LYS A HB3  1  
ATOM 208   H HG2  . LYS A 1 15  ? -15.260 -0.278  -9.801  1.00 0.00 ? 15  LYS A HG2  1  
ATOM 209   H HG3  . LYS A 1 15  ? -14.206 -1.457  -9.016  1.00 0.00 ? 15  LYS A HG3  1  
ATOM 210   H HD2  . LYS A 1 15  ? -16.197 -1.735  -7.867  1.00 0.00 ? 15  LYS A HD2  1  
ATOM 211   H HD3  . LYS A 1 15  ? -15.321 -0.608  -6.827  1.00 0.00 ? 15  LYS A HD3  1  
ATOM 212   H HE2  . LYS A 1 15  ? -17.088 0.484   -8.962  1.00 0.00 ? 15  LYS A HE2  1  
ATOM 213   H HE3  . LYS A 1 15  ? -17.830 -0.179  -7.507  1.00 0.00 ? 15  LYS A HE3  1  
ATOM 214   H HZ1  . LYS A 1 15  ? -16.118 2.183   -7.809  1.00 0.00 ? 15  LYS A HZ1  1  
ATOM 215   H HZ2  . LYS A 1 15  ? -16.071 1.336   -6.346  1.00 0.00 ? 15  LYS A HZ2  1  
ATOM 216   H HZ3  . LYS A 1 15  ? -17.531 1.988   -6.900  1.00 0.00 ? 15  LYS A HZ3  1  
ATOM 217   N N    . THR A 1 16  ? -10.951 -0.511  -8.912  1.00 0.00 ? 16  THR A N    1  
ATOM 218   C CA   . THR A 1 16  ? -10.003 -1.443  -9.510  1.00 0.00 ? 16  THR A CA   1  
ATOM 219   C C    . THR A 1 16  ? -9.150  -2.119  -8.443  1.00 0.00 ? 16  THR A C    1  
ATOM 220   O O    . THR A 1 16  ? -8.854  -3.311  -8.535  1.00 0.00 ? 16  THR A O    1  
ATOM 221   C CB   . THR A 1 16  ? -9.079  -0.734  -10.517 1.00 0.00 ? 16  THR A CB   1  
ATOM 222   O OG1  . THR A 1 16  ? -8.213  0.178   -9.831  1.00 0.00 ? 16  THR A OG1  1  
ATOM 223   C CG2  . THR A 1 16  ? -9.890  0.018   -11.561 1.00 0.00 ? 16  THR A CG2  1  
ATOM 224   H H    . THR A 1 16  ? -10.942 0.428   -9.192  1.00 0.00 ? 16  THR A H    1  
ATOM 225   H HA   . THR A 1 16  ? -10.566 -2.198  -10.039 1.00 0.00 ? 16  THR A HA   1  
ATOM 226   H HB   . THR A 1 16  ? -8.478  -1.480  -11.018 1.00 0.00 ? 16  THR A HB   1  
ATOM 227   H HG1  . THR A 1 16  ? -8.651  0.500   -9.039  1.00 0.00 ? 16  THR A HG1  1  
ATOM 228   H HG21 . THR A 1 16  ? -9.270  0.222   -12.421 1.00 0.00 ? 16  THR A HG21 1  
ATOM 229   H HG22 . THR A 1 16  ? -10.242 0.949   -11.141 1.00 0.00 ? 16  THR A HG22 1  
ATOM 230   H HG23 . THR A 1 16  ? -10.735 -0.584  -11.861 1.00 0.00 ? 16  THR A HG23 1  
ATOM 231   N N    . ILE A 1 17  ? -8.759  -1.352  -7.431  1.00 0.00 ? 17  ILE A N    1  
ATOM 232   C CA   . ILE A 1 17  ? -7.942  -1.879  -6.345  1.00 0.00 ? 17  ILE A CA   1  
ATOM 233   C C    . ILE A 1 17  ? -8.432  -3.255  -5.905  1.00 0.00 ? 17  ILE A C    1  
ATOM 234   O O    . ILE A 1 17  ? -7.675  -4.042  -5.337  1.00 0.00 ? 17  ILE A O    1  
ATOM 235   C CB   . ILE A 1 17  ? -7.942  -0.934  -5.130  1.00 0.00 ? 17  ILE A CB   1  
ATOM 236   C CG1  . ILE A 1 17  ? -7.258  -1.602  -3.935  1.00 0.00 ? 17  ILE A CG1  1  
ATOM 237   C CG2  . ILE A 1 17  ? -9.365  -0.529  -4.774  1.00 0.00 ? 17  ILE A CG2  1  
ATOM 238   C CD1  . ILE A 1 17  ? -6.634  -0.620  -2.968  1.00 0.00 ? 17  ILE A CD1  1  
ATOM 239   H H    . ILE A 1 17  ? -9.028  -0.410  -7.413  1.00 0.00 ? 17  ILE A H    1  
ATOM 240   H HA   . ILE A 1 17  ? -6.927  -1.969  -6.706  1.00 0.00 ? 17  ILE A HA   1  
ATOM 241   H HB   . ILE A 1 17  ? -7.395  -0.042  -5.395  1.00 0.00 ? 17  ILE A HB   1  
ATOM 242   H HG12 . ILE A 1 17  ? -7.985  -2.185  -3.392  1.00 0.00 ? 17  ILE A HG12 1  
ATOM 243   H HG13 . ILE A 1 17  ? -6.476  -2.255  -4.297  1.00 0.00 ? 17  ILE A HG13 1  
ATOM 244   H HG21 . ILE A 1 17  ? -9.360  0.462   -4.344  1.00 0.00 ? 17  ILE A HG21 1  
ATOM 245   H HG22 . ILE A 1 17  ? -9.973  -0.530  -5.666  1.00 0.00 ? 17  ILE A HG22 1  
ATOM 246   H HG23 . ILE A 1 17  ? -9.771  -1.230  -4.060  1.00 0.00 ? 17  ILE A HG23 1  
ATOM 247   H HD11 . ILE A 1 17  ? -6.730  -0.996  -1.961  1.00 0.00 ? 17  ILE A HD11 1  
ATOM 248   H HD12 . ILE A 1 17  ? -5.590  -0.492  -3.208  1.00 0.00 ? 17  ILE A HD12 1  
ATOM 249   H HD13 . ILE A 1 17  ? -7.141  0.332   -3.046  1.00 0.00 ? 17  ILE A HD13 1  
ATOM 250   N N    . ASP A 1 18  ? -9.702  -3.537  -6.173  1.00 0.00 ? 18  ASP A N    1  
ATOM 251   C CA   . ASP A 1 18  ? -10.294 -4.819  -5.808  1.00 0.00 ? 18  ASP A CA   1  
ATOM 252   C C    . ASP A 1 18  ? -10.075 -5.852  -6.909  1.00 0.00 ? 18  ASP A C    1  
ATOM 253   O O    . ASP A 1 18  ? -9.444  -6.885  -6.686  1.00 0.00 ? 18  ASP A O    1  
ATOM 254   C CB   . ASP A 1 18  ? -11.790 -4.655  -5.535  1.00 0.00 ? 18  ASP A CB   1  
ATOM 255   C CG   . ASP A 1 18  ? -12.543 -5.967  -5.634  1.00 0.00 ? 18  ASP A CG   1  
ATOM 256   O OD1  . ASP A 1 18  ? -12.432 -6.788  -4.699  1.00 0.00 ? 18  ASP A OD1  1  
ATOM 257   O OD2  . ASP A 1 18  ? -13.246 -6.172  -6.646  1.00 0.00 ? 18  ASP A OD2  1  
ATOM 258   H H    . ASP A 1 18  ? -10.255 -2.868  -6.629  1.00 0.00 ? 18  ASP A H    1  
ATOM 259   H HA   . ASP A 1 18  ? -9.809  -5.163  -4.907  1.00 0.00 ? 18  ASP A HA   1  
ATOM 260   H HB2  . ASP A 1 18  ? -11.926 -4.257  -4.540  1.00 0.00 ? 18  ASP A HB2  1  
ATOM 261   H HB3  . ASP A 1 18  ? -12.207 -3.966  -6.254  1.00 0.00 ? 18  ASP A HB3  1  
ATOM 262   N N    . GLU A 1 19  ? -10.601 -5.566  -8.095  1.00 0.00 ? 19  GLU A N    1  
ATOM 263   C CA   . GLU A 1 19  ? -10.465 -6.471  -9.230  1.00 0.00 ? 19  GLU A CA   1  
ATOM 264   C C    . GLU A 1 19  ? -9.014  -6.913  -9.402  1.00 0.00 ? 19  GLU A C    1  
ATOM 265   O O    . GLU A 1 19  ? -8.738  -8.082  -9.668  1.00 0.00 ? 19  GLU A O    1  
ATOM 266   C CB   . GLU A 1 19  ? -10.960 -5.798  -10.511 1.00 0.00 ? 19  GLU A CB   1  
ATOM 267   C CG   . GLU A 1 19  ? -9.921  -4.906  -11.170 1.00 0.00 ? 19  GLU A CG   1  
ATOM 268   C CD   . GLU A 1 19  ? -10.521 -3.988  -12.218 1.00 0.00 ? 19  GLU A CD   1  
ATOM 269   O OE1  . GLU A 1 19  ? -11.738 -3.715  -12.139 1.00 0.00 ? 19  GLU A OE1  1  
ATOM 270   O OE2  . GLU A 1 19  ? -9.776  -3.543  -13.115 1.00 0.00 ? 19  GLU A OE2  1  
ATOM 271   H H    . GLU A 1 19  ? -11.093 -4.726  -8.210  1.00 0.00 ? 19  GLU A H    1  
ATOM 272   H HA   . GLU A 1 19  ? -11.072 -7.342  -9.034  1.00 0.00 ? 19  GLU A HA   1  
ATOM 273   H HB2  . GLU A 1 19  ? -11.248 -6.563  -11.217 1.00 0.00 ? 19  GLU A HB2  1  
ATOM 274   H HB3  . GLU A 1 19  ? -11.824 -5.195  -10.275 1.00 0.00 ? 19  GLU A HB3  1  
ATOM 275   H HG2  . GLU A 1 19  ? -9.451  -4.300  -10.410 1.00 0.00 ? 19  GLU A HG2  1  
ATOM 276   H HG3  . GLU A 1 19  ? -9.178  -5.530  -11.644 1.00 0.00 ? 19  GLU A HG3  1  
ATOM 277   N N    . GLU A 1 20  ? -8.092  -5.967  -9.249  1.00 0.00 ? 20  GLU A N    1  
ATOM 278   C CA   . GLU A 1 20  ? -6.670  -6.258  -9.389  1.00 0.00 ? 20  GLU A CA   1  
ATOM 279   C C    . GLU A 1 20  ? -6.214  -7.264  -8.336  1.00 0.00 ? 20  GLU A C    1  
ATOM 280   O O    . GLU A 1 20  ? -5.661  -8.315  -8.663  1.00 0.00 ? 20  GLU A O    1  
ATOM 281   C CB   . GLU A 1 20  ? -5.849  -4.972  -9.271  1.00 0.00 ? 20  GLU A CB   1  
ATOM 282   C CG   . GLU A 1 20  ? -4.351  -5.211  -9.195  1.00 0.00 ? 20  GLU A CG   1  
ATOM 283   C CD   . GLU A 1 20  ? -3.702  -5.283  -10.564 1.00 0.00 ? 20  GLU A CD   1  
ATOM 284   O OE1  . GLU A 1 20  ? -4.287  -4.743  -11.526 1.00 0.00 ? 20  GLU A OE1  1  
ATOM 285   O OE2  . GLU A 1 20  ? -2.609  -5.877  -10.673 1.00 0.00 ? 20  GLU A OE2  1  
ATOM 286   H H    . GLU A 1 20  ? -8.374  -5.053  -9.038  1.00 0.00 ? 20  GLU A H    1  
ATOM 287   H HA   . GLU A 1 20  ? -6.514  -6.685  -10.368 1.00 0.00 ? 20  GLU A HA   1  
ATOM 288   H HB2  . GLU A 1 20  ? -6.052  -4.350  -10.130 1.00 0.00 ? 20  GLU A HB2  1  
ATOM 289   H HB3  . GLU A 1 20  ? -6.154  -4.446  -8.378  1.00 0.00 ? 20  GLU A HB3  1  
ATOM 290   H HG2  . GLU A 1 20  ? -3.898  -4.403  -8.641  1.00 0.00 ? 20  GLU A HG2  1  
ATOM 291   H HG3  . GLU A 1 20  ? -4.173  -6.144  -8.680  1.00 0.00 ? 20  GLU A HG3  1  
ATOM 292   N N    . LEU A 1 21  ? -6.449  -6.934  -7.071  1.00 0.00 ? 21  LEU A N    1  
ATOM 293   C CA   . LEU A 1 21  ? -6.063  -7.807  -5.968  1.00 0.00 ? 21  LEU A CA   1  
ATOM 294   C C    . LEU A 1 21  ? -6.824  -9.128  -6.026  1.00 0.00 ? 21  LEU A C    1  
ATOM 295   O O    . LEU A 1 21  ? -6.527  -10.059 -5.279  1.00 0.00 ? 21  LEU A O    1  
ATOM 296   C CB   . LEU A 1 21  ? -6.322  -7.115  -4.628  1.00 0.00 ? 21  LEU A CB   1  
ATOM 297   C CG   . LEU A 1 21  ? -5.333  -6.016  -4.238  1.00 0.00 ? 21  LEU A CG   1  
ATOM 298   C CD1  . LEU A 1 21  ? -5.893  -5.172  -3.104  1.00 0.00 ? 21  LEU A CD1  1  
ATOM 299   C CD2  . LEU A 1 21  ? -3.992  -6.619  -3.846  1.00 0.00 ? 21  LEU A CD2  1  
ATOM 300   H H    . LEU A 1 21  ? -6.893  -6.083  -6.872  1.00 0.00 ? 21  LEU A H    1  
ATOM 301   H HA   . LEU A 1 21  ? -5.006  -8.010  -6.060  1.00 0.00 ? 21  LEU A HA   1  
ATOM 302   H HB2  . LEU A 1 21  ? -7.306  -6.675  -4.669  1.00 0.00 ? 21  LEU A HB2  1  
ATOM 303   H HB3  . LEU A 1 21  ? -6.299  -7.871  -3.856  1.00 0.00 ? 21  LEU A HB3  1  
ATOM 304   H HG   . LEU A 1 21  ? -5.173  -5.367  -5.088  1.00 0.00 ? 21  LEU A HG   1  
ATOM 305   H HD11 . LEU A 1 21  ? -5.656  -4.133  -3.277  1.00 0.00 ? 21  LEU A HD11 1  
ATOM 306   H HD12 . LEU A 1 21  ? -5.456  -5.490  -2.169  1.00 0.00 ? 21  LEU A HD12 1  
ATOM 307   H HD13 . LEU A 1 21  ? -6.965  -5.295  -3.060  1.00 0.00 ? 21  LEU A HD13 1  
ATOM 308   H HD21 . LEU A 1 21  ? -4.155  -7.567  -3.355  1.00 0.00 ? 21  LEU A HD21 1  
ATOM 309   H HD22 . LEU A 1 21  ? -3.480  -5.948  -3.171  1.00 0.00 ? 21  LEU A HD22 1  
ATOM 310   H HD23 . LEU A 1 21  ? -3.392  -6.769  -4.730  1.00 0.00 ? 21  LEU A HD23 1  
ATOM 311   N N    . GLU A 1 22  ? -7.804  -9.200  -6.921  1.00 0.00 ? 22  GLU A N    1  
ATOM 312   C CA   . GLU A 1 22  ? -8.607  -10.408 -7.077  1.00 0.00 ? 22  GLU A CA   1  
ATOM 313   C C    . GLU A 1 22  ? -8.023  -11.313 -8.159  1.00 0.00 ? 22  GLU A C    1  
ATOM 314   O O    . GLU A 1 22  ? -8.195  -12.531 -8.124  1.00 0.00 ? 22  GLU A O    1  
ATOM 315   C CB   . GLU A 1 22  ? -10.052 -10.046 -7.425  1.00 0.00 ? 22  GLU A CB   1  
ATOM 316   C CG   . GLU A 1 22  ? -10.971 -11.250 -7.538  1.00 0.00 ? 22  GLU A CG   1  
ATOM 317   C CD   . GLU A 1 22  ? -12.388 -10.869 -7.923  1.00 0.00 ? 22  GLU A CD   1  
ATOM 318   O OE1  . GLU A 1 22  ? -12.616 -10.560 -9.112  1.00 0.00 ? 22  GLU A OE1  1  
ATOM 319   O OE2  . GLU A 1 22  ? -13.267 -10.879 -7.037  1.00 0.00 ? 22  GLU A OE2  1  
ATOM 320   H H    . GLU A 1 22  ? -7.993  -8.424  -7.488  1.00 0.00 ? 22  GLU A H    1  
ATOM 321   H HA   . GLU A 1 22  ? -8.595  -10.938 -6.137  1.00 0.00 ? 22  GLU A HA   1  
ATOM 322   H HB2  . GLU A 1 22  ? -10.441 -9.392  -6.659  1.00 0.00 ? 22  GLU A HB2  1  
ATOM 323   H HB3  . GLU A 1 22  ? -10.061 -9.523  -8.370  1.00 0.00 ? 22  GLU A HB3  1  
ATOM 324   H HG2  . GLU A 1 22  ? -10.578 -11.918 -8.289  1.00 0.00 ? 22  GLU A HG2  1  
ATOM 325   H HG3  . GLU A 1 22  ? -10.997 -11.757 -6.585  1.00 0.00 ? 22  GLU A HG3  1  
ATOM 326   N N    . ARG A 1 23  ? -7.333  -10.707 -9.120  1.00 0.00 ? 23  ARG A N    1  
ATOM 327   C CA   . ARG A 1 23  ? -6.726  -11.456 -10.213 1.00 0.00 ? 23  ARG A CA   1  
ATOM 328   C C    . ARG A 1 23  ? -5.273  -11.799 -9.896  1.00 0.00 ? 23  ARG A C    1  
ATOM 329   O O    . ARG A 1 23  ? -4.638  -12.576 -10.609 1.00 0.00 ? 23  ARG A O    1  
ATOM 330   C CB   . ARG A 1 23  ? -6.799  -10.652 -11.513 1.00 0.00 ? 23  ARG A CB   1  
ATOM 331   C CG   . ARG A 1 23  ? -5.839  -9.474  -11.555 1.00 0.00 ? 23  ARG A CG   1  
ATOM 332   C CD   . ARG A 1 23  ? -5.486  -9.095  -12.985 1.00 0.00 ? 23  ARG A CD   1  
ATOM 333   N NE   . ARG A 1 23  ? -4.576  -7.953  -13.039 1.00 0.00 ? 23  ARG A NE   1  
ATOM 334   C CZ   . ARG A 1 23  ? -3.782  -7.695  -14.072 1.00 0.00 ? 23  ARG A CZ   1  
ATOM 335   N NH1  . ARG A 1 23  ? -3.786  -8.493  -15.131 1.00 0.00 ? 23  ARG A NH1  1  
ATOM 336   N NH2  . ARG A 1 23  ? -2.982  -6.637  -14.047 1.00 0.00 ? 23  ARG A NH2  1  
ATOM 337   H H    . ARG A 1 23  ? -7.231  -9.732  -9.094  1.00 0.00 ? 23  ARG A H    1  
ATOM 338   H HA   . ARG A 1 23  ? -7.282  -12.373 -10.336 1.00 0.00 ? 23  ARG A HA   1  
ATOM 339   H HB2  . ARG A 1 23  ? -6.567  -11.307 -12.341 1.00 0.00 ? 23  ARG A HB2  1  
ATOM 340   H HB3  . ARG A 1 23  ? -7.803  -10.275 -11.633 1.00 0.00 ? 23  ARG A HB3  1  
ATOM 341   H HG2  . ARG A 1 23  ? -6.304  -8.626  -11.074 1.00 0.00 ? 23  ARG A HG2  1  
ATOM 342   H HG3  . ARG A 1 23  ? -4.935  -9.739  -11.028 1.00 0.00 ? 23  ARG A HG3  1  
ATOM 343   H HD2  . ARG A 1 23  ? -5.015  -9.941  -13.462 1.00 0.00 ? 23  ARG A HD2  1  
ATOM 344   H HD3  . ARG A 1 23  ? -6.395  -8.844  -13.511 1.00 0.00 ? 23  ARG A HD3  1  
ATOM 345   H HE   . ARG A 1 23  ? -4.557  -7.351  -12.267 1.00 0.00 ? 23  ARG A HE   1  
ATOM 346   H HH11 . ARG A 1 23  ? -4.389  -9.290  -15.153 1.00 0.00 ? 23  ARG A HH11 1  
ATOM 347   H HH12 . ARG A 1 23  ? -3.188  -8.295  -15.908 1.00 0.00 ? 23  ARG A HH12 1  
ATOM 348   H HH21 . ARG A 1 23  ? -2.976  -6.033  -13.250 1.00 0.00 ? 23  ARG A HH21 1  
ATOM 349   H HH22 . ARG A 1 23  ? -2.384  -6.443  -14.824 1.00 0.00 ? 23  ARG A HH22 1  
ATOM 350   N N    . ASP A 1 24  ? -4.754  -11.216 -8.821  1.00 0.00 ? 24  ASP A N    1  
ATOM 351   C CA   . ASP A 1 24  ? -3.377  -11.460 -8.409  1.00 0.00 ? 24  ASP A CA   1  
ATOM 352   C C    . ASP A 1 24  ? -3.320  -11.936 -6.961  1.00 0.00 ? 24  ASP A C    1  
ATOM 353   O O    . ASP A 1 24  ? -2.303  -11.781 -6.284  1.00 0.00 ? 24  ASP A O    1  
ATOM 354   C CB   . ASP A 1 24  ? -2.540  -10.191 -8.575  1.00 0.00 ? 24  ASP A CB   1  
ATOM 355   C CG   . ASP A 1 24  ? -1.898  -10.095 -9.945  1.00 0.00 ? 24  ASP A CG   1  
ATOM 356   O OD1  . ASP A 1 24  ? -2.449  -10.682 -10.900 1.00 0.00 ? 24  ASP A OD1  1  
ATOM 357   O OD2  . ASP A 1 24  ? -0.844  -9.435  -10.062 1.00 0.00 ? 24  ASP A OD2  1  
ATOM 358   H H    . ASP A 1 24  ? -5.311  -10.606 -8.292  1.00 0.00 ? 24  ASP A H    1  
ATOM 359   H HA   . ASP A 1 24  ? -2.972  -12.233 -9.045  1.00 0.00 ? 24  ASP A HA   1  
ATOM 360   H HB2  . ASP A 1 24  ? -3.174  -9.328  -8.434  1.00 0.00 ? 24  ASP A HB2  1  
ATOM 361   H HB3  . ASP A 1 24  ? -1.758  -10.183 -7.829  1.00 0.00 ? 24  ASP A HB3  1  
ATOM 362   N N    . LYS A 1 25  ? -4.419  -12.515 -6.490  1.00 0.00 ? 25  LYS A N    1  
ATOM 363   C CA   . LYS A 1 25  ? -4.496  -13.015 -5.122  1.00 0.00 ? 25  LYS A CA   1  
ATOM 364   C C    . LYS A 1 25  ? -3.230  -13.781 -4.751  1.00 0.00 ? 25  LYS A C    1  
ATOM 365   O O    . LYS A 1 25  ? -2.409  -13.300 -3.970  1.00 0.00 ? 25  LYS A O    1  
ATOM 366   C CB   . LYS A 1 25  ? -5.719  -13.919 -4.955  1.00 0.00 ? 25  LYS A CB   1  
ATOM 367   C CG   . LYS A 1 25  ? -7.029  -13.243 -5.322  1.00 0.00 ? 25  LYS A CG   1  
ATOM 368   C CD   . LYS A 1 25  ? -8.197  -14.212 -5.245  1.00 0.00 ? 25  LYS A CD   1  
ATOM 369   C CE   . LYS A 1 25  ? -8.770  -14.283 -3.837  1.00 0.00 ? 25  LYS A CE   1  
ATOM 370   N NZ   . LYS A 1 25  ? -9.801  -15.350 -3.712  1.00 0.00 ? 25  LYS A NZ   1  
ATOM 371   H H    . LYS A 1 25  ? -5.198  -12.610 -7.078  1.00 0.00 ? 25  LYS A H    1  
ATOM 372   H HA   . LYS A 1 25  ? -4.594  -12.165 -4.464  1.00 0.00 ? 25  LYS A HA   1  
ATOM 373   H HB2  . LYS A 1 25  ? -5.598  -14.788 -5.585  1.00 0.00 ? 25  LYS A HB2  1  
ATOM 374   H HB3  . LYS A 1 25  ? -5.779  -14.237 -3.924  1.00 0.00 ? 25  LYS A HB3  1  
ATOM 375   H HG2  . LYS A 1 25  ? -7.207  -12.427 -4.637  1.00 0.00 ? 25  LYS A HG2  1  
ATOM 376   H HG3  . LYS A 1 25  ? -6.956  -12.860 -6.330  1.00 0.00 ? 25  LYS A HG3  1  
ATOM 377   H HD2  . LYS A 1 25  ? -8.973  -13.882 -5.920  1.00 0.00 ? 25  LYS A HD2  1  
ATOM 378   H HD3  . LYS A 1 25  ? -7.857  -15.195 -5.536  1.00 0.00 ? 25  LYS A HD3  1  
ATOM 379   H HE2  . LYS A 1 25  ? -7.967  -14.488 -3.146  1.00 0.00 ? 25  LYS A HE2  1  
ATOM 380   H HE3  . LYS A 1 25  ? -9.218  -13.331 -3.596  1.00 0.00 ? 25  LYS A HE3  1  
ATOM 381   H HZ1  . LYS A 1 25  ? -10.541 -15.218 -4.432  1.00 0.00 ? 25  LYS A HZ1  1  
ATOM 382   H HZ2  . LYS A 1 25  ? -10.240 -15.314 -2.770  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM 383   H HZ3  . LYS A 1 25  ? -9.367  -16.285 -3.844  1.00 0.00 ? 25  LYS A HZ3  1  
ATOM 384   N N    . ARG A 1 26  ? -3.079  -14.974 -5.317  1.00 0.00 ? 26  ARG A N    1  
ATOM 385   C CA   . ARG A 1 26  ? -1.913  -15.806 -5.045  1.00 0.00 ? 26  ARG A CA   1  
ATOM 386   C C    . ARG A 1 26  ? -0.647  -14.958 -4.963  1.00 0.00 ? 26  ARG A C    1  
ATOM 387   O O    . ARG A 1 26  ? 0.275   -15.273 -4.211  1.00 0.00 ? 26  ARG A O    1  
ATOM 388   C CB   . ARG A 1 26  ? -1.756  -16.872 -6.132  1.00 0.00 ? 26  ARG A CB   1  
ATOM 389   C CG   . ARG A 1 26  ? -1.310  -16.313 -7.473  1.00 0.00 ? 26  ARG A CG   1  
ATOM 390   C CD   . ARG A 1 26  ? -2.485  -15.762 -8.266  1.00 0.00 ? 26  ARG A CD   1  
ATOM 391   N NE   . ARG A 1 26  ? -3.447  -16.805 -8.614  1.00 0.00 ? 26  ARG A NE   1  
ATOM 392   C CZ   . ARG A 1 26  ? -4.353  -16.677 -9.576  1.00 0.00 ? 26  ARG A CZ   1  
ATOM 393   N NH1  . ARG A 1 26  ? -4.420  -15.557 -10.284 1.00 0.00 ? 26  ARG A NH1  1  
ATOM 394   N NH2  . ARG A 1 26  ? -5.194  -17.670 -9.833  1.00 0.00 ? 26  ARG A NH2  1  
ATOM 395   H H    . ARG A 1 26  ? -3.768  -15.303 -5.931  1.00 0.00 ? 26  ARG A H    1  
ATOM 396   H HA   . ARG A 1 26  ? -2.068  -16.294 -4.095  1.00 0.00 ? 26  ARG A HA   1  
ATOM 397   H HB2  . ARG A 1 26  ? -1.023  -17.596 -5.807  1.00 0.00 ? 26  ARG A HB2  1  
ATOM 398   H HB3  . ARG A 1 26  ? -2.704  -17.369 -6.271  1.00 0.00 ? 26  ARG A HB3  1  
ATOM 399   H HG2  . ARG A 1 26  ? -0.600  -15.516 -7.302  1.00 0.00 ? 26  ARG A HG2  1  
ATOM 400   H HG3  . ARG A 1 26  ? -0.839  -17.101 -8.042  1.00 0.00 ? 26  ARG A HG3  1  
ATOM 401   H HD2  . ARG A 1 26  ? -2.982  -15.010 -7.672  1.00 0.00 ? 26  ARG A HD2  1  
ATOM 402   H HD3  . ARG A 1 26  ? -2.110  -15.314 -9.174  1.00 0.00 ? 26  ARG A HD3  1  
ATOM 403   H HE   . ARG A 1 26  ? -3.415  -17.640 -8.103  1.00 0.00 ? 26  ARG A HE   1  
ATOM 404   H HH11 . ARG A 1 26  ? -3.787  -14.808 -10.093 1.00 0.00 ? 26  ARG A HH11 1  
ATOM 405   H HH12 . ARG A 1 26  ? -5.103  -15.464 -11.009 1.00 0.00 ? 26  ARG A HH12 1  
ATOM 406   H HH21 . ARG A 1 26  ? -5.146  -18.516 -9.302  1.00 0.00 ? 26  ARG A HH21 1  
ATOM 407   H HH22 . ARG A 1 26  ? -5.876  -17.573 -10.558 1.00 0.00 ? 26  ARG A HH22 1  
ATOM 408   N N    . VAL A 1 27  ? -0.611  -13.882 -5.741  1.00 0.00 ? 27  VAL A N    1  
ATOM 409   C CA   . VAL A 1 27  ? 0.541   -12.988 -5.756  1.00 0.00 ? 27  VAL A CA   1  
ATOM 410   C C    . VAL A 1 27  ? 0.433   -11.934 -4.660  1.00 0.00 ? 27  VAL A C    1  
ATOM 411   O O    . VAL A 1 27  ? -0.640  -11.380 -4.418  1.00 0.00 ? 27  VAL A O    1  
ATOM 412   C CB   . VAL A 1 27  ? 0.687   -12.283 -7.118  1.00 0.00 ? 27  VAL A CB   1  
ATOM 413   C CG1  . VAL A 1 27  ? 1.992   -11.503 -7.179  1.00 0.00 ? 27  VAL A CG1  1  
ATOM 414   C CG2  . VAL A 1 27  ? 0.607   -13.293 -8.252  1.00 0.00 ? 27  VAL A CG2  1  
ATOM 415   H H    . VAL A 1 27  ? -1.377  -13.683 -6.319  1.00 0.00 ? 27  VAL A H    1  
ATOM 416   H HA   . VAL A 1 27  ? 1.427   -13.582 -5.585  1.00 0.00 ? 27  VAL A HA   1  
ATOM 417   H HB   . VAL A 1 27  ? -0.129  -11.584 -7.228  1.00 0.00 ? 27  VAL A HB   1  
ATOM 418   H HG11 . VAL A 1 27  ? 1.913   -10.728 -7.927  1.00 0.00 ? 27  VAL A HG11 1  
ATOM 419   H HG12 . VAL A 1 27  ? 2.190   -11.057 -6.215  1.00 0.00 ? 27  VAL A HG12 1  
ATOM 420   H HG13 . VAL A 1 27  ? 2.799   -12.172 -7.439  1.00 0.00 ? 27  VAL A HG13 1  
ATOM 421   H HG21 . VAL A 1 27  ? 1.053   -12.873 -9.140  1.00 0.00 ? 27  VAL A HG21 1  
ATOM 422   H HG22 . VAL A 1 27  ? 1.138   -14.192 -7.973  1.00 0.00 ? 27  VAL A HG22 1  
ATOM 423   H HG23 . VAL A 1 27  ? -0.427  -13.534 -8.448  1.00 0.00 ? 27  VAL A HG23 1  
ATOM 424   N N    . THR A 1 28  ? 1.553   -11.660 -3.998  1.00 0.00 ? 28  THR A N    1  
ATOM 425   C CA   . THR A 1 28  ? 1.585   -10.673 -2.926  1.00 0.00 ? 28  THR A CA   1  
ATOM 426   C C    . THR A 1 28  ? 1.554   -9.254  -3.483  1.00 0.00 ? 28  THR A C    1  
ATOM 427   O O    . THR A 1 28  ? 2.147   -8.974  -4.525  1.00 0.00 ? 28  THR A O    1  
ATOM 428   C CB   . THR A 1 28  ? 2.839   -10.839 -2.046  1.00 0.00 ? 28  THR A CB   1  
ATOM 429   O OG1  . THR A 1 28  ? 2.974   -12.205 -1.639  1.00 0.00 ? 28  THR A OG1  1  
ATOM 430   C CG2  . THR A 1 28  ? 2.761   -9.944  -0.819  1.00 0.00 ? 28  THR A CG2  1  
ATOM 431   H H    . THR A 1 28  ? 2.377   -12.134 -4.236  1.00 0.00 ? 28  THR A H    1  
ATOM 432   H HA   . THR A 1 28  ? 0.713   -10.825 -2.306  1.00 0.00 ? 28  THR A HA   1  
ATOM 433   H HB   . THR A 1 28  ? 3.706   -10.556 -2.626  1.00 0.00 ? 28  THR A HB   1  
ATOM 434   H HG1  . THR A 1 28  ? 3.844   -12.528 -1.886  1.00 0.00 ? 28  THR A HG1  1  
ATOM 435   H HG21 . THR A 1 28  ? 2.331   -8.992  -1.094  1.00 0.00 ? 28  THR A HG21 1  
ATOM 436   H HG22 . THR A 1 28  ? 3.754   -9.790  -0.422  1.00 0.00 ? 28  THR A HG22 1  
ATOM 437   H HG23 . THR A 1 28  ? 2.143   -10.415 -0.069  1.00 0.00 ? 28  THR A HG23 1  
ATOM 438   N N    . TRP A 1 29  ? 0.859   -8.364  -2.784  1.00 0.00 ? 29  TRP A N    1  
ATOM 439   C CA   . TRP A 1 29  ? 0.751   -6.974  -3.210  1.00 0.00 ? 29  TRP A CA   1  
ATOM 440   C C    . TRP A 1 29  ? 0.855   -6.029  -2.017  1.00 0.00 ? 29  TRP A C    1  
ATOM 441   O O    . TRP A 1 29  ? 0.163   -6.204  -1.014  1.00 0.00 ? 29  TRP A O    1  
ATOM 442   C CB   . TRP A 1 29  ? -0.571  -6.744  -3.944  1.00 0.00 ? 29  TRP A CB   1  
ATOM 443   C CG   . TRP A 1 29  ? -0.474  -6.965  -5.424  1.00 0.00 ? 29  TRP A CG   1  
ATOM 444   C CD1  . TRP A 1 29  ? -0.808  -8.099  -6.107  1.00 0.00 ? 29  TRP A CD1  1  
ATOM 445   C CD2  . TRP A 1 29  ? -0.012  -6.027  -6.401  1.00 0.00 ? 29  TRP A CD2  1  
ATOM 446   N NE1  . TRP A 1 29  ? -0.581  -7.923  -7.450  1.00 0.00 ? 29  TRP A NE1  1  
ATOM 447   C CE2  . TRP A 1 29  ? -0.093  -6.660  -7.657  1.00 0.00 ? 29  TRP A CE2  1  
ATOM 448   C CE3  . TRP A 1 29  ? 0.461   -4.714  -6.339  1.00 0.00 ? 29  TRP A CE3  1  
ATOM 449   C CZ2  . TRP A 1 29  ? 0.282   -6.024  -8.837  1.00 0.00 ? 29  TRP A CZ2  1  
ATOM 450   C CZ3  . TRP A 1 29  ? 0.834   -4.083  -7.511  1.00 0.00 ? 29  TRP A CZ3  1  
ATOM 451   C CH2  . TRP A 1 29  ? 0.742   -4.738  -8.746  1.00 0.00 ? 29  TRP A CH2  1  
ATOM 452   H H    . TRP A 1 29  ? 0.408   -8.649  -1.961  1.00 0.00 ? 29  TRP A H    1  
ATOM 453   H HA   . TRP A 1 29  ? 1.569   -6.771  -3.887  1.00 0.00 ? 29  TRP A HA   1  
ATOM 454   H HB2  . TRP A 1 29  ? -1.314  -7.423  -3.554  1.00 0.00 ? 29  TRP A HB2  1  
ATOM 455   H HB3  . TRP A 1 29  ? -0.894  -5.727  -3.778  1.00 0.00 ? 29  TRP A HB3  1  
ATOM 456   H HD1  . TRP A 1 29  ? -1.192  -8.996  -5.645  1.00 0.00 ? 29  TRP A HD1  1  
ATOM 457   H HE1  . TRP A 1 29  ? -0.744  -8.593  -8.147  1.00 0.00 ? 29  TRP A HE1  1  
ATOM 458   H HE3  . TRP A 1 29  ? 0.539   -4.192  -5.396  1.00 0.00 ? 29  TRP A HE3  1  
ATOM 459   H HZ2  . TRP A 1 29  ? 0.217   -6.514  -9.797  1.00 0.00 ? 29  TRP A HZ2  1  
ATOM 460   H HZ3  . TRP A 1 29  ? 1.202   -3.068  -7.482  1.00 0.00 ? 29  TRP A HZ3  1  
ATOM 461   H HH2  . TRP A 1 29  ? 1.044   -4.207  -9.636  1.00 0.00 ? 29  TRP A HH2  1  
ATOM 462   N N    . ILE A 1 30  ? 1.723   -5.030  -2.133  1.00 0.00 ? 30  ILE A N    1  
ATOM 463   C CA   . ILE A 1 30  ? 1.915   -4.058  -1.064  1.00 0.00 ? 30  ILE A CA   1  
ATOM 464   C C    . ILE A 1 30  ? 1.480   -2.664  -1.504  1.00 0.00 ? 30  ILE A C    1  
ATOM 465   O O    . ILE A 1 30  ? 2.133   -2.031  -2.334  1.00 0.00 ? 30  ILE A O    1  
ATOM 466   C CB   . ILE A 1 30  ? 3.385   -4.005  -0.609  1.00 0.00 ? 30  ILE A CB   1  
ATOM 467   C CG1  . ILE A 1 30  ? 3.566   -2.947  0.482   1.00 0.00 ? 30  ILE A CG1  1  
ATOM 468   C CG2  . ILE A 1 30  ? 4.296   -3.714  -1.792  1.00 0.00 ? 30  ILE A CG2  1  
ATOM 469   C CD1  . ILE A 1 30  ? 4.871   -3.074  1.237   1.00 0.00 ? 30  ILE A CD1  1  
ATOM 470   H H    . ILE A 1 30  ? 2.245   -4.943  -2.957  1.00 0.00 ? 30  ILE A H    1  
ATOM 471   H HA   . ILE A 1 30  ? 1.309   -4.363  -0.223  1.00 0.00 ? 30  ILE A HA   1  
ATOM 472   H HB   . ILE A 1 30  ? 3.650   -4.972  -0.210  1.00 0.00 ? 30  ILE A HB   1  
ATOM 473   H HG12 . ILE A 1 30  ? 3.537   -1.967  0.033   1.00 0.00 ? 30  ILE A HG12 1  
ATOM 474   H HG13 . ILE A 1 30  ? 2.759   -3.036  1.196   1.00 0.00 ? 30  ILE A HG13 1  
ATOM 475   H HG21 . ILE A 1 30  ? 3.727   -3.777  -2.708  1.00 0.00 ? 30  ILE A HG21 1  
ATOM 476   H HG22 . ILE A 1 30  ? 4.708   -2.721  -1.693  1.00 0.00 ? 30  ILE A HG22 1  
ATOM 477   H HG23 . ILE A 1 30  ? 5.098   -4.436  -1.815  1.00 0.00 ? 30  ILE A HG23 1  
ATOM 478   H HD11 . ILE A 1 30  ? 5.649   -3.391  0.559   1.00 0.00 ? 30  ILE A HD11 1  
ATOM 479   H HD12 . ILE A 1 30  ? 5.133   -2.120  1.667   1.00 0.00 ? 30  ILE A HD12 1  
ATOM 480   H HD13 . ILE A 1 30  ? 4.761   -3.806  2.024   1.00 0.00 ? 30  ILE A HD13 1  
ATOM 481   N N    . VAL A 1 31  ? 0.373   -2.189  -0.940  1.00 0.00 ? 31  VAL A N    1  
ATOM 482   C CA   . VAL A 1 31  ? -0.148  -0.868  -1.271  1.00 0.00 ? 31  VAL A CA   1  
ATOM 483   C C    . VAL A 1 31  ? 0.114   0.124   -0.144  1.00 0.00 ? 31  VAL A C    1  
ATOM 484   O O    . VAL A 1 31  ? -0.153  -0.163  1.022   1.00 0.00 ? 31  VAL A O    1  
ATOM 485   C CB   . VAL A 1 31  ? -1.660  -0.917  -1.557  1.00 0.00 ? 31  VAL A CB   1  
ATOM 486   C CG1  . VAL A 1 31  ? -2.124  0.378   -2.206  1.00 0.00 ? 31  VAL A CG1  1  
ATOM 487   C CG2  . VAL A 1 31  ? -1.998  -2.114  -2.434  1.00 0.00 ? 31  VAL A CG2  1  
ATOM 488   H H    . VAL A 1 31  ? -0.103  -2.741  -0.285  1.00 0.00 ? 31  VAL A H    1  
ATOM 489   H HA   . VAL A 1 31  ? 0.355   -0.525  -2.164  1.00 0.00 ? 31  VAL A HA   1  
ATOM 490   H HB   . VAL A 1 31  ? -2.180  -1.029  -0.617  1.00 0.00 ? 31  VAL A HB   1  
ATOM 491   H HG11 . VAL A 1 31  ? -1.280  0.870   -2.669  1.00 0.00 ? 31  VAL A HG11 1  
ATOM 492   H HG12 . VAL A 1 31  ? -2.870  0.159   -2.956  1.00 0.00 ? 31  VAL A HG12 1  
ATOM 493   H HG13 . VAL A 1 31  ? -2.549  1.026   -1.453  1.00 0.00 ? 31  VAL A HG13 1  
ATOM 494   H HG21 . VAL A 1 31  ? -1.220  -2.251  -3.169  1.00 0.00 ? 31  VAL A HG21 1  
ATOM 495   H HG22 . VAL A 1 31  ? -2.074  -3.000  -1.821  1.00 0.00 ? 31  VAL A HG22 1  
ATOM 496   H HG23 . VAL A 1 31  ? -2.940  -1.940  -2.933  1.00 0.00 ? 31  VAL A HG23 1  
ATOM 497   N N    . GLU A 1 32  ? 0.637   1.293   -0.502  1.00 0.00 ? 32  GLU A N    1  
ATOM 498   C CA   . GLU A 1 32  ? 0.935   2.328   0.481   1.00 0.00 ? 32  GLU A CA   1  
ATOM 499   C C    . GLU A 1 32  ? -0.158  3.393   0.498   1.00 0.00 ? 32  GLU A C    1  
ATOM 500   O O    . GLU A 1 32  ? -0.319  4.148   -0.461  1.00 0.00 ? 32  GLU A O    1  
ATOM 501   C CB   . GLU A 1 32  ? 2.288   2.975   0.179   1.00 0.00 ? 32  GLU A CB   1  
ATOM 502   C CG   . GLU A 1 32  ? 2.631   4.130   1.105   1.00 0.00 ? 32  GLU A CG   1  
ATOM 503   C CD   . GLU A 1 32  ? 4.019   4.686   0.855   1.00 0.00 ? 32  GLU A CD   1  
ATOM 504   O OE1  . GLU A 1 32  ? 4.904   3.909   0.439   1.00 0.00 ? 32  GLU A OE1  1  
ATOM 505   O OE2  . GLU A 1 32  ? 4.220   5.899   1.075   1.00 0.00 ? 32  GLU A OE2  1  
ATOM 506   H H    . GLU A 1 32  ? 0.828   1.462   -1.448  1.00 0.00 ? 32  GLU A H    1  
ATOM 507   H HA   . GLU A 1 32  ? 0.979   1.860   1.453   1.00 0.00 ? 32  GLU A HA   1  
ATOM 508   H HB2  . GLU A 1 32  ? 3.060   2.226   0.270   1.00 0.00 ? 32  GLU A HB2  1  
ATOM 509   H HB3  . GLU A 1 32  ? 2.277   3.346   -0.835  1.00 0.00 ? 32  GLU A HB3  1  
ATOM 510   H HG2  . GLU A 1 32  ? 1.911   4.920   0.956   1.00 0.00 ? 32  GLU A HG2  1  
ATOM 511   H HG3  . GLU A 1 32  ? 2.577   3.783   2.127   1.00 0.00 ? 32  GLU A HG3  1  
ATOM 512   N N    . PHE A 1 33  ? -0.907  3.446   1.594   1.00 0.00 ? 33  PHE A N    1  
ATOM 513   C CA   . PHE A 1 33  ? -1.986  4.417   1.736   1.00 0.00 ? 33  PHE A CA   1  
ATOM 514   C C    . PHE A 1 33  ? -1.462  5.735   2.298   1.00 0.00 ? 33  PHE A C    1  
ATOM 515   O O    . PHE A 1 33  ? -1.160  5.840   3.487   1.00 0.00 ? 33  PHE A O    1  
ATOM 516   C CB   . PHE A 1 33  ? -3.083  3.862   2.647   1.00 0.00 ? 33  PHE A CB   1  
ATOM 517   C CG   . PHE A 1 33  ? -3.613  2.528   2.203   1.00 0.00 ? 33  PHE A CG   1  
ATOM 518   C CD1  . PHE A 1 33  ? -2.988  1.355   2.593   1.00 0.00 ? 33  PHE A CD1  1  
ATOM 519   C CD2  . PHE A 1 33  ? -4.736  2.448   1.395   1.00 0.00 ? 33  PHE A CD2  1  
ATOM 520   C CE1  . PHE A 1 33  ? -3.473  0.126   2.187   1.00 0.00 ? 33  PHE A CE1  1  
ATOM 521   C CE2  . PHE A 1 33  ? -5.226  1.223   0.986   1.00 0.00 ? 33  PHE A CE2  1  
ATOM 522   C CZ   . PHE A 1 33  ? -4.593  0.060   1.381   1.00 0.00 ? 33  PHE A CZ   1  
ATOM 523   H H    . PHE A 1 33  ? -0.730  2.818   2.325   1.00 0.00 ? 33  PHE A H    1  
ATOM 524   H HA   . PHE A 1 33  ? -2.400  4.597   0.756   1.00 0.00 ? 33  PHE A HA   1  
ATOM 525   H HB2  . PHE A 1 33  ? -2.688  3.746   3.645   1.00 0.00 ? 33  PHE A HB2  1  
ATOM 526   H HB3  . PHE A 1 33  ? -3.908  4.558   2.670   1.00 0.00 ? 33  PHE A HB3  1  
ATOM 527   H HD1  . PHE A 1 33  ? -2.111  1.406   3.224   1.00 0.00 ? 33  PHE A HD1  1  
ATOM 528   H HD2  . PHE A 1 33  ? -5.231  3.357   1.085   1.00 0.00 ? 33  PHE A HD2  1  
ATOM 529   H HE1  . PHE A 1 33  ? -2.976  -0.780  2.498   1.00 0.00 ? 33  PHE A HE1  1  
ATOM 530   H HE2  . PHE A 1 33  ? -6.102  1.174   0.356   1.00 0.00 ? 33  PHE A HE2  1  
ATOM 531   H HZ   . PHE A 1 33  ? -4.974  -0.899  1.063   1.00 0.00 ? 33  PHE A HZ   1  
ATOM 532   N N    . PHE A 1 34  ? -1.355  6.739   1.434   1.00 0.00 ? 34  PHE A N    1  
ATOM 533   C CA   . PHE A 1 34  ? -0.866  8.051   1.843   1.00 0.00 ? 34  PHE A CA   1  
ATOM 534   C C    . PHE A 1 34  ? -1.835  9.150   1.418   1.00 0.00 ? 34  PHE A C    1  
ATOM 535   O O    . PHE A 1 34  ? -2.684  8.942   0.551   1.00 0.00 ? 34  PHE A O    1  
ATOM 536   C CB   . PHE A 1 34  ? 0.516   8.313   1.241   1.00 0.00 ? 34  PHE A CB   1  
ATOM 537   C CG   . PHE A 1 34  ? 0.481   8.621   -0.229  1.00 0.00 ? 34  PHE A CG   1  
ATOM 538   C CD1  . PHE A 1 34  ? 0.336   9.926   -0.674  1.00 0.00 ? 34  PHE A CD1  1  
ATOM 539   C CD2  . PHE A 1 34  ? 0.592   7.607   -1.166  1.00 0.00 ? 34  PHE A CD2  1  
ATOM 540   C CE1  . PHE A 1 34  ? 0.303   10.213  -2.025  1.00 0.00 ? 34  PHE A CE1  1  
ATOM 541   C CE2  . PHE A 1 34  ? 0.561   7.888   -2.519  1.00 0.00 ? 34  PHE A CE2  1  
ATOM 542   C CZ   . PHE A 1 34  ? 0.415   9.192   -2.949  1.00 0.00 ? 34  PHE A CZ   1  
ATOM 543   H H    . PHE A 1 34  ? -1.612  6.594   0.499   1.00 0.00 ? 34  PHE A H    1  
ATOM 544   H HA   . PHE A 1 34  ? -0.787  8.054   2.919   1.00 0.00 ? 34  PHE A HA   1  
ATOM 545   H HB2  . PHE A 1 34  ? 0.967   9.155   1.745   1.00 0.00 ? 34  PHE A HB2  1  
ATOM 546   H HB3  . PHE A 1 34  ? 1.134   7.440   1.383   1.00 0.00 ? 34  PHE A HB3  1  
ATOM 547   H HD1  . PHE A 1 34  ? 0.248   10.725  0.049   1.00 0.00 ? 34  PHE A HD1  1  
ATOM 548   H HD2  . PHE A 1 34  ? 0.705   6.586   -0.831  1.00 0.00 ? 34  PHE A HD2  1  
ATOM 549   H HE1  . PHE A 1 34  ? 0.189   11.234  -2.358  1.00 0.00 ? 34  PHE A HE1  1  
ATOM 550   H HE2  . PHE A 1 34  ? 0.648   7.088   -3.239  1.00 0.00 ? 34  PHE A HE2  1  
ATOM 551   H HZ   . PHE A 1 34  ? 0.391   9.414   -4.005  1.00 0.00 ? 34  PHE A HZ   1  
ATOM 552   N N    . ALA A 1 35  ? -1.702  10.319  2.035   1.00 0.00 ? 35  ALA A N    1  
ATOM 553   C CA   . ALA A 1 35  ? -2.564  11.451  1.720   1.00 0.00 ? 35  ALA A CA   1  
ATOM 554   C C    . ALA A 1 35  ? -1.783  12.559  1.022   1.00 0.00 ? 35  ALA A C    1  
ATOM 555   O O    . ALA A 1 35  ? -0.595  12.749  1.278   1.00 0.00 ? 35  ALA A O    1  
ATOM 556   C CB   . ALA A 1 35  ? -3.221  11.983  2.986   1.00 0.00 ? 35  ALA A CB   1  
ATOM 557   H H    . ALA A 1 35  ? -1.007  10.423  2.717   1.00 0.00 ? 35  ALA A H    1  
ATOM 558   H HA   . ALA A 1 35  ? -3.344  11.103  1.058   1.00 0.00 ? 35  ALA A HA   1  
ATOM 559   H HB1  . ALA A 1 35  ? -3.837  11.210  3.422   1.00 0.00 ? 35  ALA A HB1  1  
ATOM 560   H HB2  . ALA A 1 35  ? -2.458  12.277  3.691   1.00 0.00 ? 35  ALA A HB2  1  
ATOM 561   H HB3  . ALA A 1 35  ? -3.834  12.837  2.741   1.00 0.00 ? 35  ALA A HB3  1  
ATOM 562   N N    . ASN A 1 36  ? -2.458  13.288  0.139   1.00 0.00 ? 36  ASN A N    1  
ATOM 563   C CA   . ASN A 1 36  ? -1.826  14.376  -0.597  1.00 0.00 ? 36  ASN A CA   1  
ATOM 564   C C    . ASN A 1 36  ? -1.352  15.472  0.353   1.00 0.00 ? 36  ASN A C    1  
ATOM 565   O O    . ASN A 1 36  ? -0.412  16.207  0.050   1.00 0.00 ? 36  ASN A O    1  
ATOM 566   C CB   . ASN A 1 36  ? -2.800  14.961  -1.622  1.00 0.00 ? 36  ASN A CB   1  
ATOM 567   C CG   . ASN A 1 36  ? -4.034  15.556  -0.972  1.00 0.00 ? 36  ASN A CG   1  
ATOM 568   O OD1  . ASN A 1 36  ? -4.044  16.726  -0.588  1.00 0.00 ? 36  ASN A OD1  1  
ATOM 569   N ND2  . ASN A 1 36  ? -5.083  14.751  -0.846  1.00 0.00 ? 36  ASN A ND2  1  
ATOM 570   H H    . ASN A 1 36  ? -3.404  13.088  -0.022  1.00 0.00 ? 36  ASN A H    1  
ATOM 571   H HA   . ASN A 1 36  ? -0.970  13.972  -1.117  1.00 0.00 ? 36  ASN A HA   1  
ATOM 572   H HB2  . ASN A 1 36  ? -2.301  15.738  -2.181  1.00 0.00 ? 36  ASN A HB2  1  
ATOM 573   H HB3  . ASN A 1 36  ? -3.113  14.180  -2.298  1.00 0.00 ? 36  ASN A HB3  1  
ATOM 574   H HD21 . ASN A 1 36  ? -5.003  13.831  -1.174  1.00 0.00 ? 36  ASN A HD21 1  
ATOM 575   H HD22 . ASN A 1 36  ? -5.894  15.111  -0.430  1.00 0.00 ? 36  ASN A HD22 1  
ATOM 576   N N    . TRP A 1 37  ? -2.009  15.575  1.503   1.00 0.00 ? 37  TRP A N    1  
ATOM 577   C CA   . TRP A 1 37  ? -1.654  16.581  2.498   1.00 0.00 ? 37  TRP A CA   1  
ATOM 578   C C    . TRP A 1 37  ? -0.745  15.989  3.570   1.00 0.00 ? 37  TRP A C    1  
ATOM 579   O O    . TRP A 1 37  ? -0.510  16.608  4.608   1.00 0.00 ? 37  TRP A O    1  
ATOM 580   C CB   . TRP A 1 37  ? -2.916  17.157  3.143   1.00 0.00 ? 37  TRP A CB   1  
ATOM 581   C CG   . TRP A 1 37  ? -4.055  16.184  3.191   1.00 0.00 ? 37  TRP A CG   1  
ATOM 582   C CD1  . TRP A 1 37  ? -5.200  16.225  2.448   1.00 0.00 ? 37  TRP A CD1  1  
ATOM 583   C CD2  . TRP A 1 37  ? -4.160  15.027  4.029   1.00 0.00 ? 37  TRP A CD2  1  
ATOM 584   N NE1  . TRP A 1 37  ? -6.010  15.164  2.773   1.00 0.00 ? 37  TRP A NE1  1  
ATOM 585   C CE2  . TRP A 1 37  ? -5.394  14.414  3.739   1.00 0.00 ? 37  TRP A CE2  1  
ATOM 586   C CE3  . TRP A 1 37  ? -3.330  14.449  4.993   1.00 0.00 ? 37  TRP A CE3  1  
ATOM 587   C CZ2  . TRP A 1 37  ? -5.816  13.253  4.381   1.00 0.00 ? 37  TRP A CZ2  1  
ATOM 588   C CZ3  . TRP A 1 37  ? -3.751  13.297  5.630   1.00 0.00 ? 37  TRP A CZ3  1  
ATOM 589   C CH2  . TRP A 1 37  ? -4.984  12.708  5.322   1.00 0.00 ? 37  TRP A CH2  1  
ATOM 590   H H    . TRP A 1 37  ? -2.749  14.960  1.688   1.00 0.00 ? 37  TRP A H    1  
ATOM 591   H HA   . TRP A 1 37  ? -1.125  17.374  1.992   1.00 0.00 ? 37  TRP A HA   1  
ATOM 592   H HB2  . TRP A 1 37  ? -2.691  17.457  4.155   1.00 0.00 ? 37  TRP A HB2  1  
ATOM 593   H HB3  . TRP A 1 37  ? -3.237  18.020  2.578   1.00 0.00 ? 37  TRP A HB3  1  
ATOM 594   H HD1  . TRP A 1 37  ? -5.423  16.987  1.717   1.00 0.00 ? 37  TRP A HD1  1  
ATOM 595   H HE1  . TRP A 1 37  ? -6.886  14.974  2.375   1.00 0.00 ? 37  TRP A HE1  1  
ATOM 596   H HE3  . TRP A 1 37  ? -2.376  14.889  5.245   1.00 0.00 ? 37  TRP A HE3  1  
ATOM 597   H HZ2  . TRP A 1 37  ? -6.764  12.786  4.155   1.00 0.00 ? 37  TRP A HZ2  1  
ATOM 598   H HZ3  . TRP A 1 37  ? -3.123  12.837  6.378   1.00 0.00 ? 37  TRP A HZ3  1  
ATOM 599   H HH2  . TRP A 1 37  ? -5.272  11.809  5.844   1.00 0.00 ? 37  TRP A HH2  1  
ATOM 600   N N    . SER A 1 38  ? -0.236  14.789  3.312   1.00 0.00 ? 38  SER A N    1  
ATOM 601   C CA   . SER A 1 38  ? 0.645   14.113  4.257   1.00 0.00 ? 38  SER A CA   1  
ATOM 602   C C    . SER A 1 38  ? 2.090   14.566  4.073   1.00 0.00 ? 38  SER A C    1  
ATOM 603   O O    . SER A 1 38  ? 2.763   14.163  3.126   1.00 0.00 ? 38  SER A O    1  
ATOM 604   C CB   . SER A 1 38  ? 0.548   12.596  4.081   1.00 0.00 ? 38  SER A CB   1  
ATOM 605   O OG   . SER A 1 38  ? 1.412   11.922  4.980   1.00 0.00 ? 38  SER A OG   1  
ATOM 606   H H    . SER A 1 38  ? -0.461  14.346  2.466   1.00 0.00 ? 38  SER A H    1  
ATOM 607   H HA   . SER A 1 38  ? 0.322   14.372  5.254   1.00 0.00 ? 38  SER A HA   1  
ATOM 608   H HB2  . SER A 1 38  ? -0.466  12.278  4.269   1.00 0.00 ? 38  SER A HB2  1  
ATOM 609   H HB3  . SER A 1 38  ? 0.826   12.335  3.070   1.00 0.00 ? 38  SER A HB3  1  
ATOM 610   H HG   . SER A 1 38  ? 2.203   12.448  5.119   1.00 0.00 ? 38  SER A HG   1  
ATOM 611   N N    . ASN A 1 39  ? 2.559   15.409  4.988   1.00 0.00 ? 39  ASN A N    1  
ATOM 612   C CA   . ASN A 1 39  ? 3.924   15.919  4.927   1.00 0.00 ? 39  ASN A CA   1  
ATOM 613   C C    . ASN A 1 39  ? 4.929   14.828  5.282   1.00 0.00 ? 39  ASN A C    1  
ATOM 614   O O    . ASN A 1 39  ? 5.891   14.594  4.551   1.00 0.00 ? 39  ASN A O    1  
ATOM 615   C CB   . ASN A 1 39  ? 4.089   17.108  5.876   1.00 0.00 ? 39  ASN A CB   1  
ATOM 616   C CG   . ASN A 1 39  ? 3.227   18.291  5.476   1.00 0.00 ? 39  ASN A CG   1  
ATOM 617   O OD1  . ASN A 1 39  ? 2.937   18.491  4.297   1.00 0.00 ? 39  ASN A OD1  1  
ATOM 618   N ND2  . ASN A 1 39  ? 2.814   19.081  6.460   1.00 0.00 ? 39  ASN A ND2  1  
ATOM 619   H H    . ASN A 1 39  ? 1.974   15.695  5.720   1.00 0.00 ? 39  ASN A H    1  
ATOM 620   H HA   . ASN A 1 39  ? 4.110   16.249  3.916   1.00 0.00 ? 39  ASN A HA   1  
ATOM 621   H HB2  . ASN A 1 39  ? 3.809   16.805  6.875   1.00 0.00 ? 39  ASN A HB2  1  
ATOM 622   H HB3  . ASN A 1 39  ? 5.122   17.422  5.876   1.00 0.00 ? 39  ASN A HB3  1  
ATOM 623   H HD21 . ASN A 1 39  ? 3.084   18.860  7.376   1.00 0.00 ? 39  ASN A HD21 1  
ATOM 624   H HD22 . ASN A 1 39  ? 2.255   19.852  6.230   1.00 0.00 ? 39  ASN A HD22 1  
ATOM 625   N N    . ASP A 1 40  ? 4.699   14.163  6.409   1.00 0.00 ? 40  ASP A N    1  
ATOM 626   C CA   . ASP A 1 40  ? 5.583   13.095  6.861   1.00 0.00 ? 40  ASP A CA   1  
ATOM 627   C C    . ASP A 1 40  ? 5.837   12.090  5.742   1.00 0.00 ? 40  ASP A C    1  
ATOM 628   O O    . ASP A 1 40  ? 6.832   11.364  5.761   1.00 0.00 ? 40  ASP A O    1  
ATOM 629   C CB   . ASP A 1 40  ? 4.980   12.385  8.074   1.00 0.00 ? 40  ASP A CB   1  
ATOM 630   C CG   . ASP A 1 40  ? 4.810   13.311  9.262   1.00 0.00 ? 40  ASP A CG   1  
ATOM 631   O OD1  . ASP A 1 40  ? 3.915   14.182  9.213   1.00 0.00 ? 40  ASP A OD1  1  
ATOM 632   O OD2  . ASP A 1 40  ? 5.571   13.165  10.242  1.00 0.00 ? 40  ASP A OD2  1  
ATOM 633   H H    . ASP A 1 40  ? 3.915   14.396  6.950   1.00 0.00 ? 40  ASP A H    1  
ATOM 634   H HA   . ASP A 1 40  ? 6.523   13.541  7.148   1.00 0.00 ? 40  ASP A HA   1  
ATOM 635   H HB2  . ASP A 1 40  ? 4.010   11.990  7.808   1.00 0.00 ? 40  ASP A HB2  1  
ATOM 636   H HB3  . ASP A 1 40  ? 5.628   11.571  8.365   1.00 0.00 ? 40  ASP A HB3  1  
ATOM 637   N N    . CYS A 1 41  ? 4.932   12.053  4.771   1.00 0.00 ? 41  CYS A N    1  
ATOM 638   C CA   . CYS A 1 41  ? 5.057   11.135  3.644   1.00 0.00 ? 41  CYS A CA   1  
ATOM 639   C C    . CYS A 1 41  ? 6.191   11.562  2.718   1.00 0.00 ? 41  CYS A C    1  
ATOM 640   O O    . CYS A 1 41  ? 6.866   10.724  2.122   1.00 0.00 ? 41  CYS A O    1  
ATOM 641   C CB   . CYS A 1 41  ? 3.743   11.070  2.864   1.00 0.00 ? 41  CYS A CB   1  
ATOM 642   S SG   . CYS A 1 41  ? 3.827   10.074  1.358   1.00 0.00 ? 41  CYS A SG   1  
ATOM 643   H H    . CYS A 1 41  ? 4.160   12.656  4.812   1.00 0.00 ? 41  CYS A H    1  
ATOM 644   H HA   . CYS A 1 41  ? 5.280   10.156  4.039   1.00 0.00 ? 41  CYS A HA   1  
ATOM 645   H HB2  . CYS A 1 41  ? 2.978   10.644  3.496   1.00 0.00 ? 41  CYS A HB2  1  
ATOM 646   H HB3  . CYS A 1 41  ? 3.451   12.071  2.582   1.00 0.00 ? 41  CYS A HB3  1  
ATOM 647   H HG   . CYS A 1 41  ? 2.694   10.241  0.693   1.00 0.00 ? 41  CYS A HG   1  
ATOM 648   N N    . GLN A 1 42  ? 6.394   12.871  2.603   1.00 0.00 ? 42  GLN A N    1  
ATOM 649   C CA   . GLN A 1 42  ? 7.445   13.409  1.748   1.00 0.00 ? 42  GLN A CA   1  
ATOM 650   C C    . GLN A 1 42  ? 8.792   12.771  2.075   1.00 0.00 ? 42  GLN A C    1  
ATOM 651   O O    . GLN A 1 42  ? 9.619   12.557  1.189   1.00 0.00 ? 42  GLN A O    1  
ATOM 652   C CB   . GLN A 1 42  ? 7.534   14.927  1.907   1.00 0.00 ? 42  GLN A CB   1  
ATOM 653   C CG   . GLN A 1 42  ? 8.429   15.367  3.054   1.00 0.00 ? 42  GLN A CG   1  
ATOM 654   C CD   . GLN A 1 42  ? 8.447   16.872  3.237   1.00 0.00 ? 42  GLN A CD   1  
ATOM 655   O OE1  . GLN A 1 42  ? 9.497   17.509  3.140   1.00 0.00 ? 42  GLN A OE1  1  
ATOM 656   N NE2  . GLN A 1 42  ? 7.281   17.450  3.502   1.00 0.00 ? 42  GLN A NE2  1  
ATOM 657   H H    . GLN A 1 42  ? 5.822   13.489  3.105   1.00 0.00 ? 42  GLN A H    1  
ATOM 658   H HA   . GLN A 1 42  ? 7.190   13.177  0.725   1.00 0.00 ? 42  GLN A HA   1  
ATOM 659   H HB2  . GLN A 1 42  ? 7.922   15.351  0.993   1.00 0.00 ? 42  GLN A HB2  1  
ATOM 660   H HB3  . GLN A 1 42  ? 6.543   15.318  2.083   1.00 0.00 ? 42  GLN A HB3  1  
ATOM 661   H HG2  . GLN A 1 42  ? 8.072   14.914  3.967   1.00 0.00 ? 42  GLN A HG2  1  
ATOM 662   H HG3  . GLN A 1 42  ? 9.436   15.031  2.857   1.00 0.00 ? 42  GLN A HG3  1  
ATOM 663   H HE21 . GLN A 1 42  ? 6.486   16.880  3.566   1.00 0.00 ? 42  GLN A HE21 1  
ATOM 664   H HE22 . GLN A 1 42  ? 7.264   18.422  3.626   1.00 0.00 ? 42  GLN A HE22 1  
ATOM 665   N N    . SER A 1 43  ? 9.005   12.472  3.352   1.00 0.00 ? 43  SER A N    1  
ATOM 666   C CA   . SER A 1 43  ? 10.253  11.863  3.797   1.00 0.00 ? 43  SER A CA   1  
ATOM 667   C C    . SER A 1 43  ? 10.355  10.419  3.314   1.00 0.00 ? 43  SER A C    1  
ATOM 668   O O    . SER A 1 43  ? 11.448  9.863   3.210   1.00 0.00 ? 43  SER A O    1  
ATOM 669   C CB   . SER A 1 43  ? 10.354  11.911  5.322   1.00 0.00 ? 43  SER A CB   1  
ATOM 670   O OG   . SER A 1 43  ? 11.699  11.783  5.749   1.00 0.00 ? 43  SER A OG   1  
ATOM 671   H H    . SER A 1 43  ? 8.306   12.667  4.012   1.00 0.00 ? 43  SER A H    1  
ATOM 672   H HA   . SER A 1 43  ? 11.068  12.430  3.372   1.00 0.00 ? 43  SER A HA   1  
ATOM 673   H HB2  . SER A 1 43  ? 9.965   12.854  5.677   1.00 0.00 ? 43  SER A HB2  1  
ATOM 674   H HB3  . SER A 1 43  ? 9.776   11.102  5.744   1.00 0.00 ? 43  SER A HB3  1  
ATOM 675   H HG   . SER A 1 43  ? 11.798  10.974  6.256   1.00 0.00 ? 43  SER A HG   1  
ATOM 676   N N    . PHE A 1 44  ? 9.207   9.817   3.022   1.00 0.00 ? 44  PHE A N    1  
ATOM 677   C CA   . PHE A 1 44  ? 9.165   8.437   2.551   1.00 0.00 ? 44  PHE A CA   1  
ATOM 678   C C    . PHE A 1 44  ? 9.140   8.383   1.027   1.00 0.00 ? 44  PHE A C    1  
ATOM 679   O O    . PHE A 1 44  ? 9.491   7.368   0.425   1.00 0.00 ? 44  PHE A O    1  
ATOM 680   C CB   . PHE A 1 44  ? 7.938   7.720   3.118   1.00 0.00 ? 44  PHE A CB   1  
ATOM 681   C CG   . PHE A 1 44  ? 8.120   6.235   3.249   1.00 0.00 ? 44  PHE A CG   1  
ATOM 682   C CD1  . PHE A 1 44  ? 8.935   5.708   4.238   1.00 0.00 ? 44  PHE A CD1  1  
ATOM 683   C CD2  . PHE A 1 44  ? 7.475   5.366   2.385   1.00 0.00 ? 44  PHE A CD2  1  
ATOM 684   C CE1  . PHE A 1 44  ? 9.105   4.342   4.360   1.00 0.00 ? 44  PHE A CE1  1  
ATOM 685   C CE2  . PHE A 1 44  ? 7.640   3.998   2.502   1.00 0.00 ? 44  PHE A CE2  1  
ATOM 686   C CZ   . PHE A 1 44  ? 8.455   3.486   3.492   1.00 0.00 ? 44  PHE A CZ   1  
ATOM 687   H H    . PHE A 1 44  ? 8.367   10.313  3.125   1.00 0.00 ? 44  PHE A H    1  
ATOM 688   H HA   . PHE A 1 44  ? 10.056  7.941   2.903   1.00 0.00 ? 44  PHE A HA   1  
ATOM 689   H HB2  . PHE A 1 44  ? 7.721   8.115   4.099   1.00 0.00 ? 44  PHE A HB2  1  
ATOM 690   H HB3  . PHE A 1 44  ? 7.095   7.897   2.469   1.00 0.00 ? 44  PHE A HB3  1  
ATOM 691   H HD1  . PHE A 1 44  ? 9.443   6.376   4.918   1.00 0.00 ? 44  PHE A HD1  1  
ATOM 692   H HD2  . PHE A 1 44  ? 6.836   5.766   1.610   1.00 0.00 ? 44  PHE A HD2  1  
ATOM 693   H HE1  . PHE A 1 44  ? 9.743   3.943   5.135   1.00 0.00 ? 44  PHE A HE1  1  
ATOM 694   H HE2  . PHE A 1 44  ? 7.131   3.332   1.821   1.00 0.00 ? 44  PHE A HE2  1  
ATOM 695   H HZ   . PHE A 1 44  ? 8.586   2.418   3.585   1.00 0.00 ? 44  PHE A HZ   1  
ATOM 696   N N    . ALA A 1 45  ? 8.722   9.483   0.408   1.00 0.00 ? 45  ALA A N    1  
ATOM 697   C CA   . ALA A 1 45  ? 8.653   9.562   -1.046  1.00 0.00 ? 45  ALA A CA   1  
ATOM 698   C C    . ALA A 1 45  ? 9.802   8.796   -1.693  1.00 0.00 ? 45  ALA A C    1  
ATOM 699   O O    . ALA A 1 45  ? 9.598   7.842   -2.444  1.00 0.00 ? 45  ALA A O    1  
ATOM 700   C CB   . ALA A 1 45  ? 8.664   11.015  -1.497  1.00 0.00 ? 45  ALA A CB   1  
ATOM 701   H H    . ALA A 1 45  ? 8.456   10.260  0.942   1.00 0.00 ? 45  ALA A H    1  
ATOM 702   H HA   . ALA A 1 45  ? 7.717   9.121   -1.360  1.00 0.00 ? 45  ALA A HA   1  
ATOM 703   H HB1  . ALA A 1 45  ? 8.782   11.657  -0.636  1.00 0.00 ? 45  ALA A HB1  1  
ATOM 704   H HB2  . ALA A 1 45  ? 9.486   11.173  -2.179  1.00 0.00 ? 45  ALA A HB2  1  
ATOM 705   H HB3  . ALA A 1 45  ? 7.733   11.245  -1.993  1.00 0.00 ? 45  ALA A HB3  1  
ATOM 706   N N    . PRO A 1 46  ? 11.039  9.222   -1.397  1.00 0.00 ? 46  PRO A N    1  
ATOM 707   C CA   . PRO A 1 46  ? 12.244  8.590   -1.940  1.00 0.00 ? 46  PRO A CA   1  
ATOM 708   C C    . PRO A 1 46  ? 12.480  7.199   -1.363  1.00 0.00 ? 46  PRO A C    1  
ATOM 709   O O    . PRO A 1 46  ? 12.922  6.291   -2.068  1.00 0.00 ? 46  PRO A O    1  
ATOM 710   C CB   . PRO A 1 46  ? 13.366  9.542   -1.516  1.00 0.00 ? 46  PRO A CB   1  
ATOM 711   C CG   . PRO A 1 46  ? 12.840  10.231  -0.304  1.00 0.00 ? 46  PRO A CG   1  
ATOM 712   C CD   . PRO A 1 46  ? 11.355  10.354  -0.510  1.00 0.00 ? 46  PRO A CD   1  
ATOM 713   H HA   . PRO A 1 46  ? 12.210  8.530   -3.018  1.00 0.00 ? 46  PRO A HA   1  
ATOM 714   H HB2  . PRO A 1 46  ? 14.258  8.974   -1.293  1.00 0.00 ? 46  PRO A HB2  1  
ATOM 715   H HB3  . PRO A 1 46  ? 13.568  10.243  -2.312  1.00 0.00 ? 46  PRO A HB3  1  
ATOM 716   H HG2  . PRO A 1 46  ? 13.049  9.639   0.574   1.00 0.00 ? 46  PRO A HG2  1  
ATOM 717   H HG3  . PRO A 1 46  ? 13.288  11.209  -0.215  1.00 0.00 ? 46  PRO A HG3  1  
ATOM 718   H HD2  . PRO A 1 46  ? 10.835  10.262  0.433   1.00 0.00 ? 46  PRO A HD2  1  
ATOM 719   H HD3  . PRO A 1 46  ? 11.116  11.294  -0.985  1.00 0.00 ? 46  PRO A HD3  1  
ATOM 720   N N    . ILE A 1 47  ? 12.182  7.038   -0.078  1.00 0.00 ? 47  ILE A N    1  
ATOM 721   C CA   . ILE A 1 47  ? 12.360  5.757   0.593   1.00 0.00 ? 47  ILE A CA   1  
ATOM 722   C C    . ILE A 1 47  ? 11.599  4.649   -0.128  1.00 0.00 ? 47  ILE A C    1  
ATOM 723   O O    . ILE A 1 47  ? 12.187  3.656   -0.558  1.00 0.00 ? 47  ILE A O    1  
ATOM 724   C CB   . ILE A 1 47  ? 11.890  5.818   2.058   1.00 0.00 ? 47  ILE A CB   1  
ATOM 725   C CG1  . ILE A 1 47  ? 12.655  6.904   2.817   1.00 0.00 ? 47  ILE A CG1  1  
ATOM 726   C CG2  . ILE A 1 47  ? 12.073  4.465   2.730   1.00 0.00 ? 47  ILE A CG2  1  
ATOM 727   C CD1  . ILE A 1 47  ? 12.268  7.008   4.276   1.00 0.00 ? 47  ILE A CD1  1  
ATOM 728   H H    . ILE A 1 47  ? 11.833  7.800   0.431   1.00 0.00 ? 47  ILE A H    1  
ATOM 729   H HA   . ILE A 1 47  ? 13.414  5.520   0.583   1.00 0.00 ? 47  ILE A HA   1  
ATOM 730   H HB   . ILE A 1 47  ? 10.838  6.057   2.065   1.00 0.00 ? 47  ILE A HB   1  
ATOM 731   H HG12 . ILE A 1 47  ? 13.712  6.691   2.769   1.00 0.00 ? 47  ILE A HG12 1  
ATOM 732   H HG13 . ILE A 1 47  ? 12.463  7.860   2.352   1.00 0.00 ? 47  ILE A HG13 1  
ATOM 733   H HG21 . ILE A 1 47  ? 12.862  4.532   3.465   1.00 0.00 ? 47  ILE A HG21 1  
ATOM 734   H HG22 . ILE A 1 47  ? 11.153  4.177   3.216   1.00 0.00 ? 47  ILE A HG22 1  
ATOM 735   H HG23 . ILE A 1 47  ? 12.335  3.726   1.988   1.00 0.00 ? 47  ILE A HG23 1  
ATOM 736   H HD11 . ILE A 1 47  ? 13.160  7.029   4.885   1.00 0.00 ? 47  ILE A HD11 1  
ATOM 737   H HD12 . ILE A 1 47  ? 11.701  7.913   4.434   1.00 0.00 ? 47  ILE A HD12 1  
ATOM 738   H HD13 . ILE A 1 47  ? 11.666  6.154   4.550   1.00 0.00 ? 47  ILE A HD13 1  
ATOM 739   N N    . TYR A 1 48  ? 10.289  4.826   -0.257  1.00 0.00 ? 48  TYR A N    1  
ATOM 740   C CA   . TYR A 1 48  ? 9.447   3.841   -0.925  1.00 0.00 ? 48  TYR A CA   1  
ATOM 741   C C    . TYR A 1 48  ? 9.948   3.566   -2.340  1.00 0.00 ? 48  TYR A C    1  
ATOM 742   O O    . TYR A 1 48  ? 10.160  2.416   -2.723  1.00 0.00 ? 48  TYR A O    1  
ATOM 743   C CB   . TYR A 1 48  ? 7.997   4.326   -0.970  1.00 0.00 ? 48  TYR A CB   1  
ATOM 744   C CG   . TYR A 1 48  ? 7.007   3.242   -1.332  1.00 0.00 ? 48  TYR A CG   1  
ATOM 745   C CD1  . TYR A 1 48  ? 6.878   2.102   -0.548  1.00 0.00 ? 48  TYR A CD1  1  
ATOM 746   C CD2  . TYR A 1 48  ? 6.201   3.356   -2.458  1.00 0.00 ? 48  TYR A CD2  1  
ATOM 747   C CE1  . TYR A 1 48  ? 5.976   1.108   -0.875  1.00 0.00 ? 48  TYR A CE1  1  
ATOM 748   C CE2  . TYR A 1 48  ? 5.295   2.369   -2.792  1.00 0.00 ? 48  TYR A CE2  1  
ATOM 749   C CZ   . TYR A 1 48  ? 5.186   1.246   -1.997  1.00 0.00 ? 48  TYR A CZ   1  
ATOM 750   O OH   . TYR A 1 48  ? 4.286   0.260   -2.327  1.00 0.00 ? 48  TYR A OH   1  
ATOM 751   H H    . TYR A 1 48  ? 9.878   5.638   0.107   1.00 0.00 ? 48  TYR A H    1  
ATOM 752   H HA   . TYR A 1 48  ? 9.492   2.924   -0.355  1.00 0.00 ? 48  TYR A HA   1  
ATOM 753   H HB2  . TYR A 1 48  ? 7.724   4.713   -0.001  1.00 0.00 ? 48  TYR A HB2  1  
ATOM 754   H HB3  . TYR A 1 48  ? 7.911   5.113   -1.705  1.00 0.00 ? 48  TYR A HB3  1  
ATOM 755   H HD1  . TYR A 1 48  ? 7.498   1.996   0.331   1.00 0.00 ? 48  TYR A HD1  1  
ATOM 756   H HD2  . TYR A 1 48  ? 6.290   4.237   -3.079  1.00 0.00 ? 48  TYR A HD2  1  
ATOM 757   H HE1  . TYR A 1 48  ? 5.890   0.229   -0.253  1.00 0.00 ? 48  TYR A HE1  1  
ATOM 758   H HE2  . TYR A 1 48  ? 4.677   2.477   -3.671  1.00 0.00 ? 48  TYR A HE2  1  
ATOM 759   H HH   . TYR A 1 48  ? 3.675   0.127   -1.598  1.00 0.00 ? 48  TYR A HH   1  
ATOM 760   N N    . ALA A 1 49  ? 10.134  4.632   -3.112  1.00 0.00 ? 49  ALA A N    1  
ATOM 761   C CA   . ALA A 1 49  ? 10.612  4.507   -4.483  1.00 0.00 ? 49  ALA A CA   1  
ATOM 762   C C    . ALA A 1 49  ? 11.802  3.557   -4.566  1.00 0.00 ? 49  ALA A C    1  
ATOM 763   O O    . ALA A 1 49  ? 11.814  2.631   -5.377  1.00 0.00 ? 49  ALA A O    1  
ATOM 764   C CB   . ALA A 1 49  ? 10.986  5.874   -5.038  1.00 0.00 ? 49  ALA A CB   1  
ATOM 765   H H    . ALA A 1 49  ? 9.947   5.523   -2.750  1.00 0.00 ? 49  ALA A H    1  
ATOM 766   H HA   . ALA A 1 49  ? 9.805   4.111   -5.083  1.00 0.00 ? 49  ALA A HA   1  
ATOM 767   H HB1  . ALA A 1 49  ? 11.604  6.395   -4.321  1.00 0.00 ? 49  ALA A HB1  1  
ATOM 768   H HB2  . ALA A 1 49  ? 11.531  5.750   -5.962  1.00 0.00 ? 49  ALA A HB2  1  
ATOM 769   H HB3  . ALA A 1 49  ? 10.088  6.445   -5.222  1.00 0.00 ? 49  ALA A HB3  1  
ATOM 770   N N    . ASP A 1 50  ? 12.801  3.793   -3.722  1.00 0.00 ? 50  ASP A N    1  
ATOM 771   C CA   . ASP A 1 50  ? 13.996  2.958   -3.700  1.00 0.00 ? 50  ASP A CA   1  
ATOM 772   C C    . ASP A 1 50  ? 13.635  1.500   -3.431  1.00 0.00 ? 50  ASP A C    1  
ATOM 773   O O    . ASP A 1 50  ? 14.106  0.595   -4.121  1.00 0.00 ? 50  ASP A O    1  
ATOM 774   C CB   . ASP A 1 50  ? 14.974  3.459   -2.636  1.00 0.00 ? 50  ASP A CB   1  
ATOM 775   C CG   . ASP A 1 50  ? 15.937  4.497   -3.178  1.00 0.00 ? 50  ASP A CG   1  
ATOM 776   O OD1  . ASP A 1 50  ? 16.946  4.103   -3.800  1.00 0.00 ? 50  ASP A OD1  1  
ATOM 777   O OD2  . ASP A 1 50  ? 15.681  5.703   -2.981  1.00 0.00 ? 50  ASP A OD2  1  
ATOM 778   H H    . ASP A 1 50  ? 12.733  4.547   -3.099  1.00 0.00 ? 50  ASP A H    1  
ATOM 779   H HA   . ASP A 1 50  ? 14.467  3.026   -4.669  1.00 0.00 ? 50  ASP A HA   1  
ATOM 780   H HB2  . ASP A 1 50  ? 14.417  3.902   -1.824  1.00 0.00 ? 50  ASP A HB2  1  
ATOM 781   H HB3  . ASP A 1 50  ? 15.547  2.623   -2.261  1.00 0.00 ? 50  ASP A HB3  1  
ATOM 782   N N    . LEU A 1 51  ? 12.798  1.280   -2.423  1.00 0.00 ? 51  LEU A N    1  
ATOM 783   C CA   . LEU A 1 51  ? 12.375  -0.069  -2.061  1.00 0.00 ? 51  LEU A CA   1  
ATOM 784   C C    . LEU A 1 51  ? 11.702  -0.763  -3.241  1.00 0.00 ? 51  LEU A C    1  
ATOM 785   O O    . LEU A 1 51  ? 12.183  -1.786  -3.728  1.00 0.00 ? 51  LEU A O    1  
ATOM 786   C CB   . LEU A 1 51  ? 11.417  -0.021  -0.869  1.00 0.00 ? 51  LEU A CB   1  
ATOM 787   C CG   . LEU A 1 51  ? 12.063  -0.096  0.514   1.00 0.00 ? 51  LEU A CG   1  
ATOM 788   C CD1  . LEU A 1 51  ? 11.131  0.477   1.571   1.00 0.00 ? 51  LEU A CD1  1  
ATOM 789   C CD2  . LEU A 1 51  ? 12.435  -1.533  0.852   1.00 0.00 ? 51  LEU A CD2  1  
ATOM 790   H H    . LEU A 1 51  ? 12.457  2.041   -1.909  1.00 0.00 ? 51  LEU A H    1  
ATOM 791   H HA   . LEU A 1 51  ? 13.255  -0.629  -1.783  1.00 0.00 ? 51  LEU A HA   1  
ATOM 792   H HB2  . LEU A 1 51  ? 10.864  0.904   -0.926  1.00 0.00 ? 51  LEU A HB2  1  
ATOM 793   H HB3  . LEU A 1 51  ? 10.733  -0.853  -0.962  1.00 0.00 ? 51  LEU A HB3  1  
ATOM 794   H HG   . LEU A 1 51  ? 12.970  0.494   0.514   1.00 0.00 ? 51  LEU A HG   1  
ATOM 795   H HD11 . LEU A 1 51  ? 11.199  1.555   1.564   1.00 0.00 ? 51  LEU A HD11 1  
ATOM 796   H HD12 . LEU A 1 51  ? 11.417  0.104   2.543   1.00 0.00 ? 51  LEU A HD12 1  
ATOM 797   H HD13 . LEU A 1 51  ? 10.116  0.178   1.355   1.00 0.00 ? 51  LEU A HD13 1  
ATOM 798   H HD21 . LEU A 1 51  ? 11.957  -1.820  1.776   1.00 0.00 ? 51  LEU A HD21 1  
ATOM 799   H HD22 . LEU A 1 51  ? 13.507  -1.610  0.962   1.00 0.00 ? 51  LEU A HD22 1  
ATOM 800   H HD23 . LEU A 1 51  ? 12.106  -2.186  0.057   1.00 0.00 ? 51  LEU A HD23 1  
ATOM 801   N N    . SER A 1 52  ? 10.588  -0.198  -3.697  1.00 0.00 ? 52  SER A N    1  
ATOM 802   C CA   . SER A 1 52  ? 9.848   -0.764  -4.819  1.00 0.00 ? 52  SER A CA   1  
ATOM 803   C C    . SER A 1 52  ? 10.799  -1.214  -5.925  1.00 0.00 ? 52  SER A C    1  
ATOM 804   O O    . SER A 1 52  ? 10.878  -2.400  -6.247  1.00 0.00 ? 52  SER A O    1  
ATOM 805   C CB   . SER A 1 52  ? 8.855   0.260   -5.370  1.00 0.00 ? 52  SER A CB   1  
ATOM 806   O OG   . SER A 1 52  ? 9.497   1.491   -5.655  1.00 0.00 ? 52  SER A OG   1  
ATOM 807   H H    . SER A 1 52  ? 10.255  0.617   -3.266  1.00 0.00 ? 52  SER A H    1  
ATOM 808   H HA   . SER A 1 52  ? 9.303   -1.623  -4.457  1.00 0.00 ? 52  SER A HA   1  
ATOM 809   H HB2  . SER A 1 52  ? 8.416   -0.121  -6.279  1.00 0.00 ? 52  SER A HB2  1  
ATOM 810   H HB3  . SER A 1 52  ? 8.078   0.433   -4.640  1.00 0.00 ? 52  SER A HB3  1  
ATOM 811   H HG   . SER A 1 52  ? 8.969   1.990   -6.282  1.00 0.00 ? 52  SER A HG   1  
ATOM 812   N N    . LEU A 1 53  ? 11.518  -0.258  -6.503  1.00 0.00 ? 53  LEU A N    1  
ATOM 813   C CA   . LEU A 1 53  ? 12.464  -0.554  -7.573  1.00 0.00 ? 53  LEU A CA   1  
ATOM 814   C C    . LEU A 1 53  ? 13.251  -1.825  -7.268  1.00 0.00 ? 53  LEU A C    1  
ATOM 815   O O    . LEU A 1 53  ? 13.483  -2.652  -8.150  1.00 0.00 ? 53  LEU A O    1  
ATOM 816   C CB   . LEU A 1 53  ? 13.425  0.619   -7.770  1.00 0.00 ? 53  LEU A CB   1  
ATOM 817   C CG   . LEU A 1 53  ? 12.800  1.921   -8.275  1.00 0.00 ? 53  LEU A CG   1  
ATOM 818   C CD1  . LEU A 1 53  ? 13.682  3.108   -7.922  1.00 0.00 ? 53  LEU A CD1  1  
ATOM 819   C CD2  . LEU A 1 53  ? 12.568  1.854   -9.777  1.00 0.00 ? 53  LEU A CD2  1  
ATOM 820   H H    . LEU A 1 53  ? 11.411  0.668   -6.203  1.00 0.00 ? 53  LEU A H    1  
ATOM 821   H HA   . LEU A 1 53  ? 11.900  -0.704  -8.481  1.00 0.00 ? 53  LEU A HA   1  
ATOM 822   H HB2  . LEU A 1 53  ? 13.895  0.825   -6.821  1.00 0.00 ? 53  LEU A HB2  1  
ATOM 823   H HB3  . LEU A 1 53  ? 14.177  0.314   -8.484  1.00 0.00 ? 53  LEU A HB3  1  
ATOM 824   H HG   . LEU A 1 53  ? 11.842  2.063   -7.793  1.00 0.00 ? 53  LEU A HG   1  
ATOM 825   H HD11 . LEU A 1 53  ? 13.142  3.777   -7.270  1.00 0.00 ? 53  LEU A HD11 1  
ATOM 826   H HD12 . LEU A 1 53  ? 13.959  3.632   -8.825  1.00 0.00 ? 53  LEU A HD12 1  
ATOM 827   H HD13 . LEU A 1 53  ? 14.574  2.758   -7.422  1.00 0.00 ? 53  LEU A HD13 1  
ATOM 828   H HD21 . LEU A 1 53  ? 12.286  0.848   -10.053 1.00 0.00 ? 53  LEU A HD21 1  
ATOM 829   H HD22 . LEU A 1 53  ? 13.476  2.128   -10.294 1.00 0.00 ? 53  LEU A HD22 1  
ATOM 830   H HD23 . LEU A 1 53  ? 11.777  2.537   -10.050 1.00 0.00 ? 53  LEU A HD23 1  
ATOM 831   N N    . LYS A 1 54  ? 13.658  -1.976  -6.012  1.00 0.00 ? 54  LYS A N    1  
ATOM 832   C CA   . LYS A 1 54  ? 14.416  -3.147  -5.588  1.00 0.00 ? 54  LYS A CA   1  
ATOM 833   C C    . LYS A 1 54  ? 13.576  -4.414  -5.716  1.00 0.00 ? 54  LYS A C    1  
ATOM 834   O O    . LYS A 1 54  ? 13.960  -5.357  -6.408  1.00 0.00 ? 54  LYS A O    1  
ATOM 835   C CB   . LYS A 1 54  ? 14.888  -2.978  -4.142  1.00 0.00 ? 54  LYS A CB   1  
ATOM 836   C CG   . LYS A 1 54  ? 16.107  -3.817  -3.799  1.00 0.00 ? 54  LYS A CG   1  
ATOM 837   C CD   . LYS A 1 54  ? 16.303  -3.925  -2.296  1.00 0.00 ? 54  LYS A CD   1  
ATOM 838   C CE   . LYS A 1 54  ? 17.172  -2.795  -1.764  1.00 0.00 ? 54  LYS A CE   1  
ATOM 839   N NZ   . LYS A 1 54  ? 18.623  -3.106  -1.887  1.00 0.00 ? 54  LYS A NZ   1  
ATOM 840   H H    . LYS A 1 54  ? 13.442  -1.282  -5.354  1.00 0.00 ? 54  LYS A H    1  
ATOM 841   H HA   . LYS A 1 54  ? 15.278  -3.234  -6.232  1.00 0.00 ? 54  LYS A HA   1  
ATOM 842   H HB2  . LYS A 1 54  ? 15.132  -1.940  -3.975  1.00 0.00 ? 54  LYS A HB2  1  
ATOM 843   H HB3  . LYS A 1 54  ? 14.083  -3.262  -3.479  1.00 0.00 ? 54  LYS A HB3  1  
ATOM 844   H HG2  . LYS A 1 54  ? 15.977  -4.808  -4.206  1.00 0.00 ? 54  LYS A HG2  1  
ATOM 845   H HG3  . LYS A 1 54  ? 16.983  -3.358  -4.235  1.00 0.00 ? 54  LYS A HG3  1  
ATOM 846   H HD2  . LYS A 1 54  ? 15.339  -3.882  -1.811  1.00 0.00 ? 54  LYS A HD2  1  
ATOM 847   H HD3  . LYS A 1 54  ? 16.779  -4.870  -2.071  1.00 0.00 ? 54  LYS A HD3  1  
ATOM 848   H HE2  . LYS A 1 54  ? 16.956  -1.899  -2.325  1.00 0.00 ? 54  LYS A HE2  1  
ATOM 849   H HE3  . LYS A 1 54  ? 16.933  -2.635  -0.723  1.00 0.00 ? 54  LYS A HE3  1  
ATOM 850   H HZ1  . LYS A 1 54  ? 18.942  -2.940  -2.863  1.00 0.00 ? 54  LYS A HZ1  1  
ATOM 851   H HZ2  . LYS A 1 54  ? 18.797  -4.102  -1.642  1.00 0.00 ? 54  LYS A HZ2  1  
ATOM 852   H HZ3  . LYS A 1 54  ? 19.174  -2.501  -1.245  1.00 0.00 ? 54  LYS A HZ3  1  
ATOM 853   N N    . TYR A 1 55  ? 12.430  -4.428  -5.046  1.00 0.00 ? 55  TYR A N    1  
ATOM 854   C CA   . TYR A 1 55  ? 11.536  -5.580  -5.084  1.00 0.00 ? 55  TYR A CA   1  
ATOM 855   C C    . TYR A 1 55  ? 10.624  -5.521  -6.305  1.00 0.00 ? 55  TYR A C    1  
ATOM 856   O O    . TYR A 1 55  ? 9.619   -6.228  -6.377  1.00 0.00 ? 55  TYR A O    1  
ATOM 857   C CB   . TYR A 1 55  ? 10.696  -5.642  -3.807  1.00 0.00 ? 55  TYR A CB   1  
ATOM 858   C CG   . TYR A 1 55  ? 11.520  -5.749  -2.544  1.00 0.00 ? 55  TYR A CG   1  
ATOM 859   C CD1  . TYR A 1 55  ? 12.083  -4.620  -1.961  1.00 0.00 ? 55  TYR A CD1  1  
ATOM 860   C CD2  . TYR A 1 55  ? 11.735  -6.978  -1.934  1.00 0.00 ? 55  TYR A CD2  1  
ATOM 861   C CE1  . TYR A 1 55  ? 12.837  -4.714  -0.807  1.00 0.00 ? 55  TYR A CE1  1  
ATOM 862   C CE2  . TYR A 1 55  ? 12.487  -7.081  -0.779  1.00 0.00 ? 55  TYR A CE2  1  
ATOM 863   C CZ   . TYR A 1 55  ? 13.036  -5.946  -0.220  1.00 0.00 ? 55  TYR A CZ   1  
ATOM 864   O OH   . TYR A 1 55  ? 13.786  -6.043  0.930   1.00 0.00 ? 55  TYR A OH   1  
ATOM 865   H H    . TYR A 1 55  ? 12.178  -3.646  -4.511  1.00 0.00 ? 55  TYR A H    1  
ATOM 866   H HA   . TYR A 1 55  ? 12.145  -6.470  -5.146  1.00 0.00 ? 55  TYR A HA   1  
ATOM 867   H HB2  . TYR A 1 55  ? 10.095  -4.749  -3.736  1.00 0.00 ? 55  TYR A HB2  1  
ATOM 868   H HB3  . TYR A 1 55  ? 10.046  -6.504  -3.854  1.00 0.00 ? 55  TYR A HB3  1  
ATOM 869   H HD1  . TYR A 1 55  ? 11.924  -3.657  -2.423  1.00 0.00 ? 55  TYR A HD1  1  
ATOM 870   H HD2  . TYR A 1 55  ? 11.304  -7.866  -2.374  1.00 0.00 ? 55  TYR A HD2  1  
ATOM 871   H HE1  . TYR A 1 55  ? 13.267  -3.825  -0.369  1.00 0.00 ? 55  TYR A HE1  1  
ATOM 872   H HE2  . TYR A 1 55  ? 12.643  -8.045  -0.319  1.00 0.00 ? 55  TYR A HE2  1  
ATOM 873   H HH   . TYR A 1 55  ? 13.512  -6.818  1.426   1.00 0.00 ? 55  TYR A HH   1  
ATOM 874   N N    . ASN A 1 56  ? 10.982  -4.673  -7.263  1.00 0.00 ? 56  ASN A N    1  
ATOM 875   C CA   . ASN A 1 56  ? 10.196  -4.521  -8.482  1.00 0.00 ? 56  ASN A CA   1  
ATOM 876   C C    . ASN A 1 56  ? 10.612  -5.550  -9.529  1.00 0.00 ? 56  ASN A C    1  
ATOM 877   O O    . ASN A 1 56  ? 11.288  -5.220  -10.505 1.00 0.00 ? 56  ASN A O    1  
ATOM 878   C CB   . ASN A 1 56  ? 10.360  -3.108  -9.046  1.00 0.00 ? 56  ASN A CB   1  
ATOM 879   C CG   . ASN A 1 56  ? 9.402   -2.118  -8.412  1.00 0.00 ? 56  ASN A CG   1  
ATOM 880   O OD1  . ASN A 1 56  ? 8.668   -2.455  -7.483  1.00 0.00 ? 56  ASN A OD1  1  
ATOM 881   N ND2  . ASN A 1 56  ? 9.405   -0.888  -8.914  1.00 0.00 ? 56  ASN A ND2  1  
ATOM 882   H H    . ASN A 1 56  ? 11.794  -4.136  -7.148  1.00 0.00 ? 56  ASN A H    1  
ATOM 883   H HA   . ASN A 1 56  ? 9.159   -4.680  -8.230  1.00 0.00 ? 56  ASN A HA   1  
ATOM 884   H HB2  . ASN A 1 56  ? 11.370  -2.769  -8.865  1.00 0.00 ? 56  ASN A HB2  1  
ATOM 885   H HB3  . ASN A 1 56  ? 10.177  -3.128  -10.110 1.00 0.00 ? 56  ASN A HB3  1  
ATOM 886   H HD21 . ASN A 1 56  ? 10.016  -0.691  -9.654  1.00 0.00 ? 56  ASN A HD21 1  
ATOM 887   H HD22 . ASN A 1 56  ? 8.796   -0.228  -8.522  1.00 0.00 ? 56  ASN A HD22 1  
ATOM 888   N N    . CYS A 1 57  ? 10.204  -6.796  -9.320  1.00 0.00 ? 57  CYS A N    1  
ATOM 889   C CA   . CYS A 1 57  ? 10.534  -7.874  -10.246 1.00 0.00 ? 57  CYS A CA   1  
ATOM 890   C C    . CYS A 1 57  ? 9.422   -8.918  -10.283 1.00 0.00 ? 57  CYS A C    1  
ATOM 891   O O    . CYS A 1 57  ? 8.385   -8.760  -9.639  1.00 0.00 ? 57  CYS A O    1  
ATOM 892   C CB   . CYS A 1 57  ? 11.855  -8.532  -9.845  1.00 0.00 ? 57  CYS A CB   1  
ATOM 893   S SG   . CYS A 1 57  ? 13.318  -7.746  -10.559 1.00 0.00 ? 57  CYS A SG   1  
ATOM 894   H H    . CYS A 1 57  ? 9.668   -6.997  -8.525  1.00 0.00 ? 57  CYS A H    1  
ATOM 895   H HA   . CYS A 1 57  ? 10.639  -7.444  -11.230 1.00 0.00 ? 57  CYS A HA   1  
ATOM 896   H HB2  . CYS A 1 57  ? 11.955  -8.496  -8.770  1.00 0.00 ? 57  CYS A HB2  1  
ATOM 897   H HB3  . CYS A 1 57  ? 11.846  -9.564  -10.164 1.00 0.00 ? 57  CYS A HB3  1  
ATOM 898   H HG   . CYS A 1 57  ? 12.911  -6.738  -11.316 1.00 0.00 ? 57  CYS A HG   1  
ATOM 899   N N    . THR A 1 58  ? 9.645   -9.986  -11.043 1.00 0.00 ? 58  THR A N    1  
ATOM 900   C CA   . THR A 1 58  ? 8.662   -11.055 -11.167 1.00 0.00 ? 58  THR A CA   1  
ATOM 901   C C    . THR A 1 58  ? 8.400   -11.720 -9.821  1.00 0.00 ? 58  THR A C    1  
ATOM 902   O O    . THR A 1 58  ? 9.248   -12.443 -9.300  1.00 0.00 ? 58  THR A O    1  
ATOM 903   C CB   . THR A 1 58  ? 9.121   -12.125 -12.175 1.00 0.00 ? 58  THR A CB   1  
ATOM 904   O OG1  . THR A 1 58  ? 9.380   -11.521 -13.447 1.00 0.00 ? 58  THR A OG1  1  
ATOM 905   C CG2  . THR A 1 58  ? 8.066   -13.210 -12.329 1.00 0.00 ? 58  THR A CG2  1  
ATOM 906   H H    . THR A 1 58  ? 10.491  -10.054 -11.533 1.00 0.00 ? 58  THR A H    1  
ATOM 907   H HA   . THR A 1 58  ? 7.741   -10.621 -11.529 1.00 0.00 ? 58  THR A HA   1  
ATOM 908   H HB   . THR A 1 58  ? 10.030  -12.578 -11.808 1.00 0.00 ? 58  THR A HB   1  
ATOM 909   H HG1  . THR A 1 58  ? 9.650   -10.609 -13.319 1.00 0.00 ? 58  THR A HG1  1  
ATOM 910   H HG21 . THR A 1 58  ? 8.174   -13.934 -11.535 1.00 0.00 ? 58  THR A HG21 1  
ATOM 911   H HG22 . THR A 1 58  ? 8.191   -13.701 -13.283 1.00 0.00 ? 58  THR A HG22 1  
ATOM 912   H HG23 . THR A 1 58  ? 7.083   -12.766 -12.279 1.00 0.00 ? 58  THR A HG23 1  
ATOM 913   N N    . GLY A 1 59  ? 7.220   -11.470 -9.262  1.00 0.00 ? 59  GLY A N    1  
ATOM 914   C CA   . GLY A 1 59  ? 6.868   -12.053 -7.981  1.00 0.00 ? 59  GLY A CA   1  
ATOM 915   C C    . GLY A 1 59  ? 6.145   -11.074 -7.077  1.00 0.00 ? 59  GLY A C    1  
ATOM 916   O O    . GLY A 1 59  ? 4.955   -11.234 -6.802  1.00 0.00 ? 59  GLY A O    1  
ATOM 917   H H    . GLY A 1 59  ? 6.583   -10.885 -9.724  1.00 0.00 ? 59  GLY A H    1  
ATOM 918   H HA2  . GLY A 1 59  ? 6.231   -12.909 -8.150  1.00 0.00 ? 59  GLY A HA2  1  
ATOM 919   H HA3  . GLY A 1 59  ? 7.771   -12.381 -7.487  1.00 0.00 ? 59  GLY A HA3  1  
ATOM 920   N N    . LEU A 1 60  ? 6.864   -10.059 -6.613  1.00 0.00 ? 60  LEU A N    1  
ATOM 921   C CA   . LEU A 1 60  ? 6.284   -9.050  -5.733  1.00 0.00 ? 60  LEU A CA   1  
ATOM 922   C C    . LEU A 1 60  ? 6.063   -7.738  -6.480  1.00 0.00 ? 60  LEU A C    1  
ATOM 923   O O    . LEU A 1 60  ? 6.938   -7.273  -7.209  1.00 0.00 ? 60  LEU A O    1  
ATOM 924   C CB   . LEU A 1 60  ? 7.192   -8.815  -4.525  1.00 0.00 ? 60  LEU A CB   1  
ATOM 925   C CG   . LEU A 1 60  ? 6.635   -7.901  -3.433  1.00 0.00 ? 60  LEU A CG   1  
ATOM 926   C CD1  . LEU A 1 60  ? 5.341   -8.469  -2.871  1.00 0.00 ? 60  LEU A CD1  1  
ATOM 927   C CD2  . LEU A 1 60  ? 7.660   -7.707  -2.325  1.00 0.00 ? 60  LEU A CD2  1  
ATOM 928   H H    . LEU A 1 60  ? 7.807   -9.984  -6.867  1.00 0.00 ? 60  LEU A H    1  
ATOM 929   H HA   . LEU A 1 60  ? 5.329   -9.419  -5.389  1.00 0.00 ? 60  LEU A HA   1  
ATOM 930   H HB2  . LEU A 1 60  ? 7.401   -9.775  -4.077  1.00 0.00 ? 60  LEU A HB2  1  
ATOM 931   H HB3  . LEU A 1 60  ? 8.114   -8.380  -4.884  1.00 0.00 ? 60  LEU A HB3  1  
ATOM 932   H HG   . LEU A 1 60  ? 6.416   -6.933  -3.861  1.00 0.00 ? 60  LEU A HG   1  
ATOM 933   H HD11 . LEU A 1 60  ? 5.507   -9.482  -2.536  1.00 0.00 ? 60  LEU A HD11 1  
ATOM 934   H HD12 . LEU A 1 60  ? 4.582   -8.464  -3.639  1.00 0.00 ? 60  LEU A HD12 1  
ATOM 935   H HD13 . LEU A 1 60  ? 5.014   -7.863  -2.039  1.00 0.00 ? 60  LEU A HD13 1  
ATOM 936   H HD21 . LEU A 1 60  ? 8.639   -7.574  -2.761  1.00 0.00 ? 60  LEU A HD21 1  
ATOM 937   H HD22 . LEU A 1 60  ? 7.666   -8.577  -1.684  1.00 0.00 ? 60  LEU A HD22 1  
ATOM 938   H HD23 . LEU A 1 60  ? 7.402   -6.834  -1.745  1.00 0.00 ? 60  LEU A HD23 1  
ATOM 939   N N    . ASN A 1 61  ? 4.889   -7.146  -6.290  1.00 0.00 ? 61  ASN A N    1  
ATOM 940   C CA   . ASN A 1 61  ? 4.554   -5.886  -6.945  1.00 0.00 ? 61  ASN A CA   1  
ATOM 941   C C    . ASN A 1 61  ? 4.287   -4.792  -5.915  1.00 0.00 ? 61  ASN A C    1  
ATOM 942   O O    . ASN A 1 61  ? 3.930   -5.075  -4.771  1.00 0.00 ? 61  ASN A O    1  
ATOM 943   C CB   . ASN A 1 61  ? 3.329   -6.065  -7.844  1.00 0.00 ? 61  ASN A CB   1  
ATOM 944   C CG   . ASN A 1 61  ? 3.267   -7.445  -8.470  1.00 0.00 ? 61  ASN A CG   1  
ATOM 945   O OD1  . ASN A 1 61  ? 2.942   -8.427  -7.802  1.00 0.00 ? 61  ASN A OD1  1  
ATOM 946   N ND2  . ASN A 1 61  ? 3.580   -7.525  -9.758  1.00 0.00 ? 61  ASN A ND2  1  
ATOM 947   H H    . ASN A 1 61  ? 4.231   -7.565  -5.697  1.00 0.00 ? 61  ASN A H    1  
ATOM 948   H HA   . ASN A 1 61  ? 5.397   -5.594  -7.553  1.00 0.00 ? 61  ASN A HA   1  
ATOM 949   H HB2  . ASN A 1 61  ? 2.434   -5.916  -7.257  1.00 0.00 ? 61  ASN A HB2  1  
ATOM 950   H HB3  . ASN A 1 61  ? 3.361   -5.331  -8.636  1.00 0.00 ? 61  ASN A HB3  1  
ATOM 951   H HD21 . ASN A 1 61  ? 3.830   -6.701  -10.226 1.00 0.00 ? 61  ASN A HD21 1  
ATOM 952   H HD22 . ASN A 1 61  ? 3.548   -8.405  -10.188 1.00 0.00 ? 61  ASN A HD22 1  
ATOM 953   N N    . PHE A 1 62  ? 4.462   -3.542  -6.330  1.00 0.00 ? 62  PHE A N    1  
ATOM 954   C CA   . PHE A 1 62  ? 4.241   -2.405  -5.444  1.00 0.00 ? 62  PHE A CA   1  
ATOM 955   C C    . PHE A 1 62  ? 3.158   -1.485  -6.000  1.00 0.00 ? 62  PHE A C    1  
ATOM 956   O O    . PHE A 1 62  ? 3.032   -1.318  -7.212  1.00 0.00 ? 62  PHE A O    1  
ATOM 957   C CB   . PHE A 1 62  ? 5.541   -1.622  -5.250  1.00 0.00 ? 62  PHE A CB   1  
ATOM 958   C CG   . PHE A 1 62  ? 6.464   -2.234  -4.235  1.00 0.00 ? 62  PHE A CG   1  
ATOM 959   C CD1  . PHE A 1 62  ? 6.832   -3.566  -4.329  1.00 0.00 ? 62  PHE A CD1  1  
ATOM 960   C CD2  . PHE A 1 62  ? 6.964   -1.477  -3.188  1.00 0.00 ? 62  PHE A CD2  1  
ATOM 961   C CE1  . PHE A 1 62  ? 7.680   -4.132  -3.396  1.00 0.00 ? 62  PHE A CE1  1  
ATOM 962   C CE2  . PHE A 1 62  ? 7.813   -2.037  -2.252  1.00 0.00 ? 62  PHE A CE2  1  
ATOM 963   C CZ   . PHE A 1 62  ? 8.172   -3.366  -2.357  1.00 0.00 ? 62  PHE A CZ   1  
ATOM 964   H H    . PHE A 1 62  ? 4.747   -3.380  -7.254  1.00 0.00 ? 62  PHE A H    1  
ATOM 965   H HA   . PHE A 1 62  ? 3.916   -2.788  -4.489  1.00 0.00 ? 62  PHE A HA   1  
ATOM 966   H HB2  . PHE A 1 62  ? 6.068   -1.574  -6.191  1.00 0.00 ? 62  PHE A HB2  1  
ATOM 967   H HB3  . PHE A 1 62  ? 5.304   -0.620  -4.924  1.00 0.00 ? 62  PHE A HB3  1  
ATOM 968   H HD1  . PHE A 1 62  ? 6.449   -4.166  -5.141  1.00 0.00 ? 62  PHE A HD1  1  
ATOM 969   H HD2  . PHE A 1 62  ? 6.683   -0.436  -3.105  1.00 0.00 ? 62  PHE A HD2  1  
ATOM 970   H HE1  . PHE A 1 62  ? 7.960   -5.172  -3.480  1.00 0.00 ? 62  PHE A HE1  1  
ATOM 971   H HE2  . PHE A 1 62  ? 8.195   -1.435  -1.441  1.00 0.00 ? 62  PHE A HE2  1  
ATOM 972   H HZ   . PHE A 1 62  ? 8.835   -3.806  -1.627  1.00 0.00 ? 62  PHE A HZ   1  
ATOM 973   N N    . GLY A 1 63  ? 2.377   -0.890  -5.103  1.00 0.00 ? 63  GLY A N    1  
ATOM 974   C CA   . GLY A 1 63  ? 1.315   0.005   -5.522  1.00 0.00 ? 63  GLY A CA   1  
ATOM 975   C C    . GLY A 1 63  ? 1.135   1.176   -4.575  1.00 0.00 ? 63  GLY A C    1  
ATOM 976   O O    . GLY A 1 63  ? 1.734   1.212   -3.500  1.00 0.00 ? 63  GLY A O    1  
ATOM 977   H H    . GLY A 1 63  ? 2.524   -1.060  -4.149  1.00 0.00 ? 63  GLY A H    1  
ATOM 978   H HA2  . GLY A 1 63  ? 1.545   0.384   -6.507  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 979   H HA3  . GLY A 1 63  ? 0.389   -0.550  -5.569  1.00 0.00 ? 63  GLY A HA3  1  
ATOM 980   N N    . LYS A 1 64  ? 0.309   2.137   -4.975  1.00 0.00 ? 64  LYS A N    1  
ATOM 981   C CA   . LYS A 1 64  ? 0.052   3.315   -4.155  1.00 0.00 ? 64  LYS A CA   1  
ATOM 982   C C    . LYS A 1 64  ? -1.338  3.878   -4.433  1.00 0.00 ? 64  LYS A C    1  
ATOM 983   O O    . LYS A 1 64  ? -1.715  4.090   -5.586  1.00 0.00 ? 64  LYS A O    1  
ATOM 984   C CB   . LYS A 1 64  ? 1.110   4.388   -4.421  1.00 0.00 ? 64  LYS A CB   1  
ATOM 985   C CG   . LYS A 1 64  ? 2.323   4.284   -3.513  1.00 0.00 ? 64  LYS A CG   1  
ATOM 986   C CD   . LYS A 1 64  ? 3.503   5.064   -4.067  1.00 0.00 ? 64  LYS A CD   1  
ATOM 987   C CE   . LYS A 1 64  ? 3.406   6.542   -3.723  1.00 0.00 ? 64  LYS A CE   1  
ATOM 988   N NZ   . LYS A 1 64  ? 4.558   7.315   -4.265  1.00 0.00 ? 64  LYS A NZ   1  
ATOM 989   H H    . LYS A 1 64  ? -0.139  2.051   -5.843  1.00 0.00 ? 64  LYS A H    1  
ATOM 990   H HA   . LYS A 1 64  ? 0.106   3.017   -3.119  1.00 0.00 ? 64  LYS A HA   1  
ATOM 991   H HB2  . LYS A 1 64  ? 1.445   4.300   -5.445  1.00 0.00 ? 64  LYS A HB2  1  
ATOM 992   H HB3  . LYS A 1 64  ? 0.663   5.361   -4.280  1.00 0.00 ? 64  LYS A HB3  1  
ATOM 993   H HG2  . LYS A 1 64  ? 2.068   4.680   -2.541  1.00 0.00 ? 64  LYS A HG2  1  
ATOM 994   H HG3  . LYS A 1 64  ? 2.603   3.244   -3.418  1.00 0.00 ? 64  LYS A HG3  1  
ATOM 995   H HD2  . LYS A 1 64  ? 4.416   4.667   -3.647  1.00 0.00 ? 64  LYS A HD2  1  
ATOM 996   H HD3  . LYS A 1 64  ? 3.523   4.954   -5.142  1.00 0.00 ? 64  LYS A HD3  1  
ATOM 997   H HE2  . LYS A 1 64  ? 2.492   6.936   -4.140  1.00 0.00 ? 64  LYS A HE2  1  
ATOM 998   H HE3  . LYS A 1 64  ? 3.387   6.648   -2.649  1.00 0.00 ? 64  LYS A HE3  1  
ATOM 999   H HZ1  . LYS A 1 64  ? 5.259   6.667   -4.679  1.00 0.00 ? 64  LYS A HZ1  1  
ATOM 1000  H HZ2  . LYS A 1 64  ? 5.012   7.860   -3.505  1.00 0.00 ? 64  LYS A HZ2  1  
ATOM 1001  H HZ3  . LYS A 1 64  ? 4.232   7.973   -5.002  1.00 0.00 ? 64  LYS A HZ3  1  
ATOM 1002  N N    . VAL A 1 65  ? -2.098  4.119   -3.369  1.00 0.00 ? 65  VAL A N    1  
ATOM 1003  C CA   . VAL A 1 65  ? -3.445  4.660   -3.498  1.00 0.00 ? 65  VAL A CA   1  
ATOM 1004  C C    . VAL A 1 65  ? -3.659  5.834   -2.550  1.00 0.00 ? 65  VAL A C    1  
ATOM 1005  O O    . VAL A 1 65  ? -3.902  5.647   -1.358  1.00 0.00 ? 65  VAL A O    1  
ATOM 1006  C CB   . VAL A 1 65  ? -4.511  3.584   -3.214  1.00 0.00 ? 65  VAL A CB   1  
ATOM 1007  C CG1  . VAL A 1 65  ? -4.289  2.960   -1.844  1.00 0.00 ? 65  VAL A CG1  1  
ATOM 1008  C CG2  . VAL A 1 65  ? -5.908  4.179   -3.317  1.00 0.00 ? 65  VAL A CG2  1  
ATOM 1009  H H    . VAL A 1 65  ? -1.742  3.929   -2.475  1.00 0.00 ? 65  VAL A H    1  
ATOM 1010  H HA   . VAL A 1 65  ? -3.572  5.002   -4.515  1.00 0.00 ? 65  VAL A HA   1  
ATOM 1011  H HB   . VAL A 1 65  ? -4.417  2.808   -3.958  1.00 0.00 ? 65  VAL A HB   1  
ATOM 1012  H HG11 . VAL A 1 65  ? -4.508  1.904   -1.891  1.00 0.00 ? 65  VAL A HG11 1  
ATOM 1013  H HG12 . VAL A 1 65  ? -3.260  3.103   -1.546  1.00 0.00 ? 65  VAL A HG12 1  
ATOM 1014  H HG13 . VAL A 1 65  ? -4.941  3.431   -1.124  1.00 0.00 ? 65  VAL A HG13 1  
ATOM 1015  H HG21 . VAL A 1 65  ? -5.834  5.239   -3.508  1.00 0.00 ? 65  VAL A HG21 1  
ATOM 1016  H HG22 . VAL A 1 65  ? -6.443  3.704   -4.127  1.00 0.00 ? 65  VAL A HG22 1  
ATOM 1017  H HG23 . VAL A 1 65  ? -6.438  4.016   -2.391  1.00 0.00 ? 65  VAL A HG23 1  
ATOM 1018  N N    . ASP A 1 66  ? -3.568  7.045   -3.088  1.00 0.00 ? 66  ASP A N    1  
ATOM 1019  C CA   . ASP A 1 66  ? -3.753  8.252   -2.291  1.00 0.00 ? 66  ASP A CA   1  
ATOM 1020  C C    . ASP A 1 66  ? -5.120  8.253   -1.614  1.00 0.00 ? 66  ASP A C    1  
ATOM 1021  O O    . ASP A 1 66  ? -6.140  8.512   -2.253  1.00 0.00 ? 66  ASP A O    1  
ATOM 1022  C CB   . ASP A 1 66  ? -3.604  9.497   -3.168  1.00 0.00 ? 66  ASP A CB   1  
ATOM 1023  C CG   . ASP A 1 66  ? -4.144  9.285   -4.569  1.00 0.00 ? 66  ASP A CG   1  
ATOM 1024  O OD1  . ASP A 1 66  ? -3.402  8.745   -5.415  1.00 0.00 ? 66  ASP A OD1  1  
ATOM 1025  O OD2  . ASP A 1 66  ? -5.309  9.661   -4.819  1.00 0.00 ? 66  ASP A OD2  1  
ATOM 1026  H H    . ASP A 1 66  ? -3.372  7.130   -4.045  1.00 0.00 ? 66  ASP A H    1  
ATOM 1027  H HA   . ASP A 1 66  ? -2.988  8.267   -1.529  1.00 0.00 ? 66  ASP A HA   1  
ATOM 1028  H HB2  . ASP A 1 66  ? -4.143  10.316  -2.714  1.00 0.00 ? 66  ASP A HB2  1  
ATOM 1029  H HB3  . ASP A 1 66  ? -2.558  9.755   -3.240  1.00 0.00 ? 66  ASP A HB3  1  
ATOM 1030  N N    . VAL A 1 67  ? -5.133  7.959   -0.318  1.00 0.00 ? 67  VAL A N    1  
ATOM 1031  C CA   . VAL A 1 67  ? -6.375  7.925   0.445   1.00 0.00 ? 67  VAL A CA   1  
ATOM 1032  C C    . VAL A 1 67  ? -6.814  9.330   0.844   1.00 0.00 ? 67  VAL A C    1  
ATOM 1033  O O    . VAL A 1 67  ? -8.007  9.621   0.920   1.00 0.00 ? 67  VAL A O    1  
ATOM 1034  C CB   . VAL A 1 67  ? -6.230  7.065   1.715   1.00 0.00 ? 67  VAL A CB   1  
ATOM 1035  C CG1  . VAL A 1 67  ? -6.095  5.594   1.352   1.00 0.00 ? 67  VAL A CG1  1  
ATOM 1036  C CG2  . VAL A 1 67  ? -5.039  7.530   2.540   1.00 0.00 ? 67  VAL A CG2  1  
ATOM 1037  H H    . VAL A 1 67  ? -4.288  7.761   0.136   1.00 0.00 ? 67  VAL A H    1  
ATOM 1038  H HA   . VAL A 1 67  ? -7.138  7.483   -0.178  1.00 0.00 ? 67  VAL A HA   1  
ATOM 1039  H HB   . VAL A 1 67  ? -7.123  7.185   2.311   1.00 0.00 ? 67  VAL A HB   1  
ATOM 1040  H HG11 . VAL A 1 67  ? -6.706  5.380   0.487   1.00 0.00 ? 67  VAL A HG11 1  
ATOM 1041  H HG12 . VAL A 1 67  ? -5.062  5.372   1.128   1.00 0.00 ? 67  VAL A HG12 1  
ATOM 1042  H HG13 . VAL A 1 67  ? -6.422  4.987   2.183   1.00 0.00 ? 67  VAL A HG13 1  
ATOM 1043  H HG21 . VAL A 1 67  ? -4.130  7.136   2.112   1.00 0.00 ? 67  VAL A HG21 1  
ATOM 1044  H HG22 . VAL A 1 67  ? -4.999  8.610   2.538   1.00 0.00 ? 67  VAL A HG22 1  
ATOM 1045  H HG23 . VAL A 1 67  ? -5.143  7.177   3.555   1.00 0.00 ? 67  VAL A HG23 1  
ATOM 1046  N N    . GLY A 1 68  ? -5.840  10.199  1.097   1.00 0.00 ? 68  GLY A N    1  
ATOM 1047  C CA   . GLY A 1 68  ? -6.146  11.564  1.484   1.00 0.00 ? 68  GLY A CA   1  
ATOM 1048  C C    . GLY A 1 68  ? -7.263  12.165  0.655   1.00 0.00 ? 68  GLY A C    1  
ATOM 1049  O O    . GLY A 1 68  ? -7.922  13.112  1.083   1.00 0.00 ? 68  GLY A O    1  
ATOM 1050  H H    . GLY A 1 68  ? -4.906  9.911   1.020   1.00 0.00 ? 68  GLY A H    1  
ATOM 1051  H HA2  . GLY A 1 68  ? -6.436  11.575  2.524   1.00 0.00 ? 68  GLY A HA2  1  
ATOM 1052  H HA3  . GLY A 1 68  ? -5.258  12.167  1.362   1.00 0.00 ? 68  GLY A HA3  1  
ATOM 1053  N N    . ARG A 1 69  ? -7.476  11.615  -0.536  1.00 0.00 ? 69  ARG A N    1  
ATOM 1054  C CA   . ARG A 1 69  ? -8.520  12.105  -1.428  1.00 0.00 ? 69  ARG A CA   1  
ATOM 1055  C C    . ARG A 1 69  ? -9.573  11.029  -1.675  1.00 0.00 ? 69  ARG A C    1  
ATOM 1056  O O    . ARG A 1 69  ? -10.761 11.326  -1.803  1.00 0.00 ? 69  ARG A O    1  
ATOM 1057  C CB   . ARG A 1 69  ? -7.914  12.555  -2.758  1.00 0.00 ? 69  ARG A CB   1  
ATOM 1058  C CG   . ARG A 1 69  ? -8.836  13.441  -3.580  1.00 0.00 ? 69  ARG A CG   1  
ATOM 1059  C CD   . ARG A 1 69  ? -8.170  13.894  -4.869  1.00 0.00 ? 69  ARG A CD   1  
ATOM 1060  N NE   . ARG A 1 69  ? -8.941  14.934  -5.547  1.00 0.00 ? 69  ARG A NE   1  
ATOM 1061  C CZ   . ARG A 1 69  ? -8.597  15.457  -6.718  1.00 0.00 ? 69  ARG A CZ   1  
ATOM 1062  N NH1  . ARG A 1 69  ? -7.503  15.040  -7.340  1.00 0.00 ? 69  ARG A NH1  1  
ATOM 1063  N NH2  . ARG A 1 69  ? -9.350  16.400  -7.271  1.00 0.00 ? 69  ARG A NH2  1  
ATOM 1064  H H    . ARG A 1 69  ? -6.918  10.862  -0.822  1.00 0.00 ? 69  ARG A H    1  
ATOM 1065  H HA   . ARG A 1 69  ? -8.992  12.951  -0.953  1.00 0.00 ? 69  ARG A HA   1  
ATOM 1066  H HB2  . ARG A 1 69  ? -7.006  13.105  -2.559  1.00 0.00 ? 69  ARG A HB2  1  
ATOM 1067  H HB3  . ARG A 1 69  ? -7.674  11.681  -3.345  1.00 0.00 ? 69  ARG A HB3  1  
ATOM 1068  H HG2  . ARG A 1 69  ? -9.729  12.885  -3.825  1.00 0.00 ? 69  ARG A HG2  1  
ATOM 1069  H HG3  . ARG A 1 69  ? -9.099  14.310  -2.995  1.00 0.00 ? 69  ARG A HG3  1  
ATOM 1070  H HD2  . ARG A 1 69  ? -7.190  14.281  -4.636  1.00 0.00 ? 69  ARG A HD2  1  
ATOM 1071  H HD3  . ARG A 1 69  ? -8.074  13.044  -5.527  1.00 0.00 ? 69  ARG A HD3  1  
ATOM 1072  H HE   . ARG A 1 69  ? -9.753  15.257  -5.105  1.00 0.00 ? 69  ARG A HE   1  
ATOM 1073  H HH11 . ARG A 1 69  ? -6.934  14.329  -6.926  1.00 0.00 ? 69  ARG A HH11 1  
ATOM 1074  H HH12 . ARG A 1 69  ? -7.247  15.435  -8.222  1.00 0.00 ? 69  ARG A HH12 1  
ATOM 1075  H HH21 . ARG A 1 69  ? -10.176 16.717  -6.806  1.00 0.00 ? 69  ARG A HH21 1  
ATOM 1076  H HH22 . ARG A 1 69  ? -9.090  16.793  -8.153  1.00 0.00 ? 69  ARG A HH22 1  
ATOM 1077  N N    . TYR A 1 70  ? -9.130  9.778   -1.743  1.00 0.00 ? 70  TYR A N    1  
ATOM 1078  C CA   . TYR A 1 70  ? -10.033 8.658   -1.978  1.00 0.00 ? 70  TYR A CA   1  
ATOM 1079  C C    . TYR A 1 70  ? -10.728 8.239   -0.686  1.00 0.00 ? 70  TYR A C    1  
ATOM 1080  O O    . TYR A 1 70  ? -10.443 7.179   -0.128  1.00 0.00 ? 70  TYR A O    1  
ATOM 1081  C CB   . TYR A 1 70  ? -9.267  7.472   -2.566  1.00 0.00 ? 70  TYR A CB   1  
ATOM 1082  C CG   . TYR A 1 70  ? -8.849  7.675   -4.005  1.00 0.00 ? 70  TYR A CG   1  
ATOM 1083  C CD1  . TYR A 1 70  ? -8.171  8.823   -4.396  1.00 0.00 ? 70  TYR A CD1  1  
ATOM 1084  C CD2  . TYR A 1 70  ? -9.132  6.719   -4.972  1.00 0.00 ? 70  TYR A CD2  1  
ATOM 1085  C CE1  . TYR A 1 70  ? -7.787  9.013   -5.710  1.00 0.00 ? 70  TYR A CE1  1  
ATOM 1086  C CE2  . TYR A 1 70  ? -8.751  6.900   -6.288  1.00 0.00 ? 70  TYR A CE2  1  
ATOM 1087  C CZ   . TYR A 1 70  ? -8.080  8.049   -6.652  1.00 0.00 ? 70  TYR A CZ   1  
ATOM 1088  O OH   . TYR A 1 70  ? -7.700  8.233   -7.961  1.00 0.00 ? 70  TYR A OH   1  
ATOM 1089  H H    . TYR A 1 70  ? -8.172  9.604   -1.634  1.00 0.00 ? 70  TYR A H    1  
ATOM 1090  H HA   . TYR A 1 70  ? -10.781 8.979   -2.688  1.00 0.00 ? 70  TYR A HA   1  
ATOM 1091  H HB2  . TYR A 1 70  ? -8.375  7.304   -1.982  1.00 0.00 ? 70  TYR A HB2  1  
ATOM 1092  H HB3  . TYR A 1 70  ? -9.891  6.592   -2.522  1.00 0.00 ? 70  TYR A HB3  1  
ATOM 1093  H HD1  . TYR A 1 70  ? -7.943  9.577   -3.656  1.00 0.00 ? 70  TYR A HD1  1  
ATOM 1094  H HD2  . TYR A 1 70  ? -9.659  5.821   -4.684  1.00 0.00 ? 70  TYR A HD2  1  
ATOM 1095  H HE1  . TYR A 1 70  ? -7.261  9.912   -5.995  1.00 0.00 ? 70  TYR A HE1  1  
ATOM 1096  H HE2  . TYR A 1 70  ? -8.981  6.146   -7.026  1.00 0.00 ? 70  TYR A HE2  1  
ATOM 1097  H HH   . TYR A 1 70  ? -7.606  7.379   -8.391  1.00 0.00 ? 70  TYR A HH   1  
ATOM 1098  N N    . THR A 1 71  ? -11.645 9.079   -0.215  1.00 0.00 ? 71  THR A N    1  
ATOM 1099  C CA   . THR A 1 71  ? -12.381 8.798   1.011   1.00 0.00 ? 71  THR A CA   1  
ATOM 1100  C C    . THR A 1 71  ? -13.159 7.492   0.897   1.00 0.00 ? 71  THR A C    1  
ATOM 1101  O O    . THR A 1 71  ? -13.561 6.909   1.904   1.00 0.00 ? 71  THR A O    1  
ATOM 1102  C CB   . THR A 1 71  ? -13.361 9.937   1.351   1.00 0.00 ? 71  THR A CB   1  
ATOM 1103  O OG1  . THR A 1 71  ? -14.059 9.637   2.565   1.00 0.00 ? 71  THR A OG1  1  
ATOM 1104  C CG2  . THR A 1 71  ? -14.360 10.147  0.224   1.00 0.00 ? 71  THR A CG2  1  
ATOM 1105  H H    . THR A 1 71  ? -11.828 9.908   -0.704  1.00 0.00 ? 71  THR A H    1  
ATOM 1106  H HA   . THR A 1 71  ? -11.667 8.712   1.817   1.00 0.00 ? 71  THR A HA   1  
ATOM 1107  H HB   . THR A 1 71  ? -12.796 10.849  1.486   1.00 0.00 ? 71  THR A HB   1  
ATOM 1108  H HG1  . THR A 1 71  ? -14.842 9.117   2.363   1.00 0.00 ? 71  THR A HG1  1  
ATOM 1109  H HG21 . THR A 1 71  ? -15.083 9.345   0.229   1.00 0.00 ? 71  THR A HG21 1  
ATOM 1110  H HG22 . THR A 1 71  ? -13.839 10.156  -0.722  1.00 0.00 ? 71  THR A HG22 1  
ATOM 1111  H HG23 . THR A 1 71  ? -14.868 11.089  0.364   1.00 0.00 ? 71  THR A HG23 1  
ATOM 1112  N N    . ASP A 1 72  ? -13.367 7.037   -0.333  1.00 0.00 ? 72  ASP A N    1  
ATOM 1113  C CA   . ASP A 1 72  ? -14.095 5.798   -0.578  1.00 0.00 ? 72  ASP A CA   1  
ATOM 1114  C C    . ASP A 1 72  ? -13.251 4.587   -0.192  1.00 0.00 ? 72  ASP A C    1  
ATOM 1115  O O    . ASP A 1 72  ? -13.781 3.551   0.209   1.00 0.00 ? 72  ASP A O    1  
ATOM 1116  C CB   . ASP A 1 72  ? -14.503 5.703   -2.049  1.00 0.00 ? 72  ASP A CB   1  
ATOM 1117  C CG   . ASP A 1 72  ? -15.679 6.600   -2.382  1.00 0.00 ? 72  ASP A CG   1  
ATOM 1118  O OD1  . ASP A 1 72  ? -15.627 7.799   -2.038  1.00 0.00 ? 72  ASP A OD1  1  
ATOM 1119  O OD2  . ASP A 1 72  ? -16.653 6.103   -2.987  1.00 0.00 ? 72  ASP A OD2  1  
ATOM 1120  H H    . ASP A 1 72  ? -13.021 7.548   -1.096  1.00 0.00 ? 72  ASP A H    1  
ATOM 1121  H HA   . ASP A 1 72  ? -14.985 5.810   0.033   1.00 0.00 ? 72  ASP A HA   1  
ATOM 1122  H HB2  . ASP A 1 72  ? -13.666 5.994   -2.668  1.00 0.00 ? 72  ASP A HB2  1  
ATOM 1123  H HB3  . ASP A 1 72  ? -14.776 4.683   -2.275  1.00 0.00 ? 72  ASP A HB3  1  
ATOM 1124  N N    . VAL A 1 73  ? -11.935 4.724   -0.318  1.00 0.00 ? 73  VAL A N    1  
ATOM 1125  C CA   . VAL A 1 73  ? -11.018 3.642   0.017   1.00 0.00 ? 73  VAL A CA   1  
ATOM 1126  C C    . VAL A 1 73  ? -10.727 3.612   1.513   1.00 0.00 ? 73  VAL A C    1  
ATOM 1127  O O    . VAL A 1 73  ? -11.052 2.643   2.200   1.00 0.00 ? 73  VAL A O    1  
ATOM 1128  C CB   . VAL A 1 73  ? -9.689  3.774   -0.751  1.00 0.00 ? 73  VAL A CB   1  
ATOM 1129  C CG1  . VAL A 1 73  ? -8.737  2.651   -0.369  1.00 0.00 ? 73  VAL A CG1  1  
ATOM 1130  C CG2  . VAL A 1 73  ? -9.940  3.785   -2.251  1.00 0.00 ? 73  VAL A CG2  1  
ATOM 1131  H H    . VAL A 1 73  ? -11.573 5.575   -0.644  1.00 0.00 ? 73  VAL A H    1  
ATOM 1132  H HA   . VAL A 1 73  ? -11.483 2.709   -0.269  1.00 0.00 ? 73  VAL A HA   1  
ATOM 1133  H HB   . VAL A 1 73  ? -9.230  4.713   -0.477  1.00 0.00 ? 73  VAL A HB   1  
ATOM 1134  H HG11 . VAL A 1 73  ? -8.976  1.767   -0.943  1.00 0.00 ? 73  VAL A HG11 1  
ATOM 1135  H HG12 . VAL A 1 73  ? -7.721  2.953   -0.577  1.00 0.00 ? 73  VAL A HG12 1  
ATOM 1136  H HG13 . VAL A 1 73  ? -8.841  2.434   0.684   1.00 0.00 ? 73  VAL A HG13 1  
ATOM 1137  H HG21 . VAL A 1 73  ? -10.561 4.631   -2.505  1.00 0.00 ? 73  VAL A HG21 1  
ATOM 1138  H HG22 . VAL A 1 73  ? -8.997  3.860   -2.774  1.00 0.00 ? 73  VAL A HG22 1  
ATOM 1139  H HG23 . VAL A 1 73  ? -10.439 2.872   -2.540  1.00 0.00 ? 73  VAL A HG23 1  
ATOM 1140  N N    . SER A 1 74  ? -10.112 4.679   2.013   1.00 0.00 ? 74  SER A N    1  
ATOM 1141  C CA   . SER A 1 74  ? -9.774  4.774   3.428   1.00 0.00 ? 74  SER A CA   1  
ATOM 1142  C C    . SER A 1 74  ? -10.905 4.227   4.294   1.00 0.00 ? 74  SER A C    1  
ATOM 1143  O O    . SER A 1 74  ? -10.684 3.387   5.167   1.00 0.00 ? 74  SER A O    1  
ATOM 1144  C CB   . SER A 1 74  ? -9.482  6.227   3.808   1.00 0.00 ? 74  SER A CB   1  
ATOM 1145  O OG   . SER A 1 74  ? -10.263 7.123   3.036   1.00 0.00 ? 74  SER A OG   1  
ATOM 1146  H H    . SER A 1 74  ? -9.879  5.420   1.414   1.00 0.00 ? 74  SER A H    1  
ATOM 1147  H HA   . SER A 1 74  ? -8.888  4.182   3.597   1.00 0.00 ? 74  SER A HA   1  
ATOM 1148  H HB2  . SER A 1 74  ? -9.711  6.376   4.852   1.00 0.00 ? 74  SER A HB2  1  
ATOM 1149  H HB3  . SER A 1 74  ? -8.437  6.438   3.635   1.00 0.00 ? 74  SER A HB3  1  
ATOM 1150  H HG   . SER A 1 74  ? -11.193 6.987   3.231   1.00 0.00 ? 74  SER A HG   1  
ATOM 1151  N N    . THR A 1 75  ? -12.118 4.711   4.048   1.00 0.00 ? 75  THR A N    1  
ATOM 1152  C CA   . THR A 1 75  ? -13.284 4.273   4.805   1.00 0.00 ? 75  THR A CA   1  
ATOM 1153  C C    . THR A 1 75  ? -13.459 2.761   4.719   1.00 0.00 ? 75  THR A C    1  
ATOM 1154  O O    . THR A 1 75  ? -13.869 2.118   5.685   1.00 0.00 ? 75  THR A O    1  
ATOM 1155  C CB   . THR A 1 75  ? -14.569 4.957   4.302   1.00 0.00 ? 75  THR A CB   1  
ATOM 1156  O OG1  . THR A 1 75  ? -14.432 6.380   4.386   1.00 0.00 ? 75  THR A OG1  1  
ATOM 1157  C CG2  . THR A 1 75  ? -15.774 4.510   5.117   1.00 0.00 ? 75  THR A CG2  1  
ATOM 1158  H H    . THR A 1 75  ? -12.230 5.379   3.340   1.00 0.00 ? 75  THR A H    1  
ATOM 1159  H HA   . THR A 1 75  ? -13.134 4.550   5.838   1.00 0.00 ? 75  THR A HA   1  
ATOM 1160  H HB   . THR A 1 75  ? -14.728 4.678   3.270   1.00 0.00 ? 75  THR A HB   1  
ATOM 1161  H HG1  . THR A 1 75  ? -13.508 6.619   4.278   1.00 0.00 ? 75  THR A HG1  1  
ATOM 1162  H HG21 . THR A 1 75  ? -15.894 5.162   5.970   1.00 0.00 ? 75  THR A HG21 1  
ATOM 1163  H HG22 . THR A 1 75  ? -15.623 3.496   5.457   1.00 0.00 ? 75  THR A HG22 1  
ATOM 1164  H HG23 . THR A 1 75  ? -16.660 4.556   4.502   1.00 0.00 ? 75  THR A HG23 1  
ATOM 1165  N N    . ARG A 1 76  ? -13.146 2.199   3.556   1.00 0.00 ? 76  ARG A N    1  
ATOM 1166  C CA   . ARG A 1 76  ? -13.269 0.762   3.344   1.00 0.00 ? 76  ARG A CA   1  
ATOM 1167  C C    . ARG A 1 76  ? -12.099 0.016   3.979   1.00 0.00 ? 76  ARG A C    1  
ATOM 1168  O O    . ARG A 1 76  ? -12.226 -1.147  4.361   1.00 0.00 ? 76  ARG A O    1  
ATOM 1169  C CB   . ARG A 1 76  ? -13.336 0.449   1.848   1.00 0.00 ? 76  ARG A CB   1  
ATOM 1170  C CG   . ARG A 1 76  ? -13.773 -0.974  1.542   1.00 0.00 ? 76  ARG A CG   1  
ATOM 1171  C CD   . ARG A 1 76  ? -13.857 -1.221  0.044   1.00 0.00 ? 76  ARG A CD   1  
ATOM 1172  N NE   . ARG A 1 76  ? -14.848 -0.361  -0.597  1.00 0.00 ? 76  ARG A NE   1  
ATOM 1173  C CZ   . ARG A 1 76  ? -15.136 -0.411  -1.893  1.00 0.00 ? 76  ARG A CZ   1  
ATOM 1174  N NH1  . ARG A 1 76  ? -14.511 -1.275  -2.681  1.00 0.00 ? 76  ARG A NH1  1  
ATOM 1175  N NH2  . ARG A 1 76  ? -16.050 0.404   -2.403  1.00 0.00 ? 76  ARG A NH2  1  
ATOM 1176  H H    . ARG A 1 76  ? -12.824 2.764   2.822   1.00 0.00 ? 76  ARG A H    1  
ATOM 1177  H HA   . ARG A 1 76  ? -14.186 0.435   3.812   1.00 0.00 ? 76  ARG A HA   1  
ATOM 1178  H HB2  . ARG A 1 76  ? -14.038 1.125   1.382   1.00 0.00 ? 76  ARG A HB2  1  
ATOM 1179  H HB3  . ARG A 1 76  ? -12.359 0.604   1.417   1.00 0.00 ? 76  ARG A HB3  1  
ATOM 1180  H HG2  . ARG A 1 76  ? -13.056 -1.660  1.969   1.00 0.00 ? 76  ARG A HG2  1  
ATOM 1181  H HG3  . ARG A 1 76  ? -14.744 -1.145  1.982   1.00 0.00 ? 76  ARG A HG3  1  
ATOM 1182  H HD2  . ARG A 1 76  ? -12.890 -1.028  -0.394  1.00 0.00 ? 76  ARG A HD2  1  
ATOM 1183  H HD3  . ARG A 1 76  ? -14.128 -2.253  -0.122  1.00 0.00 ? 76  ARG A HD3  1  
ATOM 1184  H HE   . ARG A 1 76  ? -15.322 0.285   -0.033  1.00 0.00 ? 76  ARG A HE   1  
ATOM 1185  H HH11 . ARG A 1 76  ? -13.823 -1.891  -2.300  1.00 0.00 ? 76  ARG A HH11 1  
ATOM 1186  H HH12 . ARG A 1 76  ? -14.731 -1.311  -3.657  1.00 0.00 ? 76  ARG A HH12 1  
ATOM 1187  H HH21 . ARG A 1 76  ? -16.523 1.057   -1.812  1.00 0.00 ? 76  ARG A HH21 1  
ATOM 1188  H HH22 . ARG A 1 76  ? -16.266 0.366   -3.378  1.00 0.00 ? 76  ARG A HH22 1  
ATOM 1189  N N    . TYR A 1 77  ? -10.962 0.694   4.087   1.00 0.00 ? 77  TYR A N    1  
ATOM 1190  C CA   . TYR A 1 77  ? -9.768  0.095   4.672   1.00 0.00 ? 77  TYR A CA   1  
ATOM 1191  C C    . TYR A 1 77  ? -9.540  0.609   6.091   1.00 0.00 ? 77  TYR A C    1  
ATOM 1192  O O    . TYR A 1 77  ? -8.421  0.577   6.603   1.00 0.00 ? 77  TYR A O    1  
ATOM 1193  C CB   . TYR A 1 77  ? -8.544  0.395   3.806   1.00 0.00 ? 77  TYR A CB   1  
ATOM 1194  C CG   . TYR A 1 77  ? -8.501  -0.402  2.522   1.00 0.00 ? 77  TYR A CG   1  
ATOM 1195  C CD1  . TYR A 1 77  ? -9.431  -0.181  1.513   1.00 0.00 ? 77  TYR A CD1  1  
ATOM 1196  C CD2  . TYR A 1 77  ? -7.532  -1.376  2.317   1.00 0.00 ? 77  TYR A CD2  1  
ATOM 1197  C CE1  . TYR A 1 77  ? -9.396  -0.908  0.338   1.00 0.00 ? 77  TYR A CE1  1  
ATOM 1198  C CE2  . TYR A 1 77  ? -7.489  -2.106  1.145   1.00 0.00 ? 77  TYR A CE2  1  
ATOM 1199  C CZ   . TYR A 1 77  ? -8.423  -1.869  0.159   1.00 0.00 ? 77  TYR A CZ   1  
ATOM 1200  O OH   . TYR A 1 77  ? -8.384  -2.594  -1.009  1.00 0.00 ? 77  TYR A OH   1  
ATOM 1201  H H    . TYR A 1 77  ? -10.923 1.618   3.764   1.00 0.00 ? 77  TYR A H    1  
ATOM 1202  H HA   . TYR A 1 77  ? -9.918  -0.975  4.709   1.00 0.00 ? 77  TYR A HA   1  
ATOM 1203  H HB2  . TYR A 1 77  ? -8.544  1.442   3.546   1.00 0.00 ? 77  TYR A HB2  1  
ATOM 1204  H HB3  . TYR A 1 77  ? -7.650  0.168   4.368   1.00 0.00 ? 77  TYR A HB3  1  
ATOM 1205  H HD1  . TYR A 1 77  ? -10.192 0.572   1.656   1.00 0.00 ? 77  TYR A HD1  1  
ATOM 1206  H HD2  . TYR A 1 77  ? -6.802  -1.561  3.092   1.00 0.00 ? 77  TYR A HD2  1  
ATOM 1207  H HE1  . TYR A 1 77  ? -10.127 -0.721  -0.435  1.00 0.00 ? 77  TYR A HE1  1  
ATOM 1208  H HE2  . TYR A 1 77  ? -6.727  -2.859  1.005   1.00 0.00 ? 77  TYR A HE2  1  
ATOM 1209  H HH   . TYR A 1 77  ? -8.988  -3.338  -0.944  1.00 0.00 ? 77  TYR A HH   1  
ATOM 1210  N N    . LYS A 1 78  ? -10.610 1.083   6.720   1.00 0.00 ? 78  LYS A N    1  
ATOM 1211  C CA   . LYS A 1 78  ? -10.530 1.603   8.080   1.00 0.00 ? 78  LYS A CA   1  
ATOM 1212  C C    . LYS A 1 78  ? -9.240  2.391   8.286   1.00 0.00 ? 78  LYS A C    1  
ATOM 1213  O O    . LYS A 1 78  ? -8.514  2.168   9.255   1.00 0.00 ? 78  LYS A O    1  
ATOM 1214  C CB   . LYS A 1 78  ? -10.608 0.458   9.092   1.00 0.00 ? 78  LYS A CB   1  
ATOM 1215  C CG   . LYS A 1 78  ? -11.920 -0.306  9.046   1.00 0.00 ? 78  LYS A CG   1  
ATOM 1216  C CD   . LYS A 1 78  ? -11.854 -1.470  8.071   1.00 0.00 ? 78  LYS A CD   1  
ATOM 1217  C CE   . LYS A 1 78  ? -13.176 -2.221  8.009   1.00 0.00 ? 78  LYS A CE   1  
ATOM 1218  N NZ   . LYS A 1 78  ? -13.321 -2.983  6.738   1.00 0.00 ? 78  LYS A NZ   1  
ATOM 1219  H H    . LYS A 1 78  ? -11.475 1.082   6.259   1.00 0.00 ? 78  LYS A H    1  
ATOM 1220  H HA   . LYS A 1 78  ? -11.370 2.264   8.232   1.00 0.00 ? 78  LYS A HA   1  
ATOM 1221  H HB2  . LYS A 1 78  ? -9.805  -0.236  8.894   1.00 0.00 ? 78  LYS A HB2  1  
ATOM 1222  H HB3  . LYS A 1 78  ? -10.486 0.863   10.086  1.00 0.00 ? 78  LYS A HB3  1  
ATOM 1223  H HG2  . LYS A 1 78  ? -12.139 -0.688  10.032  1.00 0.00 ? 78  LYS A HG2  1  
ATOM 1224  H HG3  . LYS A 1 78  ? -12.707 0.367   8.736   1.00 0.00 ? 78  LYS A HG3  1  
ATOM 1225  H HD2  . LYS A 1 78  ? -11.622 -1.092  7.087   1.00 0.00 ? 78  LYS A HD2  1  
ATOM 1226  H HD3  . LYS A 1 78  ? -11.077 -2.151  8.389   1.00 0.00 ? 78  LYS A HD3  1  
ATOM 1227  H HE2  . LYS A 1 78  ? -13.223 -2.909  8.839   1.00 0.00 ? 78  LYS A HE2  1  
ATOM 1228  H HE3  . LYS A 1 78  ? -13.983 -1.508  8.086   1.00 0.00 ? 78  LYS A HE3  1  
ATOM 1229  H HZ1  . LYS A 1 78  ? -14.289 -3.355  6.654   1.00 0.00 ? 78  LYS A HZ1  1  
ATOM 1230  H HZ2  . LYS A 1 78  ? -12.653 -3.780  6.721   1.00 0.00 ? 78  LYS A HZ2  1  
ATOM 1231  H HZ3  . LYS A 1 78  ? -13.127 -2.364  5.926   1.00 0.00 ? 78  LYS A HZ3  1  
ATOM 1232  N N    . VAL A 1 79  ? -8.962  3.313   7.370   1.00 0.00 ? 79  VAL A N    1  
ATOM 1233  C CA   . VAL A 1 79  ? -7.761  4.135   7.453   1.00 0.00 ? 79  VAL A CA   1  
ATOM 1234  C C    . VAL A 1 79  ? -8.112  5.599   7.693   1.00 0.00 ? 79  VAL A C    1  
ATOM 1235  O O    . VAL A 1 79  ? -8.412  6.337   6.755   1.00 0.00 ? 79  VAL A O    1  
ATOM 1236  C CB   . VAL A 1 79  ? -6.915  4.025   6.171   1.00 0.00 ? 79  VAL A CB   1  
ATOM 1237  C CG1  . VAL A 1 79  ? -5.731  4.978   6.228   1.00 0.00 ? 79  VAL A CG1  1  
ATOM 1238  C CG2  . VAL A 1 79  ? -6.447  2.592   5.963   1.00 0.00 ? 79  VAL A CG2  1  
ATOM 1239  H H    . VAL A 1 79  ? -9.579  3.443   6.621   1.00 0.00 ? 79  VAL A H    1  
ATOM 1240  H HA   . VAL A 1 79  ? -7.168  3.777   8.282   1.00 0.00 ? 79  VAL A HA   1  
ATOM 1241  H HB   . VAL A 1 79  ? -7.534  4.304   5.331   1.00 0.00 ? 79  VAL A HB   1  
ATOM 1242  H HG11 . VAL A 1 79  ? -5.930  5.836   5.601   1.00 0.00 ? 79  VAL A HG11 1  
ATOM 1243  H HG12 . VAL A 1 79  ? -5.579  5.303   7.247   1.00 0.00 ? 79  VAL A HG12 1  
ATOM 1244  H HG13 . VAL A 1 79  ? -4.845  4.473   5.874   1.00 0.00 ? 79  VAL A HG13 1  
ATOM 1245  H HG21 . VAL A 1 79  ? -5.465  2.597   5.514   1.00 0.00 ? 79  VAL A HG21 1  
ATOM 1246  H HG22 . VAL A 1 79  ? -6.404  2.085   6.916   1.00 0.00 ? 79  VAL A HG22 1  
ATOM 1247  H HG23 . VAL A 1 79  ? -7.138  2.078   5.313   1.00 0.00 ? 79  VAL A HG23 1  
ATOM 1248  N N    . SER A 1 80  ? -8.073  6.012   8.955   1.00 0.00 ? 80  SER A N    1  
ATOM 1249  C CA   . SER A 1 80  ? -8.391  7.388   9.320   1.00 0.00 ? 80  SER A CA   1  
ATOM 1250  C C    . SER A 1 80  ? -7.538  8.371   8.525   1.00 0.00 ? 80  SER A C    1  
ATOM 1251  O O    . SER A 1 80  ? -6.320  8.218   8.427   1.00 0.00 ? 80  SER A O    1  
ATOM 1252  C CB   . SER A 1 80  ? -8.176  7.604   10.819  1.00 0.00 ? 80  SER A CB   1  
ATOM 1253  O OG   . SER A 1 80  ? -9.229  7.030   11.573  1.00 0.00 ? 80  SER A OG   1  
ATOM 1254  H H    . SER A 1 80  ? -7.827  5.376   9.659   1.00 0.00 ? 80  SER A H    1  
ATOM 1255  H HA   . SER A 1 80  ? -9.431  7.561   9.086   1.00 0.00 ? 80  SER A HA   1  
ATOM 1256  H HB2  . SER A 1 80  ? -7.245  7.145   11.116  1.00 0.00 ? 80  SER A HB2  1  
ATOM 1257  H HB3  . SER A 1 80  ? -8.137  8.664   11.025  1.00 0.00 ? 80  SER A HB3  1  
ATOM 1258  H HG   . SER A 1 80  ? -8.867  6.597   12.350  1.00 0.00 ? 80  SER A HG   1  
ATOM 1259  N N    . THR A 1 81  ? -8.186  9.384   7.957   1.00 0.00 ? 81  THR A N    1  
ATOM 1260  C CA   . THR A 1 81  ? -7.489  10.393  7.170   1.00 0.00 ? 81  THR A CA   1  
ATOM 1261  C C    . THR A 1 81  ? -7.469  11.736  7.890   1.00 0.00 ? 81  THR A C    1  
ATOM 1262  O O    . THR A 1 81  ? -7.814  12.767  7.312   1.00 0.00 ? 81  THR A O    1  
ATOM 1263  C CB   . THR A 1 81  ? -8.141  10.575  5.786   1.00 0.00 ? 81  THR A CB   1  
ATOM 1264  O OG1  . THR A 1 81  ? -9.557  10.727  5.928   1.00 0.00 ? 81  THR A OG1  1  
ATOM 1265  C CG2  . THR A 1 81  ? -7.841  9.385   4.886   1.00 0.00 ? 81  THR A CG2  1  
ATOM 1266  H H    . THR A 1 81  ? -9.157  9.452   8.072   1.00 0.00 ? 81  THR A H    1  
ATOM 1267  H HA   . THR A 1 81  ? -6.472  10.058  7.024   1.00 0.00 ? 81  THR A HA   1  
ATOM 1268  H HB   . THR A 1 81  ? -7.734  11.465  5.328   1.00 0.00 ? 81  THR A HB   1  
ATOM 1269  H HG1  . THR A 1 81  ? -9.749  11.575  6.337   1.00 0.00 ? 81  THR A HG1  1  
ATOM 1270  H HG21 . THR A 1 81  ? -8.612  9.299   4.135   1.00 0.00 ? 81  THR A HG21 1  
ATOM 1271  H HG22 . THR A 1 81  ? -7.814  8.483   5.479   1.00 0.00 ? 81  THR A HG22 1  
ATOM 1272  H HG23 . THR A 1 81  ? -6.885  9.529   4.406   1.00 0.00 ? 81  THR A HG23 1  
ATOM 1273  N N    . SER A 1 82  ? -7.064  11.718  9.156   1.00 0.00 ? 82  SER A N    1  
ATOM 1274  C CA   . SER A 1 82  ? -7.002  12.935  9.956   1.00 0.00 ? 82  SER A CA   1  
ATOM 1275  C C    . SER A 1 82  ? -5.557  13.381  10.156  1.00 0.00 ? 82  SER A C    1  
ATOM 1276  O O    . SER A 1 82  ? -4.638  12.568  10.261  1.00 0.00 ? 82  SER A O    1  
ATOM 1277  C CB   . SER A 1 82  ? -7.672  12.712  11.314  1.00 0.00 ? 82  SER A CB   1  
ATOM 1278  O OG   . SER A 1 82  ? -9.064  12.964  11.243  1.00 0.00 ? 82  SER A OG   1  
ATOM 1279  H H    . SER A 1 82  ? -6.802  10.865  9.561   1.00 0.00 ? 82  SER A H    1  
ATOM 1280  H HA   . SER A 1 82  ? -7.535  13.709  9.424   1.00 0.00 ? 82  SER A HA   1  
ATOM 1281  H HB2  . SER A 1 82  ? -7.518  11.690  11.624  1.00 0.00 ? 82  SER A HB2  1  
ATOM 1282  H HB3  . SER A 1 82  ? -7.233  13.379  12.042  1.00 0.00 ? 82  SER A HB3  1  
ATOM 1283  H HG   . SER A 1 82  ? -9.493  12.260  10.750  1.00 0.00 ? 82  SER A HG   1  
ATOM 1284  N N    . PRO A 1 83  ? -5.349  14.705  10.211  1.00 0.00 ? 83  PRO A N    1  
ATOM 1285  C CA   . PRO A 1 83  ? -4.019  15.291  10.399  1.00 0.00 ? 83  PRO A CA   1  
ATOM 1286  C C    . PRO A 1 83  ? -3.472  15.048  11.802  1.00 0.00 ? 83  PRO A C    1  
ATOM 1287  O O    . PRO A 1 83  ? -2.333  15.406  12.106  1.00 0.00 ? 83  PRO A O    1  
ATOM 1288  C CB   . PRO A 1 83  ? -4.253  16.786  10.168  1.00 0.00 ? 83  PRO A CB   1  
ATOM 1289  C CG   . PRO A 1 83  ? -5.692  16.998  10.493  1.00 0.00 ? 83  PRO A CG   1  
ATOM 1290  C CD   . PRO A 1 83  ? -6.398  15.732  10.094  1.00 0.00 ? 83  PRO A CD   1  
ATOM 1291  H HA   . PRO A 1 83  ? -3.314  14.918  9.670   1.00 0.00 ? 83  PRO A HA   1  
ATOM 1292  H HB2  . PRO A 1 83  ? -3.611  17.359  10.822  1.00 0.00 ? 83  PRO A HB2  1  
ATOM 1293  H HB3  . PRO A 1 83  ? -4.041  17.032  9.139   1.00 0.00 ? 83  PRO A HB3  1  
ATOM 1294  H HG2  . PRO A 1 83  ? -5.807  17.174  11.552  1.00 0.00 ? 83  PRO A HG2  1  
ATOM 1295  H HG3  . PRO A 1 83  ? -6.075  17.835  9.929   1.00 0.00 ? 83  PRO A HG3  1  
ATOM 1296  H HD2  . PRO A 1 83  ? -7.216  15.528  10.769  1.00 0.00 ? 83  PRO A HD2  1  
ATOM 1297  H HD3  . PRO A 1 83  ? -6.755  15.804  9.077   1.00 0.00 ? 83  PRO A HD3  1  
ATOM 1298  N N    . LEU A 1 84  ? -4.290  14.439  12.654  1.00 0.00 ? 84  LEU A N    1  
ATOM 1299  C CA   . LEU A 1 84  ? -3.887  14.148  14.025  1.00 0.00 ? 84  LEU A CA   1  
ATOM 1300  C C    . LEU A 1 84  ? -3.527  12.675  14.186  1.00 0.00 ? 84  LEU A C    1  
ATOM 1301  O O    . LEU A 1 84  ? -2.504  12.335  14.782  1.00 0.00 ? 84  LEU A O    1  
ATOM 1302  C CB   . LEU A 1 84  ? -5.009  14.519  14.996  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1303  C CG   . LEU A 1 84  ? -5.132  16.003  15.345  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1304  C CD1  . LEU A 1 84  ? -6.429  16.270  16.093  1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1305  C CD2  . LEU A 1 84  ? -3.936  16.458  16.168  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1306  H H    . LEU A 1 84  ? -5.185  14.178  12.354  1.00 0.00 ? 84  LEU A H    1  
ATOM 1307  H HA   . LEU A 1 84  ? -3.016  14.746  14.249  1.00 0.00 ? 84  LEU A HA   1  
ATOM 1308  H HB2  . LEU A 1 84  ? -5.944  14.204  14.558  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1309  H HB3  . LEU A 1 84  ? -4.844  13.975  15.915  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1310  H HG   . LEU A 1 84  ? -5.150  16.581  14.431  1.00 0.00 ? 84  LEU A HG   1  
ATOM 1311  H HD11 . LEU A 1 84  ? -7.224  16.446  15.385  1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1312  H HD12 . LEU A 1 84  ? -6.309  17.139  16.723  1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1313  H HD13 . LEU A 1 84  ? -6.674  15.414  16.705  1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1314  H HD21 . LEU A 1 84  ? -3.144  15.728  16.085  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1315  H HD22 . LEU A 1 84  ? -4.228  16.557  17.203  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1316  H HD23 . LEU A 1 84  ? -3.587  17.411  15.799  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1317  N N    . THR A 1 85  ? -4.373  11.802  13.648  1.00 0.00 ? 85  THR A N    1  
ATOM 1318  C CA   . THR A 1 85  ? -4.143  10.365  13.731  1.00 0.00 ? 85  THR A CA   1  
ATOM 1319  C C    . THR A 1 85  ? -2.769  9.995   13.184  1.00 0.00 ? 85  THR A C    1  
ATOM 1320  O O    . THR A 1 85  ? -2.067  10.835  12.622  1.00 0.00 ? 85  THR A O    1  
ATOM 1321  C CB   . THR A 1 85  ? -5.219  9.579   12.958  1.00 0.00 ? 85  THR A CB   1  
ATOM 1322  O OG1  . THR A 1 85  ? -5.134  8.186   13.279  1.00 0.00 ? 85  THR A OG1  1  
ATOM 1323  C CG2  . THR A 1 85  ? -5.055  9.769   11.457  1.00 0.00 ? 85  THR A CG2  1  
ATOM 1324  H H    . THR A 1 85  ? -5.171  12.133  13.186  1.00 0.00 ? 85  THR A H    1  
ATOM 1325  H HA   . THR A 1 85  ? -4.196  10.078  14.771  1.00 0.00 ? 85  THR A HA   1  
ATOM 1326  H HB   . THR A 1 85  ? -6.192  9.949   13.248  1.00 0.00 ? 85  THR A HB   1  
ATOM 1327  H HG1  . THR A 1 85  ? -5.558  8.026   14.125  1.00 0.00 ? 85  THR A HG1  1  
ATOM 1328  H HG21 . THR A 1 85  ? -5.458  10.729  11.170  1.00 0.00 ? 85  THR A HG21 1  
ATOM 1329  H HG22 . THR A 1 85  ? -5.583  8.985   10.935  1.00 0.00 ? 85  THR A HG22 1  
ATOM 1330  H HG23 . THR A 1 85  ? -4.007  9.729   11.203  1.00 0.00 ? 85  THR A HG23 1  
ATOM 1331  N N    . LYS A 1 86  ? -2.391  8.733   13.353  1.00 0.00 ? 86  LYS A N    1  
ATOM 1332  C CA   . LYS A 1 86  ? -1.100  8.250   12.875  1.00 0.00 ? 86  LYS A CA   1  
ATOM 1333  C C    . LYS A 1 86  ? -1.282  7.113   11.874  1.00 0.00 ? 86  LYS A C    1  
ATOM 1334  O O    . LYS A 1 86  ? -0.503  6.161   11.855  1.00 0.00 ? 86  LYS A O    1  
ATOM 1335  C CB   . LYS A 1 86  ? -0.243  7.776   14.050  1.00 0.00 ? 86  LYS A CB   1  
ATOM 1336  C CG   . LYS A 1 86  ? 0.157   8.892   15.000  1.00 0.00 ? 86  LYS A CG   1  
ATOM 1337  C CD   . LYS A 1 86  ? -0.898  9.118   16.070  1.00 0.00 ? 86  LYS A CD   1  
ATOM 1338  C CE   . LYS A 1 86  ? -0.800  8.079   17.177  1.00 0.00 ? 86  LYS A CE   1  
ATOM 1339  N NZ   . LYS A 1 86  ? 0.174   8.480   18.229  1.00 0.00 ? 86  LYS A NZ   1  
ATOM 1340  H H    . LYS A 1 86  ? -2.995  8.109   13.809  1.00 0.00 ? 86  LYS A H    1  
ATOM 1341  H HA   . LYS A 1 86  ? -0.601  9.071   12.383  1.00 0.00 ? 86  LYS A HA   1  
ATOM 1342  H HB2  . LYS A 1 86  ? -0.796  7.037   14.609  1.00 0.00 ? 86  LYS A HB2  1  
ATOM 1343  H HB3  . LYS A 1 86  ? 0.658   7.322   13.663  1.00 0.00 ? 86  LYS A HB3  1  
ATOM 1344  H HG2  . LYS A 1 86  ? 1.089   8.629   15.478  1.00 0.00 ? 86  LYS A HG2  1  
ATOM 1345  H HG3  . LYS A 1 86  ? 0.285   9.805   14.435  1.00 0.00 ? 86  LYS A HG3  1  
ATOM 1346  H HD2  . LYS A 1 86  ? -0.759  10.099  16.500  1.00 0.00 ? 86  LYS A HD2  1  
ATOM 1347  H HD3  . LYS A 1 86  ? -1.877  9.057   15.617  1.00 0.00 ? 86  LYS A HD3  1  
ATOM 1348  H HE2  . LYS A 1 86  ? -1.773  7.958   17.627  1.00 0.00 ? 86  LYS A HE2  1  
ATOM 1349  H HE3  . LYS A 1 86  ? -0.485  7.141   16.745  1.00 0.00 ? 86  LYS A HE3  1  
ATOM 1350  H HZ1  . LYS A 1 86  ? 0.517   9.445   18.050  1.00 0.00 ? 86  LYS A HZ1  1  
ATOM 1351  H HZ2  . LYS A 1 86  ? 0.987   7.831   18.230  1.00 0.00 ? 86  LYS A HZ2  1  
ATOM 1352  H HZ3  . LYS A 1 86  ? -0.279  8.452   19.165  1.00 0.00 ? 86  LYS A HZ3  1  
ATOM 1353  N N    . GLN A 1 87  ? -2.313  7.222   11.042  1.00 0.00 ? 87  GLN A N    1  
ATOM 1354  C CA   . GLN A 1 87  ? -2.595  6.203   10.038  1.00 0.00 ? 87  GLN A CA   1  
ATOM 1355  C C    . GLN A 1 87  ? -2.116  6.649   8.661   1.00 0.00 ? 87  GLN A C    1  
ATOM 1356  O O    . GLN A 1 87  ? -2.621  6.187   7.637   1.00 0.00 ? 87  GLN A O    1  
ATOM 1357  C CB   . GLN A 1 87  ? -4.093  5.898   9.997   1.00 0.00 ? 87  GLN A CB   1  
ATOM 1358  C CG   . GLN A 1 87  ? -4.684  5.561   11.356  1.00 0.00 ? 87  GLN A CG   1  
ATOM 1359  C CD   . GLN A 1 87  ? -5.854  4.602   11.263  1.00 0.00 ? 87  GLN A CD   1  
ATOM 1360  O OE1  . GLN A 1 87  ? -7.005  4.988   11.469  1.00 0.00 ? 87  GLN A OE1  1  
ATOM 1361  N NE2  . GLN A 1 87  ? -5.566  3.344   10.951  1.00 0.00 ? 87  GLN A NE2  1  
ATOM 1362  H H    . GLN A 1 87  ? -2.898  8.005   11.106  1.00 0.00 ? 87  GLN A H    1  
ATOM 1363  H HA   . GLN A 1 87  ? -2.062  5.306   10.318  1.00 0.00 ? 87  GLN A HA   1  
ATOM 1364  H HB2  . GLN A 1 87  ? -4.613  6.760   9.606   1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1365  H HB3  . GLN A 1 87  ? -4.260  5.058   9.338   1.00 0.00 ? 87  GLN A HB3  1  
ATOM 1366  H HG2  . GLN A 1 87  ? -3.916  5.108   11.966  1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1367  H HG3  . GLN A 1 87  ? -5.021  6.474   11.824  1.00 0.00 ? 87  GLN A HG3  1  
ATOM 1368  H HE21 . GLN A 1 87  ? -4.626  3.109   10.802  1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1369  H HE22 . GLN A 1 87  ? -6.303  2.703   10.885  1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1370  N N    . LEU A 1 88  ? -1.140  7.550   8.642   1.00 0.00 ? 88  LEU A N    1  
ATOM 1371  C CA   . LEU A 1 88  ? -0.593  8.060   7.390   1.00 0.00 ? 88  LEU A CA   1  
ATOM 1372  C C    . LEU A 1 88  ? 0.848   8.526   7.575   1.00 0.00 ? 88  LEU A C    1  
ATOM 1373  O O    . LEU A 1 88  ? 1.150   9.368   8.420   1.00 0.00 ? 88  LEU A O    1  
ATOM 1374  C CB   . LEU A 1 88  ? -1.451  9.213   6.867   1.00 0.00 ? 88  LEU A CB   1  
ATOM 1375  C CG   . LEU A 1 88  ? -2.735  8.818   6.138   1.00 0.00 ? 88  LEU A CG   1  
ATOM 1376  C CD1  . LEU A 1 88  ? -3.615  10.037  5.907   1.00 0.00 ? 88  LEU A CD1  1  
ATOM 1377  C CD2  . LEU A 1 88  ? -2.410  8.135   4.817   1.00 0.00 ? 88  LEU A CD2  1  
ATOM 1378  H H    . LEU A 1 88  ? -0.779  7.881   9.490   1.00 0.00 ? 88  LEU A H    1  
ATOM 1379  H HA   . LEU A 1 88  ? -0.609  7.255   6.670   1.00 0.00 ? 88  LEU A HA   1  
ATOM 1380  H HB2  . LEU A 1 88  ? -1.726  9.829   7.710   1.00 0.00 ? 88  LEU A HB2  1  
ATOM 1381  H HB3  . LEU A 1 88  ? -0.846  9.792   6.184   1.00 0.00 ? 88  LEU A HB3  1  
ATOM 1382  H HG   . LEU A 1 88  ? -3.289  8.119   6.749   1.00 0.00 ? 88  LEU A HG   1  
ATOM 1383  H HD11 . LEU A 1 88  ? -3.056  10.788  5.370   1.00 0.00 ? 88  LEU A HD11 1  
ATOM 1384  H HD12 . LEU A 1 88  ? -3.933  10.436  6.858   1.00 0.00 ? 88  LEU A HD12 1  
ATOM 1385  H HD13 . LEU A 1 88  ? -4.482  9.751   5.329   1.00 0.00 ? 88  LEU A HD13 1  
ATOM 1386  H HD21 . LEU A 1 88  ? -3.179  7.413   4.587   1.00 0.00 ? 88  LEU A HD21 1  
ATOM 1387  H HD22 . LEU A 1 88  ? -1.457  7.632   4.898   1.00 0.00 ? 88  LEU A HD22 1  
ATOM 1388  H HD23 . LEU A 1 88  ? -2.362  8.874   4.032   1.00 0.00 ? 88  LEU A HD23 1  
ATOM 1389  N N    . PRO A 1 89  ? 1.759   7.967   6.765   1.00 0.00 ? 89  PRO A N    1  
ATOM 1390  C CA   . PRO A 1 89  ? 1.411   6.962   5.755   1.00 0.00 ? 89  PRO A CA   1  
ATOM 1391  C C    . PRO A 1 89  ? 1.005   5.631   6.378   1.00 0.00 ? 89  PRO A C    1  
ATOM 1392  O O    . PRO A 1 89  ? 1.022   5.474   7.599   1.00 0.00 ? 89  PRO A O    1  
ATOM 1393  C CB   . PRO A 1 89  ? 2.704   6.804   4.952   1.00 0.00 ? 89  PRO A CB   1  
ATOM 1394  C CG   . PRO A 1 89  ? 3.787   7.202   5.894   1.00 0.00 ? 89  PRO A CG   1  
ATOM 1395  C CD   . PRO A 1 89  ? 3.200   8.272   6.772   1.00 0.00 ? 89  PRO A CD   1  
ATOM 1396  H HA   . PRO A 1 89  ? 0.621   7.310   5.105   1.00 0.00 ? 89  PRO A HA   1  
ATOM 1397  H HB2  . PRO A 1 89  ? 2.812   5.776   4.636   1.00 0.00 ? 89  PRO A HB2  1  
ATOM 1398  H HB3  . PRO A 1 89  ? 2.676   7.451   4.087   1.00 0.00 ? 89  PRO A HB3  1  
ATOM 1399  H HG2  . PRO A 1 89  ? 4.087   6.352   6.488   1.00 0.00 ? 89  PRO A HG2  1  
ATOM 1400  H HG3  . PRO A 1 89  ? 4.629   7.592   5.342   1.00 0.00 ? 89  PRO A HG3  1  
ATOM 1401  H HD2  . PRO A 1 89  ? 3.603   8.204   7.771   1.00 0.00 ? 89  PRO A HD2  1  
ATOM 1402  H HD3  . PRO A 1 89  ? 3.388   9.250   6.353   1.00 0.00 ? 89  PRO A HD3  1  
ATOM 1403  N N    . THR A 1 90  ? 0.640   4.673   5.531   1.00 0.00 ? 90  THR A N    1  
ATOM 1404  C CA   . THR A 1 90  ? 0.229   3.356   5.999   1.00 0.00 ? 90  THR A CA   1  
ATOM 1405  C C    . THR A 1 90  ? 0.595   2.275   4.988   1.00 0.00 ? 90  THR A C    1  
ATOM 1406  O O    . THR A 1 90  ? 0.507   2.486   3.778   1.00 0.00 ? 90  THR A O    1  
ATOM 1407  C CB   . THR A 1 90  ? -1.288  3.302   6.264   1.00 0.00 ? 90  THR A CB   1  
ATOM 1408  O OG1  . THR A 1 90  ? -1.592  3.954   7.502   1.00 0.00 ? 90  THR A OG1  1  
ATOM 1409  C CG2  . THR A 1 90  ? -1.778  1.862   6.309   1.00 0.00 ? 90  THR A CG2  1  
ATOM 1410  H H    . THR A 1 90  ? 0.647   4.860   4.569   1.00 0.00 ? 90  THR A H    1  
ATOM 1411  H HA   . THR A 1 90  ? 0.743   3.156   6.928   1.00 0.00 ? 90  THR A HA   1  
ATOM 1412  H HB   . THR A 1 90  ? -1.797  3.815   5.461   1.00 0.00 ? 90  THR A HB   1  
ATOM 1413  H HG1  . THR A 1 90  ? -1.526  3.321   8.222   1.00 0.00 ? 90  THR A HG1  1  
ATOM 1414  H HG21 . THR A 1 90  ? -2.826  1.847   6.569   1.00 0.00 ? 90  THR A HG21 1  
ATOM 1415  H HG22 . THR A 1 90  ? -1.215  1.313   7.049   1.00 0.00 ? 90  THR A HG22 1  
ATOM 1416  H HG23 . THR A 1 90  ? -1.642  1.406   5.340   1.00 0.00 ? 90  THR A HG23 1  
ATOM 1417  N N    . LEU A 1 91  ? 1.006   1.116   5.492   1.00 0.00 ? 91  LEU A N    1  
ATOM 1418  C CA   . LEU A 1 91  ? 1.386   0.000   4.632   1.00 0.00 ? 91  LEU A CA   1  
ATOM 1419  C C    . LEU A 1 91  ? 0.606   -1.259  4.998   1.00 0.00 ? 91  LEU A C    1  
ATOM 1420  O O    . LEU A 1 91  ? 0.413   -1.561  6.176   1.00 0.00 ? 91  LEU A O    1  
ATOM 1421  C CB   . LEU A 1 91  ? 2.888   -0.266  4.743   1.00 0.00 ? 91  LEU A CB   1  
ATOM 1422  C CG   . LEU A 1 91  ? 3.796   0.665   3.939   1.00 0.00 ? 91  LEU A CG   1  
ATOM 1423  C CD1  . LEU A 1 91  ? 5.256   0.411   4.279   1.00 0.00 ? 91  LEU A CD1  1  
ATOM 1424  C CD2  . LEU A 1 91  ? 3.555   0.488   2.447   1.00 0.00 ? 91  LEU A CD2  1  
ATOM 1425  H H    . LEU A 1 91  ? 1.056   1.007   6.464   1.00 0.00 ? 91  LEU A H    1  
ATOM 1426  H HA   . LEU A 1 91  ? 1.151   0.272   3.614   1.00 0.00 ? 91  LEU A HA   1  
ATOM 1427  H HB2  . LEU A 1 91  ? 3.163   -0.180  5.783   1.00 0.00 ? 91  LEU A HB2  1  
ATOM 1428  H HB3  . LEU A 1 91  ? 3.069   -1.278  4.407   1.00 0.00 ? 91  LEU A HB3  1  
ATOM 1429  H HG   . LEU A 1 91  ? 3.567   1.690   4.196   1.00 0.00 ? 91  LEU A HG   1  
ATOM 1430  H HD11 . LEU A 1 91  ? 5.405   -0.642  4.462   1.00 0.00 ? 91  LEU A HD11 1  
ATOM 1431  H HD12 . LEU A 1 91  ? 5.523   0.972   5.163   1.00 0.00 ? 91  LEU A HD12 1  
ATOM 1432  H HD13 . LEU A 1 91  ? 5.878   0.725   3.453   1.00 0.00 ? 91  LEU A HD13 1  
ATOM 1433  H HD21 . LEU A 1 91  ? 2.954   1.307   2.080   1.00 0.00 ? 91  LEU A HD21 1  
ATOM 1434  H HD22 . LEU A 1 91  ? 3.036   -0.444  2.275   1.00 0.00 ? 91  LEU A HD22 1  
ATOM 1435  H HD23 . LEU A 1 91  ? 4.502   0.475   1.929   1.00 0.00 ? 91  LEU A HD23 1  
ATOM 1436  N N    . ILE A 1 92  ? 0.162   -1.990  3.981   1.00 0.00 ? 92  ILE A N    1  
ATOM 1437  C CA   . ILE A 1 92  ? -0.593  -3.218  4.196   1.00 0.00 ? 92  ILE A CA   1  
ATOM 1438  C C    . ILE A 1 92  ? -0.106  -4.331  3.275   1.00 0.00 ? 92  ILE A C    1  
ATOM 1439  O O    . ILE A 1 92  ? 0.067   -4.126  2.073   1.00 0.00 ? 92  ILE A O    1  
ATOM 1440  C CB   . ILE A 1 92  ? -2.100  -2.999  3.967   1.00 0.00 ? 92  ILE A CB   1  
ATOM 1441  C CG1  . ILE A 1 92  ? -2.621  -1.886  4.878   1.00 0.00 ? 92  ILE A CG1  1  
ATOM 1442  C CG2  . ILE A 1 92  ? -2.866  -4.291  4.209   1.00 0.00 ? 92  ILE A CG2  1  
ATOM 1443  C CD1  . ILE A 1 92  ? -4.101  -1.615  4.717   1.00 0.00 ? 92  ILE A CD1  1  
ATOM 1444  H H    . ILE A 1 92  ? 0.348   -1.697  3.065   1.00 0.00 ? 92  ILE A H    1  
ATOM 1445  H HA   . ILE A 1 92  ? -0.446  -3.524  5.222   1.00 0.00 ? 92  ILE A HA   1  
ATOM 1446  H HB   . ILE A 1 92  ? -2.247  -2.710  2.937   1.00 0.00 ? 92  ILE A HB   1  
ATOM 1447  H HG12 . ILE A 1 92  ? -2.445  -2.159  5.907   1.00 0.00 ? 92  ILE A HG12 1  
ATOM 1448  H HG13 . ILE A 1 92  ? -2.090  -0.971  4.657   1.00 0.00 ? 92  ILE A HG13 1  
ATOM 1449  H HG21 . ILE A 1 92  ? -2.843  -4.531  5.262   1.00 0.00 ? 92  ILE A HG21 1  
ATOM 1450  H HG22 . ILE A 1 92  ? -3.890  -4.167  3.891   1.00 0.00 ? 92  ILE A HG22 1  
ATOM 1451  H HG23 . ILE A 1 92  ? -2.409  -5.092  3.647   1.00 0.00 ? 92  ILE A HG23 1  
ATOM 1452  H HD11 . ILE A 1 92  ? -4.373  -1.711  3.676   1.00 0.00 ? 92  ILE A HD11 1  
ATOM 1453  H HD12 . ILE A 1 92  ? -4.663  -2.325  5.304   1.00 0.00 ? 92  ILE A HD12 1  
ATOM 1454  H HD13 . ILE A 1 92  ? -4.322  -0.613  5.055   1.00 0.00 ? 92  ILE A HD13 1  
ATOM 1455  N N    . LEU A 1 93  ? 0.111   -5.511  3.846   1.00 0.00 ? 93  LEU A N    1  
ATOM 1456  C CA   . LEU A 1 93  ? 0.576   -6.659  3.076   1.00 0.00 ? 93  LEU A CA   1  
ATOM 1457  C C    . LEU A 1 93  ? -0.575  -7.614  2.774   1.00 0.00 ? 93  LEU A C    1  
ATOM 1458  O O    . LEU A 1 93  ? -1.254  -8.092  3.683   1.00 0.00 ? 93  LEU A O    1  
ATOM 1459  C CB   . LEU A 1 93  ? 1.679   -7.396  3.838   1.00 0.00 ? 93  LEU A CB   1  
ATOM 1460  C CG   . LEU A 1 93  ? 2.360   -8.543  3.090   1.00 0.00 ? 93  LEU A CG   1  
ATOM 1461  C CD1  . LEU A 1 93  ? 3.392   -8.003  2.112   1.00 0.00 ? 93  LEU A CD1  1  
ATOM 1462  C CD2  . LEU A 1 93  ? 3.007   -9.510  4.071   1.00 0.00 ? 93  LEU A CD2  1  
ATOM 1463  H H    . LEU A 1 93  ? -0.045  -5.613  4.808   1.00 0.00 ? 93  LEU A H    1  
ATOM 1464  H HA   . LEU A 1 93  ? 0.977   -6.292  2.143   1.00 0.00 ? 93  LEU A HA   1  
ATOM 1465  H HB2  . LEU A 1 93  ? 2.438   -6.675  4.100   1.00 0.00 ? 93  LEU A HB2  1  
ATOM 1466  H HB3  . LEU A 1 93  ? 1.242   -7.801  4.740   1.00 0.00 ? 93  LEU A HB3  1  
ATOM 1467  H HG   . LEU A 1 93  ? 1.617   -9.087  2.524   1.00 0.00 ? 93  LEU A HG   1  
ATOM 1468  H HD11 . LEU A 1 93  ? 2.922   -7.293  1.449   1.00 0.00 ? 93  LEU A HD11 1  
ATOM 1469  H HD12 . LEU A 1 93  ? 3.801   -8.819  1.534   1.00 0.00 ? 93  LEU A HD12 1  
ATOM 1470  H HD13 . LEU A 1 93  ? 4.186   -7.517  2.659   1.00 0.00 ? 93  LEU A HD13 1  
ATOM 1471  H HD21 . LEU A 1 93  ? 2.238   -10.046 4.607   1.00 0.00 ? 93  LEU A HD21 1  
ATOM 1472  H HD22 . LEU A 1 93  ? 3.615   -8.957  4.773   1.00 0.00 ? 93  LEU A HD22 1  
ATOM 1473  H HD23 . LEU A 1 93  ? 3.626   -10.210 3.531   1.00 0.00 ? 93  LEU A HD23 1  
ATOM 1474  N N    . PHE A 1 94  ? -0.787  -7.889  1.491   1.00 0.00 ? 94  PHE A N    1  
ATOM 1475  C CA   . PHE A 1 94  ? -1.854  -8.789  1.068   1.00 0.00 ? 94  PHE A CA   1  
ATOM 1476  C C    . PHE A 1 94  ? -1.281  -10.070 0.470   1.00 0.00 ? 94  PHE A C    1  
ATOM 1477  O O    . PHE A 1 94  ? -0.554  -10.032 -0.522  1.00 0.00 ? 94  PHE A O    1  
ATOM 1478  C CB   . PHE A 1 94  ? -2.759  -8.096  0.047   1.00 0.00 ? 94  PHE A CB   1  
ATOM 1479  C CG   . PHE A 1 94  ? -3.411  -6.849  0.573   1.00 0.00 ? 94  PHE A CG   1  
ATOM 1480  C CD1  . PHE A 1 94  ? -4.517  -6.927  1.404   1.00 0.00 ? 94  PHE A CD1  1  
ATOM 1481  C CD2  . PHE A 1 94  ? -2.919  -5.599  0.235   1.00 0.00 ? 94  PHE A CD2  1  
ATOM 1482  C CE1  . PHE A 1 94  ? -5.119  -5.782  1.890   1.00 0.00 ? 94  PHE A CE1  1  
ATOM 1483  C CE2  . PHE A 1 94  ? -3.517  -4.450  0.717   1.00 0.00 ? 94  PHE A CE2  1  
ATOM 1484  C CZ   . PHE A 1 94  ? -4.619  -4.542  1.545   1.00 0.00 ? 94  PHE A CZ   1  
ATOM 1485  H H    . PHE A 1 94  ? -0.212  -7.477  0.812   1.00 0.00 ? 94  PHE A H    1  
ATOM 1486  H HA   . PHE A 1 94  ? -2.437  -9.042  1.940   1.00 0.00 ? 94  PHE A HA   1  
ATOM 1487  H HB2  . PHE A 1 94  ? -2.172  -7.824  -0.817  1.00 0.00 ? 94  PHE A HB2  1  
ATOM 1488  H HB3  . PHE A 1 94  ? -3.539  -8.779  -0.253  1.00 0.00 ? 94  PHE A HB3  1  
ATOM 1489  H HD1  . PHE A 1 94  ? -4.909  -7.898  1.674   1.00 0.00 ? 94  PHE A HD1  1  
ATOM 1490  H HD2  . PHE A 1 94  ? -2.058  -5.526  -0.413  1.00 0.00 ? 94  PHE A HD2  1  
ATOM 1491  H HE1  . PHE A 1 94  ? -5.980  -5.857  2.537   1.00 0.00 ? 94  PHE A HE1  1  
ATOM 1492  H HE2  . PHE A 1 94  ? -3.124  -3.482  0.446   1.00 0.00 ? 94  PHE A HE2  1  
ATOM 1493  H HZ   . PHE A 1 94  ? -5.087  -3.646  1.924   1.00 0.00 ? 94  PHE A HZ   1  
ATOM 1494  N N    . GLN A 1 95  ? -1.614  -11.202 1.082   1.00 0.00 ? 95  GLN A N    1  
ATOM 1495  C CA   . GLN A 1 95  ? -1.131  -12.495 0.611   1.00 0.00 ? 95  GLN A CA   1  
ATOM 1496  C C    . GLN A 1 95  ? -2.295  -13.424 0.283   1.00 0.00 ? 95  GLN A C    1  
ATOM 1497  O O    . GLN A 1 95  ? -2.997  -13.895 1.177   1.00 0.00 ? 95  GLN A O    1  
ATOM 1498  C CB   . GLN A 1 95  ? -0.228  -13.140 1.663   1.00 0.00 ? 95  GLN A CB   1  
ATOM 1499  C CG   . GLN A 1 95  ? 1.222   -12.691 1.580   1.00 0.00 ? 95  GLN A CG   1  
ATOM 1500  C CD   . GLN A 1 95  ? 2.168   -13.636 2.293   1.00 0.00 ? 95  GLN A CD   1  
ATOM 1501  O OE1  . GLN A 1 95  ? 1.925   -14.841 2.362   1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1502  N NE2  . GLN A 1 95  ? 3.255   -13.094 2.829   1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1503  H H    . GLN A 1 95  ? -2.196  -11.167 1.868   1.00 0.00 ? 95  GLN A H    1  
ATOM 1504  H HA   . GLN A 1 95  ? -0.557  -12.327 -0.288  1.00 0.00 ? 95  GLN A HA   1  
ATOM 1505  H HB2  . GLN A 1 95  ? -0.604  -12.892 2.644   1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1506  H HB3  . GLN A 1 95  ? -0.257  -14.213 1.537   1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1507  H HG2  . GLN A 1 95  ? 1.509   -12.636 0.540   1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1508  H HG3  . GLN A 1 95  ? 1.308   -11.712 2.028   1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1509  H HE21 . GLN A 1 95  ? 3.383   -12.126 2.736   1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1510  H HE22 . GLN A 1 95  ? 3.883   -13.681 3.296   1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1511  N N    . GLY A 1 96  ? -2.494  -13.684 -1.006  1.00 0.00 ? 96  GLY A N    1  
ATOM 1512  C CA   . GLY A 1 96  ? -3.575  -14.555 -1.428  1.00 0.00 ? 96  GLY A CA   1  
ATOM 1513  C C    . GLY A 1 96  ? -4.939  -13.921 -1.240  1.00 0.00 ? 96  GLY A C    1  
ATOM 1514  O O    . GLY A 1 96  ? -5.934  -14.618 -1.045  1.00 0.00 ? 96  GLY A O    1  
ATOM 1515  H H    . GLY A 1 96  ? -1.903  -13.280 -1.675  1.00 0.00 ? 96  GLY A H    1  
ATOM 1516  H HA2  . GLY A 1 96  ? -3.442  -14.795 -2.473  1.00 0.00 ? 96  GLY A HA2  1  
ATOM 1517  H HA3  . GLY A 1 96  ? -3.533  -15.467 -0.852  1.00 0.00 ? 96  GLY A HA3  1  
ATOM 1518  N N    . GLY A 1 97  ? -4.986  -12.593 -1.298  1.00 0.00 ? 97  GLY A N    1  
ATOM 1519  C CA   . GLY A 1 97  ? -6.242  -11.887 -1.129  1.00 0.00 ? 97  GLY A CA   1  
ATOM 1520  C C    . GLY A 1 97  ? -6.654  -11.777 0.326   1.00 0.00 ? 97  GLY A C    1  
ATOM 1521  O O    . GLY A 1 97  ? -7.843  -11.705 0.639   1.00 0.00 ? 97  GLY A O    1  
ATOM 1522  H H    . GLY A 1 97  ? -4.160  -12.089 -1.457  1.00 0.00 ? 97  GLY A H    1  
ATOM 1523  H HA2  . GLY A 1 97  ? -6.142  -10.894 -1.540  1.00 0.00 ? 97  GLY A HA2  1  
ATOM 1524  H HA3  . GLY A 1 97  ? -7.014  -12.414 -1.671  1.00 0.00 ? 97  GLY A HA3  1  
ATOM 1525  N N    . LYS A 1 98  ? -5.670  -11.767 1.219   1.00 0.00 ? 98  LYS A N    1  
ATOM 1526  C CA   . LYS A 1 98  ? -5.935  -11.666 2.649   1.00 0.00 ? 98  LYS A CA   1  
ATOM 1527  C C    . LYS A 1 98  ? -4.944  -10.721 3.320   1.00 0.00 ? 98  LYS A C    1  
ATOM 1528  O O    . LYS A 1 98  ? -3.737  -10.814 3.100   1.00 0.00 ? 98  LYS A O    1  
ATOM 1529  C CB   . LYS A 1 98  ? -5.860  -13.049 3.301   1.00 0.00 ? 98  LYS A CB   1  
ATOM 1530  C CG   . LYS A 1 98  ? -6.868  -14.039 2.746   1.00 0.00 ? 98  LYS A CG   1  
ATOM 1531  C CD   . LYS A 1 98  ? -6.385  -15.472 2.898   1.00 0.00 ? 98  LYS A CD   1  
ATOM 1532  C CE   . LYS A 1 98  ? -5.547  -15.907 1.706   1.00 0.00 ? 98  LYS A CE   1  
ATOM 1533  N NZ   . LYS A 1 98  ? -4.557  -16.956 2.077   1.00 0.00 ? 98  LYS A NZ   1  
ATOM 1534  H H    . LYS A 1 98  ? -4.742  -11.828 0.908   1.00 0.00 ? 98  LYS A H    1  
ATOM 1535  H HA   . LYS A 1 98  ? -6.932  -11.272 2.775   1.00 0.00 ? 98  LYS A HA   1  
ATOM 1536  H HB2  . LYS A 1 98  ? -4.869  -13.452 3.149   1.00 0.00 ? 98  LYS A HB2  1  
ATOM 1537  H HB3  . LYS A 1 98  ? -6.037  -12.943 4.362   1.00 0.00 ? 98  LYS A HB3  1  
ATOM 1538  H HG2  . LYS A 1 98  ? -7.801  -13.927 3.279   1.00 0.00 ? 98  LYS A HG2  1  
ATOM 1539  H HG3  . LYS A 1 98  ? -7.023  -13.831 1.697   1.00 0.00 ? 98  LYS A HG3  1  
ATOM 1540  H HD2  . LYS A 1 98  ? -5.784  -15.547 3.792   1.00 0.00 ? 98  LYS A HD2  1  
ATOM 1541  H HD3  . LYS A 1 98  ? -7.242  -16.125 2.982   1.00 0.00 ? 98  LYS A HD3  1  
ATOM 1542  H HE2  . LYS A 1 98  ? -6.204  -16.298 0.944   1.00 0.00 ? 98  LYS A HE2  1  
ATOM 1543  H HE3  . LYS A 1 98  ? -5.020  -15.047 1.320   1.00 0.00 ? 98  LYS A HE3  1  
ATOM 1544  H HZ1  . LYS A 1 98  ? -4.617  -17.754 1.412   1.00 0.00 ? 98  LYS A HZ1  1  
ATOM 1545  H HZ2  . LYS A 1 98  ? -4.750  -17.305 3.038   1.00 0.00 ? 98  LYS A HZ2  1  
ATOM 1546  H HZ3  . LYS A 1 98  ? -3.594  -16.565 2.048   1.00 0.00 ? 98  LYS A HZ3  1  
ATOM 1547  N N    . GLU A 1 99  ? -5.463  -9.813  4.142   1.00 0.00 ? 99  GLU A N    1  
ATOM 1548  C CA   . GLU A 1 99  ? -4.622  -8.852  4.845   1.00 0.00 ? 99  GLU A CA   1  
ATOM 1549  C C    . GLU A 1 99  ? -3.686  -9.559  5.821   1.00 0.00 ? 99  GLU A C    1  
ATOM 1550  O O    . GLU A 1 99  ? -4.028  -9.768  6.985   1.00 0.00 ? 99  GLU A O    1  
ATOM 1551  C CB   . GLU A 1 99  ? -5.487  -7.838  5.596   1.00 0.00 ? 99  GLU A CB   1  
ATOM 1552  C CG   . GLU A 1 99  ? -4.690  -6.717  6.242   1.00 0.00 ? 99  GLU A CG   1  
ATOM 1553  C CD   . GLU A 1 99  ? -5.567  -5.571  6.709   1.00 0.00 ? 99  GLU A CD   1  
ATOM 1554  O OE1  . GLU A 1 99  ? -6.360  -5.778  7.651   1.00 0.00 ? 99  GLU A OE1  1  
ATOM 1555  O OE2  . GLU A 1 99  ? -5.461  -4.468  6.133   1.00 0.00 ? 99  GLU A OE2  1  
ATOM 1556  H H    . GLU A 1 99  ? -6.433  -9.789  4.277   1.00 0.00 ? 99  GLU A H    1  
ATOM 1557  H HA   . GLU A 1 99  ? -4.029  -8.330  4.110   1.00 0.00 ? 99  GLU A HA   1  
ATOM 1558  H HB2  . GLU A 1 99  ? -6.191  -7.399  4.903   1.00 0.00 ? 99  GLU A HB2  1  
ATOM 1559  H HB3  . GLU A 1 99  ? -6.034  -8.354  6.371   1.00 0.00 ? 99  GLU A HB3  1  
ATOM 1560  H HG2  . GLU A 1 99  ? -4.159  -7.114  7.094   1.00 0.00 ? 99  GLU A HG2  1  
ATOM 1561  H HG3  . GLU A 1 99  ? -3.980  -6.337  5.522   1.00 0.00 ? 99  GLU A HG3  1  
ATOM 1562  N N    . ALA A 1 100 ? -2.504  -9.926  5.337   1.00 0.00 ? 100 ALA A N    1  
ATOM 1563  C CA   . ALA A 1 100 ? -1.518  -10.609 6.165   1.00 0.00 ? 100 ALA A CA   1  
ATOM 1564  C C    . ALA A 1 100 ? -1.174  -9.784  7.401   1.00 0.00 ? 100 ALA A C    1  
ATOM 1565  O O    . ALA A 1 100 ? -1.217  -10.285 8.524   1.00 0.00 ? 100 ALA A O    1  
ATOM 1566  C CB   . ALA A 1 100 ? -0.262  -10.902 5.358   1.00 0.00 ? 100 ALA A CB   1  
ATOM 1567  H H    . ALA A 1 100 ? -2.290  -9.732  4.401   1.00 0.00 ? 100 ALA A H    1  
ATOM 1568  H HA   . ALA A 1 100 ? -1.942  -11.552 6.481   1.00 0.00 ? 100 ALA A HA   1  
ATOM 1569  H HB1  . ALA A 1 100 ? 0.237   -11.766 5.771   1.00 0.00 ? 100 ALA A HB1  1  
ATOM 1570  H HB2  . ALA A 1 100 ? -0.533  -11.099 4.331   1.00 0.00 ? 100 ALA A HB2  1  
ATOM 1571  H HB3  . ALA A 1 100 ? 0.399   -10.050 5.399   1.00 0.00 ? 100 ALA A HB3  1  
ATOM 1572  N N    . MET A 1 101 ? -0.832  -8.518  7.186   1.00 0.00 ? 101 MET A N    1  
ATOM 1573  C CA   . MET A 1 101 ? -0.481  -7.625  8.283   1.00 0.00 ? 101 MET A CA   1  
ATOM 1574  C C    . MET A 1 101 ? -0.470  -6.172  7.819   1.00 0.00 ? 101 MET A C    1  
ATOM 1575  O O    . MET A 1 101 ? -0.477  -5.893  6.620   1.00 0.00 ? 101 MET A O    1  
ATOM 1576  C CB   . MET A 1 101 ? 0.887   -7.999  8.856   1.00 0.00 ? 101 MET A CB   1  
ATOM 1577  C CG   . MET A 1 101 ? 2.036   -7.771  7.887   1.00 0.00 ? 101 MET A CG   1  
ATOM 1578  S SD   . MET A 1 101 ? 3.647   -8.093  8.630   1.00 0.00 ? 101 MET A SD   1  
ATOM 1579  C CE   . MET A 1 101 ? 4.126   -6.441  9.128   1.00 0.00 ? 101 MET A CE   1  
ATOM 1580  H H    . MET A 1 101 ? -0.816  -8.176  6.267   1.00 0.00 ? 101 MET A H    1  
ATOM 1581  H HA   . MET A 1 101 ? -1.227  -7.738  9.054   1.00 0.00 ? 101 MET A HA   1  
ATOM 1582  H HB2  . MET A 1 101 ? 1.068   -7.407  9.741   1.00 0.00 ? 101 MET A HB2  1  
ATOM 1583  H HB3  . MET A 1 101 ? 0.877   -9.044  9.128   1.00 0.00 ? 101 MET A HB3  1  
ATOM 1584  H HG2  . MET A 1 101 ? 1.909   -8.427  7.038   1.00 0.00 ? 101 MET A HG2  1  
ATOM 1585  H HG3  . MET A 1 101 ? 2.007   -6.744  7.553   1.00 0.00 ? 101 MET A HG3  1  
ATOM 1586  H HE1  . MET A 1 101 ? 3.313   -5.757  8.939   1.00 0.00 ? 101 MET A HE1  1  
ATOM 1587  H HE2  . MET A 1 101 ? 4.361   -6.438  10.182  1.00 0.00 ? 101 MET A HE2  1  
ATOM 1588  H HE3  . MET A 1 101 ? 4.995   -6.133  8.564   1.00 0.00 ? 101 MET A HE3  1  
ATOM 1589  N N    . ARG A 1 102 ? -0.454  -5.249  8.776   1.00 0.00 ? 102 ARG A N    1  
ATOM 1590  C CA   . ARG A 1 102 ? -0.444  -3.825  8.464   1.00 0.00 ? 102 ARG A CA   1  
ATOM 1591  C C    . ARG A 1 102 ? 0.261   -3.033  9.561   1.00 0.00 ? 102 ARG A C    1  
ATOM 1592  O O    . ARG A 1 102 ? 0.376   -3.495  10.697  1.00 0.00 ? 102 ARG A O    1  
ATOM 1593  C CB   . ARG A 1 102 ? -1.873  -3.310  8.287   1.00 0.00 ? 102 ARG A CB   1  
ATOM 1594  C CG   . ARG A 1 102 ? -2.637  -3.173  9.594   1.00 0.00 ? 102 ARG A CG   1  
ATOM 1595  C CD   . ARG A 1 102 ? -3.721  -2.110  9.497   1.00 0.00 ? 102 ARG A CD   1  
ATOM 1596  N NE   . ARG A 1 102 ? -3.161  -0.773  9.317   1.00 0.00 ? 102 ARG A NE   1  
ATOM 1597  C CZ   . ARG A 1 102 ? -3.898  0.306   9.078   1.00 0.00 ? 102 ARG A CZ   1  
ATOM 1598  N NH1  . ARG A 1 102 ? -5.217  0.206   8.990   1.00 0.00 ? 102 ARG A NH1  1  
ATOM 1599  N NH2  . ARG A 1 102 ? -3.315  1.488   8.926   1.00 0.00 ? 102 ARG A NH2  1  
ATOM 1600  H H    . ARG A 1 102 ? -0.449  -5.533  9.714   1.00 0.00 ? 102 ARG A H    1  
ATOM 1601  H HA   . ARG A 1 102 ? 0.095   -3.692  7.538   1.00 0.00 ? 102 ARG A HA   1  
ATOM 1602  H HB2  . ARG A 1 102 ? -1.838  -2.340  7.813   1.00 0.00 ? 102 ARG A HB2  1  
ATOM 1603  H HB3  . ARG A 1 102 ? -2.413  -3.994  7.650   1.00 0.00 ? 102 ARG A HB3  1  
ATOM 1604  H HG2  . ARG A 1 102 ? -3.099  -4.120  9.832   1.00 0.00 ? 102 ARG A HG2  1  
ATOM 1605  H HG3  . ARG A 1 102 ? -1.946  -2.900  10.377  1.00 0.00 ? 102 ARG A HG3  1  
ATOM 1606  H HD2  . ARG A 1 102 ? -4.357  -2.339  8.656   1.00 0.00 ? 102 ARG A HD2  1  
ATOM 1607  H HD3  . ARG A 1 102 ? -4.305  -2.127  10.405  1.00 0.00 ? 102 ARG A HD3  1  
ATOM 1608  H HE   . ARG A 1 102 ? -2.188  -0.676  9.378   1.00 0.00 ? 102 ARG A HE   1  
ATOM 1609  H HH11 . ARG A 1 102 ? -5.659  -0.684  9.106   1.00 0.00 ? 102 ARG A HH11 1  
ATOM 1610  H HH12 . ARG A 1 102 ? -5.770  1.020   8.811   1.00 0.00 ? 102 ARG A HH12 1  
ATOM 1611  H HH21 . ARG A 1 102 ? -2.321  1.568   8.992   1.00 0.00 ? 102 ARG A HH21 1  
ATOM 1612  H HH22 . ARG A 1 102 ? -3.870  2.300   8.746   1.00 0.00 ? 102 ARG A HH22 1  
ATOM 1613  N N    . ARG A 1 103 ? 0.732   -1.840  9.214   1.00 0.00 ? 103 ARG A N    1  
ATOM 1614  C CA   . ARG A 1 103 ? 1.428   -0.985  10.168  1.00 0.00 ? 103 ARG A CA   1  
ATOM 1615  C C    . ARG A 1 103 ? 1.165   0.488   9.870   1.00 0.00 ? 103 ARG A C    1  
ATOM 1616  O O    . ARG A 1 103 ? 1.045   0.901   8.717   1.00 0.00 ? 103 ARG A O    1  
ATOM 1617  C CB   . ARG A 1 103 ? 2.931   -1.264  10.133  1.00 0.00 ? 103 ARG A CB   1  
ATOM 1618  C CG   . ARG A 1 103 ? 3.276   -2.744  10.081  1.00 0.00 ? 103 ARG A CG   1  
ATOM 1619  C CD   . ARG A 1 103 ? 3.163   -3.390  11.453  1.00 0.00 ? 103 ARG A CD   1  
ATOM 1620  N NE   . ARG A 1 103 ? 4.314   -3.085  12.298  1.00 0.00 ? 103 ARG A NE   1  
ATOM 1621  C CZ   . ARG A 1 103 ? 4.494   -3.599  13.510  1.00 0.00 ? 103 ARG A CZ   1  
ATOM 1622  N NH1  . ARG A 1 103 ? 3.602   -4.440  14.015  1.00 0.00 ? 103 ARG A NH1  1  
ATOM 1623  N NH2  . ARG A 1 103 ? 5.567   -3.272  14.218  1.00 0.00 ? 103 ARG A NH2  1  
ATOM 1624  H H    . ARG A 1 103 ? 0.610   -1.527  8.293   1.00 0.00 ? 103 ARG A H    1  
ATOM 1625  H HA   . ARG A 1 103 ? 1.051   -1.214  11.154  1.00 0.00 ? 103 ARG A HA   1  
ATOM 1626  H HB2  . ARG A 1 103 ? 3.354   -0.788  9.261   1.00 0.00 ? 103 ARG A HB2  1  
ATOM 1627  H HB3  . ARG A 1 103 ? 3.384   -0.842  11.018  1.00 0.00 ? 103 ARG A HB3  1  
ATOM 1628  H HG2  . ARG A 1 103 ? 2.594   -3.239  9.405   1.00 0.00 ? 103 ARG A HG2  1  
ATOM 1629  H HG3  . ARG A 1 103 ? 4.287   -2.856  9.722   1.00 0.00 ? 103 ARG A HG3  1  
ATOM 1630  H HD2  . ARG A 1 103 ? 2.268   -3.027  11.935  1.00 0.00 ? 103 ARG A HD2  1  
ATOM 1631  H HD3  . ARG A 1 103 ? 3.095   -4.461  11.327  1.00 0.00 ? 103 ARG A HD3  1  
ATOM 1632  H HE   . ARG A 1 103 ? 4.986   -2.465  11.944  1.00 0.00 ? 103 ARG A HE   1  
ATOM 1633  H HH11 . ARG A 1 103 ? 2.793   -4.688  13.484  1.00 0.00 ? 103 ARG A HH11 1  
ATOM 1634  H HH12 . ARG A 1 103 ? 3.740   -4.826  14.928  1.00 0.00 ? 103 ARG A HH12 1  
ATOM 1635  H HH21 . ARG A 1 103 ? 6.242   -2.639  13.840  1.00 0.00 ? 103 ARG A HH21 1  
ATOM 1636  H HH22 . ARG A 1 103 ? 5.701   -3.659  15.130  1.00 0.00 ? 103 ARG A HH22 1  
ATOM 1637  N N    . PRO A 1 104 ? 1.074   1.300   10.934  1.00 0.00 ? 104 PRO A N    1  
ATOM 1638  C CA   . PRO A 1 104 ? 1.215   0.819   12.311  1.00 0.00 ? 104 PRO A CA   1  
ATOM 1639  C C    . PRO A 1 104 ? 0.037   -0.045  12.747  1.00 0.00 ? 104 PRO A C    1  
ATOM 1640  O O    . PRO A 1 104 ? -1.054  0.050   12.186  1.00 0.00 ? 104 PRO A O    1  
ATOM 1641  C CB   . PRO A 1 104 ? 1.266   2.109   13.134  1.00 0.00 ? 104 PRO A CB   1  
ATOM 1642  C CG   . PRO A 1 104 ? 0.545   3.115   12.305  1.00 0.00 ? 104 PRO A CG   1  
ATOM 1643  C CD   . PRO A 1 104 ? 0.826   2.750   10.873  1.00 0.00 ? 104 PRO A CD   1  
ATOM 1644  H HA   . PRO A 1 104 ? 2.135   0.268   12.447  1.00 0.00 ? 104 PRO A HA   1  
ATOM 1645  H HB2  . PRO A 1 104 ? 0.773   1.953   14.083  1.00 0.00 ? 104 PRO A HB2  1  
ATOM 1646  H HB3  . PRO A 1 104 ? 2.293   2.396   13.298  1.00 0.00 ? 104 PRO A HB3  1  
ATOM 1647  H HG2  . PRO A 1 104 ? -0.515  3.064   12.504  1.00 0.00 ? 104 PRO A HG2  1  
ATOM 1648  H HG3  . PRO A 1 104 ? 0.921   4.105   12.519  1.00 0.00 ? 104 PRO A HG3  1  
ATOM 1649  H HD2  . PRO A 1 104 ? -0.030  2.969   10.253  1.00 0.00 ? 104 PRO A HD2  1  
ATOM 1650  H HD3  . PRO A 1 104 ? 1.699   3.276   10.514  1.00 0.00 ? 104 PRO A HD3  1  
ATOM 1651  N N    . GLN A 1 105 ? 0.266   -0.887  13.750  1.00 0.00 ? 105 GLN A N    1  
ATOM 1652  C CA   . GLN A 1 105 ? -0.778  -1.768  14.260  1.00 0.00 ? 105 GLN A CA   1  
ATOM 1653  C C    . GLN A 1 105 ? -1.803  -0.983  15.073  1.00 0.00 ? 105 GLN A C    1  
ATOM 1654  O O    . GLN A 1 105 ? -1.466  0.001   15.731  1.00 0.00 ? 105 GLN A O    1  
ATOM 1655  C CB   . GLN A 1 105 ? -0.166  -2.874  15.121  1.00 0.00 ? 105 GLN A CB   1  
ATOM 1656  C CG   . GLN A 1 105 ? 0.303   -4.078  14.320  1.00 0.00 ? 105 GLN A CG   1  
ATOM 1657  C CD   . GLN A 1 105 ? 0.742   -5.230  15.202  1.00 0.00 ? 105 GLN A CD   1  
ATOM 1658  O OE1  . GLN A 1 105 ? 1.894   -5.292  15.635  1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1659  N NE2  . GLN A 1 105 ? -0.175  -6.151  15.475  1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1660  H H    . GLN A 1 105 ? 1.157   -0.916  14.156  1.00 0.00 ? 105 GLN A H    1  
ATOM 1661  H HA   . GLN A 1 105 ? -1.276  -2.216  13.414  1.00 0.00 ? 105 GLN A HA   1  
ATOM 1662  H HB2  . GLN A 1 105 ? 0.682   -2.471  15.654  1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1663  H HB3  . GLN A 1 105 ? -0.904  -3.209  15.835  1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1664  H HG2  . GLN A 1 105 ? -0.509  -4.416  13.693  1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1665  H HG3  . GLN A 1 105 ? 1.135   -3.780  13.700  1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1666  H HE21 . GLN A 1 105 ? -1.071  -6.037  15.094  1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1667  H HE22 . GLN A 1 105 ? 0.082   -6.907  16.041  1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1668  N N    . ILE A 1 106 ? -3.055  -1.426  15.022  1.00 0.00 ? 106 ILE A N    1  
ATOM 1669  C CA   . ILE A 1 106 ? -4.128  -0.766  15.755  1.00 0.00 ? 106 ILE A CA   1  
ATOM 1670  C C    . ILE A 1 106 ? -4.360  -1.430  17.108  1.00 0.00 ? 106 ILE A C    1  
ATOM 1671  O O    . ILE A 1 106 ? -4.511  -2.648  17.195  1.00 0.00 ? 106 ILE A O    1  
ATOM 1672  C CB   . ILE A 1 106 ? -5.445  -0.779  14.957  1.00 0.00 ? 106 ILE A CB   1  
ATOM 1673  C CG1  . ILE A 1 106 ? -5.198  -0.332  13.515  1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1674  C CG2  . ILE A 1 106 ? -6.478  0.116   15.625  1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1675  C CD1  . ILE A 1 106 ? -4.569  1.039   13.407  1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1676  H H    . ILE A 1 106 ? -3.261  -2.216  14.481  1.00 0.00 ? 106 ILE A H    1  
ATOM 1677  H HA   . ILE A 1 106 ? -3.838  0.263   15.915  1.00 0.00 ? 106 ILE A HA   1  
ATOM 1678  H HB   . ILE A 1 106 ? -5.828  -1.789  14.953  1.00 0.00 ? 106 ILE A HB   1  
ATOM 1679  H HG12 . ILE A 1 106 ? -4.539  -1.038  13.034  1.00 0.00 ? 106 ILE A HG12 1  
ATOM 1680  H HG13 . ILE A 1 106 ? -6.140  -0.309  12.986  1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1681  H HG21 . ILE A 1 106 ? -6.036  0.595   16.486  1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1682  H HG22 . ILE A 1 106 ? -6.808  0.869   14.925  1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1683  H HG23 . ILE A 1 106 ? -7.323  -0.480  15.938  1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1684  H HD11 . ILE A 1 106 ? -3.629  1.048   13.938  1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1685  H HD12 . ILE A 1 106 ? -4.399  1.277   12.367  1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1686  H HD13 . ILE A 1 106 ? -5.233  1.774   13.839  1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1687  N N    . ASP A 1 107 ? -4.388  -0.620  18.161  1.00 0.00 ? 107 ASP A N    1  
ATOM 1688  C CA   . ASP A 1 107 ? -4.604  -1.128  19.511  1.00 0.00 ? 107 ASP A CA   1  
ATOM 1689  C C    . ASP A 1 107 ? -6.059  -1.539  19.710  1.00 0.00 ? 107 ASP A C    1  
ATOM 1690  O O    . ASP A 1 107 ? -6.929  -1.191  18.911  1.00 0.00 ? 107 ASP A O    1  
ATOM 1691  C CB   . ASP A 1 107 ? -4.213  -0.071  20.545  1.00 0.00 ? 107 ASP A CB   1  
ATOM 1692  C CG   . ASP A 1 107 ? -4.379  -0.565  21.969  1.00 0.00 ? 107 ASP A CG   1  
ATOM 1693  O OD1  . ASP A 1 107 ? -3.528  -1.356  22.425  1.00 0.00 ? 107 ASP A OD1  1  
ATOM 1694  O OD2  . ASP A 1 107 ? -5.362  -0.162  22.626  1.00 0.00 ? 107 ASP A OD2  1  
ATOM 1695  H H    . ASP A 1 107 ? -4.260  0.343   18.027  1.00 0.00 ? 107 ASP A H    1  
ATOM 1696  H HA   . ASP A 1 107 ? -3.977  -1.997  19.642  1.00 0.00 ? 107 ASP A HA   1  
ATOM 1697  H HB2  . ASP A 1 107 ? -3.178  0.202   20.397  1.00 0.00 ? 107 ASP A HB2  1  
ATOM 1698  H HB3  . ASP A 1 107 ? -4.834  0.802   20.411  1.00 0.00 ? 107 ASP A HB3  1  
ATOM 1699  N N    . LYS A 1 108 ? -6.318  -2.282  20.780  1.00 0.00 ? 108 LYS A N    1  
ATOM 1700  C CA   . LYS A 1 108 ? -7.668  -2.741  21.086  1.00 0.00 ? 108 LYS A CA   1  
ATOM 1701  C C    . LYS A 1 108 ? -8.661  -1.585  21.028  1.00 0.00 ? 108 LYS A C    1  
ATOM 1702  O O    . LYS A 1 108 ? -9.654  -1.641  20.302  1.00 0.00 ? 108 LYS A O    1  
ATOM 1703  C CB   . LYS A 1 108 ? -7.706  -3.391  22.471  1.00 0.00 ? 108 LYS A CB   1  
ATOM 1704  C CG   . LYS A 1 108 ? -8.882  -4.332  22.669  1.00 0.00 ? 108 LYS A CG   1  
ATOM 1705  C CD   . LYS A 1 108 ? -8.875  -4.950  24.057  1.00 0.00 ? 108 LYS A CD   1  
ATOM 1706  C CE   . LYS A 1 108 ? -10.223 -5.564  24.401  1.00 0.00 ? 108 LYS A CE   1  
ATOM 1707  N NZ   . LYS A 1 108 ? -11.280 -4.527  24.562  1.00 0.00 ? 108 LYS A NZ   1  
ATOM 1708  H H    . LYS A 1 108 ? -5.582  -2.527  21.381  1.00 0.00 ? 108 LYS A H    1  
ATOM 1709  H HA   . LYS A 1 108 ? -7.944  -3.475  20.345  1.00 0.00 ? 108 LYS A HA   1  
ATOM 1710  H HB2  . LYS A 1 108 ? -6.795  -3.952  22.617  1.00 0.00 ? 108 LYS A HB2  1  
ATOM 1711  H HB3  . LYS A 1 108 ? -7.764  -2.614  23.219  1.00 0.00 ? 108 LYS A HB3  1  
ATOM 1712  H HG2  . LYS A 1 108 ? -9.800  -3.778  22.538  1.00 0.00 ? 108 LYS A HG2  1  
ATOM 1713  H HG3  . LYS A 1 108 ? -8.828  -5.121  21.933  1.00 0.00 ? 108 LYS A HG3  1  
ATOM 1714  H HD2  . LYS A 1 108 ? -8.120  -5.721  24.094  1.00 0.00 ? 108 LYS A HD2  1  
ATOM 1715  H HD3  . LYS A 1 108 ? -8.643  -4.182  24.782  1.00 0.00 ? 108 LYS A HD3  1  
ATOM 1716  H HE2  . LYS A 1 108 ? -10.510 -6.238  23.608  1.00 0.00 ? 108 LYS A HE2  1  
ATOM 1717  H HE3  . LYS A 1 108 ? -10.127 -6.115  25.325  1.00 0.00 ? 108 LYS A HE3  1  
ATOM 1718  H HZ1  . LYS A 1 108 ? -11.048 -3.689  23.992  1.00 0.00 ? 108 LYS A HZ1  1  
ATOM 1719  H HZ2  . LYS A 1 108 ? -11.353 -4.244  25.560  1.00 0.00 ? 108 LYS A HZ2  1  
ATOM 1720  H HZ3  . LYS A 1 108 ? -12.199 -4.902  24.251  1.00 0.00 ? 108 LYS A HZ3  1  
ATOM 1721  N N    . LYS A 1 109 ? -8.388  -0.536  21.797  1.00 0.00 ? 109 LYS A N    1  
ATOM 1722  C CA   . LYS A 1 109 ? -9.256  0.635   21.832  1.00 0.00 ? 109 LYS A CA   1  
ATOM 1723  C C    . LYS A 1 109 ? -9.529  1.151   20.423  1.00 0.00 ? 109 LYS A C    1  
ATOM 1724  O O    . LYS A 1 109 ? -10.670 1.445   20.070  1.00 0.00 ? 109 LYS A O    1  
ATOM 1725  C CB   . LYS A 1 109 ? -8.621  1.741   22.678  1.00 0.00 ? 109 LYS A CB   1  
ATOM 1726  C CG   . LYS A 1 109 ? -8.876  1.589   24.168  1.00 0.00 ? 109 LYS A CG   1  
ATOM 1727  C CD   . LYS A 1 109 ? -7.798  0.753   24.836  1.00 0.00 ? 109 LYS A CD   1  
ATOM 1728  C CE   . LYS A 1 109 ? -7.653  1.104   26.309  1.00 0.00 ? 109 LYS A CE   1  
ATOM 1729  N NZ   . LYS A 1 109 ? -7.027  2.442   26.501  1.00 0.00 ? 109 LYS A NZ   1  
ATOM 1730  H H    . LYS A 1 109 ? -7.581  -0.550  22.355  1.00 0.00 ? 109 LYS A H    1  
ATOM 1731  H HA   . LYS A 1 109 ? -10.192 0.341   22.283  1.00 0.00 ? 109 LYS A HA   1  
ATOM 1732  H HB2  . LYS A 1 109 ? -7.553  1.734   22.515  1.00 0.00 ? 109 LYS A HB2  1  
ATOM 1733  H HB3  . LYS A 1 109 ? -9.019  2.694   22.361  1.00 0.00 ? 109 LYS A HB3  1  
ATOM 1734  H HG2  . LYS A 1 109 ? -8.890  2.569   24.623  1.00 0.00 ? 109 LYS A HG2  1  
ATOM 1735  H HG3  . LYS A 1 109 ? -9.833  1.109   24.313  1.00 0.00 ? 109 LYS A HG3  1  
ATOM 1736  H HD2  . LYS A 1 109 ? -8.060  -0.291  24.751  1.00 0.00 ? 109 LYS A HD2  1  
ATOM 1737  H HD3  . LYS A 1 109 ? -6.855  0.931   24.338  1.00 0.00 ? 109 LYS A HD3  1  
ATOM 1738  H HE2  . LYS A 1 109 ? -8.632  1.105   26.763  1.00 0.00 ? 109 LYS A HE2  1  
ATOM 1739  H HE3  . LYS A 1 109 ? -7.036  0.356   26.785  1.00 0.00 ? 109 LYS A HE3  1  
ATOM 1740  H HZ1  . LYS A 1 109 ? -6.107  2.341   26.975  1.00 0.00 ? 109 LYS A HZ1  1  
ATOM 1741  H HZ2  . LYS A 1 109 ? -7.642  3.043   27.087  1.00 0.00 ? 109 LYS A HZ2  1  
ATOM 1742  H HZ3  . LYS A 1 109 ? -6.883  2.904   25.581  1.00 0.00 ? 109 LYS A HZ3  1  
ATOM 1743  N N    . GLY A 1 110 ? -8.474  1.259   19.622  1.00 0.00 ? 110 GLY A N    1  
ATOM 1744  C CA   . GLY A 1 110 ? -8.622  1.739   18.260  1.00 0.00 ? 110 GLY A CA   1  
ATOM 1745  C C    . GLY A 1 110 ? -7.690  2.893   17.948  1.00 0.00 ? 110 GLY A C    1  
ATOM 1746  O O    . GLY A 1 110 ? -8.104  3.891   17.358  1.00 0.00 ? 110 GLY A O    1  
ATOM 1747  H H    . GLY A 1 110 ? -7.587  1.011   19.958  1.00 0.00 ? 110 GLY A H    1  
ATOM 1748  H HA2  . GLY A 1 110 ? -8.414  0.927   17.580  1.00 0.00 ? 110 GLY A HA2  1  
ATOM 1749  H HA3  . GLY A 1 110 ? -9.641  2.065   18.115  1.00 0.00 ? 110 GLY A HA3  1  
ATOM 1750  N N    . ARG A 1 111 ? -6.429  2.758   18.345  1.00 0.00 ? 111 ARG A N    1  
ATOM 1751  C CA   . ARG A 1 111 ? -5.437  3.799   18.107  1.00 0.00 ? 111 ARG A CA   1  
ATOM 1752  C C    . ARG A 1 111 ? -4.181  3.217   17.466  1.00 0.00 ? 111 ARG A C    1  
ATOM 1753  O O    . ARG A 1 111 ? -3.729  2.134   17.835  1.00 0.00 ? 111 ARG A O    1  
ATOM 1754  C CB   . ARG A 1 111 ? -5.076  4.499   19.418  1.00 0.00 ? 111 ARG A CB   1  
ATOM 1755  C CG   . ARG A 1 111 ? -6.060  5.586   19.820  1.00 0.00 ? 111 ARG A CG   1  
ATOM 1756  C CD   . ARG A 1 111 ? -5.922  6.816   18.937  1.00 0.00 ? 111 ARG A CD   1  
ATOM 1757  N NE   . ARG A 1 111 ? -4.934  7.757   19.459  1.00 0.00 ? 111 ARG A NE   1  
ATOM 1758  C CZ   . ARG A 1 111 ? -4.597  8.885   18.844  1.00 0.00 ? 111 ARG A CZ   1  
ATOM 1759  N NH1  . ARG A 1 111 ? -5.166  9.211   17.691  1.00 0.00 ? 111 ARG A NH1  1  
ATOM 1760  N NH2  . ARG A 1 111 ? -3.689  9.689   19.382  1.00 0.00 ? 111 ARG A NH2  1  
ATOM 1761  H H    . ARG A 1 111 ? -6.160  1.939   18.811  1.00 0.00 ? 111 ARG A H    1  
ATOM 1762  H HA   . ARG A 1 111 ? -5.870  4.522   17.431  1.00 0.00 ? 111 ARG A HA   1  
ATOM 1763  H HB2  . ARG A 1 111 ? -5.043  3.764   20.208  1.00 0.00 ? 111 ARG A HB2  1  
ATOM 1764  H HB3  . ARG A 1 111 ? -4.099  4.948   19.315  1.00 0.00 ? 111 ARG A HB3  1  
ATOM 1765  H HG2  . ARG A 1 111 ? -7.065  5.200   19.728  1.00 0.00 ? 111 ARG A HG2  1  
ATOM 1766  H HG3  . ARG A 1 111 ? -5.872  5.866   20.846  1.00 0.00 ? 111 ARG A HG3  1  
ATOM 1767  H HD2  . ARG A 1 111 ? -5.620  6.502   17.949  1.00 0.00 ? 111 ARG A HD2  1  
ATOM 1768  H HD3  . ARG A 1 111 ? -6.881  7.310   18.880  1.00 0.00 ? 111 ARG A HD3  1  
ATOM 1769  H HE   . ARG A 1 111 ? -4.502  7.535   20.309  1.00 0.00 ? 111 ARG A HE   1  
ATOM 1770  H HH11 . ARG A 1 111 ? -5.851  8.607   17.284  1.00 0.00 ? 111 ARG A HH11 1  
ATOM 1771  H HH12 . ARG A 1 111 ? -4.911  10.062  17.231  1.00 0.00 ? 111 ARG A HH12 1  
ATOM 1772  H HH21 . ARG A 1 111 ? -3.258  9.447   20.250  1.00 0.00 ? 111 ARG A HH21 1  
ATOM 1773  H HH22 . ARG A 1 111 ? -3.436  10.538  18.918  1.00 0.00 ? 111 ARG A HH22 1  
ATOM 1774  N N    . ALA A 1 112 ? -3.623  3.943   16.503  1.00 0.00 ? 112 ALA A N    1  
ATOM 1775  C CA   . ALA A 1 112 ? -2.419  3.500   15.812  1.00 0.00 ? 112 ALA A CA   1  
ATOM 1776  C C    . ALA A 1 112 ? -1.202  3.571   16.728  1.00 0.00 ? 112 ALA A C    1  
ATOM 1777  O O    . ALA A 1 112 ? -0.866  4.635   17.249  1.00 0.00 ? 112 ALA A O    1  
ATOM 1778  C CB   . ALA A 1 112 ? -2.190  4.336   14.561  1.00 0.00 ? 112 ALA A CB   1  
ATOM 1779  H H    . ALA A 1 112 ? -4.030  4.799   16.253  1.00 0.00 ? 112 ALA A H    1  
ATOM 1780  H HA   . ALA A 1 112 ? -2.568  2.474   15.507  1.00 0.00 ? 112 ALA A HA   1  
ATOM 1781  H HB1  . ALA A 1 112 ? -1.212  4.117   14.157  1.00 0.00 ? 112 ALA A HB1  1  
ATOM 1782  H HB2  . ALA A 1 112 ? -2.945  4.098   13.826  1.00 0.00 ? 112 ALA A HB2  1  
ATOM 1783  H HB3  . ALA A 1 112 ? -2.250  5.384   14.813  1.00 0.00 ? 112 ALA A HB3  1  
ATOM 1784  N N    . VAL A 1 113 ? -0.544  2.432   16.920  1.00 0.00 ? 113 VAL A N    1  
ATOM 1785  C CA   . VAL A 1 113 ? 0.636   2.366   17.774  1.00 0.00 ? 113 VAL A CA   1  
ATOM 1786  C C    . VAL A 1 113 ? 1.787   3.172   17.183  1.00 0.00 ? 113 VAL A C    1  
ATOM 1787  O O    . VAL A 1 113 ? 2.074   3.082   15.989  1.00 0.00 ? 113 VAL A O    1  
ATOM 1788  C CB   . VAL A 1 113 ? 1.097   0.911   17.982  1.00 0.00 ? 113 VAL A CB   1  
ATOM 1789  C CG1  . VAL A 1 113 ? 2.374   0.868   18.807  1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1790  C CG2  . VAL A 1 113 ? -0.003  0.094   18.643  1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1791  H H    . VAL A 1 113 ? -0.860  1.617   16.477  1.00 0.00 ? 113 VAL A H    1  
ATOM 1792  H HA   . VAL A 1 113 ? 0.376   2.780   18.737  1.00 0.00 ? 113 VAL A HA   1  
ATOM 1793  H HB   . VAL A 1 113 ? 1.305   0.479   17.014  1.00 0.00 ? 113 VAL A HB   1  
ATOM 1794  H HG11 . VAL A 1 113 ? 3.065   0.167   18.364  1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1795  H HG12 . VAL A 1 113 ? 2.821   1.851   18.830  1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1796  H HG13 . VAL A 1 113 ? 2.141   0.555   19.814  1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1797  H HG21 . VAL A 1 113 ? -0.588  0.733   19.287  1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1798  H HG22 . VAL A 1 113 ? -0.641  -0.333  17.883  1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1799  H HG23 . VAL A 1 113 ? 0.440   -0.699  19.228  1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1800  N N    . SER A 1 114 ? 2.445   3.961   18.028  1.00 0.00 ? 114 SER A N    1  
ATOM 1801  C CA   . SER A 1 114 ? 3.563   4.786   17.589  1.00 0.00 ? 114 SER A CA   1  
ATOM 1802  C C    . SER A 1 114 ? 4.716   3.920   17.091  1.00 0.00 ? 114 SER A C    1  
ATOM 1803  O O    . SER A 1 114 ? 5.557   3.477   17.873  1.00 0.00 ? 114 SER A O    1  
ATOM 1804  C CB   . SER A 1 114 ? 4.042   5.683   18.733  1.00 0.00 ? 114 SER A CB   1  
ATOM 1805  O OG   . SER A 1 114 ? 4.641   6.867   18.236  1.00 0.00 ? 114 SER A OG   1  
ATOM 1806  H H    . SER A 1 114 ? 2.169   3.989   18.968  1.00 0.00 ? 114 SER A H    1  
ATOM 1807  H HA   . SER A 1 114 ? 3.218   5.408   16.776  1.00 0.00 ? 114 SER A HA   1  
ATOM 1808  H HB2  . SER A 1 114 ? 3.200   5.952   19.352  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1809  H HB3  . SER A 1 114 ? 4.769   5.147   19.326  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1810  H HG   . SER A 1 114 ? 5.315   7.168   18.850  1.00 0.00 ? 114 SER A HG   1  
ATOM 1811  N N    . TRP A 1 115 ? 4.747   3.682   15.785  1.00 0.00 ? 115 TRP A N    1  
ATOM 1812  C CA   . TRP A 1 115 ? 5.796   2.868   15.181  1.00 0.00 ? 115 TRP A CA   1  
ATOM 1813  C C    . TRP A 1 115 ? 6.686   3.712   14.275  1.00 0.00 ? 115 TRP A C    1  
ATOM 1814  O O    . TRP A 1 115 ? 6.207   4.604   13.574  1.00 0.00 ? 115 TRP A O    1  
ATOM 1815  C CB   . TRP A 1 115 ? 5.181   1.717   14.383  1.00 0.00 ? 115 TRP A CB   1  
ATOM 1816  C CG   . TRP A 1 115 ? 6.190   0.928   13.604  1.00 0.00 ? 115 TRP A CG   1  
ATOM 1817  C CD1  . TRP A 1 115 ? 7.245   0.223   14.108  1.00 0.00 ? 115 TRP A CD1  1  
ATOM 1818  C CD2  . TRP A 1 115 ? 6.239   0.768   12.182  1.00 0.00 ? 115 TRP A CD2  1  
ATOM 1819  N NE1  . TRP A 1 115 ? 7.947   -0.367  13.084  1.00 0.00 ? 115 TRP A NE1  1  
ATOM 1820  C CE2  . TRP A 1 115 ? 7.350   -0.048  11.893  1.00 0.00 ? 115 TRP A CE2  1  
ATOM 1821  C CE3  . TRP A 1 115 ? 5.452   1.233   11.125  1.00 0.00 ? 115 TRP A CE3  1  
ATOM 1822  C CZ2  . TRP A 1 115 ? 7.691   -0.407  10.592  1.00 0.00 ? 115 TRP A CZ2  1  
ATOM 1823  C CZ3  . TRP A 1 115 ? 5.792   0.876   9.834   1.00 0.00 ? 115 TRP A CZ3  1  
ATOM 1824  C CH2  . TRP A 1 115 ? 6.903   0.062   9.577   1.00 0.00 ? 115 TRP A CH2  1  
ATOM 1825  H H    . TRP A 1 115 ? 4.048   4.063   15.212  1.00 0.00 ? 115 TRP A H    1  
ATOM 1826  H HA   . TRP A 1 115 ? 6.398   2.460   15.979  1.00 0.00 ? 115 TRP A HA   1  
ATOM 1827  H HB2  . TRP A 1 115 ? 4.683   1.041   15.063  1.00 0.00 ? 115 TRP A HB2  1  
ATOM 1828  H HB3  . TRP A 1 115 ? 4.458   2.117   13.686  1.00 0.00 ? 115 TRP A HB3  1  
ATOM 1829  H HD1  . TRP A 1 115 ? 7.481   0.149   15.158  1.00 0.00 ? 115 TRP A HD1  1  
ATOM 1830  H HE1  . TRP A 1 115 ? 8.745   -0.926  13.191  1.00 0.00 ? 115 TRP A HE1  1  
ATOM 1831  H HE3  . TRP A 1 115 ? 4.591   1.861   11.304  1.00 0.00 ? 115 TRP A HE3  1  
ATOM 1832  H HZ2  . TRP A 1 115 ? 8.544   -1.034  10.377  1.00 0.00 ? 115 TRP A HZ2  1  
ATOM 1833  H HZ3  . TRP A 1 115 ? 5.196   1.226   9.004   1.00 0.00 ? 115 TRP A HZ3  1  
ATOM 1834  H HH2  . TRP A 1 115 ? 7.132   -0.191  8.553   1.00 0.00 ? 115 TRP A HH2  1  
ATOM 1835  N N    . THR A 1 116 ? 7.983   3.424   14.293  1.00 0.00 ? 116 THR A N    1  
ATOM 1836  C CA   . THR A 1 116 ? 8.940   4.157   13.474  1.00 0.00 ? 116 THR A CA   1  
ATOM 1837  C C    . THR A 1 116 ? 8.790   3.799   12.000  1.00 0.00 ? 116 THR A C    1  
ATOM 1838  O O    . THR A 1 116 ? 8.507   2.652   11.655  1.00 0.00 ? 116 THR A O    1  
ATOM 1839  C CB   . THR A 1 116 ? 10.389  3.875   13.914  1.00 0.00 ? 116 THR A CB   1  
ATOM 1840  O OG1  . THR A 1 116 ? 10.616  4.408   15.224  1.00 0.00 ? 116 THR A OG1  1  
ATOM 1841  C CG2  . THR A 1 116 ? 11.381  4.484   12.934  1.00 0.00 ? 116 THR A CG2  1  
ATOM 1842  H H    . THR A 1 116 ? 8.304   2.702   14.873  1.00 0.00 ? 116 THR A H    1  
ATOM 1843  H HA   . THR A 1 116 ? 8.747   5.213   13.599  1.00 0.00 ? 116 THR A HA   1  
ATOM 1844  H HB   . THR A 1 116 ? 10.540  2.805   13.938  1.00 0.00 ? 116 THR A HB   1  
ATOM 1845  H HG1  . THR A 1 116 ? 11.171  3.804   15.723  1.00 0.00 ? 116 THR A HG1  1  
ATOM 1846  H HG21 . THR A 1 116 ? 12.263  4.806   13.468  1.00 0.00 ? 116 THR A HG21 1  
ATOM 1847  H HG22 . THR A 1 116 ? 10.927  5.332   12.443  1.00 0.00 ? 116 THR A HG22 1  
ATOM 1848  H HG23 . THR A 1 116 ? 11.657  3.746   12.197  1.00 0.00 ? 116 THR A HG23 1  
ATOM 1849  N N    . PHE A 1 117 ? 8.982   4.788   11.133  1.00 0.00 ? 117 PHE A N    1  
ATOM 1850  C CA   . PHE A 1 117 ? 8.867   4.577   9.695   1.00 0.00 ? 117 PHE A CA   1  
ATOM 1851  C C    . PHE A 1 117 ? 10.238  4.631   9.026   1.00 0.00 ? 117 PHE A C    1  
ATOM 1852  O O    . PHE A 1 117 ? 10.760  5.709   8.742   1.00 0.00 ? 117 PHE A O    1  
ATOM 1853  C CB   . PHE A 1 117 ? 7.943   5.627   9.075   1.00 0.00 ? 117 PHE A CB   1  
ATOM 1854  C CG   . PHE A 1 117 ? 6.498   5.221   9.061   1.00 0.00 ? 117 PHE A CG   1  
ATOM 1855  C CD1  . PHE A 1 117 ? 6.012   4.375   8.077   1.00 0.00 ? 117 PHE A CD1  1  
ATOM 1856  C CD2  . PHE A 1 117 ? 5.624   5.684   10.032  1.00 0.00 ? 117 PHE A CD2  1  
ATOM 1857  C CE1  . PHE A 1 117 ? 4.682   3.999   8.061   1.00 0.00 ? 117 PHE A CE1  1  
ATOM 1858  C CE2  . PHE A 1 117 ? 4.293   5.312   10.021  1.00 0.00 ? 117 PHE A CE2  1  
ATOM 1859  C CZ   . PHE A 1 117 ? 3.822   4.467   9.035   1.00 0.00 ? 117 PHE A CZ   1  
ATOM 1860  H H    . PHE A 1 117 ? 9.205   5.682   11.469  1.00 0.00 ? 117 PHE A H    1  
ATOM 1861  H HA   . PHE A 1 117 ? 8.442   3.598   9.537   1.00 0.00 ? 117 PHE A HA   1  
ATOM 1862  H HB2  . PHE A 1 117 ? 8.024   6.544   9.639   1.00 0.00 ? 117 PHE A HB2  1  
ATOM 1863  H HB3  . PHE A 1 117 ? 8.249   5.809   8.056   1.00 0.00 ? 117 PHE A HB3  1  
ATOM 1864  H HD1  . PHE A 1 117 ? 6.684   4.007   7.315   1.00 0.00 ? 117 PHE A HD1  1  
ATOM 1865  H HD2  . PHE A 1 117 ? 5.992   6.344   10.804  1.00 0.00 ? 117 PHE A HD2  1  
ATOM 1866  H HE1  . PHE A 1 117 ? 4.316   3.339   7.289   1.00 0.00 ? 117 PHE A HE1  1  
ATOM 1867  H HE2  . PHE A 1 117 ? 3.623   5.679   10.784  1.00 0.00 ? 117 PHE A HE2  1  
ATOM 1868  H HZ   . PHE A 1 117 ? 2.782   4.176   9.024   1.00 0.00 ? 117 PHE A HZ   1  
ATOM 1869  N N    . SER A 1 118 ? 10.815  3.460   8.778   1.00 0.00 ? 118 SER A N    1  
ATOM 1870  C CA   . SER A 1 118 ? 12.127  3.372   8.147   1.00 0.00 ? 118 SER A CA   1  
ATOM 1871  C C    . SER A 1 118 ? 12.223  2.134   7.261   1.00 0.00 ? 118 SER A C    1  
ATOM 1872  O O    . SER A 1 118 ? 11.422  1.208   7.383   1.00 0.00 ? 118 SER A O    1  
ATOM 1873  C CB   . SER A 1 118 ? 13.227  3.339   9.211   1.00 0.00 ? 118 SER A CB   1  
ATOM 1874  O OG   . SER A 1 118 ? 12.840  2.545   10.319  1.00 0.00 ? 118 SER A OG   1  
ATOM 1875  H H    . SER A 1 118 ? 10.349  2.635   9.028   1.00 0.00 ? 118 SER A H    1  
ATOM 1876  H HA   . SER A 1 118 ? 12.259  4.251   7.534   1.00 0.00 ? 118 SER A HA   1  
ATOM 1877  H HB2  . SER A 1 118 ? 14.126  2.923   8.782   1.00 0.00 ? 118 SER A HB2  1  
ATOM 1878  H HB3  . SER A 1 118 ? 13.423  4.344   9.554   1.00 0.00 ? 118 SER A HB3  1  
ATOM 1879  H HG   . SER A 1 118 ? 12.924  1.616   10.093  1.00 0.00 ? 118 SER A HG   1  
ATOM 1880  N N    . GLU A 1 119 ? 13.209  2.127   6.370   1.00 0.00 ? 119 GLU A N    1  
ATOM 1881  C CA   . GLU A 1 119 ? 13.409  1.003   5.462   1.00 0.00 ? 119 GLU A CA   1  
ATOM 1882  C C    . GLU A 1 119 ? 13.837  -0.245  6.228   1.00 0.00 ? 119 GLU A C    1  
ATOM 1883  O O    . GLU A 1 119 ? 13.379  -1.350  5.939   1.00 0.00 ? 119 GLU A O    1  
ATOM 1884  C CB   . GLU A 1 119 ? 14.459  1.352   4.406   1.00 0.00 ? 119 GLU A CB   1  
ATOM 1885  C CG   . GLU A 1 119 ? 14.271  0.612   3.093   1.00 0.00 ? 119 GLU A CG   1  
ATOM 1886  C CD   . GLU A 1 119 ? 15.383  0.893   2.100   1.00 0.00 ? 119 GLU A CD   1  
ATOM 1887  O OE1  . GLU A 1 119 ? 15.910  2.025   2.107   1.00 0.00 ? 119 GLU A OE1  1  
ATOM 1888  O OE2  . GLU A 1 119 ? 15.725  -0.017  1.318   1.00 0.00 ? 119 GLU A OE2  1  
ATOM 1889  H H    . GLU A 1 119 ? 13.815  2.895   6.321   1.00 0.00 ? 119 GLU A H    1  
ATOM 1890  H HA   . GLU A 1 119 ? 12.469  0.803   4.970   1.00 0.00 ? 119 GLU A HA   1  
ATOM 1891  H HB2  . GLU A 1 119 ? 14.414  2.413   4.208   1.00 0.00 ? 119 GLU A HB2  1  
ATOM 1892  H HB3  . GLU A 1 119 ? 15.437  1.109   4.795   1.00 0.00 ? 119 GLU A HB3  1  
ATOM 1893  H HG2  . GLU A 1 119 ? 14.248  -0.449  3.292   1.00 0.00 ? 119 GLU A HG2  1  
ATOM 1894  H HG3  . GLU A 1 119 ? 13.332  0.915   2.654   1.00 0.00 ? 119 GLU A HG3  1  
ATOM 1895  N N    . GLU A 1 120 ? 14.719  -0.059  7.206   1.00 0.00 ? 120 GLU A N    1  
ATOM 1896  C CA   . GLU A 1 120 ? 15.210  -1.170  8.012   1.00 0.00 ? 120 GLU A CA   1  
ATOM 1897  C C    . GLU A 1 120 ? 14.072  -1.819  8.795   1.00 0.00 ? 120 GLU A C    1  
ATOM 1898  O O    . GLU A 1 120 ? 14.021  -3.040  8.938   1.00 0.00 ? 120 GLU A O    1  
ATOM 1899  C CB   . GLU A 1 120 ? 16.297  -0.689  8.975   1.00 0.00 ? 120 GLU A CB   1  
ATOM 1900  C CG   . GLU A 1 120 ? 15.864  0.477   9.848   1.00 0.00 ? 120 GLU A CG   1  
ATOM 1901  C CD   . GLU A 1 120 ? 17.028  1.348   10.279  1.00 0.00 ? 120 GLU A CD   1  
ATOM 1902  O OE1  . GLU A 1 120 ? 17.524  2.131   9.442   1.00 0.00 ? 120 GLU A OE1  1  
ATOM 1903  O OE2  . GLU A 1 120 ? 17.444  1.245   11.452  1.00 0.00 ? 120 GLU A OE2  1  
ATOM 1904  H H    . GLU A 1 120 ? 15.047  0.846   7.388   1.00 0.00 ? 120 GLU A H    1  
ATOM 1905  H HA   . GLU A 1 120 ? 15.635  -1.903  7.343   1.00 0.00 ? 120 GLU A HA   1  
ATOM 1906  H HB2  . GLU A 1 120 ? 16.579  -1.509  9.620   1.00 0.00 ? 120 GLU A HB2  1  
ATOM 1907  H HB3  . GLU A 1 120 ? 17.159  -0.381  8.402   1.00 0.00 ? 120 GLU A HB3  1  
ATOM 1908  H HG2  . GLU A 1 120 ? 15.166  1.086   9.293   1.00 0.00 ? 120 GLU A HG2  1  
ATOM 1909  H HG3  . GLU A 1 120 ? 15.378  0.089   10.731  1.00 0.00 ? 120 GLU A HG3  1  
ATOM 1910  N N    . ASN A 1 121 ? 13.163  -0.993  9.300   1.00 0.00 ? 121 ASN A N    1  
ATOM 1911  C CA   . ASN A 1 121 ? 12.026  -1.485  10.069  1.00 0.00 ? 121 ASN A CA   1  
ATOM 1912  C C    . ASN A 1 121 ? 10.983  -2.119  9.154   1.00 0.00 ? 121 ASN A C    1  
ATOM 1913  O O    . ASN A 1 121 ? 10.395  -3.149  9.484   1.00 0.00 ? 121 ASN A O    1  
ATOM 1914  C CB   . ASN A 1 121 ? 11.393  -0.345  10.869  1.00 0.00 ? 121 ASN A CB   1  
ATOM 1915  C CG   . ASN A 1 121 ? 12.278  0.125   12.007  1.00 0.00 ? 121 ASN A CG   1  
ATOM 1916  O OD1  . ASN A 1 121 ? 13.278  -0.515  12.335  1.00 0.00 ? 121 ASN A OD1  1  
ATOM 1917  N ND2  . ASN A 1 121 ? 11.915  1.248   12.615  1.00 0.00 ? 121 ASN A ND2  1  
ATOM 1918  H H    . ASN A 1 121 ? 13.258  -0.029  9.152   1.00 0.00 ? 121 ASN A H    1  
ATOM 1919  H HA   . ASN A 1 121 ? 12.390  -2.235  10.755  1.00 0.00 ? 121 ASN A HA   1  
ATOM 1920  H HB2  . ASN A 1 121 ? 11.212  0.492   10.210  1.00 0.00 ? 121 ASN A HB2  1  
ATOM 1921  H HB3  . ASN A 1 121 ? 10.454  -0.681  11.283  1.00 0.00 ? 121 ASN A HB3  1  
ATOM 1922  H HD21 . ASN A 1 121 ? 11.107  1.704   12.300  1.00 0.00 ? 121 ASN A HD21 1  
ATOM 1923  H HD22 . ASN A 1 121 ? 12.470  1.575   13.353  1.00 0.00 ? 121 ASN A HD22 1  
ATOM 1924  N N    . VAL A 1 122 ? 10.759  -1.497  8.001   1.00 0.00 ? 122 VAL A N    1  
ATOM 1925  C CA   . VAL A 1 122 ? 9.789   -2.001  7.036   1.00 0.00 ? 122 VAL A CA   1  
ATOM 1926  C C    . VAL A 1 122 ? 10.219  -3.354  6.480   1.00 0.00 ? 122 VAL A C    1  
ATOM 1927  O O    . VAL A 1 122 ? 9.479   -4.334  6.564   1.00 0.00 ? 122 VAL A O    1  
ATOM 1928  C CB   . VAL A 1 122 ? 9.595   -1.016  5.868   1.00 0.00 ? 122 VAL A CB   1  
ATOM 1929  C CG1  . VAL A 1 122 ? 8.835   -1.680  4.730   1.00 0.00 ? 122 VAL A CG1  1  
ATOM 1930  C CG2  . VAL A 1 122 ? 8.874   0.237   6.342   1.00 0.00 ? 122 VAL A CG2  1  
ATOM 1931  H H    . VAL A 1 122 ? 11.259  -0.680  7.794   1.00 0.00 ? 122 VAL A H    1  
ATOM 1932  H HA   . VAL A 1 122 ? 8.842   -2.116  7.543   1.00 0.00 ? 122 VAL A HA   1  
ATOM 1933  H HB   . VAL A 1 122 ? 10.570  -0.728  5.501   1.00 0.00 ? 122 VAL A HB   1  
ATOM 1934  H HG11 . VAL A 1 122 ? 9.415   -2.506  4.344   1.00 0.00 ? 122 VAL A HG11 1  
ATOM 1935  H HG12 . VAL A 1 122 ? 7.886   -2.043  5.094   1.00 0.00 ? 122 VAL A HG12 1  
ATOM 1936  H HG13 . VAL A 1 122 ? 8.668   -0.960  3.942   1.00 0.00 ? 122 VAL A HG13 1  
ATOM 1937  H HG21 . VAL A 1 122 ? 9.409   1.110   6.000   1.00 0.00 ? 122 VAL A HG21 1  
ATOM 1938  H HG22 . VAL A 1 122 ? 7.871   0.249   5.941   1.00 0.00 ? 122 VAL A HG22 1  
ATOM 1939  H HG23 . VAL A 1 122 ? 8.830   0.241   7.421   1.00 0.00 ? 122 VAL A HG23 1  
ATOM 1940  N N    . ILE A 1 123 ? 11.419  -3.399  5.912   1.00 0.00 ? 123 ILE A N    1  
ATOM 1941  C CA   . ILE A 1 123 ? 11.948  -4.633  5.343   1.00 0.00 ? 123 ILE A CA   1  
ATOM 1942  C C    . ILE A 1 123 ? 11.906  -5.769  6.359   1.00 0.00 ? 123 ILE A C    1  
ATOM 1943  O O    . ILE A 1 123 ? 11.545  -6.898  6.028   1.00 0.00 ? 123 ILE A O    1  
ATOM 1944  C CB   . ILE A 1 123 ? 13.397  -4.451  4.853   1.00 0.00 ? 123 ILE A CB   1  
ATOM 1945  C CG1  . ILE A 1 123 ? 13.457  -3.388  3.755   1.00 0.00 ? 123 ILE A CG1  1  
ATOM 1946  C CG2  . ILE A 1 123 ? 13.956  -5.773  4.350   1.00 0.00 ? 123 ILE A CG2  1  
ATOM 1947  C CD1  . ILE A 1 123 ? 14.866  -2.987  3.378   1.00 0.00 ? 123 ILE A CD1  1  
ATOM 1948  H H    . ILE A 1 123 ? 11.962  -2.585  5.876   1.00 0.00 ? 123 ILE A H    1  
ATOM 1949  H HA   . ILE A 1 123 ? 11.333  -4.899  4.495   1.00 0.00 ? 123 ILE A HA   1  
ATOM 1950  H HB   . ILE A 1 123 ? 13.998  -4.128  5.690   1.00 0.00 ? 123 ILE A HB   1  
ATOM 1951  H HG12 . ILE A 1 123 ? 12.973  -3.767  2.869   1.00 0.00 ? 123 ILE A HG12 1  
ATOM 1952  H HG13 . ILE A 1 123 ? 12.939  -2.502  4.092   1.00 0.00 ? 123 ILE A HG13 1  
ATOM 1953  H HG21 . ILE A 1 123 ? 14.932  -5.938  4.781   1.00 0.00 ? 123 ILE A HG21 1  
ATOM 1954  H HG22 . ILE A 1 123 ? 13.295  -6.576  4.640   1.00 0.00 ? 123 ILE A HG22 1  
ATOM 1955  H HG23 . ILE A 1 123 ? 14.038  -5.743  3.274   1.00 0.00 ? 123 ILE A HG23 1  
ATOM 1956  H HD11 . ILE A 1 123 ? 14.840  -2.361  2.498   1.00 0.00 ? 123 ILE A HD11 1  
ATOM 1957  H HD12 . ILE A 1 123 ? 15.317  -2.444  4.194   1.00 0.00 ? 123 ILE A HD12 1  
ATOM 1958  H HD13 . ILE A 1 123 ? 15.449  -3.873  3.170   1.00 0.00 ? 123 ILE A HD13 1  
ATOM 1959  N N    . ARG A 1 124 ? 12.276  -5.462  7.598   1.00 0.00 ? 124 ARG A N    1  
ATOM 1960  C CA   . ARG A 1 124 ? 12.280  -6.457  8.663   1.00 0.00 ? 124 ARG A CA   1  
ATOM 1961  C C    . ARG A 1 124 ? 10.856  -6.858  9.038   1.00 0.00 ? 124 ARG A C    1  
ATOM 1962  O O    . ARG A 1 124 ? 10.471  -8.018  8.896   1.00 0.00 ? 124 ARG A O    1  
ATOM 1963  C CB   . ARG A 1 124 ? 13.009  -5.915  9.894   1.00 0.00 ? 124 ARG A CB   1  
ATOM 1964  C CG   . ARG A 1 124 ? 13.370  -6.987  10.909  1.00 0.00 ? 124 ARG A CG   1  
ATOM 1965  C CD   . ARG A 1 124 ? 13.723  -6.381  12.258  1.00 0.00 ? 124 ARG A CD   1  
ATOM 1966  N NE   . ARG A 1 124 ? 15.076  -5.830  12.273  1.00 0.00 ? 124 ARG A NE   1  
ATOM 1967  C CZ   . ARG A 1 124 ? 16.161  -6.553  12.522  1.00 0.00 ? 124 ARG A CZ   1  
ATOM 1968  N NH1  . ARG A 1 124 ? 16.054  -7.850  12.774  1.00 0.00 ? 124 ARG A NH1  1  
ATOM 1969  N NH2  . ARG A 1 124 ? 17.358  -5.980  12.517  1.00 0.00 ? 124 ARG A NH2  1  
ATOM 1970  H H    . ARG A 1 124 ? 12.554  -4.544  7.801   1.00 0.00 ? 124 ARG A H    1  
ATOM 1971  H HA   . ARG A 1 124 ? 12.803  -7.329  8.301   1.00 0.00 ? 124 ARG A HA   1  
ATOM 1972  H HB2  . ARG A 1 124 ? 13.920  -5.432  9.575   1.00 0.00 ? 124 ARG A HB2  1  
ATOM 1973  H HB3  . ARG A 1 124 ? 12.377  -5.188  10.381  1.00 0.00 ? 124 ARG A HB3  1  
ATOM 1974  H HG2  . ARG A 1 124 ? 12.526  -7.650  11.035  1.00 0.00 ? 124 ARG A HG2  1  
ATOM 1975  H HG3  . ARG A 1 124 ? 14.218  -7.546  10.542  1.00 0.00 ? 124 ARG A HG3  1  
ATOM 1976  H HD2  . ARG A 1 124 ? 13.021  -5.591  12.478  1.00 0.00 ? 124 ARG A HD2  1  
ATOM 1977  H HD3  . ARG A 1 124 ? 13.649  -7.149  13.014  1.00 0.00 ? 124 ARG A HD3  1  
ATOM 1978  H HE   . ARG A 1 124 ? 15.178  -4.873  12.089  1.00 0.00 ? 124 ARG A HE   1  
ATOM 1979  H HH11 . ARG A 1 124 ? 15.154  -8.286  12.777  1.00 0.00 ? 124 ARG A HH11 1  
ATOM 1980  H HH12 . ARG A 1 124 ? 16.873  -8.393  12.960  1.00 0.00 ? 124 ARG A HH12 1  
ATOM 1981  H HH21 . ARG A 1 124 ? 17.443  -5.002  12.327  1.00 0.00 ? 124 ARG A HH21 1  
ATOM 1982  H HH22 . ARG A 1 124 ? 18.174  -6.525  12.704  1.00 0.00 ? 124 ARG A HH22 1  
ATOM 1983  N N    . GLU A 1 125 ? 10.081  -5.891  9.517   1.00 0.00 ? 125 GLU A N    1  
ATOM 1984  C CA   . GLU A 1 125 ? 8.700   -6.144  9.913   1.00 0.00 ? 125 GLU A CA   1  
ATOM 1985  C C    . GLU A 1 125 ? 7.965   -6.943  8.841   1.00 0.00 ? 125 GLU A C    1  
ATOM 1986  O O    . GLU A 1 125 ? 7.425   -8.016  9.111   1.00 0.00 ? 125 GLU A O    1  
ATOM 1987  C CB   . GLU A 1 125 ? 7.970   -4.825  10.172  1.00 0.00 ? 125 GLU A CB   1  
ATOM 1988  C CG   . GLU A 1 125 ? 8.600   -3.987  11.272  1.00 0.00 ? 125 GLU A CG   1  
ATOM 1989  C CD   . GLU A 1 125 ? 8.032   -4.301  12.642  1.00 0.00 ? 125 GLU A CD   1  
ATOM 1990  O OE1  . GLU A 1 125 ? 7.468   -5.402  12.813  1.00 0.00 ? 125 GLU A OE1  1  
ATOM 1991  O OE2  . GLU A 1 125 ? 8.153   -3.446  13.545  1.00 0.00 ? 125 GLU A OE2  1  
ATOM 1992  H H    . GLU A 1 125 ? 10.445  -4.986  9.606   1.00 0.00 ? 125 GLU A H    1  
ATOM 1993  H HA   . GLU A 1 125 ? 8.718   -6.721  10.825  1.00 0.00 ? 125 GLU A HA   1  
ATOM 1994  H HB2  . GLU A 1 125 ? 7.967   -4.244  9.261   1.00 0.00 ? 125 GLU A HB2  1  
ATOM 1995  H HB3  . GLU A 1 125 ? 6.950   -5.042  10.453  1.00 0.00 ? 125 GLU A HB3  1  
ATOM 1996  H HG2  . GLU A 1 125 ? 9.663   -4.176  11.288  1.00 0.00 ? 125 GLU A HG2  1  
ATOM 1997  H HG3  . GLU A 1 125 ? 8.424   -2.943  11.057  1.00 0.00 ? 125 GLU A HG3  1  
ATOM 1998  N N    . PHE A 1 126 ? 7.948   -6.412  7.623   1.00 0.00 ? 126 PHE A N    1  
ATOM 1999  C CA   . PHE A 1 126 ? 7.278   -7.073  6.509   1.00 0.00 ? 126 PHE A CA   1  
ATOM 2000  C C    . PHE A 1 126 ? 8.091   -8.267  6.016   1.00 0.00 ? 126 PHE A C    1  
ATOM 2001  O O    . PHE A 1 126 ? 7.566   -9.156  5.349   1.00 0.00 ? 126 PHE A O    1  
ATOM 2002  C CB   . PHE A 1 126 ? 7.053   -6.086  5.362   1.00 0.00 ? 126 PHE A CB   1  
ATOM 2003  C CG   . PHE A 1 126 ? 5.989   -5.065  5.649   1.00 0.00 ? 126 PHE A CG   1  
ATOM 2004  C CD1  . PHE A 1 126 ? 6.306   -3.874  6.280   1.00 0.00 ? 126 PHE A CD1  1  
ATOM 2005  C CD2  . PHE A 1 126 ? 4.672   -5.299  5.288   1.00 0.00 ? 126 PHE A CD2  1  
ATOM 2006  C CE1  . PHE A 1 126 ? 5.329   -2.932  6.545   1.00 0.00 ? 126 PHE A CE1  1  
ATOM 2007  C CE2  . PHE A 1 126 ? 3.691   -4.361  5.550   1.00 0.00 ? 126 PHE A CE2  1  
ATOM 2008  C CZ   . PHE A 1 126 ? 4.020   -3.177  6.181   1.00 0.00 ? 126 PHE A CZ   1  
ATOM 2009  H H    . PHE A 1 126 ? 8.397   -5.554  7.469   1.00 0.00 ? 126 PHE A H    1  
ATOM 2010  H HA   . PHE A 1 126 ? 6.321   -7.426  6.862   1.00 0.00 ? 126 PHE A HA   1  
ATOM 2011  H HB2  . PHE A 1 126 ? 7.974   -5.558  5.166   1.00 0.00 ? 126 PHE A HB2  1  
ATOM 2012  H HB3  . PHE A 1 126 ? 6.761   -6.633  4.478   1.00 0.00 ? 126 PHE A HB3  1  
ATOM 2013  H HD1  . PHE A 1 126 ? 7.331   -3.681  6.566   1.00 0.00 ? 126 PHE A HD1  1  
ATOM 2014  H HD2  . PHE A 1 126 ? 4.413   -6.225  4.796   1.00 0.00 ? 126 PHE A HD2  1  
ATOM 2015  H HE1  . PHE A 1 126 ? 5.590   -2.008  7.039   1.00 0.00 ? 126 PHE A HE1  1  
ATOM 2016  H HE2  . PHE A 1 126 ? 2.668   -4.555  5.264   1.00 0.00 ? 126 PHE A HE2  1  
ATOM 2017  H HZ   . PHE A 1 126 ? 3.255   -2.443  6.386   1.00 0.00 ? 126 PHE A HZ   1  
ATOM 2018  N N    . ASN A 1 127 ? 9.377   -8.277  6.351   1.00 0.00 ? 127 ASN A N    1  
ATOM 2019  C CA   . ASN A 1 127 ? 10.265  -9.359  5.941   1.00 0.00 ? 127 ASN A CA   1  
ATOM 2020  C C    . ASN A 1 127 ? 10.366  -9.435  4.421   1.00 0.00 ? 127 ASN A C    1  
ATOM 2021  O O    . ASN A 1 127 ? 10.448  -10.521 3.846   1.00 0.00 ? 127 ASN A O    1  
ATOM 2022  C CB   . ASN A 1 127 ? 9.764   -10.694 6.497   1.00 0.00 ? 127 ASN A CB   1  
ATOM 2023  C CG   . ASN A 1 127 ? 9.881   -10.772 8.007   1.00 0.00 ? 127 ASN A CG   1  
ATOM 2024  O OD1  . ASN A 1 127 ? 8.896   -10.605 8.726   1.00 0.00 ? 127 ASN A OD1  1  
ATOM 2025  N ND2  . ASN A 1 127 ? 11.089  -11.028 8.494   1.00 0.00 ? 127 ASN A ND2  1  
ATOM 2026  H H    . ASN A 1 127 ? 9.739   -7.539  6.885   1.00 0.00 ? 127 ASN A H    1  
ATOM 2027  H HA   . ASN A 1 127 ? 11.245  -9.156  6.346   1.00 0.00 ? 127 ASN A HA   1  
ATOM 2028  H HB2  . ASN A 1 127 ? 8.726   -10.822 6.228   1.00 0.00 ? 127 ASN A HB2  1  
ATOM 2029  H HB3  . ASN A 1 127 ? 10.345  -11.497 6.067   1.00 0.00 ? 127 ASN A HB3  1  
ATOM 2030  H HD21 . ASN A 1 127 ? 11.828  -11.150 7.862   1.00 0.00 ? 127 ASN A HD21 1  
ATOM 2031  H HD22 . ASN A 1 127 ? 11.193  -11.085 9.467   1.00 0.00 ? 127 ASN A HD22 1  
ATOM 2032  N N    . LEU A 1 128 ? 10.362  -8.274  3.775   1.00 0.00 ? 128 LEU A N    1  
ATOM 2033  C CA   . LEU A 1 128 ? 10.454  -8.207  2.321   1.00 0.00 ? 128 LEU A CA   1  
ATOM 2034  C C    . LEU A 1 128 ? 11.585  -9.091  1.806   1.00 0.00 ? 128 LEU A C    1  
ATOM 2035  O O    . LEU A 1 128 ? 11.362  -9.991  0.997   1.00 0.00 ? 128 LEU A O    1  
ATOM 2036  C CB   . LEU A 1 128 ? 10.676  -6.762  1.871   1.00 0.00 ? 128 LEU A CB   1  
ATOM 2037  C CG   . LEU A 1 128 ? 9.689   -5.729  2.416   1.00 0.00 ? 128 LEU A CG   1  
ATOM 2038  C CD1  . LEU A 1 128 ? 10.094  -4.327  1.990   1.00 0.00 ? 128 LEU A CD1  1  
ATOM 2039  C CD2  . LEU A 1 128 ? 8.275   -6.044  1.949   1.00 0.00 ? 128 LEU A CD2  1  
ATOM 2040  H H    . LEU A 1 128 ? 10.295  -7.441  4.288   1.00 0.00 ? 128 LEU A H    1  
ATOM 2041  H HA   . LEU A 1 128 ? 9.520   -8.563  1.913   1.00 0.00 ? 128 LEU A HA   1  
ATOM 2042  H HB2  . LEU A 1 128 ? 11.667  -6.467  2.180   1.00 0.00 ? 128 LEU A HB2  1  
ATOM 2043  H HB3  . LEU A 1 128 ? 10.617  -6.740  0.792   1.00 0.00 ? 128 LEU A HB3  1  
ATOM 2044  H HG   . LEU A 1 128 ? 9.701   -5.765  3.497   1.00 0.00 ? 128 LEU A HG   1  
ATOM 2045  H HD11 . LEU A 1 128 ? 9.289   -3.874  1.431   1.00 0.00 ? 128 LEU A HD11 1  
ATOM 2046  H HD12 . LEU A 1 128 ? 10.977  -4.379  1.371   1.00 0.00 ? 128 LEU A HD12 1  
ATOM 2047  H HD13 . LEU A 1 128 ? 10.303  -3.731  2.866   1.00 0.00 ? 128 LEU A HD13 1  
ATOM 2048  H HD21 . LEU A 1 128 ? 7.564   -5.591  2.624   1.00 0.00 ? 128 LEU A HD21 1  
ATOM 2049  H HD22 . LEU A 1 128 ? 8.130   -7.114  1.938   1.00 0.00 ? 128 LEU A HD22 1  
ATOM 2050  H HD23 . LEU A 1 128 ? 8.129   -5.649  0.954   1.00 0.00 ? 128 LEU A HD23 1  
ATOM 2051  N N    . ASN A 1 129 ? 12.798  -8.830  2.282   1.00 0.00 ? 129 ASN A N    1  
ATOM 2052  C CA   . ASN A 1 129 ? 13.964  -9.604  1.871   1.00 0.00 ? 129 ASN A CA   1  
ATOM 2053  C C    . ASN A 1 129 ? 13.636  -11.093 1.815   1.00 0.00 ? 129 ASN A C    1  
ATOM 2054  O O    . ASN A 1 129 ? 14.175  -11.826 0.987   1.00 0.00 ? 129 ASN A O    1  
ATOM 2055  C CB   . ASN A 1 129 ? 15.128  -9.361  2.833   1.00 0.00 ? 129 ASN A CB   1  
ATOM 2056  C CG   . ASN A 1 129 ? 15.963  -8.158  2.440   1.00 0.00 ? 129 ASN A CG   1  
ATOM 2057  O OD1  . ASN A 1 129 ? 15.995  -7.766  1.273   1.00 0.00 ? 129 ASN A OD1  1  
ATOM 2058  N ND2  . ASN A 1 129 ? 16.643  -7.566  3.415   1.00 0.00 ? 129 ASN A ND2  1  
ATOM 2059  H H    . ASN A 1 129 ? 12.912  -8.099  2.925   1.00 0.00 ? 129 ASN A H    1  
ATOM 2060  H HA   . ASN A 1 129 ? 14.249  -9.273  0.884   1.00 0.00 ? 129 ASN A HA   1  
ATOM 2061  H HB2  . ASN A 1 129 ? 14.737  -9.195  3.827   1.00 0.00 ? 129 ASN A HB2  1  
ATOM 2062  H HB3  . ASN A 1 129 ? 15.766  -10.232 2.843   1.00 0.00 ? 129 ASN A HB3  1  
ATOM 2063  H HD21 . ASN A 1 129 ? 16.569  -7.933  4.320   1.00 0.00 ? 129 ASN A HD21 1  
ATOM 2064  H HD22 . ASN A 1 129 ? 17.190  -6.785  3.188   1.00 0.00 ? 129 ASN A HD22 1  
ATOM 2065  N N    . GLU A 1 130 ? 12.749  -11.532 2.703   1.00 0.00 ? 130 GLU A N    1  
ATOM 2066  C CA   . GLU A 1 130 ? 12.351  -12.933 2.755   1.00 0.00 ? 130 GLU A CA   1  
ATOM 2067  C C    . GLU A 1 130 ? 11.257  -13.226 1.732   1.00 0.00 ? 130 GLU A C    1  
ATOM 2068  O O    . GLU A 1 130 ? 11.323  -14.215 1.001   1.00 0.00 ? 130 GLU A O    1  
ATOM 2069  C CB   . GLU A 1 130 ? 11.861  -13.296 4.159   1.00 0.00 ? 130 GLU A CB   1  
ATOM 2070  C CG   . GLU A 1 130 ? 12.986  -13.571 5.143   1.00 0.00 ? 130 GLU A CG   1  
ATOM 2071  C CD   . GLU A 1 130 ? 14.091  -14.418 4.544   1.00 0.00 ? 130 GLU A CD   1  
ATOM 2072  O OE1  . GLU A 1 130 ? 15.004  -13.845 3.913   1.00 0.00 ? 130 GLU A OE1  1  
ATOM 2073  O OE2  . GLU A 1 130 ? 14.043  -15.656 4.707   1.00 0.00 ? 130 GLU A OE2  1  
ATOM 2074  H H    . GLU A 1 130 ? 12.355  -10.898 3.338   1.00 0.00 ? 130 GLU A H    1  
ATOM 2075  H HA   . GLU A 1 130 ? 13.217  -13.533 2.520   1.00 0.00 ? 130 GLU A HA   1  
ATOM 2076  H HB2  . GLU A 1 130 ? 11.266  -12.480 4.542   1.00 0.00 ? 130 GLU A HB2  1  
ATOM 2077  H HB3  . GLU A 1 130 ? 11.244  -14.180 4.094   1.00 0.00 ? 130 GLU A HB3  1  
ATOM 2078  H HG2  . GLU A 1 130 ? 13.408  -12.629 5.460   1.00 0.00 ? 130 GLU A HG2  1  
ATOM 2079  H HG3  . GLU A 1 130 ? 12.579  -14.088 5.999   1.00 0.00 ? 130 GLU A HG3  1  
ATOM 2080  N N    . LEU A 1 131 ? 10.251  -12.359 1.686   1.00 0.00 ? 131 LEU A N    1  
ATOM 2081  C CA   . LEU A 1 131 ? 9.142   -12.524 0.753   1.00 0.00 ? 131 LEU A CA   1  
ATOM 2082  C C    . LEU A 1 131 ? 9.652   -12.743 -0.667  1.00 0.00 ? 131 LEU A C    1  
ATOM 2083  O O    . LEU A 1 131 ? 9.591   -13.854 -1.195  1.00 0.00 ? 131 LEU A O    1  
ATOM 2084  C CB   . LEU A 1 131 ? 8.229   -11.297 0.795   1.00 0.00 ? 131 LEU A CB   1  
ATOM 2085  C CG   . LEU A 1 131 ? 7.624   -10.956 2.157   1.00 0.00 ? 131 LEU A CG   1  
ATOM 2086  C CD1  . LEU A 1 131 ? 6.961   -9.588  2.120   1.00 0.00 ? 131 LEU A CD1  1  
ATOM 2087  C CD2  . LEU A 1 131 ? 6.626   -12.024 2.580   1.00 0.00 ? 131 LEU A CD2  1  
ATOM 2088  H H    . LEU A 1 131 ? 10.254  -11.590 2.293   1.00 0.00 ? 131 LEU A H    1  
ATOM 2089  H HA   . LEU A 1 131 ? 8.578   -13.393 1.059   1.00 0.00 ? 131 LEU A HA   1  
ATOM 2090  H HB2  . LEU A 1 131 ? 8.804   -10.445 0.466   1.00 0.00 ? 131 LEU A HB2  1  
ATOM 2091  H HB3  . LEU A 1 131 ? 7.415   -11.468 0.104   1.00 0.00 ? 131 LEU A HB3  1  
ATOM 2092  H HG   . LEU A 1 131 ? 8.413   -10.923 2.896   1.00 0.00 ? 131 LEU A HG   1  
ATOM 2093  H HD11 . LEU A 1 131 ? 5.895   -9.708  1.995   1.00 0.00 ? 131 LEU A HD11 1  
ATOM 2094  H HD12 . LEU A 1 131 ? 7.358   -9.018  1.293   1.00 0.00 ? 131 LEU A HD12 1  
ATOM 2095  H HD13 . LEU A 1 131 ? 7.159   -9.066  3.045   1.00 0.00 ? 131 LEU A HD13 1  
ATOM 2096  H HD21 . LEU A 1 131 ? 6.601   -12.807 1.837   1.00 0.00 ? 131 LEU A HD21 1  
ATOM 2097  H HD22 . LEU A 1 131 ? 5.644   -11.582 2.672   1.00 0.00 ? 131 LEU A HD22 1  
ATOM 2098  H HD23 . LEU A 1 131 ? 6.925   -12.439 3.531   1.00 0.00 ? 131 LEU A HD23 1  
ATOM 2099  N N    . SER A 1 132 ? 10.158  -11.678 -1.280  1.00 0.00 ? 132 SER A N    1  
ATOM 2100  C CA   . SER A 1 132 ? 10.679  -11.754 -2.640  1.00 0.00 ? 132 SER A CA   1  
ATOM 2101  C C    . SER A 1 132 ? 12.116  -12.266 -2.644  1.00 0.00 ? 132 SER A C    1  
ATOM 2102  O O    . SER A 1 132 ? 12.976  -11.730 -3.342  1.00 0.00 ? 132 SER A O    1  
ATOM 2103  C CB   . SER A 1 132 ? 10.612  -10.381 -3.312  1.00 0.00 ? 132 SER A CB   1  
ATOM 2104  O OG   . SER A 1 132 ? 10.455  -10.507 -4.715  1.00 0.00 ? 132 SER A OG   1  
ATOM 2105  H H    . SER A 1 132 ? 10.180  -10.820 -0.807  1.00 0.00 ? 132 SER A H    1  
ATOM 2106  H HA   . SER A 1 132 ? 10.061  -12.446 -3.193  1.00 0.00 ? 132 SER A HA   1  
ATOM 2107  H HB2  . SER A 1 132 ? 9.773   -9.830  -2.916  1.00 0.00 ? 132 SER A HB2  1  
ATOM 2108  H HB3  . SER A 1 132 ? 11.526  -9.841  -3.111  1.00 0.00 ? 132 SER A HB3  1  
ATOM 2109  H HG   . SER A 1 132 ? 10.998  -11.231 -5.034  1.00 0.00 ? 132 SER A HG   1  
ATOM 2110  N N    . GLY A 1 133 ? 12.369  -13.309 -1.859  1.00 0.00 ? 133 GLY A N    1  
ATOM 2111  C CA   . GLY A 1 133 ? 13.702  -13.876 -1.785  1.00 0.00 ? 133 GLY A CA   1  
ATOM 2112  C C    . GLY A 1 133 ? 14.753  -12.844 -1.430  1.00 0.00 ? 133 GLY A C    1  
ATOM 2113  O O    . GLY A 1 133 ? 14.496  -11.640 -1.429  1.00 0.00 ? 133 GLY A O    1  
ATOM 2114  H H    . GLY A 1 133 ? 11.643  -13.695 -1.324  1.00 0.00 ? 133 GLY A H    1  
ATOM 2115  H HA2  . GLY A 1 133 ? 13.709  -14.655 -1.037  1.00 0.00 ? 133 GLY A HA2  1  
ATOM 2116  H HA3  . GLY A 1 133 ? 13.950  -14.310 -2.743  1.00 0.00 ? 133 GLY A HA3  1  
ATOM 2117  N N    . PRO A 1 134 ? 15.970  -13.315 -1.118  1.00 0.00 ? 134 PRO A N    1  
ATOM 2118  C CA   . PRO A 1 134 ? 17.088  -12.440 -0.752  1.00 0.00 ? 134 PRO A CA   1  
ATOM 2119  C C    . PRO A 1 134 ? 17.599  -11.626 -1.937  1.00 0.00 ? 134 PRO A C    1  
ATOM 2120  O O    . PRO A 1 134 ? 17.411  -12.009 -3.092  1.00 0.00 ? 134 PRO A O    1  
ATOM 2121  C CB   . PRO A 1 134 ? 18.162  -13.419 -0.273  1.00 0.00 ? 134 PRO A CB   1  
ATOM 2122  C CG   . PRO A 1 134 ? 17.845  -14.699 -0.966  1.00 0.00 ? 134 PRO A CG   1  
ATOM 2123  C CD   . PRO A 1 134 ? 16.348  -14.738 -1.099  1.00 0.00 ? 134 PRO A CD   1  
ATOM 2124  H HA   . PRO A 1 134 ? 16.821  -11.772 0.054   1.00 0.00 ? 134 PRO A HA   1  
ATOM 2125  H HB2  . PRO A 1 134 ? 19.139  -13.049 -0.551  1.00 0.00 ? 134 PRO A HB2  1  
ATOM 2126  H HB3  . PRO A 1 134 ? 18.103  -13.526 0.800   1.00 0.00 ? 134 PRO A HB3  1  
ATOM 2127  H HG2  . PRO A 1 134 ? 18.309  -14.713 -1.941  1.00 0.00 ? 134 PRO A HG2  1  
ATOM 2128  H HG3  . PRO A 1 134 ? 18.190  -15.533 -0.373  1.00 0.00 ? 134 PRO A HG3  1  
ATOM 2129  H HD2  . PRO A 1 134 ? 16.063  -15.225 -2.020  1.00 0.00 ? 134 PRO A HD2  1  
ATOM 2130  H HD3  . PRO A 1 134 ? 15.907  -15.242 -0.252  1.00 0.00 ? 134 PRO A HD3  1  
ATOM 2131  N N    . SER A 1 135 ? 18.245  -10.503 -1.642  1.00 0.00 ? 135 SER A N    1  
ATOM 2132  C CA   . SER A 1 135 ? 18.780  -9.633  -2.683  1.00 0.00 ? 135 SER A CA   1  
ATOM 2133  C C    . SER A 1 135 ? 19.869  -10.347 -3.480  1.00 0.00 ? 135 SER A C    1  
ATOM 2134  O O    . SER A 1 135 ? 19.813  -10.410 -4.708  1.00 0.00 ? 135 SER A O    1  
ATOM 2135  C CB   . SER A 1 135 ? 19.341  -8.350  -2.067  1.00 0.00 ? 135 SER A CB   1  
ATOM 2136  O OG   . SER A 1 135 ? 18.306  -7.425  -1.786  1.00 0.00 ? 135 SER A OG   1  
ATOM 2137  H H    . SER A 1 135 ? 18.362  -10.252 -0.702  1.00 0.00 ? 135 SER A H    1  
ATOM 2138  H HA   . SER A 1 135 ? 17.971  -9.378  -3.351  1.00 0.00 ? 135 SER A HA   1  
ATOM 2139  H HB2  . SER A 1 135 ? 19.853  -8.590  -1.148  1.00 0.00 ? 135 SER A HB2  1  
ATOM 2140  H HB3  . SER A 1 135 ? 20.036  -7.896  -2.759  1.00 0.00 ? 135 SER A HB3  1  
ATOM 2141  H HG   . SER A 1 135 ? 18.042  -6.983  -2.596  1.00 0.00 ? 135 SER A HG   1  
ATOM 2142  N N    . SER A 1 136 ? 20.858  -10.881 -2.771  1.00 0.00 ? 136 SER A N    1  
ATOM 2143  C CA   . SER A 1 136 ? 21.962  -11.587 -3.411  1.00 0.00 ? 136 SER A CA   1  
ATOM 2144  C C    . SER A 1 136 ? 21.475  -12.368 -4.628  1.00 0.00 ? 136 SER A C    1  
ATOM 2145  O O    . SER A 1 136 ? 20.556  -13.181 -4.530  1.00 0.00 ? 136 SER A O    1  
ATOM 2146  C CB   . SER A 1 136 ? 22.633  -12.536 -2.417  1.00 0.00 ? 136 SER A CB   1  
ATOM 2147  O OG   . SER A 1 136 ? 21.787  -13.628 -2.103  1.00 0.00 ? 136 SER A OG   1  
ATOM 2148  H H    . SER A 1 136 ? 20.846  -10.797 -1.795  1.00 0.00 ? 136 SER A H    1  
ATOM 2149  H HA   . SER A 1 136 ? 22.682  -10.851 -3.736  1.00 0.00 ? 136 SER A HA   1  
ATOM 2150  H HB2  . SER A 1 136 ? 23.547  -12.916 -2.847  1.00 0.00 ? 136 SER A HB2  1  
ATOM 2151  H HB3  . SER A 1 136 ? 22.860  -11.998 -1.507  1.00 0.00 ? 136 SER A HB3  1  
ATOM 2152  H HG   . SER A 1 136 ? 22.310  -14.431 -2.039  1.00 0.00 ? 136 SER A HG   1  
ATOM 2153  N N    . GLY A 1 137 ? 22.098  -12.115 -5.774  1.00 0.00 ? 137 GLY A N    1  
ATOM 2154  C CA   . GLY A 1 137 ? 21.716  -12.802 -6.994  1.00 0.00 ? 137 GLY A CA   1  
ATOM 2155  C C    . GLY A 1 137 ? 21.644  -14.306 -6.815  1.00 0.00 ? 137 GLY A C    1  
ATOM 2156  O O    . GLY A 1 137 ? 20.798  -14.969 -7.413  1.00 0.00 ? 137 GLY A O    1  
ATOM 2157  H H    . GLY A 1 137 ? 22.824  -11.457 -5.792  1.00 0.00 ? 137 GLY A H    1  
ATOM 2158  H HA2  . GLY A 1 137 ? 20.748  -12.441 -7.309  1.00 0.00 ? 137 GLY A HA2  1  
ATOM 2159  H HA3  . GLY A 1 137 ? 22.440  -12.577 -7.763  1.00 0.00 ? 137 GLY A HA3  1  
ATOM 2160  N N    . GLY A 1 1   ? 7.149   -0.218  -23.584 1.00 0.00 ? 1   GLY A N    2  
ATOM 2161  C CA   . GLY A 1 1   ? 7.844   0.316   -22.427 1.00 0.00 ? 1   GLY A CA   2  
ATOM 2162  C C    . GLY A 1 1   ? 9.152   -0.400  -22.155 1.00 0.00 ? 1   GLY A C    2  
ATOM 2163  O O    . GLY A 1 1   ? 9.586   -1.238  -22.946 1.00 0.00 ? 1   GLY A O    2  
ATOM 2164  H H1   . GLY A 1 1   ? 7.350   -1.124  -23.898 1.00 0.00 ? 1   GLY A H1   2  
ATOM 2165  H HA2  . GLY A 1 1   ? 8.048   1.363   -22.595 1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2166  H HA3  . GLY A 1 1   ? 7.206   0.218   -21.561 1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2167  N N    . SER A 1 2   ? 9.783   -0.071  -21.033 1.00 0.00 ? 2   SER A N    2  
ATOM 2168  C CA   . SER A 1 2   ? 11.052  -0.685  -20.660 1.00 0.00 ? 2   SER A CA   2  
ATOM 2169  C C    . SER A 1 2   ? 10.910  -1.486  -19.370 1.00 0.00 ? 2   SER A C    2  
ATOM 2170  O O    . SER A 1 2   ? 10.356  -1.001  -18.383 1.00 0.00 ? 2   SER A O    2  
ATOM 2171  C CB   . SER A 1 2   ? 12.132  0.386   -20.493 1.00 0.00 ? 2   SER A CB   2  
ATOM 2172  O OG   . SER A 1 2   ? 12.744  0.691   -21.734 1.00 0.00 ? 2   SER A OG   2  
ATOM 2173  H H    . SER A 1 2   ? 9.387   0.604   -20.442 1.00 0.00 ? 2   SER A H    2  
ATOM 2174  H HA   . SER A 1 2   ? 11.342  -1.355  -21.456 1.00 0.00 ? 2   SER A HA   2  
ATOM 2175  H HB2  . SER A 1 2   ? 11.686  1.285   -20.096 1.00 0.00 ? 2   SER A HB2  2  
ATOM 2176  H HB3  . SER A 1 2   ? 12.889  0.027   -19.810 1.00 0.00 ? 2   SER A HB3  2  
ATOM 2177  H HG   . SER A 1 2   ? 13.597  0.253   -21.787 1.00 0.00 ? 2   SER A HG   2  
ATOM 2178  N N    . SER A 1 3   ? 11.416  -2.715  -19.385 1.00 0.00 ? 3   SER A N    2  
ATOM 2179  C CA   . SER A 1 3   ? 11.343  -3.586  -18.218 1.00 0.00 ? 3   SER A CA   2  
ATOM 2180  C C    . SER A 1 3   ? 12.024  -2.941  -17.015 1.00 0.00 ? 3   SER A C    2  
ATOM 2181  O O    . SER A 1 3   ? 11.678  -3.220  -15.868 1.00 0.00 ? 3   SER A O    2  
ATOM 2182  C CB   . SER A 1 3   ? 11.992  -4.938  -18.522 1.00 0.00 ? 3   SER A CB   2  
ATOM 2183  O OG   . SER A 1 3   ? 13.396  -4.808  -18.666 1.00 0.00 ? 3   SER A OG   2  
ATOM 2184  H H    . SER A 1 3   ? 11.846  -3.045  -20.202 1.00 0.00 ? 3   SER A H    2  
ATOM 2185  H HA   . SER A 1 3   ? 10.300  -3.742  -17.985 1.00 0.00 ? 3   SER A HA   2  
ATOM 2186  H HB2  . SER A 1 3   ? 11.787  -5.623  -17.714 1.00 0.00 ? 3   SER A HB2  2  
ATOM 2187  H HB3  . SER A 1 3   ? 11.583  -5.332  -19.441 1.00 0.00 ? 3   SER A HB3  2  
ATOM 2188  H HG   . SER A 1 3   ? 13.598  -3.975  -19.098 1.00 0.00 ? 3   SER A HG   2  
ATOM 2189  N N    . GLY A 1 4   ? 12.996  -2.075  -17.287 1.00 0.00 ? 4   GLY A N    2  
ATOM 2190  C CA   . GLY A 1 4   ? 13.712  -1.404  -16.218 1.00 0.00 ? 4   GLY A CA   2  
ATOM 2191  C C    . GLY A 1 4   ? 13.425  0.084   -16.174 1.00 0.00 ? 4   GLY A C    2  
ATOM 2192  O O    . GLY A 1 4   ? 14.253  0.895   -16.589 1.00 0.00 ? 4   GLY A O    2  
ATOM 2193  H H    . GLY A 1 4   ? 13.229  -1.892  -18.221 1.00 0.00 ? 4   GLY A H    2  
ATOM 2194  H HA2  . GLY A 1 4   ? 13.424  -1.843  -15.275 1.00 0.00 ? 4   GLY A HA2  2  
ATOM 2195  H HA3  . GLY A 1 4   ? 14.772  -1.549  -16.363 1.00 0.00 ? 4   GLY A HA3  2  
ATOM 2196  N N    . SER A 1 5   ? 12.248  0.444   -15.671 1.00 0.00 ? 5   SER A N    2  
ATOM 2197  C CA   . SER A 1 5   ? 11.852  1.844   -15.579 1.00 0.00 ? 5   SER A CA   2  
ATOM 2198  C C    . SER A 1 5   ? 12.385  2.477   -14.298 1.00 0.00 ? 5   SER A C    2  
ATOM 2199  O O    . SER A 1 5   ? 12.527  1.808   -13.275 1.00 0.00 ? 5   SER A O    2  
ATOM 2200  C CB   . SER A 1 5   ? 10.328  1.968   -15.627 1.00 0.00 ? 5   SER A CB   2  
ATOM 2201  O OG   . SER A 1 5   ? 9.933   3.301   -15.903 1.00 0.00 ? 5   SER A OG   2  
ATOM 2202  H H    . SER A 1 5   ? 11.631  -0.250  -15.357 1.00 0.00 ? 5   SER A H    2  
ATOM 2203  H HA   . SER A 1 5   ? 12.273  2.364   -16.427 1.00 0.00 ? 5   SER A HA   2  
ATOM 2204  H HB2  . SER A 1 5   ? 9.940   1.324   -16.401 1.00 0.00 ? 5   SER A HB2  2  
ATOM 2205  H HB3  . SER A 1 5   ? 9.915   1.673   -14.673 1.00 0.00 ? 5   SER A HB3  2  
ATOM 2206  H HG   . SER A 1 5   ? 9.090   3.297   -16.362 1.00 0.00 ? 5   SER A HG   2  
ATOM 2207  N N    . SER A 1 6   ? 12.679  3.771   -14.363 1.00 0.00 ? 6   SER A N    2  
ATOM 2208  C CA   . SER A 1 6   ? 13.201  4.495   -13.210 1.00 0.00 ? 6   SER A CA   2  
ATOM 2209  C C    . SER A 1 6   ? 12.076  4.873   -12.251 1.00 0.00 ? 6   SER A C    2  
ATOM 2210  O O    . SER A 1 6   ? 11.119  5.545   -12.633 1.00 0.00 ? 6   SER A O    2  
ATOM 2211  C CB   . SER A 1 6   ? 13.943  5.754   -13.664 1.00 0.00 ? 6   SER A CB   2  
ATOM 2212  O OG   . SER A 1 6   ? 15.293  5.463   -13.983 1.00 0.00 ? 6   SER A OG   2  
ATOM 2213  H H    . SER A 1 6   ? 12.544  4.250   -15.207 1.00 0.00 ? 6   SER A H    2  
ATOM 2214  H HA   . SER A 1 6   ? 13.893  3.845   -12.695 1.00 0.00 ? 6   SER A HA   2  
ATOM 2215  H HB2  . SER A 1 6   ? 13.458  6.159   -14.539 1.00 0.00 ? 6   SER A HB2  2  
ATOM 2216  H HB3  . SER A 1 6   ? 13.923  6.486   -12.870 1.00 0.00 ? 6   SER A HB3  2  
ATOM 2217  H HG   . SER A 1 6   ? 15.376  5.329   -14.930 1.00 0.00 ? 6   SER A HG   2  
ATOM 2218  N N    . GLY A 1 7   ? 12.199  4.435   -11.001 1.00 0.00 ? 7   GLY A N    2  
ATOM 2219  C CA   . GLY A 1 7   ? 11.186  4.736   -10.007 1.00 0.00 ? 7   GLY A CA   2  
ATOM 2220  C C    . GLY A 1 7   ? 9.789   4.771   -10.593 1.00 0.00 ? 7   GLY A C    2  
ATOM 2221  O O    . GLY A 1 7   ? 9.271   5.839   -10.917 1.00 0.00 ? 7   GLY A O    2  
ATOM 2222  H H    . GLY A 1 7   ? 12.984  3.903   -10.753 1.00 0.00 ? 7   GLY A H    2  
ATOM 2223  H HA2  . GLY A 1 7   ? 11.222  3.983   -9.233  1.00 0.00 ? 7   GLY A HA2  2  
ATOM 2224  H HA3  . GLY A 1 7   ? 11.404  5.699   -9.568  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 2225  N N    . TYR A 1 8   ? 9.179   3.599   -10.732 1.00 0.00 ? 8   TYR A N    2  
ATOM 2226  C CA   . TYR A 1 8   ? 7.834   3.499   -11.288 1.00 0.00 ? 8   TYR A CA   2  
ATOM 2227  C C    . TYR A 1 8   ? 6.903   2.762   -10.331 1.00 0.00 ? 8   TYR A C    2  
ATOM 2228  O O    . TYR A 1 8   ? 7.191   1.643   -9.905  1.00 0.00 ? 8   TYR A O    2  
ATOM 2229  C CB   . TYR A 1 8   ? 7.870   2.780   -12.638 1.00 0.00 ? 8   TYR A CB   2  
ATOM 2230  C CG   . TYR A 1 8   ? 8.166   1.301   -12.529 1.00 0.00 ? 8   TYR A CG   2  
ATOM 2231  C CD1  . TYR A 1 8   ? 9.408   0.851   -12.097 1.00 0.00 ? 8   TYR A CD1  2  
ATOM 2232  C CD2  . TYR A 1 8   ? 7.205   0.354   -12.859 1.00 0.00 ? 8   TYR A CD2  2  
ATOM 2233  C CE1  . TYR A 1 8   ? 9.683   -0.499  -11.996 1.00 0.00 ? 8   TYR A CE1  2  
ATOM 2234  C CE2  . TYR A 1 8   ? 7.470   -0.998  -12.760 1.00 0.00 ? 8   TYR A CE2  2  
ATOM 2235  C CZ   . TYR A 1 8   ? 8.711   -1.419  -12.328 1.00 0.00 ? 8   TYR A CZ   2  
ATOM 2236  O OH   . TYR A 1 8   ? 8.980   -2.765  -12.229 1.00 0.00 ? 8   TYR A OH   2  
ATOM 2237  H H    . TYR A 1 8   ? 9.643   2.782   -10.456 1.00 0.00 ? 8   TYR A H    2  
ATOM 2238  H HA   . TYR A 1 8   ? 7.461   4.502   -11.436 1.00 0.00 ? 8   TYR A HA   2  
ATOM 2239  H HB2  . TYR A 1 8   ? 6.913   2.891   -13.123 1.00 0.00 ? 8   TYR A HB2  2  
ATOM 2240  H HB3  . TYR A 1 8   ? 8.636   3.227   -13.256 1.00 0.00 ? 8   TYR A HB3  2  
ATOM 2241  H HD1  . TYR A 1 8   ? 10.167  1.575   -11.837 1.00 0.00 ? 8   TYR A HD1  2  
ATOM 2242  H HD2  . TYR A 1 8   ? 6.234   0.688   -13.197 1.00 0.00 ? 8   TYR A HD2  2  
ATOM 2243  H HE1  . TYR A 1 8   ? 10.654  -0.829  -11.658 1.00 0.00 ? 8   TYR A HE1  2  
ATOM 2244  H HE2  . TYR A 1 8   ? 6.710   -1.719  -13.020 1.00 0.00 ? 8   TYR A HE2  2  
ATOM 2245  H HH   . TYR A 1 8   ? 9.833   -2.891  -11.808 1.00 0.00 ? 8   TYR A HH   2  
ATOM 2246  N N    . ILE A 1 9   ? 5.784   3.397   -9.999  1.00 0.00 ? 9   ILE A N    2  
ATOM 2247  C CA   . ILE A 1 9   ? 4.808   2.801   -9.094  1.00 0.00 ? 9   ILE A CA   2  
ATOM 2248  C C    . ILE A 1 9   ? 3.455   2.634   -9.778  1.00 0.00 ? 9   ILE A C    2  
ATOM 2249  O O    . ILE A 1 9   ? 2.985   3.531   -10.477 1.00 0.00 ? 9   ILE A O    2  
ATOM 2250  C CB   . ILE A 1 9   ? 4.627   3.652   -7.823  1.00 0.00 ? 9   ILE A CB   2  
ATOM 2251  C CG1  . ILE A 1 9   ? 5.936   3.714   -7.034  1.00 0.00 ? 9   ILE A CG1  2  
ATOM 2252  C CG2  . ILE A 1 9   ? 3.509   3.084   -6.961  1.00 0.00 ? 9   ILE A CG2  2  
ATOM 2253  C CD1  . ILE A 1 9   ? 6.044   4.928   -6.138  1.00 0.00 ? 9   ILE A CD1  2  
ATOM 2254  H H    . ILE A 1 9   ? 5.610   4.286   -10.371 1.00 0.00 ? 9   ILE A H    2  
ATOM 2255  H HA   . ILE A 1 9   ? 5.175   1.828   -8.803  1.00 0.00 ? 9   ILE A HA   2  
ATOM 2256  H HB   . ILE A 1 9   ? 4.347   4.650   -8.122  1.00 0.00 ? 9   ILE A HB   2  
ATOM 2257  H HG12 . ILE A 1 9   ? 6.017   2.836   -6.413  1.00 0.00 ? 9   ILE A HG12 2  
ATOM 2258  H HG13 . ILE A 1 9   ? 6.765   3.738   -7.727  1.00 0.00 ? 9   ILE A HG13 2  
ATOM 2259  H HG21 . ILE A 1 9   ? 3.447   3.642   -6.038  1.00 0.00 ? 9   ILE A HG21 2  
ATOM 2260  H HG22 . ILE A 1 9   ? 2.572   3.162   -7.491  1.00 0.00 ? 9   ILE A HG22 2  
ATOM 2261  H HG23 . ILE A 1 9   ? 3.714   2.047   -6.742  1.00 0.00 ? 9   ILE A HG23 2  
ATOM 2262  H HD11 . ILE A 1 9   ? 5.310   5.663   -6.436  1.00 0.00 ? 9   ILE A HD11 2  
ATOM 2263  H HD12 . ILE A 1 9   ? 5.868   4.637   -5.114  1.00 0.00 ? 9   ILE A HD12 2  
ATOM 2264  H HD13 . ILE A 1 9   ? 7.034   5.354   -6.226  1.00 0.00 ? 9   ILE A HD13 2  
ATOM 2265  N N    . LYS A 1 10  ? 2.833   1.479   -9.570  1.00 0.00 ? 10  LYS A N    2  
ATOM 2266  C CA   . LYS A 1 10  ? 1.532   1.193   -10.163 1.00 0.00 ? 10  LYS A CA   2  
ATOM 2267  C C    . LYS A 1 10  ? 0.405   1.737   -9.290  1.00 0.00 ? 10  LYS A C    2  
ATOM 2268  O O    . LYS A 1 10  ? 0.015   1.114   -8.302  1.00 0.00 ? 10  LYS A O    2  
ATOM 2269  C CB   . LYS A 1 10  ? 1.357   -0.315  -10.357 1.00 0.00 ? 10  LYS A CB   2  
ATOM 2270  C CG   . LYS A 1 10  ? 0.209   -0.680  -11.282 1.00 0.00 ? 10  LYS A CG   2  
ATOM 2271  C CD   . LYS A 1 10  ? 0.479   -1.982  -12.019 1.00 0.00 ? 10  LYS A CD   2  
ATOM 2272  C CE   . LYS A 1 10  ? -0.782  -2.521  -12.677 1.00 0.00 ? 10  LYS A CE   2  
ATOM 2273  N NZ   . LYS A 1 10  ? -0.693  -3.986  -12.929 1.00 0.00 ? 10  LYS A NZ   2  
ATOM 2274  H H    . LYS A 1 10  ? 3.259   0.802   -9.002  1.00 0.00 ? 10  LYS A H    2  
ATOM 2275  H HA   . LYS A 1 10  ? 1.492   1.678   -11.126 1.00 0.00 ? 10  LYS A HA   2  
ATOM 2276  H HB2  . LYS A 1 10  ? 2.269   -0.720  -10.771 1.00 0.00 ? 10  LYS A HB2  2  
ATOM 2277  H HB3  . LYS A 1 10  ? 1.175   -0.771  -9.395  1.00 0.00 ? 10  LYS A HB3  2  
ATOM 2278  H HG2  . LYS A 1 10  ? -0.692  -0.790  -10.697 1.00 0.00 ? 10  LYS A HG2  2  
ATOM 2279  H HG3  . LYS A 1 10  ? 0.076   0.112   -12.006 1.00 0.00 ? 10  LYS A HG3  2  
ATOM 2280  H HD2  . LYS A 1 10  ? 1.223   -1.806  -12.781 1.00 0.00 ? 10  LYS A HD2  2  
ATOM 2281  H HD3  . LYS A 1 10  ? 0.848   -2.714  -11.315 1.00 0.00 ? 10  LYS A HD3  2  
ATOM 2282  H HE2  . LYS A 1 10  ? -1.623  -2.326  -12.029 1.00 0.00 ? 10  LYS A HE2  2  
ATOM 2283  H HE3  . LYS A 1 10  ? -0.927  -2.011  -13.618 1.00 0.00 ? 10  LYS A HE3  2  
ATOM 2284  H HZ1  . LYS A 1 10  ? -0.494  -4.164  -13.934 1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 2285  H HZ2  . LYS A 1 10  ? -1.591  -4.447  -12.679 1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 2286  H HZ3  . LYS A 1 10  ? 0.069   -4.402  -12.356 1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 2287  N N    . TYR A 1 11  ? -0.116  2.901   -9.663  1.00 0.00 ? 11  TYR A N    2  
ATOM 2288  C CA   . TYR A 1 11  ? -1.197  3.529   -8.914  1.00 0.00 ? 11  TYR A CA   2  
ATOM 2289  C C    . TYR A 1 11  ? -2.507  2.772   -9.110  1.00 0.00 ? 11  TYR A C    2  
ATOM 2290  O O    . TYR A 1 11  ? -2.912  2.491   -10.238 1.00 0.00 ? 11  TYR A O    2  
ATOM 2291  C CB   . TYR A 1 11  ? -1.367  4.986   -9.348  1.00 0.00 ? 11  TYR A CB   2  
ATOM 2292  C CG   . TYR A 1 11  ? -0.116  5.819   -9.178  1.00 0.00 ? 11  TYR A CG   2  
ATOM 2293  C CD1  . TYR A 1 11  ? 0.145   6.480   -7.985  1.00 0.00 ? 11  TYR A CD1  2  
ATOM 2294  C CD2  . TYR A 1 11  ? 0.804   5.943   -10.211 1.00 0.00 ? 11  TYR A CD2  2  
ATOM 2295  C CE1  . TYR A 1 11  ? 1.286   7.242   -7.825  1.00 0.00 ? 11  TYR A CE1  2  
ATOM 2296  C CE2  . TYR A 1 11  ? 1.949   6.702   -10.061 1.00 0.00 ? 11  TYR A CE2  2  
ATOM 2297  C CZ   . TYR A 1 11  ? 2.185   7.350   -8.866  1.00 0.00 ? 11  TYR A CZ   2  
ATOM 2298  O OH   . TYR A 1 11  ? 3.324   8.107   -8.711  1.00 0.00 ? 11  TYR A OH   2  
ATOM 2299  H H    . TYR A 1 11  ? 0.237   3.350   -10.460 1.00 0.00 ? 11  TYR A H    2  
ATOM 2300  H HA   . TYR A 1 11  ? -0.934  3.505   -7.867  1.00 0.00 ? 11  TYR A HA   2  
ATOM 2301  H HB2  . TYR A 1 11  ? -1.644  5.014   -10.390 1.00 0.00 ? 11  TYR A HB2  2  
ATOM 2302  H HB3  . TYR A 1 11  ? -2.151  5.441   -8.760  1.00 0.00 ? 11  TYR A HB3  2  
ATOM 2303  H HD1  . TYR A 1 11  ? -0.561  6.393   -7.171  1.00 0.00 ? 11  TYR A HD1  2  
ATOM 2304  H HD2  . TYR A 1 11  ? 0.616   5.435   -11.146 1.00 0.00 ? 11  TYR A HD2  2  
ATOM 2305  H HE1  . TYR A 1 11  ? 1.472   7.749   -6.890  1.00 0.00 ? 11  TYR A HE1  2  
ATOM 2306  H HE2  . TYR A 1 11  ? 2.653   6.787   -10.876 1.00 0.00 ? 11  TYR A HE2  2  
ATOM 2307  H HH   . TYR A 1 11  ? 3.137   9.018   -8.949  1.00 0.00 ? 11  TYR A HH   2  
ATOM 2308  N N    . PHE A 1 12  ? -3.166  2.446   -8.003  1.00 0.00 ? 12  PHE A N    2  
ATOM 2309  C CA   . PHE A 1 12  ? -4.430  1.722   -8.051  1.00 0.00 ? 12  PHE A CA   2  
ATOM 2310  C C    . PHE A 1 12  ? -5.599  2.643   -7.714  1.00 0.00 ? 12  PHE A C    2  
ATOM 2311  O O    . PHE A 1 12  ? -5.416  3.697   -7.107  1.00 0.00 ? 12  PHE A O    2  
ATOM 2312  C CB   . PHE A 1 12  ? -4.402  0.540   -7.080  1.00 0.00 ? 12  PHE A CB   2  
ATOM 2313  C CG   . PHE A 1 12  ? -3.421  -0.530  -7.465  1.00 0.00 ? 12  PHE A CG   2  
ATOM 2314  C CD1  . PHE A 1 12  ? -3.538  -1.192  -8.677  1.00 0.00 ? 12  PHE A CD1  2  
ATOM 2315  C CD2  . PHE A 1 12  ? -2.382  -0.874  -6.616  1.00 0.00 ? 12  PHE A CD2  2  
ATOM 2316  C CE1  . PHE A 1 12  ? -2.637  -2.177  -9.035  1.00 0.00 ? 12  PHE A CE1  2  
ATOM 2317  C CE2  . PHE A 1 12  ? -1.477  -1.858  -6.969  1.00 0.00 ? 12  PHE A CE2  2  
ATOM 2318  C CZ   . PHE A 1 12  ? -1.606  -2.511  -8.179  1.00 0.00 ? 12  PHE A CZ   2  
ATOM 2319  H H    . PHE A 1 12  ? -2.792  2.699   -7.132  1.00 0.00 ? 12  PHE A H    2  
ATOM 2320  H HA   . PHE A 1 12  ? -4.560  1.348   -9.055  1.00 0.00 ? 12  PHE A HA   2  
ATOM 2321  H HB2  . PHE A 1 12  ? -4.134  0.897   -6.097  1.00 0.00 ? 12  PHE A HB2  2  
ATOM 2322  H HB3  . PHE A 1 12  ? -5.384  0.093   -7.040  1.00 0.00 ? 12  PHE A HB3  2  
ATOM 2323  H HD1  . PHE A 1 12  ? -4.345  -0.932  -9.347  1.00 0.00 ? 12  PHE A HD1  2  
ATOM 2324  H HD2  . PHE A 1 12  ? -2.281  -0.365  -5.669  1.00 0.00 ? 12  PHE A HD2  2  
ATOM 2325  H HE1  . PHE A 1 12  ? -2.740  -2.685  -9.982  1.00 0.00 ? 12  PHE A HE1  2  
ATOM 2326  H HE2  . PHE A 1 12  ? -0.672  -2.117  -6.298  1.00 0.00 ? 12  PHE A HE2  2  
ATOM 2327  H HZ   . PHE A 1 12  ? -0.900  -3.279  -8.458  1.00 0.00 ? 12  PHE A HZ   2  
ATOM 2328  N N    . ASN A 1 13  ? -6.799  2.238   -8.115  1.00 0.00 ? 13  ASN A N    2  
ATOM 2329  C CA   . ASN A 1 13  ? -7.998  3.027   -7.857  1.00 0.00 ? 13  ASN A CA   2  
ATOM 2330  C C    . ASN A 1 13  ? -8.782  2.457   -6.678  1.00 0.00 ? 13  ASN A C    2  
ATOM 2331  O O    . ASN A 1 13  ? -8.376  1.467   -6.071  1.00 0.00 ? 13  ASN A O    2  
ATOM 2332  C CB   . ASN A 1 13  ? -8.886  3.066   -9.103  1.00 0.00 ? 13  ASN A CB   2  
ATOM 2333  C CG   . ASN A 1 13  ? -9.700  4.342   -9.193  1.00 0.00 ? 13  ASN A CG   2  
ATOM 2334  O OD1  . ASN A 1 13  ? -9.207  5.429   -8.891  1.00 0.00 ? 13  ASN A OD1  2  
ATOM 2335  N ND2  . ASN A 1 13  ? -10.955 4.215   -9.609  1.00 0.00 ? 13  ASN A ND2  2  
ATOM 2336  H H    . ASN A 1 13  ? -6.881  1.387   -8.595  1.00 0.00 ? 13  ASN A H    2  
ATOM 2337  H HA   . ASN A 1 13  ? -7.687  4.032   -7.616  1.00 0.00 ? 13  ASN A HA   2  
ATOM 2338  H HB2  . ASN A 1 13  ? -8.263  2.997   -9.983  1.00 0.00 ? 13  ASN A HB2  2  
ATOM 2339  H HB3  . ASN A 1 13  ? -9.565  2.228   -9.080  1.00 0.00 ? 13  ASN A HB3  2  
ATOM 2340  H HD21 . ASN A 1 13  ? -11.280 3.318   -9.832  1.00 0.00 ? 13  ASN A HD21 2  
ATOM 2341  H HD22 . ASN A 1 13  ? -11.503 5.024   -9.677  1.00 0.00 ? 13  ASN A HD22 2  
ATOM 2342  N N    . ASP A 1 14  ? -9.906  3.090   -6.362  1.00 0.00 ? 14  ASP A N    2  
ATOM 2343  C CA   . ASP A 1 14  ? -10.749 2.645   -5.257  1.00 0.00 ? 14  ASP A CA   2  
ATOM 2344  C C    . ASP A 1 14  ? -11.491 1.363   -5.622  1.00 0.00 ? 14  ASP A C    2  
ATOM 2345  O O    . ASP A 1 14  ? -11.814 0.552   -4.754  1.00 0.00 ? 14  ASP A O    2  
ATOM 2346  C CB   . ASP A 1 14  ? -11.749 3.739   -4.879  1.00 0.00 ? 14  ASP A CB   2  
ATOM 2347  C CG   . ASP A 1 14  ? -12.910 3.204   -4.064  1.00 0.00 ? 14  ASP A CG   2  
ATOM 2348  O OD1  . ASP A 1 14  ? -12.663 2.625   -2.985  1.00 0.00 ? 14  ASP A OD1  2  
ATOM 2349  O OD2  . ASP A 1 14  ? -14.067 3.365   -4.506  1.00 0.00 ? 14  ASP A OD2  2  
ATOM 2350  H H    . ASP A 1 14  ? -10.177 3.874   -6.884  1.00 0.00 ? 14  ASP A H    2  
ATOM 2351  H HA   . ASP A 1 14  ? -10.108 2.447   -4.411  1.00 0.00 ? 14  ASP A HA   2  
ATOM 2352  H HB2  . ASP A 1 14  ? -11.242 4.494   -4.295  1.00 0.00 ? 14  ASP A HB2  2  
ATOM 2353  H HB3  . ASP A 1 14  ? -12.140 4.187   -5.780  1.00 0.00 ? 14  ASP A HB3  2  
ATOM 2354  N N    . LYS A 1 15  ? -11.760 1.188   -6.911  1.00 0.00 ? 15  LYS A N    2  
ATOM 2355  C CA   . LYS A 1 15  ? -12.465 0.005   -7.392  1.00 0.00 ? 15  LYS A CA   2  
ATOM 2356  C C    . LYS A 1 15  ? -11.483 -1.035  -7.923  1.00 0.00 ? 15  LYS A C    2  
ATOM 2357  O O    . LYS A 1 15  ? -11.479 -2.184  -7.480  1.00 0.00 ? 15  LYS A O    2  
ATOM 2358  C CB   . LYS A 1 15  ? -13.459 0.390   -8.489  1.00 0.00 ? 15  LYS A CB   2  
ATOM 2359  C CG   . LYS A 1 15  ? -14.610 -0.590  -8.638  1.00 0.00 ? 15  LYS A CG   2  
ATOM 2360  C CD   . LYS A 1 15  ? -14.244 -1.746  -9.554  1.00 0.00 ? 15  LYS A CD   2  
ATOM 2361  C CE   . LYS A 1 15  ? -15.362 -2.775  -9.627  1.00 0.00 ? 15  LYS A CE   2  
ATOM 2362  N NZ   . LYS A 1 15  ? -15.432 -3.605  -8.393  1.00 0.00 ? 15  LYS A NZ   2  
ATOM 2363  H H    . LYS A 1 15  ? -11.477 1.870   -7.556  1.00 0.00 ? 15  LYS A H    2  
ATOM 2364  H HA   . LYS A 1 15  ? -13.006 -0.420  -6.560  1.00 0.00 ? 15  LYS A HA   2  
ATOM 2365  H HB2  . LYS A 1 15  ? -13.869 1.363   -8.262  1.00 0.00 ? 15  LYS A HB2  2  
ATOM 2366  H HB3  . LYS A 1 15  ? -12.934 0.441   -9.432  1.00 0.00 ? 15  LYS A HB3  2  
ATOM 2367  H HG2  . LYS A 1 15  ? -14.864 -0.984  -7.665  1.00 0.00 ? 15  LYS A HG2  2  
ATOM 2368  H HG3  . LYS A 1 15  ? -15.463 -0.070  -9.052  1.00 0.00 ? 15  LYS A HG3  2  
ATOM 2369  H HD2  . LYS A 1 15  ? -14.058 -1.362  -10.546 1.00 0.00 ? 15  LYS A HD2  2  
ATOM 2370  H HD3  . LYS A 1 15  ? -13.350 -2.223  -9.178  1.00 0.00 ? 15  LYS A HD3  2  
ATOM 2371  H HE2  . LYS A 1 15  ? -16.300 -2.259  -9.758  1.00 0.00 ? 15  LYS A HE2  2  
ATOM 2372  H HE3  . LYS A 1 15  ? -15.184 -3.420  -10.475 1.00 0.00 ? 15  LYS A HE3  2  
ATOM 2373  H HZ1  . LYS A 1 15  ? -15.380 -2.998  -7.550  1.00 0.00 ? 15  LYS A HZ1  2  
ATOM 2374  H HZ2  . LYS A 1 15  ? -14.641 -4.279  -8.370  1.00 0.00 ? 15  LYS A HZ2  2  
ATOM 2375  H HZ3  . LYS A 1 15  ? -16.326 -4.136  -8.370  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM 2376  N N    . THR A 1 16  ? -10.650 -0.624  -8.874  1.00 0.00 ? 16  THR A N    2  
ATOM 2377  C CA   . THR A 1 16  ? -9.663  -1.520  -9.464  1.00 0.00 ? 16  THR A CA   2  
ATOM 2378  C C    . THR A 1 16  ? -8.874  -2.256  -8.387  1.00 0.00 ? 16  THR A C    2  
ATOM 2379  O O    . THR A 1 16  ? -8.624  -3.456  -8.500  1.00 0.00 ? 16  THR A O    2  
ATOM 2380  C CB   . THR A 1 16  ? -8.681  -0.754  -10.371 1.00 0.00 ? 16  THR A CB   2  
ATOM 2381  O OG1  . THR A 1 16  ? -7.991  0.245   -9.612  1.00 0.00 ? 16  THR A OG1  2  
ATOM 2382  C CG2  . THR A 1 16  ? -9.414  -0.100  -11.532 1.00 0.00 ? 16  THR A CG2  2  
ATOM 2383  H H    . THR A 1 16  ? -10.701 0.304   -9.185  1.00 0.00 ? 16  THR A H    2  
ATOM 2384  H HA   . THR A 1 16  ? -10.190 -2.243  -10.070 1.00 0.00 ? 16  THR A HA   2  
ATOM 2385  H HB   . THR A 1 16  ? -7.960  -1.455  -10.768 1.00 0.00 ? 16  THR A HB   2  
ATOM 2386  H HG1  . THR A 1 16  ? -8.536  0.515   -8.868  1.00 0.00 ? 16  THR A HG1  2  
ATOM 2387  H HG21 . THR A 1 16  ? -8.706  0.157   -12.306 1.00 0.00 ? 16  THR A HG21 2  
ATOM 2388  H HG22 . THR A 1 16  ? -9.910  0.795   -11.186 1.00 0.00 ? 16  THR A HG22 2  
ATOM 2389  H HG23 . THR A 1 16  ? -10.146 -0.787  -11.928 1.00 0.00 ? 16  THR A HG23 2  
ATOM 2390  N N    . ILE A 1 17  ? -8.486  -1.530  -7.345  1.00 0.00 ? 17  ILE A N    2  
ATOM 2391  C CA   . ILE A 1 17  ? -7.727  -2.116  -6.247  1.00 0.00 ? 17  ILE A CA   2  
ATOM 2392  C C    . ILE A 1 17  ? -8.240  -3.511  -5.907  1.00 0.00 ? 17  ILE A C    2  
ATOM 2393  O O    . ILE A 1 17  ? -7.501  -4.345  -5.384  1.00 0.00 ? 17  ILE A O    2  
ATOM 2394  C CB   . ILE A 1 17  ? -7.792  -1.236  -4.984  1.00 0.00 ? 17  ILE A CB   2  
ATOM 2395  C CG1  . ILE A 1 17  ? -7.020  -1.892  -3.838  1.00 0.00 ? 17  ILE A CG1  2  
ATOM 2396  C CG2  . ILE A 1 17  ? -9.239  -0.991  -4.583  1.00 0.00 ? 17  ILE A CG2  2  
ATOM 2397  C CD1  . ILE A 1 17  ? -6.632  -0.926  -2.740  1.00 0.00 ? 17  ILE A CD1  2  
ATOM 2398  H H    . ILE A 1 17  ? -8.716  -0.578  -7.312  1.00 0.00 ? 17  ILE A H    2  
ATOM 2399  H HA   . ILE A 1 17  ? -6.695  -2.189  -6.557  1.00 0.00 ? 17  ILE A HA   2  
ATOM 2400  H HB   . ILE A 1 17  ? -7.341  -0.282  -5.214  1.00 0.00 ? 17  ILE A HB   2  
ATOM 2401  H HG12 . ILE A 1 17  ? -7.629  -2.666  -3.398  1.00 0.00 ? 17  ILE A HG12 2  
ATOM 2402  H HG13 . ILE A 1 17  ? -6.114  -2.331  -4.230  1.00 0.00 ? 17  ILE A HG13 2  
ATOM 2403  H HG21 . ILE A 1 17  ? -9.539  -1.727  -3.851  1.00 0.00 ? 17  ILE A HG21 2  
ATOM 2404  H HG22 . ILE A 1 17  ? -9.332  -0.003  -4.158  1.00 0.00 ? 17  ILE A HG22 2  
ATOM 2405  H HG23 . ILE A 1 17  ? -9.873  -1.070  -5.454  1.00 0.00 ? 17  ILE A HG23 2  
ATOM 2406  H HD11 . ILE A 1 17  ? -7.499  -0.359  -2.436  1.00 0.00 ? 17  ILE A HD11 2  
ATOM 2407  H HD12 . ILE A 1 17  ? -6.245  -1.477  -1.896  1.00 0.00 ? 17  ILE A HD12 2  
ATOM 2408  H HD13 . ILE A 1 17  ? -5.872  -0.250  -3.107  1.00 0.00 ? 17  ILE A HD13 2  
ATOM 2409  N N    . ASP A 1 18  ? -9.510  -3.758  -6.208  1.00 0.00 ? 18  ASP A N    2  
ATOM 2410  C CA   . ASP A 1 18  ? -10.122 -5.054  -5.938  1.00 0.00 ? 18  ASP A CA   2  
ATOM 2411  C C    . ASP A 1 18  ? -9.843  -6.034  -7.073  1.00 0.00 ? 18  ASP A C    2  
ATOM 2412  O O    . ASP A 1 18  ? -9.252  -7.092  -6.860  1.00 0.00 ? 18  ASP A O    2  
ATOM 2413  C CB   . ASP A 1 18  ? -11.631 -4.898  -5.742  1.00 0.00 ? 18  ASP A CB   2  
ATOM 2414  C CG   . ASP A 1 18  ? -12.293 -6.187  -5.295  1.00 0.00 ? 18  ASP A CG   2  
ATOM 2415  O OD1  . ASP A 1 18  ? -11.687 -6.915  -4.481  1.00 0.00 ? 18  ASP A OD1  2  
ATOM 2416  O OD2  . ASP A 1 18  ? -13.418 -6.467  -5.759  1.00 0.00 ? 18  ASP A OD2  2  
ATOM 2417  H H    . ASP A 1 18  ? -10.049 -3.052  -6.624  1.00 0.00 ? 18  ASP A H    2  
ATOM 2418  H HA   . ASP A 1 18  ? -9.689  -5.442  -5.029  1.00 0.00 ? 18  ASP A HA   2  
ATOM 2419  H HB2  . ASP A 1 18  ? -11.814 -4.143  -4.991  1.00 0.00 ? 18  ASP A HB2  2  
ATOM 2420  H HB3  . ASP A 1 18  ? -12.079 -4.588  -6.674  1.00 0.00 ? 18  ASP A HB3  2  
ATOM 2421  N N    . GLU A 1 19  ? -10.274 -5.675  -8.278  1.00 0.00 ? 19  GLU A N    2  
ATOM 2422  C CA   . GLU A 1 19  ? -10.071 -6.525  -9.446  1.00 0.00 ? 19  GLU A CA   2  
ATOM 2423  C C    . GLU A 1 19  ? -8.614  -6.965  -9.552  1.00 0.00 ? 19  GLU A C    2  
ATOM 2424  O O    . GLU A 1 19  ? -8.325  -8.108  -9.904  1.00 0.00 ? 19  GLU A O    2  
ATOM 2425  C CB   . GLU A 1 19  ? -10.487 -5.786  -10.720 1.00 0.00 ? 19  GLU A CB   2  
ATOM 2426  C CG   . GLU A 1 19  ? -9.450  -4.792  -11.213 1.00 0.00 ? 19  GLU A CG   2  
ATOM 2427  C CD   . GLU A 1 19  ? -9.812  -4.189  -12.556 1.00 0.00 ? 19  GLU A CD   2  
ATOM 2428  O OE1  . GLU A 1 19  ? -10.977 -4.342  -12.980 1.00 0.00 ? 19  GLU A OE1  2  
ATOM 2429  O OE2  . GLU A 1 19  ? -8.931  -3.564  -13.183 1.00 0.00 ? 19  GLU A OE2  2  
ATOM 2430  H H    . GLU A 1 19  ? -10.739 -4.819  -8.384  1.00 0.00 ? 19  GLU A H    2  
ATOM 2431  H HA   . GLU A 1 19  ? -10.692 -7.401  -9.330  1.00 0.00 ? 19  GLU A HA   2  
ATOM 2432  H HB2  . GLU A 1 19  ? -10.661 -6.511  -11.501 1.00 0.00 ? 19  GLU A HB2  2  
ATOM 2433  H HB3  . GLU A 1 19  ? -11.405 -5.251  -10.527 1.00 0.00 ? 19  GLU A HB3  2  
ATOM 2434  H HG2  . GLU A 1 19  ? -9.362  -3.995  -10.490 1.00 0.00 ? 19  GLU A HG2  2  
ATOM 2435  H HG3  . GLU A 1 19  ? -8.500  -5.298  -11.306 1.00 0.00 ? 19  GLU A HG3  2  
ATOM 2436  N N    . GLU A 1 20  ? -7.701  -6.048  -9.246  1.00 0.00 ? 20  GLU A N    2  
ATOM 2437  C CA   . GLU A 1 20  ? -6.274  -6.341  -9.309  1.00 0.00 ? 20  GLU A CA   2  
ATOM 2438  C C    . GLU A 1 20  ? -5.887  -7.384  -8.265  1.00 0.00 ? 20  GLU A C    2  
ATOM 2439  O O    . GLU A 1 20  ? -5.386  -8.459  -8.600  1.00 0.00 ? 20  GLU A O    2  
ATOM 2440  C CB   . GLU A 1 20  ? -5.459  -5.064  -9.097  1.00 0.00 ? 20  GLU A CB   2  
ATOM 2441  C CG   . GLU A 1 20  ? -3.957  -5.280  -9.182  1.00 0.00 ? 20  GLU A CG   2  
ATOM 2442  C CD   . GLU A 1 20  ? -3.499  -5.651  -10.579 1.00 0.00 ? 20  GLU A CD   2  
ATOM 2443  O OE1  . GLU A 1 20  ? -3.665  -6.827  -10.965 1.00 0.00 ? 20  GLU A OE1  2  
ATOM 2444  O OE2  . GLU A 1 20  ? -2.974  -4.765  -11.285 1.00 0.00 ? 20  GLU A OE2  2  
ATOM 2445  H H    . GLU A 1 20  ? -7.994  -5.154  -8.973  1.00 0.00 ? 20  GLU A H    2  
ATOM 2446  H HA   . GLU A 1 20  ? -6.060  -6.735  -10.291 1.00 0.00 ? 20  GLU A HA   2  
ATOM 2447  H HB2  . GLU A 1 20  ? -5.741  -4.342  -9.849  1.00 0.00 ? 20  GLU A HB2  2  
ATOM 2448  H HB3  . GLU A 1 20  ? -5.689  -4.663  -8.121  1.00 0.00 ? 20  GLU A HB3  2  
ATOM 2449  H HG2  . GLU A 1 20  ? -3.458  -4.369  -8.886  1.00 0.00 ? 20  GLU A HG2  2  
ATOM 2450  H HG3  . GLU A 1 20  ? -3.682  -6.075  -8.505  1.00 0.00 ? 20  GLU A HG3  2  
ATOM 2451  N N    . LEU A 1 21  ? -6.121  -7.060  -6.998  1.00 0.00 ? 21  LEU A N    2  
ATOM 2452  C CA   . LEU A 1 21  ? -5.797  -7.968  -5.904  1.00 0.00 ? 21  LEU A CA   2  
ATOM 2453  C C    . LEU A 1 21  ? -6.582  -9.270  -6.025  1.00 0.00 ? 21  LEU A C    2  
ATOM 2454  O O    . LEU A 1 21  ? -6.174  -10.303 -5.496  1.00 0.00 ? 21  LEU A O    2  
ATOM 2455  C CB   . LEU A 1 21  ? -6.094  -7.303  -4.558  1.00 0.00 ? 21  LEU A CB   2  
ATOM 2456  C CG   . LEU A 1 21  ? -5.034  -6.330  -4.042  1.00 0.00 ? 21  LEU A CG   2  
ATOM 2457  C CD1  . LEU A 1 21  ? -5.527  -5.618  -2.792  1.00 0.00 ? 21  LEU A CD1  2  
ATOM 2458  C CD2  . LEU A 1 21  ? -3.729  -7.061  -3.762  1.00 0.00 ? 21  LEU A CD2  2  
ATOM 2459  H H    . LEU A 1 21  ? -6.522  -6.190  -6.793  1.00 0.00 ? 21  LEU A H    2  
ATOM 2460  H HA   . LEU A 1 21  ? -4.742  -8.192  -5.960  1.00 0.00 ? 21  LEU A HA   2  
ATOM 2461  H HB2  . LEU A 1 21  ? -7.021  -6.760  -4.656  1.00 0.00 ? 21  LEU A HB2  2  
ATOM 2462  H HB3  . LEU A 1 21  ? -6.212  -8.086  -3.823  1.00 0.00 ? 21  LEU A HB3  2  
ATOM 2463  H HG   . LEU A 1 21  ? -4.843  -5.581  -4.799  1.00 0.00 ? 21  LEU A HG   2  
ATOM 2464  H HD11 . LEU A 1 21  ? -5.124  -4.617  -2.766  1.00 0.00 ? 21  LEU A HD11 2  
ATOM 2465  H HD12 . LEU A 1 21  ? -5.201  -6.160  -1.917  1.00 0.00 ? 21  LEU A HD12 2  
ATOM 2466  H HD13 . LEU A 1 21  ? -6.606  -5.572  -2.806  1.00 0.00 ? 21  LEU A HD13 2  
ATOM 2467  H HD21 . LEU A 1 21  ? -3.020  -6.376  -3.323  1.00 0.00 ? 21  LEU A HD21 2  
ATOM 2468  H HD22 . LEU A 1 21  ? -3.329  -7.450  -4.687  1.00 0.00 ? 21  LEU A HD22 2  
ATOM 2469  H HD23 . LEU A 1 21  ? -3.913  -7.877  -3.078  1.00 0.00 ? 21  LEU A HD23 2  
ATOM 2470  N N    . GLU A 1 22  ? -7.710  -9.212  -6.726  1.00 0.00 ? 22  GLU A N    2  
ATOM 2471  C CA   . GLU A 1 22  ? -8.551  -10.387 -6.918  1.00 0.00 ? 22  GLU A CA   2  
ATOM 2472  C C    . GLU A 1 22  ? -7.913  -11.358 -7.907  1.00 0.00 ? 22  GLU A C    2  
ATOM 2473  O O    . GLU A 1 22  ? -7.782  -12.550 -7.627  1.00 0.00 ? 22  GLU A O    2  
ATOM 2474  C CB   . GLU A 1 22  ? -9.938  -9.974  -7.414  1.00 0.00 ? 22  GLU A CB   2  
ATOM 2475  C CG   . GLU A 1 22  ? -10.863 -9.494  -6.308  1.00 0.00 ? 22  GLU A CG   2  
ATOM 2476  C CD   . GLU A 1 22  ? -11.382 -10.630 -5.448  1.00 0.00 ? 22  GLU A CD   2  
ATOM 2477  O OE1  . GLU A 1 22  ? -12.009 -11.556 -6.003  1.00 0.00 ? 22  GLU A OE1  2  
ATOM 2478  O OE2  . GLU A 1 22  ? -11.161 -10.592 -4.220  1.00 0.00 ? 22  GLU A OE2  2  
ATOM 2479  H H    . GLU A 1 22  ? -7.983  -8.359  -7.123  1.00 0.00 ? 22  GLU A H    2  
ATOM 2480  H HA   . GLU A 1 22  ? -8.654  -10.881 -5.963  1.00 0.00 ? 22  GLU A HA   2  
ATOM 2481  H HB2  . GLU A 1 22  ? -9.827  -9.176  -8.134  1.00 0.00 ? 22  GLU A HB2  2  
ATOM 2482  H HB3  . GLU A 1 22  ? -10.401 -10.821 -7.899  1.00 0.00 ? 22  GLU A HB3  2  
ATOM 2483  H HG2  . GLU A 1 22  ? -10.322 -8.804  -5.678  1.00 0.00 ? 22  GLU A HG2  2  
ATOM 2484  H HG3  . GLU A 1 22  ? -11.705 -8.987  -6.756  1.00 0.00 ? 22  GLU A HG3  2  
ATOM 2485  N N    . ARG A 1 23  ? -7.518  -10.839 -9.065  1.00 0.00 ? 23  ARG A N    2  
ATOM 2486  C CA   . ARG A 1 23  ? -6.896  -11.659 -10.097 1.00 0.00 ? 23  ARG A CA   2  
ATOM 2487  C C    . ARG A 1 23  ? -5.469  -12.034 -9.707  1.00 0.00 ? 23  ARG A C    2  
ATOM 2488  O O    . ARG A 1 23  ? -5.045  -13.175 -9.888  1.00 0.00 ? 23  ARG A O    2  
ATOM 2489  C CB   . ARG A 1 23  ? -6.891  -10.917 -11.435 1.00 0.00 ? 23  ARG A CB   2  
ATOM 2490  C CG   . ARG A 1 23  ? -5.967  -9.710  -11.459 1.00 0.00 ? 23  ARG A CG   2  
ATOM 2491  C CD   . ARG A 1 23  ? -6.240  -8.823  -12.663 1.00 0.00 ? 23  ARG A CD   2  
ATOM 2492  N NE   . ARG A 1 23  ? -5.641  -9.356  -13.883 1.00 0.00 ? 23  ARG A NE   2  
ATOM 2493  C CZ   . ARG A 1 23  ? -6.239  -10.244 -14.669 1.00 0.00 ? 23  ARG A CZ   2  
ATOM 2494  N NH1  . ARG A 1 23  ? -7.448  -10.695 -14.364 1.00 0.00 ? 23  ARG A NH1  2  
ATOM 2495  N NH2  . ARG A 1 23  ? -5.629  -10.682 -15.763 1.00 0.00 ? 23  ARG A NH2  2  
ATOM 2496  H H    . ARG A 1 23  ? -7.650  -9.882  -9.230  1.00 0.00 ? 23  ARG A H    2  
ATOM 2497  H HA   . ARG A 1 23  ? -7.478  -12.563 -10.199 1.00 0.00 ? 23  ARG A HA   2  
ATOM 2498  H HB2  . ARG A 1 23  ? -6.576  -11.599 -12.211 1.00 0.00 ? 23  ARG A HB2  2  
ATOM 2499  H HB3  . ARG A 1 23  ? -7.894  -10.579 -11.648 1.00 0.00 ? 23  ARG A HB3  2  
ATOM 2500  H HG2  . ARG A 1 23  ? -6.120  -9.133  -10.559 1.00 0.00 ? 23  ARG A HG2  2  
ATOM 2501  H HG3  . ARG A 1 23  ? -4.944  -10.053 -11.499 1.00 0.00 ? 23  ARG A HG3  2  
ATOM 2502  H HD2  . ARG A 1 23  ? -7.308  -8.746  -12.802 1.00 0.00 ? 23  ARG A HD2  2  
ATOM 2503  H HD3  . ARG A 1 23  ? -5.832  -7.842  -12.471 1.00 0.00 ? 23  ARG A HD3  2  
ATOM 2504  H HE   . ARG A 1 23  ? -4.748  -9.036  -14.127 1.00 0.00 ? 23  ARG A HE   2  
ATOM 2505  H HH11 . ARG A 1 23  ? -7.911  -10.366 -13.541 1.00 0.00 ? 23  ARG A HH11 2  
ATOM 2506  H HH12 . ARG A 1 23  ? -7.897  -11.363 -14.958 1.00 0.00 ? 23  ARG A HH12 2  
ATOM 2507  H HH21 . ARG A 1 23  ? -4.718  -10.344 -15.996 1.00 0.00 ? 23  ARG A HH21 2  
ATOM 2508  H HH22 . ARG A 1 23  ? -6.080  -11.350 -16.353 1.00 0.00 ? 23  ARG A HH22 2  
ATOM 2509  N N    . ASP A 1 24  ? -4.734  -11.065 -9.171  1.00 0.00 ? 24  ASP A N    2  
ATOM 2510  C CA   . ASP A 1 24  ? -3.356  -11.293 -8.754  1.00 0.00 ? 24  ASP A CA   2  
ATOM 2511  C C    . ASP A 1 24  ? -3.292  -11.701 -7.285  1.00 0.00 ? 24  ASP A C    2  
ATOM 2512  O O    . ASP A 1 24  ? -2.288  -11.477 -6.610  1.00 0.00 ? 24  ASP A O    2  
ATOM 2513  C CB   . ASP A 1 24  ? -2.516  -10.035 -8.983  1.00 0.00 ? 24  ASP A CB   2  
ATOM 2514  C CG   . ASP A 1 24  ? -1.934  -9.975  -10.381 1.00 0.00 ? 24  ASP A CG   2  
ATOM 2515  O OD1  . ASP A 1 24  ? -2.649  -9.529  -11.303 1.00 0.00 ? 24  ASP A OD1  2  
ATOM 2516  O OD2  . ASP A 1 24  ? -0.763  -10.374 -10.555 1.00 0.00 ? 24  ASP A OD2  2  
ATOM 2517  H H    . ASP A 1 24  ? -5.129  -10.176 -9.052  1.00 0.00 ? 24  ASP A H    2  
ATOM 2518  H HA   . ASP A 1 24  ? -2.956  -12.096 -9.355  1.00 0.00 ? 24  ASP A HA   2  
ATOM 2519  H HB2  . ASP A 1 24  ? -3.138  -9.164  -8.834  1.00 0.00 ? 24  ASP A HB2  2  
ATOM 2520  H HB3  . ASP A 1 24  ? -1.703  -10.018 -8.272  1.00 0.00 ? 24  ASP A HB3  2  
ATOM 2521  N N    . LYS A 1 25  ? -4.372  -12.301 -6.796  1.00 0.00 ? 25  LYS A N    2  
ATOM 2522  C CA   . LYS A 1 25  ? -4.441  -12.741 -5.408  1.00 0.00 ? 25  LYS A CA   2  
ATOM 2523  C C    . LYS A 1 25  ? -3.176  -13.498 -5.014  1.00 0.00 ? 25  LYS A C    2  
ATOM 2524  O O    . LYS A 1 25  ? -2.375  -13.012 -4.214  1.00 0.00 ? 25  LYS A O    2  
ATOM 2525  C CB   . LYS A 1 25  ? -5.668  -13.631 -5.193  1.00 0.00 ? 25  LYS A CB   2  
ATOM 2526  C CG   . LYS A 1 25  ? -6.898  -12.869 -4.731  1.00 0.00 ? 25  LYS A CG   2  
ATOM 2527  C CD   . LYS A 1 25  ? -8.025  -13.812 -4.346  1.00 0.00 ? 25  LYS A CD   2  
ATOM 2528  C CE   . LYS A 1 25  ? -9.387  -13.164 -4.546  1.00 0.00 ? 25  LYS A CE   2  
ATOM 2529  N NZ   . LYS A 1 25  ? -10.496 -14.062 -4.120  1.00 0.00 ? 25  LYS A NZ   2  
ATOM 2530  H H    . LYS A 1 25  ? -5.142  -12.452 -7.384  1.00 0.00 ? 25  LYS A H    2  
ATOM 2531  H HA   . LYS A 1 25  ? -4.530  -11.864 -4.785  1.00 0.00 ? 25  LYS A HA   2  
ATOM 2532  H HB2  . LYS A 1 25  ? -5.905  -14.127 -6.123  1.00 0.00 ? 25  LYS A HB2  2  
ATOM 2533  H HB3  . LYS A 1 25  ? -5.431  -14.376 -4.448  1.00 0.00 ? 25  LYS A HB3  2  
ATOM 2534  H HG2  . LYS A 1 25  ? -6.637  -12.268 -3.873  1.00 0.00 ? 25  LYS A HG2  2  
ATOM 2535  H HG3  . LYS A 1 25  ? -7.235  -12.228 -5.533  1.00 0.00 ? 25  LYS A HG3  2  
ATOM 2536  H HD2  . LYS A 1 25  ? -7.967  -14.699 -4.959  1.00 0.00 ? 25  LYS A HD2  2  
ATOM 2537  H HD3  . LYS A 1 25  ? -7.915  -14.084 -3.305  1.00 0.00 ? 25  LYS A HD3  2  
ATOM 2538  H HE2  . LYS A 1 25  ? -9.428  -12.255 -3.966  1.00 0.00 ? 25  LYS A HE2  2  
ATOM 2539  H HE3  . LYS A 1 25  ? -9.508  -12.928 -5.593  1.00 0.00 ? 25  LYS A HE3  2  
ATOM 2540  H HZ1  . LYS A 1 25  ? -11.275 -13.501 -3.719  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM 2541  H HZ2  . LYS A 1 25  ? -10.158 -14.730 -3.398  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM 2542  H HZ3  . LYS A 1 25  ? -10.854 -14.600 -4.935  1.00 0.00 ? 25  LYS A HZ3  2  
ATOM 2543  N N    . ARG A 1 26  ? -3.003  -14.687 -5.580  1.00 0.00 ? 26  ARG A N    2  
ATOM 2544  C CA   . ARG A 1 26  ? -1.835  -15.510 -5.288  1.00 0.00 ? 26  ARG A CA   2  
ATOM 2545  C C    . ARG A 1 26  ? -0.575  -14.654 -5.200  1.00 0.00 ? 26  ARG A C    2  
ATOM 2546  O O    . ARG A 1 26  ? 0.345   -14.960 -4.442  1.00 0.00 ? 26  ARG A O    2  
ATOM 2547  C CB   . ARG A 1 26  ? -1.661  -16.585 -6.362  1.00 0.00 ? 26  ARG A CB   2  
ATOM 2548  C CG   . ARG A 1 26  ? -1.154  -16.044 -7.688  1.00 0.00 ? 26  ARG A CG   2  
ATOM 2549  C CD   . ARG A 1 26  ? 0.365   -16.064 -7.754  1.00 0.00 ? 26  ARG A CD   2  
ATOM 2550  N NE   . ARG A 1 26  ? 0.903   -17.413 -7.599  1.00 0.00 ? 26  ARG A NE   2  
ATOM 2551  C CZ   . ARG A 1 26  ? 2.143   -17.668 -7.197  1.00 0.00 ? 26  ARG A CZ   2  
ATOM 2552  N NH1  . ARG A 1 26  ? 2.968   -16.671 -6.909  1.00 0.00 ? 26  ARG A NH1  2  
ATOM 2553  N NH2  . ARG A 1 26  ? 2.558   -18.923 -7.080  1.00 0.00 ? 26  ARG A NH2  2  
ATOM 2554  H H    . ARG A 1 26  ? -3.677  -15.020 -6.209  1.00 0.00 ? 26  ARG A H    2  
ATOM 2555  H HA   . ARG A 1 26  ? -1.997  -15.989 -4.334  1.00 0.00 ? 26  ARG A HA   2  
ATOM 2556  H HB2  . ARG A 1 26  ? -0.956  -17.322 -6.006  1.00 0.00 ? 26  ARG A HB2  2  
ATOM 2557  H HB3  . ARG A 1 26  ? -2.613  -17.064 -6.533  1.00 0.00 ? 26  ARG A HB3  2  
ATOM 2558  H HG2  . ARG A 1 26  ? -1.545  -16.655 -8.489  1.00 0.00 ? 26  ARG A HG2  2  
ATOM 2559  H HG3  . ARG A 1 26  ? -1.498  -15.028 -7.807  1.00 0.00 ? 26  ARG A HG3  2  
ATOM 2560  H HD2  . ARG A 1 26  ? 0.676   -15.671 -8.711  1.00 0.00 ? 26  ARG A HD2  2  
ATOM 2561  H HD3  . ARG A 1 26  ? 0.754   -15.438 -6.964  1.00 0.00 ? 26  ARG A HD3  2  
ATOM 2562  H HE   . ARG A 1 26  ? 0.310   -18.164 -7.806  1.00 0.00 ? 26  ARG A HE   2  
ATOM 2563  H HH11 . ARG A 1 26  ? 2.657   -15.725 -6.995  1.00 0.00 ? 26  ARG A HH11 2  
ATOM 2564  H HH12 . ARG A 1 26  ? 3.901   -16.866 -6.605  1.00 0.00 ? 26  ARG A HH12 2  
ATOM 2565  H HH21 . ARG A 1 26  ? 1.939   -19.677 -7.295  1.00 0.00 ? 26  ARG A HH21 2  
ATOM 2566  H HH22 . ARG A 1 26  ? 3.492   -19.114 -6.777  1.00 0.00 ? 26  ARG A HH22 2  
ATOM 2567  N N    . VAL A 1 27  ? -0.540  -13.580 -5.983  1.00 0.00 ? 27  VAL A N    2  
ATOM 2568  C CA   . VAL A 1 27  ? 0.606   -12.679 -5.994  1.00 0.00 ? 27  VAL A CA   2  
ATOM 2569  C C    . VAL A 1 27  ? 0.543   -11.695 -4.832  1.00 0.00 ? 27  VAL A C    2  
ATOM 2570  O O    . VAL A 1 27  ? -0.497  -11.088 -4.573  1.00 0.00 ? 27  VAL A O    2  
ATOM 2571  C CB   . VAL A 1 27  ? 0.689   -11.892 -7.316  1.00 0.00 ? 27  VAL A CB   2  
ATOM 2572  C CG1  . VAL A 1 27  ? 1.790   -10.845 -7.246  1.00 0.00 ? 27  VAL A CG1  2  
ATOM 2573  C CG2  . VAL A 1 27  ? 0.914   -12.838 -8.486  1.00 0.00 ? 27  VAL A CG2  2  
ATOM 2574  H H    . VAL A 1 27  ? -1.304  -13.388 -6.567  1.00 0.00 ? 27  VAL A H    2  
ATOM 2575  H HA   . VAL A 1 27  ? 1.501   -13.277 -5.899  1.00 0.00 ? 27  VAL A HA   2  
ATOM 2576  H HB   . VAL A 1 27  ? -0.252  -11.383 -7.467  1.00 0.00 ? 27  VAL A HB   2  
ATOM 2577  H HG11 . VAL A 1 27  ? 2.476   -10.989 -8.068  1.00 0.00 ? 27  VAL A HG11 2  
ATOM 2578  H HG12 . VAL A 1 27  ? 1.355   -9.859  -7.307  1.00 0.00 ? 27  VAL A HG12 2  
ATOM 2579  H HG13 . VAL A 1 27  ? 2.324   -10.946 -6.312  1.00 0.00 ? 27  VAL A HG13 2  
ATOM 2580  H HG21 . VAL A 1 27  ? 1.360   -13.753 -8.127  1.00 0.00 ? 27  VAL A HG21 2  
ATOM 2581  H HG22 . VAL A 1 27  ? -0.033  -13.060 -8.957  1.00 0.00 ? 27  VAL A HG22 2  
ATOM 2582  H HG23 . VAL A 1 27  ? 1.572   -12.372 -9.204  1.00 0.00 ? 27  VAL A HG23 2  
ATOM 2583  N N    . THR A 1 28  ? 1.663   -11.539 -4.133  1.00 0.00 ? 28  THR A N    2  
ATOM 2584  C CA   . THR A 1 28  ? 1.736   -10.629 -2.997  1.00 0.00 ? 28  THR A CA   2  
ATOM 2585  C C    . THR A 1 28  ? 1.828   -9.179  -3.460  1.00 0.00 ? 28  THR A C    2  
ATOM 2586  O O    . THR A 1 28  ? 2.820   -8.774  -4.066  1.00 0.00 ? 28  THR A O    2  
ATOM 2587  C CB   . THR A 1 28  ? 2.945   -10.947 -2.098  1.00 0.00 ? 28  THR A CB   2  
ATOM 2588  O OG1  . THR A 1 28  ? 2.961   -12.342 -1.774  1.00 0.00 ? 28  THR A OG1  2  
ATOM 2589  C CG2  . THR A 1 28  ? 2.900   -10.125 -0.820  1.00 0.00 ? 28  THR A CG2  2  
ATOM 2590  H H    . THR A 1 28  ? 2.459   -12.051 -4.389  1.00 0.00 ? 28  THR A H    2  
ATOM 2591  H HA   . THR A 1 28  ? 0.836   -10.753 -2.412  1.00 0.00 ? 28  THR A HA   2  
ATOM 2592  H HB   . THR A 1 28  ? 3.850   -10.700 -2.636  1.00 0.00 ? 28  THR A HB   2  
ATOM 2593  H HG1  . THR A 1 28  ? 2.079   -12.706 -1.881  1.00 0.00 ? 28  THR A HG1  2  
ATOM 2594  H HG21 . THR A 1 28  ? 3.899   -9.801  -0.565  1.00 0.00 ? 28  THR A HG21 2  
ATOM 2595  H HG22 . THR A 1 28  ? 2.502   -10.728 -0.018  1.00 0.00 ? 28  THR A HG22 2  
ATOM 2596  H HG23 . THR A 1 28  ? 2.270   -9.262  -0.969  1.00 0.00 ? 28  THR A HG23 2  
ATOM 2597  N N    . TRP A 1 29  ? 0.791   -8.403  -3.170  1.00 0.00 ? 29  TRP A N    2  
ATOM 2598  C CA   . TRP A 1 29  ? 0.756   -6.997  -3.556  1.00 0.00 ? 29  TRP A CA   2  
ATOM 2599  C C    . TRP A 1 29  ? 0.913   -6.094  -2.337  1.00 0.00 ? 29  TRP A C    2  
ATOM 2600  O O    . TRP A 1 29  ? 0.160   -6.206  -1.370  1.00 0.00 ? 29  TRP A O    2  
ATOM 2601  C CB   . TRP A 1 29  ? -0.554  -6.678  -4.278  1.00 0.00 ? 29  TRP A CB   2  
ATOM 2602  C CG   . TRP A 1 29  ? -0.470  -6.847  -5.764  1.00 0.00 ? 29  TRP A CG   2  
ATOM 2603  C CD1  . TRP A 1 29  ? -0.935  -7.902  -6.496  1.00 0.00 ? 29  TRP A CD1  2  
ATOM 2604  C CD2  . TRP A 1 29  ? 0.117   -5.935  -6.699  1.00 0.00 ? 29  TRP A CD2  2  
ATOM 2605  N NE1  . TRP A 1 29  ? -0.672  -7.701  -7.830  1.00 0.00 ? 29  TRP A NE1  2  
ATOM 2606  C CE2  . TRP A 1 29  ? -0.029  -6.501  -7.981  1.00 0.00 ? 29  TRP A CE2  2  
ATOM 2607  C CE3  . TRP A 1 29  ? 0.749   -4.695  -6.579  1.00 0.00 ? 29  TRP A CE3  2  
ATOM 2608  C CZ2  . TRP A 1 29  ? 0.436   -5.869  -9.131  1.00 0.00 ? 29  TRP A CZ2  2  
ATOM 2609  C CZ3  . TRP A 1 29  ? 1.210   -4.069  -7.721  1.00 0.00 ? 29  TRP A CZ3  2  
ATOM 2610  C CH2  . TRP A 1 29  ? 1.051   -4.655  -8.983  1.00 0.00 ? 29  TRP A CH2  2  
ATOM 2611  H H    . TRP A 1 29  ? 0.029   -8.785  -2.684  1.00 0.00 ? 29  TRP A H    2  
ATOM 2612  H HA   . TRP A 1 29  ? 1.581   -6.819  -4.230  1.00 0.00 ? 29  TRP A HA   2  
ATOM 2613  H HB2  . TRP A 1 29  ? -1.329  -7.333  -3.911  1.00 0.00 ? 29  TRP A HB2  2  
ATOM 2614  H HB3  . TRP A 1 29  ? -0.828  -5.652  -4.073  1.00 0.00 ? 29  TRP A HB3  2  
ATOM 2615  H HD1  . TRP A 1 29  ? -1.432  -8.763  -6.075  1.00 0.00 ? 29  TRP A HD1  2  
ATOM 2616  H HE1  . TRP A 1 29  ? -0.910  -8.316  -8.556  1.00 0.00 ? 29  TRP A HE1  2  
ATOM 2617  H HE3  . TRP A 1 29  ? 0.881   -4.227  -5.614  1.00 0.00 ? 29  TRP A HE3  2  
ATOM 2618  H HZ2  . TRP A 1 29  ? 0.321   -6.308  -10.111 1.00 0.00 ? 29  TRP A HZ2  2  
ATOM 2619  H HZ3  . TRP A 1 29  ? 1.702   -3.110  -7.647  1.00 0.00 ? 29  TRP A HZ3  2  
ATOM 2620  H HH2  . TRP A 1 29  ? 1.427   -4.130  -9.848  1.00 0.00 ? 29  TRP A HH2  2  
ATOM 2621  N N    . ILE A 1 30  ? 1.894   -5.200  -2.391  1.00 0.00 ? 30  ILE A N    2  
ATOM 2622  C CA   . ILE A 1 30  ? 2.148   -4.278  -1.292  1.00 0.00 ? 30  ILE A CA   2  
ATOM 2623  C C    . ILE A 1 30  ? 1.742   -2.855  -1.663  1.00 0.00 ? 30  ILE A C    2  
ATOM 2624  O O    . ILE A 1 30  ? 2.422   -2.188  -2.443  1.00 0.00 ? 30  ILE A O    2  
ATOM 2625  C CB   . ILE A 1 30  ? 3.632   -4.285  -0.881  1.00 0.00 ? 30  ILE A CB   2  
ATOM 2626  C CG1  . ILE A 1 30  ? 3.854   -3.376  0.329   1.00 0.00 ? 30  ILE A CG1  2  
ATOM 2627  C CG2  . ILE A 1 30  ? 4.506   -3.847  -2.047  1.00 0.00 ? 30  ILE A CG2  2  
ATOM 2628  C CD1  . ILE A 1 30  ? 5.089   -3.726  1.130   1.00 0.00 ? 30  ILE A CD1  2  
ATOM 2629  H H    . ILE A 1 30  ? 2.461   -5.160  -3.190  1.00 0.00 ? 30  ILE A H    2  
ATOM 2630  H HA   . ILE A 1 30  ? 1.559   -4.599  -0.445  1.00 0.00 ? 30  ILE A HA   2  
ATOM 2631  H HB   . ILE A 1 30  ? 3.905   -5.296  -0.618  1.00 0.00 ? 30  ILE A HB   2  
ATOM 2632  H HG12 . ILE A 1 30  ? 3.956   -2.356  -0.008  1.00 0.00 ? 30  ILE A HG12 2  
ATOM 2633  H HG13 . ILE A 1 30  ? 2.999   -3.450  0.986   1.00 0.00 ? 30  ILE A HG13 2  
ATOM 2634  H HG21 . ILE A 1 30  ? 4.949   -2.887  -1.824  1.00 0.00 ? 30  ILE A HG21 2  
ATOM 2635  H HG22 . ILE A 1 30  ? 5.288   -4.575  -2.203  1.00 0.00 ? 30  ILE A HG22 2  
ATOM 2636  H HG23 . ILE A 1 30  ? 3.904   -3.767  -2.939  1.00 0.00 ? 30  ILE A HG23 2  
ATOM 2637  H HD11 . ILE A 1 30  ? 4.821   -3.851  2.169   1.00 0.00 ? 30  ILE A HD11 2  
ATOM 2638  H HD12 . ILE A 1 30  ? 5.515   -4.643  0.753   1.00 0.00 ? 30  ILE A HD12 2  
ATOM 2639  H HD13 . ILE A 1 30  ? 5.814   -2.929  1.040   1.00 0.00 ? 30  ILE A HD13 2  
ATOM 2640  N N    . VAL A 1 31  ? 0.630   -2.396  -1.098  1.00 0.00 ? 31  VAL A N    2  
ATOM 2641  C CA   . VAL A 1 31  ? 0.134   -1.052  -1.367  1.00 0.00 ? 31  VAL A CA   2  
ATOM 2642  C C    . VAL A 1 31  ? 0.511   -0.092  -0.244  1.00 0.00 ? 31  VAL A C    2  
ATOM 2643  O O    . VAL A 1 31  ? 0.589   -0.484  0.920   1.00 0.00 ? 31  VAL A O    2  
ATOM 2644  C CB   . VAL A 1 31  ? -1.396  -1.043  -1.543  1.00 0.00 ? 31  VAL A CB   2  
ATOM 2645  C CG1  . VAL A 1 31  ? -1.881  0.348   -1.922  1.00 0.00 ? 31  VAL A CG1  2  
ATOM 2646  C CG2  . VAL A 1 31  ? -1.818  -2.066  -2.586  1.00 0.00 ? 31  VAL A CG2  2  
ATOM 2647  H H    . VAL A 1 31  ? 0.131   -2.976  -0.485  1.00 0.00 ? 31  VAL A H    2  
ATOM 2648  H HA   . VAL A 1 31  ? 0.584   -0.708  -2.287  1.00 0.00 ? 31  VAL A HA   2  
ATOM 2649  H HB   . VAL A 1 31  ? -1.848  -1.313  -0.600  1.00 0.00 ? 31  VAL A HB   2  
ATOM 2650  H HG11 . VAL A 1 31  ? -1.385  0.668   -2.827  1.00 0.00 ? 31  VAL A HG11 2  
ATOM 2651  H HG12 . VAL A 1 31  ? -2.949  0.326   -2.084  1.00 0.00 ? 31  VAL A HG12 2  
ATOM 2652  H HG13 . VAL A 1 31  ? -1.653  1.039   -1.124  1.00 0.00 ? 31  VAL A HG13 2  
ATOM 2653  H HG21 . VAL A 1 31  ? -1.777  -3.056  -2.156  1.00 0.00 ? 31  VAL A HG21 2  
ATOM 2654  H HG22 . VAL A 1 31  ? -2.827  -1.856  -2.909  1.00 0.00 ? 31  VAL A HG22 2  
ATOM 2655  H HG23 . VAL A 1 31  ? -1.151  -2.013  -3.434  1.00 0.00 ? 31  VAL A HG23 2  
ATOM 2656  N N    . GLU A 1 32  ? 0.744   1.167   -0.602  1.00 0.00 ? 32  GLU A N    2  
ATOM 2657  C CA   . GLU A 1 32  ? 1.114   2.182   0.377   1.00 0.00 ? 32  GLU A CA   2  
ATOM 2658  C C    . GLU A 1 32  ? 0.081   3.305   0.412   1.00 0.00 ? 32  GLU A C    2  
ATOM 2659  O O    . GLU A 1 32  ? 0.011   4.129   -0.500  1.00 0.00 ? 32  GLU A O    2  
ATOM 2660  C CB   . GLU A 1 32  ? 2.495   2.756   0.054   1.00 0.00 ? 32  GLU A CB   2  
ATOM 2661  C CG   . GLU A 1 32  ? 2.921   3.880   0.983   1.00 0.00 ? 32  GLU A CG   2  
ATOM 2662  C CD   . GLU A 1 32  ? 4.428   4.008   1.091   1.00 0.00 ? 32  GLU A CD   2  
ATOM 2663  O OE1  . GLU A 1 32  ? 5.088   2.999   1.415   1.00 0.00 ? 32  GLU A OE1  2  
ATOM 2664  O OE2  . GLU A 1 32  ? 4.946   5.119   0.852   1.00 0.00 ? 32  GLU A OE2  2  
ATOM 2665  H H    . GLU A 1 32  ? 0.666   1.418   -1.546  1.00 0.00 ? 32  GLU A H    2  
ATOM 2666  H HA   . GLU A 1 32  ? 1.148   1.711   1.347   1.00 0.00 ? 32  GLU A HA   2  
ATOM 2667  H HB2  . GLU A 1 32  ? 3.226   1.963   0.122   1.00 0.00 ? 32  GLU A HB2  2  
ATOM 2668  H HB3  . GLU A 1 32  ? 2.485   3.137   -0.957  1.00 0.00 ? 32  GLU A HB3  2  
ATOM 2669  H HG2  . GLU A 1 32  ? 2.522   4.810   0.608   1.00 0.00 ? 32  GLU A HG2  2  
ATOM 2670  H HG3  . GLU A 1 32  ? 2.519   3.688   1.967   1.00 0.00 ? 32  GLU A HG3  2  
ATOM 2671  N N    . PHE A 1 33  ? -0.720  3.331   1.473   1.00 0.00 ? 33  PHE A N    2  
ATOM 2672  C CA   . PHE A 1 33  ? -1.751  4.351   1.627   1.00 0.00 ? 33  PHE A CA   2  
ATOM 2673  C C    . PHE A 1 33  ? -1.150  5.659   2.132   1.00 0.00 ? 33  PHE A C    2  
ATOM 2674  O O    . PHE A 1 33  ? -0.365  5.670   3.081   1.00 0.00 ? 33  PHE A O    2  
ATOM 2675  C CB   . PHE A 1 33  ? -2.835  3.868   2.593   1.00 0.00 ? 33  PHE A CB   2  
ATOM 2676  C CG   . PHE A 1 33  ? -3.386  2.514   2.247   1.00 0.00 ? 33  PHE A CG   2  
ATOM 2677  C CD1  . PHE A 1 33  ? -2.702  1.363   2.599   1.00 0.00 ? 33  PHE A CD1  2  
ATOM 2678  C CD2  . PHE A 1 33  ? -4.589  2.394   1.570   1.00 0.00 ? 33  PHE A CD2  2  
ATOM 2679  C CE1  . PHE A 1 33  ? -3.206  0.115   2.283   1.00 0.00 ? 33  PHE A CE1  2  
ATOM 2680  C CE2  . PHE A 1 33  ? -5.099  1.149   1.251   1.00 0.00 ? 33  PHE A CE2  2  
ATOM 2681  C CZ   . PHE A 1 33  ? -4.406  0.009   1.607   1.00 0.00 ? 33  PHE A CZ   2  
ATOM 2682  H H    . PHE A 1 33  ? -0.616  2.647   2.167   1.00 0.00 ? 33  PHE A H    2  
ATOM 2683  H HA   . PHE A 1 33  ? -2.194  4.523   0.659   1.00 0.00 ? 33  PHE A HA   2  
ATOM 2684  H HB2  . PHE A 1 33  ? -2.421  3.813   3.589   1.00 0.00 ? 33  PHE A HB2  2  
ATOM 2685  H HB3  . PHE A 1 33  ? -3.653  4.573   2.586   1.00 0.00 ? 33  PHE A HB3  2  
ATOM 2686  H HD1  . PHE A 1 33  ? -1.762  1.445   3.128   1.00 0.00 ? 33  PHE A HD1  2  
ATOM 2687  H HD2  . PHE A 1 33  ? -5.131  3.285   1.290   1.00 0.00 ? 33  PHE A HD2  2  
ATOM 2688  H HE1  . PHE A 1 33  ? -2.662  -0.774  2.563   1.00 0.00 ? 33  PHE A HE1  2  
ATOM 2689  H HE2  . PHE A 1 33  ? -6.037  1.069   0.723   1.00 0.00 ? 33  PHE A HE2  2  
ATOM 2690  H HZ   . PHE A 1 33  ? -4.802  -0.965  1.360   1.00 0.00 ? 33  PHE A HZ   2  
ATOM 2691  N N    . PHE A 1 34  ? -1.524  6.762   1.491   1.00 0.00 ? 34  PHE A N    2  
ATOM 2692  C CA   . PHE A 1 34  ? -1.021  8.076   1.874   1.00 0.00 ? 34  PHE A CA   2  
ATOM 2693  C C    . PHE A 1 34  ? -2.037  9.165   1.540   1.00 0.00 ? 34  PHE A C    2  
ATOM 2694  O O    . PHE A 1 34  ? -3.045  8.908   0.883   1.00 0.00 ? 34  PHE A O    2  
ATOM 2695  C CB   . PHE A 1 34  ? 0.303   8.365   1.164   1.00 0.00 ? 34  PHE A CB   2  
ATOM 2696  C CG   . PHE A 1 34  ? 0.140   8.752   -0.278  1.00 0.00 ? 34  PHE A CG   2  
ATOM 2697  C CD1  . PHE A 1 34  ? -0.279  7.821   -1.215  1.00 0.00 ? 34  PHE A CD1  2  
ATOM 2698  C CD2  . PHE A 1 34  ? 0.403   10.046  -0.695  1.00 0.00 ? 34  PHE A CD2  2  
ATOM 2699  C CE1  . PHE A 1 34  ? -0.429  8.175   -2.543  1.00 0.00 ? 34  PHE A CE1  2  
ATOM 2700  C CE2  . PHE A 1 34  ? 0.254   10.406  -2.022  1.00 0.00 ? 34  PHE A CE2  2  
ATOM 2701  C CZ   . PHE A 1 34  ? -0.164  9.469   -2.946  1.00 0.00 ? 34  PHE A CZ   2  
ATOM 2702  H H    . PHE A 1 34  ? -2.153  6.689   0.743   1.00 0.00 ? 34  PHE A H    2  
ATOM 2703  H HA   . PHE A 1 34  ? -0.855  8.069   2.940   1.00 0.00 ? 34  PHE A HA   2  
ATOM 2704  H HB2  . PHE A 1 34  ? 0.805   9.177   1.670   1.00 0.00 ? 34  PHE A HB2  2  
ATOM 2705  H HB3  . PHE A 1 34  ? 0.924   7.483   1.204   1.00 0.00 ? 34  PHE A HB3  2  
ATOM 2706  H HD1  . PHE A 1 34  ? -0.488  6.809   -0.901  1.00 0.00 ? 34  PHE A HD1  2  
ATOM 2707  H HD2  . PHE A 1 34  ? 0.730   10.781  0.028   1.00 0.00 ? 34  PHE A HD2  2  
ATOM 2708  H HE1  . PHE A 1 34  ? -0.756  7.440   -3.263  1.00 0.00 ? 34  PHE A HE1  2  
ATOM 2709  H HE2  . PHE A 1 34  ? 0.462   11.418  -2.334  1.00 0.00 ? 34  PHE A HE2  2  
ATOM 2710  H HZ   . PHE A 1 34  ? -0.280  9.747   -3.983  1.00 0.00 ? 34  PHE A HZ   2  
ATOM 2711  N N    . ALA A 1 35  ? -1.764  10.381  2.001   1.00 0.00 ? 35  ALA A N    2  
ATOM 2712  C CA   . ALA A 1 35  ? -2.653  11.510  1.751   1.00 0.00 ? 35  ALA A CA   2  
ATOM 2713  C C    . ALA A 1 35  ? -1.888  12.690  1.162   1.00 0.00 ? 35  ALA A C    2  
ATOM 2714  O O    . ALA A 1 35  ? -0.681  12.820  1.358   1.00 0.00 ? 35  ALA A O    2  
ATOM 2715  C CB   . ALA A 1 35  ? -3.356  11.922  3.036   1.00 0.00 ? 35  ALA A CB   2  
ATOM 2716  H H    . ALA A 1 35  ? -0.945  10.524  2.519   1.00 0.00 ? 35  ALA A H    2  
ATOM 2717  H HA   . ALA A 1 35  ? -3.405  11.192  1.044   1.00 0.00 ? 35  ALA A HA   2  
ATOM 2718  H HB1  . ALA A 1 35  ? -2.629  12.010  3.830   1.00 0.00 ? 35  ALA A HB1  2  
ATOM 2719  H HB2  . ALA A 1 35  ? -3.846  12.873  2.888   1.00 0.00 ? 35  ALA A HB2  2  
ATOM 2720  H HB3  . ALA A 1 35  ? -4.089  11.175  3.300   1.00 0.00 ? 35  ALA A HB3  2  
ATOM 2721  N N    . ASN A 1 36  ? -2.600  13.548  0.438   1.00 0.00 ? 36  ASN A N    2  
ATOM 2722  C CA   . ASN A 1 36  ? -1.988  14.718  -0.181  1.00 0.00 ? 36  ASN A CA   2  
ATOM 2723  C C    . ASN A 1 36  ? -1.684  15.790  0.862   1.00 0.00 ? 36  ASN A C    2  
ATOM 2724  O O    . ASN A 1 36  ? -0.671  16.484  0.776   1.00 0.00 ? 36  ASN A O    2  
ATOM 2725  C CB   . ASN A 1 36  ? -2.907  15.289  -1.263  1.00 0.00 ? 36  ASN A CB   2  
ATOM 2726  C CG   . ASN A 1 36  ? -2.628  16.752  -1.546  1.00 0.00 ? 36  ASN A CG   2  
ATOM 2727  O OD1  . ASN A 1 36  ? -1.485  17.144  -1.781  1.00 0.00 ? 36  ASN A OD1  2  
ATOM 2728  N ND2  . ASN A 1 36  ? -3.675  17.569  -1.524  1.00 0.00 ? 36  ASN A ND2  2  
ATOM 2729  H H    . ASN A 1 36  ? -3.560  13.391  0.317   1.00 0.00 ? 36  ASN A H    2  
ATOM 2730  H HA   . ASN A 1 36  ? -1.061  14.404  -0.638  1.00 0.00 ? 36  ASN A HA   2  
ATOM 2731  H HB2  . ASN A 1 36  ? -2.766  14.732  -2.178  1.00 0.00 ? 36  ASN A HB2  2  
ATOM 2732  H HB3  . ASN A 1 36  ? -3.934  15.192  -0.942  1.00 0.00 ? 36  ASN A HB3  2  
ATOM 2733  H HD21 . ASN A 1 36  ? -4.557  17.187  -1.329  1.00 0.00 ? 36  ASN A HD21 2  
ATOM 2734  H HD22 . ASN A 1 36  ? -3.523  18.520  -1.704  1.00 0.00 ? 36  ASN A HD22 2  
ATOM 2735  N N    . TRP A 1 37  ? -2.568  15.917  1.844   1.00 0.00 ? 37  TRP A N    2  
ATOM 2736  C CA   . TRP A 1 37  ? -2.395  16.904  2.905   1.00 0.00 ? 37  TRP A CA   2  
ATOM 2737  C C    . TRP A 1 37  ? -1.526  16.349  4.028   1.00 0.00 ? 37  TRP A C    2  
ATOM 2738  O O    . TRP A 1 37  ? -1.561  16.844  5.154   1.00 0.00 ? 37  TRP A O    2  
ATOM 2739  C CB   . TRP A 1 37  ? -3.755  17.331  3.459   1.00 0.00 ? 37  TRP A CB   2  
ATOM 2740  C CG   . TRP A 1 37  ? -4.753  16.215  3.510   1.00 0.00 ? 37  TRP A CG   2  
ATOM 2741  C CD1  . TRP A 1 37  ? -5.907  16.113  2.786   1.00 0.00 ? 37  TRP A CD1  2  
ATOM 2742  C CD2  . TRP A 1 37  ? -4.687  15.043  4.330   1.00 0.00 ? 37  TRP A CD2  2  
ATOM 2743  N NE1  . TRP A 1 37  ? -6.562  14.948  3.107   1.00 0.00 ? 37  TRP A NE1  2  
ATOM 2744  C CE2  . TRP A 1 37  ? -5.833  14.274  4.051   1.00 0.00 ? 37  TRP A CE2  2  
ATOM 2745  C CE3  . TRP A 1 37  ? -3.770  14.567  5.271   1.00 0.00 ? 37  TRP A CE3  2  
ATOM 2746  C CZ2  . TRP A 1 37  ? -6.085  13.057  4.680   1.00 0.00 ? 37  TRP A CZ2  2  
ATOM 2747  C CZ3  . TRP A 1 37  ? -4.021  13.360  5.895   1.00 0.00 ? 37  TRP A CZ3  2  
ATOM 2748  C CH2  . TRP A 1 37  ? -5.170  12.616  5.597   1.00 0.00 ? 37  TRP A CH2  2  
ATOM 2749  H H    . TRP A 1 37  ? -3.356  15.335  1.858   1.00 0.00 ? 37  TRP A H    2  
ATOM 2750  H HA   . TRP A 1 37  ? -1.904  17.766  2.477   1.00 0.00 ? 37  TRP A HA   2  
ATOM 2751  H HB2  . TRP A 1 37  ? -3.625  17.709  4.462   1.00 0.00 ? 37  TRP A HB2  2  
ATOM 2752  H HB3  . TRP A 1 37  ? -4.160  18.114  2.834   1.00 0.00 ? 37  TRP A HB3  2  
ATOM 2753  H HD1  . TRP A 1 37  ? -6.243  16.849  2.072   1.00 0.00 ? 37  TRP A HD1  2  
ATOM 2754  H HE1  . TRP A 1 37  ? -7.412  14.649  2.721   1.00 0.00 ? 37  TRP A HE1  2  
ATOM 2755  H HE3  . TRP A 1 37  ? -2.878  15.126  5.513   1.00 0.00 ? 37  TRP A HE3  2  
ATOM 2756  H HZ2  . TRP A 1 37  ? -6.966  12.472  4.461   1.00 0.00 ? 37  TRP A HZ2  2  
ATOM 2757  H HZ3  . TRP A 1 37  ? -3.324  12.977  6.625   1.00 0.00 ? 37  TRP A HZ3  2  
ATOM 2758  H HH2  . TRP A 1 37  ? -5.326  11.679  6.109   1.00 0.00 ? 37  TRP A HH2  2  
ATOM 2759  N N    . SER A 1 38  ? -0.747  15.319  3.714   1.00 0.00 ? 38  SER A N    2  
ATOM 2760  C CA   . SER A 1 38  ? 0.129   14.695  4.699   1.00 0.00 ? 38  SER A CA   2  
ATOM 2761  C C    . SER A 1 38  ? 1.593   14.853  4.301   1.00 0.00 ? 38  SER A C    2  
ATOM 2762  O O    . SER A 1 38  ? 2.164   13.988  3.637   1.00 0.00 ? 38  SER A O    2  
ATOM 2763  C CB   . SER A 1 38  ? -0.213  13.211  4.849   1.00 0.00 ? 38  SER A CB   2  
ATOM 2764  O OG   . SER A 1 38  ? 0.323   12.683  6.049   1.00 0.00 ? 38  SER A OG   2  
ATOM 2765  H H    . SER A 1 38  ? -0.764  14.969  2.798   1.00 0.00 ? 38  SER A H    2  
ATOM 2766  H HA   . SER A 1 38  ? -0.031  15.190  5.645   1.00 0.00 ? 38  SER A HA   2  
ATOM 2767  H HB2  . SER A 1 38  ? -1.286  13.091  4.865   1.00 0.00 ? 38  SER A HB2  2  
ATOM 2768  H HB3  . SER A 1 38  ? 0.197   12.663  4.013   1.00 0.00 ? 38  SER A HB3  2  
ATOM 2769  H HG   . SER A 1 38  ? -0.359  12.663  6.724   1.00 0.00 ? 38  SER A HG   2  
ATOM 2770  N N    . ASN A 1 39  ? 2.195   15.964  4.712   1.00 0.00 ? 39  ASN A N    2  
ATOM 2771  C CA   . ASN A 1 39  ? 3.593   16.237  4.399   1.00 0.00 ? 39  ASN A CA   2  
ATOM 2772  C C    . ASN A 1 39  ? 4.481   15.065  4.806   1.00 0.00 ? 39  ASN A C    2  
ATOM 2773  O O    . ASN A 1 39  ? 5.447   14.736  4.117   1.00 0.00 ? 39  ASN A O    2  
ATOM 2774  C CB   . ASN A 1 39  ? 4.056   17.512  5.108   1.00 0.00 ? 39  ASN A CB   2  
ATOM 2775  C CG   . ASN A 1 39  ? 5.544   17.756  4.944   1.00 0.00 ? 39  ASN A CG   2  
ATOM 2776  O OD1  . ASN A 1 39  ? 6.343   16.819  4.951   1.00 0.00 ? 39  ASN A OD1  2  
ATOM 2777  N ND2  . ASN A 1 39  ? 5.923   19.020  4.795   1.00 0.00 ? 39  ASN A ND2  2  
ATOM 2778  H H    . ASN A 1 39  ? 1.687   16.616  5.239   1.00 0.00 ? 39  ASN A H    2  
ATOM 2779  H HA   . ASN A 1 39  ? 3.671   16.380  3.332   1.00 0.00 ? 39  ASN A HA   2  
ATOM 2780  H HB2  . ASN A 1 39  ? 3.525   18.358  4.697   1.00 0.00 ? 39  ASN A HB2  2  
ATOM 2781  H HB3  . ASN A 1 39  ? 3.837   17.431  6.162   1.00 0.00 ? 39  ASN A HB3  2  
ATOM 2782  H HD21 . ASN A 1 39  ? 5.231   19.715  4.800   1.00 0.00 ? 39  ASN A HD21 2  
ATOM 2783  H HD22 . ASN A 1 39  ? 6.879   19.207  4.687   1.00 0.00 ? 39  ASN A HD22 2  
ATOM 2784  N N    . ASP A 1 40  ? 4.146   14.438  5.928   1.00 0.00 ? 40  ASP A N    2  
ATOM 2785  C CA   . ASP A 1 40  ? 4.911   13.300  6.426   1.00 0.00 ? 40  ASP A CA   2  
ATOM 2786  C C    . ASP A 1 40  ? 5.294   12.362  5.285   1.00 0.00 ? 40  ASP A C    2  
ATOM 2787  O O    . ASP A 1 40  ? 6.406   11.834  5.250   1.00 0.00 ? 40  ASP A O    2  
ATOM 2788  C CB   . ASP A 1 40  ? 4.106   12.540  7.480   1.00 0.00 ? 40  ASP A CB   2  
ATOM 2789  C CG   . ASP A 1 40  ? 3.772   13.398  8.684   1.00 0.00 ? 40  ASP A CG   2  
ATOM 2790  O OD1  . ASP A 1 40  ? 4.629   13.517  9.584   1.00 0.00 ? 40  ASP A OD1  2  
ATOM 2791  O OD2  . ASP A 1 40  ? 2.653   13.951  8.727   1.00 0.00 ? 40  ASP A OD2  2  
ATOM 2792  H H    . ASP A 1 40  ? 3.364   14.747  6.433   1.00 0.00 ? 40  ASP A H    2  
ATOM 2793  H HA   . ASP A 1 40  ? 5.813   13.681  6.880   1.00 0.00 ? 40  ASP A HA   2  
ATOM 2794  H HB2  . ASP A 1 40  ? 3.182   12.195  7.040   1.00 0.00 ? 40  ASP A HB2  2  
ATOM 2795  H HB3  . ASP A 1 40  ? 4.679   11.688  7.816   1.00 0.00 ? 40  ASP A HB3  2  
ATOM 2796  N N    . CYS A 1 41  ? 4.366   12.159  4.356   1.00 0.00 ? 41  CYS A N    2  
ATOM 2797  C CA   . CYS A 1 41  ? 4.606   11.282  3.215   1.00 0.00 ? 41  CYS A CA   2  
ATOM 2798  C C    . CYS A 1 41  ? 5.895   11.666  2.497   1.00 0.00 ? 41  CYS A C    2  
ATOM 2799  O O    . CYS A 1 41  ? 6.669   10.801  2.087   1.00 0.00 ? 41  CYS A O    2  
ATOM 2800  C CB   . CYS A 1 41  ? 3.427   11.344  2.242   1.00 0.00 ? 41  CYS A CB   2  
ATOM 2801  S SG   . CYS A 1 41  ? 3.340   12.875  1.285   1.00 0.00 ? 41  CYS A SG   2  
ATOM 2802  H H    . CYS A 1 41  ? 3.499   12.608  4.440   1.00 0.00 ? 41  CYS A H    2  
ATOM 2803  H HA   . CYS A 1 41  ? 4.702   10.274  3.588   1.00 0.00 ? 41  CYS A HA   2  
ATOM 2804  H HB2  . CYS A 1 41  ? 3.505   10.524  1.543   1.00 0.00 ? 41  CYS A HB2  2  
ATOM 2805  H HB3  . CYS A 1 41  ? 2.506   11.249  2.798   1.00 0.00 ? 41  CYS A HB3  2  
ATOM 2806  H HG   . CYS A 1 41  ? 3.224   12.551  0.006   1.00 0.00 ? 41  CYS A HG   2  
ATOM 2807  N N    . GLN A 1 42  ? 6.118   12.968  2.346   1.00 0.00 ? 42  GLN A N    2  
ATOM 2808  C CA   . GLN A 1 42  ? 7.313   13.465  1.675   1.00 0.00 ? 42  GLN A CA   2  
ATOM 2809  C C    . GLN A 1 42  ? 8.567   12.798  2.230   1.00 0.00 ? 42  GLN A C    2  
ATOM 2810  O O    . GLN A 1 42  ? 9.564   12.644  1.525   1.00 0.00 ? 42  GLN A O    2  
ATOM 2811  C CB   . GLN A 1 42  ? 7.416   14.983  1.830   1.00 0.00 ? 42  GLN A CB   2  
ATOM 2812  C CG   . GLN A 1 42  ? 8.178   15.417  3.071   1.00 0.00 ? 42  GLN A CG   2  
ATOM 2813  C CD   . GLN A 1 42  ? 8.408   16.915  3.121   1.00 0.00 ? 42  GLN A CD   2  
ATOM 2814  O OE1  . GLN A 1 42  ? 9.514   17.375  3.405   1.00 0.00 ? 42  GLN A OE1  2  
ATOM 2815  N NE2  . GLN A 1 42  ? 7.362   17.684  2.844   1.00 0.00 ? 42  GLN A NE2  2  
ATOM 2816  H H    . GLN A 1 42  ? 5.464   13.608  2.695   1.00 0.00 ? 42  GLN A H    2  
ATOM 2817  H HA   . GLN A 1 42  ? 7.227   13.224  0.626   1.00 0.00 ? 42  GLN A HA   2  
ATOM 2818  H HB2  . GLN A 1 42  ? 7.920   15.388  0.965   1.00 0.00 ? 42  GLN A HB2  2  
ATOM 2819  H HB3  . GLN A 1 42  ? 6.420   15.396  1.883   1.00 0.00 ? 42  GLN A HB3  2  
ATOM 2820  H HG2  . GLN A 1 42  ? 7.613   15.127  3.945   1.00 0.00 ? 42  GLN A HG2  2  
ATOM 2821  H HG3  . GLN A 1 42  ? 9.137   14.920  3.082   1.00 0.00 ? 42  GLN A HG3  2  
ATOM 2822  H HE21 . GLN A 1 42  ? 6.511   17.248  2.627   1.00 0.00 ? 42  GLN A HE21 2  
ATOM 2823  H HE22 . GLN A 1 42  ? 7.482   18.656  2.869   1.00 0.00 ? 42  GLN A HE22 2  
ATOM 2824  N N    . SER A 1 43  ? 8.510   12.406  3.499   1.00 0.00 ? 43  SER A N    2  
ATOM 2825  C CA   . SER A 1 43  ? 9.643   11.759  4.151   1.00 0.00 ? 43  SER A CA   2  
ATOM 2826  C C    . SER A 1 43  ? 9.880   10.367  3.574   1.00 0.00 ? 43  SER A C    2  
ATOM 2827  O O    . SER A 1 43  ? 10.998  10.024  3.188   1.00 0.00 ? 43  SER A O    2  
ATOM 2828  C CB   . SER A 1 43  ? 9.405   11.665  5.659   1.00 0.00 ? 43  SER A CB   2  
ATOM 2829  O OG   . SER A 1 43  ? 10.471  10.988  6.302   1.00 0.00 ? 43  SER A OG   2  
ATOM 2830  H H    . SER A 1 43  ? 7.687   12.557  4.009   1.00 0.00 ? 43  SER A H    2  
ATOM 2831  H HA   . SER A 1 43  ? 10.519  12.365  3.970   1.00 0.00 ? 43  SER A HA   2  
ATOM 2832  H HB2  . SER A 1 43  ? 9.325   12.659  6.071   1.00 0.00 ? 43  SER A HB2  2  
ATOM 2833  H HB3  . SER A 1 43  ? 8.488   11.124  5.843   1.00 0.00 ? 43  SER A HB3  2  
ATOM 2834  H HG   . SER A 1 43  ? 10.519  11.266  7.220   1.00 0.00 ? 43  SER A HG   2  
ATOM 2835  N N    . PHE A 1 44  ? 8.819   9.569   3.517   1.00 0.00 ? 44  PHE A N    2  
ATOM 2836  C CA   . PHE A 1 44  ? 8.911   8.213   2.989   1.00 0.00 ? 44  PHE A CA   2  
ATOM 2837  C C    . PHE A 1 44  ? 8.635   8.194   1.488   1.00 0.00 ? 44  PHE A C    2  
ATOM 2838  O O    . PHE A 1 44  ? 8.424   7.135   0.898   1.00 0.00 ? 44  PHE A O    2  
ATOM 2839  C CB   . PHE A 1 44  ? 7.923   7.293   3.711   1.00 0.00 ? 44  PHE A CB   2  
ATOM 2840  C CG   . PHE A 1 44  ? 8.285   5.838   3.623   1.00 0.00 ? 44  PHE A CG   2  
ATOM 2841  C CD1  . PHE A 1 44  ? 9.281   5.309   4.428   1.00 0.00 ? 44  PHE A CD1  2  
ATOM 2842  C CD2  . PHE A 1 44  ? 7.628   5.000   2.737   1.00 0.00 ? 44  PHE A CD2  2  
ATOM 2843  C CE1  . PHE A 1 44  ? 9.617   3.970   4.348   1.00 0.00 ? 44  PHE A CE1  2  
ATOM 2844  C CE2  . PHE A 1 44  ? 7.959   3.660   2.654   1.00 0.00 ? 44  PHE A CE2  2  
ATOM 2845  C CZ   . PHE A 1 44  ? 8.954   3.145   3.461   1.00 0.00 ? 44  PHE A CZ   2  
ATOM 2846  H H    . PHE A 1 44  ? 7.955   9.899   3.840   1.00 0.00 ? 44  PHE A H    2  
ATOM 2847  H HA   . PHE A 1 44  ? 9.914   7.857   3.163   1.00 0.00 ? 44  PHE A HA   2  
ATOM 2848  H HB2  . PHE A 1 44  ? 7.889   7.564   4.755   1.00 0.00 ? 44  PHE A HB2  2  
ATOM 2849  H HB3  . PHE A 1 44  ? 6.943   7.420   3.278   1.00 0.00 ? 44  PHE A HB3  2  
ATOM 2850  H HD1  . PHE A 1 44  ? 9.800   5.953   5.122   1.00 0.00 ? 44  PHE A HD1  2  
ATOM 2851  H HD2  . PHE A 1 44  ? 6.849   5.402   2.105   1.00 0.00 ? 44  PHE A HD2  2  
ATOM 2852  H HE1  . PHE A 1 44  ? 10.395  3.570   4.981   1.00 0.00 ? 44  PHE A HE1  2  
ATOM 2853  H HE2  . PHE A 1 44  ? 7.439   3.018   1.959   1.00 0.00 ? 44  PHE A HE2  2  
ATOM 2854  H HZ   . PHE A 1 44  ? 9.214   2.099   3.397   1.00 0.00 ? 44  PHE A HZ   2  
ATOM 2855  N N    . ALA A 1 45  ? 8.639   9.375   0.877   1.00 0.00 ? 45  ALA A N    2  
ATOM 2856  C CA   . ALA A 1 45  ? 8.391   9.495   -0.554  1.00 0.00 ? 45  ALA A CA   2  
ATOM 2857  C C    . ALA A 1 45  ? 9.460   8.764   -1.360  1.00 0.00 ? 45  ALA A C    2  
ATOM 2858  O O    . ALA A 1 45  ? 9.173   7.848   -2.129  1.00 0.00 ? 45  ALA A O    2  
ATOM 2859  C CB   . ALA A 1 45  ? 8.333   10.961  -0.958  1.00 0.00 ? 45  ALA A CB   2  
ATOM 2860  H H    . ALA A 1 45  ? 8.814   10.184  1.402   1.00 0.00 ? 45  ALA A H    2  
ATOM 2861  H HA   . ALA A 1 45  ? 7.429   9.051   -0.765  1.00 0.00 ? 45  ALA A HA   2  
ATOM 2862  H HB1  . ALA A 1 45  ? 8.457   11.580  -0.081  1.00 0.00 ? 45  ALA A HB1  2  
ATOM 2863  H HB2  . ALA A 1 45  ? 9.124   11.171  -1.663  1.00 0.00 ? 45  ALA A HB2  2  
ATOM 2864  H HB3  . ALA A 1 45  ? 7.378   11.171  -1.415  1.00 0.00 ? 45  ALA A HB3  2  
ATOM 2865  N N    . PRO A 1 46  ? 10.723  9.178   -1.181  1.00 0.00 ? 46  PRO A N    2  
ATOM 2866  C CA   . PRO A 1 46  ? 11.861  8.576   -1.883  1.00 0.00 ? 46  PRO A CA   2  
ATOM 2867  C C    . PRO A 1 46  ? 12.153  7.158   -1.403  1.00 0.00 ? 46  PRO A C    2  
ATOM 2868  O O    . PRO A 1 46  ? 12.455  6.272   -2.203  1.00 0.00 ? 46  PRO A O    2  
ATOM 2869  C CB   . PRO A 1 46  ? 13.025  9.508   -1.538  1.00 0.00 ? 46  PRO A CB   2  
ATOM 2870  C CG   . PRO A 1 46  ? 12.637  10.135  -0.243  1.00 0.00 ? 46  PRO A CG   2  
ATOM 2871  C CD   . PRO A 1 46  ? 11.139  10.265  -0.279  1.00 0.00 ? 46  PRO A CD   2  
ATOM 2872  H HA   . PRO A 1 46  ? 11.708  8.568   -2.952  1.00 0.00 ? 46  PRO A HA   2  
ATOM 2873  H HB2  . PRO A 1 46  ? 13.934  8.932   -1.441  1.00 0.00 ? 46  PRO A HB2  2  
ATOM 2874  H HB3  . PRO A 1 46  ? 13.141  10.248  -2.315  1.00 0.00 ? 46  PRO A HB3  2  
ATOM 2875  H HG2  . PRO A 1 46  ? 12.939  9.502   0.577   1.00 0.00 ? 46  PRO A HG2  2  
ATOM 2876  H HG3  . PRO A 1 46  ? 13.095  11.110  -0.156  1.00 0.00 ? 46  PRO A HG3  2  
ATOM 2877  H HD2  . PRO A 1 46  ? 10.725  10.127  0.709   1.00 0.00 ? 46  PRO A HD2  2  
ATOM 2878  H HD3  . PRO A 1 46  ? 10.853  11.227  -0.678  1.00 0.00 ? 46  PRO A HD3  2  
ATOM 2879  N N    . ILE A 1 47  ? 12.062  6.951   -0.094  1.00 0.00 ? 47  ILE A N    2  
ATOM 2880  C CA   . ILE A 1 47  ? 12.316  5.640   0.491   1.00 0.00 ? 47  ILE A CA   2  
ATOM 2881  C C    . ILE A 1 47  ? 11.441  4.571   -0.155  1.00 0.00 ? 47  ILE A C    2  
ATOM 2882  O O    . ILE A 1 47  ? 11.908  3.473   -0.459  1.00 0.00 ? 47  ILE A O    2  
ATOM 2883  C CB   . ILE A 1 47  ? 12.065  5.644   2.011   1.00 0.00 ? 47  ILE A CB   2  
ATOM 2884  C CG1  . ILE A 1 47  ? 12.966  6.673   2.697   1.00 0.00 ? 47  ILE A CG1  2  
ATOM 2885  C CG2  . ILE A 1 47  ? 12.299  4.257   2.590   1.00 0.00 ? 47  ILE A CG2  2  
ATOM 2886  C CD1  . ILE A 1 47  ? 12.612  6.914   4.147   1.00 0.00 ? 47  ILE A CD1  2  
ATOM 2887  H H    . ILE A 1 47  ? 11.818  7.697   0.493   1.00 0.00 ? 47  ILE A H    2  
ATOM 2888  H HA   . ILE A 1 47  ? 13.354  5.394   0.319   1.00 0.00 ? 47  ILE A HA   2  
ATOM 2889  H HB   . ILE A 1 47  ? 11.033  5.909   2.182   1.00 0.00 ? 47  ILE A HB   2  
ATOM 2890  H HG12 . ILE A 1 47  ? 13.988  6.329   2.658   1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2891  H HG13 . ILE A 1 47  ? 12.887  7.615   2.173   1.00 0.00 ? 47  ILE A HG13 2  
ATOM 2892  H HG21 . ILE A 1 47  ? 11.384  3.686   2.539   1.00 0.00 ? 47  ILE A HG21 2  
ATOM 2893  H HG22 . ILE A 1 47  ? 13.067  3.755   2.020   1.00 0.00 ? 47  ILE A HG22 2  
ATOM 2894  H HG23 . ILE A 1 47  ? 12.613  4.344   3.619   1.00 0.00 ? 47  ILE A HG23 2  
ATOM 2895  H HD11 . ILE A 1 47  ? 12.940  6.075   4.743   1.00 0.00 ? 47  ILE A HD11 2  
ATOM 2896  H HD12 . ILE A 1 47  ? 13.099  7.814   4.492   1.00 0.00 ? 47  ILE A HD12 2  
ATOM 2897  H HD13 . ILE A 1 47  ? 11.542  7.026   4.243   1.00 0.00 ? 47  ILE A HD13 2  
ATOM 2898  N N    . TYR A 1 48  ? 10.171  4.901   -0.363  1.00 0.00 ? 48  TYR A N    2  
ATOM 2899  C CA   . TYR A 1 48  ? 9.230   3.969   -0.973  1.00 0.00 ? 48  TYR A CA   2  
ATOM 2900  C C    . TYR A 1 48  ? 9.624   3.663   -2.415  1.00 0.00 ? 48  TYR A C    2  
ATOM 2901  O O    . TYR A 1 48  ? 9.591   2.511   -2.848  1.00 0.00 ? 48  TYR A O    2  
ATOM 2902  C CB   . TYR A 1 48  ? 7.813   4.541   -0.930  1.00 0.00 ? 48  TYR A CB   2  
ATOM 2903  C CG   . TYR A 1 48  ? 6.742   3.534   -1.283  1.00 0.00 ? 48  TYR A CG   2  
ATOM 2904  C CD1  . TYR A 1 48  ? 6.675   2.306   -0.637  1.00 0.00 ? 48  TYR A CD1  2  
ATOM 2905  C CD2  . TYR A 1 48  ? 5.797   3.810   -2.264  1.00 0.00 ? 48  TYR A CD2  2  
ATOM 2906  C CE1  . TYR A 1 48  ? 5.699   1.382   -0.957  1.00 0.00 ? 48  TYR A CE1  2  
ATOM 2907  C CE2  . TYR A 1 48  ? 4.817   2.893   -2.589  1.00 0.00 ? 48  TYR A CE2  2  
ATOM 2908  C CZ   . TYR A 1 48  ? 4.772   1.681   -1.933  1.00 0.00 ? 48  TYR A CZ   2  
ATOM 2909  O OH   . TYR A 1 48  ? 3.798   0.764   -2.256  1.00 0.00 ? 48  TYR A OH   2  
ATOM 2910  H H    . TYR A 1 48  ? 9.858   5.791   -0.099  1.00 0.00 ? 48  TYR A H    2  
ATOM 2911  H HA   . TYR A 1 48  ? 9.255   3.052   -0.402  1.00 0.00 ? 48  TYR A HA   2  
ATOM 2912  H HB2  . TYR A 1 48  ? 7.609   4.906   0.065   1.00 0.00 ? 48  TYR A HB2  2  
ATOM 2913  H HB3  . TYR A 1 48  ? 7.742   5.361   -1.630  1.00 0.00 ? 48  TYR A HB3  2  
ATOM 2914  H HD1  . TYR A 1 48  ? 7.403   2.075   0.128   1.00 0.00 ? 48  TYR A HD1  2  
ATOM 2915  H HD2  . TYR A 1 48  ? 5.835   4.761   -2.776  1.00 0.00 ? 48  TYR A HD2  2  
ATOM 2916  H HE1  . TYR A 1 48  ? 5.663   0.433   -0.443  1.00 0.00 ? 48  TYR A HE1  2  
ATOM 2917  H HE2  . TYR A 1 48  ? 4.091   3.126   -3.354  1.00 0.00 ? 48  TYR A HE2  2  
ATOM 2918  H HH   . TYR A 1 48  ? 3.818   0.594   -3.200  1.00 0.00 ? 48  TYR A HH   2  
ATOM 2919  N N    . ALA A 1 49  ? 9.997   4.703   -3.153  1.00 0.00 ? 49  ALA A N    2  
ATOM 2920  C CA   . ALA A 1 49  ? 10.400  4.547   -4.545  1.00 0.00 ? 49  ALA A CA   2  
ATOM 2921  C C    . ALA A 1 49  ? 11.591  3.603   -4.669  1.00 0.00 ? 49  ALA A C    2  
ATOM 2922  O O    . ALA A 1 49  ? 11.580  2.678   -5.481  1.00 0.00 ? 49  ALA A O    2  
ATOM 2923  C CB   . ALA A 1 49  ? 10.731  5.901   -5.154  1.00 0.00 ? 49  ALA A CB   2  
ATOM 2924  H H    . ALA A 1 49  ? 10.002  5.596   -2.751  1.00 0.00 ? 49  ALA A H    2  
ATOM 2925  H HA   . ALA A 1 49  ? 9.564   4.129   -5.089  1.00 0.00 ? 49  ALA A HA   2  
ATOM 2926  H HB1  . ALA A 1 49  ? 11.180  5.758   -6.126  1.00 0.00 ? 49  ALA A HB1  2  
ATOM 2927  H HB2  . ALA A 1 49  ? 9.826   6.480   -5.257  1.00 0.00 ? 49  ALA A HB2  2  
ATOM 2928  H HB3  . ALA A 1 49  ? 11.422  6.425   -4.511  1.00 0.00 ? 49  ALA A HB3  2  
ATOM 2929  N N    . ASP A 1 50  ? 12.617  3.844   -3.860  1.00 0.00 ? 50  ASP A N    2  
ATOM 2930  C CA   . ASP A 1 50  ? 13.816  3.015   -3.880  1.00 0.00 ? 50  ASP A CA   2  
ATOM 2931  C C    . ASP A 1 50  ? 13.483  1.568   -3.527  1.00 0.00 ? 50  ASP A C    2  
ATOM 2932  O O    . ASP A 1 50  ? 13.869  0.640   -4.239  1.00 0.00 ? 50  ASP A O    2  
ATOM 2933  C CB   . ASP A 1 50  ? 14.857  3.564   -2.903  1.00 0.00 ? 50  ASP A CB   2  
ATOM 2934  C CG   . ASP A 1 50  ? 15.250  4.993   -3.218  1.00 0.00 ? 50  ASP A CG   2  
ATOM 2935  O OD1  . ASP A 1 50  ? 15.152  5.389   -4.399  1.00 0.00 ? 50  ASP A OD1  2  
ATOM 2936  O OD2  . ASP A 1 50  ? 15.655  5.717   -2.285  1.00 0.00 ? 50  ASP A OD2  2  
ATOM 2937  H H    . ASP A 1 50  ? 12.566  4.597   -3.235  1.00 0.00 ? 50  ASP A H    2  
ATOM 2938  H HA   . ASP A 1 50  ? 14.224  3.044   -4.879  1.00 0.00 ? 50  ASP A HA   2  
ATOM 2939  H HB2  . ASP A 1 50  ? 14.453  3.534   -1.901  1.00 0.00 ? 50  ASP A HB2  2  
ATOM 2940  H HB3  . ASP A 1 50  ? 15.743  2.947   -2.947  1.00 0.00 ? 50  ASP A HB3  2  
ATOM 2941  N N    . LEU A 1 51  ? 12.766  1.384   -2.425  1.00 0.00 ? 51  LEU A N    2  
ATOM 2942  C CA   . LEU A 1 51  ? 12.381  0.050   -1.976  1.00 0.00 ? 51  LEU A CA   2  
ATOM 2943  C C    . LEU A 1 51  ? 11.548  -0.662  -3.037  1.00 0.00 ? 51  LEU A C    2  
ATOM 2944  O O    . LEU A 1 51  ? 11.894  -1.756  -3.482  1.00 0.00 ? 51  LEU A O    2  
ATOM 2945  C CB   . LEU A 1 51  ? 11.594  0.137   -0.667  1.00 0.00 ? 51  LEU A CB   2  
ATOM 2946  C CG   . LEU A 1 51  ? 12.427  0.212   0.613   1.00 0.00 ? 51  LEU A CG   2  
ATOM 2947  C CD1  . LEU A 1 51  ? 11.554  0.596   1.797   1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2948  C CD2  . LEU A 1 51  ? 13.127  -1.115  0.872   1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2949  H H    . LEU A 1 51  ? 12.488  2.162   -1.898  1.00 0.00 ? 51  LEU A H    2  
ATOM 2950  H HA   . LEU A 1 51  ? 13.285  -0.516  -1.807  1.00 0.00 ? 51  LEU A HA   2  
ATOM 2951  H HB2  . LEU A 1 51  ? 10.977  1.021   -0.711  1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2952  H HB3  . LEU A 1 51  ? 10.964  -0.738  -0.603  1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2953  H HG   . LEU A 1 51  ? 13.186  0.973   0.497   1.00 0.00 ? 51  LEU A HG   2  
ATOM 2954  H HD11 . LEU A 1 51  ? 11.154  1.586   1.642   1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2955  H HD12 . LEU A 1 51  ? 12.145  0.583   2.700   1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2956  H HD13 . LEU A 1 51  ? 10.742  -0.111  1.889   1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2957  H HD21 . LEU A 1 51  ? 13.983  -0.952  1.509   1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2958  H HD22 . LEU A 1 51  ? 13.453  -1.539  -0.067  1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2959  H HD23 . LEU A 1 51  ? 12.441  -1.795  1.356   1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2960  N N    . SER A 1 52  ? 10.449  -0.031  -3.440  1.00 0.00 ? 52  SER A N    2  
ATOM 2961  C CA   . SER A 1 52  ? 9.565   -0.605  -4.448  1.00 0.00 ? 52  SER A CA   2  
ATOM 2962  C C    . SER A 1 52  ? 10.368  -1.172  -5.616  1.00 0.00 ? 52  SER A C    2  
ATOM 2963  O O    . SER A 1 52  ? 10.272  -2.358  -5.932  1.00 0.00 ? 52  SER A O    2  
ATOM 2964  C CB   . SER A 1 52  ? 8.582   0.452   -4.956  1.00 0.00 ? 52  SER A CB   2  
ATOM 2965  O OG   . SER A 1 52  ? 9.263   1.623   -5.373  1.00 0.00 ? 52  SER A OG   2  
ATOM 2966  H H    . SER A 1 52  ? 10.227  0.839   -3.048  1.00 0.00 ? 52  SER A H    2  
ATOM 2967  H HA   . SER A 1 52  ? 9.010   -1.407  -3.985  1.00 0.00 ? 52  SER A HA   2  
ATOM 2968  H HB2  . SER A 1 52  ? 8.030   0.054   -5.793  1.00 0.00 ? 52  SER A HB2  2  
ATOM 2969  H HB3  . SER A 1 52  ? 7.896   0.712   -4.163  1.00 0.00 ? 52  SER A HB3  2  
ATOM 2970  H HG   . SER A 1 52  ? 8.716   2.107   -5.996  1.00 0.00 ? 52  SER A HG   2  
ATOM 2971  N N    . LEU A 1 53  ? 11.159  -0.315  -6.253  1.00 0.00 ? 53  LEU A N    2  
ATOM 2972  C CA   . LEU A 1 53  ? 11.979  -0.729  -7.386  1.00 0.00 ? 53  LEU A CA   2  
ATOM 2973  C C    . LEU A 1 53  ? 12.700  -2.039  -7.087  1.00 0.00 ? 53  LEU A C    2  
ATOM 2974  O O    . LEU A 1 53  ? 12.584  -3.009  -7.836  1.00 0.00 ? 53  LEU A O    2  
ATOM 2975  C CB   . LEU A 1 53  ? 12.998  0.360   -7.727  1.00 0.00 ? 53  LEU A CB   2  
ATOM 2976  C CG   . LEU A 1 53  ? 12.446  1.597   -8.437  1.00 0.00 ? 53  LEU A CG   2  
ATOM 2977  C CD1  . LEU A 1 53  ? 13.300  2.816   -8.126  1.00 0.00 ? 53  LEU A CD1  2  
ATOM 2978  C CD2  . LEU A 1 53  ? 12.374  1.363   -9.938  1.00 0.00 ? 53  LEU A CD2  2  
ATOM 2979  H H    . LEU A 1 53  ? 11.192  0.617   -5.955  1.00 0.00 ? 53  LEU A H    2  
ATOM 2980  H HA   . LEU A 1 53  ? 11.325  -0.877  -8.232  1.00 0.00 ? 53  LEU A HA   2  
ATOM 2981  H HB2  . LEU A 1 53  ? 13.456  0.685   -6.806  1.00 0.00 ? 53  LEU A HB2  2  
ATOM 2982  H HB3  . LEU A 1 53  ? 13.750  -0.081  -8.366  1.00 0.00 ? 53  LEU A HB3  2  
ATOM 2983  H HG   . LEU A 1 53  ? 11.444  1.792   -8.079  1.00 0.00 ? 53  LEU A HG   2  
ATOM 2984  H HD11 . LEU A 1 53  ? 13.156  3.562   -8.893  1.00 0.00 ? 53  LEU A HD11 2  
ATOM 2985  H HD12 . LEU A 1 53  ? 14.340  2.528   -8.094  1.00 0.00 ? 53  LEU A HD12 2  
ATOM 2986  H HD13 . LEU A 1 53  ? 13.010  3.224   -7.168  1.00 0.00 ? 53  LEU A HD13 2  
ATOM 2987  H HD21 . LEU A 1 53  ? 13.359  1.130   -10.314 1.00 0.00 ? 53  LEU A HD21 2  
ATOM 2988  H HD22 . LEU A 1 53  ? 12.005  2.255   -10.425 1.00 0.00 ? 53  LEU A HD22 2  
ATOM 2989  H HD23 . LEU A 1 53  ? 11.706  0.539   -10.143 1.00 0.00 ? 53  LEU A HD23 2  
ATOM 2990  N N    . LYS A 1 54  ? 13.442  -2.062  -5.985  1.00 0.00 ? 54  LYS A N    2  
ATOM 2991  C CA   . LYS A 1 54  ? 14.179  -3.255  -5.583  1.00 0.00 ? 54  LYS A CA   2  
ATOM 2992  C C    . LYS A 1 54  ? 13.261  -4.471  -5.534  1.00 0.00 ? 54  LYS A C    2  
ATOM 2993  O O    . LYS A 1 54  ? 13.588  -5.530  -6.070  1.00 0.00 ? 54  LYS A O    2  
ATOM 2994  C CB   . LYS A 1 54  ? 14.832  -3.039  -4.216  1.00 0.00 ? 54  LYS A CB   2  
ATOM 2995  C CG   . LYS A 1 54  ? 16.069  -3.891  -3.991  1.00 0.00 ? 54  LYS A CG   2  
ATOM 2996  C CD   . LYS A 1 54  ? 16.386  -4.035  -2.512  1.00 0.00 ? 54  LYS A CD   2  
ATOM 2997  C CE   . LYS A 1 54  ? 17.292  -2.915  -2.025  1.00 0.00 ? 54  LYS A CE   2  
ATOM 2998  N NZ   . LYS A 1 54  ? 18.724  -3.186  -2.331  1.00 0.00 ? 54  LYS A NZ   2  
ATOM 2999  H H    . LYS A 1 54  ? 13.495  -1.257  -5.427  1.00 0.00 ? 54  LYS A H    2  
ATOM 3000  H HA   . LYS A 1 54  ? 14.951  -3.431  -6.317  1.00 0.00 ? 54  LYS A HA   2  
ATOM 3001  H HB2  . LYS A 1 54  ? 15.114  -2.000  -4.125  1.00 0.00 ? 54  LYS A HB2  2  
ATOM 3002  H HB3  . LYS A 1 54  ? 14.112  -3.276  -3.446  1.00 0.00 ? 54  LYS A HB3  2  
ATOM 3003  H HG2  . LYS A 1 54  ? 15.900  -4.872  -4.409  1.00 0.00 ? 54  LYS A HG2  2  
ATOM 3004  H HG3  . LYS A 1 54  ? 16.910  -3.426  -4.487  1.00 0.00 ? 54  LYS A HG3  2  
ATOM 3005  H HD2  . LYS A 1 54  ? 15.464  -4.007  -1.951  1.00 0.00 ? 54  LYS A HD2  2  
ATOM 3006  H HD3  . LYS A 1 54  ? 16.880  -4.983  -2.350  1.00 0.00 ? 54  LYS A HD3  2  
ATOM 3007  H HE2  . LYS A 1 54  ? 16.998  -1.996  -2.507  1.00 0.00 ? 54  LYS A HE2  2  
ATOM 3008  H HE3  . LYS A 1 54  ? 17.174  -2.814  -0.956  1.00 0.00 ? 54  LYS A HE3  2  
ATOM 3009  H HZ1  . LYS A 1 54  ? 19.327  -2.831  -1.562  1.00 0.00 ? 54  LYS A HZ1  2  
ATOM 3010  H HZ2  . LYS A 1 54  ? 18.996  -2.714  -3.216  1.00 0.00 ? 54  LYS A HZ2  2  
ATOM 3011  H HZ3  . LYS A 1 54  ? 18.880  -4.209  -2.435  1.00 0.00 ? 54  LYS A HZ3  2  
ATOM 3012  N N    . TYR A 1 55  ? 12.111  -4.312  -4.888  1.00 0.00 ? 55  TYR A N    2  
ATOM 3013  C CA   . TYR A 1 55  ? 11.145  -5.399  -4.768  1.00 0.00 ? 55  TYR A CA   2  
ATOM 3014  C C    . TYR A 1 55  ? 10.200  -5.422  -5.965  1.00 0.00 ? 55  TYR A C    2  
ATOM 3015  O O    . TYR A 1 55  ? 9.136   -6.038  -5.918  1.00 0.00 ? 55  TYR A O    2  
ATOM 3016  C CB   . TYR A 1 55  ? 10.343  -5.256  -3.473  1.00 0.00 ? 55  TYR A CB   2  
ATOM 3017  C CG   . TYR A 1 55  ? 11.163  -5.487  -2.224  1.00 0.00 ? 55  TYR A CG   2  
ATOM 3018  C CD1  . TYR A 1 55  ? 11.323  -6.765  -1.702  1.00 0.00 ? 55  TYR A CD1  2  
ATOM 3019  C CD2  . TYR A 1 55  ? 11.778  -4.429  -1.567  1.00 0.00 ? 55  TYR A CD2  2  
ATOM 3020  C CE1  . TYR A 1 55  ? 12.071  -6.981  -0.560  1.00 0.00 ? 55  TYR A CE1  2  
ATOM 3021  C CE2  . TYR A 1 55  ? 12.528  -4.636  -0.426  1.00 0.00 ? 55  TYR A CE2  2  
ATOM 3022  C CZ   . TYR A 1 55  ? 12.672  -5.914  0.074   1.00 0.00 ? 55  TYR A CZ   2  
ATOM 3023  O OH   . TYR A 1 55  ? 13.417  -6.125  1.211   1.00 0.00 ? 55  TYR A OH   2  
ATOM 3024  H H    . TYR A 1 55  ? 11.906  -3.445  -4.481  1.00 0.00 ? 55  TYR A H    2  
ATOM 3025  H HA   . TYR A 1 55  ? 11.694  -6.328  -4.739  1.00 0.00 ? 55  TYR A HA   2  
ATOM 3026  H HB2  . TYR A 1 55  ? 9.933   -4.259  -3.420  1.00 0.00 ? 55  TYR A HB2  2  
ATOM 3027  H HB3  . TYR A 1 55  ? 9.535   -5.972  -3.478  1.00 0.00 ? 55  TYR A HB3  2  
ATOM 3028  H HD1  . TYR A 1 55  ? 10.851  -7.599  -2.201  1.00 0.00 ? 55  TYR A HD1  2  
ATOM 3029  H HD2  . TYR A 1 55  ? 11.663  -3.429  -1.960  1.00 0.00 ? 55  TYR A HD2  2  
ATOM 3030  H HE1  . TYR A 1 55  ? 12.183  -7.982  -0.169  1.00 0.00 ? 55  TYR A HE1  2  
ATOM 3031  H HE2  . TYR A 1 55  ? 12.999  -3.801  0.071   1.00 0.00 ? 55  TYR A HE2  2  
ATOM 3032  H HH   . TYR A 1 55  ? 12.854  -6.038  1.983   1.00 0.00 ? 55  TYR A HH   2  
ATOM 3033  N N    . ASN A 1 56  ? 10.597  -4.745  -7.038  1.00 0.00 ? 56  ASN A N    2  
ATOM 3034  C CA   . ASN A 1 56  ? 9.786   -4.688  -8.249  1.00 0.00 ? 56  ASN A CA   2  
ATOM 3035  C C    . ASN A 1 56  ? 10.616  -5.049  -9.477  1.00 0.00 ? 56  ASN A C    2  
ATOM 3036  O O    . ASN A 1 56  ? 11.260  -4.189  -10.079 1.00 0.00 ? 56  ASN A O    2  
ATOM 3037  C CB   . ASN A 1 56  ? 9.185   -3.291  -8.419  1.00 0.00 ? 56  ASN A CB   2  
ATOM 3038  C CG   . ASN A 1 56  ? 8.041   -3.271  -9.415  1.00 0.00 ? 56  ASN A CG   2  
ATOM 3039  O OD1  . ASN A 1 56  ? 7.458   -4.309  -9.728  1.00 0.00 ? 56  ASN A OD1  2  
ATOM 3040  N ND2  . ASN A 1 56  ? 7.716   -2.086  -9.918  1.00 0.00 ? 56  ASN A ND2  2  
ATOM 3041  H H    . ASN A 1 56  ? 11.456  -4.274  -7.015  1.00 0.00 ? 56  ASN A H    2  
ATOM 3042  H HA   . ASN A 1 56  ? 8.986   -5.405  -8.146  1.00 0.00 ? 56  ASN A HA   2  
ATOM 3043  H HB2  . ASN A 1 56  ? 8.812   -2.948  -7.465  1.00 0.00 ? 56  ASN A HB2  2  
ATOM 3044  H HB3  . ASN A 1 56  ? 9.952   -2.615  -8.765  1.00 0.00 ? 56  ASN A HB3  2  
ATOM 3045  H HD21 . ASN A 1 56  ? 8.224   -1.302  -9.623  1.00 0.00 ? 56  ASN A HD21 2  
ATOM 3046  H HD22 . ASN A 1 56  ? 6.979   -2.045  -10.563 1.00 0.00 ? 56  ASN A HD22 2  
ATOM 3047  N N    . CYS A 1 57  ? 10.596  -6.326  -9.843  1.00 0.00 ? 57  CYS A N    2  
ATOM 3048  C CA   . CYS A 1 57  ? 11.346  -6.802  -11.000 1.00 0.00 ? 57  CYS A CA   2  
ATOM 3049  C C    . CYS A 1 57  ? 10.457  -7.631  -11.921 1.00 0.00 ? 57  CYS A C    2  
ATOM 3050  O O    . CYS A 1 57  ? 10.440  -7.426  -13.136 1.00 0.00 ? 57  CYS A O    2  
ATOM 3051  C CB   . CYS A 1 57  ? 12.548  -7.633  -10.547 1.00 0.00 ? 57  CYS A CB   2  
ATOM 3052  S SG   . CYS A 1 57  ? 12.114  -9.068  -9.537  1.00 0.00 ? 57  CYS A SG   2  
ATOM 3053  H H    . CYS A 1 57  ? 10.063  -6.964  -9.324  1.00 0.00 ? 57  CYS A H    2  
ATOM 3054  H HA   . CYS A 1 57  ? 11.700  -5.938  -11.542 1.00 0.00 ? 57  CYS A HA   2  
ATOM 3055  H HB2  . CYS A 1 57  ? 13.076  -7.993  -11.418 1.00 0.00 ? 57  CYS A HB2  2  
ATOM 3056  H HB3  . CYS A 1 57  ? 13.210  -7.008  -9.967  1.00 0.00 ? 57  CYS A HB3  2  
ATOM 3057  H HG   . CYS A 1 57  ? 11.336  -8.652  -8.549  1.00 0.00 ? 57  CYS A HG   2  
ATOM 3058  N N    . THR A 1 58  ? 9.720   -8.570  -11.336 1.00 0.00 ? 58  THR A N    2  
ATOM 3059  C CA   . THR A 1 58  ? 8.830   -9.432  -12.104 1.00 0.00 ? 58  THR A CA   2  
ATOM 3060  C C    . THR A 1 58  ? 7.462   -9.540  -11.442 1.00 0.00 ? 58  THR A C    2  
ATOM 3061  O O    . THR A 1 58  ? 6.490   -8.941  -11.901 1.00 0.00 ? 58  THR A O    2  
ATOM 3062  C CB   . THR A 1 58  ? 9.422   -10.845 -12.268 1.00 0.00 ? 58  THR A CB   2  
ATOM 3063  O OG1  . THR A 1 58  ? 10.708  -10.768 -12.892 1.00 0.00 ? 58  THR A OG1  2  
ATOM 3064  C CG2  . THR A 1 58  ? 8.500   -11.724 -13.101 1.00 0.00 ? 58  THR A CG2  2  
ATOM 3065  H H    . THR A 1 58  ? 9.777   -8.684  -10.365 1.00 0.00 ? 58  THR A H    2  
ATOM 3066  H HA   . THR A 1 58  ? 8.711   -8.998  -13.086 1.00 0.00 ? 58  THR A HA   2  
ATOM 3067  H HB   . THR A 1 58  ? 9.531   -11.289 -11.289 1.00 0.00 ? 58  THR A HB   2  
ATOM 3068  H HG1  . THR A 1 58  ? 11.345  -11.268 -12.376 1.00 0.00 ? 58  THR A HG1  2  
ATOM 3069  H HG21 . THR A 1 58  ? 7.495   -11.332 -13.059 1.00 0.00 ? 58  THR A HG21 2  
ATOM 3070  H HG22 . THR A 1 58  ? 8.512   -12.730 -12.709 1.00 0.00 ? 58  THR A HG22 2  
ATOM 3071  H HG23 . THR A 1 58  ? 8.840   -11.732 -14.125 1.00 0.00 ? 58  THR A HG23 2  
ATOM 3072  N N    . GLY A 1 59  ? 7.392   -10.308 -10.359 1.00 0.00 ? 59  GLY A N    2  
ATOM 3073  C CA   . GLY A 1 59  ? 6.138   -10.479 -9.650  1.00 0.00 ? 59  GLY A CA   2  
ATOM 3074  C C    . GLY A 1 59  ? 5.901   -9.394  -8.619  1.00 0.00 ? 59  GLY A C    2  
ATOM 3075  O O    . GLY A 1 59  ? 5.162   -8.441  -8.868  1.00 0.00 ? 59  GLY A O    2  
ATOM 3076  H H    . GLY A 1 59  ? 8.200   -10.762 -10.038 1.00 0.00 ? 59  GLY A H    2  
ATOM 3077  H HA2  . GLY A 1 59  ? 5.328   -10.465 -10.365 1.00 0.00 ? 59  GLY A HA2  2  
ATOM 3078  H HA3  . GLY A 1 59  ? 6.147   -11.438 -9.151  1.00 0.00 ? 59  GLY A HA3  2  
ATOM 3079  N N    . LEU A 1 60  ? 6.528   -9.538  -7.457  1.00 0.00 ? 60  LEU A N    2  
ATOM 3080  C CA   . LEU A 1 60  ? 6.380   -8.562  -6.382  1.00 0.00 ? 60  LEU A CA   2  
ATOM 3081  C C    . LEU A 1 60  ? 6.315   -7.144  -6.940  1.00 0.00 ? 60  LEU A C    2  
ATOM 3082  O O    . LEU A 1 60  ? 7.288   -6.642  -7.500  1.00 0.00 ? 60  LEU A O    2  
ATOM 3083  C CB   . LEU A 1 60  ? 7.543   -8.682  -5.395  1.00 0.00 ? 60  LEU A CB   2  
ATOM 3084  C CG   . LEU A 1 60  ? 7.275   -8.175  -3.978  1.00 0.00 ? 60  LEU A CG   2  
ATOM 3085  C CD1  . LEU A 1 60  ? 6.161   -8.979  -3.325  1.00 0.00 ? 60  LEU A CD1  2  
ATOM 3086  C CD2  . LEU A 1 60  ? 8.543   -8.240  -3.139  1.00 0.00 ? 60  LEU A CD2  2  
ATOM 3087  H H    . LEU A 1 60  ? 7.103   -10.318 -7.316  1.00 0.00 ? 60  LEU A H    2  
ATOM 3088  H HA   . LEU A 1 60  ? 5.457   -8.776  -5.865  1.00 0.00 ? 60  LEU A HA   2  
ATOM 3089  H HB2  . LEU A 1 60  ? 7.813   -9.724  -5.328  1.00 0.00 ? 60  LEU A HB2  2  
ATOM 3090  H HB3  . LEU A 1 60  ? 8.375   -8.121  -5.796  1.00 0.00 ? 60  LEU A HB3  2  
ATOM 3091  H HG   . LEU A 1 60  ? 6.956   -7.143  -4.025  1.00 0.00 ? 60  LEU A HG   2  
ATOM 3092  H HD11 . LEU A 1 60  ? 6.394   -10.031 -3.385  1.00 0.00 ? 60  LEU A HD11 2  
ATOM 3093  H HD12 . LEU A 1 60  ? 5.230   -8.787  -3.838  1.00 0.00 ? 60  LEU A HD12 2  
ATOM 3094  H HD13 . LEU A 1 60  ? 6.067   -8.688  -2.289  1.00 0.00 ? 60  LEU A HD13 2  
ATOM 3095  H HD21 . LEU A 1 60  ? 8.663   -9.238  -2.745  1.00 0.00 ? 60  LEU A HD21 2  
ATOM 3096  H HD22 . LEU A 1 60  ? 8.470   -7.537  -2.322  1.00 0.00 ? 60  LEU A HD22 2  
ATOM 3097  H HD23 . LEU A 1 60  ? 9.394   -7.990  -3.755  1.00 0.00 ? 60  LEU A HD23 2  
ATOM 3098  N N    . ASN A 1 61  ? 5.162   -6.503  -6.779  1.00 0.00 ? 61  ASN A N    2  
ATOM 3099  C CA   . ASN A 1 61  ? 4.971   -5.141  -7.265  1.00 0.00 ? 61  ASN A CA   2  
ATOM 3100  C C    . ASN A 1 61  ? 4.677   -4.188  -6.110  1.00 0.00 ? 61  ASN A C    2  
ATOM 3101  O O    . ASN A 1 61  ? 4.434   -4.618  -4.983  1.00 0.00 ? 61  ASN A O    2  
ATOM 3102  C CB   . ASN A 1 61  ? 3.828   -5.096  -8.282  1.00 0.00 ? 61  ASN A CB   2  
ATOM 3103  C CG   . ASN A 1 61  ? 4.258   -5.573  -9.655  1.00 0.00 ? 61  ASN A CG   2  
ATOM 3104  O OD1  . ASN A 1 61  ? 4.985   -4.878  -10.367 1.00 0.00 ? 61  ASN A OD1  2  
ATOM 3105  N ND2  . ASN A 1 61  ? 3.809   -6.763  -10.035 1.00 0.00 ? 61  ASN A ND2  2  
ATOM 3106  H H    . ASN A 1 61  ? 4.422   -6.956  -6.323  1.00 0.00 ? 61  ASN A H    2  
ATOM 3107  H HA   . ASN A 1 61  ? 5.884   -4.830  -7.749  1.00 0.00 ? 61  ASN A HA   2  
ATOM 3108  H HB2  . ASN A 1 61  ? 3.024   -5.729  -7.938  1.00 0.00 ? 61  ASN A HB2  2  
ATOM 3109  H HB3  . ASN A 1 61  ? 3.471   -4.081  -8.368  1.00 0.00 ? 61  ASN A HB3  2  
ATOM 3110  H HD21 . ASN A 1 61  ? 3.234   -7.261  -9.417  1.00 0.00 ? 61  ASN A HD21 2  
ATOM 3111  H HD22 . ASN A 1 61  ? 4.072   -7.096  -10.919 1.00 0.00 ? 61  ASN A HD22 2  
ATOM 3112  N N    . PHE A 1 62  ? 4.701   -2.891  -6.400  1.00 0.00 ? 62  PHE A N    2  
ATOM 3113  C CA   . PHE A 1 62  ? 4.438   -1.876  -5.387  1.00 0.00 ? 62  PHE A CA   2  
ATOM 3114  C C    . PHE A 1 62  ? 3.390   -0.880  -5.874  1.00 0.00 ? 62  PHE A C    2  
ATOM 3115  O O    . PHE A 1 62  ? 3.554   -0.251  -6.919  1.00 0.00 ? 62  PHE A O    2  
ATOM 3116  C CB   . PHE A 1 62  ? 5.729   -1.139  -5.025  1.00 0.00 ? 62  PHE A CB   2  
ATOM 3117  C CG   . PHE A 1 62  ? 6.494   -1.784  -3.905  1.00 0.00 ? 62  PHE A CG   2  
ATOM 3118  C CD1  . PHE A 1 62  ? 6.922   -3.098  -4.007  1.00 0.00 ? 62  PHE A CD1  2  
ATOM 3119  C CD2  . PHE A 1 62  ? 6.785   -1.076  -2.750  1.00 0.00 ? 62  PHE A CD2  2  
ATOM 3120  C CE1  . PHE A 1 62  ? 7.625   -3.693  -2.977  1.00 0.00 ? 62  PHE A CE1  2  
ATOM 3121  C CE2  . PHE A 1 62  ? 7.488   -1.667  -1.716  1.00 0.00 ? 62  PHE A CE2  2  
ATOM 3122  C CZ   . PHE A 1 62  ? 7.909   -2.977  -1.831  1.00 0.00 ? 62  PHE A CZ   2  
ATOM 3123  H H    . PHE A 1 62  ? 4.902   -2.610  -7.318  1.00 0.00 ? 62  PHE A H    2  
ATOM 3124  H HA   . PHE A 1 62  ? 4.061   -2.376  -4.508  1.00 0.00 ? 62  PHE A HA   2  
ATOM 3125  H HB2  . PHE A 1 62  ? 6.373   -1.109  -5.891  1.00 0.00 ? 62  PHE A HB2  2  
ATOM 3126  H HB3  . PHE A 1 62  ? 5.487   -0.130  -4.726  1.00 0.00 ? 62  PHE A HB3  2  
ATOM 3127  H HD1  . PHE A 1 62  ? 6.701   -3.659  -4.903  1.00 0.00 ? 62  PHE A HD1  2  
ATOM 3128  H HD2  . PHE A 1 62  ? 6.455   -0.050  -2.659  1.00 0.00 ? 62  PHE A HD2  2  
ATOM 3129  H HE1  . PHE A 1 62  ? 7.954   -4.718  -3.069  1.00 0.00 ? 62  PHE A HE1  2  
ATOM 3130  H HE2  . PHE A 1 62  ? 7.708   -1.103  -0.822  1.00 0.00 ? 62  PHE A HE2  2  
ATOM 3131  H HZ   . PHE A 1 62  ? 8.458   -3.440  -1.025  1.00 0.00 ? 62  PHE A HZ   2  
ATOM 3132  N N    . GLY A 1 63  ? 2.311   -0.743  -5.109  1.00 0.00 ? 63  GLY A N    2  
ATOM 3133  C CA   . GLY A 1 63  ? 1.251   0.177   -5.479  1.00 0.00 ? 63  GLY A CA   2  
ATOM 3134  C C    . GLY A 1 63  ? 1.082   1.300   -4.475  1.00 0.00 ? 63  GLY A C    2  
ATOM 3135  O O    . GLY A 1 63  ? 1.388   1.139   -3.293  1.00 0.00 ? 63  GLY A O    2  
ATOM 3136  H H    . GLY A 1 63  ? 2.234   -1.271  -4.287  1.00 0.00 ? 63  GLY A H    2  
ATOM 3137  H HA2  . GLY A 1 63  ? 1.479   0.602   -6.445  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 3138  H HA3  . GLY A 1 63  ? 0.323   -0.371  -5.548  1.00 0.00 ? 63  GLY A HA3  2  
ATOM 3139  N N    . LYS A 1 64  ? 0.594   2.443   -4.945  1.00 0.00 ? 64  LYS A N    2  
ATOM 3140  C CA   . LYS A 1 64  ? 0.384   3.599   -4.081  1.00 0.00 ? 64  LYS A CA   2  
ATOM 3141  C C    . LYS A 1 64  ? -0.937  4.289   -4.407  1.00 0.00 ? 64  LYS A C    2  
ATOM 3142  O O    . LYS A 1 64  ? -1.103  4.857   -5.486  1.00 0.00 ? 64  LYS A O    2  
ATOM 3143  C CB   . LYS A 1 64  ? 1.540   4.590   -4.232  1.00 0.00 ? 64  LYS A CB   2  
ATOM 3144  C CG   . LYS A 1 64  ? 1.682   5.542   -3.057  1.00 0.00 ? 64  LYS A CG   2  
ATOM 3145  C CD   . LYS A 1 64  ? 3.060   6.180   -3.020  1.00 0.00 ? 64  LYS A CD   2  
ATOM 3146  C CE   . LYS A 1 64  ? 3.133   7.404   -3.921  1.00 0.00 ? 64  LYS A CE   2  
ATOM 3147  N NZ   . LYS A 1 64  ? 4.521   7.932   -4.028  1.00 0.00 ? 64  LYS A NZ   2  
ATOM 3148  H H    . LYS A 1 64  ? 0.368   2.510   -5.897  1.00 0.00 ? 64  LYS A H    2  
ATOM 3149  H HA   . LYS A 1 64  ? 0.352   3.249   -3.061  1.00 0.00 ? 64  LYS A HA   2  
ATOM 3150  H HB2  . LYS A 1 64  ? 2.462   4.037   -4.334  1.00 0.00 ? 64  LYS A HB2  2  
ATOM 3151  H HB3  . LYS A 1 64  ? 1.382   5.176   -5.126  1.00 0.00 ? 64  LYS A HB3  2  
ATOM 3152  H HG2  . LYS A 1 64  ? 0.939   6.321   -3.145  1.00 0.00 ? 64  LYS A HG2  2  
ATOM 3153  H HG3  . LYS A 1 64  ? 1.524   4.993   -2.140  1.00 0.00 ? 64  LYS A HG3  2  
ATOM 3154  H HD2  . LYS A 1 64  ? 3.281   6.481   -2.006  1.00 0.00 ? 64  LYS A HD2  2  
ATOM 3155  H HD3  . LYS A 1 64  ? 3.792   5.456   -3.350  1.00 0.00 ? 64  LYS A HD3  2  
ATOM 3156  H HE2  . LYS A 1 64  ? 2.784   7.131   -4.905  1.00 0.00 ? 64  LYS A HE2  2  
ATOM 3157  H HE3  . LYS A 1 64  ? 2.494   8.173   -3.513  1.00 0.00 ? 64  LYS A HE3  2  
ATOM 3158  H HZ1  . LYS A 1 64  ? 5.207   7.174   -3.838  1.00 0.00 ? 64  LYS A HZ1  2  
ATOM 3159  H HZ2  . LYS A 1 64  ? 4.667   8.696   -3.337  1.00 0.00 ? 64  LYS A HZ2  2  
ATOM 3160  H HZ3  . LYS A 1 64  ? 4.688   8.307   -4.983  1.00 0.00 ? 64  LYS A HZ3  2  
ATOM 3161  N N    . VAL A 1 65  ? -1.874  4.237   -3.465  1.00 0.00 ? 65  VAL A N    2  
ATOM 3162  C CA   . VAL A 1 65  ? -3.179  4.859   -3.651  1.00 0.00 ? 65  VAL A CA   2  
ATOM 3163  C C    . VAL A 1 65  ? -3.389  6.002   -2.664  1.00 0.00 ? 65  VAL A C    2  
ATOM 3164  O O    . VAL A 1 65  ? -3.175  5.844   -1.462  1.00 0.00 ? 65  VAL A O    2  
ATOM 3165  C CB   . VAL A 1 65  ? -4.318  3.835   -3.484  1.00 0.00 ? 65  VAL A CB   2  
ATOM 3166  C CG1  . VAL A 1 65  ? -4.165  3.075   -2.175  1.00 0.00 ? 65  VAL A CG1  2  
ATOM 3167  C CG2  . VAL A 1 65  ? -5.671  4.528   -3.552  1.00 0.00 ? 65  VAL A CG2  2  
ATOM 3168  H H    . VAL A 1 65  ? -1.682  3.769   -2.626  1.00 0.00 ? 65  VAL A H    2  
ATOM 3169  H HA   . VAL A 1 65  ? -3.222  5.252   -4.656  1.00 0.00 ? 65  VAL A HA   2  
ATOM 3170  H HB   . VAL A 1 65  ? -4.259  3.125   -4.296  1.00 0.00 ? 65  VAL A HB   2  
ATOM 3171  H HG11 . VAL A 1 65  ? -3.365  2.355   -2.269  1.00 0.00 ? 65  VAL A HG11 2  
ATOM 3172  H HG12 . VAL A 1 65  ? -3.935  3.769   -1.380  1.00 0.00 ? 65  VAL A HG12 2  
ATOM 3173  H HG13 . VAL A 1 65  ? -5.087  2.560   -1.948  1.00 0.00 ? 65  VAL A HG13 2  
ATOM 3174  H HG21 . VAL A 1 65  ? -5.533  5.558   -3.846  1.00 0.00 ? 65  VAL A HG21 2  
ATOM 3175  H HG22 . VAL A 1 65  ? -6.295  4.027   -4.278  1.00 0.00 ? 65  VAL A HG22 2  
ATOM 3176  H HG23 . VAL A 1 65  ? -6.145  4.489   -2.583  1.00 0.00 ? 65  VAL A HG23 2  
ATOM 3177  N N    . ASP A 1 66  ? -3.809  7.152   -3.179  1.00 0.00 ? 66  ASP A N    2  
ATOM 3178  C CA   . ASP A 1 66  ? -4.049  8.322   -2.343  1.00 0.00 ? 66  ASP A CA   2  
ATOM 3179  C C    . ASP A 1 66  ? -5.381  8.200   -1.608  1.00 0.00 ? 66  ASP A C    2  
ATOM 3180  O O    . ASP A 1 66  ? -6.448  8.294   -2.215  1.00 0.00 ? 66  ASP A O    2  
ATOM 3181  C CB   . ASP A 1 66  ? -4.036  9.594   -3.192  1.00 0.00 ? 66  ASP A CB   2  
ATOM 3182  C CG   . ASP A 1 66  ? -4.299  10.841  -2.372  1.00 0.00 ? 66  ASP A CG   2  
ATOM 3183  O OD1  . ASP A 1 66  ? -3.638  11.015  -1.327  1.00 0.00 ? 66  ASP A OD1  2  
ATOM 3184  O OD2  . ASP A 1 66  ? -5.167  11.643  -2.775  1.00 0.00 ? 66  ASP A OD2  2  
ATOM 3185  H H    . ASP A 1 66  ? -3.962  7.215   -4.146  1.00 0.00 ? 66  ASP A H    2  
ATOM 3186  H HA   . ASP A 1 66  ? -3.255  8.378   -1.615  1.00 0.00 ? 66  ASP A HA   2  
ATOM 3187  H HB2  . ASP A 1 66  ? -3.069  9.694   -3.664  1.00 0.00 ? 66  ASP A HB2  2  
ATOM 3188  H HB3  . ASP A 1 66  ? -4.797  9.518   -3.954  1.00 0.00 ? 66  ASP A HB3  2  
ATOM 3189  N N    . VAL A 1 67  ? -5.310  7.990   -0.298  1.00 0.00 ? 67  VAL A N    2  
ATOM 3190  C CA   . VAL A 1 67  ? -6.510  7.855   0.520   1.00 0.00 ? 67  VAL A CA   2  
ATOM 3191  C C    . VAL A 1 67  ? -7.004  9.215   0.998   1.00 0.00 ? 67  VAL A C    2  
ATOM 3192  O O    . VAL A 1 67  ? -8.208  9.456   1.082   1.00 0.00 ? 67  VAL A O    2  
ATOM 3193  C CB   . VAL A 1 67  ? -6.257  6.954   1.744   1.00 0.00 ? 67  VAL A CB   2  
ATOM 3194  C CG1  . VAL A 1 67  ? -6.059  5.509   1.311   1.00 0.00 ? 67  VAL A CG1  2  
ATOM 3195  C CG2  . VAL A 1 67  ? -5.055  7.452   2.532   1.00 0.00 ? 67  VAL A CG2  2  
ATOM 3196  H H    . VAL A 1 67  ? -4.431  7.924   0.129   1.00 0.00 ? 67  VAL A H    2  
ATOM 3197  H HA   . VAL A 1 67  ? -7.278  7.396   -0.086  1.00 0.00 ? 67  VAL A HA   2  
ATOM 3198  H HB   . VAL A 1 67  ? -7.125  6.999   2.385   1.00 0.00 ? 67  VAL A HB   2  
ATOM 3199  H HG11 . VAL A 1 67  ? -6.477  5.369   0.325   1.00 0.00 ? 67  VAL A HG11 2  
ATOM 3200  H HG12 . VAL A 1 67  ? -5.004  5.279   1.293   1.00 0.00 ? 67  VAL A HG12 2  
ATOM 3201  H HG13 . VAL A 1 67  ? -6.559  4.853   2.010   1.00 0.00 ? 67  VAL A HG13 2  
ATOM 3202  H HG21 . VAL A 1 67  ? -5.082  7.039   3.529   1.00 0.00 ? 67  VAL A HG21 2  
ATOM 3203  H HG22 . VAL A 1 67  ? -4.145  7.141   2.038   1.00 0.00 ? 67  VAL A HG22 2  
ATOM 3204  H HG23 . VAL A 1 67  ? -5.082  8.530   2.588   1.00 0.00 ? 67  VAL A HG23 2  
ATOM 3205  N N    . GLY A 1 68  ? -6.066  10.104  1.311   1.00 0.00 ? 68  GLY A N    2  
ATOM 3206  C CA   . GLY A 1 68  ? -6.426  11.430  1.777   1.00 0.00 ? 68  GLY A CA   2  
ATOM 3207  C C    . GLY A 1 68  ? -7.563  12.036  0.979   1.00 0.00 ? 68  GLY A C    2  
ATOM 3208  O O    . GLY A 1 68  ? -8.401  12.754  1.526   1.00 0.00 ? 68  GLY A O    2  
ATOM 3209  H H    . GLY A 1 68  ? -5.121  9.857   1.225   1.00 0.00 ? 68  GLY A H    2  
ATOM 3210  H HA2  . GLY A 1 68  ? -6.721  11.368  2.814   1.00 0.00 ? 68  GLY A HA2  2  
ATOM 3211  H HA3  . GLY A 1 68  ? -5.563  12.074  1.697   1.00 0.00 ? 68  GLY A HA3  2  
ATOM 3212  N N    . ARG A 1 69  ? -7.593  11.749  -0.318  1.00 0.00 ? 69  ARG A N    2  
ATOM 3213  C CA   . ARG A 1 69  ? -8.634  12.273  -1.194  1.00 0.00 ? 69  ARG A CA   2  
ATOM 3214  C C    . ARG A 1 69  ? -9.705  11.218  -1.457  1.00 0.00 ? 69  ARG A C    2  
ATOM 3215  O O    . ARG A 1 69  ? -10.891 11.534  -1.558  1.00 0.00 ? 69  ARG A O    2  
ATOM 3216  C CB   . ARG A 1 69  ? -8.029  12.742  -2.518  1.00 0.00 ? 69  ARG A CB   2  
ATOM 3217  C CG   . ARG A 1 69  ? -8.979  13.577  -3.360  1.00 0.00 ? 69  ARG A CG   2  
ATOM 3218  C CD   . ARG A 1 69  ? -8.299  14.096  -4.618  1.00 0.00 ? 69  ARG A CD   2  
ATOM 3219  N NE   . ARG A 1 69  ? -9.265  14.496  -5.637  1.00 0.00 ? 69  ARG A NE   2  
ATOM 3220  C CZ   . ARG A 1 69  ? -8.985  15.336  -6.627  1.00 0.00 ? 69  ARG A CZ   2  
ATOM 3221  N NH1  . ARG A 1 69  ? -7.772  15.862  -6.730  1.00 0.00 ? 69  ARG A NH1  2  
ATOM 3222  N NH2  . ARG A 1 69  ? -9.918  15.652  -7.516  1.00 0.00 ? 69  ARG A NH2  2  
ATOM 3223  H H    . ARG A 1 69  ? -6.897  11.171  -0.696  1.00 0.00 ? 69  ARG A H    2  
ATOM 3224  H HA   . ARG A 1 69  ? -9.091  13.116  -0.698  1.00 0.00 ? 69  ARG A HA   2  
ATOM 3225  H HB2  . ARG A 1 69  ? -7.151  13.335  -2.309  1.00 0.00 ? 69  ARG A HB2  2  
ATOM 3226  H HB3  . ARG A 1 69  ? -7.739  11.876  -3.094  1.00 0.00 ? 69  ARG A HB3  2  
ATOM 3227  H HG2  . ARG A 1 69  ? -9.823  12.967  -3.646  1.00 0.00 ? 69  ARG A HG2  2  
ATOM 3228  H HG3  . ARG A 1 69  ? -9.321  14.417  -2.774  1.00 0.00 ? 69  ARG A HG3  2  
ATOM 3229  H HD2  . ARG A 1 69  ? -7.692  14.950  -4.357  1.00 0.00 ? 69  ARG A HD2  2  
ATOM 3230  H HD3  . ARG A 1 69  ? -7.669  13.316  -5.018  1.00 0.00 ? 69  ARG A HD3  2  
ATOM 3231  H HE   . ARG A 1 69  ? -10.168 14.119  -5.580  1.00 0.00 ? 69  ARG A HE   2  
ATOM 3232  H HH11 . ARG A 1 69  ? -7.067  15.626  -6.062  1.00 0.00 ? 69  ARG A HH11 2  
ATOM 3233  H HH12 . ARG A 1 69  ? -7.563  16.494  -7.477  1.00 0.00 ? 69  ARG A HH12 2  
ATOM 3234  H HH21 . ARG A 1 69  ? -10.833 15.257  -7.441  1.00 0.00 ? 69  ARG A HH21 2  
ATOM 3235  H HH22 . ARG A 1 69  ? -9.705  16.284  -8.260  1.00 0.00 ? 69  ARG A HH22 2  
ATOM 3236  N N    . TYR A 1 70  ? -9.279  9.965   -1.567  1.00 0.00 ? 70  TYR A N    2  
ATOM 3237  C CA   . TYR A 1 70  ? -10.200 8.864   -1.821  1.00 0.00 ? 70  TYR A CA   2  
ATOM 3238  C C    . TYR A 1 70  ? -10.866 8.401   -0.529  1.00 0.00 ? 70  TYR A C    2  
ATOM 3239  O O    . TYR A 1 70  ? -10.443 7.422   0.087   1.00 0.00 ? 70  TYR A O    2  
ATOM 3240  C CB   . TYR A 1 70  ? -9.463  7.694   -2.475  1.00 0.00 ? 70  TYR A CB   2  
ATOM 3241  C CG   . TYR A 1 70  ? -9.166  7.910   -3.941  1.00 0.00 ? 70  TYR A CG   2  
ATOM 3242  C CD1  . TYR A 1 70  ? -8.517  9.059   -4.377  1.00 0.00 ? 70  TYR A CD1  2  
ATOM 3243  C CD2  . TYR A 1 70  ? -9.534  6.965   -4.891  1.00 0.00 ? 70  TYR A CD2  2  
ATOM 3244  C CE1  . TYR A 1 70  ? -8.244  9.260   -5.717  1.00 0.00 ? 70  TYR A CE1  2  
ATOM 3245  C CE2  . TYR A 1 70  ? -9.263  7.157   -6.232  1.00 0.00 ? 70  TYR A CE2  2  
ATOM 3246  C CZ   . TYR A 1 70  ? -8.619  8.306   -6.640  1.00 0.00 ? 70  TYR A CZ   2  
ATOM 3247  O OH   . TYR A 1 70  ? -8.349  8.502   -7.975  1.00 0.00 ? 70  TYR A OH   2  
ATOM 3248  H H    . TYR A 1 70  ? -8.322  9.775   -1.476  1.00 0.00 ? 70  TYR A H    2  
ATOM 3249  H HA   . TYR A 1 70  ? -10.963 9.219   -2.498  1.00 0.00 ? 70  TYR A HA   2  
ATOM 3250  H HB2  . TYR A 1 70  ? -8.524  7.540   -1.966  1.00 0.00 ? 70  TYR A HB2  2  
ATOM 3251  H HB3  . TYR A 1 70  ? -10.066 6.802   -2.385  1.00 0.00 ? 70  TYR A HB3  2  
ATOM 3252  H HD1  . TYR A 1 70  ? -8.225  9.804   -3.652  1.00 0.00 ? 70  TYR A HD1  2  
ATOM 3253  H HD2  . TYR A 1 70  ? -10.039 6.066   -4.568  1.00 0.00 ? 70  TYR A HD2  2  
ATOM 3254  H HE1  . TYR A 1 70  ? -7.739  10.160  -6.037  1.00 0.00 ? 70  TYR A HE1  2  
ATOM 3255  H HE2  . TYR A 1 70  ? -9.557  6.411   -6.955  1.00 0.00 ? 70  TYR A HE2  2  
ATOM 3256  H HH   . TYR A 1 70  ? -8.317  7.654   -8.423  1.00 0.00 ? 70  TYR A HH   2  
ATOM 3257  N N    . THR A 1 71  ? -11.913 9.113   -0.122  1.00 0.00 ? 71  THR A N    2  
ATOM 3258  C CA   . THR A 1 71  ? -12.639 8.778   1.096   1.00 0.00 ? 71  THR A CA   2  
ATOM 3259  C C    . THR A 1 71  ? -13.260 7.389   1.002   1.00 0.00 ? 71  THR A C    2  
ATOM 3260  O O    . THR A 1 71  ? -13.562 6.763   2.018   1.00 0.00 ? 71  THR A O    2  
ATOM 3261  C CB   . THR A 1 71  ? -13.749 9.805   1.390   1.00 0.00 ? 71  THR A CB   2  
ATOM 3262  O OG1  . THR A 1 71  ? -14.713 9.800   0.332   1.00 0.00 ? 71  THR A OG1  2  
ATOM 3263  C CG2  . THR A 1 71  ? -13.166 11.201  1.546   1.00 0.00 ? 71  THR A CG2  2  
ATOM 3264  H H    . THR A 1 71  ? -12.203 9.882   -0.656  1.00 0.00 ? 71  THR A H    2  
ATOM 3265  H HA   . THR A 1 71  ? -11.937 8.793   1.917   1.00 0.00 ? 71  THR A HA   2  
ATOM 3266  H HB   . THR A 1 71  ? -14.237 9.530   2.314   1.00 0.00 ? 71  THR A HB   2  
ATOM 3267  H HG1  . THR A 1 71  ? -14.797 8.911   -0.021  1.00 0.00 ? 71  THR A HG1  2  
ATOM 3268  H HG21 . THR A 1 71  ? -12.218 11.141  2.061   1.00 0.00 ? 71  THR A HG21 2  
ATOM 3269  H HG22 . THR A 1 71  ? -13.848 11.814  2.116   1.00 0.00 ? 71  THR A HG22 2  
ATOM 3270  H HG23 . THR A 1 71  ? -13.018 11.640  0.570   1.00 0.00 ? 71  THR A HG23 2  
ATOM 3271  N N    . ASP A 1 72  ? -13.447 6.912   -0.224  1.00 0.00 ? 72  ASP A N    2  
ATOM 3272  C CA   . ASP A 1 72  ? -14.031 5.595   -0.451  1.00 0.00 ? 72  ASP A CA   2  
ATOM 3273  C C    . ASP A 1 72  ? -13.083 4.493   0.013   1.00 0.00 ? 72  ASP A C    2  
ATOM 3274  O O    . ASP A 1 72  ? -13.503 3.524   0.646   1.00 0.00 ? 72  ASP A O    2  
ATOM 3275  C CB   . ASP A 1 72  ? -14.363 5.409   -1.932  1.00 0.00 ? 72  ASP A CB   2  
ATOM 3276  C CG   . ASP A 1 72  ? -15.376 6.422   -2.430  1.00 0.00 ? 72  ASP A CG   2  
ATOM 3277  O OD1  . ASP A 1 72  ? -16.562 6.309   -2.054  1.00 0.00 ? 72  ASP A OD1  2  
ATOM 3278  O OD2  . ASP A 1 72  ? -14.983 7.327   -3.194  1.00 0.00 ? 72  ASP A OD2  2  
ATOM 3279  H H    . ASP A 1 72  ? -13.186 7.458   -0.994  1.00 0.00 ? 72  ASP A H    2  
ATOM 3280  H HA   . ASP A 1 72  ? -14.943 5.533   0.124   1.00 0.00 ? 72  ASP A HA   2  
ATOM 3281  H HB2  . ASP A 1 72  ? -13.459 5.517   -2.513  1.00 0.00 ? 72  ASP A HB2  2  
ATOM 3282  H HB3  . ASP A 1 72  ? -14.767 4.419   -2.082  1.00 0.00 ? 72  ASP A HB3  2  
ATOM 3283  N N    . VAL A 1 73  ? -11.803 4.647   -0.308  1.00 0.00 ? 73  VAL A N    2  
ATOM 3284  C CA   . VAL A 1 73  ? -10.795 3.666   0.076   1.00 0.00 ? 73  VAL A CA   2  
ATOM 3285  C C    . VAL A 1 73  ? -10.553 3.686   1.581   1.00 0.00 ? 73  VAL A C    2  
ATOM 3286  O O    . VAL A 1 73  ? -10.841 2.715   2.280   1.00 0.00 ? 73  VAL A O    2  
ATOM 3287  C CB   . VAL A 1 73  ? -9.461  3.918   -0.651  1.00 0.00 ? 73  VAL A CB   2  
ATOM 3288  C CG1  . VAL A 1 73  ? -8.411  2.913   -0.204  1.00 0.00 ? 73  VAL A CG1  2  
ATOM 3289  C CG2  . VAL A 1 73  ? -9.657  3.861   -2.159  1.00 0.00 ? 73  VAL A CG2  2  
ATOM 3290  H H    . VAL A 1 73  ? -11.529 5.441   -0.813  1.00 0.00 ? 73  VAL A H    2  
ATOM 3291  H HA   . VAL A 1 73  ? -11.156 2.688   -0.208  1.00 0.00 ? 73  VAL A HA   2  
ATOM 3292  H HB   . VAL A 1 73  ? -9.114  4.907   -0.392  1.00 0.00 ? 73  VAL A HB   2  
ATOM 3293  H HG11 . VAL A 1 73  ? -7.425  3.316   -0.387  1.00 0.00 ? 73  VAL A HG11 2  
ATOM 3294  H HG12 . VAL A 1 73  ? -8.529  2.713   0.851   1.00 0.00 ? 73  VAL A HG12 2  
ATOM 3295  H HG13 . VAL A 1 73  ? -8.531  1.995   -0.761  1.00 0.00 ? 73  VAL A HG13 2  
ATOM 3296  H HG21 . VAL A 1 73  ? -10.670 4.147   -2.400  1.00 0.00 ? 73  VAL A HG21 2  
ATOM 3297  H HG22 . VAL A 1 73  ? -8.968  4.541   -2.638  1.00 0.00 ? 73  VAL A HG22 2  
ATOM 3298  H HG23 . VAL A 1 73  ? -9.473  2.857   -2.509  1.00 0.00 ? 73  VAL A HG23 2  
ATOM 3299  N N    . SER A 1 74  ? -10.021 4.800   2.074   1.00 0.00 ? 74  SER A N    2  
ATOM 3300  C CA   . SER A 1 74  ? -9.736  4.947   3.497   1.00 0.00 ? 74  SER A CA   2  
ATOM 3301  C C    . SER A 1 74  ? -10.784 4.223   4.337   1.00 0.00 ? 74  SER A C    2  
ATOM 3302  O O    . SER A 1 74  ? -10.481 3.245   5.021   1.00 0.00 ? 74  SER A O    2  
ATOM 3303  C CB   . SER A 1 74  ? -9.692  6.427   3.880   1.00 0.00 ? 74  SER A CB   2  
ATOM 3304  O OG   . SER A 1 74  ? -10.811 7.123   3.357   1.00 0.00 ? 74  SER A OG   2  
ATOM 3305  H H    . SER A 1 74  ? -9.813  5.540   1.466   1.00 0.00 ? 74  SER A H    2  
ATOM 3306  H HA   . SER A 1 74  ? -8.770  4.505   3.688   1.00 0.00 ? 74  SER A HA   2  
ATOM 3307  H HB2  . SER A 1 74  ? -9.697  6.518   4.955   1.00 0.00 ? 74  SER A HB2  2  
ATOM 3308  H HB3  . SER A 1 74  ? -8.790  6.871   3.485   1.00 0.00 ? 74  SER A HB3  2  
ATOM 3309  H HG   . SER A 1 74  ? -11.093 6.707   2.539   1.00 0.00 ? 74  SER A HG   2  
ATOM 3310  N N    . THR A 1 75  ? -12.019 4.712   4.282   1.00 0.00 ? 75  THR A N    2  
ATOM 3311  C CA   . THR A 1 75  ? -13.112 4.114   5.038   1.00 0.00 ? 75  THR A CA   2  
ATOM 3312  C C    . THR A 1 75  ? -13.161 2.604   4.834   1.00 0.00 ? 75  THR A C    2  
ATOM 3313  O O    . THR A 1 75  ? -13.437 1.851   5.767   1.00 0.00 ? 75  THR A O    2  
ATOM 3314  C CB   . THR A 1 75  ? -14.470 4.719   4.636   1.00 0.00 ? 75  THR A CB   2  
ATOM 3315  O OG1  . THR A 1 75  ? -14.401 6.149   4.678   1.00 0.00 ? 75  THR A OG1  2  
ATOM 3316  C CG2  . THR A 1 75  ? -15.575 4.232   5.561   1.00 0.00 ? 75  THR A CG2  2  
ATOM 3317  H H    . THR A 1 75  ? -12.197 5.493   3.719   1.00 0.00 ? 75  THR A H    2  
ATOM 3318  H HA   . THR A 1 75  ? -12.945 4.321   6.085   1.00 0.00 ? 75  THR A HA   2  
ATOM 3319  H HB   . THR A 1 75  ? -14.702 4.407   3.627   1.00 0.00 ? 75  THR A HB   2  
ATOM 3320  H HG1  . THR A 1 75  ? -15.263 6.504   4.908   1.00 0.00 ? 75  THR A HG1  2  
ATOM 3321  H HG21 . THR A 1 75  ? -15.690 3.163   5.453   1.00 0.00 ? 75  THR A HG21 2  
ATOM 3322  H HG22 . THR A 1 75  ? -16.502 4.722   5.303   1.00 0.00 ? 75  THR A HG22 2  
ATOM 3323  H HG23 . THR A 1 75  ? -15.317 4.464   6.583   1.00 0.00 ? 75  THR A HG23 2  
ATOM 3324  N N    . ARG A 1 76  ? -12.890 2.168   3.608   1.00 0.00 ? 76  ARG A N    2  
ATOM 3325  C CA   . ARG A 1 76  ? -12.903 0.747   3.282   1.00 0.00 ? 76  ARG A CA   2  
ATOM 3326  C C    . ARG A 1 76  ? -11.828 0.000   4.064   1.00 0.00 ? 76  ARG A C    2  
ATOM 3327  O O    . ARG A 1 76  ? -12.067 -1.092  4.580   1.00 0.00 ? 76  ARG A O    2  
ATOM 3328  C CB   . ARG A 1 76  ? -12.691 0.545   1.780   1.00 0.00 ? 76  ARG A CB   2  
ATOM 3329  C CG   . ARG A 1 76  ? -12.900 -0.890  1.324   1.00 0.00 ? 76  ARG A CG   2  
ATOM 3330  C CD   . ARG A 1 76  ? -12.488 -1.077  -0.128  1.00 0.00 ? 76  ARG A CD   2  
ATOM 3331  N NE   . ARG A 1 76  ? -12.426 -2.488  -0.501  1.00 0.00 ? 76  ARG A NE   2  
ATOM 3332  C CZ   . ARG A 1 76  ? -13.488 -3.200  -0.863  1.00 0.00 ? 76  ARG A CZ   2  
ATOM 3333  N NH1  . ARG A 1 76  ? -14.687 -2.636  -0.900  1.00 0.00 ? 76  ARG A NH1  2  
ATOM 3334  N NH2  . ARG A 1 76  ? -13.351 -4.479  -1.188  1.00 0.00 ? 76  ARG A NH2  2  
ATOM 3335  H H    . ARG A 1 76  ? -12.676 2.818   2.906   1.00 0.00 ? 76  ARG A H    2  
ATOM 3336  H HA   . ARG A 1 76  ? -13.870 0.353   3.556   1.00 0.00 ? 76  ARG A HA   2  
ATOM 3337  H HB2  . ARG A 1 76  ? -13.383 1.175   1.242   1.00 0.00 ? 76  ARG A HB2  2  
ATOM 3338  H HB3  . ARG A 1 76  ? -11.682 0.836   1.530   1.00 0.00 ? 76  ARG A HB3  2  
ATOM 3339  H HG2  . ARG A 1 76  ? -12.304 -1.545  1.942   1.00 0.00 ? 76  ARG A HG2  2  
ATOM 3340  H HG3  . ARG A 1 76  ? -13.944 -1.142  1.429   1.00 0.00 ? 76  ARG A HG3  2  
ATOM 3341  H HD2  . ARG A 1 76  ? -13.209 -0.579  -0.760  1.00 0.00 ? 76  ARG A HD2  2  
ATOM 3342  H HD3  . ARG A 1 76  ? -11.515 -0.633  -0.273  1.00 0.00 ? 76  ARG A HD3  2  
ATOM 3343  H HE   . ARG A 1 76  ? -11.550 -2.925  -0.481  1.00 0.00 ? 76  ARG A HE   2  
ATOM 3344  H HH11 . ARG A 1 76  ? -14.793 -1.672  -0.656  1.00 0.00 ? 76  ARG A HH11 2  
ATOM 3345  H HH12 . ARG A 1 76  ? -15.485 -3.174  -1.173  1.00 0.00 ? 76  ARG A HH12 2  
ATOM 3346  H HH21 . ARG A 1 76  ? -12.448 -4.908  -1.162  1.00 0.00 ? 76  ARG A HH21 2  
ATOM 3347  H HH22 . ARG A 1 76  ? -14.150 -5.014  -1.460  1.00 0.00 ? 76  ARG A HH22 2  
ATOM 3348  N N    . TYR A 1 77  ? -10.643 0.594   4.147   1.00 0.00 ? 77  TYR A N    2  
ATOM 3349  C CA   . TYR A 1 77  ? -9.529  -0.016  4.863   1.00 0.00 ? 77  TYR A CA   2  
ATOM 3350  C C    . TYR A 1 77  ? -9.392  0.575   6.262   1.00 0.00 ? 77  TYR A C    2  
ATOM 3351  O O    . TYR A 1 77  ? -8.294  0.646   6.815   1.00 0.00 ? 77  TYR A O    2  
ATOM 3352  C CB   . TYR A 1 77  ? -8.227  0.178   4.085   1.00 0.00 ? 77  TYR A CB   2  
ATOM 3353  C CG   . TYR A 1 77  ? -8.179  -0.589  2.783   1.00 0.00 ? 77  TYR A CG   2  
ATOM 3354  C CD1  . TYR A 1 77  ? -8.809  -0.102  1.643   1.00 0.00 ? 77  TYR A CD1  2  
ATOM 3355  C CD2  . TYR A 1 77  ? -7.507  -1.801  2.691   1.00 0.00 ? 77  TYR A CD2  2  
ATOM 3356  C CE1  . TYR A 1 77  ? -8.769  -0.799  0.452   1.00 0.00 ? 77  TYR A CE1  2  
ATOM 3357  C CE2  . TYR A 1 77  ? -7.460  -2.505  1.503   1.00 0.00 ? 77  TYR A CE2  2  
ATOM 3358  C CZ   . TYR A 1 77  ? -8.093  -2.000  0.387   1.00 0.00 ? 77  TYR A CZ   2  
ATOM 3359  O OH   . TYR A 1 77  ? -8.050  -2.698  -0.798  1.00 0.00 ? 77  TYR A OH   2  
ATOM 3360  H H    . TYR A 1 77  ? -10.513 1.464   3.714   1.00 0.00 ? 77  TYR A H    2  
ATOM 3361  H HA   . TYR A 1 77  ? -9.731  -1.074  4.950   1.00 0.00 ? 77  TYR A HA   2  
ATOM 3362  H HB2  . TYR A 1 77  ? -8.105  1.225   3.857   1.00 0.00 ? 77  TYR A HB2  2  
ATOM 3363  H HB3  . TYR A 1 77  ? -7.399  -0.152  4.695   1.00 0.00 ? 77  TYR A HB3  2  
ATOM 3364  H HD1  . TYR A 1 77  ? -9.337  0.839   1.698   1.00 0.00 ? 77  TYR A HD1  2  
ATOM 3365  H HD2  . TYR A 1 77  ? -7.013  -2.194  3.568   1.00 0.00 ? 77  TYR A HD2  2  
ATOM 3366  H HE1  . TYR A 1 77  ? -9.264  -0.404  -0.423  1.00 0.00 ? 77  TYR A HE1  2  
ATOM 3367  H HE2  . TYR A 1 77  ? -6.931  -3.445  1.452   1.00 0.00 ? 77  TYR A HE2  2  
ATOM 3368  H HH   . TYR A 1 77  ? -7.153  -3.003  -0.958  1.00 0.00 ? 77  TYR A HH   2  
ATOM 3369  N N    . LYS A 1 78  ? -10.515 0.999   6.831   1.00 0.00 ? 78  LYS A N    2  
ATOM 3370  C CA   . LYS A 1 78  ? -10.524 1.584   8.167   1.00 0.00 ? 78  LYS A CA   2  
ATOM 3371  C C    . LYS A 1 78  ? -9.298  2.466   8.383   1.00 0.00 ? 78  LYS A C    2  
ATOM 3372  O O    . LYS A 1 78  ? -8.638  2.386   9.419   1.00 0.00 ? 78  LYS A O    2  
ATOM 3373  C CB   . LYS A 1 78  ? -10.565 0.482   9.228   1.00 0.00 ? 78  LYS A CB   2  
ATOM 3374  C CG   . LYS A 1 78  ? -11.943 -0.128  9.418   1.00 0.00 ? 78  LYS A CG   2  
ATOM 3375  C CD   . LYS A 1 78  ? -12.191 -1.262  8.437   1.00 0.00 ? 78  LYS A CD   2  
ATOM 3376  C CE   . LYS A 1 78  ? -13.657 -1.666  8.411   1.00 0.00 ? 78  LYS A CE   2  
ATOM 3377  N NZ   . LYS A 1 78  ? -13.880 -2.894  7.597   1.00 0.00 ? 78  LYS A NZ   2  
ATOM 3378  H H    . LYS A 1 78  ? -11.360 0.916   6.340   1.00 0.00 ? 78  LYS A H    2  
ATOM 3379  H HA   . LYS A 1 78  ? -11.411 2.192   8.257   1.00 0.00 ? 78  LYS A HA   2  
ATOM 3380  H HB2  . LYS A 1 78  ? -9.883  -0.304  8.940   1.00 0.00 ? 78  LYS A HB2  2  
ATOM 3381  H HB3  . LYS A 1 78  ? -10.245 0.896   10.173  1.00 0.00 ? 78  LYS A HB3  2  
ATOM 3382  H HG2  . LYS A 1 78  ? -12.021 -0.514  10.424  1.00 0.00 ? 78  LYS A HG2  2  
ATOM 3383  H HG3  . LYS A 1 78  ? -12.690 0.638   9.265   1.00 0.00 ? 78  LYS A HG3  2  
ATOM 3384  H HD2  . LYS A 1 78  ? -11.900 -0.941  7.448   1.00 0.00 ? 78  LYS A HD2  2  
ATOM 3385  H HD3  . LYS A 1 78  ? -11.596 -2.116  8.729   1.00 0.00 ? 78  LYS A HD3  2  
ATOM 3386  H HE2  . LYS A 1 78  ? -13.984 -1.851  9.423   1.00 0.00 ? 78  LYS A HE2  2  
ATOM 3387  H HE3  . LYS A 1 78  ? -14.233 -0.856  7.989   1.00 0.00 ? 78  LYS A HE3  2  
ATOM 3388  H HZ1  . LYS A 1 78  ? -13.730 -2.686  6.589   1.00 0.00 ? 78  LYS A HZ1  2  
ATOM 3389  H HZ2  . LYS A 1 78  ? -14.852 -3.237  7.728   1.00 0.00 ? 78  LYS A HZ2  2  
ATOM 3390  H HZ3  . LYS A 1 78  ? -13.217 -3.641  7.889   1.00 0.00 ? 78  LYS A HZ3  2  
ATOM 3391  N N    . VAL A 1 79  ? -9.000  3.308   7.399   1.00 0.00 ? 79  VAL A N    2  
ATOM 3392  C CA   . VAL A 1 79  ? -7.855  4.207   7.482   1.00 0.00 ? 79  VAL A CA   2  
ATOM 3393  C C    . VAL A 1 79  ? -8.299  5.634   7.785   1.00 0.00 ? 79  VAL A C    2  
ATOM 3394  O O    . VAL A 1 79  ? -8.635  6.396   6.879   1.00 0.00 ? 79  VAL A O    2  
ATOM 3395  C CB   . VAL A 1 79  ? -7.040  4.201   6.175   1.00 0.00 ? 79  VAL A CB   2  
ATOM 3396  C CG1  . VAL A 1 79  ? -5.822  5.103   6.302   1.00 0.00 ? 79  VAL A CG1  2  
ATOM 3397  C CG2  . VAL A 1 79  ? -6.629  2.783   5.811   1.00 0.00 ? 79  VAL A CG2  2  
ATOM 3398  H H    . VAL A 1 79  ? -9.564  3.326   6.597   1.00 0.00 ? 79  VAL A H    2  
ATOM 3399  H HA   . VAL A 1 79  ? -7.217  3.862   8.282   1.00 0.00 ? 79  VAL A HA   2  
ATOM 3400  H HB   . VAL A 1 79  ? -7.665  4.587   5.383   1.00 0.00 ? 79  VAL A HB   2  
ATOM 3401  H HG11 . VAL A 1 79  ? -4.925  4.502   6.270   1.00 0.00 ? 79  VAL A HG11 2  
ATOM 3402  H HG12 . VAL A 1 79  ? -5.811  5.811   5.486   1.00 0.00 ? 79  VAL A HG12 2  
ATOM 3403  H HG13 . VAL A 1 79  ? -5.864  5.635   7.241   1.00 0.00 ? 79  VAL A HG13 2  
ATOM 3404  H HG21 . VAL A 1 79  ? -5.890  2.814   5.025   1.00 0.00 ? 79  VAL A HG21 2  
ATOM 3405  H HG22 . VAL A 1 79  ? -6.210  2.295   6.680   1.00 0.00 ? 79  VAL A HG22 2  
ATOM 3406  H HG23 . VAL A 1 79  ? -7.494  2.232   5.472   1.00 0.00 ? 79  VAL A HG23 2  
ATOM 3407  N N    . SER A 1 80  ? -8.295  5.990   9.066   1.00 0.00 ? 80  SER A N    2  
ATOM 3408  C CA   . SER A 1 80  ? -8.700  7.325   9.490   1.00 0.00 ? 80  SER A CA   2  
ATOM 3409  C C    . SER A 1 80  ? -7.944  8.396   8.708   1.00 0.00 ? 80  SER A C    2  
ATOM 3410  O O    . SER A 1 80  ? -6.717  8.359   8.608   1.00 0.00 ? 80  SER A O    2  
ATOM 3411  C CB   . SER A 1 80  ? -8.455  7.504   10.989  1.00 0.00 ? 80  SER A CB   2  
ATOM 3412  O OG   . SER A 1 80  ? -9.299  6.655   11.748  1.00 0.00 ? 80  SER A OG   2  
ATOM 3413  H H    . SER A 1 80  ? -8.016  5.338   9.742   1.00 0.00 ? 80  SER A H    2  
ATOM 3414  H HA   . SER A 1 80  ? -9.756  7.430   9.291   1.00 0.00 ? 80  SER A HA   2  
ATOM 3415  H HB2  . SER A 1 80  ? -7.427  7.264   11.214  1.00 0.00 ? 80  SER A HB2  2  
ATOM 3416  H HB3  . SER A 1 80  ? -8.654  8.530   11.264  1.00 0.00 ? 80  SER A HB3  2  
ATOM 3417  H HG   . SER A 1 80  ? -10.183 7.028   11.780  1.00 0.00 ? 80  SER A HG   2  
ATOM 3418  N N    . THR A 1 81  ? -8.686  9.350   8.155   1.00 0.00 ? 81  THR A N    2  
ATOM 3419  C CA   . THR A 1 81  ? -8.088  10.431  7.381   1.00 0.00 ? 81  THR A CA   2  
ATOM 3420  C C    . THR A 1 81  ? -8.120  11.744  8.155   1.00 0.00 ? 81  THR A C    2  
ATOM 3421  O O    . THR A 1 81  ? -8.186  12.822  7.565   1.00 0.00 ? 81  THR A O    2  
ATOM 3422  C CB   . THR A 1 81  ? -8.810  10.624  6.035   1.00 0.00 ? 81  THR A CB   2  
ATOM 3423  O OG1  . THR A 1 81  ? -10.177 10.990  6.259   1.00 0.00 ? 81  THR A OG1  2  
ATOM 3424  C CG2  . THR A 1 81  ? -8.751  9.353   5.201   1.00 0.00 ? 81  THR A CG2  2  
ATOM 3425  H H    . THR A 1 81  ? -9.659  9.325   8.270   1.00 0.00 ? 81  THR A H    2  
ATOM 3426  H HA   . THR A 1 81  ? -7.060  10.168  7.180   1.00 0.00 ? 81  THR A HA   2  
ATOM 3427  H HB   . THR A 1 81  ? -8.318  11.418  5.490   1.00 0.00 ? 81  THR A HB   2  
ATOM 3428  H HG1  . THR A 1 81  ? -10.496 10.560  7.057   1.00 0.00 ? 81  THR A HG1  2  
ATOM 3429  H HG21 . THR A 1 81  ? -8.990  8.503   5.823   1.00 0.00 ? 81  THR A HG21 2  
ATOM 3430  H HG22 . THR A 1 81  ? -7.757  9.235   4.796   1.00 0.00 ? 81  THR A HG22 2  
ATOM 3431  H HG23 . THR A 1 81  ? -9.464  9.419   4.393   1.00 0.00 ? 81  THR A HG23 2  
ATOM 3432  N N    . SER A 1 82  ? -8.072  11.646  9.480   1.00 0.00 ? 82  SER A N    2  
ATOM 3433  C CA   . SER A 1 82  ? -8.099  12.827  10.335  1.00 0.00 ? 82  SER A CA   2  
ATOM 3434  C C    . SER A 1 82  ? -6.762  13.561  10.290  1.00 0.00 ? 82  SER A C    2  
ATOM 3435  O O    . SER A 1 82  ? -5.710  12.973  10.035  1.00 0.00 ? 82  SER A O    2  
ATOM 3436  C CB   . SER A 1 82  ? -8.429  12.432  11.776  1.00 0.00 ? 82  SER A CB   2  
ATOM 3437  O OG   . SER A 1 82  ? -9.709  11.829  11.859  1.00 0.00 ? 82  SER A OG   2  
ATOM 3438  H H    . SER A 1 82  ? -8.020  10.758  9.892   1.00 0.00 ? 82  SER A H    2  
ATOM 3439  H HA   . SER A 1 82  ? -8.870  13.487  9.966   1.00 0.00 ? 82  SER A HA   2  
ATOM 3440  H HB2  . SER A 1 82  ? -7.690  11.731  12.132  1.00 0.00 ? 82  SER A HB2  2  
ATOM 3441  H HB3  . SER A 1 82  ? -8.419  13.315  12.399  1.00 0.00 ? 82  SER A HB3  2  
ATOM 3442  H HG   . SER A 1 82  ? -9.611  10.875  11.890  1.00 0.00 ? 82  SER A HG   2  
ATOM 3443  N N    . PRO A 1 83  ? -6.801  14.877  10.545  1.00 0.00 ? 83  PRO A N    2  
ATOM 3444  C CA   . PRO A 1 83  ? -5.602  15.720  10.541  1.00 0.00 ? 83  PRO A CA   2  
ATOM 3445  C C    . PRO A 1 83  ? -4.678  15.421  11.716  1.00 0.00 ? 83  PRO A C    2  
ATOM 3446  O O    . PRO A 1 83  ? -3.455  15.499  11.594  1.00 0.00 ? 83  PRO A O    2  
ATOM 3447  C CB   . PRO A 1 83  ? -6.165  17.139  10.651  1.00 0.00 ? 83  PRO A CB   2  
ATOM 3448  C CG   . PRO A 1 83  ? -7.486  16.971  11.320  1.00 0.00 ? 83  PRO A CG   2  
ATOM 3449  C CD   . PRO A 1 83  ? -8.019  15.643  10.857  1.00 0.00 ? 83  PRO A CD   2  
ATOM 3450  H HA   . PRO A 1 83  ? -5.050  15.621  9.617   1.00 0.00 ? 83  PRO A HA   2  
ATOM 3451  H HB2  . PRO A 1 83  ? -5.497  17.749  11.242  1.00 0.00 ? 83  PRO A HB2  2  
ATOM 3452  H HB3  . PRO A 1 83  ? -6.274  17.565  9.665   1.00 0.00 ? 83  PRO A HB3  2  
ATOM 3453  H HG2  . PRO A 1 83  ? -7.357  16.970  12.392  1.00 0.00 ? 83  PRO A HG2  2  
ATOM 3454  H HG3  . PRO A 1 83  ? -8.152  17.767  11.022  1.00 0.00 ? 83  PRO A HG3  2  
ATOM 3455  H HD2  . PRO A 1 83  ? -8.582  15.167  11.646  1.00 0.00 ? 83  PRO A HD2  2  
ATOM 3456  H HD3  . PRO A 1 83  ? -8.631  15.769  9.976   1.00 0.00 ? 83  PRO A HD3  2  
ATOM 3457  N N    . LEU A 1 84  ? -5.270  15.077  12.855  1.00 0.00 ? 84  LEU A N    2  
ATOM 3458  C CA   . LEU A 1 84  ? -4.500  14.764  14.054  1.00 0.00 ? 84  LEU A CA   2  
ATOM 3459  C C    . LEU A 1 84  ? -4.466  13.260  14.303  1.00 0.00 ? 84  LEU A C    2  
ATOM 3460  O O    . LEU A 1 84  ? -4.802  12.791  15.391  1.00 0.00 ? 84  LEU A O    2  
ATOM 3461  C CB   . LEU A 1 84  ? -5.096  15.480  15.267  1.00 0.00 ? 84  LEU A CB   2  
ATOM 3462  C CG   . LEU A 1 84  ? -4.830  16.984  15.357  1.00 0.00 ? 84  LEU A CG   2  
ATOM 3463  C CD1  . LEU A 1 84  ? -3.347  17.252  15.559  1.00 0.00 ? 84  LEU A CD1  2  
ATOM 3464  C CD2  . LEU A 1 84  ? -5.336  17.690  14.108  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 3465  H H    . LEU A 1 84  ? -6.248  15.031  12.891  1.00 0.00 ? 84  LEU A H    2  
ATOM 3466  H HA   . LEU A 1 84  ? -3.490  15.114  13.899  1.00 0.00 ? 84  LEU A HA   2  
ATOM 3467  H HB2  . LEU A 1 84  ? -6.165  15.335  15.245  1.00 0.00 ? 84  LEU A HB2  2  
ATOM 3468  H HB3  . LEU A 1 84  ? -4.689  15.018  16.155  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 3469  H HG   . LEU A 1 84  ? -5.361  17.386  16.208  1.00 0.00 ? 84  LEU A HG   2  
ATOM 3470  H HD11 . LEU A 1 84  ? -3.216  18.219  16.021  1.00 0.00 ? 84  LEU A HD11 2  
ATOM 3471  H HD12 . LEU A 1 84  ? -2.845  17.240  14.603  1.00 0.00 ? 84  LEU A HD12 2  
ATOM 3472  H HD13 . LEU A 1 84  ? -2.926  16.488  16.196  1.00 0.00 ? 84  LEU A HD13 2  
ATOM 3473  H HD21 . LEU A 1 84  ? -4.875  17.252  13.235  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 3474  H HD22 . LEU A 1 84  ? -5.083  18.739  14.160  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 3475  H HD23 . LEU A 1 84  ? -6.408  17.581  14.042  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 3476  N N    . THR A 1 85  ? -4.056  12.506  13.287  1.00 0.00 ? 85  THR A N    2  
ATOM 3477  C CA   . THR A 1 85  ? -3.977  11.055  13.396  1.00 0.00 ? 85  THR A CA   2  
ATOM 3478  C C    . THR A 1 85  ? -2.584  10.552  13.034  1.00 0.00 ? 85  THR A C    2  
ATOM 3479  O O    . THR A 1 85  ? -1.738  11.315  12.569  1.00 0.00 ? 85  THR A O    2  
ATOM 3480  C CB   . THR A 1 85  ? -5.012  10.366  12.486  1.00 0.00 ? 85  THR A CB   2  
ATOM 3481  O OG1  . THR A 1 85  ? -5.123  8.981   12.832  1.00 0.00 ? 85  THR A OG1  2  
ATOM 3482  C CG2  . THR A 1 85  ? -4.618  10.499  11.022  1.00 0.00 ? 85  THR A CG2  2  
ATOM 3483  H H    . THR A 1 85  ? -3.802  12.938  12.445  1.00 0.00 ? 85  THR A H    2  
ATOM 3484  H HA   . THR A 1 85  ? -4.193  10.785  14.419  1.00 0.00 ? 85  THR A HA   2  
ATOM 3485  H HB   . THR A 1 85  ? -5.970  10.844  12.630  1.00 0.00 ? 85  THR A HB   2  
ATOM 3486  H HG1  . THR A 1 85  ? -5.844  8.584   12.336  1.00 0.00 ? 85  THR A HG1  2  
ATOM 3487  H HG21 . THR A 1 85  ? -5.474  10.286  10.399  1.00 0.00 ? 85  THR A HG21 2  
ATOM 3488  H HG22 . THR A 1 85  ? -3.826  9.800   10.798  1.00 0.00 ? 85  THR A HG22 2  
ATOM 3489  H HG23 . THR A 1 85  ? -4.276  11.504  10.832  1.00 0.00 ? 85  THR A HG23 2  
ATOM 3490  N N    . LYS A 1 86  ? -2.352  9.261   13.251  1.00 0.00 ? 86  LYS A N    2  
ATOM 3491  C CA   . LYS A 1 86  ? -1.062  8.654   12.946  1.00 0.00 ? 86  LYS A CA   2  
ATOM 3492  C C    . LYS A 1 86  ? -1.235  7.428   12.055  1.00 0.00 ? 86  LYS A C    2  
ATOM 3493  O O    . LYS A 1 86  ? -0.630  6.384   12.298  1.00 0.00 ? 86  LYS A O    2  
ATOM 3494  C CB   . LYS A 1 86  ? -0.342  8.262   14.238  1.00 0.00 ? 86  LYS A CB   2  
ATOM 3495  C CG   . LYS A 1 86  ? 0.153   9.451   15.043  1.00 0.00 ? 86  LYS A CG   2  
ATOM 3496  C CD   . LYS A 1 86  ? 1.401   10.061  14.427  1.00 0.00 ? 86  LYS A CD   2  
ATOM 3497  C CE   . LYS A 1 86  ? 2.596   9.128   14.549  1.00 0.00 ? 86  LYS A CE   2  
ATOM 3498  N NZ   . LYS A 1 86  ? 3.864   9.795   14.141  1.00 0.00 ? 86  LYS A NZ   2  
ATOM 3499  H H    . LYS A 1 86  ? -3.067  8.703   13.624  1.00 0.00 ? 86  LYS A H    2  
ATOM 3500  H HA   . LYS A 1 86  ? -0.467  9.385   12.420  1.00 0.00 ? 86  LYS A HA   2  
ATOM 3501  H HB2  . LYS A 1 86  ? -1.021  7.693   14.856  1.00 0.00 ? 86  LYS A HB2  2  
ATOM 3502  H HB3  . LYS A 1 86  ? 0.509   7.644   13.988  1.00 0.00 ? 86  LYS A HB3  2  
ATOM 3503  H HG2  . LYS A 1 86  ? -0.623  10.201  15.075  1.00 0.00 ? 86  LYS A HG2  2  
ATOM 3504  H HG3  . LYS A 1 86  ? 0.382   9.124   16.048  1.00 0.00 ? 86  LYS A HG3  2  
ATOM 3505  H HD2  . LYS A 1 86  ? 1.217   10.257  13.381  1.00 0.00 ? 86  LYS A HD2  2  
ATOM 3506  H HD3  . LYS A 1 86  ? 1.626   10.989  14.934  1.00 0.00 ? 86  LYS A HD3  2  
ATOM 3507  H HE2  . LYS A 1 86  ? 2.683   8.808   15.576  1.00 0.00 ? 86  LYS A HE2  2  
ATOM 3508  H HE3  . LYS A 1 86  ? 2.432   8.269   13.916  1.00 0.00 ? 86  LYS A HE3  2  
ATOM 3509  H HZ1  . LYS A 1 86  ? 4.679   9.284   14.535  1.00 0.00 ? 86  LYS A HZ1  2  
ATOM 3510  H HZ2  . LYS A 1 86  ? 3.881   10.774  14.491  1.00 0.00 ? 86  LYS A HZ2  2  
ATOM 3511  H HZ3  . LYS A 1 86  ? 3.944   9.807   13.104  1.00 0.00 ? 86  LYS A HZ3  2  
ATOM 3512  N N    . GLN A 1 87  ? -2.062  7.563   11.024  1.00 0.00 ? 87  GLN A N    2  
ATOM 3513  C CA   . GLN A 1 87  ? -2.312  6.465   10.097  1.00 0.00 ? 87  GLN A CA   2  
ATOM 3514  C C    . GLN A 1 87  ? -1.864  6.831   8.686   1.00 0.00 ? 87  GLN A C    2  
ATOM 3515  O O    . GLN A 1 87  ? -2.445  6.375   7.701   1.00 0.00 ? 87  GLN A O    2  
ATOM 3516  C CB   . GLN A 1 87  ? -3.797  6.101   10.095  1.00 0.00 ? 87  GLN A CB   2  
ATOM 3517  C CG   . GLN A 1 87  ? -4.304  5.605   11.440  1.00 0.00 ? 87  GLN A CG   2  
ATOM 3518  C CD   . GLN A 1 87  ? -3.997  4.139   11.675  1.00 0.00 ? 87  GLN A CD   2  
ATOM 3519  O OE1  . GLN A 1 87  ? -2.855  3.768   11.945  1.00 0.00 ? 87  GLN A OE1  2  
ATOM 3520  N NE2  . GLN A 1 87  ? -5.018  3.297   11.574  1.00 0.00 ? 87  GLN A NE2  2  
ATOM 3521  H H    . GLN A 1 87  ? -2.514  8.420   10.883  1.00 0.00 ? 87  GLN A H    2  
ATOM 3522  H HA   . GLN A 1 87  ? -1.742  5.612   10.432  1.00 0.00 ? 87  GLN A HA   2  
ATOM 3523  H HB2  . GLN A 1 87  ? -4.370  6.973   9.818   1.00 0.00 ? 87  GLN A HB2  2  
ATOM 3524  H HB3  . GLN A 1 87  ? -3.964  5.324   9.364   1.00 0.00 ? 87  GLN A HB3  2  
ATOM 3525  H HG2  . GLN A 1 87  ? -3.837  6.185   12.222  1.00 0.00 ? 87  GLN A HG2  2  
ATOM 3526  H HG3  . GLN A 1 87  ? -5.375  5.745   11.480  1.00 0.00 ? 87  GLN A HG3  2  
ATOM 3527  H HE21 . GLN A 1 87  ? -5.901  3.664   11.355  1.00 0.00 ? 87  GLN A HE21 2  
ATOM 3528  H HE22 . GLN A 1 87  ? -4.848  2.344   11.720  1.00 0.00 ? 87  GLN A HE22 2  
ATOM 3529  N N    . LEU A 1 88  ? -0.827  7.657   8.595   1.00 0.00 ? 88  LEU A N    2  
ATOM 3530  C CA   . LEU A 1 88  ? -0.300  8.085   7.304   1.00 0.00 ? 88  LEU A CA   2  
ATOM 3531  C C    . LEU A 1 88  ? 1.166   8.489   7.421   1.00 0.00 ? 88  LEU A C    2  
ATOM 3532  O O    . LEU A 1 88  ? 1.538   9.341   8.228   1.00 0.00 ? 88  LEU A O    2  
ATOM 3533  C CB   . LEU A 1 88  ? -1.122  9.254   6.758   1.00 0.00 ? 88  LEU A CB   2  
ATOM 3534  C CG   . LEU A 1 88  ? -2.580  8.948   6.415   1.00 0.00 ? 88  LEU A CG   2  
ATOM 3535  C CD1  . LEU A 1 88  ? -3.339  10.232  6.117   1.00 0.00 ? 88  LEU A CD1  2  
ATOM 3536  C CD2  . LEU A 1 88  ? -2.660  7.992   5.234   1.00 0.00 ? 88  LEU A CD2  2  
ATOM 3537  H H    . LEU A 1 88  ? -0.405  7.987   9.415   1.00 0.00 ? 88  LEU A H    2  
ATOM 3538  H HA   . LEU A 1 88  ? -0.379  7.252   6.622   1.00 0.00 ? 88  LEU A HA   2  
ATOM 3539  H HB2  . LEU A 1 88  ? -1.114  10.038  7.500   1.00 0.00 ? 88  LEU A HB2  2  
ATOM 3540  H HB3  . LEU A 1 88  ? -0.636  9.607   5.860   1.00 0.00 ? 88  LEU A HB3  2  
ATOM 3541  H HG   . LEU A 1 88  ? -3.051  8.472   7.265   1.00 0.00 ? 88  LEU A HG   2  
ATOM 3542  H HD11 . LEU A 1 88  ? -2.749  10.855  5.462   1.00 0.00 ? 88  LEU A HD11 2  
ATOM 3543  H HD12 . LEU A 1 88  ? -3.530  10.759  7.040   1.00 0.00 ? 88  LEU A HD12 2  
ATOM 3544  H HD13 . LEU A 1 88  ? -4.277  9.992   5.639   1.00 0.00 ? 88  LEU A HD13 2  
ATOM 3545  H HD21 . LEU A 1 88  ? -2.131  7.081   5.472   1.00 0.00 ? 88  LEU A HD21 2  
ATOM 3546  H HD22 . LEU A 1 88  ? -2.210  8.453   4.367   1.00 0.00 ? 88  LEU A HD22 2  
ATOM 3547  H HD23 . LEU A 1 88  ? -3.695  7.764   5.026   1.00 0.00 ? 88  LEU A HD23 2  
ATOM 3548  N N    . PRO A 1 89  ? 2.019   7.866   6.595   1.00 0.00 ? 89  PRO A N    2  
ATOM 3549  C CA   . PRO A 1 89  ? 1.588   6.850   5.630   1.00 0.00 ? 89  PRO A CA   2  
ATOM 3550  C C    . PRO A 1 89  ? 1.146   5.557   6.308   1.00 0.00 ? 89  PRO A C    2  
ATOM 3551  O O    . PRO A 1 89  ? 1.111   5.468   7.535   1.00 0.00 ? 89  PRO A O    2  
ATOM 3552  C CB   . PRO A 1 89  ? 2.840   6.610   4.784   1.00 0.00 ? 89  PRO A CB   2  
ATOM 3553  C CG   . PRO A 1 89  ? 3.976   6.984   5.673   1.00 0.00 ? 89  PRO A CG   2  
ATOM 3554  C CD   . PRO A 1 89  ? 3.471   8.105   6.539   1.00 0.00 ? 89  PRO A CD   2  
ATOM 3555  H HA   . PRO A 1 89  ? 0.790   7.215   5.000   1.00 0.00 ? 89  PRO A HA   2  
ATOM 3556  H HB2  . PRO A 1 89  ? 2.889   5.569   4.496   1.00 0.00 ? 89  PRO A HB2  2  
ATOM 3557  H HB3  . PRO A 1 89  ? 2.808   7.232   3.902   1.00 0.00 ? 89  PRO A HB3  2  
ATOM 3558  H HG2  . PRO A 1 89  ? 4.260   6.139   6.281   1.00 0.00 ? 89  PRO A HG2  2  
ATOM 3559  H HG3  . PRO A 1 89  ? 4.813   7.318   5.078   1.00 0.00 ? 89  PRO A HG3  2  
ATOM 3560  H HD2  . PRO A 1 89  ? 3.909   8.047   7.524   1.00 0.00 ? 89  PRO A HD2  2  
ATOM 3561  H HD3  . PRO A 1 89  ? 3.687   9.060   6.084   1.00 0.00 ? 89  PRO A HD3  2  
ATOM 3562  N N    . THR A 1 90  ? 0.810   4.556   5.500   1.00 0.00 ? 90  THR A N    2  
ATOM 3563  C CA   . THR A 1 90  ? 0.371   3.268   6.022   1.00 0.00 ? 90  THR A CA   2  
ATOM 3564  C C    . THR A 1 90  ? 0.692   2.141   5.047   1.00 0.00 ? 90  THR A C    2  
ATOM 3565  O O    . THR A 1 90  ? 0.198   2.123   3.919   1.00 0.00 ? 90  THR A O    2  
ATOM 3566  C CB   . THR A 1 90  ? -1.142  3.266   6.311   1.00 0.00 ? 90  THR A CB   2  
ATOM 3567  O OG1  . THR A 1 90  ? -1.436  4.162   7.389   1.00 0.00 ? 90  THR A OG1  2  
ATOM 3568  C CG2  . THR A 1 90  ? -1.624  1.866   6.663   1.00 0.00 ? 90  THR A CG2  2  
ATOM 3569  H H    . THR A 1 90  ? 0.859   4.688   4.531   1.00 0.00 ? 90  THR A H    2  
ATOM 3570  H HA   . THR A 1 90  ? 0.894   3.088   6.950   1.00 0.00 ? 90  THR A HA   2  
ATOM 3571  H HB   . THR A 1 90  ? -1.663  3.598   5.425   1.00 0.00 ? 90  THR A HB   2  
ATOM 3572  H HG1  . THR A 1 90  ? -0.891  3.940   8.148   1.00 0.00 ? 90  THR A HG1  2  
ATOM 3573  H HG21 . THR A 1 90  ? -2.345  1.925   7.465   1.00 0.00 ? 90  THR A HG21 2  
ATOM 3574  H HG22 . THR A 1 90  ? -0.784  1.265   6.977   1.00 0.00 ? 90  THR A HG22 2  
ATOM 3575  H HG23 . THR A 1 90  ? -2.085  1.417   5.797   1.00 0.00 ? 90  THR A HG23 2  
ATOM 3576  N N    . LEU A 1 91  ? 1.521   1.202   5.488   1.00 0.00 ? 91  LEU A N    2  
ATOM 3577  C CA   . LEU A 1 91  ? 1.908   0.069   4.654   1.00 0.00 ? 91  LEU A CA   2  
ATOM 3578  C C    . LEU A 1 91  ? 1.154   -1.192  5.064   1.00 0.00 ? 91  LEU A C    2  
ATOM 3579  O O    . LEU A 1 91  ? 1.062   -1.514  6.248   1.00 0.00 ? 91  LEU A O    2  
ATOM 3580  C CB   . LEU A 1 91  ? 3.415   -0.170  4.751   1.00 0.00 ? 91  LEU A CB   2  
ATOM 3581  C CG   . LEU A 1 91  ? 4.290   0.671   3.820   1.00 0.00 ? 91  LEU A CG   2  
ATOM 3582  C CD1  . LEU A 1 91  ? 5.762   0.372   4.056   1.00 0.00 ? 91  LEU A CD1  2  
ATOM 3583  C CD2  . LEU A 1 91  ? 3.919   0.416   2.366   1.00 0.00 ? 91  LEU A CD2  2  
ATOM 3584  H H    . LEU A 1 91  ? 1.882   1.270   6.396   1.00 0.00 ? 91  LEU A H    2  
ATOM 3585  H HA   . LEU A 1 91  ? 1.655   0.309   3.632   1.00 0.00 ? 91  LEU A HA   2  
ATOM 3586  H HB2  . LEU A 1 91  ? 3.718   0.038   5.766   1.00 0.00 ? 91  LEU A HB2  2  
ATOM 3587  H HB3  . LEU A 1 91  ? 3.599   -1.211  4.529   1.00 0.00 ? 91  LEU A HB3  2  
ATOM 3588  H HG   . LEU A 1 91  ? 4.125   1.719   4.030   1.00 0.00 ? 91  LEU A HG   2  
ATOM 3589  H HD11 . LEU A 1 91  ? 5.931   -0.691  3.978   1.00 0.00 ? 91  LEU A HD11 2  
ATOM 3590  H HD12 . LEU A 1 91  ? 6.044   0.710   5.043   1.00 0.00 ? 91  LEU A HD12 2  
ATOM 3591  H HD13 . LEU A 1 91  ? 6.357   0.887   3.316   1.00 0.00 ? 91  LEU A HD13 2  
ATOM 3592  H HD21 . LEU A 1 91  ? 3.316   -0.478  2.300   1.00 0.00 ? 91  LEU A HD21 2  
ATOM 3593  H HD22 . LEU A 1 91  ? 4.819   0.287   1.782   1.00 0.00 ? 91  LEU A HD22 2  
ATOM 3594  H HD23 . LEU A 1 91  ? 3.359   1.257   1.985   1.00 0.00 ? 91  LEU A HD23 2  
ATOM 3595  N N    . ILE A 1 92  ? 0.618   -1.901  4.077   1.00 0.00 ? 92  ILE A N    2  
ATOM 3596  C CA   . ILE A 1 92  ? -0.125  -3.129  4.335   1.00 0.00 ? 92  ILE A CA   2  
ATOM 3597  C C    . ILE A 1 92  ? 0.193   -4.194  3.291   1.00 0.00 ? 92  ILE A C    2  
ATOM 3598  O O    . ILE A 1 92  ? 0.163   -3.929  2.088   1.00 0.00 ? 92  ILE A O    2  
ATOM 3599  C CB   . ILE A 1 92  ? -1.644  -2.875  4.346   1.00 0.00 ? 92  ILE A CB   2  
ATOM 3600  C CG1  . ILE A 1 92  ? -2.007  -1.868  5.440   1.00 0.00 ? 92  ILE A CG1  2  
ATOM 3601  C CG2  . ILE A 1 92  ? -2.397  -4.182  4.551   1.00 0.00 ? 92  ILE A CG2  2  
ATOM 3602  C CD1  . ILE A 1 92  ? -3.415  -1.328  5.320   1.00 0.00 ? 92  ILE A CD1  2  
ATOM 3603  H H    . ILE A 1 92  ? 0.725   -1.593  3.153   1.00 0.00 ? 92  ILE A H    2  
ATOM 3604  H HA   . ILE A 1 92  ? 0.166   -3.495  5.309   1.00 0.00 ? 92  ILE A HA   2  
ATOM 3605  H HB   . ILE A 1 92  ? -1.927  -2.471  3.386   1.00 0.00 ? 92  ILE A HB   2  
ATOM 3606  H HG12 . ILE A 1 92  ? -1.916  -2.344  6.403   1.00 0.00 ? 92  ILE A HG12 2  
ATOM 3607  H HG13 . ILE A 1 92  ? -1.324  -1.033  5.390   1.00 0.00 ? 92  ILE A HG13 2  
ATOM 3608  H HG21 . ILE A 1 92  ? -1.710  -5.010  4.463   1.00 0.00 ? 92  ILE A HG21 2  
ATOM 3609  H HG22 . ILE A 1 92  ? -2.845  -4.189  5.533   1.00 0.00 ? 92  ILE A HG22 2  
ATOM 3610  H HG23 . ILE A 1 92  ? -3.169  -4.273  3.802   1.00 0.00 ? 92  ILE A HG23 2  
ATOM 3611  H HD11 . ILE A 1 92  ? -3.990  -1.626  6.184   1.00 0.00 ? 92  ILE A HD11 2  
ATOM 3612  H HD12 . ILE A 1 92  ? -3.383  -0.250  5.262   1.00 0.00 ? 92  ILE A HD12 2  
ATOM 3613  H HD13 . ILE A 1 92  ? -3.877  -1.723  4.427   1.00 0.00 ? 92  ILE A HD13 2  
ATOM 3614  N N    . LEU A 1 93  ? 0.498   -5.400  3.758   1.00 0.00 ? 93  LEU A N    2  
ATOM 3615  C CA   . LEU A 1 93  ? 0.821   -6.507  2.866   1.00 0.00 ? 93  LEU A CA   2  
ATOM 3616  C C    . LEU A 1 93  ? -0.422  -7.334  2.552   1.00 0.00 ? 93  LEU A C    2  
ATOM 3617  O O    . LEU A 1 93  ? -1.120  -7.792  3.457   1.00 0.00 ? 93  LEU A O    2  
ATOM 3618  C CB   . LEU A 1 93  ? 1.894   -7.398  3.493   1.00 0.00 ? 93  LEU A CB   2  
ATOM 3619  C CG   . LEU A 1 93  ? 2.643   -8.324  2.534   1.00 0.00 ? 93  LEU A CG   2  
ATOM 3620  C CD1  . LEU A 1 93  ? 3.624   -7.532  1.684   1.00 0.00 ? 93  LEU A CD1  2  
ATOM 3621  C CD2  . LEU A 1 93  ? 3.365   -9.419  3.305   1.00 0.00 ? 93  LEU A CD2  2  
ATOM 3622  H H    . LEU A 1 93  ? 0.506   -5.549  4.726   1.00 0.00 ? 93  LEU A H    2  
ATOM 3623  H HA   . LEU A 1 93  ? 1.203   -6.090  1.946   1.00 0.00 ? 93  LEU A HA   2  
ATOM 3624  H HB2  . LEU A 1 93  ? 2.621   -6.756  3.967   1.00 0.00 ? 93  LEU A HB2  2  
ATOM 3625  H HB3  . LEU A 1 93  ? 1.416   -8.012  4.243   1.00 0.00 ? 93  LEU A HB3  2  
ATOM 3626  H HG   . LEU A 1 93  ? 1.931   -8.795  1.870   1.00 0.00 ? 93  LEU A HG   2  
ATOM 3627  H HD11 . LEU A 1 93  ? 3.159   -6.615  1.358   1.00 0.00 ? 93  LEU A HD11 2  
ATOM 3628  H HD12 . LEU A 1 93  ? 3.908   -8.118  0.822   1.00 0.00 ? 93  LEU A HD12 2  
ATOM 3629  H HD13 . LEU A 1 93  ? 4.503   -7.303  2.269   1.00 0.00 ? 93  LEU A HD13 2  
ATOM 3630  H HD21 . LEU A 1 93  ? 2.979   -9.464  4.313   1.00 0.00 ? 93  LEU A HD21 2  
ATOM 3631  H HD22 . LEU A 1 93  ? 4.423   -9.201  3.335   1.00 0.00 ? 93  LEU A HD22 2  
ATOM 3632  H HD23 . LEU A 1 93  ? 3.206   -10.369 2.816   1.00 0.00 ? 93  LEU A HD23 2  
ATOM 3633  N N    . PHE A 1 94  ? -0.692  -7.522  1.265   1.00 0.00 ? 94  PHE A N    2  
ATOM 3634  C CA   . PHE A 1 94  ? -1.851  -8.294  0.831   1.00 0.00 ? 94  PHE A CA   2  
ATOM 3635  C C    . PHE A 1 94  ? -1.424  -9.652  0.282   1.00 0.00 ? 94  PHE A C    2  
ATOM 3636  O O    . PHE A 1 94  ? -0.719  -9.732  -0.724  1.00 0.00 ? 94  PHE A O    2  
ATOM 3637  C CB   . PHE A 1 94  ? -2.635  -7.524  -0.233  1.00 0.00 ? 94  PHE A CB   2  
ATOM 3638  C CG   . PHE A 1 94  ? -3.289  -6.277  0.289   1.00 0.00 ? 94  PHE A CG   2  
ATOM 3639  C CD1  . PHE A 1 94  ? -4.530  -6.335  0.902   1.00 0.00 ? 94  PHE A CD1  2  
ATOM 3640  C CD2  . PHE A 1 94  ? -2.663  -5.047  0.166   1.00 0.00 ? 94  PHE A CD2  2  
ATOM 3641  C CE1  . PHE A 1 94  ? -5.135  -5.190  1.384   1.00 0.00 ? 94  PHE A CE1  2  
ATOM 3642  C CE2  . PHE A 1 94  ? -3.263  -3.899  0.646   1.00 0.00 ? 94  PHE A CE2  2  
ATOM 3643  C CZ   . PHE A 1 94  ? -4.501  -3.970  1.255   1.00 0.00 ? 94  PHE A CZ   2  
ATOM 3644  H H    . PHE A 1 94  ? -0.099  -7.131  0.590   1.00 0.00 ? 94  PHE A H    2  
ATOM 3645  H HA   . PHE A 1 94  ? -2.485  -8.450  1.690   1.00 0.00 ? 94  PHE A HA   2  
ATOM 3646  H HB2  . PHE A 1 94  ? -1.963  -7.238  -1.028  1.00 0.00 ? 94  PHE A HB2  2  
ATOM 3647  H HB3  . PHE A 1 94  ? -3.407  -8.164  -0.634  1.00 0.00 ? 94  PHE A HB3  2  
ATOM 3648  H HD1  . PHE A 1 94  ? -5.028  -7.290  1.003   1.00 0.00 ? 94  PHE A HD1  2  
ATOM 3649  H HD2  . PHE A 1 94  ? -1.696  -4.990  -0.311  1.00 0.00 ? 94  PHE A HD2  2  
ATOM 3650  H HE1  . PHE A 1 94  ? -6.103  -5.249  1.859   1.00 0.00 ? 94  PHE A HE1  2  
ATOM 3651  H HE2  . PHE A 1 94  ? -2.766  -2.946  0.544   1.00 0.00 ? 94  PHE A HE2  2  
ATOM 3652  H HZ   . PHE A 1 94  ? -4.972  -3.074  1.632   1.00 0.00 ? 94  PHE A HZ   2  
ATOM 3653  N N    . GLN A 1 95  ? -1.856  -10.717 0.950   1.00 0.00 ? 95  GLN A N    2  
ATOM 3654  C CA   . GLN A 1 95  ? -1.518  -12.071 0.530   1.00 0.00 ? 95  GLN A CA   2  
ATOM 3655  C C    . GLN A 1 95  ? -2.760  -12.824 0.066   1.00 0.00 ? 95  GLN A C    2  
ATOM 3656  O O    . GLN A 1 95  ? -3.437  -13.476 0.860   1.00 0.00 ? 95  GLN A O    2  
ATOM 3657  C CB   . GLN A 1 95  ? -0.846  -12.831 1.676   1.00 0.00 ? 95  GLN A CB   2  
ATOM 3658  C CG   . GLN A 1 95  ? 0.611   -12.450 1.885   1.00 0.00 ? 95  GLN A CG   2  
ATOM 3659  C CD   . GLN A 1 95  ? 1.432   -13.583 2.470   1.00 0.00 ? 95  GLN A CD   2  
ATOM 3660  O OE1  . GLN A 1 95  ? 1.115   -14.758 2.278   1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3661  N NE2  . GLN A 1 95  ? 2.494   -13.237 3.187   1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3662  H H    . GLN A 1 95  ? -2.414  -10.588 1.745   1.00 0.00 ? 95  GLN A H    2  
ATOM 3663  H HA   . GLN A 1 95  ? -0.826  -11.999 -0.296  1.00 0.00 ? 95  GLN A HA   2  
ATOM 3664  H HB2  . GLN A 1 95  ? -1.383  -12.629 2.590   1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3665  H HB3  . GLN A 1 95  ? -0.892  -13.889 1.466   1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3666  H HG2  . GLN A 1 95  ? 1.038   -12.172 0.933   1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3667  H HG3  . GLN A 1 95  ? 0.656   -11.608 2.559   1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3668  H HE21 . GLN A 1 95  ? 2.685   -12.281 3.299   1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3669  H HE22 . GLN A 1 95  ? 3.041   -13.948 3.577   1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3670  N N    . GLY A 1 96  ? -3.055  -12.728 -1.227  1.00 0.00 ? 96  GLY A N    2  
ATOM 3671  C CA   . GLY A 1 96  ? -4.217  -13.404 -1.775  1.00 0.00 ? 96  GLY A CA   2  
ATOM 3672  C C    . GLY A 1 96  ? -5.506  -12.656 -1.500  1.00 0.00 ? 96  GLY A C    2  
ATOM 3673  O O    . GLY A 1 96  ? -6.512  -13.256 -1.122  1.00 0.00 ? 96  GLY A O    2  
ATOM 3674  H H    . GLY A 1 96  ? -2.480  -12.194 -1.814  1.00 0.00 ? 96  GLY A H    2  
ATOM 3675  H HA2  . GLY A 1 96  ? -4.092  -13.504 -2.843  1.00 0.00 ? 96  GLY A HA2  2  
ATOM 3676  H HA3  . GLY A 1 96  ? -4.286  -14.389 -1.337  1.00 0.00 ? 96  GLY A HA3  2  
ATOM 3677  N N    . GLY A 1 97  ? -5.477  -11.340 -1.689  1.00 0.00 ? 97  GLY A N    2  
ATOM 3678  C CA   . GLY A 1 97  ? -6.658  -10.531 -1.453  1.00 0.00 ? 97  GLY A CA   2  
ATOM 3679  C C    . GLY A 1 97  ? -7.041  -10.477 0.013   1.00 0.00 ? 97  GLY A C    2  
ATOM 3680  O O    . GLY A 1 97  ? -8.208  -10.282 0.352   1.00 0.00 ? 97  GLY A O    2  
ATOM 3681  H H    . GLY A 1 97  ? -4.647  -10.916 -1.992  1.00 0.00 ? 97  GLY A H    2  
ATOM 3682  H HA2  . GLY A 1 97  ? -6.469  -9.526  -1.801  1.00 0.00 ? 97  GLY A HA2  2  
ATOM 3683  H HA3  . GLY A 1 97  ? -7.483  -10.946 -2.013  1.00 0.00 ? 97  GLY A HA3  2  
ATOM 3684  N N    . LYS A 1 98  ? -6.055  -10.653 0.887   1.00 0.00 ? 98  LYS A N    2  
ATOM 3685  C CA   . LYS A 1 98  ? -6.293  -10.625 2.325   1.00 0.00 ? 98  LYS A CA   2  
ATOM 3686  C C    . LYS A 1 98  ? -5.362  -9.630  3.011   1.00 0.00 ? 98  LYS A C    2  
ATOM 3687  O O    . LYS A 1 98  ? -4.491  -9.040  2.372   1.00 0.00 ? 98  LYS A O    2  
ATOM 3688  C CB   . LYS A 1 98  ? -6.096  -12.020 2.923   1.00 0.00 ? 98  LYS A CB   2  
ATOM 3689  C CG   . LYS A 1 98  ? -7.243  -12.973 2.635   1.00 0.00 ? 98  LYS A CG   2  
ATOM 3690  C CD   . LYS A 1 98  ? -6.766  -14.414 2.566   1.00 0.00 ? 98  LYS A CD   2  
ATOM 3691  C CE   . LYS A 1 98  ? -6.181  -14.872 3.893   1.00 0.00 ? 98  LYS A CE   2  
ATOM 3692  N NZ   . LYS A 1 98  ? -5.948  -16.342 3.919   1.00 0.00 ? 98  LYS A NZ   2  
ATOM 3693  H H    . LYS A 1 98  ? -5.145  -10.805 0.556   1.00 0.00 ? 98  LYS A H    2  
ATOM 3694  H HA   . LYS A 1 98  ? -7.314  -10.314 2.487   1.00 0.00 ? 98  LYS A HA   2  
ATOM 3695  H HB2  . LYS A 1 98  ? -5.190  -12.447 2.519   1.00 0.00 ? 98  LYS A HB2  2  
ATOM 3696  H HB3  . LYS A 1 98  ? -5.993  -11.927 3.995   1.00 0.00 ? 98  LYS A HB3  2  
ATOM 3697  H HG2  . LYS A 1 98  ? -7.978  -12.885 3.421   1.00 0.00 ? 98  LYS A HG2  2  
ATOM 3698  H HG3  . LYS A 1 98  ? -7.691  -12.705 1.688   1.00 0.00 ? 98  LYS A HG3  2  
ATOM 3699  H HD2  . LYS A 1 98  ? -7.603  -15.049 2.316   1.00 0.00 ? 98  LYS A HD2  2  
ATOM 3700  H HD3  . LYS A 1 98  ? -6.008  -14.497 1.800   1.00 0.00 ? 98  LYS A HD3  2  
ATOM 3701  H HE2  . LYS A 1 98  ? -5.242  -14.364 4.052   1.00 0.00 ? 98  LYS A HE2  2  
ATOM 3702  H HE3  . LYS A 1 98  ? -6.870  -14.611 4.683   1.00 0.00 ? 98  LYS A HE3  2  
ATOM 3703  H HZ1  . LYS A 1 98  ? -6.815  -16.836 4.214   1.00 0.00 ? 98  LYS A HZ1  2  
ATOM 3704  H HZ2  . LYS A 1 98  ? -5.187  -16.572 4.589   1.00 0.00 ? 98  LYS A HZ2  2  
ATOM 3705  H HZ3  . LYS A 1 98  ? -5.676  -16.678 2.973   1.00 0.00 ? 98  LYS A HZ3  2  
ATOM 3706  N N    . GLU A 1 99  ? -5.551  -9.451  4.314   1.00 0.00 ? 99  GLU A N    2  
ATOM 3707  C CA   . GLU A 1 99  ? -4.727  -8.528  5.086   1.00 0.00 ? 99  GLU A CA   2  
ATOM 3708  C C    . GLU A 1 99  ? -3.812  -9.285  6.043   1.00 0.00 ? 99  GLU A C    2  
ATOM 3709  O O    . GLU A 1 99  ? -4.201  -9.611  7.164   1.00 0.00 ? 99  GLU A O    2  
ATOM 3710  C CB   . GLU A 1 99  ? -5.609  -7.554  5.869   1.00 0.00 ? 99  GLU A CB   2  
ATOM 3711  C CG   . GLU A 1 99  ? -4.824  -6.508  6.643   1.00 0.00 ? 99  GLU A CG   2  
ATOM 3712  C CD   . GLU A 1 99  ? -5.615  -5.234  6.870   1.00 0.00 ? 99  GLU A CD   2  
ATOM 3713  O OE1  . GLU A 1 99  ? -6.372  -5.176  7.862   1.00 0.00 ? 99  GLU A OE1  2  
ATOM 3714  O OE2  . GLU A 1 99  ? -5.477  -4.297  6.057   1.00 0.00 ? 99  GLU A OE2  2  
ATOM 3715  H H    . GLU A 1 99  ? -6.262  -9.950  4.768   1.00 0.00 ? 99  GLU A H    2  
ATOM 3716  H HA   . GLU A 1 99  ? -4.118  -7.968  4.392   1.00 0.00 ? 99  GLU A HA   2  
ATOM 3717  H HB2  . GLU A 1 99  ? -6.265  -7.045  5.178   1.00 0.00 ? 99  GLU A HB2  2  
ATOM 3718  H HB3  . GLU A 1 99  ? -6.208  -8.115  6.571   1.00 0.00 ? 99  GLU A HB3  2  
ATOM 3719  H HG2  . GLU A 1 99  ? -4.550  -6.919  7.603   1.00 0.00 ? 99  GLU A HG2  2  
ATOM 3720  H HG3  . GLU A 1 99  ? -3.930  -6.265  6.088   1.00 0.00 ? 99  GLU A HG3  2  
ATOM 3721  N N    . ALA A 1 100 ? -2.592  -9.562  5.592   1.00 0.00 ? 100 ALA A N    2  
ATOM 3722  C CA   . ALA A 1 100 ? -1.621  -10.280 6.408   1.00 0.00 ? 100 ALA A CA   2  
ATOM 3723  C C    . ALA A 1 100 ? -1.203  -9.453  7.619   1.00 0.00 ? 100 ALA A C    2  
ATOM 3724  O O    . ALA A 1 100 ? -1.311  -9.905  8.758   1.00 0.00 ? 100 ALA A O    2  
ATOM 3725  C CB   . ALA A 1 100 ? -0.403  -10.651 5.575   1.00 0.00 ? 100 ALA A CB   2  
ATOM 3726  H H    . ALA A 1 100 ? -2.340  -9.276  4.690   1.00 0.00 ? 100 ALA A H    2  
ATOM 3727  H HA   . ALA A 1 100 ? -2.084  -11.194 6.752   1.00 0.00 ? 100 ALA A HA   2  
ATOM 3728  H HB1  . ALA A 1 100 ? -0.722  -11.185 4.691   1.00 0.00 ? 100 ALA A HB1  2  
ATOM 3729  H HB2  . ALA A 1 100 ? 0.121   -9.753  5.284   1.00 0.00 ? 100 ALA A HB2  2  
ATOM 3730  H HB3  . ALA A 1 100 ? 0.254   -11.279 6.158   1.00 0.00 ? 100 ALA A HB3  2  
ATOM 3731  N N    . MET A 1 101 ? -0.726  -8.239  7.364   1.00 0.00 ? 101 MET A N    2  
ATOM 3732  C CA   . MET A 1 101 ? -0.292  -7.348  8.435   1.00 0.00 ? 101 MET A CA   2  
ATOM 3733  C C    . MET A 1 101 ? -0.432  -5.888  8.017   1.00 0.00 ? 101 MET A C    2  
ATOM 3734  O O    . MET A 1 101 ? -0.481  -5.575  6.828   1.00 0.00 ? 101 MET A O    2  
ATOM 3735  C CB   . MET A 1 101 ? 1.159   -7.645  8.817   1.00 0.00 ? 101 MET A CB   2  
ATOM 3736  C CG   . MET A 1 101 ? 2.114   -7.631  7.635   1.00 0.00 ? 101 MET A CG   2  
ATOM 3737  S SD   . MET A 1 101 ? 3.810   -8.020  8.107   1.00 0.00 ? 101 MET A SD   2  
ATOM 3738  C CE   . MET A 1 101 ? 4.259   -6.540  9.010   1.00 0.00 ? 101 MET A CE   2  
ATOM 3739  H H    . MET A 1 101 ? -0.664  -7.934  6.435   1.00 0.00 ? 101 MET A H    2  
ATOM 3740  H HA   . MET A 1 101 ? -0.924  -7.528  9.291   1.00 0.00 ? 101 MET A HA   2  
ATOM 3741  H HB2  . MET A 1 101 ? 1.490   -6.903  9.529   1.00 0.00 ? 101 MET A HB2  2  
ATOM 3742  H HB3  . MET A 1 101 ? 1.206   -8.620  9.278   1.00 0.00 ? 101 MET A HB3  2  
ATOM 3743  H HG2  . MET A 1 101 ? 1.782   -8.360  6.911   1.00 0.00 ? 101 MET A HG2  2  
ATOM 3744  H HG3  . MET A 1 101 ? 2.096   -6.648  7.187   1.00 0.00 ? 101 MET A HG3  2  
ATOM 3745  H HE1  . MET A 1 101 ? 4.477   -5.745  8.313   1.00 0.00 ? 101 MET A HE1  2  
ATOM 3746  H HE2  . MET A 1 101 ? 3.438   -6.244  9.647   1.00 0.00 ? 101 MET A HE2  2  
ATOM 3747  H HE3  . MET A 1 101 ? 5.131   -6.738  9.615   1.00 0.00 ? 101 MET A HE3  2  
ATOM 3748  N N    . ARG A 1 102 ? -0.497  -4.999  9.003   1.00 0.00 ? 102 ARG A N    2  
ATOM 3749  C CA   . ARG A 1 102 ? -0.633  -3.572  8.737   1.00 0.00 ? 102 ARG A CA   2  
ATOM 3750  C C    . ARG A 1 102 ? 0.150   -2.752  9.758   1.00 0.00 ? 102 ARG A C    2  
ATOM 3751  O O    . ARG A 1 102 ? 0.203   -3.098  10.938  1.00 0.00 ? 102 ARG A O    2  
ATOM 3752  C CB   . ARG A 1 102 ? -2.107  -3.165  8.763   1.00 0.00 ? 102 ARG A CB   2  
ATOM 3753  C CG   . ARG A 1 102 ? -2.723  -3.196  10.153  1.00 0.00 ? 102 ARG A CG   2  
ATOM 3754  C CD   . ARG A 1 102 ? -3.930  -2.276  10.248  1.00 0.00 ? 102 ARG A CD   2  
ATOM 3755  N NE   . ARG A 1 102 ? -5.020  -2.710  9.378   1.00 0.00 ? 102 ARG A NE   2  
ATOM 3756  C CZ   . ARG A 1 102 ? -5.974  -1.900  8.934   1.00 0.00 ? 102 ARG A CZ   2  
ATOM 3757  N NH1  . ARG A 1 102 ? -5.973  -0.619  9.276   1.00 0.00 ? 102 ARG A NH1  2  
ATOM 3758  N NH2  . ARG A 1 102 ? -6.932  -2.370  8.145   1.00 0.00 ? 102 ARG A NH2  2  
ATOM 3759  H H    . ARG A 1 102 ? -0.453  -5.310  9.932   1.00 0.00 ? 102 ARG A H    2  
ATOM 3760  H HA   . ARG A 1 102 ? -0.233  -3.378  7.754   1.00 0.00 ? 102 ARG A HA   2  
ATOM 3761  H HB2  . ARG A 1 102 ? -2.199  -2.161  8.375   1.00 0.00 ? 102 ARG A HB2  2  
ATOM 3762  H HB3  . ARG A 1 102 ? -2.665  -3.839  8.131   1.00 0.00 ? 102 ARG A HB3  2  
ATOM 3763  H HG2  . ARG A 1 102 ? -3.036  -4.205  10.376  1.00 0.00 ? 102 ARG A HG2  2  
ATOM 3764  H HG3  . ARG A 1 102 ? -1.982  -2.879  10.872  1.00 0.00 ? 102 ARG A HG3  2  
ATOM 3765  H HD2  . ARG A 1 102 ? -4.280  -2.267  11.269  1.00 0.00 ? 102 ARG A HD2  2  
ATOM 3766  H HD3  . ARG A 1 102 ? -3.629  -1.279  9.962   1.00 0.00 ? 102 ARG A HD3  2  
ATOM 3767  H HE   . ARG A 1 102 ? -5.040  -3.653  9.112   1.00 0.00 ? 102 ARG A HE   2  
ATOM 3768  H HH11 . ARG A 1 102 ? -5.252  -0.262  9.870   1.00 0.00 ? 102 ARG A HH11 2  
ATOM 3769  H HH12 . ARG A 1 102 ? -6.692  -0.011  8.940   1.00 0.00 ? 102 ARG A HH12 2  
ATOM 3770  H HH21 . ARG A 1 102 ? -6.936  -3.335  7.885   1.00 0.00 ? 102 ARG A HH21 2  
ATOM 3771  H HH22 . ARG A 1 102 ? -7.650  -1.760  7.812   1.00 0.00 ? 102 ARG A HH22 2  
ATOM 3772  N N    . ARG A 1 103 ? 0.757   -1.664  9.295   1.00 0.00 ? 103 ARG A N    2  
ATOM 3773  C CA   . ARG A 1 103 ? 1.539   -0.795  10.167  1.00 0.00 ? 103 ARG A CA   2  
ATOM 3774  C C    . ARG A 1 103 ? 1.289   0.673   9.837   1.00 0.00 ? 103 ARG A C    2  
ATOM 3775  O O    . ARG A 1 103 ? 1.105   1.053   8.681   1.00 0.00 ? 103 ARG A O    2  
ATOM 3776  C CB   . ARG A 1 103 ? 3.029   -1.112  10.034  1.00 0.00 ? 103 ARG A CB   2  
ATOM 3777  C CG   . ARG A 1 103 ? 3.394   -2.522  10.470  1.00 0.00 ? 103 ARG A CG   2  
ATOM 3778  C CD   . ARG A 1 103 ? 3.630   -2.597  11.971  1.00 0.00 ? 103 ARG A CD   2  
ATOM 3779  N NE   . ARG A 1 103 ? 3.316   -3.918  12.509  1.00 0.00 ? 103 ARG A NE   2  
ATOM 3780  C CZ   . ARG A 1 103 ? 3.839   -4.397  13.632  1.00 0.00 ? 103 ARG A CZ   2  
ATOM 3781  N NH1  . ARG A 1 103 ? 4.697   -3.668  14.332  1.00 0.00 ? 103 ARG A NH1  2  
ATOM 3782  N NH2  . ARG A 1 103 ? 3.504   -5.609  14.057  1.00 0.00 ? 103 ARG A NH2  2  
ATOM 3783  H H    . ARG A 1 103 ? 0.678   -1.440  8.344   1.00 0.00 ? 103 ARG A H    2  
ATOM 3784  H HA   . ARG A 1 103 ? 1.230   -0.981  11.184  1.00 0.00 ? 103 ARG A HA   2  
ATOM 3785  H HB2  . ARG A 1 103 ? 3.321   -0.993  9.001   1.00 0.00 ? 103 ARG A HB2  2  
ATOM 3786  H HB3  . ARG A 1 103 ? 3.588   -0.415  10.640  1.00 0.00 ? 103 ARG A HB3  2  
ATOM 3787  H HG2  . ARG A 1 103 ? 2.585   -3.189  10.211  1.00 0.00 ? 103 ARG A HG2  2  
ATOM 3788  H HG3  . ARG A 1 103 ? 4.293   -2.826  9.957   1.00 0.00 ? 103 ARG A HG3  2  
ATOM 3789  H HD2  . ARG A 1 103 ? 4.668   -2.376  12.169  1.00 0.00 ? 103 ARG A HD2  2  
ATOM 3790  H HD3  . ARG A 1 103 ? 3.007   -1.862  12.457  1.00 0.00 ? 103 ARG A HD3  2  
ATOM 3791  H HE   . ARG A 1 103 ? 2.684   -4.473  12.008  1.00 0.00 ? 103 ARG A HE   2  
ATOM 3792  H HH11 . ARG A 1 103 ? 4.951   -2.755  14.014  1.00 0.00 ? 103 ARG A HH11 2  
ATOM 3793  H HH12 . ARG A 1 103 ? 5.089   -4.031  15.177  1.00 0.00 ? 103 ARG A HH12 2  
ATOM 3794  H HH21 . ARG A 1 103 ? 2.857   -6.161  13.532  1.00 0.00 ? 103 ARG A HH21 2  
ATOM 3795  H HH22 . ARG A 1 103 ? 3.898   -5.969  14.902  1.00 0.00 ? 103 ARG A HH22 2  
ATOM 3796  N N    . PRO A 1 104 ? 1.280   1.520   10.877  1.00 0.00 ? 104 PRO A N    2  
ATOM 3797  C CA   . PRO A 1 104 ? 1.497   1.080   12.259  1.00 0.00 ? 104 PRO A CA   2  
ATOM 3798  C C    . PRO A 1 104 ? 0.330   0.256   12.794  1.00 0.00 ? 104 PRO A C    2  
ATOM 3799  O O    . PRO A 1 104 ? -0.806  0.410   12.347  1.00 0.00 ? 104 PRO A O    2  
ATOM 3800  C CB   . PRO A 1 104 ? 1.624   2.393   13.034  1.00 0.00 ? 104 PRO A CB   2  
ATOM 3801  C CG   . PRO A 1 104 ? 0.874   3.389   12.218  1.00 0.00 ? 104 PRO A CG   2  
ATOM 3802  C CD   . PRO A 1 104 ? 1.058   2.973   10.785  1.00 0.00 ? 104 PRO A CD   2  
ATOM 3803  H HA   . PRO A 1 104 ? 2.411   0.513   12.356  1.00 0.00 ? 104 PRO A HA   2  
ATOM 3804  H HB2  . PRO A 1 104 ? 1.188   2.278   14.017  1.00 0.00 ? 104 PRO A HB2  2  
ATOM 3805  H HB3  . PRO A 1 104 ? 2.665   2.663   13.125  1.00 0.00 ? 104 PRO A HB3  2  
ATOM 3806  H HG2  . PRO A 1 104 ? -0.172  3.368   12.484  1.00 0.00 ? 104 PRO A HG2  2  
ATOM 3807  H HG3  . PRO A 1 104 ? 1.283   4.376   12.377  1.00 0.00 ? 104 PRO A HG3  2  
ATOM 3808  H HD2  . PRO A 1 104 ? 0.169   3.192   10.212  1.00 0.00 ? 104 PRO A HD2  2  
ATOM 3809  H HD3  . PRO A 1 104 ? 1.917   3.467   10.356  1.00 0.00 ? 104 PRO A HD3  2  
ATOM 3810  N N    . GLN A 1 105 ? 0.620   -0.617  13.753  1.00 0.00 ? 105 GLN A N    2  
ATOM 3811  C CA   . GLN A 1 105 ? -0.406  -1.465  14.348  1.00 0.00 ? 105 GLN A CA   2  
ATOM 3812  C C    . GLN A 1 105 ? -1.242  -0.682  15.356  1.00 0.00 ? 105 GLN A C    2  
ATOM 3813  O O    . GLN A 1 105 ? -0.736  0.209   16.037  1.00 0.00 ? 105 GLN A O    2  
ATOM 3814  C CB   . GLN A 1 105 ? 0.234   -2.675  15.030  1.00 0.00 ? 105 GLN A CB   2  
ATOM 3815  C CG   . GLN A 1 105 ? 0.485   -3.842  14.089  1.00 0.00 ? 105 GLN A CG   2  
ATOM 3816  C CD   . GLN A 1 105 ? -0.709  -4.770  13.979  1.00 0.00 ? 105 GLN A CD   2  
ATOM 3817  O OE1  . GLN A 1 105 ? -1.400  -5.031  14.965  1.00 0.00 ? 105 GLN A OE1  2  
ATOM 3818  N NE2  . GLN A 1 105 ? -0.958  -5.275  12.777  1.00 0.00 ? 105 GLN A NE2  2  
ATOM 3819  H H    . GLN A 1 105 ? 1.544   -0.694  14.067  1.00 0.00 ? 105 GLN A H    2  
ATOM 3820  H HA   . GLN A 1 105 ? -1.052  -1.811  13.555  1.00 0.00 ? 105 GLN A HA   2  
ATOM 3821  H HB2  . GLN A 1 105 ? 1.180   -2.375  15.456  1.00 0.00 ? 105 GLN A HB2  2  
ATOM 3822  H HB3  . GLN A 1 105 ? -0.417  -3.014  15.823  1.00 0.00 ? 105 GLN A HB3  2  
ATOM 3823  H HG2  . GLN A 1 105 ? 0.711   -3.454  13.107  1.00 0.00 ? 105 GLN A HG2  2  
ATOM 3824  H HG3  . GLN A 1 105 ? 1.330   -4.407  14.454  1.00 0.00 ? 105 GLN A HG3  2  
ATOM 3825  H HE21 . GLN A 1 105 ? -0.364  -5.024  12.038  1.00 0.00 ? 105 GLN A HE21 2  
ATOM 3826  H HE22 . GLN A 1 105 ? -1.723  -5.878  12.677  1.00 0.00 ? 105 GLN A HE22 2  
ATOM 3827  N N    . ILE A 1 106 ? -2.524  -1.022  15.444  1.00 0.00 ? 106 ILE A N    2  
ATOM 3828  C CA   . ILE A 1 106 ? -3.429  -0.351  16.369  1.00 0.00 ? 106 ILE A CA   2  
ATOM 3829  C C    . ILE A 1 106 ? -3.480  -1.074  17.710  1.00 0.00 ? 106 ILE A C    2  
ATOM 3830  O O    . ILE A 1 106 ? -3.842  -2.249  17.781  1.00 0.00 ? 106 ILE A O    2  
ATOM 3831  C CB   . ILE A 1 106 ? -4.855  -0.259  15.794  1.00 0.00 ? 106 ILE A CB   2  
ATOM 3832  C CG1  . ILE A 1 106 ? -4.840  0.473   14.450  1.00 0.00 ? 106 ILE A CG1  2  
ATOM 3833  C CG2  . ILE A 1 106 ? -5.778  0.446   16.776  1.00 0.00 ? 106 ILE A CG2  2  
ATOM 3834  C CD1  . ILE A 1 106 ? -4.392  1.914   14.551  1.00 0.00 ? 106 ILE A CD1  2  
ATOM 3835  H H    . ILE A 1 106 ? -2.869  -1.741  14.875  1.00 0.00 ? 106 ILE A H    2  
ATOM 3836  H HA   . ILE A 1 106 ? -3.061  0.653   16.526  1.00 0.00 ? 106 ILE A HA   2  
ATOM 3837  H HB   . ILE A 1 106 ? -5.225  -1.262  15.645  1.00 0.00 ? 106 ILE A HB   2  
ATOM 3838  H HG12 . ILE A 1 106 ? -4.169  -0.037  13.777  1.00 0.00 ? 106 ILE A HG12 2  
ATOM 3839  H HG13 . ILE A 1 106 ? -5.837  0.463   14.033  1.00 0.00 ? 106 ILE A HG13 2  
ATOM 3840  H HG21 . ILE A 1 106 ? -6.044  -0.235  17.572  1.00 0.00 ? 106 ILE A HG21 2  
ATOM 3841  H HG22 . ILE A 1 106 ? -5.272  1.304   17.193  1.00 0.00 ? 106 ILE A HG22 2  
ATOM 3842  H HG23 . ILE A 1 106 ? -6.672  0.767   16.264  1.00 0.00 ? 106 ILE A HG23 2  
ATOM 3843  H HD11 . ILE A 1 106 ? -4.892  2.389   15.382  1.00 0.00 ? 106 ILE A HD11 2  
ATOM 3844  H HD12 . ILE A 1 106 ? -3.324  1.949   14.705  1.00 0.00 ? 106 ILE A HD12 2  
ATOM 3845  H HD13 . ILE A 1 106 ? -4.641  2.433   13.637  1.00 0.00 ? 106 ILE A HD13 2  
ATOM 3846  N N    . ASP A 1 107 ? -3.117  -0.364  18.773  1.00 0.00 ? 107 ASP A N    2  
ATOM 3847  C CA   . ASP A 1 107 ? -3.123  -0.937  20.114  1.00 0.00 ? 107 ASP A CA   2  
ATOM 3848  C C    . ASP A 1 107 ? -4.543  -1.288  20.548  1.00 0.00 ? 107 ASP A C    2  
ATOM 3849  O O    . ASP A 1 107 ? -5.513  -0.950  19.869  1.00 0.00 ? 107 ASP A O    2  
ATOM 3850  C CB   . ASP A 1 107 ? -2.499  0.040   21.112  1.00 0.00 ? 107 ASP A CB   2  
ATOM 3851  C CG   . ASP A 1 107 ? -2.153  -0.623  22.431  1.00 0.00 ? 107 ASP A CG   2  
ATOM 3852  O OD1  . ASP A 1 107 ? -1.349  -1.578  22.421  1.00 0.00 ? 107 ASP A OD1  2  
ATOM 3853  O OD2  . ASP A 1 107 ? -2.686  -0.186  23.472  1.00 0.00 ? 107 ASP A OD2  2  
ATOM 3854  H H    . ASP A 1 107 ? -2.838  0.568   18.652  1.00 0.00 ? 107 ASP A H    2  
ATOM 3855  H HA   . ASP A 1 107 ? -2.533  -1.841  20.091  1.00 0.00 ? 107 ASP A HA   2  
ATOM 3856  H HB2  . ASP A 1 107 ? -1.593  0.448   20.687  1.00 0.00 ? 107 ASP A HB2  2  
ATOM 3857  H HB3  . ASP A 1 107 ? -3.195  0.842   21.304  1.00 0.00 ? 107 ASP A HB3  2  
ATOM 3858  N N    . LYS A 1 108 ? -4.658  -1.969  21.683  1.00 0.00 ? 108 LYS A N    2  
ATOM 3859  C CA   . LYS A 1 108 ? -5.958  -2.367  22.208  1.00 0.00 ? 108 LYS A CA   2  
ATOM 3860  C C    . LYS A 1 108 ? -6.954  -1.215  22.126  1.00 0.00 ? 108 LYS A C    2  
ATOM 3861  O O    . LYS A 1 108 ? -7.870  -1.230  21.302  1.00 0.00 ? 108 LYS A O    2  
ATOM 3862  C CB   . LYS A 1 108 ? -5.823  -2.836  23.659  1.00 0.00 ? 108 LYS A CB   2  
ATOM 3863  C CG   . LYS A 1 108 ? -6.814  -3.922  24.042  1.00 0.00 ? 108 LYS A CG   2  
ATOM 3864  C CD   . LYS A 1 108 ? -8.067  -3.336  24.671  1.00 0.00 ? 108 LYS A CD   2  
ATOM 3865  C CE   . LYS A 1 108 ? -9.141  -3.069  23.627  1.00 0.00 ? 108 LYS A CE   2  
ATOM 3866  N NZ   . LYS A 1 108 ? -10.463 -2.786  24.252  1.00 0.00 ? 108 LYS A NZ   2  
ATOM 3867  H H    . LYS A 1 108 ? -3.847  -2.210  22.180  1.00 0.00 ? 108 LYS A H    2  
ATOM 3868  H HA   . LYS A 1 108 ? -6.323  -3.186  21.607  1.00 0.00 ? 108 LYS A HA   2  
ATOM 3869  H HB2  . LYS A 1 108 ? -4.825  -3.218  23.810  1.00 0.00 ? 108 LYS A HB2  2  
ATOM 3870  H HB3  . LYS A 1 108 ? -5.978  -1.990  24.314  1.00 0.00 ? 108 LYS A HB3  2  
ATOM 3871  H HG2  . LYS A 1 108 ? -7.092  -4.472  23.156  1.00 0.00 ? 108 LYS A HG2  2  
ATOM 3872  H HG3  . LYS A 1 108 ? -6.345  -4.590  24.751  1.00 0.00 ? 108 LYS A HG3  2  
ATOM 3873  H HD2  . LYS A 1 108 ? -8.454  -4.034  25.398  1.00 0.00 ? 108 LYS A HD2  2  
ATOM 3874  H HD3  . LYS A 1 108 ? -7.814  -2.407  25.161  1.00 0.00 ? 108 LYS A HD3  2  
ATOM 3875  H HE2  . LYS A 1 108 ? -8.844  -2.218  23.034  1.00 0.00 ? 108 LYS A HE2  2  
ATOM 3876  H HE3  . LYS A 1 108 ? -9.231  -3.937  22.992  1.00 0.00 ? 108 LYS A HE3  2  
ATOM 3877  H HZ1  . LYS A 1 108 ? -10.331 -2.391  25.205  1.00 0.00 ? 108 LYS A HZ1  2  
ATOM 3878  H HZ2  . LYS A 1 108 ? -11.018 -3.663  24.326  1.00 0.00 ? 108 LYS A HZ2  2  
ATOM 3879  H HZ3  . LYS A 1 108 ? -10.992 -2.102  23.675  1.00 0.00 ? 108 LYS A HZ3  2  
ATOM 3880  N N    . LYS A 1 109 ? -6.770  -0.217  22.983  1.00 0.00 ? 109 LYS A N    2  
ATOM 3881  C CA   . LYS A 1 109 ? -7.650  0.946   23.006  1.00 0.00 ? 109 LYS A CA   2  
ATOM 3882  C C    . LYS A 1 109 ? -8.156  1.272   21.604  1.00 0.00 ? 109 LYS A C    2  
ATOM 3883  O O    . LYS A 1 109 ? -9.349  1.495   21.401  1.00 0.00 ? 109 LYS A O    2  
ATOM 3884  C CB   . LYS A 1 109 ? -6.916  2.155   23.589  1.00 0.00 ? 109 LYS A CB   2  
ATOM 3885  C CG   . LYS A 1 109 ? -7.057  2.283   25.096  1.00 0.00 ? 109 LYS A CG   2  
ATOM 3886  C CD   . LYS A 1 109 ? -6.837  3.714   25.557  1.00 0.00 ? 109 LYS A CD   2  
ATOM 3887  C CE   . LYS A 1 109 ? -8.044  4.589   25.254  1.00 0.00 ? 109 LYS A CE   2  
ATOM 3888  N NZ   . LYS A 1 109 ? -7.776  6.025   25.546  1.00 0.00 ? 109 LYS A NZ   2  
ATOM 3889  H H    . LYS A 1 109 ? -6.022  -0.262  23.616  1.00 0.00 ? 109 LYS A H    2  
ATOM 3890  H HA   . LYS A 1 109 ? -8.495  0.710   23.635  1.00 0.00 ? 109 LYS A HA   2  
ATOM 3891  H HB2  . LYS A 1 109 ? -5.866  2.073   23.352  1.00 0.00 ? 109 LYS A HB2  2  
ATOM 3892  H HB3  . LYS A 1 109 ? -7.309  3.053   23.134  1.00 0.00 ? 109 LYS A HB3  2  
ATOM 3893  H HG2  . LYS A 1 109 ? -8.050  1.973   25.383  1.00 0.00 ? 109 LYS A HG2  2  
ATOM 3894  H HG3  . LYS A 1 109 ? -6.326  1.645   25.572  1.00 0.00 ? 109 LYS A HG3  2  
ATOM 3895  H HD2  . LYS A 1 109 ? -6.663  3.718   26.622  1.00 0.00 ? 109 LYS A HD2  2  
ATOM 3896  H HD3  . LYS A 1 109 ? -5.973  4.119   25.048  1.00 0.00 ? 109 LYS A HD3  2  
ATOM 3897  H HE2  . LYS A 1 109 ? -8.295  4.484   24.210  1.00 0.00 ? 109 LYS A HE2  2  
ATOM 3898  H HE3  . LYS A 1 109 ? -8.874  4.256   25.859  1.00 0.00 ? 109 LYS A HE3  2  
ATOM 3899  H HZ1  . LYS A 1 109 ? -8.210  6.291   26.453  1.00 0.00 ? 109 LYS A HZ1  2  
ATOM 3900  H HZ2  . LYS A 1 109 ? -8.176  6.623   24.795  1.00 0.00 ? 109 LYS A HZ2  2  
ATOM 3901  H HZ3  . LYS A 1 109 ? -6.752  6.193   25.600  1.00 0.00 ? 109 LYS A HZ3  2  
ATOM 3902  N N    . GLY A 1 110 ? -7.241  1.297   20.640  1.00 0.00 ? 110 GLY A N    2  
ATOM 3903  C CA   . GLY A 1 110 ? -7.615  1.595   19.270  1.00 0.00 ? 110 GLY A CA   2  
ATOM 3904  C C    . GLY A 1 110 ? -6.846  2.772   18.702  1.00 0.00 ? 110 GLY A C    2  
ATOM 3905  O O    . GLY A 1 110 ? -7.395  3.575   17.948  1.00 0.00 ? 110 GLY A O    2  
ATOM 3906  H H    . GLY A 1 110 ? -6.304  1.111   20.861  1.00 0.00 ? 110 GLY A H    2  
ATOM 3907  H HA2  . GLY A 1 110 ? -7.426  0.726   18.659  1.00 0.00 ? 110 GLY A HA2  2  
ATOM 3908  H HA3  . GLY A 1 110 ? -8.671  1.822   19.238  1.00 0.00 ? 110 GLY A HA3  2  
ATOM 3909  N N    . ARG A 1 111 ? -5.572  2.874   19.066  1.00 0.00 ? 111 ARG A N    2  
ATOM 3910  C CA   . ARG A 1 111 ? -4.726  3.963   18.590  1.00 0.00 ? 111 ARG A CA   2  
ATOM 3911  C C    . ARG A 1 111 ? -3.515  3.421   17.837  1.00 0.00 ? 111 ARG A C    2  
ATOM 3912  O O    . ARG A 1 111 ? -3.128  2.266   18.013  1.00 0.00 ? 111 ARG A O    2  
ATOM 3913  C CB   . ARG A 1 111 ? -4.266  4.830   19.763  1.00 0.00 ? 111 ARG A CB   2  
ATOM 3914  C CG   . ARG A 1 111 ? -5.405  5.319   20.643  1.00 0.00 ? 111 ARG A CG   2  
ATOM 3915  C CD   . ARG A 1 111 ? -5.964  6.642   20.145  1.00 0.00 ? 111 ARG A CD   2  
ATOM 3916  N NE   . ARG A 1 111 ? -6.870  6.463   19.014  1.00 0.00 ? 111 ARG A NE   2  
ATOM 3917  C CZ   . ARG A 1 111 ? -7.367  7.470   18.304  1.00 0.00 ? 111 ARG A CZ   2  
ATOM 3918  N NH1  . ARG A 1 111 ? -7.048  8.721   18.607  1.00 0.00 ? 111 ARG A NH1  2  
ATOM 3919  N NH2  . ARG A 1 111 ? -8.185  7.227   17.288  1.00 0.00 ? 111 ARG A NH2  2  
ATOM 3920  H H    . ARG A 1 111 ? -5.191  2.203   19.670  1.00 0.00 ? 111 ARG A H    2  
ATOM 3921  H HA   . ARG A 1 111 ? -5.313  4.568   17.915  1.00 0.00 ? 111 ARG A HA   2  
ATOM 3922  H HB2  . ARG A 1 111 ? -3.588  4.255   20.376  1.00 0.00 ? 111 ARG A HB2  2  
ATOM 3923  H HB3  . ARG A 1 111 ? -3.744  5.691   19.374  1.00 0.00 ? 111 ARG A HB3  2  
ATOM 3924  H HG2  . ARG A 1 111 ? -6.194  4.582   20.636  1.00 0.00 ? 111 ARG A HG2  2  
ATOM 3925  H HG3  . ARG A 1 111 ? -5.038  5.448   21.650  1.00 0.00 ? 111 ARG A HG3  2  
ATOM 3926  H HD2  . ARG A 1 111 ? -6.502  7.117   20.952  1.00 0.00 ? 111 ARG A HD2  2  
ATOM 3927  H HD3  . ARG A 1 111 ? -5.142  7.273   19.841  1.00 0.00 ? 111 ARG A HD3  2  
ATOM 3928  H HE   . ARG A 1 111 ? -7.119  5.547   18.772  1.00 0.00 ? 111 ARG A HE   2  
ATOM 3929  H HH11 . ARG A 1 111 ? -6.431  8.907   19.371  1.00 0.00 ? 111 ARG A HH11 2  
ATOM 3930  H HH12 . ARG A 1 111 ? -7.423  9.477   18.070  1.00 0.00 ? 111 ARG A HH12 2  
ATOM 3931  H HH21 . ARG A 1 111 ? -8.428  6.285   17.056  1.00 0.00 ? 111 ARG A HH21 2  
ATOM 3932  H HH22 . ARG A 1 111 ? -8.559  7.985   16.754  1.00 0.00 ? 111 ARG A HH22 2  
ATOM 3933  N N    . ALA A 1 112 ? -2.921  4.263   16.998  1.00 0.00 ? 112 ALA A N    2  
ATOM 3934  C CA   . ALA A 1 112 ? -1.752  3.869   16.220  1.00 0.00 ? 112 ALA A CA   2  
ATOM 3935  C C    . ALA A 1 112 ? -0.503  3.822   17.092  1.00 0.00 ? 112 ALA A C    2  
ATOM 3936  O O    . ALA A 1 112 ? -0.259  4.722   17.895  1.00 0.00 ? 112 ALA A O    2  
ATOM 3937  C CB   . ALA A 1 112 ? -1.549  4.824   15.054  1.00 0.00 ? 112 ALA A CB   2  
ATOM 3938  H H    . ALA A 1 112 ? -3.276  5.171   16.901  1.00 0.00 ? 112 ALA A H    2  
ATOM 3939  H HA   . ALA A 1 112 ? -1.936  2.883   15.818  1.00 0.00 ? 112 ALA A HA   2  
ATOM 3940  H HB1  . ALA A 1 112 ? -2.469  4.908   14.493  1.00 0.00 ? 112 ALA A HB1  2  
ATOM 3941  H HB2  . ALA A 1 112 ? -1.266  5.796   15.430  1.00 0.00 ? 112 ALA A HB2  2  
ATOM 3942  H HB3  . ALA A 1 112 ? -0.768  4.445   14.411  1.00 0.00 ? 112 ALA A HB3  2  
ATOM 3943  N N    . VAL A 1 113 ? 0.287   2.765   16.930  1.00 0.00 ? 113 VAL A N    2  
ATOM 3944  C CA   . VAL A 1 113 ? 1.513   2.600   17.702  1.00 0.00 ? 113 VAL A CA   2  
ATOM 3945  C C    . VAL A 1 113 ? 2.671   3.360   17.064  1.00 0.00 ? 113 VAL A C    2  
ATOM 3946  O O    . VAL A 1 113 ? 2.864   3.311   15.850  1.00 0.00 ? 113 VAL A O    2  
ATOM 3947  C CB   . VAL A 1 113 ? 1.898   1.115   17.834  1.00 0.00 ? 113 VAL A CB   2  
ATOM 3948  C CG1  . VAL A 1 113 ? 3.205   0.968   18.599  1.00 0.00 ? 113 VAL A CG1  2  
ATOM 3949  C CG2  . VAL A 1 113 ? 0.783   0.334   18.513  1.00 0.00 ? 113 VAL A CG2  2  
ATOM 3950  H H    . VAL A 1 113 ? 0.040   2.080   16.274  1.00 0.00 ? 113 VAL A H    2  
ATOM 3951  H HA   . VAL A 1 113 ? 1.339   2.995   18.693  1.00 0.00 ? 113 VAL A HA   2  
ATOM 3952  H HB   . VAL A 1 113 ? 2.040   0.711   16.843  1.00 0.00 ? 113 VAL A HB   2  
ATOM 3953  H HG11 . VAL A 1 113 ? 4.028   0.931   17.901  1.00 0.00 ? 113 VAL A HG11 2  
ATOM 3954  H HG12 . VAL A 1 113 ? 3.331   1.811   19.263  1.00 0.00 ? 113 VAL A HG12 2  
ATOM 3955  H HG13 . VAL A 1 113 ? 3.183   0.055   19.177  1.00 0.00 ? 113 VAL A HG13 2  
ATOM 3956  H HG21 . VAL A 1 113 ? 0.839   -0.703  18.217  1.00 0.00 ? 113 VAL A HG21 2  
ATOM 3957  H HG22 . VAL A 1 113 ? 0.891   0.408   19.585  1.00 0.00 ? 113 VAL A HG22 2  
ATOM 3958  H HG23 . VAL A 1 113 ? -0.173  0.742   18.219  1.00 0.00 ? 113 VAL A HG23 2  
ATOM 3959  N N    . SER A 1 114 ? 3.439   4.061   17.892  1.00 0.00 ? 114 SER A N    2  
ATOM 3960  C CA   . SER A 1 114 ? 4.577   4.834   17.408  1.00 0.00 ? 114 SER A CA   2  
ATOM 3961  C C    . SER A 1 114 ? 5.678   3.914   16.890  1.00 0.00 ? 114 SER A C    2  
ATOM 3962  O O    . SER A 1 114 ? 6.610   3.572   17.617  1.00 0.00 ? 114 SER A O    2  
ATOM 3963  C CB   . SER A 1 114 ? 5.125   5.726   18.524  1.00 0.00 ? 114 SER A CB   2  
ATOM 3964  O OG   . SER A 1 114 ? 4.113   6.567   19.049  1.00 0.00 ? 114 SER A OG   2  
ATOM 3965  H H    . SER A 1 114 ? 3.233   4.060   18.850  1.00 0.00 ? 114 SER A H    2  
ATOM 3966  H HA   . SER A 1 114 ? 4.233   5.458   16.597  1.00 0.00 ? 114 SER A HA   2  
ATOM 3967  H HB2  . SER A 1 114 ? 5.511   5.107   19.319  1.00 0.00 ? 114 SER A HB2  2  
ATOM 3968  H HB3  . SER A 1 114 ? 5.920   6.343   18.129  1.00 0.00 ? 114 SER A HB3  2  
ATOM 3969  H HG   . SER A 1 114 ? 3.254   6.164   18.901  1.00 0.00 ? 114 SER A HG   2  
ATOM 3970  N N    . TRP A 1 115 ? 5.562   3.516   15.628  1.00 0.00 ? 115 TRP A N    2  
ATOM 3971  C CA   . TRP A 1 115 ? 6.547   2.635   15.011  1.00 0.00 ? 115 TRP A CA   2  
ATOM 3972  C C    . TRP A 1 115 ? 7.526   3.430   14.153  1.00 0.00 ? 115 TRP A C    2  
ATOM 3973  O O    . TRP A 1 115 ? 7.157   4.428   13.534  1.00 0.00 ? 115 TRP A O    2  
ATOM 3974  C CB   . TRP A 1 115 ? 5.849   1.574   14.159  1.00 0.00 ? 115 TRP A CB   2  
ATOM 3975  C CG   . TRP A 1 115 ? 6.794   0.777   13.311  1.00 0.00 ? 115 TRP A CG   2  
ATOM 3976  C CD1  . TRP A 1 115 ? 7.830   0.001   13.746  1.00 0.00 ? 115 TRP A CD1  2  
ATOM 3977  C CD2  . TRP A 1 115 ? 6.790   0.681   11.883  1.00 0.00 ? 115 TRP A CD2  2  
ATOM 3978  N NE1  . TRP A 1 115 ? 8.471   -0.572  12.674  1.00 0.00 ? 115 TRP A NE1  2  
ATOM 3979  C CE2  . TRP A 1 115 ? 7.852   -0.172  11.520  1.00 0.00 ? 115 TRP A CE2  2  
ATOM 3980  C CE3  . TRP A 1 115 ? 5.993   1.229   10.875  1.00 0.00 ? 115 TRP A CE3  2  
ATOM 3981  C CZ2  . TRP A 1 115 ? 8.134   -0.485  10.193  1.00 0.00 ? 115 TRP A CZ2  2  
ATOM 3982  C CZ3  . TRP A 1 115 ? 6.274   0.918   9.559   1.00 0.00 ? 115 TRP A CZ3  2  
ATOM 3983  C CH2  . TRP A 1 115 ? 7.337   0.067   9.227   1.00 0.00 ? 115 TRP A CH2  2  
ATOM 3984  H H    . TRP A 1 115 ? 4.796   3.823   15.098  1.00 0.00 ? 115 TRP A H    2  
ATOM 3985  H HA   . TRP A 1 115 ? 7.095   2.146   15.803  1.00 0.00 ? 115 TRP A HA   2  
ATOM 3986  H HB2  . TRP A 1 115 ? 5.325   0.888   14.808  1.00 0.00 ? 115 TRP A HB2  2  
ATOM 3987  H HB3  . TRP A 1 115 ? 5.140   2.058   13.504  1.00 0.00 ? 115 TRP A HB3  2  
ATOM 3988  H HD1  . TRP A 1 115 ? 8.096   -0.132  14.784  1.00 0.00 ? 115 TRP A HD1  2  
ATOM 3989  H HE1  . TRP A 1 115 ? 9.245   -1.172  12.728  1.00 0.00 ? 115 TRP A HE1  2  
ATOM 3990  H HE3  . TRP A 1 115 ? 5.169   1.888   11.111  1.00 0.00 ? 115 TRP A HE3  2  
ATOM 3991  H HZ2  . TRP A 1 115 ? 8.949   -1.140  9.921   1.00 0.00 ? 115 TRP A HZ2  2  
ATOM 3992  H HZ3  . TRP A 1 115 ? 5.669   1.333   8.766   1.00 0.00 ? 115 TRP A HZ3  2  
ATOM 3993  H HH2  . TRP A 1 115 ? 7.521   -0.149  8.186   1.00 0.00 ? 115 TRP A HH2  2  
ATOM 3994  N N    . THR A 1 116 ? 8.777   2.980   14.121  1.00 0.00 ? 116 THR A N    2  
ATOM 3995  C CA   . THR A 1 116 ? 9.809   3.650   13.340  1.00 0.00 ? 116 THR A CA   2  
ATOM 3996  C C    . THR A 1 116 ? 9.636   3.376   11.850  1.00 0.00 ? 116 THR A C    2  
ATOM 3997  O O    . THR A 1 116 ? 9.521   2.225   11.429  1.00 0.00 ? 116 THR A O    2  
ATOM 3998  C CB   . THR A 1 116 ? 11.219  3.203   13.772  1.00 0.00 ? 116 THR A CB   2  
ATOM 3999  O OG1  . THR A 1 116 ? 11.420  3.489   15.160  1.00 0.00 ? 116 THR A OG1  2  
ATOM 4000  C CG2  . THR A 1 116 ? 12.286  3.904   12.945  1.00 0.00 ? 116 THR A CG2  2  
ATOM 4001  H H    . THR A 1 116 ? 9.010   2.179   14.635  1.00 0.00 ? 116 THR A H    2  
ATOM 4002  H HA   . THR A 1 116 ? 9.722   4.713   13.514  1.00 0.00 ? 116 THR A HA   2  
ATOM 4003  H HB   . THR A 1 116 ? 11.306  2.137   13.615  1.00 0.00 ? 116 THR A HB   2  
ATOM 4004  H HG1  . THR A 1 116 ? 10.700  3.111   15.672  1.00 0.00 ? 116 THR A HG1  2  
ATOM 4005  H HG21 . THR A 1 116 ? 12.265  4.964   13.155  1.00 0.00 ? 116 THR A HG21 2  
ATOM 4006  H HG22 . THR A 1 116 ? 12.093  3.741   11.895  1.00 0.00 ? 116 THR A HG22 2  
ATOM 4007  H HG23 . THR A 1 116 ? 13.257  3.506   13.199  1.00 0.00 ? 116 THR A HG23 2  
ATOM 4008  N N    . PHE A 1 117 ? 9.619   4.442   11.056  1.00 0.00 ? 117 PHE A N    2  
ATOM 4009  C CA   . PHE A 1 117 ? 9.460   4.316   9.612   1.00 0.00 ? 117 PHE A CA   2  
ATOM 4010  C C    . PHE A 1 117 ? 10.810  4.395   8.907   1.00 0.00 ? 117 PHE A C    2  
ATOM 4011  O O    . PHE A 1 117 ? 11.250  5.472   8.504   1.00 0.00 ? 117 PHE A O    2  
ATOM 4012  C CB   . PHE A 1 117 ? 8.531   5.411   9.083   1.00 0.00 ? 117 PHE A CB   2  
ATOM 4013  C CG   . PHE A 1 117 ? 7.082   5.015   9.074   1.00 0.00 ? 117 PHE A CG   2  
ATOM 4014  C CD1  . PHE A 1 117 ? 6.546   4.321   8.001   1.00 0.00 ? 117 PHE A CD1  2  
ATOM 4015  C CD2  . PHE A 1 117 ? 6.256   5.335   10.140  1.00 0.00 ? 117 PHE A CD2  2  
ATOM 4016  C CE1  . PHE A 1 117 ? 5.213   3.957   7.991   1.00 0.00 ? 117 PHE A CE1  2  
ATOM 4017  C CE2  . PHE A 1 117 ? 4.922   4.973   10.135  1.00 0.00 ? 117 PHE A CE2  2  
ATOM 4018  C CZ   . PHE A 1 117 ? 4.400   4.281   9.059   1.00 0.00 ? 117 PHE A CZ   2  
ATOM 4019  H H    . PHE A 1 117 ? 9.716   5.334   11.451  1.00 0.00 ? 117 PHE A H    2  
ATOM 4020  H HA   . PHE A 1 117 ? 9.018   3.353   9.411   1.00 0.00 ? 117 PHE A HA   2  
ATOM 4021  H HB2  . PHE A 1 117 ? 8.630   6.289   9.704   1.00 0.00 ? 117 PHE A HB2  2  
ATOM 4022  H HB3  . PHE A 1 117 ? 8.815   5.656   8.071   1.00 0.00 ? 117 PHE A HB3  2  
ATOM 4023  H HD1  . PHE A 1 117 ? 7.180   4.066   7.165   1.00 0.00 ? 117 PHE A HD1  2  
ATOM 4024  H HD2  . PHE A 1 117 ? 6.664   5.876   10.983  1.00 0.00 ? 117 PHE A HD2  2  
ATOM 4025  H HE1  . PHE A 1 117 ? 4.807   3.416   7.149   1.00 0.00 ? 117 PHE A HE1  2  
ATOM 4026  H HE2  . PHE A 1 117 ? 4.290   5.228   10.973  1.00 0.00 ? 117 PHE A HE2  2  
ATOM 4027  H HZ   . PHE A 1 117 ? 3.358   3.998   9.053   1.00 0.00 ? 117 PHE A HZ   2  
ATOM 4028  N N    . SER A 1 118 ? 11.464  3.247   8.762   1.00 0.00 ? 118 SER A N    2  
ATOM 4029  C CA   . SER A 1 118 ? 12.767  3.186   8.109   1.00 0.00 ? 118 SER A CA   2  
ATOM 4030  C C    . SER A 1 118 ? 12.837  2.004   7.147   1.00 0.00 ? 118 SER A C    2  
ATOM 4031  O O    . SER A 1 118 ? 11.936  1.167   7.109   1.00 0.00 ? 118 SER A O    2  
ATOM 4032  C CB   . SER A 1 118 ? 13.879  3.075   9.154   1.00 0.00 ? 118 SER A CB   2  
ATOM 4033  O OG   . SER A 1 118 ? 13.804  1.843   9.850   1.00 0.00 ? 118 SER A OG   2  
ATOM 4034  H H    . SER A 1 118 ? 11.061  2.422   9.104   1.00 0.00 ? 118 SER A H    2  
ATOM 4035  H HA   . SER A 1 118 ? 12.900  4.099   7.549   1.00 0.00 ? 118 SER A HA   2  
ATOM 4036  H HB2  . SER A 1 118 ? 14.838  3.139   8.663   1.00 0.00 ? 118 SER A HB2  2  
ATOM 4037  H HB3  . SER A 1 118 ? 13.783  3.883   9.865   1.00 0.00 ? 118 SER A HB3  2  
ATOM 4038  H HG   . SER A 1 118 ? 13.386  1.184   9.291   1.00 0.00 ? 118 SER A HG   2  
ATOM 4039  N N    . GLU A 1 119 ? 13.915  1.944   6.371   1.00 0.00 ? 119 GLU A N    2  
ATOM 4040  C CA   . GLU A 1 119 ? 14.103  0.866   5.408   1.00 0.00 ? 119 GLU A CA   2  
ATOM 4041  C C    . GLU A 1 119 ? 14.253  -0.477  6.117   1.00 0.00 ? 119 GLU A C    2  
ATOM 4042  O O    . GLU A 1 119 ? 13.414  -1.365  5.969   1.00 0.00 ? 119 GLU A O    2  
ATOM 4043  C CB   . GLU A 1 119 ? 15.334  1.137   4.539   1.00 0.00 ? 119 GLU A CB   2  
ATOM 4044  C CG   . GLU A 1 119 ? 15.481  0.172   3.375   1.00 0.00 ? 119 GLU A CG   2  
ATOM 4045  C CD   . GLU A 1 119 ? 16.910  0.073   2.877   1.00 0.00 ? 119 GLU A CD   2  
ATOM 4046  O OE1  . GLU A 1 119 ? 17.302  0.907   2.034   1.00 0.00 ? 119 GLU A OE1  2  
ATOM 4047  O OE2  . GLU A 1 119 ? 17.635  -0.837  3.329   1.00 0.00 ? 119 GLU A OE2  2  
ATOM 4048  H H    . GLU A 1 119 ? 14.599  2.642   6.448   1.00 0.00 ? 119 GLU A H    2  
ATOM 4049  H HA   . GLU A 1 119 ? 13.229  0.830   4.776   1.00 0.00 ? 119 GLU A HA   2  
ATOM 4050  H HB2  . GLU A 1 119 ? 15.266  2.139   4.143   1.00 0.00 ? 119 GLU A HB2  2  
ATOM 4051  H HB3  . GLU A 1 119 ? 16.217  1.062   5.156   1.00 0.00 ? 119 GLU A HB3  2  
ATOM 4052  H HG2  . GLU A 1 119 ? 15.159  -0.808  3.694   1.00 0.00 ? 119 GLU A HG2  2  
ATOM 4053  H HG3  . GLU A 1 119 ? 14.855  0.509   2.563   1.00 0.00 ? 119 GLU A HG3  2  
ATOM 4054  N N    . GLU A 1 120 ? 15.328  -0.616  6.886   1.00 0.00 ? 120 GLU A N    2  
ATOM 4055  C CA   . GLU A 1 120 ? 15.589  -1.851  7.617   1.00 0.00 ? 120 GLU A CA   2  
ATOM 4056  C C    . GLU A 1 120 ? 14.315  -2.373  8.275   1.00 0.00 ? 120 GLU A C    2  
ATOM 4057  O O    . GLU A 1 120 ? 13.935  -3.528  8.086   1.00 0.00 ? 120 GLU A O    2  
ATOM 4058  C CB   . GLU A 1 120 ? 16.668  -1.624  8.678   1.00 0.00 ? 120 GLU A CB   2  
ATOM 4059  C CG   . GLU A 1 120 ? 16.314  -0.541  9.683   1.00 0.00 ? 120 GLU A CG   2  
ATOM 4060  C CD   . GLU A 1 120 ? 17.519  -0.058  10.469  1.00 0.00 ? 120 GLU A CD   2  
ATOM 4061  O OE1  . GLU A 1 120 ? 17.896  -0.732  11.450  1.00 0.00 ? 120 GLU A OE1  2  
ATOM 4062  O OE2  . GLU A 1 120 ? 18.084  0.993   10.101  1.00 0.00 ? 120 GLU A OE2  2  
ATOM 4063  H H    . GLU A 1 120 ? 15.961  0.128   6.964   1.00 0.00 ? 120 GLU A H    2  
ATOM 4064  H HA   . GLU A 1 120 ? 15.942  -2.587  6.910   1.00 0.00 ? 120 GLU A HA   2  
ATOM 4065  H HB2  . GLU A 1 120 ? 16.827  -2.547  9.215   1.00 0.00 ? 120 GLU A HB2  2  
ATOM 4066  H HB3  . GLU A 1 120 ? 17.586  -1.342  8.185   1.00 0.00 ? 120 GLU A HB3  2  
ATOM 4067  H HG2  . GLU A 1 120 ? 15.890  0.299   9.154   1.00 0.00 ? 120 GLU A HG2  2  
ATOM 4068  H HG3  . GLU A 1 120 ? 15.585  -0.934  10.376  1.00 0.00 ? 120 GLU A HG3  2  
ATOM 4069  N N    . ASN A 1 121 ? 13.661  -1.513  9.049   1.00 0.00 ? 121 ASN A N    2  
ATOM 4070  C CA   . ASN A 1 121 ? 12.430  -1.887  9.737   1.00 0.00 ? 121 ASN A CA   2  
ATOM 4071  C C    . ASN A 1 121 ? 11.405  -2.444  8.753   1.00 0.00 ? 121 ASN A C    2  
ATOM 4072  O O    . ASN A 1 121 ? 11.034  -3.615  8.823   1.00 0.00 ? 121 ASN A O    2  
ATOM 4073  C CB   . ASN A 1 121 ? 11.845  -0.680  10.472  1.00 0.00 ? 121 ASN A CB   2  
ATOM 4074  C CG   . ASN A 1 121 ? 12.712  -0.235  11.634  1.00 0.00 ? 121 ASN A CG   2  
ATOM 4075  O OD1  . ASN A 1 121 ? 13.915  -0.022  11.479  1.00 0.00 ? 121 ASN A OD1  2  
ATOM 4076  N ND2  . ASN A 1 121 ? 12.104  -0.092  12.806  1.00 0.00 ? 121 ASN A ND2  2  
ATOM 4077  H H    . ASN A 1 121 ? 14.014  -0.606  9.161   1.00 0.00 ? 121 ASN A H    2  
ATOM 4078  H HA   . ASN A 1 121 ? 12.673  -2.654  10.457  1.00 0.00 ? 121 ASN A HA   2  
ATOM 4079  H HB2  . ASN A 1 121 ? 11.753  0.145   9.781   1.00 0.00 ? 121 ASN A HB2  2  
ATOM 4080  H HB3  . ASN A 1 121 ? 10.868  -0.936  10.853  1.00 0.00 ? 121 ASN A HB3  2  
ATOM 4081  H HD21 . ASN A 1 121 ? 11.143  -0.279  12.854  1.00 0.00 ? 121 ASN A HD21 2  
ATOM 4082  H HD22 . ASN A 1 121 ? 12.641  0.196   13.573  1.00 0.00 ? 121 ASN A HD22 2  
ATOM 4083  N N    . VAL A 1 122 ? 10.951  -1.595  7.836   1.00 0.00 ? 122 VAL A N    2  
ATOM 4084  C CA   . VAL A 1 122 ? 9.970   -2.001  6.837   1.00 0.00 ? 122 VAL A CA   2  
ATOM 4085  C C    . VAL A 1 122 ? 10.287  -3.388  6.289   1.00 0.00 ? 122 VAL A C    2  
ATOM 4086  O O    . VAL A 1 122 ? 9.409   -4.247  6.203   1.00 0.00 ? 122 VAL A O    2  
ATOM 4087  C CB   . VAL A 1 122 ? 9.912   -0.999  5.668   1.00 0.00 ? 122 VAL A CB   2  
ATOM 4088  C CG1  . VAL A 1 122 ? 8.999   -1.516  4.567   1.00 0.00 ? 122 VAL A CG1  2  
ATOM 4089  C CG2  . VAL A 1 122 ? 9.452   0.365   6.159   1.00 0.00 ? 122 VAL A CG2  2  
ATOM 4090  H H    . VAL A 1 122 ? 11.285  -0.673  7.832   1.00 0.00 ? 122 VAL A H    2  
ATOM 4091  H HA   . VAL A 1 122 ? 9.000   -2.025  7.312   1.00 0.00 ? 122 VAL A HA   2  
ATOM 4092  H HB   . VAL A 1 122 ? 10.907  -0.895  5.260   1.00 0.00 ? 122 VAL A HB   2  
ATOM 4093  H HG11 . VAL A 1 122 ? 8.815   -0.727  3.853   1.00 0.00 ? 122 VAL A HG11 2  
ATOM 4094  H HG12 . VAL A 1 122 ? 9.470   -2.351  4.070   1.00 0.00 ? 122 VAL A HG12 2  
ATOM 4095  H HG13 . VAL A 1 122 ? 8.061   -1.835  4.999   1.00 0.00 ? 122 VAL A HG13 2  
ATOM 4096  H HG21 . VAL A 1 122 ? 9.889   1.135   5.540   1.00 0.00 ? 122 VAL A HG21 2  
ATOM 4097  H HG22 . VAL A 1 122 ? 8.374   0.424   6.100   1.00 0.00 ? 122 VAL A HG22 2  
ATOM 4098  H HG23 . VAL A 1 122 ? 9.764   0.504   7.183   1.00 0.00 ? 122 VAL A HG23 2  
ATOM 4099  N N    . ILE A 1 123 ? 11.545  -3.599  5.919   1.00 0.00 ? 123 ILE A N    2  
ATOM 4100  C CA   . ILE A 1 123 ? 11.978  -4.882  5.380   1.00 0.00 ? 123 ILE A CA   2  
ATOM 4101  C C    . ILE A 1 123 ? 11.838  -5.990  6.418   1.00 0.00 ? 123 ILE A C    2  
ATOM 4102  O O    . ILE A 1 123 ? 11.448  -7.112  6.096   1.00 0.00 ? 123 ILE A O    2  
ATOM 4103  C CB   . ILE A 1 123 ? 13.440  -4.827  4.899   1.00 0.00 ? 123 ILE A CB   2  
ATOM 4104  C CG1  . ILE A 1 123 ? 13.584  -3.829  3.748   1.00 0.00 ? 123 ILE A CG1  2  
ATOM 4105  C CG2  . ILE A 1 123 ? 13.909  -6.209  4.470   1.00 0.00 ? 123 ILE A CG2  2  
ATOM 4106  C CD1  . ILE A 1 123 ? 15.021  -3.499  3.410   1.00 0.00 ? 123 ILE A CD1  2  
ATOM 4107  H H    . ILE A 1 123 ? 12.199  -2.874  6.011   1.00 0.00 ? 123 ILE A H    2  
ATOM 4108  H HA   . ILE A 1 123 ? 11.350  -5.116  4.532   1.00 0.00 ? 123 ILE A HA   2  
ATOM 4109  H HB   . ILE A 1 123 ? 14.055  -4.504  5.725   1.00 0.00 ? 123 ILE A HB   2  
ATOM 4110  H HG12 . ILE A 1 123 ? 13.122  -4.238  2.864   1.00 0.00 ? 123 ILE A HG12 2  
ATOM 4111  H HG13 . ILE A 1 123 ? 13.085  -2.908  4.016   1.00 0.00 ? 123 ILE A HG13 2  
ATOM 4112  H HG21 . ILE A 1 123 ? 14.234  -6.175  3.440   1.00 0.00 ? 123 ILE A HG21 2  
ATOM 4113  H HG22 . ILE A 1 123 ? 14.732  -6.520  5.096   1.00 0.00 ? 123 ILE A HG22 2  
ATOM 4114  H HG23 . ILE A 1 123 ? 13.096  -6.912  4.568   1.00 0.00 ? 123 ILE A HG23 2  
ATOM 4115  H HD11 . ILE A 1 123 ? 15.466  -4.328  2.881   1.00 0.00 ? 123 ILE A HD11 2  
ATOM 4116  H HD12 . ILE A 1 123 ? 15.052  -2.616  2.790   1.00 0.00 ? 123 ILE A HD12 2  
ATOM 4117  H HD13 . ILE A 1 123 ? 15.572  -3.318  4.322   1.00 0.00 ? 123 ILE A HD13 2  
ATOM 4118  N N    . ARG A 1 124 ? 12.157  -5.666  7.667   1.00 0.00 ? 124 ARG A N    2  
ATOM 4119  C CA   . ARG A 1 124 ? 12.066  -6.633  8.754   1.00 0.00 ? 124 ARG A CA   2  
ATOM 4120  C C    . ARG A 1 124 ? 10.610  -6.898  9.126   1.00 0.00 ? 124 ARG A C    2  
ATOM 4121  O O    . ARG A 1 124 ? 10.099  -7.999  8.925   1.00 0.00 ? 124 ARG A O    2  
ATOM 4122  C CB   . ARG A 1 124 ? 12.833  -6.130  9.979   1.00 0.00 ? 124 ARG A CB   2  
ATOM 4123  C CG   . ARG A 1 124 ? 12.934  -7.155  11.097  1.00 0.00 ? 124 ARG A CG   2  
ATOM 4124  C CD   . ARG A 1 124 ? 13.874  -8.292  10.728  1.00 0.00 ? 124 ARG A CD   2  
ATOM 4125  N NE   . ARG A 1 124 ? 13.592  -9.504  11.491  1.00 0.00 ? 124 ARG A NE   2  
ATOM 4126  C CZ   . ARG A 1 124 ? 13.944  -10.722 11.093  1.00 0.00 ? 124 ARG A CZ   2  
ATOM 4127  N NH1  . ARG A 1 124 ? 14.588  -10.887 9.946   1.00 0.00 ? 124 ARG A NH1  2  
ATOM 4128  N NH2  . ARG A 1 124 ? 13.651  -11.777 11.842  1.00 0.00 ? 124 ARG A NH2  2  
ATOM 4129  H H    . ARG A 1 124 ? 12.462  -4.755  7.863   1.00 0.00 ? 124 ARG A H    2  
ATOM 4130  H HA   . ARG A 1 124 ? 12.512  -7.556  8.415   1.00 0.00 ? 124 ARG A HA   2  
ATOM 4131  H HB2  . ARG A 1 124 ? 13.835  -5.861  9.676   1.00 0.00 ? 124 ARG A HB2  2  
ATOM 4132  H HB3  . ARG A 1 124 ? 12.335  -5.255  10.366  1.00 0.00 ? 124 ARG A HB3  2  
ATOM 4133  H HG2  . ARG A 1 124 ? 13.308  -6.668  11.986  1.00 0.00 ? 124 ARG A HG2  2  
ATOM 4134  H HG3  . ARG A 1 124 ? 11.952  -7.559  11.292  1.00 0.00 ? 124 ARG A HG3  2  
ATOM 4135  H HD2  . ARG A 1 124 ? 13.763  -8.506  9.676   1.00 0.00 ? 124 ARG A HD2  2  
ATOM 4136  H HD3  . ARG A 1 124 ? 14.889  -7.980  10.926  1.00 0.00 ? 124 ARG A HD3  2  
ATOM 4137  H HE   . ARG A 1 124 ? 13.116  -9.405  12.342  1.00 0.00 ? 124 ARG A HE   2  
ATOM 4138  H HH11 . ARG A 1 124 ? 14.810  -10.094 9.380   1.00 0.00 ? 124 ARG A HH11 2  
ATOM 4139  H HH12 . ARG A 1 124 ? 14.853  -11.805 9.649   1.00 0.00 ? 124 ARG A HH12 2  
ATOM 4140  H HH21 . ARG A 1 124 ? 13.166  -11.656 12.708  1.00 0.00 ? 124 ARG A HH21 2  
ATOM 4141  H HH22 . ARG A 1 124 ? 13.916  -12.693 11.542  1.00 0.00 ? 124 ARG A HH22 2  
ATOM 4142  N N    . GLU A 1 125 ? 9.949   -5.881  9.670   1.00 0.00 ? 125 GLU A N    2  
ATOM 4143  C CA   . GLU A 1 125 ? 8.553   -6.005  10.071  1.00 0.00 ? 125 GLU A CA   2  
ATOM 4144  C C    . GLU A 1 125 ? 7.758   -6.796  9.037   1.00 0.00 ? 125 GLU A C    2  
ATOM 4145  O O    . GLU A 1 125 ? 7.133   -7.807  9.359   1.00 0.00 ? 125 GLU A O    2  
ATOM 4146  C CB   . GLU A 1 125 ? 7.929   -4.621  10.261  1.00 0.00 ? 125 GLU A CB   2  
ATOM 4147  C CG   . GLU A 1 125 ? 8.629   -3.775  11.311  1.00 0.00 ? 125 GLU A CG   2  
ATOM 4148  C CD   . GLU A 1 125 ? 8.102   -4.029  12.710  1.00 0.00 ? 125 GLU A CD   2  
ATOM 4149  O OE1  . GLU A 1 125 ? 6.943   -4.475  12.836  1.00 0.00 ? 125 GLU A OE1  2  
ATOM 4150  O OE2  . GLU A 1 125 ? 8.850   -3.781  13.679  1.00 0.00 ? 125 GLU A OE2  2  
ATOM 4151  H H    . GLU A 1 125 ? 10.412  -5.027  9.805   1.00 0.00 ? 125 GLU A H    2  
ATOM 4152  H HA   . GLU A 1 125 ? 8.524   -6.534  11.012  1.00 0.00 ? 125 GLU A HA   2  
ATOM 4153  H HB2  . GLU A 1 125 ? 7.964   -4.091  9.320   1.00 0.00 ? 125 GLU A HB2  2  
ATOM 4154  H HB3  . GLU A 1 125 ? 6.897   -4.742  10.556  1.00 0.00 ? 125 GLU A HB3  2  
ATOM 4155  H HG2  . GLU A 1 125 ? 9.684   -4.004  11.294  1.00 0.00 ? 125 GLU A HG2  2  
ATOM 4156  H HG3  . GLU A 1 125 ? 8.484   -2.732  11.071  1.00 0.00 ? 125 GLU A HG3  2  
ATOM 4157  N N    . PHE A 1 126 ? 7.787   -6.329  7.793   1.00 0.00 ? 126 PHE A N    2  
ATOM 4158  C CA   . PHE A 1 126 ? 7.068   -6.992  6.711   1.00 0.00 ? 126 PHE A CA   2  
ATOM 4159  C C    . PHE A 1 126 ? 7.788   -8.266  6.281   1.00 0.00 ? 126 PHE A C    2  
ATOM 4160  O O    . PHE A 1 126 ? 7.174   -9.187  5.744   1.00 0.00 ? 126 PHE A O    2  
ATOM 4161  C CB   . PHE A 1 126 ? 6.920   -6.048  5.516   1.00 0.00 ? 126 PHE A CB   2  
ATOM 4162  C CG   . PHE A 1 126 ? 5.895   -4.970  5.727   1.00 0.00 ? 126 PHE A CG   2  
ATOM 4163  C CD1  . PHE A 1 126 ? 4.544   -5.245  5.596   1.00 0.00 ? 126 PHE A CD1  2  
ATOM 4164  C CD2  . PHE A 1 126 ? 6.284   -3.681  6.056   1.00 0.00 ? 126 PHE A CD2  2  
ATOM 4165  C CE1  . PHE A 1 126 ? 3.599   -4.255  5.789   1.00 0.00 ? 126 PHE A CE1  2  
ATOM 4166  C CE2  . PHE A 1 126 ? 5.344   -2.687  6.250   1.00 0.00 ? 126 PHE A CE2  2  
ATOM 4167  C CZ   . PHE A 1 126 ? 3.999   -2.975  6.117   1.00 0.00 ? 126 PHE A CZ   2  
ATOM 4168  H H    . PHE A 1 126 ? 8.303   -5.519  7.599   1.00 0.00 ? 126 PHE A H    2  
ATOM 4169  H HA   . PHE A 1 126 ? 6.087   -7.252  7.077   1.00 0.00 ? 126 PHE A HA   2  
ATOM 4170  H HB2  . PHE A 1 126 ? 7.869   -5.570  5.324   1.00 0.00 ? 126 PHE A HB2  2  
ATOM 4171  H HB3  . PHE A 1 126 ? 6.628   -6.620  4.649   1.00 0.00 ? 126 PHE A HB3  2  
ATOM 4172  H HD1  . PHE A 1 126 ? 4.229   -6.247  5.340   1.00 0.00 ? 126 PHE A HD1  2  
ATOM 4173  H HD2  . PHE A 1 126 ? 7.336   -3.455  6.160   1.00 0.00 ? 126 PHE A HD2  2  
ATOM 4174  H HE1  . PHE A 1 126 ? 2.549   -4.483  5.685   1.00 0.00 ? 126 PHE A HE1  2  
ATOM 4175  H HE2  . PHE A 1 126 ? 5.660   -1.687  6.507   1.00 0.00 ? 126 PHE A HE2  2  
ATOM 4176  H HZ   . PHE A 1 126 ? 3.263   -2.199  6.268   1.00 0.00 ? 126 PHE A HZ   2  
ATOM 4177  N N    . ASN A 1 127 ? 9.094   -8.311  6.520   1.00 0.00 ? 127 ASN A N    2  
ATOM 4178  C CA   . ASN A 1 127 ? 9.899   -9.472  6.157   1.00 0.00 ? 127 ASN A CA   2  
ATOM 4179  C C    . ASN A 1 127 ? 9.879   -9.696  4.648   1.00 0.00 ? 127 ASN A C    2  
ATOM 4180  O O    . ASN A 1 127 ? 9.820   -10.834 4.179   1.00 0.00 ? 127 ASN A O    2  
ATOM 4181  C CB   . ASN A 1 127 ? 9.385   -10.720 6.877   1.00 0.00 ? 127 ASN A CB   2  
ATOM 4182  C CG   . ASN A 1 127 ? 9.552   -10.630 8.381   1.00 0.00 ? 127 ASN A CG   2  
ATOM 4183  O OD1  . ASN A 1 127 ? 8.607   -10.314 9.104   1.00 0.00 ? 127 ASN A OD1  2  
ATOM 4184  N ND2  . ASN A 1 127 ? 10.758  -10.909 8.860   1.00 0.00 ? 127 ASN A ND2  2  
ATOM 4185  H H    . ASN A 1 127 ? 9.528   -7.545  6.952   1.00 0.00 ? 127 ASN A H    2  
ATOM 4186  H HA   . ASN A 1 127 ? 10.915  -9.281  6.468   1.00 0.00 ? 127 ASN A HA   2  
ATOM 4187  H HB2  . ASN A 1 127 ? 8.335   -10.848 6.657   1.00 0.00 ? 127 ASN A HB2  2  
ATOM 4188  H HB3  . ASN A 1 127 ? 9.930   -11.583 6.523   1.00 0.00 ? 127 ASN A HB3  2  
ATOM 4189  H HD21 . ASN A 1 127 ? 11.464  -11.154 8.225   1.00 0.00 ? 127 ASN A HD21 2  
ATOM 4190  H HD22 . ASN A 1 127 ? 10.894  -10.859 9.830   1.00 0.00 ? 127 ASN A HD22 2  
ATOM 4191  N N    . LEU A 1 128 ? 9.929   -8.605  3.892   1.00 0.00 ? 128 LEU A N    2  
ATOM 4192  C CA   . LEU A 1 128 ? 9.918   -8.682  2.436   1.00 0.00 ? 128 LEU A CA   2  
ATOM 4193  C C    . LEU A 1 128 ? 11.034  -9.590  1.930   1.00 0.00 ? 128 LEU A C    2  
ATOM 4194  O O    . LEU A 1 128 ? 10.788  -10.534 1.180   1.00 0.00 ? 128 LEU A O    2  
ATOM 4195  C CB   . LEU A 1 128 ? 10.068  -7.285  1.831   1.00 0.00 ? 128 LEU A CB   2  
ATOM 4196  C CG   . LEU A 1 128 ? 9.122   -6.213  2.374   1.00 0.00 ? 128 LEU A CG   2  
ATOM 4197  C CD1  . LEU A 1 128 ? 9.654   -4.823  2.060   1.00 0.00 ? 128 LEU A CD1  2  
ATOM 4198  C CD2  . LEU A 1 128 ? 7.725   -6.394  1.799   1.00 0.00 ? 128 LEU A CD2  2  
ATOM 4199  H H    . LEU A 1 128 ? 9.975   -7.726  4.323   1.00 0.00 ? 128 LEU A H    2  
ATOM 4200  H HA   . LEU A 1 128 ? 8.968   -9.096  2.133   1.00 0.00 ? 128 LEU A HA   2  
ATOM 4201  H HB2  . LEU A 1 128 ? 11.079  -6.954  2.009   1.00 0.00 ? 128 LEU A HB2  2  
ATOM 4202  H HB3  . LEU A 1 128 ? 9.900   -7.367  0.766   1.00 0.00 ? 128 LEU A HB3  2  
ATOM 4203  H HG   . LEU A 1 128 ? 9.057   -6.310  3.449   1.00 0.00 ? 128 LEU A HG   2  
ATOM 4204  H HD11 . LEU A 1 128 ? 9.385   -4.555  1.050   1.00 0.00 ? 128 LEU A HD11 2  
ATOM 4205  H HD12 . LEU A 1 128 ? 10.729  -4.818  2.161   1.00 0.00 ? 128 LEU A HD12 2  
ATOM 4206  H HD13 . LEU A 1 128 ? 9.225   -4.110  2.749   1.00 0.00 ? 128 LEU A HD13 2  
ATOM 4207  H HD21 . LEU A 1 128 ? 7.019   -6.528  2.605   1.00 0.00 ? 128 LEU A HD21 2  
ATOM 4208  H HD22 . LEU A 1 128 ? 7.709   -7.264  1.158   1.00 0.00 ? 128 LEU A HD22 2  
ATOM 4209  H HD23 . LEU A 1 128 ? 7.455   -5.519  1.226   1.00 0.00 ? 128 LEU A HD23 2  
ATOM 4210  N N    . ASN A 1 129 ? 12.262  -9.298  2.346   1.00 0.00 ? 129 ASN A N    2  
ATOM 4211  C CA   . ASN A 1 129 ? 13.416  -10.090 1.937   1.00 0.00 ? 129 ASN A CA   2  
ATOM 4212  C C    . ASN A 1 129 ? 13.054  -11.568 1.835   1.00 0.00 ? 129 ASN A C    2  
ATOM 4213  O O    . ASN A 1 129 ? 13.397  -12.236 0.860   1.00 0.00 ? 129 ASN A O    2  
ATOM 4214  C CB   . ASN A 1 129 ? 14.567  -9.902  2.927   1.00 0.00 ? 129 ASN A CB   2  
ATOM 4215  C CG   . ASN A 1 129 ? 15.470  -8.743  2.552   1.00 0.00 ? 129 ASN A CG   2  
ATOM 4216  O OD1  . ASN A 1 129 ? 15.735  -8.505  1.373   1.00 0.00 ? 129 ASN A OD1  2  
ATOM 4217  N ND2  . ASN A 1 129 ? 15.947  -8.016  3.555   1.00 0.00 ? 129 ASN A ND2  2  
ATOM 4218  H H    . ASN A 1 129 ? 12.395  -8.533  2.944   1.00 0.00 ? 129 ASN A H    2  
ATOM 4219  H HA   . ASN A 1 129 ? 13.729  -9.740  0.964   1.00 0.00 ? 129 ASN A HA   2  
ATOM 4220  H HB2  . ASN A 1 129 ? 14.161  -9.713  3.910   1.00 0.00 ? 129 ASN A HB2  2  
ATOM 4221  H HB3  . ASN A 1 129 ? 15.161  -10.803 2.955   1.00 0.00 ? 129 ASN A HB3  2  
ATOM 4222  H HD21 . ASN A 1 129 ? 15.694  -8.264  4.469   1.00 0.00 ? 129 ASN A HD21 2  
ATOM 4223  H HD22 . ASN A 1 129 ? 16.533  -7.260  3.341   1.00 0.00 ? 129 ASN A HD22 2  
ATOM 4224  N N    . GLU A 1 130 ? 12.357  -12.072 2.849   1.00 0.00 ? 130 GLU A N    2  
ATOM 4225  C CA   . GLU A 1 130 ? 11.949  -13.472 2.874   1.00 0.00 ? 130 GLU A CA   2  
ATOM 4226  C C    . GLU A 1 130 ? 10.873  -13.743 1.826   1.00 0.00 ? 130 GLU A C    2  
ATOM 4227  O O    . GLU A 1 130 ? 10.875  -14.788 1.174   1.00 0.00 ? 130 GLU A O    2  
ATOM 4228  C CB   . GLU A 1 130 ? 11.431  -13.851 4.263   1.00 0.00 ? 130 GLU A CB   2  
ATOM 4229  C CG   . GLU A 1 130 ? 12.534  -14.107 5.275   1.00 0.00 ? 130 GLU A CG   2  
ATOM 4230  C CD   . GLU A 1 130 ? 12.979  -15.556 5.300   1.00 0.00 ? 130 GLU A CD   2  
ATOM 4231  O OE1  . GLU A 1 130 ? 13.364  -16.077 4.232   1.00 0.00 ? 130 GLU A OE1  2  
ATOM 4232  O OE2  . GLU A 1 130 ? 12.942  -16.169 6.387   1.00 0.00 ? 130 GLU A OE2  2  
ATOM 4233  H H    . GLU A 1 130 ? 12.114  -11.490 3.599   1.00 0.00 ? 130 GLU A H    2  
ATOM 4234  H HA   . GLU A 1 130 ? 12.815  -14.074 2.647   1.00 0.00 ? 130 GLU A HA   2  
ATOM 4235  H HB2  . GLU A 1 130 ? 10.809  -13.049 4.633   1.00 0.00 ? 130 GLU A HB2  2  
ATOM 4236  H HB3  . GLU A 1 130 ? 10.834  -14.747 4.179   1.00 0.00 ? 130 GLU A HB3  2  
ATOM 4237  H HG2  . GLU A 1 130 ? 13.384  -13.490 5.026   1.00 0.00 ? 130 GLU A HG2  2  
ATOM 4238  H HG3  . GLU A 1 130 ? 12.173  -13.840 6.258   1.00 0.00 ? 130 GLU A HG3  2  
ATOM 4239  N N    . LEU A 1 131 ? 9.955   -12.795 1.671   1.00 0.00 ? 131 LEU A N    2  
ATOM 4240  C CA   . LEU A 1 131 ? 8.872   -12.931 0.703   1.00 0.00 ? 131 LEU A CA   2  
ATOM 4241  C C    . LEU A 1 131 ? 9.422   -13.108 -0.709  1.00 0.00 ? 131 LEU A C    2  
ATOM 4242  O O    . LEU A 1 131 ? 9.127   -14.097 -1.381  1.00 0.00 ? 131 LEU A O    2  
ATOM 4243  C CB   . LEU A 1 131 ? 7.958   -11.705 0.756   1.00 0.00 ? 131 LEU A CB   2  
ATOM 4244  C CG   . LEU A 1 131 ? 7.243   -11.457 2.085   1.00 0.00 ? 131 LEU A CG   2  
ATOM 4245  C CD1  . LEU A 1 131 ? 6.649   -10.058 2.118   1.00 0.00 ? 131 LEU A CD1  2  
ATOM 4246  C CD2  . LEU A 1 131 ? 6.162   -12.504 2.312   1.00 0.00 ? 131 LEU A CD2  2  
ATOM 4247  H H    . LEU A 1 131 ? 10.006  -11.985 2.219   1.00 0.00 ? 131 LEU A H    2  
ATOM 4248  H HA   . LEU A 1 131 ? 8.300   -13.808 0.967   1.00 0.00 ? 131 LEU A HA   2  
ATOM 4249  H HB2  . LEU A 1 131 ? 8.559   -10.835 0.537   1.00 0.00 ? 131 LEU A HB2  2  
ATOM 4250  H HB3  . LEU A 1 131 ? 7.205   -11.822 -0.010  1.00 0.00 ? 131 LEU A HB3  2  
ATOM 4251  H HG   . LEU A 1 131 ? 7.960   -11.535 2.891   1.00 0.00 ? 131 LEU A HG   2  
ATOM 4252  H HD11 . LEU A 1 131 ? 7.111   -9.452  1.354   1.00 0.00 ? 131 LEU A HD11 2  
ATOM 4253  H HD12 . LEU A 1 131 ? 6.827   -9.615  3.087   1.00 0.00 ? 131 LEU A HD12 2  
ATOM 4254  H HD13 . LEU A 1 131 ? 5.585   -10.115 1.939   1.00 0.00 ? 131 LEU A HD13 2  
ATOM 4255  H HD21 . LEU A 1 131 ? 5.984   -13.042 1.392   1.00 0.00 ? 131 LEU A HD21 2  
ATOM 4256  H HD22 . LEU A 1 131 ? 5.251   -12.018 2.626   1.00 0.00 ? 131 LEU A HD22 2  
ATOM 4257  H HD23 . LEU A 1 131 ? 6.485   -13.195 3.077   1.00 0.00 ? 131 LEU A HD23 2  
ATOM 4258  N N    . SER A 1 132 ? 10.225  -12.146 -1.151  1.00 0.00 ? 132 SER A N    2  
ATOM 4259  C CA   . SER A 1 132 ? 10.816  -12.195 -2.483  1.00 0.00 ? 132 SER A CA   2  
ATOM 4260  C C    . SER A 1 132 ? 11.612  -13.482 -2.677  1.00 0.00 ? 132 SER A C    2  
ATOM 4261  O O    . SER A 1 132 ? 12.012  -14.129 -1.710  1.00 0.00 ? 132 SER A O    2  
ATOM 4262  C CB   . SER A 1 132 ? 11.721  -10.983 -2.708  1.00 0.00 ? 132 SER A CB   2  
ATOM 4263  O OG   . SER A 1 132 ? 12.369  -11.056 -3.966  1.00 0.00 ? 132 SER A OG   2  
ATOM 4264  H H    . SER A 1 132 ? 10.423  -11.383 -0.568  1.00 0.00 ? 132 SER A H    2  
ATOM 4265  H HA   . SER A 1 132 ? 10.011  -12.172 -3.203  1.00 0.00 ? 132 SER A HA   2  
ATOM 4266  H HB2  . SER A 1 132 ? 11.127  -10.082 -2.675  1.00 0.00 ? 132 SER A HB2  2  
ATOM 4267  H HB3  . SER A 1 132 ? 12.471  -10.948 -1.931  1.00 0.00 ? 132 SER A HB3  2  
ATOM 4268  H HG   . SER A 1 132 ? 12.946  -10.297 -4.074  1.00 0.00 ? 132 SER A HG   2  
ATOM 4269  N N    . GLY A 1 133 ? 11.839  -13.846 -3.935  1.00 0.00 ? 133 GLY A N    2  
ATOM 4270  C CA   . GLY A 1 133 ? 12.587  -15.054 -4.235  1.00 0.00 ? 133 GLY A CA   2  
ATOM 4271  C C    . GLY A 1 133 ? 14.081  -14.808 -4.306  1.00 0.00 ? 133 GLY A C    2  
ATOM 4272  O O    . GLY A 1 133 ? 14.552  -13.677 -4.185  1.00 0.00 ? 133 GLY A O    2  
ATOM 4273  H H    . GLY A 1 133 ? 11.496  -13.291 -4.667  1.00 0.00 ? 133 GLY A H    2  
ATOM 4274  H HA2  . GLY A 1 133 ? 12.389  -15.786 -3.466  1.00 0.00 ? 133 GLY A HA2  2  
ATOM 4275  H HA3  . GLY A 1 133 ? 12.252  -15.444 -5.185  1.00 0.00 ? 133 GLY A HA3  2  
ATOM 4276  N N    . PRO A 1 134 ? 14.853  -15.886 -4.505  1.00 0.00 ? 134 PRO A N    2  
ATOM 4277  C CA   . PRO A 1 134 ? 16.314  -15.808 -4.595  1.00 0.00 ? 134 PRO A CA   2  
ATOM 4278  C C    . PRO A 1 134 ? 16.780  -15.118 -5.872  1.00 0.00 ? 134 PRO A C    2  
ATOM 4279  O O    . PRO A 1 134 ? 17.978  -14.943 -6.093  1.00 0.00 ? 134 PRO A O    2  
ATOM 4280  C CB   . PRO A 1 134 ? 16.749  -17.276 -4.591  1.00 0.00 ? 134 PRO A CB   2  
ATOM 4281  C CG   . PRO A 1 134 ? 15.573  -18.020 -5.123  1.00 0.00 ? 134 PRO A CG   2  
ATOM 4282  C CD   . PRO A 1 134 ? 14.359  -17.265 -4.657  1.00 0.00 ? 134 PRO A CD   2  
ATOM 4283  H HA   . PRO A 1 134 ? 16.738  -15.303 -3.739  1.00 0.00 ? 134 PRO A HA   2  
ATOM 4284  H HB2  . PRO A 1 134 ? 17.616  -17.398 -5.225  1.00 0.00 ? 134 PRO A HB2  2  
ATOM 4285  H HB3  . PRO A 1 134 ? 16.987  -17.582 -3.583  1.00 0.00 ? 134 PRO A HB3  2  
ATOM 4286  H HG2  . PRO A 1 134 ? 15.610  -18.043 -6.201  1.00 0.00 ? 134 PRO A HG2  2  
ATOM 4287  H HG3  . PRO A 1 134 ? 15.565  -19.025 -4.726  1.00 0.00 ? 134 PRO A HG3  2  
ATOM 4288  H HD2  . PRO A 1 134 ? 13.577  -17.315 -5.399  1.00 0.00 ? 134 PRO A HD2  2  
ATOM 4289  H HD3  . PRO A 1 134 ? 14.011  -17.656 -3.712  1.00 0.00 ? 134 PRO A HD3  2  
ATOM 4290  N N    . SER A 1 135 ? 15.825  -14.726 -6.710  1.00 0.00 ? 135 SER A N    2  
ATOM 4291  C CA   . SER A 1 135 ? 16.138  -14.057 -7.967  1.00 0.00 ? 135 SER A CA   2  
ATOM 4292  C C    . SER A 1 135 ? 17.268  -13.049 -7.780  1.00 0.00 ? 135 SER A C    2  
ATOM 4293  O O    . SER A 1 135 ? 17.365  -12.396 -6.741  1.00 0.00 ? 135 SER A O    2  
ATOM 4294  C CB   . SER A 1 135 ? 14.897  -13.353 -8.518  1.00 0.00 ? 135 SER A CB   2  
ATOM 4295  O OG   . SER A 1 135 ? 13.990  -14.285 -9.082  1.00 0.00 ? 135 SER A OG   2  
ATOM 4296  H H    . SER A 1 135 ? 14.888  -14.894 -6.477  1.00 0.00 ? 135 SER A H    2  
ATOM 4297  H HA   . SER A 1 135 ? 16.457  -14.810 -8.672  1.00 0.00 ? 135 SER A HA   2  
ATOM 4298  H HB2  . SER A 1 135 ? 14.401  -12.826 -7.717  1.00 0.00 ? 135 SER A HB2  2  
ATOM 4299  H HB3  . SER A 1 135 ? 15.194  -12.650 -9.282  1.00 0.00 ? 135 SER A HB3  2  
ATOM 4300  H HG   . SER A 1 135 ? 13.109  -13.903 -9.102  1.00 0.00 ? 135 SER A HG   2  
ATOM 4301  N N    . SER A 1 136 ? 18.119  -12.928 -8.793  1.00 0.00 ? 136 SER A N    2  
ATOM 4302  C CA   . SER A 1 136 ? 19.244  -12.002 -8.740  1.00 0.00 ? 136 SER A CA   2  
ATOM 4303  C C    . SER A 1 136 ? 19.014  -10.813 -9.668  1.00 0.00 ? 136 SER A C    2  
ATOM 4304  O O    . SER A 1 136 ? 18.431  -10.954 -10.742 1.00 0.00 ? 136 SER A O    2  
ATOM 4305  C CB   . SER A 1 136 ? 20.540  -12.719 -9.123  1.00 0.00 ? 136 SER A CB   2  
ATOM 4306  O OG   . SER A 1 136 ? 20.459  -13.256 -10.432 1.00 0.00 ? 136 SER A OG   2  
ATOM 4307  H H    . SER A 1 136 ? 17.988  -13.476 -9.595  1.00 0.00 ? 136 SER A H    2  
ATOM 4308  H HA   . SER A 1 136 ? 19.329  -11.641 -7.726  1.00 0.00 ? 136 SER A HA   2  
ATOM 4309  H HB2  . SER A 1 136 ? 21.361  -12.019 -9.084  1.00 0.00 ? 136 SER A HB2  2  
ATOM 4310  H HB3  . SER A 1 136 ? 20.721  -13.526 -8.426  1.00 0.00 ? 136 SER A HB3  2  
ATOM 4311  H HG   . SER A 1 136 ? 20.510  -12.544 -11.074 1.00 0.00 ? 136 SER A HG   2  
ATOM 4312  N N    . GLY A 1 137 ? 19.478  -9.641  -9.244  1.00 0.00 ? 137 GLY A N    2  
ATOM 4313  C CA   . GLY A 1 137 ? 19.313  -8.444  -10.048 1.00 0.00 ? 137 GLY A CA   2  
ATOM 4314  C C    . GLY A 1 137 ? 20.607  -7.671  -10.208 1.00 0.00 ? 137 GLY A C    2  
ATOM 4315  O O    . GLY A 1 137 ? 20.664  -6.476  -9.919  1.00 0.00 ? 137 GLY A O    2  
ATOM 4316  H H    . GLY A 1 137 ? 19.935  -9.589  -8.379  1.00 0.00 ? 137 GLY A H    2  
ATOM 4317  H HA2  . GLY A 1 137 ? 18.952  -8.727  -11.025 1.00 0.00 ? 137 GLY A HA2  2  
ATOM 4318  H HA3  . GLY A 1 137 ? 18.582  -7.805  -9.576  1.00 0.00 ? 137 GLY A HA3  2  
ATOM 4319  N N    . GLY A 1 1   ? 16.045  1.942   -22.278 1.00 0.00 ? 1   GLY A N    3  
ATOM 4320  C CA   . GLY A 1 1   ? 15.037  2.779   -21.654 1.00 0.00 ? 1   GLY A CA   3  
ATOM 4321  C C    . GLY A 1 1   ? 15.486  4.220   -21.513 1.00 0.00 ? 1   GLY A C    3  
ATOM 4322  O O    . GLY A 1 1   ? 16.277  4.547   -20.629 1.00 0.00 ? 1   GLY A O    3  
ATOM 4323  H H1   . GLY A 1 1   ? 16.995  2.164   -22.177 1.00 0.00 ? 1   GLY A H1   3  
ATOM 4324  H HA2  . GLY A 1 1   ? 14.139  2.749   -22.254 1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4325  H HA3  . GLY A 1 1   ? 14.816  2.385   -20.673 1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4326  N N    . SER A 1 2   ? 14.980  5.084   -22.388 1.00 0.00 ? 2   SER A N    3  
ATOM 4327  C CA   . SER A 1 2   ? 15.338  6.497   -22.360 1.00 0.00 ? 2   SER A CA   3  
ATOM 4328  C C    . SER A 1 2   ? 14.814  7.165   -21.092 1.00 0.00 ? 2   SER A C    3  
ATOM 4329  O O    . SER A 1 2   ? 15.523  7.936   -20.446 1.00 0.00 ? 2   SER A O    3  
ATOM 4330  C CB   . SER A 1 2   ? 14.781  7.210   -23.594 1.00 0.00 ? 2   SER A CB   3  
ATOM 4331  O OG   . SER A 1 2   ? 15.202  6.571   -24.786 1.00 0.00 ? 2   SER A OG   3  
ATOM 4332  H H    . SER A 1 2   ? 14.354  4.762   -23.070 1.00 0.00 ? 2   SER A H    3  
ATOM 4333  H HA   . SER A 1 2   ? 16.416  6.567   -22.371 1.00 0.00 ? 2   SER A HA   3  
ATOM 4334  H HB2  . SER A 1 2   ? 13.703  7.201   -23.555 1.00 0.00 ? 2   SER A HB2  3  
ATOM 4335  H HB3  . SER A 1 2   ? 15.132  8.232   -23.604 1.00 0.00 ? 2   SER A HB3  3  
ATOM 4336  H HG   . SER A 1 2   ? 14.451  6.465   -25.375 1.00 0.00 ? 2   SER A HG   3  
ATOM 4337  N N    . SER A 1 3   ? 13.568  6.864   -20.744 1.00 0.00 ? 3   SER A N    3  
ATOM 4338  C CA   . SER A 1 3   ? 12.946  7.437   -19.556 1.00 0.00 ? 3   SER A CA   3  
ATOM 4339  C C    . SER A 1 3   ? 13.954  7.550   -18.416 1.00 0.00 ? 3   SER A C    3  
ATOM 4340  O O    . SER A 1 3   ? 14.379  6.545   -17.847 1.00 0.00 ? 3   SER A O    3  
ATOM 4341  C CB   . SER A 1 3   ? 11.754  6.585   -19.116 1.00 0.00 ? 3   SER A CB   3  
ATOM 4342  O OG   . SER A 1 3   ? 12.159  5.260   -18.814 1.00 0.00 ? 3   SER A OG   3  
ATOM 4343  H H    . SER A 1 3   ? 13.053  6.242   -21.300 1.00 0.00 ? 3   SER A H    3  
ATOM 4344  H HA   . SER A 1 3   ? 12.596  8.426   -19.810 1.00 0.00 ? 3   SER A HA   3  
ATOM 4345  H HB2  . SER A 1 3   ? 11.308  7.021   -18.235 1.00 0.00 ? 3   SER A HB2  3  
ATOM 4346  H HB3  . SER A 1 3   ? 11.024  6.554   -19.912 1.00 0.00 ? 3   SER A HB3  3  
ATOM 4347  H HG   . SER A 1 3   ? 12.955  5.283   -18.278 1.00 0.00 ? 3   SER A HG   3  
ATOM 4348  N N    . GLY A 1 4   ? 14.332  8.782   -18.088 1.00 0.00 ? 4   GLY A N    3  
ATOM 4349  C CA   . GLY A 1 4   ? 15.286  9.005   -17.018 1.00 0.00 ? 4   GLY A CA   3  
ATOM 4350  C C    . GLY A 1 4   ? 14.879  8.323   -15.726 1.00 0.00 ? 4   GLY A C    3  
ATOM 4351  O O    . GLY A 1 4   ? 15.503  7.348   -15.308 1.00 0.00 ? 4   GLY A O    3  
ATOM 4352  H H    . GLY A 1 4   ? 13.959  9.545   -18.576 1.00 0.00 ? 4   GLY A H    3  
ATOM 4353  H HA2  . GLY A 1 4   ? 16.250  8.625   -17.325 1.00 0.00 ? 4   GLY A HA2  3  
ATOM 4354  H HA3  . GLY A 1 4   ? 15.369  10.067  -16.840 1.00 0.00 ? 4   GLY A HA3  3  
ATOM 4355  N N    . SER A 1 5   ? 13.831  8.838   -15.092 1.00 0.00 ? 5   SER A N    3  
ATOM 4356  C CA   . SER A 1 5   ? 13.345  8.276   -13.837 1.00 0.00 ? 5   SER A CA   3  
ATOM 4357  C C    . SER A 1 5   ? 13.204  6.760   -13.939 1.00 0.00 ? 5   SER A C    3  
ATOM 4358  O O    . SER A 1 5   ? 12.697  6.238   -14.932 1.00 0.00 ? 5   SER A O    3  
ATOM 4359  C CB   . SER A 1 5   ? 11.999  8.900   -13.462 1.00 0.00 ? 5   SER A CB   3  
ATOM 4360  O OG   . SER A 1 5   ? 11.022  8.641   -14.456 1.00 0.00 ? 5   SER A OG   3  
ATOM 4361  H H    . SER A 1 5   ? 13.375  9.616   -15.476 1.00 0.00 ? 5   SER A H    3  
ATOM 4362  H HA   . SER A 1 5   ? 14.066  8.508   -13.069 1.00 0.00 ? 5   SER A HA   3  
ATOM 4363  H HB2  . SER A 1 5   ? 11.661  8.484   -12.525 1.00 0.00 ? 5   SER A HB2  3  
ATOM 4364  H HB3  . SER A 1 5   ? 12.117  9.969   -13.360 1.00 0.00 ? 5   SER A HB3  3  
ATOM 4365  H HG   . SER A 1 5   ? 11.454  8.509   -15.303 1.00 0.00 ? 5   SER A HG   3  
ATOM 4366  N N    . SER A 1 6   ? 13.658  6.059   -12.905 1.00 0.00 ? 6   SER A N    3  
ATOM 4367  C CA   . SER A 1 6   ? 13.588  4.603   -12.879 1.00 0.00 ? 6   SER A CA   3  
ATOM 4368  C C    . SER A 1 6   ? 12.413  4.132   -12.027 1.00 0.00 ? 6   SER A C    3  
ATOM 4369  O O    . SER A 1 6   ? 11.565  3.368   -12.487 1.00 0.00 ? 6   SER A O    3  
ATOM 4370  C CB   . SER A 1 6   ? 14.893  4.018   -12.336 1.00 0.00 ? 6   SER A CB   3  
ATOM 4371  O OG   . SER A 1 6   ? 15.921  4.073   -13.310 1.00 0.00 ? 6   SER A OG   3  
ATOM 4372  H H    . SER A 1 6   ? 14.053  6.533   -12.143 1.00 0.00 ? 6   SER A H    3  
ATOM 4373  H HA   . SER A 1 6   ? 13.443  4.260   -13.892 1.00 0.00 ? 6   SER A HA   3  
ATOM 4374  H HB2  . SER A 1 6   ? 15.204  4.581   -11.470 1.00 0.00 ? 6   SER A HB2  3  
ATOM 4375  H HB3  . SER A 1 6   ? 14.733  2.987   -12.056 1.00 0.00 ? 6   SER A HB3  3  
ATOM 4376  H HG   . SER A 1 6   ? 16.671  4.558   -12.958 1.00 0.00 ? 6   SER A HG   3  
ATOM 4377  N N    . GLY A 1 7   ? 12.370  4.594   -10.781 1.00 0.00 ? 7   GLY A N    3  
ATOM 4378  C CA   . GLY A 1 7   ? 11.297  4.209   -9.883  1.00 0.00 ? 7   GLY A CA   3  
ATOM 4379  C C    . GLY A 1 7   ? 9.939   4.238   -10.558 1.00 0.00 ? 7   GLY A C    3  
ATOM 4380  O O    . GLY A 1 7   ? 9.485   5.289   -11.010 1.00 0.00 ? 7   GLY A O    3  
ATOM 4381  H H    . GLY A 1 7   ? 13.074  5.200   -10.468 1.00 0.00 ? 7   GLY A H    3  
ATOM 4382  H HA2  . GLY A 1 7   ? 11.486  3.210   -9.521  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 4383  H HA3  . GLY A 1 7   ? 11.283  4.889   -9.044  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 4384  N N    . TYR A 1 8   ? 9.291   3.081   -10.627 1.00 0.00 ? 8   TYR A N    3  
ATOM 4385  C CA   . TYR A 1 8   ? 7.979   2.977   -11.255 1.00 0.00 ? 8   TYR A CA   3  
ATOM 4386  C C    . TYR A 1 8   ? 6.960   2.375   -10.292 1.00 0.00 ? 8   TYR A C    3  
ATOM 4387  O O    . TYR A 1 8   ? 7.073   1.213   -9.899  1.00 0.00 ? 8   TYR A O    3  
ATOM 4388  C CB   . TYR A 1 8   ? 8.063   2.126   -12.523 1.00 0.00 ? 8   TYR A CB   3  
ATOM 4389  C CG   . TYR A 1 8   ? 8.264   0.652   -12.252 1.00 0.00 ? 8   TYR A CG   3  
ATOM 4390  C CD1  . TYR A 1 8   ? 9.540   0.121   -12.105 1.00 0.00 ? 8   TYR A CD1  3  
ATOM 4391  C CD2  . TYR A 1 8   ? 7.180   -0.209  -12.142 1.00 0.00 ? 8   TYR A CD2  3  
ATOM 4392  C CE1  . TYR A 1 8   ? 9.729   -1.225  -11.858 1.00 0.00 ? 8   TYR A CE1  3  
ATOM 4393  C CE2  . TYR A 1 8   ? 7.359   -1.556  -11.893 1.00 0.00 ? 8   TYR A CE2  3  
ATOM 4394  C CZ   . TYR A 1 8   ? 8.635   -2.059  -11.752 1.00 0.00 ? 8   TYR A CZ   3  
ATOM 4395  O OH   . TYR A 1 8   ? 8.818   -3.400  -11.505 1.00 0.00 ? 8   TYR A OH   3  
ATOM 4396  H H    . TYR A 1 8   ? 9.704   2.277   -10.249 1.00 0.00 ? 8   TYR A H    3  
ATOM 4397  H HA   . TYR A 1 8   ? 7.659   3.973   -11.523 1.00 0.00 ? 8   TYR A HA   3  
ATOM 4398  H HB2  . TYR A 1 8   ? 7.149   2.237   -13.085 1.00 0.00 ? 8   TYR A HB2  3  
ATOM 4399  H HB3  . TYR A 1 8   ? 8.893   2.469   -13.124 1.00 0.00 ? 8   TYR A HB3  3  
ATOM 4400  H HD1  . TYR A 1 8   ? 10.395  0.776   -12.189 1.00 0.00 ? 8   TYR A HD1  3  
ATOM 4401  H HD2  . TYR A 1 8   ? 6.181   0.189   -12.254 1.00 0.00 ? 8   TYR A HD2  3  
ATOM 4402  H HE1  . TYR A 1 8   ? 10.728  -1.620  -11.747 1.00 0.00 ? 8   TYR A HE1  3  
ATOM 4403  H HE2  . TYR A 1 8   ? 6.503   -2.209  -11.811 1.00 0.00 ? 8   TYR A HE2  3  
ATOM 4404  H HH   . TYR A 1 8   ? 8.009   -3.876  -11.708 1.00 0.00 ? 8   TYR A HH   3  
ATOM 4405  N N    . ILE A 1 9   ? 5.966   3.173   -9.917  1.00 0.00 ? 9   ILE A N    3  
ATOM 4406  C CA   . ILE A 1 9   ? 4.926   2.719   -9.003  1.00 0.00 ? 9   ILE A CA   3  
ATOM 4407  C C    . ILE A 1 9   ? 3.591   2.562   -9.722  1.00 0.00 ? 9   ILE A C    3  
ATOM 4408  O O    . ILE A 1 9   ? 3.143   3.466   -10.427 1.00 0.00 ? 9   ILE A O    3  
ATOM 4409  C CB   . ILE A 1 9   ? 4.749   3.694   -7.823  1.00 0.00 ? 9   ILE A CB   3  
ATOM 4410  C CG1  . ILE A 1 9   ? 5.947   3.604   -6.875  1.00 0.00 ? 9   ILE A CG1  3  
ATOM 4411  C CG2  . ILE A 1 9   ? 3.455   3.397   -7.081  1.00 0.00 ? 9   ILE A CG2  3  
ATOM 4412  C CD1  . ILE A 1 9   ? 5.918   4.634   -5.767  1.00 0.00 ? 9   ILE A CD1  3  
ATOM 4413  H H    . ILE A 1 9   ? 5.931   4.088   -10.265 1.00 0.00 ? 9   ILE A H    3  
ATOM 4414  H HA   . ILE A 1 9   ? 5.226   1.759   -8.608  1.00 0.00 ? 9   ILE A HA   3  
ATOM 4415  H HB   . ILE A 1 9   ? 4.687   4.696   -8.220  1.00 0.00 ? 9   ILE A HB   3  
ATOM 4416  H HG12 . ILE A 1 9   ? 5.964   2.627   -6.419  1.00 0.00 ? 9   ILE A HG12 3  
ATOM 4417  H HG13 . ILE A 1 9   ? 6.856   3.750   -7.441  1.00 0.00 ? 9   ILE A HG13 3  
ATOM 4418  H HG21 . ILE A 1 9   ? 3.499   2.402   -6.664  1.00 0.00 ? 9   ILE A HG21 3  
ATOM 4419  H HG22 . ILE A 1 9   ? 3.325   4.115   -6.285  1.00 0.00 ? 9   ILE A HG22 3  
ATOM 4420  H HG23 . ILE A 1 9   ? 2.623   3.464   -7.766  1.00 0.00 ? 9   ILE A HG23 3  
ATOM 4421  H HD11 . ILE A 1 9   ? 6.929   4.885   -5.482  1.00 0.00 ? 9   ILE A HD11 3  
ATOM 4422  H HD12 . ILE A 1 9   ? 5.409   5.521   -6.112  1.00 0.00 ? 9   ILE A HD12 3  
ATOM 4423  H HD13 . ILE A 1 9   ? 5.395   4.228   -4.913  1.00 0.00 ? 9   ILE A HD13 3  
ATOM 4424  N N    . LYS A 1 10  ? 2.959   1.408   -9.538  1.00 0.00 ? 10  LYS A N    3  
ATOM 4425  C CA   . LYS A 1 10  ? 1.672   1.131   -10.167 1.00 0.00 ? 10  LYS A CA   3  
ATOM 4426  C C    . LYS A 1 10  ? 0.524   1.652   -9.309  1.00 0.00 ? 10  LYS A C    3  
ATOM 4427  O O    . LYS A 1 10  ? 0.297   1.170   -8.199  1.00 0.00 ? 10  LYS A O    3  
ATOM 4428  C CB   . LYS A 1 10  ? 1.508   -0.373  -10.399 1.00 0.00 ? 10  LYS A CB   3  
ATOM 4429  C CG   . LYS A 1 10  ? 0.543   -0.713  -11.522 1.00 0.00 ? 10  LYS A CG   3  
ATOM 4430  C CD   . LYS A 1 10  ? 0.787   -2.111  -12.063 1.00 0.00 ? 10  LYS A CD   3  
ATOM 4431  C CE   . LYS A 1 10  ? -0.473  -2.699  -12.678 1.00 0.00 ? 10  LYS A CE   3  
ATOM 4432  N NZ   . LYS A 1 10  ? -0.256  -4.088  -13.168 1.00 0.00 ? 10  LYS A NZ   3  
ATOM 4433  H H    . LYS A 1 10  ? 3.367   0.725   -8.965  1.00 0.00 ? 10  LYS A H    3  
ATOM 4434  H HA   . LYS A 1 10  ? 1.653   1.638   -11.120 1.00 0.00 ? 10  LYS A HA   3  
ATOM 4435  H HB2  . LYS A 1 10  ? 2.472   -0.795  -10.641 1.00 0.00 ? 10  LYS A HB2  3  
ATOM 4436  H HB3  . LYS A 1 10  ? 1.143   -0.827  -9.489  1.00 0.00 ? 10  LYS A HB3  3  
ATOM 4437  H HG2  . LYS A 1 10  ? -0.468  -0.655  -11.146 1.00 0.00 ? 10  LYS A HG2  3  
ATOM 4438  H HG3  . LYS A 1 10  ? 0.672   0.001   -12.323 1.00 0.00 ? 10  LYS A HG3  3  
ATOM 4439  H HD2  . LYS A 1 10  ? 1.556   -2.066  -12.819 1.00 0.00 ? 10  LYS A HD2  3  
ATOM 4440  H HD3  . LYS A 1 10  ? 1.114   -2.749  -11.253 1.00 0.00 ? 10  LYS A HD3  3  
ATOM 4441  H HE2  . LYS A 1 10  ? -1.252  -2.708  -11.931 1.00 0.00 ? 10  LYS A HE2  3  
ATOM 4442  H HE3  . LYS A 1 10  ? -0.777  -2.077  -13.507 1.00 0.00 ? 10  LYS A HE3  3  
ATOM 4443  H HZ1  . LYS A 1 10  ? -1.148  -4.622  -13.137 1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 4444  H HZ2  . LYS A 1 10  ? 0.445   -4.572  -12.572 1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 4445  H HZ3  . LYS A 1 10  ? 0.092   -4.071  -14.148 1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 4446  N N    . TYR A 1 11  ? -0.198  2.638   -9.830  1.00 0.00 ? 11  TYR A N    3  
ATOM 4447  C CA   . TYR A 1 11  ? -1.322  3.225   -9.111  1.00 0.00 ? 11  TYR A CA   3  
ATOM 4448  C C    . TYR A 1 11  ? -2.531  2.294   -9.136  1.00 0.00 ? 11  TYR A C    3  
ATOM 4449  O O    . TYR A 1 11  ? -2.576  1.337   -9.910  1.00 0.00 ? 11  TYR A O    3  
ATOM 4450  C CB   . TYR A 1 11  ? -1.694  4.578   -9.719  1.00 0.00 ? 11  TYR A CB   3  
ATOM 4451  C CG   . TYR A 1 11  ? -0.527  5.533   -9.830  1.00 0.00 ? 11  TYR A CG   3  
ATOM 4452  C CD1  . TYR A 1 11  ? 0.268   5.820   -8.727  1.00 0.00 ? 11  TYR A CD1  3  
ATOM 4453  C CD2  . TYR A 1 11  ? -0.220  6.148   -11.037 1.00 0.00 ? 11  TYR A CD2  3  
ATOM 4454  C CE1  . TYR A 1 11  ? 1.334   6.693   -8.823  1.00 0.00 ? 11  TYR A CE1  3  
ATOM 4455  C CE2  . TYR A 1 11  ? 0.846   7.021   -11.143 1.00 0.00 ? 11  TYR A CE2  3  
ATOM 4456  C CZ   . TYR A 1 11  ? 1.619   7.291   -10.033 1.00 0.00 ? 11  TYR A CZ   3  
ATOM 4457  O OH   . TYR A 1 11  ? 2.681   8.160   -10.133 1.00 0.00 ? 11  TYR A OH   3  
ATOM 4458  H H    . TYR A 1 11  ? 0.031   2.980   -10.719 1.00 0.00 ? 11  TYR A H    3  
ATOM 4459  H HA   . TYR A 1 11  ? -1.018  3.374   -8.085  1.00 0.00 ? 11  TYR A HA   3  
ATOM 4460  H HB2  . TYR A 1 11  ? -2.089  4.422   -10.711 1.00 0.00 ? 11  TYR A HB2  3  
ATOM 4461  H HB3  . TYR A 1 11  ? -2.450  5.046   -9.105  1.00 0.00 ? 11  TYR A HB3  3  
ATOM 4462  H HD1  . TYR A 1 11  ? 0.042   5.350   -7.781  1.00 0.00 ? 11  TYR A HD1  3  
ATOM 4463  H HD2  . TYR A 1 11  ? -0.827  5.935   -11.905 1.00 0.00 ? 11  TYR A HD2  3  
ATOM 4464  H HE1  . TYR A 1 11  ? 1.940   6.904   -7.955  1.00 0.00 ? 11  TYR A HE1  3  
ATOM 4465  H HE2  . TYR A 1 11  ? 1.069   7.490   -12.090 1.00 0.00 ? 11  TYR A HE2  3  
ATOM 4466  H HH   . TYR A 1 11  ? 3.440   7.792   -9.674  1.00 0.00 ? 11  TYR A HH   3  
ATOM 4467  N N    . PHE A 1 12  ? -3.509  2.581   -8.284  1.00 0.00 ? 12  PHE A N    3  
ATOM 4468  C CA   . PHE A 1 12  ? -4.719  1.771   -8.206  1.00 0.00 ? 12  PHE A CA   3  
ATOM 4469  C C    . PHE A 1 12  ? -5.913  2.616   -7.772  1.00 0.00 ? 12  PHE A C    3  
ATOM 4470  O O    . PHE A 1 12  ? -5.767  3.567   -7.006  1.00 0.00 ? 12  PHE A O    3  
ATOM 4471  C CB   . PHE A 1 12  ? -4.519  0.610   -7.230  1.00 0.00 ? 12  PHE A CB   3  
ATOM 4472  C CG   . PHE A 1 12  ? -3.527  -0.411  -7.707  1.00 0.00 ? 12  PHE A CG   3  
ATOM 4473  C CD1  . PHE A 1 12  ? -3.754  -1.125  -8.873  1.00 0.00 ? 12  PHE A CD1  3  
ATOM 4474  C CD2  . PHE A 1 12  ? -2.367  -0.657  -6.991  1.00 0.00 ? 12  PHE A CD2  3  
ATOM 4475  C CE1  . PHE A 1 12  ? -2.842  -2.066  -9.315  1.00 0.00 ? 12  PHE A CE1  3  
ATOM 4476  C CE2  . PHE A 1 12  ? -1.451  -1.596  -7.428  1.00 0.00 ? 12  PHE A CE2  3  
ATOM 4477  C CZ   . PHE A 1 12  ? -1.690  -2.302  -8.591  1.00 0.00 ? 12  PHE A CZ   3  
ATOM 4478  H H    . PHE A 1 12  ? -3.414  3.357   -7.692  1.00 0.00 ? 12  PHE A H    3  
ATOM 4479  H HA   . PHE A 1 12  ? -4.913  1.373   -9.190  1.00 0.00 ? 12  PHE A HA   3  
ATOM 4480  H HB2  . PHE A 1 12  ? -4.166  0.999   -6.287  1.00 0.00 ? 12  PHE A HB2  3  
ATOM 4481  H HB3  . PHE A 1 12  ? -5.464  0.111   -7.078  1.00 0.00 ? 12  PHE A HB3  3  
ATOM 4482  H HD1  . PHE A 1 12  ? -4.656  -0.942  -9.440  1.00 0.00 ? 12  PHE A HD1  3  
ATOM 4483  H HD2  . PHE A 1 12  ? -2.179  -0.107  -6.080  1.00 0.00 ? 12  PHE A HD2  3  
ATOM 4484  H HE1  . PHE A 1 12  ? -3.032  -2.616  -10.225 1.00 0.00 ? 12  PHE A HE1  3  
ATOM 4485  H HE2  . PHE A 1 12  ? -0.551  -1.779  -6.860  1.00 0.00 ? 12  PHE A HE2  3  
ATOM 4486  H HZ   . PHE A 1 12  ? -0.976  -3.035  -8.935  1.00 0.00 ? 12  PHE A HZ   3  
ATOM 4487  N N    . ASN A 1 13  ? -7.093  2.261   -8.269  1.00 0.00 ? 13  ASN A N    3  
ATOM 4488  C CA   . ASN A 1 13  ? -8.313  2.987   -7.934  1.00 0.00 ? 13  ASN A CA   3  
ATOM 4489  C C    . ASN A 1 13  ? -9.102  2.255   -6.852  1.00 0.00 ? 13  ASN A C    3  
ATOM 4490  O O    . ASN A 1 13  ? -8.928  1.053   -6.648  1.00 0.00 ? 13  ASN A O    3  
ATOM 4491  C CB   . ASN A 1 13  ? -9.182  3.167   -9.180  1.00 0.00 ? 13  ASN A CB   3  
ATOM 4492  C CG   . ASN A 1 13  ? -8.405  3.740   -10.349 1.00 0.00 ? 13  ASN A CG   3  
ATOM 4493  O OD1  . ASN A 1 13  ? -7.217  4.043   -10.231 1.00 0.00 ? 13  ASN A OD1  3  
ATOM 4494  N ND2  . ASN A 1 13  ? -9.073  3.891   -11.487 1.00 0.00 ? 13  ASN A ND2  3  
ATOM 4495  H H    . ASN A 1 13  ? -7.146  1.493   -8.875  1.00 0.00 ? 13  ASN A H    3  
ATOM 4496  H HA   . ASN A 1 13  ? -8.028  3.959   -7.560  1.00 0.00 ? 13  ASN A HA   3  
ATOM 4497  H HB2  . ASN A 1 13  ? -9.583  2.208   -9.474  1.00 0.00 ? 13  ASN A HB2  3  
ATOM 4498  H HB3  . ASN A 1 13  ? -9.997  3.837   -8.950  1.00 0.00 ? 13  ASN A HB3  3  
ATOM 4499  H HD21 . ASN A 1 13  ? -10.017 3.629   -11.508 1.00 0.00 ? 13  ASN A HD21 3  
ATOM 4500  H HD22 . ASN A 1 13  ? -8.595  4.259   -12.259 1.00 0.00 ? 13  ASN A HD22 3  
ATOM 4501  N N    . ASP A 1 14  ? -9.968  2.988   -6.161  1.00 0.00 ? 14  ASP A N    3  
ATOM 4502  C CA   . ASP A 1 14  ? -10.785 2.409   -5.101  1.00 0.00 ? 14  ASP A CA   3  
ATOM 4503  C C    . ASP A 1 14  ? -11.601 1.232   -5.625  1.00 0.00 ? 14  ASP A C    3  
ATOM 4504  O O    . ASP A 1 14  ? -12.160 0.456   -4.850  1.00 0.00 ? 14  ASP A O    3  
ATOM 4505  C CB   . ASP A 1 14  ? -11.716 3.469   -4.509  1.00 0.00 ? 14  ASP A CB   3  
ATOM 4506  C CG   . ASP A 1 14  ? -12.891 3.778   -5.415  1.00 0.00 ? 14  ASP A CG   3  
ATOM 4507  O OD1  . ASP A 1 14  ? -13.767 2.901   -5.572  1.00 0.00 ? 14  ASP A OD1  3  
ATOM 4508  O OD2  . ASP A 1 14  ? -12.935 4.897   -5.968  1.00 0.00 ? 14  ASP A OD2  3  
ATOM 4509  H H    . ASP A 1 14  ? -10.061 3.941   -6.370  1.00 0.00 ? 14  ASP A H    3  
ATOM 4510  H HA   . ASP A 1 14  ? -10.121 2.054   -4.327  1.00 0.00 ? 14  ASP A HA   3  
ATOM 4511  H HB2  . ASP A 1 14  ? -12.098 3.115   -3.563  1.00 0.00 ? 14  ASP A HB2  3  
ATOM 4512  H HB3  . ASP A 1 14  ? -11.158 4.380   -4.349  1.00 0.00 ? 14  ASP A HB3  3  
ATOM 4513  N N    . LYS A 1 15  ? -11.668 1.107   -6.946  1.00 0.00 ? 15  LYS A N    3  
ATOM 4514  C CA   . LYS A 1 15  ? -12.416 0.025   -7.576  1.00 0.00 ? 15  LYS A CA   3  
ATOM 4515  C C    . LYS A 1 15  ? -11.478 -1.080  -8.051  1.00 0.00 ? 15  LYS A C    3  
ATOM 4516  O O    . LYS A 1 15  ? -11.575 -2.225  -7.608  1.00 0.00 ? 15  LYS A O    3  
ATOM 4517  C CB   . LYS A 1 15  ? -13.231 0.560   -8.755  1.00 0.00 ? 15  LYS A CB   3  
ATOM 4518  C CG   . LYS A 1 15  ? -14.520 -0.205  -9.001  1.00 0.00 ? 15  LYS A CG   3  
ATOM 4519  C CD   . LYS A 1 15  ? -14.247 -1.604  -9.527  1.00 0.00 ? 15  LYS A CD   3  
ATOM 4520  C CE   . LYS A 1 15  ? -14.167 -2.619  -8.396  1.00 0.00 ? 15  LYS A CE   3  
ATOM 4521  N NZ   . LYS A 1 15  ? -13.298 -3.775  -8.750  1.00 0.00 ? 15  LYS A NZ   3  
ATOM 4522  H H    . LYS A 1 15  ? -11.201 1.758   -7.512  1.00 0.00 ? 15  LYS A H    3  
ATOM 4523  H HA   . LYS A 1 15  ? -13.091 -0.384  -6.839  1.00 0.00 ? 15  LYS A HA   3  
ATOM 4524  H HB2  . LYS A 1 15  ? -13.480 1.593   -8.566  1.00 0.00 ? 15  LYS A HB2  3  
ATOM 4525  H HB3  . LYS A 1 15  ? -12.627 0.502   -9.650  1.00 0.00 ? 15  LYS A HB3  3  
ATOM 4526  H HG2  . LYS A 1 15  ? -15.065 -0.281  -8.072  1.00 0.00 ? 15  LYS A HG2  3  
ATOM 4527  H HG3  . LYS A 1 15  ? -15.114 0.333   -9.726  1.00 0.00 ? 15  LYS A HG3  3  
ATOM 4528  H HD2  . LYS A 1 15  ? -15.044 -1.890  -10.196 1.00 0.00 ? 15  LYS A HD2  3  
ATOM 4529  H HD3  . LYS A 1 15  ? -13.308 -1.601  -10.063 1.00 0.00 ? 15  LYS A HD3  3  
ATOM 4530  H HE2  . LYS A 1 15  ? -13.765 -2.132  -7.521  1.00 0.00 ? 15  LYS A HE2  3  
ATOM 4531  H HE3  . LYS A 1 15  ? -15.162 -2.979  -8.183  1.00 0.00 ? 15  LYS A HE3  3  
ATOM 4532  H HZ1  . LYS A 1 15  ? -12.407 -3.438  -9.167  1.00 0.00 ? 15  LYS A HZ1  3  
ATOM 4533  H HZ2  . LYS A 1 15  ? -13.780 -4.387  -9.438  1.00 0.00 ? 15  LYS A HZ2  3  
ATOM 4534  H HZ3  . LYS A 1 15  ? -13.081 -4.333  -7.899  1.00 0.00 ? 15  LYS A HZ3  3  
ATOM 4535  N N    . THR A 1 16  ? -10.568 -0.730  -8.955  1.00 0.00 ? 16  THR A N    3  
ATOM 4536  C CA   . THR A 1 16  ? -9.613  -1.692  -9.490  1.00 0.00 ? 16  THR A CA   3  
ATOM 4537  C C    . THR A 1 16  ? -8.772  -2.308  -8.378  1.00 0.00 ? 16  THR A C    3  
ATOM 4538  O O    . THR A 1 16  ? -8.459  -3.499  -8.411  1.00 0.00 ? 16  THR A O    3  
ATOM 4539  C CB   . THR A 1 16  ? -8.677  -1.038  -10.524 1.00 0.00 ? 16  THR A CB   3  
ATOM 4540  O OG1  . THR A 1 16  ? -7.829  -0.080  -9.880  1.00 0.00 ? 16  THR A OG1  3  
ATOM 4541  C CG2  . THR A 1 16  ? -9.477  -0.356  -11.624 1.00 0.00 ? 16  THR A CG2  3  
ATOM 4542  H H    . THR A 1 16  ? -10.541 0.198   -9.269  1.00 0.00 ? 16  THR A H    3  
ATOM 4543  H HA   . THR A 1 16  ? -10.169 -2.475  -9.984  1.00 0.00 ? 16  THR A HA   3  
ATOM 4544  H HB   . THR A 1 16  ? -8.063  -1.808  -10.969 1.00 0.00 ? 16  THR A HB   3  
ATOM 4545  H HG1  . THR A 1 16  ? -7.121  -0.537  -9.419  1.00 0.00 ? 16  THR A HG1  3  
ATOM 4546  H HG21 . THR A 1 16  ? -9.002  0.577   -11.889 1.00 0.00 ? 16  THR A HG21 3  
ATOM 4547  H HG22 . THR A 1 16  ? -10.479 -0.163  -11.272 1.00 0.00 ? 16  THR A HG22 3  
ATOM 4548  H HG23 . THR A 1 16  ? -9.516  -0.999  -12.490 1.00 0.00 ? 16  THR A HG23 3  
ATOM 4549  N N    . ILE A 1 17  ? -8.410  -1.492  -7.394  1.00 0.00 ? 17  ILE A N    3  
ATOM 4550  C CA   . ILE A 1 17  ? -7.607  -1.958  -6.271  1.00 0.00 ? 17  ILE A CA   3  
ATOM 4551  C C    . ILE A 1 17  ? -8.058  -3.340  -5.810  1.00 0.00 ? 17  ILE A C    3  
ATOM 4552  O O    . ILE A 1 17  ? -7.273  -4.106  -5.250  1.00 0.00 ? 17  ILE A O    3  
ATOM 4553  C CB   . ILE A 1 17  ? -7.681  -0.983  -5.082  1.00 0.00 ? 17  ILE A CB   3  
ATOM 4554  C CG1  . ILE A 1 17  ? -6.692  -1.398  -3.991  1.00 0.00 ? 17  ILE A CG1  3  
ATOM 4555  C CG2  . ILE A 1 17  ? -9.097  -0.929  -4.528  1.00 0.00 ? 17  ILE A CG2  3  
ATOM 4556  C CD1  . ILE A 1 17  ? -6.262  -0.255  -3.098  1.00 0.00 ? 17  ILE A CD1  3  
ATOM 4557  H H    . ILE A 1 17  ? -8.691  -0.553  -7.424  1.00 0.00 ? 17  ILE A H    3  
ATOM 4558  H HA   . ILE A 1 17  ? -6.579  -2.018  -6.599  1.00 0.00 ? 17  ILE A HA   3  
ATOM 4559  H HB   . ILE A 1 17  ? -7.422  0.003   -5.437  1.00 0.00 ? 17  ILE A HB   3  
ATOM 4560  H HG12 . ILE A 1 17  ? -7.148  -2.151  -3.368  1.00 0.00 ? 17  ILE A HG12 3  
ATOM 4561  H HG13 . ILE A 1 17  ? -5.807  -1.808  -4.456  1.00 0.00 ? 17  ILE A HG13 3  
ATOM 4562  H HG21 . ILE A 1 17  ? -9.796  -0.784  -5.339  1.00 0.00 ? 17  ILE A HG21 3  
ATOM 4563  H HG22 . ILE A 1 17  ? -9.321  -1.857  -4.024  1.00 0.00 ? 17  ILE A HG22 3  
ATOM 4564  H HG23 . ILE A 1 17  ? -9.181  -0.110  -3.830  1.00 0.00 ? 17  ILE A HG23 3  
ATOM 4565  H HD11 . ILE A 1 17  ? -5.612  -0.629  -2.322  1.00 0.00 ? 17  ILE A HD11 3  
ATOM 4566  H HD12 . ILE A 1 17  ? -5.737  0.483   -3.685  1.00 0.00 ? 17  ILE A HD12 3  
ATOM 4567  H HD13 . ILE A 1 17  ? -7.134  0.198   -2.649  1.00 0.00 ? 17  ILE A HD13 3  
ATOM 4568  N N    . ASP A 1 18  ? -9.326  -3.653  -6.050  1.00 0.00 ? 18  ASP A N    3  
ATOM 4569  C CA   . ASP A 1 18  ? -9.882  -4.944  -5.662  1.00 0.00 ? 18  ASP A CA   3  
ATOM 4570  C C    . ASP A 1 18  ? -9.694  -5.973  -6.772  1.00 0.00 ? 18  ASP A C    3  
ATOM 4571  O O    . ASP A 1 18  ? -9.011  -6.980  -6.589  1.00 0.00 ? 18  ASP A O    3  
ATOM 4572  C CB   . ASP A 1 18  ? -11.367 -4.804  -5.325  1.00 0.00 ? 18  ASP A CB   3  
ATOM 4573  C CG   . ASP A 1 18  ? -11.604 -3.961  -4.088  1.00 0.00 ? 18  ASP A CG   3  
ATOM 4574  O OD1  . ASP A 1 18  ? -10.823 -4.093  -3.123  1.00 0.00 ? 18  ASP A OD1  3  
ATOM 4575  O OD2  . ASP A 1 18  ? -12.570 -3.170  -4.084  1.00 0.00 ? 18  ASP A OD2  3  
ATOM 4576  H H    . ASP A 1 18  ? -9.903  -3.000  -6.500  1.00 0.00 ? 18  ASP A H    3  
ATOM 4577  H HA   . ASP A 1 18  ? -9.354  -5.282  -4.783  1.00 0.00 ? 18  ASP A HA   3  
ATOM 4578  H HB2  . ASP A 1 18  ? -11.876 -4.339  -6.157  1.00 0.00 ? 18  ASP A HB2  3  
ATOM 4579  H HB3  . ASP A 1 18  ? -11.785 -5.786  -5.156  1.00 0.00 ? 18  ASP A HB3  3  
ATOM 4580  N N    . GLU A 1 19  ? -10.305 -5.712  -7.923  1.00 0.00 ? 19  GLU A N    3  
ATOM 4581  C CA   . GLU A 1 19  ? -10.206 -6.617  -9.063  1.00 0.00 ? 19  GLU A CA   3  
ATOM 4582  C C    . GLU A 1 19  ? -8.770  -7.097  -9.253  1.00 0.00 ? 19  GLU A C    3  
ATOM 4583  O O    . GLU A 1 19  ? -8.527  -8.281  -9.483  1.00 0.00 ? 19  GLU A O    3  
ATOM 4584  C CB   . GLU A 1 19  ? -10.698 -5.925  -10.336 1.00 0.00 ? 19  GLU A CB   3  
ATOM 4585  C CG   . GLU A 1 19  ? -9.641  -5.065  -11.008 1.00 0.00 ? 19  GLU A CG   3  
ATOM 4586  C CD   . GLU A 1 19  ? -10.152 -4.387  -12.264 1.00 0.00 ? 19  GLU A CD   3  
ATOM 4587  O OE1  . GLU A 1 19  ? -11.385 -4.367  -12.467 1.00 0.00 ? 19  GLU A OE1  3  
ATOM 4588  O OE2  . GLU A 1 19  ? -9.322  -3.876  -13.043 1.00 0.00 ? 19  GLU A OE2  3  
ATOM 4589  H H    . GLU A 1 19  ? -10.836 -4.893  -8.008  1.00 0.00 ? 19  GLU A H    3  
ATOM 4590  H HA   . GLU A 1 19  ? -10.835 -7.471  -8.863  1.00 0.00 ? 19  GLU A HA   3  
ATOM 4591  H HB2  . GLU A 1 19  ? -11.020 -6.679  -11.039 1.00 0.00 ? 19  GLU A HB2  3  
ATOM 4592  H HB3  . GLU A 1 19  ? -11.539 -5.295  -10.087 1.00 0.00 ? 19  GLU A HB3  3  
ATOM 4593  H HG2  . GLU A 1 19  ? -9.318  -4.305  -10.313 1.00 0.00 ? 19  GLU A HG2  3  
ATOM 4594  H HG3  . GLU A 1 19  ? -8.800  -5.691  -11.272 1.00 0.00 ? 19  GLU A HG3  3  
ATOM 4595  N N    . GLU A 1 20  ? -7.824  -6.168  -9.156  1.00 0.00 ? 20  GLU A N    3  
ATOM 4596  C CA   . GLU A 1 20  ? -6.413  -6.496  -9.319  1.00 0.00 ? 20  GLU A CA   3  
ATOM 4597  C C    . GLU A 1 20  ? -5.967  -7.515  -8.274  1.00 0.00 ? 20  GLU A C    3  
ATOM 4598  O O    . GLU A 1 20  ? -5.471  -8.591  -8.612  1.00 0.00 ? 20  GLU A O    3  
ATOM 4599  C CB   . GLU A 1 20  ? -5.557  -5.232  -9.212  1.00 0.00 ? 20  GLU A CB   3  
ATOM 4600  C CG   . GLU A 1 20  ? -4.082  -5.470  -9.488  1.00 0.00 ? 20  GLU A CG   3  
ATOM 4601  C CD   . GLU A 1 20  ? -3.745  -5.393  -10.964 1.00 0.00 ? 20  GLU A CD   3  
ATOM 4602  O OE1  . GLU A 1 20  ? -4.267  -4.485  -11.644 1.00 0.00 ? 20  GLU A OE1  3  
ATOM 4603  O OE2  . GLU A 1 20  ? -2.959  -6.239  -11.439 1.00 0.00 ? 20  GLU A OE2  3  
ATOM 4604  H H    . GLU A 1 20  ? -8.082  -5.241  -8.970  1.00 0.00 ? 20  GLU A H    3  
ATOM 4605  H HA   . GLU A 1 20  ? -6.283  -6.925  -10.301 1.00 0.00 ? 20  GLU A HA   3  
ATOM 4606  H HB2  . GLU A 1 20  ? -5.922  -4.503  -9.921  1.00 0.00 ? 20  GLU A HB2  3  
ATOM 4607  H HB3  . GLU A 1 20  ? -5.654  -4.830  -8.214  1.00 0.00 ? 20  GLU A HB3  3  
ATOM 4608  H HG2  . GLU A 1 20  ? -3.505  -4.724  -8.963  1.00 0.00 ? 20  GLU A HG2  3  
ATOM 4609  H HG3  . GLU A 1 20  ? -3.815  -6.452  -9.123  1.00 0.00 ? 20  GLU A HG3  3  
ATOM 4610  N N    . LEU A 1 21  ? -6.146  -7.169  -7.004  1.00 0.00 ? 21  LEU A N    3  
ATOM 4611  C CA   . LEU A 1 21  ? -5.762  -8.052  -5.909  1.00 0.00 ? 21  LEU A CA   3  
ATOM 4612  C C    . LEU A 1 21  ? -6.513  -9.378  -5.990  1.00 0.00 ? 21  LEU A C    3  
ATOM 4613  O O    . LEU A 1 21  ? -6.144  -10.351 -5.334  1.00 0.00 ? 21  LEU A O    3  
ATOM 4614  C CB   . LEU A 1 21  ? -6.038  -7.378  -4.563  1.00 0.00 ? 21  LEU A CB   3  
ATOM 4615  C CG   . LEU A 1 21  ? -5.194  -6.144  -4.246  1.00 0.00 ? 21  LEU A CG   3  
ATOM 4616  C CD1  . LEU A 1 21  ? -5.747  -5.418  -3.029  1.00 0.00 ? 21  LEU A CD1  3  
ATOM 4617  C CD2  . LEU A 1 21  ? -3.740  -6.535  -4.021  1.00 0.00 ? 21  LEU A CD2  3  
ATOM 4618  H H    . LEU A 1 21  ? -6.546  -6.299  -6.797  1.00 0.00 ? 21  LEU A H    3  
ATOM 4619  H HA   . LEU A 1 21  ? -4.704  -8.246  -5.995  1.00 0.00 ? 21  LEU A HA   3  
ATOM 4620  H HB2  . LEU A 1 21  ? -7.076  -7.082  -4.548  1.00 0.00 ? 21  LEU A HB2  3  
ATOM 4621  H HB3  . LEU A 1 21  ? -5.863  -8.109  -3.786  1.00 0.00 ? 21  LEU A HB3  3  
ATOM 4622  H HG   . LEU A 1 21  ? -5.232  -5.464  -5.085  1.00 0.00 ? 21  LEU A HG   3  
ATOM 4623  H HD11 . LEU A 1 21  ? -6.803  -5.241  -3.164  1.00 0.00 ? 21  LEU A HD11 3  
ATOM 4624  H HD12 . LEU A 1 21  ? -5.236  -4.474  -2.910  1.00 0.00 ? 21  LEU A HD12 3  
ATOM 4625  H HD13 . LEU A 1 21  ? -5.592  -6.023  -2.148  1.00 0.00 ? 21  LEU A HD13 3  
ATOM 4626  H HD21 . LEU A 1 21  ? -3.291  -5.855  -3.313  1.00 0.00 ? 21  LEU A HD21 3  
ATOM 4627  H HD22 . LEU A 1 21  ? -3.205  -6.484  -4.958  1.00 0.00 ? 21  LEU A HD22 3  
ATOM 4628  H HD23 . LEU A 1 21  ? -3.694  -7.541  -3.633  1.00 0.00 ? 21  LEU A HD23 3  
ATOM 4629  N N    . GLU A 1 22  ? -7.567  -9.407  -6.800  1.00 0.00 ? 22  GLU A N    3  
ATOM 4630  C CA   . GLU A 1 22  ? -8.368  -10.614 -6.967  1.00 0.00 ? 22  GLU A CA   3  
ATOM 4631  C C    . GLU A 1 22  ? -7.758  -11.529 -8.025  1.00 0.00 ? 22  GLU A C    3  
ATOM 4632  O O    . GLU A 1 22  ? -7.820  -12.753 -7.912  1.00 0.00 ? 22  GLU A O    3  
ATOM 4633  C CB   . GLU A 1 22  ? -9.802  -10.251 -7.356  1.00 0.00 ? 22  GLU A CB   3  
ATOM 4634  C CG   . GLU A 1 22  ? -10.806 -11.357 -7.079  1.00 0.00 ? 22  GLU A CG   3  
ATOM 4635  C CD   . GLU A 1 22  ? -12.086 -11.196 -7.877  1.00 0.00 ? 22  GLU A CD   3  
ATOM 4636  O OE1  . GLU A 1 22  ? -12.020 -11.266 -9.123  1.00 0.00 ? 22  GLU A OE1  3  
ATOM 4637  O OE2  . GLU A 1 22  ? -13.152 -11.001 -7.257  1.00 0.00 ? 22  GLU A OE2  3  
ATOM 4638  H H    . GLU A 1 22  ? -7.811  -8.598  -7.296  1.00 0.00 ? 22  GLU A H    3  
ATOM 4639  H HA   . GLU A 1 22  ? -8.382  -11.136 -6.022  1.00 0.00 ? 22  GLU A HA   3  
ATOM 4640  H HB2  . GLU A 1 22  ? -10.102 -9.374  -6.801  1.00 0.00 ? 22  GLU A HB2  3  
ATOM 4641  H HB3  . GLU A 1 22  ? -9.830  -10.024 -8.411  1.00 0.00 ? 22  GLU A HB3  3  
ATOM 4642  H HG2  . GLU A 1 22  ? -10.358 -12.305 -7.336  1.00 0.00 ? 22  GLU A HG2  3  
ATOM 4643  H HG3  . GLU A 1 22  ? -11.052 -11.349 -6.028  1.00 0.00 ? 22  GLU A HG3  3  
ATOM 4644  N N    . ARG A 1 23  ? -7.172  -10.925 -9.054  1.00 0.00 ? 23  ARG A N    3  
ATOM 4645  C CA   . ARG A 1 23  ? -6.553  -11.685 -10.134 1.00 0.00 ? 23  ARG A CA   3  
ATOM 4646  C C    . ARG A 1 23  ? -5.078  -11.942 -9.842  1.00 0.00 ? 23  ARG A C    3  
ATOM 4647  O O    . ARG A 1 23  ? -4.422  -12.716 -10.540 1.00 0.00 ? 23  ARG A O    3  
ATOM 4648  C CB   . ARG A 1 23  ? -6.699  -10.937 -11.460 1.00 0.00 ? 23  ARG A CB   3  
ATOM 4649  C CG   . ARG A 1 23  ? -5.826  -9.696  -11.559 1.00 0.00 ? 23  ARG A CG   3  
ATOM 4650  C CD   . ARG A 1 23  ? -5.454  -9.390  -13.002 1.00 0.00 ? 23  ARG A CD   3  
ATOM 4651  N NE   . ARG A 1 23  ? -6.598  -8.908  -13.771 1.00 0.00 ? 23  ARG A NE   3  
ATOM 4652  C CZ   . ARG A 1 23  ? -6.505  -8.441  -15.011 1.00 0.00 ? 23  ARG A CZ   3  
ATOM 4653  N NH1  . ARG A 1 23  ? -5.327  -8.393  -15.619 1.00 0.00 ? 23  ARG A NH1  3  
ATOM 4654  N NH2  . ARG A 1 23  ? -7.591  -8.020  -15.646 1.00 0.00 ? 23  ARG A NH2  3  
ATOM 4655  H H    . ARG A 1 23  ? -7.155  -9.946  -9.088  1.00 0.00 ? 23  ARG A H    3  
ATOM 4656  H HA   . ARG A 1 23  ? -7.064  -12.633 -10.208 1.00 0.00 ? 23  ARG A HA   3  
ATOM 4657  H HB2  . ARG A 1 23  ? -6.431  -11.603 -12.267 1.00 0.00 ? 23  ARG A HB2  3  
ATOM 4658  H HB3  . ARG A 1 23  ? -7.729  -10.636 -11.579 1.00 0.00 ? 23  ARG A HB3  3  
ATOM 4659  H HG2  . ARG A 1 23  ? -6.366  -8.854  -11.152 1.00 0.00 ? 23  ARG A HG2  3  
ATOM 4660  H HG3  . ARG A 1 23  ? -4.923  -9.857  -10.990 1.00 0.00 ? 23  ARG A HG3  3  
ATOM 4661  H HD2  . ARG A 1 23  ? -4.684  -8.634  -13.008 1.00 0.00 ? 23  ARG A HD2  3  
ATOM 4662  H HD3  . ARG A 1 23  ? -5.077  -10.292 -13.461 1.00 0.00 ? 23  ARG A HD3  3  
ATOM 4663  H HE   . ARG A 1 23  ? -7.478  -8.934  -13.341 1.00 0.00 ? 23  ARG A HE   3  
ATOM 4664  H HH11 . ARG A 1 23  ? -4.507  -8.710  -15.143 1.00 0.00 ? 23  ARG A HH11 3  
ATOM 4665  H HH12 . ARG A 1 23  ? -5.260  -8.041  -16.553 1.00 0.00 ? 23  ARG A HH12 3  
ATOM 4666  H HH21 . ARG A 1 23  ? -8.481  -8.055  -15.191 1.00 0.00 ? 23  ARG A HH21 3  
ATOM 4667  H HH22 . ARG A 1 23  ? -7.520  -7.668  -16.579 1.00 0.00 ? 23  ARG A HH22 3  
ATOM 4668  N N    . ASP A 1 24  ? -4.562  -11.287 -8.807  1.00 0.00 ? 24  ASP A N    3  
ATOM 4669  C CA   . ASP A 1 24  ? -3.164  -11.445 -8.422  1.00 0.00 ? 24  ASP A CA   3  
ATOM 4670  C C    . ASP A 1 24  ? -3.050  -12.066 -7.034  1.00 0.00 ? 24  ASP A C    3  
ATOM 4671  O O    . ASP A 1 24  ? -1.991  -12.023 -6.408  1.00 0.00 ? 24  ASP A O    3  
ATOM 4672  C CB   . ASP A 1 24  ? -2.450  -10.093 -8.450  1.00 0.00 ? 24  ASP A CB   3  
ATOM 4673  C CG   . ASP A 1 24  ? -2.238  -9.579  -9.860  1.00 0.00 ? 24  ASP A CG   3  
ATOM 4674  O OD1  . ASP A 1 24  ? -1.741  -10.352 -10.706 1.00 0.00 ? 24  ASP A OD1  3  
ATOM 4675  O OD2  . ASP A 1 24  ? -2.569  -8.403  -10.119 1.00 0.00 ? 24  ASP A OD2  3  
ATOM 4676  H H    . ASP A 1 24  ? -5.136  -10.684 -8.289  1.00 0.00 ? 24  ASP A H    3  
ATOM 4677  H HA   . ASP A 1 24  ? -2.696  -12.104 -9.137  1.00 0.00 ? 24  ASP A HA   3  
ATOM 4678  H HB2  . ASP A 1 24  ? -3.042  -9.369  -7.908  1.00 0.00 ? 24  ASP A HB2  3  
ATOM 4679  H HB3  . ASP A 1 24  ? -1.486  -10.192 -7.973  1.00 0.00 ? 24  ASP A HB3  3  
ATOM 4680  N N    . LYS A 1 25  ? -4.148  -12.643 -6.557  1.00 0.00 ? 25  LYS A N    3  
ATOM 4681  C CA   . LYS A 1 25  ? -4.172  -13.274 -5.243  1.00 0.00 ? 25  LYS A CA   3  
ATOM 4682  C C    . LYS A 1 25  ? -2.857  -13.992 -4.959  1.00 0.00 ? 25  LYS A C    3  
ATOM 4683  O O    . LYS A 1 25  ? -2.040  -13.522 -4.167  1.00 0.00 ? 25  LYS A O    3  
ATOM 4684  C CB   . LYS A 1 25  ? -5.336  -14.264 -5.151  1.00 0.00 ? 25  LYS A CB   3  
ATOM 4685  C CG   . LYS A 1 25  ? -6.636  -13.632 -4.685  1.00 0.00 ? 25  LYS A CG   3  
ATOM 4686  C CD   . LYS A 1 25  ? -7.688  -14.685 -4.378  1.00 0.00 ? 25  LYS A CD   3  
ATOM 4687  C CE   . LYS A 1 25  ? -9.031  -14.051 -4.047  1.00 0.00 ? 25  LYS A CE   3  
ATOM 4688  N NZ   . LYS A 1 25  ? -9.846  -14.915 -3.149  1.00 0.00 ? 25  LYS A NZ   3  
ATOM 4689  H H    . LYS A 1 25  ? -4.962  -12.645 -7.103  1.00 0.00 ? 25  LYS A H    3  
ATOM 4690  H HA   . LYS A 1 25  ? -4.311  -12.498 -4.505  1.00 0.00 ? 25  LYS A HA   3  
ATOM 4691  H HB2  . LYS A 1 25  ? -5.500  -14.699 -6.126  1.00 0.00 ? 25  LYS A HB2  3  
ATOM 4692  H HB3  . LYS A 1 25  ? -5.071  -15.048 -4.456  1.00 0.00 ? 25  LYS A HB3  3  
ATOM 4693  H HG2  . LYS A 1 25  ? -6.446  -13.057 -3.791  1.00 0.00 ? 25  LYS A HG2  3  
ATOM 4694  H HG3  . LYS A 1 25  ? -7.008  -12.980 -5.462  1.00 0.00 ? 25  LYS A HG3  3  
ATOM 4695  H HD2  . LYS A 1 25  ? -7.808  -15.324 -5.239  1.00 0.00 ? 25  LYS A HD2  3  
ATOM 4696  H HD3  . LYS A 1 25  ? -7.360  -15.273 -3.533  1.00 0.00 ? 25  LYS A HD3  3  
ATOM 4697  H HE2  . LYS A 1 25  ? -8.857  -13.103 -3.560  1.00 0.00 ? 25  LYS A HE2  3  
ATOM 4698  H HE3  . LYS A 1 25  ? -9.573  -13.888 -4.967  1.00 0.00 ? 25  LYS A HE3  3  
ATOM 4699  H HZ1  . LYS A 1 25  ? -10.507 -14.332 -2.597  1.00 0.00 ? 25  LYS A HZ1  3  
ATOM 4700  H HZ2  . LYS A 1 25  ? -9.228  -15.433 -2.493  1.00 0.00 ? 25  LYS A HZ2  3  
ATOM 4701  H HZ3  . LYS A 1 25  ? -10.391 -15.600 -3.710  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM 4702  N N    . ARG A 1 26  ? -2.657  -15.132 -5.613  1.00 0.00 ? 26  ARG A N    3  
ATOM 4703  C CA   . ARG A 1 26  ? -1.440  -15.914 -5.431  1.00 0.00 ? 26  ARG A CA   3  
ATOM 4704  C C    . ARG A 1 26  ? -0.228  -15.002 -5.261  1.00 0.00 ? 26  ARG A C    3  
ATOM 4705  O O    . ARG A 1 26  ? 0.625   -15.239 -4.406  1.00 0.00 ? 26  ARG A O    3  
ATOM 4706  C CB   . ARG A 1 26  ? -1.226  -16.848 -6.623  1.00 0.00 ? 26  ARG A CB   3  
ATOM 4707  C CG   . ARG A 1 26  ? -1.066  -16.119 -7.947  1.00 0.00 ? 26  ARG A CG   3  
ATOM 4708  C CD   . ARG A 1 26  ? -1.522  -16.980 -9.115  1.00 0.00 ? 26  ARG A CD   3  
ATOM 4709  N NE   . ARG A 1 26  ? -1.034  -16.470 -10.394 1.00 0.00 ? 26  ARG A NE   3  
ATOM 4710  C CZ   . ARG A 1 26  ? -0.997  -17.193 -11.508 1.00 0.00 ? 26  ARG A CZ   3  
ATOM 4711  N NH1  . ARG A 1 26  ? -1.418  -18.450 -11.500 1.00 0.00 ? 26  ARG A NH1  3  
ATOM 4712  N NH2  . ARG A 1 26  ? -0.540  -16.658 -12.633 1.00 0.00 ? 26  ARG A NH2  3  
ATOM 4713  H H    . ARG A 1 26  ? -3.345  -15.455 -6.232  1.00 0.00 ? 26  ARG A H    3  
ATOM 4714  H HA   . ARG A 1 26  ? -1.558  -16.507 -4.536  1.00 0.00 ? 26  ARG A HA   3  
ATOM 4715  H HB2  . ARG A 1 26  ? -0.335  -17.434 -6.451  1.00 0.00 ? 26  ARG A HB2  3  
ATOM 4716  H HB3  . ARG A 1 26  ? -2.074  -17.511 -6.702  1.00 0.00 ? 26  ARG A HB3  3  
ATOM 4717  H HG2  . ARG A 1 26  ? -1.661  -15.218 -7.925  1.00 0.00 ? 26  ARG A HG2  3  
ATOM 4718  H HG3  . ARG A 1 26  ? -0.026  -15.863 -8.084  1.00 0.00 ? 26  ARG A HG3  3  
ATOM 4719  H HD2  . ARG A 1 26  ? -1.149  -17.983 -8.973  1.00 0.00 ? 26  ARG A HD2  3  
ATOM 4720  H HD3  . ARG A 1 26  ? -2.601  -16.997 -9.133  1.00 0.00 ? 26  ARG A HD3  3  
ATOM 4721  H HE   . ARG A 1 26  ? -0.719  -15.543 -10.422 1.00 0.00 ? 26  ARG A HE   3  
ATOM 4722  H HH11 . ARG A 1 26  ? -1.764  -18.855 -10.654 1.00 0.00 ? 26  ARG A HH11 3  
ATOM 4723  H HH12 . ARG A 1 26  ? -1.390  -18.992 -12.340 1.00 0.00 ? 26  ARG A HH12 3  
ATOM 4724  H HH21 . ARG A 1 26  ? -0.223  -15.710 -12.642 1.00 0.00 ? 26  ARG A HH21 3  
ATOM 4725  H HH22 . ARG A 1 26  ? -0.512  -17.202 -13.470 1.00 0.00 ? 26  ARG A HH22 3  
ATOM 4726  N N    . VAL A 1 27  ? -0.159  -13.959 -6.083  1.00 0.00 ? 27  VAL A N    3  
ATOM 4727  C CA   . VAL A 1 27  ? 0.948   -13.012 -6.024  1.00 0.00 ? 27  VAL A CA   3  
ATOM 4728  C C    . VAL A 1 27  ? 0.738   -11.991 -4.911  1.00 0.00 ? 27  VAL A C    3  
ATOM 4729  O O    . VAL A 1 27  ? -0.358  -11.455 -4.743  1.00 0.00 ? 27  VAL A O    3  
ATOM 4730  C CB   . VAL A 1 27  ? 1.122   -12.269 -7.361  1.00 0.00 ? 27  VAL A CB   3  
ATOM 4731  C CG1  . VAL A 1 27  ? 2.352   -11.375 -7.319  1.00 0.00 ? 27  VAL A CG1  3  
ATOM 4732  C CG2  . VAL A 1 27  ? 1.212   -13.259 -8.513  1.00 0.00 ? 27  VAL A CG2  3  
ATOM 4733  H H    . VAL A 1 27  ? -0.870  -13.824 -6.744  1.00 0.00 ? 27  VAL A H    3  
ATOM 4734  H HA   . VAL A 1 27  ? 1.852   -13.567 -5.823  1.00 0.00 ? 27  VAL A HA   3  
ATOM 4735  H HB   . VAL A 1 27  ? 0.256   -11.644 -7.518  1.00 0.00 ? 27  VAL A HB   3  
ATOM 4736  H HG11 . VAL A 1 27  ? 3.225   -11.950 -7.592  1.00 0.00 ? 27  VAL A HG11 3  
ATOM 4737  H HG12 . VAL A 1 27  ? 2.227   -10.557 -8.013  1.00 0.00 ? 27  VAL A HG12 3  
ATOM 4738  H HG13 . VAL A 1 27  ? 2.478   -10.984 -6.320  1.00 0.00 ? 27  VAL A HG13 3  
ATOM 4739  H HG21 . VAL A 1 27  ? 1.440   -14.241 -8.125  1.00 0.00 ? 27  VAL A HG21 3  
ATOM 4740  H HG22 . VAL A 1 27  ? 0.267   -13.290 -9.036  1.00 0.00 ? 27  VAL A HG22 3  
ATOM 4741  H HG23 . VAL A 1 27  ? 1.990   -12.950 -9.194  1.00 0.00 ? 27  VAL A HG23 3  
ATOM 4742  N N    . THR A 1 28  ? 1.797   -11.724 -4.152  1.00 0.00 ? 28  THR A N    3  
ATOM 4743  C CA   . THR A 1 28  ? 1.729   -10.767 -3.055  1.00 0.00 ? 28  THR A CA   3  
ATOM 4744  C C    . THR A 1 28  ? 1.738   -9.334  -3.574  1.00 0.00 ? 28  THR A C    3  
ATOM 4745  O O    . THR A 1 28  ? 2.398   -9.028  -4.567  1.00 0.00 ? 28  THR A O    3  
ATOM 4746  C CB   . THR A 1 28  ? 2.902   -10.954 -2.074  1.00 0.00 ? 28  THR A CB   3  
ATOM 4747  O OG1  . THR A 1 28  ? 3.041   -12.338 -1.734  1.00 0.00 ? 28  THR A OG1  3  
ATOM 4748  C CG2  . THR A 1 28  ? 2.687   -10.134 -0.811  1.00 0.00 ? 28  THR A CG2  3  
ATOM 4749  H H    . THR A 1 28  ? 2.642   -12.183 -4.336  1.00 0.00 ? 28  THR A H    3  
ATOM 4750  H HA   . THR A 1 28  ? 0.808   -10.940 -2.518  1.00 0.00 ? 28  THR A HA   3  
ATOM 4751  H HB   . THR A 1 28  ? 3.810   -10.616 -2.554  1.00 0.00 ? 28  THR A HB   3  
ATOM 4752  H HG1  . THR A 1 28  ? 2.192   -12.777 -1.828  1.00 0.00 ? 28  THR A HG1  3  
ATOM 4753  H HG21 . THR A 1 28  ? 3.479   -9.406  -0.715  1.00 0.00 ? 28  THR A HG21 3  
ATOM 4754  H HG22 . THR A 1 28  ? 2.693   -10.789 0.048   1.00 0.00 ? 28  THR A HG22 3  
ATOM 4755  H HG23 . THR A 1 28  ? 1.736   -9.626  -0.870  1.00 0.00 ? 28  THR A HG23 3  
ATOM 4756  N N    . TRP A 1 29  ? 1.003   -8.460  -2.896  1.00 0.00 ? 29  TRP A N    3  
ATOM 4757  C CA   . TRP A 1 29  ? 0.928   -7.058  -3.289  1.00 0.00 ? 29  TRP A CA   3  
ATOM 4758  C C    . TRP A 1 29  ? 1.035   -6.145  -2.072  1.00 0.00 ? 29  TRP A C    3  
ATOM 4759  O O    . TRP A 1 29  ? 0.432   -6.409  -1.032  1.00 0.00 ? 29  TRP A O    3  
ATOM 4760  C CB   . TRP A 1 29  ? -0.381  -6.785  -4.032  1.00 0.00 ? 29  TRP A CB   3  
ATOM 4761  C CG   . TRP A 1 29  ? -0.273  -6.978  -5.515  1.00 0.00 ? 29  TRP A CG   3  
ATOM 4762  C CD1  . TRP A 1 29  ? -0.663  -8.076  -6.228  1.00 0.00 ? 29  TRP A CD1  3  
ATOM 4763  C CD2  . TRP A 1 29  ? 0.261   -6.049  -6.464  1.00 0.00 ? 29  TRP A CD2  3  
ATOM 4764  N NE1  . TRP A 1 29  ? -0.403  -7.884  -7.564  1.00 0.00 ? 29  TRP A NE1  3  
ATOM 4765  C CE2  . TRP A 1 29  ? 0.163   -6.649  -7.735  1.00 0.00 ? 29  TRP A CE2  3  
ATOM 4766  C CE3  . TRP A 1 29  ? 0.810   -4.768  -6.364  1.00 0.00 ? 29  TRP A CE3  3  
ATOM 4767  C CZ2  . TRP A 1 29  ? 0.595   -6.010  -8.894  1.00 0.00 ? 29  TRP A CZ2  3  
ATOM 4768  C CZ3  . TRP A 1 29  ? 1.239   -4.136  -7.516  1.00 0.00 ? 29  TRP A CZ3  3  
ATOM 4769  C CH2  . TRP A 1 29  ? 1.129   -4.756  -8.767  1.00 0.00 ? 29  TRP A CH2  3  
ATOM 4770  H H    . TRP A 1 29  ? 0.499   -8.765  -2.112  1.00 0.00 ? 29  TRP A H    3  
ATOM 4771  H HA   . TRP A 1 29  ? 1.756   -6.855  -3.951  1.00 0.00 ? 29  TRP A HA   3  
ATOM 4772  H HB2  . TRP A 1 29  ? -1.144  -7.454  -3.663  1.00 0.00 ? 29  TRP A HB2  3  
ATOM 4773  H HB3  . TRP A 1 29  ? -0.684  -5.764  -3.850  1.00 0.00 ? 29  TRP A HB3  3  
ATOM 4774  H HD1  . TRP A 1 29  ? -1.106  -8.958  -5.793  1.00 0.00 ? 29  TRP A HD1  3  
ATOM 4775  H HE1  . TRP A 1 29  ? -0.594  -8.528  -8.278  1.00 0.00 ? 29  TRP A HE1  3  
ATOM 4776  H HE3  . TRP A 1 29  ? 0.903   -4.273  -5.409  1.00 0.00 ? 29  TRP A HE3  3  
ATOM 4777  H HZ2  . TRP A 1 29  ? 0.516   -6.475  -9.866  1.00 0.00 ? 29  TRP A HZ2  3  
ATOM 4778  H HZ3  . TRP A 1 29  ? 1.666   -3.145  -7.458  1.00 0.00 ? 29  TRP A HZ3  3  
ATOM 4779  H HH2  . TRP A 1 29  ? 1.477   -4.226  -9.640  1.00 0.00 ? 29  TRP A HH2  3  
ATOM 4780  N N    . ILE A 1 30  ? 1.806   -5.071  -2.210  1.00 0.00 ? 30  ILE A N    3  
ATOM 4781  C CA   . ILE A 1 30  ? 1.991   -4.119  -1.121  1.00 0.00 ? 30  ILE A CA   3  
ATOM 4782  C C    . ILE A 1 30  ? 1.557   -2.718  -1.537  1.00 0.00 ? 30  ILE A C    3  
ATOM 4783  O O    . ILE A 1 30  ? 2.237   -2.053  -2.320  1.00 0.00 ? 30  ILE A O    3  
ATOM 4784  C CB   . ILE A 1 30  ? 3.458   -4.074  -0.656  1.00 0.00 ? 30  ILE A CB   3  
ATOM 4785  C CG1  . ILE A 1 30  ? 3.607   -3.134  0.542   1.00 0.00 ? 30  ILE A CG1  3  
ATOM 4786  C CG2  . ILE A 1 30  ? 4.362   -3.633  -1.797  1.00 0.00 ? 30  ILE A CG2  3  
ATOM 4787  C CD1  . ILE A 1 30  ? 4.832   -3.417  1.384   1.00 0.00 ? 30  ILE A CD1  3  
ATOM 4788  H H    . ILE A 1 30  ? 2.261   -4.915  -3.063  1.00 0.00 ? 30  ILE A H    3  
ATOM 4789  H HA   . ILE A 1 30  ? 1.380   -4.442  -0.290  1.00 0.00 ? 30  ILE A HA   3  
ATOM 4790  H HB   . ILE A 1 30  ? 3.750   -5.070  -0.362  1.00 0.00 ? 30  ILE A HB   3  
ATOM 4791  H HG12 . ILE A 1 30  ? 3.676   -2.118  0.188   1.00 0.00 ? 30  ILE A HG12 3  
ATOM 4792  H HG13 . ILE A 1 30  ? 2.738   -3.232  1.177   1.00 0.00 ? 30  ILE A HG13 3  
ATOM 4793  H HG21 . ILE A 1 30  ? 4.664   -2.608  -1.642  1.00 0.00 ? 30  ILE A HG21 3  
ATOM 4794  H HG22 . ILE A 1 30  ? 5.238   -4.264  -1.827  1.00 0.00 ? 30  ILE A HG22 3  
ATOM 4795  H HG23 . ILE A 1 30  ? 3.828   -3.714  -2.732  1.00 0.00 ? 30  ILE A HG23 3  
ATOM 4796  H HD11 . ILE A 1 30  ? 5.038   -4.477  1.375   1.00 0.00 ? 30  ILE A HD11 3  
ATOM 4797  H HD12 . ILE A 1 30  ? 5.678   -2.881  0.981   1.00 0.00 ? 30  ILE A HD12 3  
ATOM 4798  H HD13 . ILE A 1 30  ? 4.653   -3.095  2.400   1.00 0.00 ? 30  ILE A HD13 3  
ATOM 4799  N N    . VAL A 1 31  ? 0.422   -2.274  -1.007  1.00 0.00 ? 31  VAL A N    3  
ATOM 4800  C CA   . VAL A 1 31  ? -0.101  -0.949  -1.321  1.00 0.00 ? 31  VAL A CA   3  
ATOM 4801  C C    . VAL A 1 31  ? 0.213   0.043   -0.208  1.00 0.00 ? 31  VAL A C    3  
ATOM 4802  O O    . VAL A 1 31  ? 0.134   -0.290  0.974   1.00 0.00 ? 31  VAL A O    3  
ATOM 4803  C CB   . VAL A 1 31  ? -1.624  -0.987  -1.546  1.00 0.00 ? 31  VAL A CB   3  
ATOM 4804  C CG1  . VAL A 1 31  ? -2.125  0.362   -2.040  1.00 0.00 ? 31  VAL A CG1  3  
ATOM 4805  C CG2  . VAL A 1 31  ? -1.991  -2.092  -2.525  1.00 0.00 ? 31  VAL A CG2  3  
ATOM 4806  H H    . VAL A 1 31  ? -0.075  -2.850  -0.390  1.00 0.00 ? 31  VAL A H    3  
ATOM 4807  H HA   . VAL A 1 31  ? 0.368   -0.612  -2.234  1.00 0.00 ? 31  VAL A HA   3  
ATOM 4808  H HB   . VAL A 1 31  ? -2.102  -1.199  -0.601  1.00 0.00 ? 31  VAL A HB   3  
ATOM 4809  H HG11 . VAL A 1 31  ? -1.985  0.428   -3.109  1.00 0.00 ? 31  VAL A HG11 3  
ATOM 4810  H HG12 . VAL A 1 31  ? -3.174  0.465   -1.806  1.00 0.00 ? 31  VAL A HG12 3  
ATOM 4811  H HG13 . VAL A 1 31  ? -1.568  1.151   -1.557  1.00 0.00 ? 31  VAL A HG13 3  
ATOM 4812  H HG21 . VAL A 1 31  ? -3.040  -2.021  -2.771  1.00 0.00 ? 31  VAL A HG21 3  
ATOM 4813  H HG22 . VAL A 1 31  ? -1.403  -1.986  -3.425  1.00 0.00 ? 31  VAL A HG22 3  
ATOM 4814  H HG23 . VAL A 1 31  ? -1.790  -3.053  -2.076  1.00 0.00 ? 31  VAL A HG23 3  
ATOM 4815  N N    . GLU A 1 32  ? 0.568   1.265   -0.594  1.00 0.00 ? 32  GLU A N    3  
ATOM 4816  C CA   . GLU A 1 32  ? 0.895   2.307   0.373   1.00 0.00 ? 32  GLU A CA   3  
ATOM 4817  C C    . GLU A 1 32  ? -0.228  3.336   0.463   1.00 0.00 ? 32  GLU A C    3  
ATOM 4818  O O    . GLU A 1 32  ? -0.579  3.977   -0.528  1.00 0.00 ? 32  GLU A O    3  
ATOM 4819  C CB   . GLU A 1 32  ? 2.205   2.997   -0.011  1.00 0.00 ? 32  GLU A CB   3  
ATOM 4820  C CG   . GLU A 1 32  ? 2.621   4.093   0.956   1.00 0.00 ? 32  GLU A CG   3  
ATOM 4821  C CD   . GLU A 1 32  ? 3.490   5.149   0.301   1.00 0.00 ? 32  GLU A CD   3  
ATOM 4822  O OE1  . GLU A 1 32  ? 2.929   6.089   -0.299  1.00 0.00 ? 32  GLU A OE1  3  
ATOM 4823  O OE2  . GLU A 1 32  ? 4.730   5.036   0.389   1.00 0.00 ? 32  GLU A OE2  3  
ATOM 4824  H H    . GLU A 1 32  ? 0.613   1.470   -1.551  1.00 0.00 ? 32  GLU A H    3  
ATOM 4825  H HA   . GLU A 1 32  ? 1.015   1.838   1.338   1.00 0.00 ? 32  GLU A HA   3  
ATOM 4826  H HB2  . GLU A 1 32  ? 2.991   2.257   -0.045  1.00 0.00 ? 32  GLU A HB2  3  
ATOM 4827  H HB3  . GLU A 1 32  ? 2.093   3.435   -0.992  1.00 0.00 ? 32  GLU A HB3  3  
ATOM 4828  H HG2  . GLU A 1 32  ? 1.733   4.569   1.344   1.00 0.00 ? 32  GLU A HG2  3  
ATOM 4829  H HG3  . GLU A 1 32  ? 3.174   3.647   1.770   1.00 0.00 ? 32  GLU A HG3  3  
ATOM 4830  N N    . PHE A 1 33  ? -0.788  3.489   1.659   1.00 0.00 ? 33  PHE A N    3  
ATOM 4831  C CA   . PHE A 1 33  ? -1.872  4.439   1.879   1.00 0.00 ? 33  PHE A CA   3  
ATOM 4832  C C    . PHE A 1 33  ? -1.327  5.790   2.332   1.00 0.00 ? 33  PHE A C    3  
ATOM 4833  O O    . PHE A 1 33  ? -0.796  5.920   3.435   1.00 0.00 ? 33  PHE A O    3  
ATOM 4834  C CB   . PHE A 1 33  ? -2.851  3.895   2.922   1.00 0.00 ? 33  PHE A CB   3  
ATOM 4835  C CG   . PHE A 1 33  ? -3.455  2.573   2.545   1.00 0.00 ? 33  PHE A CG   3  
ATOM 4836  C CD1  . PHE A 1 33  ? -2.683  1.423   2.527   1.00 0.00 ? 33  PHE A CD1  3  
ATOM 4837  C CD2  . PHE A 1 33  ? -4.796  2.480   2.209   1.00 0.00 ? 33  PHE A CD2  3  
ATOM 4838  C CE1  . PHE A 1 33  ? -3.236  0.205   2.181   1.00 0.00 ? 33  PHE A CE1  3  
ATOM 4839  C CE2  . PHE A 1 33  ? -5.355  1.265   1.863   1.00 0.00 ? 33  PHE A CE2  3  
ATOM 4840  C CZ   . PHE A 1 33  ? -4.574  0.126   1.848   1.00 0.00 ? 33  PHE A CZ   3  
ATOM 4841  H H    . PHE A 1 33  ? -0.465  2.949   2.410   1.00 0.00 ? 33  PHE A H    3  
ATOM 4842  H HA   . PHE A 1 33  ? -2.393  4.569   0.943   1.00 0.00 ? 33  PHE A HA   3  
ATOM 4843  H HB2  . PHE A 1 33  ? -2.331  3.767   3.860   1.00 0.00 ? 33  PHE A HB2  3  
ATOM 4844  H HB3  . PHE A 1 33  ? -3.655  4.604   3.055   1.00 0.00 ? 33  PHE A HB3  3  
ATOM 4845  H HD1  . PHE A 1 33  ? -1.635  1.484   2.787   1.00 0.00 ? 33  PHE A HD1  3  
ATOM 4846  H HD2  . PHE A 1 33  ? -5.409  3.370   2.220   1.00 0.00 ? 33  PHE A HD2  3  
ATOM 4847  H HE1  . PHE A 1 33  ? -2.622  -0.684  2.170   1.00 0.00 ? 33  PHE A HE1  3  
ATOM 4848  H HE2  . PHE A 1 33  ? -6.402  1.206   1.603   1.00 0.00 ? 33  PHE A HE2  3  
ATOM 4849  H HZ   . PHE A 1 33  ? -5.009  -0.825  1.578   1.00 0.00 ? 33  PHE A HZ   3  
ATOM 4850  N N    . PHE A 1 34  ? -1.463  6.794   1.472   1.00 0.00 ? 34  PHE A N    3  
ATOM 4851  C CA   . PHE A 1 34  ? -0.983  8.136   1.781   1.00 0.00 ? 34  PHE A CA   3  
ATOM 4852  C C    . PHE A 1 34  ? -2.032  9.185   1.423   1.00 0.00 ? 34  PHE A C    3  
ATOM 4853  O O    . PHE A 1 34  ? -3.028  8.883   0.767   1.00 0.00 ? 34  PHE A O    3  
ATOM 4854  C CB   . PHE A 1 34  ? 0.318   8.422   1.028   1.00 0.00 ? 34  PHE A CB   3  
ATOM 4855  C CG   . PHE A 1 34  ? 0.103   8.996   -0.343  1.00 0.00 ? 34  PHE A CG   3  
ATOM 4856  C CD1  . PHE A 1 34  ? -0.376  8.203   -1.373  1.00 0.00 ? 34  PHE A CD1  3  
ATOM 4857  C CD2  . PHE A 1 34  ? 0.381   10.329  -0.602  1.00 0.00 ? 34  PHE A CD2  3  
ATOM 4858  C CE1  . PHE A 1 34  ? -0.574  8.729   -2.636  1.00 0.00 ? 34  PHE A CE1  3  
ATOM 4859  C CE2  . PHE A 1 34  ? 0.185   10.860  -1.863  1.00 0.00 ? 34  PHE A CE2  3  
ATOM 4860  C CZ   . PHE A 1 34  ? -0.294  10.059  -2.881  1.00 0.00 ? 34  PHE A CZ   3  
ATOM 4861  H H    . PHE A 1 34  ? -1.895  6.628   0.607   1.00 0.00 ? 34  PHE A H    3  
ATOM 4862  H HA   . PHE A 1 34  ? -0.792  8.182   2.842   1.00 0.00 ? 34  PHE A HA   3  
ATOM 4863  H HB2  . PHE A 1 34  ? 0.906   9.129   1.595   1.00 0.00 ? 34  PHE A HB2  3  
ATOM 4864  H HB3  . PHE A 1 34  ? 0.873   7.502   0.921   1.00 0.00 ? 34  PHE A HB3  3  
ATOM 4865  H HD1  . PHE A 1 34  ? -0.596  7.163   -1.183  1.00 0.00 ? 34  PHE A HD1  3  
ATOM 4866  H HD2  . PHE A 1 34  ? 0.755   10.956  0.194   1.00 0.00 ? 34  PHE A HD2  3  
ATOM 4867  H HE1  . PHE A 1 34  ? -0.949  8.100   -3.430  1.00 0.00 ? 34  PHE A HE1  3  
ATOM 4868  H HE2  . PHE A 1 34  ? 0.404   11.901  -2.050  1.00 0.00 ? 34  PHE A HE2  3  
ATOM 4869  H HZ   . PHE A 1 34  ? -0.448  10.472  -3.867  1.00 0.00 ? 34  PHE A HZ   3  
ATOM 4870  N N    . ALA A 1 35  ? -1.800  10.418  1.860   1.00 0.00 ? 35  ALA A N    3  
ATOM 4871  C CA   . ALA A 1 35  ? -2.723  11.512  1.585   1.00 0.00 ? 35  ALA A CA   3  
ATOM 4872  C C    . ALA A 1 35  ? -2.022  12.651  0.851   1.00 0.00 ? 35  ALA A C    3  
ATOM 4873  O O    . ALA A 1 35  ? -0.804  12.631  0.675   1.00 0.00 ? 35  ALA A O    3  
ATOM 4874  C CB   . ALA A 1 35  ? -3.342  12.018  2.879   1.00 0.00 ? 35  ALA A CB   3  
ATOM 4875  H H    . ALA A 1 35  ? -0.988  10.597  2.378   1.00 0.00 ? 35  ALA A H    3  
ATOM 4876  H HA   . ALA A 1 35  ? -3.517  11.130  0.959   1.00 0.00 ? 35  ALA A HA   3  
ATOM 4877  H HB1  . ALA A 1 35  ? -3.790  12.986  2.708   1.00 0.00 ? 35  ALA A HB1  3  
ATOM 4878  H HB2  . ALA A 1 35  ? -4.100  11.324  3.210   1.00 0.00 ? 35  ALA A HB2  3  
ATOM 4879  H HB3  . ALA A 1 35  ? -2.576  12.104  3.635   1.00 0.00 ? 35  ALA A HB3  3  
ATOM 4880  N N    . ASN A 1 36  ? -2.799  13.642  0.426   1.00 0.00 ? 36  ASN A N    3  
ATOM 4881  C CA   . ASN A 1 36  ? -2.252  14.789  -0.290  1.00 0.00 ? 36  ASN A CA   3  
ATOM 4882  C C    . ASN A 1 36  ? -1.906  15.918  0.676   1.00 0.00 ? 36  ASN A C    3  
ATOM 4883  O O    . ASN A 1 36  ? -1.142  16.824  0.340   1.00 0.00 ? 36  ASN A O    3  
ATOM 4884  C CB   . ASN A 1 36  ? -3.250  15.286  -1.338  1.00 0.00 ? 36  ASN A CB   3  
ATOM 4885  C CG   . ASN A 1 36  ? -3.240  14.437  -2.594  1.00 0.00 ? 36  ASN A CG   3  
ATOM 4886  O OD1  . ASN A 1 36  ? -2.475  13.478  -2.703  1.00 0.00 ? 36  ASN A OD1  3  
ATOM 4887  N ND2  . ASN A 1 36  ? -4.092  14.786  -3.551  1.00 0.00 ? 36  ASN A ND2  3  
ATOM 4888  H H    . ASN A 1 36  ? -3.763  13.601  0.597   1.00 0.00 ? 36  ASN A H    3  
ATOM 4889  H HA   . ASN A 1 36  ? -1.349  14.468  -0.789  1.00 0.00 ? 36  ASN A HA   3  
ATOM 4890  H HB2  . ASN A 1 36  ? -4.245  15.262  -0.918  1.00 0.00 ? 36  ASN A HB2  3  
ATOM 4891  H HB3  . ASN A 1 36  ? -3.003  16.301  -1.609  1.00 0.00 ? 36  ASN A HB3  3  
ATOM 4892  H HD21 . ASN A 1 36  ? -4.671  15.562  -3.395  1.00 0.00 ? 36  ASN A HD21 3  
ATOM 4893  H HD22 . ASN A 1 36  ? -4.107  14.254  -4.373  1.00 0.00 ? 36  ASN A HD22 3  
ATOM 4894  N N    . TRP A 1 37  ? -2.472  15.857  1.875   1.00 0.00 ? 37  TRP A N    3  
ATOM 4895  C CA   . TRP A 1 37  ? -2.223  16.875  2.890   1.00 0.00 ? 37  TRP A CA   3  
ATOM 4896  C C    . TRP A 1 37  ? -1.317  16.335  3.991   1.00 0.00 ? 37  TRP A C    3  
ATOM 4897  O O    . TRP A 1 37  ? -1.059  17.015  4.984   1.00 0.00 ? 37  TRP A O    3  
ATOM 4898  C CB   . TRP A 1 37  ? -3.544  17.358  3.491   1.00 0.00 ? 37  TRP A CB   3  
ATOM 4899  C CG   . TRP A 1 37  ? -4.615  16.309  3.494   1.00 0.00 ? 37  TRP A CG   3  
ATOM 4900  C CD1  . TRP A 1 37  ? -5.750  16.295  2.735   1.00 0.00 ? 37  TRP A CD1  3  
ATOM 4901  C CD2  . TRP A 1 37  ? -4.650  15.124  4.296   1.00 0.00 ? 37  TRP A CD2  3  
ATOM 4902  N NE1  . TRP A 1 37  ? -6.489  15.172  3.017   1.00 0.00 ? 37  TRP A NE1  3  
ATOM 4903  C CE2  . TRP A 1 37  ? -5.836  14.436  3.971   1.00 0.00 ? 37  TRP A CE2  3  
ATOM 4904  C CE3  . TRP A 1 37  ? -3.796  14.575  5.256   1.00 0.00 ? 37  TRP A CE3  3  
ATOM 4905  C CZ2  . TRP A 1 37  ? -6.186  13.231  4.572   1.00 0.00 ? 37  TRP A CZ2  3  
ATOM 4906  C CZ3  . TRP A 1 37  ? -4.145  13.378  5.852   1.00 0.00 ? 37  TRP A CZ3  3  
ATOM 4907  C CH2  . TRP A 1 37  ? -5.331  12.716  5.508   1.00 0.00 ? 37  TRP A CH2  3  
ATOM 4908  H H    . TRP A 1 37  ? -3.072  15.110  2.084   1.00 0.00 ? 37  TRP A H    3  
ATOM 4909  H HA   . TRP A 1 37  ? -1.731  17.707  2.410   1.00 0.00 ? 37  TRP A HA   3  
ATOM 4910  H HB2  . TRP A 1 37  ? -3.376  17.666  4.513   1.00 0.00 ? 37  TRP A HB2  3  
ATOM 4911  H HB3  . TRP A 1 37  ? -3.904  18.201  2.920   1.00 0.00 ? 37  TRP A HB3  3  
ATOM 4912  H HD1  . TRP A 1 37  ? -6.015  17.062  2.024   1.00 0.00 ? 37  TRP A HD1  3  
ATOM 4913  H HE1  . TRP A 1 37  ? -7.345  14.935  2.601   1.00 0.00 ? 37  TRP A HE1  3  
ATOM 4914  H HE3  . TRP A 1 37  ? -2.877  15.070  5.534   1.00 0.00 ? 37  TRP A HE3  3  
ATOM 4915  H HZ2  . TRP A 1 37  ? -7.097  12.708  4.318   1.00 0.00 ? 37  TRP A HZ2  3  
ATOM 4916  H HZ3  . TRP A 1 37  ? -3.497  12.939  6.596   1.00 0.00 ? 37  TRP A HZ3  3  
ATOM 4917  H HH2  . TRP A 1 37  ? -5.563  11.784  6.000   1.00 0.00 ? 37  TRP A HH2  3  
ATOM 4918  N N    . SER A 1 38  ? -0.836  15.110  3.808   1.00 0.00 ? 38  SER A N    3  
ATOM 4919  C CA   . SER A 1 38  ? 0.040   14.478  4.788   1.00 0.00 ? 38  SER A CA   3  
ATOM 4920  C C    . SER A 1 38  ? 1.504   14.624  4.383   1.00 0.00 ? 38  SER A C    3  
ATOM 4921  O O    . SER A 1 38  ? 2.110   13.689  3.861   1.00 0.00 ? 38  SER A O    3  
ATOM 4922  C CB   . SER A 1 38  ? -0.314  12.998  4.941   1.00 0.00 ? 38  SER A CB   3  
ATOM 4923  O OG   . SER A 1 38  ? -0.129  12.301  3.720   1.00 0.00 ? 38  SER A OG   3  
ATOM 4924  H H    . SER A 1 38  ? -1.078  14.618  2.995   1.00 0.00 ? 38  SER A H    3  
ATOM 4925  H HA   . SER A 1 38  ? -0.110  14.975  5.735   1.00 0.00 ? 38  SER A HA   3  
ATOM 4926  H HB2  . SER A 1 38  ? 0.319   12.554  5.694   1.00 0.00 ? 38  SER A HB2  3  
ATOM 4927  H HB3  . SER A 1 38  ? -1.348  12.907  5.241   1.00 0.00 ? 38  SER A HB3  3  
ATOM 4928  H HG   . SER A 1 38  ? 0.249   11.437  3.899   1.00 0.00 ? 38  SER A HG   3  
ATOM 4929  N N    . ASN A 1 39  ? 2.064   15.804  4.628   1.00 0.00 ? 39  ASN A N    3  
ATOM 4930  C CA   . ASN A 1 39  ? 3.457   16.073  4.288   1.00 0.00 ? 39  ASN A CA   3  
ATOM 4931  C C    . ASN A 1 39  ? 4.358   14.928  4.739   1.00 0.00 ? 39  ASN A C    3  
ATOM 4932  O O    . ASN A 1 39  ? 5.317   14.572  4.053   1.00 0.00 ? 39  ASN A O    3  
ATOM 4933  C CB   . ASN A 1 39  ? 3.916   17.383  4.932   1.00 0.00 ? 39  ASN A CB   3  
ATOM 4934  C CG   . ASN A 1 39  ? 3.339   18.602  4.238   1.00 0.00 ? 39  ASN A CG   3  
ATOM 4935  O OD1  . ASN A 1 39  ? 3.207   18.629  3.015   1.00 0.00 ? 39  ASN A OD1  3  
ATOM 4936  N ND2  . ASN A 1 39  ? 2.992   19.618  5.020   1.00 0.00 ? 39  ASN A ND2  3  
ATOM 4937  H H    . ASN A 1 39  ? 1.529   16.510  5.046   1.00 0.00 ? 39  ASN A H    3  
ATOM 4938  H HA   . ASN A 1 39  ? 3.524   16.167  3.215   1.00 0.00 ? 39  ASN A HA   3  
ATOM 4939  H HB2  . ASN A 1 39  ? 3.602   17.398  5.965   1.00 0.00 ? 39  ASN A HB2  3  
ATOM 4940  H HB3  . ASN A 1 39  ? 4.993   17.442  4.887   1.00 0.00 ? 39  ASN A HB3  3  
ATOM 4941  H HD21 . ASN A 1 39  ? 3.125   19.526  5.986   1.00 0.00 ? 39  ASN A HD21 3  
ATOM 4942  H HD22 . ASN A 1 39  ? 2.615   20.418  4.598   1.00 0.00 ? 39  ASN A HD22 3  
ATOM 4943  N N    . ASP A 1 40  ? 4.044   14.356  5.896   1.00 0.00 ? 40  ASP A N    3  
ATOM 4944  C CA   . ASP A 1 40  ? 4.824   13.249  6.438   1.00 0.00 ? 40  ASP A CA   3  
ATOM 4945  C C    . ASP A 1 40  ? 5.200   12.259  5.340   1.00 0.00 ? 40  ASP A C    3  
ATOM 4946  O O    . ASP A 1 40  ? 6.250   11.619  5.401   1.00 0.00 ? 40  ASP A O    3  
ATOM 4947  C CB   . ASP A 1 40  ? 4.038   12.535  7.539   1.00 0.00 ? 40  ASP A CB   3  
ATOM 4948  C CG   . ASP A 1 40  ? 2.579   12.342  7.177   1.00 0.00 ? 40  ASP A CG   3  
ATOM 4949  O OD1  . ASP A 1 40  ? 2.284   11.443  6.361   1.00 0.00 ? 40  ASP A OD1  3  
ATOM 4950  O OD2  . ASP A 1 40  ? 1.732   13.089  7.709   1.00 0.00 ? 40  ASP A OD2  3  
ATOM 4951  H H    . ASP A 1 40  ? 3.268   14.684  6.396   1.00 0.00 ? 40  ASP A H    3  
ATOM 4952  H HA   . ASP A 1 40  ? 5.729   13.658  6.862   1.00 0.00 ? 40  ASP A HA   3  
ATOM 4953  H HB2  . ASP A 1 40  ? 4.478   11.564  7.714   1.00 0.00 ? 40  ASP A HB2  3  
ATOM 4954  H HB3  . ASP A 1 40  ? 4.092   13.118  8.447   1.00 0.00 ? 40  ASP A HB3  3  
ATOM 4955  N N    . CYS A 1 41  ? 4.335   12.138  4.339   1.00 0.00 ? 41  CYS A N    3  
ATOM 4956  C CA   . CYS A 1 41  ? 4.575   11.224  3.228   1.00 0.00 ? 41  CYS A CA   3  
ATOM 4957  C C    . CYS A 1 41  ? 5.857   11.593  2.488   1.00 0.00 ? 41  CYS A C    3  
ATOM 4958  O O    . CYS A 1 41  ? 6.651   10.723  2.133   1.00 0.00 ? 41  CYS A O    3  
ATOM 4959  C CB   . CYS A 1 41  ? 3.390   11.241  2.261   1.00 0.00 ? 41  CYS A CB   3  
ATOM 4960  S SG   . CYS A 1 41  ? 3.482   12.538  1.005   1.00 0.00 ? 41  CYS A SG   3  
ATOM 4961  H H    . CYS A 1 41  ? 3.515   12.675  4.347   1.00 0.00 ? 41  CYS A H    3  
ATOM 4962  H HA   . CYS A 1 41  ? 4.683   10.230  3.635   1.00 0.00 ? 41  CYS A HA   3  
ATOM 4963  H HB2  . CYS A 1 41  ? 3.340   10.292  1.749   1.00 0.00 ? 41  CYS A HB2  3  
ATOM 4964  H HB3  . CYS A 1 41  ? 2.480   11.389  2.823   1.00 0.00 ? 41  CYS A HB3  3  
ATOM 4965  H HG   . CYS A 1 41  ? 2.897   13.622  1.493   1.00 0.00 ? 41  CYS A HG   3  
ATOM 4966  N N    . GLN A 1 42  ? 6.049   12.888  2.257   1.00 0.00 ? 42  GLN A N    3  
ATOM 4967  C CA   . GLN A 1 42  ? 7.233   13.371  1.557   1.00 0.00 ? 42  GLN A CA   3  
ATOM 4968  C C    . GLN A 1 42  ? 8.499   12.742  2.129   1.00 0.00 ? 42  GLN A C    3  
ATOM 4969  O O    . GLN A 1 42  ? 9.510   12.621  1.438   1.00 0.00 ? 42  GLN A O    3  
ATOM 4970  C CB   . GLN A 1 42  ? 7.320   14.896  1.650   1.00 0.00 ? 42  GLN A CB   3  
ATOM 4971  C CG   . GLN A 1 42  ? 8.087   15.388  2.867   1.00 0.00 ? 42  GLN A CG   3  
ATOM 4972  C CD   . GLN A 1 42  ? 8.312   16.887  2.848   1.00 0.00 ? 42  GLN A CD   3  
ATOM 4973  O OE1  . GLN A 1 42  ? 9.238   17.379  2.204   1.00 0.00 ? 42  GLN A OE1  3  
ATOM 4974  N NE2  . GLN A 1 42  ? 7.463   17.622  3.557   1.00 0.00 ? 42  GLN A NE2  3  
ATOM 4975  H H    . GLN A 1 42  ? 5.379   13.533  2.565   1.00 0.00 ? 42  GLN A H    3  
ATOM 4976  H HA   . GLN A 1 42  ? 7.142   13.088  0.519   1.00 0.00 ? 42  GLN A HA   3  
ATOM 4977  H HB2  . GLN A 1 42  ? 7.811   15.271  0.765   1.00 0.00 ? 42  GLN A HB2  3  
ATOM 4978  H HB3  . GLN A 1 42  ? 6.319   15.299  1.696   1.00 0.00 ? 42  GLN A HB3  3  
ATOM 4979  H HG2  . GLN A 1 42  ? 7.528   15.135  3.756   1.00 0.00 ? 42  GLN A HG2  3  
ATOM 4980  H HG3  . GLN A 1 42  ? 9.047   14.894  2.895   1.00 0.00 ? 42  GLN A HG3  3  
ATOM 4981  H HE21 . GLN A 1 42  ? 6.749   17.161  4.046   1.00 0.00 ? 42  GLN A HE21 3  
ATOM 4982  H HE22 . GLN A 1 42  ? 7.585   18.594  3.563   1.00 0.00 ? 42  GLN A HE22 3  
ATOM 4983  N N    . SER A 1 43  ? 8.435   12.343  3.396   1.00 0.00 ? 43  SER A N    3  
ATOM 4984  C CA   . SER A 1 43  ? 9.578   11.730  4.062   1.00 0.00 ? 43  SER A CA   3  
ATOM 4985  C C    . SER A 1 43  ? 9.814   10.315  3.543   1.00 0.00 ? 43  SER A C    3  
ATOM 4986  O O    . SER A 1 43  ? 10.954  9.862   3.437   1.00 0.00 ? 43  SER A O    3  
ATOM 4987  C CB   . SER A 1 43  ? 9.357   11.700  5.576   1.00 0.00 ? 43  SER A CB   3  
ATOM 4988  O OG   . SER A 1 43  ? 10.558  11.391  6.260   1.00 0.00 ? 43  SER A OG   3  
ATOM 4989  H H    . SER A 1 43  ? 7.600   12.467  3.894   1.00 0.00 ? 43  SER A H    3  
ATOM 4990  H HA   . SER A 1 43  ? 10.449  12.330  3.846   1.00 0.00 ? 43  SER A HA   3  
ATOM 4991  H HB2  . SER A 1 43  ? 9.007   12.667  5.905   1.00 0.00 ? 43  SER A HB2  3  
ATOM 4992  H HB3  . SER A 1 43  ? 8.617   10.950  5.814   1.00 0.00 ? 43  SER A HB3  3  
ATOM 4993  H HG   . SER A 1 43  ? 10.401  11.411  7.207   1.00 0.00 ? 43  SER A HG   3  
ATOM 4994  N N    . PHE A 1 44  ? 8.727   9.620   3.222   1.00 0.00 ? 44  PHE A N    3  
ATOM 4995  C CA   . PHE A 1 44  ? 8.814   8.255   2.716   1.00 0.00 ? 44  PHE A CA   3  
ATOM 4996  C C    . PHE A 1 44  ? 8.757   8.237   1.191   1.00 0.00 ? 44  PHE A C    3  
ATOM 4997  O O    . PHE A 1 44  ? 8.815   7.176   0.570   1.00 0.00 ? 44  PHE A O    3  
ATOM 4998  C CB   . PHE A 1 44  ? 7.682   7.402   3.291   1.00 0.00 ? 44  PHE A CB   3  
ATOM 4999  C CG   . PHE A 1 44  ? 7.963   5.927   3.252   1.00 0.00 ? 44  PHE A CG   3  
ATOM 5000  C CD1  . PHE A 1 44  ? 8.925   5.370   4.079   1.00 0.00 ? 44  PHE A CD1  3  
ATOM 5001  C CD2  . PHE A 1 44  ? 7.267   5.098   2.387   1.00 0.00 ? 44  PHE A CD2  3  
ATOM 5002  C CE1  . PHE A 1 44  ? 9.186   4.013   4.045   1.00 0.00 ? 44  PHE A CE1  3  
ATOM 5003  C CE2  . PHE A 1 44  ? 7.523   3.740   2.349   1.00 0.00 ? 44  PHE A CE2  3  
ATOM 5004  C CZ   . PHE A 1 44  ? 8.484   3.197   3.179   1.00 0.00 ? 44  PHE A CZ   3  
ATOM 5005  H H    . PHE A 1 44  ? 7.846   10.035  3.329   1.00 0.00 ? 44  PHE A H    3  
ATOM 5006  H HA   . PHE A 1 44  ? 9.760   7.844   3.033   1.00 0.00 ? 44  PHE A HA   3  
ATOM 5007  H HB2  . PHE A 1 44  ? 7.518   7.681   4.321   1.00 0.00 ? 44  PHE A HB2  3  
ATOM 5008  H HB3  . PHE A 1 44  ? 6.781   7.584   2.725   1.00 0.00 ? 44  PHE A HB3  3  
ATOM 5009  H HD1  . PHE A 1 44  ? 9.474   6.006   4.758   1.00 0.00 ? 44  PHE A HD1  3  
ATOM 5010  H HD2  . PHE A 1 44  ? 6.514   5.522   1.737   1.00 0.00 ? 44  PHE A HD2  3  
ATOM 5011  H HE1  . PHE A 1 44  ? 9.937   3.591   4.695   1.00 0.00 ? 44  PHE A HE1  3  
ATOM 5012  H HE2  . PHE A 1 44  ? 6.972   3.106   1.671   1.00 0.00 ? 44  PHE A HE2  3  
ATOM 5013  H HZ   . PHE A 1 44  ? 8.686   2.137   3.150   1.00 0.00 ? 44  PHE A HZ   3  
ATOM 5014  N N    . ALA A 1 45  ? 8.641   9.419   0.595   1.00 0.00 ? 45  ALA A N    3  
ATOM 5015  C CA   . ALA A 1 45  ? 8.577   9.539   -0.857  1.00 0.00 ? 45  ALA A CA   3  
ATOM 5016  C C    . ALA A 1 45  ? 9.705   8.759   -1.523  1.00 0.00 ? 45  ALA A C    3  
ATOM 5017  O O    . ALA A 1 45  ? 9.478   7.805   -2.267  1.00 0.00 ? 45  ALA A O    3  
ATOM 5018  C CB   . ALA A 1 45  ? 8.630   11.003  -1.267  1.00 0.00 ? 45  ALA A CB   3  
ATOM 5019  H H    . ALA A 1 45  ? 8.600   10.229  1.144   1.00 0.00 ? 45  ALA A H    3  
ATOM 5020  H HA   . ALA A 1 45  ? 7.630   9.133   -1.184  1.00 0.00 ? 45  ALA A HA   3  
ATOM 5021  H HB1  . ALA A 1 45  ? 9.391   11.136  -2.023  1.00 0.00 ? 45  ALA A HB1  3  
ATOM 5022  H HB2  . ALA A 1 45  ? 7.671   11.300  -1.665  1.00 0.00 ? 45  ALA A HB2  3  
ATOM 5023  H HB3  . ALA A 1 45  ? 8.868   11.610  -0.407  1.00 0.00 ? 45  ALA A HB3  3  
ATOM 5024  N N    . PRO A 1 46  ? 10.952  9.173   -1.251  1.00 0.00 ? 46  PRO A N    3  
ATOM 5025  C CA   . PRO A 1 46  ? 12.141  8.527   -1.815  1.00 0.00 ? 46  PRO A CA   3  
ATOM 5026  C C    . PRO A 1 46  ? 12.372  7.134   -1.238  1.00 0.00 ? 46  PRO A C    3  
ATOM 5027  O O    . PRO A 1 46  ? 12.746  6.208   -1.958  1.00 0.00 ? 46  PRO A O    3  
ATOM 5028  C CB   . PRO A 1 46  ? 13.280  9.468   -1.414  1.00 0.00 ? 46  PRO A CB   3  
ATOM 5029  C CG   . PRO A 1 46  ? 12.784  10.165  -0.195  1.00 0.00 ? 46  PRO A CG   3  
ATOM 5030  C CD   . PRO A 1 46  ? 11.297  10.303  -0.373  1.00 0.00 ? 46  PRO A CD   3  
ATOM 5031  H HA   . PRO A 1 46  ? 12.086  8.464   -2.892  1.00 0.00 ? 46  PRO A HA   3  
ATOM 5032  H HB2  . PRO A 1 46  ? 14.170  8.891   -1.206  1.00 0.00 ? 46  PRO A HB2  3  
ATOM 5033  H HB3  . PRO A 1 46  ? 13.475  10.165  -2.215  1.00 0.00 ? 46  PRO A HB3  3  
ATOM 5034  H HG2  . PRO A 1 46  ? 13.003  9.574   0.681   1.00 0.00 ? 46  PRO A HG2  3  
ATOM 5035  H HG3  . PRO A 1 46  ? 13.244  11.139  -0.117  1.00 0.00 ? 46  PRO A HG3  3  
ATOM 5036  H HD2  . PRO A 1 46  ? 10.794  10.220  0.579   1.00 0.00 ? 46  PRO A HD2  3  
ATOM 5037  H HD3  . PRO A 1 46  ? 11.060  11.245  -0.846  1.00 0.00 ? 46  PRO A HD3  3  
ATOM 5038  N N    . ILE A 1 47  ? 12.148  6.994   0.064   1.00 0.00 ? 47  ILE A N    3  
ATOM 5039  C CA   . ILE A 1 47  ? 12.330  5.713   0.737   1.00 0.00 ? 47  ILE A CA   3  
ATOM 5040  C C    . ILE A 1 47  ? 11.447  4.636   0.116   1.00 0.00 ? 47  ILE A C    3  
ATOM 5041  O O    . ILE A 1 47  ? 11.787  3.453   0.136   1.00 0.00 ? 47  ILE A O    3  
ATOM 5042  C CB   . ILE A 1 47  ? 12.015  5.817   2.240   1.00 0.00 ? 47  ILE A CB   3  
ATOM 5043  C CG1  . ILE A 1 47  ? 13.027  6.731   2.934   1.00 0.00 ? 47  ILE A CG1  3  
ATOM 5044  C CG2  . ILE A 1 47  ? 12.016  4.436   2.878   1.00 0.00 ? 47  ILE A CG2  3  
ATOM 5045  C CD1  . ILE A 1 47  ? 12.710  6.987   4.391   1.00 0.00 ? 47  ILE A CD1  3  
ATOM 5046  H H    . ILE A 1 47  ? 11.851  7.769   0.585   1.00 0.00 ? 47  ILE A H    3  
ATOM 5047  H HA   . ILE A 1 47  ? 13.366  5.424   0.625   1.00 0.00 ? 47  ILE A HA   3  
ATOM 5048  H HB   . ILE A 1 47  ? 11.027  6.237   2.350   1.00 0.00 ? 47  ILE A HB   3  
ATOM 5049  H HG12 . ILE A 1 47  ? 14.005  6.280   2.882   1.00 0.00 ? 47  ILE A HG12 3  
ATOM 5050  H HG13 . ILE A 1 47  ? 13.047  7.684   2.426   1.00 0.00 ? 47  ILE A HG13 3  
ATOM 5051  H HG21 . ILE A 1 47  ? 12.066  4.536   3.953   1.00 0.00 ? 47  ILE A HG21 3  
ATOM 5052  H HG22 . ILE A 1 47  ? 11.110  3.914   2.608   1.00 0.00 ? 47  ILE A HG22 3  
ATOM 5053  H HG23 . ILE A 1 47  ? 12.871  3.878   2.528   1.00 0.00 ? 47  ILE A HG23 3  
ATOM 5054  H HD11 . ILE A 1 47  ? 13.432  6.476   5.012   1.00 0.00 ? 47  ILE A HD11 3  
ATOM 5055  H HD12 . ILE A 1 47  ? 12.751  8.047   4.588   1.00 0.00 ? 47  ILE A HD12 3  
ATOM 5056  H HD13 . ILE A 1 47  ? 11.720  6.618   4.614   1.00 0.00 ? 47  ILE A HD13 3  
ATOM 5057  N N    . TYR A 1 48  ? 10.314  5.053   -0.435  1.00 0.00 ? 48  TYR A N    3  
ATOM 5058  C CA   . TYR A 1 48  ? 9.381   4.124   -1.061  1.00 0.00 ? 48  TYR A CA   3  
ATOM 5059  C C    . TYR A 1 48  ? 9.817   3.791   -2.485  1.00 0.00 ? 48  TYR A C    3  
ATOM 5060  O O    . TYR A 1 48  ? 9.652   2.663   -2.948  1.00 0.00 ? 48  TYR A O    3  
ATOM 5061  C CB   . TYR A 1 48  ? 7.970   4.715   -1.073  1.00 0.00 ? 48  TYR A CB   3  
ATOM 5062  C CG   . TYR A 1 48  ? 6.889   3.697   -1.358  1.00 0.00 ? 48  TYR A CG   3  
ATOM 5063  C CD1  . TYR A 1 48  ? 6.891   2.458   -0.728  1.00 0.00 ? 48  TYR A CD1  3  
ATOM 5064  C CD2  . TYR A 1 48  ? 5.867   3.972   -2.258  1.00 0.00 ? 48  TYR A CD2  3  
ATOM 5065  C CE1  . TYR A 1 48  ? 5.906   1.524   -0.985  1.00 0.00 ? 48  TYR A CE1  3  
ATOM 5066  C CE2  . TYR A 1 48  ? 4.877   3.045   -2.520  1.00 0.00 ? 48  TYR A CE2  3  
ATOM 5067  C CZ   . TYR A 1 48  ? 4.901   1.823   -1.882  1.00 0.00 ? 48  TYR A CZ   3  
ATOM 5068  O OH   . TYR A 1 48  ? 3.918   0.896   -2.142  1.00 0.00 ? 48  TYR A OH   3  
ATOM 5069  H H    . TYR A 1 48  ? 10.097  6.009   -0.420  1.00 0.00 ? 48  TYR A H    3  
ATOM 5070  H HA   . TYR A 1 48  ? 9.375   3.215   -0.477  1.00 0.00 ? 48  TYR A HA   3  
ATOM 5071  H HB2  . TYR A 1 48  ? 7.764   5.156   -0.110  1.00 0.00 ? 48  TYR A HB2  3  
ATOM 5072  H HB3  . TYR A 1 48  ? 7.914   5.480   -1.833  1.00 0.00 ? 48  TYR A HB3  3  
ATOM 5073  H HD1  . TYR A 1 48  ? 7.679   2.227   -0.026  1.00 0.00 ? 48  TYR A HD1  3  
ATOM 5074  H HD2  . TYR A 1 48  ? 5.852   4.931   -2.757  1.00 0.00 ? 48  TYR A HD2  3  
ATOM 5075  H HE1  . TYR A 1 48  ? 5.924   0.567   -0.485  1.00 0.00 ? 48  TYR A HE1  3  
ATOM 5076  H HE2  . TYR A 1 48  ? 4.091   3.278   -3.223  1.00 0.00 ? 48  TYR A HE2  3  
ATOM 5077  H HH   . TYR A 1 48  ? 3.695   0.919   -3.076  1.00 0.00 ? 48  TYR A HH   3  
ATOM 5078  N N    . ALA A 1 49  ? 10.374  4.782   -3.173  1.00 0.00 ? 49  ALA A N    3  
ATOM 5079  C CA   . ALA A 1 49  ? 10.836  4.595   -4.543  1.00 0.00 ? 49  ALA A CA   3  
ATOM 5080  C C    . ALA A 1 49  ? 12.036  3.655   -4.594  1.00 0.00 ? 49  ALA A C    3  
ATOM 5081  O O    . ALA A 1 49  ? 12.122  2.789   -5.464  1.00 0.00 ? 49  ALA A O    3  
ATOM 5082  C CB   . ALA A 1 49  ? 11.187  5.936   -5.169  1.00 0.00 ? 49  ALA A CB   3  
ATOM 5083  H H    . ALA A 1 49  ? 10.478  5.659   -2.749  1.00 0.00 ? 49  ALA A H    3  
ATOM 5084  H HA   . ALA A 1 49  ? 10.027  4.160   -5.112  1.00 0.00 ? 49  ALA A HA   3  
ATOM 5085  H HB1  . ALA A 1 49  ? 11.848  6.479   -4.508  1.00 0.00 ? 49  ALA A HB1  3  
ATOM 5086  H HB2  . ALA A 1 49  ? 11.679  5.774   -6.116  1.00 0.00 ? 49  ALA A HB2  3  
ATOM 5087  H HB3  . ALA A 1 49  ? 10.285  6.508   -5.324  1.00 0.00 ? 49  ALA A HB3  3  
ATOM 5088  N N    . ASP A 1 50  ? 12.961  3.833   -3.657  1.00 0.00 ? 50  ASP A N    3  
ATOM 5089  C CA   . ASP A 1 50  ? 14.157  3.000   -3.594  1.00 0.00 ? 50  ASP A CA   3  
ATOM 5090  C C    . ASP A 1 50  ? 13.792  1.545   -3.320  1.00 0.00 ? 50  ASP A C    3  
ATOM 5091  O O    . ASP A 1 50  ? 14.236  0.638   -4.026  1.00 0.00 ? 50  ASP A O    3  
ATOM 5092  C CB   . ASP A 1 50  ? 15.106  3.514   -2.511  1.00 0.00 ? 50  ASP A CB   3  
ATOM 5093  C CG   . ASP A 1 50  ? 15.187  5.027   -2.482  1.00 0.00 ? 50  ASP A CG   3  
ATOM 5094  O OD1  . ASP A 1 50  ? 15.324  5.636   -3.564  1.00 0.00 ? 50  ASP A OD1  3  
ATOM 5095  O OD2  . ASP A 1 50  ? 15.112  5.604   -1.377  1.00 0.00 ? 50  ASP A OD2  3  
ATOM 5096  H H    . ASP A 1 50  ? 12.836  4.541   -2.990  1.00 0.00 ? 50  ASP A H    3  
ATOM 5097  H HA   . ASP A 1 50  ? 14.652  3.060   -4.552  1.00 0.00 ? 50  ASP A HA   3  
ATOM 5098  H HB2  . ASP A 1 50  ? 14.760  3.172   -1.546  1.00 0.00 ? 50  ASP A HB2  3  
ATOM 5099  H HB3  . ASP A 1 50  ? 16.096  3.122   -2.693  1.00 0.00 ? 50  ASP A HB3  3  
ATOM 5100  N N    . LEU A 1 51  ? 12.981  1.328   -2.290  1.00 0.00 ? 51  LEU A N    3  
ATOM 5101  C CA   . LEU A 1 51  ? 12.557  -0.018  -1.921  1.00 0.00 ? 51  LEU A CA   3  
ATOM 5102  C C    . LEU A 1 51  ? 11.892  -0.722  -3.100  1.00 0.00 ? 51  LEU A C    3  
ATOM 5103  O O    . LEU A 1 51  ? 12.241  -1.853  -3.438  1.00 0.00 ? 51  LEU A O    3  
ATOM 5104  C CB   . LEU A 1 51  ? 11.592  0.037   -0.736  1.00 0.00 ? 51  LEU A CB   3  
ATOM 5105  C CG   . LEU A 1 51  ? 12.234  0.132   0.649   1.00 0.00 ? 51  LEU A CG   3  
ATOM 5106  C CD1  . LEU A 1 51  ? 11.262  0.740   1.648   1.00 0.00 ? 51  LEU A CD1  3  
ATOM 5107  C CD2  . LEU A 1 51  ? 12.696  -1.240  1.118   1.00 0.00 ? 51  LEU A CD2  3  
ATOM 5108  H H    . LEU A 1 51  ? 12.660  2.089   -1.765  1.00 0.00 ? 51  LEU A H    3  
ATOM 5109  H HA   . LEU A 1 51  ? 13.436  -0.576  -1.634  1.00 0.00 ? 51  LEU A HA   3  
ATOM 5110  H HB2  . LEU A 1 51  ? 10.958  0.900   -0.866  1.00 0.00 ? 51  LEU A HB2  3  
ATOM 5111  H HB3  . LEU A 1 51  ? 10.987  -0.859  -0.760  1.00 0.00 ? 51  LEU A HB3  3  
ATOM 5112  H HG   . LEU A 1 51  ? 13.101  0.777   0.593   1.00 0.00 ? 51  LEU A HG   3  
ATOM 5113  H HD11 . LEU A 1 51  ? 10.624  -0.035  2.045   1.00 0.00 ? 51  LEU A HD11 3  
ATOM 5114  H HD12 . LEU A 1 51  ? 10.658  1.486   1.154   1.00 0.00 ? 51  LEU A HD12 3  
ATOM 5115  H HD13 . LEU A 1 51  ? 11.815  1.200   2.453   1.00 0.00 ? 51  LEU A HD13 3  
ATOM 5116  H HD21 . LEU A 1 51  ? 11.891  -1.950  0.999   1.00 0.00 ? 51  LEU A HD21 3  
ATOM 5117  H HD22 . LEU A 1 51  ? 12.979  -1.188  2.159   1.00 0.00 ? 51  LEU A HD22 3  
ATOM 5118  H HD23 . LEU A 1 51  ? 13.545  -1.555  0.529   1.00 0.00 ? 51  LEU A HD23 3  
ATOM 5119  N N    . SER A 1 52  ? 10.933  -0.044  -3.723  1.00 0.00 ? 52  SER A N    3  
ATOM 5120  C CA   . SER A 1 52  ? 10.218  -0.605  -4.864  1.00 0.00 ? 52  SER A CA   3  
ATOM 5121  C C    . SER A 1 52  ? 11.194  -1.101  -5.926  1.00 0.00 ? 52  SER A C    3  
ATOM 5122  O O    . SER A 1 52  ? 11.194  -2.280  -6.284  1.00 0.00 ? 52  SER A O    3  
ATOM 5123  C CB   . SER A 1 52  ? 9.278   0.441   -5.467  1.00 0.00 ? 52  SER A CB   3  
ATOM 5124  O OG   . SER A 1 52  ? 9.994   1.590   -5.884  1.00 0.00 ? 52  SER A OG   3  
ATOM 5125  H H    . SER A 1 52  ? 10.700  0.854   -3.406  1.00 0.00 ? 52  SER A H    3  
ATOM 5126  H HA   . SER A 1 52  ? 9.634   -1.441  -4.510  1.00 0.00 ? 52  SER A HA   3  
ATOM 5127  H HB2  . SER A 1 52  ? 8.773   0.016   -6.322  1.00 0.00 ? 52  SER A HB2  3  
ATOM 5128  H HB3  . SER A 1 52  ? 8.548   0.734   -4.727  1.00 0.00 ? 52  SER A HB3  3  
ATOM 5129  H HG   . SER A 1 52  ? 9.474   2.075   -6.529  1.00 0.00 ? 52  SER A HG   3  
ATOM 5130  N N    . LEU A 1 53  ? 12.026  -0.194  -6.427  1.00 0.00 ? 53  LEU A N    3  
ATOM 5131  C CA   . LEU A 1 53  ? 13.008  -0.538  -7.449  1.00 0.00 ? 53  LEU A CA   3  
ATOM 5132  C C    . LEU A 1 53  ? 13.677  -1.872  -7.134  1.00 0.00 ? 53  LEU A C    3  
ATOM 5133  O O    . LEU A 1 53  ? 14.027  -2.632  -8.037  1.00 0.00 ? 53  LEU A O    3  
ATOM 5134  C CB   . LEU A 1 53  ? 14.065  0.562   -7.559  1.00 0.00 ? 53  LEU A CB   3  
ATOM 5135  C CG   . LEU A 1 53  ? 13.656  1.809   -8.345  1.00 0.00 ? 53  LEU A CG   3  
ATOM 5136  C CD1  . LEU A 1 53  ? 14.410  3.029   -7.839  1.00 0.00 ? 53  LEU A CD1  3  
ATOM 5137  C CD2  . LEU A 1 53  ? 13.902  1.606   -9.833  1.00 0.00 ? 53  LEU A CD2  3  
ATOM 5138  H H    . LEU A 1 53  ? 11.978  0.729   -6.102  1.00 0.00 ? 53  LEU A H    3  
ATOM 5139  H HA   . LEU A 1 53  ? 12.489  -0.623  -8.392  1.00 0.00 ? 53  LEU A HA   3  
ATOM 5140  H HB2  . LEU A 1 53  ? 14.325  0.873   -6.559  1.00 0.00 ? 53  LEU A HB2  3  
ATOM 5141  H HB3  . LEU A 1 53  ? 14.935  0.137   -8.040  1.00 0.00 ? 53  LEU A HB3  3  
ATOM 5142  H HG   . LEU A 1 53  ? 12.599  1.987   -8.201  1.00 0.00 ? 53  LEU A HG   3  
ATOM 5143  H HD11 . LEU A 1 53  ? 15.292  2.711   -7.304  1.00 0.00 ? 53  LEU A HD11 3  
ATOM 5144  H HD12 . LEU A 1 53  ? 13.773  3.598   -7.178  1.00 0.00 ? 53  LEU A HD12 3  
ATOM 5145  H HD13 . LEU A 1 53  ? 14.700  3.646   -8.678  1.00 0.00 ? 53  LEU A HD13 3  
ATOM 5146  H HD21 . LEU A 1 53  ? 13.173  2.168   -10.397 1.00 0.00 ? 53  LEU A HD21 3  
ATOM 5147  H HD22 . LEU A 1 53  ? 13.813  0.556   -10.072 1.00 0.00 ? 53  LEU A HD22 3  
ATOM 5148  H HD23 . LEU A 1 53  ? 14.895  1.950   -10.083 1.00 0.00 ? 53  LEU A HD23 3  
ATOM 5149  N N    . LYS A 1 54  ? 13.851  -2.151  -5.846  1.00 0.00 ? 54  LYS A N    3  
ATOM 5150  C CA   . LYS A 1 54  ? 14.475  -3.395  -5.410  1.00 0.00 ? 54  LYS A CA   3  
ATOM 5151  C C    . LYS A 1 54  ? 13.528  -4.575  -5.603  1.00 0.00 ? 54  LYS A C    3  
ATOM 5152  O O    . LYS A 1 54  ? 13.873  -5.559  -6.257  1.00 0.00 ? 54  LYS A O    3  
ATOM 5153  C CB   . LYS A 1 54  ? 14.889  -3.294  -3.940  1.00 0.00 ? 54  LYS A CB   3  
ATOM 5154  C CG   . LYS A 1 54  ? 16.089  -4.154  -3.586  1.00 0.00 ? 54  LYS A CG   3  
ATOM 5155  C CD   . LYS A 1 54  ? 16.667  -3.776  -2.232  1.00 0.00 ? 54  LYS A CD   3  
ATOM 5156  C CE   . LYS A 1 54  ? 17.317  -4.969  -1.550  1.00 0.00 ? 54  LYS A CE   3  
ATOM 5157  N NZ   . LYS A 1 54  ? 18.689  -5.225  -2.069  1.00 0.00 ? 54  LYS A NZ   3  
ATOM 5158  H H    . LYS A 1 54  ? 13.551  -1.505  -5.173  1.00 0.00 ? 54  LYS A H    3  
ATOM 5159  H HA   . LYS A 1 54  ? 15.356  -3.553  -6.013  1.00 0.00 ? 54  LYS A HA   3  
ATOM 5160  H HB2  . LYS A 1 54  ? 15.131  -2.265  -3.717  1.00 0.00 ? 54  LYS A HB2  3  
ATOM 5161  H HB3  . LYS A 1 54  ? 14.057  -3.601  -3.323  1.00 0.00 ? 54  LYS A HB3  3  
ATOM 5162  H HG2  . LYS A 1 54  ? 15.783  -5.189  -3.558  1.00 0.00 ? 54  LYS A HG2  3  
ATOM 5163  H HG3  . LYS A 1 54  ? 16.851  -4.022  -4.341  1.00 0.00 ? 54  LYS A HG3  3  
ATOM 5164  H HD2  . LYS A 1 54  ? 17.410  -3.005  -2.370  1.00 0.00 ? 54  LYS A HD2  3  
ATOM 5165  H HD3  . LYS A 1 54  ? 15.871  -3.402  -1.603  1.00 0.00 ? 54  LYS A HD3  3  
ATOM 5166  H HE2  . LYS A 1 54  ? 17.373  -4.776  -0.490  1.00 0.00 ? 54  LYS A HE2  3  
ATOM 5167  H HE3  . LYS A 1 54  ? 16.707  -5.843  -1.725  1.00 0.00 ? 54  LYS A HE3  3  
ATOM 5168  H HZ1  . LYS A 1 54  ? 18.645  -5.829  -2.914  1.00 0.00 ? 54  LYS A HZ1  3  
ATOM 5169  H HZ2  . LYS A 1 54  ? 19.262  -5.703  -1.345  1.00 0.00 ? 54  LYS A HZ2  3  
ATOM 5170  H HZ3  . LYS A 1 54  ? 19.149  -4.327  -2.323  1.00 0.00 ? 54  LYS A HZ3  3  
ATOM 5171  N N    . TYR A 1 55  ? 12.335  -4.469  -5.030  1.00 0.00 ? 55  TYR A N    3  
ATOM 5172  C CA   . TYR A 1 55  ? 11.338  -5.529  -5.137  1.00 0.00 ? 55  TYR A CA   3  
ATOM 5173  C C    . TYR A 1 55  ? 10.544  -5.400  -6.434  1.00 0.00 ? 55  TYR A C    3  
ATOM 5174  O O    . TYR A 1 55  ? 9.553   -6.098  -6.639  1.00 0.00 ? 55  TYR A O    3  
ATOM 5175  C CB   . TYR A 1 55  ? 10.389  -5.489  -3.939  1.00 0.00 ? 55  TYR A CB   3  
ATOM 5176  C CG   . TYR A 1 55  ? 11.089  -5.638  -2.607  1.00 0.00 ? 55  TYR A CG   3  
ATOM 5177  C CD1  . TYR A 1 55  ? 11.314  -6.893  -2.054  1.00 0.00 ? 55  TYR A CD1  3  
ATOM 5178  C CD2  . TYR A 1 55  ? 11.525  -4.523  -1.900  1.00 0.00 ? 55  TYR A CD2  3  
ATOM 5179  C CE1  . TYR A 1 55  ? 11.953  -7.033  -0.837  1.00 0.00 ? 55  TYR A CE1  3  
ATOM 5180  C CE2  . TYR A 1 55  ? 12.166  -4.655  -0.684  1.00 0.00 ? 55  TYR A CE2  3  
ATOM 5181  C CZ   . TYR A 1 55  ? 12.377  -5.911  -0.156  1.00 0.00 ? 55  TYR A CZ   3  
ATOM 5182  O OH   . TYR A 1 55  ? 13.014  -6.046  1.056   1.00 0.00 ? 55  TYR A OH   3  
ATOM 5183  H H    . TYR A 1 55  ? 12.118  -3.661  -4.520  1.00 0.00 ? 55  TYR A H    3  
ATOM 5184  H HA   . TYR A 1 55  ? 11.860  -6.475  -5.140  1.00 0.00 ? 55  TYR A HA   3  
ATOM 5185  H HB2  . TYR A 1 55  ? 9.866   -4.546  -3.934  1.00 0.00 ? 55  TYR A HB2  3  
ATOM 5186  H HB3  . TYR A 1 55  ? 9.673   -6.293  -4.029  1.00 0.00 ? 55  TYR A HB3  3  
ATOM 5187  H HD1  . TYR A 1 55  ? 10.980  -7.769  -2.590  1.00 0.00 ? 55  TYR A HD1  3  
ATOM 5188  H HD2  . TYR A 1 55  ? 11.358  -3.540  -2.317  1.00 0.00 ? 55  TYR A HD2  3  
ATOM 5189  H HE1  . TYR A 1 55  ? 12.119  -8.017  -0.424  1.00 0.00 ? 55  TYR A HE1  3  
ATOM 5190  H HE2  . TYR A 1 55  ? 12.498  -3.776  -0.150  1.00 0.00 ? 55  TYR A HE2  3  
ATOM 5191  H HH   . TYR A 1 55  ? 13.942  -5.821  0.957   1.00 0.00 ? 55  TYR A HH   3  
ATOM 5192  N N    . ASN A 1 56  ? 10.990  -4.501  -7.306  1.00 0.00 ? 56  ASN A N    3  
ATOM 5193  C CA   . ASN A 1 56  ? 10.321  -4.280  -8.583  1.00 0.00 ? 56  ASN A CA   3  
ATOM 5194  C C    . ASN A 1 56  ? 10.655  -5.393  -9.572  1.00 0.00 ? 56  ASN A C    3  
ATOM 5195  O O    . ASN A 1 56  ? 11.649  -5.317  -10.295 1.00 0.00 ? 56  ASN A O    3  
ATOM 5196  C CB   . ASN A 1 56  ? 10.728  -2.925  -9.167  1.00 0.00 ? 56  ASN A CB   3  
ATOM 5197  C CG   . ASN A 1 56  ? 9.806   -1.805  -8.725  1.00 0.00 ? 56  ASN A CG   3  
ATOM 5198  O OD1  . ASN A 1 56  ? 10.261  -0.750  -8.282  1.00 0.00 ? 56  ASN A OD1  3  
ATOM 5199  N ND2  . ASN A 1 56  ? 8.503   -2.030  -8.843  1.00 0.00 ? 56  ASN A ND2  3  
ATOM 5200  H H    . ASN A 1 56  ? 11.786  -3.974  -7.085  1.00 0.00 ? 56  ASN A H    3  
ATOM 5201  H HA   . ASN A 1 56  ? 9.257   -4.279  -8.404  1.00 0.00 ? 56  ASN A HA   3  
ATOM 5202  H HB2  . ASN A 1 56  ? 11.732  -2.688  -8.844  1.00 0.00 ? 56  ASN A HB2  3  
ATOM 5203  H HB3  . ASN A 1 56  ? 10.705  -2.982  -10.245 1.00 0.00 ? 56  ASN A HB3  3  
ATOM 5204  H HD21 . ASN A 1 56  ? 8.213   -2.894  -9.204  1.00 0.00 ? 56  ASN A HD21 3  
ATOM 5205  H HD22 . ASN A 1 56  ? 7.885   -1.322  -8.566  1.00 0.00 ? 56  ASN A HD22 3  
ATOM 5206  N N    . CYS A 1 57  ? 9.818   -6.424  -9.597  1.00 0.00 ? 57  CYS A N    3  
ATOM 5207  C CA   . CYS A 1 57  ? 10.023  -7.553  -10.497 1.00 0.00 ? 57  CYS A CA   3  
ATOM 5208  C C    . CYS A 1 57  ? 8.693   -8.192  -10.880 1.00 0.00 ? 57  CYS A C    3  
ATOM 5209  O O    . CYS A 1 57  ? 7.632   -7.766  -10.423 1.00 0.00 ? 57  CYS A O    3  
ATOM 5210  C CB   . CYS A 1 57  ? 10.934  -8.594  -9.843  1.00 0.00 ? 57  CYS A CB   3  
ATOM 5211  S SG   . CYS A 1 57  ? 11.907  -9.565  -11.018 1.00 0.00 ? 57  CYS A SG   3  
ATOM 5212  H H    . CYS A 1 57  ? 9.043   -6.427  -8.997  1.00 0.00 ? 57  CYS A H    3  
ATOM 5213  H HA   . CYS A 1 57  ? 10.500  -7.181  -11.391 1.00 0.00 ? 57  CYS A HA   3  
ATOM 5214  H HB2  . CYS A 1 57  ? 11.624  -8.092  -9.182  1.00 0.00 ? 57  CYS A HB2  3  
ATOM 5215  H HB3  . CYS A 1 57  ? 10.329  -9.280  -9.269  1.00 0.00 ? 57  CYS A HB3  3  
ATOM 5216  H HG   . CYS A 1 57  ? 11.268  -10.704 -11.234 1.00 0.00 ? 57  CYS A HG   3  
ATOM 5217  N N    . THR A 1 58  ? 8.756   -9.218  -11.723 1.00 0.00 ? 58  THR A N    3  
ATOM 5218  C CA   . THR A 1 58  ? 7.556   -9.915  -12.170 1.00 0.00 ? 58  THR A CA   3  
ATOM 5219  C C    . THR A 1 58  ? 6.872   -10.631 -11.011 1.00 0.00 ? 58  THR A C    3  
ATOM 5220  O O    . THR A 1 58  ? 5.724   -11.060 -11.124 1.00 0.00 ? 58  THR A O    3  
ATOM 5221  C CB   . THR A 1 58  ? 7.880   -10.941 -13.272 1.00 0.00 ? 58  THR A CB   3  
ATOM 5222  O OG1  . THR A 1 58  ? 6.831   -11.911 -13.363 1.00 0.00 ? 58  THR A OG1  3  
ATOM 5223  C CG2  . THR A 1 58  ? 9.201   -11.641 -12.989 1.00 0.00 ? 58  THR A CG2  3  
ATOM 5224  H H    . THR A 1 58  ? 9.631   -9.512  -12.052 1.00 0.00 ? 58  THR A H    3  
ATOM 5225  H HA   . THR A 1 58  ? 6.877   -9.181  -12.579 1.00 0.00 ? 58  THR A HA   3  
ATOM 5226  H HB   . THR A 1 58  ? 7.961   -10.420 -14.216 1.00 0.00 ? 58  THR A HB   3  
ATOM 5227  H HG1  . THR A 1 58  ? 6.940   -12.567 -12.669 1.00 0.00 ? 58  THR A HG1  3  
ATOM 5228  H HG21 . THR A 1 58  ? 9.972   -11.225 -13.622 1.00 0.00 ? 58  THR A HG21 3  
ATOM 5229  H HG22 . THR A 1 58  ? 9.100   -12.697 -13.191 1.00 0.00 ? 58  THR A HG22 3  
ATOM 5230  H HG23 . THR A 1 58  ? 9.469   -11.496 -11.953 1.00 0.00 ? 58  THR A HG23 3  
ATOM 5231  N N    . GLY A 1 59  ? 7.584   -10.755 -9.895  1.00 0.00 ? 59  GLY A N    3  
ATOM 5232  C CA   . GLY A 1 59  ? 7.027   -11.419 -8.731  1.00 0.00 ? 59  GLY A CA   3  
ATOM 5233  C C    . GLY A 1 59  ? 6.282   -10.464 -7.820  1.00 0.00 ? 59  GLY A C    3  
ATOM 5234  O O    . GLY A 1 59  ? 5.056   -10.359 -7.888  1.00 0.00 ? 59  GLY A O    3  
ATOM 5235  H H    . GLY A 1 59  ? 8.494   -10.393 -9.862  1.00 0.00 ? 59  GLY A H    3  
ATOM 5236  H HA2  . GLY A 1 59  ? 6.348   -12.191 -9.060  1.00 0.00 ? 59  GLY A HA2  3  
ATOM 5237  H HA3  . GLY A 1 59  ? 7.832   -11.876 -8.173  1.00 0.00 ? 59  GLY A HA3  3  
ATOM 5238  N N    . LEU A 1 60  ? 7.021   -9.767  -6.964  1.00 0.00 ? 60  LEU A N    3  
ATOM 5239  C CA   . LEU A 1 60  ? 6.422   -8.816  -6.033  1.00 0.00 ? 60  LEU A CA   3  
ATOM 5240  C C    . LEU A 1 60  ? 6.335   -7.427  -6.656  1.00 0.00 ? 60  LEU A C    3  
ATOM 5241  O O    . LEU A 1 60  ? 7.334   -6.880  -7.119  1.00 0.00 ? 60  LEU A O    3  
ATOM 5242  C CB   . LEU A 1 60  ? 7.235   -8.758  -4.739  1.00 0.00 ? 60  LEU A CB   3  
ATOM 5243  C CG   . LEU A 1 60  ? 6.600   -7.987  -3.581  1.00 0.00 ? 60  LEU A CG   3  
ATOM 5244  C CD1  . LEU A 1 60  ? 5.388   -8.734  -3.044  1.00 0.00 ? 60  LEU A CD1  3  
ATOM 5245  C CD2  . LEU A 1 60  ? 7.617   -7.753  -2.474  1.00 0.00 ? 60  LEU A CD2  3  
ATOM 5246  H H    . LEU A 1 60  ? 7.992   -9.894  -6.956  1.00 0.00 ? 60  LEU A H    3  
ATOM 5247  H HA   . LEU A 1 60  ? 5.423   -9.159  -5.806  1.00 0.00 ? 60  LEU A HA   3  
ATOM 5248  H HB2  . LEU A 1 60  ? 7.403   -9.771  -4.408  1.00 0.00 ? 60  LEU A HB2  3  
ATOM 5249  H HB3  . LEU A 1 60  ? 8.184   -8.293  -4.966  1.00 0.00 ? 60  LEU A HB3  3  
ATOM 5250  H HG   . LEU A 1 60  ? 6.265   -7.023  -3.939  1.00 0.00 ? 60  LEU A HG   3  
ATOM 5251  H HD11 . LEU A 1 60  ? 4.778   -9.070  -3.869  1.00 0.00 ? 60  LEU A HD11 3  
ATOM 5252  H HD12 . LEU A 1 60  ? 4.810   -8.074  -2.414  1.00 0.00 ? 60  LEU A HD12 3  
ATOM 5253  H HD13 . LEU A 1 60  ? 5.717   -9.586  -2.468  1.00 0.00 ? 60  LEU A HD13 3  
ATOM 5254  H HD21 . LEU A 1 60  ? 8.109   -6.804  -2.633  1.00 0.00 ? 60  LEU A HD21 3  
ATOM 5255  H HD22 . LEU A 1 60  ? 8.352   -8.545  -2.487  1.00 0.00 ? 60  LEU A HD22 3  
ATOM 5256  H HD23 . LEU A 1 60  ? 7.114   -7.743  -1.519  1.00 0.00 ? 60  LEU A HD23 3  
ATOM 5257  N N    . ASN A 1 61  ? 5.132   -6.860  -6.660  1.00 0.00 ? 61  ASN A N    3  
ATOM 5258  C CA   . ASN A 1 61  ? 4.915   -5.533  -7.224  1.00 0.00 ? 61  ASN A CA   3  
ATOM 5259  C C    . ASN A 1 61  ? 4.571   -4.527  -6.130  1.00 0.00 ? 61  ASN A C    3  
ATOM 5260  O O    . ASN A 1 61  ? 4.163   -4.904  -5.030  1.00 0.00 ? 61  ASN A O    3  
ATOM 5261  C CB   . ASN A 1 61  ? 3.794   -5.575  -8.264  1.00 0.00 ? 61  ASN A CB   3  
ATOM 5262  C CG   . ASN A 1 61  ? 4.185   -6.355  -9.504  1.00 0.00 ? 61  ASN A CG   3  
ATOM 5263  O OD1  . ASN A 1 61  ? 4.447   -5.775  -10.559 1.00 0.00 ? 61  ASN A OD1  3  
ATOM 5264  N ND2  . ASN A 1 61  ? 4.227   -7.676  -9.384  1.00 0.00 ? 61  ASN A ND2  3  
ATOM 5265  H H    . ASN A 1 61  ? 4.373   -7.346  -6.275  1.00 0.00 ? 61  ASN A H    3  
ATOM 5266  H HA   . ASN A 1 61  ? 5.830   -5.224  -7.706  1.00 0.00 ? 61  ASN A HA   3  
ATOM 5267  H HB2  . ASN A 1 61  ? 2.924   -6.044  -7.828  1.00 0.00 ? 61  ASN A HB2  3  
ATOM 5268  H HB3  . ASN A 1 61  ? 3.545   -4.567  -8.558  1.00 0.00 ? 61  ASN A HB3  3  
ATOM 5269  H HD21 . ASN A 1 61  ? 4.006   -8.069  -8.513  1.00 0.00 ? 61  ASN A HD21 3  
ATOM 5270  H HD22 . ASN A 1 61  ? 4.478   -8.205  -10.170 1.00 0.00 ? 61  ASN A HD22 3  
ATOM 5271  N N    . PHE A 1 62  ? 4.737   -3.245  -6.438  1.00 0.00 ? 62  PHE A N    3  
ATOM 5272  C CA   . PHE A 1 62  ? 4.444   -2.184  -5.482  1.00 0.00 ? 62  PHE A CA   3  
ATOM 5273  C C    . PHE A 1 62  ? 3.332   -1.277  -5.999  1.00 0.00 ? 62  PHE A C    3  
ATOM 5274  O O    . PHE A 1 62  ? 3.204   -1.058  -7.203  1.00 0.00 ? 62  PHE A O    3  
ATOM 5275  C CB   . PHE A 1 62  ? 5.702   -1.359  -5.203  1.00 0.00 ? 62  PHE A CB   3  
ATOM 5276  C CG   . PHE A 1 62  ? 6.575   -1.941  -4.129  1.00 0.00 ? 62  PHE A CG   3  
ATOM 5277  C CD1  . PHE A 1 62  ? 6.918   -3.284  -4.148  1.00 0.00 ? 62  PHE A CD1  3  
ATOM 5278  C CD2  . PHE A 1 62  ? 7.055   -1.146  -3.100  1.00 0.00 ? 62  PHE A CD2  3  
ATOM 5279  C CE1  . PHE A 1 62  ? 7.720   -3.822  -3.160  1.00 0.00 ? 62  PHE A CE1  3  
ATOM 5280  C CE2  . PHE A 1 62  ? 7.858   -1.679  -2.109  1.00 0.00 ? 62  PHE A CE2  3  
ATOM 5281  C CZ   . PHE A 1 62  ? 8.192   -3.019  -2.140  1.00 0.00 ? 62  PHE A CZ   3  
ATOM 5282  H H    . PHE A 1 62  ? 5.065   -3.007  -7.331  1.00 0.00 ? 62  PHE A H    3  
ATOM 5283  H HA   . PHE A 1 62  ? 4.117   -2.647  -4.564  1.00 0.00 ? 62  PHE A HA   3  
ATOM 5284  H HB2  . PHE A 1 62  ? 6.289   -1.293  -6.107  1.00 0.00 ? 62  PHE A HB2  3  
ATOM 5285  H HB3  . PHE A 1 62  ? 5.411   -0.366  -4.894  1.00 0.00 ? 62  PHE A HB3  3  
ATOM 5286  H HD1  . PHE A 1 62  ? 6.551   -3.913  -4.945  1.00 0.00 ? 62  PHE A HD1  3  
ATOM 5287  H HD2  . PHE A 1 62  ? 6.794   -0.097  -3.075  1.00 0.00 ? 62  PHE A HD2  3  
ATOM 5288  H HE1  . PHE A 1 62  ? 7.981   -4.870  -3.187  1.00 0.00 ? 62  PHE A HE1  3  
ATOM 5289  H HE2  . PHE A 1 62  ? 8.225   -1.048  -1.314  1.00 0.00 ? 62  PHE A HE2  3  
ATOM 5290  H HZ   . PHE A 1 62  ? 8.819   -3.438  -1.367  1.00 0.00 ? 62  PHE A HZ   3  
ATOM 5291  N N    . GLY A 1 63  ? 2.528   -0.752  -5.079  1.00 0.00 ? 63  GLY A N    3  
ATOM 5292  C CA   . GLY A 1 63  ? 1.436   0.124   -5.460  1.00 0.00 ? 63  GLY A CA   3  
ATOM 5293  C C    . GLY A 1 63  ? 1.282   1.302   -4.519  1.00 0.00 ? 63  GLY A C    3  
ATOM 5294  O O    . GLY A 1 63  ? 1.857   1.316   -3.430  1.00 0.00 ? 63  GLY A O    3  
ATOM 5295  H H    . GLY A 1 63  ? 2.678   -0.962  -4.133  1.00 0.00 ? 63  GLY A H    3  
ATOM 5296  H HA2  . GLY A 1 63  ? 1.618   0.495   -6.458  1.00 0.00 ? 63  GLY A HA2  3  
ATOM 5297  H HA3  . GLY A 1 63  ? 0.517   -0.444  -5.460  1.00 0.00 ? 63  GLY A HA3  3  
ATOM 5298  N N    . LYS A 1 64  ? 0.506   2.295   -4.939  1.00 0.00 ? 64  LYS A N    3  
ATOM 5299  C CA   . LYS A 1 64  ? 0.278   3.485   -4.127  1.00 0.00 ? 64  LYS A CA   3  
ATOM 5300  C C    . LYS A 1 64  ? -1.084  4.100   -4.433  1.00 0.00 ? 64  LYS A C    3  
ATOM 5301  O O    . LYS A 1 64  ? -1.420  4.344   -5.592  1.00 0.00 ? 64  LYS A O    3  
ATOM 5302  C CB   . LYS A 1 64  ? 1.382   4.515   -4.374  1.00 0.00 ? 64  LYS A CB   3  
ATOM 5303  C CG   . LYS A 1 64  ? 1.537   5.522   -3.247  1.00 0.00 ? 64  LYS A CG   3  
ATOM 5304  C CD   . LYS A 1 64  ? 2.680   6.487   -3.515  1.00 0.00 ? 64  LYS A CD   3  
ATOM 5305  C CE   . LYS A 1 64  ? 2.325   7.480   -4.611  1.00 0.00 ? 64  LYS A CE   3  
ATOM 5306  N NZ   . LYS A 1 64  ? 3.279   8.623   -4.654  1.00 0.00 ? 64  LYS A NZ   3  
ATOM 5307  H H    . LYS A 1 64  ? 0.075   2.226   -5.817  1.00 0.00 ? 64  LYS A H    3  
ATOM 5308  H HA   . LYS A 1 64  ? 0.300   3.187   -3.089  1.00 0.00 ? 64  LYS A HA   3  
ATOM 5309  H HB2  . LYS A 1 64  ? 2.321   3.996   -4.497  1.00 0.00 ? 64  LYS A HB2  3  
ATOM 5310  H HB3  . LYS A 1 64  ? 1.157   5.055   -5.282  1.00 0.00 ? 64  LYS A HB3  3  
ATOM 5311  H HG2  . LYS A 1 64  ? 0.620   6.085   -3.150  1.00 0.00 ? 64  LYS A HG2  3  
ATOM 5312  H HG3  . LYS A 1 64  ? 1.735   4.991   -2.327  1.00 0.00 ? 64  LYS A HG3  3  
ATOM 5313  H HD2  . LYS A 1 64  ? 2.900   7.032   -2.609  1.00 0.00 ? 64  LYS A HD2  3  
ATOM 5314  H HD3  . LYS A 1 64  ? 3.551   5.924   -3.819  1.00 0.00 ? 64  LYS A HD3  3  
ATOM 5315  H HE2  . LYS A 1 64  ? 2.345   6.970   -5.562  1.00 0.00 ? 64  LYS A HE2  3  
ATOM 5316  H HE3  . LYS A 1 64  ? 1.330   7.859   -4.427  1.00 0.00 ? 64  LYS A HE3  3  
ATOM 5317  H HZ1  . LYS A 1 64  ? 3.009   9.285   -5.411  1.00 0.00 ? 64  LYS A HZ1  3  
ATOM 5318  H HZ2  . LYS A 1 64  ? 4.242   8.278   -4.839  1.00 0.00 ? 64  LYS A HZ2  3  
ATOM 5319  H HZ3  . LYS A 1 64  ? 3.271   9.130   -3.746  1.00 0.00 ? 64  LYS A HZ3  3  
ATOM 5320  N N    . VAL A 1 65  ? -1.864  4.350   -3.386  1.00 0.00 ? 65  VAL A N    3  
ATOM 5321  C CA   . VAL A 1 65  ? -3.189  4.939   -3.544  1.00 0.00 ? 65  VAL A CA   3  
ATOM 5322  C C    . VAL A 1 65  ? -3.380  6.120   -2.599  1.00 0.00 ? 65  VAL A C    3  
ATOM 5323  O O    . VAL A 1 65  ? -2.971  6.073   -1.439  1.00 0.00 ? 65  VAL A O    3  
ATOM 5324  C CB   . VAL A 1 65  ? -4.298  3.903   -3.284  1.00 0.00 ? 65  VAL A CB   3  
ATOM 5325  C CG1  . VAL A 1 65  ? -4.179  3.333   -1.879  1.00 0.00 ? 65  VAL A CG1  3  
ATOM 5326  C CG2  . VAL A 1 65  ? -5.669  4.526   -3.501  1.00 0.00 ? 65  VAL A CG2  3  
ATOM 5327  H H    . VAL A 1 65  ? -1.541  4.133   -2.487  1.00 0.00 ? 65  VAL A H    3  
ATOM 5328  H HA   . VAL A 1 65  ? -3.281  5.287   -4.562  1.00 0.00 ? 65  VAL A HA   3  
ATOM 5329  H HB   . VAL A 1 65  ? -4.179  3.093   -3.988  1.00 0.00 ? 65  VAL A HB   3  
ATOM 5330  H HG11 . VAL A 1 65  ? -4.438  2.284   -1.893  1.00 0.00 ? 65  VAL A HG11 3  
ATOM 5331  H HG12 . VAL A 1 65  ? -3.164  3.450   -1.528  1.00 0.00 ? 65  VAL A HG12 3  
ATOM 5332  H HG13 . VAL A 1 65  ? -4.852  3.860   -1.218  1.00 0.00 ? 65  VAL A HG13 3  
ATOM 5333  H HG21 . VAL A 1 65  ? -5.570  5.599   -3.565  1.00 0.00 ? 65  VAL A HG21 3  
ATOM 5334  H HG22 . VAL A 1 65  ? -6.095  4.148   -4.420  1.00 0.00 ? 65  VAL A HG22 3  
ATOM 5335  H HG23 . VAL A 1 65  ? -6.316  4.271   -2.674  1.00 0.00 ? 65  VAL A HG23 3  
ATOM 5336  N N    . ASP A 1 66  ? -4.005  7.178   -3.103  1.00 0.00 ? 66  ASP A N    3  
ATOM 5337  C CA   . ASP A 1 66  ? -4.253  8.372   -2.304  1.00 0.00 ? 66  ASP A CA   3  
ATOM 5338  C C    . ASP A 1 66  ? -5.558  8.243   -1.524  1.00 0.00 ? 66  ASP A C    3  
ATOM 5339  O O    . ASP A 1 66  ? -6.645  8.300   -2.098  1.00 0.00 ? 66  ASP A O    3  
ATOM 5340  C CB   . ASP A 1 66  ? -4.301  9.611   -3.200  1.00 0.00 ? 66  ASP A CB   3  
ATOM 5341  C CG   . ASP A 1 66  ? -5.300  9.469   -4.331  1.00 0.00 ? 66  ASP A CG   3  
ATOM 5342  O OD1  . ASP A 1 66  ? -5.012  8.719   -5.286  1.00 0.00 ? 66  ASP A OD1  3  
ATOM 5343  O OD2  . ASP A 1 66  ? -6.371  10.109  -4.261  1.00 0.00 ? 66  ASP A OD2  3  
ATOM 5344  H H    . ASP A 1 66  ? -4.308  7.155   -4.035  1.00 0.00 ? 66  ASP A H    3  
ATOM 5345  H HA   . ASP A 1 66  ? -3.439  8.478   -1.603  1.00 0.00 ? 66  ASP A HA   3  
ATOM 5346  H HB2  . ASP A 1 66  ? -4.580  10.468  -2.604  1.00 0.00 ? 66  ASP A HB2  3  
ATOM 5347  H HB3  . ASP A 1 66  ? -3.323  9.777   -3.626  1.00 0.00 ? 66  ASP A HB3  3  
ATOM 5348  N N    . VAL A 1 67  ? -5.442  8.068   -0.211  1.00 0.00 ? 67  VAL A N    3  
ATOM 5349  C CA   . VAL A 1 67  ? -6.612  7.930   0.648   1.00 0.00 ? 67  VAL A CA   3  
ATOM 5350  C C    . VAL A 1 67  ? -7.048  9.281   1.203   1.00 0.00 ? 67  VAL A C    3  
ATOM 5351  O O    . VAL A 1 67  ? -8.169  9.433   1.686   1.00 0.00 ? 67  VAL A O    3  
ATOM 5352  C CB   . VAL A 1 67  ? -6.337  6.970   1.821   1.00 0.00 ? 67  VAL A CB   3  
ATOM 5353  C CG1  . VAL A 1 67  ? -6.172  5.544   1.317   1.00 0.00 ? 67  VAL A CG1  3  
ATOM 5354  C CG2  . VAL A 1 67  ? -5.106  7.415   2.596   1.00 0.00 ? 67  VAL A CG2  3  
ATOM 5355  H H    . VAL A 1 67  ? -4.548  8.031   0.189   1.00 0.00 ? 67  VAL A H    3  
ATOM 5356  H HA   . VAL A 1 67  ? -7.416  7.519   0.055   1.00 0.00 ? 67  VAL A HA   3  
ATOM 5357  H HB   . VAL A 1 67  ? -7.186  6.997   2.488   1.00 0.00 ? 67  VAL A HB   3  
ATOM 5358  H HG11 . VAL A 1 67  ? -5.159  5.216   1.493   1.00 0.00 ? 67  VAL A HG11 3  
ATOM 5359  H HG12 . VAL A 1 67  ? -6.859  4.895   1.840   1.00 0.00 ? 67  VAL A HG12 3  
ATOM 5360  H HG13 . VAL A 1 67  ? -6.382  5.511   0.258   1.00 0.00 ? 67  VAL A HG13 3  
ATOM 5361  H HG21 . VAL A 1 67  ? -5.151  7.019   3.600   1.00 0.00 ? 67  VAL A HG21 3  
ATOM 5362  H HG22 . VAL A 1 67  ? -4.217  7.049   2.104   1.00 0.00 ? 67  VAL A HG22 3  
ATOM 5363  H HG23 . VAL A 1 67  ? -5.076  8.494   2.636   1.00 0.00 ? 67  VAL A HG23 3  
ATOM 5364  N N    . GLY A 1 68  ? -6.152  10.262  1.132   1.00 0.00 ? 68  GLY A N    3  
ATOM 5365  C CA   . GLY A 1 68  ? -6.463  11.588  1.631   1.00 0.00 ? 68  GLY A CA   3  
ATOM 5366  C C    . GLY A 1 68  ? -7.583  12.252  0.854   1.00 0.00 ? 68  GLY A C    3  
ATOM 5367  O O    . GLY A 1 68  ? -8.267  13.136  1.370   1.00 0.00 ? 68  GLY A O    3  
ATOM 5368  H H    . GLY A 1 68  ? -5.273  10.082  0.737   1.00 0.00 ? 68  GLY A H    3  
ATOM 5369  H HA2  . GLY A 1 68  ? -6.755  11.512  2.668   1.00 0.00 ? 68  GLY A HA2  3  
ATOM 5370  H HA3  . GLY A 1 68  ? -5.578  12.204  1.560   1.00 0.00 ? 68  GLY A HA3  3  
ATOM 5371  N N    . ARG A 1 69  ? -7.770  11.827  -0.391  1.00 0.00 ? 69  ARG A N    3  
ATOM 5372  C CA   . ARG A 1 69  ? -8.813  12.388  -1.242  1.00 0.00 ? 69  ARG A CA   3  
ATOM 5373  C C    . ARG A 1 69  ? -9.961  11.399  -1.419  1.00 0.00 ? 69  ARG A C    3  
ATOM 5374  O O    . ARG A 1 69  ? -11.130 11.785  -1.435  1.00 0.00 ? 69  ARG A O    3  
ATOM 5375  C CB   . ARG A 1 69  ? -8.238  12.768  -2.607  1.00 0.00 ? 69  ARG A CB   3  
ATOM 5376  C CG   . ARG A 1 69  ? -9.279  13.291  -3.583  1.00 0.00 ? 69  ARG A CG   3  
ATOM 5377  C CD   . ARG A 1 69  ? -8.632  14.016  -4.753  1.00 0.00 ? 69  ARG A CD   3  
ATOM 5378  N NE   . ARG A 1 69  ? -7.803  13.124  -5.558  1.00 0.00 ? 69  ARG A NE   3  
ATOM 5379  C CZ   . ARG A 1 69  ? -7.406  13.405  -6.794  1.00 0.00 ? 69  ARG A CZ   3  
ATOM 5380  N NH1  . ARG A 1 69  ? -7.761  14.548  -7.364  1.00 0.00 ? 69  ARG A NH1  3  
ATOM 5381  N NH2  . ARG A 1 69  ? -6.653  12.542  -7.463  1.00 0.00 ? 69  ARG A NH2  3  
ATOM 5382  H H    . ARG A 1 69  ? -7.193  11.119  -0.747  1.00 0.00 ? 69  ARG A H    3  
ATOM 5383  H HA   . ARG A 1 69  ? -9.191  13.277  -0.760  1.00 0.00 ? 69  ARG A HA   3  
ATOM 5384  H HB2  . ARG A 1 69  ? -7.489  13.534  -2.469  1.00 0.00 ? 69  ARG A HB2  3  
ATOM 5385  H HB3  . ARG A 1 69  ? -7.773  11.896  -3.044  1.00 0.00 ? 69  ARG A HB3  3  
ATOM 5386  H HG2  . ARG A 1 69  ? -9.854  12.460  -3.963  1.00 0.00 ? 69  ARG A HG2  3  
ATOM 5387  H HG3  . ARG A 1 69  ? -9.933  13.976  -3.063  1.00 0.00 ? 69  ARG A HG3  3  
ATOM 5388  H HD2  . ARG A 1 69  ? -9.410  14.430  -5.377  1.00 0.00 ? 69  ARG A HD2  3  
ATOM 5389  H HD3  . ARG A 1 69  ? -8.016  14.815  -4.368  1.00 0.00 ? 69  ARG A HD3  3  
ATOM 5390  H HE   . ARG A 1 69  ? -7.529  12.273  -5.157  1.00 0.00 ? 69  ARG A HE   3  
ATOM 5391  H HH11 . ARG A 1 69  ? -8.328  15.201  -6.862  1.00 0.00 ? 69  ARG A HH11 3  
ATOM 5392  H HH12 . ARG A 1 69  ? -7.460  14.758  -8.294  1.00 0.00 ? 69  ARG A HH12 3  
ATOM 5393  H HH21 . ARG A 1 69  ? -6.383  11.679  -7.037  1.00 0.00 ? 69  ARG A HH21 3  
ATOM 5394  H HH22 . ARG A 1 69  ? -6.355  12.754  -8.394  1.00 0.00 ? 69  ARG A HH22 3  
ATOM 5395  N N    . TYR A 1 70  ? -9.620  10.122  -1.552  1.00 0.00 ? 70  TYR A N    3  
ATOM 5396  C CA   . TYR A 1 70  ? -10.622 9.078   -1.731  1.00 0.00 ? 70  TYR A CA   3  
ATOM 5397  C C    . TYR A 1 70  ? -11.144 8.587   -0.384  1.00 0.00 ? 70  TYR A C    3  
ATOM 5398  O O    . TYR A 1 70  ? -10.639 7.612   0.175   1.00 0.00 ? 70  TYR A O    3  
ATOM 5399  C CB   . TYR A 1 70  ? -10.032 7.907   -2.519  1.00 0.00 ? 70  TYR A CB   3  
ATOM 5400  C CG   . TYR A 1 70  ? -9.773  8.225   -3.974  1.00 0.00 ? 70  TYR A CG   3  
ATOM 5401  C CD1  . TYR A 1 70  ? -9.023  9.336   -4.339  1.00 0.00 ? 70  TYR A CD1  3  
ATOM 5402  C CD2  . TYR A 1 70  ? -10.279 7.416   -4.984  1.00 0.00 ? 70  TYR A CD2  3  
ATOM 5403  C CE1  . TYR A 1 70  ? -8.784  9.632   -5.667  1.00 0.00 ? 70  TYR A CE1  3  
ATOM 5404  C CE2  . TYR A 1 70  ? -10.044 7.704   -6.315  1.00 0.00 ? 70  TYR A CE2  3  
ATOM 5405  C CZ   . TYR A 1 70  ? -9.296  8.813   -6.651  1.00 0.00 ? 70  TYR A CZ   3  
ATOM 5406  O OH   . TYR A 1 70  ? -9.061  9.103   -7.976  1.00 0.00 ? 70  TYR A OH   3  
ATOM 5407  H H    . TYR A 1 70  ? -8.672  9.876   -1.531  1.00 0.00 ? 70  TYR A H    3  
ATOM 5408  H HA   . TYR A 1 70  ? -11.443 9.499   -2.291  1.00 0.00 ? 70  TYR A HA   3  
ATOM 5409  H HB2  . TYR A 1 70  ? -9.094  7.616   -2.072  1.00 0.00 ? 70  TYR A HB2  3  
ATOM 5410  H HB3  . TYR A 1 70  ? -10.718 7.073   -2.479  1.00 0.00 ? 70  TYR A HB3  3  
ATOM 5411  H HD1  . TYR A 1 70  ? -8.623  9.977   -3.566  1.00 0.00 ? 70  TYR A HD1  3  
ATOM 5412  H HD2  . TYR A 1 70  ? -10.865 6.549   -4.717  1.00 0.00 ? 70  TYR A HD2  3  
ATOM 5413  H HE1  . TYR A 1 70  ? -8.198  10.500  -5.931  1.00 0.00 ? 70  TYR A HE1  3  
ATOM 5414  H HE2  . TYR A 1 70  ? -10.446 7.062   -7.085  1.00 0.00 ? 70  TYR A HE2  3  
ATOM 5415  H HH   . TYR A 1 70  ? -9.216  10.038  -8.130  1.00 0.00 ? 70  TYR A HH   3  
ATOM 5416  N N    . THR A 1 71  ? -12.161 9.270   0.133   1.00 0.00 ? 71  THR A N    3  
ATOM 5417  C CA   . THR A 1 71  ? -12.753 8.906   1.414   1.00 0.00 ? 71  THR A CA   3  
ATOM 5418  C C    . THR A 1 71  ? -13.241 7.462   1.404   1.00 0.00 ? 71  THR A C    3  
ATOM 5419  O O    . THR A 1 71  ? -13.241 6.789   2.435   1.00 0.00 ? 71  THR A O    3  
ATOM 5420  C CB   . THR A 1 71  ? -13.931 9.832   1.772   1.00 0.00 ? 71  THR A CB   3  
ATOM 5421  O OG1  . THR A 1 71  ? -14.541 9.399   2.993   1.00 0.00 ? 71  THR A OG1  3  
ATOM 5422  C CG2  . THR A 1 71  ? -14.967 9.844   0.658   1.00 0.00 ? 71  THR A CG2  3  
ATOM 5423  H H    . THR A 1 71  ? -12.519 10.037  -0.359  1.00 0.00 ? 71  THR A H    3  
ATOM 5424  H HA   . THR A 1 71  ? -11.993 9.014   2.175   1.00 0.00 ? 71  THR A HA   3  
ATOM 5425  H HB   . THR A 1 71  ? -13.553 10.836  1.903   1.00 0.00 ? 71  THR A HB   3  
ATOM 5426  H HG1  . THR A 1 71  ? -15.239 8.769   2.796   1.00 0.00 ? 71  THR A HG1  3  
ATOM 5427  H HG21 . THR A 1 71  ? -15.685 9.055   0.825   1.00 0.00 ? 71  THR A HG21 3  
ATOM 5428  H HG22 . THR A 1 71  ? -14.476 9.690   -0.292  1.00 0.00 ? 71  THR A HG22 3  
ATOM 5429  H HG23 . THR A 1 71  ? -15.475 10.797  0.650   1.00 0.00 ? 71  THR A HG23 3  
ATOM 5430  N N    . ASP A 1 72  ? -13.655 6.991   0.233   1.00 0.00 ? 72  ASP A N    3  
ATOM 5431  C CA   . ASP A 1 72  ? -14.145 5.625   0.088   1.00 0.00 ? 72  ASP A CA   3  
ATOM 5432  C C    . ASP A 1 72  ? -13.085 4.619   0.525   1.00 0.00 ? 72  ASP A C    3  
ATOM 5433  O O    . ASP A 1 72  ? -13.317 3.804   1.418   1.00 0.00 ? 72  ASP A O    3  
ATOM 5434  C CB   . ASP A 1 72  ? -14.552 5.358   -1.361  1.00 0.00 ? 72  ASP A CB   3  
ATOM 5435  C CG   . ASP A 1 72  ? -13.735 6.164   -2.351  1.00 0.00 ? 72  ASP A CG   3  
ATOM 5436  O OD1  . ASP A 1 72  ? -12.613 5.730   -2.686  1.00 0.00 ? 72  ASP A OD1  3  
ATOM 5437  O OD2  . ASP A 1 72  ? -14.216 7.230   -2.790  1.00 0.00 ? 72  ASP A OD2  3  
ATOM 5438  H H    . ASP A 1 72  ? -13.631 7.576   -0.553  1.00 0.00 ? 72  ASP A H    3  
ATOM 5439  H HA   . ASP A 1 72  ? -15.011 5.514   0.723   1.00 0.00 ? 72  ASP A HA   3  
ATOM 5440  H HB2  . ASP A 1 72  ? -14.415 4.309   -1.580  1.00 0.00 ? 72  ASP A HB2  3  
ATOM 5441  H HB3  . ASP A 1 72  ? -15.594 5.614   -1.488  1.00 0.00 ? 72  ASP A HB3  3  
ATOM 5442  N N    . VAL A 1 73  ? -11.919 4.681   -0.111  1.00 0.00 ? 73  VAL A N    3  
ATOM 5443  C CA   . VAL A 1 73  ? -10.823 3.775   0.212   1.00 0.00 ? 73  VAL A CA   3  
ATOM 5444  C C    . VAL A 1 73  ? -10.540 3.767   1.710   1.00 0.00 ? 73  VAL A C    3  
ATOM 5445  O O    . VAL A 1 73  ? -10.720 2.751   2.380   1.00 0.00 ? 73  VAL A O    3  
ATOM 5446  C CB   . VAL A 1 73  ? -9.536  4.162   -0.541  1.00 0.00 ? 73  VAL A CB   3  
ATOM 5447  C CG1  . VAL A 1 73  ? -8.388  3.246   -0.142  1.00 0.00 ? 73  VAL A CG1  3  
ATOM 5448  C CG2  . VAL A 1 73  ? -9.765  4.120   -2.044  1.00 0.00 ? 73  VAL A CG2  3  
ATOM 5449  H H    . VAL A 1 73  ? -11.793 5.352   -0.814  1.00 0.00 ? 73  VAL A H    3  
ATOM 5450  H HA   . VAL A 1 73  ? -11.110 2.780   -0.096  1.00 0.00 ? 73  VAL A HA   3  
ATOM 5451  H HB   . VAL A 1 73  ? -9.272  5.173   -0.266  1.00 0.00 ? 73  VAL A HB   3  
ATOM 5452  H HG11 . VAL A 1 73  ? -8.451  3.030   0.914   1.00 0.00 ? 73  VAL A HG11 3  
ATOM 5453  H HG12 . VAL A 1 73  ? -8.451  2.325   -0.704  1.00 0.00 ? 73  VAL A HG12 3  
ATOM 5454  H HG13 . VAL A 1 73  ? -7.448  3.734   -0.354  1.00 0.00 ? 73  VAL A HG13 3  
ATOM 5455  H HG21 . VAL A 1 73  ? -9.859  3.093   -2.365  1.00 0.00 ? 73  VAL A HG21 3  
ATOM 5456  H HG22 . VAL A 1 73  ? -10.671 4.657   -2.286  1.00 0.00 ? 73  VAL A HG22 3  
ATOM 5457  H HG23 . VAL A 1 73  ? -8.929  4.580   -2.549  1.00 0.00 ? 73  VAL A HG23 3  
ATOM 5458  N N    . SER A 1 74  ? -10.095 4.907   2.229   1.00 0.00 ? 74  SER A N    3  
ATOM 5459  C CA   . SER A 1 74  ? -9.784  5.031   3.648   1.00 0.00 ? 74  SER A CA   3  
ATOM 5460  C C    . SER A 1 74  ? -10.782 4.247   4.494   1.00 0.00 ? 74  SER A C    3  
ATOM 5461  O O    . SER A 1 74  ? -10.418 3.289   5.177   1.00 0.00 ? 74  SER A O    3  
ATOM 5462  C CB   . SER A 1 74  ? -9.789  6.503   4.066   1.00 0.00 ? 74  SER A CB   3  
ATOM 5463  O OG   . SER A 1 74  ? -11.044 7.104   3.801   1.00 0.00 ? 74  SER A OG   3  
ATOM 5464  H H    . SER A 1 74  ? -9.972  5.683   1.642   1.00 0.00 ? 74  SER A H    3  
ATOM 5465  H HA   . SER A 1 74  ? -8.796  4.624   3.807   1.00 0.00 ? 74  SER A HA   3  
ATOM 5466  H HB2  . SER A 1 74  ? -9.586  6.574   5.124   1.00 0.00 ? 74  SER A HB2  3  
ATOM 5467  H HB3  . SER A 1 74  ? -9.025  7.033   3.516   1.00 0.00 ? 74  SER A HB3  3  
ATOM 5468  H HG   . SER A 1 74  ? -11.353 6.832   2.933   1.00 0.00 ? 74  SER A HG   3  
ATOM 5469  N N    . THR A 1 75  ? -12.045 4.660   4.443   1.00 0.00 ? 75  THR A N    3  
ATOM 5470  C CA   . THR A 1 75  ? -13.097 3.999   5.204   1.00 0.00 ? 75  THR A CA   3  
ATOM 5471  C C    . THR A 1 75  ? -13.098 2.496   4.949   1.00 0.00 ? 75  THR A C    3  
ATOM 5472  O O    . THR A 1 75  ? -13.302 1.701   5.867   1.00 0.00 ? 75  THR A O    3  
ATOM 5473  C CB   . THR A 1 75  ? -14.485 4.568   4.856   1.00 0.00 ? 75  THR A CB   3  
ATOM 5474  O OG1  . THR A 1 75  ? -14.476 5.994   4.984   1.00 0.00 ? 75  THR A OG1  3  
ATOM 5475  C CG2  . THR A 1 75  ? -15.555 3.979   5.763   1.00 0.00 ? 75  THR A CG2  3  
ATOM 5476  H H    . THR A 1 75  ? -12.272 5.429   3.880   1.00 0.00 ? 75  THR A H    3  
ATOM 5477  H HA   . THR A 1 75  ? -12.911 4.176   6.253   1.00 0.00 ? 75  THR A HA   3  
ATOM 5478  H HB   . THR A 1 75  ? -14.718 4.307   3.833   1.00 0.00 ? 75  THR A HB   3  
ATOM 5479  H HG1  . THR A 1 75  ? -13.875 6.248   5.689   1.00 0.00 ? 75  THR A HG1  3  
ATOM 5480  H HG21 . THR A 1 75  ? -15.084 3.480   6.597   1.00 0.00 ? 75  THR A HG21 3  
ATOM 5481  H HG22 . THR A 1 75  ? -16.148 3.269   5.206   1.00 0.00 ? 75  THR A HG22 3  
ATOM 5482  H HG23 . THR A 1 75  ? -16.190 4.770   6.130   1.00 0.00 ? 75  THR A HG23 3  
ATOM 5483  N N    . ARG A 1 76  ? -12.867 2.112   3.698   1.00 0.00 ? 76  ARG A N    3  
ATOM 5484  C CA   . ARG A 1 76  ? -12.842 0.704   3.322   1.00 0.00 ? 76  ARG A CA   3  
ATOM 5485  C C    . ARG A 1 76  ? -11.729 -0.036  4.059   1.00 0.00 ? 76  ARG A C    3  
ATOM 5486  O O    . ARG A 1 76  ? -11.938 -1.129  4.585   1.00 0.00 ? 76  ARG A O    3  
ATOM 5487  C CB   . ARG A 1 76  ? -12.652 0.560   1.811   1.00 0.00 ? 76  ARG A CB   3  
ATOM 5488  C CG   . ARG A 1 76  ? -13.118 -0.779  1.263   1.00 0.00 ? 76  ARG A CG   3  
ATOM 5489  C CD   . ARG A 1 76  ? -12.727 -0.950  -0.196  1.00 0.00 ? 76  ARG A CD   3  
ATOM 5490  N NE   . ARG A 1 76  ? -13.687 -0.319  -1.098  1.00 0.00 ? 76  ARG A NE   3  
ATOM 5491  C CZ   . ARG A 1 76  ? -14.884 -0.826  -1.369  1.00 0.00 ? 76  ARG A CZ   3  
ATOM 5492  N NH1  . ARG A 1 76  ? -15.267 -1.966  -0.812  1.00 0.00 ? 76  ARG A NH1  3  
ATOM 5493  N NH2  . ARG A 1 76  ? -15.702 -0.192  -2.200  1.00 0.00 ? 76  ARG A NH2  3  
ATOM 5494  H H    . ARG A 1 76  ? -12.711 2.793   3.010   1.00 0.00 ? 76  ARG A H    3  
ATOM 5495  H HA   . ARG A 1 76  ? -13.791 0.269   3.600   1.00 0.00 ? 76  ARG A HA   3  
ATOM 5496  H HB2  . ARG A 1 76  ? -13.208 1.341   1.314   1.00 0.00 ? 76  ARG A HB2  3  
ATOM 5497  H HB3  . ARG A 1 76  ? -11.603 0.673   1.581   1.00 0.00 ? 76  ARG A HB3  3  
ATOM 5498  H HG2  . ARG A 1 76  ? -12.666 -1.572  1.841   1.00 0.00 ? 76  ARG A HG2  3  
ATOM 5499  H HG3  . ARG A 1 76  ? -14.193 -0.837  1.349   1.00 0.00 ? 76  ARG A HG3  3  
ATOM 5500  H HD2  . ARG A 1 76  ? -11.756 -0.504  -0.349  1.00 0.00 ? 76  ARG A HD2  3  
ATOM 5501  H HD3  . ARG A 1 76  ? -12.678 -2.006  -0.420  1.00 0.00 ? 76  ARG A HD3  3  
ATOM 5502  H HE   . ARG A 1 76  ? -13.425 0.525   -1.521  1.00 0.00 ? 76  ARG A HE   3  
ATOM 5503  H HH11 . ARG A 1 76  ? -14.653 -2.446  -0.184  1.00 0.00 ? 76  ARG A HH11 3  
ATOM 5504  H HH12 . ARG A 1 76  ? -16.169 -2.346  -1.017  1.00 0.00 ? 76  ARG A HH12 3  
ATOM 5505  H HH21 . ARG A 1 76  ? -15.417 0.668   -2.623  1.00 0.00 ? 76  ARG A HH21 3  
ATOM 5506  H HH22 . ARG A 1 76  ? -16.602 -0.575  -2.404  1.00 0.00 ? 76  ARG A HH22 3  
ATOM 5507  N N    . TYR A 1 77  ? -10.546 0.568   4.092   1.00 0.00 ? 77  TYR A N    3  
ATOM 5508  C CA   . TYR A 1 77  ? -9.399  -0.034  4.762   1.00 0.00 ? 77  TYR A CA   3  
ATOM 5509  C C    . TYR A 1 77  ? -9.299  0.445   6.207   1.00 0.00 ? 77  TYR A C    3  
ATOM 5510  O O    . TYR A 1 77  ? -8.254  0.317   6.845   1.00 0.00 ? 77  TYR A O    3  
ATOM 5511  C CB   . TYR A 1 77  ? -8.110  0.302   4.010   1.00 0.00 ? 77  TYR A CB   3  
ATOM 5512  C CG   . TYR A 1 77  ? -8.034  -0.315  2.632   1.00 0.00 ? 77  TYR A CG   3  
ATOM 5513  C CD1  . TYR A 1 77  ? -8.647  0.293   1.543   1.00 0.00 ? 77  TYR A CD1  3  
ATOM 5514  C CD2  . TYR A 1 77  ? -7.351  -1.506  2.419   1.00 0.00 ? 77  TYR A CD2  3  
ATOM 5515  C CE1  . TYR A 1 77  ? -8.581  -0.267  0.282   1.00 0.00 ? 77  TYR A CE1  3  
ATOM 5516  C CE2  . TYR A 1 77  ? -7.279  -2.073  1.161   1.00 0.00 ? 77  TYR A CE2  3  
ATOM 5517  C CZ   . TYR A 1 77  ? -7.895  -1.450  0.096   1.00 0.00 ? 77  TYR A CZ   3  
ATOM 5518  O OH   . TYR A 1 77  ? -7.827  -2.012  -1.158  1.00 0.00 ? 77  TYR A OH   3  
ATOM 5519  H H    . TYR A 1 77  ? -10.442 1.439   3.655   1.00 0.00 ? 77  TYR A H    3  
ATOM 5520  H HA   . TYR A 1 77  ? -9.538  -1.105  4.758   1.00 0.00 ? 77  TYR A HA   3  
ATOM 5521  H HB2  . TYR A 1 77  ? -8.035  1.373   3.898   1.00 0.00 ? 77  TYR A HB2  3  
ATOM 5522  H HB3  . TYR A 1 77  ? -7.266  -0.055  4.581   1.00 0.00 ? 77  TYR A HB3  3  
ATOM 5523  H HD1  . TYR A 1 77  ? -9.183  1.219   1.692   1.00 0.00 ? 77  TYR A HD1  3  
ATOM 5524  H HD2  . TYR A 1 77  ? -6.870  -1.991  3.256   1.00 0.00 ? 77  TYR A HD2  3  
ATOM 5525  H HE1  . TYR A 1 77  ? -9.063  0.220   -0.553  1.00 0.00 ? 77  TYR A HE1  3  
ATOM 5526  H HE2  . TYR A 1 77  ? -6.743  -2.999  1.015   1.00 0.00 ? 77  TYR A HE2  3  
ATOM 5527  H HH   . TYR A 1 77  ? -8.308  -2.843  -1.163  1.00 0.00 ? 77  TYR A HH   3  
ATOM 5528  N N    . LYS A 1 78  ? -10.394 0.999   6.717   1.00 0.00 ? 78  LYS A N    3  
ATOM 5529  C CA   . LYS A 1 78  ? -10.433 1.496   8.087   1.00 0.00 ? 78  LYS A CA   3  
ATOM 5530  C C    . LYS A 1 78  ? -9.164  2.276   8.419   1.00 0.00 ? 78  LYS A C    3  
ATOM 5531  O O    . LYS A 1 78  ? -8.482  1.983   9.400   1.00 0.00 ? 78  LYS A O    3  
ATOM 5532  C CB   . LYS A 1 78  ? -10.601 0.335   9.069   1.00 0.00 ? 78  LYS A CB   3  
ATOM 5533  C CG   . LYS A 1 78  ? -12.050 -0.046  9.318   1.00 0.00 ? 78  LYS A CG   3  
ATOM 5534  C CD   . LYS A 1 78  ? -12.562 -1.014  8.264   1.00 0.00 ? 78  LYS A CD   3  
ATOM 5535  C CE   . LYS A 1 78  ? -14.079 -1.113  8.288   1.00 0.00 ? 78  LYS A CE   3  
ATOM 5536  N NZ   . LYS A 1 78  ? -14.586 -2.102  7.297   1.00 0.00 ? 78  LYS A NZ   3  
ATOM 5537  H H    . LYS A 1 78  ? -11.196 1.074   6.159   1.00 0.00 ? 78  LYS A H    3  
ATOM 5538  H HA   . LYS A 1 78  ? -11.281 2.158   8.176   1.00 0.00 ? 78  LYS A HA   3  
ATOM 5539  H HB2  . LYS A 1 78  ? -10.086 -0.530  8.677   1.00 0.00 ? 78  LYS A HB2  3  
ATOM 5540  H HB3  . LYS A 1 78  ? -10.156 0.610   10.014  1.00 0.00 ? 78  LYS A HB3  3  
ATOM 5541  H HG2  . LYS A 1 78  ? -12.129 -0.513  10.288  1.00 0.00 ? 78  LYS A HG2  3  
ATOM 5542  H HG3  . LYS A 1 78  ? -12.656 0.849   9.297   1.00 0.00 ? 78  LYS A HG3  3  
ATOM 5543  H HD2  . LYS A 1 78  ? -12.250 -0.669  7.289   1.00 0.00 ? 78  LYS A HD2  3  
ATOM 5544  H HD3  . LYS A 1 78  ? -12.142 -1.992  8.452   1.00 0.00 ? 78  LYS A HD3  3  
ATOM 5545  H HE2  . LYS A 1 78  ? -14.392 -1.414  9.276   1.00 0.00 ? 78  LYS A HE2  3  
ATOM 5546  H HE3  . LYS A 1 78  ? -14.494 -0.142  8.059   1.00 0.00 ? 78  LYS A HE3  3  
ATOM 5547  H HZ1  . LYS A 1 78  ? -13.807 -2.708  6.967   1.00 0.00 ? 78  LYS A HZ1  3  
ATOM 5548  H HZ2  . LYS A 1 78  ? -14.997 -1.610  6.478   1.00 0.00 ? 78  LYS A HZ2  3  
ATOM 5549  H HZ3  . LYS A 1 78  ? -15.317 -2.701  7.731   1.00 0.00 ? 78  LYS A HZ3  3  
ATOM 5550  N N    . VAL A 1 79  ? -8.855  3.273   7.595   1.00 0.00 ? 79  VAL A N    3  
ATOM 5551  C CA   . VAL A 1 79  ? -7.670  4.096   7.803   1.00 0.00 ? 79  VAL A CA   3  
ATOM 5552  C C    . VAL A 1 79  ? -8.049  5.554   8.042   1.00 0.00 ? 79  VAL A C    3  
ATOM 5553  O O    . VAL A 1 79  ? -8.436  6.265   7.115   1.00 0.00 ? 79  VAL A O    3  
ATOM 5554  C CB   . VAL A 1 79  ? -6.713  4.017   6.598   1.00 0.00 ? 79  VAL A CB   3  
ATOM 5555  C CG1  . VAL A 1 79  ? -5.595  5.039   6.737   1.00 0.00 ? 79  VAL A CG1  3  
ATOM 5556  C CG2  . VAL A 1 79  ? -6.148  2.612   6.459   1.00 0.00 ? 79  VAL A CG2  3  
ATOM 5557  H H    . VAL A 1 79  ? -9.438  3.458   6.830   1.00 0.00 ? 79  VAL A H    3  
ATOM 5558  H HA   . VAL A 1 79  ? -7.151  3.722   8.673   1.00 0.00 ? 79  VAL A HA   3  
ATOM 5559  H HB   . VAL A 1 79  ? -7.273  4.248   5.704   1.00 0.00 ? 79  VAL A HB   3  
ATOM 5560  H HG11 . VAL A 1 79  ? -5.929  5.992   6.352   1.00 0.00 ? 79  VAL A HG11 3  
ATOM 5561  H HG12 . VAL A 1 79  ? -5.328  5.143   7.778   1.00 0.00 ? 79  VAL A HG12 3  
ATOM 5562  H HG13 . VAL A 1 79  ? -4.734  4.707   6.175   1.00 0.00 ? 79  VAL A HG13 3  
ATOM 5563  H HG21 . VAL A 1 79  ? -6.225  2.098   7.405   1.00 0.00 ? 79  VAL A HG21 3  
ATOM 5564  H HG22 . VAL A 1 79  ? -6.708  2.071   5.710   1.00 0.00 ? 79  VAL A HG22 3  
ATOM 5565  H HG23 . VAL A 1 79  ? -5.112  2.668   6.162   1.00 0.00 ? 79  VAL A HG23 3  
ATOM 5566  N N    . SER A 1 80  ? -7.934  5.992   9.291   1.00 0.00 ? 80  SER A N    3  
ATOM 5567  C CA   . SER A 1 80  ? -8.268  7.364   9.654   1.00 0.00 ? 80  SER A CA   3  
ATOM 5568  C C    . SER A 1 80  ? -7.487  8.357   8.798   1.00 0.00 ? 80  SER A C    3  
ATOM 5569  O O    . SER A 1 80  ? -6.269  8.247   8.652   1.00 0.00 ? 80  SER A O    3  
ATOM 5570  C CB   . SER A 1 80  ? -7.974  7.609   11.135  1.00 0.00 ? 80  SER A CB   3  
ATOM 5571  O OG   . SER A 1 80  ? -8.919  6.947   11.958  1.00 0.00 ? 80  SER A OG   3  
ATOM 5572  H H    . SER A 1 80  ? -7.620  5.376   9.986   1.00 0.00 ? 80  SER A H    3  
ATOM 5573  H HA   . SER A 1 80  ? -9.324  7.507   9.476   1.00 0.00 ? 80  SER A HA   3  
ATOM 5574  H HB2  . SER A 1 80  ? -6.988  7.238   11.370  1.00 0.00 ? 80  SER A HB2  3  
ATOM 5575  H HB3  . SER A 1 80  ? -8.018  8.669   11.337  1.00 0.00 ? 80  SER A HB3  3  
ATOM 5576  H HG   . SER A 1 80  ? -8.716  6.010   11.990  1.00 0.00 ? 80  SER A HG   3  
ATOM 5577  N N    . THR A 1 81  ? -8.198  9.329   8.233   1.00 0.00 ? 81  THR A N    3  
ATOM 5578  C CA   . THR A 1 81  ? -7.574  10.341  7.391   1.00 0.00 ? 81  THR A CA   3  
ATOM 5579  C C    . THR A 1 81  ? -7.558  11.699  8.083   1.00 0.00 ? 81  THR A C    3  
ATOM 5580  O O    . THR A 1 81  ? -7.862  12.723  7.471   1.00 0.00 ? 81  THR A O    3  
ATOM 5581  C CB   . THR A 1 81  ? -8.302  10.475  6.040   1.00 0.00 ? 81  THR A CB   3  
ATOM 5582  O OG1  . THR A 1 81  ? -9.711  10.612  6.255   1.00 0.00 ? 81  THR A OG1  3  
ATOM 5583  C CG2  . THR A 1 81  ? -8.034  9.265   5.158   1.00 0.00 ? 81  THR A CG2  3  
ATOM 5584  H H    . THR A 1 81  ? -9.165  9.363   8.387   1.00 0.00 ? 81  THR A H    3  
ATOM 5585  H HA   . THR A 1 81  ? -6.556  10.034  7.198   1.00 0.00 ? 81  THR A HA   3  
ATOM 5586  H HB   . THR A 1 81  ? -7.935  11.358  5.536   1.00 0.00 ? 81  THR A HB   3  
ATOM 5587  H HG1  . THR A 1 81  ? -10.085 11.177  5.574   1.00 0.00 ? 81  THR A HG1  3  
ATOM 5588  H HG21 . THR A 1 81  ? -7.067  9.369   4.688   1.00 0.00 ? 81  THR A HG21 3  
ATOM 5589  H HG22 . THR A 1 81  ? -8.798  9.196   4.399   1.00 0.00 ? 81  THR A HG22 3  
ATOM 5590  H HG23 . THR A 1 81  ? -8.045  8.370   5.762   1.00 0.00 ? 81  THR A HG23 3  
ATOM 5591  N N    . SER A 1 82  ? -7.201  11.701  9.364   1.00 0.00 ? 82  SER A N    3  
ATOM 5592  C CA   . SER A 1 82  ? -7.148  12.934  10.141  1.00 0.00 ? 82  SER A CA   3  
ATOM 5593  C C    . SER A 1 82  ? -5.705  13.387  10.344  1.00 0.00 ? 82  SER A C    3  
ATOM 5594  O O    . SER A 1 82  ? -4.789  12.578  10.491  1.00 0.00 ? 82  SER A O    3  
ATOM 5595  C CB   . SER A 1 82  ? -7.828  12.736  11.497  1.00 0.00 ? 82  SER A CB   3  
ATOM 5596  O OG   . SER A 1 82  ? -9.166  12.298  11.337  1.00 0.00 ? 82  SER A OG   3  
ATOM 5597  H H    . SER A 1 82  ? -6.969  10.852  9.796   1.00 0.00 ? 82  SER A H    3  
ATOM 5598  H HA   . SER A 1 82  ? -7.678  13.696  9.589   1.00 0.00 ? 82  SER A HA   3  
ATOM 5599  H HB2  . SER A 1 82  ? -7.285  11.996  12.065  1.00 0.00 ? 82  SER A HB2  3  
ATOM 5600  H HB3  . SER A 1 82  ? -7.831  13.673  12.035  1.00 0.00 ? 82  SER A HB3  3  
ATOM 5601  H HG   . SER A 1 82  ? -9.766  12.984  11.638  1.00 0.00 ? 82  SER A HG   3  
ATOM 5602  N N    . PRO A 1 83  ? -5.498  14.712  10.353  1.00 0.00 ? 83  PRO A N    3  
ATOM 5603  C CA   . PRO A 1 83  ? -4.169  15.304  10.537  1.00 0.00 ? 83  PRO A CA   3  
ATOM 5604  C C    . PRO A 1 83  ? -3.642  15.113  11.955  1.00 0.00 ? 83  PRO A C    3  
ATOM 5605  O O    . PRO A 1 83  ? -2.475  15.389  12.237  1.00 0.00 ? 83  PRO A O    3  
ATOM 5606  C CB   . PRO A 1 83  ? -4.400  16.789  10.248  1.00 0.00 ? 83  PRO A CB   3  
ATOM 5607  C CG   . PRO A 1 83  ? -5.842  17.014  10.545  1.00 0.00 ? 83  PRO A CG   3  
ATOM 5608  C CD   . PRO A 1 83  ? -6.544  15.734  10.183  1.00 0.00 ? 83  PRO A CD   3  
ATOM 5609  H HA   . PRO A 1 83  ? -3.456  14.904  9.832   1.00 0.00 ? 83  PRO A HA   3  
ATOM 5610  H HB2  . PRO A 1 83  ? -3.766  17.386  10.888  1.00 0.00 ? 83  PRO A HB2  3  
ATOM 5611  H HB3  . PRO A 1 83  ? -4.173  16.997  9.213   1.00 0.00 ? 83  PRO A HB3  3  
ATOM 5612  H HG2  . PRO A 1 83  ? -5.971  17.229  11.595  1.00 0.00 ? 83  PRO A HG2  3  
ATOM 5613  H HG3  . PRO A 1 83  ? -6.218  17.830  9.945   1.00 0.00 ? 83  PRO A HG3  3  
ATOM 5614  H HD2  . PRO A 1 83  ? -7.371  15.555  10.854  1.00 0.00 ? 83  PRO A HD2  3  
ATOM 5615  H HD3  . PRO A 1 83  ? -6.887  15.768  9.160   1.00 0.00 ? 83  PRO A HD3  3  
ATOM 5616  N N    . LEU A 1 84  ? -4.508  14.640  12.845  1.00 0.00 ? 84  LEU A N    3  
ATOM 5617  C CA   . LEU A 1 84  ? -4.128  14.411  14.235  1.00 0.00 ? 84  LEU A CA   3  
ATOM 5618  C C    . LEU A 1 84  ? -3.689  12.967  14.449  1.00 0.00 ? 84  LEU A C    3  
ATOM 5619  O O    . LEU A 1 84  ? -2.700  12.702  15.134  1.00 0.00 ? 84  LEU A O    3  
ATOM 5620  C CB   . LEU A 1 84  ? -5.297  14.744  15.164  1.00 0.00 ? 84  LEU A CB   3  
ATOM 5621  C CG   . LEU A 1 84  ? -5.504  16.226  15.479  1.00 0.00 ? 84  LEU A CG   3  
ATOM 5622  C CD1  . LEU A 1 84  ? -4.321  16.776  16.259  1.00 0.00 ? 84  LEU A CD1  3  
ATOM 5623  C CD2  . LEU A 1 84  ? -5.716  17.018  14.197  1.00 0.00 ? 84  LEU A CD2  3  
ATOM 5624  H H    . LEU A 1 84  ? -5.423  14.439  12.561  1.00 0.00 ? 84  LEU A H    3  
ATOM 5625  H HA   . LEU A 1 84  ? -3.300  15.065  14.464  1.00 0.00 ? 84  LEU A HA   3  
ATOM 5626  H HB2  . LEU A 1 84  ? -6.201  14.374  14.704  1.00 0.00 ? 84  LEU A HB2  3  
ATOM 5627  H HB3  . LEU A 1 84  ? -5.133  14.226  16.098  1.00 0.00 ? 84  LEU A HB3  3  
ATOM 5628  H HG   . LEU A 1 84  ? -6.388  16.337  16.091  1.00 0.00 ? 84  LEU A HG   3  
ATOM 5629  H HD11 . LEU A 1 84  ? -4.671  17.490  16.988  1.00 0.00 ? 84  LEU A HD11 3  
ATOM 5630  H HD12 . LEU A 1 84  ? -3.636  17.262  15.579  1.00 0.00 ? 84  LEU A HD12 3  
ATOM 5631  H HD13 . LEU A 1 84  ? -3.814  15.966  16.762  1.00 0.00 ? 84  LEU A HD13 3  
ATOM 5632  H HD21 . LEU A 1 84  ? -5.899  16.337  13.379  1.00 0.00 ? 84  LEU A HD21 3  
ATOM 5633  H HD22 . LEU A 1 84  ? -4.833  17.604  13.986  1.00 0.00 ? 84  LEU A HD22 3  
ATOM 5634  H HD23 . LEU A 1 84  ? -6.564  17.675  14.316  1.00 0.00 ? 84  LEU A HD23 3  
ATOM 5635  N N    . THR A 1 85  ? -4.428  12.034  13.857  1.00 0.00 ? 85  THR A N    3  
ATOM 5636  C CA   . THR A 1 85  ? -4.114  10.616  13.981  1.00 0.00 ? 85  THR A CA   3  
ATOM 5637  C C    . THR A 1 85  ? -2.748  10.301  13.384  1.00 0.00 ? 85  THR A C    3  
ATOM 5638  O O    . THR A 1 85  ? -2.119  11.156  12.760  1.00 0.00 ? 85  THR A O    3  
ATOM 5639  C CB   . THR A 1 85  ? -5.178  9.743   13.290  1.00 0.00 ? 85  THR A CB   3  
ATOM 5640  O OG1  . THR A 1 85  ? -4.982  8.367   13.635  1.00 0.00 ? 85  THR A OG1  3  
ATOM 5641  C CG2  . THR A 1 85  ? -5.114  9.906   11.779  1.00 0.00 ? 85  THR A CG2  3  
ATOM 5642  H H    . THR A 1 85  ? -5.204  12.308  13.324  1.00 0.00 ? 85  THR A H    3  
ATOM 5643  H HA   . THR A 1 85  ? -4.103  10.368  15.033  1.00 0.00 ? 85  THR A HA   3  
ATOM 5644  H HB   . THR A 1 85  ? -6.155  10.055  13.630  1.00 0.00 ? 85  THR A HB   3  
ATOM 5645  H HG1  . THR A 1 85  ? -5.793  8.011   14.005  1.00 0.00 ? 85  THR A HG1  3  
ATOM 5646  H HG21 . THR A 1 85  ? -4.097  10.121  11.483  1.00 0.00 ? 85  THR A HG21 3  
ATOM 5647  H HG22 . THR A 1 85  ? -5.757  10.719  11.477  1.00 0.00 ? 85  THR A HG22 3  
ATOM 5648  H HG23 . THR A 1 85  ? -5.440  8.993   11.304  1.00 0.00 ? 85  THR A HG23 3  
ATOM 5649  N N    . LYS A 1 86  ? -2.293  9.068   13.578  1.00 0.00 ? 86  LYS A N    3  
ATOM 5650  C CA   . LYS A 1 86  ? -1.001  8.638   13.057  1.00 0.00 ? 86  LYS A CA   3  
ATOM 5651  C C    . LYS A 1 86  ? -1.164  7.460   12.101  1.00 0.00 ? 86  LYS A C    3  
ATOM 5652  O O    . LYS A 1 86  ? -0.350  6.537   12.096  1.00 0.00 ? 86  LYS A O    3  
ATOM 5653  C CB   . LYS A 1 86  ? -0.067  8.250   14.206  1.00 0.00 ? 86  LYS A CB   3  
ATOM 5654  C CG   . LYS A 1 86  ? 0.257   9.403   15.141  1.00 0.00 ? 86  LYS A CG   3  
ATOM 5655  C CD   . LYS A 1 86  ? 1.288   10.340  14.534  1.00 0.00 ? 86  LYS A CD   3  
ATOM 5656  C CE   . LYS A 1 86  ? 1.950   11.204  15.596  1.00 0.00 ? 86  LYS A CE   3  
ATOM 5657  N NZ   . LYS A 1 86  ? 3.060   12.022  15.033  1.00 0.00 ? 86  LYS A NZ   3  
ATOM 5658  H H    . LYS A 1 86  ? -2.840  8.431   14.084  1.00 0.00 ? 86  LYS A H    3  
ATOM 5659  H HA   . LYS A 1 86  ? -0.568  9.467   12.517  1.00 0.00 ? 86  LYS A HA   3  
ATOM 5660  H HB2  . LYS A 1 86  ? -0.534  7.466   14.784  1.00 0.00 ? 86  LYS A HB2  3  
ATOM 5661  H HB3  . LYS A 1 86  ? 0.859   7.878   13.792  1.00 0.00 ? 86  LYS A HB3  3  
ATOM 5662  H HG2  . LYS A 1 86  ? -0.646  9.959   15.339  1.00 0.00 ? 86  LYS A HG2  3  
ATOM 5663  H HG3  . LYS A 1 86  ? 0.648   9.004   16.067  1.00 0.00 ? 86  LYS A HG3  3  
ATOM 5664  H HD2  . LYS A 1 86  ? 2.048   9.753   14.038  1.00 0.00 ? 86  LYS A HD2  3  
ATOM 5665  H HD3  . LYS A 1 86  ? 0.799   10.981  13.814  1.00 0.00 ? 86  LYS A HD3  3  
ATOM 5666  H HE2  . LYS A 1 86  ? 1.208   11.862  16.020  1.00 0.00 ? 86  LYS A HE2  3  
ATOM 5667  H HE3  . LYS A 1 86  ? 2.345   10.561  16.369  1.00 0.00 ? 86  LYS A HE3  3  
ATOM 5668  H HZ1  . LYS A 1 86  ? 3.135   12.923  15.547  1.00 0.00 ? 86  LYS A HZ1  3  
ATOM 5669  H HZ2  . LYS A 1 86  ? 2.881   12.224  14.028  1.00 0.00 ? 86  LYS A HZ2  3  
ATOM 5670  H HZ3  . LYS A 1 86  ? 3.961   11.510  15.118  1.00 0.00 ? 86  LYS A HZ3  3  
ATOM 5671  N N    . GLN A 1 87  ? -2.219  7.501   11.294  1.00 0.00 ? 87  GLN A N    3  
ATOM 5672  C CA   . GLN A 1 87  ? -2.487  6.436   10.334  1.00 0.00 ? 87  GLN A CA   3  
ATOM 5673  C C    . GLN A 1 87  ? -2.121  6.874   8.920   1.00 0.00 ? 87  GLN A C    3  
ATOM 5674  O O    . GLN A 1 87  ? -2.726  6.427   7.944   1.00 0.00 ? 87  GLN A O    3  
ATOM 5675  C CB   . GLN A 1 87  ? -3.961  6.030   10.389  1.00 0.00 ? 87  GLN A CB   3  
ATOM 5676  C CG   . GLN A 1 87  ? -4.451  5.707   11.792  1.00 0.00 ? 87  GLN A CG   3  
ATOM 5677  C CD   . GLN A 1 87  ? -5.553  4.666   11.800  1.00 0.00 ? 87  GLN A CD   3  
ATOM 5678  O OE1  . GLN A 1 87  ? -6.737  4.999   11.745  1.00 0.00 ? 87  GLN A OE1  3  
ATOM 5679  N NE2  . GLN A 1 87  ? -5.168  3.397   11.867  1.00 0.00 ? 87  GLN A NE2  3  
ATOM 5680  H H    . GLN A 1 87  ? -2.831  8.263   11.346  1.00 0.00 ? 87  GLN A H    3  
ATOM 5681  H HA   . GLN A 1 87  ? -1.879  5.586   10.603  1.00 0.00 ? 87  GLN A HA   3  
ATOM 5682  H HB2  . GLN A 1 87  ? -4.560  6.840   9.999   1.00 0.00 ? 87  GLN A HB2  3  
ATOM 5683  H HB3  . GLN A 1 87  ? -4.105  5.156   9.771   1.00 0.00 ? 87  GLN A HB3  3  
ATOM 5684  H HG2  . GLN A 1 87  ? -3.621  5.334   12.372  1.00 0.00 ? 87  GLN A HG2  3  
ATOM 5685  H HG3  . GLN A 1 87  ? -4.827  6.613   12.245  1.00 0.00 ? 87  GLN A HG3  3  
ATOM 5686  H HE21 . GLN A 1 87  ? -4.207  3.207   11.909  1.00 0.00 ? 87  GLN A HE21 3  
ATOM 5687  H HE22 . GLN A 1 87  ? -5.859  2.704   11.875  1.00 0.00 ? 87  GLN A HE22 3  
ATOM 5688  N N    . LEU A 1 88  ? -1.128  7.750   8.816   1.00 0.00 ? 88  LEU A N    3  
ATOM 5689  C CA   . LEU A 1 88  ? -0.680  8.249   7.520   1.00 0.00 ? 88  LEU A CA   3  
ATOM 5690  C C    . LEU A 1 88  ? 0.762   8.739   7.594   1.00 0.00 ? 88  LEU A C    3  
ATOM 5691  O O    . LEU A 1 88  ? 1.107   9.614   8.389   1.00 0.00 ? 88  LEU A O    3  
ATOM 5692  C CB   . LEU A 1 88  ? -1.592  9.382   7.045   1.00 0.00 ? 88  LEU A CB   3  
ATOM 5693  C CG   . LEU A 1 88  ? -2.955  8.960   6.494   1.00 0.00 ? 88  LEU A CG   3  
ATOM 5694  C CD1  . LEU A 1 88  ? -3.756  10.179  6.062   1.00 0.00 ? 88  LEU A CD1  3  
ATOM 5695  C CD2  . LEU A 1 88  ? -2.785  7.992   5.333   1.00 0.00 ? 88  LEU A CD2  3  
ATOM 5696  H H    . LEU A 1 88  ? -0.684  8.070   9.629   1.00 0.00 ? 88  LEU A H    3  
ATOM 5697  H HA   . LEU A 1 88  ? -0.735  7.434   6.814   1.00 0.00 ? 88  LEU A HA   3  
ATOM 5698  H HB2  . LEU A 1 88  ? -1.763  10.041  7.882   1.00 0.00 ? 88  LEU A HB2  3  
ATOM 5699  H HB3  . LEU A 1 88  ? -1.071  9.920   6.266   1.00 0.00 ? 88  LEU A HB3  3  
ATOM 5700  H HG   . LEU A 1 88  ? -3.510  8.456   7.273   1.00 0.00 ? 88  LEU A HG   3  
ATOM 5701  H HD11 . LEU A 1 88  ? -3.099  10.889  5.583   1.00 0.00 ? 88  LEU A HD11 3  
ATOM 5702  H HD12 . LEU A 1 88  ? -4.211  10.636  6.928   1.00 0.00 ? 88  LEU A HD12 3  
ATOM 5703  H HD13 . LEU A 1 88  ? -4.526  9.875   5.368   1.00 0.00 ? 88  LEU A HD13 3  
ATOM 5704  H HD21 . LEU A 1 88  ? -1.994  8.343   4.686   1.00 0.00 ? 88  LEU A HD21 3  
ATOM 5705  H HD22 . LEU A 1 88  ? -3.708  7.933   4.775   1.00 0.00 ? 88  LEU A HD22 3  
ATOM 5706  H HD23 . LEU A 1 88  ? -2.531  7.014   5.714   1.00 0.00 ? 88  LEU A HD23 3  
ATOM 5707  N N    . PRO A 1 89  ? 1.627   8.164   6.745   1.00 0.00 ? 89  PRO A N    3  
ATOM 5708  C CA   . PRO A 1 89  ? 1.229   7.121   5.794   1.00 0.00 ? 89  PRO A CA   3  
ATOM 5709  C C    . PRO A 1 89  ? 0.884   5.807   6.487   1.00 0.00 ? 89  PRO A C    3  
ATOM 5710  O O    . PRO A 1 89  ? 0.951   5.702   7.712   1.00 0.00 ? 89  PRO A O    3  
ATOM 5711  C CB   . PRO A 1 89  ? 2.468   6.952   4.913   1.00 0.00 ? 89  PRO A CB   3  
ATOM 5712  C CG   . PRO A 1 89  ? 3.605   7.396   5.768   1.00 0.00 ? 89  PRO A CG   3  
ATOM 5713  C CD   . PRO A 1 89  ? 3.060   8.488   6.647   1.00 0.00 ? 89  PRO A CD   3  
ATOM 5714  H HA   . PRO A 1 89  ? 0.393   7.437   5.187   1.00 0.00 ? 89  PRO A HA   3  
ATOM 5715  H HB2  . PRO A 1 89  ? 2.570   5.915   4.626   1.00 0.00 ? 89  PRO A HB2  3  
ATOM 5716  H HB3  . PRO A 1 89  ? 2.375   7.568   4.031   1.00 0.00 ? 89  PRO A HB3  3  
ATOM 5717  H HG2  . PRO A 1 89  ? 3.956   6.571   6.370   1.00 0.00 ? 89  PRO A HG2  3  
ATOM 5718  H HG3  . PRO A 1 89  ? 4.403   7.777   5.149   1.00 0.00 ? 89  PRO A HG3  3  
ATOM 5719  H HD2  . PRO A 1 89  ? 3.529   8.459   7.619   1.00 0.00 ? 89  PRO A HD2  3  
ATOM 5720  H HD3  . PRO A 1 89  ? 3.206   9.453   6.183   1.00 0.00 ? 89  PRO A HD3  3  
ATOM 5721  N N    . THR A 1 90  ? 0.515   4.805   5.695   1.00 0.00 ? 90  THR A N    3  
ATOM 5722  C CA   . THR A 1 90  ? 0.159   3.498   6.232   1.00 0.00 ? 90  THR A CA   3  
ATOM 5723  C C    . THR A 1 90  ? 0.465   2.390   5.230   1.00 0.00 ? 90  THR A C    3  
ATOM 5724  O O    . THR A 1 90  ? 0.002   2.426   4.089   1.00 0.00 ? 90  THR A O    3  
ATOM 5725  C CB   . THR A 1 90  ? -1.332  3.434   6.612   1.00 0.00 ? 90  THR A CB   3  
ATOM 5726  O OG1  . THR A 1 90  ? -1.556  4.137   7.839   1.00 0.00 ? 90  THR A OG1  3  
ATOM 5727  C CG2  . THR A 1 90  ? -1.792  1.991   6.757   1.00 0.00 ? 90  THR A CG2  3  
ATOM 5728  H H    . THR A 1 90  ? 0.481   4.950   4.727   1.00 0.00 ? 90  THR A H    3  
ATOM 5729  H HA   . THR A 1 90  ? 0.744   3.334   7.125   1.00 0.00 ? 90  THR A HA   3  
ATOM 5730  H HB   . THR A 1 90  ? -1.909  3.902   5.827   1.00 0.00 ? 90  THR A HB   3  
ATOM 5731  H HG1  . THR A 1 90  ? -0.980  4.904   7.878   1.00 0.00 ? 90  THR A HG1  3  
ATOM 5732  H HG21 . THR A 1 90  ? -2.301  1.682   5.856   1.00 0.00 ? 90  THR A HG21 3  
ATOM 5733  H HG22 . THR A 1 90  ? -2.466  1.911   7.597   1.00 0.00 ? 90  THR A HG22 3  
ATOM 5734  H HG23 . THR A 1 90  ? -0.935  1.355   6.921   1.00 0.00 ? 90  THR A HG23 3  
ATOM 5735  N N    . LEU A 1 91  ? 1.245   1.406   5.663   1.00 0.00 ? 91  LEU A N    3  
ATOM 5736  C CA   . LEU A 1 91  ? 1.612   0.286   4.804   1.00 0.00 ? 91  LEU A CA   3  
ATOM 5737  C C    . LEU A 1 91  ? 0.822   -0.965  5.173   1.00 0.00 ? 91  LEU A C    3  
ATOM 5738  O O    . LEU A 1 91  ? 0.635   -1.268  6.351   1.00 0.00 ? 91  LEU A O    3  
ATOM 5739  C CB   . LEU A 1 91  ? 3.112   0.006   4.911   1.00 0.00 ? 91  LEU A CB   3  
ATOM 5740  C CG   . LEU A 1 91  ? 4.027   0.925   4.102   1.00 0.00 ? 91  LEU A CG   3  
ATOM 5741  C CD1  . LEU A 1 91  ? 5.487   0.621   4.398   1.00 0.00 ? 91  LEU A CD1  3  
ATOM 5742  C CD2  . LEU A 1 91  ? 3.742   0.785   2.613   1.00 0.00 ? 91  LEU A CD2  3  
ATOM 5743  H H    . LEU A 1 91  ? 1.583   1.433   6.582   1.00 0.00 ? 91  LEU A H    3  
ATOM 5744  H HA   . LEU A 1 91  ? 1.377   0.559   3.786   1.00 0.00 ? 91  LEU A HA   3  
ATOM 5745  H HB2  . LEU A 1 91  ? 3.391   0.093   5.950   1.00 0.00 ? 91  LEU A HB2  3  
ATOM 5746  H HB3  . LEU A 1 91  ? 3.283   -1.008  4.579   1.00 0.00 ? 91  LEU A HB3  3  
ATOM 5747  H HG   . LEU A 1 91  ? 3.837   1.952   4.384   1.00 0.00 ? 91  LEU A HG   3  
ATOM 5748  H HD11 . LEU A 1 91  ? 5.851   1.301   5.153   1.00 0.00 ? 91  LEU A HD11 3  
ATOM 5749  H HD12 . LEU A 1 91  ? 6.070   0.740   3.496   1.00 0.00 ? 91  LEU A HD12 3  
ATOM 5750  H HD13 . LEU A 1 91  ? 5.578   -0.395  4.753   1.00 0.00 ? 91  LEU A HD13 3  
ATOM 5751  H HD21 . LEU A 1 91  ? 3.533   -0.249  2.383   1.00 0.00 ? 91  LEU A HD21 3  
ATOM 5752  H HD22 . LEU A 1 91  ? 4.604   1.112   2.050   1.00 0.00 ? 91  LEU A HD22 3  
ATOM 5753  H HD23 . LEU A 1 91  ? 2.888   1.392   2.352   1.00 0.00 ? 91  LEU A HD23 3  
ATOM 5754  N N    . ILE A 1 92  ? 0.362   -1.688  4.157   1.00 0.00 ? 92  ILE A N    3  
ATOM 5755  C CA   . ILE A 1 92  ? -0.405  -2.908  4.375   1.00 0.00 ? 92  ILE A CA   3  
ATOM 5756  C C    . ILE A 1 92  ? -0.028  -3.983  3.361   1.00 0.00 ? 92  ILE A C    3  
ATOM 5757  O O    . ILE A 1 92  ? 0.088   -3.711  2.166   1.00 0.00 ? 92  ILE A O    3  
ATOM 5758  C CB   . ILE A 1 92  ? -1.920  -2.644  4.286   1.00 0.00 ? 92  ILE A CB   3  
ATOM 5759  C CG1  . ILE A 1 92  ? -2.336  -1.588  5.312   1.00 0.00 ? 92  ILE A CG1  3  
ATOM 5760  C CG2  . ILE A 1 92  ? -2.696  -3.935  4.502   1.00 0.00 ? 92  ILE A CG2  3  
ATOM 5761  C CD1  . ILE A 1 92  ? -3.743  -1.071  5.110   1.00 0.00 ? 92  ILE A CD1  3  
ATOM 5762  H H    . ILE A 1 92  ? 0.544   -1.395  3.240   1.00 0.00 ? 92  ILE A H    3  
ATOM 5763  H HA   . ILE A 1 92  ? -0.181  -3.270  5.368   1.00 0.00 ? 92  ILE A HA   3  
ATOM 5764  H HB   . ILE A 1 92  ? -2.142  -2.280  3.295   1.00 0.00 ? 92  ILE A HB   3  
ATOM 5765  H HG12 . ILE A 1 92  ? -2.279  -2.014  6.301   1.00 0.00 ? 92  ILE A HG12 3  
ATOM 5766  H HG13 . ILE A 1 92  ? -1.660  -0.747  5.247   1.00 0.00 ? 92  ILE A HG13 3  
ATOM 5767  H HG21 . ILE A 1 92  ? -3.706  -3.813  4.138   1.00 0.00 ? 92  ILE A HG21 3  
ATOM 5768  H HG22 . ILE A 1 92  ? -2.215  -4.738  3.964   1.00 0.00 ? 92  ILE A HG22 3  
ATOM 5769  H HG23 . ILE A 1 92  ? -2.719  -4.170  5.555   1.00 0.00 ? 92  ILE A HG23 3  
ATOM 5770  H HD11 . ILE A 1 92  ? -3.709  -0.128  4.584   1.00 0.00 ? 92  ILE A HD11 3  
ATOM 5771  H HD12 . ILE A 1 92  ? -4.311  -1.785  4.533   1.00 0.00 ? 92  ILE A HD12 3  
ATOM 5772  H HD13 . ILE A 1 92  ? -4.216  -0.929  6.071   1.00 0.00 ? 92  ILE A HD13 3  
ATOM 5773  N N    . LEU A 1 93  ? 0.160   -5.206  3.846   1.00 0.00 ? 93  LEU A N    3  
ATOM 5774  C CA   . LEU A 1 93  ? 0.523   -6.324  2.982   1.00 0.00 ? 93  LEU A CA   3  
ATOM 5775  C C    . LEU A 1 93  ? -0.696  -7.184  2.664   1.00 0.00 ? 93  LEU A C    3  
ATOM 5776  O O    . LEU A 1 93  ? -1.454  -7.561  3.559   1.00 0.00 ? 93  LEU A O    3  
ATOM 5777  C CB   . LEU A 1 93  ? 1.604   -7.178  3.647   1.00 0.00 ? 93  LEU A CB   3  
ATOM 5778  C CG   . LEU A 1 93  ? 2.185   -8.307  2.795   1.00 0.00 ? 93  LEU A CG   3  
ATOM 5779  C CD1  . LEU A 1 93  ? 3.288   -7.780  1.890   1.00 0.00 ? 93  LEU A CD1  3  
ATOM 5780  C CD2  . LEU A 1 93  ? 2.710   -9.427  3.681   1.00 0.00 ? 93  LEU A CD2  3  
ATOM 5781  H H    . LEU A 1 93  ? 0.053   -5.361  4.807   1.00 0.00 ? 93  LEU A H    3  
ATOM 5782  H HA   . LEU A 1 93  ? 0.912   -5.918  2.060   1.00 0.00 ? 93  LEU A HA   3  
ATOM 5783  H HB2  . LEU A 1 93  ? 2.416   -6.524  3.927   1.00 0.00 ? 93  LEU A HB2  3  
ATOM 5784  H HB3  . LEU A 1 93  ? 1.176   -7.619  4.536   1.00 0.00 ? 93  LEU A HB3  3  
ATOM 5785  H HG   . LEU A 1 93  ? 1.405   -8.714  2.167   1.00 0.00 ? 93  LEU A HG   3  
ATOM 5786  H HD11 . LEU A 1 93  ? 3.324   -6.703  1.957   1.00 0.00 ? 93  LEU A HD11 3  
ATOM 5787  H HD12 . LEU A 1 93  ? 3.086   -8.070  0.870   1.00 0.00 ? 93  LEU A HD12 3  
ATOM 5788  H HD13 . LEU A 1 93  ? 4.236   -8.193  2.200   1.00 0.00 ? 93  LEU A HD13 3  
ATOM 5789  H HD21 . LEU A 1 93  ? 3.640   -9.800  3.277   1.00 0.00 ? 93  LEU A HD21 3  
ATOM 5790  H HD22 . LEU A 1 93  ? 1.986   -10.229 3.715   1.00 0.00 ? 93  LEU A HD22 3  
ATOM 5791  H HD23 . LEU A 1 93  ? 2.876   -9.049  4.679   1.00 0.00 ? 93  LEU A HD23 3  
ATOM 5792  N N    . PHE A 1 94  ? -0.879  -7.492  1.384   1.00 0.00 ? 94  PHE A N    3  
ATOM 5793  C CA   . PHE A 1 94  ? -2.006  -8.309  0.948   1.00 0.00 ? 94  PHE A CA   3  
ATOM 5794  C C    . PHE A 1 94  ? -1.523  -9.635  0.367   1.00 0.00 ? 94  PHE A C    3  
ATOM 5795  O O    . PHE A 1 94  ? -0.795  -9.661  -0.624  1.00 0.00 ? 94  PHE A O    3  
ATOM 5796  C CB   . PHE A 1 94  ? -2.836  -7.555  -0.093  1.00 0.00 ? 94  PHE A CB   3  
ATOM 5797  C CG   . PHE A 1 94  ? -3.404  -6.261  0.416   1.00 0.00 ? 94  PHE A CG   3  
ATOM 5798  C CD1  . PHE A 1 94  ? -4.624  -6.235  1.072   1.00 0.00 ? 94  PHE A CD1  3  
ATOM 5799  C CD2  . PHE A 1 94  ? -2.719  -5.070  0.237   1.00 0.00 ? 94  PHE A CD2  3  
ATOM 5800  C CE1  . PHE A 1 94  ? -5.149  -5.046  1.542   1.00 0.00 ? 94  PHE A CE1  3  
ATOM 5801  C CE2  . PHE A 1 94  ? -3.239  -3.879  0.704   1.00 0.00 ? 94  PHE A CE2  3  
ATOM 5802  C CZ   . PHE A 1 94  ? -4.456  -3.866  1.357   1.00 0.00 ? 94  PHE A CZ   3  
ATOM 5803  H H    . PHE A 1 94  ? -0.241  -7.161  0.717   1.00 0.00 ? 94  PHE A H    3  
ATOM 5804  H HA   . PHE A 1 94  ? -2.622  -8.510  1.811   1.00 0.00 ? 94  PHE A HA   3  
ATOM 5805  H HB2  . PHE A 1 94  ? -2.213  -7.331  -0.946  1.00 0.00 ? 94  PHE A HB2  3  
ATOM 5806  H HB3  . PHE A 1 94  ? -3.659  -8.180  -0.407  1.00 0.00 ? 94  PHE A HB3  3  
ATOM 5807  H HD1  . PHE A 1 94  ? -5.167  -7.159  1.218   1.00 0.00 ? 94  PHE A HD1  3  
ATOM 5808  H HD2  . PHE A 1 94  ? -1.767  -5.078  -0.275  1.00 0.00 ? 94  PHE A HD2  3  
ATOM 5809  H HE1  . PHE A 1 94  ? -6.101  -5.041  2.052   1.00 0.00 ? 94  PHE A HE1  3  
ATOM 5810  H HE2  . PHE A 1 94  ? -2.695  -2.957  0.558   1.00 0.00 ? 94  PHE A HE2  3  
ATOM 5811  H HZ   . PHE A 1 94  ? -4.865  -2.936  1.724   1.00 0.00 ? 94  PHE A HZ   3  
ATOM 5812  N N    . GLN A 1 95  ? -1.935  -10.733 0.994   1.00 0.00 ? 95  GLN A N    3  
ATOM 5813  C CA   . GLN A 1 95  ? -1.543  -12.062 0.540   1.00 0.00 ? 95  GLN A CA   3  
ATOM 5814  C C    . GLN A 1 95  ? -2.765  -12.879 0.133   1.00 0.00 ? 95  GLN A C    3  
ATOM 5815  O O    . GLN A 1 95  ? -3.211  -13.758 0.870   1.00 0.00 ? 95  GLN A O    3  
ATOM 5816  C CB   . GLN A 1 95  ? -0.771  -12.792 1.640   1.00 0.00 ? 95  GLN A CB   3  
ATOM 5817  C CG   . GLN A 1 95  ? 0.608   -12.209 1.905   1.00 0.00 ? 95  GLN A CG   3  
ATOM 5818  C CD   . GLN A 1 95  ? 1.518   -13.172 2.640   1.00 0.00 ? 95  GLN A CD   3  
ATOM 5819  O OE1  . GLN A 1 95  ? 1.089   -14.242 3.073   1.00 0.00 ? 95  GLN A OE1  3  
ATOM 5820  N NE2  . GLN A 1 95  ? 2.784   -12.798 2.786   1.00 0.00 ? 95  GLN A NE2  3  
ATOM 5821  H H    . GLN A 1 95  ? -2.514  -10.646 1.779   1.00 0.00 ? 95  GLN A H    3  
ATOM 5822  H HA   . GLN A 1 95  ? -0.902  -11.943 -0.320  1.00 0.00 ? 95  GLN A HA   3  
ATOM 5823  H HB2  . GLN A 1 95  ? -1.340  -12.745 2.556   1.00 0.00 ? 95  GLN A HB2  3  
ATOM 5824  H HB3  . GLN A 1 95  ? -0.650  -13.826 1.353   1.00 0.00 ? 95  GLN A HB3  3  
ATOM 5825  H HG2  . GLN A 1 95  ? 1.066   -11.956 0.960   1.00 0.00 ? 95  GLN A HG2  3  
ATOM 5826  H HG3  . GLN A 1 95  ? 0.498   -11.315 2.501   1.00 0.00 ? 95  GLN A HG3  3  
ATOM 5827  H HE21 . GLN A 1 95  ? 3.055   -11.931 2.416   1.00 0.00 ? 95  GLN A HE21 3  
ATOM 5828  H HE22 . GLN A 1 95  ? 3.394   -13.401 3.258   1.00 0.00 ? 95  GLN A HE22 3  
ATOM 5829  N N    . GLY A 1 96  ? -3.302  -12.583 -1.047  1.00 0.00 ? 96  GLY A N    3  
ATOM 5830  C CA   . GLY A 1 96  ? -4.468  -13.299 -1.532  1.00 0.00 ? 96  GLY A CA   3  
ATOM 5831  C C    . GLY A 1 96  ? -5.759  -12.551 -1.268  1.00 0.00 ? 96  GLY A C    3  
ATOM 5832  O O    . GLY A 1 96  ? -6.770  -13.152 -0.905  1.00 0.00 ? 96  GLY A O    3  
ATOM 5833  H H    . GLY A 1 96  ? -2.904  -11.873 -1.592  1.00 0.00 ? 96  GLY A H    3  
ATOM 5834  H HA2  . GLY A 1 96  ? -4.365  -13.454 -2.596  1.00 0.00 ? 96  GLY A HA2  3  
ATOM 5835  H HA3  . GLY A 1 96  ? -4.515  -14.260 -1.041  1.00 0.00 ? 96  GLY A HA3  3  
ATOM 5836  N N    . GLY A 1 97  ? -5.727  -11.234 -1.449  1.00 0.00 ? 97  GLY A N    3  
ATOM 5837  C CA   . GLY A 1 97  ? -6.909  -10.425 -1.221  1.00 0.00 ? 97  GLY A CA   3  
ATOM 5838  C C    . GLY A 1 97  ? -7.190  -10.210 0.253   1.00 0.00 ? 97  GLY A C    3  
ATOM 5839  O O    . GLY A 1 97  ? -8.154  -9.537  0.618   1.00 0.00 ? 97  GLY A O    3  
ATOM 5840  H H    . GLY A 1 97  ? -4.893  -10.809 -1.739  1.00 0.00 ? 97  GLY A H    3  
ATOM 5841  H HA2  . GLY A 1 97  ? -6.771  -9.464  -1.694  1.00 0.00 ? 97  GLY A HA2  3  
ATOM 5842  H HA3  . GLY A 1 97  ? -7.760  -10.916 -1.669  1.00 0.00 ? 97  GLY A HA3  3  
ATOM 5843  N N    . LYS A 1 98  ? -6.347  -10.786 1.104   1.00 0.00 ? 98  LYS A N    3  
ATOM 5844  C CA   . LYS A 1 98  ? -6.509  -10.656 2.547   1.00 0.00 ? 98  LYS A CA   3  
ATOM 5845  C C    . LYS A 1 98  ? -5.306  -9.951  3.168   1.00 0.00 ? 98  LYS A C    3  
ATOM 5846  O O    . LYS A 1 98  ? -4.162  -10.226 2.809   1.00 0.00 ? 98  LYS A O    3  
ATOM 5847  C CB   . LYS A 1 98  ? -6.692  -12.034 3.187   1.00 0.00 ? 98  LYS A CB   3  
ATOM 5848  C CG   . LYS A 1 98  ? -7.776  -12.870 2.530   1.00 0.00 ? 98  LYS A CG   3  
ATOM 5849  C CD   . LYS A 1 98  ? -7.480  -14.356 2.644   1.00 0.00 ? 98  LYS A CD   3  
ATOM 5850  C CE   . LYS A 1 98  ? -7.509  -14.821 4.092   1.00 0.00 ? 98  LYS A CE   3  
ATOM 5851  N NZ   . LYS A 1 98  ? -7.556  -16.306 4.197   1.00 0.00 ? 98  LYS A NZ   3  
ATOM 5852  H H    . LYS A 1 98  ? -5.597  -11.311 0.752   1.00 0.00 ? 98  LYS A H    3  
ATOM 5853  H HA   . LYS A 1 98  ? -7.392  -10.063 2.730   1.00 0.00 ? 98  LYS A HA   3  
ATOM 5854  H HB2  . LYS A 1 98  ? -5.760  -12.575 3.121   1.00 0.00 ? 98  LYS A HB2  3  
ATOM 5855  H HB3  . LYS A 1 98  ? -6.949  -11.902 4.228   1.00 0.00 ? 98  LYS A HB3  3  
ATOM 5856  H HG2  . LYS A 1 98  ? -8.720  -12.664 3.013   1.00 0.00 ? 98  LYS A HG2  3  
ATOM 5857  H HG3  . LYS A 1 98  ? -7.839  -12.604 1.485   1.00 0.00 ? 98  LYS A HG3  3  
ATOM 5858  H HD2  . LYS A 1 98  ? -8.223  -14.906 2.086   1.00 0.00 ? 98  LYS A HD2  3  
ATOM 5859  H HD3  . LYS A 1 98  ? -6.500  -14.552 2.232   1.00 0.00 ? 98  LYS A HD3  3  
ATOM 5860  H HE2  . LYS A 1 98  ? -6.622  -14.461 4.590   1.00 0.00 ? 98  LYS A HE2  3  
ATOM 5861  H HE3  . LYS A 1 98  ? -8.384  -14.407 4.571   1.00 0.00 ? 98  LYS A HE3  3  
ATOM 5862  H HZ1  . LYS A 1 98  ? -8.452  -16.605 4.632   1.00 0.00 ? 98  LYS A HZ1  3  
ATOM 5863  H HZ2  . LYS A 1 98  ? -6.768  -16.647 4.784   1.00 0.00 ? 98  LYS A HZ2  3  
ATOM 5864  H HZ3  . LYS A 1 98  ? -7.481  -16.734 3.253   1.00 0.00 ? 98  LYS A HZ3  3  
ATOM 5865  N N    . GLU A 1 99  ? -5.575  -9.044  4.101   1.00 0.00 ? 99  GLU A N    3  
ATOM 5866  C CA   . GLU A 1 99  ? -4.513  -8.301  4.772   1.00 0.00 ? 99  GLU A CA   3  
ATOM 5867  C C    . GLU A 1 99  ? -3.785  -9.185  5.780   1.00 0.00 ? 99  GLU A C    3  
ATOM 5868  O O    . GLU A 1 99  ? -4.363  -9.609  6.781   1.00 0.00 ? 99  GLU A O    3  
ATOM 5869  C CB   . GLU A 1 99  ? -5.088  -7.071  5.476   1.00 0.00 ? 99  GLU A CB   3  
ATOM 5870  C CG   . GLU A 1 99  ? -4.101  -6.386  6.407   1.00 0.00 ? 99  GLU A CG   3  
ATOM 5871  C CD   . GLU A 1 99  ? -4.159  -6.930  7.821   1.00 0.00 ? 99  GLU A CD   3  
ATOM 5872  O OE1  . GLU A 1 99  ? -5.154  -7.605  8.157   1.00 0.00 ? 99  GLU A OE1  3  
ATOM 5873  O OE2  . GLU A 1 99  ? -3.208  -6.680  8.591   1.00 0.00 ? 99  GLU A OE2  3  
ATOM 5874  H H    . GLU A 1 99  ? -6.508  -8.869  4.345   1.00 0.00 ? 99  GLU A H    3  
ATOM 5875  H HA   . GLU A 1 99  ? -3.809  -7.978  4.020   1.00 0.00 ? 99  GLU A HA   3  
ATOM 5876  H HB2  . GLU A 1 99  ? -5.402  -6.357  4.729   1.00 0.00 ? 99  GLU A HB2  3  
ATOM 5877  H HB3  . GLU A 1 99  ? -5.948  -7.372  6.056   1.00 0.00 ? 99  GLU A HB3  3  
ATOM 5878  H HG2  . GLU A 1 99  ? -3.103  -6.531  6.022   1.00 0.00 ? 99  GLU A HG2  3  
ATOM 5879  H HG3  . GLU A 1 99  ? -4.325  -5.330  6.434   1.00 0.00 ? 99  GLU A HG3  3  
ATOM 5880  N N    . ALA A 1 100 ? -2.513  -9.457  5.509   1.00 0.00 ? 100 ALA A N    3  
ATOM 5881  C CA   . ALA A 1 100 ? -1.704  -10.289 6.392   1.00 0.00 ? 100 ALA A CA   3  
ATOM 5882  C C    . ALA A 1 100 ? -1.212  -9.493  7.596   1.00 0.00 ? 100 ALA A C    3  
ATOM 5883  O O    . ALA A 1 100 ? -1.036  -10.040 8.684   1.00 0.00 ? 100 ALA A O    3  
ATOM 5884  C CB   . ALA A 1 100 ? -0.527  -10.879 5.631   1.00 0.00 ? 100 ALA A CB   3  
ATOM 5885  H H    . ALA A 1 100 ? -2.108  -9.090  4.696   1.00 0.00 ? 100 ALA A H    3  
ATOM 5886  H HA   . ALA A 1 100 ? -2.322  -11.104 6.741   1.00 0.00 ? 100 ALA A HA   3  
ATOM 5887  H HB1  . ALA A 1 100 ? -0.244  -11.820 6.080   1.00 0.00 ? 100 ALA A HB1  3  
ATOM 5888  H HB2  . ALA A 1 100 ? -0.810  -11.042 4.601   1.00 0.00 ? 100 ALA A HB2  3  
ATOM 5889  H HB3  . ALA A 1 100 ? 0.307   -10.195 5.671   1.00 0.00 ? 100 ALA A HB3  3  
ATOM 5890  N N    . MET A 1 101 ? -0.991  -8.198  7.394   1.00 0.00 ? 101 MET A N    3  
ATOM 5891  C CA   . MET A 1 101 ? -0.519  -7.327  8.464   1.00 0.00 ? 101 MET A CA   3  
ATOM 5892  C C    . MET A 1 101 ? -0.465  -5.875  7.999   1.00 0.00 ? 101 MET A C    3  
ATOM 5893  O O    . MET A 1 101 ? -0.368  -5.600  6.803   1.00 0.00 ? 101 MET A O    3  
ATOM 5894  C CB   . MET A 1 101 ? 0.863   -7.774  8.942   1.00 0.00 ? 101 MET A CB   3  
ATOM 5895  C CG   . MET A 1 101 ? 1.984   -7.420  7.977   1.00 0.00 ? 101 MET A CG   3  
ATOM 5896  S SD   . MET A 1 101 ? 3.580   -7.254  8.798   1.00 0.00 ? 101 MET A SD   3  
ATOM 5897  C CE   . MET A 1 101 ? 3.651   -5.482  9.046   1.00 0.00 ? 101 MET A CE   3  
ATOM 5898  H H    . MET A 1 101 ? -1.150  -7.818  6.504   1.00 0.00 ? 101 MET A H    3  
ATOM 5899  H HA   . MET A 1 101 ? -1.216  -7.404  9.285   1.00 0.00 ? 101 MET A HA   3  
ATOM 5900  H HB2  . MET A 1 101 ? 1.073   -7.303  9.891   1.00 0.00 ? 101 MET A HB2  3  
ATOM 5901  H HB3  . MET A 1 101 ? 0.857   -8.846  9.074   1.00 0.00 ? 101 MET A HB3  3  
ATOM 5902  H HG2  . MET A 1 101 ? 2.058   -8.198  7.232   1.00 0.00 ? 101 MET A HG2  3  
ATOM 5903  H HG3  . MET A 1 101 ? 1.743   -6.484  7.496   1.00 0.00 ? 101 MET A HG3  3  
ATOM 5904  H HE1  . MET A 1 101 ? 2.679   -5.052  8.857   1.00 0.00 ? 101 MET A HE1  3  
ATOM 5905  H HE2  . MET A 1 101 ? 3.945   -5.272  10.064  1.00 0.00 ? 101 MET A HE2  3  
ATOM 5906  H HE3  . MET A 1 101 ? 4.373   -5.052  8.367   1.00 0.00 ? 101 MET A HE3  3  
ATOM 5907  N N    . ARG A 1 102 ? -0.527  -4.950  8.952   1.00 0.00 ? 102 ARG A N    3  
ATOM 5908  C CA   . ARG A 1 102 ? -0.486  -3.527  8.639   1.00 0.00 ? 102 ARG A CA   3  
ATOM 5909  C C    . ARG A 1 102 ? 0.582   -2.819  9.468   1.00 0.00 ? 102 ARG A C    3  
ATOM 5910  O O    . ARG A 1 102 ? 1.039   -3.340  10.485  1.00 0.00 ? 102 ARG A O    3  
ATOM 5911  C CB   . ARG A 1 102 ? -1.852  -2.888  8.894   1.00 0.00 ? 102 ARG A CB   3  
ATOM 5912  C CG   . ARG A 1 102 ? -2.246  -2.858  10.361  1.00 0.00 ? 102 ARG A CG   3  
ATOM 5913  C CD   . ARG A 1 102 ? -3.395  -1.893  10.610  1.00 0.00 ? 102 ARG A CD   3  
ATOM 5914  N NE   . ARG A 1 102 ? -4.637  -2.351  9.995   1.00 0.00 ? 102 ARG A NE   3  
ATOM 5915  C CZ   . ARG A 1 102 ? -5.702  -1.575  9.823   1.00 0.00 ? 102 ARG A CZ   3  
ATOM 5916  N NH1  . ARG A 1 102 ? -5.675  -0.310  10.217  1.00 0.00 ? 102 ARG A NH1  3  
ATOM 5917  N NH2  . ARG A 1 102 ? -6.797  -2.066  9.256   1.00 0.00 ? 102 ARG A NH2  3  
ATOM 5918  H H    . ARG A 1 102 ? -0.603  -5.232  9.887   1.00 0.00 ? 102 ARG A H    3  
ATOM 5919  H HA   . ARG A 1 102 ? -0.240  -3.424  7.593   1.00 0.00 ? 102 ARG A HA   3  
ATOM 5920  H HB2  . ARG A 1 102 ? -1.835  -1.872  8.528   1.00 0.00 ? 102 ARG A HB2  3  
ATOM 5921  H HB3  . ARG A 1 102 ? -2.603  -3.444  8.353   1.00 0.00 ? 102 ARG A HB3  3  
ATOM 5922  H HG2  . ARG A 1 102 ? -2.551  -3.849  10.663  1.00 0.00 ? 102 ARG A HG2  3  
ATOM 5923  H HG3  . ARG A 1 102 ? -1.393  -2.548  10.947  1.00 0.00 ? 102 ARG A HG3  3  
ATOM 5924  H HD2  . ARG A 1 102 ? -3.544  -1.799  11.675  1.00 0.00 ? 102 ARG A HD2  3  
ATOM 5925  H HD3  . ARG A 1 102 ? -3.133  -0.930  10.198  1.00 0.00 ? 102 ARG A HD3  3  
ATOM 5926  H HE   . ARG A 1 102 ? -4.679  -3.283  9.697   1.00 0.00 ? 102 ARG A HE   3  
ATOM 5927  H HH11 . ARG A 1 102 ? -4.851  0.062   10.644  1.00 0.00 ? 102 ARG A HH11 3  
ATOM 5928  H HH12 . ARG A 1 102 ? -6.477  0.273   10.085  1.00 0.00 ? 102 ARG A HH12 3  
ATOM 5929  H HH21 . ARG A 1 102 ? -6.821  -3.019  8.957   1.00 0.00 ? 102 ARG A HH21 3  
ATOM 5930  H HH22 . ARG A 1 102 ? -7.597  -1.481  9.127   1.00 0.00 ? 102 ARG A HH22 3  
ATOM 5931  N N    . ARG A 1 103 ? 0.975   -1.629  9.024   1.00 0.00 ? 103 ARG A N    3  
ATOM 5932  C CA   . ARG A 1 103 ? 1.990   -0.851  9.724   1.00 0.00 ? 103 ARG A CA   3  
ATOM 5933  C C    . ARG A 1 103 ? 1.768   0.645   9.515   1.00 0.00 ? 103 ARG A C    3  
ATOM 5934  O O    . ARG A 1 103 ? 1.742   1.142   8.389   1.00 0.00 ? 103 ARG A O    3  
ATOM 5935  C CB   . ARG A 1 103 ? 3.387   -1.242  9.239   1.00 0.00 ? 103 ARG A CB   3  
ATOM 5936  C CG   . ARG A 1 103 ? 4.461   -1.109  10.307  1.00 0.00 ? 103 ARG A CG   3  
ATOM 5937  C CD   . ARG A 1 103 ? 4.587   -2.380  11.132  1.00 0.00 ? 103 ARG A CD   3  
ATOM 5938  N NE   . ARG A 1 103 ? 3.690   -2.376  12.284  1.00 0.00 ? 103 ARG A NE   3  
ATOM 5939  C CZ   . ARG A 1 103 ? 3.984   -1.796  13.443  1.00 0.00 ? 103 ARG A CZ   3  
ATOM 5940  N NH1  . ARG A 1 103 ? 5.146   -1.177  13.601  1.00 0.00 ? 103 ARG A NH1  3  
ATOM 5941  N NH2  . ARG A 1 103 ? 3.115   -1.835  14.445  1.00 0.00 ? 103 ARG A NH2  3  
ATOM 5942  H H    . ARG A 1 103 ? 0.574   -1.267  8.207   1.00 0.00 ? 103 ARG A H    3  
ATOM 5943  H HA   . ARG A 1 103 ? 1.909   -1.071  10.778  1.00 0.00 ? 103 ARG A HA   3  
ATOM 5944  H HB2  . ARG A 1 103 ? 3.366   -2.269  8.907   1.00 0.00 ? 103 ARG A HB2  3  
ATOM 5945  H HB3  . ARG A 1 103 ? 3.657   -0.609  8.408   1.00 0.00 ? 103 ARG A HB3  3  
ATOM 5946  H HG2  . ARG A 1 103 ? 5.409   -0.909  9.828   1.00 0.00 ? 103 ARG A HG2  3  
ATOM 5947  H HG3  . ARG A 1 103 ? 4.206   -0.289  10.961  1.00 0.00 ? 103 ARG A HG3  3  
ATOM 5948  H HD2  . ARG A 1 103 ? 4.347   -3.226  10.504  1.00 0.00 ? 103 ARG A HD2  3  
ATOM 5949  H HD3  . ARG A 1 103 ? 5.605   -2.468  11.480  1.00 0.00 ? 103 ARG A HD3  3  
ATOM 5950  H HE   . ARG A 1 103 ? 2.826   -2.828  12.188  1.00 0.00 ? 103 ARG A HE   3  
ATOM 5951  H HH11 . ARG A 1 103 ? 5.802   -1.146  12.848  1.00 0.00 ? 103 ARG A HH11 3  
ATOM 5952  H HH12 . ARG A 1 103 ? 5.365   -0.741  14.474  1.00 0.00 ? 103 ARG A HH12 3  
ATOM 5953  H HH21 . ARG A 1 103 ? 2.239   -2.300  14.329  1.00 0.00 ? 103 ARG A HH21 3  
ATOM 5954  H HH22 . ARG A 1 103 ? 3.338   -1.399  15.316  1.00 0.00 ? 103 ARG A HH22 3  
ATOM 5955  N N    . PRO A 1 104 ? 1.603   1.379   10.625  1.00 0.00 ? 104 PRO A N    3  
ATOM 5956  C CA   . PRO A 1 104 ? 1.631   0.798   11.970  1.00 0.00 ? 104 PRO A CA   3  
ATOM 5957  C C    . PRO A 1 104 ? 0.414   -0.076  12.250  1.00 0.00 ? 104 PRO A C    3  
ATOM 5958  O O    . PRO A 1 104 ? -0.476  -0.202  11.410  1.00 0.00 ? 104 PRO A O    3  
ATOM 5959  C CB   . PRO A 1 104 ? 1.631   2.024   12.887  1.00 0.00 ? 104 PRO A CB   3  
ATOM 5960  C CG   . PRO A 1 104 ? 0.988   3.100   12.080  1.00 0.00 ? 104 PRO A CG   3  
ATOM 5961  C CD   . PRO A 1 104 ? 1.376   2.834   10.652  1.00 0.00 ? 104 PRO A CD   3  
ATOM 5962  H HA   . PRO A 1 104 ? 2.531   0.223   12.136  1.00 0.00 ? 104 PRO A HA   3  
ATOM 5963  H HB2  . PRO A 1 104 ? 1.065   1.808   13.782  1.00 0.00 ? 104 PRO A HB2  3  
ATOM 5964  H HB3  . PRO A 1 104 ? 2.646   2.282   13.149  1.00 0.00 ? 104 PRO A HB3  3  
ATOM 5965  H HG2  . PRO A 1 104 ? -0.084  3.052   12.193  1.00 0.00 ? 104 PRO A HG2  3  
ATOM 5966  H HG3  . PRO A 1 104 ? 1.357   4.065   12.395  1.00 0.00 ? 104 PRO A HG3  3  
ATOM 5967  H HD2  . PRO A 1 104 ? 0.572   3.111   9.985   1.00 0.00 ? 104 PRO A HD2  3  
ATOM 5968  H HD3  . PRO A 1 104 ? 2.279   3.369   10.400  1.00 0.00 ? 104 PRO A HD3  3  
ATOM 5969  N N    . GLN A 1 105 ? 0.381   -0.676  13.436  1.00 0.00 ? 105 GLN A N    3  
ATOM 5970  C CA   . GLN A 1 105 ? -0.728  -1.538  13.825  1.00 0.00 ? 105 GLN A CA   3  
ATOM 5971  C C    . GLN A 1 105 ? -1.511  -0.929  14.983  1.00 0.00 ? 105 GLN A C    3  
ATOM 5972  O O    . GLN A 1 105 ? -0.940  -0.267  15.851  1.00 0.00 ? 105 GLN A O    3  
ATOM 5973  C CB   . GLN A 1 105 ? -0.212  -2.924  14.216  1.00 0.00 ? 105 GLN A CB   3  
ATOM 5974  C CG   . GLN A 1 105 ? -1.297  -3.987  14.260  1.00 0.00 ? 105 GLN A CG   3  
ATOM 5975  C CD   . GLN A 1 105 ? -0.877  -5.218  15.039  1.00 0.00 ? 105 GLN A CD   3  
ATOM 5976  O OE1  . GLN A 1 105 ? -1.144  -5.331  16.235  1.00 0.00 ? 105 GLN A OE1  3  
ATOM 5977  N NE2  . GLN A 1 105 ? -0.215  -6.150  14.362  1.00 0.00 ? 105 GLN A NE2  3  
ATOM 5978  H H    . GLN A 1 105 ? 1.121   -0.536  14.063  1.00 0.00 ? 105 GLN A H    3  
ATOM 5979  H HA   . GLN A 1 105 ? -1.386  -1.636  12.975  1.00 0.00 ? 105 GLN A HA   3  
ATOM 5980  H HB2  . GLN A 1 105 ? 0.536   -3.232  13.500  1.00 0.00 ? 105 GLN A HB2  3  
ATOM 5981  H HB3  . GLN A 1 105 ? 0.242   -2.863  15.194  1.00 0.00 ? 105 GLN A HB3  3  
ATOM 5982  H HG2  . GLN A 1 105 ? -2.176  -3.568  14.727  1.00 0.00 ? 105 GLN A HG2  3  
ATOM 5983  H HG3  . GLN A 1 105 ? -1.534  -4.283  13.248  1.00 0.00 ? 105 GLN A HG3  3  
ATOM 5984  H HE21 . GLN A 1 105 ? -0.037  -5.992  13.411  1.00 0.00 ? 105 GLN A HE21 3  
ATOM 5985  H HE22 . GLN A 1 105 ? 0.069   -6.955  14.841  1.00 0.00 ? 105 GLN A HE22 3  
ATOM 5986  N N    . ILE A 1 106 ? -2.820  -1.156  14.991  1.00 0.00 ? 106 ILE A N    3  
ATOM 5987  C CA   . ILE A 1 106 ? -3.680  -0.630  16.043  1.00 0.00 ? 106 ILE A CA   3  
ATOM 5988  C C    . ILE A 1 106 ? -3.857  -1.644  17.168  1.00 0.00 ? 106 ILE A C    3  
ATOM 5989  O O    . ILE A 1 106 ? -4.027  -2.838  16.920  1.00 0.00 ? 106 ILE A O    3  
ATOM 5990  C CB   . ILE A 1 106 ? -5.066  -0.241  15.495  1.00 0.00 ? 106 ILE A CB   3  
ATOM 5991  C CG1  . ILE A 1 106 ? -4.924  0.488   14.158  1.00 0.00 ? 106 ILE A CG1  3  
ATOM 5992  C CG2  . ILE A 1 106 ? -5.809  0.626   16.501  1.00 0.00 ? 106 ILE A CG2  3  
ATOM 5993  C CD1  . ILE A 1 106 ? -4.228  1.826   14.270  1.00 0.00 ? 106 ILE A CD1  3  
ATOM 5994  H H    . ILE A 1 106 ? -3.217  -1.691  14.272  1.00 0.00 ? 106 ILE A H    3  
ATOM 5995  H HA   . ILE A 1 106 ? -3.212  0.258   16.443  1.00 0.00 ? 106 ILE A HA   3  
ATOM 5996  H HB   . ILE A 1 106 ? -5.636  -1.145  15.345  1.00 0.00 ? 106 ILE A HB   3  
ATOM 5997  H HG12 . ILE A 1 106 ? -4.354  -0.126  13.479  1.00 0.00 ? 106 ILE A HG12 3  
ATOM 5998  H HG13 . ILE A 1 106 ? -5.907  0.659   13.743  1.00 0.00 ? 106 ILE A HG13 3  
ATOM 5999  H HG21 . ILE A 1 106 ? -6.874  0.505   16.363  1.00 0.00 ? 106 ILE A HG21 3  
ATOM 6000  H HG22 . ILE A 1 106 ? -5.541  0.325   17.503  1.00 0.00 ? 106 ILE A HG22 3  
ATOM 6001  H HG23 . ILE A 1 106 ? -5.542  1.661   16.351  1.00 0.00 ? 106 ILE A HG23 3  
ATOM 6002  H HD11 . ILE A 1 106 ? -3.704  1.882   15.213  1.00 0.00 ? 106 ILE A HD11 3  
ATOM 6003  H HD12 . ILE A 1 106 ? -3.524  1.935   13.459  1.00 0.00 ? 106 ILE A HD12 3  
ATOM 6004  H HD13 . ILE A 1 106 ? -4.961  2.619   14.219  1.00 0.00 ? 106 ILE A HD13 3  
ATOM 6005  N N    . ASP A 1 107 ? -3.816  -1.161  18.404  1.00 0.00 ? 107 ASP A N    3  
ATOM 6006  C CA   . ASP A 1 107 ? -3.975  -2.025  19.569  1.00 0.00 ? 107 ASP A CA   3  
ATOM 6007  C C    . ASP A 1 107 ? -5.451  -2.253  19.879  1.00 0.00 ? 107 ASP A C    3  
ATOM 6008  O O    . ASP A 1 107 ? -5.922  -1.939  20.972  1.00 0.00 ? 107 ASP A O    3  
ATOM 6009  C CB   . ASP A 1 107 ? -3.274  -1.414  20.783  1.00 0.00 ? 107 ASP A CB   3  
ATOM 6010  C CG   . ASP A 1 107 ? -1.764  -1.501  20.685  1.00 0.00 ? 107 ASP A CG   3  
ATOM 6011  O OD1  . ASP A 1 107 ? -1.259  -2.535  20.198  1.00 0.00 ? 107 ASP A OD1  3  
ATOM 6012  O OD2  . ASP A 1 107 ? -1.086  -0.535  21.093  1.00 0.00 ? 107 ASP A OD2  3  
ATOM 6013  H H    . ASP A 1 107 ? -3.677  -0.200  18.538  1.00 0.00 ? 107 ASP A H    3  
ATOM 6014  H HA   . ASP A 1 107 ? -3.516  -2.975  19.341  1.00 0.00 ? 107 ASP A HA   3  
ATOM 6015  H HB2  . ASP A 1 107 ? -3.551  -0.373  20.864  1.00 0.00 ? 107 ASP A HB2  3  
ATOM 6016  H HB3  . ASP A 1 107 ? -3.590  -1.937  21.674  1.00 0.00 ? 107 ASP A HB3  3  
ATOM 6017  N N    . LYS A 1 108 ? -6.176  -2.801  18.910  1.00 0.00 ? 108 LYS A N    3  
ATOM 6018  C CA   . LYS A 1 108 ? -7.599  -3.073  19.078  1.00 0.00 ? 108 LYS A CA   3  
ATOM 6019  C C    . LYS A 1 108 ? -8.267  -1.978  19.903  1.00 0.00 ? 108 LYS A C    3  
ATOM 6020  O O    . LYS A 1 108 ? -9.202  -2.239  20.660  1.00 0.00 ? 108 LYS A O    3  
ATOM 6021  C CB   . LYS A 1 108 ? -7.803  -4.431  19.753  1.00 0.00 ? 108 LYS A CB   3  
ATOM 6022  C CG   . LYS A 1 108 ? -9.211  -4.980  19.600  1.00 0.00 ? 108 LYS A CG   3  
ATOM 6023  C CD   . LYS A 1 108 ? -9.351  -6.345  20.252  1.00 0.00 ? 108 LYS A CD   3  
ATOM 6024  C CE   . LYS A 1 108 ? -9.408  -6.236  21.768  1.00 0.00 ? 108 LYS A CE   3  
ATOM 6025  N NZ   . LYS A 1 108 ? -10.648 -5.552  22.229  1.00 0.00 ? 108 LYS A NZ   3  
ATOM 6026  H H    . LYS A 1 108 ? -5.743  -3.030  18.060  1.00 0.00 ? 108 LYS A H    3  
ATOM 6027  H HA   . LYS A 1 108 ? -8.050  -3.095  18.098  1.00 0.00 ? 108 LYS A HA   3  
ATOM 6028  H HB2  . LYS A 1 108 ? -7.114  -5.141  19.322  1.00 0.00 ? 108 LYS A HB2  3  
ATOM 6029  H HB3  . LYS A 1 108 ? -7.591  -4.331  20.808  1.00 0.00 ? 108 LYS A HB3  3  
ATOM 6030  H HG2  . LYS A 1 108 ? -9.907  -4.297  20.066  1.00 0.00 ? 108 LYS A HG2  3  
ATOM 6031  H HG3  . LYS A 1 108 ? -9.441  -5.068  18.548  1.00 0.00 ? 108 LYS A HG3  3  
ATOM 6032  H HD2  . LYS A 1 108 ? -10.261 -6.810  19.902  1.00 0.00 ? 108 LYS A HD2  3  
ATOM 6033  H HD3  . LYS A 1 108 ? -8.503  -6.955  19.975  1.00 0.00 ? 108 LYS A HD3  3  
ATOM 6034  H HE2  . LYS A 1 108 ? -9.377  -7.229  22.189  1.00 0.00 ? 108 LYS A HE2  3  
ATOM 6035  H HE3  . LYS A 1 108 ? -8.550  -5.674  22.107  1.00 0.00 ? 108 LYS A HE3  3  
ATOM 6036  H HZ1  . LYS A 1 108 ? -10.508 -4.522  22.232  1.00 0.00 ? 108 LYS A HZ1  3  
ATOM 6037  H HZ2  . LYS A 1 108 ? -10.889 -5.860  23.192  1.00 0.00 ? 108 LYS A HZ2  3  
ATOM 6038  H HZ3  . LYS A 1 108 ? -11.440 -5.782  21.595  1.00 0.00 ? 108 LYS A HZ3  3  
ATOM 6039  N N    . LYS A 1 109 ? -7.784  -0.749  19.750  1.00 0.00 ? 109 LYS A N    3  
ATOM 6040  C CA   . LYS A 1 109 ? -8.336  0.387   20.478  1.00 0.00 ? 109 LYS A CA   3  
ATOM 6041  C C    . LYS A 1 109 ? -8.630  1.547   19.533  1.00 0.00 ? 109 LYS A C    3  
ATOM 6042  O O    . LYS A 1 109 ? -9.591  2.291   19.727  1.00 0.00 ? 109 LYS A O    3  
ATOM 6043  C CB   . LYS A 1 109 ? -7.365  0.839   21.571  1.00 0.00 ? 109 LYS A CB   3  
ATOM 6044  C CG   . LYS A 1 109 ? -7.341  -0.079  22.781  1.00 0.00 ? 109 LYS A CG   3  
ATOM 6045  C CD   . LYS A 1 109 ? -8.375  0.333   23.815  1.00 0.00 ? 109 LYS A CD   3  
ATOM 6046  C CE   . LYS A 1 109 ? -7.917  1.547   24.608  1.00 0.00 ? 109 LYS A CE   3  
ATOM 6047  N NZ   . LYS A 1 109 ? -8.922  1.955   25.628  1.00 0.00 ? 109 LYS A NZ   3  
ATOM 6048  H H    . LYS A 1 109 ? -7.037  -0.603  19.131  1.00 0.00 ? 109 LYS A H    3  
ATOM 6049  H HA   . LYS A 1 109 ? -9.260  0.069   20.937  1.00 0.00 ? 109 LYS A HA   3  
ATOM 6050  H HB2  . LYS A 1 109 ? -6.369  0.881   21.156  1.00 0.00 ? 109 LYS A HB2  3  
ATOM 6051  H HB3  . LYS A 1 109 ? -7.650  1.828   21.902  1.00 0.00 ? 109 LYS A HB3  3  
ATOM 6052  H HG2  . LYS A 1 109 ? -7.552  -1.089  22.459  1.00 0.00 ? 109 LYS A HG2  3  
ATOM 6053  H HG3  . LYS A 1 109 ? -6.359  -0.040  23.231  1.00 0.00 ? 109 LYS A HG3  3  
ATOM 6054  H HD2  . LYS A 1 109 ? -9.299  0.574   23.311  1.00 0.00 ? 109 LYS A HD2  3  
ATOM 6055  H HD3  . LYS A 1 109 ? -8.538  -0.490  24.496  1.00 0.00 ? 109 LYS A HD3  3  
ATOM 6056  H HE2  . LYS A 1 109 ? -6.989  1.307   25.105  1.00 0.00 ? 109 LYS A HE2  3  
ATOM 6057  H HE3  . LYS A 1 109 ? -7.757  2.368   23.924  1.00 0.00 ? 109 LYS A HE3  3  
ATOM 6058  H HZ1  . LYS A 1 109 ? -9.340  2.872   25.370  1.00 0.00 ? 109 LYS A HZ1  3  
ATOM 6059  H HZ2  . LYS A 1 109 ? -8.469  2.044   26.560  1.00 0.00 ? 109 LYS A HZ2  3  
ATOM 6060  H HZ3  . LYS A 1 109 ? -9.679  1.245   25.688  1.00 0.00 ? 109 LYS A HZ3  3  
ATOM 6061  N N    . GLY A 1 110 ? -7.796  1.696   18.507  1.00 0.00 ? 110 GLY A N    3  
ATOM 6062  C CA   . GLY A 1 110 ? -7.985  2.767   17.547  1.00 0.00 ? 110 GLY A CA   3  
ATOM 6063  C C    . GLY A 1 110 ? -6.762  3.653   17.417  1.00 0.00 ? 110 GLY A C    3  
ATOM 6064  O O    . GLY A 1 110 ? -6.699  4.511   16.537  1.00 0.00 ? 110 GLY A O    3  
ATOM 6065  H H    . GLY A 1 110 ? -7.047  1.073   18.403  1.00 0.00 ? 110 GLY A H    3  
ATOM 6066  H HA2  . GLY A 1 110 ? -8.209  2.336   16.583  1.00 0.00 ? 110 GLY A HA2  3  
ATOM 6067  H HA3  . GLY A 1 110 ? -8.822  3.374   17.862  1.00 0.00 ? 110 GLY A HA3  3  
ATOM 6068  N N    . ARG A 1 111 ? -5.787  3.445   18.297  1.00 0.00 ? 111 ARG A N    3  
ATOM 6069  C CA   . ARG A 1 111 ? -4.561  4.233   18.279  1.00 0.00 ? 111 ARG A CA   3  
ATOM 6070  C C    . ARG A 1 111 ? -3.435  3.470   17.587  1.00 0.00 ? 111 ARG A C    3  
ATOM 6071  O O    . ARG A 1 111 ? -3.261  2.271   17.802  1.00 0.00 ? 111 ARG A O    3  
ATOM 6072  C CB   . ARG A 1 111 ? -4.143  4.598   19.704  1.00 0.00 ? 111 ARG A CB   3  
ATOM 6073  C CG   . ARG A 1 111 ? -4.846  5.831   20.248  1.00 0.00 ? 111 ARG A CG   3  
ATOM 6074  C CD   . ARG A 1 111 ? -4.349  7.100   19.573  1.00 0.00 ? 111 ARG A CD   3  
ATOM 6075  N NE   . ARG A 1 111 ? -3.153  7.631   20.221  1.00 0.00 ? 111 ARG A NE   3  
ATOM 6076  C CZ   . ARG A 1 111 ? -3.163  8.223   21.411  1.00 0.00 ? 111 ARG A CZ   3  
ATOM 6077  N NH1  . ARG A 1 111 ? -4.301  8.357   22.078  1.00 0.00 ? 111 ARG A NH1  3  
ATOM 6078  N NH2  . ARG A 1 111 ? -2.034  8.681   21.935  1.00 0.00 ? 111 ARG A NH2  3  
ATOM 6079  H H    . ARG A 1 111 ? -5.896  2.746   18.975  1.00 0.00 ? 111 ARG A H    3  
ATOM 6080  H HA   . ARG A 1 111 ? -4.757  5.140   17.727  1.00 0.00 ? 111 ARG A HA   3  
ATOM 6081  H HB2  . ARG A 1 111 ? -4.365  3.767   20.357  1.00 0.00 ? 111 ARG A HB2  3  
ATOM 6082  H HB3  . ARG A 1 111 ? -3.079  4.782   19.718  1.00 0.00 ? 111 ARG A HB3  3  
ATOM 6083  H HG2  . ARG A 1 111 ? -5.908  5.736   20.072  1.00 0.00 ? 111 ARG A HG2  3  
ATOM 6084  H HG3  . ARG A 1 111 ? -4.660  5.901   21.309  1.00 0.00 ? 111 ARG A HG3  3  
ATOM 6085  H HD2  . ARG A 1 111 ? -4.118  6.877   18.542  1.00 0.00 ? 111 ARG A HD2  3  
ATOM 6086  H HD3  . ARG A 1 111 ? -5.130  7.843   19.614  1.00 0.00 ? 111 ARG A HD3  3  
ATOM 6087  H HE   . ARG A 1 111 ? -2.301  7.543   19.746  1.00 0.00 ? 111 ARG A HE   3  
ATOM 6088  H HH11 . ARG A 1 111 ? -5.153  8.012   21.686  1.00 0.00 ? 111 ARG A HH11 3  
ATOM 6089  H HH12 . ARG A 1 111 ? -4.306  8.802   22.974  1.00 0.00 ? 111 ARG A HH12 3  
ATOM 6090  H HH21 . ARG A 1 111 ? -1.174  8.582   21.435  1.00 0.00 ? 111 ARG A HH21 3  
ATOM 6091  H HH22 . ARG A 1 111 ? -2.043  9.126   22.830  1.00 0.00 ? 111 ARG A HH22 3  
ATOM 6092  N N    . ALA A 1 112 ? -2.674  4.174   16.755  1.00 0.00 ? 112 ALA A N    3  
ATOM 6093  C CA   . ALA A 1 112 ? -1.564  3.564   16.033  1.00 0.00 ? 112 ALA A CA   3  
ATOM 6094  C C    . ALA A 1 112 ? -0.275  3.637   16.844  1.00 0.00 ? 112 ALA A C    3  
ATOM 6095  O O    . ALA A 1 112 ? 0.202   4.723   17.173  1.00 0.00 ? 112 ALA A O    3  
ATOM 6096  C CB   . ALA A 1 112 ? -1.380  4.238   14.682  1.00 0.00 ? 112 ALA A CB   3  
ATOM 6097  H H    . ALA A 1 112 ? -2.862  5.126   16.625  1.00 0.00 ? 112 ALA A H    3  
ATOM 6098  H HA   . ALA A 1 112 ? -1.810  2.526   15.859  1.00 0.00 ? 112 ALA A HA   3  
ATOM 6099  H HB1  . ALA A 1 112 ? -0.505  3.832   14.194  1.00 0.00 ? 112 ALA A HB1  3  
ATOM 6100  H HB2  . ALA A 1 112 ? -2.250  4.059   14.068  1.00 0.00 ? 112 ALA A HB2  3  
ATOM 6101  H HB3  . ALA A 1 112 ? -1.252  5.301   14.825  1.00 0.00 ? 112 ALA A HB3  3  
ATOM 6102  N N    . VAL A 1 113 ? 0.285   2.475   17.164  1.00 0.00 ? 113 VAL A N    3  
ATOM 6103  C CA   . VAL A 1 113 ? 1.520   2.408   17.936  1.00 0.00 ? 113 VAL A CA   3  
ATOM 6104  C C    . VAL A 1 113 ? 2.656   3.130   17.220  1.00 0.00 ? 113 VAL A C    3  
ATOM 6105  O O    . VAL A 1 113 ? 2.895   2.908   16.033  1.00 0.00 ? 113 VAL A O    3  
ATOM 6106  C CB   . VAL A 1 113 ? 1.938   0.949   18.199  1.00 0.00 ? 113 VAL A CB   3  
ATOM 6107  C CG1  . VAL A 1 113 ? 3.203   0.901   19.043  1.00 0.00 ? 113 VAL A CG1  3  
ATOM 6108  C CG2  . VAL A 1 113 ? 0.809   0.184   18.873  1.00 0.00 ? 113 VAL A CG2  3  
ATOM 6109  H H    . VAL A 1 113 ? -0.143  1.643   16.873  1.00 0.00 ? 113 VAL A H    3  
ATOM 6110  H HA   . VAL A 1 113 ? 1.344   2.887   18.888  1.00 0.00 ? 113 VAL A HA   3  
ATOM 6111  H HB   . VAL A 1 113 ? 2.147   0.479   17.250  1.00 0.00 ? 113 VAL A HB   3  
ATOM 6112  H HG11 . VAL A 1 113 ? 3.766   0.012   18.796  1.00 0.00 ? 113 VAL A HG11 3  
ATOM 6113  H HG12 . VAL A 1 113 ? 3.804   1.776   18.842  1.00 0.00 ? 113 VAL A HG12 3  
ATOM 6114  H HG13 . VAL A 1 113 ? 2.937   0.878   20.089  1.00 0.00 ? 113 VAL A HG13 3  
ATOM 6115  H HG21 . VAL A 1 113 ? 0.564   -0.687  18.284  1.00 0.00 ? 113 VAL A HG21 3  
ATOM 6116  H HG22 . VAL A 1 113 ? 1.121   -0.125  19.860  1.00 0.00 ? 113 VAL A HG22 3  
ATOM 6117  H HG23 . VAL A 1 113 ? -0.059  0.821   18.954  1.00 0.00 ? 113 VAL A HG23 3  
ATOM 6118  N N    . SER A 1 114 ? 3.353   3.994   17.950  1.00 0.00 ? 114 SER A N    3  
ATOM 6119  C CA   . SER A 1 114 ? 4.463   4.752   17.384  1.00 0.00 ? 114 SER A CA   3  
ATOM 6120  C C    . SER A 1 114 ? 5.484   3.820   16.739  1.00 0.00 ? 114 SER A C    3  
ATOM 6121  O O    . SER A 1 114 ? 6.198   3.092   17.428  1.00 0.00 ? 114 SER A O    3  
ATOM 6122  C CB   . SER A 1 114 ? 5.138   5.595   18.468  1.00 0.00 ? 114 SER A CB   3  
ATOM 6123  O OG   . SER A 1 114 ? 4.209   6.468   19.087  1.00 0.00 ? 114 SER A OG   3  
ATOM 6124  H H    . SER A 1 114 ? 3.114   4.127   18.891  1.00 0.00 ? 114 SER A H    3  
ATOM 6125  H HA   . SER A 1 114 ? 4.063   5.409   16.626  1.00 0.00 ? 114 SER A HA   3  
ATOM 6126  H HB2  . SER A 1 114 ? 5.557   4.943   19.219  1.00 0.00 ? 114 SER A HB2  3  
ATOM 6127  H HB3  . SER A 1 114 ? 5.926   6.184   18.022  1.00 0.00 ? 114 SER A HB3  3  
ATOM 6128  H HG   . SER A 1 114 ? 4.478   7.378   18.941  1.00 0.00 ? 114 SER A HG   3  
ATOM 6129  N N    . TRP A 1 115 ? 5.547   3.849   15.413  1.00 0.00 ? 115 TRP A N    3  
ATOM 6130  C CA   . TRP A 1 115 ? 6.480   3.007   14.673  1.00 0.00 ? 115 TRP A CA   3  
ATOM 6131  C C    . TRP A 1 115 ? 7.439   3.855   13.845  1.00 0.00 ? 115 TRP A C    3  
ATOM 6132  O O    . TRP A 1 115 ? 7.074   4.922   13.352  1.00 0.00 ? 115 TRP A O    3  
ATOM 6133  C CB   . TRP A 1 115 ? 5.718   2.042   13.764  1.00 0.00 ? 115 TRP A CB   3  
ATOM 6134  C CG   . TRP A 1 115 ? 6.614   1.125   12.987  1.00 0.00 ? 115 TRP A CG   3  
ATOM 6135  C CD1  . TRP A 1 115 ? 7.486   0.206   13.497  1.00 0.00 ? 115 TRP A CD1  3  
ATOM 6136  C CD2  . TRP A 1 115 ? 6.726   1.041   11.562  1.00 0.00 ? 115 TRP A CD2  3  
ATOM 6137  N NE1  . TRP A 1 115 ? 8.133   -0.445  12.474  1.00 0.00 ? 115 TRP A NE1  3  
ATOM 6138  C CE2  . TRP A 1 115 ? 7.684   0.049   11.278  1.00 0.00 ? 115 TRP A CE2  3  
ATOM 6139  C CE3  . TRP A 1 115 ? 6.109   1.705   10.499  1.00 0.00 ? 115 TRP A CE3  3  
ATOM 6140  C CZ2  . TRP A 1 115 ? 8.039   -0.292  9.975   1.00 0.00 ? 115 TRP A CZ2  3  
ATOM 6141  C CZ3  . TRP A 1 115 ? 6.462   1.367   9.207   1.00 0.00 ? 115 TRP A CZ3  3  
ATOM 6142  C CH2  . TRP A 1 115 ? 7.419   0.375   8.954   1.00 0.00 ? 115 TRP A CH2  3  
ATOM 6143  H H    . TRP A 1 115 ? 4.951   4.451   14.919  1.00 0.00 ? 115 TRP A H    3  
ATOM 6144  H HA   . TRP A 1 115 ? 7.051   2.436   15.391  1.00 0.00 ? 115 TRP A HA   3  
ATOM 6145  H HB2  . TRP A 1 115 ? 5.060   1.434   14.366  1.00 0.00 ? 115 TRP A HB2  3  
ATOM 6146  H HB3  . TRP A 1 115 ? 5.131   2.612   13.058  1.00 0.00 ? 115 TRP A HB3  3  
ATOM 6147  H HD1  . TRP A 1 115 ? 7.635   0.028   14.551  1.00 0.00 ? 115 TRP A HD1  3  
ATOM 6148  H HE1  . TRP A 1 115 ? 8.806   -1.149  12.584  1.00 0.00 ? 115 TRP A HE1  3  
ATOM 6149  H HE3  . TRP A 1 115 ? 5.369   2.472   10.674  1.00 0.00 ? 115 TRP A HE3  3  
ATOM 6150  H HZ2  . TRP A 1 115 ? 8.774   -1.054  9.763   1.00 0.00 ? 115 TRP A HZ2  3  
ATOM 6151  H HZ3  . TRP A 1 115 ? 5.996   1.870   8.372   1.00 0.00 ? 115 TRP A HZ3  3  
ATOM 6152  H HH2  . TRP A 1 115 ? 7.664   0.143   7.929   1.00 0.00 ? 115 TRP A HH2  3  
ATOM 6153  N N    . THR A 1 116 ? 8.670   3.374   13.695  1.00 0.00 ? 116 THR A N    3  
ATOM 6154  C CA   . THR A 1 116 ? 9.681   4.088   12.927  1.00 0.00 ? 116 THR A CA   3  
ATOM 6155  C C    . THR A 1 116 ? 9.610   3.722   11.449  1.00 0.00 ? 116 THR A C    3  
ATOM 6156  O O    . THR A 1 116 ? 9.917   2.595   11.062  1.00 0.00 ? 116 THR A O    3  
ATOM 6157  C CB   . THR A 1 116 ? 11.099  3.788   13.450  1.00 0.00 ? 116 THR A CB   3  
ATOM 6158  O OG1  . THR A 1 116 ? 11.185  4.107   14.843  1.00 0.00 ? 116 THR A OG1  3  
ATOM 6159  C CG2  . THR A 1 116 ? 12.140  4.584   12.677  1.00 0.00 ? 116 THR A CG2  3  
ATOM 6160  H H    . THR A 1 116 ? 8.901   2.518   14.112  1.00 0.00 ? 116 THR A H    3  
ATOM 6161  H HA   . THR A 1 116 ? 9.497   5.147   13.036  1.00 0.00 ? 116 THR A HA   3  
ATOM 6162  H HB   . THR A 1 116 ? 11.300  2.735   13.316  1.00 0.00 ? 116 THR A HB   3  
ATOM 6163  H HG1  . THR A 1 116 ? 10.729  4.936   15.011  1.00 0.00 ? 116 THR A HG1  3  
ATOM 6164  H HG21 . THR A 1 116 ? 12.766  5.127   13.371  1.00 0.00 ? 116 THR A HG21 3  
ATOM 6165  H HG22 . THR A 1 116 ? 11.644  5.281   12.018  1.00 0.00 ? 116 THR A HG22 3  
ATOM 6166  H HG23 . THR A 1 116 ? 12.750  3.909   12.096  1.00 0.00 ? 116 THR A HG23 3  
ATOM 6167  N N    . PHE A 1 117 ? 9.202   4.683   10.626  1.00 0.00 ? 117 PHE A N    3  
ATOM 6168  C CA   . PHE A 1 117 ? 9.090   4.461   9.189   1.00 0.00 ? 117 PHE A CA   3  
ATOM 6169  C C    . PHE A 1 117 ? 10.467  4.449   8.531   1.00 0.00 ? 117 PHE A C    3  
ATOM 6170  O O    . PHE A 1 117 ? 10.952  5.479   8.063   1.00 0.00 ? 117 PHE A O    3  
ATOM 6171  C CB   . PHE A 1 117 ? 8.217   5.545   8.551   1.00 0.00 ? 117 PHE A CB   3  
ATOM 6172  C CG   . PHE A 1 117 ? 6.758   5.193   8.512   1.00 0.00 ? 117 PHE A CG   3  
ATOM 6173  C CD1  . PHE A 1 117 ? 5.950   5.409   9.617   1.00 0.00 ? 117 PHE A CD1  3  
ATOM 6174  C CD2  . PHE A 1 117 ? 6.194   4.646   7.371   1.00 0.00 ? 117 PHE A CD2  3  
ATOM 6175  C CE1  . PHE A 1 117 ? 4.606   5.086   9.584   1.00 0.00 ? 117 PHE A CE1  3  
ATOM 6176  C CE2  . PHE A 1 117 ? 4.851   4.322   7.332   1.00 0.00 ? 117 PHE A CE2  3  
ATOM 6177  C CZ   . PHE A 1 117 ? 4.056   4.541   8.440   1.00 0.00 ? 117 PHE A CZ   3  
ATOM 6178  H H    . PHE A 1 117 ? 8.971   5.562   10.994  1.00 0.00 ? 117 PHE A H    3  
ATOM 6179  H HA   . PHE A 1 117 ? 8.623   3.500   9.038   1.00 0.00 ? 117 PHE A HA   3  
ATOM 6180  H HB2  . PHE A 1 117 ? 8.323   6.460   9.114   1.00 0.00 ? 117 PHE A HB2  3  
ATOM 6181  H HB3  . PHE A 1 117 ? 8.547   5.711   7.537   1.00 0.00 ? 117 PHE A HB3  3  
ATOM 6182  H HD1  . PHE A 1 117 ? 6.379   5.835   10.512  1.00 0.00 ? 117 PHE A HD1  3  
ATOM 6183  H HD2  . PHE A 1 117 ? 6.814   4.473   6.503   1.00 0.00 ? 117 PHE A HD2  3  
ATOM 6184  H HE1  . PHE A 1 117 ? 3.988   5.259   10.452  1.00 0.00 ? 117 PHE A HE1  3  
ATOM 6185  H HE2  . PHE A 1 117 ? 4.423   3.896   6.437   1.00 0.00 ? 117 PHE A HE2  3  
ATOM 6186  H HZ   . PHE A 1 117 ? 3.007   4.290   8.412   1.00 0.00 ? 117 PHE A HZ   3  
ATOM 6187  N N    . SER A 1 118 ? 11.090  3.275   8.500   1.00 0.00 ? 118 SER A N    3  
ATOM 6188  C CA   . SER A 1 118 ? 12.413  3.128   7.904   1.00 0.00 ? 118 SER A CA   3  
ATOM 6189  C C    . SER A 1 118 ? 12.431  1.983   6.897   1.00 0.00 ? 118 SER A C    3  
ATOM 6190  O O    . SER A 1 118 ? 11.465  1.229   6.782   1.00 0.00 ? 118 SER A O    3  
ATOM 6191  C CB   . SER A 1 118 ? 13.461  2.882   8.992   1.00 0.00 ? 118 SER A CB   3  
ATOM 6192  O OG   . SER A 1 118 ? 13.364  1.565   9.505   1.00 0.00 ? 118 SER A OG   3  
ATOM 6193  H H    . SER A 1 118 ? 10.651  2.491   8.890   1.00 0.00 ? 118 SER A H    3  
ATOM 6194  H HA   . SER A 1 118 ? 12.649  4.048   7.390   1.00 0.00 ? 118 SER A HA   3  
ATOM 6195  H HB2  . SER A 1 118 ? 14.447  3.023   8.576   1.00 0.00 ? 118 SER A HB2  3  
ATOM 6196  H HB3  . SER A 1 118 ? 13.308  3.583   9.800   1.00 0.00 ? 118 SER A HB3  3  
ATOM 6197  H HG   . SER A 1 118 ? 12.469  1.240   9.385   1.00 0.00 ? 118 SER A HG   3  
ATOM 6198  N N    . GLU A 1 119 ? 13.537  1.860   6.169   1.00 0.00 ? 119 GLU A N    3  
ATOM 6199  C CA   . GLU A 1 119 ? 13.680  0.807   5.171   1.00 0.00 ? 119 GLU A CA   3  
ATOM 6200  C C    . GLU A 1 119 ? 13.973  -0.536  5.834   1.00 0.00 ? 119 GLU A C    3  
ATOM 6201  O O    . GLU A 1 119 ? 13.513  -1.580  5.373   1.00 0.00 ? 119 GLU A O    3  
ATOM 6202  C CB   . GLU A 1 119 ? 14.797  1.156   4.186   1.00 0.00 ? 119 GLU A CB   3  
ATOM 6203  C CG   . GLU A 1 119 ? 14.908  0.186   3.021   1.00 0.00 ? 119 GLU A CG   3  
ATOM 6204  C CD   . GLU A 1 119 ? 16.301  0.150   2.423   1.00 0.00 ? 119 GLU A CD   3  
ATOM 6205  O OE1  . GLU A 1 119 ? 17.015  1.169   2.522   1.00 0.00 ? 119 GLU A OE1  3  
ATOM 6206  O OE2  . GLU A 1 119 ? 16.676  -0.898  1.856   1.00 0.00 ? 119 GLU A OE2  3  
ATOM 6207  H H    . GLU A 1 119 ? 14.272  2.492   6.307   1.00 0.00 ? 119 GLU A H    3  
ATOM 6208  H HA   . GLU A 1 119 ? 12.748  0.733   4.631   1.00 0.00 ? 119 GLU A HA   3  
ATOM 6209  H HB2  . GLU A 1 119 ? 14.615  2.144   3.789   1.00 0.00 ? 119 GLU A HB2  3  
ATOM 6210  H HB3  . GLU A 1 119 ? 15.739  1.159   4.715   1.00 0.00 ? 119 GLU A HB3  3  
ATOM 6211  H HG2  . GLU A 1 119 ? 14.657  -0.804  3.370   1.00 0.00 ? 119 GLU A HG2  3  
ATOM 6212  H HG3  . GLU A 1 119 ? 14.210  0.485   2.253   1.00 0.00 ? 119 GLU A HG3  3  
ATOM 6213  N N    . GLU A 1 120 ? 14.742  -0.498  6.918   1.00 0.00 ? 120 GLU A N    3  
ATOM 6214  C CA   . GLU A 1 120 ? 15.097  -1.712  7.643   1.00 0.00 ? 120 GLU A CA   3  
ATOM 6215  C C    . GLU A 1 120 ? 13.863  -2.352  8.272   1.00 0.00 ? 120 GLU A C    3  
ATOM 6216  O O    . GLU A 1 120 ? 13.602  -3.539  8.085   1.00 0.00 ? 120 GLU A O    3  
ATOM 6217  C CB   . GLU A 1 120 ? 16.132  -1.401  8.727   1.00 0.00 ? 120 GLU A CB   3  
ATOM 6218  C CG   . GLU A 1 120 ? 15.683  -0.331  9.707   1.00 0.00 ? 120 GLU A CG   3  
ATOM 6219  C CD   . GLU A 1 120 ? 16.793  0.106   10.644  1.00 0.00 ? 120 GLU A CD   3  
ATOM 6220  O OE1  . GLU A 1 120 ? 17.967  0.093   10.217  1.00 0.00 ? 120 GLU A OE1  3  
ATOM 6221  O OE2  . GLU A 1 120 ? 16.488  0.459   11.802  1.00 0.00 ? 120 GLU A OE2  3  
ATOM 6222  H H    . GLU A 1 120 ? 15.078  0.365   7.236   1.00 0.00 ? 120 GLU A H    3  
ATOM 6223  H HA   . GLU A 1 120 ? 15.527  -2.407  6.937   1.00 0.00 ? 120 GLU A HA   3  
ATOM 6224  H HB2  . GLU A 1 120 ? 16.338  -2.305  9.281   1.00 0.00 ? 120 GLU A HB2  3  
ATOM 6225  H HB3  . GLU A 1 120 ? 17.042  -1.065  8.252   1.00 0.00 ? 120 GLU A HB3  3  
ATOM 6226  H HG2  . GLU A 1 120 ? 15.344  0.530   9.151   1.00 0.00 ? 120 GLU A HG2  3  
ATOM 6227  H HG3  . GLU A 1 120 ? 14.867  -0.721  10.297  1.00 0.00 ? 120 GLU A HG3  3  
ATOM 6228  N N    . ASN A 1 121 ? 13.106  -1.554  9.019   1.00 0.00 ? 121 ASN A N    3  
ATOM 6229  C CA   . ASN A 1 121 ? 11.899  -2.042  9.677   1.00 0.00 ? 121 ASN A CA   3  
ATOM 6230  C C    . ASN A 1 121 ? 10.867  -2.499  8.651   1.00 0.00 ? 121 ASN A C    3  
ATOM 6231  O O    . ASN A 1 121 ? 10.157  -3.482  8.864   1.00 0.00 ? 121 ASN A O    3  
ATOM 6232  C CB   . ASN A 1 121 ? 11.302  -0.949  10.566  1.00 0.00 ? 121 ASN A CB   3  
ATOM 6233  C CG   . ASN A 1 121 ? 12.261  -0.497  11.650  1.00 0.00 ? 121 ASN A CG   3  
ATOM 6234  O OD1  . ASN A 1 121 ? 13.291  -1.129  11.887  1.00 0.00 ? 121 ASN A OD1  3  
ATOM 6235  N ND2  . ASN A 1 121 ? 11.926  0.603   12.315  1.00 0.00 ? 121 ASN A ND2  3  
ATOM 6236  H H    . ASN A 1 121 ? 13.365  -0.616  9.131   1.00 0.00 ? 121 ASN A H    3  
ATOM 6237  H HA   . ASN A 1 121 ? 12.175  -2.884  10.293  1.00 0.00 ? 121 ASN A HA   3  
ATOM 6238  H HB2  . ASN A 1 121 ? 11.050  -0.094  9.956   1.00 0.00 ? 121 ASN A HB2  3  
ATOM 6239  H HB3  . ASN A 1 121 ? 10.406  -1.326  11.037  1.00 0.00 ? 121 ASN A HB3  3  
ATOM 6240  H HD21 . ASN A 1 121 ? 11.091  1.055   12.072  1.00 0.00 ? 121 ASN A HD21 3  
ATOM 6241  H HD22 . ASN A 1 121 ? 12.529  0.918   13.020  1.00 0.00 ? 121 ASN A HD22 3  
ATOM 6242  N N    . VAL A 1 122 ? 10.790  -1.779  7.536   1.00 0.00 ? 122 VAL A N    3  
ATOM 6243  C CA   . VAL A 1 122 ? 9.846   -2.111  6.475   1.00 0.00 ? 122 VAL A CA   3  
ATOM 6244  C C    . VAL A 1 122 ? 10.115  -3.504  5.917   1.00 0.00 ? 122 VAL A C    3  
ATOM 6245  O O    . VAL A 1 122 ? 9.185   -4.255  5.621   1.00 0.00 ? 122 VAL A O    3  
ATOM 6246  C CB   . VAL A 1 122 ? 9.912   -1.088  5.325   1.00 0.00 ? 122 VAL A CB   3  
ATOM 6247  C CG1  . VAL A 1 122 ? 9.246   -1.646  4.076   1.00 0.00 ? 122 VAL A CG1  3  
ATOM 6248  C CG2  . VAL A 1 122 ? 9.265   0.224   5.743   1.00 0.00 ? 122 VAL A CG2  3  
ATOM 6249  H H    . VAL A 1 122 ? 11.383  -1.007  7.424   1.00 0.00 ? 122 VAL A H    3  
ATOM 6250  H HA   . VAL A 1 122 ? 8.851   -2.087  6.894   1.00 0.00 ? 122 VAL A HA   3  
ATOM 6251  H HB   . VAL A 1 122 ? 10.950  -0.898  5.099   1.00 0.00 ? 122 VAL A HB   3  
ATOM 6252  H HG11 . VAL A 1 122 ? 8.486   -2.359  4.361   1.00 0.00 ? 122 VAL A HG11 3  
ATOM 6253  H HG12 . VAL A 1 122 ? 8.794   -0.839  3.518   1.00 0.00 ? 122 VAL A HG12 3  
ATOM 6254  H HG13 . VAL A 1 122 ? 9.988   -2.137  3.463   1.00 0.00 ? 122 VAL A HG13 3  
ATOM 6255  H HG21 . VAL A 1 122 ? 9.702   1.035   5.179   1.00 0.00 ? 122 VAL A HG21 3  
ATOM 6256  H HG22 . VAL A 1 122 ? 8.204   0.181   5.548   1.00 0.00 ? 122 VAL A HG22 3  
ATOM 6257  H HG23 . VAL A 1 122 ? 9.431   0.388   6.797   1.00 0.00 ? 122 VAL A HG23 3  
ATOM 6258  N N    . ILE A 1 123 ? 11.392  -3.844  5.777   1.00 0.00 ? 123 ILE A N    3  
ATOM 6259  C CA   . ILE A 1 123 ? 11.783  -5.148  5.256   1.00 0.00 ? 123 ILE A CA   3  
ATOM 6260  C C    . ILE A 1 123 ? 11.605  -6.236  6.309   1.00 0.00 ? 123 ILE A C    3  
ATOM 6261  O O    . ILE A 1 123 ? 11.082  -7.313  6.022   1.00 0.00 ? 123 ILE A O    3  
ATOM 6262  C CB   . ILE A 1 123 ? 13.246  -5.147  4.777   1.00 0.00 ? 123 ILE A CB   3  
ATOM 6263  C CG1  . ILE A 1 123 ? 13.436  -4.132  3.648   1.00 0.00 ? 123 ILE A CG1  3  
ATOM 6264  C CG2  . ILE A 1 123 ? 13.654  -6.539  4.320   1.00 0.00 ? 123 ILE A CG2  3  
ATOM 6265  C CD1  . ILE A 1 123 ? 14.884  -3.787  3.383   1.00 0.00 ? 123 ILE A CD1  3  
ATOM 6266  H H    . ILE A 1 123 ? 12.087  -3.202  6.031   1.00 0.00 ? 123 ILE A H    3  
ATOM 6267  H HA   . ILE A 1 123 ? 11.148  -5.372  4.411   1.00 0.00 ? 123 ILE A HA   3  
ATOM 6268  H HB   . ILE A 1 123 ? 13.874  -4.870  5.610   1.00 0.00 ? 123 ILE A HB   3  
ATOM 6269  H HG12 . ILE A 1 123 ? 13.019  -4.534  2.738   1.00 0.00 ? 123 ILE A HG12 3  
ATOM 6270  H HG13 . ILE A 1 123 ? 12.917  -3.220  3.904   1.00 0.00 ? 123 ILE A HG13 3  
ATOM 6271  H HG21 . ILE A 1 123 ? 13.708  -6.563  3.241   1.00 0.00 ? 123 ILE A HG21 3  
ATOM 6272  H HG22 . ILE A 1 123 ? 14.622  -6.784  4.732   1.00 0.00 ? 123 ILE A HG22 3  
ATOM 6273  H HG23 . ILE A 1 123 ? 12.925  -7.259  4.660   1.00 0.00 ? 123 ILE A HG23 3  
ATOM 6274  H HD11 . ILE A 1 123 ? 15.275  -4.437  2.614   1.00 0.00 ? 123 ILE A HD11 3  
ATOM 6275  H HD12 . ILE A 1 123 ? 14.956  -2.760  3.057   1.00 0.00 ? 123 ILE A HD12 3  
ATOM 6276  H HD13 . ILE A 1 123 ? 15.457  -3.918  4.290   1.00 0.00 ? 123 ILE A HD13 3  
ATOM 6277  N N    . ARG A 1 124 ? 12.041  -5.947  7.531   1.00 0.00 ? 124 ARG A N    3  
ATOM 6278  C CA   . ARG A 1 124 ? 11.930  -6.901  8.628   1.00 0.00 ? 124 ARG A CA   3  
ATOM 6279  C C    . ARG A 1 124 ? 10.468  -7.134  8.999   1.00 0.00 ? 124 ARG A C    3  
ATOM 6280  O O    . ARG A 1 124 ? 9.971   -8.257  8.925   1.00 0.00 ? 124 ARG A O    3  
ATOM 6281  C CB   . ARG A 1 124 ? 12.703  -6.400  9.849   1.00 0.00 ? 124 ARG A CB   3  
ATOM 6282  C CG   . ARG A 1 124 ? 12.826  -7.431  10.958  1.00 0.00 ? 124 ARG A CG   3  
ATOM 6283  C CD   . ARG A 1 124 ? 13.244  -6.790  12.272  1.00 0.00 ? 124 ARG A CD   3  
ATOM 6284  N NE   . ARG A 1 124 ? 12.786  -7.558  13.426  1.00 0.00 ? 124 ARG A NE   3  
ATOM 6285  C CZ   . ARG A 1 124 ? 13.285  -8.741  13.767  1.00 0.00 ? 124 ARG A CZ   3  
ATOM 6286  N NH1  . ARG A 1 124 ? 14.253  -9.288  13.045  1.00 0.00 ? 124 ARG A NH1  3  
ATOM 6287  N NH2  . ARG A 1 124 ? 12.816  -9.379  14.832  1.00 0.00 ? 124 ARG A NH2  3  
ATOM 6288  H H    . ARG A 1 124 ? 12.449  -5.072  7.699   1.00 0.00 ? 124 ARG A H    3  
ATOM 6289  H HA   . ARG A 1 124 ? 12.359  -7.836  8.300   1.00 0.00 ? 124 ARG A HA   3  
ATOM 6290  H HB2  . ARG A 1 124 ? 13.699  -6.117  9.539   1.00 0.00 ? 124 ARG A HB2  3  
ATOM 6291  H HB3  . ARG A 1 124 ? 12.199  -5.532  10.247  1.00 0.00 ? 124 ARG A HB3  3  
ATOM 6292  H HG2  . ARG A 1 124 ? 11.870  -7.915  11.095  1.00 0.00 ? 124 ARG A HG2  3  
ATOM 6293  H HG3  . ARG A 1 124 ? 13.565  -8.165  10.674  1.00 0.00 ? 124 ARG A HG3  3  
ATOM 6294  H HD2  . ARG A 1 124 ? 14.322  -6.726  12.299  1.00 0.00 ? 124 ARG A HD2  3  
ATOM 6295  H HD3  . ARG A 1 124 ? 12.824  -5.797  12.322  1.00 0.00 ? 124 ARG A HD3  3  
ATOM 6296  H HE   . ARG A 1 124 ? 12.071  -7.172  13.974  1.00 0.00 ? 124 ARG A HE   3  
ATOM 6297  H HH11 . ARG A 1 124 ? 14.609  -8.810  12.243  1.00 0.00 ? 124 ARG A HH11 3  
ATOM 6298  H HH12 . ARG A 1 124 ? 14.628  -10.179 13.304  1.00 0.00 ? 124 ARG A HH12 3  
ATOM 6299  H HH21 . ARG A 1 124 ? 12.087  -8.969  15.378  1.00 0.00 ? 124 ARG A HH21 3  
ATOM 6300  H HH22 . ARG A 1 124 ? 13.192  -10.269 15.087  1.00 0.00 ? 124 ARG A HH22 3  
ATOM 6301  N N    . GLU A 1 125 ? 9.786   -6.065  9.398   1.00 0.00 ? 125 GLU A N    3  
ATOM 6302  C CA   . GLU A 1 125 ? 8.382   -6.154  9.782   1.00 0.00 ? 125 GLU A CA   3  
ATOM 6303  C C    . GLU A 1 125 ? 7.581   -6.926  8.737   1.00 0.00 ? 125 GLU A C    3  
ATOM 6304  O O    . GLU A 1 125 ? 6.911   -7.909  9.054   1.00 0.00 ? 125 GLU A O    3  
ATOM 6305  C CB   . GLU A 1 125 ? 7.790   -4.755  9.964   1.00 0.00 ? 125 GLU A CB   3  
ATOM 6306  C CG   . GLU A 1 125 ? 8.558   -3.893  10.952  1.00 0.00 ? 125 GLU A CG   3  
ATOM 6307  C CD   . GLU A 1 125 ? 8.077   -4.071  12.379  1.00 0.00 ? 125 GLU A CD   3  
ATOM 6308  O OE1  . GLU A 1 125 ? 7.577   -5.168  12.705  1.00 0.00 ? 125 GLU A OE1  3  
ATOM 6309  O OE2  . GLU A 1 125 ? 8.200   -3.112  13.169  1.00 0.00 ? 125 GLU A OE2  3  
ATOM 6310  H H    . GLU A 1 125 ? 10.238  -5.196  9.436   1.00 0.00 ? 125 GLU A H    3  
ATOM 6311  H HA   . GLU A 1 125 ? 8.329   -6.683  10.722  1.00 0.00 ? 125 GLU A HA   3  
ATOM 6312  H HB2  . GLU A 1 125 ? 7.784   -4.253  9.008   1.00 0.00 ? 125 GLU A HB2  3  
ATOM 6313  H HB3  . GLU A 1 125 ? 6.774   -4.851  10.317  1.00 0.00 ? 125 GLU A HB3  3  
ATOM 6314  H HG2  . GLU A 1 125 ? 9.604   -4.159  10.905  1.00 0.00 ? 125 GLU A HG2  3  
ATOM 6315  H HG3  . GLU A 1 125 ? 8.439   -2.856  10.674  1.00 0.00 ? 125 GLU A HG3  3  
ATOM 6316  N N    . PHE A 1 126 ? 7.654   -6.472  7.491   1.00 0.00 ? 126 PHE A N    3  
ATOM 6317  C CA   . PHE A 1 126 ? 6.934   -7.117  6.399   1.00 0.00 ? 126 PHE A CA   3  
ATOM 6318  C C    . PHE A 1 126 ? 7.756   -8.258  5.805   1.00 0.00 ? 126 PHE A C    3  
ATOM 6319  O O    . PHE A 1 126 ? 7.434   -8.779  4.738   1.00 0.00 ? 126 PHE A O    3  
ATOM 6320  C CB   . PHE A 1 126 ? 6.595   -6.097  5.310   1.00 0.00 ? 126 PHE A CB   3  
ATOM 6321  C CG   . PHE A 1 126 ? 5.580   -5.077  5.740   1.00 0.00 ? 126 PHE A CG   3  
ATOM 6322  C CD1  . PHE A 1 126 ? 4.225   -5.351  5.659   1.00 0.00 ? 126 PHE A CD1  3  
ATOM 6323  C CD2  . PHE A 1 126 ? 5.982   -3.843  6.225   1.00 0.00 ? 126 PHE A CD2  3  
ATOM 6324  C CE1  . PHE A 1 126 ? 3.289   -4.414  6.053   1.00 0.00 ? 126 PHE A CE1  3  
ATOM 6325  C CE2  . PHE A 1 126 ? 5.051   -2.901  6.621   1.00 0.00 ? 126 PHE A CE2  3  
ATOM 6326  C CZ   . PHE A 1 126 ? 3.703   -3.187  6.536   1.00 0.00 ? 126 PHE A CZ   3  
ATOM 6327  H H    . PHE A 1 126 ? 8.204   -5.683  7.300   1.00 0.00 ? 126 PHE A H    3  
ATOM 6328  H HA   . PHE A 1 126 ? 6.018   -7.521  6.800   1.00 0.00 ? 126 PHE A HA   3  
ATOM 6329  H HB2  . PHE A 1 126 ? 7.494   -5.572  5.026   1.00 0.00 ? 126 PHE A HB2  3  
ATOM 6330  H HB3  . PHE A 1 126 ? 6.201   -6.618  4.450   1.00 0.00 ? 126 PHE A HB3  3  
ATOM 6331  H HD1  . PHE A 1 126 ? 3.900   -6.310  5.283   1.00 0.00 ? 126 PHE A HD1  3  
ATOM 6332  H HD2  . PHE A 1 126 ? 7.038   -3.618  6.292   1.00 0.00 ? 126 PHE A HD2  3  
ATOM 6333  H HE1  . PHE A 1 126 ? 2.236   -4.640  5.986   1.00 0.00 ? 126 PHE A HE1  3  
ATOM 6334  H HE2  . PHE A 1 126 ? 5.379   -1.943  6.998   1.00 0.00 ? 126 PHE A HE2  3  
ATOM 6335  H HZ   . PHE A 1 126 ? 2.974   -2.453  6.844   1.00 0.00 ? 126 PHE A HZ   3  
ATOM 6336  N N    . ASN A 1 127 ? 8.820   -8.639  6.504   1.00 0.00 ? 127 ASN A N    3  
ATOM 6337  C CA   . ASN A 1 127 ? 9.690   -9.716  6.046   1.00 0.00 ? 127 ASN A CA   3  
ATOM 6338  C C    . ASN A 1 127 ? 9.792   -9.724  4.524   1.00 0.00 ? 127 ASN A C    3  
ATOM 6339  O O    . ASN A 1 127 ? 9.762   -10.781 3.894   1.00 0.00 ? 127 ASN A O    3  
ATOM 6340  C CB   . ASN A 1 127 ? 9.167   -11.067 6.540   1.00 0.00 ? 127 ASN A CB   3  
ATOM 6341  C CG   . ASN A 1 127 ? 9.568   -11.353 7.974   1.00 0.00 ? 127 ASN A CG   3  
ATOM 6342  O OD1  . ASN A 1 127 ? 9.295   -10.562 8.877   1.00 0.00 ? 127 ASN A OD1  3  
ATOM 6343  N ND2  . ASN A 1 127 ? 10.220  -12.490 8.190   1.00 0.00 ? 127 ASN A ND2  3  
ATOM 6344  H H    . ASN A 1 127 ? 9.026   -8.185  7.348   1.00 0.00 ? 127 ASN A H    3  
ATOM 6345  H HA   . ASN A 1 127 ? 10.672  -9.548  6.461   1.00 0.00 ? 127 ASN A HA   3  
ATOM 6346  H HB2  . ASN A 1 127 ? 8.088   -11.071 6.481   1.00 0.00 ? 127 ASN A HB2  3  
ATOM 6347  H HB3  . ASN A 1 127 ? 9.561   -11.851 5.911   1.00 0.00 ? 127 ASN A HB3  3  
ATOM 6348  H HD21 . ASN A 1 127 ? 10.403  -13.072 7.422   1.00 0.00 ? 127 ASN A HD21 3  
ATOM 6349  H HD22 . ASN A 1 127 ? 10.491  -12.701 9.107   1.00 0.00 ? 127 ASN A HD22 3  
ATOM 6350  N N    . LEU A 1 128 ? 9.914   -8.537  3.940   1.00 0.00 ? 128 LEU A N    3  
ATOM 6351  C CA   . LEU A 1 128 ? 10.021  -8.405  2.491   1.00 0.00 ? 128 LEU A CA   3  
ATOM 6352  C C    . LEU A 1 128 ? 11.176  -9.244  1.952   1.00 0.00 ? 128 LEU A C    3  
ATOM 6353  O O    . LEU A 1 128 ? 11.033  -9.943  0.950   1.00 0.00 ? 128 LEU A O    3  
ATOM 6354  C CB   . LEU A 1 128 ? 10.219  -6.938  2.105   1.00 0.00 ? 128 LEU A CB   3  
ATOM 6355  C CG   . LEU A 1 128 ? 9.048   -6.002  2.405   1.00 0.00 ? 128 LEU A CG   3  
ATOM 6356  C CD1  . LEU A 1 128 ? 9.441   -4.556  2.149   1.00 0.00 ? 128 LEU A CD1  3  
ATOM 6357  C CD2  . LEU A 1 128 ? 7.833   -6.382  1.571   1.00 0.00 ? 128 LEU A CD2  3  
ATOM 6358  H H    . LEU A 1 128 ? 9.932   -7.730  4.494   1.00 0.00 ? 128 LEU A H    3  
ATOM 6359  H HA   . LEU A 1 128 ? 9.099   -8.762  2.056   1.00 0.00 ? 128 LEU A HA   3  
ATOM 6360  H HB2  . LEU A 1 128 ? 11.082  -6.570  2.639   1.00 0.00 ? 128 LEU A HB2  3  
ATOM 6361  H HB3  . LEU A 1 128 ? 10.411  -6.899  1.042   1.00 0.00 ? 128 LEU A HB3  3  
ATOM 6362  H HG   . LEU A 1 128 ? 8.780   -6.094  3.449   1.00 0.00 ? 128 LEU A HG   3  
ATOM 6363  H HD11 . LEU A 1 128 ? 8.646   -3.903  2.474   1.00 0.00 ? 128 LEU A HD11 3  
ATOM 6364  H HD12 . LEU A 1 128 ? 9.615   -4.412  1.092   1.00 0.00 ? 128 LEU A HD12 3  
ATOM 6365  H HD13 . LEU A 1 128 ? 10.344  -4.326  2.696   1.00 0.00 ? 128 LEU A HD13 3  
ATOM 6366  H HD21 . LEU A 1 128 ? 7.635   -7.438  1.685   1.00 0.00 ? 128 LEU A HD21 3  
ATOM 6367  H HD22 . LEU A 1 128 ? 8.028   -6.163  0.531   1.00 0.00 ? 128 LEU A HD22 3  
ATOM 6368  H HD23 . LEU A 1 128 ? 6.976   -5.816  1.904   1.00 0.00 ? 128 LEU A HD23 3  
ATOM 6369  N N    . ASN A 1 129 ? 12.319  -9.171  2.626   1.00 0.00 ? 129 ASN A N    3  
ATOM 6370  C CA   . ASN A 1 129 ? 13.498  -9.925  2.216   1.00 0.00 ? 129 ASN A CA   3  
ATOM 6371  C C    . ASN A 1 129 ? 13.136  -11.374 1.905   1.00 0.00 ? 129 ASN A C    3  
ATOM 6372  O O    . ASN A 1 129 ? 13.661  -11.967 0.964   1.00 0.00 ? 129 ASN A O    3  
ATOM 6373  C CB   . ASN A 1 129 ? 14.565  -9.878  3.310   1.00 0.00 ? 129 ASN A CB   3  
ATOM 6374  C CG   . ASN A 1 129 ? 13.995  -10.158 4.687   1.00 0.00 ? 129 ASN A CG   3  
ATOM 6375  O OD1  . ASN A 1 129 ? 12.841  -10.568 4.822   1.00 0.00 ? 129 ASN A OD1  3  
ATOM 6376  N ND2  . ASN A 1 129 ? 14.802  -9.939  5.718   1.00 0.00 ? 129 ASN A ND2  3  
ATOM 6377  H H    . ASN A 1 129 ? 12.371  -8.595  3.417   1.00 0.00 ? 129 ASN A H    3  
ATOM 6378  H HA   . ASN A 1 129 ? 13.891  -9.465  1.322   1.00 0.00 ? 129 ASN A HA   3  
ATOM 6379  H HB2  . ASN A 1 129 ? 15.323  -10.618 3.098   1.00 0.00 ? 129 ASN A HB2  3  
ATOM 6380  H HB3  . ASN A 1 129 ? 15.019  -8.898  3.322   1.00 0.00 ? 129 ASN A HB3  3  
ATOM 6381  H HD21 . ASN A 1 129 ? 15.708  -9.613  5.536   1.00 0.00 ? 129 ASN A HD21 3  
ATOM 6382  H HD22 . ASN A 1 129 ? 14.459  -10.113 6.620   1.00 0.00 ? 129 ASN A HD22 3  
ATOM 6383  N N    . GLU A 1 130 ? 12.234  -11.937 2.703   1.00 0.00 ? 130 GLU A N    3  
ATOM 6384  C CA   . GLU A 1 130 ? 11.802  -13.317 2.513   1.00 0.00 ? 130 GLU A CA   3  
ATOM 6385  C C    . GLU A 1 130 ? 10.854  -13.431 1.323   1.00 0.00 ? 130 GLU A C    3  
ATOM 6386  O O    . GLU A 1 130 ? 11.142  -14.132 0.351   1.00 0.00 ? 130 GLU A O    3  
ATOM 6387  C CB   . GLU A 1 130 ? 11.115  -13.838 3.777   1.00 0.00 ? 130 GLU A CB   3  
ATOM 6388  C CG   . GLU A 1 130 ? 12.042  -13.938 4.977   1.00 0.00 ? 130 GLU A CG   3  
ATOM 6389  C CD   . GLU A 1 130 ? 13.396  -14.520 4.621   1.00 0.00 ? 130 GLU A CD   3  
ATOM 6390  O OE1  . GLU A 1 130 ? 13.473  -15.745 4.392   1.00 0.00 ? 130 GLU A OE1  3  
ATOM 6391  O OE2  . GLU A 1 130 ? 14.379  -13.751 4.572   1.00 0.00 ? 130 GLU A OE2  3  
ATOM 6392  H H    . GLU A 1 130 ? 11.851  -11.413 3.437   1.00 0.00 ? 130 GLU A H    3  
ATOM 6393  H HA   . GLU A 1 130 ? 12.679  -13.915 2.319   1.00 0.00 ? 130 GLU A HA   3  
ATOM 6394  H HB2  . GLU A 1 130 ? 10.302  -13.174 4.031   1.00 0.00 ? 130 GLU A HB2  3  
ATOM 6395  H HB3  . GLU A 1 130 ? 10.716  -14.821 3.576   1.00 0.00 ? 130 GLU A HB3  3  
ATOM 6396  H HG2  . GLU A 1 130 ? 12.189  -12.949 5.385   1.00 0.00 ? 130 GLU A HG2  3  
ATOM 6397  H HG3  . GLU A 1 130 ? 11.580  -14.568 5.722   1.00 0.00 ? 130 GLU A HG3  3  
ATOM 6398  N N    . LEU A 1 131 ? 9.724   -12.738 1.405   1.00 0.00 ? 131 LEU A N    3  
ATOM 6399  C CA   . LEU A 1 131 ? 8.733   -12.762 0.335   1.00 0.00 ? 131 LEU A CA   3  
ATOM 6400  C C    . LEU A 1 131 ? 9.407   -12.856 -1.030  1.00 0.00 ? 131 LEU A C    3  
ATOM 6401  O O    . LEU A 1 131 ? 9.217   -13.827 -1.762  1.00 0.00 ? 131 LEU A O    3  
ATOM 6402  C CB   . LEU A 1 131 ? 7.856   -11.510 0.398   1.00 0.00 ? 131 LEU A CB   3  
ATOM 6403  C CG   . LEU A 1 131 ? 7.017   -11.341 1.666   1.00 0.00 ? 131 LEU A CG   3  
ATOM 6404  C CD1  . LEU A 1 131 ? 6.352   -9.973  1.687   1.00 0.00 ? 131 LEU A CD1  3  
ATOM 6405  C CD2  . LEU A 1 131 ? 5.975   -12.445 1.767   1.00 0.00 ? 131 LEU A CD2  3  
ATOM 6406  H H    . LEU A 1 131 ? 9.551   -12.198 2.203   1.00 0.00 ? 131 LEU A H    3  
ATOM 6407  H HA   . LEU A 1 131 ? 8.112   -13.634 0.477   1.00 0.00 ? 131 LEU A HA   3  
ATOM 6408  H HB2  . LEU A 1 131 ? 8.501   -10.649 0.312   1.00 0.00 ? 131 LEU A HB2  3  
ATOM 6409  H HB3  . LEU A 1 131 ? 7.181   -11.537 -0.445  1.00 0.00 ? 131 LEU A HB3  3  
ATOM 6410  H HG   . LEU A 1 131 ? 7.664   -11.410 2.529   1.00 0.00 ? 131 LEU A HG   3  
ATOM 6411  H HD11 . LEU A 1 131 ? 5.296   -10.090 1.876   1.00 0.00 ? 131 LEU A HD11 3  
ATOM 6412  H HD12 . LEU A 1 131 ? 6.496   -9.488  0.733   1.00 0.00 ? 131 LEU A HD12 3  
ATOM 6413  H HD13 . LEU A 1 131 ? 6.793   -9.371  2.467   1.00 0.00 ? 131 LEU A HD13 3  
ATOM 6414  H HD21 . LEU A 1 131 ? 6.459   -13.373 2.033   1.00 0.00 ? 131 LEU A HD21 3  
ATOM 6415  H HD22 . LEU A 1 131 ? 5.478   -12.559 0.814   1.00 0.00 ? 131 LEU A HD22 3  
ATOM 6416  H HD23 . LEU A 1 131 ? 5.250   -12.187 2.523   1.00 0.00 ? 131 LEU A HD23 3  
ATOM 6417  N N    . SER A 1 132 ? 10.197  -11.841 -1.365  1.00 0.00 ? 132 SER A N    3  
ATOM 6418  C CA   . SER A 1 132 ? 10.899  -11.808 -2.643  1.00 0.00 ? 132 SER A CA   3  
ATOM 6419  C C    . SER A 1 132 ? 12.195  -12.611 -2.572  1.00 0.00 ? 132 SER A C    3  
ATOM 6420  O O    . SER A 1 132 ? 13.105  -12.276 -1.815  1.00 0.00 ? 132 SER A O    3  
ATOM 6421  C CB   . SER A 1 132 ? 11.202  -10.364 -3.046  1.00 0.00 ? 132 SER A CB   3  
ATOM 6422  O OG   . SER A 1 132 ? 11.599  -10.286 -4.404  1.00 0.00 ? 132 SER A OG   3  
ATOM 6423  H H    . SER A 1 132 ? 10.309  -11.095 -0.739  1.00 0.00 ? 132 SER A H    3  
ATOM 6424  H HA   . SER A 1 132 ? 10.254  -12.253 -3.387  1.00 0.00 ? 132 SER A HA   3  
ATOM 6425  H HB2  . SER A 1 132 ? 10.318  -9.761  -2.907  1.00 0.00 ? 132 SER A HB2  3  
ATOM 6426  H HB3  . SER A 1 132 ? 12.001  -9.981  -2.427  1.00 0.00 ? 132 SER A HB3  3  
ATOM 6427  H HG   . SER A 1 132 ? 11.998  -11.117 -4.669  1.00 0.00 ? 132 SER A HG   3  
ATOM 6428  N N    . GLY A 1 133 ? 12.270  -13.674 -3.368  1.00 0.00 ? 133 GLY A N    3  
ATOM 6429  C CA   . GLY A 1 133 ? 13.457  -14.508 -3.380  1.00 0.00 ? 133 GLY A CA   3  
ATOM 6430  C C    . GLY A 1 133 ? 14.730  -13.703 -3.543  1.00 0.00 ? 133 GLY A C    3  
ATOM 6431  O O    . GLY A 1 133 ? 14.705  -12.528 -3.911  1.00 0.00 ? 133 GLY A O    3  
ATOM 6432  H H    . GLY A 1 133 ? 11.513  -13.893 -3.951  1.00 0.00 ? 133 GLY A H    3  
ATOM 6433  H HA2  . GLY A 1 133 ? 13.507  -15.058 -2.453  1.00 0.00 ? 133 GLY A HA2  3  
ATOM 6434  H HA3  . GLY A 1 133 ? 13.381  -15.209 -4.199  1.00 0.00 ? 133 GLY A HA3  3  
ATOM 6435  N N    . PRO A 1 134 ? 15.877  -14.339 -3.263  1.00 0.00 ? 134 PRO A N    3  
ATOM 6436  C CA   . PRO A 1 134 ? 17.188  -13.692 -3.372  1.00 0.00 ? 134 PRO A CA   3  
ATOM 6437  C C    . PRO A 1 134 ? 17.581  -13.417 -4.819  1.00 0.00 ? 134 PRO A C    3  
ATOM 6438  O O    . PRO A 1 134 ? 17.607  -14.326 -5.649  1.00 0.00 ? 134 PRO A O    3  
ATOM 6439  C CB   . PRO A 1 134 ? 18.141  -14.713 -2.744  1.00 0.00 ? 134 PRO A CB   3  
ATOM 6440  C CG   . PRO A 1 134 ? 17.456  -16.025 -2.915  1.00 0.00 ? 134 PRO A CG   3  
ATOM 6441  C CD   . PRO A 1 134 ? 15.983  -15.739 -2.818  1.00 0.00 ? 134 PRO A CD   3  
ATOM 6442  H HA   . PRO A 1 134 ? 17.224  -12.770 -2.809  1.00 0.00 ? 134 PRO A HA   3  
ATOM 6443  H HB2  . PRO A 1 134 ? 19.089  -14.690 -3.263  1.00 0.00 ? 134 PRO A HB2  3  
ATOM 6444  H HB3  . PRO A 1 134 ? 18.289  -14.478 -1.701  1.00 0.00 ? 134 PRO A HB3  3  
ATOM 6445  H HG2  . PRO A 1 134 ? 17.695  -16.440 -3.882  1.00 0.00 ? 134 PRO A HG2  3  
ATOM 6446  H HG3  . PRO A 1 134 ? 17.758  -16.701 -2.129  1.00 0.00 ? 134 PRO A HG3  3  
ATOM 6447  H HD2  . PRO A 1 134 ? 15.428  -16.394 -3.473  1.00 0.00 ? 134 PRO A HD2  3  
ATOM 6448  H HD3  . PRO A 1 134 ? 15.644  -15.845 -1.798  1.00 0.00 ? 134 PRO A HD3  3  
ATOM 6449  N N    . SER A 1 135 ? 17.885  -12.158 -5.116  1.00 0.00 ? 135 SER A N    3  
ATOM 6450  C CA   . SER A 1 135 ? 18.273  -11.763 -6.465  1.00 0.00 ? 135 SER A CA   3  
ATOM 6451  C C    . SER A 1 135 ? 19.536  -10.907 -6.439  1.00 0.00 ? 135 SER A C    3  
ATOM 6452  O O    . SER A 1 135 ? 19.574  -9.855  -5.800  1.00 0.00 ? 135 SER A O    3  
ATOM 6453  C CB   . SER A 1 135 ? 17.136  -10.993 -7.141  1.00 0.00 ? 135 SER A CB   3  
ATOM 6454  O OG   . SER A 1 135 ? 17.572  -10.396 -8.350  1.00 0.00 ? 135 SER A OG   3  
ATOM 6455  H H    . SER A 1 135 ? 17.846  -11.478 -4.411  1.00 0.00 ? 135 SER A H    3  
ATOM 6456  H HA   . SER A 1 135 ? 18.473  -12.661 -7.029  1.00 0.00 ? 135 SER A HA   3  
ATOM 6457  H HB2  . SER A 1 135 ? 16.326  -11.672 -7.360  1.00 0.00 ? 135 SER A HB2  3  
ATOM 6458  H HB3  . SER A 1 135 ? 16.786  -10.217 -6.476  1.00 0.00 ? 135 SER A HB3  3  
ATOM 6459  H HG   . SER A 1 135 ? 17.870  -11.080 -8.955  1.00 0.00 ? 135 SER A HG   3  
ATOM 6460  N N    . SER A 1 136 ? 20.569  -11.367 -7.137  1.00 0.00 ? 136 SER A N    3  
ATOM 6461  C CA   . SER A 1 136 ? 21.836  -10.647 -7.191  1.00 0.00 ? 136 SER A CA   3  
ATOM 6462  C C    . SER A 1 136 ? 22.368  -10.590 -8.620  1.00 0.00 ? 136 SER A C    3  
ATOM 6463  O O    . SER A 1 136 ? 22.450  -11.609 -9.305  1.00 0.00 ? 136 SER A O    3  
ATOM 6464  C CB   . SER A 1 136 ? 22.866  -11.315 -6.278  1.00 0.00 ? 136 SER A CB   3  
ATOM 6465  O OG   . SER A 1 136 ? 23.936  -10.434 -5.986  1.00 0.00 ? 136 SER A OG   3  
ATOM 6466  H H    . SER A 1 136 ? 20.478  -12.212 -7.625  1.00 0.00 ? 136 SER A H    3  
ATOM 6467  H HA   . SER A 1 136 ? 21.660  -9.640  -6.845  1.00 0.00 ? 136 SER A HA   3  
ATOM 6468  H HB2  . SER A 1 136 ? 22.390  -11.603 -5.353  1.00 0.00 ? 136 SER A HB2  3  
ATOM 6469  H HB3  . SER A 1 136 ? 23.262  -12.193 -6.768  1.00 0.00 ? 136 SER A HB3  3  
ATOM 6470  H HG   . SER A 1 136 ? 24.623  -10.532 -6.650  1.00 0.00 ? 136 SER A HG   3  
ATOM 6471  N N    . GLY A 1 137 ? 22.728  -9.390  -9.064  1.00 0.00 ? 137 GLY A N    3  
ATOM 6472  C CA   . GLY A 1 137 ? 23.247  -9.221  -10.408 1.00 0.00 ? 137 GLY A CA   3  
ATOM 6473  C C    . GLY A 1 137 ? 24.033  -7.934  -10.569 1.00 0.00 ? 137 GLY A C    3  
ATOM 6474  O O    . GLY A 1 137 ? 24.076  -7.357  -11.655 1.00 0.00 ? 137 GLY A O    3  
ATOM 6475  H H    . GLY A 1 137 ? 22.641  -8.612  -8.473  1.00 0.00 ? 137 GLY A H    3  
ATOM 6476  H HA2  . GLY A 1 137 ? 23.891  -10.055 -10.642 1.00 0.00 ? 137 GLY A HA2  3  
ATOM 6477  H HA3  . GLY A 1 137 ? 22.420  -9.212  -11.103 1.00 0.00 ? 137 GLY A HA3  3  
ATOM 6478  N N    . GLY A 1 1   ? 26.499  -1.275  -17.941 1.00 0.00 ? 1   GLY A N    4  
ATOM 6479  C CA   . GLY A 1 1   ? 26.323  -0.345  -16.840 1.00 0.00 ? 1   GLY A CA   4  
ATOM 6480  C C    . GLY A 1 1   ? 25.172  0.614   -17.071 1.00 0.00 ? 1   GLY A C    4  
ATOM 6481  O O    . GLY A 1 1   ? 25.185  1.392   -18.025 1.00 0.00 ? 1   GLY A O    4  
ATOM 6482  H H1   . GLY A 1 1   ? 27.220  -1.132  -18.590 1.00 0.00 ? 1   GLY A H1   4  
ATOM 6483  H HA2  . GLY A 1 1   ? 26.135  -0.905  -15.936 1.00 0.00 ? 1   GLY A HA2  4  
ATOM 6484  H HA3  . GLY A 1 1   ? 27.232  0.225   -16.716 1.00 0.00 ? 1   GLY A HA3  4  
ATOM 6485  N N    . SER A 1 2   ? 24.173  0.559   -16.196 1.00 0.00 ? 2   SER A N    4  
ATOM 6486  C CA   . SER A 1 2   ? 23.007  1.426   -16.311 1.00 0.00 ? 2   SER A CA   4  
ATOM 6487  C C    . SER A 1 2   ? 22.646  2.035   -14.960 1.00 0.00 ? 2   SER A C    4  
ATOM 6488  O O    . SER A 1 2   ? 23.070  1.545   -13.913 1.00 0.00 ? 2   SER A O    4  
ATOM 6489  C CB   . SER A 1 2   ? 21.815  0.643   -16.865 1.00 0.00 ? 2   SER A CB   4  
ATOM 6490  O OG   . SER A 1 2   ? 21.833  0.622   -18.282 1.00 0.00 ? 2   SER A OG   4  
ATOM 6491  H H    . SER A 1 2   ? 24.221  -0.082  -15.456 1.00 0.00 ? 2   SER A H    4  
ATOM 6492  H HA   . SER A 1 2   ? 23.253  2.223   -16.997 1.00 0.00 ? 2   SER A HA   4  
ATOM 6493  H HB2  . SER A 1 2   ? 21.855  -0.373  -16.502 1.00 0.00 ? 2   SER A HB2  4  
ATOM 6494  H HB3  . SER A 1 2   ? 20.897  1.107   -16.535 1.00 0.00 ? 2   SER A HB3  4  
ATOM 6495  H HG   . SER A 1 2   ? 21.184  1.244   -18.620 1.00 0.00 ? 2   SER A HG   4  
ATOM 6496  N N    . SER A 1 3   ? 21.858  3.105   -14.991 1.00 0.00 ? 3   SER A N    4  
ATOM 6497  C CA   . SER A 1 3   ? 21.442  3.784   -13.769 1.00 0.00 ? 3   SER A CA   4  
ATOM 6498  C C    . SER A 1 3   ? 19.978  3.490   -13.456 1.00 0.00 ? 3   SER A C    4  
ATOM 6499  O O    . SER A 1 3   ? 19.179  3.234   -14.355 1.00 0.00 ? 3   SER A O    4  
ATOM 6500  C CB   . SER A 1 3   ? 21.654  5.293   -13.901 1.00 0.00 ? 3   SER A CB   4  
ATOM 6501  O OG   . SER A 1 3   ? 21.855  5.893   -12.633 1.00 0.00 ? 3   SER A OG   4  
ATOM 6502  H H    . SER A 1 3   ? 21.552  3.448   -15.856 1.00 0.00 ? 3   SER A H    4  
ATOM 6503  H HA   . SER A 1 3   ? 22.053  3.413   -12.959 1.00 0.00 ? 3   SER A HA   4  
ATOM 6504  H HB2  . SER A 1 3   ? 22.522  5.480   -14.516 1.00 0.00 ? 3   SER A HB2  4  
ATOM 6505  H HB3  . SER A 1 3   ? 20.784  5.737   -14.363 1.00 0.00 ? 3   SER A HB3  4  
ATOM 6506  H HG   . SER A 1 3   ? 22.212  5.243   -12.024 1.00 0.00 ? 3   SER A HG   4  
ATOM 6507  N N    . GLY A 1 4   ? 19.635  3.529   -12.172 1.00 0.00 ? 4   GLY A N    4  
ATOM 6508  C CA   . GLY A 1 4   ? 18.268  3.264   -11.761 1.00 0.00 ? 4   GLY A CA   4  
ATOM 6509  C C    . GLY A 1 4   ? 17.430  4.526   -11.688 1.00 0.00 ? 4   GLY A C    4  
ATOM 6510  O O    . GLY A 1 4   ? 17.048  4.963   -10.603 1.00 0.00 ? 4   GLY A O    4  
ATOM 6511  H H    . GLY A 1 4   ? 20.315  3.738   -11.498 1.00 0.00 ? 4   GLY A H    4  
ATOM 6512  H HA2  . GLY A 1 4   ? 17.816  2.585   -12.469 1.00 0.00 ? 4   GLY A HA2  4  
ATOM 6513  H HA3  . GLY A 1 4   ? 18.281  2.798   -10.787 1.00 0.00 ? 4   GLY A HA3  4  
ATOM 6514  N N    . SER A 1 5   ? 17.146  5.114   -12.846 1.00 0.00 ? 5   SER A N    4  
ATOM 6515  C CA   . SER A 1 5   ? 16.353  6.336   -12.909 1.00 0.00 ? 5   SER A CA   4  
ATOM 6516  C C    . SER A 1 5   ? 14.946  6.045   -13.419 1.00 0.00 ? 5   SER A C    4  
ATOM 6517  O O    . SER A 1 5   ? 14.399  6.794   -14.228 1.00 0.00 ? 5   SER A O    4  
ATOM 6518  C CB   . SER A 1 5   ? 17.034  7.364   -13.814 1.00 0.00 ? 5   SER A CB   4  
ATOM 6519  O OG   . SER A 1 5   ? 18.231  7.847   -13.229 1.00 0.00 ? 5   SER A OG   4  
ATOM 6520  H H    . SER A 1 5   ? 17.480  4.717   -13.678 1.00 0.00 ? 5   SER A H    4  
ATOM 6521  H HA   . SER A 1 5   ? 16.285  6.738   -11.909 1.00 0.00 ? 5   SER A HA   4  
ATOM 6522  H HB2  . SER A 1 5   ? 17.271  6.905   -14.762 1.00 0.00 ? 5   SER A HB2  4  
ATOM 6523  H HB3  . SER A 1 5   ? 16.364  8.197   -13.975 1.00 0.00 ? 5   SER A HB3  4  
ATOM 6524  H HG   . SER A 1 5   ? 18.161  7.800   -12.272 1.00 0.00 ? 5   SER A HG   4  
ATOM 6525  N N    . SER A 1 6   ? 14.364  4.950   -12.939 1.00 0.00 ? 6   SER A N    4  
ATOM 6526  C CA   . SER A 1 6   ? 13.021  4.556   -13.349 1.00 0.00 ? 6   SER A CA   4  
ATOM 6527  C C    . SER A 1 6   ? 11.978  5.072   -12.361 1.00 0.00 ? 6   SER A C    4  
ATOM 6528  O O    . SER A 1 6   ? 11.017  5.736   -12.747 1.00 0.00 ? 6   SER A O    4  
ATOM 6529  C CB   . SER A 1 6   ? 12.925  3.033   -13.459 1.00 0.00 ? 6   SER A CB   4  
ATOM 6530  O OG   . SER A 1 6   ? 11.617  2.630   -13.827 1.00 0.00 ? 6   SER A OG   4  
ATOM 6531  H H    . SER A 1 6   ? 14.851  4.393   -12.296 1.00 0.00 ? 6   SER A H    4  
ATOM 6532  H HA   . SER A 1 6   ? 12.829  4.992   -14.318 1.00 0.00 ? 6   SER A HA   4  
ATOM 6533  H HB2  . SER A 1 6   ? 13.619  2.685   -14.208 1.00 0.00 ? 6   SER A HB2  4  
ATOM 6534  H HB3  . SER A 1 6   ? 13.171  2.589   -12.505 1.00 0.00 ? 6   SER A HB3  4  
ATOM 6535  H HG   . SER A 1 6   ? 10.982  3.282   -13.520 1.00 0.00 ? 6   SER A HG   4  
ATOM 6536  N N    . GLY A 1 7   ? 12.177  4.762   -11.084 1.00 0.00 ? 7   GLY A N    4  
ATOM 6537  C CA   . GLY A 1 7   ? 11.247  5.202   -10.060 1.00 0.00 ? 7   GLY A CA   4  
ATOM 6538  C C    . GLY A 1 7   ? 9.811   5.203   -10.544 1.00 0.00 ? 7   GLY A C    4  
ATOM 6539  O O    . GLY A 1 7   ? 9.226   6.262   -10.772 1.00 0.00 ? 7   GLY A O    4  
ATOM 6540  H H    . GLY A 1 7   ? 12.962  4.230   -10.835 1.00 0.00 ? 7   GLY A H    4  
ATOM 6541  H HA2  . GLY A 1 7   ? 11.329  4.543   -9.208  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 6542  H HA3  . GLY A 1 7   ? 11.513  6.203   -9.755  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 6543  N N    . TYR A 1 8   ? 9.241   4.014   -10.703 1.00 0.00 ? 8   TYR A N    4  
ATOM 6544  C CA   . TYR A 1 8   ? 7.865   3.882   -11.167 1.00 0.00 ? 8   TYR A CA   4  
ATOM 6545  C C    . TYR A 1 8   ? 7.061   2.977   -10.238 1.00 0.00 ? 8   TYR A C    4  
ATOM 6546  O O    . TYR A 1 8   ? 7.478   1.861   -9.926  1.00 0.00 ? 8   TYR A O    4  
ATOM 6547  C CB   . TYR A 1 8   ? 7.836   3.323   -12.591 1.00 0.00 ? 8   TYR A CB   4  
ATOM 6548  C CG   . TYR A 1 8   ? 7.965   1.818   -12.654 1.00 0.00 ? 8   TYR A CG   4  
ATOM 6549  C CD1  . TYR A 1 8   ? 9.135   1.184   -12.253 1.00 0.00 ? 8   TYR A CD1  4  
ATOM 6550  C CD2  . TYR A 1 8   ? 6.918   1.030   -13.114 1.00 0.00 ? 8   TYR A CD2  4  
ATOM 6551  C CE1  . TYR A 1 8   ? 9.258   -0.190  -12.310 1.00 0.00 ? 8   TYR A CE1  4  
ATOM 6552  C CE2  . TYR A 1 8   ? 7.031   -0.346  -13.173 1.00 0.00 ? 8   TYR A CE2  4  
ATOM 6553  C CZ   . TYR A 1 8   ? 8.203   -0.951  -12.770 1.00 0.00 ? 8   TYR A CZ   4  
ATOM 6554  O OH   . TYR A 1 8   ? 8.321   -2.321  -12.828 1.00 0.00 ? 8   TYR A OH   4  
ATOM 6555  H H    . TYR A 1 8   ? 9.758   3.205   -10.505 1.00 0.00 ? 8   TYR A H    4  
ATOM 6556  H HA   . TYR A 1 8   ? 7.419   4.865   -11.167 1.00 0.00 ? 8   TYR A HA   4  
ATOM 6557  H HB2  . TYR A 1 8   ? 6.902   3.595   -13.058 1.00 0.00 ? 8   TYR A HB2  4  
ATOM 6558  H HB3  . TYR A 1 8   ? 8.653   3.751   -13.154 1.00 0.00 ? 8   TYR A HB3  4  
ATOM 6559  H HD1  . TYR A 1 8   ? 9.959   1.783   -11.893 1.00 0.00 ? 8   TYR A HD1  4  
ATOM 6560  H HD2  . TYR A 1 8   ? 6.001   1.508   -13.430 1.00 0.00 ? 8   TYR A HD2  4  
ATOM 6561  H HE1  . TYR A 1 8   ? 10.175  -0.665  -11.994 1.00 0.00 ? 8   TYR A HE1  4  
ATOM 6562  H HE2  . TYR A 1 8   ? 6.206   -0.941  -13.534 1.00 0.00 ? 8   TYR A HE2  4  
ATOM 6563  H HH   . TYR A 1 8   ? 7.695   -2.721  -12.219 1.00 0.00 ? 8   TYR A HH   4  
ATOM 6564  N N    . ILE A 1 9   ? 5.907   3.467   -9.799  1.00 0.00 ? 9   ILE A N    4  
ATOM 6565  C CA   . ILE A 1 9   ? 5.043   2.703   -8.907  1.00 0.00 ? 9   ILE A CA   4  
ATOM 6566  C C    . ILE A 1 9   ? 3.718   2.365   -9.581  1.00 0.00 ? 9   ILE A C    4  
ATOM 6567  O O    . ILE A 1 9   ? 3.240   3.103   -10.443 1.00 0.00 ? 9   ILE A O    4  
ATOM 6568  C CB   . ILE A 1 9   ? 4.760   3.472   -7.602  1.00 0.00 ? 9   ILE A CB   4  
ATOM 6569  C CG1  . ILE A 1 9   ? 6.041   3.606   -6.776  1.00 0.00 ? 9   ILE A CG1  4  
ATOM 6570  C CG2  . ILE A 1 9   ? 3.676   2.770   -6.799  1.00 0.00 ? 9   ILE A CG2  4  
ATOM 6571  C CD1  . ILE A 1 9   ? 5.976   4.700   -5.733  1.00 0.00 ? 9   ILE A CD1  4  
ATOM 6572  H H    . ILE A 1 9   ? 5.629   4.363   -10.082 1.00 0.00 ? 9   ILE A H    4  
ATOM 6573  H HA   . ILE A 1 9   ? 5.553   1.784   -8.656  1.00 0.00 ? 9   ILE A HA   4  
ATOM 6574  H HB   . ILE A 1 9   ? 4.403   4.457   -7.861  1.00 0.00 ? 9   ILE A HB   4  
ATOM 6575  H HG12 . ILE A 1 9   ? 6.233   2.675   -6.267  1.00 0.00 ? 9   ILE A HG12 4  
ATOM 6576  H HG13 . ILE A 1 9   ? 6.866   3.826   -7.438  1.00 0.00 ? 9   ILE A HG13 4  
ATOM 6577  H HG21 . ILE A 1 9   ? 2.705   3.055   -7.178  1.00 0.00 ? 9   ILE A HG21 4  
ATOM 6578  H HG22 . ILE A 1 9   ? 3.797   1.701   -6.888  1.00 0.00 ? 9   ILE A HG22 4  
ATOM 6579  H HG23 . ILE A 1 9   ? 3.754   3.056   -5.761  1.00 0.00 ? 9   ILE A HG23 4  
ATOM 6580  H HD11 . ILE A 1 9   ? 6.958   5.126   -5.596  1.00 0.00 ? 9   ILE A HD11 4  
ATOM 6581  H HD12 . ILE A 1 9   ? 5.291   5.468   -6.059  1.00 0.00 ? 9   ILE A HD12 4  
ATOM 6582  H HD13 . ILE A 1 9   ? 5.630   4.284   -4.797  1.00 0.00 ? 9   ILE A HD13 4  
ATOM 6583  N N    . LYS A 1 10  ? 3.127   1.244   -9.183  1.00 0.00 ? 10  LYS A N    4  
ATOM 6584  C CA   . LYS A 1 10  ? 1.855   0.807   -9.745  1.00 0.00 ? 10  LYS A CA   4  
ATOM 6585  C C    . LYS A 1 10  ? 0.685   1.325   -8.914  1.00 0.00 ? 10  LYS A C    4  
ATOM 6586  O O    . LYS A 1 10  ? 0.325   0.734   -7.896  1.00 0.00 ? 10  LYS A O    4  
ATOM 6587  C CB   . LYS A 1 10  ? 1.804   -0.721  -9.819  1.00 0.00 ? 10  LYS A CB   4  
ATOM 6588  C CG   . LYS A 1 10  ? 0.485   -1.261  -10.345 1.00 0.00 ? 10  LYS A CG   4  
ATOM 6589  C CD   . LYS A 1 10  ? 0.499   -1.387  -11.860 1.00 0.00 ? 10  LYS A CD   4  
ATOM 6590  C CE   . LYS A 1 10  ? -0.894  -1.215  -12.446 1.00 0.00 ? 10  LYS A CE   4  
ATOM 6591  N NZ   . LYS A 1 10  ? -0.883  -1.292  -13.933 1.00 0.00 ? 10  LYS A NZ   4  
ATOM 6592  H H    . LYS A 1 10  ? 3.557   0.697   -8.491  1.00 0.00 ? 10  LYS A H    4  
ATOM 6593  H HA   . LYS A 1 10  ? 1.778   1.210   -10.744 1.00 0.00 ? 10  LYS A HA   4  
ATOM 6594  H HB2  . LYS A 1 10  ? 2.595   -1.064  -10.469 1.00 0.00 ? 10  LYS A HB2  4  
ATOM 6595  H HB3  . LYS A 1 10  ? 1.964   -1.123  -8.829  1.00 0.00 ? 10  LYS A HB3  4  
ATOM 6596  H HG2  . LYS A 1 10  ? 0.308   -2.235  -9.915  1.00 0.00 ? 10  LYS A HG2  4  
ATOM 6597  H HG3  . LYS A 1 10  ? -0.310  -0.588  -10.057 1.00 0.00 ? 10  LYS A HG3  4  
ATOM 6598  H HD2  . LYS A 1 10  ? 1.147   -0.627  -12.270 1.00 0.00 ? 10  LYS A HD2  4  
ATOM 6599  H HD3  . LYS A 1 10  ? 0.874   -2.365  -12.127 1.00 0.00 ? 10  LYS A HD3  4  
ATOM 6600  H HE2  . LYS A 1 10  ? -1.532  -1.994  -12.059 1.00 0.00 ? 10  LYS A HE2  4  
ATOM 6601  H HE3  . LYS A 1 10  ? -1.279  -0.251  -12.147 1.00 0.00 ? 10  LYS A HE3  4  
ATOM 6602  H HZ1  . LYS A 1 10  ? -1.779  -1.693  -14.276 1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 6603  H HZ2  . LYS A 1 10  ? -0.100  -1.897  -14.254 1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 6604  H HZ3  . LYS A 1 10  ? -0.762  -0.343  -14.340 1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 6605  N N    . TYR A 1 11  ? 0.097   2.431   -9.355  1.00 0.00 ? 11  TYR A N    4  
ATOM 6606  C CA   . TYR A 1 11  ? -1.032  3.029   -8.651  1.00 0.00 ? 11  TYR A CA   4  
ATOM 6607  C C    . TYR A 1 11  ? -2.282  2.167   -8.793  1.00 0.00 ? 11  TYR A C    4  
ATOM 6608  O O    . TYR A 1 11  ? -2.351  1.290   -9.655  1.00 0.00 ? 11  TYR A O    4  
ATOM 6609  C CB   . TYR A 1 11  ? -1.305  4.436   -9.185  1.00 0.00 ? 11  TYR A CB   4  
ATOM 6610  C CG   . TYR A 1 11  ? -0.212  5.430   -8.862  1.00 0.00 ? 11  TYR A CG   4  
ATOM 6611  C CD1  . TYR A 1 11  ? 0.944   5.494   -9.631  1.00 0.00 ? 11  TYR A CD1  4  
ATOM 6612  C CD2  . TYR A 1 11  ? -0.334  6.303   -7.789  1.00 0.00 ? 11  TYR A CD2  4  
ATOM 6613  C CE1  . TYR A 1 11  ? 1.946   6.399   -9.340  1.00 0.00 ? 11  TYR A CE1  4  
ATOM 6614  C CE2  . TYR A 1 11  ? 0.662   7.213   -7.491  1.00 0.00 ? 11  TYR A CE2  4  
ATOM 6615  C CZ   . TYR A 1 11  ? 1.800   7.257   -8.269  1.00 0.00 ? 11  TYR A CZ   4  
ATOM 6616  O OH   . TYR A 1 11  ? 2.796   8.161   -7.975  1.00 0.00 ? 11  TYR A OH   4  
ATOM 6617  H H    . TYR A 1 11  ? 0.429   2.857   -10.173 1.00 0.00 ? 11  TYR A H    4  
ATOM 6618  H HA   . TYR A 1 11  ? -0.772  3.096   -7.605  1.00 0.00 ? 11  TYR A HA   4  
ATOM 6619  H HB2  . TYR A 1 11  ? -1.407  4.393   -10.258 1.00 0.00 ? 11  TYR A HB2  4  
ATOM 6620  H HB3  . TYR A 1 11  ? -2.225  4.804   -8.755  1.00 0.00 ? 11  TYR A HB3  4  
ATOM 6621  H HD1  . TYR A 1 11  ? 1.056   4.821   -10.469 1.00 0.00 ? 11  TYR A HD1  4  
ATOM 6622  H HD2  . TYR A 1 11  ? -1.227  6.266   -7.181  1.00 0.00 ? 11  TYR A HD2  4  
ATOM 6623  H HE1  . TYR A 1 11  ? 2.838   6.434   -9.949  1.00 0.00 ? 11  TYR A HE1  4  
ATOM 6624  H HE2  . TYR A 1 11  ? 0.548   7.884   -6.653  1.00 0.00 ? 11  TYR A HE2  4  
ATOM 6625  H HH   . TYR A 1 11  ? 3.637   7.702   -7.915  1.00 0.00 ? 11  TYR A HH   4  
ATOM 6626  N N    . PHE A 1 12  ? -3.270  2.424   -7.942  1.00 0.00 ? 12  PHE A N    4  
ATOM 6627  C CA   . PHE A 1 12  ? -4.519  1.672   -7.972  1.00 0.00 ? 12  PHE A CA   4  
ATOM 6628  C C    . PHE A 1 12  ? -5.696  2.556   -7.570  1.00 0.00 ? 12  PHE A C    4  
ATOM 6629  O O    . PHE A 1 12  ? -5.543  3.491   -6.785  1.00 0.00 ? 12  PHE A O    4  
ATOM 6630  C CB   . PHE A 1 12  ? -4.433  0.462   -7.038  1.00 0.00 ? 12  PHE A CB   4  
ATOM 6631  C CG   . PHE A 1 12  ? -3.483  -0.598  -7.517  1.00 0.00 ? 12  PHE A CG   4  
ATOM 6632  C CD1  . PHE A 1 12  ? -3.706  -1.258  -8.715  1.00 0.00 ? 12  PHE A CD1  4  
ATOM 6633  C CD2  . PHE A 1 12  ? -2.366  -0.935  -6.769  1.00 0.00 ? 12  PHE A CD2  4  
ATOM 6634  C CE1  . PHE A 1 12  ? -2.833  -2.234  -9.158  1.00 0.00 ? 12  PHE A CE1  4  
ATOM 6635  C CE2  . PHE A 1 12  ? -1.490  -1.910  -7.207  1.00 0.00 ? 12  PHE A CE2  4  
ATOM 6636  C CZ   . PHE A 1 12  ? -1.724  -2.561  -8.403  1.00 0.00 ? 12  PHE A CZ   4  
ATOM 6637  H H    . PHE A 1 12  ? -3.155  3.135   -7.278  1.00 0.00 ? 12  PHE A H    4  
ATOM 6638  H HA   . PHE A 1 12  ? -4.673  1.326   -8.982  1.00 0.00 ? 12  PHE A HA   4  
ATOM 6639  H HB2  . PHE A 1 12  ? -4.100  0.790   -6.065  1.00 0.00 ? 12  PHE A HB2  4  
ATOM 6640  H HB3  . PHE A 1 12  ? -5.412  0.016   -6.948  1.00 0.00 ? 12  PHE A HB3  4  
ATOM 6641  H HD1  . PHE A 1 12  ? -4.574  -1.002  -9.307  1.00 0.00 ? 12  PHE A HD1  4  
ATOM 6642  H HD2  . PHE A 1 12  ? -2.182  -0.428  -5.833  1.00 0.00 ? 12  PHE A HD2  4  
ATOM 6643  H HE1  . PHE A 1 12  ? -3.020  -2.740  -10.094 1.00 0.00 ? 12  PHE A HE1  4  
ATOM 6644  H HE2  . PHE A 1 12  ? -0.624  -2.164  -6.615  1.00 0.00 ? 12  PHE A HE2  4  
ATOM 6645  H HZ   . PHE A 1 12  ? -1.041  -3.322  -8.748  1.00 0.00 ? 12  PHE A HZ   4  
ATOM 6646  N N    . ASN A 1 13  ? -6.869  2.253   -8.115  1.00 0.00 ? 13  ASN A N    4  
ATOM 6647  C CA   . ASN A 1 13  ? -8.072  3.020   -7.815  1.00 0.00 ? 13  ASN A CA   4  
ATOM 6648  C C    . ASN A 1 13  ? -8.797  2.444   -6.602  1.00 0.00 ? 13  ASN A C    4  
ATOM 6649  O O    . ASN A 1 13  ? -8.346  1.466   -6.004  1.00 0.00 ? 13  ASN A O    4  
ATOM 6650  C CB   . ASN A 1 13  ? -9.010  3.033   -9.024  1.00 0.00 ? 13  ASN A CB   4  
ATOM 6651  C CG   . ASN A 1 13  ? -9.851  4.293   -9.091  1.00 0.00 ? 13  ASN A CG   4  
ATOM 6652  O OD1  . ASN A 1 13  ? -9.340  5.402   -8.938  1.00 0.00 ? 13  ASN A OD1  4  
ATOM 6653  N ND2  . ASN A 1 13  ? -11.148 4.126   -9.319  1.00 0.00 ? 13  ASN A ND2  4  
ATOM 6654  H H    . ASN A 1 13  ? -6.928  1.495   -8.734  1.00 0.00 ? 13  ASN A H    4  
ATOM 6655  H HA   . ASN A 1 13  ? -7.773  4.033   -7.592  1.00 0.00 ? 13  ASN A HA   4  
ATOM 6656  H HB2  . ASN A 1 13  ? -8.421  2.968   -9.928  1.00 0.00 ? 13  ASN A HB2  4  
ATOM 6657  H HB3  . ASN A 1 13  ? -9.672  2.182   -8.969  1.00 0.00 ? 13  ASN A HB3  4  
ATOM 6658  H HD21 . ASN A 1 13  ? -11.486 3.213   -9.431  1.00 0.00 ? 13  ASN A HD21 4  
ATOM 6659  H HD22 . ASN A 1 13  ? -11.715 4.924   -9.368  1.00 0.00 ? 13  ASN A HD22 4  
ATOM 6660  N N    . ASP A 1 14  ? -9.921  3.055   -6.246  1.00 0.00 ? 14  ASP A N    4  
ATOM 6661  C CA   . ASP A 1 14  ? -10.710 2.602   -5.106  1.00 0.00 ? 14  ASP A CA   4  
ATOM 6662  C C    . ASP A 1 14  ? -11.465 1.320   -5.442  1.00 0.00 ? 14  ASP A C    4  
ATOM 6663  O O    . ASP A 1 14  ? -11.764 0.513   -4.562  1.00 0.00 ? 14  ASP A O    4  
ATOM 6664  C CB   . ASP A 1 14  ? -11.694 3.690   -4.675  1.00 0.00 ? 14  ASP A CB   4  
ATOM 6665  C CG   . ASP A 1 14  ? -12.563 4.171   -5.820  1.00 0.00 ? 14  ASP A CG   4  
ATOM 6666  O OD1  . ASP A 1 14  ? -12.093 5.022   -6.604  1.00 0.00 ? 14  ASP A OD1  4  
ATOM 6667  O OD2  . ASP A 1 14  ? -13.714 3.698   -5.931  1.00 0.00 ? 14  ASP A OD2  4  
ATOM 6668  H H    . ASP A 1 14  ? -10.229 3.829   -6.763  1.00 0.00 ? 14  ASP A H    4  
ATOM 6669  H HA   . ASP A 1 14  ? -10.030 2.401   -4.291  1.00 0.00 ? 14  ASP A HA   4  
ATOM 6670  H HB2  . ASP A 1 14  ? -12.337 3.298   -3.899  1.00 0.00 ? 14  ASP A HB2  4  
ATOM 6671  H HB3  . ASP A 1 14  ? -11.141 4.533   -4.287  1.00 0.00 ? 14  ASP A HB3  4  
ATOM 6672  N N    . LYS A 1 15  ? -11.772 1.139   -6.723  1.00 0.00 ? 15  LYS A N    4  
ATOM 6673  C CA   . LYS A 1 15  ? -12.492 -0.045  -7.177  1.00 0.00 ? 15  LYS A CA   4  
ATOM 6674  C C    . LYS A 1 15  ? -11.532 -1.074  -7.765  1.00 0.00 ? 15  LYS A C    4  
ATOM 6675  O O    . LYS A 1 15  ? -11.555 -2.247  -7.390  1.00 0.00 ? 15  LYS A O    4  
ATOM 6676  C CB   . LYS A 1 15  ? -13.543 0.342   -8.220  1.00 0.00 ? 15  LYS A CB   4  
ATOM 6677  C CG   . LYS A 1 15  ? -14.465 -0.801  -8.608  1.00 0.00 ? 15  LYS A CG   4  
ATOM 6678  C CD   . LYS A 1 15  ? -13.863 -1.652  -9.714  1.00 0.00 ? 15  LYS A CD   4  
ATOM 6679  C CE   . LYS A 1 15  ? -14.941 -2.352  -10.527 1.00 0.00 ? 15  LYS A CE   4  
ATOM 6680  N NZ   . LYS A 1 15  ? -15.850 -3.159  -9.666  1.00 0.00 ? 15  LYS A NZ   4  
ATOM 6681  H H    . LYS A 1 15  ? -11.506 1.818   -7.378  1.00 0.00 ? 15  LYS A H    4  
ATOM 6682  H HA   . LYS A 1 15  ? -12.988 -0.480  -6.323  1.00 0.00 ? 15  LYS A HA   4  
ATOM 6683  H HB2  . LYS A 1 15  ? -14.146 1.146   -7.825  1.00 0.00 ? 15  LYS A HB2  4  
ATOM 6684  H HB3  . LYS A 1 15  ? -13.038 0.687   -9.111  1.00 0.00 ? 15  LYS A HB3  4  
ATOM 6685  H HG2  . LYS A 1 15  ? -14.635 -1.423  -7.742  1.00 0.00 ? 15  LYS A HG2  4  
ATOM 6686  H HG3  . LYS A 1 15  ? -15.405 -0.393  -8.951  1.00 0.00 ? 15  LYS A HG3  4  
ATOM 6687  H HD2  . LYS A 1 15  ? -13.287 -1.019  -10.371 1.00 0.00 ? 15  LYS A HD2  4  
ATOM 6688  H HD3  . LYS A 1 15  ? -13.217 -2.398  -9.271  1.00 0.00 ? 15  LYS A HD3  4  
ATOM 6689  H HE2  . LYS A 1 15  ? -15.521 -1.607  -11.049 1.00 0.00 ? 15  LYS A HE2  4  
ATOM 6690  H HE3  . LYS A 1 15  ? -14.465 -3.005  -11.244 1.00 0.00 ? 15  LYS A HE3  4  
ATOM 6691  H HZ1  . LYS A 1 15  ? -15.913 -4.132  -10.028 1.00 0.00 ? 15  LYS A HZ1  4  
ATOM 6692  H HZ2  . LYS A 1 15  ? -16.802 -2.741  -9.661  1.00 0.00 ? 15  LYS A HZ2  4  
ATOM 6693  H HZ3  . LYS A 1 15  ? -15.489 -3.186  -8.691  1.00 0.00 ? 15  LYS A HZ3  4  
ATOM 6694  N N    . THR A 1 16  ? -10.685 -0.628  -8.688  1.00 0.00 ? 16  THR A N    4  
ATOM 6695  C CA   . THR A 1 16  ? -9.717  -1.509  -9.327  1.00 0.00 ? 16  THR A CA   4  
ATOM 6696  C C    . THR A 1 16  ? -8.864  -2.232  -8.291  1.00 0.00 ? 16  THR A C    4  
ATOM 6697  O O    . THR A 1 16  ? -8.554  -3.414  -8.444  1.00 0.00 ? 16  THR A O    4  
ATOM 6698  C CB   . THR A 1 16  ? -8.793  -0.731  -10.282 1.00 0.00 ? 16  THR A CB   4  
ATOM 6699  O OG1  . THR A 1 16  ? -8.066  0.267   -9.557  1.00 0.00 ? 16  THR A OG1  4  
ATOM 6700  C CG2  . THR A 1 16  ? -9.596  -0.072  -11.394 1.00 0.00 ? 16  THR A CG2  4  
ATOM 6701  H H    . THR A 1 16  ? -10.715 0.318   -8.945  1.00 0.00 ? 16  THR A H    4  
ATOM 6702  H HA   . THR A 1 16  ? -10.262 -2.242  -9.904  1.00 0.00 ? 16  THR A HA   4  
ATOM 6703  H HB   . THR A 1 16  ? -8.093  -1.424  -10.726 1.00 0.00 ? 16  THR A HB   4  
ATOM 6704  H HG1  . THR A 1 16  ? -8.548  0.497   -8.759  1.00 0.00 ? 16  THR A HG1  4  
ATOM 6705  H HG21 . THR A 1 16  ? -10.013 0.857   -11.035 1.00 0.00 ? 16  THR A HG21 4  
ATOM 6706  H HG22 . THR A 1 16  ? -10.394 -0.731  -11.700 1.00 0.00 ? 16  THR A HG22 4  
ATOM 6707  H HG23 . THR A 1 16  ? -8.949  0.125   -12.236 1.00 0.00 ? 16  THR A HG23 4  
ATOM 6708  N N    . ILE A 1 17  ? -8.488  -1.516  -7.237  1.00 0.00 ? 17  ILE A N    4  
ATOM 6709  C CA   . ILE A 1 17  ? -7.672  -2.091  -6.175  1.00 0.00 ? 17  ILE A CA   4  
ATOM 6710  C C    . ILE A 1 17  ? -8.152  -3.491  -5.809  1.00 0.00 ? 17  ILE A C    4  
ATOM 6711  O O    . ILE A 1 17  ? -7.364  -4.339  -5.390  1.00 0.00 ? 17  ILE A O    4  
ATOM 6712  C CB   . ILE A 1 17  ? -7.689  -1.209  -4.912  1.00 0.00 ? 17  ILE A CB   4  
ATOM 6713  C CG1  . ILE A 1 17  ? -6.896  -1.877  -3.786  1.00 0.00 ? 17  ILE A CG1  4  
ATOM 6714  C CG2  . ILE A 1 17  ? -9.120  -0.941  -4.472  1.00 0.00 ? 17  ILE A CG2  4  
ATOM 6715  C CD1  . ILE A 1 17  ? -6.383  -0.903  -2.749  1.00 0.00 ? 17  ILE A CD1  4  
ATOM 6716  H H    . ILE A 1 17  ? -8.766  -0.579  -7.172  1.00 0.00 ? 17  ILE A H    4  
ATOM 6717  H HA   . ILE A 1 17  ? -6.654  -2.153  -6.533  1.00 0.00 ? 17  ILE A HA   4  
ATOM 6718  H HB   . ILE A 1 17  ? -7.229  -0.263  -5.154  1.00 0.00 ? 17  ILE A HB   4  
ATOM 6719  H HG12 . ILE A 1 17  ? -7.528  -2.593  -3.285  1.00 0.00 ? 17  ILE A HG12 4  
ATOM 6720  H HG13 . ILE A 1 17  ? -6.045  -2.389  -4.211  1.00 0.00 ? 17  ILE A HG13 4  
ATOM 6721  H HG21 . ILE A 1 17  ? -9.803  -1.415  -5.161  1.00 0.00 ? 17  ILE A HG21 4  
ATOM 6722  H HG22 . ILE A 1 17  ? -9.273  -1.342  -3.482  1.00 0.00 ? 17  ILE A HG22 4  
ATOM 6723  H HG23 . ILE A 1 17  ? -9.300  0.123   -4.462  1.00 0.00 ? 17  ILE A HG23 4  
ATOM 6724  H HD11 . ILE A 1 17  ? -6.547  -1.309  -1.761  1.00 0.00 ? 17  ILE A HD11 4  
ATOM 6725  H HD12 . ILE A 1 17  ? -5.327  -0.738  -2.900  1.00 0.00 ? 17  ILE A HD12 4  
ATOM 6726  H HD13 . ILE A 1 17  ? -6.911  0.035   -2.843  1.00 0.00 ? 17  ILE A HD13 4  
ATOM 6727  N N    . ASP A 1 18  ? -9.449  -3.727  -5.973  1.00 0.00 ? 18  ASP A N    4  
ATOM 6728  C CA   . ASP A 1 18  ? -10.035 -5.026  -5.663  1.00 0.00 ? 18  ASP A CA   4  
ATOM 6729  C C    . ASP A 1 18  ? -9.795  -6.015  -6.800  1.00 0.00 ? 18  ASP A C    4  
ATOM 6730  O O    . ASP A 1 18  ? -9.069  -6.995  -6.638  1.00 0.00 ? 18  ASP A O    4  
ATOM 6731  C CB   . ASP A 1 18  ? -11.536 -4.883  -5.403  1.00 0.00 ? 18  ASP A CB   4  
ATOM 6732  C CG   . ASP A 1 18  ? -12.145 -6.145  -4.824  1.00 0.00 ? 18  ASP A CG   4  
ATOM 6733  O OD1  . ASP A 1 18  ? -12.094 -7.193  -5.501  1.00 0.00 ? 18  ASP A OD1  4  
ATOM 6734  O OD2  . ASP A 1 18  ? -12.674 -6.084  -3.694  1.00 0.00 ? 18  ASP A OD2  4  
ATOM 6735  H H    . ASP A 1 18  ? -10.027 -3.010  -6.311  1.00 0.00 ? 18  ASP A H    4  
ATOM 6736  H HA   . ASP A 1 18  ? -9.559  -5.401  -4.770  1.00 0.00 ? 18  ASP A HA   4  
ATOM 6737  H HB2  . ASP A 1 18  ? -11.699 -4.075  -4.706  1.00 0.00 ? 18  ASP A HB2  4  
ATOM 6738  H HB3  . ASP A 1 18  ? -12.036 -4.657  -6.333  1.00 0.00 ? 18  ASP A HB3  4  
ATOM 6739  N N    . GLU A 1 19  ? -10.412 -5.751  -7.947  1.00 0.00 ? 19  GLU A N    4  
ATOM 6740  C CA   . GLU A 1 19  ? -10.266 -6.620  -9.109  1.00 0.00 ? 19  GLU A CA   4  
ATOM 6741  C C    . GLU A 1 19  ? -8.826  -7.104  -9.250  1.00 0.00 ? 19  GLU A C    4  
ATOM 6742  O O    . GLU A 1 19  ? -8.579  -8.279  -9.521  1.00 0.00 ? 19  GLU A O    4  
ATOM 6743  C CB   . GLU A 1 19  ? -10.695 -5.885  -10.381 1.00 0.00 ? 19  GLU A CB   4  
ATOM 6744  C CG   . GLU A 1 19  ? -9.579  -5.079  -11.023 1.00 0.00 ? 19  GLU A CG   4  
ATOM 6745  C CD   . GLU A 1 19  ? -10.019 -4.385  -12.297 1.00 0.00 ? 19  GLU A CD   4  
ATOM 6746  O OE1  . GLU A 1 19  ? -11.174 -3.913  -12.346 1.00 0.00 ? 19  GLU A OE1  4  
ATOM 6747  O OE2  . GLU A 1 19  ? -9.210  -4.313  -13.245 1.00 0.00 ? 19  GLU A OE2  4  
ATOM 6748  H H    . GLU A 1 19  ? -10.979 -4.955  -8.014  1.00 0.00 ? 19  GLU A H    4  
ATOM 6749  H HA   . GLU A 1 19  ? -10.908 -7.476  -8.966  1.00 0.00 ? 19  GLU A HA   4  
ATOM 6750  H HB2  . GLU A 1 19  ? -11.048 -6.609  -11.100 1.00 0.00 ? 19  GLU A HB2  4  
ATOM 6751  H HB3  . GLU A 1 19  ? -11.503 -5.210  -10.137 1.00 0.00 ? 19  GLU A HB3  4  
ATOM 6752  H HG2  . GLU A 1 19  ? -9.243  -4.330  -10.322 1.00 0.00 ? 19  GLU A HG2  4  
ATOM 6753  H HG3  . GLU A 1 19  ? -8.760  -5.744  -11.257 1.00 0.00 ? 19  GLU A HG3  4  
ATOM 6754  N N    . GLU A 1 20  ? -7.880  -6.189  -9.063  1.00 0.00 ? 20  GLU A N    4  
ATOM 6755  C CA   . GLU A 1 20  ? -6.464  -6.522  -9.170  1.00 0.00 ? 20  GLU A CA   4  
ATOM 6756  C C    . GLU A 1 20  ? -6.057  -7.520  -8.089  1.00 0.00 ? 20  GLU A C    4  
ATOM 6757  O O    . GLU A 1 20  ? -5.532  -8.594  -8.386  1.00 0.00 ? 20  GLU A O    4  
ATOM 6758  C CB   . GLU A 1 20  ? -5.610  -5.258  -9.061  1.00 0.00 ? 20  GLU A CB   4  
ATOM 6759  C CG   . GLU A 1 20  ? -4.224  -5.405  -9.665  1.00 0.00 ? 20  GLU A CG   4  
ATOM 6760  C CD   . GLU A 1 20  ? -4.184  -5.026  -11.132 1.00 0.00 ? 20  GLU A CD   4  
ATOM 6761  O OE1  . GLU A 1 20  ? -4.708  -3.947  -11.480 1.00 0.00 ? 20  GLU A OE1  4  
ATOM 6762  O OE2  . GLU A 1 20  ? -3.629  -5.807  -11.933 1.00 0.00 ? 20  GLU A OE2  4  
ATOM 6763  H H    . GLU A 1 20  ? -8.140  -5.269  -8.849  1.00 0.00 ? 20  GLU A H    4  
ATOM 6764  H HA   . GLU A 1 20  ? -6.302  -6.972  -10.138 1.00 0.00 ? 20  GLU A HA   4  
ATOM 6765  H HB2  . GLU A 1 20  ? -6.117  -4.450  -9.567  1.00 0.00 ? 20  GLU A HB2  4  
ATOM 6766  H HB3  . GLU A 1 20  ? -5.499  -5.002  -8.017  1.00 0.00 ? 20  GLU A HB3  4  
ATOM 6767  H HG2  . GLU A 1 20  ? -3.540  -4.767  -9.125  1.00 0.00 ? 20  GLU A HG2  4  
ATOM 6768  H HG3  . GLU A 1 20  ? -3.909  -6.434  -9.565  1.00 0.00 ? 20  GLU A HG3  4  
ATOM 6769  N N    . LEU A 1 21  ? -6.301  -7.156  -6.835  1.00 0.00 ? 21  LEU A N    4  
ATOM 6770  C CA   . LEU A 1 21  ? -5.959  -8.018  -5.709  1.00 0.00 ? 21  LEU A CA   4  
ATOM 6771  C C    . LEU A 1 21  ? -6.750  -9.322  -5.761  1.00 0.00 ? 21  LEU A C    4  
ATOM 6772  O O    . LEU A 1 21  ? -6.452  -10.268 -5.033  1.00 0.00 ? 21  LEU A O    4  
ATOM 6773  C CB   . LEU A 1 21  ? -6.232  -7.296  -4.388  1.00 0.00 ? 21  LEU A CB   4  
ATOM 6774  C CG   . LEU A 1 21  ? -5.296  -6.134  -4.053  1.00 0.00 ? 21  LEU A CG   4  
ATOM 6775  C CD1  . LEU A 1 21  ? -5.800  -5.377  -2.834  1.00 0.00 ? 21  LEU A CD1  4  
ATOM 6776  C CD2  . LEU A 1 21  ? -3.880  -6.641  -3.820  1.00 0.00 ? 21  LEU A CD2  4  
ATOM 6777  H H    . LEU A 1 21  ? -6.721  -6.289  -6.661  1.00 0.00 ? 21  LEU A H    4  
ATOM 6778  H HA   . LEU A 1 21  ? -4.906  -8.247  -5.774  1.00 0.00 ? 21  LEU A HA   4  
ATOM 6779  H HB2  . LEU A 1 21  ? -7.238  -6.909  -4.424  1.00 0.00 ? 21  LEU A HB2  4  
ATOM 6780  H HB3  . LEU A 1 21  ? -6.156  -8.024  -3.592  1.00 0.00 ? 21  LEU A HB3  4  
ATOM 6781  H HG   . LEU A 1 21  ? -5.273  -5.447  -4.887  1.00 0.00 ? 21  LEU A HG   4  
ATOM 6782  H HD11 . LEU A 1 21  ? -6.879  -5.376  -2.833  1.00 0.00 ? 21  LEU A HD11 4  
ATOM 6783  H HD12 . LEU A 1 21  ? -5.439  -4.360  -2.868  1.00 0.00 ? 21  LEU A HD12 4  
ATOM 6784  H HD13 . LEU A 1 21  ? -5.438  -5.857  -1.937  1.00 0.00 ? 21  LEU A HD13 4  
ATOM 6785  H HD21 . LEU A 1 21  ? -3.913  -7.680  -3.526  1.00 0.00 ? 21  LEU A HD21 4  
ATOM 6786  H HD22 . LEU A 1 21  ? -3.414  -6.060  -3.036  1.00 0.00 ? 21  LEU A HD22 4  
ATOM 6787  H HD23 . LEU A 1 21  ? -3.308  -6.542  -4.730  1.00 0.00 ? 21  LEU A HD23 4  
ATOM 6788  N N    . GLU A 1 22  ? -7.757  -9.363  -6.628  1.00 0.00 ? 22  GLU A N    4  
ATOM 6789  C CA   . GLU A 1 22  ? -8.589  -10.551 -6.776  1.00 0.00 ? 22  GLU A CA   4  
ATOM 6790  C C    . GLU A 1 22  ? -8.010  -11.493 -7.828  1.00 0.00 ? 22  GLU A C    4  
ATOM 6791  O O    . GLU A 1 22  ? -8.160  -12.711 -7.736  1.00 0.00 ? 22  GLU A O    4  
ATOM 6792  C CB   . GLU A 1 22  ? -10.017 -10.157 -7.158  1.00 0.00 ? 22  GLU A CB   4  
ATOM 6793  C CG   . GLU A 1 22  ? -11.047 -11.231 -6.852  1.00 0.00 ? 22  GLU A CG   4  
ATOM 6794  C CD   . GLU A 1 22  ? -11.500 -11.210 -5.405  1.00 0.00 ? 22  GLU A CD   4  
ATOM 6795  O OE1  . GLU A 1 22  ? -10.634 -11.097 -4.513  1.00 0.00 ? 22  GLU A OE1  4  
ATOM 6796  O OE2  . GLU A 1 22  ? -12.722 -11.306 -5.165  1.00 0.00 ? 22  GLU A OE2  4  
ATOM 6797  H H    . GLU A 1 22  ? -7.945  -8.576  -7.181  1.00 0.00 ? 22  GLU A H    4  
ATOM 6798  H HA   . GLU A 1 22  ? -8.608  -11.062 -5.825  1.00 0.00 ? 22  GLU A HA   4  
ATOM 6799  H HB2  . GLU A 1 22  ? -10.287 -9.262  -6.617  1.00 0.00 ? 22  GLU A HB2  4  
ATOM 6800  H HB3  . GLU A 1 22  ? -10.049 -9.949  -8.217  1.00 0.00 ? 22  GLU A HB3  4  
ATOM 6801  H HG2  . GLU A 1 22  ? -11.908 -11.077 -7.484  1.00 0.00 ? 22  GLU A HG2  4  
ATOM 6802  H HG3  . GLU A 1 22  ? -10.615 -12.198 -7.064  1.00 0.00 ? 22  GLU A HG3  4  
ATOM 6803  N N    . ARG A 1 23  ? -7.351  -10.918 -8.829  1.00 0.00 ? 23  ARG A N    4  
ATOM 6804  C CA   . ARG A 1 23  ? -6.752  -11.705 -9.900  1.00 0.00 ? 23  ARG A CA   4  
ATOM 6805  C C    . ARG A 1 23  ? -5.297  -12.039 -9.582  1.00 0.00 ? 23  ARG A C    4  
ATOM 6806  O O    . ARG A 1 23  ? -4.746  -13.012 -10.098 1.00 0.00 ? 23  ARG A O    4  
ATOM 6807  C CB   . ARG A 1 23  ? -6.833  -10.946 -11.226 1.00 0.00 ? 23  ARG A CB   4  
ATOM 6808  C CG   . ARG A 1 23  ? -6.117  -9.605  -11.204 1.00 0.00 ? 23  ARG A CG   4  
ATOM 6809  C CD   . ARG A 1 23  ? -6.012  -9.007  -12.599 1.00 0.00 ? 23  ARG A CD   4  
ATOM 6810  N NE   . ARG A 1 23  ? -5.221  -9.845  -13.495 1.00 0.00 ? 23  ARG A NE   4  
ATOM 6811  C CZ   . ARG A 1 23  ? -4.767  -9.436  -14.675 1.00 0.00 ? 23  ARG A CZ   4  
ATOM 6812  N NH1  . ARG A 1 23  ? -5.026  -8.206  -15.098 1.00 0.00 ? 23  ARG A NH1  4  
ATOM 6813  N NH2  . ARG A 1 23  ? -4.054  -10.257 -15.434 1.00 0.00 ? 23  ARG A NH2  4  
ATOM 6814  H H    . ARG A 1 23  ? -7.265  -9.942  -8.848  1.00 0.00 ? 23  ARG A H    4  
ATOM 6815  H HA   . ARG A 1 23  ? -7.309  -12.625 -9.988  1.00 0.00 ? 23  ARG A HA   4  
ATOM 6816  H HB2  . ARG A 1 23  ? -6.390  -11.552 -12.003 1.00 0.00 ? 23  ARG A HB2  4  
ATOM 6817  H HB3  . ARG A 1 23  ? -7.871  -10.771 -11.464 1.00 0.00 ? 23  ARG A HB3  4  
ATOM 6818  H HG2  . ARG A 1 23  ? -6.669  -8.923  -10.573 1.00 0.00 ? 23  ARG A HG2  4  
ATOM 6819  H HG3  . ARG A 1 23  ? -5.124  -9.744  -10.806 1.00 0.00 ? 23  ARG A HG3  4  
ATOM 6820  H HD2  . ARG A 1 23  ? -7.006  -8.900  -13.006 1.00 0.00 ? 23  ARG A HD2  4  
ATOM 6821  H HD3  . ARG A 1 23  ? -5.547  -8.035  -12.525 1.00 0.00 ? 23  ARG A HD3  4  
ATOM 6822  H HE   . ARG A 1 23  ? -5.018  -10.758 -13.202 1.00 0.00 ? 23  ARG A HE   4  
ATOM 6823  H HH11 . ARG A 1 23  ? -5.563  -7.585  -14.527 1.00 0.00 ? 23  ARG A HH11 4  
ATOM 6824  H HH12 . ARG A 1 23  ? -4.683  -7.900  -15.986 1.00 0.00 ? 23  ARG A HH12 4  
ATOM 6825  H HH21 . ARG A 1 23  ? -3.857  -11.185 -15.119 1.00 0.00 ? 23  ARG A HH21 4  
ATOM 6826  H HH22 . ARG A 1 23  ? -3.713  -9.949  -16.322 1.00 0.00 ? 23  ARG A HH22 4  
ATOM 6827  N N    . ASP A 1 24  ? -4.682  -11.227 -8.729  1.00 0.00 ? 24  ASP A N    4  
ATOM 6828  C CA   . ASP A 1 24  ? -3.292  -11.437 -8.341  1.00 0.00 ? 24  ASP A CA   4  
ATOM 6829  C C    . ASP A 1 24  ? -3.202  -11.982 -6.919  1.00 0.00 ? 24  ASP A C    4  
ATOM 6830  O O    . ASP A 1 24  ? -2.165  -11.870 -6.264  1.00 0.00 ? 24  ASP A O    4  
ATOM 6831  C CB   . ASP A 1 24  ? -2.507  -10.129 -8.450  1.00 0.00 ? 24  ASP A CB   4  
ATOM 6832  C CG   . ASP A 1 24  ? -2.257  -9.722  -9.889  1.00 0.00 ? 24  ASP A CG   4  
ATOM 6833  O OD1  . ASP A 1 24  ? -1.888  -10.598 -10.698 1.00 0.00 ? 24  ASP A OD1  4  
ATOM 6834  O OD2  . ASP A 1 24  ? -2.432  -8.527  -10.206 1.00 0.00 ? 24  ASP A OD2  4  
ATOM 6835  H H    . ASP A 1 24  ? -5.175  -10.469 -8.351  1.00 0.00 ? 24  ASP A H    4  
ATOM 6836  H HA   . ASP A 1 24  ? -2.864  -12.160 -9.018  1.00 0.00 ? 24  ASP A HA   4  
ATOM 6837  H HB2  . ASP A 1 24  ? -3.064  -9.341  -7.964  1.00 0.00 ? 24  ASP A HB2  4  
ATOM 6838  H HB3  . ASP A 1 24  ? -1.554  -10.247 -7.957  1.00 0.00 ? 24  ASP A HB3  4  
ATOM 6839  N N    . LYS A 1 25  ? -4.294  -12.571 -6.446  1.00 0.00 ? 25  LYS A N    4  
ATOM 6840  C CA   . LYS A 1 25  ? -4.340  -13.134 -5.102  1.00 0.00 ? 25  LYS A CA   4  
ATOM 6841  C C    . LYS A 1 25  ? -3.047  -13.876 -4.778  1.00 0.00 ? 25  LYS A C    4  
ATOM 6842  O O    . LYS A 1 25  ? -2.253  -13.427 -3.952  1.00 0.00 ? 25  LYS A O    4  
ATOM 6843  C CB   . LYS A 1 25  ? -5.533  -14.083 -4.964  1.00 0.00 ? 25  LYS A CB   4  
ATOM 6844  C CG   . LYS A 1 25  ? -6.824  -13.385 -4.576  1.00 0.00 ? 25  LYS A CG   4  
ATOM 6845  C CD   . LYS A 1 25  ? -7.900  -14.381 -4.179  1.00 0.00 ? 25  LYS A CD   4  
ATOM 6846  C CE   . LYS A 1 25  ? -9.229  -13.691 -3.914  1.00 0.00 ? 25  LYS A CE   4  
ATOM 6847  N NZ   . LYS A 1 25  ? -10.170 -14.568 -3.163  1.00 0.00 ? 25  LYS A NZ   4  
ATOM 6848  H H    . LYS A 1 25  ? -5.090  -12.630 -7.016  1.00 0.00 ? 25  LYS A H    4  
ATOM 6849  H HA   . LYS A 1 25  ? -4.457  -12.319 -4.404  1.00 0.00 ? 25  LYS A HA   4  
ATOM 6850  H HB2  . LYS A 1 25  ? -5.688  -14.586 -5.907  1.00 0.00 ? 25  LYS A HB2  4  
ATOM 6851  H HB3  . LYS A 1 25  ? -5.305  -14.820 -4.207  1.00 0.00 ? 25  LYS A HB3  4  
ATOM 6852  H HG2  . LYS A 1 25  ? -6.631  -12.728 -3.741  1.00 0.00 ? 25  LYS A HG2  4  
ATOM 6853  H HG3  . LYS A 1 25  ? -7.176  -12.805 -5.418  1.00 0.00 ? 25  LYS A HG3  4  
ATOM 6854  H HD2  . LYS A 1 25  ? -8.031  -15.095 -4.980  1.00 0.00 ? 25  LYS A HD2  4  
ATOM 6855  H HD3  . LYS A 1 25  ? -7.587  -14.898 -3.282  1.00 0.00 ? 25  LYS A HD3  4  
ATOM 6856  H HE2  . LYS A 1 25  ? -9.047  -12.796 -3.339  1.00 0.00 ? 25  LYS A HE2  4  
ATOM 6857  H HE3  . LYS A 1 25  ? -9.677  -13.425 -4.861  1.00 0.00 ? 25  LYS A HE3  4  
ATOM 6858  H HZ1  . LYS A 1 25  ? -9.862  -15.559 -3.227  1.00 0.00 ? 25  LYS A HZ1  4  
ATOM 6859  H HZ2  . LYS A 1 25  ? -11.127 -14.488 -3.560  1.00 0.00 ? 25  LYS A HZ2  4  
ATOM 6860  H HZ3  . LYS A 1 25  ? -10.196 -14.288 -2.162  1.00 0.00 ? 25  LYS A HZ3  4  
ATOM 6861  N N    . ARG A 1 26  ? -2.841  -15.012 -5.437  1.00 0.00 ? 26  ARG A N    4  
ATOM 6862  C CA   . ARG A 1 26  ? -1.644  -15.816 -5.219  1.00 0.00 ? 26  ARG A CA   4  
ATOM 6863  C C    . ARG A 1 26  ? -0.410  -14.928 -5.092  1.00 0.00 ? 26  ARG A C    4  
ATOM 6864  O O    . ARG A 1 26  ? 0.478   -15.193 -4.282  1.00 0.00 ? 26  ARG A O    4  
ATOM 6865  C CB   . ARG A 1 26  ? -1.455  -16.809 -6.367  1.00 0.00 ? 26  ARG A CB   4  
ATOM 6866  C CG   . ARG A 1 26  ? -1.319  -16.148 -7.729  1.00 0.00 ? 26  ARG A CG   4  
ATOM 6867  C CD   . ARG A 1 26  ? -1.759  -17.080 -8.847  1.00 0.00 ? 26  ARG A CD   4  
ATOM 6868  N NE   . ARG A 1 26  ? -1.278  -16.634 -10.152 1.00 0.00 ? 26  ARG A NE   4  
ATOM 6869  C CZ   . ARG A 1 26  ? -0.032  -16.814 -10.576 1.00 0.00 ? 26  ARG A CZ   4  
ATOM 6870  N NH1  . ARG A 1 26  ? 0.854   -17.426 -9.802  1.00 0.00 ? 26  ARG A NH1  4  
ATOM 6871  N NH2  . ARG A 1 26  ? 0.331   -16.380 -11.776 1.00 0.00 ? 26  ARG A NH2  4  
ATOM 6872  H H    . ARG A 1 26  ? -3.511  -15.318 -6.083  1.00 0.00 ? 26  ARG A H    4  
ATOM 6873  H HA   . ARG A 1 26  ? -1.775  -16.364 -4.298  1.00 0.00 ? 26  ARG A HA   4  
ATOM 6874  H HB2  . ARG A 1 26  ? -0.563  -17.389 -6.183  1.00 0.00 ? 26  ARG A HB2  4  
ATOM 6875  H HB3  . ARG A 1 26  ? -2.306  -17.472 -6.396  1.00 0.00 ? 26  ARG A HB3  4  
ATOM 6876  H HG2  . ARG A 1 26  ? -1.935  -15.261 -7.751  1.00 0.00 ? 26  ARG A HG2  4  
ATOM 6877  H HG3  . ARG A 1 26  ? -0.286  -15.875 -7.884  1.00 0.00 ? 26  ARG A HG3  4  
ATOM 6878  H HD2  . ARG A 1 26  ? -1.370  -18.067 -8.649  1.00 0.00 ? 26  ARG A HD2  4  
ATOM 6879  H HD3  . ARG A 1 26  ? -2.838  -17.115 -8.864  1.00 0.00 ? 26  ARG A HD3  4  
ATOM 6880  H HE   . ARG A 1 26  ? -1.915  -16.179 -10.740 1.00 0.00 ? 26  ARG A HE   4  
ATOM 6881  H HH11 . ARG A 1 26  ? 0.583   -17.755 -8.898  1.00 0.00 ? 26  ARG A HH11 4  
ATOM 6882  H HH12 . ARG A 1 26  ? 1.791   -17.561 -10.124 1.00 0.00 ? 26  ARG A HH12 4  
ATOM 6883  H HH21 . ARG A 1 26  ? -0.334  -15.918 -12.362 1.00 0.00 ? 26  ARG A HH21 4  
ATOM 6884  H HH22 . ARG A 1 26  ? 1.269   -16.515 -12.094 1.00 0.00 ? 26  ARG A HH22 4  
ATOM 6885  N N    . VAL A 1 27  ? -0.360  -13.873 -5.899  1.00 0.00 ? 27  VAL A N    4  
ATOM 6886  C CA   . VAL A 1 27  ? 0.765   -12.945 -5.877  1.00 0.00 ? 27  VAL A CA   4  
ATOM 6887  C C    . VAL A 1 27  ? 0.601   -11.909 -4.770  1.00 0.00 ? 27  VAL A C    4  
ATOM 6888  O O    . VAL A 1 27  ? -0.493  -11.390 -4.546  1.00 0.00 ? 27  VAL A O    4  
ATOM 6889  C CB   . VAL A 1 27  ? 0.920   -12.218 -7.226  1.00 0.00 ? 27  VAL A CB   4  
ATOM 6890  C CG1  . VAL A 1 27  ? 2.115   -11.278 -7.192  1.00 0.00 ? 27  VAL A CG1  4  
ATOM 6891  C CG2  . VAL A 1 27  ? 1.054   -13.224 -8.360  1.00 0.00 ? 27  VAL A CG2  4  
ATOM 6892  H H    . VAL A 1 27  ? -1.098  -13.713 -6.523  1.00 0.00 ? 27  VAL A H    4  
ATOM 6893  H HA   . VAL A 1 27  ? 1.664   -13.515 -5.693  1.00 0.00 ? 27  VAL A HA   4  
ATOM 6894  H HB   . VAL A 1 27  ? 0.031   -11.629 -7.399  1.00 0.00 ? 27  VAL A HB   4  
ATOM 6895  H HG11 . VAL A 1 27  ? 2.396   -11.091 -6.166  1.00 0.00 ? 27  VAL A HG11 4  
ATOM 6896  H HG12 . VAL A 1 27  ? 2.944   -11.730 -7.716  1.00 0.00 ? 27  VAL A HG12 4  
ATOM 6897  H HG13 . VAL A 1 27  ? 1.852   -10.345 -7.668  1.00 0.00 ? 27  VAL A HG13 4  
ATOM 6898  H HG21 . VAL A 1 27  ? 1.704   -14.029 -8.051  1.00 0.00 ? 27  VAL A HG21 4  
ATOM 6899  H HG22 . VAL A 1 27  ? 0.080   -13.622 -8.605  1.00 0.00 ? 27  VAL A HG22 4  
ATOM 6900  H HG23 . VAL A 1 27  ? 1.472   -12.735 -9.227  1.00 0.00 ? 27  VAL A HG23 4  
ATOM 6901  N N    . THR A 1 28  ? 1.697   -11.612 -4.079  1.00 0.00 ? 28  THR A N    4  
ATOM 6902  C CA   . THR A 1 28  ? 1.676   -10.638 -2.994  1.00 0.00 ? 28  THR A CA   4  
ATOM 6903  C C    . THR A 1 28  ? 1.727   -9.213  -3.534  1.00 0.00 ? 28  THR A C    4  
ATOM 6904  O O    . THR A 1 28  ? 2.596   -8.874  -4.336  1.00 0.00 ? 28  THR A O    4  
ATOM 6905  C CB   . THR A 1 28  ? 2.855   -10.851 -2.026  1.00 0.00 ? 28  THR A CB   4  
ATOM 6906  O OG1  . THR A 1 28  ? 2.889   -12.213 -1.586  1.00 0.00 ? 28  THR A OG1  4  
ATOM 6907  C CG2  . THR A 1 28  ? 2.741   -9.927  -0.823  1.00 0.00 ? 28  THR A CG2  4  
ATOM 6908  H H    . THR A 1 28  ? 2.540   -12.059 -4.305  1.00 0.00 ? 28  THR A H    4  
ATOM 6909  H HA   . THR A 1 28  ? 0.757   -10.772 -2.444  1.00 0.00 ? 28  THR A HA   4  
ATOM 6910  H HB   . THR A 1 28  ? 3.775   -10.626 -2.547  1.00 0.00 ? 28  THR A HB   4  
ATOM 6911  H HG1  . THR A 1 28  ? 2.050   -12.636 -1.789  1.00 0.00 ? 28  THR A HG1  4  
ATOM 6912  H HG21 . THR A 1 28  ? 3.698   -9.466  -0.631  1.00 0.00 ? 28  THR A HG21 4  
ATOM 6913  H HG22 . THR A 1 28  ? 2.435   -10.497 0.041   1.00 0.00 ? 28  THR A HG22 4  
ATOM 6914  H HG23 . THR A 1 28  ? 2.007   -9.161  -1.027  1.00 0.00 ? 28  THR A HG23 4  
ATOM 6915  N N    . TRP A 1 29  ? 0.791   -8.384  -3.087  1.00 0.00 ? 29  TRP A N    4  
ATOM 6916  C CA   . TRP A 1 29  ? 0.729   -6.994  -3.525  1.00 0.00 ? 29  TRP A CA   4  
ATOM 6917  C C    . TRP A 1 29  ? 0.858   -6.044  -2.340  1.00 0.00 ? 29  TRP A C    4  
ATOM 6918  O O    . TRP A 1 29  ? 0.054   -6.087  -1.408  1.00 0.00 ? 29  TRP A O    4  
ATOM 6919  C CB   . TRP A 1 29  ? -0.581  -6.729  -4.268  1.00 0.00 ? 29  TRP A CB   4  
ATOM 6920  C CG   . TRP A 1 29  ? -0.484  -6.958  -5.746  1.00 0.00 ? 29  TRP A CG   4  
ATOM 6921  C CD1  . TRP A 1 29  ? -0.860  -8.079  -6.428  1.00 0.00 ? 29  TRP A CD1  4  
ATOM 6922  C CD2  . TRP A 1 29  ? 0.026   -6.043  -6.722  1.00 0.00 ? 29  TRP A CD2  4  
ATOM 6923  N NE1  . TRP A 1 29  ? -0.616  -7.917  -7.771  1.00 0.00 ? 29  TRP A NE1  4  
ATOM 6924  C CE2  . TRP A 1 29  ? -0.073  -6.676  -7.977  1.00 0.00 ? 29  TRP A CE2  4  
ATOM 6925  C CE3  . TRP A 1 29  ? 0.554   -4.751  -6.660  1.00 0.00 ? 29  TRP A CE3  4  
ATOM 6926  C CZ2  . TRP A 1 29  ? 0.338   -6.059  -9.156  1.00 0.00 ? 29  TRP A CZ2  4  
ATOM 6927  C CZ3  . TRP A 1 29  ? 0.961   -4.140  -7.831  1.00 0.00 ? 29  TRP A CZ3  4  
ATOM 6928  C CH2  . TRP A 1 29  ? 0.851   -4.794  -9.065  1.00 0.00 ? 29  TRP A CH2  4  
ATOM 6929  H H    . TRP A 1 29  ? 0.124   -8.713  -2.448  1.00 0.00 ? 29  TRP A H    4  
ATOM 6930  H HA   . TRP A 1 29  ? 1.556   -6.823  -4.200  1.00 0.00 ? 29  TRP A HA   4  
ATOM 6931  H HB2  . TRP A 1 29  ? -1.347  -7.384  -3.879  1.00 0.00 ? 29  TRP A HB2  4  
ATOM 6932  H HB3  . TRP A 1 29  ? -0.876  -5.702  -4.107  1.00 0.00 ? 29  TRP A HB3  4  
ATOM 6933  H HD1  . TRP A 1 29  ? -1.285  -8.957  -5.967  1.00 0.00 ? 29  TRP A HD1  4  
ATOM 6934  H HE1  . TRP A 1 29  ? -0.802  -8.581  -8.467  1.00 0.00 ? 29  TRP A HE1  4  
ATOM 6935  H HE3  . TRP A 1 29  ? 0.647   -4.231  -5.718  1.00 0.00 ? 29  TRP A HE3  4  
ATOM 6936  H HZ2  . TRP A 1 29  ? 0.259   -6.550  -10.115 1.00 0.00 ? 29  TRP A HZ2  4  
ATOM 6937  H HZ3  . TRP A 1 29  ? 1.372   -3.142  -7.802  1.00 0.00 ? 29  TRP A HZ3  4  
ATOM 6938  H HH2  . TRP A 1 29  ? 1.182   -4.279  -9.954  1.00 0.00 ? 29  TRP A HH2  4  
ATOM 6939  N N    . ILE A 1 30  ? 1.872   -5.187  -2.382  1.00 0.00 ? 30  ILE A N    4  
ATOM 6940  C CA   . ILE A 1 30  ? 2.104   -4.225  -1.311  1.00 0.00 ? 30  ILE A CA   4  
ATOM 6941  C C    . ILE A 1 30  ? 1.725   -2.814  -1.748  1.00 0.00 ? 30  ILE A C    4  
ATOM 6942  O O    . ILE A 1 30  ? 2.457   -2.167  -2.498  1.00 0.00 ? 30  ILE A O    4  
ATOM 6943  C CB   . ILE A 1 30  ? 3.575   -4.232  -0.856  1.00 0.00 ? 30  ILE A CB   4  
ATOM 6944  C CG1  . ILE A 1 30  ? 3.752   -3.359  0.388   1.00 0.00 ? 30  ILE A CG1  4  
ATOM 6945  C CG2  . ILE A 1 30  ? 4.479   -3.750  -1.981  1.00 0.00 ? 30  ILE A CG2  4  
ATOM 6946  C CD1  . ILE A 1 30  ? 5.038   -3.627  1.137   1.00 0.00 ? 30  ILE A CD1  4  
ATOM 6947  H H    . ILE A 1 30  ? 2.479   -5.201  -3.151  1.00 0.00 ? 30  ILE A H    4  
ATOM 6948  H HA   . ILE A 1 30  ? 1.487   -4.508  -0.470  1.00 0.00 ? 30  ILE A HA   4  
ATOM 6949  H HB   . ILE A 1 30  ? 3.850   -5.248  -0.617  1.00 0.00 ? 30  ILE A HB   4  
ATOM 6950  H HG12 . ILE A 1 30  ? 3.749   -2.321  0.095   1.00 0.00 ? 30  ILE A HG12 4  
ATOM 6951  H HG13 . ILE A 1 30  ? 2.929   -3.540  1.065   1.00 0.00 ? 30  ILE A HG13 4  
ATOM 6952  H HG21 . ILE A 1 30  ? 3.945   -3.798  -2.918  1.00 0.00 ? 30  ILE A HG21 4  
ATOM 6953  H HG22 . ILE A 1 30  ? 4.778   -2.730  -1.790  1.00 0.00 ? 30  ILE A HG22 4  
ATOM 6954  H HG23 . ILE A 1 30  ? 5.356   -4.378  -2.034  1.00 0.00 ? 30  ILE A HG23 4  
ATOM 6955  H HD11 . ILE A 1 30  ? 5.502   -2.689  1.403   1.00 0.00 ? 30  ILE A HD11 4  
ATOM 6956  H HD12 . ILE A 1 30  ? 4.824   -4.191  2.032   1.00 0.00 ? 30  ILE A HD12 4  
ATOM 6957  H HD13 . ILE A 1 30  ? 5.710   -4.194  0.507   1.00 0.00 ? 30  ILE A HD13 4  
ATOM 6958  N N    . VAL A 1 31  ? 0.578   -2.341  -1.272  1.00 0.00 ? 31  VAL A N    4  
ATOM 6959  C CA   . VAL A 1 31  ? 0.103   -1.005  -1.611  1.00 0.00 ? 31  VAL A CA   4  
ATOM 6960  C C    . VAL A 1 31  ? 0.295   -0.041  -0.445  1.00 0.00 ? 31  VAL A C    4  
ATOM 6961  O O    . VAL A 1 31  ? 0.022   -0.382  0.705   1.00 0.00 ? 31  VAL A O    4  
ATOM 6962  C CB   . VAL A 1 31  ? -1.385  -1.022  -2.009  1.00 0.00 ? 31  VAL A CB   4  
ATOM 6963  C CG1  . VAL A 1 31  ? -1.799  0.322   -2.588  1.00 0.00 ? 31  VAL A CG1  4  
ATOM 6964  C CG2  . VAL A 1 31  ? -1.659  -2.145  -2.997  1.00 0.00 ? 31  VAL A CG2  4  
ATOM 6965  H H    . VAL A 1 31  ? 0.038   -2.903  -0.678  1.00 0.00 ? 31  VAL A H    4  
ATOM 6966  H HA   . VAL A 1 31  ? 0.675   -0.651  -2.456  1.00 0.00 ? 31  VAL A HA   4  
ATOM 6967  H HB   . VAL A 1 31  ? -1.972  -1.202  -1.120  1.00 0.00 ? 31  VAL A HB   4  
ATOM 6968  H HG11 . VAL A 1 31  ? -1.808  1.064   -1.804  1.00 0.00 ? 31  VAL A HG11 4  
ATOM 6969  H HG12 . VAL A 1 31  ? -1.097  0.615   -3.355  1.00 0.00 ? 31  VAL A HG12 4  
ATOM 6970  H HG13 . VAL A 1 31  ? -2.787  0.240   -3.016  1.00 0.00 ? 31  VAL A HG13 4  
ATOM 6971  H HG21 . VAL A 1 31  ? -1.382  -3.090  -2.553  1.00 0.00 ? 31  VAL A HG21 4  
ATOM 6972  H HG22 . VAL A 1 31  ? -2.710  -2.159  -3.246  1.00 0.00 ? 31  VAL A HG22 4  
ATOM 6973  H HG23 . VAL A 1 31  ? -1.080  -1.985  -3.894  1.00 0.00 ? 31  VAL A HG23 4  
ATOM 6974  N N    . GLU A 1 32  ? 0.765   1.164   -0.752  1.00 0.00 ? 32  GLU A N    4  
ATOM 6975  C CA   . GLU A 1 32  ? 0.994   2.177   0.272   1.00 0.00 ? 32  GLU A CA   4  
ATOM 6976  C C    . GLU A 1 32  ? -0.178  3.153   0.343   1.00 0.00 ? 32  GLU A C    4  
ATOM 6977  O O    . GLU A 1 32  ? -0.627  3.676   -0.677  1.00 0.00 ? 32  GLU A O    4  
ATOM 6978  C CB   . GLU A 1 32  ? 2.290   2.939   -0.013  1.00 0.00 ? 32  GLU A CB   4  
ATOM 6979  C CG   . GLU A 1 32  ? 2.673   3.919   1.082   1.00 0.00 ? 32  GLU A CG   4  
ATOM 6980  C CD   . GLU A 1 32  ? 4.169   4.156   1.156   1.00 0.00 ? 32  GLU A CD   4  
ATOM 6981  O OE1  . GLU A 1 32  ? 4.872   3.324   1.765   1.00 0.00 ? 32  GLU A OE1  4  
ATOM 6982  O OE2  . GLU A 1 32  ? 4.635   5.175   0.604   1.00 0.00 ? 32  GLU A OE2  4  
ATOM 6983  H H    . GLU A 1 32  ? 0.963   1.376   -1.688  1.00 0.00 ? 32  GLU A H    4  
ATOM 6984  H HA   . GLU A 1 32  ? 1.085   1.674   1.222   1.00 0.00 ? 32  GLU A HA   4  
ATOM 6985  H HB2  . GLU A 1 32  ? 3.094   2.227   -0.129  1.00 0.00 ? 32  GLU A HB2  4  
ATOM 6986  H HB3  . GLU A 1 32  ? 2.173   3.489   -0.935  1.00 0.00 ? 32  GLU A HB3  4  
ATOM 6987  H HG2  . GLU A 1 32  ? 2.184   4.863   0.890   1.00 0.00 ? 32  GLU A HG2  4  
ATOM 6988  H HG3  . GLU A 1 32  ? 2.338   3.528   2.031   1.00 0.00 ? 32  GLU A HG3  4  
ATOM 6989  N N    . PHE A 1 33  ? -0.668  3.392   1.554   1.00 0.00 ? 33  PHE A N    4  
ATOM 6990  C CA   . PHE A 1 33  ? -1.788  4.303   1.759   1.00 0.00 ? 33  PHE A CA   4  
ATOM 6991  C C    . PHE A 1 33  ? -1.302  5.654   2.277   1.00 0.00 ? 33  PHE A C    4  
ATOM 6992  O O    . PHE A 1 33  ? -0.807  5.760   3.399   1.00 0.00 ? 33  PHE A O    4  
ATOM 6993  C CB   . PHE A 1 33  ? -2.792  3.698   2.743   1.00 0.00 ? 33  PHE A CB   4  
ATOM 6994  C CG   . PHE A 1 33  ? -3.444  2.443   2.238   1.00 0.00 ? 33  PHE A CG   4  
ATOM 6995  C CD1  . PHE A 1 33  ? -2.684  1.325   1.936   1.00 0.00 ? 33  PHE A CD1  4  
ATOM 6996  C CD2  . PHE A 1 33  ? -4.817  2.382   2.065   1.00 0.00 ? 33  PHE A CD2  4  
ATOM 6997  C CE1  . PHE A 1 33  ? -3.281  0.168   1.471   1.00 0.00 ? 33  PHE A CE1  4  
ATOM 6998  C CE2  . PHE A 1 33  ? -5.420  1.228   1.601   1.00 0.00 ? 33  PHE A CE2  4  
ATOM 6999  C CZ   . PHE A 1 33  ? -4.651  0.120   1.303   1.00 0.00 ? 33  PHE A CZ   4  
ATOM 7000  H H    . PHE A 1 33  ? -0.267  2.945   2.329   1.00 0.00 ? 33  PHE A H    4  
ATOM 7001  H HA   . PHE A 1 33  ? -2.274  4.450   0.807   1.00 0.00 ? 33  PHE A HA   4  
ATOM 7002  H HB2  . PHE A 1 33  ? -2.282  3.459   3.665   1.00 0.00 ? 33  PHE A HB2  4  
ATOM 7003  H HB3  . PHE A 1 33  ? -3.569  4.421   2.943   1.00 0.00 ? 33  PHE A HB3  4  
ATOM 7004  H HD1  . PHE A 1 33  ? -1.611  1.362   2.067   1.00 0.00 ? 33  PHE A HD1  4  
ATOM 7005  H HD2  . PHE A 1 33  ? -5.420  3.248   2.296   1.00 0.00 ? 33  PHE A HD2  4  
ATOM 7006  H HE1  . PHE A 1 33  ? -2.676  -0.696  1.239   1.00 0.00 ? 33  PHE A HE1  4  
ATOM 7007  H HE2  . PHE A 1 33  ? -6.491  1.193   1.470   1.00 0.00 ? 33  PHE A HE2  4  
ATOM 7008  H HZ   . PHE A 1 33  ? -5.119  -0.783  0.940   1.00 0.00 ? 33  PHE A HZ   4  
ATOM 7009  N N    . PHE A 1 34  ? -1.448  6.685   1.451   1.00 0.00 ? 34  PHE A N    4  
ATOM 7010  C CA   . PHE A 1 34  ? -1.023  8.029   1.823   1.00 0.00 ? 34  PHE A CA   4  
ATOM 7011  C C    . PHE A 1 34  ? -2.052  9.066   1.383   1.00 0.00 ? 34  PHE A C    4  
ATOM 7012  O O    . PHE A 1 34  ? -2.978  8.758   0.633   1.00 0.00 ? 34  PHE A O    4  
ATOM 7013  C CB   . PHE A 1 34  ? 0.337   8.348   1.201   1.00 0.00 ? 34  PHE A CB   4  
ATOM 7014  C CG   . PHE A 1 34  ? 0.254   8.766   -0.239  1.00 0.00 ? 34  PHE A CG   4  
ATOM 7015  C CD1  . PHE A 1 34  ? 0.205   7.818   -1.248  1.00 0.00 ? 34  PHE A CD1  4  
ATOM 7016  C CD2  . PHE A 1 34  ? 0.225   10.108  -0.584  1.00 0.00 ? 34  PHE A CD2  4  
ATOM 7017  C CE1  . PHE A 1 34  ? 0.129   8.200   -2.574  1.00 0.00 ? 34  PHE A CE1  4  
ATOM 7018  C CE2  . PHE A 1 34  ? 0.149   10.496  -1.909  1.00 0.00 ? 34  PHE A CE2  4  
ATOM 7019  C CZ   . PHE A 1 34  ? 0.100   9.541   -2.905  1.00 0.00 ? 34  PHE A CZ   4  
ATOM 7020  H H    . PHE A 1 34  ? -1.850  6.537   0.569   1.00 0.00 ? 34  PHE A H    4  
ATOM 7021  H HA   . PHE A 1 34  ? -0.934  8.062   2.898   1.00 0.00 ? 34  PHE A HA   4  
ATOM 7022  H HB2  . PHE A 1 34  ? 0.799   9.153   1.753   1.00 0.00 ? 34  PHE A HB2  4  
ATOM 7023  H HB3  . PHE A 1 34  ? 0.965   7.472   1.257   1.00 0.00 ? 34  PHE A HB3  4  
ATOM 7024  H HD1  . PHE A 1 34  ? 0.226   6.769   -0.992  1.00 0.00 ? 34  PHE A HD1  4  
ATOM 7025  H HD2  . PHE A 1 34  ? 0.264   10.856  0.195   1.00 0.00 ? 34  PHE A HD2  4  
ATOM 7026  H HE1  . PHE A 1 34  ? 0.090   7.452   -3.351  1.00 0.00 ? 34  PHE A HE1  4  
ATOM 7027  H HE2  . PHE A 1 34  ? 0.127   11.546  -2.163  1.00 0.00 ? 34  PHE A HE2  4  
ATOM 7028  H HZ   . PHE A 1 34  ? 0.041   9.842   -3.940  1.00 0.00 ? 34  PHE A HZ   4  
ATOM 7029  N N    . ALA A 1 35  ? -1.883  10.297  1.856   1.00 0.00 ? 35  ALA A N    4  
ATOM 7030  C CA   . ALA A 1 35  ? -2.795  11.380  1.510   1.00 0.00 ? 35  ALA A CA   4  
ATOM 7031  C C    . ALA A 1 35  ? -2.046  12.547  0.875   1.00 0.00 ? 35  ALA A C    4  
ATOM 7032  O O    . ALA A 1 35  ? -0.831  12.668  1.019   1.00 0.00 ? 35  ALA A O    4  
ATOM 7033  C CB   . ALA A 1 35  ? -3.552  11.846  2.745   1.00 0.00 ? 35  ALA A CB   4  
ATOM 7034  H H    . ALA A 1 35  ? -1.126  10.481  2.449   1.00 0.00 ? 35  ALA A H    4  
ATOM 7035  H HA   . ALA A 1 35  ? -3.514  10.997  0.800   1.00 0.00 ? 35  ALA A HA   4  
ATOM 7036  H HB1  . ALA A 1 35  ? -4.503  11.335  2.797   1.00 0.00 ? 35  ALA A HB1  4  
ATOM 7037  H HB2  . ALA A 1 35  ? -2.973  11.622  3.628   1.00 0.00 ? 35  ALA A HB2  4  
ATOM 7038  H HB3  . ALA A 1 35  ? -3.719  12.911  2.684   1.00 0.00 ? 35  ALA A HB3  4  
ATOM 7039  N N    . ASN A 1 36  ? -2.781  13.402  0.171   1.00 0.00 ? 36  ASN A N    4  
ATOM 7040  C CA   . ASN A 1 36  ? -2.185  14.559  -0.488  1.00 0.00 ? 36  ASN A CA   4  
ATOM 7041  C C    . ASN A 1 36  ? -1.736  15.597  0.536   1.00 0.00 ? 36  ASN A C    4  
ATOM 7042  O O    . ASN A 1 36  ? -0.814  16.372  0.285   1.00 0.00 ? 36  ASN A O    4  
ATOM 7043  C CB   . ASN A 1 36  ? -3.183  15.186  -1.463  1.00 0.00 ? 36  ASN A CB   4  
ATOM 7044  C CG   . ASN A 1 36  ? -3.131  14.545  -2.837  1.00 0.00 ? 36  ASN A CG   4  
ATOM 7045  O OD1  . ASN A 1 36  ? -2.342  14.946  -3.692  1.00 0.00 ? 36  ASN A OD1  4  
ATOM 7046  N ND2  . ASN A 1 36  ? -3.974  13.542  -3.053  1.00 0.00 ? 36  ASN A ND2  4  
ATOM 7047  H H    . ASN A 1 36  ? -3.746  13.252  0.092   1.00 0.00 ? 36  ASN A H    4  
ATOM 7048  H HA   . ASN A 1 36  ? -1.322  14.218  -1.040  1.00 0.00 ? 36  ASN A HA   4  
ATOM 7049  H HB2  . ASN A 1 36  ? -4.182  15.070  -1.071  1.00 0.00 ? 36  ASN A HB2  4  
ATOM 7050  H HB3  . ASN A 1 36  ? -2.962  16.238  -1.569  1.00 0.00 ? 36  ASN A HB3  4  
ATOM 7051  H HD21 . ASN A 1 36  ? -4.574  13.275  -2.325  1.00 0.00 ? 36  ASN A HD21 4  
ATOM 7052  H HD22 . ASN A 1 36  ? -3.961  13.108  -3.932  1.00 0.00 ? 36  ASN A HD22 4  
ATOM 7053  N N    . TRP A 1 37  ? -2.394  15.604  1.689   1.00 0.00 ? 37  TRP A N    4  
ATOM 7054  C CA   . TRP A 1 37  ? -2.062  16.547  2.752   1.00 0.00 ? 37  TRP A CA   4  
ATOM 7055  C C    . TRP A 1 37  ? -1.155  15.898  3.791   1.00 0.00 ? 37  TRP A C    4  
ATOM 7056  O O    . TRP A 1 37  ? -0.986  16.420  4.893   1.00 0.00 ? 37  TRP A O    4  
ATOM 7057  C CB   . TRP A 1 37  ? -3.338  17.062  3.421   1.00 0.00 ? 37  TRP A CB   4  
ATOM 7058  C CG   . TRP A 1 37  ? -4.463  16.072  3.396   1.00 0.00 ? 37  TRP A CG   4  
ATOM 7059  C CD1  . TRP A 1 37  ? -5.589  16.131  2.625   1.00 0.00 ? 37  TRP A CD1  4  
ATOM 7060  C CD2  . TRP A 1 37  ? -4.572  14.878  4.179   1.00 0.00 ? 37  TRP A CD2  4  
ATOM 7061  N NE1  . TRP A 1 37  ? -6.391  15.045  2.881   1.00 0.00 ? 37  TRP A NE1  4  
ATOM 7062  C CE2  . TRP A 1 37  ? -5.789  14.261  3.830   1.00 0.00 ? 37  TRP A CE2  4  
ATOM 7063  C CE3  . TRP A 1 37  ? -3.759  14.270  5.138   1.00 0.00 ? 37  TRP A CE3  4  
ATOM 7064  C CZ2  . TRP A 1 37  ? -6.210  13.067  4.408   1.00 0.00 ? 37  TRP A CZ2  4  
ATOM 7065  C CZ3  . TRP A 1 37  ? -4.179  13.085  5.712   1.00 0.00 ? 37  TRP A CZ3  4  
ATOM 7066  C CH2  . TRP A 1 37  ? -5.395  12.493  5.345   1.00 0.00 ? 37  TRP A CH2  4  
ATOM 7067  H H    . TRP A 1 37  ? -3.120  14.961  1.830   1.00 0.00 ? 37  TRP A H    4  
ATOM 7068  H HA   . TRP A 1 37  ? -1.540  17.379  2.304   1.00 0.00 ? 37  TRP A HA   4  
ATOM 7069  H HB2  . TRP A 1 37  ? -3.125  17.299  4.453   1.00 0.00 ? 37  TRP A HB2  4  
ATOM 7070  H HB3  . TRP A 1 37  ? -3.667  17.956  2.911   1.00 0.00 ? 37  TRP A HB3  4  
ATOM 7071  H HD1  . TRP A 1 37  ? -5.804  16.921  1.923   1.00 0.00 ? 37  TRP A HD1  4  
ATOM 7072  H HE1  . TRP A 1 37  ? -7.253  14.861  2.452   1.00 0.00 ? 37  TRP A HE1  4  
ATOM 7073  H HE3  . TRP A 1 37  ? -2.818  14.710  5.434   1.00 0.00 ? 37  TRP A HE3  4  
ATOM 7074  H HZ2  . TRP A 1 37  ? -7.144  12.598  4.136   1.00 0.00 ? 37  TRP A HZ2  4  
ATOM 7075  H HZ3  . TRP A 1 37  ? -3.564  12.600  6.456   1.00 0.00 ? 37  TRP A HZ3  4  
ATOM 7076  H HH2  . TRP A 1 37  ? -5.682  11.567  5.819   1.00 0.00 ? 37  TRP A HH2  4  
ATOM 7077  N N    . SER A 1 38  ? -0.573  14.758  3.433   1.00 0.00 ? 38  SER A N    4  
ATOM 7078  C CA   . SER A 1 38  ? 0.315   14.036  4.337   1.00 0.00 ? 38  SER A CA   4  
ATOM 7079  C C    . SER A 1 38  ? 1.774   14.392  4.065   1.00 0.00 ? 38  SER A C    4  
ATOM 7080  O O    . SER A 1 38  ? 2.469   13.690  3.332   1.00 0.00 ? 38  SER A O    4  
ATOM 7081  C CB   . SER A 1 38  ? 0.111   12.527  4.190   1.00 0.00 ? 38  SER A CB   4  
ATOM 7082  O OG   . SER A 1 38  ? 0.522   11.841  5.359   1.00 0.00 ? 38  SER A OG   4  
ATOM 7083  H H    . SER A 1 38  ? -0.747  14.392  2.540   1.00 0.00 ? 38  SER A H    4  
ATOM 7084  H HA   . SER A 1 38  ? 0.068   14.328  5.347   1.00 0.00 ? 38  SER A HA   4  
ATOM 7085  H HB2  . SER A 1 38  ? -0.935  12.324  4.017   1.00 0.00 ? 38  SER A HB2  4  
ATOM 7086  H HB3  . SER A 1 38  ? 0.691   12.168  3.352   1.00 0.00 ? 38  SER A HB3  4  
ATOM 7087  H HG   . SER A 1 38  ? 0.815   10.957  5.125   1.00 0.00 ? 38  SER A HG   4  
ATOM 7088  N N    . ASN A 1 39  ? 2.230   15.489  4.661   1.00 0.00 ? 39  ASN A N    4  
ATOM 7089  C CA   . ASN A 1 39  ? 3.605   15.940  4.484   1.00 0.00 ? 39  ASN A CA   4  
ATOM 7090  C C    . ASN A 1 39  ? 4.591   14.895  4.998   1.00 0.00 ? 39  ASN A C    4  
ATOM 7091  O O    . ASN A 1 39  ? 5.630   14.651  4.384   1.00 0.00 ? 39  ASN A O    4  
ATOM 7092  C CB   . ASN A 1 39  ? 3.827   17.268  5.210   1.00 0.00 ? 39  ASN A CB   4  
ATOM 7093  C CG   . ASN A 1 39  ? 3.290   18.451  4.428   1.00 0.00 ? 39  ASN A CG   4  
ATOM 7094  O OD1  . ASN A 1 39  ? 3.044   18.355  3.226   1.00 0.00 ? 39  ASN A OD1  4  
ATOM 7095  N ND2  . ASN A 1 39  ? 3.106   19.576  5.109   1.00 0.00 ? 39  ASN A ND2  4  
ATOM 7096  H H    . ASN A 1 39  ? 1.627   16.007  5.235   1.00 0.00 ? 39  ASN A H    4  
ATOM 7097  H HA   . ASN A 1 39  ? 3.772   16.086  3.427   1.00 0.00 ? 39  ASN A HA   4  
ATOM 7098  H HB2  . ASN A 1 39  ? 3.325   17.236  6.166   1.00 0.00 ? 39  ASN A HB2  4  
ATOM 7099  H HB3  . ASN A 1 39  ? 4.885   17.414  5.368   1.00 0.00 ? 39  ASN A HB3  4  
ATOM 7100  H HD21 . ASN A 1 39  ? 3.323   19.580  6.065   1.00 0.00 ? 39  ASN A HD21 4  
ATOM 7101  H HD22 . ASN A 1 39  ? 2.759   20.357  4.629   1.00 0.00 ? 39  ASN A HD22 4  
ATOM 7102  N N    . ASP A 1 40  ? 4.258   14.282  6.128   1.00 0.00 ? 40  ASP A N    4  
ATOM 7103  C CA   . ASP A 1 40  ? 5.112   13.262  6.726   1.00 0.00 ? 40  ASP A CA   4  
ATOM 7104  C C    . ASP A 1 40  ? 5.479   12.193  5.702   1.00 0.00 ? 40  ASP A C    4  
ATOM 7105  O O    . ASP A 1 40  ? 6.504   11.521  5.830   1.00 0.00 ? 40  ASP A O    4  
ATOM 7106  C CB   . ASP A 1 40  ? 4.414   12.619  7.925   1.00 0.00 ? 40  ASP A CB   4  
ATOM 7107  C CG   . ASP A 1 40  ? 5.382   11.894  8.838   1.00 0.00 ? 40  ASP A CG   4  
ATOM 7108  O OD1  . ASP A 1 40  ? 6.480   11.528  8.369   1.00 0.00 ? 40  ASP A OD1  4  
ATOM 7109  O OD2  . ASP A 1 40  ? 5.042   11.691  10.023  1.00 0.00 ? 40  ASP A OD2  4  
ATOM 7110  H H    . ASP A 1 40  ? 3.416   14.520  6.571   1.00 0.00 ? 40  ASP A H    4  
ATOM 7111  H HA   . ASP A 1 40  ? 6.017   13.744  7.064   1.00 0.00 ? 40  ASP A HA   4  
ATOM 7112  H HB2  . ASP A 1 40  ? 3.915   13.388  8.497   1.00 0.00 ? 40  ASP A HB2  4  
ATOM 7113  H HB3  . ASP A 1 40  ? 3.682   11.910  7.569   1.00 0.00 ? 40  ASP A HB3  4  
ATOM 7114  N N    . CYS A 1 41  ? 4.636   12.039  4.687   1.00 0.00 ? 41  CYS A N    4  
ATOM 7115  C CA   . CYS A 1 41  ? 4.870   11.049  3.641   1.00 0.00 ? 41  CYS A CA   4  
ATOM 7116  C C    . CYS A 1 41  ? 6.086   11.425  2.799   1.00 0.00 ? 41  CYS A C    4  
ATOM 7117  O O    . CYS A 1 41  ? 6.883   10.565  2.425   1.00 0.00 ? 41  CYS A O    4  
ATOM 7118  C CB   . CYS A 1 41  ? 3.636   10.919  2.747   1.00 0.00 ? 41  CYS A CB   4  
ATOM 7119  S SG   . CYS A 1 41  ? 3.808   9.698   1.425   1.00 0.00 ? 41  CYS A SG   4  
ATOM 7120  H H    . CYS A 1 41  ? 3.837   12.604  4.639   1.00 0.00 ? 41  CYS A H    4  
ATOM 7121  H HA   . CYS A 1 41  ? 5.059   10.101  4.120   1.00 0.00 ? 41  CYS A HA   4  
ATOM 7122  H HB2  . CYS A 1 41  ? 2.791   10.628  3.354   1.00 0.00 ? 41  CYS A HB2  4  
ATOM 7123  H HB3  . CYS A 1 41  ? 3.430   11.875  2.289   1.00 0.00 ? 41  CYS A HB3  4  
ATOM 7124  H HG   . CYS A 1 41  ? 2.796   9.859   0.586   1.00 0.00 ? 41  CYS A HG   4  
ATOM 7125  N N    . GLN A 1 42  ? 6.219   12.714  2.504   1.00 0.00 ? 42  GLN A N    4  
ATOM 7126  C CA   . GLN A 1 42  ? 7.336   13.203  1.704   1.00 0.00 ? 42  GLN A CA   4  
ATOM 7127  C C    . GLN A 1 42  ? 8.652   12.595  2.178   1.00 0.00 ? 42  GLN A C    4  
ATOM 7128  O O    . GLN A 1 42  ? 9.560   12.359  1.381   1.00 0.00 ? 42  GLN A O    4  
ATOM 7129  C CB   . GLN A 1 42  ? 7.411   14.729  1.774   1.00 0.00 ? 42  GLN A CB   4  
ATOM 7130  C CG   . GLN A 1 42  ? 8.229   15.245  2.947   1.00 0.00 ? 42  GLN A CG   4  
ATOM 7131  C CD   . GLN A 1 42  ? 8.335   16.757  2.965   1.00 0.00 ? 42  GLN A CD   4  
ATOM 7132  O OE1  . GLN A 1 42  ? 9.426   17.315  2.841   1.00 0.00 ? 42  GLN A OE1  4  
ATOM 7133  N NE2  . GLN A 1 42  ? 7.200   17.429  3.119   1.00 0.00 ? 42  GLN A NE2  4  
ATOM 7134  H H    . GLN A 1 42  ? 5.550   13.351  2.831   1.00 0.00 ? 42  GLN A H    4  
ATOM 7135  H HA   . GLN A 1 42  ? 7.165   12.907  0.681   1.00 0.00 ? 42  GLN A HA   4  
ATOM 7136  H HB2  . GLN A 1 42  ? 7.857   15.098  0.862   1.00 0.00 ? 42  GLN A HB2  4  
ATOM 7137  H HB3  . GLN A 1 42  ? 6.409   15.123  1.861   1.00 0.00 ? 42  GLN A HB3  4  
ATOM 7138  H HG2  . GLN A 1 42  ? 7.761   14.922  3.865   1.00 0.00 ? 42  GLN A HG2  4  
ATOM 7139  H HG3  . GLN A 1 42  ? 9.224   14.829  2.886   1.00 0.00 ? 42  GLN A HG3  4  
ATOM 7140  H HE21 . GLN A 1 42  ? 6.369   16.917  3.213   1.00 0.00 ? 42  GLN A HE21 4  
ATOM 7141  H HE22 . GLN A 1 42  ? 7.240   18.407  3.135   1.00 0.00 ? 42  GLN A HE22 4  
ATOM 7142  N N    . SER A 1 43  ? 8.747   12.343  3.480   1.00 0.00 ? 43  SER A N    4  
ATOM 7143  C CA   . SER A 1 43  ? 9.954   11.766  4.060   1.00 0.00 ? 43  SER A CA   4  
ATOM 7144  C C    . SER A 1 43  ? 10.166  10.338  3.565   1.00 0.00 ? 43  SER A C    4  
ATOM 7145  O O    . SER A 1 43  ? 11.298  9.904   3.355   1.00 0.00 ? 43  SER A O    4  
ATOM 7146  C CB   . SER A 1 43  ? 9.868   11.781  5.587   1.00 0.00 ? 43  SER A CB   4  
ATOM 7147  O OG   . SER A 1 43  ? 11.157  11.861  6.170   1.00 0.00 ? 43  SER A OG   4  
ATOM 7148  H H    . SER A 1 43  ? 7.988   12.553  4.064   1.00 0.00 ? 43  SER A H    4  
ATOM 7149  H HA   . SER A 1 43  ? 10.793  12.370  3.749   1.00 0.00 ? 43  SER A HA   4  
ATOM 7150  H HB2  . SER A 1 43  ? 9.289   12.635  5.905   1.00 0.00 ? 43  SER A HB2  4  
ATOM 7151  H HB3  . SER A 1 43  ? 9.388   10.874  5.927   1.00 0.00 ? 43  SER A HB3  4  
ATOM 7152  H HG   . SER A 1 43  ? 11.269  12.720  6.584   1.00 0.00 ? 43  SER A HG   4  
ATOM 7153  N N    . PHE A 1 44  ? 9.067   9.614   3.381   1.00 0.00 ? 44  PHE A N    4  
ATOM 7154  C CA   . PHE A 1 44  ? 9.131   8.234   2.911   1.00 0.00 ? 44  PHE A CA   4  
ATOM 7155  C C    . PHE A 1 44  ? 8.962   8.167   1.397   1.00 0.00 ? 44  PHE A C    4  
ATOM 7156  O O    . PHE A 1 44  ? 9.234   7.140   0.776   1.00 0.00 ? 44  PHE A O    4  
ATOM 7157  C CB   . PHE A 1 44  ? 8.053   7.391   3.595   1.00 0.00 ? 44  PHE A CB   4  
ATOM 7158  C CG   . PHE A 1 44  ? 8.327   5.915   3.546   1.00 0.00 ? 44  PHE A CG   4  
ATOM 7159  C CD1  . PHE A 1 44  ? 9.370   5.366   4.274   1.00 0.00 ? 44  PHE A CD1  4  
ATOM 7160  C CD2  . PHE A 1 44  ? 7.540   5.076   2.774   1.00 0.00 ? 44  PHE A CD2  4  
ATOM 7161  C CE1  . PHE A 1 44  ? 9.625   4.008   4.230   1.00 0.00 ? 44  PHE A CE1  4  
ATOM 7162  C CE2  . PHE A 1 44  ? 7.790   3.717   2.726   1.00 0.00 ? 44  PHE A CE2  4  
ATOM 7163  C CZ   . PHE A 1 44  ? 8.833   3.183   3.457   1.00 0.00 ? 44  PHE A CZ   4  
ATOM 7164  H H    . PHE A 1 44  ? 8.192   10.016  3.565   1.00 0.00 ? 44  PHE A H    4  
ATOM 7165  H HA   . PHE A 1 44  ? 10.102  7.842   3.171   1.00 0.00 ? 44  PHE A HA   4  
ATOM 7166  H HB2  . PHE A 1 44  ? 7.982   7.681   4.632   1.00 0.00 ? 44  PHE A HB2  4  
ATOM 7167  H HB3  . PHE A 1 44  ? 7.105   7.570   3.110   1.00 0.00 ? 44  PHE A HB3  4  
ATOM 7168  H HD1  . PHE A 1 44  ? 9.990   6.010   4.880   1.00 0.00 ? 44  PHE A HD1  4  
ATOM 7169  H HD2  . PHE A 1 44  ? 6.723   5.493   2.202   1.00 0.00 ? 44  PHE A HD2  4  
ATOM 7170  H HE1  . PHE A 1 44  ? 10.441  3.593   4.803   1.00 0.00 ? 44  PHE A HE1  4  
ATOM 7171  H HE2  . PHE A 1 44  ? 7.168   3.074   2.121   1.00 0.00 ? 44  PHE A HE2  4  
ATOM 7172  H HZ   . PHE A 1 44  ? 9.030   2.122   3.421   1.00 0.00 ? 44  PHE A HZ   4  
ATOM 7173  N N    . ALA A 1 45  ? 8.510   9.270   0.808   1.00 0.00 ? 45  ALA A N    4  
ATOM 7174  C CA   . ALA A 1 45  ? 8.306   9.337   -0.634  1.00 0.00 ? 45  ALA A CA   4  
ATOM 7175  C C    . ALA A 1 45  ? 9.419   8.611   -1.381  1.00 0.00 ? 45  ALA A C    4  
ATOM 7176  O O    . ALA A 1 45  ? 9.185   7.643   -2.105  1.00 0.00 ? 45  ALA A O    4  
ATOM 7177  C CB   . ALA A 1 45  ? 8.221   10.787  -1.087  1.00 0.00 ? 45  ALA A CB   4  
ATOM 7178  H H    . ALA A 1 45  ? 8.311   10.057  1.356   1.00 0.00 ? 45  ALA A H    4  
ATOM 7179  H HA   . ALA A 1 45  ? 7.363   8.859   -0.860  1.00 0.00 ? 45  ALA A HA   4  
ATOM 7180  H HB1  . ALA A 1 45  ? 7.238   10.980  -1.492  1.00 0.00 ? 45  ALA A HB1  4  
ATOM 7181  H HB2  . ALA A 1 45  ? 8.399   11.439  -0.245  1.00 0.00 ? 45  ALA A HB2  4  
ATOM 7182  H HB3  . ALA A 1 45  ? 8.966   10.970  -1.848  1.00 0.00 ? 45  ALA A HB3  4  
ATOM 7183  N N    . PRO A 1 46  ? 10.661  9.087   -1.203  1.00 0.00 ? 46  PRO A N    4  
ATOM 7184  C CA   . PRO A 1 46  ? 11.835  8.498   -1.852  1.00 0.00 ? 46  PRO A CA   4  
ATOM 7185  C C    . PRO A 1 46  ? 12.178  7.122   -1.292  1.00 0.00 ? 46  PRO A C    4  
ATOM 7186  O O    . PRO A 1 46  ? 12.440  6.183   -2.045  1.00 0.00 ? 46  PRO A O    4  
ATOM 7187  C CB   . PRO A 1 46  ? 12.952  9.496   -1.539  1.00 0.00 ? 46  PRO A CB   4  
ATOM 7188  C CG   . PRO A 1 46  ? 12.514  10.174  -0.287  1.00 0.00 ? 46  PRO A CG   4  
ATOM 7189  C CD   . PRO A 1 46  ? 11.013  10.238  -0.354  1.00 0.00 ? 46  PRO A CD   4  
ATOM 7190  H HA   . PRO A 1 46  ? 11.703  8.427   -2.922  1.00 0.00 ? 46  PRO A HA   4  
ATOM 7191  H HB2  . PRO A 1 46  ? 13.883  8.966   -1.396  1.00 0.00 ? 46  PRO A HB2  4  
ATOM 7192  H HB3  . PRO A 1 46  ? 13.052  10.198  -2.353  1.00 0.00 ? 46  PRO A HB3  4  
ATOM 7193  H HG2  . PRO A 1 46  ? 12.827  9.599   0.571   1.00 0.00 ? 46  PRO A HG2  4  
ATOM 7194  H HG3  . PRO A 1 46  ? 12.929  11.170  -0.244  1.00 0.00 ? 46  PRO A HG3  4  
ATOM 7195  H HD2  . PRO A 1 46  ? 10.586  10.134  0.633   1.00 0.00 ? 46  PRO A HD2  4  
ATOM 7196  H HD3  . PRO A 1 46  ? 10.695  11.164  -0.809  1.00 0.00 ? 46  PRO A HD3  4  
ATOM 7197  N N    . ILE A 1 47  ? 12.174  7.009   0.032   1.00 0.00 ? 47  ILE A N    4  
ATOM 7198  C CA   . ILE A 1 47  ? 12.483  5.747   0.691   1.00 0.00 ? 47  ILE A CA   4  
ATOM 7199  C C    . ILE A 1 47  ? 11.664  4.604   0.102   1.00 0.00 ? 47  ILE A C    4  
ATOM 7200  O O    . ILE A 1 47  ? 12.154  3.483   -0.038  1.00 0.00 ? 47  ILE A O    4  
ATOM 7201  C CB   . ILE A 1 47  ? 12.218  5.824   2.207   1.00 0.00 ? 47  ILE A CB   4  
ATOM 7202  C CG1  . ILE A 1 47  ? 13.102  6.897   2.846   1.00 0.00 ? 47  ILE A CG1  4  
ATOM 7203  C CG2  . ILE A 1 47  ? 12.465  4.471   2.857   1.00 0.00 ? 47  ILE A CG2  4  
ATOM 7204  C CD1  . ILE A 1 47  ? 12.734  7.206   4.281   1.00 0.00 ? 47  ILE A CD1  4  
ATOM 7205  H H    . ILE A 1 47  ? 11.957  7.794   0.577   1.00 0.00 ? 47  ILE A H    4  
ATOM 7206  H HA   . ILE A 1 47  ? 13.532  5.540   0.539   1.00 0.00 ? 47  ILE A HA   4  
ATOM 7207  H HB   . ILE A 1 47  ? 11.182  6.085   2.356   1.00 0.00 ? 47  ILE A HB   4  
ATOM 7208  H HG12 . ILE A 1 47  ? 14.128  6.566   2.831   1.00 0.00 ? 47  ILE A HG12 4  
ATOM 7209  H HG13 . ILE A 1 47  ? 13.014  7.811   2.277   1.00 0.00 ? 47  ILE A HG13 4  
ATOM 7210  H HG21 . ILE A 1 47  ? 11.589  3.850   2.738   1.00 0.00 ? 47  ILE A HG21 4  
ATOM 7211  H HG22 . ILE A 1 47  ? 13.310  3.994   2.385   1.00 0.00 ? 47  ILE A HG22 4  
ATOM 7212  H HG23 . ILE A 1 47  ? 12.669  4.608   3.908   1.00 0.00 ? 47  ILE A HG23 4  
ATOM 7213  H HD11 . ILE A 1 47  ? 11.692  7.482   4.335   1.00 0.00 ? 47  ILE A HD11 4  
ATOM 7214  H HD12 . ILE A 1 47  ? 12.909  6.335   4.893   1.00 0.00 ? 47  ILE A HD12 4  
ATOM 7215  H HD13 . ILE A 1 47  ? 13.341  8.025   4.639   1.00 0.00 ? 47  ILE A HD13 4  
ATOM 7216  N N    . TYR A 1 48  ? 10.415  4.895   -0.245  1.00 0.00 ? 48  TYR A N    4  
ATOM 7217  C CA   . TYR A 1 48  ? 9.527   3.891   -0.819  1.00 0.00 ? 48  TYR A CA   4  
ATOM 7218  C C    . TYR A 1 48  ? 9.881   3.623   -2.279  1.00 0.00 ? 48  TYR A C    4  
ATOM 7219  O O    . TYR A 1 48  ? 9.802   2.489   -2.750  1.00 0.00 ? 48  TYR A O    4  
ATOM 7220  C CB   . TYR A 1 48  ? 8.071   4.346   -0.711  1.00 0.00 ? 48  TYR A CB   4  
ATOM 7221  C CG   . TYR A 1 48  ? 7.074   3.288   -1.127  1.00 0.00 ? 48  TYR A CG   4  
ATOM 7222  C CD1  . TYR A 1 48  ? 6.999   2.074   -0.454  1.00 0.00 ? 48  TYR A CD1  4  
ATOM 7223  C CD2  . TYR A 1 48  ? 6.207   3.502   -2.191  1.00 0.00 ? 48  TYR A CD2  4  
ATOM 7224  C CE1  . TYR A 1 48  ? 6.090   1.105   -0.831  1.00 0.00 ? 48  TYR A CE1  4  
ATOM 7225  C CE2  . TYR A 1 48  ? 5.294   2.539   -2.573  1.00 0.00 ? 48  TYR A CE2  4  
ATOM 7226  C CZ   . TYR A 1 48  ? 5.239   1.342   -1.890  1.00 0.00 ? 48  TYR A CZ   4  
ATOM 7227  O OH   . TYR A 1 48  ? 4.332   0.379   -2.269  1.00 0.00 ? 48  TYR A OH   4  
ATOM 7228  H H    . TYR A 1 48  ? 10.081  5.806   -0.109  1.00 0.00 ? 48  TYR A H    4  
ATOM 7229  H HA   . TYR A 1 48  ? 9.652   2.977   -0.257  1.00 0.00 ? 48  TYR A HA   4  
ATOM 7230  H HB2  . TYR A 1 48  ? 7.860   4.616   0.312   1.00 0.00 ? 48  TYR A HB2  4  
ATOM 7231  H HB3  . TYR A 1 48  ? 7.923   5.209   -1.344  1.00 0.00 ? 48  TYR A HB3  4  
ATOM 7232  H HD1  . TYR A 1 48  ? 7.666   1.892   0.375   1.00 0.00 ? 48  TYR A HD1  4  
ATOM 7233  H HD2  . TYR A 1 48  ? 6.253   4.441   -2.724  1.00 0.00 ? 48  TYR A HD2  4  
ATOM 7234  H HE1  . TYR A 1 48  ? 6.046   0.167   -0.296  1.00 0.00 ? 48  TYR A HE1  4  
ATOM 7235  H HE2  . TYR A 1 48  ? 4.628   2.724   -3.403  1.00 0.00 ? 48  TYR A HE2  4  
ATOM 7236  H HH   . TYR A 1 48  ? 4.351   -0.345  -1.638  1.00 0.00 ? 48  TYR A HH   4  
ATOM 7237  N N    . ALA A 1 49  ? 10.272  4.676   -2.989  1.00 0.00 ? 49  ALA A N    4  
ATOM 7238  C CA   . ALA A 1 49  ? 10.641  4.555   -4.394  1.00 0.00 ? 49  ALA A CA   4  
ATOM 7239  C C    . ALA A 1 49  ? 11.809  3.591   -4.575  1.00 0.00 ? 49  ALA A C    4  
ATOM 7240  O O    . ALA A 1 49  ? 11.743  2.666   -5.384  1.00 0.00 ? 49  ALA A O    4  
ATOM 7241  C CB   . ALA A 1 49  ? 10.988  5.921   -4.968  1.00 0.00 ? 49  ALA A CB   4  
ATOM 7242  H H    . ALA A 1 49  ? 10.315  5.554   -2.558  1.00 0.00 ? 49  ALA A H    4  
ATOM 7243  H HA   . ALA A 1 49  ? 9.785   4.173   -4.932  1.00 0.00 ? 49  ALA A HA   4  
ATOM 7244  H HB1  . ALA A 1 49  ? 11.347  6.562   -4.176  1.00 0.00 ? 49  ALA A HB1  4  
ATOM 7245  H HB2  . ALA A 1 49  ? 11.755  5.811   -5.719  1.00 0.00 ? 49  ALA A HB2  4  
ATOM 7246  H HB3  . ALA A 1 49  ? 10.107  6.358   -5.414  1.00 0.00 ? 49  ALA A HB3  4  
ATOM 7247  N N    . ASP A 1 50  ? 12.876  3.815   -3.816  1.00 0.00 ? 50  ASP A N    4  
ATOM 7248  C CA   . ASP A 1 50  ? 14.059  2.965   -3.892  1.00 0.00 ? 50  ASP A CA   4  
ATOM 7249  C C    . ASP A 1 50  ? 13.701  1.509   -3.614  1.00 0.00 ? 50  ASP A C    4  
ATOM 7250  O O    . ASP A 1 50  ? 14.102  0.608   -4.352  1.00 0.00 ? 50  ASP A O    4  
ATOM 7251  C CB   . ASP A 1 50  ? 15.120  3.441   -2.898  1.00 0.00 ? 50  ASP A CB   4  
ATOM 7252  C CG   . ASP A 1 50  ? 15.651  4.821   -3.235  1.00 0.00 ? 50  ASP A CG   4  
ATOM 7253  O OD1  . ASP A 1 50  ? 15.608  5.199   -4.425  1.00 0.00 ? 50  ASP A OD1  4  
ATOM 7254  O OD2  . ASP A 1 50  ? 16.108  5.522   -2.309  1.00 0.00 ? 50  ASP A OD2  4  
ATOM 7255  H H    . ASP A 1 50  ? 12.868  4.568   -3.189  1.00 0.00 ? 50  ASP A H    4  
ATOM 7256  H HA   . ASP A 1 50  ? 14.457  3.040   -4.893  1.00 0.00 ? 50  ASP A HA   4  
ATOM 7257  H HB2  . ASP A 1 50  ? 14.688  3.474   -1.909  1.00 0.00 ? 50  ASP A HB2  4  
ATOM 7258  H HB3  . ASP A 1 50  ? 15.946  2.746   -2.903  1.00 0.00 ? 50  ASP A HB3  4  
ATOM 7259  N N    . LEU A 1 51  ? 12.945  1.285   -2.545  1.00 0.00 ? 51  LEU A N    4  
ATOM 7260  C CA   . LEU A 1 51  ? 12.533  -0.063  -2.168  1.00 0.00 ? 51  LEU A CA   4  
ATOM 7261  C C    . LEU A 1 51  ? 11.754  -0.730  -3.296  1.00 0.00 ? 51  LEU A C    4  
ATOM 7262  O O    . LEU A 1 51  ? 12.150  -1.781  -3.801  1.00 0.00 ? 51  LEU A O    4  
ATOM 7263  C CB   . LEU A 1 51  ? 11.680  -0.021  -0.899  1.00 0.00 ? 51  LEU A CB   4  
ATOM 7264  C CG   . LEU A 1 51  ? 12.442  -0.082  0.425   1.00 0.00 ? 51  LEU A CG   4  
ATOM 7265  C CD1  . LEU A 1 51  ? 11.556  0.375   1.573   1.00 0.00 ? 51  LEU A CD1  4  
ATOM 7266  C CD2  . LEU A 1 51  ? 12.961  -1.490  0.677   1.00 0.00 ? 51  LEU A CD2  4  
ATOM 7267  H H    . LEU A 1 51  ? 12.656  2.042   -1.995  1.00 0.00 ? 51  LEU A H    4  
ATOM 7268  H HA   . LEU A 1 51  ? 13.425  -0.640  -1.973  1.00 0.00 ? 51  LEU A HA   4  
ATOM 7269  H HB2  . LEU A 1 51  ? 11.114  0.898   -0.912  1.00 0.00 ? 51  LEU A HB2  4  
ATOM 7270  H HB3  . LEU A 1 51  ? 11.001  -0.861  -0.930  1.00 0.00 ? 51  LEU A HB3  4  
ATOM 7271  H HG   . LEU A 1 51  ? 13.292  0.585   0.375   1.00 0.00 ? 51  LEU A HG   4  
ATOM 7272  H HD11 . LEU A 1 51  ? 11.250  1.397   1.407   1.00 0.00 ? 51  LEU A HD11 4  
ATOM 7273  H HD12 . LEU A 1 51  ? 12.105  0.310   2.500   1.00 0.00 ? 51  LEU A HD12 4  
ATOM 7274  H HD13 . LEU A 1 51  ? 10.682  -0.259  1.628   1.00 0.00 ? 51  LEU A HD13 4  
ATOM 7275  H HD21 . LEU A 1 51  ? 13.604  -1.486  1.545   1.00 0.00 ? 51  LEU A HD21 4  
ATOM 7276  H HD22 . LEU A 1 51  ? 13.520  -1.827  -0.184  1.00 0.00 ? 51  LEU A HD22 4  
ATOM 7277  H HD23 . LEU A 1 51  ? 12.128  -2.155  0.849   1.00 0.00 ? 51  LEU A HD23 4  
ATOM 7278  N N    . SER A 1 52  ? 10.645  -0.112  -3.689  1.00 0.00 ? 52  SER A N    4  
ATOM 7279  C CA   . SER A 1 52  ? 9.809   -0.646  -4.757  1.00 0.00 ? 52  SER A CA   4  
ATOM 7280  C C    . SER A 1 52  ? 10.660  -1.096  -5.940  1.00 0.00 ? 52  SER A C    4  
ATOM 7281  O O    . SER A 1 52  ? 10.598  -2.252  -6.362  1.00 0.00 ? 52  SER A O    4  
ATOM 7282  C CB   . SER A 1 52  ? 8.795   0.405   -5.215  1.00 0.00 ? 52  SER A CB   4  
ATOM 7283  O OG   . SER A 1 52  ? 9.413   1.668   -5.387  1.00 0.00 ? 52  SER A OG   4  
ATOM 7284  H H    . SER A 1 52  ? 10.382  0.723   -3.248  1.00 0.00 ? 52  SER A H    4  
ATOM 7285  H HA   . SER A 1 52  ? 9.277   -1.501  -4.366  1.00 0.00 ? 52  SER A HA   4  
ATOM 7286  H HB2  . SER A 1 52  ? 8.362   0.098   -6.154  1.00 0.00 ? 52  SER A HB2  4  
ATOM 7287  H HB3  . SER A 1 52  ? 8.016   0.496   -4.472  1.00 0.00 ? 52  SER A HB3  4  
ATOM 7288  H HG   . SER A 1 52  ? 8.964   2.152   -6.084  1.00 0.00 ? 52  SER A HG   4  
ATOM 7289  N N    . LEU A 1 53  ? 11.456  -0.175  -6.472  1.00 0.00 ? 53  LEU A N    4  
ATOM 7290  C CA   . LEU A 1 53  ? 12.322  -0.475  -7.608  1.00 0.00 ? 53  LEU A CA   4  
ATOM 7291  C C    . LEU A 1 53  ? 13.076  -1.782  -7.386  1.00 0.00 ? 53  LEU A C    4  
ATOM 7292  O O    . LEU A 1 53  ? 13.166  -2.620  -8.285  1.00 0.00 ? 53  LEU A O    4  
ATOM 7293  C CB   . LEU A 1 53  ? 13.314  0.667   -7.834  1.00 0.00 ? 53  LEU A CB   4  
ATOM 7294  C CG   . LEU A 1 53  ? 12.738  1.944   -8.449  1.00 0.00 ? 53  LEU A CG   4  
ATOM 7295  C CD1  . LEU A 1 53  ? 13.550  3.156   -8.019  1.00 0.00 ? 53  LEU A CD1  4  
ATOM 7296  C CD2  . LEU A 1 53  ? 12.701  1.835   -9.966  1.00 0.00 ? 53  LEU A CD2  4  
ATOM 7297  H H    . LEU A 1 53  ? 11.463  0.728   -6.094  1.00 0.00 ? 53  LEU A H    4  
ATOM 7298  H HA   . LEU A 1 53  ? 11.697  -0.577  -8.482  1.00 0.00 ? 53  LEU A HA   4  
ATOM 7299  H HB2  . LEU A 1 53  ? 13.744  0.926   -6.878  1.00 0.00 ? 53  LEU A HB2  4  
ATOM 7300  H HB3  . LEU A 1 53  ? 14.091  0.304   -8.490  1.00 0.00 ? 53  LEU A HB3  4  
ATOM 7301  H HG   . LEU A 1 53  ? 11.725  2.080   -8.097  1.00 0.00 ? 53  LEU A HG   4  
ATOM 7302  H HD11 . LEU A 1 53  ? 13.536  3.895   -8.805  1.00 0.00 ? 53  LEU A HD11 4  
ATOM 7303  H HD12 . LEU A 1 53  ? 14.569  2.856   -7.825  1.00 0.00 ? 53  LEU A HD12 4  
ATOM 7304  H HD13 . LEU A 1 53  ? 13.121  3.576   -7.121  1.00 0.00 ? 53  LEU A HD13 4  
ATOM 7305  H HD21 . LEU A 1 53  ? 11.900  2.448   -10.351 1.00 0.00 ? 53  LEU A HD21 4  
ATOM 7306  H HD22 . LEU A 1 53  ? 12.534  0.806   -10.249 1.00 0.00 ? 53  LEU A HD22 4  
ATOM 7307  H HD23 . LEU A 1 53  ? 13.642  2.173   -10.374 1.00 0.00 ? 53  LEU A HD23 4  
ATOM 7308  N N    . LYS A 1 54  ? 13.616  -1.952  -6.184  1.00 0.00 ? 54  LYS A N    4  
ATOM 7309  C CA   . LYS A 1 54  ? 14.360  -3.158  -5.842  1.00 0.00 ? 54  LYS A CA   4  
ATOM 7310  C C    . LYS A 1 54  ? 13.447  -4.381  -5.849  1.00 0.00 ? 54  LYS A C    4  
ATOM 7311  O O    . LYS A 1 54  ? 13.738  -5.381  -6.504  1.00 0.00 ? 54  LYS A O    4  
ATOM 7312  C CB   . LYS A 1 54  ? 15.015  -3.006  -4.467  1.00 0.00 ? 54  LYS A CB   4  
ATOM 7313  C CG   . LYS A 1 54  ? 16.242  -3.880  -4.278  1.00 0.00 ? 54  LYS A CG   4  
ATOM 7314  C CD   . LYS A 1 54  ? 16.538  -4.116  -2.807  1.00 0.00 ? 54  LYS A CD   4  
ATOM 7315  C CE   . LYS A 1 54  ? 17.111  -2.871  -2.147  1.00 0.00 ? 54  LYS A CE   4  
ATOM 7316  N NZ   . LYS A 1 54  ? 16.041  -1.965  -1.646  1.00 0.00 ? 54  LYS A NZ   4  
ATOM 7317  H H    . LYS A 1 54  ? 13.510  -1.248  -5.509  1.00 0.00 ? 54  LYS A H    4  
ATOM 7318  H HA   . LYS A 1 54  ? 15.130  -3.295  -6.585  1.00 0.00 ? 54  LYS A HA   4  
ATOM 7319  H HB2  . LYS A 1 54  ? 15.309  -1.975  -4.335  1.00 0.00 ? 54  LYS A HB2  4  
ATOM 7320  H HB3  . LYS A 1 54  ? 14.293  -3.266  -3.707  1.00 0.00 ? 54  LYS A HB3  4  
ATOM 7321  H HG2  . LYS A 1 54  ? 16.072  -4.833  -4.757  1.00 0.00 ? 54  LYS A HG2  4  
ATOM 7322  H HG3  . LYS A 1 54  ? 17.093  -3.394  -4.734  1.00 0.00 ? 54  LYS A HG3  4  
ATOM 7323  H HD2  . LYS A 1 54  ? 15.622  -4.386  -2.303  1.00 0.00 ? 54  LYS A HD2  4  
ATOM 7324  H HD3  . LYS A 1 54  ? 17.252  -4.922  -2.716  1.00 0.00 ? 54  LYS A HD3  4  
ATOM 7325  H HE2  . LYS A 1 54  ? 17.733  -3.172  -1.318  1.00 0.00 ? 54  LYS A HE2  4  
ATOM 7326  H HE3  . LYS A 1 54  ? 17.710  -2.339  -2.872  1.00 0.00 ? 54  LYS A HE3  4  
ATOM 7327  H HZ1  . LYS A 1 54  ? 15.247  -1.944  -2.318  1.00 0.00 ? 54  LYS A HZ1  4  
ATOM 7328  H HZ2  . LYS A 1 54  ? 16.412  -1.000  -1.535  1.00 0.00 ? 54  LYS A HZ2  4  
ATOM 7329  H HZ3  . LYS A 1 54  ? 15.692  -2.299  -0.725  1.00 0.00 ? 54  LYS A HZ3  4  
ATOM 7330  N N    . TYR A 1 55  ? 12.342  -4.292  -5.117  1.00 0.00 ? 55  TYR A N    4  
ATOM 7331  C CA   . TYR A 1 55  ? 11.387  -5.391  -5.039  1.00 0.00 ? 55  TYR A CA   4  
ATOM 7332  C C    . TYR A 1 55  ? 10.382  -5.323  -6.184  1.00 0.00 ? 55  TYR A C    4  
ATOM 7333  O O    . TYR A 1 55  ? 9.329   -5.957  -6.139  1.00 0.00 ? 55  TYR A O    4  
ATOM 7334  C CB   . TYR A 1 55  ? 10.652  -5.361  -3.698  1.00 0.00 ? 55  TYR A CB   4  
ATOM 7335  C CG   . TYR A 1 55  ? 11.532  -5.702  -2.517  1.00 0.00 ? 55  TYR A CG   4  
ATOM 7336  C CD1  . TYR A 1 55  ? 11.729  -7.022  -2.131  1.00 0.00 ? 55  TYR A CD1  4  
ATOM 7337  C CD2  . TYR A 1 55  ? 12.165  -4.704  -1.785  1.00 0.00 ? 55  TYR A CD2  4  
ATOM 7338  C CE1  . TYR A 1 55  ? 12.532  -7.339  -1.052  1.00 0.00 ? 55  TYR A CE1  4  
ATOM 7339  C CE2  . TYR A 1 55  ? 12.970  -5.012  -0.706  1.00 0.00 ? 55  TYR A CE2  4  
ATOM 7340  C CZ   . TYR A 1 55  ? 13.151  -6.330  -0.343  1.00 0.00 ? 55  TYR A CZ   4  
ATOM 7341  O OH   . TYR A 1 55  ? 13.951  -6.641  0.732   1.00 0.00 ? 55  TYR A OH   4  
ATOM 7342  H H    . TYR A 1 55  ? 12.164  -3.468  -4.617  1.00 0.00 ? 55  TYR A H    4  
ATOM 7343  H HA   . TYR A 1 55  ? 11.939  -6.316  -5.114  1.00 0.00 ? 55  TYR A HA   4  
ATOM 7344  H HB2  . TYR A 1 55  ? 10.251  -4.372  -3.537  1.00 0.00 ? 55  TYR A HB2  4  
ATOM 7345  H HB3  . TYR A 1 55  ? 9.840   -6.073  -3.724  1.00 0.00 ? 55  TYR A HB3  4  
ATOM 7346  H HD1  . TYR A 1 55  ? 11.243  -7.810  -2.688  1.00 0.00 ? 55  TYR A HD1  4  
ATOM 7347  H HD2  . TYR A 1 55  ? 12.021  -3.673  -2.072  1.00 0.00 ? 55  TYR A HD2  4  
ATOM 7348  H HE1  . TYR A 1 55  ? 12.674  -8.371  -0.768  1.00 0.00 ? 55  TYR A HE1  4  
ATOM 7349  H HE2  . TYR A 1 55  ? 13.455  -4.222  -0.151  1.00 0.00 ? 55  TYR A HE2  4  
ATOM 7350  H HH   . TYR A 1 55  ? 13.782  -6.021  1.446   1.00 0.00 ? 55  TYR A HH   4  
ATOM 7351  N N    . ASN A 1 56  ? 10.717  -4.548  -7.211  1.00 0.00 ? 56  ASN A N    4  
ATOM 7352  C CA   . ASN A 1 56  ? 9.844   -4.395  -8.370  1.00 0.00 ? 56  ASN A CA   4  
ATOM 7353  C C    . ASN A 1 56  ? 10.220  -5.386  -9.468  1.00 0.00 ? 56  ASN A C    4  
ATOM 7354  O O    . ASN A 1 56  ? 11.129  -5.135  -10.260 1.00 0.00 ? 56  ASN A O    4  
ATOM 7355  C CB   . ASN A 1 56  ? 9.923   -2.966  -8.909  1.00 0.00 ? 56  ASN A CB   4  
ATOM 7356  C CG   . ASN A 1 56  ? 8.896   -2.050  -8.271  1.00 0.00 ? 56  ASN A CG   4  
ATOM 7357  O OD1  . ASN A 1 56  ? 8.055   -2.492  -7.488  1.00 0.00 ? 56  ASN A OD1  4  
ATOM 7358  N ND2  . ASN A 1 56  ? 8.960   -0.766  -8.605  1.00 0.00 ? 56  ASN A ND2  4  
ATOM 7359  H H    . ASN A 1 56  ? 11.570  -4.067  -7.189  1.00 0.00 ? 56  ASN A H    4  
ATOM 7360  H HA   . ASN A 1 56  ? 8.832   -4.595  -8.051  1.00 0.00 ? 56  ASN A HA   4  
ATOM 7361  H HB2  . ASN A 1 56  ? 10.907  -2.566  -8.709  1.00 0.00 ? 56  ASN A HB2  4  
ATOM 7362  H HB3  . ASN A 1 56  ? 9.754   -2.979  -9.975  1.00 0.00 ? 56  ASN A HB3  4  
ATOM 7363  H HD21 . ASN A 1 56  ? 9.656   -0.485  -9.235  1.00 0.00 ? 56  ASN A HD21 4  
ATOM 7364  H HD22 . ASN A 1 56  ? 8.308   -0.152  -8.207  1.00 0.00 ? 56  ASN A HD22 4  
ATOM 7365  N N    . CYS A 1 57  ? 9.515   -6.511  -9.508  1.00 0.00 ? 57  CYS A N    4  
ATOM 7366  C CA   . CYS A 1 57  ? 9.774   -7.540  -10.509 1.00 0.00 ? 57  CYS A CA   4  
ATOM 7367  C C    . CYS A 1 57  ? 8.497   -8.304  -10.847 1.00 0.00 ? 57  CYS A C    4  
ATOM 7368  O O    . CYS A 1 57  ? 7.451   -8.088  -10.235 1.00 0.00 ? 57  CYS A O    4  
ATOM 7369  C CB   . CYS A 1 57  ? 10.845  -8.509  -10.008 1.00 0.00 ? 57  CYS A CB   4  
ATOM 7370  S SG   . CYS A 1 57  ? 10.384  -9.409  -8.509  1.00 0.00 ? 57  CYS A SG   4  
ATOM 7371  H H    . CYS A 1 57  ? 8.802   -6.653  -8.850  1.00 0.00 ? 57  CYS A H    4  
ATOM 7372  H HA   . CYS A 1 57  ? 10.132  -7.050  -11.402 1.00 0.00 ? 57  CYS A HA   4  
ATOM 7373  H HB2  . CYS A 1 57  ? 11.048  -9.239  -10.778 1.00 0.00 ? 57  CYS A HB2  4  
ATOM 7374  H HB3  . CYS A 1 57  ? 11.749  -7.957  -9.797  1.00 0.00 ? 57  CYS A HB3  4  
ATOM 7375  H HG   . CYS A 1 57  ? 10.854  -10.643 -8.612  1.00 0.00 ? 57  CYS A HG   4  
ATOM 7376  N N    . THR A 1 58  ? 8.590   -9.197  -11.827 1.00 0.00 ? 58  THR A N    4  
ATOM 7377  C CA   . THR A 1 58  ? 7.443   -9.991  -12.248 1.00 0.00 ? 58  THR A CA   4  
ATOM 7378  C C    . THR A 1 58  ? 6.650   -10.492 -11.047 1.00 0.00 ? 58  THR A C    4  
ATOM 7379  O O    . THR A 1 58  ? 5.420   -10.460 -11.046 1.00 0.00 ? 58  THR A O    4  
ATOM 7380  C CB   . THR A 1 58  ? 7.878   -11.198 -13.101 1.00 0.00 ? 58  THR A CB   4  
ATOM 7381  O OG1  . THR A 1 58  ? 6.730   -11.954 -13.502 1.00 0.00 ? 58  THR A OG1  4  
ATOM 7382  C CG2  . THR A 1 58  ? 8.834   -12.092 -12.326 1.00 0.00 ? 58  THR A CG2  4  
ATOM 7383  H H    . THR A 1 58  ? 9.451   -9.324  -12.277 1.00 0.00 ? 58  THR A H    4  
ATOM 7384  H HA   . THR A 1 58  ? 6.805   -9.361  -12.852 1.00 0.00 ? 58  THR A HA   4  
ATOM 7385  H HB   . THR A 1 58  ? 8.385   -10.832 -13.983 1.00 0.00 ? 58  THR A HB   4  
ATOM 7386  H HG1  . THR A 1 58  ? 6.359   -11.573 -14.302 1.00 0.00 ? 58  THR A HG1  4  
ATOM 7387  H HG21 . THR A 1 58  ? 8.279   -12.673 -11.605 1.00 0.00 ? 58  THR A HG21 4  
ATOM 7388  H HG22 . THR A 1 58  ? 9.562   -11.480 -11.813 1.00 0.00 ? 58  THR A HG22 4  
ATOM 7389  H HG23 . THR A 1 58  ? 9.340   -12.756 -13.011 1.00 0.00 ? 58  THR A HG23 4  
ATOM 7390  N N    . GLY A 1 59  ? 7.362   -10.954 -10.024 1.00 0.00 ? 59  GLY A N    4  
ATOM 7391  C CA   . GLY A 1 59  ? 6.707   -11.454 -8.829  1.00 0.00 ? 59  GLY A CA   4  
ATOM 7392  C C    . GLY A 1 59  ? 6.199   -10.340 -7.937  1.00 0.00 ? 59  GLY A C    4  
ATOM 7393  O O    . GLY A 1 59  ? 5.132   -9.774  -8.182  1.00 0.00 ? 59  GLY A O    4  
ATOM 7394  H H    . GLY A 1 59  ? 8.340   -10.955 -10.080 1.00 0.00 ? 59  GLY A H    4  
ATOM 7395  H HA2  . GLY A 1 59  ? 5.873   -12.075 -9.123  1.00 0.00 ? 59  GLY A HA2  4  
ATOM 7396  H HA3  . GLY A 1 59  ? 7.410   -12.054 -8.271  1.00 0.00 ? 59  GLY A HA3  4  
ATOM 7397  N N    . LEU A 1 60  ? 6.961   -10.023 -6.896  1.00 0.00 ? 60  LEU A N    4  
ATOM 7398  C CA   . LEU A 1 60  ? 6.582   -8.969  -5.961  1.00 0.00 ? 60  LEU A CA   4  
ATOM 7399  C C    . LEU A 1 60  ? 6.521   -7.616  -6.662  1.00 0.00 ? 60  LEU A C    4  
ATOM 7400  O O    . LEU A 1 60  ? 7.424   -7.255  -7.415  1.00 0.00 ? 60  LEU A O    4  
ATOM 7401  C CB   . LEU A 1 60  ? 7.574   -8.910  -4.798  1.00 0.00 ? 60  LEU A CB   4  
ATOM 7402  C CG   . LEU A 1 60  ? 7.121   -8.121  -3.570  1.00 0.00 ? 60  LEU A CG   4  
ATOM 7403  C CD1  . LEU A 1 60  ? 5.971   -8.832  -2.872  1.00 0.00 ? 60  LEU A CD1  4  
ATOM 7404  C CD2  . LEU A 1 60  ? 8.284   -7.915  -2.610  1.00 0.00 ? 60  LEU A CD2  4  
ATOM 7405  H H    . LEU A 1 60  ? 7.799   -10.509 -6.752  1.00 0.00 ? 60  LEU A H    4  
ATOM 7406  H HA   . LEU A 1 60  ? 5.601   -9.206  -5.576  1.00 0.00 ? 60  LEU A HA   4  
ATOM 7407  H HB2  . LEU A 1 60  ? 7.776   -9.923  -4.485  1.00 0.00 ? 60  LEU A HB2  4  
ATOM 7408  H HB3  . LEU A 1 60  ? 8.485   -8.460  -5.165  1.00 0.00 ? 60  LEU A HB3  4  
ATOM 7409  H HG   . LEU A 1 60  ? 6.769   -7.148  -3.884  1.00 0.00 ? 60  LEU A HG   4  
ATOM 7410  H HD11 . LEU A 1 60  ? 6.333   -9.743  -2.421  1.00 0.00 ? 60  LEU A HD11 4  
ATOM 7411  H HD12 . LEU A 1 60  ? 5.203   -9.067  -3.594  1.00 0.00 ? 60  LEU A HD12 4  
ATOM 7412  H HD13 . LEU A 1 60  ? 5.561   -8.189  -2.107  1.00 0.00 ? 60  LEU A HD13 4  
ATOM 7413  H HD21 . LEU A 1 60  ? 9.186   -8.316  -3.047  1.00 0.00 ? 60  LEU A HD21 4  
ATOM 7414  H HD22 . LEU A 1 60  ? 8.077   -8.425  -1.680  1.00 0.00 ? 60  LEU A HD22 4  
ATOM 7415  H HD23 . LEU A 1 60  ? 8.413   -6.860  -2.422  1.00 0.00 ? 60  LEU A HD23 4  
ATOM 7416  N N    . ASN A 1 61  ? 5.450   -6.871  -6.407  1.00 0.00 ? 61  ASN A N    4  
ATOM 7417  C CA   . ASN A 1 61  ? 5.272   -5.556  -7.013  1.00 0.00 ? 61  ASN A CA   4  
ATOM 7418  C C    . ASN A 1 61  ? 4.965   -4.505  -5.950  1.00 0.00 ? 61  ASN A C    4  
ATOM 7419  O O    . ASN A 1 61  ? 4.681   -4.836  -4.799  1.00 0.00 ? 61  ASN A O    4  
ATOM 7420  C CB   . ASN A 1 61  ? 4.145   -5.596  -8.047  1.00 0.00 ? 61  ASN A CB   4  
ATOM 7421  C CG   . ASN A 1 61  ? 4.598   -6.178  -9.373  1.00 0.00 ? 61  ASN A CG   4  
ATOM 7422  O OD1  . ASN A 1 61  ? 5.390   -5.569  -10.092 1.00 0.00 ? 61  ASN A OD1  4  
ATOM 7423  N ND2  . ASN A 1 61  ? 4.096   -7.362  -9.701  1.00 0.00 ? 61  ASN A ND2  4  
ATOM 7424  H H    . ASN A 1 61  ? 4.763   -7.214  -5.798  1.00 0.00 ? 61  ASN A H    4  
ATOM 7425  H HA   . ASN A 1 61  ? 6.194   -5.292  -7.508  1.00 0.00 ? 61  ASN A HA   4  
ATOM 7426  H HB2  . ASN A 1 61  ? 3.337   -6.204  -7.667  1.00 0.00 ? 61  ASN A HB2  4  
ATOM 7427  H HB3  . ASN A 1 61  ? 3.786   -4.593  -8.219  1.00 0.00 ? 61  ASN A HB3  4  
ATOM 7428  H HD21 . ASN A 1 61  ? 3.470   -7.789  -9.079  1.00 0.00 ? 61  ASN A HD21 4  
ATOM 7429  H HD22 . ASN A 1 61  ? 4.372   -7.762  -10.552 1.00 0.00 ? 61  ASN A HD22 4  
ATOM 7430  N N    . PHE A 1 62  ? 5.023   -3.238  -6.346  1.00 0.00 ? 62  PHE A N    4  
ATOM 7431  C CA   . PHE A 1 62  ? 4.751   -2.138  -5.428  1.00 0.00 ? 62  PHE A CA   4  
ATOM 7432  C C    . PHE A 1 62  ? 3.704   -1.191  -6.008  1.00 0.00 ? 62  PHE A C    4  
ATOM 7433  O O    . PHE A 1 62  ? 3.699   -0.913  -7.206  1.00 0.00 ? 62  PHE A O    4  
ATOM 7434  C CB   . PHE A 1 62  ? 6.039   -1.369  -5.125  1.00 0.00 ? 62  PHE A CB   4  
ATOM 7435  C CG   . PHE A 1 62  ? 6.824   -1.942  -3.980  1.00 0.00 ? 62  PHE A CG   4  
ATOM 7436  C CD1  . PHE A 1 62  ? 7.207   -3.274  -3.984  1.00 0.00 ? 62  PHE A CD1  4  
ATOM 7437  C CD2  . PHE A 1 62  ? 7.180   -1.150  -2.901  1.00 0.00 ? 62  PHE A CD2  4  
ATOM 7438  C CE1  . PHE A 1 62  ? 7.929   -3.804  -2.931  1.00 0.00 ? 62  PHE A CE1  4  
ATOM 7439  C CE2  . PHE A 1 62  ? 7.902   -1.674  -1.845  1.00 0.00 ? 62  PHE A CE2  4  
ATOM 7440  C CZ   . PHE A 1 62  ? 8.278   -3.003  -1.862  1.00 0.00 ? 62  PHE A CZ   4  
ATOM 7441  H H    . PHE A 1 62  ? 5.254   -3.038  -7.277  1.00 0.00 ? 62  PHE A H    4  
ATOM 7442  H HA   . PHE A 1 62  ? 4.369   -2.559  -4.511  1.00 0.00 ? 62  PHE A HA   4  
ATOM 7443  H HB2  . PHE A 1 62  ? 6.671   -1.381  -5.999  1.00 0.00 ? 62  PHE A HB2  4  
ATOM 7444  H HB3  . PHE A 1 62  ? 5.790   -0.347  -4.879  1.00 0.00 ? 62  PHE A HB3  4  
ATOM 7445  H HD1  . PHE A 1 62  ? 6.936   -3.901  -4.820  1.00 0.00 ? 62  PHE A HD1  4  
ATOM 7446  H HD2  . PHE A 1 62  ? 6.886   -0.109  -2.887  1.00 0.00 ? 62  PHE A HD2  4  
ATOM 7447  H HE1  . PHE A 1 62  ? 8.222   -4.843  -2.946  1.00 0.00 ? 62  PHE A HE1  4  
ATOM 7448  H HE2  . PHE A 1 62  ? 8.173   -1.045  -1.011  1.00 0.00 ? 62  PHE A HE2  4  
ATOM 7449  H HZ   . PHE A 1 62  ? 8.842   -3.415  -1.038  1.00 0.00 ? 62  PHE A HZ   4  
ATOM 7450  N N    . GLY A 1 63  ? 2.818   -0.699  -5.148  1.00 0.00 ? 63  GLY A N    4  
ATOM 7451  C CA   . GLY A 1 63  ? 1.779   0.211   -5.592  1.00 0.00 ? 63  GLY A CA   4  
ATOM 7452  C C    . GLY A 1 63  ? 1.455   1.272   -4.559  1.00 0.00 ? 63  GLY A C    4  
ATOM 7453  O O    . GLY A 1 63  ? 1.997   1.259   -3.454  1.00 0.00 ? 63  GLY A O    4  
ATOM 7454  H H    . GLY A 1 63  ? 2.871   -0.955  -4.203  1.00 0.00 ? 63  GLY A H    4  
ATOM 7455  H HA2  . GLY A 1 63  ? 2.104   0.695   -6.501  1.00 0.00 ? 63  GLY A HA2  4  
ATOM 7456  H HA3  . GLY A 1 63  ? 0.884   -0.358  -5.800  1.00 0.00 ? 63  GLY A HA3  4  
ATOM 7457  N N    . LYS A 1 64  ? 0.570   2.195   -4.918  1.00 0.00 ? 64  LYS A N    4  
ATOM 7458  C CA   . LYS A 1 64  ? 0.174   3.269   -4.015  1.00 0.00 ? 64  LYS A CA   4  
ATOM 7459  C C    . LYS A 1 64  ? -1.281  3.666   -4.246  1.00 0.00 ? 64  LYS A C    4  
ATOM 7460  O O    . LYS A 1 64  ? -1.849  3.391   -5.303  1.00 0.00 ? 64  LYS A O    4  
ATOM 7461  C CB   . LYS A 1 64  ? 1.082   4.485   -4.208  1.00 0.00 ? 64  LYS A CB   4  
ATOM 7462  C CG   . LYS A 1 64  ? 2.313   4.473   -3.318  1.00 0.00 ? 64  LYS A CG   4  
ATOM 7463  C CD   . LYS A 1 64  ? 3.447   5.283   -3.922  1.00 0.00 ? 64  LYS A CD   4  
ATOM 7464  C CE   . LYS A 1 64  ? 3.201   6.777   -3.782  1.00 0.00 ? 64  LYS A CE   4  
ATOM 7465  N NZ   . LYS A 1 64  ? 3.260   7.219   -2.361  1.00 0.00 ? 64  LYS A NZ   4  
ATOM 7466  H H    . LYS A 1 64  ? 0.172   2.152   -5.814  1.00 0.00 ? 64  LYS A H    4  
ATOM 7467  H HA   . LYS A 1 64  ? 0.280   2.908   -3.004  1.00 0.00 ? 64  LYS A HA   4  
ATOM 7468  H HB2  . LYS A 1 64  ? 1.408   4.517   -5.237  1.00 0.00 ? 64  LYS A HB2  4  
ATOM 7469  H HB3  . LYS A 1 64  ? 0.517   5.380   -3.991  1.00 0.00 ? 64  LYS A HB3  4  
ATOM 7470  H HG2  . LYS A 1 64  ? 2.056   4.894   -2.357  1.00 0.00 ? 64  LYS A HG2  4  
ATOM 7471  H HG3  . LYS A 1 64  ? 2.642   3.451   -3.188  1.00 0.00 ? 64  LYS A HG3  4  
ATOM 7472  H HD2  . LYS A 1 64  ? 4.367   5.033   -3.416  1.00 0.00 ? 64  LYS A HD2  4  
ATOM 7473  H HD3  . LYS A 1 64  ? 3.534   5.038   -4.972  1.00 0.00 ? 64  LYS A HD3  4  
ATOM 7474  H HE2  . LYS A 1 64  ? 3.952   7.308   -4.347  1.00 0.00 ? 64  LYS A HE2  4  
ATOM 7475  H HE3  . LYS A 1 64  ? 2.223   7.006   -4.180  1.00 0.00 ? 64  LYS A HE3  4  
ATOM 7476  H HZ1  . LYS A 1 64  ? 3.436   6.402   -1.741  1.00 0.00 ? 64  LYS A HZ1  4  
ATOM 7477  H HZ2  . LYS A 1 64  ? 2.361   7.661   -2.086  1.00 0.00 ? 64  LYS A HZ2  4  
ATOM 7478  H HZ3  . LYS A 1 64  ? 4.028   7.909   -2.233  1.00 0.00 ? 64  LYS A HZ3  4  
ATOM 7479  N N    . VAL A 1 65  ? -1.877  4.315   -3.251  1.00 0.00 ? 65  VAL A N    4  
ATOM 7480  C CA   . VAL A 1 65  ? -3.265  4.752   -3.347  1.00 0.00 ? 65  VAL A CA   4  
ATOM 7481  C C    . VAL A 1 65  ? -3.523  5.961   -2.455  1.00 0.00 ? 65  VAL A C    4  
ATOM 7482  O O    . VAL A 1 65  ? -3.441  5.871   -1.230  1.00 0.00 ? 65  VAL A O    4  
ATOM 7483  C CB   . VAL A 1 65  ? -4.237  3.623   -2.957  1.00 0.00 ? 65  VAL A CB   4  
ATOM 7484  C CG1  . VAL A 1 65  ? -3.950  3.135   -1.545  1.00 0.00 ? 65  VAL A CG1  4  
ATOM 7485  C CG2  . VAL A 1 65  ? -5.678  4.094   -3.084  1.00 0.00 ? 65  VAL A CG2  4  
ATOM 7486  H H    . VAL A 1 65  ? -1.372  4.505   -2.433  1.00 0.00 ? 65  VAL A H    4  
ATOM 7487  H HA   . VAL A 1 65  ? -3.458  5.026   -4.374  1.00 0.00 ? 65  VAL A HA   4  
ATOM 7488  H HB   . VAL A 1 65  ? -4.089  2.797   -3.636  1.00 0.00 ? 65  VAL A HB   4  
ATOM 7489  H HG11 . VAL A 1 65  ? -4.373  2.151   -1.412  1.00 0.00 ? 65  VAL A HG11 4  
ATOM 7490  H HG12 . VAL A 1 65  ? -2.882  3.094   -1.388  1.00 0.00 ? 65  VAL A HG12 4  
ATOM 7491  H HG13 . VAL A 1 65  ? -4.393  3.816   -0.832  1.00 0.00 ? 65  VAL A HG13 4  
ATOM 7492  H HG21 . VAL A 1 65  ? -6.237  3.780   -2.215  1.00 0.00 ? 65  VAL A HG21 4  
ATOM 7493  H HG22 . VAL A 1 65  ? -5.700  5.172   -3.156  1.00 0.00 ? 65  VAL A HG22 4  
ATOM 7494  H HG23 . VAL A 1 65  ? -6.120  3.665   -3.972  1.00 0.00 ? 65  VAL A HG23 4  
ATOM 7495  N N    . ASP A 1 66  ? -3.836  7.092   -3.078  1.00 0.00 ? 66  ASP A N    4  
ATOM 7496  C CA   . ASP A 1 66  ? -4.108  8.321   -2.340  1.00 0.00 ? 66  ASP A CA   4  
ATOM 7497  C C    . ASP A 1 66  ? -5.462  8.247   -1.642  1.00 0.00 ? 66  ASP A C    4  
ATOM 7498  O O    . ASP A 1 66  ? -6.507  8.404   -2.274  1.00 0.00 ? 66  ASP A O    4  
ATOM 7499  C CB   . ASP A 1 66  ? -4.071  9.525   -3.283  1.00 0.00 ? 66  ASP A CB   4  
ATOM 7500  C CG   . ASP A 1 66  ? -4.051  10.844  -2.535  1.00 0.00 ? 66  ASP A CG   4  
ATOM 7501  O OD1  . ASP A 1 66  ? -2.963  11.251  -2.077  1.00 0.00 ? 66  ASP A OD1  4  
ATOM 7502  O OD2  . ASP A 1 66  ? -5.124  11.471  -2.410  1.00 0.00 ? 66  ASP A OD2  4  
ATOM 7503  H H    . ASP A 1 66  ? -3.886  7.101   -4.057  1.00 0.00 ? 66  ASP A H    4  
ATOM 7504  H HA   . ASP A 1 66  ? -3.338  8.436   -1.593  1.00 0.00 ? 66  ASP A HA   4  
ATOM 7505  H HB2  . ASP A 1 66  ? -3.183  9.467   -3.896  1.00 0.00 ? 66  ASP A HB2  4  
ATOM 7506  H HB3  . ASP A 1 66  ? -4.944  9.504   -3.917  1.00 0.00 ? 66  ASP A HB3  4  
ATOM 7507  N N    . VAL A 1 67  ? -5.437  8.005   -0.335  1.00 0.00 ? 67  VAL A N    4  
ATOM 7508  C CA   . VAL A 1 67  ? -6.662  7.910   0.449   1.00 0.00 ? 67  VAL A CA   4  
ATOM 7509  C C    . VAL A 1 67  ? -7.129  9.287   0.908   1.00 0.00 ? 67  VAL A C    4  
ATOM 7510  O O    . VAL A 1 67  ? -8.314  9.501   1.158   1.00 0.00 ? 67  VAL A O    4  
ATOM 7511  C CB   . VAL A 1 67  ? -6.471  7.008   1.682   1.00 0.00 ? 67  VAL A CB   4  
ATOM 7512  C CG1  . VAL A 1 67  ? -6.351  5.550   1.264   1.00 0.00 ? 67  VAL A CG1  4  
ATOM 7513  C CG2  . VAL A 1 67  ? -5.250  7.444   2.477   1.00 0.00 ? 67  VAL A CG2  4  
ATOM 7514  H H    . VAL A 1 67  ? -4.573  7.889   0.112   1.00 0.00 ? 67  VAL A H    4  
ATOM 7515  H HA   . VAL A 1 67  ? -7.426  7.472   -0.177  1.00 0.00 ? 67  VAL A HA   4  
ATOM 7516  H HB   . VAL A 1 67  ? -7.341  7.107   2.314   1.00 0.00 ? 67  VAL A HB   4  
ATOM 7517  H HG11 . VAL A 1 67  ? -6.922  5.387   0.361   1.00 0.00 ? 67  VAL A HG11 4  
ATOM 7518  H HG12 . VAL A 1 67  ? -5.313  5.311   1.083   1.00 0.00 ? 67  VAL A HG12 4  
ATOM 7519  H HG13 . VAL A 1 67  ? -6.735  4.917   2.050   1.00 0.00 ? 67  VAL A HG13 4  
ATOM 7520  H HG21 . VAL A 1 67  ? -5.542  7.662   3.493   1.00 0.00 ? 67  VAL A HG21 4  
ATOM 7521  H HG22 . VAL A 1 67  ? -4.516  6.651   2.476   1.00 0.00 ? 67  VAL A HG22 4  
ATOM 7522  H HG23 . VAL A 1 67  ? -4.824  8.328   2.027   1.00 0.00 ? 67  VAL A HG23 4  
ATOM 7523  N N    . GLY A 1 68  ? -6.187  10.219  1.017   1.00 0.00 ? 68  GLY A N    4  
ATOM 7524  C CA   . GLY A 1 68  ? -6.521  11.565  1.446   1.00 0.00 ? 68  GLY A CA   4  
ATOM 7525  C C    . GLY A 1 68  ? -7.614  12.188  0.600   1.00 0.00 ? 68  GLY A C    4  
ATOM 7526  O O    . GLY A 1 68  ? -8.319  13.091  1.051   1.00 0.00 ? 68  GLY A O    4  
ATOM 7527  H H    . GLY A 1 68  ? -5.258  9.992   0.804   1.00 0.00 ? 68  GLY A H    4  
ATOM 7528  H HA2  . GLY A 1 68  ? -6.851  11.532  2.473   1.00 0.00 ? 68  GLY A HA2  4  
ATOM 7529  H HA3  . GLY A 1 68  ? -5.637  12.181  1.381   1.00 0.00 ? 68  GLY A HA3  4  
ATOM 7530  N N    . ARG A 1 69  ? -7.754  11.708  -0.631  1.00 0.00 ? 69  ARG A N    4  
ATOM 7531  C CA   . ARG A 1 69  ? -8.766  12.226  -1.544  1.00 0.00 ? 69  ARG A CA   4  
ATOM 7532  C C    . ARG A 1 69  ? -9.809  11.159  -1.861  1.00 0.00 ? 69  ARG A C    4  
ATOM 7533  O O    . ARG A 1 69  ? -10.920 11.470  -2.292  1.00 0.00 ? 69  ARG A O    4  
ATOM 7534  C CB   . ARG A 1 69  ? -8.114  12.718  -2.837  1.00 0.00 ? 69  ARG A CB   4  
ATOM 7535  C CG   . ARG A 1 69  ? -9.105  13.282  -3.842  1.00 0.00 ? 69  ARG A CG   4  
ATOM 7536  C CD   . ARG A 1 69  ? -8.396  14.000  -4.980  1.00 0.00 ? 69  ARG A CD   4  
ATOM 7537  N NE   . ARG A 1 69  ? -7.806  13.065  -5.934  1.00 0.00 ? 69  ARG A NE   4  
ATOM 7538  C CZ   . ARG A 1 69  ? -7.318  13.430  -7.115  1.00 0.00 ? 69  ARG A CZ   4  
ATOM 7539  N NH1  . ARG A 1 69  ? -7.350  14.703  -7.484  1.00 0.00 ? 69  ARG A NH1  4  
ATOM 7540  N NH2  . ARG A 1 69  ? -6.797  12.520  -7.929  1.00 0.00 ? 69  ARG A NH2  4  
ATOM 7541  H H    . ARG A 1 69  ? -7.161  10.988  -0.934  1.00 0.00 ? 69  ARG A H    4  
ATOM 7542  H HA   . ARG A 1 69  ? -9.255  13.058  -1.059  1.00 0.00 ? 69  ARG A HA   4  
ATOM 7543  H HB2  . ARG A 1 69  ? -7.400  13.491  -2.595  1.00 0.00 ? 69  ARG A HB2  4  
ATOM 7544  H HB3  . ARG A 1 69  ? -7.595  11.892  -3.300  1.00 0.00 ? 69  ARG A HB3  4  
ATOM 7545  H HG2  . ARG A 1 69  ? -9.689  12.471  -4.252  1.00 0.00 ? 69  ARG A HG2  4  
ATOM 7546  H HG3  . ARG A 1 69  ? -9.757  13.979  -3.338  1.00 0.00 ? 69  ARG A HG3  4  
ATOM 7547  H HD2  . ARG A 1 69  ? -9.111  14.622  -5.496  1.00 0.00 ? 69  ARG A HD2  4  
ATOM 7548  H HD3  . ARG A 1 69  ? -7.614  14.619  -4.565  1.00 0.00 ? 69  ARG A HD3  4  
ATOM 7549  H HE   . ARG A 1 69  ? -7.772  12.119  -5.682  1.00 0.00 ? 69  ARG A HE   4  
ATOM 7550  H HH11 . ARG A 1 69  ? -7.741  15.390  -6.873  1.00 0.00 ? 69  ARG A HH11 4  
ATOM 7551  H HH12 . ARG A 1 69  ? -6.981  14.975  -8.373  1.00 0.00 ? 69  ARG A HH12 4  
ATOM 7552  H HH21 . ARG A 1 69  ? -6.771  11.560  -7.653  1.00 0.00 ? 69  ARG A HH21 4  
ATOM 7553  H HH22 . ARG A 1 69  ? -6.431  12.796  -8.817  1.00 0.00 ? 69  ARG A HH22 4  
ATOM 7554  N N    . TYR A 1 70  ? -9.445  9.900   -1.645  1.00 0.00 ? 70  TYR A N    4  
ATOM 7555  C CA   . TYR A 1 70  ? -10.347 8.786   -1.911  1.00 0.00 ? 70  TYR A CA   4  
ATOM 7556  C C    . TYR A 1 70  ? -11.076 8.360   -0.640  1.00 0.00 ? 70  TYR A C    4  
ATOM 7557  O O    . TYR A 1 70  ? -11.026 7.196   -0.241  1.00 0.00 ? 70  TYR A O    4  
ATOM 7558  C CB   . TYR A 1 70  ? -9.573  7.601   -2.490  1.00 0.00 ? 70  TYR A CB   4  
ATOM 7559  C CG   . TYR A 1 70  ? -9.057  7.841   -3.891  1.00 0.00 ? 70  TYR A CG   4  
ATOM 7560  C CD1  . TYR A 1 70  ? -8.281  8.956   -4.185  1.00 0.00 ? 70  TYR A CD1  4  
ATOM 7561  C CD2  . TYR A 1 70  ? -9.345  6.954   -4.920  1.00 0.00 ? 70  TYR A CD2  4  
ATOM 7562  C CE1  . TYR A 1 70  ? -7.808  9.180   -5.463  1.00 0.00 ? 70  TYR A CE1  4  
ATOM 7563  C CE2  . TYR A 1 70  ? -8.875  7.169   -6.201  1.00 0.00 ? 70  TYR A CE2  4  
ATOM 7564  C CZ   . TYR A 1 70  ? -8.107  8.283   -6.468  1.00 0.00 ? 70  TYR A CZ   4  
ATOM 7565  O OH   . TYR A 1 70  ? -7.638  8.502   -7.743  1.00 0.00 ? 70  TYR A OH   4  
ATOM 7566  H H    . TYR A 1 70  ? -8.546  9.714   -1.301  1.00 0.00 ? 70  TYR A H    4  
ATOM 7567  H HA   . TYR A 1 70  ? -11.076 9.116   -2.637  1.00 0.00 ? 70  TYR A HA   4  
ATOM 7568  H HB2  . TYR A 1 70  ? -8.725  7.390   -1.857  1.00 0.00 ? 70  TYR A HB2  4  
ATOM 7569  H HB3  . TYR A 1 70  ? -10.219 6.736   -2.518  1.00 0.00 ? 70  TYR A HB3  4  
ATOM 7570  H HD1  . TYR A 1 70  ? -8.049  9.657   -3.396  1.00 0.00 ? 70  TYR A HD1  4  
ATOM 7571  H HD2  . TYR A 1 70  ? -9.947  6.082   -4.708  1.00 0.00 ? 70  TYR A HD2  4  
ATOM 7572  H HE1  . TYR A 1 70  ? -7.207  10.052  -5.673  1.00 0.00 ? 70  TYR A HE1  4  
ATOM 7573  H HE2  . TYR A 1 70  ? -9.109  6.467   -6.988  1.00 0.00 ? 70  TYR A HE2  4  
ATOM 7574  H HH   . TYR A 1 70  ? -7.810  7.728   -8.284  1.00 0.00 ? 70  TYR A HH   4  
ATOM 7575  N N    . THR A 1 71  ? -11.755 9.312   -0.007  1.00 0.00 ? 71  THR A N    4  
ATOM 7576  C CA   . THR A 1 71  ? -12.494 9.038   1.218   1.00 0.00 ? 71  THR A CA   4  
ATOM 7577  C C    . THR A 1 71  ? -13.154 7.665   1.167   1.00 0.00 ? 71  THR A C    4  
ATOM 7578  O O    . THR A 1 71  ? -13.352 7.021   2.197   1.00 0.00 ? 71  THR A O    4  
ATOM 7579  C CB   . THR A 1 71  ? -13.574 10.106  1.474   1.00 0.00 ? 71  THR A CB   4  
ATOM 7580  O OG1  . THR A 1 71  ? -13.206 11.336  0.841   1.00 0.00 ? 71  THR A OG1  4  
ATOM 7581  C CG2  . THR A 1 71  ? -13.766 10.335  2.966   1.00 0.00 ? 71  THR A CG2  4  
ATOM 7582  H H    . THR A 1 71  ? -11.757 10.221  -0.375  1.00 0.00 ? 71  THR A H    4  
ATOM 7583  H HA   . THR A 1 71  ? -11.794 9.059   2.041   1.00 0.00 ? 71  THR A HA   4  
ATOM 7584  H HB   . THR A 1 71  ? -14.508 9.759   1.054   1.00 0.00 ? 71  THR A HB   4  
ATOM 7585  H HG1  . THR A 1 71  ? -13.775 12.042  1.157   1.00 0.00 ? 71  THR A HG1  4  
ATOM 7586  H HG21 . THR A 1 71  ? -14.535 11.078  3.120   1.00 0.00 ? 71  THR A HG21 4  
ATOM 7587  H HG22 . THR A 1 71  ? -12.840 10.679  3.399   1.00 0.00 ? 71  THR A HG22 4  
ATOM 7588  H HG23 . THR A 1 71  ? -14.062 9.409   3.436   1.00 0.00 ? 71  THR A HG23 4  
ATOM 7589  N N    . ASP A 1 72  ? -13.494 7.223   -0.039  1.00 0.00 ? 72  ASP A N    4  
ATOM 7590  C CA   . ASP A 1 72  ? -14.132 5.924   -0.225  1.00 0.00 ? 72  ASP A CA   4  
ATOM 7591  C C    . ASP A 1 72  ? -13.205 4.796   0.216   1.00 0.00 ? 72  ASP A C    4  
ATOM 7592  O O    . ASP A 1 72  ? -13.618 3.884   0.933   1.00 0.00 ? 72  ASP A O    4  
ATOM 7593  C CB   . ASP A 1 72  ? -14.528 5.732   -1.690  1.00 0.00 ? 72  ASP A CB   4  
ATOM 7594  C CG   . ASP A 1 72  ? -15.755 6.538   -2.068  1.00 0.00 ? 72  ASP A CG   4  
ATOM 7595  O OD1  . ASP A 1 72  ? -16.682 6.633   -1.236  1.00 0.00 ? 72  ASP A OD1  4  
ATOM 7596  O OD2  . ASP A 1 72  ? -15.789 7.074   -3.195  1.00 0.00 ? 72  ASP A OD2  4  
ATOM 7597  H H    . ASP A 1 72  ? -13.311 7.782   -0.823  1.00 0.00 ? 72  ASP A H    4  
ATOM 7598  H HA   . ASP A 1 72  ? -15.022 5.901   0.385   1.00 0.00 ? 72  ASP A HA   4  
ATOM 7599  H HB2  . ASP A 1 72  ? -13.708 6.043   -2.322  1.00 0.00 ? 72  ASP A HB2  4  
ATOM 7600  H HB3  . ASP A 1 72  ? -14.737 4.687   -1.866  1.00 0.00 ? 72  ASP A HB3  4  
ATOM 7601  N N    . VAL A 1 73  ? -11.950 4.863   -0.218  1.00 0.00 ? 73  VAL A N    4  
ATOM 7602  C CA   . VAL A 1 73  ? -10.965 3.847   0.132   1.00 0.00 ? 73  VAL A CA   4  
ATOM 7603  C C    . VAL A 1 73  ? -10.731 3.803   1.638   1.00 0.00 ? 73  VAL A C    4  
ATOM 7604  O O    . VAL A 1 73  ? -11.088 2.832   2.304   1.00 0.00 ? 73  VAL A O    4  
ATOM 7605  C CB   . VAL A 1 73  ? -9.621  4.100   -0.578  1.00 0.00 ? 73  VAL A CB   4  
ATOM 7606  C CG1  . VAL A 1 73  ? -8.597  3.050   -0.174  1.00 0.00 ? 73  VAL A CG1  4  
ATOM 7607  C CG2  . VAL A 1 73  ? -9.812  4.117   -2.087  1.00 0.00 ? 73  VAL A CG2  4  
ATOM 7608  H H    . VAL A 1 73  ? -11.681 5.614   -0.787  1.00 0.00 ? 73  VAL A H    4  
ATOM 7609  H HA   . VAL A 1 73  ? -11.344 2.888   -0.192  1.00 0.00 ? 73  VAL A HA   4  
ATOM 7610  H HB   . VAL A 1 73  ? -9.252  5.068   -0.272  1.00 0.00 ? 73  VAL A HB   4  
ATOM 7611  H HG11 . VAL A 1 73  ? -8.862  2.643   0.791   1.00 0.00 ? 73  VAL A HG11 4  
ATOM 7612  H HG12 . VAL A 1 73  ? -8.583  2.259   -0.909  1.00 0.00 ? 73  VAL A HG12 4  
ATOM 7613  H HG13 . VAL A 1 73  ? -7.620  3.506   -0.114  1.00 0.00 ? 73  VAL A HG13 4  
ATOM 7614  H HG21 . VAL A 1 73  ? -9.508  3.166   -2.498  1.00 0.00 ? 73  VAL A HG21 4  
ATOM 7615  H HG22 . VAL A 1 73  ? -10.853 4.294   -2.317  1.00 0.00 ? 73  VAL A HG22 4  
ATOM 7616  H HG23 . VAL A 1 73  ? -9.210  4.904   -2.517  1.00 0.00 ? 73  VAL A HG23 4  
ATOM 7617  N N    . SER A 1 74  ? -10.131 4.864   2.169   1.00 0.00 ? 74  SER A N    4  
ATOM 7618  C CA   . SER A 1 74  ? -9.846  4.946   3.596   1.00 0.00 ? 74  SER A CA   4  
ATOM 7619  C C    . SER A 1 74  ? -10.942 4.263   4.409   1.00 0.00 ? 74  SER A C    4  
ATOM 7620  O O    . SER A 1 74  ? -10.696 3.272   5.097   1.00 0.00 ? 74  SER A O    4  
ATOM 7621  C CB   . SER A 1 74  ? -9.711  6.407   4.028   1.00 0.00 ? 74  SER A CB   4  
ATOM 7622  O OG   . SER A 1 74  ? -10.721 7.208   3.440   1.00 0.00 ? 74  SER A OG   4  
ATOM 7623  H H    . SER A 1 74  ? -9.870  5.607   1.585   1.00 0.00 ? 74  SER A H    4  
ATOM 7624  H HA   . SER A 1 74  ? -8.910  4.438   3.778   1.00 0.00 ? 74  SER A HA   4  
ATOM 7625  H HB2  . SER A 1 74  ? -9.797  6.472   5.102   1.00 0.00 ? 74  SER A HB2  4  
ATOM 7626  H HB3  . SER A 1 74  ? -8.746  6.783   3.720   1.00 0.00 ? 74  SER A HB3  4  
ATOM 7627  H HG   . SER A 1 74  ? -10.756 7.038   2.495   1.00 0.00 ? 74  SER A HG   4  
ATOM 7628  N N    . THR A 1 75  ? -12.155 4.801   4.325   1.00 0.00 ? 75  THR A N    4  
ATOM 7629  C CA   . THR A 1 75  ? -13.290 4.246   5.052   1.00 0.00 ? 75  THR A CA   4  
ATOM 7630  C C    . THR A 1 75  ? -13.375 2.735   4.868   1.00 0.00 ? 75  THR A C    4  
ATOM 7631  O O    . THR A 1 75  ? -13.509 1.989   5.838   1.00 0.00 ? 75  THR A O    4  
ATOM 7632  C CB   . THR A 1 75  ? -14.615 4.883   4.595   1.00 0.00 ? 75  THR A CB   4  
ATOM 7633  O OG1  . THR A 1 75  ? -14.526 6.310   4.674   1.00 0.00 ? 75  THR A OG1  4  
ATOM 7634  C CG2  . THR A 1 75  ? -15.774 4.394   5.451   1.00 0.00 ? 75  THR A CG2  4  
ATOM 7635  H H    . THR A 1 75  ? -12.288 5.591   3.760   1.00 0.00 ? 75  THR A H    4  
ATOM 7636  H HA   . THR A 1 75  ? -13.152 4.464   6.101   1.00 0.00 ? 75  THR A HA   4  
ATOM 7637  H HB   . THR A 1 75  ? -14.800 4.597   3.569   1.00 0.00 ? 75  THR A HB   4  
ATOM 7638  H HG1  . THR A 1 75  ? -14.526 6.680   3.787   1.00 0.00 ? 75  THR A HG1  4  
ATOM 7639  H HG21 . THR A 1 75  ? -15.967 5.109   6.238   1.00 0.00 ? 75  THR A HG21 4  
ATOM 7640  H HG22 . THR A 1 75  ? -15.522 3.439   5.887   1.00 0.00 ? 75  THR A HG22 4  
ATOM 7641  H HG23 . THR A 1 75  ? -16.656 4.289   4.837   1.00 0.00 ? 75  THR A HG23 4  
ATOM 7642  N N    . ARG A 1 76  ? -13.296 2.291   3.618   1.00 0.00 ? 76  ARG A N    4  
ATOM 7643  C CA   . ARG A 1 76  ? -13.364 0.868   3.307   1.00 0.00 ? 76  ARG A CA   4  
ATOM 7644  C C    . ARG A 1 76  ? -12.216 0.111   3.967   1.00 0.00 ? 76  ARG A C    4  
ATOM 7645  O O    . ARG A 1 76  ? -12.379 -1.028  4.405   1.00 0.00 ? 76  ARG A O    4  
ATOM 7646  C CB   . ARG A 1 76  ? -13.328 0.652   1.793   1.00 0.00 ? 76  ARG A CB   4  
ATOM 7647  C CG   . ARG A 1 76  ? -13.427 -0.808  1.383   1.00 0.00 ? 76  ARG A CG   4  
ATOM 7648  C CD   . ARG A 1 76  ? -13.878 -0.952  -0.062  1.00 0.00 ? 76  ARG A CD   4  
ATOM 7649  N NE   . ARG A 1 76  ? -14.248 -2.327  -0.386  1.00 0.00 ? 76  ARG A NE   4  
ATOM 7650  C CZ   . ARG A 1 76  ? -14.500 -2.749  -1.620  1.00 0.00 ? 76  ARG A CZ   4  
ATOM 7651  N NH1  . ARG A 1 76  ? -14.420 -1.907  -2.641  1.00 0.00 ? 76  ARG A NH1  4  
ATOM 7652  N NH2  . ARG A 1 76  ? -14.831 -4.016  -1.834  1.00 0.00 ? 76  ARG A NH2  4  
ATOM 7653  H H    . ARG A 1 76  ? -13.189 2.935   2.887   1.00 0.00 ? 76  ARG A H    4  
ATOM 7654  H HA   . ARG A 1 76  ? -14.299 0.489   3.693   1.00 0.00 ? 76  ARG A HA   4  
ATOM 7655  H HB2  . ARG A 1 76  ? -14.154 1.185   1.345   1.00 0.00 ? 76  ARG A HB2  4  
ATOM 7656  H HB3  . ARG A 1 76  ? -12.401 1.050   1.407   1.00 0.00 ? 76  ARG A HB3  4  
ATOM 7657  H HG2  . ARG A 1 76  ? -12.457 -1.270  1.494   1.00 0.00 ? 76  ARG A HG2  4  
ATOM 7658  H HG3  . ARG A 1 76  ? -14.139 -1.305  2.025   1.00 0.00 ? 76  ARG A HG3  4  
ATOM 7659  H HD2  . ARG A 1 76  ? -14.732 -0.311  -0.224  1.00 0.00 ? 76  ARG A HD2  4  
ATOM 7660  H HD3  . ARG A 1 76  ? -13.070 -0.645  -0.709  1.00 0.00 ? 76  ARG A HD3  4  
ATOM 7661  H HE   . ARG A 1 76  ? -14.313 -2.965  0.354   1.00 0.00 ? 76  ARG A HE   4  
ATOM 7662  H HH11 . ARG A 1 76  ? -14.170 -0.953  -2.483  1.00 0.00 ? 76  ARG A HH11 4  
ATOM 7663  H HH12 . ARG A 1 76  ? -14.609 -2.228  -3.570  1.00 0.00 ? 76  ARG A HH12 4  
ATOM 7664  H HH21 . ARG A 1 76  ? -14.892 -4.653  -1.067  1.00 0.00 ? 76  ARG A HH21 4  
ATOM 7665  H HH22 . ARG A 1 76  ? -15.021 -4.333  -2.763  1.00 0.00 ? 76  ARG A HH22 4  
ATOM 7666  N N    . TYR A 1 77  ? -11.054 0.752   4.035   1.00 0.00 ? 77  TYR A N    4  
ATOM 7667  C CA   . TYR A 1 77  ? -9.877  0.138   4.638   1.00 0.00 ? 77  TYR A CA   4  
ATOM 7668  C C    . TYR A 1 77  ? -9.662  0.653   6.058   1.00 0.00 ? 77  TYR A C    4  
ATOM 7669  O O    . TYR A 1 77  ? -8.548  0.618   6.583   1.00 0.00 ? 77  TYR A O    4  
ATOM 7670  C CB   . TYR A 1 77  ? -8.637  0.419   3.788   1.00 0.00 ? 77  TYR A CB   4  
ATOM 7671  C CG   . TYR A 1 77  ? -8.645  -0.288  2.452   1.00 0.00 ? 77  TYR A CG   4  
ATOM 7672  C CD1  . TYR A 1 77  ? -9.490  0.128   1.430   1.00 0.00 ? 77  TYR A CD1  4  
ATOM 7673  C CD2  . TYR A 1 77  ? -7.810  -1.372  2.212   1.00 0.00 ? 77  TYR A CD2  4  
ATOM 7674  C CE1  . TYR A 1 77  ? -9.502  -0.516  0.207   1.00 0.00 ? 77  TYR A CE1  4  
ATOM 7675  C CE2  . TYR A 1 77  ? -7.815  -2.020  0.992   1.00 0.00 ? 77  TYR A CE2  4  
ATOM 7676  C CZ   . TYR A 1 77  ? -8.662  -1.589  -0.007  1.00 0.00 ? 77  TYR A CZ   4  
ATOM 7677  O OH   . TYR A 1 77  ? -8.670  -2.233  -1.223  1.00 0.00 ? 77  TYR A OH   4  
ATOM 7678  H H    . TYR A 1 77  ? -10.985 1.658   3.668   1.00 0.00 ? 77  TYR A H    4  
ATOM 7679  H HA   . TYR A 1 77  ? -10.041 -0.929  4.676   1.00 0.00 ? 77  TYR A HA   4  
ATOM 7680  H HB2  . TYR A 1 77  ? -8.570  1.480   3.601   1.00 0.00 ? 77  TYR A HB2  4  
ATOM 7681  H HB3  . TYR A 1 77  ? -7.758  0.098   4.329   1.00 0.00 ? 77  TYR A HB3  4  
ATOM 7682  H HD1  . TYR A 1 77  ? -10.146 0.969   1.600   1.00 0.00 ? 77  TYR A HD1  4  
ATOM 7683  H HD2  . TYR A 1 77  ? -7.148  -1.708  2.997   1.00 0.00 ? 77  TYR A HD2  4  
ATOM 7684  H HE1  . TYR A 1 77  ? -10.165 -0.178  -0.576  1.00 0.00 ? 77  TYR A HE1  4  
ATOM 7685  H HE2  . TYR A 1 77  ? -7.158  -2.861  0.824   1.00 0.00 ? 77  TYR A HE2  4  
ATOM 7686  H HH   . TYR A 1 77  ? -7.927  -2.838  -1.269  1.00 0.00 ? 77  TYR A HH   4  
ATOM 7687  N N    . LYS A 1 78  ? -10.736 1.132   6.676   1.00 0.00 ? 78  LYS A N    4  
ATOM 7688  C CA   . LYS A 1 78  ? -10.669 1.654   8.036   1.00 0.00 ? 78  LYS A CA   4  
ATOM 7689  C C    . LYS A 1 78  ? -9.336  2.352   8.285   1.00 0.00 ? 78  LYS A C    4  
ATOM 7690  O O    . LYS A 1 78  ? -8.699  2.145   9.319   1.00 0.00 ? 78  LYS A O    4  
ATOM 7691  C CB   . LYS A 1 78  ? -10.861 0.522   9.048   1.00 0.00 ? 78  LYS A CB   4  
ATOM 7692  C CG   . LYS A 1 78  ? -12.294 0.025   9.139   1.00 0.00 ? 78  LYS A CG   4  
ATOM 7693  C CD   . LYS A 1 78  ? -12.411 -1.170  10.070  1.00 0.00 ? 78  LYS A CD   4  
ATOM 7694  C CE   . LYS A 1 78  ? -12.576 -0.734  11.518  1.00 0.00 ? 78  LYS A CE   4  
ATOM 7695  N NZ   . LYS A 1 78  ? -12.111 -1.782  12.469  1.00 0.00 ? 78  LYS A NZ   4  
ATOM 7696  H H    . LYS A 1 78  ? -11.597 1.134   6.205   1.00 0.00 ? 78  LYS A H    4  
ATOM 7697  H HA   . LYS A 1 78  ? -11.466 2.372   8.156   1.00 0.00 ? 78  LYS A HA   4  
ATOM 7698  H HB2  . LYS A 1 78  ? -10.231 -0.308  8.766   1.00 0.00 ? 78  LYS A HB2  4  
ATOM 7699  H HB3  . LYS A 1 78  ? -10.562 0.875   10.025  1.00 0.00 ? 78  LYS A HB3  4  
ATOM 7700  H HG2  . LYS A 1 78  ? -12.919 0.822   9.514   1.00 0.00 ? 78  LYS A HG2  4  
ATOM 7701  H HG3  . LYS A 1 78  ? -12.628 -0.264  8.153   1.00 0.00 ? 78  LYS A HG3  4  
ATOM 7702  H HD2  . LYS A 1 78  ? -13.271 -1.757  9.783   1.00 0.00 ? 78  LYS A HD2  4  
ATOM 7703  H HD3  . LYS A 1 78  ? -11.517 -1.771  9.984   1.00 0.00 ? 78  LYS A HD3  4  
ATOM 7704  H HE2  . LYS A 1 78  ? -12.002 0.165   11.678  1.00 0.00 ? 78  LYS A HE2  4  
ATOM 7705  H HE3  . LYS A 1 78  ? -13.621 -0.532  11.702  1.00 0.00 ? 78  LYS A HE3  4  
ATOM 7706  H HZ1  . LYS A 1 78  ? -11.477 -2.449  11.983  1.00 0.00 ? 78  LYS A HZ1  4  
ATOM 7707  H HZ2  . LYS A 1 78  ? -12.924 -2.308  12.848  1.00 0.00 ? 78  LYS A HZ2  4  
ATOM 7708  H HZ3  . LYS A 1 78  ? -11.596 -1.344  13.259  1.00 0.00 ? 78  LYS A HZ3  4  
ATOM 7709  N N    . VAL A 1 79  ? -8.919  3.180   7.333   1.00 0.00 ? 79  VAL A N    4  
ATOM 7710  C CA   . VAL A 1 79  ? -7.663  3.911   7.451   1.00 0.00 ? 79  VAL A CA   4  
ATOM 7711  C C    . VAL A 1 79  ? -7.911  5.392   7.710   1.00 0.00 ? 79  VAL A C    4  
ATOM 7712  O O    . VAL A 1 79  ? -7.913  6.204   6.784   1.00 0.00 ? 79  VAL A O    4  
ATOM 7713  C CB   . VAL A 1 79  ? -6.804  3.760   6.181   1.00 0.00 ? 79  VAL A CB   4  
ATOM 7714  C CG1  . VAL A 1 79  ? -5.556  4.625   6.274   1.00 0.00 ? 79  VAL A CG1  4  
ATOM 7715  C CG2  . VAL A 1 79  ? -6.437  2.301   5.957   1.00 0.00 ? 79  VAL A CG2  4  
ATOM 7716  H H    . VAL A 1 79  ? -9.470  3.303   6.532   1.00 0.00 ? 79  VAL A H    4  
ATOM 7717  H HA   . VAL A 1 79  ? -7.113  3.497   8.283   1.00 0.00 ? 79  VAL A HA   4  
ATOM 7718  H HB   . VAL A 1 79  ? -7.386  4.097   5.335   1.00 0.00 ? 79  VAL A HB   4  
ATOM 7719  H HG11 . VAL A 1 79  ? -4.831  4.288   5.547   1.00 0.00 ? 79  VAL A HG11 4  
ATOM 7720  H HG12 . VAL A 1 79  ? -5.816  5.654   6.076   1.00 0.00 ? 79  VAL A HG12 4  
ATOM 7721  H HG13 . VAL A 1 79  ? -5.136  4.543   7.265   1.00 0.00 ? 79  VAL A HG13 4  
ATOM 7722  H HG21 . VAL A 1 79  ? -5.432  2.240   5.567   1.00 0.00 ? 79  VAL A HG21 4  
ATOM 7723  H HG22 . VAL A 1 79  ? -6.493  1.767   6.894   1.00 0.00 ? 79  VAL A HG22 4  
ATOM 7724  H HG23 . VAL A 1 79  ? -7.125  1.860   5.251   1.00 0.00 ? 79  VAL A HG23 4  
ATOM 7725  N N    . SER A 1 80  ? -8.120  5.739   8.976   1.00 0.00 ? 80  SER A N    4  
ATOM 7726  C CA   . SER A 1 80  ? -8.373  7.123   9.358   1.00 0.00 ? 80  SER A CA   4  
ATOM 7727  C C    . SER A 1 80  ? -7.577  8.083   8.479   1.00 0.00 ? 80  SER A C    4  
ATOM 7728  O O    . SER A 1 80  ? -6.426  7.818   8.131   1.00 0.00 ? 80  SER A O    4  
ATOM 7729  C CB   . SER A 1 80  ? -8.012  7.343   10.829  1.00 0.00 ? 80  SER A CB   4  
ATOM 7730  O OG   . SER A 1 80  ? -8.862  6.595   11.680  1.00 0.00 ? 80  SER A OG   4  
ATOM 7731  H H    . SER A 1 80  ? -8.106  5.046   9.670   1.00 0.00 ? 80  SER A H    4  
ATOM 7732  H HA   . SER A 1 80  ? -9.426  7.318   9.222   1.00 0.00 ? 80  SER A HA   4  
ATOM 7733  H HB2  . SER A 1 80  ? -6.992  7.033   10.997  1.00 0.00 ? 80  SER A HB2  4  
ATOM 7734  H HB3  . SER A 1 80  ? -8.114  8.392   11.069  1.00 0.00 ? 80  SER A HB3  4  
ATOM 7735  H HG   . SER A 1 80  ? -9.706  6.453   11.245  1.00 0.00 ? 80  SER A HG   4  
ATOM 7736  N N    . THR A 1 81  ? -8.200  9.203   8.122   1.00 0.00 ? 81  THR A N    4  
ATOM 7737  C CA   . THR A 1 81  ? -7.552  10.203  7.282   1.00 0.00 ? 81  THR A CA   4  
ATOM 7738  C C    . THR A 1 81  ? -7.458  11.545  7.999   1.00 0.00 ? 81  THR A C    4  
ATOM 7739  O O    . THR A 1 81  ? -7.611  12.600  7.384   1.00 0.00 ? 81  THR A O    4  
ATOM 7740  C CB   . THR A 1 81  ? -8.308  10.395  5.953   1.00 0.00 ? 81  THR A CB   4  
ATOM 7741  O OG1  . THR A 1 81  ? -9.720  10.412  6.191   1.00 0.00 ? 81  THR A OG1  4  
ATOM 7742  C CG2  . THR A 1 81  ? -7.967  9.284   4.971   1.00 0.00 ? 81  THR A CG2  4  
ATOM 7743  H H    . THR A 1 81  ? -9.117  9.358   8.430   1.00 0.00 ? 81  THR A H    4  
ATOM 7744  H HA   . THR A 1 81  ? -6.555  9.854   7.057   1.00 0.00 ? 81  THR A HA   4  
ATOM 7745  H HB   . THR A 1 81  ? -8.012  11.341  5.522   1.00 0.00 ? 81  THR A HB   4  
ATOM 7746  H HG1  . THR A 1 81  ? -10.182 10.143  5.393   1.00 0.00 ? 81  THR A HG1  4  
ATOM 7747  H HG21 . THR A 1 81  ? -7.248  8.615   5.420   1.00 0.00 ? 81  THR A HG21 4  
ATOM 7748  H HG22 . THR A 1 81  ? -7.549  9.714   4.073   1.00 0.00 ? 81  THR A HG22 4  
ATOM 7749  H HG23 . THR A 1 81  ? -8.864  8.736   4.724   1.00 0.00 ? 81  THR A HG23 4  
ATOM 7750  N N    . SER A 1 82  ? -7.205  11.497  9.303   1.00 0.00 ? 82  SER A N    4  
ATOM 7751  C CA   . SER A 1 82  ? -7.093  12.710  10.104  1.00 0.00 ? 82  SER A CA   4  
ATOM 7752  C C    . SER A 1 82  ? -5.645  13.188  10.168  1.00 0.00 ? 82  SER A C    4  
ATOM 7753  O O    . SER A 1 82  ? -4.705  12.395  10.230  1.00 0.00 ? 82  SER A O    4  
ATOM 7754  C CB   . SER A 1 82  ? -7.623  12.464  11.518  1.00 0.00 ? 82  SER A CB   4  
ATOM 7755  O OG   . SER A 1 82  ? -9.014  12.724  11.594  1.00 0.00 ? 82  SER A OG   4  
ATOM 7756  H H    . SER A 1 82  ? -7.093  10.625  9.736   1.00 0.00 ? 82  SER A H    4  
ATOM 7757  H HA   . SER A 1 82  ? -7.692  13.475  9.633   1.00 0.00 ? 82  SER A HA   4  
ATOM 7758  H HB2  . SER A 1 82  ? -7.447  11.434  11.791  1.00 0.00 ? 82  SER A HB2  4  
ATOM 7759  H HB3  . SER A 1 82  ? -7.109  13.114  12.211  1.00 0.00 ? 82  SER A HB3  4  
ATOM 7760  H HG   . SER A 1 82  ? -9.212  13.168  12.421  1.00 0.00 ? 82  SER A HG   4  
ATOM 7761  N N    . PRO A 1 83  ? -5.460  14.516  10.152  1.00 0.00 ? 83  PRO A N    4  
ATOM 7762  C CA   . PRO A 1 83  ? -4.130  15.131  10.208  1.00 0.00 ? 83  PRO A CA   4  
ATOM 7763  C C    . PRO A 1 83  ? -3.468  14.956  11.570  1.00 0.00 ? 83  PRO A C    4  
ATOM 7764  O O    . PRO A 1 83  ? -2.283  15.248  11.737  1.00 0.00 ? 83  PRO A O    4  
ATOM 7765  C CB   . PRO A 1 83  ? -4.412  16.611  9.936   1.00 0.00 ? 83  PRO A CB   4  
ATOM 7766  C CG   . PRO A 1 83  ? -5.823  16.813  10.368  1.00 0.00 ? 83  PRO A CG   4  
ATOM 7767  C CD   . PRO A 1 83  ? -6.535  15.520  10.079  1.00 0.00 ? 83  PRO A CD   4  
ATOM 7768  H HA   . PRO A 1 83  ? -3.480  14.739  9.439   1.00 0.00 ? 83  PRO A HA   4  
ATOM 7769  H HB2  . PRO A 1 83  ? -3.730  17.221  10.511  1.00 0.00 ? 83  PRO A HB2  4  
ATOM 7770  H HB3  . PRO A 1 83  ? -4.288  16.817  8.884   1.00 0.00 ? 83  PRO A HB3  4  
ATOM 7771  H HG2  . PRO A 1 83  ? -5.856  17.031  11.425  1.00 0.00 ? 83  PRO A HG2  4  
ATOM 7772  H HG3  . PRO A 1 83  ? -6.268  17.619  9.803   1.00 0.00 ? 83  PRO A HG3  4  
ATOM 7773  H HD2  . PRO A 1 83  ? -7.291  15.331  10.826  1.00 0.00 ? 83  PRO A HD2  4  
ATOM 7774  H HD3  . PRO A 1 83  ? -6.973  15.544  9.092   1.00 0.00 ? 83  PRO A HD3  4  
ATOM 7775  N N    . LEU A 1 84  ? -4.239  14.478  12.541  1.00 0.00 ? 84  LEU A N    4  
ATOM 7776  C CA   . LEU A 1 84  ? -3.726  14.264  13.890  1.00 0.00 ? 84  LEU A CA   4  
ATOM 7777  C C    . LEU A 1 84  ? -3.320  12.808  14.093  1.00 0.00 ? 84  LEU A C    4  
ATOM 7778  O O    . LEU A 1 84  ? -2.228  12.518  14.583  1.00 0.00 ? 84  LEU A O    4  
ATOM 7779  C CB   . LEU A 1 84  ? -4.778  14.661  14.926  1.00 0.00 ? 84  LEU A CB   4  
ATOM 7780  C CG   . LEU A 1 84  ? -5.091  16.155  15.027  1.00 0.00 ? 84  LEU A CG   4  
ATOM 7781  C CD1  . LEU A 1 84  ? -6.517  16.370  15.509  1.00 0.00 ? 84  LEU A CD1  4  
ATOM 7782  C CD2  . LEU A 1 84  ? -4.102  16.844  15.955  1.00 0.00 ? 84  LEU A CD2  4  
ATOM 7783  H H    . LEU A 1 84  ? -5.175  14.264  12.347  1.00 0.00 ? 84  LEU A H    4  
ATOM 7784  H HA   . LEU A 1 84  ? -2.854  14.889  14.016  1.00 0.00 ? 84  LEU A HA   4  
ATOM 7785  H HB2  . LEU A 1 84  ? -5.695  14.148  14.679  1.00 0.00 ? 84  LEU A HB2  4  
ATOM 7786  H HB3  . LEU A 1 84  ? -4.431  14.328  15.894  1.00 0.00 ? 84  LEU A HB3  4  
ATOM 7787  H HG   . LEU A 1 84  ? -4.999  16.602  14.047  1.00 0.00 ? 84  LEU A HG   4  
ATOM 7788  H HD11 . LEU A 1 84  ? -7.173  15.667  15.018  1.00 0.00 ? 84  LEU A HD11 4  
ATOM 7789  H HD12 . LEU A 1 84  ? -6.827  17.378  15.274  1.00 0.00 ? 84  LEU A HD12 4  
ATOM 7790  H HD13 . LEU A 1 84  ? -6.562  16.220  16.578  1.00 0.00 ? 84  LEU A HD13 4  
ATOM 7791  H HD21 . LEU A 1 84  ? -4.420  17.862  16.128  1.00 0.00 ? 84  LEU A HD21 4  
ATOM 7792  H HD22 . LEU A 1 84  ? -3.122  16.847  15.500  1.00 0.00 ? 84  LEU A HD22 4  
ATOM 7793  H HD23 . LEU A 1 84  ? -4.061  16.315  16.896  1.00 0.00 ? 84  LEU A HD23 4  
ATOM 7794  N N    . THR A 1 85  ? -4.205  11.893  13.710  1.00 0.00 ? 85  THR A N    4  
ATOM 7795  C CA   . THR A 1 85  ? -3.939  10.467  13.849  1.00 0.00 ? 85  THR A CA   4  
ATOM 7796  C C    . THR A 1 85  ? -2.610  10.090  13.206  1.00 0.00 ? 85  THR A C    4  
ATOM 7797  O O    . THR A 1 85  ? -1.973  10.911  12.545  1.00 0.00 ? 85  THR A O    4  
ATOM 7798  C CB   . THR A 1 85  ? -5.061  9.622   13.216  1.00 0.00 ? 85  THR A CB   4  
ATOM 7799  O OG1  . THR A 1 85  ? -4.913  8.249   13.594  1.00 0.00 ? 85  THR A OG1  4  
ATOM 7800  C CG2  . THR A 1 85  ? -5.037  9.741   11.699  1.00 0.00 ? 85  THR A CG2  4  
ATOM 7801  H H    . THR A 1 85  ? -5.058  12.186  13.326  1.00 0.00 ? 85  THR A H    4  
ATOM 7802  H HA   . THR A 1 85  ? -3.896  10.237  14.904  1.00 0.00 ? 85  THR A HA   4  
ATOM 7803  H HB   . THR A 1 85  ? -6.012  9.986   13.576  1.00 0.00 ? 85  THR A HB   4  
ATOM 7804  H HG1  . THR A 1 85  ? -5.775  7.879   13.801  1.00 0.00 ? 85  THR A HG1  4  
ATOM 7805  H HG21 . THR A 1 85  ? -5.551  8.896   11.264  1.00 0.00 ? 85  THR A HG21 4  
ATOM 7806  H HG22 . THR A 1 85  ? -4.014  9.756   11.356  1.00 0.00 ? 85  THR A HG22 4  
ATOM 7807  H HG23 . THR A 1 85  ? -5.531  10.654  11.403  1.00 0.00 ? 85  THR A HG23 4  
ATOM 7808  N N    . LYS A 1 86  ? -2.195  8.843   13.402  1.00 0.00 ? 86  LYS A N    4  
ATOM 7809  C CA   . LYS A 1 86  ? -0.942  8.356   12.839  1.00 0.00 ? 86  LYS A CA   4  
ATOM 7810  C C    . LYS A 1 86  ? -1.191  7.201   11.873  1.00 0.00 ? 86  LYS A C    4  
ATOM 7811  O O    . LYS A 1 86  ? -0.393  6.268   11.790  1.00 0.00 ? 86  LYS A O    4  
ATOM 7812  C CB   . LYS A 1 86  ? 0.002   7.905   13.956  1.00 0.00 ? 86  LYS A CB   4  
ATOM 7813  C CG   . LYS A 1 86  ? 0.309   8.995   14.969  1.00 0.00 ? 86  LYS A CG   4  
ATOM 7814  C CD   . LYS A 1 86  ? 1.437   9.895   14.494  1.00 0.00 ? 86  LYS A CD   4  
ATOM 7815  C CE   . LYS A 1 86  ? 1.376   11.263  15.157  1.00 0.00 ? 86  LYS A CE   4  
ATOM 7816  N NZ   . LYS A 1 86  ? 2.054   12.307  14.340  1.00 0.00 ? 86  LYS A NZ   4  
ATOM 7817  H H    . LYS A 1 86  ? -2.747  8.235   13.937  1.00 0.00 ? 86  LYS A H    4  
ATOM 7818  H HA   . LYS A 1 86  ? -0.482  9.169   12.298  1.00 0.00 ? 86  LYS A HA   4  
ATOM 7819  H HB2  . LYS A 1 86  ? -0.449  7.074   14.478  1.00 0.00 ? 86  LYS A HB2  4  
ATOM 7820  H HB3  . LYS A 1 86  ? 0.933   7.580   13.515  1.00 0.00 ? 86  LYS A HB3  4  
ATOM 7821  H HG2  . LYS A 1 86  ? -0.576  9.594   15.119  1.00 0.00 ? 86  LYS A HG2  4  
ATOM 7822  H HG3  . LYS A 1 86  ? 0.598   8.534   15.903  1.00 0.00 ? 86  LYS A HG3  4  
ATOM 7823  H HD2  . LYS A 1 86  ? 2.382   9.433   14.736  1.00 0.00 ? 86  LYS A HD2  4  
ATOM 7824  H HD3  . LYS A 1 86  ? 1.360   10.021  13.423  1.00 0.00 ? 86  LYS A HD3  4  
ATOM 7825  H HE2  . LYS A 1 86  ? 0.341   11.538  15.290  1.00 0.00 ? 86  LYS A HE2  4  
ATOM 7826  H HE3  . LYS A 1 86  ? 1.858   11.202  16.122  1.00 0.00 ? 86  LYS A HE3  4  
ATOM 7827  H HZ1  . LYS A 1 86  ? 2.907   11.912  13.894  1.00 0.00 ? 86  LYS A HZ1  4  
ATOM 7828  H HZ2  . LYS A 1 86  ? 2.332   13.107  14.943  1.00 0.00 ? 86  LYS A HZ2  4  
ATOM 7829  H HZ3  . LYS A 1 86  ? 1.414   12.651  13.597  1.00 0.00 ? 86  LYS A HZ3  4  
ATOM 7830  N N    . GLN A 1 87  ? -2.301  7.273   11.146  1.00 0.00 ? 87  GLN A N    4  
ATOM 7831  C CA   . GLN A 1 87  ? -2.653  6.234   10.186  1.00 0.00 ? 87  GLN A CA   4  
ATOM 7832  C C    . GLN A 1 87  ? -2.276  6.651   8.769   1.00 0.00 ? 87  GLN A C    4  
ATOM 7833  O O    . GLN A 1 87  ? -2.871  6.189   7.794   1.00 0.00 ? 87  GLN A O    4  
ATOM 7834  C CB   . GLN A 1 87  ? -4.151  5.929   10.259  1.00 0.00 ? 87  GLN A CB   4  
ATOM 7835  C CG   . GLN A 1 87  ? -4.640  5.615   11.664  1.00 0.00 ? 87  GLN A CG   4  
ATOM 7836  C CD   . GLN A 1 87  ? -5.816  4.659   11.672  1.00 0.00 ? 87  GLN A CD   4  
ATOM 7837  O OE1  . GLN A 1 87  ? -6.913  5.009   12.108  1.00 0.00 ? 87  GLN A OE1  4  
ATOM 7838  N NE2  . GLN A 1 87  ? -5.593  3.442   11.189  1.00 0.00 ? 87  GLN A NE2  4  
ATOM 7839  H H    . GLN A 1 87  ? -2.897  8.043   11.258  1.00 0.00 ? 87  GLN A H    4  
ATOM 7840  H HA   . GLN A 1 87  ? -2.101  5.343   10.445  1.00 0.00 ? 87  GLN A HA   4  
ATOM 7841  H HB2  . GLN A 1 87  ? -4.698  6.785   9.893   1.00 0.00 ? 87  GLN A HB2  4  
ATOM 7842  H HB3  . GLN A 1 87  ? -4.364  5.079   9.629   1.00 0.00 ? 87  GLN A HB3  4  
ATOM 7843  H HG2  . GLN A 1 87  ? -3.830  5.170   12.222  1.00 0.00 ? 87  GLN A HG2  4  
ATOM 7844  H HG3  . GLN A 1 87  ? -4.940  6.537   12.141  1.00 0.00 ? 87  GLN A HG3  4  
ATOM 7845  H HE21 . GLN A 1 87  ? -4.693  3.233   10.860  1.00 0.00 ? 87  GLN A HE21 4  
ATOM 7846  H HE22 . GLN A 1 87  ? -6.335  2.803   11.183  1.00 0.00 ? 87  GLN A HE22 4  
ATOM 7847  N N    . LEU A 1 88  ? -1.284  7.528   8.660   1.00 0.00 ? 88  LEU A N    4  
ATOM 7848  C CA   . LEU A 1 88  ? -0.827  8.009   7.361   1.00 0.00 ? 88  LEU A CA   4  
ATOM 7849  C C    . LEU A 1 88  ? 0.618   8.492   7.436   1.00 0.00 ? 88  LEU A C    4  
ATOM 7850  O O    . LEU A 1 88  ? 0.966   9.363   8.234   1.00 0.00 ? 88  LEU A O    4  
ATOM 7851  C CB   . LEU A 1 88  ? -1.730  9.141   6.867   1.00 0.00 ? 88  LEU A CB   4  
ATOM 7852  C CG   . LEU A 1 88  ? -3.109  8.725   6.356   1.00 0.00 ? 88  LEU A CG   4  
ATOM 7853  C CD1  . LEU A 1 88  ? -3.919  9.946   5.949   1.00 0.00 ? 88  LEU A CD1  4  
ATOM 7854  C CD2  . LEU A 1 88  ? -2.976  7.758   5.188   1.00 0.00 ? 88  LEU A CD2  4  
ATOM 7855  H H    . LEU A 1 88  ? -0.848  7.861   9.472   1.00 0.00 ? 88  LEU A H    4  
ATOM 7856  H HA   . LEU A 1 88  ? -0.882  7.185   6.664   1.00 0.00 ? 88  LEU A HA   4  
ATOM 7857  H HB2  . LEU A 1 88  ? -1.874  9.829   7.685   1.00 0.00 ? 88  LEU A HB2  4  
ATOM 7858  H HB3  . LEU A 1 88  ? -1.215  9.645   6.061   1.00 0.00 ? 88  LEU A HB3  4  
ATOM 7859  H HG   . LEU A 1 88  ? -3.643  8.220   7.150   1.00 0.00 ? 88  LEU A HG   4  
ATOM 7860  H HD11 . LEU A 1 88  ? -3.252  10.718  5.596   1.00 0.00 ? 88  LEU A HD11 4  
ATOM 7861  H HD12 . LEU A 1 88  ? -4.473  10.310  6.801   1.00 0.00 ? 88  LEU A HD12 4  
ATOM 7862  H HD13 . LEU A 1 88  ? -4.607  9.676   5.161   1.00 0.00 ? 88  LEU A HD13 4  
ATOM 7863  H HD21 . LEU A 1 88  ? -2.805  6.760   5.565   1.00 0.00 ? 88  LEU A HD21 4  
ATOM 7864  H HD22 . LEU A 1 88  ? -2.143  8.055   4.568   1.00 0.00 ? 88  LEU A HD22 4  
ATOM 7865  H HD23 . LEU A 1 88  ? -3.884  7.771   4.604   1.00 0.00 ? 88  LEU A HD23 4  
ATOM 7866  N N    . PRO A 1 89  ? 1.480   7.915   6.586   1.00 0.00 ? 89  PRO A N    4  
ATOM 7867  C CA   . PRO A 1 89  ? 1.077   6.877   5.633   1.00 0.00 ? 89  PRO A CA   4  
ATOM 7868  C C    . PRO A 1 89  ? 0.726   5.563   6.322   1.00 0.00 ? 89  PRO A C    4  
ATOM 7869  O O    . PRO A 1 89  ? 0.859   5.432   7.539   1.00 0.00 ? 89  PRO A O    4  
ATOM 7870  C CB   . PRO A 1 89  ? 2.317   6.704   4.752   1.00 0.00 ? 89  PRO A CB   4  
ATOM 7871  C CG   . PRO A 1 89  ? 3.455   7.140   5.609   1.00 0.00 ? 89  PRO A CG   4  
ATOM 7872  C CD   . PRO A 1 89  ? 2.915   8.232   6.490   1.00 0.00 ? 89  PRO A CD   4  
ATOM 7873  H HA   . PRO A 1 89  ? 0.244   7.198   5.026   1.00 0.00 ? 89  PRO A HA   4  
ATOM 7874  H HB2  . PRO A 1 89  ? 2.414   5.667   4.462   1.00 0.00 ? 89  PRO A HB2  4  
ATOM 7875  H HB3  . PRO A 1 89  ? 2.227   7.323   3.872   1.00 0.00 ? 89  PRO A HB3  4  
ATOM 7876  H HG2  . PRO A 1 89  ? 3.802   6.312   6.208   1.00 0.00 ? 89  PRO A HG2  4  
ATOM 7877  H HG3  . PRO A 1 89  ? 4.256   7.519   4.991   1.00 0.00 ? 89  PRO A HG3  4  
ATOM 7878  H HD2  . PRO A 1 89  ? 3.383   8.199   7.462   1.00 0.00 ? 89  PRO A HD2  4  
ATOM 7879  H HD3  . PRO A 1 89  ? 3.066   9.198   6.029   1.00 0.00 ? 89  PRO A HD3  4  
ATOM 7880  N N    . THR A 1 90  ? 0.277   4.589   5.536   1.00 0.00 ? 90  THR A N    4  
ATOM 7881  C CA   . THR A 1 90  ? -0.094  3.285   6.070   1.00 0.00 ? 90  THR A CA   4  
ATOM 7882  C C    . THR A 1 90  ? 0.185   2.178   5.060   1.00 0.00 ? 90  THR A C    4  
ATOM 7883  O O    . THR A 1 90  ? -0.366  2.175   3.958   1.00 0.00 ? 90  THR A O    4  
ATOM 7884  C CB   . THR A 1 90  ? -1.582  3.242   6.464   1.00 0.00 ? 90  THR A CB   4  
ATOM 7885  O OG1  . THR A 1 90  ? -1.783  3.944   7.696   1.00 0.00 ? 90  THR A OG1  4  
ATOM 7886  C CG2  . THR A 1 90  ? -2.063  1.806   6.609   1.00 0.00 ? 90  THR A CG2  4  
ATOM 7887  H H    . THR A 1 90  ? 0.193   4.754   4.573   1.00 0.00 ? 90  THR A H    4  
ATOM 7888  H HA   . THR A 1 90  ? 0.497   3.108   6.957   1.00 0.00 ? 90  THR A HA   4  
ATOM 7889  H HB   . THR A 1 90  ? -2.159  3.723   5.687   1.00 0.00 ? 90  THR A HB   4  
ATOM 7890  H HG1  . THR A 1 90  ? -0.973  3.924   8.212   1.00 0.00 ? 90  THR A HG1  4  
ATOM 7891  H HG21 . THR A 1 90  ? -1.289  1.212   7.073   1.00 0.00 ? 90  THR A HG21 4  
ATOM 7892  H HG22 . THR A 1 90  ? -2.290  1.403   5.633   1.00 0.00 ? 90  THR A HG22 4  
ATOM 7893  H HG23 . THR A 1 90  ? -2.950  1.784   7.223   1.00 0.00 ? 90  THR A HG23 4  
ATOM 7894  N N    . LEU A 1 91  ? 1.041   1.237   5.442   1.00 0.00 ? 91  LEU A N    4  
ATOM 7895  C CA   . LEU A 1 91  ? 1.392   0.122   4.570   1.00 0.00 ? 91  LEU A CA   4  
ATOM 7896  C C    . LEU A 1 91  ? 0.562   -1.113  4.903   1.00 0.00 ? 91  LEU A C    4  
ATOM 7897  O O    . LEU A 1 91  ? 0.317   -1.411  6.073   1.00 0.00 ? 91  LEU A O    4  
ATOM 7898  C CB   . LEU A 1 91  ? 2.882   -0.201  4.697   1.00 0.00 ? 91  LEU A CB   4  
ATOM 7899  C CG   . LEU A 1 91  ? 3.840   0.760   3.994   1.00 0.00 ? 91  LEU A CG   4  
ATOM 7900  C CD1  . LEU A 1 91  ? 5.285   0.376   4.275   1.00 0.00 ? 91  LEU A CD1  4  
ATOM 7901  C CD2  . LEU A 1 91  ? 3.573   0.779   2.496   1.00 0.00 ? 91  LEU A CD2  4  
ATOM 7902  H H    . LEU A 1 91  ? 1.447   1.292   6.332   1.00 0.00 ? 91  LEU A H    4  
ATOM 7903  H HA   . LEU A 1 91  ? 1.182   0.418   3.553   1.00 0.00 ? 91  LEU A HA   4  
ATOM 7904  H HB2  . LEU A 1 91  ? 3.131   -0.206  5.747   1.00 0.00 ? 91  LEU A HB2  4  
ATOM 7905  H HB3  . LEU A 1 91  ? 3.042   -1.189  4.287   1.00 0.00 ? 91  LEU A HB3  4  
ATOM 7906  H HG   . LEU A 1 91  ? 3.681   1.760   4.375   1.00 0.00 ? 91  LEU A HG   4  
ATOM 7907  H HD11 . LEU A 1 91  ? 5.320   -0.303  5.113   1.00 0.00 ? 91  LEU A HD11 4  
ATOM 7908  H HD12 . LEU A 1 91  ? 5.855   1.263   4.506   1.00 0.00 ? 91  LEU A HD12 4  
ATOM 7909  H HD13 . LEU A 1 91  ? 5.705   -0.105  3.403   1.00 0.00 ? 91  LEU A HD13 4  
ATOM 7910  H HD21 . LEU A 1 91  ? 2.879   1.573   2.264   1.00 0.00 ? 91  LEU A HD21 4  
ATOM 7911  H HD22 . LEU A 1 91  ? 3.150   -0.169  2.194   1.00 0.00 ? 91  LEU A HD22 4  
ATOM 7912  H HD23 . LEU A 1 91  ? 4.500   0.944   1.967   1.00 0.00 ? 91  LEU A HD23 4  
ATOM 7913  N N    . ILE A 1 92  ? 0.134   -1.829  3.869   1.00 0.00 ? 92  ILE A N    4  
ATOM 7914  C CA   . ILE A 1 92  ? -0.665  -3.034  4.053   1.00 0.00 ? 92  ILE A CA   4  
ATOM 7915  C C    . ILE A 1 92  ? -0.192  -4.154  3.133   1.00 0.00 ? 92  ILE A C    4  
ATOM 7916  O O    . ILE A 1 92  ? -0.011  -3.951  1.931   1.00 0.00 ? 92  ILE A O    4  
ATOM 7917  C CB   . ILE A 1 92  ? -2.159  -2.764  3.788   1.00 0.00 ? 92  ILE A CB   4  
ATOM 7918  C CG1  . ILE A 1 92  ? -2.684  -1.693  4.747   1.00 0.00 ? 92  ILE A CG1  4  
ATOM 7919  C CG2  . ILE A 1 92  ? -2.962  -4.049  3.929   1.00 0.00 ? 92  ILE A CG2  4  
ATOM 7920  C CD1  . ILE A 1 92  ? -4.081  -1.220  4.416   1.00 0.00 ? 92  ILE A CD1  4  
ATOM 7921  H H    . ILE A 1 92  ? 0.362   -1.541  2.961   1.00 0.00 ? 92  ILE A H    4  
ATOM 7922  H HA   . ILE A 1 92  ? -0.554  -3.354  5.079   1.00 0.00 ? 92  ILE A HA   4  
ATOM 7923  H HB   . ILE A 1 92  ? -2.264  -2.412  2.774   1.00 0.00 ? 92  ILE A HB   4  
ATOM 7924  H HG12 . ILE A 1 92  ? -2.697  -2.092  5.749   1.00 0.00 ? 92  ILE A HG12 4  
ATOM 7925  H HG13 . ILE A 1 92  ? -2.025  -0.837  4.713   1.00 0.00 ? 92  ILE A HG13 4  
ATOM 7926  H HG21 . ILE A 1 92  ? -2.736  -4.707  3.103   1.00 0.00 ? 92  ILE A HG21 4  
ATOM 7927  H HG22 . ILE A 1 92  ? -2.701  -4.536  4.857   1.00 0.00 ? 92  ILE A HG22 4  
ATOM 7928  H HG23 . ILE A 1 92  ? -4.016  -3.816  3.927   1.00 0.00 ? 92  ILE A HG23 4  
ATOM 7929  H HD11 . ILE A 1 92  ? -4.787  -2.014  4.609   1.00 0.00 ? 92  ILE A HD11 4  
ATOM 7930  H HD12 . ILE A 1 92  ? -4.326  -0.364  5.027   1.00 0.00 ? 92  ILE A HD12 4  
ATOM 7931  H HD13 . ILE A 1 92  ? -4.130  -0.942  3.373   1.00 0.00 ? 92  ILE A HD13 4  
ATOM 7932  N N    . LEU A 1 93  ? 0.006   -5.337  3.704   1.00 0.00 ? 93  LEU A N    4  
ATOM 7933  C CA   . LEU A 1 93  ? 0.457   -6.492  2.935   1.00 0.00 ? 93  LEU A CA   4  
ATOM 7934  C C    . LEU A 1 93  ? -0.707  -7.427  2.623   1.00 0.00 ? 93  LEU A C    4  
ATOM 7935  O O    . LEU A 1 93  ? -1.408  -7.885  3.526   1.00 0.00 ? 93  LEU A O    4  
ATOM 7936  C CB   . LEU A 1 93  ? 1.543   -7.248  3.702   1.00 0.00 ? 93  LEU A CB   4  
ATOM 7937  C CG   . LEU A 1 93  ? 2.312   -8.305  2.910   1.00 0.00 ? 93  LEU A CG   4  
ATOM 7938  C CD1  . LEU A 1 93  ? 3.349   -7.650  2.011   1.00 0.00 ? 93  LEU A CD1  4  
ATOM 7939  C CD2  . LEU A 1 93  ? 2.973   -9.302  3.852   1.00 0.00 ? 93  LEU A CD2  4  
ATOM 7940  H H    . LEU A 1 93  ? -0.154  -5.437  4.665   1.00 0.00 ? 93  LEU A H    4  
ATOM 7941  H HA   . LEU A 1 93  ? 0.871   -6.130  2.005   1.00 0.00 ? 93  LEU A HA   4  
ATOM 7942  H HB2  . LEU A 1 93  ? 2.256   -6.524  4.066   1.00 0.00 ? 93  LEU A HB2  4  
ATOM 7943  H HB3  . LEU A 1 93  ? 1.072   -7.740  4.542   1.00 0.00 ? 93  LEU A HB3  4  
ATOM 7944  H HG   . LEU A 1 93  ? 1.621   -8.848  2.280   1.00 0.00 ? 93  LEU A HG   4  
ATOM 7945  H HD11 . LEU A 1 93  ? 3.504   -6.629  2.326   1.00 0.00 ? 93  LEU A HD11 4  
ATOM 7946  H HD12 . LEU A 1 93  ? 3.000   -7.662  0.990   1.00 0.00 ? 93  LEU A HD12 4  
ATOM 7947  H HD13 . LEU A 1 93  ? 4.280   -8.194  2.080   1.00 0.00 ? 93  LEU A HD13 4  
ATOM 7948  H HD21 . LEU A 1 93  ? 3.024   -10.269 3.374   1.00 0.00 ? 93  LEU A HD21 4  
ATOM 7949  H HD22 . LEU A 1 93  ? 2.392   -9.379  4.759   1.00 0.00 ? 93  LEU A HD22 4  
ATOM 7950  H HD23 . LEU A 1 93  ? 3.971   -8.964  4.090   1.00 0.00 ? 93  LEU A HD23 4  
ATOM 7951  N N    . PHE A 1 94  ? -0.906  -7.709  1.340   1.00 0.00 ? 94  PHE A N    4  
ATOM 7952  C CA   . PHE A 1 94  ? -1.984  -8.591  0.909   1.00 0.00 ? 94  PHE A CA   4  
ATOM 7953  C C    . PHE A 1 94  ? -1.427  -9.890  0.334   1.00 0.00 ? 94  PHE A C    4  
ATOM 7954  O O    . PHE A 1 94  ? -0.678  -9.877  -0.642  1.00 0.00 ? 94  PHE A O    4  
ATOM 7955  C CB   . PHE A 1 94  ? -2.858  -7.891  -0.134  1.00 0.00 ? 94  PHE A CB   4  
ATOM 7956  C CG   . PHE A 1 94  ? -3.555  -6.669  0.391   1.00 0.00 ? 94  PHE A CG   4  
ATOM 7957  C CD1  . PHE A 1 94  ? -4.665  -6.786  1.212   1.00 0.00 ? 94  PHE A CD1  4  
ATOM 7958  C CD2  . PHE A 1 94  ? -3.100  -5.402  0.062   1.00 0.00 ? 94  PHE A CD2  4  
ATOM 7959  C CE1  . PHE A 1 94  ? -5.308  -5.663  1.697   1.00 0.00 ? 94  PHE A CE1  4  
ATOM 7960  C CE2  . PHE A 1 94  ? -3.739  -4.275  0.544   1.00 0.00 ? 94  PHE A CE2  4  
ATOM 7961  C CZ   . PHE A 1 94  ? -4.845  -4.405  1.362   1.00 0.00 ? 94  PHE A CZ   4  
ATOM 7962  H H    . PHE A 1 94  ? -0.314  -7.313  0.666   1.00 0.00 ? 94  PHE A H    4  
ATOM 7963  H HA   . PHE A 1 94  ? -2.586  -8.823  1.774   1.00 0.00 ? 94  PHE A HA   4  
ATOM 7964  H HB2  . PHE A 1 94  ? -2.241  -7.589  -0.966  1.00 0.00 ? 94  PHE A HB2  4  
ATOM 7965  H HB3  . PHE A 1 94  ? -3.612  -8.581  -0.482  1.00 0.00 ? 94  PHE A HB3  4  
ATOM 7966  H HD1  . PHE A 1 94  ? -5.028  -7.770  1.475   1.00 0.00 ? 94  PHE A HD1  4  
ATOM 7967  H HD2  . PHE A 1 94  ? -2.236  -5.297  -0.578  1.00 0.00 ? 94  PHE A HD2  4  
ATOM 7968  H HE1  . PHE A 1 94  ? -6.172  -5.769  2.336   1.00 0.00 ? 94  PHE A HE1  4  
ATOM 7969  H HE2  . PHE A 1 94  ? -3.376  -3.293  0.281   1.00 0.00 ? 94  PHE A HE2  4  
ATOM 7970  H HZ   . PHE A 1 94  ? -5.346  -3.527  1.740   1.00 0.00 ? 94  PHE A HZ   4  
ATOM 7971  N N    . GLN A 1 95  ? -1.799  -11.009 0.947   1.00 0.00 ? 95  GLN A N    4  
ATOM 7972  C CA   . GLN A 1 95  ? -1.336  -12.316 0.497   1.00 0.00 ? 95  GLN A CA   4  
ATOM 7973  C C    . GLN A 1 95  ? -2.509  -13.195 0.078   1.00 0.00 ? 95  GLN A C    4  
ATOM 7974  O O    . GLN A 1 95  ? -2.863  -14.148 0.771   1.00 0.00 ? 95  GLN A O    4  
ATOM 7975  C CB   . GLN A 1 95  ? -0.536  -13.006 1.604   1.00 0.00 ? 95  GLN A CB   4  
ATOM 7976  C CG   . GLN A 1 95  ? 0.907   -12.538 1.694   1.00 0.00 ? 95  GLN A CG   4  
ATOM 7977  C CD   . GLN A 1 95  ? 1.834   -13.325 0.789   1.00 0.00 ? 95  GLN A CD   4  
ATOM 7978  O OE1  . GLN A 1 95  ? 1.388   -14.005 -0.135  1.00 0.00 ? 95  GLN A OE1  4  
ATOM 7979  N NE2  . GLN A 1 95  ? 3.133   -13.238 1.052   1.00 0.00 ? 95  GLN A NE2  4  
ATOM 7980  H H    . GLN A 1 95  ? -2.398  -10.954 1.720   1.00 0.00 ? 95  GLN A H    4  
ATOM 7981  H HA   . GLN A 1 95  ? -0.693  -12.164 -0.357  1.00 0.00 ? 95  GLN A HA   4  
ATOM 7982  H HB2  . GLN A 1 95  ? -1.015  -12.813 2.552   1.00 0.00 ? 95  GLN A HB2  4  
ATOM 7983  H HB3  . GLN A 1 95  ? -0.535  -14.071 1.420   1.00 0.00 ? 95  GLN A HB3  4  
ATOM 7984  H HG2  . GLN A 1 95  ? 0.953   -11.496 1.411   1.00 0.00 ? 95  GLN A HG2  4  
ATOM 7985  H HG3  . GLN A 1 95  ? 1.244   -12.647 2.714   1.00 0.00 ? 95  GLN A HG3  4  
ATOM 7986  H HE21 . GLN A 1 95  ? 3.416   -12.678 1.806   1.00 0.00 ? 95  GLN A HE21 4  
ATOM 7987  H HE22 . GLN A 1 95  ? 3.755   -13.737 0.484   1.00 0.00 ? 95  GLN A HE22 4  
ATOM 7988  N N    . GLY A 1 96  ? -3.110  -12.868 -1.063  1.00 0.00 ? 96  GLY A N    4  
ATOM 7989  C CA   . GLY A 1 96  ? -4.238  -13.637 -1.554  1.00 0.00 ? 96  GLY A CA   4  
ATOM 7990  C C    . GLY A 1 96  ? -5.558  -12.916 -1.364  1.00 0.00 ? 96  GLY A C    4  
ATOM 7991  O O    . GLY A 1 96  ? -6.609  -13.548 -1.261  1.00 0.00 ? 96  GLY A O    4  
ATOM 7992  H H    . GLY A 1 96  ? -2.784  -12.097 -1.574  1.00 0.00 ? 96  GLY A H    4  
ATOM 7993  H HA2  . GLY A 1 96  ? -4.095  -13.833 -2.606  1.00 0.00 ? 96  GLY A HA2  4  
ATOM 7994  H HA3  . GLY A 1 96  ? -4.275  -14.578 -1.025  1.00 0.00 ? 96  GLY A HA3  4  
ATOM 7995  N N    . GLY A 1 97  ? -5.505  -11.589 -1.315  1.00 0.00 ? 97  GLY A N    4  
ATOM 7996  C CA   . GLY A 1 97  ? -6.712  -10.804 -1.133  1.00 0.00 ? 97  GLY A CA   4  
ATOM 7997  C C    . GLY A 1 97  ? -7.015  -10.536 0.327   1.00 0.00 ? 97  GLY A C    4  
ATOM 7998  O O    . GLY A 1 97  ? -7.871  -9.712  0.651   1.00 0.00 ? 97  GLY A O    4  
ATOM 7999  H H    . GLY A 1 97  ? -4.638  -11.139 -1.402  1.00 0.00 ? 97  GLY A H    4  
ATOM 8000  H HA2  . GLY A 1 97  ? -6.595  -9.860  -1.645  1.00 0.00 ? 97  GLY A HA2  4  
ATOM 8001  H HA3  . GLY A 1 97  ? -7.543  -11.338 -1.569  1.00 0.00 ? 97  GLY A HA3  4  
ATOM 8002  N N    . LYS A 1 98  ? -6.313  -11.234 1.214   1.00 0.00 ? 98  LYS A N    4  
ATOM 8003  C CA   . LYS A 1 98  ? -6.510  -11.068 2.649   1.00 0.00 ? 98  LYS A CA   4  
ATOM 8004  C C    . LYS A 1 98  ? -5.433  -10.168 3.246   1.00 0.00 ? 98  LYS A C    4  
ATOM 8005  O O    . LYS A 1 98  ? -4.262  -10.261 2.881   1.00 0.00 ? 98  LYS A O    4  
ATOM 8006  C CB   . LYS A 1 98  ? -6.497  -12.430 3.347   1.00 0.00 ? 98  LYS A CB   4  
ATOM 8007  C CG   . LYS A 1 98  ? -7.794  -13.205 3.193   1.00 0.00 ? 98  LYS A CG   4  
ATOM 8008  C CD   . LYS A 1 98  ? -7.781  -14.072 1.946   1.00 0.00 ? 98  LYS A CD   4  
ATOM 8009  C CE   . LYS A 1 98  ? -9.045  -14.912 1.837   1.00 0.00 ? 98  LYS A CE   4  
ATOM 8010  N NZ   . LYS A 1 98  ? -9.137  -15.918 2.932   1.00 0.00 ? 98  LYS A NZ   4  
ATOM 8011  H H    . LYS A 1 98  ? -5.644  -11.876 0.894   1.00 0.00 ? 98  LYS A H    4  
ATOM 8012  H HA   . LYS A 1 98  ? -7.474  -10.605 2.800   1.00 0.00 ? 98  LYS A HA   4  
ATOM 8013  H HB2  . LYS A 1 98  ? -5.695  -13.025 2.934   1.00 0.00 ? 98  LYS A HB2  4  
ATOM 8014  H HB3  . LYS A 1 98  ? -6.315  -12.279 4.401   1.00 0.00 ? 98  LYS A HB3  4  
ATOM 8015  H HG2  . LYS A 1 98  ? -7.929  -13.838 4.057   1.00 0.00 ? 98  LYS A HG2  4  
ATOM 8016  H HG3  . LYS A 1 98  ? -8.615  -12.505 3.126   1.00 0.00 ? 98  LYS A HG3  4  
ATOM 8017  H HD2  . LYS A 1 98  ? -7.710  -13.436 1.076   1.00 0.00 ? 98  LYS A HD2  4  
ATOM 8018  H HD3  . LYS A 1 98  ? -6.924  -14.730 1.984   1.00 0.00 ? 98  LYS A HD3  4  
ATOM 8019  H HE2  . LYS A 1 98  ? -9.901  -14.258 1.888   1.00 0.00 ? 98  LYS A HE2  4  
ATOM 8020  H HE3  . LYS A 1 98  ? -9.039  -15.426 0.887   1.00 0.00 ? 98  LYS A HE3  4  
ATOM 8021  H HZ1  . LYS A 1 98  ? -9.565  -15.488 3.776   1.00 0.00 ? 98  LYS A HZ1  4  
ATOM 8022  H HZ2  . LYS A 1 98  ? -8.189  -16.267 3.177   1.00 0.00 ? 98  LYS A HZ2  4  
ATOM 8023  H HZ3  . LYS A 1 98  ? -9.723  -16.722 2.630   1.00 0.00 ? 98  LYS A HZ3  4  
ATOM 8024  N N    . GLU A 1 99  ? -5.838  -9.299  4.167   1.00 0.00 ? 99  GLU A N    4  
ATOM 8025  C CA   . GLU A 1 99  ? -4.906  -8.384  4.814   1.00 0.00 ? 99  GLU A CA   4  
ATOM 8026  C C    . GLU A 1 99  ? -3.968  -9.136  5.753   1.00 0.00 ? 99  GLU A C    4  
ATOM 8027  O O    . GLU A 1 99  ? -4.258  -9.299  6.938   1.00 0.00 ? 99  GLU A O    4  
ATOM 8028  C CB   . GLU A 1 99  ? -5.669  -7.309  5.591   1.00 0.00 ? 99  GLU A CB   4  
ATOM 8029  C CG   . GLU A 1 99  ? -4.803  -6.134  6.014   1.00 0.00 ? 99  GLU A CG   4  
ATOM 8030  C CD   . GLU A 1 99  ? -5.386  -5.373  7.189   1.00 0.00 ? 99  GLU A CD   4  
ATOM 8031  O OE1  . GLU A 1 99  ? -5.461  -5.953  8.293   1.00 0.00 ? 99  GLU A OE1  4  
ATOM 8032  O OE2  . GLU A 1 99  ? -5.767  -4.198  7.006   1.00 0.00 ? 99  GLU A OE2  4  
ATOM 8033  H H    . GLU A 1 99  ? -6.785  -9.272  4.416   1.00 0.00 ? 99  GLU A H    4  
ATOM 8034  H HA   . GLU A 1 99  ? -4.318  -7.908  4.043   1.00 0.00 ? 99  GLU A HA   4  
ATOM 8035  H HB2  . GLU A 1 99  ? -6.471  -6.935  4.972   1.00 0.00 ? 99  GLU A HB2  4  
ATOM 8036  H HB3  . GLU A 1 99  ? -6.091  -7.756  6.479   1.00 0.00 ? 99  GLU A HB3  4  
ATOM 8037  H HG2  . GLU A 1 99  ? -3.828  -6.503  6.293   1.00 0.00 ? 99  GLU A HG2  4  
ATOM 8038  H HG3  . GLU A 1 99  ? -4.705  -5.456  5.179   1.00 0.00 ? 99  GLU A HG3  4  
ATOM 8039  N N    . ALA A 1 100 ? -2.842  -9.594  5.215   1.00 0.00 ? 100 ALA A N    4  
ATOM 8040  C CA   . ALA A 1 100 ? -1.861  -10.328 6.004   1.00 0.00 ? 100 ALA A CA   4  
ATOM 8041  C C    . ALA A 1 100 ? -1.411  -9.516  7.213   1.00 0.00 ? 100 ALA A C    4  
ATOM 8042  O O    . ALA A 1 100 ? -1.264  -10.051 8.312   1.00 0.00 ? 100 ALA A O    4  
ATOM 8043  C CB   . ALA A 1 100 ? -0.664  -10.702 5.142   1.00 0.00 ? 100 ALA A CB   4  
ATOM 8044  H H    . ALA A 1 100 ? -2.668  -9.433  4.264   1.00 0.00 ? 100 ALA A H    4  
ATOM 8045  H HA   . ALA A 1 100 ? -2.325  -11.241 6.348   1.00 0.00 ? 100 ALA A HA   4  
ATOM 8046  H HB1  . ALA A 1 100 ? 0.235   -10.662 5.739   1.00 0.00 ? 100 ALA A HB1  4  
ATOM 8047  H HB2  . ALA A 1 100 ? -0.797  -11.702 4.757   1.00 0.00 ? 100 ALA A HB2  4  
ATOM 8048  H HB3  . ALA A 1 100 ? -0.582  -10.007 4.320   1.00 0.00 ? 100 ALA A HB3  4  
ATOM 8049  N N    . MET A 1 101 ? -1.193  -8.222  7.004   1.00 0.00 ? 101 MET A N    4  
ATOM 8050  C CA   . MET A 1 101 ? -0.760  -7.336  8.079   1.00 0.00 ? 101 MET A CA   4  
ATOM 8051  C C    . MET A 1 101 ? -0.876  -5.875  7.658   1.00 0.00 ? 101 MET A C    4  
ATOM 8052  O O    . MET A 1 101 ? -1.160  -5.573  6.499   1.00 0.00 ? 101 MET A O    4  
ATOM 8053  C CB   . MET A 1 101 ? 0.683   -7.652  8.478   1.00 0.00 ? 101 MET A CB   4  
ATOM 8054  C CG   . MET A 1 101 ? 1.719   -6.910  7.650   1.00 0.00 ? 101 MET A CG   4  
ATOM 8055  S SD   . MET A 1 101 ? 2.165   -5.315  8.362   1.00 0.00 ? 101 MET A SD   4  
ATOM 8056  C CE   . MET A 1 101 ? 3.896   -5.583  8.734   1.00 0.00 ? 101 MET A CE   4  
ATOM 8057  H H    . MET A 1 101 ? -1.328  -7.853  6.106   1.00 0.00 ? 101 MET A H    4  
ATOM 8058  H HA   . MET A 1 101 ? -1.405  -7.507  8.928   1.00 0.00 ? 101 MET A HA   4  
ATOM 8059  H HB2  . MET A 1 101 ? 0.823   -7.385  9.515   1.00 0.00 ? 101 MET A HB2  4  
ATOM 8060  H HB3  . MET A 1 101 ? 0.852   -8.712  8.362   1.00 0.00 ? 101 MET A HB3  4  
ATOM 8061  H HG2  . MET A 1 101 ? 2.608   -7.518  7.580   1.00 0.00 ? 101 MET A HG2  4  
ATOM 8062  H HG3  . MET A 1 101 ? 1.318   -6.748  6.660   1.00 0.00 ? 101 MET A HG3  4  
ATOM 8063  H HE1  . MET A 1 101 ? 4.384   -6.027  7.879   1.00 0.00 ? 101 MET A HE1  4  
ATOM 8064  H HE2  . MET A 1 101 ? 4.365   -4.638  8.965   1.00 0.00 ? 101 MET A HE2  4  
ATOM 8065  H HE3  . MET A 1 101 ? 3.983   -6.246  9.583   1.00 0.00 ? 101 MET A HE3  4  
ATOM 8066  N N    . ARG A 1 102 ? -0.654  -4.971  8.608   1.00 0.00 ? 102 ARG A N    4  
ATOM 8067  C CA   . ARG A 1 102 ? -0.735  -3.541  8.336   1.00 0.00 ? 102 ARG A CA   4  
ATOM 8068  C C    . ARG A 1 102 ? -0.002  -2.742  9.408   1.00 0.00 ? 102 ARG A C    4  
ATOM 8069  O O    . ARG A 1 102 ? -0.082  -3.057  10.596  1.00 0.00 ? 102 ARG A O    4  
ATOM 8070  C CB   . ARG A 1 102 ? -2.197  -3.096  8.262   1.00 0.00 ? 102 ARG A CB   4  
ATOM 8071  C CG   . ARG A 1 102 ? -2.830  -2.859  9.624   1.00 0.00 ? 102 ARG A CG   4  
ATOM 8072  C CD   . ARG A 1 102 ? -2.667  -1.415  10.070  1.00 0.00 ? 102 ARG A CD   4  
ATOM 8073  N NE   . ARG A 1 102 ? -3.405  -0.490  9.213   1.00 0.00 ? 102 ARG A NE   4  
ATOM 8074  C CZ   . ARG A 1 102 ? -4.727  -0.360  9.240   1.00 0.00 ? 102 ARG A CZ   4  
ATOM 8075  N NH1  . ARG A 1 102 ? -5.451  -1.089  10.076  1.00 0.00 ? 102 ARG A NH1  4  
ATOM 8076  N NH2  . ARG A 1 102 ? -5.326  0.503   8.429   1.00 0.00 ? 102 ARG A NH2  4  
ATOM 8077  H H    . ARG A 1 102 ? -0.432  -5.274  9.513   1.00 0.00 ? 102 ARG A H    4  
ATOM 8078  H HA   . ARG A 1 102 ? -0.264  -3.358  7.382   1.00 0.00 ? 102 ARG A HA   4  
ATOM 8079  H HB2  . ARG A 1 102 ? -2.254  -2.177  7.699   1.00 0.00 ? 102 ARG A HB2  4  
ATOM 8080  H HB3  . ARG A 1 102 ? -2.767  -3.858  7.752   1.00 0.00 ? 102 ARG A HB3  4  
ATOM 8081  H HG2  . ARG A 1 102 ? -3.884  -3.089  9.565   1.00 0.00 ? 102 ARG A HG2  4  
ATOM 8082  H HG3  . ARG A 1 102 ? -2.358  -3.506  10.348  1.00 0.00 ? 102 ARG A HG3  4  
ATOM 8083  H HD2  . ARG A 1 102 ? -3.032  -1.321  11.082  1.00 0.00 ? 102 ARG A HD2  4  
ATOM 8084  H HD3  . ARG A 1 102 ? -1.618  -1.159  10.040  1.00 0.00 ? 102 ARG A HD3  4  
ATOM 8085  H HE   . ARG A 1 102 ? -2.889  0.059   8.587   1.00 0.00 ? 102 ARG A HE   4  
ATOM 8086  H HH11 . ARG A 1 102 ? -5.003  -1.739  10.689  1.00 0.00 ? 102 ARG A HH11 4  
ATOM 8087  H HH12 . ARG A 1 102 ? -6.446  -0.988  10.095  1.00 0.00 ? 102 ARG A HH12 4  
ATOM 8088  H HH21 . ARG A 1 102 ? -4.782  1.055   7.797   1.00 0.00 ? 102 ARG A HH21 4  
ATOM 8089  H HH22 . ARG A 1 102 ? -6.320  0.601   8.450   1.00 0.00 ? 102 ARG A HH22 4  
ATOM 8090  N N    . ARG A 1 103 ? 0.713   -1.706  8.982   1.00 0.00 ? 103 ARG A N    4  
ATOM 8091  C CA   . ARG A 1 103 ? 1.462   -0.862  9.905   1.00 0.00 ? 103 ARG A CA   4  
ATOM 8092  C C    . ARG A 1 103 ? 1.194   0.615   9.632   1.00 0.00 ? 103 ARG A C    4  
ATOM 8093  O O    . ARG A 1 103 ? 1.038   1.042   8.487   1.00 0.00 ? 103 ARG A O    4  
ATOM 8094  C CB   . ARG A 1 103 ? 2.960   -1.149  9.791   1.00 0.00 ? 103 ARG A CB   4  
ATOM 8095  C CG   . ARG A 1 103 ? 3.360   -2.517  10.318  1.00 0.00 ? 103 ARG A CG   4  
ATOM 8096  C CD   . ARG A 1 103 ? 3.535   -2.503  11.828  1.00 0.00 ? 103 ARG A CD   4  
ATOM 8097  N NE   . ARG A 1 103 ? 3.493   -3.848  12.397  1.00 0.00 ? 103 ARG A NE   4  
ATOM 8098  C CZ   . ARG A 1 103 ? 3.315   -4.094  13.690  1.00 0.00 ? 103 ARG A CZ   4  
ATOM 8099  N NH1  . ARG A 1 103 ? 3.163   -3.091  14.544  1.00 0.00 ? 103 ARG A NH1  4  
ATOM 8100  N NH2  . ARG A 1 103 ? 3.288   -5.345  14.131  1.00 0.00 ? 103 ARG A NH2  4  
ATOM 8101  H H    . ARG A 1 103 ? 0.738   -1.504  8.023   1.00 0.00 ? 103 ARG A H    4  
ATOM 8102  H HA   . ARG A 1 103 ? 1.135   -1.095  10.907  1.00 0.00 ? 103 ARG A HA   4  
ATOM 8103  H HB2  . ARG A 1 103 ? 3.248   -1.089  8.752   1.00 0.00 ? 103 ARG A HB2  4  
ATOM 8104  H HB3  . ARG A 1 103 ? 3.501   -0.400  10.349  1.00 0.00 ? 103 ARG A HB3  4  
ATOM 8105  H HG2  . ARG A 1 103 ? 2.591   -3.230  10.062  1.00 0.00 ? 103 ARG A HG2  4  
ATOM 8106  H HG3  . ARG A 1 103 ? 4.293   -2.810  9.859   1.00 0.00 ? 103 ARG A HG3  4  
ATOM 8107  H HD2  . ARG A 1 103 ? 4.489   -2.053  12.063  1.00 0.00 ? 103 ARG A HD2  4  
ATOM 8108  H HD3  . ARG A 1 103 ? 2.743   -1.913  12.263  1.00 0.00 ? 103 ARG A HD3  4  
ATOM 8109  H HE   . ARG A 1 103 ? 3.603   -4.603  11.783  1.00 0.00 ? 103 ARG A HE   4  
ATOM 8110  H HH11 . ARG A 1 103 ? 3.181   -2.147  14.214  1.00 0.00 ? 103 ARG A HH11 4  
ATOM 8111  H HH12 . ARG A 1 103 ? 3.027   -3.279  15.517  1.00 0.00 ? 103 ARG A HH12 4  
ATOM 8112  H HH21 . ARG A 1 103 ? 3.402   -6.103  13.490  1.00 0.00 ? 103 ARG A HH21 4  
ATOM 8113  H HH22 . ARG A 1 103 ? 3.154   -5.529  15.104  1.00 0.00 ? 103 ARG A HH22 4  
ATOM 8114  N N    . PRO A 1 104 ? 1.137   1.416   10.706  1.00 0.00 ? 104 PRO A N    4  
ATOM 8115  C CA   . PRO A 1 104 ? 1.319   0.919   12.074  1.00 0.00 ? 104 PRO A CA   4  
ATOM 8116  C C    . PRO A 1 104 ? 0.153   0.052   12.536  1.00 0.00 ? 104 PRO A C    4  
ATOM 8117  O O    . PRO A 1 104 ? -1.000  0.317   12.199  1.00 0.00 ? 104 PRO A O    4  
ATOM 8118  C CB   . PRO A 1 104 ? 1.397   2.200   12.909  1.00 0.00 ? 104 PRO A CB   4  
ATOM 8119  C CG   . PRO A 1 104 ? 0.653   3.216   12.113  1.00 0.00 ? 104 PRO A CG   4  
ATOM 8120  C CD   . PRO A 1 104 ? 0.889   2.867   10.670  1.00 0.00 ? 104 PRO A CD   4  
ATOM 8121  H HA   . PRO A 1 104 ? 2.241   0.365   12.175  1.00 0.00 ? 104 PRO A HA   4  
ATOM 8122  H HB2  . PRO A 1 104 ? 0.934   2.034   13.871  1.00 0.00 ? 104 PRO A HB2  4  
ATOM 8123  H HB3  . PRO A 1 104 ? 2.430   2.483   13.044  1.00 0.00 ? 104 PRO A HB3  4  
ATOM 8124  H HG2  . PRO A 1 104 ? -0.400  3.165   12.344  1.00 0.00 ? 104 PRO A HG2  4  
ATOM 8125  H HG3  . PRO A 1 104 ? 1.038   4.203   12.327  1.00 0.00 ? 104 PRO A HG3  4  
ATOM 8126  H HD2  . PRO A 1 104 ? 0.015   3.094   10.079  1.00 0.00 ? 104 PRO A HD2  4  
ATOM 8127  H HD3  . PRO A 1 104 ? 1.751   3.395   10.290  1.00 0.00 ? 104 PRO A HD3  4  
ATOM 8128  N N    . GLN A 1 105 ? 0.463   -0.984  13.310  1.00 0.00 ? 105 GLN A N    4  
ATOM 8129  C CA   . GLN A 1 105 ? -0.561  -1.890  13.818  1.00 0.00 ? 105 GLN A CA   4  
ATOM 8130  C C    . GLN A 1 105 ? -1.397  -1.214  14.900  1.00 0.00 ? 105 GLN A C    4  
ATOM 8131  O O    . GLN A 1 105 ? -0.869  -0.484  15.740  1.00 0.00 ? 105 GLN A O    4  
ATOM 8132  C CB   . GLN A 1 105 ? 0.084   -3.161  14.373  1.00 0.00 ? 105 GLN A CB   4  
ATOM 8133  C CG   . GLN A 1 105 ? -0.863  -4.349  14.427  1.00 0.00 ? 105 GLN A CG   4  
ATOM 8134  C CD   . GLN A 1 105 ? -0.317  -5.493  15.258  1.00 0.00 ? 105 GLN A CD   4  
ATOM 8135  O OE1  . GLN A 1 105 ? -0.134  -6.605  14.760  1.00 0.00 ? 105 GLN A OE1  4  
ATOM 8136  N NE2  . GLN A 1 105 ? -0.052  -5.227  16.532  1.00 0.00 ? 105 GLN A NE2  4  
ATOM 8137  H H    . GLN A 1 105 ? 1.400   -1.142  13.544  1.00 0.00 ? 105 GLN A H    4  
ATOM 8138  H HA   . GLN A 1 105 ? -1.207  -2.154  12.994  1.00 0.00 ? 105 GLN A HA   4  
ATOM 8139  H HB2  . GLN A 1 105 ? 0.924   -3.426  13.749  1.00 0.00 ? 105 GLN A HB2  4  
ATOM 8140  H HB3  . GLN A 1 105 ? 0.436   -2.963  15.374  1.00 0.00 ? 105 GLN A HB3  4  
ATOM 8141  H HG2  . GLN A 1 105 ? -1.800  -4.027  14.859  1.00 0.00 ? 105 GLN A HG2  4  
ATOM 8142  H HG3  . GLN A 1 105 ? -1.035  -4.703  13.422  1.00 0.00 ? 105 GLN A HG3  4  
ATOM 8143  H HE21 . GLN A 1 105 ? -0.224  -4.319  16.860  1.00 0.00 ? 105 GLN A HE21 4  
ATOM 8144  H HE22 . GLN A 1 105 ? 0.302   -5.948  17.092  1.00 0.00 ? 105 GLN A HE22 4  
ATOM 8145  N N    . ILE A 1 106 ? -2.702  -1.463  14.874  1.00 0.00 ? 106 ILE A N    4  
ATOM 8146  C CA   . ILE A 1 106 ? -3.610  -0.880  15.854  1.00 0.00 ? 106 ILE A CA   4  
ATOM 8147  C C    . ILE A 1 106 ? -3.803  -1.810  17.046  1.00 0.00 ? 106 ILE A C    4  
ATOM 8148  O O    . ILE A 1 106 ? -3.972  -3.018  16.883  1.00 0.00 ? 106 ILE A O    4  
ATOM 8149  C CB   . ILE A 1 106 ? -4.984  -0.568  15.232  1.00 0.00 ? 106 ILE A CB   4  
ATOM 8150  C CG1  . ILE A 1 106 ? -4.812  0.207   13.924  1.00 0.00 ? 106 ILE A CG1  4  
ATOM 8151  C CG2  . ILE A 1 106 ? -5.842  0.218   16.212  1.00 0.00 ? 106 ILE A CG2  4  
ATOM 8152  C CD1  . ILE A 1 106 ? -4.231  1.591   14.114  1.00 0.00 ? 106 ILE A CD1  4  
ATOM 8153  H H    . ILE A 1 106 ? -3.062  -2.053  14.180  1.00 0.00 ? 106 ILE A H    4  
ATOM 8154  H HA   . ILE A 1 106 ? -3.175  0.047   16.200  1.00 0.00 ? 106 ILE A HA   4  
ATOM 8155  H HB   . ILE A 1 106 ? -5.481  -1.503  15.025  1.00 0.00 ? 106 ILE A HB   4  
ATOM 8156  H HG12 . ILE A 1 106 ? -4.153  -0.342  13.271  1.00 0.00 ? 106 ILE A HG12 4  
ATOM 8157  H HG13 . ILE A 1 106 ? -5.777  0.314   13.449  1.00 0.00 ? 106 ILE A HG13 4  
ATOM 8158  H HG21 . ILE A 1 106 ? -6.423  0.952   15.672  1.00 0.00 ? 106 ILE A HG21 4  
ATOM 8159  H HG22 . ILE A 1 106 ? -6.507  -0.457  16.729  1.00 0.00 ? 106 ILE A HG22 4  
ATOM 8160  H HG23 . ILE A 1 106 ? -5.207  0.718   16.927  1.00 0.00 ? 106 ILE A HG23 4  
ATOM 8161  H HD11 . ILE A 1 106 ? -4.633  2.257   13.364  1.00 0.00 ? 106 ILE A HD11 4  
ATOM 8162  H HD12 . ILE A 1 106 ? -4.485  1.957   15.096  1.00 0.00 ? 106 ILE A HD12 4  
ATOM 8163  H HD13 . ILE A 1 106 ? -3.156  1.546   14.014  1.00 0.00 ? 106 ILE A HD13 4  
ATOM 8164  N N    . ASP A 1 107 ? -3.779  -1.238  18.245  1.00 0.00 ? 107 ASP A N    4  
ATOM 8165  C CA   . ASP A 1 107 ? -3.954  -2.015  19.467  1.00 0.00 ? 107 ASP A CA   4  
ATOM 8166  C C    . ASP A 1 107 ? -5.432  -2.137  19.826  1.00 0.00 ? 107 ASP A C    4  
ATOM 8167  O O    . ASP A 1 107 ? -6.302  -1.676  19.087  1.00 0.00 ? 107 ASP A O    4  
ATOM 8168  C CB   . ASP A 1 107 ? -3.187  -1.370  20.622  1.00 0.00 ? 107 ASP A CB   4  
ATOM 8169  C CG   . ASP A 1 107 ? -2.773  -2.378  21.676  1.00 0.00 ? 107 ASP A CG   4  
ATOM 8170  O OD1  . ASP A 1 107 ? -1.814  -3.137  21.426  1.00 0.00 ? 107 ASP A OD1  4  
ATOM 8171  O OD2  . ASP A 1 107 ? -3.408  -2.407  22.751  1.00 0.00 ? 107 ASP A OD2  4  
ATOM 8172  H H    . ASP A 1 107 ? -3.640  -0.270  18.310  1.00 0.00 ? 107 ASP A H    4  
ATOM 8173  H HA   . ASP A 1 107 ? -3.557  -3.004  19.291  1.00 0.00 ? 107 ASP A HA   4  
ATOM 8174  H HB2  . ASP A 1 107 ? -2.297  -0.896  20.234  1.00 0.00 ? 107 ASP A HB2  4  
ATOM 8175  H HB3  . ASP A 1 107 ? -3.813  -0.624  21.089  1.00 0.00 ? 107 ASP A HB3  4  
ATOM 8176  N N    . LYS A 1 108 ? -5.709  -2.761  20.966  1.00 0.00 ? 108 LYS A N    4  
ATOM 8177  C CA   . LYS A 1 108 ? -7.081  -2.944  21.424  1.00 0.00 ? 108 LYS A CA   4  
ATOM 8178  C C    . LYS A 1 108 ? -7.772  -1.599  21.624  1.00 0.00 ? 108 LYS A C    4  
ATOM 8179  O O    . LYS A 1 108 ? -8.982  -1.476  21.433  1.00 0.00 ? 108 LYS A O    4  
ATOM 8180  C CB   . LYS A 1 108 ? -7.101  -3.738  22.732  1.00 0.00 ? 108 LYS A CB   4  
ATOM 8181  C CG   . LYS A 1 108 ? -6.844  -5.224  22.545  1.00 0.00 ? 108 LYS A CG   4  
ATOM 8182  C CD   . LYS A 1 108 ? -6.291  -5.857  23.811  1.00 0.00 ? 108 LYS A CD   4  
ATOM 8183  C CE   . LYS A 1 108 ? -7.328  -5.879  24.923  1.00 0.00 ? 108 LYS A CE   4  
ATOM 8184  N NZ   . LYS A 1 108 ? -8.431  -6.836  24.634  1.00 0.00 ? 108 LYS A NZ   4  
ATOM 8185  H H    . LYS A 1 108 ? -4.972  -3.107  21.512  1.00 0.00 ? 108 LYS A H    4  
ATOM 8186  H HA   . LYS A 1 108 ? -7.613  -3.500  20.667  1.00 0.00 ? 108 LYS A HA   4  
ATOM 8187  H HB2  . LYS A 1 108 ? -6.343  -3.343  23.392  1.00 0.00 ? 108 LYS A HB2  4  
ATOM 8188  H HB3  . LYS A 1 108 ? -8.069  -3.618  23.197  1.00 0.00 ? 108 LYS A HB3  4  
ATOM 8189  H HG2  . LYS A 1 108 ? -7.773  -5.711  22.288  1.00 0.00 ? 108 LYS A HG2  4  
ATOM 8190  H HG3  . LYS A 1 108 ? -6.131  -5.358  21.745  1.00 0.00 ? 108 LYS A HG3  4  
ATOM 8191  H HD2  . LYS A 1 108 ? -5.991  -6.872  23.594  1.00 0.00 ? 108 LYS A HD2  4  
ATOM 8192  H HD3  . LYS A 1 108 ? -5.433  -5.289  24.142  1.00 0.00 ? 108 LYS A HD3  4  
ATOM 8193  H HE2  . LYS A 1 108 ? -6.844  -6.168  25.843  1.00 0.00 ? 108 LYS A HE2  4  
ATOM 8194  H HE3  . LYS A 1 108 ? -7.742  -4.887  25.030  1.00 0.00 ? 108 LYS A HE3  4  
ATOM 8195  H HZ1  . LYS A 1 108 ? -8.289  -7.717  25.170  1.00 0.00 ? 108 LYS A HZ1  4  
ATOM 8196  H HZ2  . LYS A 1 108 ? -8.452  -7.061  23.619  1.00 0.00 ? 108 LYS A HZ2  4  
ATOM 8197  H HZ3  . LYS A 1 108 ? -9.345  -6.422  24.905  1.00 0.00 ? 108 LYS A HZ3  4  
ATOM 8198  N N    . LYS A 1 109 ? -6.995  -0.591  22.007  1.00 0.00 ? 109 LYS A N    4  
ATOM 8199  C CA   . LYS A 1 109 ? -7.531  0.747   22.230  1.00 0.00 ? 109 LYS A CA   4  
ATOM 8200  C C    . LYS A 1 109 ? -7.553  1.547   20.931  1.00 0.00 ? 109 LYS A C    4  
ATOM 8201  O O    . LYS A 1 109 ? -7.344  2.759   20.934  1.00 0.00 ? 109 LYS A O    4  
ATOM 8202  C CB   . LYS A 1 109 ? -6.698  1.483   23.281  1.00 0.00 ? 109 LYS A CB   4  
ATOM 8203  C CG   . LYS A 1 109 ? -7.075  1.132   24.710  1.00 0.00 ? 109 LYS A CG   4  
ATOM 8204  C CD   . LYS A 1 109 ? -8.254  1.958   25.195  1.00 0.00 ? 109 LYS A CD   4  
ATOM 8205  C CE   . LYS A 1 109 ? -7.800  3.280   25.795  1.00 0.00 ? 109 LYS A CE   4  
ATOM 8206  N NZ   . LYS A 1 109 ? -8.948  4.188   26.071  1.00 0.00 ? 109 LYS A NZ   4  
ATOM 8207  H H    . LYS A 1 109 ? -6.037  -0.751  22.143  1.00 0.00 ? 109 LYS A H    4  
ATOM 8208  H HA   . LYS A 1 109 ? -8.543  0.643   22.591  1.00 0.00 ? 109 LYS A HA   4  
ATOM 8209  H HB2  . LYS A 1 109 ? -5.657  1.239   23.135  1.00 0.00 ? 109 LYS A HB2  4  
ATOM 8210  H HB3  . LYS A 1 109 ? -6.831  2.547   23.147  1.00 0.00 ? 109 LYS A HB3  4  
ATOM 8211  H HG2  . LYS A 1 109 ? -7.338  0.086   24.757  1.00 0.00 ? 109 LYS A HG2  4  
ATOM 8212  H HG3  . LYS A 1 109 ? -6.226  1.320   25.353  1.00 0.00 ? 109 LYS A HG3  4  
ATOM 8213  H HD2  . LYS A 1 109 ? -8.908  2.161   24.360  1.00 0.00 ? 109 LYS A HD2  4  
ATOM 8214  H HD3  . LYS A 1 109 ? -8.791  1.397   25.947  1.00 0.00 ? 109 LYS A HD3  4  
ATOM 8215  H HE2  . LYS A 1 109 ? -7.280  3.081   26.720  1.00 0.00 ? 109 LYS A HE2  4  
ATOM 8216  H HE3  . LYS A 1 109 ? -7.128  3.763   25.101  1.00 0.00 ? 109 LYS A HE3  4  
ATOM 8217  H HZ1  . LYS A 1 109 ? -9.776  3.895   25.514  1.00 0.00 ? 109 LYS A HZ1  4  
ATOM 8218  H HZ2  . LYS A 1 109 ? -8.700  5.165   25.816  1.00 0.00 ? 109 LYS A HZ2  4  
ATOM 8219  H HZ3  . LYS A 1 109 ? -9.194  4.156   27.081  1.00 0.00 ? 109 LYS A HZ3  4  
ATOM 8220  N N    . GLY A 1 110 ? -7.808  0.860   19.822  1.00 0.00 ? 110 GLY A N    4  
ATOM 8221  C CA   . GLY A 1 110 ? -7.854  1.524   18.532  1.00 0.00 ? 110 GLY A CA   4  
ATOM 8222  C C    . GLY A 1 110 ? -6.812  2.618   18.406  1.00 0.00 ? 110 GLY A C    4  
ATOM 8223  O O    . GLY A 1 110 ? -7.108  3.714   17.929  1.00 0.00 ? 110 GLY A O    4  
ATOM 8224  H H    . GLY A 1 110 ? -7.967  -0.105  19.879  1.00 0.00 ? 110 GLY A H    4  
ATOM 8225  H HA2  . GLY A 1 110 ? -7.688  0.792   17.756  1.00 0.00 ? 110 GLY A HA2  4  
ATOM 8226  H HA3  . GLY A 1 110 ? -8.834  1.959   18.398  1.00 0.00 ? 110 GLY A HA3  4  
ATOM 8227  N N    . ARG A 1 111 ? -5.590  2.322   18.836  1.00 0.00 ? 111 ARG A N    4  
ATOM 8228  C CA   . ARG A 1 111 ? -4.502  3.290   18.772  1.00 0.00 ? 111 ARG A CA   4  
ATOM 8229  C C    . ARG A 1 111 ? -3.379  2.786   17.869  1.00 0.00 ? 111 ARG A C    4  
ATOM 8230  O O    . ARG A 1 111 ? -3.109  1.587   17.808  1.00 0.00 ? 111 ARG A O    4  
ATOM 8231  C CB   . ARG A 1 111 ? -3.957  3.571   20.173  1.00 0.00 ? 111 ARG A CB   4  
ATOM 8232  C CG   . ARG A 1 111 ? -3.181  2.409   20.769  1.00 0.00 ? 111 ARG A CG   4  
ATOM 8233  C CD   . ARG A 1 111 ? -2.219  2.877   21.850  1.00 0.00 ? 111 ARG A CD   4  
ATOM 8234  N NE   . ARG A 1 111 ? -2.859  2.944   23.161  1.00 0.00 ? 111 ARG A NE   4  
ATOM 8235  C CZ   . ARG A 1 111 ? -2.250  3.387   24.255  1.00 0.00 ? 111 ARG A CZ   4  
ATOM 8236  N NH1  . ARG A 1 111 ? -0.991  3.801   24.195  1.00 0.00 ? 111 ARG A NH1  4  
ATOM 8237  N NH2  . ARG A 1 111 ? -2.899  3.418   25.412  1.00 0.00 ? 111 ARG A NH2  4  
ATOM 8238  H H    . ARG A 1 111 ? -5.416  1.431   19.207  1.00 0.00 ? 111 ARG A H    4  
ATOM 8239  H HA   . ARG A 1 111 ? -4.897  4.206   18.358  1.00 0.00 ? 111 ARG A HA   4  
ATOM 8240  H HB2  . ARG A 1 111 ? -3.301  4.428   20.127  1.00 0.00 ? 111 ARG A HB2  4  
ATOM 8241  H HB3  . ARG A 1 111 ? -4.785  3.797   20.829  1.00 0.00 ? 111 ARG A HB3  4  
ATOM 8242  H HG2  . ARG A 1 111 ? -3.877  1.707   21.203  1.00 0.00 ? 111 ARG A HG2  4  
ATOM 8243  H HG3  . ARG A 1 111 ? -2.619  1.924   19.985  1.00 0.00 ? 111 ARG A HG3  4  
ATOM 8244  H HD2  . ARG A 1 111 ? -1.390  2.187   21.900  1.00 0.00 ? 111 ARG A HD2  4  
ATOM 8245  H HD3  . ARG A 1 111 ? -1.854  3.859   21.587  1.00 0.00 ? 111 ARG A HD3  4  
ATOM 8246  H HE   . ARG A 1 111 ? -3.789  2.643   23.228  1.00 0.00 ? 111 ARG A HE   4  
ATOM 8247  H HH11 . ARG A 1 111 ? -0.500  3.780   23.325  1.00 0.00 ? 111 ARG A HH11 4  
ATOM 8248  H HH12 . ARG A 1 111 ? -0.535  4.135   25.020  1.00 0.00 ? 111 ARG A HH12 4  
ATOM 8249  H HH21 . ARG A 1 111 ? -3.848  3.107   25.460  1.00 0.00 ? 111 ARG A HH21 4  
ATOM 8250  H HH22 . ARG A 1 111 ? -2.440  3.751   26.234  1.00 0.00 ? 111 ARG A HH22 4  
ATOM 8251  N N    . ALA A 1 112 ? -2.729  3.711   17.171  1.00 0.00 ? 112 ALA A N    4  
ATOM 8252  C CA   . ALA A 1 112 ? -1.634  3.361   16.274  1.00 0.00 ? 112 ALA A CA   4  
ATOM 8253  C C    . ALA A 1 112 ? -0.312  3.276   17.028  1.00 0.00 ? 112 ALA A C    4  
ATOM 8254  O O    . ALA A 1 112 ? 0.181   4.275   17.551  1.00 0.00 ? 112 ALA A O    4  
ATOM 8255  C CB   . ALA A 1 112 ? -1.535  4.374   15.143  1.00 0.00 ? 112 ALA A CB   4  
ATOM 8256  H H    . ALA A 1 112 ? -2.990  4.651   17.263  1.00 0.00 ? 112 ALA A H    4  
ATOM 8257  H HA   . ALA A 1 112 ? -1.853  2.396   15.841  1.00 0.00 ? 112 ALA A HA   4  
ATOM 8258  H HB1  . ALA A 1 112 ? -1.454  5.369   15.557  1.00 0.00 ? 112 ALA A HB1  4  
ATOM 8259  H HB2  . ALA A 1 112 ? -0.662  4.161   14.545  1.00 0.00 ? 112 ALA A HB2  4  
ATOM 8260  H HB3  . ALA A 1 112 ? -2.419  4.312   14.526  1.00 0.00 ? 112 ALA A HB3  4  
ATOM 8261  N N    . VAL A 1 113 ? 0.258   2.076   17.080  1.00 0.00 ? 113 VAL A N    4  
ATOM 8262  C CA   . VAL A 1 113 ? 1.524   1.861   17.770  1.00 0.00 ? 113 VAL A CA   4  
ATOM 8263  C C    . VAL A 1 113 ? 2.651   2.645   17.108  1.00 0.00 ? 113 VAL A C    4  
ATOM 8264  O O    . VAL A 1 113 ? 2.907   2.496   15.914  1.00 0.00 ? 113 VAL A O    4  
ATOM 8265  C CB   . VAL A 1 113 ? 1.901   0.368   17.799  1.00 0.00 ? 113 VAL A CB   4  
ATOM 8266  C CG1  . VAL A 1 113 ? 3.253   0.171   18.466  1.00 0.00 ? 113 VAL A CG1  4  
ATOM 8267  C CG2  . VAL A 1 113 ? 0.824   -0.439  18.510  1.00 0.00 ? 113 VAL A CG2  4  
ATOM 8268  H H    . VAL A 1 113 ? -0.183  1.318   16.644  1.00 0.00 ? 113 VAL A H    4  
ATOM 8269  H HA   . VAL A 1 113 ? 1.411   2.202   18.789  1.00 0.00 ? 113 VAL A HA   4  
ATOM 8270  H HB   . VAL A 1 113 ? 1.972   0.015   16.781  1.00 0.00 ? 113 VAL A HB   4  
ATOM 8271  H HG11 . VAL A 1 113 ? 3.135   -0.446  19.345  1.00 0.00 ? 113 VAL A HG11 4  
ATOM 8272  H HG12 . VAL A 1 113 ? 3.929   -0.311  17.775  1.00 0.00 ? 113 VAL A HG12 4  
ATOM 8273  H HG13 . VAL A 1 113 ? 3.656   1.131   18.754  1.00 0.00 ? 113 VAL A HG13 4  
ATOM 8274  H HG21 . VAL A 1 113 ? 0.527   0.075   19.411  1.00 0.00 ? 113 VAL A HG21 4  
ATOM 8275  H HG22 . VAL A 1 113 ? -0.032  -0.550  17.859  1.00 0.00 ? 113 VAL A HG22 4  
ATOM 8276  H HG23 . VAL A 1 113 ? 1.213   -1.415  18.762  1.00 0.00 ? 113 VAL A HG23 4  
ATOM 8277  N N    . SER A 1 114 ? 3.323   3.482   17.893  1.00 0.00 ? 114 SER A N    4  
ATOM 8278  C CA   . SER A 1 114 ? 4.422   4.294   17.382  1.00 0.00 ? 114 SER A CA   4  
ATOM 8279  C C    . SER A 1 114 ? 5.515   3.413   16.784  1.00 0.00 ? 114 SER A C    4  
ATOM 8280  O O    . SER A 1 114 ? 6.264   2.757   17.508  1.00 0.00 ? 114 SER A O    4  
ATOM 8281  C CB   . SER A 1 114 ? 5.004   5.162   18.499  1.00 0.00 ? 114 SER A CB   4  
ATOM 8282  O OG   . SER A 1 114 ? 5.494   4.364   19.563  1.00 0.00 ? 114 SER A OG   4  
ATOM 8283  H H    . SER A 1 114 ? 3.071   3.557   18.837  1.00 0.00 ? 114 SER A H    4  
ATOM 8284  H HA   . SER A 1 114 ? 4.028   4.935   16.608  1.00 0.00 ? 114 SER A HA   4  
ATOM 8285  H HB2  . SER A 1 114 ? 5.817   5.753   18.105  1.00 0.00 ? 114 SER A HB2  4  
ATOM 8286  H HB3  . SER A 1 114 ? 4.234   5.817   18.881  1.00 0.00 ? 114 SER A HB3  4  
ATOM 8287  H HG   . SER A 1 114 ? 6.358   4.683   19.831  1.00 0.00 ? 114 SER A HG   4  
ATOM 8288  N N    . TRP A 1 115 ? 5.599   3.404   15.459  1.00 0.00 ? 115 TRP A N    4  
ATOM 8289  C CA   . TRP A 1 115 ? 6.600   2.605   14.762  1.00 0.00 ? 115 TRP A CA   4  
ATOM 8290  C C    . TRP A 1 115 ? 7.479   3.482   13.878  1.00 0.00 ? 115 TRP A C    4  
ATOM 8291  O O    . TRP A 1 115 ? 6.995   4.409   13.227  1.00 0.00 ? 115 TRP A O    4  
ATOM 8292  C CB   . TRP A 1 115 ? 5.923   1.524   13.918  1.00 0.00 ? 115 TRP A CB   4  
ATOM 8293  C CG   . TRP A 1 115 ? 6.864   0.821   12.987  1.00 0.00 ? 115 TRP A CG   4  
ATOM 8294  C CD1  . TRP A 1 115 ? 7.927   0.037   13.335  1.00 0.00 ? 115 TRP A CD1  4  
ATOM 8295  C CD2  . TRP A 1 115 ? 6.828   0.839   11.556  1.00 0.00 ? 115 TRP A CD2  4  
ATOM 8296  N NE1  . TRP A 1 115 ? 8.553   -0.434  12.206  1.00 0.00 ? 115 TRP A NE1  4  
ATOM 8297  C CE2  . TRP A 1 115 ? 7.898   0.043   11.102  1.00 0.00 ? 115 TRP A CE2  4  
ATOM 8298  C CE3  . TRP A 1 115 ? 5.994   1.448   10.614  1.00 0.00 ? 115 TRP A CE3  4  
ATOM 8299  C CZ2  . TRP A 1 115 ? 8.155   -0.156  9.749   1.00 0.00 ? 115 TRP A CZ2  4  
ATOM 8300  C CZ3  . TRP A 1 115 ? 6.251   1.249   9.271   1.00 0.00 ? 115 TRP A CZ3  4  
ATOM 8301  C CH2  . TRP A 1 115 ? 7.323   0.452   8.848   1.00 0.00 ? 115 TRP A CH2  4  
ATOM 8302  H H    . TRP A 1 115 ? 4.973   3.948   14.936  1.00 0.00 ? 115 TRP A H    4  
ATOM 8303  H HA   . TRP A 1 115 ? 7.221   2.129   15.508  1.00 0.00 ? 115 TRP A HA   4  
ATOM 8304  H HB2  . TRP A 1 115 ? 5.486   0.785   14.572  1.00 0.00 ? 115 TRP A HB2  4  
ATOM 8305  H HB3  . TRP A 1 115 ? 5.143   1.979   13.323  1.00 0.00 ? 115 TRP A HB3  4  
ATOM 8306  H HD1  . TRP A 1 115 ? 8.221   -0.173  14.352  1.00 0.00 ? 115 TRP A HD1  4  
ATOM 8307  H HE1  . TRP A 1 115 ? 9.341   -1.018  12.195  1.00 0.00 ? 115 TRP A HE1  4  
ATOM 8308  H HE3  . TRP A 1 115 ? 5.163   2.066   10.920  1.00 0.00 ? 115 TRP A HE3  4  
ATOM 8309  H HZ2  . TRP A 1 115 ? 8.977   -0.768  9.407   1.00 0.00 ? 115 TRP A HZ2  4  
ATOM 8310  H HZ3  . TRP A 1 115 ? 5.618   1.712   8.528   1.00 0.00 ? 115 TRP A HZ3  4  
ATOM 8311  H HH2  . TRP A 1 115 ? 7.486   0.325   7.789   1.00 0.00 ? 115 TRP A HH2  4  
ATOM 8312  N N    . THR A 1 116 ? 8.775   3.186   13.858  1.00 0.00 ? 116 THR A N    4  
ATOM 8313  C CA   . THR A 1 116 ? 9.722   3.949   13.054  1.00 0.00 ? 116 THR A CA   4  
ATOM 8314  C C    . THR A 1 116 ? 9.563   3.633   11.571  1.00 0.00 ? 116 THR A C    4  
ATOM 8315  O O    . THR A 1 116 ? 9.639   2.475   11.161  1.00 0.00 ? 116 THR A O    4  
ATOM 8316  C CB   . THR A 1 116 ? 11.175  3.662   13.475  1.00 0.00 ? 116 THR A CB   4  
ATOM 8317  O OG1  . THR A 1 116 ? 11.357  3.985   14.859  1.00 0.00 ? 116 THR A OG1  4  
ATOM 8318  C CG2  . THR A 1 116 ? 12.152  4.465   12.630  1.00 0.00 ? 116 THR A CG2  4  
ATOM 8319  H H    . THR A 1 116 ? 9.101   2.436   14.398  1.00 0.00 ? 116 THR A H    4  
ATOM 8320  H HA   . THR A 1 116 ? 9.523   4.999   13.212  1.00 0.00 ? 116 THR A HA   4  
ATOM 8321  H HB   . THR A 1 116 ? 11.376  2.611   13.329  1.00 0.00 ? 116 THR A HB   4  
ATOM 8322  H HG1  . THR A 1 116 ? 10.722  4.658   15.117  1.00 0.00 ? 116 THR A HG1  4  
ATOM 8323  H HG21 . THR A 1 116 ? 12.329  3.950   11.697  1.00 0.00 ? 116 THR A HG21 4  
ATOM 8324  H HG22 . THR A 1 116 ? 13.084  4.576   13.163  1.00 0.00 ? 116 THR A HG22 4  
ATOM 8325  H HG23 . THR A 1 116 ? 11.735  5.441   12.428  1.00 0.00 ? 116 THR A HG23 4  
ATOM 8326  N N    . PHE A 1 117 ? 9.341   4.671   10.771  1.00 0.00 ? 117 PHE A N    4  
ATOM 8327  C CA   . PHE A 1 117 ? 9.171   4.504   9.332   1.00 0.00 ? 117 PHE A CA   4  
ATOM 8328  C C    . PHE A 1 117 ? 10.515  4.583   8.613   1.00 0.00 ? 117 PHE A C    4  
ATOM 8329  O O    . PHE A 1 117 ? 10.905  5.640   8.117   1.00 0.00 ? 117 PHE A O    4  
ATOM 8330  C CB   . PHE A 1 117 ? 8.223   5.571   8.782   1.00 0.00 ? 117 PHE A CB   4  
ATOM 8331  C CG   . PHE A 1 117 ? 6.777   5.163   8.817   1.00 0.00 ? 117 PHE A CG   4  
ATOM 8332  C CD1  . PHE A 1 117 ? 6.226   4.428   7.779   1.00 0.00 ? 117 PHE A CD1  4  
ATOM 8333  C CD2  . PHE A 1 117 ? 5.970   5.514   9.887   1.00 0.00 ? 117 PHE A CD2  4  
ATOM 8334  C CE1  . PHE A 1 117 ? 4.896   4.053   7.808   1.00 0.00 ? 117 PHE A CE1  4  
ATOM 8335  C CE2  . PHE A 1 117 ? 4.640   5.141   9.921   1.00 0.00 ? 117 PHE A CE2  4  
ATOM 8336  C CZ   . PHE A 1 117 ? 4.103   4.408   8.881   1.00 0.00 ? 117 PHE A CZ   4  
ATOM 8337  H H    . PHE A 1 117 ? 9.291   5.570   11.157  1.00 0.00 ? 117 PHE A H    4  
ATOM 8338  H HA   . PHE A 1 117 ? 8.741   3.529   9.161   1.00 0.00 ? 117 PHE A HA   4  
ATOM 8339  H HB2  . PHE A 1 117 ? 8.327   6.472   9.368   1.00 0.00 ? 117 PHE A HB2  4  
ATOM 8340  H HB3  . PHE A 1 117 ? 8.485   5.781   7.756   1.00 0.00 ? 117 PHE A HB3  4  
ATOM 8341  H HD1  . PHE A 1 117 ? 6.846   4.148   6.940   1.00 0.00 ? 117 PHE A HD1  4  
ATOM 8342  H HD2  . PHE A 1 117 ? 6.390   6.088   10.702  1.00 0.00 ? 117 PHE A HD2  4  
ATOM 8343  H HE1  . PHE A 1 117 ? 4.479   3.480   6.994   1.00 0.00 ? 117 PHE A HE1  4  
ATOM 8344  H HE2  . PHE A 1 117 ? 4.022   5.421   10.762  1.00 0.00 ? 117 PHE A HE2  4  
ATOM 8345  H HZ   . PHE A 1 117 ? 3.063   4.116   8.906   1.00 0.00 ? 117 PHE A HZ   4  
ATOM 8346  N N    . SER A 1 118 ? 11.218  3.456   8.561   1.00 0.00 ? 118 SER A N    4  
ATOM 8347  C CA   . SER A 1 118 ? 12.520  3.397   7.907   1.00 0.00 ? 118 SER A CA   4  
ATOM 8348  C C    . SER A 1 118 ? 12.618  2.173   7.002   1.00 0.00 ? 118 SER A C    4  
ATOM 8349  O O    . SER A 1 118 ? 11.831  1.235   7.122   1.00 0.00 ? 118 SER A O    4  
ATOM 8350  C CB   . SER A 1 118 ? 13.638  3.364   8.951   1.00 0.00 ? 118 SER A CB   4  
ATOM 8351  O OG   . SER A 1 118 ? 13.448  2.301   9.868   1.00 0.00 ? 118 SER A OG   4  
ATOM 8352  H H    . SER A 1 118 ? 10.854  2.646   8.975   1.00 0.00 ? 118 SER A H    4  
ATOM 8353  H HA   . SER A 1 118 ? 12.629  4.286   7.304   1.00 0.00 ? 118 SER A HA   4  
ATOM 8354  H HB2  . SER A 1 118 ? 14.587  3.231   8.455   1.00 0.00 ? 118 SER A HB2  4  
ATOM 8355  H HB3  . SER A 1 118 ? 13.645  4.297   9.496   1.00 0.00 ? 118 SER A HB3  4  
ATOM 8356  H HG   . SER A 1 118 ? 13.599  1.464   9.423   1.00 0.00 ? 118 SER A HG   4  
ATOM 8357  N N    . GLU A 1 119 ? 13.591  2.191   6.096   1.00 0.00 ? 119 GLU A N    4  
ATOM 8358  C CA   . GLU A 1 119 ? 13.792  1.084   5.169   1.00 0.00 ? 119 GLU A CA   4  
ATOM 8359  C C    . GLU A 1 119 ? 14.014  -0.224  5.924   1.00 0.00 ? 119 GLU A C    4  
ATOM 8360  O O    . GLU A 1 119 ? 13.223  -1.160  5.810   1.00 0.00 ? 119 GLU A O    4  
ATOM 8361  C CB   . GLU A 1 119 ? 14.986  1.365   4.254   1.00 0.00 ? 119 GLU A CB   4  
ATOM 8362  C CG   . GLU A 1 119 ? 15.118  0.379   3.106   1.00 0.00 ? 119 GLU A CG   4  
ATOM 8363  C CD   . GLU A 1 119 ? 15.870  0.958   1.923   1.00 0.00 ? 119 GLU A CD   4  
ATOM 8364  O OE1  . GLU A 1 119 ? 15.262  1.737   1.158   1.00 0.00 ? 119 GLU A OE1  4  
ATOM 8365  O OE2  . GLU A 1 119 ? 17.064  0.633   1.762   1.00 0.00 ? 119 GLU A OE2  4  
ATOM 8366  H H    . GLU A 1 119 ? 14.187  2.968   6.049   1.00 0.00 ? 119 GLU A H    4  
ATOM 8367  H HA   . GLU A 1 119 ? 12.902  0.990   4.566   1.00 0.00 ? 119 GLU A HA   4  
ATOM 8368  H HB2  . GLU A 1 119 ? 14.880  2.357   3.840   1.00 0.00 ? 119 GLU A HB2  4  
ATOM 8369  H HB3  . GLU A 1 119 ? 15.891  1.325   4.841   1.00 0.00 ? 119 GLU A HB3  4  
ATOM 8370  H HG2  . GLU A 1 119 ? 15.648  -0.494  3.457   1.00 0.00 ? 119 GLU A HG2  4  
ATOM 8371  H HG3  . GLU A 1 119 ? 14.129  0.091   2.779   1.00 0.00 ? 119 GLU A HG3  4  
ATOM 8372  N N    . GLU A 1 120 ? 15.095  -0.280  6.695   1.00 0.00 ? 120 GLU A N    4  
ATOM 8373  C CA   . GLU A 1 120 ? 15.421  -1.473  7.468   1.00 0.00 ? 120 GLU A CA   4  
ATOM 8374  C C    . GLU A 1 120 ? 14.185  -2.016  8.177   1.00 0.00 ? 120 GLU A C    4  
ATOM 8375  O O    . GLU A 1 120 ? 13.693  -3.095  7.850   1.00 0.00 ? 120 GLU A O    4  
ATOM 8376  C CB   . GLU A 1 120 ? 16.515  -1.161  8.492   1.00 0.00 ? 120 GLU A CB   4  
ATOM 8377  C CG   . GLU A 1 120 ? 17.640  -0.303  7.939   1.00 0.00 ? 120 GLU A CG   4  
ATOM 8378  C CD   . GLU A 1 120 ? 17.366  1.181   8.079   1.00 0.00 ? 120 GLU A CD   4  
ATOM 8379  O OE1  . GLU A 1 120 ? 17.463  1.697   9.212   1.00 0.00 ? 120 GLU A OE1  4  
ATOM 8380  O OE2  . GLU A 1 120 ? 17.054  1.827   7.057   1.00 0.00 ? 120 GLU A OE2  4  
ATOM 8381  H H    . GLU A 1 120 ? 15.688  0.499   6.745   1.00 0.00 ? 120 GLU A H    4  
ATOM 8382  H HA   . GLU A 1 120 ? 15.787  -2.222  6.782   1.00 0.00 ? 120 GLU A HA   4  
ATOM 8383  H HB2  . GLU A 1 120 ? 16.070  -0.641  9.328   1.00 0.00 ? 120 GLU A HB2  4  
ATOM 8384  H HB3  . GLU A 1 120 ? 16.938  -2.091  8.842   1.00 0.00 ? 120 GLU A HB3  4  
ATOM 8385  H HG2  . GLU A 1 120 ? 18.549  -0.537  8.472   1.00 0.00 ? 120 GLU A HG2  4  
ATOM 8386  H HG3  . GLU A 1 120 ? 17.769  -0.533  6.891   1.00 0.00 ? 120 GLU A HG3  4  
ATOM 8387  N N    . ASN A 1 121 ? 13.688  -1.261  9.151   1.00 0.00 ? 121 ASN A N    4  
ATOM 8388  C CA   . ASN A 1 121 ? 12.510  -1.666  9.908   1.00 0.00 ? 121 ASN A CA   4  
ATOM 8389  C C    . ASN A 1 121 ? 11.423  -2.200  8.979   1.00 0.00 ? 121 ASN A C    4  
ATOM 8390  O O    . ASN A 1 121 ? 10.892  -3.291  9.190   1.00 0.00 ? 121 ASN A O    4  
ATOM 8391  C CB   . ASN A 1 121 ? 11.968  -0.488  10.720  1.00 0.00 ? 121 ASN A CB   4  
ATOM 8392  C CG   . ASN A 1 121 ? 12.923  -0.053  11.815  1.00 0.00 ? 121 ASN A CG   4  
ATOM 8393  O OD1  . ASN A 1 121 ? 13.739  -0.841  12.291  1.00 0.00 ? 121 ASN A OD1  4  
ATOM 8394  N ND2  . ASN A 1 121 ? 12.823  1.208   12.220  1.00 0.00 ? 121 ASN A ND2  4  
ATOM 8395  H H    . ASN A 1 121 ? 14.125  -0.410  9.366   1.00 0.00 ? 121 ASN A H    4  
ATOM 8396  H HA   . ASN A 1 121 ? 12.806  -2.453  10.586  1.00 0.00 ? 121 ASN A HA   4  
ATOM 8397  H HB2  . ASN A 1 121 ? 11.804  0.351   10.059  1.00 0.00 ? 121 ASN A HB2  4  
ATOM 8398  H HB3  . ASN A 1 121 ? 11.031  -0.771  11.175  1.00 0.00 ? 121 ASN A HB3  4  
ATOM 8399  H HD21 . ASN A 1 121 ? 12.149  1.779   11.795  1.00 0.00 ? 121 ASN A HD21 4  
ATOM 8400  H HD22 . ASN A 1 121 ? 13.429  1.516   12.926  1.00 0.00 ? 121 ASN A HD22 4  
ATOM 8401  N N    . VAL A 1 122 ? 11.098  -1.424  7.950   1.00 0.00 ? 122 VAL A N    4  
ATOM 8402  C CA   . VAL A 1 122 ? 10.077  -1.819  6.987   1.00 0.00 ? 122 VAL A CA   4  
ATOM 8403  C C    . VAL A 1 122 ? 10.329  -3.229  6.466   1.00 0.00 ? 122 VAL A C    4  
ATOM 8404  O O    . VAL A 1 122 ? 9.442   -4.083  6.501   1.00 0.00 ? 122 VAL A O    4  
ATOM 8405  C CB   . VAL A 1 122 ? 10.023  -0.845  5.795   1.00 0.00 ? 122 VAL A CB   4  
ATOM 8406  C CG1  . VAL A 1 122 ? 9.174   -1.422  4.673   1.00 0.00 ? 122 VAL A CG1  4  
ATOM 8407  C CG2  . VAL A 1 122 ? 9.488   0.508   6.238   1.00 0.00 ? 122 VAL A CG2  4  
ATOM 8408  H H    . VAL A 1 122 ? 11.557  -0.566  7.835   1.00 0.00 ? 122 VAL A H    4  
ATOM 8409  H HA   . VAL A 1 122 ? 9.120   -1.796  7.488   1.00 0.00 ? 122 VAL A HA   4  
ATOM 8410  H HB   . VAL A 1 122 ? 11.027  -0.708  5.423   1.00 0.00 ? 122 VAL A HB   4  
ATOM 8411  H HG11 . VAL A 1 122 ? 8.652   -2.298  5.030   1.00 0.00 ? 122 VAL A HG11 4  
ATOM 8412  H HG12 . VAL A 1 122 ? 8.458   -0.682  4.346   1.00 0.00 ? 122 VAL A HG12 4  
ATOM 8413  H HG13 . VAL A 1 122 ? 9.811   -1.696  3.845   1.00 0.00 ? 122 VAL A HG13 4  
ATOM 8414  H HG21 . VAL A 1 122 ? 10.024  1.292   5.724   1.00 0.00 ? 122 VAL A HG21 4  
ATOM 8415  H HG22 . VAL A 1 122 ? 8.436   0.576   5.999   1.00 0.00 ? 122 VAL A HG22 4  
ATOM 8416  H HG23 . VAL A 1 122 ? 9.623   0.618   7.304   1.00 0.00 ? 122 VAL A HG23 4  
ATOM 8417  N N    . ILE A 1 123 ? 11.544  -3.468  5.984   1.00 0.00 ? 123 ILE A N    4  
ATOM 8418  C CA   . ILE A 1 123 ? 11.914  -4.776  5.457   1.00 0.00 ? 123 ILE A CA   4  
ATOM 8419  C C    . ILE A 1 123 ? 11.596  -5.881  6.458   1.00 0.00 ? 123 ILE A C    4  
ATOM 8420  O O    . ILE A 1 123 ? 10.860  -6.819  6.150   1.00 0.00 ? 123 ILE A O    4  
ATOM 8421  C CB   . ILE A 1 123 ? 13.411  -4.836  5.100   1.00 0.00 ? 123 ILE A CB   4  
ATOM 8422  C CG1  . ILE A 1 123 ? 13.754  -3.764  4.064   1.00 0.00 ? 123 ILE A CG1  4  
ATOM 8423  C CG2  . ILE A 1 123 ? 13.775  -6.219  4.579   1.00 0.00 ? 123 ILE A CG2  4  
ATOM 8424  C CD1  . ILE A 1 123 ? 15.241  -3.560  3.875   1.00 0.00 ? 123 ILE A CD1  4  
ATOM 8425  H H    . ILE A 1 123 ? 12.208  -2.747  5.983   1.00 0.00 ? 123 ILE A H    4  
ATOM 8426  H HA   . ILE A 1 123 ? 11.342  -4.945  4.556   1.00 0.00 ? 123 ILE A HA   4  
ATOM 8427  H HB   . ILE A 1 123 ? 13.980  -4.654  5.998   1.00 0.00 ? 123 ILE A HB   4  
ATOM 8428  H HG12 . ILE A 1 123 ? 13.335  -4.045  3.111   1.00 0.00 ? 123 ILE A HG12 4  
ATOM 8429  H HG13 . ILE A 1 123 ? 13.326  -2.822  4.377   1.00 0.00 ? 123 ILE A HG13 4  
ATOM 8430  H HG21 . ILE A 1 123 ? 14.757  -6.491  4.939   1.00 0.00 ? 123 ILE A HG21 4  
ATOM 8431  H HG22 . ILE A 1 123 ? 13.052  -6.938  4.932   1.00 0.00 ? 123 ILE A HG22 4  
ATOM 8432  H HG23 . ILE A 1 123 ? 13.777  -6.209  3.500   1.00 0.00 ? 123 ILE A HG23 4  
ATOM 8433  H HD11 . ILE A 1 123 ? 15.409  -2.739  3.194   1.00 0.00 ? 123 ILE A HD11 4  
ATOM 8434  H HD12 . ILE A 1 123 ? 15.698  -3.338  4.827   1.00 0.00 ? 123 ILE A HD12 4  
ATOM 8435  H HD13 . ILE A 1 123 ? 15.678  -4.460  3.468   1.00 0.00 ? 123 ILE A HD13 4  
ATOM 8436  N N    . ARG A 1 124 ? 12.154  -5.764  7.658   1.00 0.00 ? 124 ARG A N    4  
ATOM 8437  C CA   . ARG A 1 124 ? 11.930  -6.753  8.705   1.00 0.00 ? 124 ARG A CA   4  
ATOM 8438  C C    . ARG A 1 124 ? 10.440  -6.919  8.986   1.00 0.00 ? 124 ARG A C    4  
ATOM 8439  O O    . ARG A 1 124 ? 9.941   -8.038  9.101   1.00 0.00 ? 124 ARG A O    4  
ATOM 8440  C CB   . ARG A 1 124 ? 12.659  -6.345  9.987   1.00 0.00 ? 124 ARG A CB   4  
ATOM 8441  C CG   . ARG A 1 124 ? 12.618  -7.405  11.075  1.00 0.00 ? 124 ARG A CG   4  
ATOM 8442  C CD   . ARG A 1 124 ? 13.271  -6.913  12.357  1.00 0.00 ? 124 ARG A CD   4  
ATOM 8443  N NE   . ARG A 1 124 ? 13.116  -7.867  13.451  1.00 0.00 ? 124 ARG A NE   4  
ATOM 8444  C CZ   . ARG A 1 124 ? 13.849  -7.840  14.559  1.00 0.00 ? 124 ARG A CZ   4  
ATOM 8445  N NH1  . ARG A 1 124 ? 14.781  -6.911  14.719  1.00 0.00 ? 124 ARG A NH1  4  
ATOM 8446  N NH2  . ARG A 1 124 ? 13.649  -8.743  15.511  1.00 0.00 ? 124 ARG A NH2  4  
ATOM 8447  H H    . ARG A 1 124 ? 12.731  -4.993  7.844   1.00 0.00 ? 124 ARG A H    4  
ATOM 8448  H HA   . ARG A 1 124 ? 12.327  -7.696  8.361   1.00 0.00 ? 124 ARG A HA   4  
ATOM 8449  H HB2  . ARG A 1 124 ? 13.694  -6.143  9.750   1.00 0.00 ? 124 ARG A HB2  4  
ATOM 8450  H HB3  . ARG A 1 124 ? 12.205  -5.445  10.374  1.00 0.00 ? 124 ARG A HB3  4  
ATOM 8451  H HG2  . ARG A 1 124 ? 11.588  -7.656  11.282  1.00 0.00 ? 124 ARG A HG2  4  
ATOM 8452  H HG3  . ARG A 1 124 ? 13.142  -8.283  10.728  1.00 0.00 ? 124 ARG A HG3  4  
ATOM 8453  H HD2  . ARG A 1 124 ? 14.324  -6.758  12.173  1.00 0.00 ? 124 ARG A HD2  4  
ATOM 8454  H HD3  . ARG A 1 124 ? 12.814  -5.976  12.641  1.00 0.00 ? 124 ARG A HD3  4  
ATOM 8455  H HE   . ARG A 1 124 ? 12.433  -8.562  13.354  1.00 0.00 ? 124 ARG A HE   4  
ATOM 8456  H HH11 . ARG A 1 124 ? 14.933  -6.229  14.004  1.00 0.00 ? 124 ARG A HH11 4  
ATOM 8457  H HH12 . ARG A 1 124 ? 15.330  -6.892  15.555  1.00 0.00 ? 124 ARG A HH12 4  
ATOM 8458  H HH21 . ARG A 1 124 ? 12.947  -9.445  15.394  1.00 0.00 ? 124 ARG A HH21 4  
ATOM 8459  H HH22 . ARG A 1 124 ? 14.201  -8.722  16.344  1.00 0.00 ? 124 ARG A HH22 4  
ATOM 8460  N N    . GLU A 1 125 ? 9.735   -5.797  9.097   1.00 0.00 ? 125 GLU A N    4  
ATOM 8461  C CA   . GLU A 1 125 ? 8.302   -5.819  9.366   1.00 0.00 ? 125 GLU A CA   4  
ATOM 8462  C C    . GLU A 1 125 ? 7.560   -6.616  8.297   1.00 0.00 ? 125 GLU A C    4  
ATOM 8463  O O    . GLU A 1 125 ? 6.796   -7.530  8.607   1.00 0.00 ? 125 GLU A O    4  
ATOM 8464  C CB   . GLU A 1 125 ? 7.751   -4.393  9.431   1.00 0.00 ? 125 GLU A CB   4  
ATOM 8465  C CG   . GLU A 1 125 ? 8.380   -3.546  10.524  1.00 0.00 ? 125 GLU A CG   4  
ATOM 8466  C CD   . GLU A 1 125 ? 7.613   -3.617  11.830  1.00 0.00 ? 125 GLU A CD   4  
ATOM 8467  O OE1  . GLU A 1 125 ? 6.588   -2.916  11.956  1.00 0.00 ? 125 GLU A OE1  4  
ATOM 8468  O OE2  . GLU A 1 125 ? 8.040   -4.374  12.727  1.00 0.00 ? 125 GLU A OE2  4  
ATOM 8469  H H    . GLU A 1 125 ? 10.189  -4.935  8.996   1.00 0.00 ? 125 GLU A H    4  
ATOM 8470  H HA   . GLU A 1 125 ? 8.152   -6.296  10.323  1.00 0.00 ? 125 GLU A HA   4  
ATOM 8471  H HB2  . GLU A 1 125 ? 7.927   -3.909  8.481   1.00 0.00 ? 125 GLU A HB2  4  
ATOM 8472  H HB3  . GLU A 1 125 ? 6.686   -4.440  9.608   1.00 0.00 ? 125 GLU A HB3  4  
ATOM 8473  H HG2  . GLU A 1 125 ? 9.387   -3.893  10.696  1.00 0.00 ? 125 GLU A HG2  4  
ATOM 8474  H HG3  . GLU A 1 125 ? 8.406   -2.518  10.194  1.00 0.00 ? 125 GLU A HG3  4  
ATOM 8475  N N    . PHE A 1 126 ? 7.790   -6.261  7.037   1.00 0.00 ? 126 PHE A N    4  
ATOM 8476  C CA   . PHE A 1 126 ? 7.143   -6.941  5.921   1.00 0.00 ? 126 PHE A CA   4  
ATOM 8477  C C    . PHE A 1 126 ? 8.017   -8.075  5.395   1.00 0.00 ? 126 PHE A C    4  
ATOM 8478  O O    . PHE A 1 126 ? 7.788   -8.594  4.303   1.00 0.00 ? 126 PHE A O    4  
ATOM 8479  C CB   . PHE A 1 126 ? 6.844   -5.948  4.796   1.00 0.00 ? 126 PHE A CB   4  
ATOM 8480  C CG   . PHE A 1 126 ? 5.831   -4.904  5.171   1.00 0.00 ? 126 PHE A CG   4  
ATOM 8481  C CD1  . PHE A 1 126 ? 4.478   -5.133  4.984   1.00 0.00 ? 126 PHE A CD1  4  
ATOM 8482  C CD2  . PHE A 1 126 ? 6.233   -3.693  5.712   1.00 0.00 ? 126 PHE A CD2  4  
ATOM 8483  C CE1  . PHE A 1 126 ? 3.545   -4.173  5.327   1.00 0.00 ? 126 PHE A CE1  4  
ATOM 8484  C CE2  . PHE A 1 126 ? 5.305   -2.730  6.058   1.00 0.00 ? 126 PHE A CE2  4  
ATOM 8485  C CZ   . PHE A 1 126 ? 3.958   -2.971  5.866   1.00 0.00 ? 126 PHE A CZ   4  
ATOM 8486  H H    . PHE A 1 126 ? 8.410   -5.524  6.854   1.00 0.00 ? 126 PHE A H    4  
ATOM 8487  H HA   . PHE A 1 126 ? 6.214   -7.355  6.281   1.00 0.00 ? 126 PHE A HA   4  
ATOM 8488  H HB2  . PHE A 1 126 ? 7.756   -5.441  4.521   1.00 0.00 ? 126 PHE A HB2  4  
ATOM 8489  H HB3  . PHE A 1 126 ? 6.465   -6.488  3.941   1.00 0.00 ? 126 PHE A HB3  4  
ATOM 8490  H HD1  . PHE A 1 126 ? 4.153   -6.073  4.563   1.00 0.00 ? 126 PHE A HD1  4  
ATOM 8491  H HD2  . PHE A 1 126 ? 7.287   -3.504  5.863   1.00 0.00 ? 126 PHE A HD2  4  
ATOM 8492  H HE1  . PHE A 1 126 ? 2.493   -4.364  5.177   1.00 0.00 ? 126 PHE A HE1  4  
ATOM 8493  H HE2  . PHE A 1 126 ? 5.632   -1.791  6.479   1.00 0.00 ? 126 PHE A HE2  4  
ATOM 8494  H HZ   . PHE A 1 126 ? 3.231   -2.219  6.135   1.00 0.00 ? 126 PHE A HZ   4  
ATOM 8495  N N    . ASN A 1 127 ? 9.019   -8.455  6.180   1.00 0.00 ? 127 ASN A N    4  
ATOM 8496  C CA   . ASN A 1 127 ? 9.929   -9.528  5.794   1.00 0.00 ? 127 ASN A CA   4  
ATOM 8497  C C    . ASN A 1 127 ? 10.165  -9.524  4.286   1.00 0.00 ? 127 ASN A C    4  
ATOM 8498  O O    . ASN A 1 127 ? 10.247  -10.580 3.657   1.00 0.00 ? 127 ASN A O    4  
ATOM 8499  C CB   . ASN A 1 127 ? 9.368   -10.883 6.230   1.00 0.00 ? 127 ASN A CB   4  
ATOM 8500  C CG   . ASN A 1 127 ? 9.646   -11.180 7.691   1.00 0.00 ? 127 ASN A CG   4  
ATOM 8501  O OD1  . ASN A 1 127 ? 8.724   -11.346 8.489   1.00 0.00 ? 127 ASN A OD1  4  
ATOM 8502  N ND2  . ASN A 1 127 ? 10.924  -11.247 8.048   1.00 0.00 ? 127 ASN A ND2  4  
ATOM 8503  H H    . ASN A 1 127 ? 9.151   -8.004  7.040   1.00 0.00 ? 127 ASN A H    4  
ATOM 8504  H HA   . ASN A 1 127 ? 10.871  -9.360  6.294   1.00 0.00 ? 127 ASN A HA   4  
ATOM 8505  H HB2  . ASN A 1 127 ? 8.299   -10.888 6.079   1.00 0.00 ? 127 ASN A HB2  4  
ATOM 8506  H HB3  . ASN A 1 127 ? 9.817   -11.661 5.632   1.00 0.00 ? 127 ASN A HB3  4  
ATOM 8507  H HD21 . ASN A 1 127 ? 11.606  -11.104 7.359   1.00 0.00 ? 127 ASN A HD21 4  
ATOM 8508  H HD22 . ASN A 1 127 ? 11.132  -11.439 8.987   1.00 0.00 ? 127 ASN A HD22 4  
ATOM 8509  N N    . LEU A 1 128 ? 10.273  -8.331  3.713   1.00 0.00 ? 128 LEU A N    4  
ATOM 8510  C CA   . LEU A 1 128 ? 10.500  -8.189  2.279   1.00 0.00 ? 128 LEU A CA   4  
ATOM 8511  C C    . LEU A 1 128 ? 11.654  -9.074  1.820   1.00 0.00 ? 128 LEU A C    4  
ATOM 8512  O O    . LEU A 1 128 ? 11.595  -9.685  0.754   1.00 0.00 ? 128 LEU A O    4  
ATOM 8513  C CB   . LEU A 1 128 ? 10.794  -6.728  1.931   1.00 0.00 ? 128 LEU A CB   4  
ATOM 8514  C CG   . LEU A 1 128 ? 9.634   -5.748  2.116   1.00 0.00 ? 128 LEU A CG   4  
ATOM 8515  C CD1  . LEU A 1 128 ? 10.111  -4.316  1.928   1.00 0.00 ? 128 LEU A CD1  4  
ATOM 8516  C CD2  . LEU A 1 128 ? 8.506   -6.068  1.146   1.00 0.00 ? 128 LEU A CD2  4  
ATOM 8517  H H    . LEU A 1 128 ? 10.199  -7.526  4.266   1.00 0.00 ? 128 LEU A H    4  
ATOM 8518  H HA   . LEU A 1 128 ? 9.600   -8.498  1.769   1.00 0.00 ? 128 LEU A HA   4  
ATOM 8519  H HB2  . LEU A 1 128 ? 11.609  -6.397  2.556   1.00 0.00 ? 128 LEU A HB2  4  
ATOM 8520  H HB3  . LEU A 1 128 ? 11.098  -6.691  0.895   1.00 0.00 ? 128 LEU A HB3  4  
ATOM 8521  H HG   . LEU A 1 128 ? 9.248   -5.842  3.121   1.00 0.00 ? 128 LEU A HG   4  
ATOM 8522  H HD11 . LEU A 1 128 ? 9.348   -3.747  1.419   1.00 0.00 ? 128 LEU A HD11 4  
ATOM 8523  H HD12 . LEU A 1 128 ? 11.016  -4.313  1.340   1.00 0.00 ? 128 LEU A HD12 4  
ATOM 8524  H HD13 . LEU A 1 128 ? 10.307  -3.873  2.894   1.00 0.00 ? 128 LEU A HD13 4  
ATOM 8525  H HD21 . LEU A 1 128 ? 8.757   -6.955  0.582   1.00 0.00 ? 128 LEU A HD21 4  
ATOM 8526  H HD22 . LEU A 1 128 ? 8.368   -5.238  0.468   1.00 0.00 ? 128 LEU A HD22 4  
ATOM 8527  H HD23 . LEU A 1 128 ? 7.594   -6.239  1.698   1.00 0.00 ? 128 LEU A HD23 4  
ATOM 8528  N N    . ASN A 1 129 ? 12.703  -9.140  2.634   1.00 0.00 ? 129 ASN A N    4  
ATOM 8529  C CA   . ASN A 1 129 ? 13.871  -9.952  2.312   1.00 0.00 ? 129 ASN A CA   4  
ATOM 8530  C C    . ASN A 1 129 ? 13.469  -11.400 2.045   1.00 0.00 ? 129 ASN A C    4  
ATOM 8531  O O    . ASN A 1 129 ? 14.048  -12.066 1.188   1.00 0.00 ? 129 ASN A O    4  
ATOM 8532  C CB   . ASN A 1 129 ? 14.888  -9.895  3.453   1.00 0.00 ? 129 ASN A CB   4  
ATOM 8533  C CG   . ASN A 1 129 ? 15.816  -8.701  3.342   1.00 0.00 ? 129 ASN A CG   4  
ATOM 8534  O OD1  . ASN A 1 129 ? 15.643  -7.846  2.474   1.00 0.00 ? 129 ASN A OD1  4  
ATOM 8535  N ND2  . ASN A 1 129 ? 16.808  -8.639  4.222   1.00 0.00 ? 129 ASN A ND2  4  
ATOM 8536  H H    . ASN A 1 129 ? 12.692  -8.629  3.470   1.00 0.00 ? 129 ASN A H    4  
ATOM 8537  H HA   . ASN A 1 129 ? 14.322  -9.546  1.419   1.00 0.00 ? 129 ASN A HA   4  
ATOM 8538  H HB2  . ASN A 1 129 ? 14.361  -9.830  4.394   1.00 0.00 ? 129 ASN A HB2  4  
ATOM 8539  H HB3  . ASN A 1 129 ? 15.485  -10.795 3.442   1.00 0.00 ? 129 ASN A HB3  4  
ATOM 8540  H HD21 . ASN A 1 129 ? 16.885  -9.356  4.885   1.00 0.00 ? 129 ASN A HD21 4  
ATOM 8541  H HD22 . ASN A 1 129 ? 17.423  -7.877  4.173   1.00 0.00 ? 129 ASN A HD22 4  
ATOM 8542  N N    . GLU A 1 130 ? 12.475  -11.878 2.786   1.00 0.00 ? 130 GLU A N    4  
ATOM 8543  C CA   . GLU A 1 130 ? 11.996  -13.247 2.629   1.00 0.00 ? 130 GLU A CA   4  
ATOM 8544  C C    . GLU A 1 130 ? 11.066  -13.363 1.425   1.00 0.00 ? 130 GLU A C    4  
ATOM 8545  O O    . GLU A 1 130 ? 11.291  -14.177 0.529   1.00 0.00 ? 130 GLU A O    4  
ATOM 8546  C CB   . GLU A 1 130 ? 11.270  -13.705 3.895   1.00 0.00 ? 130 GLU A CB   4  
ATOM 8547  C CG   . GLU A 1 130 ? 12.182  -13.845 5.103   1.00 0.00 ? 130 GLU A CG   4  
ATOM 8548  C CD   . GLU A 1 130 ? 13.140  -15.014 4.979   1.00 0.00 ? 130 GLU A CD   4  
ATOM 8549  O OE1  . GLU A 1 130 ? 12.663  -16.166 4.915   1.00 0.00 ? 130 GLU A OE1  4  
ATOM 8550  O OE2  . GLU A 1 130 ? 14.365  -14.776 4.946   1.00 0.00 ? 130 GLU A OE2  4  
ATOM 8551  H H    . GLU A 1 130 ? 12.053  -11.298 3.453   1.00 0.00 ? 130 GLU A H    4  
ATOM 8552  H HA   . GLU A 1 130 ? 12.855  -13.882 2.468   1.00 0.00 ? 130 GLU A HA   4  
ATOM 8553  H HB2  . GLU A 1 130 ? 10.498  -12.988 4.133   1.00 0.00 ? 130 GLU A HB2  4  
ATOM 8554  H HB3  . GLU A 1 130 ? 10.811  -14.664 3.705   1.00 0.00 ? 130 GLU A HB3  4  
ATOM 8555  H HG2  . GLU A 1 130 ? 12.757  -12.938 5.210   1.00 0.00 ? 130 GLU A HG2  4  
ATOM 8556  H HG3  . GLU A 1 130 ? 11.572  -13.990 5.983   1.00 0.00 ? 130 GLU A HG3  4  
ATOM 8557  N N    . LEU A 1 131 ? 10.019  -12.545 1.413   1.00 0.00 ? 131 LEU A N    4  
ATOM 8558  C CA   . LEU A 1 131 ? 9.053   -12.556 0.320   1.00 0.00 ? 131 LEU A CA   4  
ATOM 8559  C C    . LEU A 1 131 ? 9.747   -12.786 -1.018  1.00 0.00 ? 131 LEU A C    4  
ATOM 8560  O O    . LEU A 1 131 ? 9.512   -13.794 -1.685  1.00 0.00 ? 131 LEU A O    4  
ATOM 8561  C CB   . LEU A 1 131 ? 8.278   -11.237 0.286   1.00 0.00 ? 131 LEU A CB   4  
ATOM 8562  C CG   . LEU A 1 131 ? 7.408   -10.938 1.506   1.00 0.00 ? 131 LEU A CG   4  
ATOM 8563  C CD1  . LEU A 1 131 ? 6.847   -9.526  1.429   1.00 0.00 ? 131 LEU A CD1  4  
ATOM 8564  C CD2  . LEU A 1 131 ? 6.282   -11.955 1.621   1.00 0.00 ? 131 LEU A CD2  4  
ATOM 8565  H H    . LEU A 1 131 ? 9.893   -11.919 2.155   1.00 0.00 ? 131 LEU A H    4  
ATOM 8566  H HA   . LEU A 1 131 ? 8.361   -13.365 0.498   1.00 0.00 ? 131 LEU A HA   4  
ATOM 8567  H HB2  . LEU A 1 131 ? 8.994   -10.436 0.186   1.00 0.00 ? 131 LEU A HB2  4  
ATOM 8568  H HB3  . LEU A 1 131 ? 7.637   -11.254 -0.584  1.00 0.00 ? 131 LEU A HB3  4  
ATOM 8569  H HG   . LEU A 1 131 ? 8.014   -11.007 2.399   1.00 0.00 ? 131 LEU A HG   4  
ATOM 8570  H HD11 . LEU A 1 131 ? 6.772   -9.114  2.424   1.00 0.00 ? 131 LEU A HD11 4  
ATOM 8571  H HD12 . LEU A 1 131 ? 5.868   -9.552  0.974   1.00 0.00 ? 131 LEU A HD12 4  
ATOM 8572  H HD13 . LEU A 1 131 ? 7.504   -8.910  0.832   1.00 0.00 ? 131 LEU A HD13 4  
ATOM 8573  H HD21 . LEU A 1 131 ? 6.385   -12.503 2.545   1.00 0.00 ? 131 LEU A HD21 4  
ATOM 8574  H HD22 . LEU A 1 131 ? 6.331   -12.641 0.787   1.00 0.00 ? 131 LEU A HD22 4  
ATOM 8575  H HD23 . LEU A 1 131 ? 5.331   -11.442 1.610   1.00 0.00 ? 131 LEU A HD23 4  
ATOM 8576  N N    . SER A 1 132 ? 10.603  -11.846 -1.405  1.00 0.00 ? 132 SER A N    4  
ATOM 8577  C CA   . SER A 1 132 ? 11.331  -11.946 -2.665  1.00 0.00 ? 132 SER A CA   4  
ATOM 8578  C C    . SER A 1 132 ? 12.284  -13.138 -2.649  1.00 0.00 ? 132 SER A C    4  
ATOM 8579  O O    . SER A 1 132 ? 12.292  -13.952 -3.571  1.00 0.00 ? 132 SER A O    4  
ATOM 8580  C CB   . SER A 1 132 ? 12.112  -10.658 -2.931  1.00 0.00 ? 132 SER A CB   4  
ATOM 8581  O OG   . SER A 1 132 ? 13.120  -10.462 -1.954  1.00 0.00 ? 132 SER A OG   4  
ATOM 8582  H H    . SER A 1 132 ? 10.748  -11.066 -0.830  1.00 0.00 ? 132 SER A H    4  
ATOM 8583  H HA   . SER A 1 132 ? 10.608  -12.089 -3.454  1.00 0.00 ? 132 SER A HA   4  
ATOM 8584  H HB2  . SER A 1 132 ? 12.576  -10.716 -3.903  1.00 0.00 ? 132 SER A HB2  4  
ATOM 8585  H HB3  . SER A 1 132 ? 11.433  -9.817  -2.905  1.00 0.00 ? 132 SER A HB3  4  
ATOM 8586  H HG   . SER A 1 132 ? 13.813  -9.905  -2.317  1.00 0.00 ? 132 SER A HG   4  
ATOM 8587  N N    . GLY A 1 133 ? 13.086  -13.232 -1.593  1.00 0.00 ? 133 GLY A N    4  
ATOM 8588  C CA   . GLY A 1 133 ? 14.032  -14.326 -1.475  1.00 0.00 ? 133 GLY A CA   4  
ATOM 8589  C C    . GLY A 1 133 ? 15.425  -13.851 -1.113  1.00 0.00 ? 133 GLY A C    4  
ATOM 8590  O O    . GLY A 1 133 ? 15.738  -12.663 -1.186  1.00 0.00 ? 133 GLY A O    4  
ATOM 8591  H H    . GLY A 1 133 ? 13.035  -12.553 -0.888  1.00 0.00 ? 133 GLY A H    4  
ATOM 8592  H HA2  . GLY A 1 133 ? 13.685  -15.007 -0.712  1.00 0.00 ? 133 GLY A HA2  4  
ATOM 8593  H HA3  . GLY A 1 133 ? 14.077  -14.851 -2.418  1.00 0.00 ? 133 GLY A HA3  4  
ATOM 8594  N N    . PRO A 1 134 ? 16.290  -14.794 -0.710  1.00 0.00 ? 134 PRO A N    4  
ATOM 8595  C CA   . PRO A 1 134 ? 17.672  -14.489 -0.326  1.00 0.00 ? 134 PRO A CA   4  
ATOM 8596  C C    . PRO A 1 134 ? 18.527  -14.076 -1.519  1.00 0.00 ? 134 PRO A C    4  
ATOM 8597  O O    . PRO A 1 134 ? 19.685  -13.689 -1.360  1.00 0.00 ? 134 PRO A O    4  
ATOM 8598  C CB   . PRO A 1 134 ? 18.176  -15.810 0.262   1.00 0.00 ? 134 PRO A CB   4  
ATOM 8599  C CG   . PRO A 1 134 ? 17.336  -16.857 -0.384  1.00 0.00 ? 134 PRO A CG   4  
ATOM 8600  C CD   . PRO A 1 134 ? 15.986  -16.231 -0.599  1.00 0.00 ? 134 PRO A CD   4  
ATOM 8601  H HA   . PRO A 1 134 ? 17.712  -13.718 0.429   1.00 0.00 ? 134 PRO A HA   4  
ATOM 8602  H HB2  . PRO A 1 134 ? 19.222  -15.938 0.021   1.00 0.00 ? 134 PRO A HB2  4  
ATOM 8603  H HB3  . PRO A 1 134 ? 18.045  -15.804 1.333   1.00 0.00 ? 134 PRO A HB3  4  
ATOM 8604  H HG2  . PRO A 1 134 ? 17.770  -17.146 -1.329  1.00 0.00 ? 134 PRO A HG2  4  
ATOM 8605  H HG3  . PRO A 1 134 ? 17.251  -17.713 0.269   1.00 0.00 ? 134 PRO A HG3  4  
ATOM 8606  H HD2  . PRO A 1 134 ? 15.538  -16.602 -1.509  1.00 0.00 ? 134 PRO A HD2  4  
ATOM 8607  H HD3  . PRO A 1 134 ? 15.341  -16.423 0.246   1.00 0.00 ? 134 PRO A HD3  4  
ATOM 8608  N N    . SER A 1 135 ? 17.950  -14.161 -2.713  1.00 0.00 ? 135 SER A N    4  
ATOM 8609  C CA   . SER A 1 135 ? 18.661  -13.798 -3.933  1.00 0.00 ? 135 SER A CA   4  
ATOM 8610  C C    . SER A 1 135 ? 19.078  -12.331 -3.904  1.00 0.00 ? 135 SER A C    4  
ATOM 8611  O O    . SER A 1 135 ? 18.255  -11.445 -3.669  1.00 0.00 ? 135 SER A O    4  
ATOM 8612  C CB   . SER A 1 135 ? 17.785  -14.067 -5.158  1.00 0.00 ? 135 SER A CB   4  
ATOM 8613  O OG   . SER A 1 135 ? 18.573  -14.221 -6.325  1.00 0.00 ? 135 SER A OG   4  
ATOM 8614  H H    . SER A 1 135 ? 17.024  -14.477 -2.775  1.00 0.00 ? 135 SER A H    4  
ATOM 8615  H HA   . SER A 1 135 ? 19.548  -14.411 -3.994  1.00 0.00 ? 135 SER A HA   4  
ATOM 8616  H HB2  . SER A 1 135 ? 17.217  -14.971 -5.000  1.00 0.00 ? 135 SER A HB2  4  
ATOM 8617  H HB3  . SER A 1 135 ? 17.108  -13.237 -5.302  1.00 0.00 ? 135 SER A HB3  4  
ATOM 8618  H HG   . SER A 1 135 ? 18.532  -15.134 -6.621  1.00 0.00 ? 135 SER A HG   4  
ATOM 8619  N N    . SER A 1 136 ? 20.361  -12.082 -4.144  1.00 0.00 ? 136 SER A N    4  
ATOM 8620  C CA   . SER A 1 136 ? 20.889  -10.723 -4.142  1.00 0.00 ? 136 SER A CA   4  
ATOM 8621  C C    . SER A 1 136 ? 20.118  -9.838  -5.116  1.00 0.00 ? 136 SER A C    4  
ATOM 8622  O O    . SER A 1 136 ? 19.812  -10.248 -6.235  1.00 0.00 ? 136 SER A O    4  
ATOM 8623  C CB   . SER A 1 136 ? 22.375  -10.729 -4.508  1.00 0.00 ? 136 SER A CB   4  
ATOM 8624  O OG   . SER A 1 136 ? 23.098  -11.628 -3.685  1.00 0.00 ? 136 SER A OG   4  
ATOM 8625  H H    . SER A 1 136 ? 20.967  -12.831 -4.325  1.00 0.00 ? 136 SER A H    4  
ATOM 8626  H HA   . SER A 1 136 ? 20.775  -10.324 -3.145  1.00 0.00 ? 136 SER A HA   4  
ATOM 8627  H HB2  . SER A 1 136 ? 22.488  -11.033 -5.537  1.00 0.00 ? 136 SER A HB2  4  
ATOM 8628  H HB3  . SER A 1 136 ? 22.779  -9.736  -4.379  1.00 0.00 ? 136 SER A HB3  4  
ATOM 8629  H HG   . SER A 1 136 ? 23.357  -12.396 -4.199  1.00 0.00 ? 136 SER A HG   4  
ATOM 8630  N N    . GLY A 1 137 ? 19.806  -8.621  -4.682  1.00 0.00 ? 137 GLY A N    4  
ATOM 8631  C CA   . GLY A 1 137 ? 19.073  -7.696  -5.527  1.00 0.00 ? 137 GLY A CA   4  
ATOM 8632  C C    . GLY A 1 137 ? 18.382  -6.607  -4.731  1.00 0.00 ? 137 GLY A C    4  
ATOM 8633  O O    . GLY A 1 137 ? 18.680  -6.404  -3.554  1.00 0.00 ? 137 GLY A O    4  
ATOM 8634  H H    . GLY A 1 137 ? 20.076  -8.348  -3.780  1.00 0.00 ? 137 GLY A H    4  
ATOM 8635  H HA2  . GLY A 1 137 ? 19.760  -7.239  -6.222  1.00 0.00 ? 137 GLY A HA2  4  
ATOM 8636  H HA3  . GLY A 1 137 ? 18.328  -8.248  -6.082  1.00 0.00 ? 137 GLY A HA3  4  
ATOM 8637  N N    . GLY A 1 1   ? 15.520  -3.837  -16.300 1.00 0.00 ? 1   GLY A N    5  
ATOM 8638  C CA   . GLY A 1 1   ? 14.856  -3.824  -15.010 1.00 0.00 ? 1   GLY A CA   5  
ATOM 8639  C C    . GLY A 1 1   ? 15.511  -2.871  -14.030 1.00 0.00 ? 1   GLY A C    5  
ATOM 8640  O O    . GLY A 1 1   ? 16.716  -2.947  -13.791 1.00 0.00 ? 1   GLY A O    5  
ATOM 8641  H H1   . GLY A 1 1   ? 16.497  -3.778  -16.347 1.00 0.00 ? 1   GLY A H1   5  
ATOM 8642  H HA2  . GLY A 1 1   ? 13.827  -3.530  -15.150 1.00 0.00 ? 1   GLY A HA2  5  
ATOM 8643  H HA3  . GLY A 1 1   ? 14.881  -4.822  -14.596 1.00 0.00 ? 1   GLY A HA3  5  
ATOM 8644  N N    . SER A 1 2   ? 14.716  -1.969  -13.463 1.00 0.00 ? 2   SER A N    5  
ATOM 8645  C CA   . SER A 1 2   ? 15.227  -0.993  -12.508 1.00 0.00 ? 2   SER A CA   5  
ATOM 8646  C C    . SER A 1 2   ? 16.627  -0.532  -12.899 1.00 0.00 ? 2   SER A C    5  
ATOM 8647  O O    . SER A 1 2   ? 17.509  -0.401  -12.050 1.00 0.00 ? 2   SER A O    5  
ATOM 8648  C CB   . SER A 1 2   ? 15.249  -1.590  -11.099 1.00 0.00 ? 2   SER A CB   5  
ATOM 8649  O OG   . SER A 1 2   ? 16.096  -2.724  -11.039 1.00 0.00 ? 2   SER A OG   5  
ATOM 8650  H H    . SER A 1 2   ? 13.763  -1.959  -13.695 1.00 0.00 ? 2   SER A H    5  
ATOM 8651  H HA   . SER A 1 2   ? 14.564  -0.141  -12.518 1.00 0.00 ? 2   SER A HA   5  
ATOM 8652  H HB2  . SER A 1 2   ? 15.610  -0.849  -10.403 1.00 0.00 ? 2   SER A HB2  5  
ATOM 8653  H HB3  . SER A 1 2   ? 14.248  -1.887  -10.822 1.00 0.00 ? 2   SER A HB3  5  
ATOM 8654  H HG   . SER A 1 2   ? 16.548  -2.832  -11.879 1.00 0.00 ? 2   SER A HG   5  
ATOM 8655  N N    . SER A 1 3   ? 16.824  -0.287  -14.190 1.00 0.00 ? 3   SER A N    5  
ATOM 8656  C CA   . SER A 1 3   ? 18.118  0.157   -14.696 1.00 0.00 ? 3   SER A CA   5  
ATOM 8657  C C    . SER A 1 3   ? 18.627  1.359   -13.907 1.00 0.00 ? 3   SER A C    5  
ATOM 8658  O O    . SER A 1 3   ? 19.779  1.391   -13.477 1.00 0.00 ? 3   SER A O    5  
ATOM 8659  C CB   . SER A 1 3   ? 18.014  0.513   -16.180 1.00 0.00 ? 3   SER A CB   5  
ATOM 8660  O OG   . SER A 1 3   ? 17.180  1.643   -16.376 1.00 0.00 ? 3   SER A OG   5  
ATOM 8661  H H    . SER A 1 3   ? 16.081  -0.409  -14.818 1.00 0.00 ? 3   SER A H    5  
ATOM 8662  H HA   . SER A 1 3   ? 18.816  -0.658  -14.579 1.00 0.00 ? 3   SER A HA   5  
ATOM 8663  H HB2  . SER A 1 3   ? 18.997  0.737   -16.564 1.00 0.00 ? 3   SER A HB2  5  
ATOM 8664  H HB3  . SER A 1 3   ? 17.598  -0.325  -16.721 1.00 0.00 ? 3   SER A HB3  5  
ATOM 8665  H HG   . SER A 1 3   ? 17.322  1.996   -17.257 1.00 0.00 ? 3   SER A HG   5  
ATOM 8666  N N    . GLY A 1 4   ? 17.757  2.348   -13.720 1.00 0.00 ? 4   GLY A N    5  
ATOM 8667  C CA   . GLY A 1 4   ? 18.136  3.539   -12.984 1.00 0.00 ? 4   GLY A CA   5  
ATOM 8668  C C    . GLY A 1 4   ? 17.190  4.698   -13.229 1.00 0.00 ? 4   GLY A C    5  
ATOM 8669  O O    . GLY A 1 4   ? 16.481  4.727   -14.234 1.00 0.00 ? 4   GLY A O    5  
ATOM 8670  H H    . GLY A 1 4   ? 16.852  2.267   -14.086 1.00 0.00 ? 4   GLY A H    5  
ATOM 8671  H HA2  . GLY A 1 4   ? 18.142  3.310   -11.929 1.00 0.00 ? 4   GLY A HA2  5  
ATOM 8672  H HA3  . GLY A 1 4   ? 19.131  3.833   -13.284 1.00 0.00 ? 4   GLY A HA3  5  
ATOM 8673  N N    . SER A 1 5   ? 17.178  5.655   -12.307 1.00 0.00 ? 5   SER A N    5  
ATOM 8674  C CA   . SER A 1 5   ? 16.307  6.819   -12.425 1.00 0.00 ? 5   SER A CA   5  
ATOM 8675  C C    . SER A 1 5   ? 14.919  6.412   -12.909 1.00 0.00 ? 5   SER A C    5  
ATOM 8676  O O    . SER A 1 5   ? 14.300  7.110   -13.712 1.00 0.00 ? 5   SER A O    5  
ATOM 8677  C CB   . SER A 1 5   ? 16.915  7.842   -13.387 1.00 0.00 ? 5   SER A CB   5  
ATOM 8678  O OG   . SER A 1 5   ? 18.106  8.397   -12.855 1.00 0.00 ? 5   SER A OG   5  
ATOM 8679  H H    . SER A 1 5   ? 17.767  5.575   -11.527 1.00 0.00 ? 5   SER A H    5  
ATOM 8680  H HA   . SER A 1 5   ? 16.218  7.267   -11.446 1.00 0.00 ? 5   SER A HA   5  
ATOM 8681  H HB2  . SER A 1 5   ? 17.145  7.358   -14.324 1.00 0.00 ? 5   SER A HB2  5  
ATOM 8682  H HB3  . SER A 1 5   ? 16.205  8.638   -13.557 1.00 0.00 ? 5   SER A HB3  5  
ATOM 8683  H HG   . SER A 1 5   ? 18.673  8.686   -13.573 1.00 0.00 ? 5   SER A HG   5  
ATOM 8684  N N    . SER A 1 6   ? 14.435  5.277   -12.413 1.00 0.00 ? 6   SER A N    5  
ATOM 8685  C CA   . SER A 1 6   ? 13.122  4.774   -12.796 1.00 0.00 ? 6   SER A CA   5  
ATOM 8686  C C    . SER A 1 6   ? 12.054  5.231   -11.806 1.00 0.00 ? 6   SER A C    5  
ATOM 8687  O O    . SER A 1 6   ? 11.101  5.915   -12.175 1.00 0.00 ? 6   SER A O    5  
ATOM 8688  C CB   . SER A 1 6   ? 13.141  3.246   -12.875 1.00 0.00 ? 6   SER A CB   5  
ATOM 8689  O OG   . SER A 1 6   ? 11.890  2.742   -13.310 1.00 0.00 ? 6   SER A OG   5  
ATOM 8690  H H    . SER A 1 6   ? 14.976  4.766   -11.775 1.00 0.00 ? 6   SER A H    5  
ATOM 8691  H HA   . SER A 1 6   ? 12.885  5.173   -13.771 1.00 0.00 ? 6   SER A HA   5  
ATOM 8692  H HB2  . SER A 1 6   ? 13.903  2.934   -13.572 1.00 0.00 ? 6   SER A HB2  5  
ATOM 8693  H HB3  . SER A 1 6   ? 13.358  2.841   -11.897 1.00 0.00 ? 6   SER A HB3  5  
ATOM 8694  H HG   . SER A 1 6   ? 12.001  2.291   -14.150 1.00 0.00 ? 6   SER A HG   5  
ATOM 8695  N N    . GLY A 1 7   ? 12.223  4.845   -10.545 1.00 0.00 ? 7   GLY A N    5  
ATOM 8696  C CA   . GLY A 1 7   ? 11.267  5.223   -9.520  1.00 0.00 ? 7   GLY A CA   5  
ATOM 8697  C C    . GLY A 1 7   ? 9.847   5.286   -10.046 1.00 0.00 ? 7   GLY A C    5  
ATOM 8698  O O    . GLY A 1 7   ? 9.297   6.370   -10.240 1.00 0.00 ? 7   GLY A O    5  
ATOM 8699  H H    . GLY A 1 7   ? 13.002  4.299   -10.308 1.00 0.00 ? 7   GLY A H    5  
ATOM 8700  H HA2  . GLY A 1 7   ? 11.311  4.501   -8.718  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 8701  H HA3  . GLY A 1 7   ? 11.538  6.194   -9.132  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 8702  N N    . TYR A 1 8   ? 9.252   4.121   -10.280 1.00 0.00 ? 8   TYR A N    5  
ATOM 8703  C CA   . TYR A 1 8   ? 7.889   4.049   -10.791 1.00 0.00 ? 8   TYR A CA   5  
ATOM 8704  C C    . TYR A 1 8   ? 7.019   3.169   -9.899  1.00 0.00 ? 8   TYR A C    5  
ATOM 8705  O O    . TYR A 1 8   ? 7.460   2.125   -9.417  1.00 0.00 ? 8   TYR A O    5  
ATOM 8706  C CB   . TYR A 1 8   ? 7.886   3.504   -12.221 1.00 0.00 ? 8   TYR A CB   5  
ATOM 8707  C CG   . TYR A 1 8   ? 7.873   1.994   -12.294 1.00 0.00 ? 8   TYR A CG   5  
ATOM 8708  C CD1  . TYR A 1 8   ? 9.011   1.255   -11.993 1.00 0.00 ? 8   TYR A CD1  5  
ATOM 8709  C CD2  . TYR A 1 8   ? 6.724   1.307   -12.664 1.00 0.00 ? 8   TYR A CD2  5  
ATOM 8710  C CE1  . TYR A 1 8   ? 9.004   -0.125  -12.059 1.00 0.00 ? 8   TYR A CE1  5  
ATOM 8711  C CE2  . TYR A 1 8   ? 6.707   -0.073  -12.731 1.00 0.00 ? 8   TYR A CE2  5  
ATOM 8712  C CZ   . TYR A 1 8   ? 7.850   -0.784  -12.428 1.00 0.00 ? 8   TYR A CZ   5  
ATOM 8713  O OH   . TYR A 1 8   ? 7.838   -2.159  -12.495 1.00 0.00 ? 8   TYR A OH   5  
ATOM 8714  H H    . TYR A 1 8   ? 9.742   3.291   -10.106 1.00 0.00 ? 8   TYR A H    5  
ATOM 8715  H HA   . TYR A 1 8   ? 7.483   5.050   -10.797 1.00 0.00 ? 8   TYR A HA   5  
ATOM 8716  H HB2  . TYR A 1 8   ? 7.011   3.868   -12.735 1.00 0.00 ? 8   TYR A HB2  5  
ATOM 8717  H HB3  . TYR A 1 8   ? 8.771   3.854   -12.733 1.00 0.00 ? 8   TYR A HB3  5  
ATOM 8718  H HD1  . TYR A 1 8   ? 9.913   1.774   -11.705 1.00 0.00 ? 8   TYR A HD1  5  
ATOM 8719  H HD2  . TYR A 1 8   ? 5.831   1.867   -12.901 1.00 0.00 ? 8   TYR A HD2  5  
ATOM 8720  H HE1  . TYR A 1 8   ? 9.898   -0.683  -11.822 1.00 0.00 ? 8   TYR A HE1  5  
ATOM 8721  H HE2  . TYR A 1 8   ? 5.804   -0.589  -13.020 1.00 0.00 ? 8   TYR A HE2  5  
ATOM 8722  H HH   . TYR A 1 8   ? 8.739   -2.484  -12.554 1.00 0.00 ? 8   TYR A HH   5  
ATOM 8723  N N    . ILE A 1 9   ? 5.780   3.598   -9.683  1.00 0.00 ? 9   ILE A N    5  
ATOM 8724  C CA   . ILE A 1 9   ? 4.846   2.850   -8.851  1.00 0.00 ? 9   ILE A CA   5  
ATOM 8725  C C    . ILE A 1 9   ? 3.488   2.718   -9.531  1.00 0.00 ? 9   ILE A C    5  
ATOM 8726  O O    . ILE A 1 9   ? 2.936   3.695   -10.038 1.00 0.00 ? 9   ILE A O    5  
ATOM 8727  C CB   . ILE A 1 9   ? 4.657   3.519   -7.477  1.00 0.00 ? 9   ILE A CB   5  
ATOM 8728  C CG1  . ILE A 1 9   ? 5.974   3.519   -6.699  1.00 0.00 ? 9   ILE A CG1  5  
ATOM 8729  C CG2  . ILE A 1 9   ? 3.569   2.807   -6.686  1.00 0.00 ? 9   ILE A CG2  5  
ATOM 8730  C CD1  . ILE A 1 9   ? 6.055   4.602   -5.646  1.00 0.00 ? 9   ILE A CD1  5  
ATOM 8731  H H    . ILE A 1 9   ? 5.486   4.438   -10.095 1.00 0.00 ? 9   ILE A H    5  
ATOM 8732  H HA   . ILE A 1 9   ? 5.257   1.863   -8.695  1.00 0.00 ? 9   ILE A HA   5  
ATOM 8733  H HB   . ILE A 1 9   ? 4.342   4.539   -7.638  1.00 0.00 ? 9   ILE A HB   5  
ATOM 8734  H HG12 . ILE A 1 9   ? 6.093   2.568   -6.204  1.00 0.00 ? 9   ILE A HG12 5  
ATOM 8735  H HG13 . ILE A 1 9   ? 6.792   3.665   -7.390  1.00 0.00 ? 9   ILE A HG13 5  
ATOM 8736  H HG21 . ILE A 1 9   ? 4.007   2.324   -5.825  1.00 0.00 ? 9   ILE A HG21 5  
ATOM 8737  H HG22 . ILE A 1 9   ? 2.833   3.527   -6.359  1.00 0.00 ? 9   ILE A HG22 5  
ATOM 8738  H HG23 . ILE A 1 9   ? 3.095   2.067   -7.313  1.00 0.00 ? 9   ILE A HG23 5  
ATOM 8739  H HD11 . ILE A 1 9   ? 7.070   4.678   -5.284  1.00 0.00 ? 9   ILE A HD11 5  
ATOM 8740  H HD12 . ILE A 1 9   ? 5.754   5.546   -6.076  1.00 0.00 ? 9   ILE A HD12 5  
ATOM 8741  H HD13 . ILE A 1 9   ? 5.398   4.355   -4.825  1.00 0.00 ? 9   ILE A HD13 5  
ATOM 8742  N N    . LYS A 1 10  ? 2.952   1.502   -9.537  1.00 0.00 ? 10  LYS A N    5  
ATOM 8743  C CA   . LYS A 1 10  ? 1.655   1.240   -10.151 1.00 0.00 ? 10  LYS A CA   5  
ATOM 8744  C C    . LYS A 1 10  ? 0.519   1.634   -9.213  1.00 0.00 ? 10  LYS A C    5  
ATOM 8745  O O    . LYS A 1 10  ? 0.273   0.969   -8.207  1.00 0.00 ? 10  LYS A O    5  
ATOM 8746  C CB   . LYS A 1 10  ? 1.534   -0.240  -10.523 1.00 0.00 ? 10  LYS A CB   5  
ATOM 8747  C CG   . LYS A 1 10  ? 0.352   -0.545  -11.426 1.00 0.00 ? 10  LYS A CG   5  
ATOM 8748  C CD   . LYS A 1 10  ? -0.060  -2.004  -11.332 1.00 0.00 ? 10  LYS A CD   5  
ATOM 8749  C CE   . LYS A 1 10  ? -1.227  -2.315  -12.257 1.00 0.00 ? 10  LYS A CE   5  
ATOM 8750  N NZ   . LYS A 1 10  ? -2.333  -1.329  -12.105 1.00 0.00 ? 10  LYS A NZ   5  
ATOM 8751  H H    . LYS A 1 10  ? 3.439   0.762   -9.116  1.00 0.00 ? 10  LYS A H    5  
ATOM 8752  H HA   . LYS A 1 10  ? 1.588   1.835   -11.049 1.00 0.00 ? 10  LYS A HA   5  
ATOM 8753  H HB2  . LYS A 1 10  ? 2.437   -0.546  -11.031 1.00 0.00 ? 10  LYS A HB2  5  
ATOM 8754  H HB3  . LYS A 1 10  ? 1.427   -0.819  -9.617  1.00 0.00 ? 10  LYS A HB3  5  
ATOM 8755  H HG2  . LYS A 1 10  ? -0.483  0.074   -11.133 1.00 0.00 ? 10  LYS A HG2  5  
ATOM 8756  H HG3  . LYS A 1 10  ? 0.625   -0.322  -12.448 1.00 0.00 ? 10  LYS A HG3  5  
ATOM 8757  H HD2  . LYS A 1 10  ? 0.779   -2.625  -11.609 1.00 0.00 ? 10  LYS A HD2  5  
ATOM 8758  H HD3  . LYS A 1 10  ? -0.351  -2.222  -10.314 1.00 0.00 ? 10  LYS A HD3  5  
ATOM 8759  H HE2  . LYS A 1 10  ? -0.876  -2.295  -13.277 1.00 0.00 ? 10  LYS A HE2  5  
ATOM 8760  H HE3  . LYS A 1 10  ? -1.601  -3.301  -12.024 1.00 0.00 ? 10  LYS A HE3  5  
ATOM 8761  H HZ1  . LYS A 1 10  ? -1.996  -0.375  -12.348 1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 8762  H HZ2  . LYS A 1 10  ? -2.674  -1.324  -11.123 1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 8763  H HZ3  . LYS A 1 10  ? -3.122  -1.578  -12.734 1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 8764  N N    . TYR A 1 11  ? -0.171  2.718   -9.550  1.00 0.00 ? 11  TYR A N    5  
ATOM 8765  C CA   . TYR A 1 11  ? -1.281  3.200   -8.737  1.00 0.00 ? 11  TYR A CA   5  
ATOM 8766  C C    . TYR A 1 11  ? -2.534  2.363   -8.974  1.00 0.00 ? 11  TYR A C    5  
ATOM 8767  O O    . TYR A 1 11  ? -2.725  1.800   -10.052 1.00 0.00 ? 11  TYR A O    5  
ATOM 8768  C CB   . TYR A 1 11  ? -1.569  4.669   -9.051  1.00 0.00 ? 11  TYR A CB   5  
ATOM 8769  C CG   . TYR A 1 11  ? -0.430  5.599   -8.699  1.00 0.00 ? 11  TYR A CG   5  
ATOM 8770  C CD1  . TYR A 1 11  ? 0.698   5.684   -9.507  1.00 0.00 ? 11  TYR A CD1  5  
ATOM 8771  C CD2  . TYR A 1 11  ? -0.479  6.391   -7.559  1.00 0.00 ? 11  TYR A CD2  5  
ATOM 8772  C CE1  . TYR A 1 11  ? 1.742   6.531   -9.189  1.00 0.00 ? 11  TYR A CE1  5  
ATOM 8773  C CE2  . TYR A 1 11  ? 0.559   7.241   -7.234  1.00 0.00 ? 11  TYR A CE2  5  
ATOM 8774  C CZ   . TYR A 1 11  ? 1.668   7.308   -8.052  1.00 0.00 ? 11  TYR A CZ   5  
ATOM 8775  O OH   . TYR A 1 11  ? 2.705   8.153   -7.732  1.00 0.00 ? 11  TYR A OH   5  
ATOM 8776  H H    . TYR A 1 11  ? 0.072   3.206   -10.364 1.00 0.00 ? 11  TYR A H    5  
ATOM 8777  H HA   . TYR A 1 11  ? -0.995  3.114   -7.699  1.00 0.00 ? 11  TYR A HA   5  
ATOM 8778  H HB2  . TYR A 1 11  ? -1.767  4.773   -10.106 1.00 0.00 ? 11  TYR A HB2  5  
ATOM 8779  H HB3  . TYR A 1 11  ? -2.439  4.985   -8.494  1.00 0.00 ? 11  TYR A HB3  5  
ATOM 8780  H HD1  . TYR A 1 11  ? 0.753   5.074   -10.397 1.00 0.00 ? 11  TYR A HD1  5  
ATOM 8781  H HD2  . TYR A 1 11  ? -1.349  6.336   -6.920  1.00 0.00 ? 11  TYR A HD2  5  
ATOM 8782  H HE1  . TYR A 1 11  ? 2.610   6.583   -9.830  1.00 0.00 ? 11  TYR A HE1  5  
ATOM 8783  H HE2  . TYR A 1 11  ? 0.502   7.850   -6.343  1.00 0.00 ? 11  TYR A HE2  5  
ATOM 8784  H HH   . TYR A 1 11  ? 2.478   9.050   -7.989  1.00 0.00 ? 11  TYR A HH   5  
ATOM 8785  N N    . PHE A 1 12  ? -3.387  2.286   -7.957  1.00 0.00 ? 12  PHE A N    5  
ATOM 8786  C CA   . PHE A 1 12  ? -4.622  1.517   -8.052  1.00 0.00 ? 12  PHE A CA   5  
ATOM 8787  C C    . PHE A 1 12  ? -5.836  2.404   -7.791  1.00 0.00 ? 12  PHE A C    5  
ATOM 8788  O O    . PHE A 1 12  ? -5.704  3.529   -7.312  1.00 0.00 ? 12  PHE A O    5  
ATOM 8789  C CB   . PHE A 1 12  ? -4.603  0.354   -7.058  1.00 0.00 ? 12  PHE A CB   5  
ATOM 8790  C CG   . PHE A 1 12  ? -3.671  -0.756  -7.452  1.00 0.00 ? 12  PHE A CG   5  
ATOM 8791  C CD1  . PHE A 1 12  ? -3.876  -1.468  -8.623  1.00 0.00 ? 12  PHE A CD1  5  
ATOM 8792  C CD2  . PHE A 1 12  ? -2.591  -1.088  -6.651  1.00 0.00 ? 12  PHE A CD2  5  
ATOM 8793  C CE1  . PHE A 1 12  ? -3.021  -2.490  -8.988  1.00 0.00 ? 12  PHE A CE1  5  
ATOM 8794  C CE2  . PHE A 1 12  ? -1.731  -2.109  -7.011  1.00 0.00 ? 12  PHE A CE2  5  
ATOM 8795  C CZ   . PHE A 1 12  ? -1.948  -2.811  -8.181  1.00 0.00 ? 12  PHE A CZ   5  
ATOM 8796  H H    . PHE A 1 12  ? -3.179  2.756   -7.123  1.00 0.00 ? 12  PHE A H    5  
ATOM 8797  H HA   . PHE A 1 12  ? -4.689  1.122   -9.054  1.00 0.00 ? 12  PHE A HA   5  
ATOM 8798  H HB2  . PHE A 1 12  ? -4.291  0.722   -6.092  1.00 0.00 ? 12  PHE A HB2  5  
ATOM 8799  H HB3  . PHE A 1 12  ? -5.597  -0.058  -6.978  1.00 0.00 ? 12  PHE A HB3  5  
ATOM 8800  H HD1  . PHE A 1 12  ? -4.716  -1.217  -9.255  1.00 0.00 ? 12  PHE A HD1  5  
ATOM 8801  H HD2  . PHE A 1 12  ? -2.421  -0.541  -5.735  1.00 0.00 ? 12  PHE A HD2  5  
ATOM 8802  H HE1  . PHE A 1 12  ? -3.193  -3.037  -9.903  1.00 0.00 ? 12  PHE A HE1  5  
ATOM 8803  H HE2  . PHE A 1 12  ? -0.893  -2.359  -6.378  1.00 0.00 ? 12  PHE A HE2  5  
ATOM 8804  H HZ   . PHE A 1 12  ? -1.277  -3.609  -8.465  1.00 0.00 ? 12  PHE A HZ   5  
ATOM 8805  N N    . ASN A 1 13  ? -7.018  1.888   -8.112  1.00 0.00 ? 13  ASN A N    5  
ATOM 8806  C CA   . ASN A 1 13  ? -8.257  2.633   -7.913  1.00 0.00 ? 13  ASN A CA   5  
ATOM 8807  C C    . ASN A 1 13  ? -9.059  2.055   -6.752  1.00 0.00 ? 13  ASN A C    5  
ATOM 8808  O O    . ASN A 1 13  ? -8.655  1.069   -6.135  1.00 0.00 ? 13  ASN A O    5  
ATOM 8809  C CB   . ASN A 1 13  ? -9.099  2.612   -9.190  1.00 0.00 ? 13  ASN A CB   5  
ATOM 8810  C CG   . ASN A 1 13  ? -9.908  3.883   -9.370  1.00 0.00 ? 13  ASN A CG   5  
ATOM 8811  O OD1  . ASN A 1 13  ? -10.267 4.546   -8.397  1.00 0.00 ? 13  ASN A OD1  5  
ATOM 8812  N ND2  . ASN A 1 13  ? -10.199 4.227   -10.619 1.00 0.00 ? 13  ASN A ND2  5  
ATOM 8813  H H    . ASN A 1 13  ? -7.060  0.985   -8.491  1.00 0.00 ? 13  ASN A H    5  
ATOM 8814  H HA   . ASN A 1 13  ? -7.995  3.655   -7.682  1.00 0.00 ? 13  ASN A HA   5  
ATOM 8815  H HB2  . ASN A 1 13  ? -8.445  2.501   -10.043 1.00 0.00 ? 13  ASN A HB2  5  
ATOM 8816  H HB3  . ASN A 1 13  ? -9.780  1.776   -9.152  1.00 0.00 ? 13  ASN A HB3  5  
ATOM 8817  H HD21 . ASN A 1 13  ? -9.880  3.650   -11.345 1.00 0.00 ? 13  ASN A HD21 5  
ATOM 8818  H HD22 . ASN A 1 13  ? -10.720 5.044   -10.764 1.00 0.00 ? 13  ASN A HD22 5  
ATOM 8819  N N    . ASP A 1 14  ? -10.198 2.674   -6.461  1.00 0.00 ? 14  ASP A N    5  
ATOM 8820  C CA   . ASP A 1 14  ? -11.059 2.221   -5.375  1.00 0.00 ? 14  ASP A CA   5  
ATOM 8821  C C    . ASP A 1 14  ? -11.751 0.911   -5.741  1.00 0.00 ? 14  ASP A C    5  
ATOM 8822  O O    . ASP A 1 14  ? -12.123 0.127   -4.867  1.00 0.00 ? 14  ASP A O    5  
ATOM 8823  C CB   . ASP A 1 14  ? -12.103 3.288   -5.043  1.00 0.00 ? 14  ASP A CB   5  
ATOM 8824  C CG   . ASP A 1 14  ? -13.044 3.557   -6.201  1.00 0.00 ? 14  ASP A CG   5  
ATOM 8825  O OD1  . ASP A 1 14  ? -13.987 2.763   -6.396  1.00 0.00 ? 14  ASP A OD1  5  
ATOM 8826  O OD2  . ASP A 1 14  ? -12.837 4.564   -6.911  1.00 0.00 ? 14  ASP A OD2  5  
ATOM 8827  H H    . ASP A 1 14  ? -10.466 3.455   -6.989  1.00 0.00 ? 14  ASP A H    5  
ATOM 8828  H HA   . ASP A 1 14  ? -10.439 2.055   -4.507  1.00 0.00 ? 14  ASP A HA   5  
ATOM 8829  H HB2  . ASP A 1 14  ? -12.688 2.959   -4.197  1.00 0.00 ? 14  ASP A HB2  5  
ATOM 8830  H HB3  . ASP A 1 14  ? -11.598 4.209   -4.790  1.00 0.00 ? 14  ASP A HB3  5  
ATOM 8831  N N    . LYS A 1 15  ? -11.922 0.681   -7.038  1.00 0.00 ? 15  LYS A N    5  
ATOM 8832  C CA   . LYS A 1 15  ? -12.569 -0.533  -7.521  1.00 0.00 ? 15  LYS A CA   5  
ATOM 8833  C C    . LYS A 1 15  ? -11.538 -1.527  -8.047  1.00 0.00 ? 15  LYS A C    5  
ATOM 8834  O O    . LYS A 1 15  ? -11.560 -2.706  -7.692  1.00 0.00 ? 15  LYS A O    5  
ATOM 8835  C CB   . LYS A 1 15  ? -13.575 -0.195  -8.624  1.00 0.00 ? 15  LYS A CB   5  
ATOM 8836  C CG   . LYS A 1 15  ? -14.364 -1.396  -9.117  1.00 0.00 ? 15  LYS A CG   5  
ATOM 8837  C CD   . LYS A 1 15  ? -13.671 -2.076  -10.285 1.00 0.00 ? 15  LYS A CD   5  
ATOM 8838  C CE   . LYS A 1 15  ? -14.265 -3.449  -10.562 1.00 0.00 ? 15  LYS A CE   5  
ATOM 8839  N NZ   . LYS A 1 15  ? -15.678 -3.359  -11.022 1.00 0.00 ? 15  LYS A NZ   5  
ATOM 8840  H H    . LYS A 1 15  ? -11.604 1.344   -7.687  1.00 0.00 ? 15  LYS A H    5  
ATOM 8841  H HA   . LYS A 1 15  ? -13.094 -0.982  -6.692  1.00 0.00 ? 15  LYS A HA   5  
ATOM 8842  H HB2  . LYS A 1 15  ? -14.273 0.538   -8.246  1.00 0.00 ? 15  LYS A HB2  5  
ATOM 8843  H HB3  . LYS A 1 15  ? -13.042 0.229   -9.463  1.00 0.00 ? 15  LYS A HB3  5  
ATOM 8844  H HG2  . LYS A 1 15  ? -14.465 -2.105  -8.309  1.00 0.00 ? 15  LYS A HG2  5  
ATOM 8845  H HG3  . LYS A 1 15  ? -15.343 -1.066  -9.433  1.00 0.00 ? 15  LYS A HG3  5  
ATOM 8846  H HD2  . LYS A 1 15  ? -13.784 -1.463  -11.167 1.00 0.00 ? 15  LYS A HD2  5  
ATOM 8847  H HD3  . LYS A 1 15  ? -12.621 -2.188  -10.054 1.00 0.00 ? 15  LYS A HD3  5  
ATOM 8848  H HE2  . LYS A 1 15  ? -13.677 -3.933  -11.327 1.00 0.00 ? 15  LYS A HE2  5  
ATOM 8849  H HE3  . LYS A 1 15  ? -14.226 -4.033  -9.655  1.00 0.00 ? 15  LYS A HE3  5  
ATOM 8850  H HZ1  . LYS A 1 15  ? -16.180 -4.245  -10.808 1.00 0.00 ? 15  LYS A HZ1  5  
ATOM 8851  H HZ2  . LYS A 1 15  ? -15.711 -3.195  -12.048 1.00 0.00 ? 15  LYS A HZ2  5  
ATOM 8852  H HZ3  . LYS A 1 15  ? -16.162 -2.575  -10.540 1.00 0.00 ? 15  LYS A HZ3  5  
ATOM 8853  N N    . THR A 1 16  ? -10.634 -1.044  -8.893  1.00 0.00 ? 16  THR A N    5  
ATOM 8854  C CA   . THR A 1 16  ? -9.595  -1.889  -9.467  1.00 0.00 ? 16  THR A CA   5  
ATOM 8855  C C    . THR A 1 16  ? -8.770  -2.562  -8.376  1.00 0.00 ? 16  THR A C    5  
ATOM 8856  O O    . THR A 1 16  ? -8.500  -3.762  -8.441  1.00 0.00 ? 16  THR A O    5  
ATOM 8857  C CB   . THR A 1 16  ? -8.655  -1.082  -10.381 1.00 0.00 ? 16  THR A CB   5  
ATOM 8858  O OG1  . THR A 1 16  ? -7.750  -0.304  -9.590  1.00 0.00 ? 16  THR A OG1  5  
ATOM 8859  C CG2  . THR A 1 16  ? -9.449  -0.165  -11.300 1.00 0.00 ? 16  THR A CG2  5  
ATOM 8860  H H    . THR A 1 16  ? -10.669 -0.095  -9.137  1.00 0.00 ? 16  THR A H    5  
ATOM 8861  H HA   . THR A 1 16  ? -10.076 -2.651  -10.063 1.00 0.00 ? 16  THR A HA   5  
ATOM 8862  H HB   . THR A 1 16  ? -8.088  -1.773  -10.989 1.00 0.00 ? 16  THR A HB   5  
ATOM 8863  H HG1  . THR A 1 16  ? -6.893  -0.737  -9.565  1.00 0.00 ? 16  THR A HG1  5  
ATOM 8864  H HG21 . THR A 1 16  ? -9.090  -0.272  -12.313 1.00 0.00 ? 16  THR A HG21 5  
ATOM 8865  H HG22 . THR A 1 16  ? -9.327  0.859   -10.980 1.00 0.00 ? 16  THR A HG22 5  
ATOM 8866  H HG23 . THR A 1 16  ? -10.494 -0.433  -11.259 1.00 0.00 ? 16  THR A HG23 5  
ATOM 8867  N N    . ILE A 1 17  ? -8.373  -1.784  -7.375  1.00 0.00 ? 17  ILE A N    5  
ATOM 8868  C CA   . ILE A 1 17  ? -7.580  -2.306  -6.270  1.00 0.00 ? 17  ILE A CA   5  
ATOM 8869  C C    . ILE A 1 17  ? -8.084  -3.676  -5.831  1.00 0.00 ? 17  ILE A C    5  
ATOM 8870  O O    . ILE A 1 17  ? -7.325  -4.489  -5.303  1.00 0.00 ? 17  ILE A O    5  
ATOM 8871  C CB   . ILE A 1 17  ? -7.602  -1.352  -5.061  1.00 0.00 ? 17  ILE A CB   5  
ATOM 8872  C CG1  . ILE A 1 17  ? -6.780  -1.934  -3.909  1.00 0.00 ? 17  ILE A CG1  5  
ATOM 8873  C CG2  . ILE A 1 17  ? -9.034  -1.091  -4.618  1.00 0.00 ? 17  ILE A CG2  5  
ATOM 8874  C CD1  . ILE A 1 17  ? -6.315  -0.895  -2.913  1.00 0.00 ? 17  ILE A CD1  5  
ATOM 8875  H H    . ILE A 1 17  ? -8.620  -0.836  -7.380  1.00 0.00 ? 17  ILE A H    5  
ATOM 8876  H HA   . ILE A 1 17  ? -6.558  -2.402  -6.609  1.00 0.00 ? 17  ILE A HA   5  
ATOM 8877  H HB   . ILE A 1 17  ? -7.168  -0.412  -5.365  1.00 0.00 ? 17  ILE A HB   5  
ATOM 8878  H HG12 . ILE A 1 17  ? -7.378  -2.658  -3.378  1.00 0.00 ? 17  ILE A HG12 5  
ATOM 8879  H HG13 . ILE A 1 17  ? -5.905  -2.423  -4.313  1.00 0.00 ? 17  ILE A HG13 5  
ATOM 8880  H HG21 . ILE A 1 17  ? -9.662  -0.967  -5.487  1.00 0.00 ? 17  ILE A HG21 5  
ATOM 8881  H HG22 . ILE A 1 17  ? -9.388  -1.928  -4.036  1.00 0.00 ? 17  ILE A HG22 5  
ATOM 8882  H HG23 . ILE A 1 17  ? -9.068  -0.194  -4.018  1.00 0.00 ? 17  ILE A HG23 5  
ATOM 8883  H HD11 . ILE A 1 17  ? -5.577  -0.257  -3.375  1.00 0.00 ? 17  ILE A HD11 5  
ATOM 8884  H HD12 . ILE A 1 17  ? -7.157  -0.300  -2.593  1.00 0.00 ? 17  ILE A HD12 5  
ATOM 8885  H HD13 . ILE A 1 17  ? -5.878  -1.388  -2.056  1.00 0.00 ? 17  ILE A HD13 5  
ATOM 8886  N N    . ASP A 1 18  ? -9.370  -3.927  -6.054  1.00 0.00 ? 18  ASP A N    5  
ATOM 8887  C CA   . ASP A 1 18  ? -9.976  -5.201  -5.684  1.00 0.00 ? 18  ASP A CA   5  
ATOM 8888  C C    . ASP A 1 18  ? -9.796  -6.231  -6.795  1.00 0.00 ? 18  ASP A C    5  
ATOM 8889  O O    . ASP A 1 18  ? -9.172  -7.272  -6.593  1.00 0.00 ? 18  ASP A O    5  
ATOM 8890  C CB   . ASP A 1 18  ? -11.464 -5.013  -5.382  1.00 0.00 ? 18  ASP A CB   5  
ATOM 8891  C CG   . ASP A 1 18  ? -11.995 -6.057  -4.420  1.00 0.00 ? 18  ASP A CG   5  
ATOM 8892  O OD1  . ASP A 1 18  ? -12.450 -7.120  -4.891  1.00 0.00 ? 18  ASP A OD1  5  
ATOM 8893  O OD2  . ASP A 1 18  ? -11.957 -5.812  -3.196  1.00 0.00 ? 18  ASP A OD2  5  
ATOM 8894  H H    . ASP A 1 18  ? -9.924  -3.239  -6.479  1.00 0.00 ? 18  ASP A H    5  
ATOM 8895  H HA   . ASP A 1 18  ? -9.480  -5.558  -4.795  1.00 0.00 ? 18  ASP A HA   5  
ATOM 8896  H HB2  . ASP A 1 18  ? -11.615 -4.037  -4.944  1.00 0.00 ? 18  ASP A HB2  5  
ATOM 8897  H HB3  . ASP A 1 18  ? -12.023 -5.080  -6.303  1.00 0.00 ? 18  ASP A HB3  5  
ATOM 8898  N N    . GLU A 1 19  ? -10.348 -5.933  -7.967  1.00 0.00 ? 19  GLU A N    5  
ATOM 8899  C CA   . GLU A 1 19  ? -10.249 -6.834  -9.109  1.00 0.00 ? 19  GLU A CA   5  
ATOM 8900  C C    . GLU A 1 19  ? -8.815  -7.320  -9.296  1.00 0.00 ? 19  GLU A C    5  
ATOM 8901  O O    . GLU A 1 19  ? -8.580  -8.491  -9.594  1.00 0.00 ? 19  GLU A O    5  
ATOM 8902  C CB   . GLU A 1 19  ? -10.733 -6.137  -10.381 1.00 0.00 ? 19  GLU A CB   5  
ATOM 8903  C CG   . GLU A 1 19  ? -9.668  -5.285  -11.051 1.00 0.00 ? 19  GLU A CG   5  
ATOM 8904  C CD   . GLU A 1 19  ? -10.152 -4.654  -12.342 1.00 0.00 ? 19  GLU A CD   5  
ATOM 8905  O OE1  . GLU A 1 19  ? -11.375 -4.687  -12.596 1.00 0.00 ? 19  GLU A OE1  5  
ATOM 8906  O OE2  . GLU A 1 19  ? -9.310  -4.127  -13.098 1.00 0.00 ? 19  GLU A OE2  5  
ATOM 8907  H H    . GLU A 1 19  ? -10.833 -5.087  -8.066  1.00 0.00 ? 19  GLU A H    5  
ATOM 8908  H HA   . GLU A 1 19  ? -10.882 -7.687  -8.913  1.00 0.00 ? 19  GLU A HA   5  
ATOM 8909  H HB2  . GLU A 1 19  ? -11.061 -6.887  -11.086 1.00 0.00 ? 19  GLU A HB2  5  
ATOM 8910  H HB3  . GLU A 1 19  ? -11.569 -5.500  -10.132 1.00 0.00 ? 19  GLU A HB3  5  
ATOM 8911  H HG2  . GLU A 1 19  ? -9.375  -4.498  -10.372 1.00 0.00 ? 19  GLU A HG2  5  
ATOM 8912  H HG3  . GLU A 1 19  ? -8.813  -5.907  -11.270 1.00 0.00 ? 19  GLU A HG3  5  
ATOM 8913  N N    . GLU A 1 20  ? -7.861  -6.412  -9.119  1.00 0.00 ? 20  GLU A N    5  
ATOM 8914  C CA   . GLU A 1 20  ? -6.450  -6.747  -9.270  1.00 0.00 ? 20  GLU A CA   5  
ATOM 8915  C C    . GLU A 1 20  ? -6.022  -7.781  -8.232  1.00 0.00 ? 20  GLU A C    5  
ATOM 8916  O O    . GLU A 1 20  ? -5.603  -8.887  -8.576  1.00 0.00 ? 20  GLU A O    5  
ATOM 8917  C CB   . GLU A 1 20  ? -5.587  -5.491  -9.140  1.00 0.00 ? 20  GLU A CB   5  
ATOM 8918  C CG   . GLU A 1 20  ? -4.101  -5.751  -9.320  1.00 0.00 ? 20  GLU A CG   5  
ATOM 8919  C CD   . GLU A 1 20  ? -3.727  -6.026  -10.763 1.00 0.00 ? 20  GLU A CD   5  
ATOM 8920  O OE1  . GLU A 1 20  ? -3.671  -5.062  -11.555 1.00 0.00 ? 20  GLU A OE1  5  
ATOM 8921  O OE2  . GLU A 1 20  ? -3.490  -7.205  -11.101 1.00 0.00 ? 20  GLU A OE2  5  
ATOM 8922  H H    . GLU A 1 20  ? -8.111  -5.494  -8.883  1.00 0.00 ? 20  GLU A H    5  
ATOM 8923  H HA   . GLU A 1 20  ? -6.312  -7.167  -10.256 1.00 0.00 ? 20  GLU A HA   5  
ATOM 8924  H HB2  . GLU A 1 20  ? -5.899  -4.775  -9.887  1.00 0.00 ? 20  GLU A HB2  5  
ATOM 8925  H HB3  . GLU A 1 20  ? -5.740  -5.064  -8.160  1.00 0.00 ? 20  GLU A HB3  5  
ATOM 8926  H HG2  . GLU A 1 20  ? -3.553  -4.885  -8.981  1.00 0.00 ? 20  GLU A HG2  5  
ATOM 8927  H HG3  . GLU A 1 20  ? -3.824  -6.607  -8.722  1.00 0.00 ? 20  GLU A HG3  5  
ATOM 8928  N N    . LEU A 1 21  ? -6.131  -7.412  -6.960  1.00 0.00 ? 21  LEU A N    5  
ATOM 8929  C CA   . LEU A 1 21  ? -5.755  -8.306  -5.870  1.00 0.00 ? 21  LEU A CA   5  
ATOM 8930  C C    . LEU A 1 21  ? -6.514  -9.626  -5.962  1.00 0.00 ? 21  LEU A C    5  
ATOM 8931  O O    . LEU A 1 21  ? -6.142  -10.612 -5.327  1.00 0.00 ? 21  LEU A O    5  
ATOM 8932  C CB   . LEU A 1 21  ? -6.029  -7.640  -4.521  1.00 0.00 ? 21  LEU A CB   5  
ATOM 8933  C CG   . LEU A 1 21  ? -5.204  -6.390  -4.210  1.00 0.00 ? 21  LEU A CG   5  
ATOM 8934  C CD1  . LEU A 1 21  ? -5.841  -5.599  -3.078  1.00 0.00 ? 21  LEU A CD1  5  
ATOM 8935  C CD2  . LEU A 1 21  ? -3.773  -6.770  -3.858  1.00 0.00 ? 21  LEU A CD2  5  
ATOM 8936  H H    . LEU A 1 21  ? -6.471  -6.519  -6.748  1.00 0.00 ? 21  LEU A H    5  
ATOM 8937  H HA   . LEU A 1 21  ? -4.697  -8.507  -5.956  1.00 0.00 ? 21  LEU A HA   5  
ATOM 8938  H HB2  . LEU A 1 21  ? -7.072  -7.363  -4.495  1.00 0.00 ? 21  LEU A HB2  5  
ATOM 8939  H HB3  . LEU A 1 21  ? -5.832  -8.369  -3.747  1.00 0.00 ? 21  LEU A HB3  5  
ATOM 8940  H HG   . LEU A 1 21  ? -5.178  -5.757  -5.086  1.00 0.00 ? 21  LEU A HG   5  
ATOM 8941  H HD11 . LEU A 1 21  ? -5.581  -4.556  -3.177  1.00 0.00 ? 21  LEU A HD11 5  
ATOM 8942  H HD12 . LEU A 1 21  ? -5.481  -5.972  -2.131  1.00 0.00 ? 21  LEU A HD12 5  
ATOM 8943  H HD13 . LEU A 1 21  ? -6.915  -5.708  -3.122  1.00 0.00 ? 21  LEU A HD13 5  
ATOM 8944  H HD21 . LEU A 1 21  ? -3.184  -5.873  -3.735  1.00 0.00 ? 21  LEU A HD21 5  
ATOM 8945  H HD22 . LEU A 1 21  ? -3.354  -7.370  -4.653  1.00 0.00 ? 21  LEU A HD22 5  
ATOM 8946  H HD23 . LEU A 1 21  ? -3.766  -7.334  -2.938  1.00 0.00 ? 21  LEU A HD23 5  
ATOM 8947  N N    . GLU A 1 22  ? -7.579  -9.636  -6.758  1.00 0.00 ? 22  GLU A N    5  
ATOM 8948  C CA   . GLU A 1 22  ? -8.389  -10.836 -6.934  1.00 0.00 ? 22  GLU A CA   5  
ATOM 8949  C C    . GLU A 1 22  ? -7.765  -11.768 -7.968  1.00 0.00 ? 22  GLU A C    5  
ATOM 8950  O O    . GLU A 1 22  ? -7.825  -12.990 -7.835  1.00 0.00 ? 22  GLU A O    5  
ATOM 8951  C CB   . GLU A 1 22  ? -9.810  -10.461 -7.361  1.00 0.00 ? 22  GLU A CB   5  
ATOM 8952  C CG   . GLU A 1 22  ? -10.830 -11.558 -7.112  1.00 0.00 ? 22  GLU A CG   5  
ATOM 8953  C CD   . GLU A 1 22  ? -12.057 -11.426 -7.994  1.00 0.00 ? 22  GLU A CD   5  
ATOM 8954  O OE1  . GLU A 1 22  ? -12.876 -10.520 -7.739  1.00 0.00 ? 22  GLU A OE1  5  
ATOM 8955  O OE2  . GLU A 1 22  ? -12.196 -12.229 -8.940  1.00 0.00 ? 22  GLU A OE2  5  
ATOM 8956  H H    . GLU A 1 22  ? -7.825  -8.818  -7.238  1.00 0.00 ? 22  GLU A H    5  
ATOM 8957  H HA   . GLU A 1 22  ? -8.432  -11.348 -5.985  1.00 0.00 ? 22  GLU A HA   5  
ATOM 8958  H HB2  . GLU A 1 22  ? -10.117 -9.581  -6.815  1.00 0.00 ? 22  GLU A HB2  5  
ATOM 8959  H HB3  . GLU A 1 22  ? -9.807  -10.234 -8.417  1.00 0.00 ? 22  GLU A HB3  5  
ATOM 8960  H HG2  . GLU A 1 22  ? -10.367 -12.514 -7.307  1.00 0.00 ? 22  GLU A HG2  5  
ATOM 8961  H HG3  . GLU A 1 22  ? -11.142 -11.515 -6.079  1.00 0.00 ? 22  GLU A HG3  5  
ATOM 8962  N N    . ARG A 1 23  ? -7.165  -11.181 -8.999  1.00 0.00 ? 23  ARG A N    5  
ATOM 8963  C CA   . ARG A 1 23  ? -6.531  -11.958 -10.058 1.00 0.00 ? 23  ARG A CA   5  
ATOM 8964  C C    . ARG A 1 23  ? -5.060  -12.209 -9.741  1.00 0.00 ? 23  ARG A C    5  
ATOM 8965  O O    . ARG A 1 23  ? -4.404  -13.022 -10.392 1.00 0.00 ? 23  ARG A O    5  
ATOM 8966  C CB   . ARG A 1 23  ? -6.659  -11.232 -11.398 1.00 0.00 ? 23  ARG A CB   5  
ATOM 8967  C CG   . ARG A 1 23  ? -6.002  -9.861  -11.413 1.00 0.00 ? 23  ARG A CG   5  
ATOM 8968  C CD   . ARG A 1 23  ? -5.932  -9.293  -12.822 1.00 0.00 ? 23  ARG A CD   5  
ATOM 8969  N NE   . ARG A 1 23  ? -5.157  -10.146 -13.719 1.00 0.00 ? 23  ARG A NE   5  
ATOM 8970  C CZ   . ARG A 1 23  ? -5.678  -11.157 -14.404 1.00 0.00 ? 23  ARG A CZ   5  
ATOM 8971  N NH1  . ARG A 1 23  ? -6.969  -11.440 -14.297 1.00 0.00 ? 23  ARG A NH1  5  
ATOM 8972  N NH2  . ARG A 1 23  ? -4.907  -11.888 -15.200 1.00 0.00 ? 23  ARG A NH2  5  
ATOM 8973  H H    . ARG A 1 23  ? -7.150  -10.202 -9.050  1.00 0.00 ? 23  ARG A H    5  
ATOM 8974  H HA   . ARG A 1 23  ? -7.040  -12.908 -10.123 1.00 0.00 ? 23  ARG A HA   5  
ATOM 8975  H HB2  . ARG A 1 23  ? -6.198  -11.836 -12.166 1.00 0.00 ? 23  ARG A HB2  5  
ATOM 8976  H HB3  . ARG A 1 23  ? -7.706  -11.109 -11.629 1.00 0.00 ? 23  ARG A HB3  5  
ATOM 8977  H HG2  . ARG A 1 23  ? -6.579  -9.190  -10.795 1.00 0.00 ? 23  ARG A HG2  5  
ATOM 8978  H HG3  . ARG A 1 23  ? -5.001  -9.948  -11.019 1.00 0.00 ? 23  ARG A HG3  5  
ATOM 8979  H HD2  . ARG A 1 23  ? -6.936  -9.200  -13.209 1.00 0.00 ? 23  ARG A HD2  5  
ATOM 8980  H HD3  . ARG A 1 23  ? -5.471  -8.317  -12.780 1.00 0.00 ? 23  ARG A HD3  5  
ATOM 8981  H HE   . ARG A 1 23  ? -4.201  -9.955  -13.813 1.00 0.00 ? 23  ARG A HE   5  
ATOM 8982  H HH11 . ARG A 1 23  ? -7.552  -10.891 -13.699 1.00 0.00 ? 23  ARG A HH11 5  
ATOM 8983  H HH12 . ARG A 1 23  ? -7.359  -12.202 -14.815 1.00 0.00 ? 23  ARG A HH12 5  
ATOM 8984  H HH21 . ARG A 1 23  ? -3.934  -11.678 -15.284 1.00 0.00 ? 23  ARG A HH21 5  
ATOM 8985  H HH22 . ARG A 1 23  ? -5.300  -12.649 -15.715 1.00 0.00 ? 23  ARG A HH22 5  
ATOM 8986  N N    . ASP A 1 24  ? -4.548  -11.505 -8.737  1.00 0.00 ? 24  ASP A N    5  
ATOM 8987  C CA   . ASP A 1 24  ? -3.154  -11.651 -8.333  1.00 0.00 ? 24  ASP A CA   5  
ATOM 8988  C C    . ASP A 1 24  ? -3.055  -12.102 -6.879  1.00 0.00 ? 24  ASP A C    5  
ATOM 8989  O O    . ASP A 1 24  ? -2.037  -11.890 -6.220  1.00 0.00 ? 24  ASP A O    5  
ATOM 8990  C CB   . ASP A 1 24  ? -2.405  -10.332 -8.523  1.00 0.00 ? 24  ASP A CB   5  
ATOM 8991  C CG   . ASP A 1 24  ? -1.969  -10.115 -9.959  1.00 0.00 ? 24  ASP A CG   5  
ATOM 8992  O OD1  . ASP A 1 24  ? -2.784  -10.369 -10.870 1.00 0.00 ? 24  ASP A OD1  5  
ATOM 8993  O OD2  . ASP A 1 24  ? -0.813  -9.693  -10.171 1.00 0.00 ? 24  ASP A OD2  5  
ATOM 8994  H H    . ASP A 1 24  ? -5.121  -10.872 -8.256  1.00 0.00 ? 24  ASP A H    5  
ATOM 8995  H HA   . ASP A 1 24  ? -2.704  -12.404 -8.962  1.00 0.00 ? 24  ASP A HA   5  
ATOM 8996  H HB2  . ASP A 1 24  ? -3.049  -9.514  -8.235  1.00 0.00 ? 24  ASP A HB2  5  
ATOM 8997  H HB3  . ASP A 1 24  ? -1.526  -10.331 -7.895  1.00 0.00 ? 24  ASP A HB3  5  
ATOM 8998  N N    . LYS A 1 25  ? -4.119  -12.726 -6.384  1.00 0.00 ? 25  LYS A N    5  
ATOM 8999  C CA   . LYS A 1 25  ? -4.152  -13.208 -5.008  1.00 0.00 ? 25  LYS A CA   5  
ATOM 9000  C C    . LYS A 1 25  ? -2.845  -13.904 -4.644  1.00 0.00 ? 25  LYS A C    5  
ATOM 9001  O O    . LYS A 1 25  ? -2.057  -13.389 -3.850  1.00 0.00 ? 25  LYS A O    5  
ATOM 9002  C CB   . LYS A 1 25  ? -5.327  -14.169 -4.812  1.00 0.00 ? 25  LYS A CB   5  
ATOM 9003  C CG   . LYS A 1 25  ? -6.611  -13.481 -4.381  1.00 0.00 ? 25  LYS A CG   5  
ATOM 9004  C CD   . LYS A 1 25  ? -7.666  -14.486 -3.953  1.00 0.00 ? 25  LYS A CD   5  
ATOM 9005  C CE   . LYS A 1 25  ? -9.036  -13.837 -3.827  1.00 0.00 ? 25  LYS A CE   5  
ATOM 9006  N NZ   . LYS A 1 25  ? -10.136 -14.815 -4.052  1.00 0.00 ? 25  LYS A NZ   5  
ATOM 9007  H H    . LYS A 1 25  ? -4.901  -12.866 -6.959  1.00 0.00 ? 25  LYS A H    5  
ATOM 9008  H HA   . LYS A 1 25  ? -4.284  -12.354 -4.361  1.00 0.00 ? 25  LYS A HA   5  
ATOM 9009  H HB2  . LYS A 1 25  ? -5.514  -14.685 -5.742  1.00 0.00 ? 25  LYS A HB2  5  
ATOM 9010  H HB3  . LYS A 1 25  ? -5.060  -14.893 -4.055  1.00 0.00 ? 25  LYS A HB3  5  
ATOM 9011  H HG2  . LYS A 1 25  ? -6.396  -12.825 -3.551  1.00 0.00 ? 25  LYS A HG2  5  
ATOM 9012  H HG3  . LYS A 1 25  ? -6.993  -12.902 -5.210  1.00 0.00 ? 25  LYS A HG3  5  
ATOM 9013  H HD2  . LYS A 1 25  ? -7.720  -15.274 -4.690  1.00 0.00 ? 25  LYS A HD2  5  
ATOM 9014  H HD3  . LYS A 1 25  ? -7.386  -14.904 -2.997  1.00 0.00 ? 25  LYS A HD3  5  
ATOM 9015  H HE2  . LYS A 1 25  ? -9.133  -13.422 -2.836  1.00 0.00 ? 25  LYS A HE2  5  
ATOM 9016  H HE3  . LYS A 1 25  ? -9.113  -13.046 -4.558  1.00 0.00 ? 25  LYS A HE3  5  
ATOM 9017  H HZ1  . LYS A 1 25  ? -11.057 -14.359 -3.893  1.00 0.00 ? 25  LYS A HZ1  5  
ATOM 9018  H HZ2  . LYS A 1 25  ? -10.041 -15.617 -3.397  1.00 0.00 ? 25  LYS A HZ2  5  
ATOM 9019  H HZ3  . LYS A 1 25  ? -10.102 -15.173 -5.028  1.00 0.00 ? 25  LYS A HZ3  5  
ATOM 9020  N N    . ARG A 1 26  ? -2.621  -15.076 -5.229  1.00 0.00 ? 26  ARG A N    5  
ATOM 9021  C CA   . ARG A 1 26  ? -1.409  -15.842 -4.965  1.00 0.00 ? 26  ARG A CA   5  
ATOM 9022  C C    . ARG A 1 26  ? -0.190  -14.926 -4.902  1.00 0.00 ? 26  ARG A C    5  
ATOM 9023  O O    . ARG A 1 26  ? 0.762   -15.192 -4.167  1.00 0.00 ? 26  ARG A O    5  
ATOM 9024  C CB   . ARG A 1 26  ? -1.206  -16.904 -6.047  1.00 0.00 ? 26  ARG A CB   5  
ATOM 9025  C CG   . ARG A 1 26  ? -1.523  -16.413 -7.450  1.00 0.00 ? 26  ARG A CG   5  
ATOM 9026  C CD   . ARG A 1 26  ? -0.956  -17.346 -8.509  1.00 0.00 ? 26  ARG A CD   5  
ATOM 9027  N NE   . ARG A 1 26  ? -0.956  -16.734 -9.835  1.00 0.00 ? 26  ARG A NE   5  
ATOM 9028  C CZ   . ARG A 1 26  ? -0.458  -17.323 -10.916 1.00 0.00 ? 26  ARG A CZ   5  
ATOM 9029  N NH1  . ARG A 1 26  ? 0.077   -18.533 -10.829 1.00 0.00 ? 26  ARG A NH1  5  
ATOM 9030  N NH2  . ARG A 1 26  ? -0.495  -16.702 -12.088 1.00 0.00 ? 26  ARG A NH2  5  
ATOM 9031  H H    . ARG A 1 26  ? -3.286  -15.434 -5.853  1.00 0.00 ? 26  ARG A H    5  
ATOM 9032  H HA   . ARG A 1 26  ? -1.527  -16.331 -4.010  1.00 0.00 ? 26  ARG A HA   5  
ATOM 9033  H HB2  . ARG A 1 26  ? -0.176  -17.229 -6.028  1.00 0.00 ? 26  ARG A HB2  5  
ATOM 9034  H HB3  . ARG A 1 26  ? -1.845  -17.747 -5.831  1.00 0.00 ? 26  ARG A HB3  5  
ATOM 9035  H HG2  . ARG A 1 26  ? -2.595  -16.361 -7.569  1.00 0.00 ? 26  ARG A HG2  5  
ATOM 9036  H HG3  . ARG A 1 26  ? -1.096  -15.430 -7.582  1.00 0.00 ? 26  ARG A HG3  5  
ATOM 9037  H HD2  . ARG A 1 26  ? 0.058   -17.600 -8.240  1.00 0.00 ? 26  ARG A HD2  5  
ATOM 9038  H HD3  . ARG A 1 26  ? -1.556  -18.244 -8.536  1.00 0.00 ? 26  ARG A HD3  5  
ATOM 9039  H HE   . ARG A 1 26  ? -1.347  -15.840 -9.922  1.00 0.00 ? 26  ARG A HE   5  
ATOM 9040  H HH11 . ARG A 1 26  ? 0.105   -19.004 -9.947  1.00 0.00 ? 26  ARG A HH11 5  
ATOM 9041  H HH12 . ARG A 1 26  ? 0.450   -18.975 -11.645 1.00 0.00 ? 26  ARG A HH12 5  
ATOM 9042  H HH21 . ARG A 1 26  ? -0.897  -15.790 -12.158 1.00 0.00 ? 26  ARG A HH21 5  
ATOM 9043  H HH22 . ARG A 1 26  ? -0.120  -17.146 -12.901 1.00 0.00 ? 26  ARG A HH22 5  
ATOM 9044  N N    . VAL A 1 27  ? -0.226  -13.847 -5.677  1.00 0.00 ? 27  VAL A N    5  
ATOM 9045  C CA   . VAL A 1 27  ? 0.875   -12.891 -5.708  1.00 0.00 ? 27  VAL A CA   5  
ATOM 9046  C C    . VAL A 1 27  ? 0.713   -11.830 -4.626  1.00 0.00 ? 27  VAL A C    5  
ATOM 9047  O O    . VAL A 1 27  ? -0.381  -11.306 -4.413  1.00 0.00 ? 27  VAL A O    5  
ATOM 9048  C CB   . VAL A 1 27  ? 0.977   -12.198 -7.080  1.00 0.00 ? 27  VAL A CB   5  
ATOM 9049  C CG1  . VAL A 1 27  ? 1.877   -10.974 -6.994  1.00 0.00 ? 27  VAL A CG1  5  
ATOM 9050  C CG2  . VAL A 1 27  ? 1.487   -13.172 -8.132  1.00 0.00 ? 27  VAL A CG2  5  
ATOM 9051  H H    . VAL A 1 27  ? -1.012  -13.689 -6.240  1.00 0.00 ? 27  VAL A H    5  
ATOM 9052  H HA   . VAL A 1 27  ? 1.793   -13.434 -5.533  1.00 0.00 ? 27  VAL A HA   5  
ATOM 9053  H HB   . VAL A 1 27  ? -0.010  -11.872 -7.370  1.00 0.00 ? 27  VAL A HB   5  
ATOM 9054  H HG11 . VAL A 1 27  ? 2.388   -10.970 -6.042  1.00 0.00 ? 27  VAL A HG11 5  
ATOM 9055  H HG12 . VAL A 1 27  ? 2.602   -11.003 -7.794  1.00 0.00 ? 27  VAL A HG12 5  
ATOM 9056  H HG13 . VAL A 1 27  ? 1.277   -10.080 -7.084  1.00 0.00 ? 27  VAL A HG13 5  
ATOM 9057  H HG21 . VAL A 1 27  ? 2.552   -13.042 -8.255  1.00 0.00 ? 27  VAL A HG21 5  
ATOM 9058  H HG22 . VAL A 1 27  ? 1.282   -14.184 -7.815  1.00 0.00 ? 27  VAL A HG22 5  
ATOM 9059  H HG23 . VAL A 1 27  ? 0.989   -12.980 -9.071  1.00 0.00 ? 27  VAL A HG23 5  
ATOM 9060  N N    . THR A 1 28  ? 1.810   -11.517 -3.942  1.00 0.00 ? 28  THR A N    5  
ATOM 9061  C CA   . THR A 1 28  ? 1.790   -10.519 -2.881  1.00 0.00 ? 28  THR A CA   5  
ATOM 9062  C C    . THR A 1 28  ? 1.789   -9.107  -3.454  1.00 0.00 ? 28  THR A C    5  
ATOM 9063  O O    . THR A 1 28  ? 2.511   -8.813  -4.407  1.00 0.00 ? 28  THR A O    5  
ATOM 9064  C CB   . THR A 1 28  ? 2.998   -10.677 -1.938  1.00 0.00 ? 28  THR A CB   5  
ATOM 9065  O OG1  . THR A 1 28  ? 2.955   -11.957 -1.297  1.00 0.00 ? 28  THR A OG1  5  
ATOM 9066  C CG2  . THR A 1 28  ? 3.013   -9.578  -0.887  1.00 0.00 ? 28  THR A CG2  5  
ATOM 9067  H H    . THR A 1 28  ? 2.652   -11.970 -4.158  1.00 0.00 ? 28  THR A H    5  
ATOM 9068  H HA   . THR A 1 28  ? 0.888   -10.664 -2.303  1.00 0.00 ? 28  THR A HA   5  
ATOM 9069  H HB   . THR A 1 28  ? 3.904   -10.607 -2.524  1.00 0.00 ? 28  THR A HB   5  
ATOM 9070  H HG1  . THR A 1 28  ? 3.711   -12.047 -0.711  1.00 0.00 ? 28  THR A HG1  5  
ATOM 9071  H HG21 . THR A 1 28  ? 2.973   -10.020 0.097   1.00 0.00 ? 28  THR A HG21 5  
ATOM 9072  H HG22 . THR A 1 28  ? 2.157   -8.934  -1.028  1.00 0.00 ? 28  THR A HG22 5  
ATOM 9073  H HG23 . THR A 1 28  ? 3.918   -8.999  -0.985  1.00 0.00 ? 28  THR A HG23 5  
ATOM 9074  N N    . TRP A 1 29  ? 0.975   -8.236  -2.867  1.00 0.00 ? 29  TRP A N    5  
ATOM 9075  C CA   . TRP A 1 29  ? 0.882   -6.853  -3.320  1.00 0.00 ? 29  TRP A CA   5  
ATOM 9076  C C    . TRP A 1 29  ? 0.917   -5.890  -2.139  1.00 0.00 ? 29  TRP A C    5  
ATOM 9077  O O    . TRP A 1 29  ? 0.019   -5.893  -1.296  1.00 0.00 ? 29  TRP A O    5  
ATOM 9078  C CB   . TRP A 1 29  ? -0.402  -6.644  -4.126  1.00 0.00 ? 29  TRP A CB   5  
ATOM 9079  C CG   . TRP A 1 29  ? -0.227  -6.885  -5.595  1.00 0.00 ? 29  TRP A CG   5  
ATOM 9080  C CD1  . TRP A 1 29  ? -0.509  -8.035  -6.276  1.00 0.00 ? 29  TRP A CD1  5  
ATOM 9081  C CD2  . TRP A 1 29  ? 0.271   -5.955  -6.562  1.00 0.00 ? 29  TRP A CD2  5  
ATOM 9082  N NE1  . TRP A 1 29  ? -0.217  -7.875  -7.609  1.00 0.00 ? 29  TRP A NE1  5  
ATOM 9083  C CE2  . TRP A 1 29  ? 0.263   -6.608  -7.810  1.00 0.00 ? 29  TRP A CE2  5  
ATOM 9084  C CE3  . TRP A 1 29  ? 0.720   -4.634  -6.496  1.00 0.00 ? 29  TRP A CE3  5  
ATOM 9085  C CZ2  . TRP A 1 29  ? 0.688   -5.983  -8.980  1.00 0.00 ? 29  TRP A CZ2  5  
ATOM 9086  C CZ3  . TRP A 1 29  ? 1.143   -4.015  -7.658  1.00 0.00 ? 29  TRP A CZ3  5  
ATOM 9087  C CH2  . TRP A 1 29  ? 1.124   -4.689  -8.886  1.00 0.00 ? 29  TRP A CH2  5  
ATOM 9088  H H    . TRP A 1 29  ? 0.425   -8.530  -2.112  1.00 0.00 ? 29  TRP A H    5  
ATOM 9089  H HA   . TRP A 1 29  ? 1.731   -6.655  -3.957  1.00 0.00 ? 29  TRP A HA   5  
ATOM 9090  H HB2  . TRP A 1 29  ? -1.160  -7.323  -3.765  1.00 0.00 ? 29  TRP A HB2  5  
ATOM 9091  H HB3  . TRP A 1 29  ? -0.741  -5.627  -3.992  1.00 0.00 ? 29  TRP A HB3  5  
ATOM 9092  H HD1  . TRP A 1 29  ? -0.902  -8.931  -5.820  1.00 0.00 ? 29  TRP A HD1  5  
ATOM 9093  H HE1  . TRP A 1 29  ? -0.334  -8.558  -8.303  1.00 0.00 ? 29  TRP A HE1  5  
ATOM 9094  H HE3  . TRP A 1 29  ? 0.743   -4.097  -5.559  1.00 0.00 ? 29  TRP A HE3  5  
ATOM 9095  H HZ2  . TRP A 1 29  ? 0.679   -6.489  -9.934  1.00 0.00 ? 29  TRP A HZ2  5  
ATOM 9096  H HZ3  . TRP A 1 29  ? 1.494   -2.994  -7.626  1.00 0.00 ? 29  TRP A HZ3  5  
ATOM 9097  H HH2  . TRP A 1 29  ? 1.463   -4.167  -9.767  1.00 0.00 ? 29  TRP A HH2  5  
ATOM 9098  N N    . ILE A 1 30  ? 1.959   -5.066  -2.084  1.00 0.00 ? 30  ILE A N    5  
ATOM 9099  C CA   . ILE A 1 30  ? 2.109   -4.097  -1.006  1.00 0.00 ? 30  ILE A CA   5  
ATOM 9100  C C    . ILE A 1 30  ? 1.604   -2.722  -1.429  1.00 0.00 ? 30  ILE A C    5  
ATOM 9101  O O    . ILE A 1 30  ? 2.270   -2.008  -2.179  1.00 0.00 ? 30  ILE A O    5  
ATOM 9102  C CB   . ILE A 1 30  ? 3.578   -3.977  -0.558  1.00 0.00 ? 30  ILE A CB   5  
ATOM 9103  C CG1  . ILE A 1 30  ? 3.701   -2.983  0.599   1.00 0.00 ? 30  ILE A CG1  5  
ATOM 9104  C CG2  . ILE A 1 30  ? 4.455   -3.551  -1.726  1.00 0.00 ? 30  ILE A CG2  5  
ATOM 9105  C CD1  . ILE A 1 30  ? 4.922   -3.209  1.463   1.00 0.00 ? 30  ILE A CD1  5  
ATOM 9106  H H    . ILE A 1 30  ? 2.642   -5.112  -2.785  1.00 0.00 ? 30  ILE A H    5  
ATOM 9107  H HA   . ILE A 1 30  ? 1.524   -4.441  -0.165  1.00 0.00 ? 30  ILE A HA   5  
ATOM 9108  H HB   . ILE A 1 30  ? 3.910   -4.948  -0.225  1.00 0.00 ? 30  ILE A HB   5  
ATOM 9109  H HG12 . ILE A 1 30  ? 3.759   -1.982  0.200   1.00 0.00 ? 30  ILE A HG12 5  
ATOM 9110  H HG13 . ILE A 1 30  ? 2.828   -3.065  1.229   1.00 0.00 ? 30  ILE A HG13 5  
ATOM 9111  H HG21 . ILE A 1 30  ? 5.320   -4.195  -1.780  1.00 0.00 ? 30  ILE A HG21 5  
ATOM 9112  H HG22 . ILE A 1 30  ? 3.892   -3.627  -2.644  1.00 0.00 ? 30  ILE A HG22 5  
ATOM 9113  H HG23 . ILE A 1 30  ? 4.775   -2.530  -1.583  1.00 0.00 ? 30  ILE A HG23 5  
ATOM 9114  H HD11 . ILE A 1 30  ? 5.698   -2.513  1.180   1.00 0.00 ? 30  ILE A HD11 5  
ATOM 9115  H HD12 . ILE A 1 30  ? 4.663   -3.060  2.500   1.00 0.00 ? 30  ILE A HD12 5  
ATOM 9116  H HD13 . ILE A 1 30  ? 5.279   -4.220  1.323   1.00 0.00 ? 30  ILE A HD13 5  
ATOM 9117  N N    . VAL A 1 31  ? 0.424   -2.355  -0.941  1.00 0.00 ? 31  VAL A N    5  
ATOM 9118  C CA   . VAL A 1 31  ? -0.170  -1.064  -1.265  1.00 0.00 ? 31  VAL A CA   5  
ATOM 9119  C C    . VAL A 1 31  ? 0.079   -0.049  -0.155  1.00 0.00 ? 31  VAL A C    5  
ATOM 9120  O O    . VAL A 1 31  ? -0.021  -0.374  1.028   1.00 0.00 ? 31  VAL A O    5  
ATOM 9121  C CB   . VAL A 1 31  ? -1.687  -1.187  -1.503  1.00 0.00 ? 31  VAL A CB   5  
ATOM 9122  C CG1  . VAL A 1 31  ? -2.291  0.174   -1.814  1.00 0.00 ? 31  VAL A CG1  5  
ATOM 9123  C CG2  . VAL A 1 31  ? -1.972  -2.175  -2.623  1.00 0.00 ? 31  VAL A CG2  5  
ATOM 9124  H H    . VAL A 1 31  ? -0.059  -2.967  -0.348  1.00 0.00 ? 31  VAL A H    5  
ATOM 9125  H HA   . VAL A 1 31  ? 0.287   -0.705  -2.176  1.00 0.00 ? 31  VAL A HA   5  
ATOM 9126  H HB   . VAL A 1 31  ? -2.143  -1.560  -0.597  1.00 0.00 ? 31  VAL A HB   5  
ATOM 9127  H HG11 . VAL A 1 31  ? -3.369  0.107   -1.772  1.00 0.00 ? 31  VAL A HG11 5  
ATOM 9128  H HG12 . VAL A 1 31  ? -1.945  0.896   -1.090  1.00 0.00 ? 31  VAL A HG12 5  
ATOM 9129  H HG13 . VAL A 1 31  ? -1.989  0.483   -2.804  1.00 0.00 ? 31  VAL A HG13 5  
ATOM 9130  H HG21 . VAL A 1 31  ? -2.911  -1.924  -3.094  1.00 0.00 ? 31  VAL A HG21 5  
ATOM 9131  H HG22 . VAL A 1 31  ? -1.179  -2.129  -3.356  1.00 0.00 ? 31  VAL A HG22 5  
ATOM 9132  H HG23 . VAL A 1 31  ? -2.028  -3.174  -2.217  1.00 0.00 ? 31  VAL A HG23 5  
ATOM 9133  N N    . GLU A 1 32  ? 0.403   1.180   -0.544  1.00 0.00 ? 32  GLU A N    5  
ATOM 9134  C CA   . GLU A 1 32  ? 0.666   2.241   0.420   1.00 0.00 ? 32  GLU A CA   5  
ATOM 9135  C C    . GLU A 1 32  ? -0.431  3.302   0.375   1.00 0.00 ? 32  GLU A C    5  
ATOM 9136  O O    . GLU A 1 32  ? -0.747  3.839   -0.687  1.00 0.00 ? 32  GLU A O    5  
ATOM 9137  C CB   . GLU A 1 32  ? 2.026   2.886   0.143   1.00 0.00 ? 32  GLU A CB   5  
ATOM 9138  C CG   . GLU A 1 32  ? 2.427   3.928   1.174   1.00 0.00 ? 32  GLU A CG   5  
ATOM 9139  C CD   . GLU A 1 32  ? 1.446   5.082   1.250   1.00 0.00 ? 32  GLU A CD   5  
ATOM 9140  O OE1  . GLU A 1 32  ? 0.911   5.477   0.193   1.00 0.00 ? 32  GLU A OE1  5  
ATOM 9141  O OE2  . GLU A 1 32  ? 1.212   5.589   2.367   1.00 0.00 ? 32  GLU A OE2  5  
ATOM 9142  H H    . GLU A 1 32  ? 0.466   1.377   -1.502  1.00 0.00 ? 32  GLU A H    5  
ATOM 9143  H HA   . GLU A 1 32  ? 0.682   1.799   1.404   1.00 0.00 ? 32  GLU A HA   5  
ATOM 9144  H HB2  . GLU A 1 32  ? 2.781   2.114   0.128   1.00 0.00 ? 32  GLU A HB2  5  
ATOM 9145  H HB3  . GLU A 1 32  ? 1.993   3.364   -0.826  1.00 0.00 ? 32  GLU A HB3  5  
ATOM 9146  H HG2  . GLU A 1 32  ? 2.478   3.455   2.143   1.00 0.00 ? 32  GLU A HG2  5  
ATOM 9147  H HG3  . GLU A 1 32  ? 3.399   4.318   0.913   1.00 0.00 ? 32  GLU A HG3  5  
ATOM 9148  N N    . PHE A 1 33  ? -1.008  3.596   1.535   1.00 0.00 ? 33  PHE A N    5  
ATOM 9149  C CA   . PHE A 1 33  ? -2.071  4.591   1.629   1.00 0.00 ? 33  PHE A CA   5  
ATOM 9150  C C    . PHE A 1 33  ? -1.520  5.933   2.101   1.00 0.00 ? 33  PHE A C    5  
ATOM 9151  O O    . PHE A 1 33  ? -1.124  6.082   3.257   1.00 0.00 ? 33  PHE A O    5  
ATOM 9152  C CB   . PHE A 1 33  ? -3.164  4.110   2.586   1.00 0.00 ? 33  PHE A CB   5  
ATOM 9153  C CG   . PHE A 1 33  ? -3.740  2.773   2.216   1.00 0.00 ? 33  PHE A CG   5  
ATOM 9154  C CD1  . PHE A 1 33  ? -2.963  1.628   2.284   1.00 0.00 ? 33  PHE A CD1  5  
ATOM 9155  C CD2  . PHE A 1 33  ? -5.057  2.662   1.800   1.00 0.00 ? 33  PHE A CD2  5  
ATOM 9156  C CE1  . PHE A 1 33  ? -3.490  0.395   1.945   1.00 0.00 ? 33  PHE A CE1  5  
ATOM 9157  C CE2  . PHE A 1 33  ? -5.588  1.432   1.460   1.00 0.00 ? 33  PHE A CE2  5  
ATOM 9158  C CZ   . PHE A 1 33  ? -4.804  0.298   1.531   1.00 0.00 ? 33  PHE A CZ   5  
ATOM 9159  H H    . PHE A 1 33  ? -0.713  3.134   2.347   1.00 0.00 ? 33  PHE A H    5  
ATOM 9160  H HA   . PHE A 1 33  ? -2.495  4.715   0.645   1.00 0.00 ? 33  PHE A HA   5  
ATOM 9161  H HB2  . PHE A 1 33  ? -2.752  4.030   3.580   1.00 0.00 ? 33  PHE A HB2  5  
ATOM 9162  H HB3  . PHE A 1 33  ? -3.969  4.830   2.591   1.00 0.00 ? 33  PHE A HB3  5  
ATOM 9163  H HD1  . PHE A 1 33  ? -1.934  1.703   2.607   1.00 0.00 ? 33  PHE A HD1  5  
ATOM 9164  H HD2  . PHE A 1 33  ? -5.671  3.548   1.743   1.00 0.00 ? 33  PHE A HD2  5  
ATOM 9165  H HE1  . PHE A 1 33  ? -2.873  -0.490  2.002   1.00 0.00 ? 33  PHE A HE1  5  
ATOM 9166  H HE2  . PHE A 1 33  ? -6.616  1.359   1.137   1.00 0.00 ? 33  PHE A HE2  5  
ATOM 9167  H HZ   . PHE A 1 33  ? -5.217  -0.664  1.267   1.00 0.00 ? 33  PHE A HZ   5  
ATOM 9168  N N    . PHE A 1 34  ? -1.496  6.907   1.197   1.00 0.00 ? 34  PHE A N    5  
ATOM 9169  C CA   . PHE A 1 34  ? -0.992  8.237   1.519   1.00 0.00 ? 34  PHE A CA   5  
ATOM 9170  C C    . PHE A 1 34  ? -2.009  9.310   1.142   1.00 0.00 ? 34  PHE A C    5  
ATOM 9171  O O    . PHE A 1 34  ? -2.970  9.043   0.421   1.00 0.00 ? 34  PHE A O    5  
ATOM 9172  C CB   . PHE A 1 34  ? 0.330   8.494   0.794   1.00 0.00 ? 34  PHE A CB   5  
ATOM 9173  C CG   . PHE A 1 34  ? 0.157   8.897   -0.643  1.00 0.00 ? 34  PHE A CG   5  
ATOM 9174  C CD1  . PHE A 1 34  ? -0.127  10.210  -0.978  1.00 0.00 ? 34  PHE A CD1  5  
ATOM 9175  C CD2  . PHE A 1 34  ? 0.279   7.961   -1.658  1.00 0.00 ? 34  PHE A CD2  5  
ATOM 9176  C CE1  . PHE A 1 34  ? -0.287  10.585  -2.299  1.00 0.00 ? 34  PHE A CE1  5  
ATOM 9177  C CE2  . PHE A 1 34  ? 0.122   8.330   -2.980  1.00 0.00 ? 34  PHE A CE2  5  
ATOM 9178  C CZ   . PHE A 1 34  ? -0.163  9.643   -3.301  1.00 0.00 ? 34  PHE A CZ   5  
ATOM 9179  H H    . PHE A 1 34  ? -1.825  6.726   0.291   1.00 0.00 ? 34  PHE A H    5  
ATOM 9180  H HA   . PHE A 1 34  ? -0.822  8.277   2.584   1.00 0.00 ? 34  PHE A HA   5  
ATOM 9181  H HB2  . PHE A 1 34  ? 0.861   9.287   1.299   1.00 0.00 ? 34  PHE A HB2  5  
ATOM 9182  H HB3  . PHE A 1 34  ? 0.927   7.594   0.818   1.00 0.00 ? 34  PHE A HB3  5  
ATOM 9183  H HD1  . PHE A 1 34  ? -0.225  10.948  -0.194  1.00 0.00 ? 34  PHE A HD1  5  
ATOM 9184  H HD2  . PHE A 1 34  ? 0.501   6.934   -1.408  1.00 0.00 ? 34  PHE A HD2  5  
ATOM 9185  H HE1  . PHE A 1 34  ? -0.509  11.612  -2.546  1.00 0.00 ? 34  PHE A HE1  5  
ATOM 9186  H HE2  . PHE A 1 34  ? 0.219   7.591   -3.762  1.00 0.00 ? 34  PHE A HE2  5  
ATOM 9187  H HZ   . PHE A 1 34  ? -0.286  9.933   -4.334  1.00 0.00 ? 34  PHE A HZ   5  
ATOM 9188  N N    . ALA A 1 35  ? -1.790  10.524  1.636   1.00 0.00 ? 35  ALA A N    5  
ATOM 9189  C CA   . ALA A 1 35  ? -2.685  11.638  1.350   1.00 0.00 ? 35  ALA A CA   5  
ATOM 9190  C C    . ALA A 1 35  ? -1.926  12.808  0.733   1.00 0.00 ? 35  ALA A C    5  
ATOM 9191  O O    . ALA A 1 35  ? -0.706  12.902  0.855   1.00 0.00 ? 35  ALA A O    5  
ATOM 9192  C CB   . ALA A 1 35  ? -3.399  12.080  2.619   1.00 0.00 ? 35  ALA A CB   5  
ATOM 9193  H H    . ALA A 1 35  ? -1.006  10.674  2.204   1.00 0.00 ? 35  ALA A H    5  
ATOM 9194  H HA   . ALA A 1 35  ? -3.431  11.295  0.647   1.00 0.00 ? 35  ALA A HA   5  
ATOM 9195  H HB1  . ALA A 1 35  ? -2.784  11.849  3.476   1.00 0.00 ? 35  ALA A HB1  5  
ATOM 9196  H HB2  . ALA A 1 35  ? -3.577  13.144  2.579   1.00 0.00 ? 35  ALA A HB2  5  
ATOM 9197  H HB3  . ALA A 1 35  ? -4.342  11.560  2.701   1.00 0.00 ? 35  ALA A HB3  5  
ATOM 9198  N N    . ASN A 1 36  ? -2.657  13.698  0.069   1.00 0.00 ? 36  ASN A N    5  
ATOM 9199  C CA   . ASN A 1 36  ? -2.052  14.861  -0.569  1.00 0.00 ? 36  ASN A CA   5  
ATOM 9200  C C    . ASN A 1 36  ? -1.653  15.905  0.470   1.00 0.00 ? 36  ASN A C    5  
ATOM 9201  O O    . ASN A 1 36  ? -0.703  16.662  0.271   1.00 0.00 ? 36  ASN A O    5  
ATOM 9202  C CB   . ASN A 1 36  ? -3.022  15.476  -1.580  1.00 0.00 ? 36  ASN A CB   5  
ATOM 9203  C CG   . ASN A 1 36  ? -4.351  15.849  -0.953  1.00 0.00 ? 36  ASN A CG   5  
ATOM 9204  O OD1  . ASN A 1 36  ? -5.097  14.985  -0.492  1.00 0.00 ? 36  ASN A OD1  5  
ATOM 9205  N ND2  . ASN A 1 36  ? -4.654  17.142  -0.933  1.00 0.00 ? 36  ASN A ND2  5  
ATOM 9206  H H    . ASN A 1 36  ? -3.627  13.568  0.006   1.00 0.00 ? 36  ASN A H    5  
ATOM 9207  H HA   . ASN A 1 36  ? -1.166  14.530  -1.089  1.00 0.00 ? 36  ASN A HA   5  
ATOM 9208  H HB2  . ASN A 1 36  ? -2.579  16.370  -1.996  1.00 0.00 ? 36  ASN A HB2  5  
ATOM 9209  H HB3  . ASN A 1 36  ? -3.204  14.767  -2.373  1.00 0.00 ? 36  ASN A HB3  5  
ATOM 9210  H HD21 . ASN A 1 36  ? -4.012  17.774  -1.319  1.00 0.00 ? 36  ASN A HD21 5  
ATOM 9211  H HD22 . ASN A 1 36  ? -5.507  17.411  -0.533  1.00 0.00 ? 36  ASN A HD22 5  
ATOM 9212  N N    . TRP A 1 37  ? -2.385  15.938  1.578   1.00 0.00 ? 37  TRP A N    5  
ATOM 9213  C CA   . TRP A 1 37  ? -2.107  16.888  2.649   1.00 0.00 ? 37  TRP A CA   5  
ATOM 9214  C C    . TRP A 1 37  ? -1.279  16.238  3.752   1.00 0.00 ? 37  TRP A C    5  
ATOM 9215  O O    . TRP A 1 37  ? -1.292  16.689  4.898   1.00 0.00 ? 37  TRP A O    5  
ATOM 9216  C CB   . TRP A 1 37  ? -3.414  17.432  3.228   1.00 0.00 ? 37  TRP A CB   5  
ATOM 9217  C CG   . TRP A 1 37  ? -4.522  16.423  3.244   1.00 0.00 ? 37  TRP A CG   5  
ATOM 9218  C CD1  . TRP A 1 37  ? -5.673  16.458  2.510   1.00 0.00 ? 37  TRP A CD1  5  
ATOM 9219  C CD2  . TRP A 1 37  ? -4.584  15.230  4.033   1.00 0.00 ? 37  TRP A CD2  5  
ATOM 9220  N NE1  . TRP A 1 37  ? -6.447  15.359  2.796   1.00 0.00 ? 37  TRP A NE1  5  
ATOM 9221  C CE2  . TRP A 1 37  ? -5.801  14.590  3.727   1.00 0.00 ? 37  TRP A CE2  5  
ATOM 9222  C CE3  . TRP A 1 37  ? -3.729  14.640  4.968   1.00 0.00 ? 37  TRP A CE3  5  
ATOM 9223  C CZ2  . TRP A 1 37  ? -6.181  13.391  4.323   1.00 0.00 ? 37  TRP A CZ2  5  
ATOM 9224  C CZ3  . TRP A 1 37  ? -4.109  13.450  5.559   1.00 0.00 ? 37  TRP A CZ3  5  
ATOM 9225  C CH2  . TRP A 1 37  ? -5.325  12.835  5.235   1.00 0.00 ? 37  TRP A CH2  5  
ATOM 9226  H H    . TRP A 1 37  ? -3.130  15.309  1.679   1.00 0.00 ? 37  TRP A H    5  
ATOM 9227  H HA   . TRP A 1 37  ? -1.543  17.707  2.226   1.00 0.00 ? 37  TRP A HA   5  
ATOM 9228  H HB2  . TRP A 1 37  ? -3.243  17.755  4.244   1.00 0.00 ? 37  TRP A HB2  5  
ATOM 9229  H HB3  . TRP A 1 37  ? -3.738  18.275  2.635   1.00 0.00 ? 37  TRP A HB3  5  
ATOM 9230  H HD1  . TRP A 1 37  ? -5.926  17.242  1.813   1.00 0.00 ? 37  TRP A HD1  5  
ATOM 9231  H HE1  . TRP A 1 37  ? -7.320  15.159  2.396   1.00 0.00 ? 37  TRP A HE1  5  
ATOM 9232  H HE3  . TRP A 1 37  ? -2.787  15.098  5.231   1.00 0.00 ? 37  TRP A HE3  5  
ATOM 9233  H HZ2  . TRP A 1 37  ? -7.116  12.905  4.083   1.00 0.00 ? 37  TRP A HZ2  5  
ATOM 9234  H HZ3  . TRP A 1 37  ? -3.461  12.979  6.284   1.00 0.00 ? 37  TRP A HZ3  5  
ATOM 9235  H HH2  . TRP A 1 37  ? -5.581  11.907  5.721   1.00 0.00 ? 37  TRP A HH2  5  
ATOM 9236  N N    . SER A 1 38  ? -0.560  15.177  3.400   1.00 0.00 ? 38  SER A N    5  
ATOM 9237  C CA   . SER A 1 38  ? 0.271   14.463  4.362   1.00 0.00 ? 38  SER A CA   5  
ATOM 9238  C C    . SER A 1 38  ? 1.752   14.696  4.078   1.00 0.00 ? 38  SER A C    5  
ATOM 9239  O O    . SER A 1 38  ? 2.371   13.959  3.312   1.00 0.00 ? 38  SER A O    5  
ATOM 9240  C CB   . SER A 1 38  ? -0.039  12.966  4.323   1.00 0.00 ? 38  SER A CB   5  
ATOM 9241  O OG   . SER A 1 38  ? 0.942   12.224  5.028   1.00 0.00 ? 38  SER A OG   5  
ATOM 9242  H H    . SER A 1 38  ? -0.592  14.866  2.471   1.00 0.00 ? 38  SER A H    5  
ATOM 9243  H HA   . SER A 1 38  ? 0.041   14.844  5.346   1.00 0.00 ? 38  SER A HA   5  
ATOM 9244  H HB2  . SER A 1 38  ? -1.002  12.788  4.776   1.00 0.00 ? 38  SER A HB2  5  
ATOM 9245  H HB3  . SER A 1 38  ? -0.057  12.631  3.296   1.00 0.00 ? 38  SER A HB3  5  
ATOM 9246  H HG   . SER A 1 38  ? 0.850   11.291  4.819   1.00 0.00 ? 38  SER A HG   5  
ATOM 9247  N N    . ASN A 1 39  ? 2.313   15.726  4.703   1.00 0.00 ? 39  ASN A N    5  
ATOM 9248  C CA   . ASN A 1 39  ? 3.721   16.058  4.518   1.00 0.00 ? 39  ASN A CA   5  
ATOM 9249  C C    . ASN A 1 39  ? 4.616   14.936  5.037   1.00 0.00 ? 39  ASN A C    5  
ATOM 9250  O O    . ASN A 1 39  ? 5.649   14.627  4.442   1.00 0.00 ? 39  ASN A O    5  
ATOM 9251  C CB   . ASN A 1 39  ? 4.057   17.367  5.235   1.00 0.00 ? 39  ASN A CB   5  
ATOM 9252  C CG   . ASN A 1 39  ? 3.514   17.407  6.650   1.00 0.00 ? 39  ASN A CG   5  
ATOM 9253  O OD1  . ASN A 1 39  ? 3.995   16.696  7.532   1.00 0.00 ? 39  ASN A OD1  5  
ATOM 9254  N ND2  . ASN A 1 39  ? 2.505   18.242  6.872   1.00 0.00 ? 39  ASN A ND2  5  
ATOM 9255  H H    . ASN A 1 39  ? 1.767   16.277  5.302   1.00 0.00 ? 39  ASN A H    5  
ATOM 9256  H HA   . ASN A 1 39  ? 3.896   16.182  3.460   1.00 0.00 ? 39  ASN A HA   5  
ATOM 9257  H HB2  . ASN A 1 39  ? 5.131   17.481  5.279   1.00 0.00 ? 39  ASN A HB2  5  
ATOM 9258  H HB3  . ASN A 1 39  ? 3.634   18.192  4.682   1.00 0.00 ? 39  ASN A HB3  5  
ATOM 9259  H HD21 . ASN A 1 39  ? 2.173   18.778  6.122   1.00 0.00 ? 39  ASN A HD21 5  
ATOM 9260  H HD22 . ASN A 1 39  ? 2.135   18.288  7.778   1.00 0.00 ? 39  ASN A HD22 5  
ATOM 9261  N N    . ASP A 1 40  ? 4.213   14.331  6.148   1.00 0.00 ? 40  ASP A N    5  
ATOM 9262  C CA   . ASP A 1 40  ? 4.977   13.243  6.747   1.00 0.00 ? 40  ASP A CA   5  
ATOM 9263  C C    . ASP A 1 40  ? 5.389   12.223  5.690   1.00 0.00 ? 40  ASP A C    5  
ATOM 9264  O O    . ASP A 1 40  ? 6.422   11.564  5.818   1.00 0.00 ? 40  ASP A O    5  
ATOM 9265  C CB   . ASP A 1 40  ? 4.158   12.559  7.842   1.00 0.00 ? 40  ASP A CB   5  
ATOM 9266  C CG   . ASP A 1 40  ? 4.865   11.351  8.425   1.00 0.00 ? 40  ASP A CG   5  
ATOM 9267  O OD1  . ASP A 1 40  ? 6.111   11.297  8.346   1.00 0.00 ? 40  ASP A OD1  5  
ATOM 9268  O OD2  . ASP A 1 40  ? 4.173   10.460  8.960   1.00 0.00 ? 40  ASP A OD2  5  
ATOM 9269  H H    . ASP A 1 40  ? 3.380   14.623  6.576   1.00 0.00 ? 40  ASP A H    5  
ATOM 9270  H HA   . ASP A 1 40  ? 5.867   13.666  7.187   1.00 0.00 ? 40  ASP A HA   5  
ATOM 9271  H HB2  . ASP A 1 40  ? 3.975   13.264  8.640   1.00 0.00 ? 40  ASP A HB2  5  
ATOM 9272  H HB3  . ASP A 1 40  ? 3.214   12.236  7.428   1.00 0.00 ? 40  ASP A HB3  5  
ATOM 9273  N N    . CYS A 1 41  ? 4.575   12.097  4.648   1.00 0.00 ? 41  CYS A N    5  
ATOM 9274  C CA   . CYS A 1 41  ? 4.854   11.155  3.569   1.00 0.00 ? 41  CYS A CA   5  
ATOM 9275  C C    . CYS A 1 41  ? 6.141   11.528  2.841   1.00 0.00 ? 41  CYS A C    5  
ATOM 9276  O O    . CYS A 1 41  ? 6.911   10.658  2.436   1.00 0.00 ? 41  CYS A O    5  
ATOM 9277  C CB   . CYS A 1 41  ? 3.687   11.118  2.582   1.00 0.00 ? 41  CYS A CB   5  
ATOM 9278  S SG   . CYS A 1 41  ? 3.955   10.031  1.162   1.00 0.00 ? 41  CYS A SG   5  
ATOM 9279  H H    . CYS A 1 41  ? 3.767   12.650  4.602   1.00 0.00 ? 41  CYS A H    5  
ATOM 9280  H HA   . CYS A 1 41  ? 4.974   10.176  4.008   1.00 0.00 ? 41  CYS A HA   5  
ATOM 9281  H HB2  . CYS A 1 41  ? 2.801   10.774  3.095   1.00 0.00 ? 41  CYS A HB2  5  
ATOM 9282  H HB3  . CYS A 1 41  ? 3.512   12.115  2.206   1.00 0.00 ? 41  CYS A HB3  5  
ATOM 9283  H HG   . CYS A 1 41  ? 5.239   10.087  0.842   1.00 0.00 ? 41  CYS A HG   5  
ATOM 9284  N N    . GLN A 1 42  ? 6.366   12.828  2.676   1.00 0.00 ? 42  GLN A N    5  
ATOM 9285  C CA   . GLN A 1 42  ? 7.559   13.316  1.994   1.00 0.00 ? 42  GLN A CA   5  
ATOM 9286  C C    . GLN A 1 42  ? 8.815   12.657  2.555   1.00 0.00 ? 42  GLN A C    5  
ATOM 9287  O O    . GLN A 1 42  ? 9.805   12.480  1.845   1.00 0.00 ? 42  GLN A O    5  
ATOM 9288  C CB   . GLN A 1 42  ? 7.663   14.836  2.127   1.00 0.00 ? 42  GLN A CB   5  
ATOM 9289  C CG   . GLN A 1 42  ? 8.398   15.288  3.378   1.00 0.00 ? 42  GLN A CG   5  
ATOM 9290  C CD   . GLN A 1 42  ? 8.627   16.786  3.412   1.00 0.00 ? 42  GLN A CD   5  
ATOM 9291  O OE1  . GLN A 1 42  ? 9.673   17.276  2.986   1.00 0.00 ? 42  GLN A OE1  5  
ATOM 9292  N NE2  . GLN A 1 42  ? 7.646   17.523  3.921   1.00 0.00 ? 42  GLN A NE2  5  
ATOM 9293  H H    . GLN A 1 42  ? 5.715   13.473  3.021   1.00 0.00 ? 42  GLN A H    5  
ATOM 9294  H HA   . GLN A 1 42  ? 7.470   13.061  0.949   1.00 0.00 ? 42  GLN A HA   5  
ATOM 9295  H HB2  . GLN A 1 42  ? 8.185   15.226  1.267   1.00 0.00 ? 42  GLN A HB2  5  
ATOM 9296  H HB3  . GLN A 1 42  ? 6.666   15.252  2.152   1.00 0.00 ? 42  GLN A HB3  5  
ATOM 9297  H HG2  . GLN A 1 42  ? 7.816   15.009  4.244   1.00 0.00 ? 42  GLN A HG2  5  
ATOM 9298  H HG3  . GLN A 1 42  ? 9.357   14.791  3.415   1.00 0.00 ? 42  GLN A HG3  5  
ATOM 9299  H HE21 . GLN A 1 42  ? 6.842   17.064  4.243   1.00 0.00 ? 42  GLN A HE21 5  
ATOM 9300  H HE22 . GLN A 1 42  ? 7.767   18.494  3.956   1.00 0.00 ? 42  GLN A HE22 5  
ATOM 9301  N N    . SER A 1 43  ? 8.767   12.296  3.833   1.00 0.00 ? 43  SER A N    5  
ATOM 9302  C CA   . SER A 1 43  ? 9.903   11.661  4.491   1.00 0.00 ? 43  SER A CA   5  
ATOM 9303  C C    . SER A 1 43  ? 10.125  10.251  3.951   1.00 0.00 ? 43  SER A C    5  
ATOM 9304  O O    . SER A 1 43  ? 11.261  9.821   3.755   1.00 0.00 ? 43  SER A O    5  
ATOM 9305  C CB   . SER A 1 43  ? 9.680   11.610  6.004   1.00 0.00 ? 43  SER A CB   5  
ATOM 9306  O OG   . SER A 1 43  ? 10.767  10.979  6.658   1.00 0.00 ? 43  SER A OG   5  
ATOM 9307  H H    . SER A 1 43  ? 7.949   12.464  4.347   1.00 0.00 ? 43  SER A H    5  
ATOM 9308  H HA   . SER A 1 43  ? 10.780  12.255  4.285   1.00 0.00 ? 43  SER A HA   5  
ATOM 9309  H HB2  . SER A 1 43  ? 9.580   12.615  6.384   1.00 0.00 ? 43  SER A HB2  5  
ATOM 9310  H HB3  . SER A 1 43  ? 8.777   11.054  6.213   1.00 0.00 ? 43  SER A HB3  5  
ATOM 9311  H HG   . SER A 1 43  ? 10.435  10.292  7.241   1.00 0.00 ? 43  SER A HG   5  
ATOM 9312  N N    . PHE A 1 44  ? 9.030   9.537   3.711   1.00 0.00 ? 44  PHE A N    5  
ATOM 9313  C CA   . PHE A 1 44  ? 9.103   8.176   3.194   1.00 0.00 ? 44  PHE A CA   5  
ATOM 9314  C C    . PHE A 1 44  ? 8.842   8.150   1.691   1.00 0.00 ? 44  PHE A C    5  
ATOM 9315  O O    . PHE A 1 44  ? 8.682   7.084   1.096   1.00 0.00 ? 44  PHE A O    5  
ATOM 9316  C CB   . PHE A 1 44  ? 8.094   7.279   3.914   1.00 0.00 ? 44  PHE A CB   5  
ATOM 9317  C CG   . PHE A 1 44  ? 8.421   5.816   3.823   1.00 0.00 ? 44  PHE A CG   5  
ATOM 9318  C CD1  . PHE A 1 44  ? 9.339   5.242   4.688   1.00 0.00 ? 44  PHE A CD1  5  
ATOM 9319  C CD2  . PHE A 1 44  ? 7.809   5.013   2.873   1.00 0.00 ? 44  PHE A CD2  5  
ATOM 9320  C CE1  . PHE A 1 44  ? 9.642   3.896   4.606   1.00 0.00 ? 44  PHE A CE1  5  
ATOM 9321  C CE2  . PHE A 1 44  ? 8.108   3.667   2.787   1.00 0.00 ? 44  PHE A CE2  5  
ATOM 9322  C CZ   . PHE A 1 44  ? 9.025   3.107   3.655   1.00 0.00 ? 44  PHE A CZ   5  
ATOM 9323  H H    . PHE A 1 44  ? 8.151   9.935   3.887   1.00 0.00 ? 44  PHE A H    5  
ATOM 9324  H HA   . PHE A 1 44  ? 10.099  7.805   3.380   1.00 0.00 ? 44  PHE A HA   5  
ATOM 9325  H HB2  . PHE A 1 44  ? 8.067   7.548   4.959   1.00 0.00 ? 44  PHE A HB2  5  
ATOM 9326  H HB3  . PHE A 1 44  ? 7.117   7.430   3.482   1.00 0.00 ? 44  PHE A HB3  5  
ATOM 9327  H HD1  . PHE A 1 44  ? 9.822   5.858   5.433   1.00 0.00 ? 44  PHE A HD1  5  
ATOM 9328  H HD2  . PHE A 1 44  ? 7.091   5.450   2.193   1.00 0.00 ? 44  PHE A HD2  5  
ATOM 9329  H HE1  . PHE A 1 44  ? 10.359  3.461   5.286   1.00 0.00 ? 44  PHE A HE1  5  
ATOM 9330  H HE2  . PHE A 1 44  ? 7.623   3.053   2.042   1.00 0.00 ? 44  PHE A HE2  5  
ATOM 9331  H HZ   . PHE A 1 44  ? 9.260   2.056   3.588   1.00 0.00 ? 44  PHE A HZ   5  
ATOM 9332  N N    . ALA A 1 45  ? 8.799   9.331   1.083   1.00 0.00 ? 45  ALA A N    5  
ATOM 9333  C CA   . ALA A 1 45  ? 8.558   9.445   -0.350  1.00 0.00 ? 45  ALA A CA   5  
ATOM 9334  C C    . ALA A 1 45  ? 9.639   8.724   -1.147  1.00 0.00 ? 45  ALA A C    5  
ATOM 9335  O O    . ALA A 1 45  ? 9.370   7.784   -1.896  1.00 0.00 ? 45  ALA A O    5  
ATOM 9336  C CB   . ALA A 1 45  ? 8.486   10.909  -0.758  1.00 0.00 ? 45  ALA A CB   5  
ATOM 9337  H H    . ALA A 1 45  ? 8.934   10.145  1.612   1.00 0.00 ? 45  ALA A H    5  
ATOM 9338  H HA   . ALA A 1 45  ? 7.602   8.989   -0.565  1.00 0.00 ? 45  ALA A HA   5  
ATOM 9339  H HB1  . ALA A 1 45  ? 9.191   11.094  -1.555  1.00 0.00 ? 45  ALA A HB1  5  
ATOM 9340  H HB2  . ALA A 1 45  ? 7.488   11.139  -1.099  1.00 0.00 ? 45  ALA A HB2  5  
ATOM 9341  H HB3  . ALA A 1 45  ? 8.729   11.531  0.090   1.00 0.00 ? 45  ALA A HB3  5  
ATOM 9342  N N    . PRO A 1 46  ? 10.893  9.172   -0.985  1.00 0.00 ? 46  PRO A N    5  
ATOM 9343  C CA   . PRO A 1 46  ? 12.040  8.583   -1.682  1.00 0.00 ? 46  PRO A CA   5  
ATOM 9344  C C    . PRO A 1 46  ? 12.371  7.184   -1.175  1.00 0.00 ? 46  PRO A C    5  
ATOM 9345  O O    . PRO A 1 46  ? 12.828  6.330   -1.936  1.00 0.00 ? 46  PRO A O    5  
ATOM 9346  C CB   . PRO A 1 46  ? 13.183  9.551   -1.365  1.00 0.00 ? 46  PRO A CB   5  
ATOM 9347  C CG   . PRO A 1 46  ? 12.788  10.195  -0.081  1.00 0.00 ? 46  PRO A CG   5  
ATOM 9348  C CD   . PRO A 1 46  ? 11.287  10.288  -0.109  1.00 0.00 ? 46  PRO A CD   5  
ATOM 9349  H HA   . PRO A 1 46  ? 11.881  8.549   -2.750  1.00 0.00 ? 46  PRO A HA   5  
ATOM 9350  H HB2  . PRO A 1 46  ? 14.107  8.999   -1.263  1.00 0.00 ? 46  PRO A HB2  5  
ATOM 9351  H HB3  . PRO A 1 46  ? 13.276  10.276  -2.159  1.00 0.00 ? 46  PRO A HB3  5  
ATOM 9352  H HG2  . PRO A 1 46  ? 13.111  9.587   0.750   1.00 0.00 ? 46  PRO A HG2  5  
ATOM 9353  H HG3  . PRO A 1 46  ? 13.222  11.182  -0.017  1.00 0.00 ? 46  PRO A HG3  5  
ATOM 9354  H HD2  . PRO A 1 46  ? 10.883  10.160  0.884   1.00 0.00 ? 46  PRO A HD2  5  
ATOM 9355  H HD3  . PRO A 1 46  ? 10.975  11.234  -0.527  1.00 0.00 ? 46  PRO A HD3  5  
ATOM 9356  N N    . ILE A 1 47  ? 12.137  6.955   0.113   1.00 0.00 ? 47  ILE A N    5  
ATOM 9357  C CA   . ILE A 1 47  ? 12.408  5.658   0.720   1.00 0.00 ? 47  ILE A CA   5  
ATOM 9358  C C    . ILE A 1 47  ? 11.580  4.559   0.063   1.00 0.00 ? 47  ILE A C    5  
ATOM 9359  O O    . ILE A 1 47  ? 12.094  3.486   -0.254  1.00 0.00 ? 47  ILE A O    5  
ATOM 9360  C CB   . ILE A 1 47  ? 12.115  5.672   2.232   1.00 0.00 ? 47  ILE A CB   5  
ATOM 9361  C CG1  . ILE A 1 47  ? 13.071  6.627   2.950   1.00 0.00 ? 47  ILE A CG1  5  
ATOM 9362  C CG2  . ILE A 1 47  ? 12.229  4.268   2.806   1.00 0.00 ? 47  ILE A CG2  5  
ATOM 9363  C CD1  . ILE A 1 47  ? 12.600  7.028   4.330   1.00 0.00 ? 47  ILE A CD1  5  
ATOM 9364  H H    . ILE A 1 47  ? 11.772  7.676   0.667   1.00 0.00 ? 47  ILE A H    5  
ATOM 9365  H HA   . ILE A 1 47  ? 13.457  5.438   0.579   1.00 0.00 ? 47  ILE A HA   5  
ATOM 9366  H HB   . ILE A 1 47  ? 11.101  6.013   2.376   1.00 0.00 ? 47  ILE A HB   5  
ATOM 9367  H HG12 . ILE A 1 47  ? 14.034  6.152   3.054   1.00 0.00 ? 47  ILE A HG12 5  
ATOM 9368  H HG13 . ILE A 1 47  ? 13.180  7.526   2.361   1.00 0.00 ? 47  ILE A HG13 5  
ATOM 9369  H HG21 . ILE A 1 47  ? 13.136  3.805   2.447   1.00 0.00 ? 47  ILE A HG21 5  
ATOM 9370  H HG22 . ILE A 1 47  ? 12.256  4.322   3.884   1.00 0.00 ? 47  ILE A HG22 5  
ATOM 9371  H HG23 . ILE A 1 47  ? 11.378  3.681   2.495   1.00 0.00 ? 47  ILE A HG23 5  
ATOM 9372  H HD11 . ILE A 1 47  ? 11.561  6.759   4.449   1.00 0.00 ? 47  ILE A HD11 5  
ATOM 9373  H HD12 . ILE A 1 47  ? 13.192  6.520   5.076   1.00 0.00 ? 47  ILE A HD12 5  
ATOM 9374  H HD13 . ILE A 1 47  ? 12.709  8.097   4.451   1.00 0.00 ? 47  ILE A HD13 5  
ATOM 9375  N N    . TYR A 1 48  ? 10.297  4.835   -0.142  1.00 0.00 ? 48  TYR A N    5  
ATOM 9376  C CA   . TYR A 1 48  ? 9.397   3.870   -0.761  1.00 0.00 ? 48  TYR A CA   5  
ATOM 9377  C C    . TYR A 1 48  ? 9.824   3.569   -2.194  1.00 0.00 ? 48  TYR A C    5  
ATOM 9378  O O    . TYR A 1 48  ? 9.717   2.435   -2.660  1.00 0.00 ? 48  TYR A O    5  
ATOM 9379  C CB   . TYR A 1 48  ? 7.961   4.397   -0.744  1.00 0.00 ? 48  TYR A CB   5  
ATOM 9380  C CG   . TYR A 1 48  ? 6.924   3.337   -1.042  1.00 0.00 ? 48  TYR A CG   5  
ATOM 9381  C CD1  . TYR A 1 48  ? 6.973   2.095   -0.420  1.00 0.00 ? 48  TYR A CD1  5  
ATOM 9382  C CD2  . TYR A 1 48  ? 5.896   3.577   -1.946  1.00 0.00 ? 48  TYR A CD2  5  
ATOM 9383  C CE1  . TYR A 1 48  ? 6.028   1.124   -0.690  1.00 0.00 ? 48  TYR A CE1  5  
ATOM 9384  C CE2  . TYR A 1 48  ? 4.947   2.612   -2.220  1.00 0.00 ? 48  TYR A CE2  5  
ATOM 9385  C CZ   . TYR A 1 48  ? 5.017   1.388   -1.590  1.00 0.00 ? 48  TYR A CZ   5  
ATOM 9386  O OH   . TYR A 1 48  ? 4.073   0.423   -1.862  1.00 0.00 ? 48  TYR A OH   5  
ATOM 9387  H H    . TYR A 1 48  ? 9.946   5.708   0.132   1.00 0.00 ? 48  TYR A H    5  
ATOM 9388  H HA   . TYR A 1 48  ? 9.442   2.957   -0.185  1.00 0.00 ? 48  TYR A HA   5  
ATOM 9389  H HB2  . TYR A 1 48  ? 7.746   4.805   0.231   1.00 0.00 ? 48  TYR A HB2  5  
ATOM 9390  H HB3  . TYR A 1 48  ? 7.862   5.176   -1.486  1.00 0.00 ? 48  TYR A HB3  5  
ATOM 9391  H HD1  . TYR A 1 48  ? 7.766   1.892   0.284   1.00 0.00 ? 48  TYR A HD1  5  
ATOM 9392  H HD2  . TYR A 1 48  ? 5.845   4.538   -2.438  1.00 0.00 ? 48  TYR A HD2  5  
ATOM 9393  H HE1  . TYR A 1 48  ? 6.082   0.165   -0.196  1.00 0.00 ? 48  TYR A HE1  5  
ATOM 9394  H HE2  . TYR A 1 48  ? 4.155   2.818   -2.925  1.00 0.00 ? 48  TYR A HE2  5  
ATOM 9395  H HH   . TYR A 1 48  ? 3.444   0.763   -2.502  1.00 0.00 ? 48  TYR A HH   5  
ATOM 9396  N N    . ALA A 1 49  ? 10.307  4.594   -2.888  1.00 0.00 ? 49  ALA A N    5  
ATOM 9397  C CA   . ALA A 1 49  ? 10.753  4.440   -4.268  1.00 0.00 ? 49  ALA A CA   5  
ATOM 9398  C C    . ALA A 1 49  ? 11.905  3.445   -4.365  1.00 0.00 ? 49  ALA A C    5  
ATOM 9399  O O    . ALA A 1 49  ? 11.846  2.487   -5.135  1.00 0.00 ? 49  ALA A O    5  
ATOM 9400  C CB   . ALA A 1 49  ? 11.167  5.787   -4.842  1.00 0.00 ? 49  ALA A CB   5  
ATOM 9401  H H    . ALA A 1 49  ? 10.367  5.474   -2.462  1.00 0.00 ? 49  ALA A H    5  
ATOM 9402  H HA   . ALA A 1 49  ? 9.920   4.070   -4.848  1.00 0.00 ? 49  ALA A HA   5  
ATOM 9403  H HB1  . ALA A 1 49  ? 10.972  6.563   -4.115  1.00 0.00 ? 49  ALA A HB1  5  
ATOM 9404  H HB2  . ALA A 1 49  ? 12.221  5.770   -5.076  1.00 0.00 ? 49  ALA A HB2  5  
ATOM 9405  H HB3  . ALA A 1 49  ? 10.601  5.985   -5.739  1.00 0.00 ? 49  ALA A HB3  5  
ATOM 9406  N N    . ASP A 1 50  ? 12.951  3.680   -3.580  1.00 0.00 ? 50  ASP A N    5  
ATOM 9407  C CA   . ASP A 1 50  ? 14.116  2.804   -3.578  1.00 0.00 ? 50  ASP A CA   5  
ATOM 9408  C C    . ASP A 1 50  ? 13.710  1.360   -3.297  1.00 0.00 ? 50  ASP A C    5  
ATOM 9409  O O    . ASP A 1 50  ? 14.110  0.441   -4.014  1.00 0.00 ? 50  ASP A O    5  
ATOM 9410  C CB   . ASP A 1 50  ? 15.131  3.273   -2.534  1.00 0.00 ? 50  ASP A CB   5  
ATOM 9411  C CG   . ASP A 1 50  ? 16.545  2.835   -2.864  1.00 0.00 ? 50  ASP A CG   5  
ATOM 9412  O OD1  . ASP A 1 50  ? 16.708  1.735   -3.433  1.00 0.00 ? 50  ASP A OD1  5  
ATOM 9413  O OD2  . ASP A 1 50  ? 17.488  3.592   -2.553  1.00 0.00 ? 50  ASP A OD2  5  
ATOM 9414  H H    . ASP A 1 50  ? 12.938  4.461   -2.988  1.00 0.00 ? 50  ASP A H    5  
ATOM 9415  H HA   . ASP A 1 50  ? 14.570  2.853   -4.556  1.00 0.00 ? 50  ASP A HA   5  
ATOM 9416  H HB2  . ASP A 1 50  ? 15.112  4.352   -2.482  1.00 0.00 ? 50  ASP A HB2  5  
ATOM 9417  H HB3  . ASP A 1 50  ? 14.862  2.865   -1.571  1.00 0.00 ? 50  ASP A HB3  5  
ATOM 9418  N N    . LEU A 1 51  ? 12.915  1.167   -2.251  1.00 0.00 ? 51  LEU A N    5  
ATOM 9419  C CA   . LEU A 1 51  ? 12.455  -0.165  -1.875  1.00 0.00 ? 51  LEU A CA   5  
ATOM 9420  C C    . LEU A 1 51  ? 11.752  -0.848  -3.043  1.00 0.00 ? 51  LEU A C    5  
ATOM 9421  O O    . LEU A 1 51  ? 12.206  -1.881  -3.536  1.00 0.00 ? 51  LEU A O    5  
ATOM 9422  C CB   . LEU A 1 51  ? 11.511  -0.080  -0.674  1.00 0.00 ? 51  LEU A CB   5  
ATOM 9423  C CG   . LEU A 1 51  ? 12.176  -0.044  0.702   1.00 0.00 ? 51  LEU A CG   5  
ATOM 9424  C CD1  . LEU A 1 51  ? 11.192  0.437   1.758   1.00 0.00 ? 51  LEU A CD1  5  
ATOM 9425  C CD2  . LEU A 1 51  ? 12.724  -1.416  1.066   1.00 0.00 ? 51  LEU A CD2  5  
ATOM 9426  H H    . LEU A 1 51  ? 12.630  1.938   -1.718  1.00 0.00 ? 51  LEU A H    5  
ATOM 9427  H HA   . LEU A 1 51  ? 13.321  -0.749  -1.600  1.00 0.00 ? 51  LEU A HA   5  
ATOM 9428  H HB2  . LEU A 1 51  ? 10.922  0.817   -0.780  1.00 0.00 ? 51  LEU A HB2  5  
ATOM 9429  H HB3  . LEU A 1 51  ? 10.860  -0.942  -0.706  1.00 0.00 ? 51  LEU A HB3  5  
ATOM 9430  H HG   . LEU A 1 51  ? 13.004  0.652   0.677   1.00 0.00 ? 51  LEU A HG   5  
ATOM 9431  H HD11 . LEU A 1 51  ? 10.574  -0.389  2.076   1.00 0.00 ? 51  LEU A HD11 5  
ATOM 9432  H HD12 . LEU A 1 51  ? 10.569  1.214   1.341   1.00 0.00 ? 51  LEU A HD12 5  
ATOM 9433  H HD13 . LEU A 1 51  ? 11.737  0.828   2.605   1.00 0.00 ? 51  LEU A HD13 5  
ATOM 9434  H HD21 . LEU A 1 51  ? 13.785  -1.342  1.252   1.00 0.00 ? 51  LEU A HD21 5  
ATOM 9435  H HD22 . LEU A 1 51  ? 12.549  -2.102  0.250   1.00 0.00 ? 51  LEU A HD22 5  
ATOM 9436  H HD23 . LEU A 1 51  ? 12.227  -1.778  1.954   1.00 0.00 ? 51  LEU A HD23 5  
ATOM 9437  N N    . SER A 1 52  ? 10.641  -0.264  -3.481  1.00 0.00 ? 52  SER A N    5  
ATOM 9438  C CA   . SER A 1 52  ? 9.873   -0.818  -4.591  1.00 0.00 ? 52  SER A CA   5  
ATOM 9439  C C    . SER A 1 52  ? 10.792  -1.217  -5.741  1.00 0.00 ? 52  SER A C    5  
ATOM 9440  O O    . SER A 1 52  ? 10.889  -2.393  -6.094  1.00 0.00 ? 52  SER A O    5  
ATOM 9441  C CB   . SER A 1 52  ? 8.838   0.198   -5.079  1.00 0.00 ? 52  SER A CB   5  
ATOM 9442  O OG   . SER A 1 52  ? 9.453   1.429   -5.419  1.00 0.00 ? 52  SER A OG   5  
ATOM 9443  H H    . SER A 1 52  ? 10.330  0.557   -3.046  1.00 0.00 ? 52  SER A H    5  
ATOM 9444  H HA   . SER A 1 52  ? 9.361   -1.698  -4.233  1.00 0.00 ? 52  SER A HA   5  
ATOM 9445  H HB2  . SER A 1 52  ? 8.337   -0.194  -5.951  1.00 0.00 ? 52  SER A HB2  5  
ATOM 9446  H HB3  . SER A 1 52  ? 8.115   0.374   -4.296  1.00 0.00 ? 52  SER A HB3  5  
ATOM 9447  H HG   . SER A 1 52  ? 8.791   2.033   -5.764  1.00 0.00 ? 52  SER A HG   5  
ATOM 9448  N N    . LEU A 1 53  ? 11.465  -0.230  -6.323  1.00 0.00 ? 53  LEU A N    5  
ATOM 9449  C CA   . LEU A 1 53  ? 12.377  -0.477  -7.434  1.00 0.00 ? 53  LEU A CA   5  
ATOM 9450  C C    . LEU A 1 53  ? 13.193  -1.744  -7.198  1.00 0.00 ? 53  LEU A C    5  
ATOM 9451  O O    . LEU A 1 53  ? 13.244  -2.631  -8.051  1.00 0.00 ? 53  LEU A O    5  
ATOM 9452  C CB   . LEU A 1 53  ? 13.313  0.718   -7.627  1.00 0.00 ? 53  LEU A CB   5  
ATOM 9453  C CG   . LEU A 1 53  ? 12.651  2.027   -8.057  1.00 0.00 ? 53  LEU A CG   5  
ATOM 9454  C CD1  . LEU A 1 53  ? 13.609  3.194   -7.877  1.00 0.00 ? 53  LEU A CD1  5  
ATOM 9455  C CD2  . LEU A 1 53  ? 12.181  1.938   -9.501  1.00 0.00 ? 53  LEU A CD2  5  
ATOM 9456  H H    . LEU A 1 53  ? 11.347  0.686   -5.998  1.00 0.00 ? 53  LEU A H    5  
ATOM 9457  H HA   . LEU A 1 53  ? 11.784  -0.606  -8.327  1.00 0.00 ? 53  LEU A HA   5  
ATOM 9458  H HB2  . LEU A 1 53  ? 13.819  0.895   -6.690  1.00 0.00 ? 53  LEU A HB2  5  
ATOM 9459  H HB3  . LEU A 1 53  ? 14.039  0.450   -8.381  1.00 0.00 ? 53  LEU A HB3  5  
ATOM 9460  H HG   . LEU A 1 53  ? 11.786  2.207   -7.434  1.00 0.00 ? 53  LEU A HG   5  
ATOM 9461  H HD11 . LEU A 1 53  ? 13.673  3.449   -6.830  1.00 0.00 ? 53  LEU A HD11 5  
ATOM 9462  H HD12 . LEU A 1 53  ? 13.247  4.046   -8.433  1.00 0.00 ? 53  LEU A HD12 5  
ATOM 9463  H HD13 . LEU A 1 53  ? 14.587  2.916   -8.241  1.00 0.00 ? 53  LEU A HD13 5  
ATOM 9464  H HD21 . LEU A 1 53  ? 13.040  1.905   -10.157 1.00 0.00 ? 53  LEU A HD21 5  
ATOM 9465  H HD22 . LEU A 1 53  ? 11.581  2.804   -9.739  1.00 0.00 ? 53  LEU A HD22 5  
ATOM 9466  H HD23 . LEU A 1 53  ? 11.592  1.043   -9.634  1.00 0.00 ? 53  LEU A HD23 5  
ATOM 9467  N N    . LYS A 1 54  ? 13.829  -1.824  -6.034  1.00 0.00 ? 54  LYS A N    5  
ATOM 9468  C CA   . LYS A 1 54  ? 14.640  -2.983  -5.683  1.00 0.00 ? 54  LYS A CA   5  
ATOM 9469  C C    . LYS A 1 54  ? 13.821  -4.267  -5.772  1.00 0.00 ? 54  LYS A C    5  
ATOM 9470  O O    . LYS A 1 54  ? 14.195  -5.205  -6.477  1.00 0.00 ? 54  LYS A O    5  
ATOM 9471  C CB   . LYS A 1 54  ? 15.207  -2.825  -4.270  1.00 0.00 ? 54  LYS A CB   5  
ATOM 9472  C CG   . LYS A 1 54  ? 16.502  -2.033  -4.220  1.00 0.00 ? 54  LYS A CG   5  
ATOM 9473  C CD   . LYS A 1 54  ? 16.847  -1.618  -2.799  1.00 0.00 ? 54  LYS A CD   5  
ATOM 9474  C CE   . LYS A 1 54  ? 17.580  -2.725  -2.058  1.00 0.00 ? 54  LYS A CE   5  
ATOM 9475  N NZ   . LYS A 1 54  ? 19.035  -2.737  -2.376  1.00 0.00 ? 54  LYS A NZ   5  
ATOM 9476  H H    . LYS A 1 54  ? 13.749  -1.084  -5.395  1.00 0.00 ? 54  LYS A H    5  
ATOM 9477  H HA   . LYS A 1 54  ? 15.457  -3.042  -6.385  1.00 0.00 ? 54  LYS A HA   5  
ATOM 9478  H HB2  . LYS A 1 54  ? 14.476  -2.320  -3.656  1.00 0.00 ? 54  LYS A HB2  5  
ATOM 9479  H HB3  . LYS A 1 54  ? 15.394  -3.807  -3.858  1.00 0.00 ? 54  LYS A HB3  5  
ATOM 9480  H HG2  . LYS A 1 54  ? 17.303  -2.644  -4.609  1.00 0.00 ? 54  LYS A HG2  5  
ATOM 9481  H HG3  . LYS A 1 54  ? 16.395  -1.146  -4.828  1.00 0.00 ? 54  LYS A HG3  5  
ATOM 9482  H HD2  . LYS A 1 54  ? 17.479  -0.743  -2.833  1.00 0.00 ? 54  LYS A HD2  5  
ATOM 9483  H HD3  . LYS A 1 54  ? 15.934  -1.385  -2.270  1.00 0.00 ? 54  LYS A HD3  5  
ATOM 9484  H HE2  . LYS A 1 54  ? 17.454  -2.575  -0.997  1.00 0.00 ? 54  LYS A HE2  5  
ATOM 9485  H HE3  . LYS A 1 54  ? 17.151  -3.675  -2.340  1.00 0.00 ? 54  LYS A HE3  5  
ATOM 9486  H HZ1  . LYS A 1 54  ? 19.411  -1.767  -2.362  1.00 0.00 ? 54  LYS A HZ1  5  
ATOM 9487  H HZ2  . LYS A 1 54  ? 19.191  -3.143  -3.320  1.00 0.00 ? 54  LYS A HZ2  5  
ATOM 9488  H HZ3  . LYS A 1 54  ? 19.550  -3.308  -1.675  1.00 0.00 ? 54  LYS A HZ3  5  
ATOM 9489  N N    . TYR A 1 55  ? 12.703  -4.302  -5.055  1.00 0.00 ? 55  TYR A N    5  
ATOM 9490  C CA   . TYR A 1 55  ? 11.833  -5.471  -5.054  1.00 0.00 ? 55  TYR A CA   5  
ATOM 9491  C C    . TYR A 1 55  ? 10.854  -5.424  -6.223  1.00 0.00 ? 55  TYR A C    5  
ATOM 9492  O O    . TYR A 1 55  ? 9.852   -6.138  -6.238  1.00 0.00 ? 55  TYR A O    5  
ATOM 9493  C CB   . TYR A 1 55  ? 11.064  -5.559  -3.734  1.00 0.00 ? 55  TYR A CB   5  
ATOM 9494  C CG   . TYR A 1 55  ? 11.953  -5.765  -2.528  1.00 0.00 ? 55  TYR A CG   5  
ATOM 9495  C CD1  . TYR A 1 55  ? 12.563  -4.688  -1.898  1.00 0.00 ? 55  TYR A CD1  5  
ATOM 9496  C CD2  . TYR A 1 55  ? 12.182  -7.038  -2.019  1.00 0.00 ? 55  TYR A CD2  5  
ATOM 9497  C CE1  . TYR A 1 55  ? 13.376  -4.872  -0.796  1.00 0.00 ? 55  TYR A CE1  5  
ATOM 9498  C CE2  . TYR A 1 55  ? 12.992  -7.231  -0.917  1.00 0.00 ? 55  TYR A CE2  5  
ATOM 9499  C CZ   . TYR A 1 55  ? 13.588  -6.145  -0.310  1.00 0.00 ? 55  TYR A CZ   5  
ATOM 9500  O OH   . TYR A 1 55  ? 14.396  -6.333  0.788   1.00 0.00 ? 55  TYR A OH   5  
ATOM 9501  H H    . TYR A 1 55  ? 12.459  -3.524  -4.513  1.00 0.00 ? 55  TYR A H    5  
ATOM 9502  H HA   . TYR A 1 55  ? 12.455  -6.349  -5.155  1.00 0.00 ? 55  TYR A HA   5  
ATOM 9503  H HB2  . TYR A 1 55  ? 10.512  -4.644  -3.585  1.00 0.00 ? 55  TYR A HB2  5  
ATOM 9504  H HB3  . TYR A 1 55  ? 10.373  -6.388  -3.782  1.00 0.00 ? 55  TYR A HB3  5  
ATOM 9505  H HD1  . TYR A 1 55  ? 12.395  -3.692  -2.281  1.00 0.00 ? 55  TYR A HD1  5  
ATOM 9506  H HD2  . TYR A 1 55  ? 11.714  -7.886  -2.497  1.00 0.00 ? 55  TYR A HD2  5  
ATOM 9507  H HE1  . TYR A 1 55  ? 13.842  -4.022  -0.320  1.00 0.00 ? 55  TYR A HE1  5  
ATOM 9508  H HE2  . TYR A 1 55  ? 13.158  -8.228  -0.536  1.00 0.00 ? 55  TYR A HE2  5  
ATOM 9509  H HH   . TYR A 1 55  ? 14.755  -5.488  1.068   1.00 0.00 ? 55  TYR A HH   5  
ATOM 9510  N N    . ASN A 1 56  ? 11.152  -4.575  -7.202  1.00 0.00 ? 56  ASN A N    5  
ATOM 9511  C CA   . ASN A 1 56  ? 10.300  -4.433  -8.376  1.00 0.00 ? 56  ASN A CA   5  
ATOM 9512  C C    . ASN A 1 56  ? 10.554  -5.560  -9.373  1.00 0.00 ? 56  ASN A C    5  
ATOM 9513  O O    . ASN A 1 56  ? 11.469  -5.482  -10.194 1.00 0.00 ? 56  ASN A O    5  
ATOM 9514  C CB   . ASN A 1 56  ? 10.542  -3.079  -9.047  1.00 0.00 ? 56  ASN A CB   5  
ATOM 9515  C CG   . ASN A 1 56  ? 9.314   -2.565  -9.772  1.00 0.00 ? 56  ASN A CG   5  
ATOM 9516  O OD1  . ASN A 1 56  ? 8.648   -3.308  -10.493 1.00 0.00 ? 56  ASN A OD1  5  
ATOM 9517  N ND2  . ASN A 1 56  ? 9.007   -1.286  -9.582  1.00 0.00 ? 56  ASN A ND2  5  
ATOM 9518  H H    . ASN A 1 56  ? 11.965  -4.032  -7.132  1.00 0.00 ? 56  ASN A H    5  
ATOM 9519  H HA   . ASN A 1 56  ? 9.273   -4.483  -8.048  1.00 0.00 ? 56  ASN A HA   5  
ATOM 9520  H HB2  . ASN A 1 56  ? 10.822  -2.356  -8.295  1.00 0.00 ? 56  ASN A HB2  5  
ATOM 9521  H HB3  . ASN A 1 56  ? 11.345  -3.177  -9.762  1.00 0.00 ? 56  ASN A HB3  5  
ATOM 9522  H HD21 . ASN A 1 56  ? 9.583   -0.755  -8.993  1.00 0.00 ? 56  ASN A HD21 5  
ATOM 9523  H HD22 . ASN A 1 56  ? 8.217   -0.928  -10.038 1.00 0.00 ? 56  ASN A HD22 5  
ATOM 9524  N N    . CYS A 1 57  ? 9.739   -6.606  -9.295  1.00 0.00 ? 57  CYS A N    5  
ATOM 9525  C CA   . CYS A 1 57  ? 9.875   -7.749  -10.190 1.00 0.00 ? 57  CYS A CA   5  
ATOM 9526  C C    . CYS A 1 57  ? 8.509   -8.329  -10.543 1.00 0.00 ? 57  CYS A C    5  
ATOM 9527  O O    . CYS A 1 57  ? 7.513   -8.056  -9.871  1.00 0.00 ? 57  CYS A O    5  
ATOM 9528  C CB   . CYS A 1 57  ? 10.748  -8.827  -9.545  1.00 0.00 ? 57  CYS A CB   5  
ATOM 9529  S SG   . CYS A 1 57  ? 11.638  -9.863  -10.730 1.00 0.00 ? 57  CYS A SG   5  
ATOM 9530  H H    . CYS A 1 57  ? 9.028   -6.610  -8.620  1.00 0.00 ? 57  CYS A H    5  
ATOM 9531  H HA   . CYS A 1 57  ? 10.351  -7.406  -11.095 1.00 0.00 ? 57  CYS A HA   5  
ATOM 9532  H HB2  . CYS A 1 57  ? 11.481  -8.353  -8.909  1.00 0.00 ? 57  CYS A HB2  5  
ATOM 9533  H HB3  . CYS A 1 57  ? 10.125  -9.473  -8.945  1.00 0.00 ? 57  CYS A HB3  5  
ATOM 9534  H HG   . CYS A 1 57  ? 12.662  -9.164  -11.195 1.00 0.00 ? 57  CYS A HG   5  
ATOM 9535  N N    . THR A 1 58  ? 8.467   -9.130  -11.604 1.00 0.00 ? 58  THR A N    5  
ATOM 9536  C CA   . THR A 1 58  ? 7.224   -9.746  -12.048 1.00 0.00 ? 58  THR A CA   5  
ATOM 9537  C C    . THR A 1 58  ? 6.398   -10.235 -10.864 1.00 0.00 ? 58  THR A C    5  
ATOM 9538  O O    . THR A 1 58  ? 5.172   -10.131 -10.864 1.00 0.00 ? 58  THR A O    5  
ATOM 9539  C CB   . THR A 1 58  ? 7.491   -10.929 -12.997 1.00 0.00 ? 58  THR A CB   5  
ATOM 9540  O OG1  . THR A 1 58  ? 8.349   -10.516 -14.067 1.00 0.00 ? 58  THR A OG1  5  
ATOM 9541  C CG2  . THR A 1 58  ? 6.188   -11.471 -13.567 1.00 0.00 ? 58  THR A CG2  5  
ATOM 9542  H H    . THR A 1 58  ? 9.294   -9.309  -12.098 1.00 0.00 ? 58  THR A H    5  
ATOM 9543  H HA   . THR A 1 58  ? 6.656   -9.000  -12.587 1.00 0.00 ? 58  THR A HA   5  
ATOM 9544  H HB   . THR A 1 58  ? 7.977   -11.716 -12.439 1.00 0.00 ? 58  THR A HB   5  
ATOM 9545  H HG1  . THR A 1 58  ? 8.744   -11.289 -14.477 1.00 0.00 ? 58  THR A HG1  5  
ATOM 9546  H HG21 . THR A 1 58  ? 6.005   -12.459 -13.170 1.00 0.00 ? 58  THR A HG21 5  
ATOM 9547  H HG22 . THR A 1 58  ? 6.260   -11.522 -14.643 1.00 0.00 ? 58  THR A HG22 5  
ATOM 9548  H HG23 . THR A 1 58  ? 5.375   -10.817 -13.290 1.00 0.00 ? 58  THR A HG23 5  
ATOM 9549  N N    . GLY A 1 59  ? 7.079   -10.768 -9.854  1.00 0.00 ? 59  GLY A N    5  
ATOM 9550  C CA   . GLY A 1 59  ? 6.391   -11.265 -8.677  1.00 0.00 ? 59  GLY A CA   5  
ATOM 9551  C C    . GLY A 1 59  ? 5.870   -10.148 -7.795  1.00 0.00 ? 59  GLY A C    5  
ATOM 9552  O O    . GLY A 1 59  ? 4.787   -9.611  -8.035  1.00 0.00 ? 59  GLY A O    5  
ATOM 9553  H H    . GLY A 1 59  ? 8.056   -10.825 -9.909  1.00 0.00 ? 59  GLY A H    5  
ATOM 9554  H HA2  . GLY A 1 59  ? 5.561   -11.879 -8.991  1.00 0.00 ? 59  GLY A HA2  5  
ATOM 9555  H HA3  . GLY A 1 59  ? 7.077   -11.871 -8.102  1.00 0.00 ? 59  GLY A HA3  5  
ATOM 9556  N N    . LEU A 1 60  ? 6.639   -9.797  -6.771  1.00 0.00 ? 60  LEU A N    5  
ATOM 9557  C CA   . LEU A 1 60  ? 6.248   -8.736  -5.848  1.00 0.00 ? 60  LEU A CA   5  
ATOM 9558  C C    . LEU A 1 60  ? 6.208   -7.386  -6.556  1.00 0.00 ? 60  LEU A C    5  
ATOM 9559  O O    . LEU A 1 60  ? 7.127   -7.034  -7.295  1.00 0.00 ? 60  LEU A O    5  
ATOM 9560  C CB   . LEU A 1 60  ? 7.219   -8.677  -4.667  1.00 0.00 ? 60  LEU A CB   5  
ATOM 9561  C CG   . LEU A 1 60  ? 6.908   -7.633  -3.595  1.00 0.00 ? 60  LEU A CG   5  
ATOM 9562  C CD1  . LEU A 1 60  ? 5.748   -8.091  -2.723  1.00 0.00 ? 60  LEU A CD1  5  
ATOM 9563  C CD2  . LEU A 1 60  ? 8.140   -7.358  -2.745  1.00 0.00 ? 60  LEU A CD2  5  
ATOM 9564  H H    . LEU A 1 60  ? 7.491   -10.260 -6.631  1.00 0.00 ? 60  LEU A H    5  
ATOM 9565  H HA   . LEU A 1 60  ? 5.259   -8.966  -5.480  1.00 0.00 ? 60  LEU A HA   5  
ATOM 9566  H HB2  . LEU A 1 60  ? 7.222   -9.647  -4.193  1.00 0.00 ? 60  LEU A HB2  5  
ATOM 9567  H HB3  . LEU A 1 60  ? 8.203   -8.467  -5.060  1.00 0.00 ? 60  LEU A HB3  5  
ATOM 9568  H HG   . LEU A 1 60  ? 6.618   -6.708  -4.075  1.00 0.00 ? 60  LEU A HG   5  
ATOM 9569  H HD11 . LEU A 1 60  ? 5.892   -7.733  -1.715  1.00 0.00 ? 60  LEU A HD11 5  
ATOM 9570  H HD12 . LEU A 1 60  ? 5.706   -9.170  -2.720  1.00 0.00 ? 60  LEU A HD12 5  
ATOM 9571  H HD13 . LEU A 1 60  ? 4.824   -7.696  -3.118  1.00 0.00 ? 60  LEU A HD13 5  
ATOM 9572  H HD21 . LEU A 1 60  ? 8.893   -8.103  -2.953  1.00 0.00 ? 60  LEU A HD21 5  
ATOM 9573  H HD22 . LEU A 1 60  ? 7.872   -7.399  -1.699  1.00 0.00 ? 60  LEU A HD22 5  
ATOM 9574  H HD23 . LEU A 1 60  ? 8.527   -6.378  -2.979  1.00 0.00 ? 60  LEU A HD23 5  
ATOM 9575  N N    . ASN A 1 61  ? 5.137   -6.633  -6.323  1.00 0.00 ? 61  ASN A N    5  
ATOM 9576  C CA   . ASN A 1 61  ? 4.978   -5.320  -6.938  1.00 0.00 ? 61  ASN A CA   5  
ATOM 9577  C C    . ASN A 1 61  ? 4.633   -4.267  -5.889  1.00 0.00 ? 61  ASN A C    5  
ATOM 9578  O O    . ASN A 1 61  ? 4.228   -4.595  -4.774  1.00 0.00 ? 61  ASN A O    5  
ATOM 9579  C CB   . ASN A 1 61  ? 3.888   -5.364  -8.010  1.00 0.00 ? 61  ASN A CB   5  
ATOM 9580  C CG   . ASN A 1 61  ? 4.295   -6.189  -9.216  1.00 0.00 ? 61  ASN A CG   5  
ATOM 9581  O OD1  . ASN A 1 61  ? 5.070   -5.736  -10.059 1.00 0.00 ? 61  ASN A OD1  5  
ATOM 9582  N ND2  . ASN A 1 61  ? 3.774   -7.408  -9.302  1.00 0.00 ? 61  ASN A ND2  5  
ATOM 9583  H H    . ASN A 1 61  ? 4.438   -6.968  -5.725  1.00 0.00 ? 61  ASN A H    5  
ATOM 9584  H HA   . ASN A 1 61  ? 5.916   -5.055  -7.402  1.00 0.00 ? 61  ASN A HA   5  
ATOM 9585  H HB2  . ASN A 1 61  ? 2.993   -5.798  -7.587  1.00 0.00 ? 61  ASN A HB2  5  
ATOM 9586  H HB3  . ASN A 1 61  ? 3.674   -4.359  -8.340  1.00 0.00 ? 61  ASN A HB3  5  
ATOM 9587  H HD21 . ASN A 1 61  ? 3.164   -7.702  -8.594  1.00 0.00 ? 61  ASN A HD21 5  
ATOM 9588  H HD22 . ASN A 1 61  ? 4.021   -7.963  -10.071 1.00 0.00 ? 61  ASN A HD22 5  
ATOM 9589  N N    . PHE A 1 62  ? 4.797   -3.000  -6.255  1.00 0.00 ? 62  PHE A N    5  
ATOM 9590  C CA   . PHE A 1 62  ? 4.503   -1.898  -5.346  1.00 0.00 ? 62  PHE A CA   5  
ATOM 9591  C C    . PHE A 1 62  ? 3.488   -0.940  -5.963  1.00 0.00 ? 62  PHE A C    5  
ATOM 9592  O O    . PHE A 1 62  ? 3.652   -0.488  -7.095  1.00 0.00 ? 62  PHE A O    5  
ATOM 9593  C CB   . PHE A 1 62  ? 5.787   -1.142  -4.996  1.00 0.00 ? 62  PHE A CB   5  
ATOM 9594  C CG   . PHE A 1 62  ? 6.745   -1.943  -4.162  1.00 0.00 ? 62  PHE A CG   5  
ATOM 9595  C CD1  . PHE A 1 62  ? 7.319   -3.101  -4.662  1.00 0.00 ? 62  PHE A CD1  5  
ATOM 9596  C CD2  . PHE A 1 62  ? 7.073   -1.537  -2.878  1.00 0.00 ? 62  PHE A CD2  5  
ATOM 9597  C CE1  . PHE A 1 62  ? 8.201   -3.840  -3.896  1.00 0.00 ? 62  PHE A CE1  5  
ATOM 9598  C CE2  . PHE A 1 62  ? 7.955   -2.272  -2.108  1.00 0.00 ? 62  PHE A CE2  5  
ATOM 9599  C CZ   . PHE A 1 62  ? 8.520   -3.424  -2.618  1.00 0.00 ? 62  PHE A CZ   5  
ATOM 9600  H H    . PHE A 1 62  ? 5.123   -2.801  -7.158  1.00 0.00 ? 62  PHE A H    5  
ATOM 9601  H HA   . PHE A 1 62  ? 4.084   -2.316  -4.444  1.00 0.00 ? 62  PHE A HA   5  
ATOM 9602  H HB2  . PHE A 1 62  ? 6.293   -0.865  -5.908  1.00 0.00 ? 62  PHE A HB2  5  
ATOM 9603  H HB3  . PHE A 1 62  ? 5.531   -0.249  -4.445  1.00 0.00 ? 62  PHE A HB3  5  
ATOM 9604  H HD1  . PHE A 1 62  ? 7.071   -3.426  -5.661  1.00 0.00 ? 62  PHE A HD1  5  
ATOM 9605  H HD2  . PHE A 1 62  ? 6.631   -0.635  -2.478  1.00 0.00 ? 62  PHE A HD2  5  
ATOM 9606  H HE1  . PHE A 1 62  ? 8.642   -4.740  -4.297  1.00 0.00 ? 62  PHE A HE1  5  
ATOM 9607  H HE2  . PHE A 1 62  ? 8.202   -1.944  -1.109  1.00 0.00 ? 62  PHE A HE2  5  
ATOM 9608  H HZ   . PHE A 1 62  ? 9.209   -4.000  -2.018  1.00 0.00 ? 62  PHE A HZ   5  
ATOM 9609  N N    . GLY A 1 63  ? 2.436   -0.636  -5.208  1.00 0.00 ? 63  GLY A N    5  
ATOM 9610  C CA   . GLY A 1 63  ? 1.408   0.265   -5.697  1.00 0.00 ? 63  GLY A CA   5  
ATOM 9611  C C    . GLY A 1 63  ? 1.051   1.338   -4.687  1.00 0.00 ? 63  GLY A C    5  
ATOM 9612  O O    . GLY A 1 63  ? 1.396   1.234   -3.510  1.00 0.00 ? 63  GLY A O    5  
ATOM 9613  H H    . GLY A 1 63  ? 2.357   -1.027  -4.313  1.00 0.00 ? 63  GLY A H    5  
ATOM 9614  H HA2  . GLY A 1 63  ? 1.760   0.738   -6.601  1.00 0.00 ? 63  GLY A HA2  5  
ATOM 9615  H HA3  . GLY A 1 63  ? 0.521   -0.309  -5.924  1.00 0.00 ? 63  GLY A HA3  5  
ATOM 9616  N N    . LYS A 1 64  ? 0.358   2.374   -5.148  1.00 0.00 ? 64  LYS A N    5  
ATOM 9617  C CA   . LYS A 1 64  ? -0.047  3.471   -4.278  1.00 0.00 ? 64  LYS A CA   5  
ATOM 9618  C C    . LYS A 1 64  ? -1.495  3.871   -4.544  1.00 0.00 ? 64  LYS A C    5  
ATOM 9619  O O    . LYS A 1 64  ? -2.064  3.526   -5.580  1.00 0.00 ? 64  LYS A O    5  
ATOM 9620  C CB   . LYS A 1 64  ? 0.872   4.678   -4.484  1.00 0.00 ? 64  LYS A CB   5  
ATOM 9621  C CG   . LYS A 1 64  ? 2.142   4.623   -3.652  1.00 0.00 ? 64  LYS A CG   5  
ATOM 9622  C CD   . LYS A 1 64  ? 2.677   6.015   -3.360  1.00 0.00 ? 64  LYS A CD   5  
ATOM 9623  C CE   . LYS A 1 64  ? 3.359   6.617   -4.580  1.00 0.00 ? 64  LYS A CE   5  
ATOM 9624  N NZ   . LYS A 1 64  ? 3.918   7.967   -4.292  1.00 0.00 ? 64  LYS A NZ   5  
ATOM 9625  H H    . LYS A 1 64  ? 0.112   2.400   -6.097  1.00 0.00 ? 64  LYS A H    5  
ATOM 9626  H HA   . LYS A 1 64  ? 0.038   3.134   -3.256  1.00 0.00 ? 64  LYS A HA   5  
ATOM 9627  H HB2  . LYS A 1 64  ? 1.151   4.729   -5.526  1.00 0.00 ? 64  LYS A HB2  5  
ATOM 9628  H HB3  . LYS A 1 64  ? 0.332   5.576   -4.219  1.00 0.00 ? 64  LYS A HB3  5  
ATOM 9629  H HG2  . LYS A 1 64  ? 1.928   4.128   -2.717  1.00 0.00 ? 64  LYS A HG2  5  
ATOM 9630  H HG3  . LYS A 1 64  ? 2.892   4.065   -4.194  1.00 0.00 ? 64  LYS A HG3  5  
ATOM 9631  H HD2  . LYS A 1 64  ? 1.857   6.654   -3.069  1.00 0.00 ? 64  LYS A HD2  5  
ATOM 9632  H HD3  . LYS A 1 64  ? 3.393   5.954   -2.552  1.00 0.00 ? 64  LYS A HD3  5  
ATOM 9633  H HE2  . LYS A 1 64  ? 4.160   5.963   -4.887  1.00 0.00 ? 64  LYS A HE2  5  
ATOM 9634  H HE3  . LYS A 1 64  ? 2.634   6.699   -5.377  1.00 0.00 ? 64  LYS A HE3  5  
ATOM 9635  H HZ1  . LYS A 1 64  ? 4.421   7.959   -3.382  1.00 0.00 ? 64  LYS A HZ1  5  
ATOM 9636  H HZ2  . LYS A 1 64  ? 3.151   8.669   -4.246  1.00 0.00 ? 64  LYS A HZ2  5  
ATOM 9637  H HZ3  . LYS A 1 64  ? 4.583   8.245   -5.042  1.00 0.00 ? 64  LYS A HZ3  5  
ATOM 9638  N N    . VAL A 1 65  ? -2.085  4.602   -3.604  1.00 0.00 ? 65  VAL A N    5  
ATOM 9639  C CA   . VAL A 1 65  ? -3.466  5.050   -3.738  1.00 0.00 ? 65  VAL A CA   5  
ATOM 9640  C C    . VAL A 1 65  ? -3.770  6.190   -2.772  1.00 0.00 ? 65  VAL A C    5  
ATOM 9641  O O    . VAL A 1 65  ? -3.905  5.976   -1.567  1.00 0.00 ? 65  VAL A O    5  
ATOM 9642  C CB   . VAL A 1 65  ? -4.457  3.899   -3.486  1.00 0.00 ? 65  VAL A CB   5  
ATOM 9643  C CG1  . VAL A 1 65  ? -4.189  3.249   -2.137  1.00 0.00 ? 65  VAL A CG1  5  
ATOM 9644  C CG2  . VAL A 1 65  ? -5.890  4.403   -3.568  1.00 0.00 ? 65  VAL A CG2  5  
ATOM 9645  H H    . VAL A 1 65  ? -1.580  4.845   -2.800  1.00 0.00 ? 65  VAL A H    5  
ATOM 9646  H HA   . VAL A 1 65  ? -3.606  5.402   -4.750  1.00 0.00 ? 65  VAL A HA   5  
ATOM 9647  H HB   . VAL A 1 65  ? -4.315  3.154   -4.254  1.00 0.00 ? 65  VAL A HB   5  
ATOM 9648  H HG11 . VAL A 1 65  ? -4.399  2.191   -2.199  1.00 0.00 ? 65  VAL A HG11 5  
ATOM 9649  H HG12 . VAL A 1 65  ? -3.154  3.397   -1.865  1.00 0.00 ? 65  VAL A HG12 5  
ATOM 9650  H HG13 . VAL A 1 65  ? -4.826  3.698   -1.388  1.00 0.00 ? 65  VAL A HG13 5  
ATOM 9651  H HG21 . VAL A 1 65  ? -5.892  5.424   -3.918  1.00 0.00 ? 65  VAL A HG21 5  
ATOM 9652  H HG22 . VAL A 1 65  ? -6.451  3.786   -4.256  1.00 0.00 ? 65  VAL A HG22 5  
ATOM 9653  H HG23 . VAL A 1 65  ? -6.346  4.356   -2.590  1.00 0.00 ? 65  VAL A HG23 5  
ATOM 9654  N N    . ASP A 1 66  ? -3.877  7.400   -3.308  1.00 0.00 ? 66  ASP A N    5  
ATOM 9655  C CA   . ASP A 1 66  ? -4.167  8.575   -2.493  1.00 0.00 ? 66  ASP A CA   5  
ATOM 9656  C C    . ASP A 1 66  ? -5.506  8.423   -1.779  1.00 0.00 ? 66  ASP A C    5  
ATOM 9657  O O    . ASP A 1 66  ? -6.564  8.440   -2.409  1.00 0.00 ? 66  ASP A O    5  
ATOM 9658  C CB   . ASP A 1 66  ? -4.178  9.834   -3.362  1.00 0.00 ? 66  ASP A CB   5  
ATOM 9659  C CG   . ASP A 1 66  ? -4.443  11.090  -2.556  1.00 0.00 ? 66  ASP A CG   5  
ATOM 9660  O OD1  . ASP A 1 66  ? -5.572  11.239  -2.043  1.00 0.00 ? 66  ASP A OD1  5  
ATOM 9661  O OD2  . ASP A 1 66  ? -3.522  11.925  -2.438  1.00 0.00 ? 66  ASP A OD2  5  
ATOM 9662  H H    . ASP A 1 66  ? -3.759  7.507   -4.275  1.00 0.00 ? 66  ASP A H    5  
ATOM 9663  H HA   . ASP A 1 66  ? -3.387  8.666   -1.753  1.00 0.00 ? 66  ASP A HA   5  
ATOM 9664  H HB2  . ASP A 1 66  ? -3.219  9.936   -3.848  1.00 0.00 ? 66  ASP A HB2  5  
ATOM 9665  H HB3  . ASP A 1 66  ? -4.949  9.739   -4.112  1.00 0.00 ? 66  ASP A HB3  5  
ATOM 9666  N N    . VAL A 1 67  ? -5.453  8.273   -0.459  1.00 0.00 ? 67  VAL A N    5  
ATOM 9667  C CA   . VAL A 1 67  ? -6.661  8.118   0.342   1.00 0.00 ? 67  VAL A CA   5  
ATOM 9668  C C    . VAL A 1 67  ? -7.229  9.473   0.749   1.00 0.00 ? 67  VAL A C    5  
ATOM 9669  O O    . VAL A 1 67  ? -8.443  9.667   0.776   1.00 0.00 ? 67  VAL A O    5  
ATOM 9670  C CB   . VAL A 1 67  ? -6.392  7.285   1.609   1.00 0.00 ? 67  VAL A CB   5  
ATOM 9671  C CG1  . VAL A 1 67  ? -6.383  5.800   1.281   1.00 0.00 ? 67  VAL A CG1  5  
ATOM 9672  C CG2  . VAL A 1 67  ? -5.079  7.705   2.253   1.00 0.00 ? 67  VAL A CG2  5  
ATOM 9673  H H    . VAL A 1 67  ? -4.580  8.267   -0.013  1.00 0.00 ? 67  VAL A H    5  
ATOM 9674  H HA   . VAL A 1 67  ? -7.394  7.597   -0.257  1.00 0.00 ? 67  VAL A HA   5  
ATOM 9675  H HB   . VAL A 1 67  ? -7.189  7.470   2.314   1.00 0.00 ? 67  VAL A HB   5  
ATOM 9676  H HG11 . VAL A 1 67  ? -7.020  5.617   0.427   1.00 0.00 ? 67  VAL A HG11 5  
ATOM 9677  H HG12 . VAL A 1 67  ? -5.375  5.487   1.053   1.00 0.00 ? 67  VAL A HG12 5  
ATOM 9678  H HG13 . VAL A 1 67  ? -6.751  5.242   2.129   1.00 0.00 ? 67  VAL A HG13 5  
ATOM 9679  H HG21 . VAL A 1 67  ? -4.256  7.266   1.709   1.00 0.00 ? 67  VAL A HG21 5  
ATOM 9680  H HG22 . VAL A 1 67  ? -4.993  8.782   2.228   1.00 0.00 ? 67  VAL A HG22 5  
ATOM 9681  H HG23 . VAL A 1 67  ? -5.056  7.366   3.278   1.00 0.00 ? 67  VAL A HG23 5  
ATOM 9682  N N    . GLY A 1 68  ? -6.339  10.410  1.065   1.00 0.00 ? 68  GLY A N    5  
ATOM 9683  C CA   . GLY A 1 68  ? -6.770  11.737  1.466   1.00 0.00 ? 68  GLY A CA   5  
ATOM 9684  C C    . GLY A 1 68  ? -7.887  12.272  0.593   1.00 0.00 ? 68  GLY A C    5  
ATOM 9685  O O    . GLY A 1 68  ? -8.648  13.145  1.012   1.00 0.00 ? 68  GLY A O    5  
ATOM 9686  H H    . GLY A 1 68  ? -5.383  10.199  1.025   1.00 0.00 ? 68  GLY A H    5  
ATOM 9687  H HA2  . GLY A 1 68  ? -7.114  11.697  2.489   1.00 0.00 ? 68  GLY A HA2  5  
ATOM 9688  H HA3  . GLY A 1 68  ? -5.928  12.410  1.406   1.00 0.00 ? 68  GLY A HA3  5  
ATOM 9689  N N    . ARG A 1 69  ? -7.986  11.750  -0.625  1.00 0.00 ? 69  ARG A N    5  
ATOM 9690  C CA   . ARG A 1 69  ? -9.016  12.184  -1.561  1.00 0.00 ? 69  ARG A CA   5  
ATOM 9691  C C    . ARG A 1 69  ? -10.067 11.095  -1.756  1.00 0.00 ? 69  ARG A C    5  
ATOM 9692  O O    . ARG A 1 69  ? -11.258 11.382  -1.878  1.00 0.00 ? 69  ARG A O    5  
ATOM 9693  C CB   . ARG A 1 69  ? -8.390  12.550  -2.908  1.00 0.00 ? 69  ARG A CB   5  
ATOM 9694  C CG   . ARG A 1 69  ? -9.371  13.177  -3.885  1.00 0.00 ? 69  ARG A CG   5  
ATOM 9695  C CD   . ARG A 1 69  ? -10.111 12.118  -4.688  1.00 0.00 ? 69  ARG A CD   5  
ATOM 9696  N NE   . ARG A 1 69  ? -10.938 12.706  -5.739  1.00 0.00 ? 69  ARG A NE   5  
ATOM 9697  C CZ   . ARG A 1 69  ? -10.463 13.099  -6.915  1.00 0.00 ? 69  ARG A CZ   5  
ATOM 9698  N NH1  . ARG A 1 69  ? -9.173  12.966  -7.191  1.00 0.00 ? 69  ARG A NH1  5  
ATOM 9699  N NH2  . ARG A 1 69  ? -11.279 13.625  -7.820  1.00 0.00 ? 69  ARG A NH2  5  
ATOM 9700  H H    . ARG A 1 69  ? -7.350  11.058  -0.902  1.00 0.00 ? 69  ARG A H    5  
ATOM 9701  H HA   . ARG A 1 69  ? -9.494  13.059  -1.147  1.00 0.00 ? 69  ARG A HA   5  
ATOM 9702  H HB2  . ARG A 1 69  ? -7.587  13.252  -2.740  1.00 0.00 ? 69  ARG A HB2  5  
ATOM 9703  H HB3  . ARG A 1 69  ? -7.988  11.656  -3.359  1.00 0.00 ? 69  ARG A HB3  5  
ATOM 9704  H HG2  . ARG A 1 69  ? -10.092 13.762  -3.333  1.00 0.00 ? 69  ARG A HG2  5  
ATOM 9705  H HG3  . ARG A 1 69  ? -8.829  13.818  -4.564  1.00 0.00 ? 69  ARG A HG3  5  
ATOM 9706  H HD2  . ARG A 1 69  ? -9.386  11.458  -5.142  1.00 0.00 ? 69  ARG A HD2  5  
ATOM 9707  H HD3  . ARG A 1 69  ? -10.742 11.554  -4.019  1.00 0.00 ? 69  ARG A HD3  5  
ATOM 9708  H HE   . ARG A 1 69  ? -11.894 12.814  -5.556  1.00 0.00 ? 69  ARG A HE   5  
ATOM 9709  H HH11 . ARG A 1 69  ? -8.556  12.569  -6.511  1.00 0.00 ? 69  ARG A HH11 5  
ATOM 9710  H HH12 . ARG A 1 69  ? -8.817  13.261  -8.078  1.00 0.00 ? 69  ARG A HH12 5  
ATOM 9711  H HH21 . ARG A 1 69  ? -12.252 13.726  -7.616  1.00 0.00 ? 69  ARG A HH21 5  
ATOM 9712  H HH22 . ARG A 1 69  ? -10.920 13.920  -8.705  1.00 0.00 ? 69  ARG A HH22 5  
ATOM 9713  N N    . TYR A 1 70  ? -9.618  9.845   -1.784  1.00 0.00 ? 70  TYR A N    5  
ATOM 9714  C CA   . TYR A 1 70  ? -10.518 8.713   -1.967  1.00 0.00 ? 70  TYR A CA   5  
ATOM 9715  C C    . TYR A 1 70  ? -11.241 8.376   -0.666  1.00 0.00 ? 70  TYR A C    5  
ATOM 9716  O O    . TYR A 1 70  ? -10.964 7.357   -0.033  1.00 0.00 ? 70  TYR A O    5  
ATOM 9717  C CB   . TYR A 1 70  ? -9.742  7.492   -2.463  1.00 0.00 ? 70  TYR A CB   5  
ATOM 9718  C CG   . TYR A 1 70  ? -9.328  7.586   -3.915  1.00 0.00 ? 70  TYR A CG   5  
ATOM 9719  C CD1  . TYR A 1 70  ? -8.667  8.709   -4.397  1.00 0.00 ? 70  TYR A CD1  5  
ATOM 9720  C CD2  . TYR A 1 70  ? -9.600  6.554   -4.804  1.00 0.00 ? 70  TYR A CD2  5  
ATOM 9721  C CE1  . TYR A 1 70  ? -8.287  8.800   -5.722  1.00 0.00 ? 70  TYR A CE1  5  
ATOM 9722  C CE2  . TYR A 1 70  ? -9.223  6.635   -6.130  1.00 0.00 ? 70  TYR A CE2  5  
ATOM 9723  C CZ   . TYR A 1 70  ? -8.567  7.760   -6.585  1.00 0.00 ? 70  TYR A CZ   5  
ATOM 9724  O OH   . TYR A 1 70  ? -8.191  7.846   -7.906  1.00 0.00 ? 70  TYR A OH   5  
ATOM 9725  H H    . TYR A 1 70  ? -8.657  9.680   -1.681  1.00 0.00 ? 70  TYR A H    5  
ATOM 9726  H HA   . TYR A 1 70  ? -11.251 8.989   -2.712  1.00 0.00 ? 70  TYR A HA   5  
ATOM 9727  H HB2  . TYR A 1 70  ? -8.848  7.377   -1.871  1.00 0.00 ? 70  TYR A HB2  5  
ATOM 9728  H HB3  . TYR A 1 70  ? -10.358 6.612   -2.350  1.00 0.00 ? 70  TYR A HB3  5  
ATOM 9729  H HD1  . TYR A 1 70  ? -8.449  9.522   -3.719  1.00 0.00 ? 70  TYR A HD1  5  
ATOM 9730  H HD2  . TYR A 1 70  ? -10.114 5.674   -4.444  1.00 0.00 ? 70  TYR A HD2  5  
ATOM 9731  H HE1  . TYR A 1 70  ? -7.773  9.681   -6.079  1.00 0.00 ? 70  TYR A HE1  5  
ATOM 9732  H HE2  . TYR A 1 70  ? -9.442  5.822   -6.806  1.00 0.00 ? 70  TYR A HE2  5  
ATOM 9733  H HH   . TYR A 1 70  ? -7.235  7.908   -7.963  1.00 0.00 ? 70  TYR A HH   5  
ATOM 9734  N N    . THR A 1 71  ? -12.171 9.241   -0.273  1.00 0.00 ? 71  THR A N    5  
ATOM 9735  C CA   . THR A 1 71  ? -12.935 9.037   0.952   1.00 0.00 ? 71  THR A CA   5  
ATOM 9736  C C    . THR A 1 71  ? -13.515 7.629   1.010   1.00 0.00 ? 71  THR A C    5  
ATOM 9737  O O    . THR A 1 71  ? -13.520 6.992   2.064   1.00 0.00 ? 71  THR A O    5  
ATOM 9738  C CB   . THR A 1 71  ? -14.081 10.058  1.076   1.00 0.00 ? 71  THR A CB   5  
ATOM 9739  O OG1  . THR A 1 71  ? -14.947 9.962   -0.060  1.00 0.00 ? 71  THR A OG1  5  
ATOM 9740  C CG2  . THR A 1 71  ? -13.535 11.474  1.185   1.00 0.00 ? 71  THR A CG2  5  
ATOM 9741  H H    . THR A 1 71  ? -12.347 10.034  -0.820  1.00 0.00 ? 71  THR A H    5  
ATOM 9742  H HA   . THR A 1 71  ? -12.265 9.175   1.789   1.00 0.00 ? 71  THR A HA   5  
ATOM 9743  H HB   . THR A 1 71  ? -14.646 9.836   1.970   1.00 0.00 ? 71  THR A HB   5  
ATOM 9744  H HG1  . THR A 1 71  ? -14.421 9.923   -0.862  1.00 0.00 ? 71  THR A HG1  5  
ATOM 9745  H HG21 . THR A 1 71  ? -14.312 12.180  0.932   1.00 0.00 ? 71  THR A HG21 5  
ATOM 9746  H HG22 . THR A 1 71  ? -12.704 11.593  0.506   1.00 0.00 ? 71  THR A HG22 5  
ATOM 9747  H HG23 . THR A 1 71  ? -13.202 11.654  2.196   1.00 0.00 ? 71  THR A HG23 5  
ATOM 9748  N N    . ASP A 1 72  ? -14.003 7.148   -0.128  1.00 0.00 ? 72  ASP A N    5  
ATOM 9749  C CA   . ASP A 1 72  ? -14.585 5.813   -0.207  1.00 0.00 ? 72  ASP A CA   5  
ATOM 9750  C C    . ASP A 1 72  ? -13.572 4.753   0.217   1.00 0.00 ? 72  ASP A C    5  
ATOM 9751  O O    . ASP A 1 72  ? -13.839 3.945   1.107   1.00 0.00 ? 72  ASP A O    5  
ATOM 9752  C CB   . ASP A 1 72  ? -15.074 5.529   -1.628  1.00 0.00 ? 72  ASP A CB   5  
ATOM 9753  C CG   . ASP A 1 72  ? -16.090 4.405   -1.677  1.00 0.00 ? 72  ASP A CG   5  
ATOM 9754  O OD1  . ASP A 1 72  ? -16.906 4.302   -0.737  1.00 0.00 ? 72  ASP A OD1  5  
ATOM 9755  O OD2  . ASP A 1 72  ? -16.069 3.628   -2.655  1.00 0.00 ? 72  ASP A OD2  5  
ATOM 9756  H H    . ASP A 1 72  ? -13.970 7.703   -0.935  1.00 0.00 ? 72  ASP A H    5  
ATOM 9757  H HA   . ASP A 1 72  ? -15.427 5.778   0.468   1.00 0.00 ? 72  ASP A HA   5  
ATOM 9758  H HB2  . ASP A 1 72  ? -15.532 6.422   -2.029  1.00 0.00 ? 72  ASP A HB2  5  
ATOM 9759  H HB3  . ASP A 1 72  ? -14.230 5.255   -2.244  1.00 0.00 ? 72  ASP A HB3  5  
ATOM 9760  N N    . VAL A 1 73  ? -12.410 4.761   -0.427  1.00 0.00 ? 73  VAL A N    5  
ATOM 9761  C CA   . VAL A 1 73  ? -11.357 3.801   -0.117  1.00 0.00 ? 73  VAL A CA   5  
ATOM 9762  C C    . VAL A 1 73  ? -10.944 3.892   1.347   1.00 0.00 ? 73  VAL A C    5  
ATOM 9763  O O    . VAL A 1 73  ? -11.066 2.925   2.099   1.00 0.00 ? 73  VAL A O    5  
ATOM 9764  C CB   . VAL A 1 73  ? -10.117 4.022   -1.004  1.00 0.00 ? 73  VAL A CB   5  
ATOM 9765  C CG1  . VAL A 1 73  ? -8.938  3.215   -0.483  1.00 0.00 ? 73  VAL A CG1  5  
ATOM 9766  C CG2  . VAL A 1 73  ? -10.425 3.660   -2.449  1.00 0.00 ? 73  VAL A CG2  5  
ATOM 9767  H H    . VAL A 1 73  ? -12.256 5.430   -1.127  1.00 0.00 ? 73  VAL A H    5  
ATOM 9768  H HA   . VAL A 1 73  ? -11.741 2.810   -0.312  1.00 0.00 ? 73  VAL A HA   5  
ATOM 9769  H HB   . VAL A 1 73  ? -9.854  5.069   -0.965  1.00 0.00 ? 73  VAL A HB   5  
ATOM 9770  H HG11 . VAL A 1 73  ? -9.175  2.162   -0.526  1.00 0.00 ? 73  VAL A HG11 5  
ATOM 9771  H HG12 . VAL A 1 73  ? -8.068  3.414   -1.092  1.00 0.00 ? 73  VAL A HG12 5  
ATOM 9772  H HG13 . VAL A 1 73  ? -8.733  3.496   0.540   1.00 0.00 ? 73  VAL A HG13 5  
ATOM 9773  H HG21 . VAL A 1 73  ? -9.686  4.108   -3.096  1.00 0.00 ? 73  VAL A HG21 5  
ATOM 9774  H HG22 . VAL A 1 73  ? -10.401 2.586   -2.565  1.00 0.00 ? 73  VAL A HG22 5  
ATOM 9775  H HG23 . VAL A 1 73  ? -11.405 4.028   -2.712  1.00 0.00 ? 73  VAL A HG23 5  
ATOM 9776  N N    . SER A 1 74  ? -10.455 5.062   1.747   1.00 0.00 ? 74  SER A N    5  
ATOM 9777  C CA   . SER A 1 74  ? -10.020 5.279   3.122   1.00 0.00 ? 74  SER A CA   5  
ATOM 9778  C C    . SER A 1 74  ? -10.968 4.599   4.105   1.00 0.00 ? 74  SER A C    5  
ATOM 9779  O O    . SER A 1 74  ? -10.579 3.679   4.827   1.00 0.00 ? 74  SER A O    5  
ATOM 9780  C CB   . SER A 1 74  ? -9.943  6.777   3.424   1.00 0.00 ? 74  SER A CB   5  
ATOM 9781  O OG   . SER A 1 74  ? -11.219 7.384   3.323   1.00 0.00 ? 74  SER A OG   5  
ATOM 9782  H H    . SER A 1 74  ? -10.383 5.795   1.101   1.00 0.00 ? 74  SER A H    5  
ATOM 9783  H HA   . SER A 1 74  ? -9.037  4.847   3.231   1.00 0.00 ? 74  SER A HA   5  
ATOM 9784  H HB2  . SER A 1 74  ? -9.567  6.920   4.426   1.00 0.00 ? 74  SER A HB2  5  
ATOM 9785  H HB3  . SER A 1 74  ? -9.275  7.249   2.718   1.00 0.00 ? 74  SER A HB3  5  
ATOM 9786  H HG   . SER A 1 74  ? -11.615 7.159   2.478   1.00 0.00 ? 74  SER A HG   5  
ATOM 9787  N N    . THR A 1 75  ? -12.216 5.057   4.129   1.00 0.00 ? 75  THR A N    5  
ATOM 9788  C CA   . THR A 1 75  ? -13.220 4.495   5.023   1.00 0.00 ? 75  THR A CA   5  
ATOM 9789  C C    . THR A 1 75  ? -13.374 2.995   4.803   1.00 0.00 ? 75  THR A C    5  
ATOM 9790  O O    . THR A 1 75  ? -13.594 2.238   5.749   1.00 0.00 ? 75  THR A O    5  
ATOM 9791  C CB   . THR A 1 75  ? -14.588 5.175   4.829   1.00 0.00 ? 75  THR A CB   5  
ATOM 9792  O OG1  . THR A 1 75  ? -14.471 6.584   5.054   1.00 0.00 ? 75  THR A OG1  5  
ATOM 9793  C CG2  . THR A 1 75  ? -15.623 4.589   5.778   1.00 0.00 ? 75  THR A CG2  5  
ATOM 9794  H H    . THR A 1 75  ? -12.465 5.792   3.530   1.00 0.00 ? 75  THR A H    5  
ATOM 9795  H HA   . THR A 1 75  ? -12.896 4.669   6.039   1.00 0.00 ? 75  THR A HA   5  
ATOM 9796  H HB   . THR A 1 75  ? -14.916 5.006   3.814   1.00 0.00 ? 75  THR A HB   5  
ATOM 9797  H HG1  . THR A 1 75  ? -15.332 6.944   5.284   1.00 0.00 ? 75  THR A HG1  5  
ATOM 9798  H HG21 . THR A 1 75  ? -15.189 4.481   6.762   1.00 0.00 ? 75  THR A HG21 5  
ATOM 9799  H HG22 . THR A 1 75  ? -15.937 3.622   5.415   1.00 0.00 ? 75  THR A HG22 5  
ATOM 9800  H HG23 . THR A 1 75  ? -16.476 5.248   5.831   1.00 0.00 ? 75  THR A HG23 5  
ATOM 9801  N N    . ARG A 1 76  ? -13.258 2.571   3.549   1.00 0.00 ? 76  ARG A N    5  
ATOM 9802  C CA   . ARG A 1 76  ? -13.385 1.160   3.204   1.00 0.00 ? 76  ARG A CA   5  
ATOM 9803  C C    . ARG A 1 76  ? -12.298 0.333   3.885   1.00 0.00 ? 76  ARG A C    5  
ATOM 9804  O O    . ARG A 1 76  ? -12.555 -0.766  4.377   1.00 0.00 ? 76  ARG A O    5  
ATOM 9805  C CB   . ARG A 1 76  ? -13.308 0.974   1.688   1.00 0.00 ? 76  ARG A CB   5  
ATOM 9806  C CG   . ARG A 1 76  ? -13.807 -0.382  1.214   1.00 0.00 ? 76  ARG A CG   5  
ATOM 9807  C CD   . ARG A 1 76  ? -13.113 -0.813  -0.069  1.00 0.00 ? 76  ARG A CD   5  
ATOM 9808  N NE   . ARG A 1 76  ? -13.971 -1.656  -0.897  1.00 0.00 ? 76  ARG A NE   5  
ATOM 9809  C CZ   . ARG A 1 76  ? -13.530 -2.356  -1.937  1.00 0.00 ? 76  ARG A CZ   5  
ATOM 9810  N NH1  . ARG A 1 76  ? -12.248 -2.314  -2.273  1.00 0.00 ? 76  ARG A NH1  5  
ATOM 9811  N NH2  . ARG A 1 76  ? -14.372 -3.100  -2.643  1.00 0.00 ? 76  ARG A NH2  5  
ATOM 9812  H H    . ARG A 1 76  ? -13.082 3.222   2.838   1.00 0.00 ? 76  ARG A H    5  
ATOM 9813  H HA   . ARG A 1 76  ? -14.349 0.819   3.551   1.00 0.00 ? 76  ARG A HA   5  
ATOM 9814  H HB2  . ARG A 1 76  ? -13.904 1.738   1.212   1.00 0.00 ? 76  ARG A HB2  5  
ATOM 9815  H HB3  . ARG A 1 76  ? -12.280 1.084   1.376   1.00 0.00 ? 76  ARG A HB3  5  
ATOM 9816  H HG2  . ARG A 1 76  ? -13.609 -1.116  1.981   1.00 0.00 ? 76  ARG A HG2  5  
ATOM 9817  H HG3  . ARG A 1 76  ? -14.870 -0.321  1.036   1.00 0.00 ? 76  ARG A HG3  5  
ATOM 9818  H HD2  . ARG A 1 76  ? -12.842 0.069   -0.629  1.00 0.00 ? 76  ARG A HD2  5  
ATOM 9819  H HD3  . ARG A 1 76  ? -12.221 -1.365  0.188   1.00 0.00 ? 76  ARG A HD3  5  
ATOM 9820  H HE   . ARG A 1 76  ? -14.922 -1.702  -0.667  1.00 0.00 ? 76  ARG A HE   5  
ATOM 9821  H HH11 . ARG A 1 76  ? -11.611 -1.755  -1.743  1.00 0.00 ? 76  ARG A HH11 5  
ATOM 9822  H HH12 . ARG A 1 76  ? -11.918 -2.842  -3.056  1.00 0.00 ? 76  ARG A HH12 5  
ATOM 9823  H HH21 . ARG A 1 76  ? -15.339 -3.135  -2.392  1.00 0.00 ? 76  ARG A HH21 5  
ATOM 9824  H HH22 . ARG A 1 76  ? -14.039 -3.626  -3.425  1.00 0.00 ? 76  ARG A HH22 5  
ATOM 9825  N N    . TYR A 1 77  ? -11.083 0.870   3.909   1.00 0.00 ? 77  TYR A N    5  
ATOM 9826  C CA   . TYR A 1 77  ? -9.956  0.181   4.526   1.00 0.00 ? 77  TYR A CA   5  
ATOM 9827  C C    . TYR A 1 77  ? -9.775  0.623   5.975   1.00 0.00 ? 77  TYR A C    5  
ATOM 9828  O O    . TYR A 1 77  ? -8.668  0.591   6.514   1.00 0.00 ? 77  TYR A O    5  
ATOM 9829  C CB   . TYR A 1 77  ? -8.673  0.448   3.736   1.00 0.00 ? 77  TYR A CB   5  
ATOM 9830  C CG   . TYR A 1 77  ? -8.643  -0.228  2.384   1.00 0.00 ? 77  TYR A CG   5  
ATOM 9831  C CD1  . TYR A 1 77  ? -9.567  0.102   1.400   1.00 0.00 ? 77  TYR A CD1  5  
ATOM 9832  C CD2  . TYR A 1 77  ? -7.692  -1.198  2.091   1.00 0.00 ? 77  TYR A CD2  5  
ATOM 9833  C CE1  . TYR A 1 77  ? -9.544  -0.514  0.163   1.00 0.00 ? 77  TYR A CE1  5  
ATOM 9834  C CE2  . TYR A 1 77  ? -7.661  -1.817  0.857   1.00 0.00 ? 77  TYR A CE2  5  
ATOM 9835  C CZ   . TYR A 1 77  ? -8.589  -1.472  -0.103  1.00 0.00 ? 77  TYR A CZ   5  
ATOM 9836  O OH   . TYR A 1 77  ? -8.562  -2.088  -1.334  1.00 0.00 ? 77  TYR A OH   5  
ATOM 9837  H H    . TYR A 1 77  ? -10.940 1.749   3.500   1.00 0.00 ? 77  TYR A H    5  
ATOM 9838  H HA   . TYR A 1 77  ? -10.164 -0.879  4.508   1.00 0.00 ? 77  TYR A HA   5  
ATOM 9839  H HB2  . TYR A 1 77  ? -8.571  1.510   3.577   1.00 0.00 ? 77  TYR A HB2  5  
ATOM 9840  H HB3  . TYR A 1 77  ? -7.827  0.090   4.305   1.00 0.00 ? 77  TYR A HB3  5  
ATOM 9841  H HD1  . TYR A 1 77  ? -10.314 0.853   1.612   1.00 0.00 ? 77  TYR A HD1  5  
ATOM 9842  H HD2  . TYR A 1 77  ? -6.967  -1.466  2.846   1.00 0.00 ? 77  TYR A HD2  5  
ATOM 9843  H HE1  . TYR A 1 77  ? -10.270 -0.243  -0.589  1.00 0.00 ? 77  TYR A HE1  5  
ATOM 9844  H HE2  . TYR A 1 77  ? -6.913  -2.568  0.648   1.00 0.00 ? 77  TYR A HE2  5  
ATOM 9845  H HH   . TYR A 1 77  ? -8.800  -3.013  -1.234  1.00 0.00 ? 77  TYR A HH   5  
ATOM 9846  N N    . LYS A 1 78  ? -10.871 1.035   6.603   1.00 0.00 ? 78  LYS A N    5  
ATOM 9847  C CA   . LYS A 1 78  ? -10.837 1.482   7.990   1.00 0.00 ? 78  LYS A CA   5  
ATOM 9848  C C    . LYS A 1 78  ? -9.664  2.427   8.229   1.00 0.00 ? 78  LYS A C    5  
ATOM 9849  O O    . LYS A 1 78  ? -8.956  2.313   9.229   1.00 0.00 ? 78  LYS A O    5  
ATOM 9850  C CB   . LYS A 1 78  ? -10.737 0.280   8.932   1.00 0.00 ? 78  LYS A CB   5  
ATOM 9851  C CG   . LYS A 1 78  ? -12.018 -0.533  9.019   1.00 0.00 ? 78  LYS A CG   5  
ATOM 9852  C CD   . LYS A 1 78  ? -11.733 -1.988  9.352   1.00 0.00 ? 78  LYS A CD   5  
ATOM 9853  C CE   . LYS A 1 78  ? -12.963 -2.682  9.916   1.00 0.00 ? 78  LYS A CE   5  
ATOM 9854  N NZ   . LYS A 1 78  ? -13.977 -2.956  8.860   1.00 0.00 ? 78  LYS A NZ   5  
ATOM 9855  H H    . LYS A 1 78  ? -11.725 1.037   6.120   1.00 0.00 ? 78  LYS A H    5  
ATOM 9856  H HA   . LYS A 1 78  ? -11.757 2.010   8.191   1.00 0.00 ? 78  LYS A HA   5  
ATOM 9857  H HB2  . LYS A 1 78  ? -9.946  -0.369  8.586   1.00 0.00 ? 78  LYS A HB2  5  
ATOM 9858  H HB3  . LYS A 1 78  ? -10.493 0.634   9.923   1.00 0.00 ? 78  LYS A HB3  5  
ATOM 9859  H HG2  . LYS A 1 78  ? -12.647 -0.115  9.790   1.00 0.00 ? 78  LYS A HG2  5  
ATOM 9860  H HG3  . LYS A 1 78  ? -12.529 -0.485  8.068   1.00 0.00 ? 78  LYS A HG3  5  
ATOM 9861  H HD2  . LYS A 1 78  ? -11.424 -2.501  8.454   1.00 0.00 ? 78  LYS A HD2  5  
ATOM 9862  H HD3  . LYS A 1 78  ? -10.939 -2.032  10.085  1.00 0.00 ? 78  LYS A HD3  5  
ATOM 9863  H HE2  . LYS A 1 78  ? -12.661 -3.616  10.363  1.00 0.00 ? 78  LYS A HE2  5  
ATOM 9864  H HE3  . LYS A 1 78  ? -13.404 -2.048  10.671  1.00 0.00 ? 78  LYS A HE3  5  
ATOM 9865  H HZ1  . LYS A 1 78  ? -14.672 -2.182  8.823   1.00 0.00 ? 78  LYS A HZ1  5  
ATOM 9866  H HZ2  . LYS A 1 78  ? -14.476 -3.845  9.065   1.00 0.00 ? 78  LYS A HZ2  5  
ATOM 9867  H HZ3  . LYS A 1 78  ? -13.515 -3.036  7.932   1.00 0.00 ? 78  LYS A HZ3  5  
ATOM 9868  N N    . VAL A 1 79  ? -9.465  3.361   7.304   1.00 0.00 ? 79  VAL A N    5  
ATOM 9869  C CA   . VAL A 1 79  ? -8.380  4.328   7.416   1.00 0.00 ? 79  VAL A CA   5  
ATOM 9870  C C    . VAL A 1 79  ? -8.915  5.756   7.431   1.00 0.00 ? 79  VAL A C    5  
ATOM 9871  O O    . VAL A 1 79  ? -9.675  6.154   6.549   1.00 0.00 ? 79  VAL A O    5  
ATOM 9872  C CB   . VAL A 1 79  ? -7.375  4.180   6.257   1.00 0.00 ? 79  VAL A CB   5  
ATOM 9873  C CG1  . VAL A 1 79  ? -6.156  5.059   6.492   1.00 0.00 ? 79  VAL A CG1  5  
ATOM 9874  C CG2  . VAL A 1 79  ? -6.969  2.724   6.088   1.00 0.00 ? 79  VAL A CG2  5  
ATOM 9875  H H    . VAL A 1 79  ? -10.063 3.401   6.529   1.00 0.00 ? 79  VAL A H    5  
ATOM 9876  H HA   . VAL A 1 79  ? -7.858  4.139   8.343   1.00 0.00 ? 79  VAL A HA   5  
ATOM 9877  H HB   . VAL A 1 79  ? -7.856  4.506   5.347   1.00 0.00 ? 79  VAL A HB   5  
ATOM 9878  H HG11 . VAL A 1 79  ? -6.436  6.097   6.391   1.00 0.00 ? 79  VAL A HG11 5  
ATOM 9879  H HG12 . VAL A 1 79  ? -5.772  4.884   7.486   1.00 0.00 ? 79  VAL A HG12 5  
ATOM 9880  H HG13 . VAL A 1 79  ? -5.395  4.820   5.764   1.00 0.00 ? 79  VAL A HG13 5  
ATOM 9881  H HG21 . VAL A 1 79  ? -7.561  2.275   5.304   1.00 0.00 ? 79  VAL A HG21 5  
ATOM 9882  H HG22 . VAL A 1 79  ? -5.922  2.671   5.824   1.00 0.00 ? 79  VAL A HG22 5  
ATOM 9883  H HG23 . VAL A 1 79  ? -7.134  2.194   7.014   1.00 0.00 ? 79  VAL A HG23 5  
ATOM 9884  N N    . SER A 1 80  ? -8.512  6.522   8.440   1.00 0.00 ? 80  SER A N    5  
ATOM 9885  C CA   . SER A 1 80  ? -8.954  7.905   8.572   1.00 0.00 ? 80  SER A CA   5  
ATOM 9886  C C    . SER A 1 80  ? -8.222  8.806   7.582   1.00 0.00 ? 80  SER A C    5  
ATOM 9887  O O    . SER A 1 80  ? -7.068  8.557   7.233   1.00 0.00 ? 80  SER A O    5  
ATOM 9888  C CB   . SER A 1 80  ? -8.720  8.402   10.000  1.00 0.00 ? 80  SER A CB   5  
ATOM 9889  O OG   . SER A 1 80  ? -8.807  9.815   10.069  1.00 0.00 ? 80  SER A OG   5  
ATOM 9890  H H    . SER A 1 80  ? -7.906  6.146   9.112   1.00 0.00 ? 80  SER A H    5  
ATOM 9891  H HA   . SER A 1 80  ? -10.011 7.938   8.357   1.00 0.00 ? 80  SER A HA   5  
ATOM 9892  H HB2  . SER A 1 80  ? -9.466  7.976   10.654  1.00 0.00 ? 80  SER A HB2  5  
ATOM 9893  H HB3  . SER A 1 80  ? -7.737  8.098   10.328  1.00 0.00 ? 80  SER A HB3  5  
ATOM 9894  H HG   . SER A 1 80  ? -9.696  10.093  9.836   1.00 0.00 ? 80  SER A HG   5  
ATOM 9895  N N    . THR A 1 81  ? -8.903  9.856   7.132   1.00 0.00 ? 81  THR A N    5  
ATOM 9896  C CA   . THR A 1 81  ? -8.320  10.794  6.181   1.00 0.00 ? 81  THR A CA   5  
ATOM 9897  C C    . THR A 1 81  ? -8.121  12.166  6.814   1.00 0.00 ? 81  THR A C    5  
ATOM 9898  O O    . THR A 1 81  ? -8.145  13.187  6.127   1.00 0.00 ? 81  THR A O    5  
ATOM 9899  C CB   . THR A 1 81  ? -9.202  10.943  4.927   1.00 0.00 ? 81  THR A CB   5  
ATOM 9900  O OG1  . THR A 1 81  ? -10.586 10.931  5.296   1.00 0.00 ? 81  THR A OG1  5  
ATOM 9901  C CG2  . THR A 1 81  ? -8.927  9.822   3.936   1.00 0.00 ? 81  THR A CG2  5  
ATOM 9902  H H    . THR A 1 81  ? -9.819  10.000  7.447   1.00 0.00 ? 81  THR A H    5  
ATOM 9903  H HA   . THR A 1 81  ? -7.359  10.406  5.876   1.00 0.00 ? 81  THR A HA   5  
ATOM 9904  H HB   . THR A 1 81  ? -8.972  11.887  4.453   1.00 0.00 ? 81  THR A HB   5  
ATOM 9905  H HG1  . THR A 1 81  ? -10.682 11.274  6.188   1.00 0.00 ? 81  THR A HG1  5  
ATOM 9906  H HG21 . THR A 1 81  ? -8.127  9.200   4.309   1.00 0.00 ? 81  THR A HG21 5  
ATOM 9907  H HG22 . THR A 1 81  ? -8.641  10.245  2.984   1.00 0.00 ? 81  THR A HG22 5  
ATOM 9908  H HG23 . THR A 1 81  ? -9.818  9.225   3.812   1.00 0.00 ? 81  THR A HG23 5  
ATOM 9909  N N    . SER A 1 82  ? -7.925  12.183  8.129   1.00 0.00 ? 82  SER A N    5  
ATOM 9910  C CA   . SER A 1 82  ? -7.724  13.431  8.856   1.00 0.00 ? 82  SER A CA   5  
ATOM 9911  C C    . SER A 1 82  ? -6.239  13.755  8.980   1.00 0.00 ? 82  SER A C    5  
ATOM 9912  O O    . SER A 1 82  ? -5.395  12.872  9.134   1.00 0.00 ? 82  SER A O    5  
ATOM 9913  C CB   . SER A 1 82  ? -8.357  13.344  10.246  1.00 0.00 ? 82  SER A CB   5  
ATOM 9914  O OG   . SER A 1 82  ? -8.816  14.613  10.678  1.00 0.00 ? 82  SER A OG   5  
ATOM 9915  H H    . SER A 1 82  ? -7.917  11.336  8.622   1.00 0.00 ? 82  SER A H    5  
ATOM 9916  H HA   . SER A 1 82  ? -8.207  14.221  8.298   1.00 0.00 ? 82  SER A HA   5  
ATOM 9917  H HB2  . SER A 1 82  ? -9.195  12.664  10.215  1.00 0.00 ? 82  SER A HB2  5  
ATOM 9918  H HB3  . SER A 1 82  ? -7.623  12.980  10.950  1.00 0.00 ? 82  SER A HB3  5  
ATOM 9919  H HG   . SER A 1 82  ? -9.727  14.736  10.401  1.00 0.00 ? 82  SER A HG   5  
ATOM 9920  N N    . PRO A 1 83  ? -5.909  15.054  8.912   1.00 0.00 ? 83  PRO A N    5  
ATOM 9921  C CA   . PRO A 1 83  ? -4.525  15.526  9.015   1.00 0.00 ? 83  PRO A CA   5  
ATOM 9922  C C    . PRO A 1 83  ? -3.958  15.355  10.420  1.00 0.00 ? 83  PRO A C    5  
ATOM 9923  O O    . PRO A 1 83  ? -2.830  15.765  10.699  1.00 0.00 ? 83  PRO A O    5  
ATOM 9924  C CB   . PRO A 1 83  ? -4.629  17.010  8.657   1.00 0.00 ? 83  PRO A CB   5  
ATOM 9925  C CG   . PRO A 1 83  ? -6.030  17.385  8.996   1.00 0.00 ? 83  PRO A CG   5  
ATOM 9926  C CD   . PRO A 1 83  ? -6.862  16.161  8.729   1.00 0.00 ? 83  PRO A CD   5  
ATOM 9927  H HA   . PRO A 1 83  ? -3.882  15.026  8.305   1.00 0.00 ? 83  PRO A HA   5  
ATOM 9928  H HB2  . PRO A 1 83  ? -3.916  17.575  9.241   1.00 0.00 ? 83  PRO A HB2  5  
ATOM 9929  H HB3  . PRO A 1 83  ? -4.428  17.145  7.605   1.00 0.00 ? 83  PRO A HB3  5  
ATOM 9930  H HG2  . PRO A 1 83  ? -6.095  17.661  10.038  1.00 0.00 ? 83  PRO A HG2  5  
ATOM 9931  H HG3  . PRO A 1 83  ? -6.354  18.202  8.369   1.00 0.00 ? 83  PRO A HG3  5  
ATOM 9932  H HD2  . PRO A 1 83  ? -7.673  16.093  9.439   1.00 0.00 ? 83  PRO A HD2  5  
ATOM 9933  H HD3  . PRO A 1 83  ? -7.244  16.178  7.718   1.00 0.00 ? 83  PRO A HD3  5  
ATOM 9934  N N    . LEU A 1 84  ? -4.745  14.747  11.301  1.00 0.00 ? 84  LEU A N    5  
ATOM 9935  C CA   . LEU A 1 84  ? -4.320  14.521  12.678  1.00 0.00 ? 84  LEU A CA   5  
ATOM 9936  C C    . LEU A 1 84  ? -3.992  13.050  12.913  1.00 0.00 ? 84  LEU A C    5  
ATOM 9937  O O    . LEU A 1 84  ? -2.981  12.719  13.533  1.00 0.00 ? 84  LEU A O    5  
ATOM 9938  C CB   . LEU A 1 84  ? -5.412  14.973  13.650  1.00 0.00 ? 84  LEU A CB   5  
ATOM 9939  C CG   . LEU A 1 84  ? -5.477  16.474  13.935  1.00 0.00 ? 84  LEU A CG   5  
ATOM 9940  C CD1  . LEU A 1 84  ? -6.704  16.806  14.771  1.00 0.00 ? 84  LEU A CD1  5  
ATOM 9941  C CD2  . LEU A 1 84  ? -4.210  16.940  14.636  1.00 0.00 ? 84  LEU A CD2  5  
ATOM 9942  H H    . LEU A 1 84  ? -5.632  14.442  11.020  1.00 0.00 ? 84  LEU A H    5  
ATOM 9943  H HA   . LEU A 1 84  ? -3.430  15.108  12.851  1.00 0.00 ? 84  LEU A HA   5  
ATOM 9944  H HB2  . LEU A 1 84  ? -6.364  14.673  13.240  1.00 0.00 ? 84  LEU A HB2  5  
ATOM 9945  H HB3  . LEU A 1 84  ? -5.249  14.464  14.589  1.00 0.00 ? 84  LEU A HB3  5  
ATOM 9946  H HG   . LEU A 1 84  ? -5.558  17.009  12.998  1.00 0.00 ? 84  LEU A HG   5  
ATOM 9947  H HD11 . LEU A 1 84  ? -7.004  15.933  15.331  1.00 0.00 ? 84  LEU A HD11 5  
ATOM 9948  H HD12 . LEU A 1 84  ? -7.510  17.112  14.121  1.00 0.00 ? 84  LEU A HD12 5  
ATOM 9949  H HD13 . LEU A 1 84  ? -6.467  17.608  15.454  1.00 0.00 ? 84  LEU A HD13 5  
ATOM 9950  H HD21 . LEU A 1 84  ? -4.443  17.770  15.286  1.00 0.00 ? 84  LEU A HD21 5  
ATOM 9951  H HD22 . LEU A 1 84  ? -3.485  17.252  13.898  1.00 0.00 ? 84  LEU A HD22 5  
ATOM 9952  H HD23 . LEU A 1 84  ? -3.803  16.128  15.220  1.00 0.00 ? 84  LEU A HD23 5  
ATOM 9953  N N    . THR A 1 85  ? -4.853  12.170  12.410  1.00 0.00 ? 85  THR A N    5  
ATOM 9954  C CA   . THR A 1 85  ? -4.654  10.734  12.564  1.00 0.00 ? 85  THR A CA   5  
ATOM 9955  C C    . THR A 1 85  ? -3.243  10.327  12.155  1.00 0.00 ? 85  THR A C    5  
ATOM 9956  O O    . THR A 1 85  ? -2.624  10.965  11.303  1.00 0.00 ? 85  THR A O    5  
ATOM 9957  C CB   . THR A 1 85  ? -5.670  9.934   11.727  1.00 0.00 ? 85  THR A CB   5  
ATOM 9958  O OG1  . THR A 1 85  ? -5.231  8.578   11.588  1.00 0.00 ? 85  THR A OG1  5  
ATOM 9959  C CG2  . THR A 1 85  ? -5.849  10.558  10.351  1.00 0.00 ? 85  THR A CG2  5  
ATOM 9960  H H    . THR A 1 85  ? -5.640  12.495  11.926  1.00 0.00 ? 85  THR A H    5  
ATOM 9961  H HA   . THR A 1 85  ? -4.802  10.486  13.605  1.00 0.00 ? 85  THR A HA   5  
ATOM 9962  H HB   . THR A 1 85  ? -6.622  9.945   12.238  1.00 0.00 ? 85  THR A HB   5  
ATOM 9963  H HG1  . THR A 1 85  ? -5.668  8.176   10.834  1.00 0.00 ? 85  THR A HG1  5  
ATOM 9964  H HG21 . THR A 1 85  ? -4.882  10.809  9.941   1.00 0.00 ? 85  THR A HG21 5  
ATOM 9965  H HG22 . THR A 1 85  ? -6.447  11.453  10.437  1.00 0.00 ? 85  THR A HG22 5  
ATOM 9966  H HG23 . THR A 1 85  ? -6.344  9.855   9.699   1.00 0.00 ? 85  THR A HG23 5  
ATOM 9967  N N    . LYS A 1 86  ? -2.739  9.261   12.766  1.00 0.00 ? 86  LYS A N    5  
ATOM 9968  C CA   . LYS A 1 86  ? -1.401  8.766   12.464  1.00 0.00 ? 86  LYS A CA   5  
ATOM 9969  C C    . LYS A 1 86  ? -1.461  7.595   11.488  1.00 0.00 ? 86  LYS A C    5  
ATOM 9970  O O    . LYS A 1 86  ? -0.457  6.926   11.246  1.00 0.00 ? 86  LYS A O    5  
ATOM 9971  C CB   . LYS A 1 86  ? -0.692  8.335   13.750  1.00 0.00 ? 86  LYS A CB   5  
ATOM 9972  C CG   . LYS A 1 86  ? -0.046  9.486   14.503  1.00 0.00 ? 86  LYS A CG   5  
ATOM 9973  C CD   . LYS A 1 86  ? 1.167   10.024  13.763  1.00 0.00 ? 86  LYS A CD   5  
ATOM 9974  C CE   . LYS A 1 86  ? 1.706   11.286  14.421  1.00 0.00 ? 86  LYS A CE   5  
ATOM 9975  N NZ   . LYS A 1 86  ? 3.138   11.519  14.084  1.00 0.00 ? 86  LYS A NZ   5  
ATOM 9976  H H    . LYS A 1 86  ? -3.282  8.794   13.437  1.00 0.00 ? 86  LYS A H    5  
ATOM 9977  H HA   . LYS A 1 86  ? -0.845  9.571   12.009  1.00 0.00 ? 86  LYS A HA   5  
ATOM 9978  H HB2  . LYS A 1 86  ? -1.412  7.864   14.404  1.00 0.00 ? 86  LYS A HB2  5  
ATOM 9979  H HB3  . LYS A 1 86  ? 0.077   7.619   13.500  1.00 0.00 ? 86  LYS A HB3  5  
ATOM 9980  H HG2  . LYS A 1 86  ? -0.768  10.281  14.616  1.00 0.00 ? 86  LYS A HG2  5  
ATOM 9981  H HG3  . LYS A 1 86  ? 0.264   9.137   15.478  1.00 0.00 ? 86  LYS A HG3  5  
ATOM 9982  H HD2  . LYS A 1 86  ? 1.942   9.272   13.765  1.00 0.00 ? 86  LYS A HD2  5  
ATOM 9983  H HD3  . LYS A 1 86  ? 0.885   10.252  12.745  1.00 0.00 ? 86  LYS A HD3  5  
ATOM 9984  H HE2  . LYS A 1 86  ? 1.124   12.129  14.082  1.00 0.00 ? 86  LYS A HE2  5  
ATOM 9985  H HE3  . LYS A 1 86  ? 1.608   11.188  15.492  1.00 0.00 ? 86  LYS A HE3  5  
ATOM 9986  H HZ1  . LYS A 1 86  ? 3.238   12.397  13.536  1.00 0.00 ? 86  LYS A HZ1  5  
ATOM 9987  H HZ2  . LYS A 1 86  ? 3.505   10.727  13.518  1.00 0.00 ? 86  LYS A HZ2  5  
ATOM 9988  H HZ3  . LYS A 1 86  ? 3.701   11.599  14.954  1.00 0.00 ? 86  LYS A HZ3  5  
ATOM 9989  N N    . GLN A 1 87  ? -2.643  7.356   10.930  1.00 0.00 ? 87  GLN A N    5  
ATOM 9990  C CA   . GLN A 1 87  ? -2.832  6.267   9.980   1.00 0.00 ? 87  GLN A CA   5  
ATOM 9991  C C    . GLN A 1 87  ? -2.448  6.702   8.569   1.00 0.00 ? 87  GLN A C    5  
ATOM 9992  O O    . GLN A 1 87  ? -2.997  6.206   7.584   1.00 0.00 ? 87  GLN A O    5  
ATOM 9993  C CB   . GLN A 1 87  ? -4.286  5.790   10.001  1.00 0.00 ? 87  GLN A CB   5  
ATOM 9994  C CG   . GLN A 1 87  ? -4.796  5.454   11.393  1.00 0.00 ? 87  GLN A CG   5  
ATOM 9995  C CD   . GLN A 1 87  ? -5.835  4.350   11.383  1.00 0.00 ? 87  GLN A CD   5  
ATOM 9996  O OE1  . GLN A 1 87  ? -6.955  4.533   11.861  1.00 0.00 ? 87  GLN A OE1  5  
ATOM 9997  N NE2  . GLN A 1 87  ? -5.469  3.196   10.838  1.00 0.00 ? 87  GLN A NE2  5  
ATOM 9998  H H    . GLN A 1 87  ? -3.406  7.925   11.163  1.00 0.00 ? 87  GLN A H    5  
ATOM 9999  H HA   . GLN A 1 87  ? -2.191  5.451   10.278  1.00 0.00 ? 87  GLN A HA   5  
ATOM 10000 H HB2  . GLN A 1 87  ? -4.913  6.565   9.588   1.00 0.00 ? 87  GLN A HB2  5  
ATOM 10001 H HB3  . GLN A 1 87  ? -4.370  4.905   9.387   1.00 0.00 ? 87  GLN A HB3  5  
ATOM 10002 H HG2  . GLN A 1 87  ? -3.962  5.136   12.001  1.00 0.00 ? 87  GLN A HG2  5  
ATOM 10003 H HG3  . GLN A 1 87  ? -5.237  6.341   11.824  1.00 0.00 ? 87  GLN A HG3  5  
ATOM 10004 H HE21 . GLN A 1 87  ? -4.559  3.123   10.479  1.00 0.00 ? 87  GLN A HE21 5  
ATOM 10005 H HE22 . GLN A 1 87  ? -6.120  2.466   10.820  1.00 0.00 ? 87  GLN A HE22 5  
ATOM 10006 N N    . LEU A 1 88  ? -1.503  7.631   8.479   1.00 0.00 ? 88  LEU A N    5  
ATOM 10007 C CA   . LEU A 1 88  ? -1.045  8.134   7.189   1.00 0.00 ? 88  LEU A CA   5  
ATOM 10008 C C    . LEU A 1 88  ? 0.387   8.652   7.283   1.00 0.00 ? 88  LEU A C    5  
ATOM 10009 O O    . LEU A 1 88  ? 0.700   9.540   8.076   1.00 0.00 ? 88  LEU A O    5  
ATOM 10010 C CB   . LEU A 1 88  ? -1.971  9.247   6.695   1.00 0.00 ? 88  LEU A CB   5  
ATOM 10011 C CG   . LEU A 1 88  ? -3.284  8.794   6.057   1.00 0.00 ? 88  LEU A CG   5  
ATOM 10012 C CD1  . LEU A 1 88  ? -4.132  9.995   5.670   1.00 0.00 ? 88  LEU A CD1  5  
ATOM 10013 C CD2  . LEU A 1 88  ? -3.013  7.917   4.843   1.00 0.00 ? 88  LEU A CD2  5  
ATOM 10014 H H    . LEU A 1 88  ? -1.103  7.988   9.299   1.00 0.00 ? 88  LEU A H    5  
ATOM 10015 H HA   . LEU A 1 88  ? -1.073  7.315   6.485   1.00 0.00 ? 88  LEU A HA   5  
ATOM 10016 H HB2  . LEU A 1 88  ? -2.213  9.874   7.539   1.00 0.00 ? 88  LEU A HB2  5  
ATOM 10017 H HB3  . LEU A 1 88  ? -1.428  9.826   5.962   1.00 0.00 ? 88  LEU A HB3  5  
ATOM 10018 H HG   . LEU A 1 88  ? -3.843  8.209   6.774   1.00 0.00 ? 88  LEU A HG   5  
ATOM 10019 H HD11 . LEU A 1 88  ? -4.653  9.786   4.748   1.00 0.00 ? 88  LEU A HD11 5  
ATOM 10020 H HD12 . LEU A 1 88  ? -3.495  10.857  5.537   1.00 0.00 ? 88  LEU A HD12 5  
ATOM 10021 H HD13 . LEU A 1 88  ? -4.850  10.196  6.452   1.00 0.00 ? 88  LEU A HD13 5  
ATOM 10022 H HD21 . LEU A 1 88  ? -1.947  7.784   4.727   1.00 0.00 ? 88  LEU A HD21 5  
ATOM 10023 H HD22 . LEU A 1 88  ? -3.414  8.392   3.959   1.00 0.00 ? 88  LEU A HD22 5  
ATOM 10024 H HD23 . LEU A 1 88  ? -3.483  6.955   4.981   1.00 0.00 ? 88  LEU A HD23 5  
ATOM 10025 N N    . PRO A 1 89  ? 1.277   8.086   6.454   1.00 0.00 ? 89  PRO A N    5  
ATOM 10026 C CA   . PRO A 1 89  ? 0.915   7.027   5.507   1.00 0.00 ? 89  PRO A CA   5  
ATOM 10027 C C    . PRO A 1 89  ? 0.583   5.713   6.206   1.00 0.00 ? 89  PRO A C    5  
ATOM 10028 O O    . PRO A 1 89  ? 0.581   5.634   7.435   1.00 0.00 ? 89  PRO A O    5  
ATOM 10029 C CB   . PRO A 1 89  ? 2.173   6.874   4.649   1.00 0.00 ? 89  PRO A CB   5  
ATOM 10030 C CG   . PRO A 1 89  ? 3.286   7.347   5.520   1.00 0.00 ? 89  PRO A CG   5  
ATOM 10031 C CD   . PRO A 1 89  ? 2.705   8.436   6.379   1.00 0.00 ? 89  PRO A CD   5  
ATOM 10032 H HA   . PRO A 1 89  ? 0.085   7.321   4.882   1.00 0.00 ? 89  PRO A HA   5  
ATOM 10033 H HB2  . PRO A 1 89  ? 2.300   5.837   4.373   1.00 0.00 ? 89  PRO A HB2  5  
ATOM 10034 H HB3  . PRO A 1 89  ? 2.083   7.480   3.760   1.00 0.00 ? 89  PRO A HB3  5  
ATOM 10035 H HG2  . PRO A 1 89  ? 3.642   6.534   6.135   1.00 0.00 ? 89  PRO A HG2  5  
ATOM 10036 H HG3  . PRO A 1 89  ? 4.088   7.737   4.911   1.00 0.00 ? 89  PRO A HG3  5  
ATOM 10037 H HD2  . PRO A 1 89  ? 3.157   8.425   7.359   1.00 0.00 ? 89  PRO A HD2  5  
ATOM 10038 H HD3  . PRO A 1 89  ? 2.841   9.399   5.909   1.00 0.00 ? 89  PRO A HD3  5  
ATOM 10039 N N    . THR A 1 90  ? 0.303   4.682   5.415   1.00 0.00 ? 90  THR A N    5  
ATOM 10040 C CA   . THR A 1 90  ? -0.031  3.371   5.957   1.00 0.00 ? 90  THR A CA   5  
ATOM 10041 C C    . THR A 1 90  ? 0.370   2.259   4.994   1.00 0.00 ? 90  THR A C    5  
ATOM 10042 O O    . THR A 1 90  ? -0.049  2.246   3.836   1.00 0.00 ? 90  THR A O    5  
ATOM 10043 C CB   . THR A 1 90  ? -1.537  3.255   6.259   1.00 0.00 ? 90  THR A CB   5  
ATOM 10044 O OG1  . THR A 1 90  ? -1.853  3.972   7.458   1.00 0.00 ? 90  THR A OG1  5  
ATOM 10045 C CG2  . THR A 1 90  ? -1.948  1.798   6.409   1.00 0.00 ? 90  THR A CG2  5  
ATOM 10046 H H    . THR A 1 90  ? 0.321   4.808   4.443   1.00 0.00 ? 90  THR A H    5  
ATOM 10047 H HA   . THR A 1 90  ? 0.511   3.246   6.883   1.00 0.00 ? 90  THR A HA   5  
ATOM 10048 H HB   . THR A 1 90  ? -2.088  3.686   5.435   1.00 0.00 ? 90  THR A HB   5  
ATOM 10049 H HG1  . THR A 1 90  ? -1.271  3.684   8.165   1.00 0.00 ? 90  THR A HG1  5  
ATOM 10050 H HG21 . THR A 1 90  ? -1.335  1.327   7.163   1.00 0.00 ? 90  THR A HG21 5  
ATOM 10051 H HG22 . THR A 1 90  ? -1.816  1.288   5.467   1.00 0.00 ? 90  THR A HG22 5  
ATOM 10052 H HG23 . THR A 1 90  ? -2.985  1.746   6.705   1.00 0.00 ? 90  THR A HG23 5  
ATOM 10053 N N    . LEU A 1 91  ? 1.183   1.328   5.480   1.00 0.00 ? 91  LEU A N    5  
ATOM 10054 C CA   . LEU A 1 91  ? 1.640   0.210   4.662   1.00 0.00 ? 91  LEU A CA   5  
ATOM 10055 C C    . LEU A 1 91  ? 0.959   -1.088  5.083   1.00 0.00 ? 91  LEU A C    5  
ATOM 10056 O O    . LEU A 1 91  ? 0.967   -1.451  6.260   1.00 0.00 ? 91  LEU A O    5  
ATOM 10057 C CB   . LEU A 1 91  ? 3.159   0.060   4.770   1.00 0.00 ? 91  LEU A CB   5  
ATOM 10058 C CG   . LEU A 1 91  ? 3.990   1.031   3.931   1.00 0.00 ? 91  LEU A CG   5  
ATOM 10059 C CD1  . LEU A 1 91  ? 5.465   0.911   4.282   1.00 0.00 ? 91  LEU A CD1  5  
ATOM 10060 C CD2  . LEU A 1 91  ? 3.770   0.777   2.447   1.00 0.00 ? 91  LEU A CD2  5  
ATOM 10061 H H    . LEU A 1 91  ? 1.483   1.392   6.410   1.00 0.00 ? 91  LEU A H    5  
ATOM 10062 H HA   . LEU A 1 91  ? 1.380   0.422   3.635   1.00 0.00 ? 91  LEU A HA   5  
ATOM 10063 H HB2  . LEU A 1 91  ? 3.431   0.200   5.805   1.00 0.00 ? 91  LEU A HB2  5  
ATOM 10064 H HB3  . LEU A 1 91  ? 3.414   -0.945  4.466   1.00 0.00 ? 91  LEU A HB3  5  
ATOM 10065 H HG   . LEU A 1 91  ? 3.678   2.043   4.148   1.00 0.00 ? 91  LEU A HG   5  
ATOM 10066 H HD11 . LEU A 1 91  ? 5.599   0.131   5.016   1.00 0.00 ? 91  LEU A HD11 5  
ATOM 10067 H HD12 . LEU A 1 91  ? 5.817   1.849   4.685   1.00 0.00 ? 91  LEU A HD12 5  
ATOM 10068 H HD13 . LEU A 1 91  ? 6.028   0.669   3.392   1.00 0.00 ? 91  LEU A HD13 5  
ATOM 10069 H HD21 . LEU A 1 91  ? 2.808   1.169   2.154   1.00 0.00 ? 91  LEU A HD21 5  
ATOM 10070 H HD22 . LEU A 1 91  ? 3.799   -0.286  2.256   1.00 0.00 ? 91  LEU A HD22 5  
ATOM 10071 H HD23 . LEU A 1 91  ? 4.547   1.267   1.879   1.00 0.00 ? 91  LEU A HD23 5  
ATOM 10072 N N    . ILE A 1 92  ? 0.371   -1.783  4.115   1.00 0.00 ? 92  ILE A N    5  
ATOM 10073 C CA   . ILE A 1 92  ? -0.312  -3.042  4.386   1.00 0.00 ? 92  ILE A CA   5  
ATOM 10074 C C    . ILE A 1 92  ? 0.136   -4.130  3.416   1.00 0.00 ? 92  ILE A C    5  
ATOM 10075 O O    . ILE A 1 92  ? 0.342   -3.873  2.229   1.00 0.00 ? 92  ILE A O    5  
ATOM 10076 C CB   . ILE A 1 92  ? -1.841  -2.884  4.292   1.00 0.00 ? 92  ILE A CB   5  
ATOM 10077 C CG1  . ILE A 1 92  ? -2.328  -1.825  5.283   1.00 0.00 ? 92  ILE A CG1  5  
ATOM 10078 C CG2  . ILE A 1 92  ? -2.528  -4.217  4.552   1.00 0.00 ? 92  ILE A CG2  5  
ATOM 10079 C CD1  . ILE A 1 92  ? -3.705  -1.286  4.963   1.00 0.00 ? 92  ILE A CD1  5  
ATOM 10080 H H    . ILE A 1 92  ? 0.398   -1.442  3.197   1.00 0.00 ? 92  ILE A H    5  
ATOM 10081 H HA   . ILE A 1 92  ? -0.063  -3.347  5.392   1.00 0.00 ? 92  ILE A HA   5  
ATOM 10082 H HB   . ILE A 1 92  ? -2.088  -2.569  3.290   1.00 0.00 ? 92  ILE A HB   5  
ATOM 10083 H HG12 . ILE A 1 92  ? -2.363  -2.255  6.272   1.00 0.00 ? 92  ILE A HG12 5  
ATOM 10084 H HG13 . ILE A 1 92  ? -1.636  -0.995  5.280   1.00 0.00 ? 92  ILE A HG13 5  
ATOM 10085 H HG21 . ILE A 1 92  ? -3.000  -4.562  3.644   1.00 0.00 ? 92  ILE A HG21 5  
ATOM 10086 H HG22 . ILE A 1 92  ? -1.796  -4.942  4.874   1.00 0.00 ? 92  ILE A HG22 5  
ATOM 10087 H HG23 . ILE A 1 92  ? -3.275  -4.093  5.321   1.00 0.00 ? 92  ILE A HG23 5  
ATOM 10088 H HD11 . ILE A 1 92  ? -3.738  -0.972  3.930   1.00 0.00 ? 92  ILE A HD11 5  
ATOM 10089 H HD12 . ILE A 1 92  ? -4.442  -2.056  5.130   1.00 0.00 ? 92  ILE A HD12 5  
ATOM 10090 H HD13 . ILE A 1 92  ? -3.917  -0.440  5.602   1.00 0.00 ? 92  ILE A HD13 5  
ATOM 10091 N N    . LEU A 1 93  ? 0.283   -5.347  3.927   1.00 0.00 ? 93  LEU A N    5  
ATOM 10092 C CA   . LEU A 1 93  ? 0.705   -6.477  3.106   1.00 0.00 ? 93  LEU A CA   5  
ATOM 10093 C C    . LEU A 1 93  ? -0.474  -7.393  2.793   1.00 0.00 ? 93  LEU A C    5  
ATOM 10094 O O    . LEU A 1 93  ? -1.103  -7.943  3.697   1.00 0.00 ? 93  LEU A O    5  
ATOM 10095 C CB   . LEU A 1 93  ? 1.805   -7.267  3.817   1.00 0.00 ? 93  LEU A CB   5  
ATOM 10096 C CG   . LEU A 1 93  ? 2.487   -8.359  2.992   1.00 0.00 ? 93  LEU A CG   5  
ATOM 10097 C CD1  . LEU A 1 93  ? 3.614   -7.771  2.157   1.00 0.00 ? 93  LEU A CD1  5  
ATOM 10098 C CD2  . LEU A 1 93  ? 3.012   -9.462  3.899   1.00 0.00 ? 93  LEU A CD2  5  
ATOM 10099 H H    . LEU A 1 93  ? 0.104   -5.491  4.880   1.00 0.00 ? 93  LEU A H    5  
ATOM 10100 H HA   . LEU A 1 93  ? 1.096   -6.084  2.179   1.00 0.00 ? 93  LEU A HA   5  
ATOM 10101 H HB2  . LEU A 1 93  ? 2.564   -6.567  4.131   1.00 0.00 ? 93  LEU A HB2  5  
ATOM 10102 H HB3  . LEU A 1 93  ? 1.365   -7.734  4.687   1.00 0.00 ? 93  LEU A HB3  5  
ATOM 10103 H HG   . LEU A 1 93  ? 1.764   -8.795  2.316   1.00 0.00 ? 93  LEU A HG   5  
ATOM 10104 H HD11 . LEU A 1 93  ? 4.501   -7.678  2.764   1.00 0.00 ? 93  LEU A HD11 5  
ATOM 10105 H HD12 . LEU A 1 93  ? 3.322   -6.796  1.794   1.00 0.00 ? 93  LEU A HD12 5  
ATOM 10106 H HD13 . LEU A 1 93  ? 3.816   -8.421  1.318   1.00 0.00 ? 93  LEU A HD13 5  
ATOM 10107 H HD21 . LEU A 1 93  ? 3.740   -9.050  4.582   1.00 0.00 ? 93  LEU A HD21 5  
ATOM 10108 H HD22 . LEU A 1 93  ? 3.477   -10.231 3.298   1.00 0.00 ? 93  LEU A HD22 5  
ATOM 10109 H HD23 . LEU A 1 93  ? 2.193   -9.889  4.458   1.00 0.00 ? 93  LEU A HD23 5  
ATOM 10110 N N    . PHE A 1 94  ? -0.767  -7.553  1.507   1.00 0.00 ? 94  PHE A N    5  
ATOM 10111 C CA   . PHE A 1 94  ? -1.870  -8.404  1.074   1.00 0.00 ? 94  PHE A CA   5  
ATOM 10112 C C    . PHE A 1 94  ? -1.357  -9.762  0.605   1.00 0.00 ? 94  PHE A C    5  
ATOM 10113 O O    . PHE A 1 94  ? -0.708  -9.865  -0.435  1.00 0.00 ? 94  PHE A O    5  
ATOM 10114 C CB   . PHE A 1 94  ? -2.654  -7.725  -0.051  1.00 0.00 ? 94  PHE A CB   5  
ATOM 10115 C CG   . PHE A 1 94  ? -3.382  -6.487  0.388   1.00 0.00 ? 94  PHE A CG   5  
ATOM 10116 C CD1  . PHE A 1 94  ? -4.673  -6.565  0.884   1.00 0.00 ? 94  PHE A CD1  5  
ATOM 10117 C CD2  . PHE A 1 94  ? -2.775  -5.244  0.304   1.00 0.00 ? 94  PHE A CD2  5  
ATOM 10118 C CE1  . PHE A 1 94  ? -5.346  -5.428  1.289   1.00 0.00 ? 94  PHE A CE1  5  
ATOM 10119 C CE2  . PHE A 1 94  ? -3.442  -4.103  0.708   1.00 0.00 ? 94  PHE A CE2  5  
ATOM 10120 C CZ   . PHE A 1 94  ? -4.730  -4.195  1.200   1.00 0.00 ? 94  PHE A CZ   5  
ATOM 10121 H H    . PHE A 1 94  ? -0.229  -7.087  0.833   1.00 0.00 ? 94  PHE A H    5  
ATOM 10122 H HA   . PHE A 1 94  ? -2.524  -8.552  1.919   1.00 0.00 ? 94  PHE A HA   5  
ATOM 10123 H HB2  . PHE A 1 94  ? -1.971  -7.446  -0.839  1.00 0.00 ? 94  PHE A HB2  5  
ATOM 10124 H HB3  . PHE A 1 94  ? -3.383  -8.419  -0.441  1.00 0.00 ? 94  PHE A HB3  5  
ATOM 10125 H HD1  . PHE A 1 94  ? -5.156  -7.530  0.954   1.00 0.00 ? 94  PHE A HD1  5  
ATOM 10126 H HD2  . PHE A 1 94  ? -1.769  -5.170  -0.081  1.00 0.00 ? 94  PHE A HD2  5  
ATOM 10127 H HE1  . PHE A 1 94  ? -6.352  -5.503  1.673   1.00 0.00 ? 94  PHE A HE1  5  
ATOM 10128 H HE2  . PHE A 1 94  ? -2.959  -3.140  0.637   1.00 0.00 ? 94  PHE A HE2  5  
ATOM 10129 H HZ   . PHE A 1 94  ? -5.253  -3.305  1.516   1.00 0.00 ? 94  PHE A HZ   5  
ATOM 10130 N N    . GLN A 1 95  ? -1.654  -10.800 1.380   1.00 0.00 ? 95  GLN A N    5  
ATOM 10131 C CA   . GLN A 1 95  ? -1.222  -12.151 1.045   1.00 0.00 ? 95  GLN A CA   5  
ATOM 10132 C C    . GLN A 1 95  ? -2.404  -13.115 1.038   1.00 0.00 ? 95  GLN A C    5  
ATOM 10133 O O    . GLN A 1 95  ? -2.801  -13.633 2.081   1.00 0.00 ? 95  GLN A O    5  
ATOM 10134 C CB   . GLN A 1 95  ? -0.162  -12.632 2.037   1.00 0.00 ? 95  GLN A CB   5  
ATOM 10135 C CG   . GLN A 1 95  ? 1.252   -12.214 1.668   1.00 0.00 ? 95  GLN A CG   5  
ATOM 10136 C CD   . GLN A 1 95  ? 1.930   -13.204 0.741   1.00 0.00 ? 95  GLN A CD   5  
ATOM 10137 O OE1  . GLN A 1 95  ? 1.310   -13.733 -0.182  1.00 0.00 ? 95  GLN A OE1  5  
ATOM 10138 N NE2  . GLN A 1 95  ? 3.210   -13.461 0.984   1.00 0.00 ? 95  GLN A NE2  5  
ATOM 10139 H H    . GLN A 1 95  ? -2.174  -10.653 2.197   1.00 0.00 ? 95  GLN A H    5  
ATOM 10140 H HA   . GLN A 1 95  ? -0.790  -12.125 0.056   1.00 0.00 ? 95  GLN A HA   5  
ATOM 10141 H HB2  . GLN A 1 95  ? -0.390  -12.229 3.013   1.00 0.00 ? 95  GLN A HB2  5  
ATOM 10142 H HB3  . GLN A 1 95  ? -0.194  -13.711 2.086   1.00 0.00 ? 95  GLN A HB3  5  
ATOM 10143 H HG2  . GLN A 1 95  ? 1.213   -11.253 1.176   1.00 0.00 ? 95  GLN A HG2  5  
ATOM 10144 H HG3  . GLN A 1 95  ? 1.837   -12.130 2.572   1.00 0.00 ? 95  GLN A HG3  5  
ATOM 10145 H HE21 . GLN A 1 95  ? 3.639   -13.004 1.738   1.00 0.00 ? 95  GLN A HE21 5  
ATOM 10146 H HE22 . GLN A 1 95  ? 3.673   -14.098 0.401   1.00 0.00 ? 95  GLN A HE22 5  
ATOM 10147 N N    . GLY A 1 96  ? -2.963  -13.350 -0.145  1.00 0.00 ? 96  GLY A N    5  
ATOM 10148 C CA   . GLY A 1 96  ? -4.095  -14.251 -0.264  1.00 0.00 ? 96  GLY A CA   5  
ATOM 10149 C C    . GLY A 1 96  ? -5.422  -13.519 -0.248  1.00 0.00 ? 96  GLY A C    5  
ATOM 10150 O O    . GLY A 1 96  ? -6.417  -14.033 0.262   1.00 0.00 ? 96  GLY A O    5  
ATOM 10151 H H    . GLY A 1 96  ? -2.604  -12.909 -0.943  1.00 0.00 ? 96  GLY A H    5  
ATOM 10152 H HA2  . GLY A 1 96  ? -4.009  -14.799 -1.191  1.00 0.00 ? 96  GLY A HA2  5  
ATOM 10153 H HA3  . GLY A 1 96  ? -4.073  -14.950 0.559   1.00 0.00 ? 96  GLY A HA3  5  
ATOM 10154 N N    . GLY A 1 97  ? -5.438  -12.313 -0.808  1.00 0.00 ? 97  GLY A N    5  
ATOM 10155 C CA   . GLY A 1 97  ? -6.658  -11.528 -0.844  1.00 0.00 ? 97  GLY A CA   5  
ATOM 10156 C C    . GLY A 1 97  ? -7.173  -11.192 0.542   1.00 0.00 ? 97  GLY A C    5  
ATOM 10157 O O    . GLY A 1 97  ? -8.381  -11.085 0.755   1.00 0.00 ? 97  GLY A O    5  
ATOM 10158 H H    . GLY A 1 97  ? -4.615  -11.953 -1.200  1.00 0.00 ? 97  GLY A H    5  
ATOM 10159 H HA2  . GLY A 1 97  ? -6.467  -10.609 -1.378  1.00 0.00 ? 97  GLY A HA2  5  
ATOM 10160 H HA3  . GLY A 1 97  ? -7.417  -12.087 -1.371  1.00 0.00 ? 97  GLY A HA3  5  
ATOM 10161 N N    . LYS A 1 98  ? -6.255  -11.028 1.488   1.00 0.00 ? 98  LYS A N    5  
ATOM 10162 C CA   . LYS A 1 98  ? -6.621  -10.703 2.862   1.00 0.00 ? 98  LYS A CA   5  
ATOM 10163 C C    . LYS A 1 98  ? -5.517  -9.901  3.544   1.00 0.00 ? 98  LYS A C    5  
ATOM 10164 O O    . LYS A 1 98  ? -4.332  -10.148 3.323   1.00 0.00 ? 98  LYS A O    5  
ATOM 10165 C CB   . LYS A 1 98  ? -6.900  -11.982 3.653   1.00 0.00 ? 98  LYS A CB   5  
ATOM 10166 C CG   . LYS A 1 98  ? -5.736  -12.958 3.662   1.00 0.00 ? 98  LYS A CG   5  
ATOM 10167 C CD   . LYS A 1 98  ? -6.179  -14.351 4.076   1.00 0.00 ? 98  LYS A CD   5  
ATOM 10168 C CE   . LYS A 1 98  ? -4.988  -15.263 4.330   1.00 0.00 ? 98  LYS A CE   5  
ATOM 10169 N NZ   . LYS A 1 98  ? -5.410  -16.601 4.829   1.00 0.00 ? 98  LYS A NZ   5  
ATOM 10170 H H    . LYS A 1 98  ? -5.307  -11.126 1.257   1.00 0.00 ? 98  LYS A H    5  
ATOM 10171 H HA   . LYS A 1 98  ? -7.518  -10.104 2.833   1.00 0.00 ? 98  LYS A HA   5  
ATOM 10172 H HB2  . LYS A 1 98  ? -7.128  -11.717 4.675   1.00 0.00 ? 98  LYS A HB2  5  
ATOM 10173 H HB3  . LYS A 1 98  ? -7.756  -12.480 3.220   1.00 0.00 ? 98  LYS A HB3  5  
ATOM 10174 H HG2  . LYS A 1 98  ? -5.311  -13.007 2.671   1.00 0.00 ? 98  LYS A HG2  5  
ATOM 10175 H HG3  . LYS A 1 98  ? -4.988  -12.606 4.359   1.00 0.00 ? 98  LYS A HG3  5  
ATOM 10176 H HD2  . LYS A 1 98  ? -6.762  -14.280 4.982   1.00 0.00 ? 98  LYS A HD2  5  
ATOM 10177 H HD3  . LYS A 1 98  ? -6.785  -14.776 3.288   1.00 0.00 ? 98  LYS A HD3  5  
ATOM 10178 H HE2  . LYS A 1 98  ? -4.444  -15.388 3.406   1.00 0.00 ? 98  LYS A HE2  5  
ATOM 10179 H HE3  . LYS A 1 98  ? -4.347  -14.800 5.065   1.00 0.00 ? 98  LYS A HE3  5  
ATOM 10180 H HZ1  . LYS A 1 98  ? -4.999  -16.778 5.768   1.00 0.00 ? 98  LYS A HZ1  5  
ATOM 10181 H HZ2  . LYS A 1 98  ? -5.088  -17.344 4.176   1.00 0.00 ? 98  LYS A HZ2  5  
ATOM 10182 H HZ3  . LYS A 1 98  ? -6.447  -16.645 4.902   1.00 0.00 ? 98  LYS A HZ3  5  
ATOM 10183 N N    . GLU A 1 99  ? -5.914  -8.942  4.375   1.00 0.00 ? 99  GLU A N    5  
ATOM 10184 C CA   . GLU A 1 99  ? -4.957  -8.106  5.089   1.00 0.00 ? 99  GLU A CA   5  
ATOM 10185 C C    . GLU A 1 99  ? -4.201  -8.918  6.136   1.00 0.00 ? 99  GLU A C    5  
ATOM 10186 O O    . GLU A 1 99  ? -4.619  -9.005  7.290   1.00 0.00 ? 99  GLU A O    5  
ATOM 10187 C CB   . GLU A 1 99  ? -5.673  -6.931  5.758   1.00 0.00 ? 99  GLU A CB   5  
ATOM 10188 C CG   . GLU A 1 99  ? -4.776  -6.112  6.671   1.00 0.00 ? 99  GLU A CG   5  
ATOM 10189 C CD   . GLU A 1 99  ? -5.355  -4.746  6.986   1.00 0.00 ? 99  GLU A CD   5  
ATOM 10190 O OE1  . GLU A 1 99  ? -5.342  -3.875  6.091   1.00 0.00 ? 99  GLU A OE1  5  
ATOM 10191 O OE2  . GLU A 1 99  ? -5.821  -4.549  8.128   1.00 0.00 ? 99  GLU A OE2  5  
ATOM 10192 H H    . GLU A 1 99  ? -6.873  -8.794  4.510   1.00 0.00 ? 99  GLU A H    5  
ATOM 10193 H HA   . GLU A 1 99  ? -4.250  -7.722  4.369   1.00 0.00 ? 99  GLU A HA   5  
ATOM 10194 H HB2  . GLU A 1 99  ? -6.063  -6.278  4.991   1.00 0.00 ? 99  GLU A HB2  5  
ATOM 10195 H HB3  . GLU A 1 99  ? -6.495  -7.313  6.344   1.00 0.00 ? 99  GLU A HB3  5  
ATOM 10196 H HG2  . GLU A 1 99  ? -4.639  -6.650  7.597   1.00 0.00 ? 99  GLU A HG2  5  
ATOM 10197 H HG3  . GLU A 1 99  ? -3.818  -5.979  6.189   1.00 0.00 ? 99  GLU A HG3  5  
ATOM 10198 N N    . ALA A 1 100 ? -3.085  -9.511  5.725   1.00 0.00 ? 100 ALA A N    5  
ATOM 10199 C CA   . ALA A 1 100 ? -2.269  -10.315 6.627   1.00 0.00 ? 100 ALA A CA   5  
ATOM 10200 C C    . ALA A 1 100 ? -1.741  -9.474  7.784   1.00 0.00 ? 100 ALA A C    5  
ATOM 10201 O O    . ALA A 1 100 ? -1.852  -9.863  8.947   1.00 0.00 ? 100 ALA A O    5  
ATOM 10202 C CB   . ALA A 1 100 ? -1.116  -10.954 5.867   1.00 0.00 ? 100 ALA A CB   5  
ATOM 10203 H H    . ALA A 1 100 ? -2.803  -9.404  4.792   1.00 0.00 ? 100 ALA A H    5  
ATOM 10204 H HA   . ALA A 1 100 ? -2.890  -11.105 7.023   1.00 0.00 ? 100 ALA A HA   5  
ATOM 10205 H HB1  . ALA A 1 100 ? -1.090  -12.013 6.079   1.00 0.00 ? 100 ALA A HB1  5  
ATOM 10206 H HB2  . ALA A 1 100 ? -1.256  -10.803 4.807   1.00 0.00 ? 100 ALA A HB2  5  
ATOM 10207 H HB3  . ALA A 1 100 ? -0.186  -10.502 6.176   1.00 0.00 ? 100 ALA A HB3  5  
ATOM 10208 N N    . MET A 1 101 ? -1.165  -8.322  7.458   1.00 0.00 ? 101 MET A N    5  
ATOM 10209 C CA   . MET A 1 101 ? -0.619  -7.427  8.472   1.00 0.00 ? 101 MET A CA   5  
ATOM 10210 C C    . MET A 1 101 ? -0.745  -5.971  8.036   1.00 0.00 ? 101 MET A C    5  
ATOM 10211 O O    . MET A 1 101 ? -1.127  -5.683  6.902   1.00 0.00 ? 101 MET A O    5  
ATOM 10212 C CB   . MET A 1 101 ? 0.848   -7.765  8.746   1.00 0.00 ? 101 MET A CB   5  
ATOM 10213 C CG   . MET A 1 101 ? 1.784   -7.363  7.618   1.00 0.00 ? 101 MET A CG   5  
ATOM 10214 S SD   . MET A 1 101 ? 2.398   -5.677  7.792   1.00 0.00 ? 101 MET A SD   5  
ATOM 10215 C CE   . MET A 1 101 ? 4.032   -5.979  8.460   1.00 0.00 ? 101 MET A CE   5  
ATOM 10216 H H    . MET A 1 101 ? -1.105  -8.066  6.514   1.00 0.00 ? 101 MET A H    5  
ATOM 10217 H HA   . MET A 1 101 ? -1.187  -7.569  9.379   1.00 0.00 ? 101 MET A HA   5  
ATOM 10218 H HB2  . MET A 1 101 ? 1.161   -7.254  9.644   1.00 0.00 ? 101 MET A HB2  5  
ATOM 10219 H HB3  . MET A 1 101 ? 0.938   -8.830  8.897   1.00 0.00 ? 101 MET A HB3  5  
ATOM 10220 H HG2  . MET A 1 101 ? 2.627   -8.038  7.609   1.00 0.00 ? 101 MET A HG2  5  
ATOM 10221 H HG3  . MET A 1 101 ? 1.252   -7.443  6.681   1.00 0.00 ? 101 MET A HG3  5  
ATOM 10222 H HE1  . MET A 1 101 ? 4.553   -6.687  7.832   1.00 0.00 ? 101 MET A HE1  5  
ATOM 10223 H HE2  . MET A 1 101 ? 4.585   -5.052  8.492   1.00 0.00 ? 101 MET A HE2  5  
ATOM 10224 H HE3  . MET A 1 101 ? 3.944   -6.381  9.459   1.00 0.00 ? 101 MET A HE3  5  
ATOM 10225 N N    . ARG A 1 102 ? -0.422  -5.056  8.945   1.00 0.00 ? 102 ARG A N    5  
ATOM 10226 C CA   . ARG A 1 102 ? -0.501  -3.629  8.654   1.00 0.00 ? 102 ARG A CA   5  
ATOM 10227 C C    . ARG A 1 102 ? 0.398   -2.832  9.594   1.00 0.00 ? 102 ARG A C    5  
ATOM 10228 O O    . ARG A 1 102 ? 0.533   -3.166  10.771  1.00 0.00 ? 102 ARG A O    5  
ATOM 10229 C CB   . ARG A 1 102 ? -1.946  -3.141  8.776   1.00 0.00 ? 102 ARG A CB   5  
ATOM 10230 C CG   . ARG A 1 102 ? -2.479  -3.167  10.199  1.00 0.00 ? 102 ARG A CG   5  
ATOM 10231 C CD   . ARG A 1 102 ? -3.552  -2.111  10.411  1.00 0.00 ? 102 ARG A CD   5  
ATOM 10232 N NE   . ARG A 1 102 ? -4.805  -2.462  9.748   1.00 0.00 ? 102 ARG A NE   5  
ATOM 10233 C CZ   . ARG A 1 102 ? -5.760  -1.583  9.469   1.00 0.00 ? 102 ARG A CZ   5  
ATOM 10234 N NH1  . ARG A 1 102 ? -5.606  -0.306  9.792   1.00 0.00 ? 102 ARG A NH1  5  
ATOM 10235 N NH2  . ARG A 1 102 ? -6.873  -1.979  8.864   1.00 0.00 ? 102 ARG A NH2  5  
ATOM 10236 H H    . ARG A 1 102 ? -0.125  -5.347  9.832   1.00 0.00 ? 102 ARG A H    5  
ATOM 10237 H HA   . ARG A 1 102 ? -0.164  -3.478  7.639   1.00 0.00 ? 102 ARG A HA   5  
ATOM 10238 H HB2  . ARG A 1 102 ? -2.002  -2.125  8.412   1.00 0.00 ? 102 ARG A HB2  5  
ATOM 10239 H HB3  . ARG A 1 102 ? -2.578  -3.769  8.166   1.00 0.00 ? 102 ARG A HB3  5  
ATOM 10240 H HG2  . ARG A 1 102 ? -2.904  -4.141  10.396  1.00 0.00 ? 102 ARG A HG2  5  
ATOM 10241 H HG3  . ARG A 1 102 ? -1.664  -2.983  10.882  1.00 0.00 ? 102 ARG A HG3  5  
ATOM 10242 H HD2  . ARG A 1 102 ? -3.733  -2.008  11.471  1.00 0.00 ? 102 ARG A HD2  5  
ATOM 10243 H HD3  . ARG A 1 102 ? -3.197  -1.172  10.014  1.00 0.00 ? 102 ARG A HD3  5  
ATOM 10244 H HE   . ARG A 1 102 ? -4.940  -3.400  9.501   1.00 0.00 ? 102 ARG A HE   5  
ATOM 10245 H HH11 . ARG A 1 102 ? -4.769  -0.004  10.247  1.00 0.00 ? 102 ARG A HH11 5  
ATOM 10246 H HH12 . ARG A 1 102 ? -6.326  0.355   9.579   1.00 0.00 ? 102 ARG A HH12 5  
ATOM 10247 H HH21 . ARG A 1 102 ? -6.993  -2.941  8.618   1.00 0.00 ? 102 ARG A HH21 5  
ATOM 10248 H HH22 . ARG A 1 102 ? -7.591  -1.317  8.654   1.00 0.00 ? 102 ARG A HH22 5  
ATOM 10249 N N    . ARG A 1 103 ? 1.011   -1.777  9.067   1.00 0.00 ? 103 ARG A N    5  
ATOM 10250 C CA   . ARG A 1 103 ? 1.898   -0.934  9.858   1.00 0.00 ? 103 ARG A CA   5  
ATOM 10251 C C    . ARG A 1 103 ? 1.700   0.539   9.512   1.00 0.00 ? 103 ARG A C    5  
ATOM 10252 O O    . ARG A 1 103 ? 1.845   0.957   8.363   1.00 0.00 ? 103 ARG A O    5  
ATOM 10253 C CB   . ARG A 1 103 ? 3.356   -1.332  9.626   1.00 0.00 ? 103 ARG A CB   5  
ATOM 10254 C CG   . ARG A 1 103 ? 3.657   -2.779  9.982   1.00 0.00 ? 103 ARG A CG   5  
ATOM 10255 C CD   . ARG A 1 103 ? 4.091   -2.917  11.433  1.00 0.00 ? 103 ARG A CD   5  
ATOM 10256 N NE   . ARG A 1 103 ? 3.903   -4.276  11.934  1.00 0.00 ? 103 ARG A NE   5  
ATOM 10257 C CZ   . ARG A 1 103 ? 4.033   -4.613  13.212  1.00 0.00 ? 103 ARG A CZ   5  
ATOM 10258 N NH1  . ARG A 1 103 ? 4.349   -3.694  14.114  1.00 0.00 ? 103 ARG A NH1  5  
ATOM 10259 N NH2  . ARG A 1 103 ? 3.847   -5.871  13.590  1.00 0.00 ? 103 ARG A NH2  5  
ATOM 10260 H H    . ARG A 1 103 ? 0.863   -1.562  8.122   1.00 0.00 ? 103 ARG A H    5  
ATOM 10261 H HA   . ARG A 1 103 ? 1.655   -1.082  10.900  1.00 0.00 ? 103 ARG A HA   5  
ATOM 10262 H HB2  . ARG A 1 103 ? 3.596   -1.184  8.583   1.00 0.00 ? 103 ARG A HB2  5  
ATOM 10263 H HB3  . ARG A 1 103 ? 3.990   -0.697  10.227  1.00 0.00 ? 103 ARG A HB3  5  
ATOM 10264 H HG2  . ARG A 1 103 ? 2.767   -3.371  9.827   1.00 0.00 ? 103 ARG A HG2  5  
ATOM 10265 H HG3  . ARG A 1 103 ? 4.449   -3.140  9.343   1.00 0.00 ? 103 ARG A HG3  5  
ATOM 10266 H HD2  . ARG A 1 103 ? 5.136   -2.656  11.509  1.00 0.00 ? 103 ARG A HD2  5  
ATOM 10267 H HD3  . ARG A 1 103 ? 3.506   -2.237  12.036  1.00 0.00 ? 103 ARG A HD3  5  
ATOM 10268 H HE   . ARG A 1 103 ? 3.670   -4.970  11.284  1.00 0.00 ? 103 ARG A HE   5  
ATOM 10269 H HH11 . ARG A 1 103 ? 4.489   -2.745  13.833  1.00 0.00 ? 103 ARG A HH11 5  
ATOM 10270 H HH12 . ARG A 1 103 ? 4.445   -3.950  15.077  1.00 0.00 ? 103 ARG A HH12 5  
ATOM 10271 H HH21 . ARG A 1 103 ? 3.608   -6.566  12.913  1.00 0.00 ? 103 ARG A HH21 5  
ATOM 10272 H HH22 . ARG A 1 103 ? 3.945   -6.123  14.552  1.00 0.00 ? 103 ARG A HH22 5  
ATOM 10273 N N    . PRO A 1 104 ? 1.360   1.346   10.528  1.00 0.00 ? 104 PRO A N    5  
ATOM 10274 C CA   . PRO A 1 104 ? 1.184   0.860   11.900  1.00 0.00 ? 104 PRO A CA   5  
ATOM 10275 C C    . PRO A 1 104 ? -0.056  -0.015  12.050  1.00 0.00 ? 104 PRO A C    5  
ATOM 10276 O O    . PRO A 1 104 ? -0.881  -0.099  11.141  1.00 0.00 ? 104 PRO A O    5  
ATOM 10277 C CB   . PRO A 1 104 ? 1.033   2.146   12.716  1.00 0.00 ? 104 PRO A CB   5  
ATOM 10278 C CG   . PRO A 1 104 ? 0.515   3.151   11.746  1.00 0.00 ? 104 PRO A CG   5  
ATOM 10279 C CD   . PRO A 1 104 ? 1.121   2.794   10.416  1.00 0.00 ? 104 PRO A CD   5  
ATOM 10280 H HA   . PRO A 1 104 ? 2.051   0.314   12.242  1.00 0.00 ? 104 PRO A HA   5  
ATOM 10281 H HB2  . PRO A 1 104 ? 0.337   1.982   13.526  1.00 0.00 ? 104 PRO A HB2  5  
ATOM 10282 H HB3  . PRO A 1 104 ? 1.994   2.439   13.113  1.00 0.00 ? 104 PRO A HB3  5  
ATOM 10283 H HG2  . PRO A 1 104 ? -0.561  3.092   11.695  1.00 0.00 ? 104 PRO A HG2  5  
ATOM 10284 H HG3  . PRO A 1 104 ? 0.824   4.142   12.044  1.00 0.00 ? 104 PRO A HG3  5  
ATOM 10285 H HD2  . PRO A 1 104 ? 0.429   3.010   9.616   1.00 0.00 ? 104 PRO A HD2  5  
ATOM 10286 H HD3  . PRO A 1 104 ? 2.049   3.327   10.269  1.00 0.00 ? 104 PRO A HD3  5  
ATOM 10287 N N    . GLN A 1 105 ? -0.182  -0.663  13.204  1.00 0.00 ? 105 GLN A N    5  
ATOM 10288 C CA   . GLN A 1 105 ? -1.322  -1.531  13.472  1.00 0.00 ? 105 GLN A CA   5  
ATOM 10289 C C    . GLN A 1 105 ? -2.233  -0.921  14.532  1.00 0.00 ? 105 GLN A C    5  
ATOM 10290 O O    . GLN A 1 105 ? -1.763  -0.298  15.485  1.00 0.00 ? 105 GLN A O    5  
ATOM 10291 C CB   . GLN A 1 105 ? -0.844  -2.911  13.927  1.00 0.00 ? 105 GLN A CB   5  
ATOM 10292 C CG   . GLN A 1 105 ? -1.970  -3.826  14.380  1.00 0.00 ? 105 GLN A CG   5  
ATOM 10293 C CD   . GLN A 1 105 ? -1.481  -5.213  14.749  1.00 0.00 ? 105 GLN A CD   5  
ATOM 10294 O OE1  . GLN A 1 105 ? -1.575  -6.149  13.954  1.00 0.00 ? 105 GLN A OE1  5  
ATOM 10295 N NE2  . GLN A 1 105 ? -0.956  -5.353  15.961  1.00 0.00 ? 105 GLN A NE2  5  
ATOM 10296 H H    . GLN A 1 105 ? 0.509   -0.555  13.890  1.00 0.00 ? 105 GLN A H    5  
ATOM 10297 H HA   . GLN A 1 105 ? -1.880  -1.638  12.554  1.00 0.00 ? 105 GLN A HA   5  
ATOM 10298 H HB2  . GLN A 1 105 ? -0.328  -3.388  13.107  1.00 0.00 ? 105 GLN A HB2  5  
ATOM 10299 H HB3  . GLN A 1 105 ? -0.156  -2.787  14.751  1.00 0.00 ? 105 GLN A HB3  5  
ATOM 10300 H HG2  . GLN A 1 105 ? -2.447  -3.388  15.244  1.00 0.00 ? 105 GLN A HG2  5  
ATOM 10301 H HG3  . GLN A 1 105 ? -2.688  -3.914  13.579  1.00 0.00 ? 105 GLN A HG3  5  
ATOM 10302 H HE21 . GLN A 1 105 ? -0.914  -4.563  16.541  1.00 0.00 ? 105 GLN A HE21 5  
ATOM 10303 H HE22 . GLN A 1 105 ? -0.633  -6.238  16.226  1.00 0.00 ? 105 GLN A HE22 5  
ATOM 10304 N N    . ILE A 1 106 ? -3.538  -1.103  14.360  1.00 0.00 ? 106 ILE A N    5  
ATOM 10305 C CA   . ILE A 1 106 ? -4.514  -0.571  15.302  1.00 0.00 ? 106 ILE A CA   5  
ATOM 10306 C C    . ILE A 1 106 ? -4.879  -1.607  16.360  1.00 0.00 ? 106 ILE A C    5  
ATOM 10307 O O    . ILE A 1 106 ? -5.330  -2.706  16.037  1.00 0.00 ? 106 ILE A O    5  
ATOM 10308 C CB   . ILE A 1 106 ? -5.798  -0.113  14.584  1.00 0.00 ? 106 ILE A CB   5  
ATOM 10309 C CG1  . ILE A 1 106 ? -5.449  0.730   13.356  1.00 0.00 ? 106 ILE A CG1  5  
ATOM 10310 C CG2  . ILE A 1 106 ? -6.686  0.673   15.537  1.00 0.00 ? 106 ILE A CG2  5  
ATOM 10311 C CD1  . ILE A 1 106 ? -4.671  1.984   13.685  1.00 0.00 ? 106 ILE A CD1  5  
ATOM 10312 H H    . ILE A 1 106 ? -3.851  -1.607  13.580  1.00 0.00 ? 106 ILE A H    5  
ATOM 10313 H HA   . ILE A 1 106 ? -4.073  0.287   15.790  1.00 0.00 ? 106 ILE A HA   5  
ATOM 10314 H HB   . ILE A 1 106 ? -6.339  -0.991  14.268  1.00 0.00 ? 106 ILE A HB   5  
ATOM 10315 H HG12 . ILE A 1 106 ? -4.852  0.138   12.679  1.00 0.00 ? 106 ILE A HG12 5  
ATOM 10316 H HG13 . ILE A 1 106 ? -6.362  1.025   12.860  1.00 0.00 ? 106 ILE A HG13 5  
ATOM 10317 H HG21 . ILE A 1 106 ? -7.086  0.007   16.288  1.00 0.00 ? 106 ILE A HG21 5  
ATOM 10318 H HG22 . ILE A 1 106 ? -6.104  1.446   16.017  1.00 0.00 ? 106 ILE A HG22 5  
ATOM 10319 H HG23 . ILE A 1 106 ? -7.497  1.123   14.986  1.00 0.00 ? 106 ILE A HG23 5  
ATOM 10320 H HD11 . ILE A 1 106 ? -3.719  1.715   14.118  1.00 0.00 ? 106 ILE A HD11 5  
ATOM 10321 H HD12 . ILE A 1 106 ? -4.508  2.555   12.783  1.00 0.00 ? 106 ILE A HD12 5  
ATOM 10322 H HD13 . ILE A 1 106 ? -5.231  2.580   14.392  1.00 0.00 ? 106 ILE A HD13 5  
ATOM 10323 N N    . ASP A 1 107 ? -4.681  -1.248  17.624  1.00 0.00 ? 107 ASP A N    5  
ATOM 10324 C CA   . ASP A 1 107 ? -4.992  -2.146  18.730  1.00 0.00 ? 107 ASP A CA   5  
ATOM 10325 C C    . ASP A 1 107 ? -6.367  -1.834  19.313  1.00 0.00 ? 107 ASP A C    5  
ATOM 10326 O O    . ASP A 1 107 ? -7.026  -0.880  18.901  1.00 0.00 ? 107 ASP A O    5  
ATOM 10327 C CB   . ASP A 1 107 ? -3.925  -2.033  19.821  1.00 0.00 ? 107 ASP A CB   5  
ATOM 10328 C CG   . ASP A 1 107 ? -3.753  -0.612  20.318  1.00 0.00 ? 107 ASP A CG   5  
ATOM 10329 O OD1  . ASP A 1 107 ? -3.665  0.306   19.475  1.00 0.00 ? 107 ASP A OD1  5  
ATOM 10330 O OD2  . ASP A 1 107 ? -3.707  -0.416  21.550  1.00 0.00 ? 107 ASP A OD2  5  
ATOM 10331 H H    . ASP A 1 107 ? -4.319  -0.358  17.817  1.00 0.00 ? 107 ASP A H    5  
ATOM 10332 H HA   . ASP A 1 107 ? -4.997  -3.155  18.347  1.00 0.00 ? 107 ASP A HA   5  
ATOM 10333 H HB2  . ASP A 1 107 ? -4.208  -2.655  20.657  1.00 0.00 ? 107 ASP A HB2  5  
ATOM 10334 H HB3  . ASP A 1 107 ? -2.979  -2.375  19.426  1.00 0.00 ? 107 ASP A HB3  5  
ATOM 10335 N N    . LYS A 1 108 ? -6.795  -2.647  20.273  1.00 0.00 ? 108 LYS A N    5  
ATOM 10336 C CA   . LYS A 1 108 ? -8.091  -2.460  20.913  1.00 0.00 ? 108 LYS A CA   5  
ATOM 10337 C C    . LYS A 1 108 ? -8.403  -0.977  21.087  1.00 0.00 ? 108 LYS A C    5  
ATOM 10338 O O    . LYS A 1 108 ? -9.457  -0.500  20.665  1.00 0.00 ? 108 LYS A O    5  
ATOM 10339 C CB   . LYS A 1 108 ? -8.117  -3.160  22.274  1.00 0.00 ? 108 LYS A CB   5  
ATOM 10340 C CG   . LYS A 1 108 ? -9.394  -2.916  23.060  1.00 0.00 ? 108 LYS A CG   5  
ATOM 10341 C CD   . LYS A 1 108 ? -9.312  -3.511  24.455  1.00 0.00 ? 108 LYS A CD   5  
ATOM 10342 C CE   . LYS A 1 108 ? -10.691 -3.857  24.996  1.00 0.00 ? 108 LYS A CE   5  
ATOM 10343 N NZ   . LYS A 1 108 ? -11.126 -5.218  24.577  1.00 0.00 ? 108 LYS A NZ   5  
ATOM 10344 H H    . LYS A 1 108 ? -6.224  -3.392  20.559  1.00 0.00 ? 108 LYS A H    5  
ATOM 10345 H HA   . LYS A 1 108 ? -8.843  -2.901  20.276  1.00 0.00 ? 108 LYS A HA   5  
ATOM 10346 H HB2  . LYS A 1 108 ? -8.012  -4.224  22.120  1.00 0.00 ? 108 LYS A HB2  5  
ATOM 10347 H HB3  . LYS A 1 108 ? -7.283  -2.807  22.863  1.00 0.00 ? 108 LYS A HB3  5  
ATOM 10348 H HG2  . LYS A 1 108 ? -9.556  -1.852  23.143  1.00 0.00 ? 108 LYS A HG2  5  
ATOM 10349 H HG3  . LYS A 1 108 ? -10.222 -3.368  22.533  1.00 0.00 ? 108 LYS A HG3  5  
ATOM 10350 H HD2  . LYS A 1 108 ? -8.716  -4.411  24.420  1.00 0.00 ? 108 LYS A HD2  5  
ATOM 10351 H HD3  . LYS A 1 108 ? -8.845  -2.794  25.116  1.00 0.00 ? 108 LYS A HD3  5  
ATOM 10352 H HE2  . LYS A 1 108 ? -10.663 -3.813  26.073  1.00 0.00 ? 108 LYS A HE2  5  
ATOM 10353 H HE3  . LYS A 1 108 ? -11.401 -3.132  24.624  1.00 0.00 ? 108 LYS A HE3  5  
ATOM 10354 H HZ1  . LYS A 1 108 ? -10.483 -5.935  24.972  1.00 0.00 ? 108 LYS A HZ1  5  
ATOM 10355 H HZ2  . LYS A 1 108 ? -11.115 -5.294  23.540  1.00 0.00 ? 108 LYS A HZ2  5  
ATOM 10356 H HZ3  . LYS A 1 108 ? -12.090 -5.407  24.918  1.00 0.00 ? 108 LYS A HZ3  5  
ATOM 10357 N N    . LYS A 1 109 ? -7.480  -0.252  21.710  1.00 0.00 ? 109 LYS A N    5  
ATOM 10358 C CA   . LYS A 1 109 ? -7.654  1.178   21.938  1.00 0.00 ? 109 LYS A CA   5  
ATOM 10359 C C    . LYS A 1 109 ? -8.281  1.850   20.721  1.00 0.00 ? 109 LYS A C    5  
ATOM 10360 O O    . LYS A 1 109 ? -9.192  2.667   20.851  1.00 0.00 ? 109 LYS A O    5  
ATOM 10361 C CB   . LYS A 1 109 ? -6.308  1.832   22.258  1.00 0.00 ? 109 LYS A CB   5  
ATOM 10362 C CG   . LYS A 1 109 ? -5.775  1.483   23.637  1.00 0.00 ? 109 LYS A CG   5  
ATOM 10363 C CD   . LYS A 1 109 ? -6.260  2.468   24.687  1.00 0.00 ? 109 LYS A CD   5  
ATOM 10364 C CE   . LYS A 1 109 ? -5.303  3.639   24.838  1.00 0.00 ? 109 LYS A CE   5  
ATOM 10365 N NZ   . LYS A 1 109 ? -5.352  4.551   23.662  1.00 0.00 ? 109 LYS A NZ   5  
ATOM 10366 H H    . LYS A 1 109 ? -6.660  -0.690  22.024  1.00 0.00 ? 109 LYS A H    5  
ATOM 10367 H HA   . LYS A 1 109 ? -8.315  1.301   22.783  1.00 0.00 ? 109 LYS A HA   5  
ATOM 10368 H HB2  . LYS A 1 109 ? -5.583  1.513   21.523  1.00 0.00 ? 109 LYS A HB2  5  
ATOM 10369 H HB3  . LYS A 1 109 ? -6.420  2.905   22.199  1.00 0.00 ? 109 LYS A HB3  5  
ATOM 10370 H HG2  . LYS A 1 109 ? -6.113  0.493   23.904  1.00 0.00 ? 109 LYS A HG2  5  
ATOM 10371 H HG3  . LYS A 1 109 ? -4.695  1.502   23.610  1.00 0.00 ? 109 LYS A HG3  5  
ATOM 10372 H HD2  . LYS A 1 109 ? -7.229  2.844   24.395  1.00 0.00 ? 109 LYS A HD2  5  
ATOM 10373 H HD3  . LYS A 1 109 ? -6.342  1.956   25.636  1.00 0.00 ? 109 LYS A HD3  5  
ATOM 10374 H HE2  . LYS A 1 109 ? -5.570  4.194   25.724  1.00 0.00 ? 109 LYS A HE2  5  
ATOM 10375 H HE3  . LYS A 1 109 ? -4.299  3.255   24.943  1.00 0.00 ? 109 LYS A HE3  5  
ATOM 10376 H HZ1  . LYS A 1 109 ? -4.950  4.079   22.827  1.00 0.00 ? 109 LYS A HZ1  5  
ATOM 10377 H HZ2  . LYS A 1 109 ? -4.805  5.414   23.855  1.00 0.00 ? 109 LYS A HZ2  5  
ATOM 10378 H HZ3  . LYS A 1 109 ? -6.337  4.816   23.456  1.00 0.00 ? 109 LYS A HZ3  5  
ATOM 10379 N N    . GLY A 1 110 ? -7.789  1.499   19.537  1.00 0.00 ? 110 GLY A N    5  
ATOM 10380 C CA   . GLY A 1 110 ? -8.314  2.077   18.314  1.00 0.00 ? 110 GLY A CA   5  
ATOM 10381 C C    . GLY A 1 110 ? -7.438  3.190   17.775  1.00 0.00 ? 110 GLY A C    5  
ATOM 10382 O O    . GLY A 1 110 ? -7.929  4.126   17.145  1.00 0.00 ? 110 GLY A O    5  
ATOM 10383 H H    . GLY A 1 110 ? -7.063  0.842   19.493  1.00 0.00 ? 110 GLY A H    5  
ATOM 10384 H HA2  . GLY A 1 110 ? -8.393  1.301   17.566  1.00 0.00 ? 110 GLY A HA2  5  
ATOM 10385 H HA3  . GLY A 1 110 ? -9.299  2.473   18.511  1.00 0.00 ? 110 GLY A HA3  5  
ATOM 10386 N N    . ARG A 1 111 ? -6.136  3.090   18.026  1.00 0.00 ? 111 ARG A N    5  
ATOM 10387 C CA   . ARG A 1 111 ? -5.190  4.099   17.564  1.00 0.00 ? 111 ARG A CA   5  
ATOM 10388 C C    . ARG A 1 111 ? -4.004  3.448   16.858  1.00 0.00 ? 111 ARG A C    5  
ATOM 10389 O O    . ARG A 1 111 ? -3.800  2.238   16.952  1.00 0.00 ? 111 ARG A O    5  
ATOM 10390 C CB   . ARG A 1 111 ? -4.696  4.942   18.741  1.00 0.00 ? 111 ARG A CB   5  
ATOM 10391 C CG   . ARG A 1 111 ? -5.693  5.996   19.195  1.00 0.00 ? 111 ARG A CG   5  
ATOM 10392 C CD   . ARG A 1 111 ? -5.507  7.301   18.437  1.00 0.00 ? 111 ARG A CD   5  
ATOM 10393 N NE   . ARG A 1 111 ? -6.510  8.297   18.808  1.00 0.00 ? 111 ARG A NE   5  
ATOM 10394 C CZ   . ARG A 1 111 ? -6.497  9.551   18.371  1.00 0.00 ? 111 ARG A CZ   5  
ATOM 10395 N NH1  . ARG A 1 111 ? -5.538  9.961   17.552  1.00 0.00 ? 111 ARG A NH1  5  
ATOM 10396 N NH2  . ARG A 1 111 ? -7.444  10.398  18.753  1.00 0.00 ? 111 ARG A NH2  5  
ATOM 10397 H H    . ARG A 1 111 ? -5.805  2.321   18.534  1.00 0.00 ? 111 ARG A H    5  
ATOM 10398 H HA   . ARG A 1 111 ? -5.704  4.740   16.864  1.00 0.00 ? 111 ARG A HA   5  
ATOM 10399 H HB2  . ARG A 1 111 ? -4.492  4.289   19.577  1.00 0.00 ? 111 ARG A HB2  5  
ATOM 10400 H HB3  . ARG A 1 111 ? -3.784  5.441   18.453  1.00 0.00 ? 111 ARG A HB3  5  
ATOM 10401 H HG2  . ARG A 1 111 ? -6.694  5.631   19.021  1.00 0.00 ? 111 ARG A HG2  5  
ATOM 10402 H HG3  . ARG A 1 111 ? -5.553  6.179   20.250  1.00 0.00 ? 111 ARG A HG3  5  
ATOM 10403 H HD2  . ARG A 1 111 ? -4.526  7.694   18.658  1.00 0.00 ? 111 ARG A HD2  5  
ATOM 10404 H HD3  . ARG A 1 111 ? -5.585  7.101   17.379  1.00 0.00 ? 111 ARG A HD3  5  
ATOM 10405 H HE   . ARG A 1 111 ? -7.228  8.015   19.412  1.00 0.00 ? 111 ARG A HE   5  
ATOM 10406 H HH11 . ARG A 1 111 ? -4.823  9.325   17.262  1.00 0.00 ? 111 ARG A HH11 5  
ATOM 10407 H HH12 . ARG A 1 111 ? -5.530  10.906  17.224  1.00 0.00 ? 111 ARG A HH12 5  
ATOM 10408 H HH21 . ARG A 1 111 ? -8.169  10.092  19.370  1.00 0.00 ? 111 ARG A HH21 5  
ATOM 10409 H HH22 . ARG A 1 111 ? -7.433  11.342  18.424  1.00 0.00 ? 111 ARG A HH22 5  
ATOM 10410 N N    . ALA A 1 112 ? -3.226  4.260   16.150  1.00 0.00 ? 112 ALA A N    5  
ATOM 10411 C CA   . ALA A 1 112 ? -2.060  3.765   15.429  1.00 0.00 ? 112 ALA A CA   5  
ATOM 10412 C C    . ALA A 1 112 ? -0.814  3.802   16.309  1.00 0.00 ? 112 ALA A C    5  
ATOM 10413 O O    . ALA A 1 112 ? -0.339  4.873   16.685  1.00 0.00 ? 112 ALA A O    5  
ATOM 10414 C CB   . ALA A 1 112 ? -1.838  4.577   14.162  1.00 0.00 ? 112 ALA A CB   5  
ATOM 10415 H H    . ALA A 1 112 ? -3.440  5.216   16.113  1.00 0.00 ? 112 ALA A H    5  
ATOM 10416 H HA   . ALA A 1 112 ? -2.255  2.742   15.142  1.00 0.00 ? 112 ALA A HA   5  
ATOM 10417 H HB1  . ALA A 1 112 ? -2.334  4.093   13.334  1.00 0.00 ? 112 ALA A HB1  5  
ATOM 10418 H HB2  . ALA A 1 112 ? -2.243  5.569   14.295  1.00 0.00 ? 112 ALA A HB2  5  
ATOM 10419 H HB3  . ALA A 1 112 ? -0.780  4.645   13.959  1.00 0.00 ? 112 ALA A HB3  5  
ATOM 10420 N N    . VAL A 1 113 ? -0.290  2.624   16.634  1.00 0.00 ? 113 VAL A N    5  
ATOM 10421 C CA   . VAL A 1 113 ? 0.901   2.522   17.468  1.00 0.00 ? 113 VAL A CA   5  
ATOM 10422 C C    . VAL A 1 113 ? 2.084   3.241   16.829  1.00 0.00 ? 113 VAL A C    5  
ATOM 10423 O O    . VAL A 1 113 ? 2.440   2.973   15.682  1.00 0.00 ? 113 VAL A O    5  
ATOM 10424 C CB   . VAL A 1 113 ? 1.284   1.052   17.722  1.00 0.00 ? 113 VAL A CB   5  
ATOM 10425 C CG1  . VAL A 1 113 ? 2.533   0.966   18.586  1.00 0.00 ? 113 VAL A CG1  5  
ATOM 10426 C CG2  . VAL A 1 113 ? 0.127   0.303   18.366  1.00 0.00 ? 113 VAL A CG2  5  
ATOM 10427 H H    . VAL A 1 113 ? -0.714  1.805   16.303  1.00 0.00 ? 113 VAL A H    5  
ATOM 10428 H HA   . VAL A 1 113 ? 0.682   2.984   18.420  1.00 0.00 ? 113 VAL A HA   5  
ATOM 10429 H HB   . VAL A 1 113 ? 1.500   0.588   16.770  1.00 0.00 ? 113 VAL A HB   5  
ATOM 10430 H HG11 . VAL A 1 113 ? 3.027   1.927   18.600  1.00 0.00 ? 113 VAL A HG11 5  
ATOM 10431 H HG12 . VAL A 1 113 ? 2.256   0.688   19.593  1.00 0.00 ? 113 VAL A HG12 5  
ATOM 10432 H HG13 . VAL A 1 113 ? 3.203   0.224   18.178  1.00 0.00 ? 113 VAL A HG13 5  
ATOM 10433 H HG21 . VAL A 1 113 ? 0.328   0.170   19.419  1.00 0.00 ? 113 VAL A HG21 5  
ATOM 10434 H HG22 . VAL A 1 113 ? -0.783  0.872   18.243  1.00 0.00 ? 113 VAL A HG22 5  
ATOM 10435 H HG23 . VAL A 1 113 ? 0.015   -0.662  17.896  1.00 0.00 ? 113 VAL A HG23 5  
ATOM 10436 N N    . SER A 1 114 ? 2.689   4.156   17.580  1.00 0.00 ? 114 SER A N    5  
ATOM 10437 C CA   . SER A 1 114 ? 3.830   4.917   17.086  1.00 0.00 ? 114 SER A CA   5  
ATOM 10438 C C    . SER A 1 114 ? 4.969   3.986   16.681  1.00 0.00 ? 114 SER A C    5  
ATOM 10439 O O    . SER A 1 114 ? 5.725   3.507   17.527  1.00 0.00 ? 114 SER A O    5  
ATOM 10440 C CB   . SER A 1 114 ? 4.315   5.900   18.153  1.00 0.00 ? 114 SER A CB   5  
ATOM 10441 O OG   . SER A 1 114 ? 4.596   5.233   19.371  1.00 0.00 ? 114 SER A OG   5  
ATOM 10442 H H    . SER A 1 114 ? 2.358   4.324   18.487  1.00 0.00 ? 114 SER A H    5  
ATOM 10443 H HA   . SER A 1 114 ? 3.508   5.471   16.218  1.00 0.00 ? 114 SER A HA   5  
ATOM 10444 H HB2  . SER A 1 114 ? 5.214   6.388   17.808  1.00 0.00 ? 114 SER A HB2  5  
ATOM 10445 H HB3  . SER A 1 114 ? 3.549   6.641   18.331  1.00 0.00 ? 114 SER A HB3  5  
ATOM 10446 H HG   . SER A 1 114 ? 4.038   4.455   19.447  1.00 0.00 ? 114 SER A HG   5  
ATOM 10447 N N    . TRP A 1 115 ? 5.086   3.735   15.382  1.00 0.00 ? 115 TRP A N    5  
ATOM 10448 C CA   . TRP A 1 115 ? 6.132   2.862   14.863  1.00 0.00 ? 115 TRP A CA   5  
ATOM 10449 C C    . TRP A 1 115 ? 7.070   3.627   13.937  1.00 0.00 ? 115 TRP A C    5  
ATOM 10450 O O    . TRP A 1 115 ? 6.691   4.642   13.352  1.00 0.00 ? 115 TRP A O    5  
ATOM 10451 C CB   . TRP A 1 115 ? 5.514   1.677   14.119  1.00 0.00 ? 115 TRP A CB   5  
ATOM 10452 C CG   . TRP A 1 115 ? 6.530   0.795   13.459  1.00 0.00 ? 115 TRP A CG   5  
ATOM 10453 C CD1  . TRP A 1 115 ? 7.519   0.081   14.074  1.00 0.00 ? 115 TRP A CD1  5  
ATOM 10454 C CD2  . TRP A 1 115 ? 6.657   0.534   12.057  1.00 0.00 ? 115 TRP A CD2  5  
ATOM 10455 N NE1  . TRP A 1 115 ? 8.253   -0.607  13.139  1.00 0.00 ? 115 TRP A NE1  5  
ATOM 10456 C CE2  . TRP A 1 115 ? 7.745   -0.347  11.894  1.00 0.00 ? 115 TRP A CE2  5  
ATOM 10457 C CE3  . TRP A 1 115 ? 5.958   0.957   10.924  1.00 0.00 ? 115 TRP A CE3  5  
ATOM 10458 C CZ2  . TRP A 1 115 ? 8.147   -0.810  10.644  1.00 0.00 ? 115 TRP A CZ2  5  
ATOM 10459 C CZ3  . TRP A 1 115 ? 6.359   0.497   9.684   1.00 0.00 ? 115 TRP A CZ3  5  
ATOM 10460 C CH2  . TRP A 1 115 ? 7.444   -0.379  9.552   1.00 0.00 ? 115 TRP A CH2  5  
ATOM 10461 H H    . TRP A 1 115 ? 4.453   4.147   14.757  1.00 0.00 ? 115 TRP A H    5  
ATOM 10462 H HA   . TRP A 1 115 ? 6.700   2.490   15.704  1.00 0.00 ? 115 TRP A HA   5  
ATOM 10463 H HB2  . TRP A 1 115 ? 4.952   1.075   14.816  1.00 0.00 ? 115 TRP A HB2  5  
ATOM 10464 H HB3  . TRP A 1 115 ? 4.849   2.051   13.354  1.00 0.00 ? 115 TRP A HB3  5  
ATOM 10465 H HD1  . TRP A 1 115 ? 7.688   0.072   15.140  1.00 0.00 ? 115 TRP A HD1  5  
ATOM 10466 H HE1  . TRP A 1 115 ? 9.017   -1.191  13.333  1.00 0.00 ? 115 TRP A HE1  5  
ATOM 10467 H HE3  . TRP A 1 115 ? 5.119   1.632   11.005  1.00 0.00 ? 115 TRP A HE3  5  
ATOM 10468 H HZ2  . TRP A 1 115 ? 8.981   -1.486  10.526  1.00 0.00 ? 115 TRP A HZ2  5  
ATOM 10469 H HZ3  . TRP A 1 115 ? 5.830   0.814   8.796   1.00 0.00 ? 115 TRP A HZ3  5  
ATOM 10470 H HH2  . TRP A 1 115 ? 7.722   -0.713  8.564   1.00 0.00 ? 115 TRP A HH2  5  
ATOM 10471 N N    . THR A 1 116 ? 8.298   3.135   13.806  1.00 0.00 ? 116 THR A N    5  
ATOM 10472 C CA   . THR A 1 116 ? 9.291   3.773   12.951  1.00 0.00 ? 116 THR A CA   5  
ATOM 10473 C C    . THR A 1 116 ? 9.144   3.318   11.503  1.00 0.00 ? 116 THR A C    5  
ATOM 10474 O O    . THR A 1 116 ? 8.927   2.137   11.232  1.00 0.00 ? 116 THR A O    5  
ATOM 10475 C CB   . THR A 1 116 ? 10.723  3.470   13.429  1.00 0.00 ? 116 THR A CB   5  
ATOM 10476 O OG1  . THR A 1 116 ? 10.861  3.814   14.813  1.00 0.00 ? 116 THR A OG1  5  
ATOM 10477 C CG2  . THR A 1 116 ? 11.744  4.241   12.606  1.00 0.00 ? 116 THR A CG2  5  
ATOM 10478 H H    . THR A 1 116 ? 8.541   2.323   14.298  1.00 0.00 ? 116 THR A H    5  
ATOM 10479 H HA   . THR A 1 116 ? 9.136   4.841   13.000  1.00 0.00 ? 116 THR A HA   5  
ATOM 10480 H HB   . THR A 1 116 ? 10.910  2.413   13.309  1.00 0.00 ? 116 THR A HB   5  
ATOM 10481 H HG1  . THR A 1 116 ? 10.248  4.521   15.029  1.00 0.00 ? 116 THR A HG1  5  
ATOM 10482 H HG21 . THR A 1 116 ? 11.458  4.218   11.565  1.00 0.00 ? 116 THR A HG21 5  
ATOM 10483 H HG22 . THR A 1 116 ? 12.717  3.789   12.723  1.00 0.00 ? 116 THR A HG22 5  
ATOM 10484 H HG23 . THR A 1 116 ? 11.780  5.265   12.946  1.00 0.00 ? 116 THR A HG23 5  
ATOM 10485 N N    . PHE A 1 117 ? 9.264   4.263   10.576  1.00 0.00 ? 117 PHE A N    5  
ATOM 10486 C CA   . PHE A 1 117 ? 9.144   3.958   9.155   1.00 0.00 ? 117 PHE A CA   5  
ATOM 10487 C C    . PHE A 1 117 ? 10.478  4.156   8.442   1.00 0.00 ? 117 PHE A C    5  
ATOM 10488 O O    . PHE A 1 117 ? 10.729  5.206   7.851   1.00 0.00 ? 117 PHE A O    5  
ATOM 10489 C CB   . PHE A 1 117 ? 8.073   4.842   8.511   1.00 0.00 ? 117 PHE A CB   5  
ATOM 10490 C CG   . PHE A 1 117 ? 6.697   4.241   8.553   1.00 0.00 ? 117 PHE A CG   5  
ATOM 10491 C CD1  . PHE A 1 117 ? 5.886   4.409   9.664   1.00 0.00 ? 117 PHE A CD1  5  
ATOM 10492 C CD2  . PHE A 1 117 ? 6.213   3.509   7.480   1.00 0.00 ? 117 PHE A CD2  5  
ATOM 10493 C CE1  . PHE A 1 117 ? 4.619   3.859   9.705   1.00 0.00 ? 117 PHE A CE1  5  
ATOM 10494 C CE2  . PHE A 1 117 ? 4.947   2.956   7.516   1.00 0.00 ? 117 PHE A CE2  5  
ATOM 10495 C CZ   . PHE A 1 117 ? 4.150   3.130   8.630   1.00 0.00 ? 117 PHE A CZ   5  
ATOM 10496 H H    . PHE A 1 117 ? 9.436   5.187   10.855  1.00 0.00 ? 117 PHE A H    5  
ATOM 10497 H HA   . PHE A 1 117 ? 8.849   2.925   9.062   1.00 0.00 ? 117 PHE A HA   5  
ATOM 10498 H HB2  . PHE A 1 117 ? 8.037   5.788   9.030   1.00 0.00 ? 117 PHE A HB2  5  
ATOM 10499 H HB3  . PHE A 1 117 ? 8.331   5.012   7.477   1.00 0.00 ? 117 PHE A HB3  5  
ATOM 10500 H HD1  . PHE A 1 117 ? 6.253   4.979   10.506  1.00 0.00 ? 117 PHE A HD1  5  
ATOM 10501 H HD2  . PHE A 1 117 ? 6.836   3.371   6.609   1.00 0.00 ? 117 PHE A HD2  5  
ATOM 10502 H HE1  . PHE A 1 117 ? 3.999   3.997   10.578  1.00 0.00 ? 117 PHE A HE1  5  
ATOM 10503 H HE2  . PHE A 1 117 ? 4.582   2.387   6.674   1.00 0.00 ? 117 PHE A HE2  5  
ATOM 10504 H HZ   . PHE A 1 117 ? 3.160   2.700   8.660   1.00 0.00 ? 117 PHE A HZ   5  
ATOM 10505 N N    . SER A 1 118 ? 11.332  3.139   8.503   1.00 0.00 ? 118 SER A N    5  
ATOM 10506 C CA   . SER A 1 118 ? 12.642  3.201   7.867   1.00 0.00 ? 118 SER A CA   5  
ATOM 10507 C C    . SER A 1 118 ? 12.841  2.027   6.914   1.00 0.00 ? 118 SER A C    5  
ATOM 10508 O O    . SER A 1 118 ? 12.178  0.997   7.036   1.00 0.00 ? 118 SER A O    5  
ATOM 10509 C CB   . SER A 1 118 ? 13.746  3.206   8.926   1.00 0.00 ? 118 SER A CB   5  
ATOM 10510 O OG   . SER A 1 118 ? 14.076  1.886   9.325   1.00 0.00 ? 118 SER A OG   5  
ATOM 10511 H H    . SER A 1 118 ? 11.074  2.328   8.990   1.00 0.00 ? 118 SER A H    5  
ATOM 10512 H HA   . SER A 1 118 ? 12.693  4.120   7.303   1.00 0.00 ? 118 SER A HA   5  
ATOM 10513 H HB2  . SER A 1 118 ? 14.629  3.677   8.521   1.00 0.00 ? 118 SER A HB2  5  
ATOM 10514 H HB3  . SER A 1 118 ? 13.409  3.757   9.792   1.00 0.00 ? 118 SER A HB3  5  
ATOM 10515 H HG   . SER A 1 118 ? 14.423  1.402   8.573   1.00 0.00 ? 118 SER A HG   5  
ATOM 10516 N N    . GLU A 1 119 ? 13.758  2.190   5.966   1.00 0.00 ? 119 GLU A N    5  
ATOM 10517 C CA   . GLU A 1 119 ? 14.043  1.144   4.991   1.00 0.00 ? 119 GLU A CA   5  
ATOM 10518 C C    . GLU A 1 119 ? 14.177  -0.214  5.674   1.00 0.00 ? 119 GLU A C    5  
ATOM 10519 O O    . GLU A 1 119 ? 13.403  -1.133  5.409   1.00 0.00 ? 119 GLU A O    5  
ATOM 10520 C CB   . GLU A 1 119 ? 15.324  1.469   4.221   1.00 0.00 ? 119 GLU A CB   5  
ATOM 10521 C CG   . GLU A 1 119 ? 15.349  0.900   2.813   1.00 0.00 ? 119 GLU A CG   5  
ATOM 10522 C CD   . GLU A 1 119 ? 16.668  1.148   2.106   1.00 0.00 ? 119 GLU A CD   5  
ATOM 10523 O OE1  . GLU A 1 119 ? 17.263  2.224   2.324   1.00 0.00 ? 119 GLU A OE1  5  
ATOM 10524 O OE2  . GLU A 1 119 ? 17.103  0.267   1.335   1.00 0.00 ? 119 GLU A OE2  5  
ATOM 10525 H H    . GLU A 1 119 ? 14.253  3.034   5.920   1.00 0.00 ? 119 GLU A H    5  
ATOM 10526 H HA   . GLU A 1 119 ? 13.217  1.104   4.297   1.00 0.00 ? 119 GLU A HA   5  
ATOM 10527 H HB2  . GLU A 1 119 ? 15.429  2.542   4.156   1.00 0.00 ? 119 GLU A HB2  5  
ATOM 10528 H HB3  . GLU A 1 119 ? 16.167  1.067   4.764   1.00 0.00 ? 119 GLU A HB3  5  
ATOM 10529 H HG2  . GLU A 1 119 ? 15.182  -0.166  2.865   1.00 0.00 ? 119 GLU A HG2  5  
ATOM 10530 H HG3  . GLU A 1 119 ? 14.558  1.359   2.239   1.00 0.00 ? 119 GLU A HG3  5  
ATOM 10531 N N    . GLU A 1 120 ? 15.166  -0.332  6.555   1.00 0.00 ? 120 GLU A N    5  
ATOM 10532 C CA   . GLU A 1 120 ? 15.403  -1.577  7.275   1.00 0.00 ? 120 GLU A CA   5  
ATOM 10533 C C    . GLU A 1 120 ? 14.132  -2.052  7.973   1.00 0.00 ? 120 GLU A C    5  
ATOM 10534 O O    . GLU A 1 120 ? 13.615  -3.129  7.677   1.00 0.00 ? 120 GLU A O    5  
ATOM 10535 C CB   . GLU A 1 120 ? 16.523  -1.394  8.301   1.00 0.00 ? 120 GLU A CB   5  
ATOM 10536 C CG   . GLU A 1 120 ? 17.863  -1.033  7.682   1.00 0.00 ? 120 GLU A CG   5  
ATOM 10537 C CD   . GLU A 1 120 ? 18.494  -2.194  6.940   1.00 0.00 ? 120 GLU A CD   5  
ATOM 10538 O OE1  . GLU A 1 120 ? 18.152  -3.354  7.250   1.00 0.00 ? 120 GLU A OE1  5  
ATOM 10539 O OE2  . GLU A 1 120 ? 19.332  -1.942  6.048   1.00 0.00 ? 120 GLU A OE2  5  
ATOM 10540 H H    . GLU A 1 120 ? 15.750  0.437   6.724   1.00 0.00 ? 120 GLU A H    5  
ATOM 10541 H HA   . GLU A 1 120 ? 15.705  -2.324  6.556   1.00 0.00 ? 120 GLU A HA   5  
ATOM 10542 H HB2  . GLU A 1 120 ? 16.242  -0.608  8.986   1.00 0.00 ? 120 GLU A HB2  5  
ATOM 10543 H HB3  . GLU A 1 120 ? 16.642  -2.314  8.854   1.00 0.00 ? 120 GLU A HB3  5  
ATOM 10544 H HG2  . GLU A 1 120 ? 17.716  -0.219  6.988   1.00 0.00 ? 120 GLU A HG2  5  
ATOM 10545 H HG3  . GLU A 1 120 ? 18.535  -0.718  8.467   1.00 0.00 ? 120 GLU A HG3  5  
ATOM 10546 N N    . ASN A 1 121 ? 13.634  -1.241  8.900   1.00 0.00 ? 121 ASN A N    5  
ATOM 10547 C CA   . ASN A 1 121 ? 12.424  -1.578  9.642   1.00 0.00 ? 121 ASN A CA   5  
ATOM 10548 C C    . ASN A 1 121 ? 11.426  -2.310  8.749   1.00 0.00 ? 121 ASN A C    5  
ATOM 10549 O O    . ASN A 1 121 ? 11.011  -3.429  9.051   1.00 0.00 ? 121 ASN A O    5  
ATOM 10550 C CB   . ASN A 1 121 ? 11.782  -0.313  10.214  1.00 0.00 ? 121 ASN A CB   5  
ATOM 10551 C CG   . ASN A 1 121 ? 12.312  0.031   11.593  1.00 0.00 ? 121 ASN A CG   5  
ATOM 10552 O OD1  . ASN A 1 121 ? 13.493  0.336   11.759  1.00 0.00 ? 121 ASN A OD1  5  
ATOM 10553 N ND2  . ASN A 1 121 ? 11.437  -0.017  12.591  1.00 0.00 ? 121 ASN A ND2  5  
ATOM 10554 H H    . ASN A 1 121 ? 14.092  -0.396  9.092   1.00 0.00 ? 121 ASN A H    5  
ATOM 10555 H HA   . ASN A 1 121 ? 12.705  -2.229  10.456  1.00 0.00 ? 121 ASN A HA   5  
ATOM 10556 H HB2  . ASN A 1 121 ? 11.987  0.517   9.554   1.00 0.00 ? 121 ASN A HB2  5  
ATOM 10557 H HB3  . ASN A 1 121 ? 10.715  -0.457  10.283  1.00 0.00 ? 121 ASN A HB3  5  
ATOM 10558 H HD21 . ASN A 1 121 ? 10.512  -0.268  12.385  1.00 0.00 ? 121 ASN A HD21 5  
ATOM 10559 H HD22 . ASN A 1 121 ? 11.752  0.201   13.493  1.00 0.00 ? 121 ASN A HD22 5  
ATOM 10560 N N    . VAL A 1 122 ? 11.045  -1.670  7.648   1.00 0.00 ? 122 VAL A N    5  
ATOM 10561 C CA   . VAL A 1 122 ? 10.097  -2.259  6.711   1.00 0.00 ? 122 VAL A CA   5  
ATOM 10562 C C    . VAL A 1 122 ? 10.592  -3.610  6.205   1.00 0.00 ? 122 VAL A C    5  
ATOM 10563 O O    . VAL A 1 122 ? 9.898   -4.620  6.323   1.00 0.00 ? 122 VAL A O    5  
ATOM 10564 C CB   . VAL A 1 122 ? 9.848   -1.332  5.506   1.00 0.00 ? 122 VAL A CB   5  
ATOM 10565 C CG1  . VAL A 1 122 ? 8.901   -1.988  4.514   1.00 0.00 ? 122 VAL A CG1  5  
ATOM 10566 C CG2  . VAL A 1 122 ? 9.302   0.009   5.971   1.00 0.00 ? 122 VAL A CG2  5  
ATOM 10567 H H    . VAL A 1 122 ? 11.411  -0.780  7.462   1.00 0.00 ? 122 VAL A H    5  
ATOM 10568 H HA   . VAL A 1 122 ? 9.160   -2.401  7.229   1.00 0.00 ? 122 VAL A HA   5  
ATOM 10569 H HB   . VAL A 1 122 ? 10.792  -1.160  5.009   1.00 0.00 ? 122 VAL A HB   5  
ATOM 10570 H HG11 . VAL A 1 122 ? 9.229   -1.773  3.507   1.00 0.00 ? 122 VAL A HG11 5  
ATOM 10571 H HG12 . VAL A 1 122 ? 8.897   -3.057  4.672   1.00 0.00 ? 122 VAL A HG12 5  
ATOM 10572 H HG13 . VAL A 1 122 ? 7.904   -1.599  4.657   1.00 0.00 ? 122 VAL A HG13 5  
ATOM 10573 H HG21 . VAL A 1 122 ? 8.393   -0.148  6.532   1.00 0.00 ? 122 VAL A HG21 5  
ATOM 10574 H HG22 . VAL A 1 122 ? 10.032  0.498   6.600   1.00 0.00 ? 122 VAL A HG22 5  
ATOM 10575 H HG23 . VAL A 1 122 ? 9.093   0.630   5.113   1.00 0.00 ? 122 VAL A HG23 5  
ATOM 10576 N N    . ILE A 1 123 ? 11.795  -3.619  5.641   1.00 0.00 ? 123 ILE A N    5  
ATOM 10577 C CA   . ILE A 1 123 ? 12.384  -4.846  5.119   1.00 0.00 ? 123 ILE A CA   5  
ATOM 10578 C C    . ILE A 1 123 ? 12.385  -5.948  6.173   1.00 0.00 ? 123 ILE A C    5  
ATOM 10579 O O    . ILE A 1 123 ? 12.374  -7.135  5.846   1.00 0.00 ? 123 ILE A O    5  
ATOM 10580 C CB   . ILE A 1 123 ? 13.827  -4.616  4.632   1.00 0.00 ? 123 ILE A CB   5  
ATOM 10581 C CG1  . ILE A 1 123 ? 13.853  -3.555  3.530   1.00 0.00 ? 123 ILE A CG1  5  
ATOM 10582 C CG2  . ILE A 1 123 ? 14.433  -5.920  4.135   1.00 0.00 ? 123 ILE A CG2  5  
ATOM 10583 C CD1  . ILE A 1 123 ? 15.222  -2.952  3.305   1.00 0.00 ? 123 ILE A CD1  5  
ATOM 10584 H H    . ILE A 1 123 ? 12.299  -2.782  5.576   1.00 0.00 ? 123 ILE A H    5  
ATOM 10585 H HA   . ILE A 1 123 ? 11.788  -5.169  4.277   1.00 0.00 ? 123 ILE A HA   5  
ATOM 10586 H HB   . ILE A 1 123 ? 14.414  -4.270  5.469   1.00 0.00 ? 123 ILE A HB   5  
ATOM 10587 H HG12 . ILE A 1 123 ? 13.531  -4.001  2.602   1.00 0.00 ? 123 ILE A HG12 5  
ATOM 10588 H HG13 . ILE A 1 123 ? 13.176  -2.755  3.794   1.00 0.00 ? 123 ILE A HG13 5  
ATOM 10589 H HG21 . ILE A 1 123 ? 15.392  -5.720  3.680   1.00 0.00 ? 123 ILE A HG21 5  
ATOM 10590 H HG22 . ILE A 1 123 ? 14.563  -6.596  4.966   1.00 0.00 ? 123 ILE A HG22 5  
ATOM 10591 H HG23 . ILE A 1 123 ? 13.774  -6.368  3.406   1.00 0.00 ? 123 ILE A HG23 5  
ATOM 10592 H HD11 . ILE A 1 123 ? 15.414  -2.881  2.244   1.00 0.00 ? 123 ILE A HD11 5  
ATOM 10593 H HD12 . ILE A 1 123 ? 15.259  -1.967  3.745   1.00 0.00 ? 123 ILE A HD12 5  
ATOM 10594 H HD13 . ILE A 1 123 ? 15.972  -3.579  3.764   1.00 0.00 ? 123 ILE A HD13 5  
ATOM 10595 N N    . ARG A 1 124 ? 12.396  -5.547  7.440   1.00 0.00 ? 124 ARG A N    5  
ATOM 10596 C CA   . ARG A 1 124 ? 12.398  -6.500  8.544   1.00 0.00 ? 124 ARG A CA   5  
ATOM 10597 C C    . ARG A 1 124 ? 10.980  -6.963  8.864   1.00 0.00 ? 124 ARG A C    5  
ATOM 10598 O O    . ARG A 1 124 ? 10.653  -8.140  8.717   1.00 0.00 ? 124 ARG A O    5  
ATOM 10599 C CB   . ARG A 1 124 ? 13.034  -5.874  9.786   1.00 0.00 ? 124 ARG A CB   5  
ATOM 10600 C CG   . ARG A 1 124 ? 13.085  -6.810  10.982  1.00 0.00 ? 124 ARG A CG   5  
ATOM 10601 C CD   . ARG A 1 124 ? 13.830  -6.183  12.149  1.00 0.00 ? 124 ARG A CD   5  
ATOM 10602 N NE   . ARG A 1 124 ? 13.053  -5.124  12.789  1.00 0.00 ? 124 ARG A NE   5  
ATOM 10603 C CZ   . ARG A 1 124 ? 13.550  -4.298  13.703  1.00 0.00 ? 124 ARG A CZ   5  
ATOM 10604 N NH1  . ARG A 1 124 ? 14.816  -4.407  14.082  1.00 0.00 ? 124 ARG A NH1  5  
ATOM 10605 N NH2  . ARG A 1 124 ? 12.780  -3.360  14.240  1.00 0.00 ? 124 ARG A NH2  5  
ATOM 10606 H H    . ARG A 1 124 ? 12.405  -4.587  7.638   1.00 0.00 ? 124 ARG A H    5  
ATOM 10607 H HA   . ARG A 1 124 ? 12.983  -7.355  8.242   1.00 0.00 ? 124 ARG A HA   5  
ATOM 10608 H HB2  . ARG A 1 124 ? 14.045  -5.576  9.547   1.00 0.00 ? 124 ARG A HB2  5  
ATOM 10609 H HB3  . ARG A 1 124 ? 12.466  -4.999  10.064  1.00 0.00 ? 124 ARG A HB3  5  
ATOM 10610 H HG2  . ARG A 1 124 ? 12.076  -7.036  11.293  1.00 0.00 ? 124 ARG A HG2  5  
ATOM 10611 H HG3  . ARG A 1 124 ? 13.587  -7.721  10.693  1.00 0.00 ? 124 ARG A HG3  5  
ATOM 10612 H HD2  . ARG A 1 124 ? 14.043  -6.951  12.878  1.00 0.00 ? 124 ARG A HD2  5  
ATOM 10613 H HD3  . ARG A 1 124 ? 14.757  -5.766  11.785  1.00 0.00 ? 124 ARG A HD3  5  
ATOM 10614 H HE   . ARG A 1 124 ? 12.115  -5.026  12.524  1.00 0.00 ? 124 ARG A HE   5  
ATOM 10615 H HH11 . ARG A 1 124 ? 15.399  -5.112  13.678  1.00 0.00 ? 124 ARG A HH11 5  
ATOM 10616 H HH12 . ARG A 1 124 ? 15.188  -3.782  14.769  1.00 0.00 ? 124 ARG A HH12 5  
ATOM 10617 H HH21 . ARG A 1 124 ? 11.825  -3.275  13.957  1.00 0.00 ? 124 ARG A HH21 5  
ATOM 10618 H HH22 . ARG A 1 124 ? 13.155  -2.739  14.927  1.00 0.00 ? 124 ARG A HH22 5  
ATOM 10619 N N    . GLU A 1 125 ? 10.143  -6.028  9.303   1.00 0.00 ? 125 GLU A N    5  
ATOM 10620 C CA   . GLU A 1 125 ? 8.760   -6.341  9.646   1.00 0.00 ? 125 GLU A CA   5  
ATOM 10621 C C    . GLU A 1 125 ? 8.057   -7.039  8.485   1.00 0.00 ? 125 GLU A C    5  
ATOM 10622 O O    . GLU A 1 125 ? 7.530   -8.142  8.637   1.00 0.00 ? 125 GLU A O    5  
ATOM 10623 C CB   . GLU A 1 125 ? 8.003   -5.066  10.022  1.00 0.00 ? 125 GLU A CB   5  
ATOM 10624 C CG   . GLU A 1 125 ? 8.576   -4.354  11.236  1.00 0.00 ? 125 GLU A CG   5  
ATOM 10625 C CD   . GLU A 1 125 ? 7.975   -4.845  12.538  1.00 0.00 ? 125 GLU A CD   5  
ATOM 10626 O OE1  . GLU A 1 125 ? 8.079   -6.057  12.821  1.00 0.00 ? 125 GLU A OE1  5  
ATOM 10627 O OE2  . GLU A 1 125 ? 7.401   -4.017  13.276  1.00 0.00 ? 125 GLU A OE2  5  
ATOM 10628 H H    . GLU A 1 125 ? 10.462  -5.107  9.400   1.00 0.00 ? 125 GLU A H    5  
ATOM 10629 H HA   . GLU A 1 125 ? 8.772   -7.006  10.496  1.00 0.00 ? 125 GLU A HA   5  
ATOM 10630 H HB2  . GLU A 1 125 ? 8.030   -4.385  9.184   1.00 0.00 ? 125 GLU A HB2  5  
ATOM 10631 H HB3  . GLU A 1 125 ? 6.975   -5.321  10.233  1.00 0.00 ? 125 GLU A HB3  5  
ATOM 10632 H HG2  . GLU A 1 125 ? 9.643   -4.520  11.265  1.00 0.00 ? 125 GLU A HG2  5  
ATOM 10633 H HG3  . GLU A 1 125 ? 8.380   -3.296  11.142  1.00 0.00 ? 125 GLU A HG3  5  
ATOM 10634 N N    . PHE A 1 126 ? 8.052   -6.389  7.327   1.00 0.00 ? 126 PHE A N    5  
ATOM 10635 C CA   . PHE A 1 126 ? 7.413   -6.945  6.140   1.00 0.00 ? 126 PHE A CA   5  
ATOM 10636 C C    . PHE A 1 126 ? 8.212   -8.125  5.594   1.00 0.00 ? 126 PHE A C    5  
ATOM 10637 O O    . PHE A 1 126 ? 7.748   -8.848  4.714   1.00 0.00 ? 126 PHE A O    5  
ATOM 10638 C CB   . PHE A 1 126 ? 7.268   -5.870  5.061   1.00 0.00 ? 126 PHE A CB   5  
ATOM 10639 C CG   . PHE A 1 126 ? 6.142   -4.909  5.320   1.00 0.00 ? 126 PHE A CG   5  
ATOM 10640 C CD1  . PHE A 1 126 ? 4.833   -5.264  5.039   1.00 0.00 ? 126 PHE A CD1  5  
ATOM 10641 C CD2  . PHE A 1 126 ? 6.394   -3.652  5.844   1.00 0.00 ? 126 PHE A CD2  5  
ATOM 10642 C CE1  . PHE A 1 126 ? 3.796   -4.381  5.275   1.00 0.00 ? 126 PHE A CE1  5  
ATOM 10643 C CE2  . PHE A 1 126 ? 5.361   -2.765  6.083   1.00 0.00 ? 126 PHE A CE2  5  
ATOM 10644 C CZ   . PHE A 1 126 ? 4.060   -3.131  5.799   1.00 0.00 ? 126 PHE A CZ   5  
ATOM 10645 H H    . PHE A 1 126 ? 8.489   -5.513  7.268   1.00 0.00 ? 126 PHE A H    5  
ATOM 10646 H HA   . PHE A 1 126 ? 6.431   -7.292  6.425   1.00 0.00 ? 126 PHE A HA   5  
ATOM 10647 H HB2  . PHE A 1 126 ? 8.183   -5.301  5.005   1.00 0.00 ? 126 PHE A HB2  5  
ATOM 10648 H HB3  . PHE A 1 126 ? 7.086   -6.348  4.110   1.00 0.00 ? 126 PHE A HB3  5  
ATOM 10649 H HD1  . PHE A 1 126 ? 4.624   -6.242  4.631   1.00 0.00 ? 126 PHE A HD1  5  
ATOM 10650 H HD2  . PHE A 1 126 ? 7.413   -3.365  6.067   1.00 0.00 ? 126 PHE A HD2  5  
ATOM 10651 H HE1  . PHE A 1 126 ? 2.779   -4.670  5.053   1.00 0.00 ? 126 PHE A HE1  5  
ATOM 10652 H HE2  . PHE A 1 126 ? 5.572   -1.788  6.493   1.00 0.00 ? 126 PHE A HE2  5  
ATOM 10653 H HZ   . PHE A 1 126 ? 3.252   -2.439  5.984   1.00 0.00 ? 126 PHE A HZ   5  
ATOM 10654 N N    . ASN A 1 127 ? 9.416   -8.312  6.124   1.00 0.00 ? 127 ASN A N    5  
ATOM 10655 C CA   . ASN A 1 127 ? 10.282  -9.403  5.690   1.00 0.00 ? 127 ASN A CA   5  
ATOM 10656 C C    . ASN A 1 127 ? 10.290  -9.517  4.168   1.00 0.00 ? 127 ASN A C    5  
ATOM 10657 O O    . ASN A 1 127 ? 10.047  -10.590 3.614   1.00 0.00 ? 127 ASN A O    5  
ATOM 10658 C CB   . ASN A 1 127 ? 9.822   -10.724 6.310   1.00 0.00 ? 127 ASN A CB   5  
ATOM 10659 C CG   . ASN A 1 127 ? 10.489  -10.999 7.643   1.00 0.00 ? 127 ASN A CG   5  
ATOM 10660 O OD1  . ASN A 1 127 ? 11.554  -10.460 7.941   1.00 0.00 ? 127 ASN A OD1  5  
ATOM 10661 N ND2  . ASN A 1 127 ? 9.862   -11.844 8.455   1.00 0.00 ? 127 ASN A ND2  5  
ATOM 10662 H H    . ASN A 1 127 ? 9.731   -7.701  6.823   1.00 0.00 ? 127 ASN A H    5  
ATOM 10663 H HA   . ASN A 1 127 ? 11.284  -9.186  6.028   1.00 0.00 ? 127 ASN A HA   5  
ATOM 10664 H HB2  . ASN A 1 127 ? 8.753   -10.689 6.464   1.00 0.00 ? 127 ASN A HB2  5  
ATOM 10665 H HB3  . ASN A 1 127 ? 10.058  -11.533 5.635   1.00 0.00 ? 127 ASN A HB3  5  
ATOM 10666 H HD21 . ASN A 1 127 ? 9.017   -12.236 8.151   1.00 0.00 ? 127 ASN A HD21 5  
ATOM 10667 H HD22 . ASN A 1 127 ? 10.270  -12.039 9.323   1.00 0.00 ? 127 ASN A HD22 5  
ATOM 10668 N N    . LEU A 1 128 ? 10.573  -8.406  3.498   1.00 0.00 ? 128 LEU A N    5  
ATOM 10669 C CA   . LEU A 1 128 ? 10.614  -8.381  2.040   1.00 0.00 ? 128 LEU A CA   5  
ATOM 10670 C C    . LEU A 1 128 ? 11.605  -9.410  1.506   1.00 0.00 ? 128 LEU A C    5  
ATOM 10671 O O    . LEU A 1 128 ? 11.307  -10.141 0.563   1.00 0.00 ? 128 LEU A O    5  
ATOM 10672 C CB   . LEU A 1 128 ? 10.995  -6.985  1.545   1.00 0.00 ? 128 LEU A CB   5  
ATOM 10673 C CG   . LEU A 1 128 ? 10.086  -5.841  1.997   1.00 0.00 ? 128 LEU A CG   5  
ATOM 10674 C CD1  . LEU A 1 128 ? 10.696  -4.497  1.630   1.00 0.00 ? 128 LEU A CD1  5  
ATOM 10675 C CD2  . LEU A 1 128 ? 8.701   -5.986  1.382   1.00 0.00 ? 128 LEU A CD2  5  
ATOM 10676 H H    . LEU A 1 128 ? 10.758  -7.582  3.995   1.00 0.00 ? 128 LEU A H    5  
ATOM 10677 H HA   . LEU A 1 128 ? 9.627   -8.626  1.677   1.00 0.00 ? 128 LEU A HA   5  
ATOM 10678 H HB2  . LEU A 1 128 ? 11.993  -6.771  1.895   1.00 0.00 ? 128 LEU A HB2  5  
ATOM 10679 H HB3  . LEU A 1 128 ? 10.991  -7.005  0.465   1.00 0.00 ? 128 LEU A HB3  5  
ATOM 10680 H HG   . LEU A 1 128 ? 9.981   -5.876  3.072   1.00 0.00 ? 128 LEU A HG   5  
ATOM 10681 H HD11 . LEU A 1 128 ? 11.458  -4.641  0.879   1.00 0.00 ? 128 LEU A HD11 5  
ATOM 10682 H HD12 . LEU A 1 128 ? 11.137  -4.050  2.508   1.00 0.00 ? 128 LEU A HD12 5  
ATOM 10683 H HD13 . LEU A 1 128 ? 9.926   -3.846  1.242   1.00 0.00 ? 128 LEU A HD13 5  
ATOM 10684 H HD21 . LEU A 1 128 ? 8.510   -7.027  1.170   1.00 0.00 ? 128 LEU A HD21 5  
ATOM 10685 H HD22 . LEU A 1 128 ? 8.654   -5.417  0.465   1.00 0.00 ? 128 LEU A HD22 5  
ATOM 10686 H HD23 . LEU A 1 128 ? 7.960   -5.617  2.075   1.00 0.00 ? 128 LEU A HD23 5  
ATOM 10687 N N    . ASN A 1 129 ? 12.784  -9.462  2.118   1.00 0.00 ? 129 ASN A N    5  
ATOM 10688 C CA   . ASN A 1 129 ? 13.818  -10.404 1.704   1.00 0.00 ? 129 ASN A CA   5  
ATOM 10689 C C    . ASN A 1 129 ? 13.247  -11.812 1.563   1.00 0.00 ? 129 ASN A C    5  
ATOM 10690 O O    . ASN A 1 129 ? 13.704  -12.596 0.733   1.00 0.00 ? 129 ASN A O    5  
ATOM 10691 C CB   . ASN A 1 129 ? 14.967  -10.406 2.714   1.00 0.00 ? 129 ASN A CB   5  
ATOM 10692 C CG   . ASN A 1 129 ? 15.835  -9.167  2.605   1.00 0.00 ? 129 ASN A CG   5  
ATOM 10693 O OD1  . ASN A 1 129 ? 15.987  -8.596  1.525   1.00 0.00 ? 129 ASN A OD1  5  
ATOM 10694 N ND2  . ASN A 1 129 ? 16.410  -8.747  3.726   1.00 0.00 ? 129 ASN A ND2  5  
ATOM 10695 H H    . ASN A 1 129 ? 12.962  -8.853  2.864   1.00 0.00 ? 129 ASN A H    5  
ATOM 10696 H HA   . ASN A 1 129 ? 14.194  -10.082 0.745   1.00 0.00 ? 129 ASN A HA   5  
ATOM 10697 H HB2  . ASN A 1 129 ? 14.560  -10.450 3.714   1.00 0.00 ? 129 ASN A HB2  5  
ATOM 10698 H HB3  . ASN A 1 129 ? 15.587  -11.274 2.544   1.00 0.00 ? 129 ASN A HB3  5  
ATOM 10699 H HD21 . ASN A 1 129 ? 16.244  -9.253  4.549   1.00 0.00 ? 129 ASN A HD21 5  
ATOM 10700 H HD22 . ASN A 1 129 ? 16.976  -7.948  3.684   1.00 0.00 ? 129 ASN A HD22 5  
ATOM 10701 N N    . GLU A 1 130 ? 12.246  -12.123 2.380   1.00 0.00 ? 130 GLU A N    5  
ATOM 10702 C CA   . GLU A 1 130 ? 11.613  -13.437 2.346   1.00 0.00 ? 130 GLU A CA   5  
ATOM 10703 C C    . GLU A 1 130 ? 10.579  -13.513 1.227   1.00 0.00 ? 130 GLU A C    5  
ATOM 10704 O O    . GLU A 1 130 ? 10.669  -14.363 0.340   1.00 0.00 ? 130 GLU A O    5  
ATOM 10705 C CB   . GLU A 1 130 ? 10.950  -13.743 3.690   1.00 0.00 ? 130 GLU A CB   5  
ATOM 10706 C CG   . GLU A 1 130 ? 11.939  -14.054 4.801   1.00 0.00 ? 130 GLU A CG   5  
ATOM 10707 C CD   . GLU A 1 130 ? 13.081  -14.937 4.334   1.00 0.00 ? 130 GLU A CD   5  
ATOM 10708 O OE1  . GLU A 1 130 ? 12.804  -15.990 3.723   1.00 0.00 ? 130 GLU A OE1  5  
ATOM 10709 O OE2  . GLU A 1 130 ? 14.250  -14.574 4.580   1.00 0.00 ? 130 GLU A OE2  5  
ATOM 10710 H H    . GLU A 1 130 ? 11.926  -11.455 3.021   1.00 0.00 ? 130 GLU A H    5  
ATOM 10711 H HA   . GLU A 1 130 ? 12.383  -14.170 2.160   1.00 0.00 ? 130 GLU A HA   5  
ATOM 10712 H HB2  . GLU A 1 130 ? 10.360  -12.889 3.990   1.00 0.00 ? 130 GLU A HB2  5  
ATOM 10713 H HB3  . GLU A 1 130 ? 10.296  -14.594 3.570   1.00 0.00 ? 130 GLU A HB3  5  
ATOM 10714 H HG2  . GLU A 1 130 ? 12.349  -13.127 5.171   1.00 0.00 ? 130 GLU A HG2  5  
ATOM 10715 H HG3  . GLU A 1 130 ? 11.416  -14.560 5.600   1.00 0.00 ? 130 GLU A HG3  5  
ATOM 10716 N N    . LEU A 1 131 ? 9.597   -12.620 1.275   1.00 0.00 ? 131 LEU A N    5  
ATOM 10717 C CA   . LEU A 1 131 ? 8.544   -12.586 0.265   1.00 0.00 ? 131 LEU A CA   5  
ATOM 10718 C C    . LEU A 1 131 ? 9.129   -12.719 -1.137  1.00 0.00 ? 131 LEU A C    5  
ATOM 10719 O O    . LEU A 1 131 ? 8.855   -13.687 -1.846  1.00 0.00 ? 131 LEU A O    5  
ATOM 10720 C CB   . LEU A 1 131 ? 7.747   -11.285 0.376   1.00 0.00 ? 131 LEU A CB   5  
ATOM 10721 C CG   . LEU A 1 131 ? 7.010   -11.060 1.697   1.00 0.00 ? 131 LEU A CG   5  
ATOM 10722 C CD1  . LEU A 1 131 ? 6.450   -9.647  1.762   1.00 0.00 ? 131 LEU A CD1  5  
ATOM 10723 C CD2  . LEU A 1 131 ? 5.898   -12.084 1.869   1.00 0.00 ? 131 LEU A CD2  5  
ATOM 10724 H H    . LEU A 1 131 ? 9.578   -11.968 2.005   1.00 0.00 ? 131 LEU A H    5  
ATOM 10725 H HA   . LEU A 1 131 ? 7.883   -13.420 0.447   1.00 0.00 ? 131 LEU A HA   5  
ATOM 10726 H HB2  . LEU A 1 131 ? 8.432   -10.464 0.236   1.00 0.00 ? 131 LEU A HB2  5  
ATOM 10727 H HB3  . LEU A 1 131 ? 7.013   -11.279 -0.418  1.00 0.00 ? 131 LEU A HB3  5  
ATOM 10728 H HG   . LEU A 1 131 ? 7.707   -11.180 2.515   1.00 0.00 ? 131 LEU A HG   5  
ATOM 10729 H HD11 . LEU A 1 131 ? 6.775   -9.173  2.676   1.00 0.00 ? 131 LEU A HD11 5  
ATOM 10730 H HD12 . LEU A 1 131 ? 5.371   -9.686  1.740   1.00 0.00 ? 131 LEU A HD12 5  
ATOM 10731 H HD13 . LEU A 1 131 ? 6.807   -9.080  0.915   1.00 0.00 ? 131 LEU A HD13 5  
ATOM 10732 H HD21 . LEU A 1 131 ? 4.953   -11.637 1.600   1.00 0.00 ? 131 LEU A HD21 5  
ATOM 10733 H HD22 . LEU A 1 131 ? 5.863   -12.407 2.900   1.00 0.00 ? 131 LEU A HD22 5  
ATOM 10734 H HD23 . LEU A 1 131 ? 6.090   -12.934 1.231   1.00 0.00 ? 131 LEU A HD23 5  
ATOM 10735 N N    . SER A 1 132 ? 9.939   -11.741 -1.530  1.00 0.00 ? 132 SER A N    5  
ATOM 10736 C CA   . SER A 1 132 ? 10.563  -11.748 -2.848  1.00 0.00 ? 132 SER A CA   5  
ATOM 10737 C C    . SER A 1 132 ? 11.497  -12.944 -3.001  1.00 0.00 ? 132 SER A C    5  
ATOM 10738 O O    . SER A 1 132 ? 11.992  -13.489 -2.015  1.00 0.00 ? 132 SER A O    5  
ATOM 10739 C CB   . SER A 1 132 ? 11.338  -10.449 -3.076  1.00 0.00 ? 132 SER A CB   5  
ATOM 10740 O OG   . SER A 1 132 ? 12.473  -10.377 -2.230  1.00 0.00 ? 132 SER A OG   5  
ATOM 10741 H H    . SER A 1 132 ? 10.119  -10.995 -0.919  1.00 0.00 ? 132 SER A H    5  
ATOM 10742 H HA   . SER A 1 132 ? 9.777   -11.823 -3.586  1.00 0.00 ? 132 SER A HA   5  
ATOM 10743 H HB2  . SER A 1 132 ? 11.666  -10.403 -4.103  1.00 0.00 ? 132 SER A HB2  5  
ATOM 10744 H HB3  . SER A 1 132 ? 10.694  -9.607  -2.866  1.00 0.00 ? 132 SER A HB3  5  
ATOM 10745 H HG   . SER A 1 132 ? 12.211  -10.565 -1.326  1.00 0.00 ? 132 SER A HG   5  
ATOM 10746 N N    . GLY A 1 133 ? 11.733  -13.347 -4.246  1.00 0.00 ? 133 GLY A N    5  
ATOM 10747 C CA   . GLY A 1 133 ? 12.607  -14.476 -4.506  1.00 0.00 ? 133 GLY A CA   5  
ATOM 10748 C C    . GLY A 1 133 ? 13.681  -14.155 -5.527  1.00 0.00 ? 133 GLY A C    5  
ATOM 10749 O O    . GLY A 1 133 ? 13.717  -13.066 -6.100  1.00 0.00 ? 133 GLY A O    5  
ATOM 10750 H H    . GLY A 1 133 ? 11.311  -12.874 -4.993  1.00 0.00 ? 133 GLY A H    5  
ATOM 10751 H HA2  . GLY A 1 133 ? 13.080  -14.772 -3.582  1.00 0.00 ? 133 GLY A HA2  5  
ATOM 10752 H HA3  . GLY A 1 133 ? 12.012  -15.300 -4.874  1.00 0.00 ? 133 GLY A HA3  5  
ATOM 10753 N N    . PRO A 1 134 ? 14.583  -15.118 -5.766  1.00 0.00 ? 134 PRO A N    5  
ATOM 10754 C CA   . PRO A 1 134 ? 15.681  -14.955 -6.724  1.00 0.00 ? 134 PRO A CA   5  
ATOM 10755 C C    . PRO A 1 134 ? 15.190  -14.922 -8.167  1.00 0.00 ? 134 PRO A C    5  
ATOM 10756 O O    . PRO A 1 134 ? 14.862  -15.957 -8.745  1.00 0.00 ? 134 PRO A O    5  
ATOM 10757 C CB   . PRO A 1 134 ? 16.549  -16.193 -6.483  1.00 0.00 ? 134 PRO A CB   5  
ATOM 10758 C CG   . PRO A 1 134 ? 15.613  -17.209 -5.924  1.00 0.00 ? 134 PRO A CG   5  
ATOM 10759 C CD   . PRO A 1 134 ? 14.601  -16.441 -5.119  1.00 0.00 ? 134 PRO A CD   5  
ATOM 10760 H HA   . PRO A 1 134 ? 16.256  -14.064 -6.520  1.00 0.00 ? 134 PRO A HA   5  
ATOM 10761 H HB2  . PRO A 1 134 ? 16.978  -16.522 -7.419  1.00 0.00 ? 134 PRO A HB2  5  
ATOM 10762 H HB3  . PRO A 1 134 ? 17.336  -15.954 -5.784  1.00 0.00 ? 134 PRO A HB3  5  
ATOM 10763 H HG2  . PRO A 1 134 ? 15.128  -17.742 -6.727  1.00 0.00 ? 134 PRO A HG2  5  
ATOM 10764 H HG3  . PRO A 1 134 ? 16.154  -17.895 -5.289  1.00 0.00 ? 134 PRO A HG3  5  
ATOM 10765 H HD2  . PRO A 1 134 ? 13.632  -16.914 -5.181  1.00 0.00 ? 134 PRO A HD2  5  
ATOM 10766 H HD3  . PRO A 1 134 ? 14.919  -16.362 -4.090  1.00 0.00 ? 134 PRO A HD3  5  
ATOM 10767 N N    . SER A 1 135 ? 15.143  -13.725 -8.743  1.00 0.00 ? 135 SER A N    5  
ATOM 10768 C CA   . SER A 1 135 ? 14.688  -13.556 -10.119 1.00 0.00 ? 135 SER A CA   5  
ATOM 10769 C C    . SER A 1 135 ? 15.630  -14.259 -11.092 1.00 0.00 ? 135 SER A C    5  
ATOM 10770 O O    . SER A 1 135 ? 16.844  -14.058 -11.053 1.00 0.00 ? 135 SER A O    5  
ATOM 10771 C CB   . SER A 1 135 ? 14.592  -12.070 -10.468 1.00 0.00 ? 135 SER A CB   5  
ATOM 10772 O OG   . SER A 1 135 ? 13.623  -11.844 -11.477 1.00 0.00 ? 135 SER A OG   5  
ATOM 10773 H H    . SER A 1 135 ? 15.417  -12.936 -8.230  1.00 0.00 ? 135 SER A H    5  
ATOM 10774 H HA   . SER A 1 135 ? 13.708  -14.001 -10.201 1.00 0.00 ? 135 SER A HA   5  
ATOM 10775 H HB2  . SER A 1 135 ? 14.313  -11.513 -9.587  1.00 0.00 ? 135 SER A HB2  5  
ATOM 10776 H HB3  . SER A 1 135 ? 15.552  -11.724 -10.824 1.00 0.00 ? 135 SER A HB3  5  
ATOM 10777 H HG   . SER A 1 135 ? 12.797  -12.265 -11.227 1.00 0.00 ? 135 SER A HG   5  
ATOM 10778 N N    . SER A 1 136 ? 15.061  -15.085 -11.964 1.00 0.00 ? 136 SER A N    5  
ATOM 10779 C CA   . SER A 1 136 ? 15.849  -15.822 -12.946 1.00 0.00 ? 136 SER A CA   5  
ATOM 10780 C C    . SER A 1 136 ? 16.935  -14.935 -13.546 1.00 0.00 ? 136 SER A C    5  
ATOM 10781 O O    . SER A 1 136 ? 16.644  -13.942 -14.213 1.00 0.00 ? 136 SER A O    5  
ATOM 10782 C CB   . SER A 1 136 ? 14.944  -16.362 -14.055 1.00 0.00 ? 136 SER A CB   5  
ATOM 10783 O OG   . SER A 1 136 ? 15.709  -16.911 -15.114 1.00 0.00 ? 136 SER A OG   5  
ATOM 10784 H H    . SER A 1 136 ? 14.088  -15.203 -11.945 1.00 0.00 ? 136 SER A H    5  
ATOM 10785 H HA   . SER A 1 136 ? 16.318  -16.652 -12.439 1.00 0.00 ? 136 SER A HA   5  
ATOM 10786 H HB2  . SER A 1 136 ? 14.305  -17.132 -13.652 1.00 0.00 ? 136 SER A HB2  5  
ATOM 10787 H HB3  . SER A 1 136 ? 14.338  -15.557 -14.445 1.00 0.00 ? 136 SER A HB3  5  
ATOM 10788 H HG   . SER A 1 136 ? 15.293  -17.719 -15.424 1.00 0.00 ? 136 SER A HG   5  
ATOM 10789 N N    . GLY A 1 137 ? 18.190  -15.301 -13.304 1.00 0.00 ? 137 GLY A N    5  
ATOM 10790 C CA   . GLY A 1 137 ? 19.302  -14.529 -13.827 1.00 0.00 ? 137 GLY A CA   5  
ATOM 10791 C C    . GLY A 1 137 ? 19.516  -13.233 -13.070 1.00 0.00 ? 137 GLY A C    5  
ATOM 10792 O O    . GLY A 1 137 ? 20.501  -13.084 -12.347 1.00 0.00 ? 137 GLY A O    5  
ATOM 10793 H H    . GLY A 1 137 ? 18.363  -16.102 -12.766 1.00 0.00 ? 137 GLY A H    5  
ATOM 10794 H HA2  . GLY A 1 137 ? 20.201  -15.124 -13.763 1.00 0.00 ? 137 GLY A HA2  5  
ATOM 10795 H HA3  . GLY A 1 137 ? 19.109  -14.298 -14.864 1.00 0.00 ? 137 GLY A HA3  5  
ATOM 10796 N N    . GLY A 1 1   ? 11.451  -4.140  -15.041 1.00 0.00 ? 1   GLY A N    6  
ATOM 10797 C CA   . GLY A 1 1   ? 10.267  -4.279  -15.868 1.00 0.00 ? 1   GLY A CA   6  
ATOM 10798 C C    . GLY A 1 1   ? 10.446  -3.672  -17.245 1.00 0.00 ? 1   GLY A C    6  
ATOM 10799 O O    . GLY A 1 1   ? 11.185  -4.204  -18.074 1.00 0.00 ? 1   GLY A O    6  
ATOM 10800 H H1   . GLY A 1 1   ? 12.020  -3.347  -15.134 1.00 0.00 ? 1   GLY A H1   6  
ATOM 10801 H HA2  . GLY A 1 1   ? 10.038  -5.329  -15.975 1.00 0.00 ? 1   GLY A HA2  6  
ATOM 10802 H HA3  . GLY A 1 1   ? 9.439   -3.789  -15.376 1.00 0.00 ? 1   GLY A HA3  6  
ATOM 10803 N N    . SER A 1 2   ? 9.767   -2.557  -17.491 1.00 0.00 ? 2   SER A N    6  
ATOM 10804 C CA   . SER A 1 2   ? 9.850   -1.880  -18.780 1.00 0.00 ? 2   SER A CA   6  
ATOM 10805 C C    . SER A 1 2   ? 11.207  -1.204  -18.952 1.00 0.00 ? 2   SER A C    6  
ATOM 10806 O O    . SER A 1 2   ? 11.521  -0.234  -18.263 1.00 0.00 ? 2   SER A O    6  
ATOM 10807 C CB   . SER A 1 2   ? 8.731   -0.844  -18.909 1.00 0.00 ? 2   SER A CB   6  
ATOM 10808 O OG   . SER A 1 2   ? 8.874   0.183   -17.944 1.00 0.00 ? 2   SER A OG   6  
ATOM 10809 H H    . SER A 1 2   ? 9.194   -2.181  -16.790 1.00 0.00 ? 2   SER A H    6  
ATOM 10810 H HA   . SER A 1 2   ? 9.731   -2.624  -19.554 1.00 0.00 ? 2   SER A HA   6  
ATOM 10811 H HB2  . SER A 1 2   ? 8.765   -0.403  -19.894 1.00 0.00 ? 2   SER A HB2  6  
ATOM 10812 H HB3  . SER A 1 2   ? 7.777   -1.329  -18.764 1.00 0.00 ? 2   SER A HB3  6  
ATOM 10813 H HG   . SER A 1 2   ? 8.356   0.947   -18.209 1.00 0.00 ? 2   SER A HG   6  
ATOM 10814 N N    . SER A 1 3   ? 12.007  -1.725  -19.877 1.00 0.00 ? 3   SER A N    6  
ATOM 10815 C CA   . SER A 1 3   ? 13.332  -1.175  -20.138 1.00 0.00 ? 3   SER A CA   6  
ATOM 10816 C C    . SER A 1 3   ? 13.319  0.347   -20.037 1.00 0.00 ? 3   SER A C    6  
ATOM 10817 O O    . SER A 1 3   ? 12.282  0.984   -20.220 1.00 0.00 ? 3   SER A O    6  
ATOM 10818 C CB   . SER A 1 3   ? 13.820  -1.601  -21.524 1.00 0.00 ? 3   SER A CB   6  
ATOM 10819 O OG   . SER A 1 3   ? 14.362  -2.910  -21.494 1.00 0.00 ? 3   SER A OG   6  
ATOM 10820 H H    . SER A 1 3   ? 11.700  -2.499  -20.394 1.00 0.00 ? 3   SER A H    6  
ATOM 10821 H HA   . SER A 1 3   ? 14.007  -1.568  -19.392 1.00 0.00 ? 3   SER A HA   6  
ATOM 10822 H HB2  . SER A 1 3   ? 12.992  -1.583  -22.216 1.00 0.00 ? 3   SER A HB2  6  
ATOM 10823 H HB3  . SER A 1 3   ? 14.585  -0.916  -21.860 1.00 0.00 ? 3   SER A HB3  6  
ATOM 10824 H HG   . SER A 1 3   ? 15.022  -3.000  -22.185 1.00 0.00 ? 3   SER A HG   6  
ATOM 10825 N N    . GLY A 1 4   ? 14.480  0.925   -19.743 1.00 0.00 ? 4   GLY A N    6  
ATOM 10826 C CA   . GLY A 1 4   ? 14.581  2.368   -19.622 1.00 0.00 ? 4   GLY A CA   6  
ATOM 10827 C C    . GLY A 1 4   ? 13.473  2.957   -18.772 1.00 0.00 ? 4   GLY A C    6  
ATOM 10828 O O    . GLY A 1 4   ? 12.620  3.690   -19.273 1.00 0.00 ? 4   GLY A O    6  
ATOM 10829 H H    . GLY A 1 4   ? 15.274  0.367   -19.607 1.00 0.00 ? 4   GLY A H    6  
ATOM 10830 H HA2  . GLY A 1 4   ? 15.533  2.615   -19.177 1.00 0.00 ? 4   GLY A HA2  6  
ATOM 10831 H HA3  . GLY A 1 4   ? 14.532  2.804   -20.609 1.00 0.00 ? 4   GLY A HA3  6  
ATOM 10832 N N    . SER A 1 5   ? 13.484  2.635   -17.482 1.00 0.00 ? 5   SER A N    6  
ATOM 10833 C CA   . SER A 1 5   ? 12.469  3.134   -16.562 1.00 0.00 ? 5   SER A CA   6  
ATOM 10834 C C    . SER A 1 5   ? 12.951  3.037   -15.117 1.00 0.00 ? 5   SER A C    6  
ATOM 10835 O O    . SER A 1 5   ? 13.521  2.026   -14.708 1.00 0.00 ? 5   SER A O    6  
ATOM 10836 C CB   . SER A 1 5   ? 11.167  2.348   -16.730 1.00 0.00 ? 5   SER A CB   6  
ATOM 10837 O OG   . SER A 1 5   ? 10.183  2.789   -15.811 1.00 0.00 ? 5   SER A OG   6  
ATOM 10838 H H    . SER A 1 5   ? 14.190  2.047   -17.143 1.00 0.00 ? 5   SER A H    6  
ATOM 10839 H HA   . SER A 1 5   ? 12.287  4.171   -16.799 1.00 0.00 ? 5   SER A HA   6  
ATOM 10840 H HB2  . SER A 1 5   ? 10.793  2.487   -17.733 1.00 0.00 ? 5   SER A HB2  6  
ATOM 10841 H HB3  . SER A 1 5   ? 11.358  1.299   -16.560 1.00 0.00 ? 5   SER A HB3  6  
ATOM 10842 H HG   . SER A 1 5   ? 10.152  3.748   -15.810 1.00 0.00 ? 5   SER A HG   6  
ATOM 10843 N N    . SER A 1 6   ? 12.717  4.097   -14.350 1.00 0.00 ? 6   SER A N    6  
ATOM 10844 C CA   . SER A 1 6   ? 13.130  4.134   -12.952 1.00 0.00 ? 6   SER A CA   6  
ATOM 10845 C C    . SER A 1 6   ? 12.033  4.731   -12.077 1.00 0.00 ? 6   SER A C    6  
ATOM 10846 O O    . SER A 1 6   ? 11.091  5.345   -12.575 1.00 0.00 ? 6   SER A O    6  
ATOM 10847 C CB   . SER A 1 6   ? 14.418  4.946   -12.800 1.00 0.00 ? 6   SER A CB   6  
ATOM 10848 O OG   . SER A 1 6   ? 15.025  4.709   -11.542 1.00 0.00 ? 6   SER A OG   6  
ATOM 10849 H H    . SER A 1 6   ? 12.258  4.873   -14.734 1.00 0.00 ? 6   SER A H    6  
ATOM 10850 H HA   . SER A 1 6   ? 13.316  3.119   -12.634 1.00 0.00 ? 6   SER A HA   6  
ATOM 10851 H HB2  . SER A 1 6   ? 15.111  4.667   -13.579 1.00 0.00 ? 6   SER A HB2  6  
ATOM 10852 H HB3  . SER A 1 6   ? 14.188  5.999   -12.883 1.00 0.00 ? 6   SER A HB3  6  
ATOM 10853 H HG   . SER A 1 6   ? 15.962  4.539   -11.665 1.00 0.00 ? 6   SER A HG   6  
ATOM 10854 N N    . GLY A 1 7   ? 12.162  4.546   -10.766 1.00 0.00 ? 7   GLY A N    6  
ATOM 10855 C CA   . GLY A 1 7   ? 11.175  5.071   -9.841  1.00 0.00 ? 7   GLY A CA   6  
ATOM 10856 C C    . GLY A 1 7   ? 9.772   5.046   -10.415 1.00 0.00 ? 7   GLY A C    6  
ATOM 10857 O O    . GLY A 1 7   ? 9.173   6.094   -10.653 1.00 0.00 ? 7   GLY A O    6  
ATOM 10858 H H    . GLY A 1 7   ? 12.935  4.048   -10.425 1.00 0.00 ? 7   GLY A H    6  
ATOM 10859 H HA2  . GLY A 1 7   ? 11.195  4.481   -8.938  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 10860 H HA3  . GLY A 1 7   ? 11.434  6.092   -9.599  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 10861 N N    . TYR A 1 8   ? 9.248   3.846   -10.638 1.00 0.00 ? 8   TYR A N    6  
ATOM 10862 C CA   . TYR A 1 8   ? 7.908   3.688   -11.191 1.00 0.00 ? 8   TYR A CA   6  
ATOM 10863 C C    . TYR A 1 8   ? 7.053   2.792   -10.300 1.00 0.00 ? 8   TYR A C    6  
ATOM 10864 O O    . TYR A 1 8   ? 7.512   1.752   -9.825  1.00 0.00 ? 8   TYR A O    6  
ATOM 10865 C CB   . TYR A 1 8   ? 7.981   3.104   -12.602 1.00 0.00 ? 8   TYR A CB   6  
ATOM 10866 C CG   . TYR A 1 8   ? 8.103   1.597   -12.628 1.00 0.00 ? 8   TYR A CG   6  
ATOM 10867 C CD1  . TYR A 1 8   ? 9.213   0.961   -12.084 1.00 0.00 ? 8   TYR A CD1  6  
ATOM 10868 C CD2  . TYR A 1 8   ? 7.110   0.809   -13.196 1.00 0.00 ? 8   TYR A CD2  6  
ATOM 10869 C CE1  . TYR A 1 8   ? 9.329   -0.416  -12.106 1.00 0.00 ? 8   TYR A CE1  6  
ATOM 10870 C CE2  . TYR A 1 8   ? 7.217   -0.568  -13.221 1.00 0.00 ? 8   TYR A CE2  6  
ATOM 10871 C CZ   . TYR A 1 8   ? 8.328   -1.176  -12.675 1.00 0.00 ? 8   TYR A CZ   6  
ATOM 10872 O OH   . TYR A 1 8   ? 8.439   -2.547  -12.699 1.00 0.00 ? 8   TYR A OH   6  
ATOM 10873 H H    . TYR A 1 8   ? 9.775   3.047   -10.427 1.00 0.00 ? 8   TYR A H    6  
ATOM 10874 H HA   . TYR A 1 8   ? 7.452   4.667   -11.240 1.00 0.00 ? 8   TYR A HA   6  
ATOM 10875 H HB2  . TYR A 1 8   ? 7.087   3.373   -13.143 1.00 0.00 ? 8   TYR A HB2  6  
ATOM 10876 H HB3  . TYR A 1 8   ? 8.841   3.515   -13.110 1.00 0.00 ? 8   TYR A HB3  6  
ATOM 10877 H HD1  . TYR A 1 8   ? 9.995   1.559   -11.639 1.00 0.00 ? 8   TYR A HD1  6  
ATOM 10878 H HD2  . TYR A 1 8   ? 6.241   1.289   -13.623 1.00 0.00 ? 8   TYR A HD2  6  
ATOM 10879 H HE1  . TYR A 1 8   ? 10.199  -0.892  -11.678 1.00 0.00 ? 8   TYR A HE1  6  
ATOM 10880 H HE2  . TYR A 1 8   ? 6.433   -1.163  -13.666 1.00 0.00 ? 8   TYR A HE2  6  
ATOM 10881 H HH   . TYR A 1 8   ? 7.564   -2.937  -12.766 1.00 0.00 ? 8   TYR A HH   6  
ATOM 10882 N N    . ILE A 1 9   ? 5.808   3.201   -10.080 1.00 0.00 ? 9   ILE A N    6  
ATOM 10883 C CA   . ILE A 1 9   ? 4.888   2.435   -9.249  1.00 0.00 ? 9   ILE A CA   6  
ATOM 10884 C C    . ILE A 1 9   ? 3.502   2.367   -9.882  1.00 0.00 ? 9   ILE A C    6  
ATOM 10885 O O    . ILE A 1 9   ? 3.018   3.346   -10.450 1.00 0.00 ? 9   ILE A O    6  
ATOM 10886 C CB   . ILE A 1 9   ? 4.767   3.040   -7.838  1.00 0.00 ? 9   ILE A CB   6  
ATOM 10887 C CG1  . ILE A 1 9   ? 6.146   3.140   -7.182  1.00 0.00 ? 9   ILE A CG1  6  
ATOM 10888 C CG2  . ILE A 1 9   ? 3.827   2.204   -6.983  1.00 0.00 ? 9   ILE A CG2  6  
ATOM 10889 C CD1  . ILE A 1 9   ? 6.226   4.195   -6.102  1.00 0.00 ? 9   ILE A CD1  6  
ATOM 10890 H H    . ILE A 1 9   ? 5.501   4.038   -10.487 1.00 0.00 ? 9   ILE A H    6  
ATOM 10891 H HA   . ILE A 1 9   ? 5.280   1.432   -9.157  1.00 0.00 ? 9   ILE A HA   6  
ATOM 10892 H HB   . ILE A 1 9   ? 4.347   4.030   -7.930  1.00 0.00 ? 9   ILE A HB   6  
ATOM 10893 H HG12 . ILE A 1 9   ? 6.396   2.190   -6.737  1.00 0.00 ? 9   ILE A HG12 6  
ATOM 10894 H HG13 . ILE A 1 9   ? 6.879   3.382   -7.938  1.00 0.00 ? 9   ILE A HG13 6  
ATOM 10895 H HG21 . ILE A 1 9   ? 3.361   1.446   -7.595  1.00 0.00 ? 9   ILE A HG21 6  
ATOM 10896 H HG22 . ILE A 1 9   ? 4.387   1.730   -6.190  1.00 0.00 ? 9   ILE A HG22 6  
ATOM 10897 H HG23 . ILE A 1 9   ? 3.067   2.840   -6.556  1.00 0.00 ? 9   ILE A HG23 6  
ATOM 10898 H HD11 . ILE A 1 9   ? 5.303   4.756   -6.076  1.00 0.00 ? 9   ILE A HD11 6  
ATOM 10899 H HD12 . ILE A 1 9   ? 6.386   3.720   -5.145  1.00 0.00 ? 9   ILE A HD12 6  
ATOM 10900 H HD13 . ILE A 1 9   ? 7.047   4.865   -6.312  1.00 0.00 ? 9   ILE A HD13 6  
ATOM 10901 N N    . LYS A 1 10  ? 2.867   1.205   -9.778  1.00 0.00 ? 10  LYS A N    6  
ATOM 10902 C CA   . LYS A 1 10  ? 1.535   1.008   -10.337 1.00 0.00 ? 10  LYS A CA   6  
ATOM 10903 C C    . LYS A 1 10  ? 0.462   1.519   -9.380  1.00 0.00 ? 10  LYS A C    6  
ATOM 10904 O O    . LYS A 1 10  ? 0.123   0.854   -8.400  1.00 0.00 ? 10  LYS A O    6  
ATOM 10905 C CB   . LYS A 1 10  ? 1.299   -0.474  -10.639 1.00 0.00 ? 10  LYS A CB   6  
ATOM 10906 C CG   . LYS A 1 10  ? 0.016   -0.742  -11.407 1.00 0.00 ? 10  LYS A CG   6  
ATOM 10907 C CD   . LYS A 1 10  ? 0.110   -2.022  -12.219 1.00 0.00 ? 10  LYS A CD   6  
ATOM 10908 C CE   . LYS A 1 10  ? -1.152  -2.259  -13.034 1.00 0.00 ? 10  LYS A CE   6  
ATOM 10909 N NZ   . LYS A 1 10  ? -2.158  -3.058  -12.281 1.00 0.00 ? 10  LYS A NZ   6  
ATOM 10910 H H    . LYS A 1 10  ? 3.305   0.461   -9.313  1.00 0.00 ? 10  LYS A H    6  
ATOM 10911 H HA   . LYS A 1 10  ? 1.475   1.568   -11.258 1.00 0.00 ? 10  LYS A HA   6  
ATOM 10912 H HB2  . LYS A 1 10  ? 2.128   -0.846  -11.223 1.00 0.00 ? 10  LYS A HB2  6  
ATOM 10913 H HB3  . LYS A 1 10  ? 1.255   -1.016  -9.705  1.00 0.00 ? 10  LYS A HB3  6  
ATOM 10914 H HG2  . LYS A 1 10  ? -0.800  -0.832  -10.706 1.00 0.00 ? 10  LYS A HG2  6  
ATOM 10915 H HG3  . LYS A 1 10  ? -0.171  0.086   -12.076 1.00 0.00 ? 10  LYS A HG3  6  
ATOM 10916 H HD2  . LYS A 1 10  ? 0.951   -1.951  -12.892 1.00 0.00 ? 10  LYS A HD2  6  
ATOM 10917 H HD3  . LYS A 1 10  ? 0.255   -2.856  -11.546 1.00 0.00 ? 10  LYS A HD3  6  
ATOM 10918 H HE2  . LYS A 1 10  ? -1.583  -1.303  -13.291 1.00 0.00 ? 10  LYS A HE2  6  
ATOM 10919 H HE3  . LYS A 1 10  ? -0.887  -2.788  -13.937 1.00 0.00 ? 10  LYS A HE3  6  
ATOM 10920 H HZ1  . LYS A 1 10  ? -2.854  -2.426  -11.835 1.00 0.00 ? 10  LYS A HZ1  6  
ATOM 10921 H HZ2  . LYS A 1 10  ? -1.688  -3.615  -11.539 1.00 0.00 ? 10  LYS A HZ2  6  
ATOM 10922 H HZ3  . LYS A 1 10  ? -2.655  -3.706  -12.924 1.00 0.00 ? 10  LYS A HZ3  6  
ATOM 10923 N N    . TYR A 1 11  ? -0.068  2.702   -9.670  1.00 0.00 ? 11  TYR A N    6  
ATOM 10924 C CA   . TYR A 1 11  ? -1.101  3.302   -8.834  1.00 0.00 ? 11  TYR A CA   6  
ATOM 10925 C C    . TYR A 1 11  ? -2.432  2.578   -9.010  1.00 0.00 ? 11  TYR A C    6  
ATOM 10926 O O    . TYR A 1 11  ? -2.826  2.240   -10.126 1.00 0.00 ? 11  TYR A O    6  
ATOM 10927 C CB   . TYR A 1 11  ? -1.265  4.784   -9.175  1.00 0.00 ? 11  TYR A CB   6  
ATOM 10928 C CG   . TYR A 1 11  ? -0.080  5.633   -8.773  1.00 0.00 ? 11  TYR A CG   6  
ATOM 10929 C CD1  . TYR A 1 11  ? -0.012  6.214   -7.513  1.00 0.00 ? 11  TYR A CD1  6  
ATOM 10930 C CD2  . TYR A 1 11  ? 0.972   5.852   -9.654  1.00 0.00 ? 11  TYR A CD2  6  
ATOM 10931 C CE1  . TYR A 1 11  ? 1.068   6.991   -7.142  1.00 0.00 ? 11  TYR A CE1  6  
ATOM 10932 C CE2  . TYR A 1 11  ? 2.057   6.627   -9.291  1.00 0.00 ? 11  TYR A CE2  6  
ATOM 10933 C CZ   . TYR A 1 11  ? 2.100   7.194   -8.034  1.00 0.00 ? 11  TYR A CZ   6  
ATOM 10934 O OH   . TYR A 1 11  ? 3.179   7.966   -7.668  1.00 0.00 ? 11  TYR A OH   6  
ATOM 10935 H H    . TYR A 1 11  ? 0.244   3.184   -10.464 1.00 0.00 ? 11  TYR A H    6  
ATOM 10936 H HA   . TYR A 1 11  ? -0.788  3.212   -7.804  1.00 0.00 ? 11  TYR A HA   6  
ATOM 10937 H HB2  . TYR A 1 11  ? -1.401  4.888   -10.241 1.00 0.00 ? 11  TYR A HB2  6  
ATOM 10938 H HB3  . TYR A 1 11  ? -2.137  5.169   -8.667  1.00 0.00 ? 11  TYR A HB3  6  
ATOM 10939 H HD1  . TYR A 1 11  ? -0.823  6.053   -6.817  1.00 0.00 ? 11  TYR A HD1  6  
ATOM 10940 H HD2  . TYR A 1 11  ? 0.936   5.407   -10.637 1.00 0.00 ? 11  TYR A HD2  6  
ATOM 10941 H HE1  . TYR A 1 11  ? 1.102   7.435   -6.159  1.00 0.00 ? 11  TYR A HE1  6  
ATOM 10942 H HE2  . TYR A 1 11  ? 2.866   6.786   -9.989  1.00 0.00 ? 11  TYR A HE2  6  
ATOM 10943 H HH   . TYR A 1 11  ? 3.366   8.604   -8.361  1.00 0.00 ? 11  TYR A HH   6  
ATOM 10944 N N    . PHE A 1 12  ? -3.121  2.343   -7.898  1.00 0.00 ? 12  PHE A N    6  
ATOM 10945 C CA   . PHE A 1 12  ? -4.409  1.659   -7.926  1.00 0.00 ? 12  PHE A CA   6  
ATOM 10946 C C    . PHE A 1 12  ? -5.543  2.618   -7.578  1.00 0.00 ? 12  PHE A C    6  
ATOM 10947 O O    . PHE A 1 12  ? -5.360  3.558   -6.805  1.00 0.00 ? 12  PHE A O    6  
ATOM 10948 C CB   . PHE A 1 12  ? -4.405  0.480   -6.951  1.00 0.00 ? 12  PHE A CB   6  
ATOM 10949 C CG   . PHE A 1 12  ? -3.446  -0.611  -7.333  1.00 0.00 ? 12  PHE A CG   6  
ATOM 10950 C CD1  . PHE A 1 12  ? -3.470  -1.159  -8.605  1.00 0.00 ? 12  PHE A CD1  6  
ATOM 10951 C CD2  . PHE A 1 12  ? -2.522  -1.090  -6.419  1.00 0.00 ? 12  PHE A CD2  6  
ATOM 10952 C CE1  . PHE A 1 12  ? -2.589  -2.163  -8.960  1.00 0.00 ? 12  PHE A CE1  6  
ATOM 10953 C CE2  . PHE A 1 12  ? -1.638  -2.093  -6.768  1.00 0.00 ? 12  PHE A CE2  6  
ATOM 10954 C CZ   . PHE A 1 12  ? -1.672  -2.631  -8.040  1.00 0.00 ? 12  PHE A CZ   6  
ATOM 10955 H H    . PHE A 1 12  ? -2.755  2.637   -7.037  1.00 0.00 ? 12  PHE A H    6  
ATOM 10956 H HA   . PHE A 1 12  ? -4.563  1.286   -8.927  1.00 0.00 ? 12  PHE A HA   6  
ATOM 10957 H HB2  . PHE A 1 12  ? -4.130  0.835   -5.970  1.00 0.00 ? 12  PHE A HB2  6  
ATOM 10958 H HB3  . PHE A 1 12  ? -5.396  0.053   -6.910  1.00 0.00 ? 12  PHE A HB3  6  
ATOM 10959 H HD1  . PHE A 1 12  ? -4.188  -0.793  -9.326  1.00 0.00 ? 12  PHE A HD1  6  
ATOM 10960 H HD2  . PHE A 1 12  ? -2.494  -0.671  -5.424  1.00 0.00 ? 12  PHE A HD2  6  
ATOM 10961 H HE1  . PHE A 1 12  ? -2.619  -2.581  -9.955  1.00 0.00 ? 12  PHE A HE1  6  
ATOM 10962 H HE2  . PHE A 1 12  ? -0.922  -2.458  -6.046  1.00 0.00 ? 12  PHE A HE2  6  
ATOM 10963 H HZ   . PHE A 1 12  ? -0.982  -3.415  -8.315  1.00 0.00 ? 12  PHE A HZ   6  
ATOM 10964 N N    . ASN A 1 13  ? -6.715  2.374   -8.155  1.00 0.00 ? 13  ASN A N    6  
ATOM 10965 C CA   . ASN A 1 13  ? -7.879  3.217   -7.907  1.00 0.00 ? 13  ASN A CA   6  
ATOM 10966 C C    . ASN A 1 13  ? -8.716  2.664   -6.758  1.00 0.00 ? 13  ASN A C    6  
ATOM 10967 O O    . ASN A 1 13  ? -8.371  1.644   -6.160  1.00 0.00 ? 13  ASN A O    6  
ATOM 10968 C CB   . ASN A 1 13  ? -8.735  3.325   -9.171  1.00 0.00 ? 13  ASN A CB   6  
ATOM 10969 C CG   . ASN A 1 13  ? -7.961  3.887   -10.348 1.00 0.00 ? 13  ASN A CG   6  
ATOM 10970 O OD1  . ASN A 1 13  ? -7.155  4.805   -10.193 1.00 0.00 ? 13  ASN A OD1  6  
ATOM 10971 N ND2  . ASN A 1 13  ? -8.203  3.337   -11.532 1.00 0.00 ? 13  ASN A ND2  6  
ATOM 10972 H H    . ASN A 1 13  ? -6.799  1.610   -8.763  1.00 0.00 ? 13  ASN A H    6  
ATOM 10973 H HA   . ASN A 1 13  ? -7.525  4.201   -7.638  1.00 0.00 ? 13  ASN A HA   6  
ATOM 10974 H HB2  . ASN A 1 13  ? -9.096  2.342   -9.439  1.00 0.00 ? 13  ASN A HB2  6  
ATOM 10975 H HB3  . ASN A 1 13  ? -9.577  3.972   -8.975  1.00 0.00 ? 13  ASN A HB3  6  
ATOM 10976 H HD21 . ASN A 1 13  ? -8.858  2.610   -11.580 1.00 0.00 ? 13  ASN A HD21 6  
ATOM 10977 H HD22 . ASN A 1 13  ? -7.715  3.681   -12.309 1.00 0.00 ? 13  ASN A HD22 6  
ATOM 10978 N N    . ASP A 1 14  ? -9.818  3.342   -6.456  1.00 0.00 ? 14  ASP A N    6  
ATOM 10979 C CA   . ASP A 1 14  ? -10.706 2.918   -5.380  1.00 0.00 ? 14  ASP A CA   6  
ATOM 10980 C C    . ASP A 1 14  ? -11.407 1.611   -5.737  1.00 0.00 ? 14  ASP A C    6  
ATOM 10981 O O    . ASP A 1 14  ? -11.898 0.898   -4.862  1.00 0.00 ? 14  ASP A O    6  
ATOM 10982 C CB   . ASP A 1 14  ? -11.743 4.004   -5.088  1.00 0.00 ? 14  ASP A CB   6  
ATOM 10983 C CG   . ASP A 1 14  ? -12.367 4.563   -6.351  1.00 0.00 ? 14  ASP A CG   6  
ATOM 10984 O OD1  . ASP A 1 14  ? -13.052 3.798   -7.063  1.00 0.00 ? 14  ASP A OD1  6  
ATOM 10985 O OD2  . ASP A 1 14  ? -12.172 5.765   -6.627  1.00 0.00 ? 14  ASP A OD2  6  
ATOM 10986 H H    . ASP A 1 14  ? -10.039 4.147   -6.970  1.00 0.00 ? 14  ASP A H    6  
ATOM 10987 H HA   . ASP A 1 14  ? -10.105 2.760   -4.497  1.00 0.00 ? 14  ASP A HA   6  
ATOM 10988 H HB2  . ASP A 1 14  ? -12.528 3.587   -4.474  1.00 0.00 ? 14  ASP A HB2  6  
ATOM 10989 H HB3  . ASP A 1 14  ? -11.266 4.813   -4.554  1.00 0.00 ? 14  ASP A HB3  6  
ATOM 10990 N N    . LYS A 1 15  ? -11.451 1.303   -7.029  1.00 0.00 ? 15  LYS A N    6  
ATOM 10991 C CA   . LYS A 1 15  ? -12.091 0.082   -7.504  1.00 0.00 ? 15  LYS A CA   6  
ATOM 10992 C C    . LYS A 1 15  ? -11.051 -0.974  -7.864  1.00 0.00 ? 15  LYS A C    6  
ATOM 10993 O O    . LYS A 1 15  ? -10.960 -2.017  -7.217  1.00 0.00 ? 15  LYS A O    6  
ATOM 10994 C CB   . LYS A 1 15  ? -12.971 0.382   -8.720  1.00 0.00 ? 15  LYS A CB   6  
ATOM 10995 C CG   . LYS A 1 15  ? -13.734 -0.826  -9.232  1.00 0.00 ? 15  LYS A CG   6  
ATOM 10996 C CD   . LYS A 1 15  ? -14.839 -1.236  -8.272  1.00 0.00 ? 15  LYS A CD   6  
ATOM 10997 C CE   . LYS A 1 15  ? -15.746 -2.292  -8.884  1.00 0.00 ? 15  LYS A CE   6  
ATOM 10998 N NZ   . LYS A 1 15  ? -16.652 -1.714  -9.915  1.00 0.00 ? 15  LYS A NZ   6  
ATOM 10999 H H    . LYS A 1 15  ? -11.041 1.912   -7.680  1.00 0.00 ? 15  LYS A H    6  
ATOM 11000 H HA   . LYS A 1 15  ? -12.712 -0.299  -6.707  1.00 0.00 ? 15  LYS A HA   6  
ATOM 11001 H HB2  . LYS A 1 15  ? -13.685 1.147   -8.452  1.00 0.00 ? 15  LYS A HB2  6  
ATOM 11002 H HB3  . LYS A 1 15  ? -12.344 0.751   -9.519  1.00 0.00 ? 15  LYS A HB3  6  
ATOM 11003 H HG2  . LYS A 1 15  ? -14.174 -0.585  -10.188 1.00 0.00 ? 15  LYS A HG2  6  
ATOM 11004 H HG3  . LYS A 1 15  ? -13.047 -1.652  -9.348  1.00 0.00 ? 15  LYS A HG3  6  
ATOM 11005 H HD2  . LYS A 1 15  ? -14.393 -1.638  -7.374  1.00 0.00 ? 15  LYS A HD2  6  
ATOM 11006 H HD3  . LYS A 1 15  ? -15.430 -0.365  -8.024  1.00 0.00 ? 15  LYS A HD3  6  
ATOM 11007 H HE2  . LYS A 1 15  ? -15.133 -3.053  -9.342  1.00 0.00 ? 15  LYS A HE2  6  
ATOM 11008 H HE3  . LYS A 1 15  ? -16.342 -2.734  -8.100  1.00 0.00 ? 15  LYS A HE3  6  
ATOM 11009 H HZ1  . LYS A 1 15  ? -17.583 -1.509  -9.497  1.00 0.00 ? 15  LYS A HZ1  6  
ATOM 11010 H HZ2  . LYS A 1 15  ? -16.777 -2.387  -10.698 1.00 0.00 ? 15  LYS A HZ2  6  
ATOM 11011 H HZ3  . LYS A 1 15  ? -16.251 -0.832  -10.290 1.00 0.00 ? 15  LYS A HZ3  6  
ATOM 11012 N N    . THR A 1 16  ? -10.266 -0.695  -8.900  1.00 0.00 ? 16  THR A N    6  
ATOM 11013 C CA   . THR A 1 16  ? -9.231  -1.620  -9.346  1.00 0.00 ? 16  THR A CA   6  
ATOM 11014 C C    . THR A 1 16  ? -8.440  -2.170  -8.165  1.00 0.00 ? 16  THR A C    6  
ATOM 11015 O O    . THR A 1 16  ? -8.037  -3.334  -8.165  1.00 0.00 ? 16  THR A O    6  
ATOM 11016 C CB   . THR A 1 16  ? -8.259  -0.943  -10.331 1.00 0.00 ? 16  THR A CB   6  
ATOM 11017 O OG1  . THR A 1 16  ? -7.793  0.296   -9.785  1.00 0.00 ? 16  THR A OG1  6  
ATOM 11018 C CG2  . THR A 1 16  ? -8.934  -0.691  -11.671 1.00 0.00 ? 16  THR A CG2  6  
ATOM 11019 H H    . THR A 1 16  ? -10.387 0.153   -9.376  1.00 0.00 ? 16  THR A H    6  
ATOM 11020 H HA   . THR A 1 16  ? -9.715  -2.440  -9.857  1.00 0.00 ? 16  THR A HA   6  
ATOM 11021 H HB   . THR A 1 16  ? -7.415  -1.599  -10.487 1.00 0.00 ? 16  THR A HB   6  
ATOM 11022 H HG1  . THR A 1 16  ? -8.338  0.540   -9.033  1.00 0.00 ? 16  THR A HG1  6  
ATOM 11023 H HG21 . THR A 1 16  ? -8.250  -0.938  -12.470 1.00 0.00 ? 16  THR A HG21 6  
ATOM 11024 H HG22 . THR A 1 16  ? -9.213  0.349   -11.743 1.00 0.00 ? 16  THR A HG22 6  
ATOM 11025 H HG23 . THR A 1 16  ? -9.817  -1.307  -11.750 1.00 0.00 ? 16  THR A HG23 6  
ATOM 11026 N N    . ILE A 1 17  ? -8.222  -1.328  -7.161  1.00 0.00 ? 17  ILE A N    6  
ATOM 11027 C CA   . ILE A 1 17  ? -7.480  -1.732  -5.973  1.00 0.00 ? 17  ILE A CA   6  
ATOM 11028 C C    . ILE A 1 17  ? -7.805  -3.171  -5.585  1.00 0.00 ? 17  ILE A C    6  
ATOM 11029 O O    . ILE A 1 17  ? -6.937  -3.910  -5.120  1.00 0.00 ? 17  ILE A O    6  
ATOM 11030 C CB   . ILE A 1 17  ? -7.783  -0.809  -4.779  1.00 0.00 ? 17  ILE A CB   6  
ATOM 11031 C CG1  . ILE A 1 17  ? -7.228  -1.411  -3.487  1.00 0.00 ? 17  ILE A CG1  6  
ATOM 11032 C CG2  . ILE A 1 17  ? -9.281  -0.573  -4.659  1.00 0.00 ? 17  ILE A CG2  6  
ATOM 11033 C CD1  . ILE A 1 17  ? -7.058  -0.401  -2.373  1.00 0.00 ? 17  ILE A CD1  6  
ATOM 11034 H H    . ILE A 1 17  ? -8.568  -0.414  -7.220  1.00 0.00 ? 17  ILE A H    6  
ATOM 11035 H HA   . ILE A 1 17  ? -6.425  -1.661  -6.199  1.00 0.00 ? 17  ILE A HA   6  
ATOM 11036 H HB   . ILE A 1 17  ? -7.307  0.143   -4.958  1.00 0.00 ? 17  ILE A HB   6  
ATOM 11037 H HG12 . ILE A 1 17  ? -7.900  -2.179  -3.137  1.00 0.00 ? 17  ILE A HG12 6  
ATOM 11038 H HG13 . ILE A 1 17  ? -6.261  -1.849  -3.689  1.00 0.00 ? 17  ILE A HG13 6  
ATOM 11039 H HG21 . ILE A 1 17  ? -9.710  -1.311  -3.996  1.00 0.00 ? 17  ILE A HG21 6  
ATOM 11040 H HG22 . ILE A 1 17  ? -9.459  0.414   -4.260  1.00 0.00 ? 17  ILE A HG22 6  
ATOM 11041 H HG23 . ILE A 1 17  ? -9.738  -0.656  -5.633  1.00 0.00 ? 17  ILE A HG23 6  
ATOM 11042 H HD11 . ILE A 1 17  ? -6.698  -0.900  -1.486  1.00 0.00 ? 17  ILE A HD11 6  
ATOM 11043 H HD12 . ILE A 1 17  ? -6.349  0.353   -2.676  1.00 0.00 ? 17  ILE A HD12 6  
ATOM 11044 H HD13 . ILE A 1 17  ? -8.010  0.064   -2.162  1.00 0.00 ? 17  ILE A HD13 6  
ATOM 11045 N N    . ASP A 1 18  ? -9.059  -3.561  -5.781  1.00 0.00 ? 18  ASP A N    6  
ATOM 11046 C CA   . ASP A 1 18  ? -9.499  -4.912  -5.454  1.00 0.00 ? 18  ASP A CA   6  
ATOM 11047 C C    . ASP A 1 18  ? -9.311  -5.848  -6.644  1.00 0.00 ? 18  ASP A C    6  
ATOM 11048 O O    . ASP A 1 18  ? -8.699  -6.908  -6.522  1.00 0.00 ? 18  ASP A O    6  
ATOM 11049 C CB   . ASP A 1 18  ? -10.966 -4.904  -5.022  1.00 0.00 ? 18  ASP A CB   6  
ATOM 11050 C CG   . ASP A 1 18  ? -11.824 -4.018  -5.904  1.00 0.00 ? 18  ASP A CG   6  
ATOM 11051 O OD1  . ASP A 1 18  ? -12.055 -4.389  -7.074  1.00 0.00 ? 18  ASP A OD1  6  
ATOM 11052 O OD2  . ASP A 1 18  ? -12.265 -2.953  -5.424  1.00 0.00 ? 18  ASP A OD2  6  
ATOM 11053 H H    . ASP A 1 18  ? -9.705  -2.925  -6.154  1.00 0.00 ? 18  ASP A H    6  
ATOM 11054 H HA   . ASP A 1 18  ? -8.894  -5.269  -4.633  1.00 0.00 ? 18  ASP A HA   6  
ATOM 11055 H HB2  . ASP A 1 18  ? -11.355 -5.911  -5.070  1.00 0.00 ? 18  ASP A HB2  6  
ATOM 11056 H HB3  . ASP A 1 18  ? -11.034 -4.544  -4.006  1.00 0.00 ? 18  ASP A HB3  6  
ATOM 11057 N N    . GLU A 1 19  ? -9.845  -5.448  -7.794  1.00 0.00 ? 19  GLU A N    6  
ATOM 11058 C CA   . GLU A 1 19  ? -9.737  -6.252  -9.006  1.00 0.00 ? 19  GLU A CA   6  
ATOM 11059 C C    . GLU A 1 19  ? -8.360  -6.901  -9.108  1.00 0.00 ? 19  GLU A C    6  
ATOM 11060 O O    . GLU A 1 19  ? -8.231  -8.041  -9.553  1.00 0.00 ? 19  GLU A O    6  
ATOM 11061 C CB   . GLU A 1 19  ? -9.999  -5.389  -10.242 1.00 0.00 ? 19  GLU A CB   6  
ATOM 11062 C CG   . GLU A 1 19  ? -8.735  -4.824  -10.869 1.00 0.00 ? 19  GLU A CG   6  
ATOM 11063 C CD   . GLU A 1 19  ? -9.004  -4.104  -12.176 1.00 0.00 ? 19  GLU A CD   6  
ATOM 11064 O OE1  . GLU A 1 19  ? -10.098 -3.517  -12.315 1.00 0.00 ? 19  GLU A OE1  6  
ATOM 11065 O OE2  . GLU A 1 19  ? -8.122  -4.127  -13.059 1.00 0.00 ? 19  GLU A OE2  6  
ATOM 11066 H H    . GLU A 1 19  ? -10.322 -4.593  -7.829  1.00 0.00 ? 19  GLU A H    6  
ATOM 11067 H HA   . GLU A 1 19  ? -10.485 -7.029  -8.956  1.00 0.00 ? 19  GLU A HA   6  
ATOM 11068 H HB2  . GLU A 1 19  ? -10.507 -5.989  -10.984 1.00 0.00 ? 19  GLU A HB2  6  
ATOM 11069 H HB3  . GLU A 1 19  ? -10.637 -4.564  -9.961  1.00 0.00 ? 19  GLU A HB3  6  
ATOM 11070 H HG2  . GLU A 1 19  ? -8.287  -4.126  -10.177 1.00 0.00 ? 19  GLU A HG2  6  
ATOM 11071 H HG3  . GLU A 1 19  ? -8.048  -5.635  -11.056 1.00 0.00 ? 19  GLU A HG3  6  
ATOM 11072 N N    . GLU A 1 20  ? -7.333  -6.165  -8.692  1.00 0.00 ? 20  GLU A N    6  
ATOM 11073 C CA   . GLU A 1 20  ? -5.965  -6.669  -8.738  1.00 0.00 ? 20  GLU A CA   6  
ATOM 11074 C C    . GLU A 1 20  ? -5.768  -7.800  -7.733  1.00 0.00 ? 20  GLU A C    6  
ATOM 11075 O O    . GLU A 1 20  ? -5.519  -8.946  -8.111  1.00 0.00 ? 20  GLU A O    6  
ATOM 11076 C CB   . GLU A 1 20  ? -4.973  -5.540  -8.453  1.00 0.00 ? 20  GLU A CB   6  
ATOM 11077 C CG   . GLU A 1 20  ? -4.506  -4.810  -9.702  1.00 0.00 ? 20  GLU A CG   6  
ATOM 11078 C CD   . GLU A 1 20  ? -5.558  -3.868  -10.254 1.00 0.00 ? 20  GLU A CD   6  
ATOM 11079 O OE1  . GLU A 1 20  ? -5.947  -2.926  -9.532  1.00 0.00 ? 20  GLU A OE1  6  
ATOM 11080 O OE2  . GLU A 1 20  ? -5.992  -4.072  -11.407 1.00 0.00 ? 20  GLU A OE2  6  
ATOM 11081 H H    . GLU A 1 20  ? -7.500  -5.263  -8.347  1.00 0.00 ? 20  GLU A H    6  
ATOM 11082 H HA   . GLU A 1 20  ? -5.786  -7.051  -9.731  1.00 0.00 ? 20  GLU A HA   6  
ATOM 11083 H HB2  . GLU A 1 20  ? -5.441  -4.822  -7.795  1.00 0.00 ? 20  GLU A HB2  6  
ATOM 11084 H HB3  . GLU A 1 20  ? -4.107  -5.955  -7.960  1.00 0.00 ? 20  GLU A HB3  6  
ATOM 11085 H HG2  . GLU A 1 20  ? -3.623  -4.238  -9.460  1.00 0.00 ? 20  GLU A HG2  6  
ATOM 11086 H HG3  . GLU A 1 20  ? -4.264  -5.540  -10.460 1.00 0.00 ? 20  GLU A HG3  6  
ATOM 11087 N N    . LEU A 1 21  ? -5.880  -7.470  -6.451  1.00 0.00 ? 21  LEU A N    6  
ATOM 11088 C CA   . LEU A 1 21  ? -5.714  -8.457  -5.389  1.00 0.00 ? 21  LEU A CA   6  
ATOM 11089 C C    . LEU A 1 21  ? -6.621  -9.662  -5.619  1.00 0.00 ? 21  LEU A C    6  
ATOM 11090 O O    . LEU A 1 21  ? -6.423  -10.721 -5.026  1.00 0.00 ? 21  LEU A O    6  
ATOM 11091 C CB   . LEU A 1 21  ? -6.017  -7.828  -4.029  1.00 0.00 ? 21  LEU A CB   6  
ATOM 11092 C CG   . LEU A 1 21  ? -5.189  -6.596  -3.659  1.00 0.00 ? 21  LEU A CG   6  
ATOM 11093 C CD1  . LEU A 1 21  ? -5.920  -5.751  -2.628  1.00 0.00 ? 21  LEU A CD1  6  
ATOM 11094 C CD2  . LEU A 1 21  ? -3.821  -7.011  -3.138  1.00 0.00 ? 21  LEU A CD2  6  
ATOM 11095 H H    . LEU A 1 21  ? -6.079  -6.541  -6.211  1.00 0.00 ? 21  LEU A H    6  
ATOM 11096 H HA   . LEU A 1 21  ? -4.686  -8.788  -5.403  1.00 0.00 ? 21  LEU A HA   6  
ATOM 11097 H HB2  . LEU A 1 21  ? -7.057  -7.540  -4.022  1.00 0.00 ? 21  LEU A HB2  6  
ATOM 11098 H HB3  . LEU A 1 21  ? -5.848  -8.581  -3.272  1.00 0.00 ? 21  LEU A HB3  6  
ATOM 11099 H HG   . LEU A 1 21  ? -5.041  -5.991  -4.543  1.00 0.00 ? 21  LEU A HG   6  
ATOM 11100 H HD11 . LEU A 1 21  ? -6.129  -4.777  -3.044  1.00 0.00 ? 21  LEU A HD11 6  
ATOM 11101 H HD12 . LEU A 1 21  ? -5.303  -5.642  -1.749  1.00 0.00 ? 21  LEU A HD12 6  
ATOM 11102 H HD13 . LEU A 1 21  ? -6.848  -6.234  -2.359  1.00 0.00 ? 21  LEU A HD13 6  
ATOM 11103 H HD21 . LEU A 1 21  ? -3.259  -7.478  -3.933  1.00 0.00 ? 21  LEU A HD21 6  
ATOM 11104 H HD22 . LEU A 1 21  ? -3.943  -7.711  -2.324  1.00 0.00 ? 21  LEU A HD22 6  
ATOM 11105 H HD23 . LEU A 1 21  ? -3.290  -6.139  -2.786  1.00 0.00 ? 21  LEU A HD23 6  
ATOM 11106 N N    . GLU A 1 22  ? -7.615  -9.491  -6.485  1.00 0.00 ? 22  GLU A N    6  
ATOM 11107 C CA   . GLU A 1 22  ? -8.551  -10.565 -6.793  1.00 0.00 ? 22  GLU A CA   6  
ATOM 11108 C C    . GLU A 1 22  ? -7.952  -11.536 -7.807  1.00 0.00 ? 22  GLU A C    6  
ATOM 11109 O O    . GLU A 1 22  ? -8.145  -12.748 -7.711  1.00 0.00 ? 22  GLU A O    6  
ATOM 11110 C CB   . GLU A 1 22  ? -9.862  -9.990  -7.335  1.00 0.00 ? 22  GLU A CB   6  
ATOM 11111 C CG   . GLU A 1 22  ? -10.850 -11.051 -7.789  1.00 0.00 ? 22  GLU A CG   6  
ATOM 11112 C CD   . GLU A 1 22  ? -12.021 -10.467 -8.556  1.00 0.00 ? 22  GLU A CD   6  
ATOM 11113 O OE1  . GLU A 1 22  ? -11.780 -9.712  -9.521  1.00 0.00 ? 22  GLU A OE1  6  
ATOM 11114 O OE2  . GLU A 1 22  ? -13.178 -10.765 -8.191  1.00 0.00 ? 22  GLU A OE2  6  
ATOM 11115 H H    . GLU A 1 22  ? -7.721  -8.622  -6.926  1.00 0.00 ? 22  GLU A H    6  
ATOM 11116 H HA   . GLU A 1 22  ? -8.755  -11.100 -5.878  1.00 0.00 ? 22  GLU A HA   6  
ATOM 11117 H HB2  . GLU A 1 22  ? -10.329 -9.399  -6.561  1.00 0.00 ? 22  GLU A HB2  6  
ATOM 11118 H HB3  . GLU A 1 22  ? -9.639  -9.352  -8.177  1.00 0.00 ? 22  GLU A HB3  6  
ATOM 11119 H HG2  . GLU A 1 22  ? -10.337 -11.754 -8.427  1.00 0.00 ? 22  GLU A HG2  6  
ATOM 11120 H HG3  . GLU A 1 22  ? -11.230 -11.567 -6.919  1.00 0.00 ? 22  GLU A HG3  6  
ATOM 11121 N N    . ARG A 1 23  ? -7.224  -10.993 -8.777  1.00 0.00 ? 23  ARG A N    6  
ATOM 11122 C CA   . ARG A 1 23  ? -6.597  -11.809 -9.810  1.00 0.00 ? 23  ARG A CA   6  
ATOM 11123 C C    . ARG A 1 23  ? -5.209  -12.269 -9.372  1.00 0.00 ? 23  ARG A C    6  
ATOM 11124 O O    . ARG A 1 23  ? -4.869  -13.446 -9.488  1.00 0.00 ? 23  ARG A O    6  
ATOM 11125 C CB   . ARG A 1 23  ? -6.496  -11.025 -11.119 1.00 0.00 ? 23  ARG A CB   6  
ATOM 11126 C CG   . ARG A 1 23  ? -5.752  -9.706  -10.984 1.00 0.00 ? 23  ARG A CG   6  
ATOM 11127 C CD   . ARG A 1 23  ? -5.677  -8.970  -12.312 1.00 0.00 ? 23  ARG A CD   6  
ATOM 11128 N NE   . ARG A 1 23  ? -4.574  -9.448  -13.141 1.00 0.00 ? 23  ARG A NE   6  
ATOM 11129 C CZ   . ARG A 1 23  ? -4.262  -8.925  -14.322 1.00 0.00 ? 23  ARG A CZ   6  
ATOM 11130 N NH1  . ARG A 1 23  ? -4.967  -7.913  -14.810 1.00 0.00 ? 23  ARG A NH1  6  
ATOM 11131 N NH2  . ARG A 1 23  ? -3.244  -9.415  -15.018 1.00 0.00 ? 23  ARG A NH2  6  
ATOM 11132 H H    . ARG A 1 23  ? -7.106  -10.020 -8.800  1.00 0.00 ? 23  ARG A H    6  
ATOM 11133 H HA   . ARG A 1 23  ? -7.218  -12.678 -9.968  1.00 0.00 ? 23  ARG A HA   6  
ATOM 11134 H HB2  . ARG A 1 23  ? -5.981  -11.630 -11.850 1.00 0.00 ? 23  ARG A HB2  6  
ATOM 11135 H HB3  . ARG A 1 23  ? -7.493  -10.815 -11.477 1.00 0.00 ? 23  ARG A HB3  6  
ATOM 11136 H HG2  . ARG A 1 23  ? -6.269  -9.084  -10.268 1.00 0.00 ? 23  ARG A HG2  6  
ATOM 11137 H HG3  . ARG A 1 23  ? -4.750  -9.904  -10.634 1.00 0.00 ? 23  ARG A HG3  6  
ATOM 11138 H HD2  . ARG A 1 23  ? -6.605  -9.119  -12.844 1.00 0.00 ? 23  ARG A HD2  6  
ATOM 11139 H HD3  . ARG A 1 23  ? -5.539  -7.917  -12.117 1.00 0.00 ? 23  ARG A HD3  6  
ATOM 11140 H HE   . ARG A 1 23  ? -4.040  -10.195 -12.800 1.00 0.00 ? 23  ARG A HE   6  
ATOM 11141 H HH11 . ARG A 1 23  ? -5.734  -7.542  -14.287 1.00 0.00 ? 23  ARG A HH11 6  
ATOM 11142 H HH12 . ARG A 1 23  ? -4.729  -7.521  -15.699 1.00 0.00 ? 23  ARG A HH12 6  
ATOM 11143 H HH21 . ARG A 1 23  ? -2.711  -10.178 -14.653 1.00 0.00 ? 23  ARG A HH21 6  
ATOM 11144 H HH22 . ARG A 1 23  ? -3.010  -9.021  -15.906 1.00 0.00 ? 23  ARG A HH22 6  
ATOM 11145 N N    . ASP A 1 24  ? -4.413  -11.332 -8.870  1.00 0.00 ? 24  ASP A N    6  
ATOM 11146 C CA   . ASP A 1 24  ? -3.062  -11.640 -8.414  1.00 0.00 ? 24  ASP A CA   6  
ATOM 11147 C C    . ASP A 1 24  ? -3.069  -12.081 -6.954  1.00 0.00 ? 24  ASP A C    6  
ATOM 11148 O O    . ASP A 1 24  ? -2.081  -11.914 -6.239  1.00 0.00 ? 24  ASP A O    6  
ATOM 11149 C CB   . ASP A 1 24  ? -2.152  -10.424 -8.588  1.00 0.00 ? 24  ASP A CB   6  
ATOM 11150 C CG   . ASP A 1 24  ? -1.509  -10.374 -9.960  1.00 0.00 ? 24  ASP A CG   6  
ATOM 11151 O OD1  . ASP A 1 24  ? -2.252  -10.318 -10.962 1.00 0.00 ? 24  ASP A OD1  6  
ATOM 11152 O OD2  . ASP A 1 24  ? -0.262  -10.391 -10.032 1.00 0.00 ? 24  ASP A OD2  6  
ATOM 11153 H H    . ASP A 1 24  ? -4.741  -10.411 -8.803  1.00 0.00 ? 24  ASP A H    6  
ATOM 11154 H HA   . ASP A 1 24  ? -2.685  -12.450 -9.019  1.00 0.00 ? 24  ASP A HA   6  
ATOM 11155 H HB2  . ASP A 1 24  ? -2.734  -9.524  -8.451  1.00 0.00 ? 24  ASP A HB2  6  
ATOM 11156 H HB3  . ASP A 1 24  ? -1.370  -10.458 -7.844  1.00 0.00 ? 24  ASP A HB3  6  
ATOM 11157 N N    . LYS A 1 25  ? -4.190  -12.644 -6.516  1.00 0.00 ? 25  LYS A N    6  
ATOM 11158 C CA   . LYS A 1 25  ? -4.327  -13.110 -5.141  1.00 0.00 ? 25  LYS A CA   6  
ATOM 11159 C C    . LYS A 1 25  ? -3.045  -13.784 -4.665  1.00 0.00 ? 25  LYS A C    6  
ATOM 11160 O O    . LYS A 1 25  ? -2.337  -13.256 -3.806  1.00 0.00 ? 25  LYS A O    6  
ATOM 11161 C CB   . LYS A 1 25  ? -5.501  -14.084 -5.025  1.00 0.00 ? 25  LYS A CB   6  
ATOM 11162 C CG   . LYS A 1 25  ? -6.823  -13.409 -4.702  1.00 0.00 ? 25  LYS A CG   6  
ATOM 11163 C CD   . LYS A 1 25  ? -7.841  -14.403 -4.168  1.00 0.00 ? 25  LYS A CD   6  
ATOM 11164 C CE   . LYS A 1 25  ? -9.262  -13.984 -4.513  1.00 0.00 ? 25  LYS A CE   6  
ATOM 11165 N NZ   . LYS A 1 25  ? -10.204 -15.137 -4.480  1.00 0.00 ? 25  LYS A NZ   6  
ATOM 11166 H H    . LYS A 1 25  ? -4.945  -12.750 -7.134  1.00 0.00 ? 25  LYS A H    6  
ATOM 11167 H HA   . LYS A 1 25  ? -4.521  -12.250 -4.517  1.00 0.00 ? 25  LYS A HA   6  
ATOM 11168 H HB2  . LYS A 1 25  ? -5.610  -14.611 -5.962  1.00 0.00 ? 25  LYS A HB2  6  
ATOM 11169 H HB3  . LYS A 1 25  ? -5.285  -14.798 -4.244  1.00 0.00 ? 25  LYS A HB3  6  
ATOM 11170 H HG2  . LYS A 1 25  ? -6.654  -12.647 -3.956  1.00 0.00 ? 25  LYS A HG2  6  
ATOM 11171 H HG3  . LYS A 1 25  ? -7.214  -12.954 -5.601  1.00 0.00 ? 25  LYS A HG3  6  
ATOM 11172 H HD2  . LYS A 1 25  ? -7.648  -15.372 -4.604  1.00 0.00 ? 25  LYS A HD2  6  
ATOM 11173 H HD3  . LYS A 1 25  ? -7.743  -14.463 -3.094  1.00 0.00 ? 25  LYS A HD3  6  
ATOM 11174 H HE2  . LYS A 1 25  ? -9.588  -13.243 -3.799  1.00 0.00 ? 25  LYS A HE2  6  
ATOM 11175 H HE3  . LYS A 1 25  ? -9.267  -13.555 -5.504  1.00 0.00 ? 25  LYS A HE3  6  
ATOM 11176 H HZ1  . LYS A 1 25  ? -10.509 -15.377 -5.445  1.00 0.00 ? 25  LYS A HZ1  6  
ATOM 11177 H HZ2  . LYS A 1 25  ? -11.042 -14.898 -3.913  1.00 0.00 ? 25  LYS A HZ2  6  
ATOM 11178 H HZ3  . LYS A 1 25  ? -9.739  -15.967 -4.059  1.00 0.00 ? 25  LYS A HZ3  6  
ATOM 11179 N N    . ARG A 1 26  ? -2.750  -14.951 -5.228  1.00 0.00 ? 26  ARG A N    6  
ATOM 11180 C CA   . ARG A 1 26  ? -1.553  -15.696 -4.860  1.00 0.00 ? 26  ARG A CA   6  
ATOM 11181 C C    . ARG A 1 26  ? -0.356  -14.762 -4.709  1.00 0.00 ? 26  ARG A C    6  
ATOM 11182 O O    . ARG A 1 26  ? 0.443   -14.903 -3.783  1.00 0.00 ? 26  ARG A O    6  
ATOM 11183 C CB   . ARG A 1 26  ? -1.249  -16.766 -5.911  1.00 0.00 ? 26  ARG A CB   6  
ATOM 11184 C CG   . ARG A 1 26  ? -1.168  -16.221 -7.328  1.00 0.00 ? 26  ARG A CG   6  
ATOM 11185 C CD   . ARG A 1 26  ? -0.558  -17.237 -8.281  1.00 0.00 ? 26  ARG A CD   6  
ATOM 11186 N NE   . ARG A 1 26  ? -0.350  -16.680 -9.615  1.00 0.00 ? 26  ARG A NE   6  
ATOM 11187 C CZ   . ARG A 1 26  ? 0.472   -17.211 -10.513 1.00 0.00 ? 26  ARG A CZ   6  
ATOM 11188 N NH1  . ARG A 1 26  ? 1.160   -18.307 -10.221 1.00 0.00 ? 26  ARG A NH1  6  
ATOM 11189 N NH2  . ARG A 1 26  ? 0.608   -16.646 -11.706 1.00 0.00 ? 26  ARG A NH2  6  
ATOM 11190 H H    . ARG A 1 26  ? -3.354  -15.320 -5.906  1.00 0.00 ? 26  ARG A H    6  
ATOM 11191 H HA   . ARG A 1 26  ? -1.740  -16.179 -3.912  1.00 0.00 ? 26  ARG A HA   6  
ATOM 11192 H HB2  . ARG A 1 26  ? -0.303  -17.230 -5.673  1.00 0.00 ? 26  ARG A HB2  6  
ATOM 11193 H HB3  . ARG A 1 26  ? -2.026  -17.514 -5.880  1.00 0.00 ? 26  ARG A HB3  6  
ATOM 11194 H HG2  . ARG A 1 26  ? -2.164  -15.978 -7.668  1.00 0.00 ? 26  ARG A HG2  6  
ATOM 11195 H HG3  . ARG A 1 26  ? -0.558  -15.330 -7.327  1.00 0.00 ? 26  ARG A HG3  6  
ATOM 11196 H HD2  . ARG A 1 26  ? 0.393   -17.559 -7.884  1.00 0.00 ? 26  ARG A HD2  6  
ATOM 11197 H HD3  . ARG A 1 26  ? -1.223  -18.085 -8.355  1.00 0.00 ? 26  ARG A HD3  6  
ATOM 11198 H HE   . ARG A 1 26  ? -0.848  -15.871 -9.852  1.00 0.00 ? 26  ARG A HE   6  
ATOM 11199 H HH11 . ARG A 1 26  ? 1.059   -18.735 -9.324  1.00 0.00 ? 26  ARG A HH11 6  
ATOM 11200 H HH12 . ARG A 1 26  ? 1.777   -18.705 -10.900 1.00 0.00 ? 26  ARG A HH12 6  
ATOM 11201 H HH21 . ARG A 1 26  ? 0.091   -15.820 -11.930 1.00 0.00 ? 26  ARG A HH21 6  
ATOM 11202 H HH22 . ARG A 1 26  ? 1.227   -17.046 -12.381 1.00 0.00 ? 26  ARG A HH22 6  
ATOM 11203 N N    . VAL A 1 27  ? -0.238  -13.807 -5.626  1.00 0.00 ? 27  VAL A N    6  
ATOM 11204 C CA   . VAL A 1 27  ? 0.861   -12.849 -5.595  1.00 0.00 ? 27  VAL A CA   6  
ATOM 11205 C C    . VAL A 1 27  ? 0.618   -11.768 -4.548  1.00 0.00 ? 27  VAL A C    6  
ATOM 11206 O O    . VAL A 1 27  ? -0.477  -11.212 -4.454  1.00 0.00 ? 27  VAL A O    6  
ATOM 11207 C CB   . VAL A 1 27  ? 1.063   -12.181 -6.968  1.00 0.00 ? 27  VAL A CB   6  
ATOM 11208 C CG1  . VAL A 1 27  ? 2.186   -11.158 -6.905  1.00 0.00 ? 27  VAL A CG1  6  
ATOM 11209 C CG2  . VAL A 1 27  ? 1.345   -13.230 -8.033  1.00 0.00 ? 27  VAL A CG2  6  
ATOM 11210 H H    . VAL A 1 27  ? -0.906  -13.745 -6.340  1.00 0.00 ? 27  VAL A H    6  
ATOM 11211 H HA   . VAL A 1 27  ? 1.764   -13.385 -5.342  1.00 0.00 ? 27  VAL A HA   6  
ATOM 11212 H HB   . VAL A 1 27  ? 0.151   -11.666 -7.233  1.00 0.00 ? 27  VAL A HB   6  
ATOM 11213 H HG11 . VAL A 1 27  ? 3.081   -11.579 -7.342  1.00 0.00 ? 27  VAL A HG11 6  
ATOM 11214 H HG12 . VAL A 1 27  ? 1.899   -10.273 -7.453  1.00 0.00 ? 27  VAL A HG12 6  
ATOM 11215 H HG13 . VAL A 1 27  ? 2.378   -10.898 -5.874  1.00 0.00 ? 27  VAL A HG13 6  
ATOM 11216 H HG21 . VAL A 1 27  ? 1.212   -14.215 -7.612  1.00 0.00 ? 27  VAL A HG21 6  
ATOM 11217 H HG22 . VAL A 1 27  ? 0.662   -13.097 -8.860  1.00 0.00 ? 27  VAL A HG22 6  
ATOM 11218 H HG23 . VAL A 1 27  ? 2.360   -13.123 -8.385  1.00 0.00 ? 27  VAL A HG23 6  
ATOM 11219 N N    . THR A 1 28  ? 1.647   -11.472 -3.760  1.00 0.00 ? 28  THR A N    6  
ATOM 11220 C CA   . THR A 1 28  ? 1.546   -10.458 -2.718  1.00 0.00 ? 28  THR A CA   6  
ATOM 11221 C C    . THR A 1 28  ? 1.579   -9.055  -3.312  1.00 0.00 ? 28  THR A C    6  
ATOM 11222 O O    . THR A 1 28  ? 2.279   -8.802  -4.293  1.00 0.00 ? 28  THR A O    6  
ATOM 11223 C CB   . THR A 1 28  ? 2.684   -10.595 -1.689  1.00 0.00 ? 28  THR A CB   6  
ATOM 11224 O OG1  . THR A 1 28  ? 2.792   -11.955 -1.256  1.00 0.00 ? 28  THR A OG1  6  
ATOM 11225 C CG2  . THR A 1 28  ? 2.439   -9.693  -0.488  1.00 0.00 ? 28  THR A CG2  6  
ATOM 11226 H H    . THR A 1 28  ? 2.494   -11.950 -3.883  1.00 0.00 ? 28  THR A H    6  
ATOM 11227 H HA   . THR A 1 28  ? 0.606   -10.600 -2.205  1.00 0.00 ? 28  THR A HA   6  
ATOM 11228 H HB   . THR A 1 28  ? 3.611   -10.299 -2.159  1.00 0.00 ? 28  THR A HB   6  
ATOM 11229 H HG1  . THR A 1 28  ? 3.257   -11.988 -0.416  1.00 0.00 ? 28  THR A HG1  6  
ATOM 11230 H HG21 . THR A 1 28  ? 1.610   -9.033  -0.697  1.00 0.00 ? 28  THR A HG21 6  
ATOM 11231 H HG22 . THR A 1 28  ? 3.324   -9.108  -0.291  1.00 0.00 ? 28  THR A HG22 6  
ATOM 11232 H HG23 . THR A 1 28  ? 2.208   -10.299 0.375   1.00 0.00 ? 28  THR A HG23 6  
ATOM 11233 N N    . TRP A 1 29  ? 0.819   -8.146  -2.713  1.00 0.00 ? 29  TRP A N    6  
ATOM 11234 C CA   . TRP A 1 29  ? 0.762   -6.767  -3.183  1.00 0.00 ? 29  TRP A CA   6  
ATOM 11235 C C    . TRP A 1 29  ? 0.903   -5.789  -2.022  1.00 0.00 ? 29  TRP A C    6  
ATOM 11236 O O    . TRP A 1 29  ? 0.089   -5.787  -1.097  1.00 0.00 ? 29  TRP A O    6  
ATOM 11237 C CB   . TRP A 1 29  ? -0.553  -6.512  -3.923  1.00 0.00 ? 29  TRP A CB   6  
ATOM 11238 C CG   . TRP A 1 29  ? -0.480  -6.823  -5.387  1.00 0.00 ? 29  TRP A CG   6  
ATOM 11239 C CD1  . TRP A 1 29  ? -0.929  -7.954  -6.008  1.00 0.00 ? 29  TRP A CD1  6  
ATOM 11240 C CD2  . TRP A 1 29  ? 0.075   -5.994  -6.413  1.00 0.00 ? 29  TRP A CD2  6  
ATOM 11241 N NE1  . TRP A 1 29  ? -0.685  -7.878  -7.358  1.00 0.00 ? 29  TRP A NE1  6  
ATOM 11242 C CE2  . TRP A 1 29  ? -0.071  -6.684  -7.632  1.00 0.00 ? 29  TRP A CE2  6  
ATOM 11243 C CE3  . TRP A 1 29  ? 0.680   -4.734  -6.421  1.00 0.00 ? 29  TRP A CE3  6  
ATOM 11244 C CZ2  . TRP A 1 29  ? 0.367   -6.156  -8.844  1.00 0.00 ? 29  TRP A CZ2  6  
ATOM 11245 C CZ3  . TRP A 1 29  ? 1.115   -4.211  -7.624  1.00 0.00 ? 29  TRP A CZ3  6  
ATOM 11246 C CH2  . TRP A 1 29  ? 0.956   -4.921  -8.822  1.00 0.00 ? 29  TRP A CH2  6  
ATOM 11247 H H    . TRP A 1 29  ? 0.282   -8.408  -1.935  1.00 0.00 ? 29  TRP A H    6  
ATOM 11248 H HA   . TRP A 1 29  ? 1.584   -6.616  -3.867  1.00 0.00 ? 29  TRP A HA   6  
ATOM 11249 H HB2  . TRP A 1 29  ? -1.327  -7.127  -3.489  1.00 0.00 ? 29  TRP A HB2  6  
ATOM 11250 H HB3  . TRP A 1 29  ? -0.822  -5.471  -3.815  1.00 0.00 ? 29  TRP A HB3  6  
ATOM 11251 H HD1  . TRP A 1 29  ? -1.401  -8.780  -5.499  1.00 0.00 ? 29  TRP A HD1  6  
ATOM 11252 H HE1  . TRP A 1 29  ? -0.916  -8.565  -8.017  1.00 0.00 ? 29  TRP A HE1  6  
ATOM 11253 H HE3  . TRP A 1 29  ? 0.811   -4.172  -5.508  1.00 0.00 ? 29  TRP A HE3  6  
ATOM 11254 H HZ2  . TRP A 1 29  ? 0.251   -6.691  -9.775  1.00 0.00 ? 29  TRP A HZ2  6  
ATOM 11255 H HZ3  . TRP A 1 29  ? 1.585   -3.239  -7.650  1.00 0.00 ? 29  TRP A HZ3  6  
ATOM 11256 H HH2  . TRP A 1 29  ? 1.310   -4.474  -9.738  1.00 0.00 ? 29  TRP A HH2  6  
ATOM 11257 N N    . ILE A 1 30  ? 1.940   -4.960  -2.075  1.00 0.00 ? 30  ILE A N    6  
ATOM 11258 C CA   . ILE A 1 30  ? 2.186   -3.977  -1.027  1.00 0.00 ? 30  ILE A CA   6  
ATOM 11259 C C    . ILE A 1 30  ? 1.616   -2.614  -1.407  1.00 0.00 ? 30  ILE A C    6  
ATOM 11260 O O    . ILE A 1 30  ? 2.186   -1.898  -2.229  1.00 0.00 ? 30  ILE A O    6  
ATOM 11261 C CB   . ILE A 1 30  ? 3.691   -3.828  -0.736  1.00 0.00 ? 30  ILE A CB   6  
ATOM 11262 C CG1  . ILE A 1 30  ? 3.926   -2.735  0.308   1.00 0.00 ? 30  ILE A CG1  6  
ATOM 11263 C CG2  . ILE A 1 30  ? 4.449   -3.516  -2.018  1.00 0.00 ? 30  ILE A CG2  6  
ATOM 11264 C CD1  . ILE A 1 30  ? 5.323   -2.742  0.887   1.00 0.00 ? 30  ILE A CD1  6  
ATOM 11265 H H    . ILE A 1 30  ? 2.553   -5.010  -2.837  1.00 0.00 ? 30  ILE A H    6  
ATOM 11266 H HA   . ILE A 1 30  ? 1.698   -4.321  -0.126  1.00 0.00 ? 30  ILE A HA   6  
ATOM 11267 H HB   . ILE A 1 30  ? 4.055   -4.768  -0.351  1.00 0.00 ? 30  ILE A HB   6  
ATOM 11268 H HG12 . ILE A 1 30  ? 3.761   -1.770  -0.146  1.00 0.00 ? 30  ILE A HG12 6  
ATOM 11269 H HG13 . ILE A 1 30  ? 3.227   -2.869  1.121   1.00 0.00 ? 30  ILE A HG13 6  
ATOM 11270 H HG21 . ILE A 1 30  ? 4.909   -2.542  -1.936  1.00 0.00 ? 30  ILE A HG21 6  
ATOM 11271 H HG22 . ILE A 1 30  ? 5.215   -4.262  -2.174  1.00 0.00 ? 30  ILE A HG22 6  
ATOM 11272 H HG23 . ILE A 1 30  ? 3.765   -3.522  -2.852  1.00 0.00 ? 30  ILE A HG23 6  
ATOM 11273 H HD11 . ILE A 1 30  ? 5.272   -2.576  1.953   1.00 0.00 ? 30  ILE A HD11 6  
ATOM 11274 H HD12 . ILE A 1 30  ? 5.789   -3.696  0.692   1.00 0.00 ? 30  ILE A HD12 6  
ATOM 11275 H HD13 . ILE A 1 30  ? 5.907   -1.957  0.429   1.00 0.00 ? 30  ILE A HD13 6  
ATOM 11276 N N    . VAL A 1 31  ? 0.487   -2.261  -0.800  1.00 0.00 ? 31  VAL A N    6  
ATOM 11277 C CA   . VAL A 1 31  ? -0.160  -0.983  -1.072  1.00 0.00 ? 31  VAL A CA   6  
ATOM 11278 C C    . VAL A 1 31  ? 0.133   0.027   0.032   1.00 0.00 ? 31  VAL A C    6  
ATOM 11279 O O    . VAL A 1 31  ? 0.071   -0.300  1.217   1.00 0.00 ? 31  VAL A O    6  
ATOM 11280 C CB   . VAL A 1 31  ? -1.685  -1.144  -1.213  1.00 0.00 ? 31  VAL A CB   6  
ATOM 11281 C CG1  . VAL A 1 31  ? -2.338  0.196   -1.516  1.00 0.00 ? 31  VAL A CG1  6  
ATOM 11282 C CG2  . VAL A 1 31  ? -2.014  -2.163  -2.294  1.00 0.00 ? 31  VAL A CG2  6  
ATOM 11283 H H    . VAL A 1 31  ? 0.080   -2.875  -0.154  1.00 0.00 ? 31  VAL A H    6  
ATOM 11284 H HA   . VAL A 1 31  ? 0.229   -0.604  -2.006  1.00 0.00 ? 31  VAL A HA   6  
ATOM 11285 H HB   . VAL A 1 31  ? -2.077  -1.507  -0.275  1.00 0.00 ? 31  VAL A HB   6  
ATOM 11286 H HG11 . VAL A 1 31  ? -1.574  0.953   -1.618  1.00 0.00 ? 31  VAL A HG11 6  
ATOM 11287 H HG12 . VAL A 1 31  ? -2.900  0.123   -2.436  1.00 0.00 ? 31  VAL A HG12 6  
ATOM 11288 H HG13 . VAL A 1 31  ? -3.003  0.462   -0.708  1.00 0.00 ? 31  VAL A HG13 6  
ATOM 11289 H HG21 . VAL A 1 31  ? -1.617  -3.127  -2.012  1.00 0.00 ? 31  VAL A HG21 6  
ATOM 11290 H HG22 . VAL A 1 31  ? -3.086  -2.235  -2.407  1.00 0.00 ? 31  VAL A HG22 6  
ATOM 11291 H HG23 . VAL A 1 31  ? -1.574  -1.852  -3.229  1.00 0.00 ? 31  VAL A HG23 6  
ATOM 11292 N N    . GLU A 1 32  ? 0.452   1.255   -0.365  1.00 0.00 ? 32  GLU A N    6  
ATOM 11293 C CA   . GLU A 1 32  ? 0.755   2.312   0.592   1.00 0.00 ? 32  GLU A CA   6  
ATOM 11294 C C    . GLU A 1 32  ? -0.293  3.420   0.527   1.00 0.00 ? 32  GLU A C    6  
ATOM 11295 O O    . GLU A 1 32  ? -0.362  4.169   -0.448  1.00 0.00 ? 32  GLU A O    6  
ATOM 11296 C CB   . GLU A 1 32  ? 2.144   2.893   0.321   1.00 0.00 ? 32  GLU A CB   6  
ATOM 11297 C CG   . GLU A 1 32  ? 2.599   3.896   1.368   1.00 0.00 ? 32  GLU A CG   6  
ATOM 11298 C CD   . GLU A 1 32  ? 3.743   4.765   0.884   1.00 0.00 ? 32  GLU A CD   6  
ATOM 11299 O OE1  . GLU A 1 32  ? 4.523   4.298   0.028   1.00 0.00 ? 32  GLU A OE1  6  
ATOM 11300 O OE2  . GLU A 1 32  ? 3.858   5.914   1.362   1.00 0.00 ? 32  GLU A OE2  6  
ATOM 11301 H H    . GLU A 1 32  ? 0.484   1.453   -1.324  1.00 0.00 ? 32  GLU A H    6  
ATOM 11302 H HA   . GLU A 1 32  ? 0.742   1.879   1.580   1.00 0.00 ? 32  GLU A HA   6  
ATOM 11303 H HB2  . GLU A 1 32  ? 2.860   2.084   0.292   1.00 0.00 ? 32  GLU A HB2  6  
ATOM 11304 H HB3  . GLU A 1 32  ? 2.134   3.386   -0.640  1.00 0.00 ? 32  GLU A HB3  6  
ATOM 11305 H HG2  . GLU A 1 32  ? 1.766   4.534   1.622   1.00 0.00 ? 32  GLU A HG2  6  
ATOM 11306 H HG3  . GLU A 1 32  ? 2.921   3.359   2.247   1.00 0.00 ? 32  GLU A HG3  6  
ATOM 11307 N N    . PHE A 1 33  ? -1.106  3.519   1.573   1.00 0.00 ? 33  PHE A N    6  
ATOM 11308 C CA   . PHE A 1 33  ? -2.152  4.534   1.636   1.00 0.00 ? 33  PHE A CA   6  
ATOM 11309 C C    . PHE A 1 33  ? -1.608  5.839   2.210   1.00 0.00 ? 33  PHE A C    6  
ATOM 11310 O O    . PHE A 1 33  ? -1.395  5.958   3.417   1.00 0.00 ? 33  PHE A O    6  
ATOM 11311 C CB   . PHE A 1 33  ? -3.323  4.038   2.486   1.00 0.00 ? 33  PHE A CB   6  
ATOM 11312 C CG   . PHE A 1 33  ? -3.809  2.670   2.098   1.00 0.00 ? 33  PHE A CG   6  
ATOM 11313 C CD1  . PHE A 1 33  ? -3.120  1.537   2.499   1.00 0.00 ? 33  PHE A CD1  6  
ATOM 11314 C CD2  . PHE A 1 33  ? -4.954  2.518   1.333   1.00 0.00 ? 33  PHE A CD2  6  
ATOM 11315 C CE1  . PHE A 1 33  ? -3.564  0.277   2.144   1.00 0.00 ? 33  PHE A CE1  6  
ATOM 11316 C CE2  . PHE A 1 33  ? -5.403  1.261   0.976   1.00 0.00 ? 33  PHE A CE2  6  
ATOM 11317 C CZ   . PHE A 1 33  ? -4.707  0.139   1.381   1.00 0.00 ? 33  PHE A CZ   6  
ATOM 11318 H H    . PHE A 1 33  ? -1.002  2.893   2.321   1.00 0.00 ? 33  PHE A H    6  
ATOM 11319 H HA   . PHE A 1 33  ? -2.499  4.713   0.630   1.00 0.00 ? 33  PHE A HA   6  
ATOM 11320 H HB2  . PHE A 1 33  ? -3.017  3.999   3.521   1.00 0.00 ? 33  PHE A HB2  6  
ATOM 11321 H HB3  . PHE A 1 33  ? -4.149  4.726   2.384   1.00 0.00 ? 33  PHE A HB3  6  
ATOM 11322 H HD1  . PHE A 1 33  ? -2.225  1.644   3.096   1.00 0.00 ? 33  PHE A HD1  6  
ATOM 11323 H HD2  . PHE A 1 33  ? -5.499  3.395   1.015   1.00 0.00 ? 33  PHE A HD2  6  
ATOM 11324 H HE1  . PHE A 1 33  ? -3.017  -0.598  2.462   1.00 0.00 ? 33  PHE A HE1  6  
ATOM 11325 H HE2  . PHE A 1 33  ? -6.297  1.156   0.379   1.00 0.00 ? 33  PHE A HE2  6  
ATOM 11326 H HZ   . PHE A 1 33  ? -5.056  -0.844  1.103   1.00 0.00 ? 33  PHE A HZ   6  
ATOM 11327 N N    . PHE A 1 34  ? -1.387  6.815   1.337   1.00 0.00 ? 34  PHE A N    6  
ATOM 11328 C CA   . PHE A 1 34  ? -0.867  8.112   1.755   1.00 0.00 ? 34  PHE A CA   6  
ATOM 11329 C C    . PHE A 1 34  ? -1.808  9.237   1.335   1.00 0.00 ? 34  PHE A C    6  
ATOM 11330 O O    . PHE A 1 34  ? -2.709  9.035   0.520   1.00 0.00 ? 34  PHE A O    6  
ATOM 11331 C CB   . PHE A 1 34  ? 0.523   8.345   1.158   1.00 0.00 ? 34  PHE A CB   6  
ATOM 11332 C CG   . PHE A 1 34  ? 0.498   8.678   -0.306  1.00 0.00 ? 34  PHE A CG   6  
ATOM 11333 C CD1  . PHE A 1 34  ? 0.437   7.673   -1.258  1.00 0.00 ? 34  PHE A CD1  6  
ATOM 11334 C CD2  . PHE A 1 34  ? 0.535   9.996   -0.731  1.00 0.00 ? 34  PHE A CD2  6  
ATOM 11335 C CE1  . PHE A 1 34  ? 0.415   7.976   -2.606  1.00 0.00 ? 34  PHE A CE1  6  
ATOM 11336 C CE2  . PHE A 1 34  ? 0.513   10.306  -2.078  1.00 0.00 ? 34  PHE A CE2  6  
ATOM 11337 C CZ   . PHE A 1 34  ? 0.452   9.295   -3.016  1.00 0.00 ? 34  PHE A CZ   6  
ATOM 11338 H H    . PHE A 1 34  ? -1.577  6.660   0.387   1.00 0.00 ? 34  PHE A H    6  
ATOM 11339 H HA   . PHE A 1 34  ? -0.791  8.106   2.831   1.00 0.00 ? 34  PHE A HA   6  
ATOM 11340 H HB2  . PHE A 1 34  ? 0.996   9.165   1.676   1.00 0.00 ? 34  PHE A HB2  6  
ATOM 11341 H HB3  . PHE A 1 34  ? 1.116   7.452   1.287   1.00 0.00 ? 34  PHE A HB3  6  
ATOM 11342 H HD1  . PHE A 1 34  ? 0.408   6.641   -0.938  1.00 0.00 ? 34  PHE A HD1  6  
ATOM 11343 H HD2  . PHE A 1 34  ? 0.582   10.789  0.003   1.00 0.00 ? 34  PHE A HD2  6  
ATOM 11344 H HE1  . PHE A 1 34  ? 0.368   7.184   -3.338  1.00 0.00 ? 34  PHE A HE1  6  
ATOM 11345 H HE2  . PHE A 1 34  ? 0.541   11.338  -2.395  1.00 0.00 ? 34  PHE A HE2  6  
ATOM 11346 H HZ   . PHE A 1 34  ? 0.435   9.534   -4.069  1.00 0.00 ? 34  PHE A HZ   6  
ATOM 11347 N N    . ALA A 1 35  ? -1.593  10.422  1.897   1.00 0.00 ? 35  ALA A N    6  
ATOM 11348 C CA   . ALA A 1 35  ? -2.421  11.579  1.581   1.00 0.00 ? 35  ALA A CA   6  
ATOM 11349 C C    . ALA A 1 35  ? -1.575  12.728  1.042   1.00 0.00 ? 35  ALA A C    6  
ATOM 11350 O O    . ALA A 1 35  ? -0.386  12.828  1.340   1.00 0.00 ? 35  ALA A O    6  
ATOM 11351 C CB   . ALA A 1 35  ? -3.198  12.025  2.811   1.00 0.00 ? 35  ALA A CB   6  
ATOM 11352 H H    . ALA A 1 35  ? -0.860  10.520  2.539   1.00 0.00 ? 35  ALA A H    6  
ATOM 11353 H HA   . ALA A 1 35  ? -3.132  11.283  0.823   1.00 0.00 ? 35  ALA A HA   6  
ATOM 11354 H HB1  . ALA A 1 35  ? -4.090  11.424  2.909   1.00 0.00 ? 35  ALA A HB1  6  
ATOM 11355 H HB2  . ALA A 1 35  ? -2.582  11.902  3.689   1.00 0.00 ? 35  ALA A HB2  6  
ATOM 11356 H HB3  . ALA A 1 35  ? -3.473  13.064  2.705   1.00 0.00 ? 35  ALA A HB3  6  
ATOM 11357 N N    . ASN A 1 36  ? -2.196  13.592  0.246   1.00 0.00 ? 36  ASN A N    6  
ATOM 11358 C CA   . ASN A 1 36  ? -1.500  14.733  -0.336  1.00 0.00 ? 36  ASN A CA   6  
ATOM 11359 C C    . ASN A 1 36  ? -1.093  15.731  0.745   1.00 0.00 ? 36  ASN A C    6  
ATOM 11360 O O    . ASN A 1 36  ? -0.042  16.364  0.655   1.00 0.00 ? 36  ASN A O    6  
ATOM 11361 C CB   . ASN A 1 36  ? -2.386  15.422  -1.375  1.00 0.00 ? 36  ASN A CB   6  
ATOM 11362 C CG   . ASN A 1 36  ? -2.501  14.622  -2.658  1.00 0.00 ? 36  ASN A CG   6  
ATOM 11363 O OD1  . ASN A 1 36  ? -3.486  13.916  -2.876  1.00 0.00 ? 36  ASN A OD1  6  
ATOM 11364 N ND2  . ASN A 1 36  ? -1.493  14.730  -3.515  1.00 0.00 ? 36  ASN A ND2  6  
ATOM 11365 H H    . ASN A 1 36  ? -3.146  13.459  0.045   1.00 0.00 ? 36  ASN A H    6  
ATOM 11366 H HA   . ASN A 1 36  ? -0.609  14.365  -0.822  1.00 0.00 ? 36  ASN A HA   6  
ATOM 11367 H HB2  . ASN A 1 36  ? -3.376  15.553  -0.965  1.00 0.00 ? 36  ASN A HB2  6  
ATOM 11368 H HB3  . ASN A 1 36  ? -1.968  16.390  -1.612  1.00 0.00 ? 36  ASN A HB3  6  
ATOM 11369 H HD21 . ASN A 1 36  ? -0.741  15.311  -3.275  1.00 0.00 ? 36  ASN A HD21 6  
ATOM 11370 H HD22 . ASN A 1 36  ? -1.542  14.224  -4.353  1.00 0.00 ? 36  ASN A HD22 6  
ATOM 11371 N N    . TRP A 1 37  ? -1.934  15.864  1.764   1.00 0.00 ? 37  TRP A N    6  
ATOM 11372 C CA   . TRP A 1 37  ? -1.662  16.785  2.863   1.00 0.00 ? 37  TRP A CA   6  
ATOM 11373 C C    . TRP A 1 37  ? -0.916  16.080  3.991   1.00 0.00 ? 37  TRP A C    6  
ATOM 11374 O O    . TRP A 1 37  ? -0.928  16.536  5.134   1.00 0.00 ? 37  TRP A O    6  
ATOM 11375 C CB   . TRP A 1 37  ? -2.968  17.380  3.392   1.00 0.00 ? 37  TRP A CB   6  
ATOM 11376 C CG   . TRP A 1 37  ? -4.123  16.426  3.331   1.00 0.00 ? 37  TRP A CG   6  
ATOM 11377 C CD1  . TRP A 1 37  ? -5.226  16.525  2.533   1.00 0.00 ? 37  TRP A CD1  6  
ATOM 11378 C CD2  . TRP A 1 37  ? -4.288  15.231  4.102   1.00 0.00 ? 37  TRP A CD2  6  
ATOM 11379 N NE1  . TRP A 1 37  ? -6.068  15.463  2.761   1.00 0.00 ? 37  TRP A NE1  6  
ATOM 11380 C CE2  . TRP A 1 37  ? -5.515  14.654  3.719   1.00 0.00 ? 37  TRP A CE2  6  
ATOM 11381 C CE3  . TRP A 1 37  ? -3.519  14.591  5.078   1.00 0.00 ? 37  TRP A CE3  6  
ATOM 11382 C CZ2  . TRP A 1 37  ? -5.987  13.470  4.278   1.00 0.00 ? 37  TRP A CZ2  6  
ATOM 11383 C CZ3  . TRP A 1 37  ? -3.989  13.416  5.632   1.00 0.00 ? 37  TRP A CZ3  6  
ATOM 11384 C CH2  . TRP A 1 37  ? -5.214  12.865  5.231   1.00 0.00 ? 37  TRP A CH2  6  
ATOM 11385 H H    . TRP A 1 37  ? -2.756  15.332  1.779   1.00 0.00 ? 37  TRP A H    6  
ATOM 11386 H HA   . TRP A 1 37  ? -1.042  17.582  2.480   1.00 0.00 ? 37  TRP A HA   6  
ATOM 11387 H HB2  . TRP A 1 37  ? -2.831  17.674  4.421   1.00 0.00 ? 37  TRP A HB2  6  
ATOM 11388 H HB3  . TRP A 1 37  ? -3.222  18.250  2.803   1.00 0.00 ? 37  TRP A HB3  6  
ATOM 11389 H HD1  . TRP A 1 37  ? -5.399  17.326  1.831   1.00 0.00 ? 37  TRP A HD1  6  
ATOM 11390 H HE1  . TRP A 1 37  ? -6.924  15.309  2.310   1.00 0.00 ? 37  TRP A HE1  6  
ATOM 11391 H HE3  . TRP A 1 37  ? -2.572  15.000  5.400   1.00 0.00 ? 37  TRP A HE3  6  
ATOM 11392 H HZ2  . TRP A 1 37  ? -6.928  13.033  3.979   1.00 0.00 ? 37  TRP A HZ2  6  
ATOM 11393 H HZ3  . TRP A 1 37  ? -3.409  12.908  6.388   1.00 0.00 ? 37  TRP A HZ3  6  
ATOM 11394 H HH2  . TRP A 1 37  ? -5.542  11.946  5.691   1.00 0.00 ? 37  TRP A HH2  6  
ATOM 11395 N N    . SER A 1 38  ? -0.268  14.968  3.662   1.00 0.00 ? 38  SER A N    6  
ATOM 11396 C CA   . SER A 1 38  ? 0.481   14.199  4.650   1.00 0.00 ? 38  SER A CA   6  
ATOM 11397 C C    . SER A 1 38  ? 1.982   14.397  4.468   1.00 0.00 ? 38  SER A C    6  
ATOM 11398 O O    . SER A 1 38  ? 2.599   13.786  3.596   1.00 0.00 ? 38  SER A O    6  
ATOM 11399 C CB   . SER A 1 38  ? 0.134   12.713  4.540   1.00 0.00 ? 38  SER A CB   6  
ATOM 11400 O OG   . SER A 1 38  ? 0.871   11.946  5.476   1.00 0.00 ? 38  SER A OG   6  
ATOM 11401 H H    . SER A 1 38  ? -0.296  14.655  2.733   1.00 0.00 ? 38  SER A H    6  
ATOM 11402 H HA   . SER A 1 38  ? 0.199   14.554  5.629   1.00 0.00 ? 38  SER A HA   6  
ATOM 11403 H HB2  . SER A 1 38  ? -0.920  12.577  4.731   1.00 0.00 ? 38  SER A HB2  6  
ATOM 11404 H HB3  . SER A 1 38  ? 0.367   12.364  3.544   1.00 0.00 ? 38  SER A HB3  6  
ATOM 11405 H HG   . SER A 1 38  ? 1.425   11.316  5.009   1.00 0.00 ? 38  SER A HG   6  
ATOM 11406 N N    . ASN A 1 39  ? 2.564   15.256  5.298   1.00 0.00 ? 39  ASN A N    6  
ATOM 11407 C CA   . ASN A 1 39  ? 3.994   15.536  5.230   1.00 0.00 ? 39  ASN A CA   6  
ATOM 11408 C C    . ASN A 1 39  ? 4.809   14.266  5.455   1.00 0.00 ? 39  ASN A C    6  
ATOM 11409 O O    . ASN A 1 39  ? 5.780   14.005  4.745   1.00 0.00 ? 39  ASN A O    6  
ATOM 11410 C CB   . ASN A 1 39  ? 4.378   16.593  6.267   1.00 0.00 ? 39  ASN A CB   6  
ATOM 11411 C CG   . ASN A 1 39  ? 3.631   17.897  6.068   1.00 0.00 ? 39  ASN A CG   6  
ATOM 11412 O OD1  . ASN A 1 39  ? 2.467   18.023  6.447   1.00 0.00 ? 39  ASN A OD1  6  
ATOM 11413 N ND2  . ASN A 1 39  ? 4.300   18.876  5.469   1.00 0.00 ? 39  ASN A ND2  6  
ATOM 11414 H H    . ASN A 1 39  ? 2.020   15.713  5.973   1.00 0.00 ? 39  ASN A H    6  
ATOM 11415 H HA   . ASN A 1 39  ? 4.210   15.918  4.243   1.00 0.00 ? 39  ASN A HA   6  
ATOM 11416 H HB2  . ASN A 1 39  ? 4.151   16.218  7.255   1.00 0.00 ? 39  ASN A HB2  6  
ATOM 11417 H HB3  . ASN A 1 39  ? 5.437   16.791  6.197   1.00 0.00 ? 39  ASN A HB3  6  
ATOM 11418 H HD21 . ASN A 1 39  ? 5.225   18.704  5.194   1.00 0.00 ? 39  ASN A HD21 6  
ATOM 11419 H HD22 . ASN A 1 39  ? 3.841   19.731  5.328   1.00 0.00 ? 39  ASN A HD22 6  
ATOM 11420 N N    . ASP A 1 40  ? 4.406   13.480  6.448   1.00 0.00 ? 40  ASP A N    6  
ATOM 11421 C CA   . ASP A 1 40  ? 5.097   12.236  6.766   1.00 0.00 ? 40  ASP A CA   6  
ATOM 11422 C C    . ASP A 1 40  ? 5.372   11.428  5.502   1.00 0.00 ? 40  ASP A C    6  
ATOM 11423 O O    . ASP A 1 40  ? 6.404   10.764  5.390   1.00 0.00 ? 40  ASP A O    6  
ATOM 11424 C CB   . ASP A 1 40  ? 4.269   11.405  7.748   1.00 0.00 ? 40  ASP A CB   6  
ATOM 11425 C CG   . ASP A 1 40  ? 3.699   12.240  8.877   1.00 0.00 ? 40  ASP A CG   6  
ATOM 11426 O OD1  . ASP A 1 40  ? 4.445   13.072  9.434   1.00 0.00 ? 40  ASP A OD1  6  
ATOM 11427 O OD2  . ASP A 1 40  ? 2.507   12.062  9.204   1.00 0.00 ? 40  ASP A OD2  6  
ATOM 11428 H H    . ASP A 1 40  ? 3.624   13.742  6.978   1.00 0.00 ? 40  ASP A H    6  
ATOM 11429 H HA   . ASP A 1 40  ? 6.039   12.489  7.229   1.00 0.00 ? 40  ASP A HA   6  
ATOM 11430 H HB2  . ASP A 1 40  ? 3.449   10.944  7.216   1.00 0.00 ? 40  ASP A HB2  6  
ATOM 11431 H HB3  . ASP A 1 40  ? 4.895   10.634  8.174   1.00 0.00 ? 40  ASP A HB3  6  
ATOM 11432 N N    . CYS A 1 41  ? 4.444   11.488  4.554   1.00 0.00 ? 41  CYS A N    6  
ATOM 11433 C CA   . CYS A 1 41  ? 4.586   10.760  3.298   1.00 0.00 ? 41  CYS A CA   6  
ATOM 11434 C C    . CYS A 1 41  ? 5.795   11.259  2.514   1.00 0.00 ? 41  CYS A C    6  
ATOM 11435 O O    . CYS A 1 41  ? 6.509   10.473  1.892   1.00 0.00 ? 41  CYS A O    6  
ATOM 11436 C CB   . CYS A 1 41  ? 3.319   10.908  2.453   1.00 0.00 ? 41  CYS A CB   6  
ATOM 11437 S SG   . CYS A 1 41  ? 3.404   10.085  0.845   1.00 0.00 ? 41  CYS A SG   6  
ATOM 11438 H H    . CYS A 1 41  ? 3.644   12.034  4.701   1.00 0.00 ? 41  CYS A H    6  
ATOM 11439 H HA   . CYS A 1 41  ? 4.730   9.717   3.535   1.00 0.00 ? 41  CYS A HA   6  
ATOM 11440 H HB2  . CYS A 1 41  ? 2.484   10.487  2.993   1.00 0.00 ? 41  CYS A HB2  6  
ATOM 11441 H HB3  . CYS A 1 41  ? 3.134   11.957  2.277   1.00 0.00 ? 41  CYS A HB3  6  
ATOM 11442 H HG   . CYS A 1 41  ? 4.338   9.148   0.915   1.00 0.00 ? 41  CYS A HG   6  
ATOM 11443 N N    . GLN A 1 42  ? 6.018   12.569  2.549   1.00 0.00 ? 42  GLN A N    6  
ATOM 11444 C CA   . GLN A 1 42  ? 7.140   13.172  1.839   1.00 0.00 ? 42  GLN A CA   6  
ATOM 11445 C C    . GLN A 1 42  ? 8.441   12.441  2.157   1.00 0.00 ? 42  GLN A C    6  
ATOM 11446 O O    . GLN A 1 42  ? 9.095   11.901  1.265   1.00 0.00 ? 42  GLN A O    6  
ATOM 11447 C CB   . GLN A 1 42  ? 7.269   14.650  2.209   1.00 0.00 ? 42  GLN A CB   6  
ATOM 11448 C CG   . GLN A 1 42  ? 6.058   15.483  1.819   1.00 0.00 ? 42  GLN A CG   6  
ATOM 11449 C CD   . GLN A 1 42  ? 6.418   16.919  1.492   1.00 0.00 ? 42  GLN A CD   6  
ATOM 11450 O OE1  . GLN A 1 42  ? 7.585   17.245  1.276   1.00 0.00 ? 42  GLN A OE1  6  
ATOM 11451 N NE2  . GLN A 1 42  ? 5.413   17.786  1.453   1.00 0.00 ? 42  GLN A NE2  6  
ATOM 11452 H H    . GLN A 1 42  ? 5.413   13.143  3.063   1.00 0.00 ? 42  GLN A H    6  
ATOM 11453 H HA   . GLN A 1 42  ? 6.945   13.090  0.781   1.00 0.00 ? 42  GLN A HA   6  
ATOM 11454 H HB2  . GLN A 1 42  ? 7.406   14.732  3.277   1.00 0.00 ? 42  GLN A HB2  6  
ATOM 11455 H HB3  . GLN A 1 42  ? 8.135   15.059  1.710   1.00 0.00 ? 42  GLN A HB3  6  
ATOM 11456 H HG2  . GLN A 1 42  ? 5.596   15.037  0.950   1.00 0.00 ? 42  GLN A HG2  6  
ATOM 11457 H HG3  . GLN A 1 42  ? 5.356   15.480  2.639   1.00 0.00 ? 42  GLN A HG3  6  
ATOM 11458 H HE21 . GLN A 1 42  ? 4.509   17.455  1.636   1.00 0.00 ? 42  GLN A HE21 6  
ATOM 11459 H HE22 . GLN A 1 42  ? 5.617   18.721  1.245   1.00 0.00 ? 42  GLN A HE22 6  
ATOM 11460 N N    . SER A 1 43  ? 8.810   12.428  3.434   1.00 0.00 ? 43  SER A N    6  
ATOM 11461 C CA   . SER A 1 43  ? 10.035  11.767  3.869   1.00 0.00 ? 43  SER A CA   6  
ATOM 11462 C C    . SER A 1 43  ? 10.069  10.318  3.392   1.00 0.00 ? 43  SER A C    6  
ATOM 11463 O O    . SER A 1 43  ? 11.122  9.680   3.381   1.00 0.00 ? 43  SER A O    6  
ATOM 11464 C CB   . SER A 1 43  ? 10.153  11.817  5.393   1.00 0.00 ? 43  SER A CB   6  
ATOM 11465 O OG   . SER A 1 43  ? 11.271  11.072  5.843   1.00 0.00 ? 43  SER A OG   6  
ATOM 11466 H H    . SER A 1 43  ? 8.246   12.876  4.099   1.00 0.00 ? 43  SER A H    6  
ATOM 11467 H HA   . SER A 1 43  ? 10.869  12.296  3.434   1.00 0.00 ? 43  SER A HA   6  
ATOM 11468 H HB2  . SER A 1 43  ? 10.268  12.842  5.709   1.00 0.00 ? 43  SER A HB2  6  
ATOM 11469 H HB3  . SER A 1 43  ? 9.258   11.402  5.834   1.00 0.00 ? 43  SER A HB3  6  
ATOM 11470 H HG   . SER A 1 43  ? 11.425  11.255  6.773   1.00 0.00 ? 43  SER A HG   6  
ATOM 11471 N N    . PHE A 1 44  ? 8.908   9.804   2.998   1.00 0.00 ? 44  PHE A N    6  
ATOM 11472 C CA   . PHE A 1 44  ? 8.804   8.430   2.521   1.00 0.00 ? 44  PHE A CA   6  
ATOM 11473 C C    . PHE A 1 44  ? 8.864   8.377   0.997   1.00 0.00 ? 44  PHE A C    6  
ATOM 11474 O O    . PHE A 1 44  ? 9.371   7.417   0.418   1.00 0.00 ? 44  PHE A O    6  
ATOM 11475 C CB   . PHE A 1 44  ? 7.501   7.795   3.012   1.00 0.00 ? 44  PHE A CB   6  
ATOM 11476 C CG   . PHE A 1 44  ? 7.566   6.297   3.114   1.00 0.00 ? 44  PHE A CG   6  
ATOM 11477 C CD1  . PHE A 1 44  ? 8.459   5.686   3.979   1.00 0.00 ? 44  PHE A CD1  6  
ATOM 11478 C CD2  . PHE A 1 44  ? 6.732   5.501   2.345   1.00 0.00 ? 44  PHE A CD2  6  
ATOM 11479 C CE1  . PHE A 1 44  ? 8.520   4.309   4.074   1.00 0.00 ? 44  PHE A CE1  6  
ATOM 11480 C CE2  . PHE A 1 44  ? 6.789   4.123   2.435   1.00 0.00 ? 44  PHE A CE2  6  
ATOM 11481 C CZ   . PHE A 1 44  ? 7.684   3.526   3.302   1.00 0.00 ? 44  PHE A CZ   6  
ATOM 11482 H H    . PHE A 1 44  ? 8.103   10.362  3.030   1.00 0.00 ? 44  PHE A H    6  
ATOM 11483 H HA   . PHE A 1 44  ? 9.638   7.876   2.922   1.00 0.00 ? 44  PHE A HA   6  
ATOM 11484 H HB2  . PHE A 1 44  ? 7.267   8.183   3.992   1.00 0.00 ? 44  PHE A HB2  6  
ATOM 11485 H HB3  . PHE A 1 44  ? 6.705   8.048   2.329   1.00 0.00 ? 44  PHE A HB3  6  
ATOM 11486 H HD1  . PHE A 1 44  ? 9.113   6.297   4.584   1.00 0.00 ? 44  PHE A HD1  6  
ATOM 11487 H HD2  . PHE A 1 44  ? 6.032   5.968   1.666   1.00 0.00 ? 44  PHE A HD2  6  
ATOM 11488 H HE1  . PHE A 1 44  ? 9.221   3.845   4.752   1.00 0.00 ? 44  PHE A HE1  6  
ATOM 11489 H HE2  . PHE A 1 44  ? 6.134   3.515   1.830   1.00 0.00 ? 44  PHE A HE2  6  
ATOM 11490 H HZ   . PHE A 1 44  ? 7.730   2.450   3.374   1.00 0.00 ? 44  PHE A HZ   6  
ATOM 11491 N N    . ALA A 1 45  ? 8.344   9.417   0.354   1.00 0.00 ? 45  ALA A N    6  
ATOM 11492 C CA   . ALA A 1 45  ? 8.340   9.491   -1.102  1.00 0.00 ? 45  ALA A CA   6  
ATOM 11493 C C    . ALA A 1 45  ? 9.573   8.812   -1.690  1.00 0.00 ? 45  ALA A C    6  
ATOM 11494 O O    . ALA A 1 45  ? 9.477   7.871   -2.478  1.00 0.00 ? 45  ALA A O    6  
ATOM 11495 C CB   . ALA A 1 45  ? 8.266   10.941  -1.557  1.00 0.00 ? 45  ALA A CB   6  
ATOM 11496 H H    . ALA A 1 45  ? 7.955   10.153  0.871   1.00 0.00 ? 45  ALA A H    6  
ATOM 11497 H HA   . ALA A 1 45  ? 7.456   8.982   -1.460  1.00 0.00 ? 45  ALA A HA   6  
ATOM 11498 H HB1  . ALA A 1 45  ? 9.167   11.194  -2.096  1.00 0.00 ? 45  ALA A HB1  6  
ATOM 11499 H HB2  . ALA A 1 45  ? 7.411   11.073  -2.202  1.00 0.00 ? 45  ALA A HB2  6  
ATOM 11500 H HB3  . ALA A 1 45  ? 8.170   11.584  -0.695  1.00 0.00 ? 45  ALA A HB3  6  
ATOM 11501 N N    . PRO A 1 46  ? 10.760  9.300   -1.299  1.00 0.00 ? 46  PRO A N    6  
ATOM 11502 C CA   . PRO A 1 46  ? 12.034  8.755   -1.776  1.00 0.00 ? 46  PRO A CA   6  
ATOM 11503 C C    . PRO A 1 46  ? 12.313  7.362   -1.220  1.00 0.00 ? 46  PRO A C    6  
ATOM 11504 O O    . PRO A 1