data_2DJN
# 
_entry.id   2DJN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2DJN         
RCSB  RCSB025492   
WWPDB D_1000025492 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsi002006337.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2DJN 
_pdbx_database_status.recvd_initial_deposition_date   2006-04-05 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sasagawa, A.'                                           1 
'Ohnishi, S.'                                            2 
'Tochio, N.'                                             3 
'Saito, K.'                                              4 
'Koshiba, S.'                                            5 
'Inoue, M.'                                              6 
'Kigawa, T.'                                             7 
'Yokoyama, S.'                                           8 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 
# 
_citation.id                        primary 
_citation.title                     'The solution structure of the homeobox domain of human Homeobox protein DLX-5' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sasagawa, A.' 1 
primary 'Ohnishi, S.'  2 
primary 'Tochio, N.'   3 
primary 'Saito, K.'    4 
primary 'Koshiba, S.'  5 
primary 'Inoue, M.'    6 
primary 'Kigawa, T.'   7 
primary 'Yokoyama, S.' 8 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Homeobox protein DLX-5' 
_entity.formula_weight             7741.847 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'homeobox domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKSGPSSG 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKSGPSSG 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsi002006337.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  ARG n 
1 9  LYS n 
1 10 PRO n 
1 11 ARG n 
1 12 THR n 
1 13 ILE n 
1 14 TYR n 
1 15 SER n 
1 16 SER n 
1 17 PHE n 
1 18 GLN n 
1 19 LEU n 
1 20 ALA n 
1 21 ALA n 
1 22 LEU n 
1 23 GLN n 
1 24 ARG n 
1 25 ARG n 
1 26 PHE n 
1 27 GLN n 
1 28 LYS n 
1 29 THR n 
1 30 GLN n 
1 31 TYR n 
1 32 LEU n 
1 33 ALA n 
1 34 LEU n 
1 35 PRO n 
1 36 GLU n 
1 37 ARG n 
1 38 ALA n 
1 39 GLU n 
1 40 LEU n 
1 41 ALA n 
1 42 ALA n 
1 43 SER n 
1 44 LEU n 
1 45 GLY n 
1 46 LEU n 
1 47 THR n 
1 48 GLN n 
1 49 THR n 
1 50 GLN n 
1 51 VAL n 
1 52 LYS n 
1 53 ILE n 
1 54 TRP n 
1 55 PHE n 
1 56 GLN n 
1 57 ASN n 
1 58 LYS n 
1 59 ARG n 
1 60 SER n 
1 61 LYS n 
1 62 ILE n 
1 63 LYS n 
1 64 LYS n 
1 65 SER n 
1 66 GLY n 
1 67 PRO n 
1 68 SER n 
1 69 SER n 
1 70 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 DLX5 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cell free synthesis' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P050509-13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DLX5_HUMAN 
_struct_ref.pdbx_db_accession          P56178 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           138 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2DJN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 64 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P56178 
_struct_ref_seq.db_align_beg                  138 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  194 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       64 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2DJN GLY A 1  ? UNP P56178 ? ? 'CLONING ARTIFACT' 1  1  
1 2DJN SER A 2  ? UNP P56178 ? ? 'CLONING ARTIFACT' 2  2  
1 2DJN SER A 3  ? UNP P56178 ? ? 'CLONING ARTIFACT' 3  3  
1 2DJN GLY A 4  ? UNP P56178 ? ? 'CLONING ARTIFACT' 4  4  
1 2DJN SER A 5  ? UNP P56178 ? ? 'CLONING ARTIFACT' 5  5  
1 2DJN SER A 6  ? UNP P56178 ? ? 'CLONING ARTIFACT' 6  6  
1 2DJN GLY A 7  ? UNP P56178 ? ? 'CLONING ARTIFACT' 7  7  
1 2DJN SER A 65 ? UNP P56178 ? ? 'CLONING ARTIFACT' 65 8  
1 2DJN GLY A 66 ? UNP P56178 ? ? 'CLONING ARTIFACT' 66 9  
1 2DJN PRO A 67 ? UNP P56178 ? ? 'CLONING ARTIFACT' 67 10 
1 2DJN SER A 68 ? UNP P56178 ? ? 'CLONING ARTIFACT' 68 11 
1 2DJN SER A 69 ? UNP P56178 ? ? 'CLONING ARTIFACT' 69 12 
1 2DJN GLY A 70 ? UNP P56178 ? ? 'CLONING ARTIFACT' 70 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.35mM homeobox domain U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 
0.02% NaN3; 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2DJN 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2DJN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function, structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2DJN 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy, fewest violations' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR   3.5      Bruker          1 
processing           NMRPipe   20030801 'Delaglio, F.'  2 
'data analysis'      NMNMRView 5.0.4    'Johnson, B.A.' 3 
'data analysis'      Kujira    0.933    'Kobayashi, N.' 4 
'structure solution' CYANA     2.0.17   'Guntert, P.'   5 
refinement           CYANA     2.0.17   'Guntert, P.'   6 
# 
_exptl.entry_id          2DJN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2DJN 
_struct.title                     'The solution structure of the homeobox domain of human Homeobox protein DLX-5' 
_struct.pdbx_descriptor           'Homeobox protein DLX-5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2DJN 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            
;homeobox, DLX5, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 15 ? GLN A 27 ? SER A 15 GLN A 27 1 ? 13 
HELX_P HELX_P2 2 ALA A 33 ? LEU A 44 ? ALA A 33 LEU A 44 1 ? 12 
HELX_P HELX_P3 3 THR A 47 ? LYS A 61 ? THR A 47 LYS A 61 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2DJN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2DJN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 17.854  1.629   -14.863 1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 18.333  0.545   -15.701 1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 18.174  0.841   -17.179 1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 19.160  0.935   -17.910 1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 17.950  2.557   -15.164 1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? 19.378  0.376   -15.489 1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? 17.778  -0.350  -15.463 1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? 16.929  0.987   -17.621 1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? 16.643  1.268   -19.023 1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? 15.784  2.521   -19.162 1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? 16.200  3.509   -19.766 1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? 15.936  0.076   -19.671 1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? 16.839  -0.992  -19.897 1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? 16.184  0.900   -16.989 1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? 17.584  1.434   -19.526 1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? 15.147  -0.268  -19.020 1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? 15.514  0.382   -20.617 1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? 17.280  -0.865  -20.740 1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? 14.581  2.471   -18.598 1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? 13.660  3.600   -18.661 1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? 13.810  4.493   -17.433 1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? 14.044  5.695   -17.550 1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? 12.218  3.103   -18.772 1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? 12.019  2.376   -19.972 1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? 14.307  1.655   -18.130 1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? 13.902  4.176   -19.542 1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? 11.997  2.458   -17.935 1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? 11.546  3.949   -18.761 1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? 12.847  1.972   -20.242 1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? 13.672  3.894   -16.253 1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? 13.794  4.649   -15.020 1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? 12.474  5.240   -14.568 1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? 11.948  6.157   -15.200 1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? 13.485  2.932   -16.221 1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? 14.167  3.995   -14.246 1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? 14.502  5.451   -15.171 1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? 11.935  4.714   -13.473 1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? 10.664  5.192   -12.941 1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? 10.841  6.533   -12.237 1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? 11.062  6.588   -11.027 1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? 10.076  4.166   -11.970 1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? 8.785   4.557   -11.536 1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? 12.402  3.984   -13.014 1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? 9.985   5.320   -13.770 1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? 10.003  3.209   -12.462 1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? 10.722  4.080   -11.107 1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? 8.264   3.776   -11.335 1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? 10.740  7.615   -13.003 1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? 10.892  8.957   -12.455 1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? 9.696   9.831   -12.818 1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? 9.021   9.595   -13.819 1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? 12.182  9.599   -12.971 1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? 13.278  9.289   -12.129 1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? 10.562  7.506   -13.961 1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? 10.948  8.872   -11.380 1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? 12.391  9.231   -13.964 1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? 12.059  10.672  -13.003 1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? 13.127  8.441   -11.705 1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? 9.438   10.843  -11.995 1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? 8.323   11.737  -12.245 1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? 7.907   12.506  -11.006 1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? 8.077   12.027  -9.885  1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? 10.010  10.983  -11.211 1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? 8.605   12.441  -13.014 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? 7.482   11.156  -12.593 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8  ? 7.363   13.701  -11.208 1.00 0.00 ? 8  ARG A N    1  
ATOM 67    C CA   . ARG A 1 8  ? 6.924   14.539  -10.098 1.00 0.00 ? 8  ARG A CA   1  
ATOM 68    C C    . ARG A 1 8  ? 5.494   15.025  -10.316 1.00 0.00 ? 8  ARG A C    1  
ATOM 69    O O    . ARG A 1 8  ? 5.191   15.666  -11.322 1.00 0.00 ? 8  ARG A O    1  
ATOM 70    C CB   . ARG A 1 8  ? 7.862   15.736  -9.934  1.00 0.00 ? 8  ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8  ? 7.446   16.687  -8.823  1.00 0.00 ? 8  ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8  ? 8.330   17.924  -8.789  1.00 0.00 ? 8  ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8  ? 8.285   18.663  -10.047 1.00 0.00 ? 8  ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8  ? 9.048   18.376  -11.096 1.00 0.00 ? 8  ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8  ? 9.909   17.369  -11.038 1.00 0.00 ? 8  ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8  ? 8.949   19.095  -12.207 1.00 0.00 ? 8  ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8  ? 7.254   14.028  -12.126 1.00 0.00 ? 8  ARG A H    1  
ATOM 78    H HA   . ARG A 1 8  ? 6.956   13.942  -9.199  1.00 0.00 ? 8  ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8  ? 8.855   15.373  -9.714  1.00 0.00 ? 8  ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8  ? 7.886   16.289  -10.861 1.00 0.00 ? 8  ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8  ? 6.424   16.993  -8.987  1.00 0.00 ? 8  ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8  ? 7.523   16.174  -7.876  1.00 0.00 ? 8  ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8  ? 7.993   18.569  -7.991  1.00 0.00 ? 8  ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8  ? 9.348   17.617  -8.598  1.00 0.00 ? 8  ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8  ? 7.656   19.411  -10.112 1.00 0.00 ? 8  ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8  ? 9.984   16.825  -10.203 1.00 0.00 ? 8  ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8  ? 10.481  17.154  -11.830 1.00 0.00 ? 8  ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8  ? 8.301   19.855  -12.254 1.00 0.00 ? 8  ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8  ? 9.523   18.878  -12.995 1.00 0.00 ? 8  ARG A HH22 1  
ATOM 90    N N    . LYS A 1 9  ? 4.619   14.715  -9.366  1.00 0.00 ? 9  LYS A N    1  
ATOM 91    C CA   . LYS A 1 9  ? 3.221   15.120  -9.451  1.00 0.00 ? 9  LYS A CA   1  
ATOM 92    C C    . LYS A 1 9  ? 2.628   15.327  -8.061  1.00 0.00 ? 9  LYS A C    1  
ATOM 93    O O    . LYS A 1 9  ? 2.964   14.626  -7.106  1.00 0.00 ? 9  LYS A O    1  
ATOM 94    C CB   . LYS A 1 9  ? 2.409   14.069  -10.212 1.00 0.00 ? 9  LYS A CB   1  
ATOM 95    C CG   . LYS A 1 9  ? 2.396   12.707  -9.540  1.00 0.00 ? 9  LYS A CG   1  
ATOM 96    C CD   . LYS A 1 9  ? 2.060   11.601  -10.526 1.00 0.00 ? 9  LYS A CD   1  
ATOM 97    C CE   . LYS A 1 9  ? 1.399   10.419  -9.834  1.00 0.00 ? 9  LYS A CE   1  
ATOM 98    N NZ   . LYS A 1 9  ? 0.835   9.448   -10.812 1.00 0.00 ? 9  LYS A NZ   1  
ATOM 99    H H    . LYS A 1 9  ? 4.921   14.202  -8.587  1.00 0.00 ? 9  LYS A H    1  
ATOM 100   H HA   . LYS A 1 9  ? 3.178   16.054  -9.990  1.00 0.00 ? 9  LYS A HA   1  
ATOM 101   H HB2  . LYS A 1 9  ? 1.390   14.413  -10.301 1.00 0.00 ? 9  LYS A HB2  1  
ATOM 102   H HB3  . LYS A 1 9  ? 2.829   13.954  -11.201 1.00 0.00 ? 9  LYS A HB3  1  
ATOM 103   H HG2  . LYS A 1 9  ? 3.372   12.514  -9.118  1.00 0.00 ? 9  LYS A HG2  1  
ATOM 104   H HG3  . LYS A 1 9  ? 1.656   12.711  -8.752  1.00 0.00 ? 9  LYS A HG3  1  
ATOM 105   H HD2  . LYS A 1 9  ? 1.385   11.990  -11.273 1.00 0.00 ? 9  LYS A HD2  1  
ATOM 106   H HD3  . LYS A 1 9  ? 2.971   11.265  -11.001 1.00 0.00 ? 9  LYS A HD3  1  
ATOM 107   H HE2  . LYS A 1 9  ? 2.135   9.917   -9.225  1.00 0.00 ? 9  LYS A HE2  1  
ATOM 108   H HE3  . LYS A 1 9  ? 0.602   10.787  -9.205  1.00 0.00 ? 9  LYS A HE3  1  
ATOM 109   H HZ1  . LYS A 1 9  ? 0.088   8.881   -10.362 1.00 0.00 ? 9  LYS A HZ1  1  
ATOM 110   H HZ2  . LYS A 1 9  ? 1.582   8.809   -11.152 1.00 0.00 ? 9  LYS A HZ2  1  
ATOM 111   H HZ3  . LYS A 1 9  ? 0.430   9.954   -11.625 1.00 0.00 ? 9  LYS A HZ3  1  
ATOM 112   N N    . PRO A 1 10 ? 1.724   16.311  -7.943  1.00 0.00 ? 10 PRO A N    1  
ATOM 113   C CA   . PRO A 1 10 ? 1.064   16.631  -6.674  1.00 0.00 ? 10 PRO A CA   1  
ATOM 114   C C    . PRO A 1 10 ? 0.085   15.546  -6.240  1.00 0.00 ? 10 PRO A C    1  
ATOM 115   O O    . PRO A 1 10 ? -0.170  15.366  -5.048  1.00 0.00 ? 10 PRO A O    1  
ATOM 116   C CB   . PRO A 1 10 ? 0.319   17.932  -6.980  1.00 0.00 ? 10 PRO A CB   1  
ATOM 117   C CG   . PRO A 1 10 ? 0.091   17.901  -8.452  1.00 0.00 ? 10 PRO A CG   1  
ATOM 118   C CD   . PRO A 1 10 ? 1.276   17.186  -9.039  1.00 0.00 ? 10 PRO A CD   1  
ATOM 119   H HA   . PRO A 1 10 ? 1.782   16.802  -5.885  1.00 0.00 ? 10 PRO A HA   1  
ATOM 120   H HB2  . PRO A 1 10 ? -0.615  17.952  -6.435  1.00 0.00 ? 10 PRO A HB2  1  
ATOM 121   H HB3  . PRO A 1 10 ? 0.928   18.776  -6.692  1.00 0.00 ? 10 PRO A HB3  1  
ATOM 122   H HG2  . PRO A 1 10 ? -0.819  17.363  -8.671  1.00 0.00 ? 10 PRO A HG2  1  
ATOM 123   H HG3  . PRO A 1 10 ? 0.034   18.909  -8.835  1.00 0.00 ? 10 PRO A HG3  1  
ATOM 124   H HD2  . PRO A 1 10 ? 0.978   16.605  -9.899  1.00 0.00 ? 10 PRO A HD2  1  
ATOM 125   H HD3  . PRO A 1 10 ? 2.048   17.892  -9.308  1.00 0.00 ? 10 PRO A HD3  1  
ATOM 126   N N    . ARG A 1 11 ? -0.462  14.824  -7.213  1.00 0.00 ? 11 ARG A N    1  
ATOM 127   C CA   . ARG A 1 11 ? -1.414  13.757  -6.931  1.00 0.00 ? 11 ARG A CA   1  
ATOM 128   C C    . ARG A 1 11 ? -0.690  12.471  -6.543  1.00 0.00 ? 11 ARG A C    1  
ATOM 129   O O    . ARG A 1 11 ? -0.354  11.651  -7.399  1.00 0.00 ? 11 ARG A O    1  
ATOM 130   C CB   . ARG A 1 11 ? -2.306  13.505  -8.148  1.00 0.00 ? 11 ARG A CB   1  
ATOM 131   C CG   . ARG A 1 11 ? -3.580  12.743  -7.822  1.00 0.00 ? 11 ARG A CG   1  
ATOM 132   C CD   . ARG A 1 11 ? -4.645  13.660  -7.241  1.00 0.00 ? 11 ARG A CD   1  
ATOM 133   N NE   . ARG A 1 11 ? -5.839  12.924  -6.835  1.00 0.00 ? 11 ARG A NE   1  
ATOM 134   C CZ   . ARG A 1 11 ? -6.820  13.455  -6.113  1.00 0.00 ? 11 ARG A CZ   1  
ATOM 135   N NH1  . ARG A 1 11 ? -6.749  14.719  -5.721  1.00 0.00 ? 11 ARG A NH1  1  
ATOM 136   N NH2  . ARG A 1 11 ? -7.874  12.721  -5.783  1.00 0.00 ? 11 ARG A NH2  1  
ATOM 137   H H    . ARG A 1 11 ? -0.219  15.015  -8.143  1.00 0.00 ? 11 ARG A H    1  
ATOM 138   H HA   . ARG A 1 11 ? -2.030  14.072  -6.103  1.00 0.00 ? 11 ARG A HA   1  
ATOM 139   H HB2  . ARG A 1 11 ? -2.582  14.456  -8.580  1.00 0.00 ? 11 ARG A HB2  1  
ATOM 140   H HB3  . ARG A 1 11 ? -1.748  12.936  -8.876  1.00 0.00 ? 11 ARG A HB3  1  
ATOM 141   H HG2  . ARG A 1 11 ? -3.962  12.295  -8.727  1.00 0.00 ? 11 ARG A HG2  1  
ATOM 142   H HG3  . ARG A 1 11 ? -3.351  11.970  -7.104  1.00 0.00 ? 11 ARG A HG3  1  
ATOM 143   H HD2  . ARG A 1 11 ? -4.234  14.165  -6.379  1.00 0.00 ? 11 ARG A HD2  1  
ATOM 144   H HD3  . ARG A 1 11 ? -4.919  14.389  -7.988  1.00 0.00 ? 11 ARG A HD3  1  
ATOM 145   H HE   . ARG A 1 11 ? -5.911  11.987  -7.114  1.00 0.00 ? 11 ARG A HE   1  
ATOM 146   H HH11 . ARG A 1 11 ? -5.956  15.275  -5.970  1.00 0.00 ? 11 ARG A HH11 1  
ATOM 147   H HH12 . ARG A 1 11 ? -7.489  15.117  -5.179  1.00 0.00 ? 11 ARG A HH12 1  
ATOM 148   H HH21 . ARG A 1 11 ? -7.931  11.767  -6.077  1.00 0.00 ? 11 ARG A HH21 1  
ATOM 149   H HH22 . ARG A 1 11 ? -8.612  13.121  -5.240  1.00 0.00 ? 11 ARG A HH22 1  
ATOM 150   N N    . THR A 1 12 ? -0.451  12.300  -5.246  1.00 0.00 ? 12 THR A N    1  
ATOM 151   C CA   . THR A 1 12 ? 0.234   11.116  -4.745  1.00 0.00 ? 12 THR A CA   1  
ATOM 152   C C    . THR A 1 12 ? -0.122  9.884   -5.569  1.00 0.00 ? 12 THR A C    1  
ATOM 153   O O    . THR A 1 12 ? -1.212  9.799   -6.136  1.00 0.00 ? 12 THR A O    1  
ATOM 154   C CB   . THR A 1 12 ? -0.113  10.849  -3.268  1.00 0.00 ? 12 THR A CB   1  
ATOM 155   O OG1  . THR A 1 12 ? 0.127   12.026  -2.488  1.00 0.00 ? 12 THR A OG1  1  
ATOM 156   C CG2  . THR A 1 12 ? 0.712   9.695   -2.718  1.00 0.00 ? 12 THR A CG2  1  
ATOM 157   H H    . THR A 1 12 ? -0.743  12.988  -4.613  1.00 0.00 ? 12 THR A H    1  
ATOM 158   H HA   . THR A 1 12 ? 1.298   11.290  -4.817  1.00 0.00 ? 12 THR A HA   1  
ATOM 159   H HB   . THR A 1 12 ? -1.159  10.589  -3.201  1.00 0.00 ? 12 THR A HB   1  
ATOM 160   H HG1  . THR A 1 12 ? 1.036   12.027  -2.181  1.00 0.00 ? 12 THR A HG1  1  
ATOM 161   H HG21 . THR A 1 12 ? 1.744   9.999   -2.630  1.00 0.00 ? 12 THR A HG21 1  
ATOM 162   H HG22 . THR A 1 12 ? 0.641   8.851   -3.388  1.00 0.00 ? 12 THR A HG22 1  
ATOM 163   H HG23 . THR A 1 12 ? 0.335   9.415   -1.746  1.00 0.00 ? 12 THR A HG23 1  
ATOM 164   N N    . ILE A 1 13 ? 0.802   8.931   -5.630  1.00 0.00 ? 13 ILE A N    1  
ATOM 165   C CA   . ILE A 1 13 ? 0.583   7.703   -6.384  1.00 0.00 ? 13 ILE A CA   1  
ATOM 166   C C    . ILE A 1 13 ? -0.751  7.063   -6.017  1.00 0.00 ? 13 ILE A C    1  
ATOM 167   O O    . ILE A 1 13 ? -1.269  6.220   -6.750  1.00 0.00 ? 13 ILE A O    1  
ATOM 168   C CB   . ILE A 1 13 ? 1.713   6.684   -6.140  1.00 0.00 ? 13 ILE A CB   1  
ATOM 169   C CG1  . ILE A 1 13 ? 3.070   7.305   -6.474  1.00 0.00 ? 13 ILE A CG1  1  
ATOM 170   C CG2  . ILE A 1 13 ? 1.481   5.429   -6.967  1.00 0.00 ? 13 ILE A CG2  1  
ATOM 171   C CD1  . ILE A 1 13 ? 3.186   7.771   -7.909  1.00 0.00 ? 13 ILE A CD1  1  
ATOM 172   H H    . ILE A 1 13 ? 1.651   9.057   -5.157  1.00 0.00 ? 13 ILE A H    1  
ATOM 173   H HA   . ILE A 1 13 ? 0.573   7.955   -7.435  1.00 0.00 ? 13 ILE A HA   1  
ATOM 174   H HB   . ILE A 1 13 ? 1.698   6.407   -5.097  1.00 0.00 ? 13 ILE A HB   1  
ATOM 175   H HG12 . ILE A 1 13 ? 3.236   8.158   -5.835  1.00 0.00 ? 13 ILE A HG12 1  
ATOM 176   H HG13 . ILE A 1 13 ? 3.846   6.573   -6.299  1.00 0.00 ? 13 ILE A HG13 1  
ATOM 177   H HG21 . ILE A 1 13 ? 0.585   4.932   -6.624  1.00 0.00 ? 13 ILE A HG21 1  
ATOM 178   H HG22 . ILE A 1 13 ? 1.365   5.699   -8.006  1.00 0.00 ? 13 ILE A HG22 1  
ATOM 179   H HG23 . ILE A 1 13 ? 2.325   4.765   -6.859  1.00 0.00 ? 13 ILE A HG23 1  
ATOM 180   H HD11 . ILE A 1 13 ? 2.317   7.449   -8.463  1.00 0.00 ? 13 ILE A HD11 1  
ATOM 181   H HD12 . ILE A 1 13 ? 3.251   8.848   -7.934  1.00 0.00 ? 13 ILE A HD12 1  
ATOM 182   H HD13 . ILE A 1 13 ? 4.074   7.347   -8.354  1.00 0.00 ? 13 ILE A HD13 1  
ATOM 183   N N    . TYR A 1 14 ? -1.304  7.471   -4.880  1.00 0.00 ? 14 TYR A N    1  
ATOM 184   C CA   . TYR A 1 14 ? -2.579  6.937   -4.415  1.00 0.00 ? 14 TYR A CA   1  
ATOM 185   C C    . TYR A 1 14 ? -3.443  8.039   -3.811  1.00 0.00 ? 14 TYR A C    1  
ATOM 186   O O    . TYR A 1 14 ? -2.936  8.957   -3.165  1.00 0.00 ? 14 TYR A O    1  
ATOM 187   C CB   . TYR A 1 14 ? -2.347  5.832   -3.384  1.00 0.00 ? 14 TYR A CB   1  
ATOM 188   C CG   . TYR A 1 14 ? -1.903  4.520   -3.991  1.00 0.00 ? 14 TYR A CG   1  
ATOM 189   C CD1  . TYR A 1 14 ? -0.607  4.353   -4.463  1.00 0.00 ? 14 TYR A CD1  1  
ATOM 190   C CD2  . TYR A 1 14 ? -2.781  3.447   -4.093  1.00 0.00 ? 14 TYR A CD2  1  
ATOM 191   C CE1  . TYR A 1 14 ? -0.198  3.156   -5.019  1.00 0.00 ? 14 TYR A CE1  1  
ATOM 192   C CE2  . TYR A 1 14 ? -2.380  2.246   -4.646  1.00 0.00 ? 14 TYR A CE2  1  
ATOM 193   C CZ   . TYR A 1 14 ? -1.088  2.106   -5.109  1.00 0.00 ? 14 TYR A CZ   1  
ATOM 194   O OH   . TYR A 1 14 ? -0.684  0.912   -5.661  1.00 0.00 ? 14 TYR A OH   1  
ATOM 195   H H    . TYR A 1 14 ? -0.843  8.146   -4.339  1.00 0.00 ? 14 TYR A H    1  
ATOM 196   H HA   . TYR A 1 14 ? -3.093  6.518   -5.268  1.00 0.00 ? 14 TYR A HA   1  
ATOM 197   H HB2  . TYR A 1 14 ? -1.584  6.150   -2.691  1.00 0.00 ? 14 TYR A HB2  1  
ATOM 198   H HB3  . TYR A 1 14 ? -3.266  5.654   -2.844  1.00 0.00 ? 14 TYR A HB3  1  
ATOM 199   H HD1  . TYR A 1 14 ? 0.087   5.177   -4.391  1.00 0.00 ? 14 TYR A HD1  1  
ATOM 200   H HD2  . TYR A 1 14 ? -3.792  3.560   -3.730  1.00 0.00 ? 14 TYR A HD2  1  
ATOM 201   H HE1  . TYR A 1 14 ? 0.813   3.046   -5.381  1.00 0.00 ? 14 TYR A HE1  1  
ATOM 202   H HE2  . TYR A 1 14 ? -3.076  1.424   -4.717  1.00 0.00 ? 14 TYR A HE2  1  
ATOM 203   H HH   . TYR A 1 14 ? -1.422  0.508   -6.124  1.00 0.00 ? 14 TYR A HH   1  
ATOM 204   N N    . SER A 1 15 ? -4.751  7.941   -4.025  1.00 0.00 ? 15 SER A N    1  
ATOM 205   C CA   . SER A 1 15 ? -5.687  8.931   -3.504  1.00 0.00 ? 15 SER A CA   1  
ATOM 206   C C    . SER A 1 15 ? -5.807  8.820   -1.987  1.00 0.00 ? 15 SER A C    1  
ATOM 207   O O    . SER A 1 15 ? -5.410  7.817   -1.394  1.00 0.00 ? 15 SER A O    1  
ATOM 208   C CB   . SER A 1 15 ? -7.062  8.752   -4.151  1.00 0.00 ? 15 SER A CB   1  
ATOM 209   O OG   . SER A 1 15 ? -7.851  9.920   -4.001  1.00 0.00 ? 15 SER A OG   1  
ATOM 210   H H    . SER A 1 15 ? -5.094  7.186   -4.548  1.00 0.00 ? 15 SER A H    1  
ATOM 211   H HA   . SER A 1 15 ? -5.306  9.910   -3.753  1.00 0.00 ? 15 SER A HA   1  
ATOM 212   H HB2  . SER A 1 15 ? -6.938  8.548   -5.203  1.00 0.00 ? 15 SER A HB2  1  
ATOM 213   H HB3  . SER A 1 15 ? -7.573  7.924   -3.681  1.00 0.00 ? 15 SER A HB3  1  
ATOM 214   H HG   . SER A 1 15 ? -7.417  10.657  -4.438  1.00 0.00 ? 15 SER A HG   1  
ATOM 215   N N    . SER A 1 16 ? -6.358  9.857   -1.366  1.00 0.00 ? 16 SER A N    1  
ATOM 216   C CA   . SER A 1 16 ? -6.528  9.879   0.082   1.00 0.00 ? 16 SER A CA   1  
ATOM 217   C C    . SER A 1 16 ? -7.500  8.793   0.532   1.00 0.00 ? 16 SER A C    1  
ATOM 218   O O    . SER A 1 16 ? -7.305  8.159   1.569   1.00 0.00 ? 16 SER A O    1  
ATOM 219   C CB   . SER A 1 16 ? -7.032  11.250  0.537   1.00 0.00 ? 16 SER A CB   1  
ATOM 220   O OG   . SER A 1 16 ? -8.267  11.570  -0.080  1.00 0.00 ? 16 SER A OG   1  
ATOM 221   H H    . SER A 1 16 ? -6.656  10.628  -1.895  1.00 0.00 ? 16 SER A H    1  
ATOM 222   H HA   . SER A 1 16 ? -5.564  9.692   0.532   1.00 0.00 ? 16 SER A HA   1  
ATOM 223   H HB2  . SER A 1 16 ? -7.170  11.243  1.607   1.00 0.00 ? 16 SER A HB2  1  
ATOM 224   H HB3  . SER A 1 16 ? -6.305  12.004  0.272   1.00 0.00 ? 16 SER A HB3  1  
ATOM 225   H HG   . SER A 1 16 ? -8.916  11.786  0.594   1.00 0.00 ? 16 SER A HG   1  
ATOM 226   N N    . PHE A 1 17 ? -8.549  8.583   -0.257  1.00 0.00 ? 17 PHE A N    1  
ATOM 227   C CA   . PHE A 1 17 ? -9.553  7.573   0.059   1.00 0.00 ? 17 PHE A CA   1  
ATOM 228   C C    . PHE A 1 17 ? -8.941  6.176   0.051   1.00 0.00 ? 17 PHE A C    1  
ATOM 229   O O    . PHE A 1 17 ? -9.166  5.384   0.966   1.00 0.00 ? 17 PHE A O    1  
ATOM 230   C CB   . PHE A 1 17 ? -10.708 7.642   -0.942  1.00 0.00 ? 17 PHE A CB   1  
ATOM 231   C CG   . PHE A 1 17 ? -11.422 6.333   -1.125  1.00 0.00 ? 17 PHE A CG   1  
ATOM 232   C CD1  . PHE A 1 17 ? -12.110 5.752   -0.072  1.00 0.00 ? 17 PHE A CD1  1  
ATOM 233   C CD2  . PHE A 1 17 ? -11.405 5.685   -2.349  1.00 0.00 ? 17 PHE A CD2  1  
ATOM 234   C CE1  . PHE A 1 17 ? -12.767 4.547   -0.237  1.00 0.00 ? 17 PHE A CE1  1  
ATOM 235   C CE2  . PHE A 1 17 ? -12.061 4.480   -2.520  1.00 0.00 ? 17 PHE A CE2  1  
ATOM 236   C CZ   . PHE A 1 17 ? -12.743 3.911   -1.463  1.00 0.00 ? 17 PHE A CZ   1  
ATOM 237   H H    . PHE A 1 17 ? -8.650  9.120   -1.071  1.00 0.00 ? 17 PHE A H    1  
ATOM 238   H HA   . PHE A 1 17 ? -9.932  7.782   1.047   1.00 0.00 ? 17 PHE A HA   1  
ATOM 239   H HB2  . PHE A 1 17 ? -11.430 8.368   -0.599  1.00 0.00 ? 17 PHE A HB2  1  
ATOM 240   H HB3  . PHE A 1 17 ? -10.324 7.949   -1.903  1.00 0.00 ? 17 PHE A HB3  1  
ATOM 241   H HD1  . PHE A 1 17 ? -12.130 6.248   0.887   1.00 0.00 ? 17 PHE A HD1  1  
ATOM 242   H HD2  . PHE A 1 17 ? -10.871 6.129   -3.177  1.00 0.00 ? 17 PHE A HD2  1  
ATOM 243   H HE1  . PHE A 1 17 ? -13.300 4.104   0.591   1.00 0.00 ? 17 PHE A HE1  1  
ATOM 244   H HE2  . PHE A 1 17 ? -12.040 3.985   -3.480  1.00 0.00 ? 17 PHE A HE2  1  
ATOM 245   H HZ   . PHE A 1 17 ? -13.255 2.969   -1.594  1.00 0.00 ? 17 PHE A HZ   1  
ATOM 246   N N    . GLN A 1 18 ? -8.167  5.881   -0.988  1.00 0.00 ? 18 GLN A N    1  
ATOM 247   C CA   . GLN A 1 18 ? -7.523  4.579   -1.116  1.00 0.00 ? 18 GLN A CA   1  
ATOM 248   C C    . GLN A 1 18 ? -6.444  4.399   -0.054  1.00 0.00 ? 18 GLN A C    1  
ATOM 249   O O    . GLN A 1 18 ? -6.330  3.335   0.556   1.00 0.00 ? 18 GLN A O    1  
ATOM 250   C CB   . GLN A 1 18 ? -6.915  4.422   -2.510  1.00 0.00 ? 18 GLN A CB   1  
ATOM 251   C CG   . GLN A 1 18 ? -7.949  4.374   -3.624  1.00 0.00 ? 18 GLN A CG   1  
ATOM 252   C CD   . GLN A 1 18 ? -7.321  4.269   -4.999  1.00 0.00 ? 18 GLN A CD   1  
ATOM 253   O OE1  . GLN A 1 18 ? -6.170  4.658   -5.201  1.00 0.00 ? 18 GLN A OE1  1  
ATOM 254   N NE2  . GLN A 1 18 ? -8.075  3.740   -5.956  1.00 0.00 ? 18 GLN A NE2  1  
ATOM 255   H H    . GLN A 1 18 ? -8.025  6.555   -1.685  1.00 0.00 ? 18 GLN A H    1  
ATOM 256   H HA   . GLN A 1 18 ? -8.279  3.821   -0.975  1.00 0.00 ? 18 GLN A HA   1  
ATOM 257   H HB2  . GLN A 1 18 ? -6.253  5.255   -2.698  1.00 0.00 ? 18 GLN A HB2  1  
ATOM 258   H HB3  . GLN A 1 18 ? -6.344  3.505   -2.540  1.00 0.00 ? 18 GLN A HB3  1  
ATOM 259   H HG2  . GLN A 1 18 ? -8.586  3.516   -3.470  1.00 0.00 ? 18 GLN A HG2  1  
ATOM 260   H HG3  . GLN A 1 18 ? -8.543  5.275   -3.583  1.00 0.00 ? 18 GLN A HG3  1  
ATOM 261   H HE21 . GLN A 1 18 ? -8.983  3.453   -5.723  1.00 0.00 ? 18 GLN A HE21 1  
ATOM 262   H HE22 . GLN A 1 18 ? -7.694  3.661   -6.855  1.00 0.00 ? 18 GLN A HE22 1  
ATOM 263   N N    . LEU A 1 19 ? -5.653  5.444   0.162   1.00 0.00 ? 19 LEU A N    1  
ATOM 264   C CA   . LEU A 1 19 ? -4.582  5.402   1.151   1.00 0.00 ? 19 LEU A CA   1  
ATOM 265   C C    . LEU A 1 19 ? -5.143  5.187   2.553   1.00 0.00 ? 19 LEU A C    1  
ATOM 266   O O    . LEU A 1 19 ? -4.806  4.213   3.225   1.00 0.00 ? 19 LEU A O    1  
ATOM 267   C CB   . LEU A 1 19 ? -3.769  6.697   1.107   1.00 0.00 ? 19 LEU A CB   1  
ATOM 268   C CG   . LEU A 1 19 ? -2.624  6.737   0.094   1.00 0.00 ? 19 LEU A CG   1  
ATOM 269   C CD1  . LEU A 1 19 ? -1.770  7.978   0.302   1.00 0.00 ? 19 LEU A CD1  1  
ATOM 270   C CD2  . LEU A 1 19 ? -1.775  5.479   0.198   1.00 0.00 ? 19 LEU A CD2  1  
ATOM 271   H H    . LEU A 1 19 ? -5.792  6.265   -0.355  1.00 0.00 ? 19 LEU A H    1  
ATOM 272   H HA   . LEU A 1 19 ? -3.936  4.572   0.904   1.00 0.00 ? 19 LEU A HA   1  
ATOM 273   H HB2  . LEU A 1 19 ? -4.445  7.504   0.874   1.00 0.00 ? 19 LEU A HB2  1  
ATOM 274   H HB3  . LEU A 1 19 ? -3.347  6.855   2.090   1.00 0.00 ? 19 LEU A HB3  1  
ATOM 275   H HG   . LEU A 1 19 ? -3.038  6.781   -0.905  1.00 0.00 ? 19 LEU A HG   1  
ATOM 276   H HD11 . LEU A 1 19 ? -1.123  7.831   1.153   1.00 0.00 ? 19 LEU A HD11 1  
ATOM 277   H HD12 . LEU A 1 19 ? -2.410  8.830   0.480   1.00 0.00 ? 19 LEU A HD12 1  
ATOM 278   H HD13 . LEU A 1 19 ? -1.173  8.156   -0.580  1.00 0.00 ? 19 LEU A HD13 1  
ATOM 279   H HD21 . LEU A 1 19 ? -2.085  4.772   -0.557  1.00 0.00 ? 19 LEU A HD21 1  
ATOM 280   H HD22 . LEU A 1 19 ? -1.902  5.039   1.177   1.00 0.00 ? 19 LEU A HD22 1  
ATOM 281   H HD23 . LEU A 1 19 ? -0.736  5.733   0.049   1.00 0.00 ? 19 LEU A HD23 1  
ATOM 282   N N    . ALA A 1 20 ? -6.002  6.104   2.988   1.00 0.00 ? 20 ALA A N    1  
ATOM 283   C CA   . ALA A 1 20 ? -6.613  6.013   4.308   1.00 0.00 ? 20 ALA A CA   1  
ATOM 284   C C    . ALA A 1 20 ? -6.856  4.560   4.701   1.00 0.00 ? 20 ALA A C    1  
ATOM 285   O O    . ALA A 1 20 ? -6.302  4.072   5.686   1.00 0.00 ? 20 ALA A O    1  
ATOM 286   C CB   . ALA A 1 20 ? -7.917  6.796   4.341   1.00 0.00 ? 20 ALA A CB   1  
ATOM 287   H H    . ALA A 1 20 ? -6.230  6.858   2.406   1.00 0.00 ? 20 ALA A H    1  
ATOM 288   H HA   . ALA A 1 20 ? -5.935  6.459   5.021   1.00 0.00 ? 20 ALA A HA   1  
ATOM 289   H HB1  . ALA A 1 20 ? -8.358  6.717   5.324   1.00 0.00 ? 20 ALA A HB1  1  
ATOM 290   H HB2  . ALA A 1 20 ? -7.719  7.834   4.117   1.00 0.00 ? 20 ALA A HB2  1  
ATOM 291   H HB3  . ALA A 1 20 ? -8.597  6.392   3.607   1.00 0.00 ? 20 ALA A HB3  1  
ATOM 292   N N    . ALA A 1 21 ? -7.690  3.873   3.926   1.00 0.00 ? 21 ALA A N    1  
ATOM 293   C CA   . ALA A 1 21 ? -8.005  2.476   4.192   1.00 0.00 ? 21 ALA A CA   1  
ATOM 294   C C    . ALA A 1 21 ? -6.750  1.610   4.145   1.00 0.00 ? 21 ALA A C    1  
ATOM 295   O O    . ALA A 1 21 ? -6.529  0.771   5.019   1.00 0.00 ? 21 ALA A O    1  
ATOM 296   C CB   . ALA A 1 21 ? -9.037  1.968   3.196   1.00 0.00 ? 21 ALA A CB   1  
ATOM 297   H H    . ALA A 1 21 ? -8.100  4.317   3.155   1.00 0.00 ? 21 ALA A H    1  
ATOM 298   H HA   . ALA A 1 21 ? -8.436  2.414   5.182   1.00 0.00 ? 21 ALA A HA   1  
ATOM 299   H HB1  . ALA A 1 21 ? -8.987  2.561   2.294   1.00 0.00 ? 21 ALA A HB1  1  
ATOM 300   H HB2  . ALA A 1 21 ? -8.830  0.935   2.959   1.00 0.00 ? 21 ALA A HB2  1  
ATOM 301   H HB3  . ALA A 1 21 ? -10.023 2.049   3.627   1.00 0.00 ? 21 ALA A HB3  1  
ATOM 302   N N    . LEU A 1 22 ? -5.932  1.819   3.119   1.00 0.00 ? 22 LEU A N    1  
ATOM 303   C CA   . LEU A 1 22 ? -4.699  1.058   2.957   1.00 0.00 ? 22 LEU A CA   1  
ATOM 304   C C    . LEU A 1 22 ? -3.841  1.135   4.217   1.00 0.00 ? 22 LEU A C    1  
ATOM 305   O O    . LEU A 1 22 ? -3.650  0.137   4.910   1.00 0.00 ? 22 LEU A O    1  
ATOM 306   C CB   . LEU A 1 22 ? -3.908  1.579   1.756   1.00 0.00 ? 22 LEU A CB   1  
ATOM 307   C CG   . LEU A 1 22 ? -4.409  1.138   0.380   1.00 0.00 ? 22 LEU A CG   1  
ATOM 308   C CD1  . LEU A 1 22 ? -3.729  1.941   -0.718  1.00 0.00 ? 22 LEU A CD1  1  
ATOM 309   C CD2  . LEU A 1 22 ? -4.174  -0.351  0.179   1.00 0.00 ? 22 LEU A CD2  1  
ATOM 310   H H    . LEU A 1 22 ? -6.162  2.502   2.455   1.00 0.00 ? 22 LEU A H    1  
ATOM 311   H HA   . LEU A 1 22 ? -4.967  0.027   2.782   1.00 0.00 ? 22 LEU A HA   1  
ATOM 312   H HB2  . LEU A 1 22 ? -3.933  2.657   1.787   1.00 0.00 ? 22 LEU A HB2  1  
ATOM 313   H HB3  . LEU A 1 22 ? -2.887  1.241   1.861   1.00 0.00 ? 22 LEU A HB3  1  
ATOM 314   H HG   . LEU A 1 22 ? -5.473  1.321   0.316   1.00 0.00 ? 22 LEU A HG   1  
ATOM 315   H HD11 . LEU A 1 22 ? -3.047  1.304   -1.259  1.00 0.00 ? 22 LEU A HD11 1  
ATOM 316   H HD12 . LEU A 1 22 ? -3.183  2.762   -0.278  1.00 0.00 ? 22 LEU A HD12 1  
ATOM 317   H HD13 . LEU A 1 22 ? -4.476  2.328   -1.396  1.00 0.00 ? 22 LEU A HD13 1  
ATOM 318   H HD21 . LEU A 1 22 ? -4.041  -0.827  1.139   1.00 0.00 ? 22 LEU A HD21 1  
ATOM 319   H HD22 . LEU A 1 22 ? -3.286  -0.497  -0.421  1.00 0.00 ? 22 LEU A HD22 1  
ATOM 320   H HD23 . LEU A 1 22 ? -5.024  -0.786  -0.325  1.00 0.00 ? 22 LEU A HD23 1  
ATOM 321   N N    . GLN A 1 23 ? -3.330  2.327   4.506   1.00 0.00 ? 23 GLN A N    1  
ATOM 322   C CA   . GLN A 1 23 ? -2.495  2.534   5.683   1.00 0.00 ? 23 GLN A CA   1  
ATOM 323   C C    . GLN A 1 23 ? -3.197  2.039   6.943   1.00 0.00 ? 23 GLN A C    1  
ATOM 324   O O    . GLN A 1 23 ? -2.572  1.441   7.819   1.00 0.00 ? 23 GLN A O    1  
ATOM 325   C CB   . GLN A 1 23 ? -2.143  4.016   5.831   1.00 0.00 ? 23 GLN A CB   1  
ATOM 326   C CG   . GLN A 1 23 ? -0.967  4.450   4.971   1.00 0.00 ? 23 GLN A CG   1  
ATOM 327   C CD   . GLN A 1 23 ? -0.374  5.772   5.418   1.00 0.00 ? 23 GLN A CD   1  
ATOM 328   O OE1  . GLN A 1 23 ? -0.266  6.044   6.614   1.00 0.00 ? 23 GLN A OE1  1  
ATOM 329   N NE2  . GLN A 1 23 ? 0.014   6.602   4.457   1.00 0.00 ? 23 GLN A NE2  1  
ATOM 330   H H    . GLN A 1 23 ? -3.519  3.085   3.915   1.00 0.00 ? 23 GLN A H    1  
ATOM 331   H HA   . GLN A 1 23 ? -1.585  1.970   5.548   1.00 0.00 ? 23 GLN A HA   1  
ATOM 332   H HB2  . GLN A 1 23 ? -3.003  4.607   5.553   1.00 0.00 ? 23 GLN A HB2  1  
ATOM 333   H HB3  . GLN A 1 23 ? -1.898  4.214   6.864   1.00 0.00 ? 23 GLN A HB3  1  
ATOM 334   H HG2  . GLN A 1 23 ? -0.199  3.693   5.024   1.00 0.00 ? 23 GLN A HG2  1  
ATOM 335   H HG3  . GLN A 1 23 ? -1.303  4.550   3.949   1.00 0.00 ? 23 GLN A HG3  1  
ATOM 336   H HE21 . GLN A 1 23 ? -0.104  6.318   3.525   1.00 0.00 ? 23 GLN A HE21 1  
ATOM 337   H HE22 . GLN A 1 23 ? 0.400   7.463   4.717   1.00 0.00 ? 23 GLN A HE22 1  
ATOM 338   N N    . ARG A 1 24 ? -4.499  2.291   7.027   1.00 0.00 ? 24 ARG A N    1  
ATOM 339   C CA   . ARG A 1 24 ? -5.286  1.872   8.181   1.00 0.00 ? 24 ARG A CA   1  
ATOM 340   C C    . ARG A 1 24 ? -5.301  0.351   8.305   1.00 0.00 ? 24 ARG A C    1  
ATOM 341   O O    . ARG A 1 24 ? -5.493  -0.191  9.394   1.00 0.00 ? 24 ARG A O    1  
ATOM 342   C CB   . ARG A 1 24 ? -6.718  2.399   8.068   1.00 0.00 ? 24 ARG A CB   1  
ATOM 343   C CG   . ARG A 1 24 ? -6.912  3.773   8.688   1.00 0.00 ? 24 ARG A CG   1  
ATOM 344   C CD   . ARG A 1 24 ? -8.379  4.053   8.975   1.00 0.00 ? 24 ARG A CD   1  
ATOM 345   N NE   . ARG A 1 24 ? -9.136  4.310   7.753   1.00 0.00 ? 24 ARG A NE   1  
ATOM 346   C CZ   . ARG A 1 24 ? -10.439 4.566   7.736   1.00 0.00 ? 24 ARG A CZ   1  
ATOM 347   N NH1  . ARG A 1 24 ? -11.126 4.599   8.870   1.00 0.00 ? 24 ARG A NH1  1  
ATOM 348   N NH2  . ARG A 1 24 ? -11.058 4.789   6.584   1.00 0.00 ? 24 ARG A NH2  1  
ATOM 349   H H    . ARG A 1 24 ? -4.941  2.772   6.297   1.00 0.00 ? 24 ARG A H    1  
ATOM 350   H HA   . ARG A 1 24 ? -4.827  2.289   9.065   1.00 0.00 ? 24 ARG A HA   1  
ATOM 351   H HB2  . ARG A 1 24 ? -6.985  2.459   7.023   1.00 0.00 ? 24 ARG A HB2  1  
ATOM 352   H HB3  . ARG A 1 24 ? -7.383  1.708   8.562   1.00 0.00 ? 24 ARG A HB3  1  
ATOM 353   H HG2  . ARG A 1 24 ? -6.360  3.820   9.615   1.00 0.00 ? 24 ARG A HG2  1  
ATOM 354   H HG3  . ARG A 1 24 ? -6.538  4.522   8.006   1.00 0.00 ? 24 ARG A HG3  1  
ATOM 355   H HD2  . ARG A 1 24 ? -8.803  3.196   9.477   1.00 0.00 ? 24 ARG A HD2  1  
ATOM 356   H HD3  . ARG A 1 24 ? -8.447  4.917   9.619   1.00 0.00 ? 24 ARG A HD3  1  
ATOM 357   H HE   . ARG A 1 24 ? -8.648  4.290   6.904   1.00 0.00 ? 24 ARG A HE   1  
ATOM 358   H HH11 . ARG A 1 24 ? -10.662 4.431   9.740   1.00 0.00 ? 24 ARG A HH11 1  
ATOM 359   H HH12 . ARG A 1 24 ? -12.107 4.793   8.855   1.00 0.00 ? 24 ARG A HH12 1  
ATOM 360   H HH21 . ARG A 1 24 ? -10.543 4.765   5.727   1.00 0.00 ? 24 ARG A HH21 1  
ATOM 361   H HH22 . ARG A 1 24 ? -12.039 4.982   6.572   1.00 0.00 ? 24 ARG A HH22 1  
ATOM 362   N N    . ARG A 1 25 ? -5.097  -0.331  7.183   1.00 0.00 ? 25 ARG A N    1  
ATOM 363   C CA   . ARG A 1 25 ? -5.089  -1.789  7.166   1.00 0.00 ? 25 ARG A CA   1  
ATOM 364   C C    . ARG A 1 25 ? -3.679  -2.327  7.391   1.00 0.00 ? 25 ARG A C    1  
ATOM 365   O O    . ARG A 1 25 ? -3.493  -3.354  8.044   1.00 0.00 ? 25 ARG A O    1  
ATOM 366   C CB   . ARG A 1 25 ? -5.638  -2.307  5.835   1.00 0.00 ? 25 ARG A CB   1  
ATOM 367   C CG   . ARG A 1 25 ? -5.719  -3.823  5.759   1.00 0.00 ? 25 ARG A CG   1  
ATOM 368   C CD   . ARG A 1 25 ? -6.793  -4.371  6.685   1.00 0.00 ? 25 ARG A CD   1  
ATOM 369   N NE   . ARG A 1 25 ? -8.104  -4.409  6.041   1.00 0.00 ? 25 ARG A NE   1  
ATOM 370   C CZ   . ARG A 1 25 ? -9.211  -4.815  6.652   1.00 0.00 ? 25 ARG A CZ   1  
ATOM 371   N NH1  . ARG A 1 25 ? -9.167  -5.214  7.915   1.00 0.00 ? 25 ARG A NH1  1  
ATOM 372   N NH2  . ARG A 1 25 ? -10.366 -4.820  5.998   1.00 0.00 ? 25 ARG A NH2  1  
ATOM 373   H H    . ARG A 1 25 ? -4.950  0.158   6.346   1.00 0.00 ? 25 ARG A H    1  
ATOM 374   H HA   . ARG A 1 25 ? -5.726  -2.134  7.966   1.00 0.00 ? 25 ARG A HA   1  
ATOM 375   H HB2  . ARG A 1 25 ? -6.631  -1.908  5.688   1.00 0.00 ? 25 ARG A HB2  1  
ATOM 376   H HB3  . ARG A 1 25 ? -4.998  -1.962  5.037   1.00 0.00 ? 25 ARG A HB3  1  
ATOM 377   H HG2  . ARG A 1 25 ? -5.952  -4.112  4.745   1.00 0.00 ? 25 ARG A HG2  1  
ATOM 378   H HG3  . ARG A 1 25 ? -4.764  -4.240  6.043   1.00 0.00 ? 25 ARG A HG3  1  
ATOM 379   H HD2  . ARG A 1 25 ? -6.519  -5.373  6.980   1.00 0.00 ? 25 ARG A HD2  1  
ATOM 380   H HD3  . ARG A 1 25 ? -6.851  -3.741  7.560   1.00 0.00 ? 25 ARG A HD3  1  
ATOM 381   H HE   . ARG A 1 25 ? -8.159  -4.118  5.107   1.00 0.00 ? 25 ARG A HE   1  
ATOM 382   H HH11 . ARG A 1 25 ? -8.299  -5.210  8.410   1.00 0.00 ? 25 ARG A HH11 1  
ATOM 383   H HH12 . ARG A 1 25 ? -10.003 -5.518  8.373   1.00 0.00 ? 25 ARG A HH12 1  
ATOM 384   H HH21 . ARG A 1 25 ? -10.403 -4.520  5.046   1.00 0.00 ? 25 ARG A HH21 1  
ATOM 385   H HH22 . ARG A 1 25 ? -11.199 -5.126  6.459   1.00 0.00 ? 25 ARG A HH22 1  
ATOM 386   N N    . PHE A 1 26 ? -2.690  -1.627  6.847   1.00 0.00 ? 26 PHE A N    1  
ATOM 387   C CA   . PHE A 1 26 ? -1.297  -2.035  6.987   1.00 0.00 ? 26 PHE A CA   1  
ATOM 388   C C    . PHE A 1 26 ? -0.872  -2.025  8.453   1.00 0.00 ? 26 PHE A C    1  
ATOM 389   O O    . PHE A 1 26 ? -0.291  -2.991  8.947   1.00 0.00 ? 26 PHE A O    1  
ATOM 390   C CB   . PHE A 1 26 ? -0.388  -1.110  6.175   1.00 0.00 ? 26 PHE A CB   1  
ATOM 391   C CG   . PHE A 1 26 ? 1.069   -1.460  6.278   1.00 0.00 ? 26 PHE A CG   1  
ATOM 392   C CD1  . PHE A 1 26 ? 1.801   -1.109  7.401   1.00 0.00 ? 26 PHE A CD1  1  
ATOM 393   C CD2  . PHE A 1 26 ? 1.707   -2.139  5.253   1.00 0.00 ? 26 PHE A CD2  1  
ATOM 394   C CE1  . PHE A 1 26 ? 3.142   -1.429  7.498   1.00 0.00 ? 26 PHE A CE1  1  
ATOM 395   C CE2  . PHE A 1 26 ? 3.047   -2.462  5.344   1.00 0.00 ? 26 PHE A CE2  1  
ATOM 396   C CZ   . PHE A 1 26 ? 3.766   -2.107  6.469   1.00 0.00 ? 26 PHE A CZ   1  
ATOM 397   H H    . PHE A 1 26 ? -2.902  -0.816  6.338   1.00 0.00 ? 26 PHE A H    1  
ATOM 398   H HA   . PHE A 1 26 ? -1.207  -3.040  6.605   1.00 0.00 ? 26 PHE A HA   1  
ATOM 399   H HB2  . PHE A 1 26 ? -0.669  -1.165  5.134   1.00 0.00 ? 26 PHE A HB2  1  
ATOM 400   H HB3  . PHE A 1 26 ? -0.513  -0.097  6.525   1.00 0.00 ? 26 PHE A HB3  1  
ATOM 401   H HD1  . PHE A 1 26 ? 1.315   -0.580  8.207   1.00 0.00 ? 26 PHE A HD1  1  
ATOM 402   H HD2  . PHE A 1 26 ? 1.145   -2.417  4.372   1.00 0.00 ? 26 PHE A HD2  1  
ATOM 403   H HE1  . PHE A 1 26 ? 3.702   -1.150  8.379   1.00 0.00 ? 26 PHE A HE1  1  
ATOM 404   H HE2  . PHE A 1 26 ? 3.532   -2.992  4.538   1.00 0.00 ? 26 PHE A HE2  1  
ATOM 405   H HZ   . PHE A 1 26 ? 4.813   -2.358  6.543   1.00 0.00 ? 26 PHE A HZ   1  
ATOM 406   N N    . GLN A 1 27 ? -1.167  -0.926  9.140   1.00 0.00 ? 27 GLN A N    1  
ATOM 407   C CA   . GLN A 1 27 ? -0.814  -0.790  10.549  1.00 0.00 ? 27 GLN A CA   1  
ATOM 408   C C    . GLN A 1 27 ? -1.248  -2.019  11.340  1.00 0.00 ? 27 GLN A C    1  
ATOM 409   O O    . GLN A 1 27 ? -0.576  -2.431  12.286  1.00 0.00 ? 27 GLN A O    1  
ATOM 410   C CB   . GLN A 1 27 ? -1.460  0.465   11.138  1.00 0.00 ? 27 GLN A CB   1  
ATOM 411   C CG   . GLN A 1 27 ? -2.978  0.402   11.189  1.00 0.00 ? 27 GLN A CG   1  
ATOM 412   C CD   . GLN A 1 27 ? -3.587  1.580   11.922  1.00 0.00 ? 27 GLN A CD   1  
ATOM 413   O OE1  . GLN A 1 27 ? -2.923  2.237   12.725  1.00 0.00 ? 27 GLN A OE1  1  
ATOM 414   N NE2  . GLN A 1 27 ? -4.857  1.855   11.650  1.00 0.00 ? 27 GLN A NE2  1  
ATOM 415   H H    . GLN A 1 27 ? -1.631  -0.191  8.690   1.00 0.00 ? 27 GLN A H    1  
ATOM 416   H HA   . GLN A 1 27 ? 0.259   -0.696  10.614  1.00 0.00 ? 27 GLN A HA   1  
ATOM 417   H HB2  . GLN A 1 27 ? -1.093  0.606   12.144  1.00 0.00 ? 27 GLN A HB2  1  
ATOM 418   H HB3  . GLN A 1 27 ? -1.177  1.317   10.538  1.00 0.00 ? 27 GLN A HB3  1  
ATOM 419   H HG2  . GLN A 1 27 ? -3.359  0.390   10.179  1.00 0.00 ? 27 GLN A HG2  1  
ATOM 420   H HG3  . GLN A 1 27 ? -3.270  -0.508  11.693  1.00 0.00 ? 27 GLN A HG3  1  
ATOM 421   H HE21 . GLN A 1 27 ? -5.324  1.288   11.000  1.00 0.00 ? 27 GLN A HE21 1  
ATOM 422   H HE22 . GLN A 1 27 ? -5.277  2.611   12.110  1.00 0.00 ? 27 GLN A HE22 1  
ATOM 423   N N    . LYS A 1 28 ? -2.376  -2.602  10.947  1.00 0.00 ? 28 LYS A N    1  
ATOM 424   C CA   . LYS A 1 28 ? -2.901  -3.785  11.619  1.00 0.00 ? 28 LYS A CA   1  
ATOM 425   C C    . LYS A 1 28 ? -2.026  -5.002  11.338  1.00 0.00 ? 28 LYS A C    1  
ATOM 426   O O    . LYS A 1 28 ? -1.730  -5.789  12.239  1.00 0.00 ? 28 LYS A O    1  
ATOM 427   C CB   . LYS A 1 28 ? -4.336  -4.060  11.165  1.00 0.00 ? 28 LYS A CB   1  
ATOM 428   C CG   . LYS A 1 28 ? -5.366  -3.157  11.822  1.00 0.00 ? 28 LYS A CG   1  
ATOM 429   C CD   . LYS A 1 28 ? -5.559  -3.508  13.288  1.00 0.00 ? 28 LYS A CD   1  
ATOM 430   C CE   . LYS A 1 28 ? -6.918  -3.050  13.796  1.00 0.00 ? 28 LYS A CE   1  
ATOM 431   N NZ   . LYS A 1 28 ? -7.055  -1.568  13.754  1.00 0.00 ? 28 LYS A NZ   1  
ATOM 432   H H    . LYS A 1 28 ? -2.868  -2.226  10.186  1.00 0.00 ? 28 LYS A H    1  
ATOM 433   H HA   . LYS A 1 28 ? -2.899  -3.592  12.681  1.00 0.00 ? 28 LYS A HA   1  
ATOM 434   H HB2  . LYS A 1 28 ? -4.396  -3.919  10.095  1.00 0.00 ? 28 LYS A HB2  1  
ATOM 435   H HB3  . LYS A 1 28 ? -4.585  -5.085  11.399  1.00 0.00 ? 28 LYS A HB3  1  
ATOM 436   H HG2  . LYS A 1 28 ? -5.032  -2.133  11.749  1.00 0.00 ? 28 LYS A HG2  1  
ATOM 437   H HG3  . LYS A 1 28 ? -6.309  -3.268  11.307  1.00 0.00 ? 28 LYS A HG3  1  
ATOM 438   H HD2  . LYS A 1 28 ? -5.485  -4.578  13.406  1.00 0.00 ? 28 LYS A HD2  1  
ATOM 439   H HD3  . LYS A 1 28 ? -4.786  -3.025  13.870  1.00 0.00 ? 28 LYS A HD3  1  
ATOM 440   H HE2  . LYS A 1 28 ? -7.685  -3.492  13.179  1.00 0.00 ? 28 LYS A HE2  1  
ATOM 441   H HE3  . LYS A 1 28 ? -7.038  -3.386  14.816  1.00 0.00 ? 28 LYS A HE3  1  
ATOM 442   H HZ1  . LYS A 1 28 ? -6.208  -1.143  13.325  1.00 0.00 ? 28 LYS A HZ1  1  
ATOM 443   H HZ2  . LYS A 1 28 ? -7.168  -1.192  14.717  1.00 0.00 ? 28 LYS A HZ2  1  
ATOM 444   H HZ3  . LYS A 1 28 ? -7.887  -1.302  13.190  1.00 0.00 ? 28 LYS A HZ3  1  
ATOM 445   N N    . THR A 1 29 ? -1.612  -5.152  10.083  1.00 0.00 ? 29 THR A N    1  
ATOM 446   C CA   . THR A 1 29 ? -0.771  -6.273  9.685   1.00 0.00 ? 29 THR A CA   1  
ATOM 447   C C    . THR A 1 29 ? -0.047  -5.979  8.376   1.00 0.00 ? 29 THR A C    1  
ATOM 448   O O    . THR A 1 29 ? -0.589  -5.315  7.493   1.00 0.00 ? 29 THR A O    1  
ATOM 449   C CB   . THR A 1 29 ? -1.595  -7.565  9.524   1.00 0.00 ? 29 THR A CB   1  
ATOM 450   O OG1  . THR A 1 29 ? -0.728  -8.665  9.226   1.00 0.00 ? 29 THR A OG1  1  
ATOM 451   C CG2  . THR A 1 29 ? -2.629  -7.413  8.418   1.00 0.00 ? 29 THR A CG2  1  
ATOM 452   H H    . THR A 1 29 ? -1.881  -4.492  9.411   1.00 0.00 ? 29 THR A H    1  
ATOM 453   H HA   . THR A 1 29 ? -0.038  -6.433  10.462  1.00 0.00 ? 29 THR A HA   1  
ATOM 454   H HB   . THR A 1 29 ? -2.110  -7.763  10.453  1.00 0.00 ? 29 THR A HB   1  
ATOM 455   H HG1  . THR A 1 29 ? -0.087  -8.768  9.933   1.00 0.00 ? 29 THR A HG1  1  
ATOM 456   H HG21 . THR A 1 29 ? -2.161  -6.982  7.545   1.00 0.00 ? 29 THR A HG21 1  
ATOM 457   H HG22 . THR A 1 29 ? -3.425  -6.767  8.756   1.00 0.00 ? 29 THR A HG22 1  
ATOM 458   H HG23 . THR A 1 29 ? -3.033  -8.382  8.168   1.00 0.00 ? 29 THR A HG23 1  
ATOM 459   N N    . GLN A 1 30 ? 1.179   -6.478  8.258   1.00 0.00 ? 30 GLN A N    1  
ATOM 460   C CA   . GLN A 1 30 ? 1.977   -6.268  7.055   1.00 0.00 ? 30 GLN A CA   1  
ATOM 461   C C    . GLN A 1 30 ? 1.510   -7.181  5.926   1.00 0.00 ? 30 GLN A C    1  
ATOM 462   O O    . GLN A 1 30 ? 1.571   -6.814  4.753   1.00 0.00 ? 30 GLN A O    1  
ATOM 463   C CB   . GLN A 1 30 ? 3.457   -6.517  7.350   1.00 0.00 ? 30 GLN A CB   1  
ATOM 464   C CG   . GLN A 1 30 ? 4.155   -5.334  8.000   1.00 0.00 ? 30 GLN A CG   1  
ATOM 465   C CD   . GLN A 1 30 ? 5.324   -5.753  8.871   1.00 0.00 ? 30 GLN A CD   1  
ATOM 466   O OE1  . GLN A 1 30 ? 5.206   -6.662  9.692   1.00 0.00 ? 30 GLN A OE1  1  
ATOM 467   N NE2  . GLN A 1 30 ? 6.460   -5.089  8.696   1.00 0.00 ? 30 GLN A NE2  1  
ATOM 468   H H    . GLN A 1 30 ? 1.556   -6.999  8.997   1.00 0.00 ? 30 GLN A H    1  
ATOM 469   H HA   . GLN A 1 30 ? 1.848   -5.241  6.748   1.00 0.00 ? 30 GLN A HA   1  
ATOM 470   H HB2  . GLN A 1 30 ? 3.542   -7.366  8.011   1.00 0.00 ? 30 GLN A HB2  1  
ATOM 471   H HB3  . GLN A 1 30 ? 3.963   -6.741  6.422   1.00 0.00 ? 30 GLN A HB3  1  
ATOM 472   H HG2  . GLN A 1 30 ? 4.522   -4.678  7.224   1.00 0.00 ? 30 GLN A HG2  1  
ATOM 473   H HG3  . GLN A 1 30 ? 3.441   -4.803  8.611   1.00 0.00 ? 30 GLN A HG3  1  
ATOM 474   H HE21 . GLN A 1 30 ? 6.480   -4.375  8.024   1.00 0.00 ? 30 GLN A HE21 1  
ATOM 475   H HE22 . GLN A 1 30 ? 7.231   -5.338  9.246   1.00 0.00 ? 30 GLN A HE22 1  
ATOM 476   N N    . TYR A 1 31 ? 1.043   -8.371  6.289   1.00 0.00 ? 31 TYR A N    1  
ATOM 477   C CA   . TYR A 1 31 ? 0.568   -9.337  5.306   1.00 0.00 ? 31 TYR A CA   1  
ATOM 478   C C    . TYR A 1 31 ? -0.955  -9.414  5.310   1.00 0.00 ? 31 TYR A C    1  
ATOM 479   O O    . TYR A 1 31 ? -1.593  -9.289  6.356   1.00 0.00 ? 31 TYR A O    1  
ATOM 480   C CB   . TYR A 1 31 ? 1.161   -10.718 5.590   1.00 0.00 ? 31 TYR A CB   1  
ATOM 481   C CG   . TYR A 1 31 ? 2.541   -10.918 5.005   1.00 0.00 ? 31 TYR A CG   1  
ATOM 482   C CD1  . TYR A 1 31 ? 3.556   -9.998  5.238   1.00 0.00 ? 31 TYR A CD1  1  
ATOM 483   C CD2  . TYR A 1 31 ? 2.829   -12.027 4.219   1.00 0.00 ? 31 TYR A CD2  1  
ATOM 484   C CE1  . TYR A 1 31 ? 4.817   -10.177 4.705   1.00 0.00 ? 31 TYR A CE1  1  
ATOM 485   C CE2  . TYR A 1 31 ? 4.089   -12.214 3.683   1.00 0.00 ? 31 TYR A CE2  1  
ATOM 486   C CZ   . TYR A 1 31 ? 5.079   -11.286 3.928   1.00 0.00 ? 31 TYR A CZ   1  
ATOM 487   O OH   . TYR A 1 31 ? 6.335   -11.467 3.396   1.00 0.00 ? 31 TYR A OH   1  
ATOM 488   H H    . TYR A 1 31 ? 1.019   -8.606  7.240   1.00 0.00 ? 31 TYR A H    1  
ATOM 489   H HA   . TYR A 1 31 ? 0.899   -9.009  4.331   1.00 0.00 ? 31 TYR A HA   1  
ATOM 490   H HB2  . TYR A 1 31 ? 1.231   -10.860 6.658   1.00 0.00 ? 31 TYR A HB2  1  
ATOM 491   H HB3  . TYR A 1 31 ? 0.511   -11.474 5.174   1.00 0.00 ? 31 TYR A HB3  1  
ATOM 492   H HD1  . TYR A 1 31 ? 3.347   -9.131  5.848   1.00 0.00 ? 31 TYR A HD1  1  
ATOM 493   H HD2  . TYR A 1 31 ? 2.051   -12.752 4.029   1.00 0.00 ? 31 TYR A HD2  1  
ATOM 494   H HE1  . TYR A 1 31 ? 5.593   -9.450  4.897   1.00 0.00 ? 31 TYR A HE1  1  
ATOM 495   H HE2  . TYR A 1 31 ? 4.294   -13.082 3.074   1.00 0.00 ? 31 TYR A HE2  1  
ATOM 496   H HH   . TYR A 1 31 ? 6.912   -10.758 3.689   1.00 0.00 ? 31 TYR A HH   1  
ATOM 497   N N    . LEU A 1 32 ? -1.533  -9.622  4.132   1.00 0.00 ? 32 LEU A N    1  
ATOM 498   C CA   . LEU A 1 32 ? -2.983  -9.717  3.997   1.00 0.00 ? 32 LEU A CA   1  
ATOM 499   C C    . LEU A 1 32 ? -3.382  -11.028 3.328   1.00 0.00 ? 32 LEU A C    1  
ATOM 500   O O    . LEU A 1 32 ? -2.872  -11.374 2.263   1.00 0.00 ? 32 LEU A O    1  
ATOM 501   C CB   . LEU A 1 32 ? -3.518  -8.535  3.187   1.00 0.00 ? 32 LEU A CB   1  
ATOM 502   C CG   . LEU A 1 32 ? -3.563  -7.190  3.913   1.00 0.00 ? 32 LEU A CG   1  
ATOM 503   C CD1  . LEU A 1 32 ? -4.331  -6.165  3.092   1.00 0.00 ? 32 LEU A CD1  1  
ATOM 504   C CD2  . LEU A 1 32 ? -4.190  -7.348  5.291   1.00 0.00 ? 32 LEU A CD2  1  
ATOM 505   H H    . LEU A 1 32 ? -0.973  -9.714  3.333   1.00 0.00 ? 32 LEU A H    1  
ATOM 506   H HA   . LEU A 1 32 ? -3.410  -9.687  4.988   1.00 0.00 ? 32 LEU A HA   1  
ATOM 507   H HB2  . LEU A 1 32 ? -2.891  -8.419  2.317   1.00 0.00 ? 32 LEU A HB2  1  
ATOM 508   H HB3  . LEU A 1 32 ? -4.524  -8.777  2.874   1.00 0.00 ? 32 LEU A HB3  1  
ATOM 509   H HG   . LEU A 1 32 ? -2.554  -6.824  4.044   1.00 0.00 ? 32 LEU A HG   1  
ATOM 510   H HD11 . LEU A 1 32 ? -5.035  -6.673  2.450   1.00 0.00 ? 32 LEU A HD11 1  
ATOM 511   H HD12 . LEU A 1 32 ? -3.639  -5.597  2.488   1.00 0.00 ? 32 LEU A HD12 1  
ATOM 512   H HD13 . LEU A 1 32 ? -4.862  -5.498  3.754   1.00 0.00 ? 32 LEU A HD13 1  
ATOM 513   H HD21 . LEU A 1 32 ? -3.501  -7.867  5.941   1.00 0.00 ? 32 LEU A HD21 1  
ATOM 514   H HD22 . LEU A 1 32 ? -5.104  -7.918  5.207   1.00 0.00 ? 32 LEU A HD22 1  
ATOM 515   H HD23 . LEU A 1 32 ? -4.408  -6.374  5.702   1.00 0.00 ? 32 LEU A HD23 1  
ATOM 516   N N    . ALA A 1 33 ? -4.300  -11.753 3.960   1.00 0.00 ? 33 ALA A N    1  
ATOM 517   C CA   . ALA A 1 33 ? -4.771  -13.024 3.424   1.00 0.00 ? 33 ALA A CA   1  
ATOM 518   C C    . ALA A 1 33 ? -5.353  -12.848 2.026   1.00 0.00 ? 33 ALA A C    1  
ATOM 519   O O    . ALA A 1 33 ? -5.343  -11.748 1.472   1.00 0.00 ? 33 ALA A O    1  
ATOM 520   C CB   . ALA A 1 33 ? -5.806  -13.638 4.356   1.00 0.00 ? 33 ALA A CB   1  
ATOM 521   H H    . ALA A 1 33 ? -4.669  -11.425 4.806   1.00 0.00 ? 33 ALA A H    1  
ATOM 522   H HA   . ALA A 1 33 ? -3.928  -13.697 3.370   1.00 0.00 ? 33 ALA A HA   1  
ATOM 523   H HB1  . ALA A 1 33 ? -5.820  -14.710 4.220   1.00 0.00 ? 33 ALA A HB1  1  
ATOM 524   H HB2  . ALA A 1 33 ? -5.551  -13.407 5.379   1.00 0.00 ? 33 ALA A HB2  1  
ATOM 525   H HB3  . ALA A 1 33 ? -6.781  -13.233 4.127   1.00 0.00 ? 33 ALA A HB3  1  
ATOM 526   N N    . LEU A 1 34 ? -5.860  -13.938 1.460   1.00 0.00 ? 34 LEU A N    1  
ATOM 527   C CA   . LEU A 1 34 ? -6.446  -13.904 0.125   1.00 0.00 ? 34 LEU A CA   1  
ATOM 528   C C    . LEU A 1 34 ? -7.623  -12.936 0.071   1.00 0.00 ? 34 LEU A C    1  
ATOM 529   O O    . LEU A 1 34 ? -7.626  -11.965 -0.687  1.00 0.00 ? 34 LEU A O    1  
ATOM 530   C CB   . LEU A 1 34 ? -6.904  -15.304 -0.288  1.00 0.00 ? 34 LEU A CB   1  
ATOM 531   C CG   . LEU A 1 34 ? -8.146  -15.369 -1.179  1.00 0.00 ? 34 LEU A CG   1  
ATOM 532   C CD1  . LEU A 1 34 ? -7.849  -14.784 -2.551  1.00 0.00 ? 34 LEU A CD1  1  
ATOM 533   C CD2  . LEU A 1 34 ? -8.638  -16.804 -1.303  1.00 0.00 ? 34 LEU A CD2  1  
ATOM 534   H H    . LEU A 1 34 ? -5.840  -14.786 1.951   1.00 0.00 ? 34 LEU A H    1  
ATOM 535   H HA   . LEU A 1 34 ? -5.685  -13.566 -0.563  1.00 0.00 ? 34 LEU A HA   1  
ATOM 536   H HB2  . LEU A 1 34 ? -6.091  -15.775 -0.819  1.00 0.00 ? 34 LEU A HB2  1  
ATOM 537   H HB3  . LEU A 1 34 ? -7.113  -15.862 0.614   1.00 0.00 ? 34 LEU A HB3  1  
ATOM 538   H HG   . LEU A 1 34 ? -8.934  -14.782 -0.729  1.00 0.00 ? 34 LEU A HG   1  
ATOM 539   H HD11 . LEU A 1 34 ? -7.473  -15.561 -3.199  1.00 0.00 ? 34 LEU A HD11 1  
ATOM 540   H HD12 . LEU A 1 34 ? -7.109  -14.004 -2.457  1.00 0.00 ? 34 LEU A HD12 1  
ATOM 541   H HD13 . LEU A 1 34 ? -8.756  -14.372 -2.969  1.00 0.00 ? 34 LEU A HD13 1  
ATOM 542   H HD21 . LEU A 1 34 ? -9.502  -16.943 -0.671  1.00 0.00 ? 34 LEU A HD21 1  
ATOM 543   H HD22 . LEU A 1 34 ? -7.854  -17.481 -0.997  1.00 0.00 ? 34 LEU A HD22 1  
ATOM 544   H HD23 . LEU A 1 34 ? -8.907  -17.004 -2.330  1.00 0.00 ? 34 LEU A HD23 1  
ATOM 545   N N    . PRO A 1 35 ? -8.647  -13.202 0.895   1.00 0.00 ? 35 PRO A N    1  
ATOM 546   C CA   . PRO A 1 35 ? -9.848  -12.364 0.962   1.00 0.00 ? 35 PRO A CA   1  
ATOM 547   C C    . PRO A 1 35 ? -9.570  -11.002 1.589   1.00 0.00 ? 35 PRO A C    1  
ATOM 548   O O    . PRO A 1 35 ? -10.368 -10.074 1.458   1.00 0.00 ? 35 PRO A O    1  
ATOM 549   C CB   . PRO A 1 35 ? -10.798 -13.175 1.846   1.00 0.00 ? 35 PRO A CB   1  
ATOM 550   C CG   . PRO A 1 35 ? -9.905  -14.024 2.683   1.00 0.00 ? 35 PRO A CG   1  
ATOM 551   C CD   . PRO A 1 35 ? -8.712  -14.342 1.825   1.00 0.00 ? 35 PRO A CD   1  
ATOM 552   H HA   . PRO A 1 35 ? -10.291 -12.226 -0.014  1.00 0.00 ? 35 PRO A HA   1  
ATOM 553   H HB2  . PRO A 1 35 ? -11.391 -12.505 2.453   1.00 0.00 ? 35 PRO A HB2  1  
ATOM 554   H HB3  . PRO A 1 35 ? -11.447 -13.777 1.226   1.00 0.00 ? 35 PRO A HB3  1  
ATOM 555   H HG2  . PRO A 1 35 ? -9.599  -13.478 3.563   1.00 0.00 ? 35 PRO A HG2  1  
ATOM 556   H HG3  . PRO A 1 35 ? -10.418 -14.932 2.963   1.00 0.00 ? 35 PRO A HG3  1  
ATOM 557   H HD2  . PRO A 1 35 ? -7.818  -14.399 2.428   1.00 0.00 ? 35 PRO A HD2  1  
ATOM 558   H HD3  . PRO A 1 35 ? -8.868  -15.267 1.290   1.00 0.00 ? 35 PRO A HD3  1  
ATOM 559   N N    . GLU A 1 36 ? -8.434  -10.890 2.270   1.00 0.00 ? 36 GLU A N    1  
ATOM 560   C CA   . GLU A 1 36 ? -8.052  -9.640  2.917   1.00 0.00 ? 36 GLU A CA   1  
ATOM 561   C C    . GLU A 1 36 ? -7.458  -8.663  1.906   1.00 0.00 ? 36 GLU A C    1  
ATOM 562   O O    . GLU A 1 36 ? -7.816  -7.486  1.881   1.00 0.00 ? 36 GLU A O    1  
ATOM 563   C CB   . GLU A 1 36 ? -7.045  -9.907  4.038   1.00 0.00 ? 36 GLU A CB   1  
ATOM 564   C CG   . GLU A 1 36 ? -7.686  -10.370 5.335   1.00 0.00 ? 36 GLU A CG   1  
ATOM 565   C CD   . GLU A 1 36 ? -8.727  -11.451 5.117   1.00 0.00 ? 36 GLU A CD   1  
ATOM 566   O OE1  . GLU A 1 36 ? -9.815  -11.132 4.594   1.00 0.00 ? 36 GLU A OE1  1  
ATOM 567   O OE2  . GLU A 1 36 ? -8.453  -12.618 5.470   1.00 0.00 ? 36 GLU A OE2  1  
ATOM 568   H H    . GLU A 1 36 ? -7.839  -11.665 2.339   1.00 0.00 ? 36 GLU A H    1  
ATOM 569   H HA   . GLU A 1 36 ? -8.942  -9.202  3.343   1.00 0.00 ? 36 GLU A HA   1  
ATOM 570   H HB2  . GLU A 1 36 ? -6.353  -10.669 3.709   1.00 0.00 ? 36 GLU A HB2  1  
ATOM 571   H HB3  . GLU A 1 36 ? -6.497  -8.998  4.236   1.00 0.00 ? 36 GLU A HB3  1  
ATOM 572   H HG2  . GLU A 1 36 ? -6.916  -10.760 5.983   1.00 0.00 ? 36 GLU A HG2  1  
ATOM 573   H HG3  . GLU A 1 36 ? -8.161  -9.524  5.809   1.00 0.00 ? 36 GLU A HG3  1  
ATOM 574   N N    . ARG A 1 37 ? -6.548  -9.161  1.076   1.00 0.00 ? 37 ARG A N    1  
ATOM 575   C CA   . ARG A 1 37 ? -5.902  -8.333  0.065   1.00 0.00 ? 37 ARG A CA   1  
ATOM 576   C C    . ARG A 1 37 ? -6.896  -7.922  -1.017  1.00 0.00 ? 37 ARG A C    1  
ATOM 577   O O    . ARG A 1 37 ? -6.823  -6.817  -1.555  1.00 0.00 ? 37 ARG A O    1  
ATOM 578   C CB   . ARG A 1 37 ? -4.727  -9.083  -0.566  1.00 0.00 ? 37 ARG A CB   1  
ATOM 579   C CG   . ARG A 1 37 ? -4.114  -8.364  -1.756  1.00 0.00 ? 37 ARG A CG   1  
ATOM 580   C CD   . ARG A 1 37 ? -3.110  -9.246  -2.482  1.00 0.00 ? 37 ARG A CD   1  
ATOM 581   N NE   . ARG A 1 37 ? -3.476  -10.658 -2.421  1.00 0.00 ? 37 ARG A NE   1  
ATOM 582   C CZ   . ARG A 1 37 ? -3.169  -11.453 -1.402  1.00 0.00 ? 37 ARG A CZ   1  
ATOM 583   N NH1  . ARG A 1 37 ? -2.494  -10.977 -0.365  1.00 0.00 ? 37 ARG A NH1  1  
ATOM 584   N NH2  . ARG A 1 37 ? -3.538  -12.728 -1.419  1.00 0.00 ? 37 ARG A NH2  1  
ATOM 585   H H    . ARG A 1 37 ? -6.303  -10.108 1.145   1.00 0.00 ? 37 ARG A H    1  
ATOM 586   H HA   . ARG A 1 37 ? -5.530  -7.444  0.552   1.00 0.00 ? 37 ARG A HA   1  
ATOM 587   H HB2  . ARG A 1 37 ? -3.958  -9.217  0.181   1.00 0.00 ? 37 ARG A HB2  1  
ATOM 588   H HB3  . ARG A 1 37 ? -5.070  -10.052 -0.896  1.00 0.00 ? 37 ARG A HB3  1  
ATOM 589   H HG2  . ARG A 1 37 ? -4.900  -8.091  -2.444  1.00 0.00 ? 37 ARG A HG2  1  
ATOM 590   H HG3  . ARG A 1 37 ? -3.612  -7.474  -1.407  1.00 0.00 ? 37 ARG A HG3  1  
ATOM 591   H HD2  . ARG A 1 37 ? -3.065  -8.940  -3.517  1.00 0.00 ? 37 ARG A HD2  1  
ATOM 592   H HD3  . ARG A 1 37 ? -2.140  -9.114  -2.026  1.00 0.00 ? 37 ARG A HD3  1  
ATOM 593   H HE   . ARG A 1 37 ? -3.976  -11.031 -3.177  1.00 0.00 ? 37 ARG A HE   1  
ATOM 594   H HH11 . ARG A 1 37 ? -2.216  -10.017 -0.349  1.00 0.00 ? 37 ARG A HH11 1  
ATOM 595   H HH12 . ARG A 1 37 ? -2.265  -11.577 0.401   1.00 0.00 ? 37 ARG A HH12 1  
ATOM 596   H HH21 . ARG A 1 37 ? -4.047  -13.090 -2.199  1.00 0.00 ? 37 ARG A HH21 1  
ATOM 597   H HH22 . ARG A 1 37 ? -3.306  -13.325 -0.652  1.00 0.00 ? 37 ARG A HH22 1  
ATOM 598   N N    . ALA A 1 38 ? -7.825  -8.819  -1.332  1.00 0.00 ? 38 ALA A N    1  
ATOM 599   C CA   . ALA A 1 38 ? -8.835  -8.549  -2.348  1.00 0.00 ? 38 ALA A CA   1  
ATOM 600   C C    . ALA A 1 38 ? -9.857  -7.533  -1.850  1.00 0.00 ? 38 ALA A C    1  
ATOM 601   O O    . ALA A 1 38 ? -10.442 -6.792  -2.639  1.00 0.00 ? 38 ALA A O    1  
ATOM 602   C CB   . ALA A 1 38 ? -9.528  -9.840  -2.759  1.00 0.00 ? 38 ALA A CB   1  
ATOM 603   H H    . ALA A 1 38 ? -7.832  -9.682  -0.868  1.00 0.00 ? 38 ALA A H    1  
ATOM 604   H HA   . ALA A 1 38 ? -8.334  -8.146  -3.217  1.00 0.00 ? 38 ALA A HA   1  
ATOM 605   H HB1  . ALA A 1 38 ? -8.960  -10.319 -3.543  1.00 0.00 ? 38 ALA A HB1  1  
ATOM 606   H HB2  . ALA A 1 38 ? -9.594  -10.500 -1.907  1.00 0.00 ? 38 ALA A HB2  1  
ATOM 607   H HB3  . ALA A 1 38 ? -10.521 -9.616  -3.119  1.00 0.00 ? 38 ALA A HB3  1  
ATOM 608   N N    . GLU A 1 39 ? -10.066 -7.505  -0.538  1.00 0.00 ? 39 GLU A N    1  
ATOM 609   C CA   . GLU A 1 39 ? -11.019 -6.579  0.063   1.00 0.00 ? 39 GLU A CA   1  
ATOM 610   C C    . GLU A 1 39 ? -10.659 -5.134  -0.269  1.00 0.00 ? 39 GLU A C    1  
ATOM 611   O O    . GLU A 1 39 ? -11.530 -4.319  -0.573  1.00 0.00 ? 39 GLU A O    1  
ATOM 612   C CB   . GLU A 1 39 ? -11.061 -6.770  1.581   1.00 0.00 ? 39 GLU A CB   1  
ATOM 613   C CG   . GLU A 1 39 ? -12.179 -5.998  2.261   1.00 0.00 ? 39 GLU A CG   1  
ATOM 614   C CD   . GLU A 1 39 ? -13.462 -6.800  2.364   1.00 0.00 ? 39 GLU A CD   1  
ATOM 615   O OE1  . GLU A 1 39 ? -13.380 -8.019  2.621   1.00 0.00 ? 39 GLU A OE1  1  
ATOM 616   O OE2  . GLU A 1 39 ? -14.548 -6.209  2.186   1.00 0.00 ? 39 GLU A OE2  1  
ATOM 617   H H    . GLU A 1 39 ? -9.568  -8.121  0.039   1.00 0.00 ? 39 GLU A H    1  
ATOM 618   H HA   . GLU A 1 39 ? -11.995 -6.797  -0.344  1.00 0.00 ? 39 GLU A HA   1  
ATOM 619   H HB2  . GLU A 1 39 ? -11.192 -7.820  1.797   1.00 0.00 ? 39 GLU A HB2  1  
ATOM 620   H HB3  . GLU A 1 39 ? -10.120 -6.441  1.998   1.00 0.00 ? 39 GLU A HB3  1  
ATOM 621   H HG2  . GLU A 1 39 ? -11.860 -5.729  3.257   1.00 0.00 ? 39 GLU A HG2  1  
ATOM 622   H HG3  . GLU A 1 39 ? -12.377 -5.101  1.693   1.00 0.00 ? 39 GLU A HG3  1  
ATOM 623   N N    . LEU A 1 40 ? -9.368  -4.824  -0.209  1.00 0.00 ? 40 LEU A N    1  
ATOM 624   C CA   . LEU A 1 40 ? -8.891  -3.478  -0.503  1.00 0.00 ? 40 LEU A CA   1  
ATOM 625   C C    . LEU A 1 40 ? -9.043  -3.158  -1.987  1.00 0.00 ? 40 LEU A C    1  
ATOM 626   O O    . LEU A 1 40 ? -9.399  -2.040  -2.358  1.00 0.00 ? 40 LEU A O    1  
ATOM 627   C CB   . LEU A 1 40 ? -7.426  -3.332  -0.086  1.00 0.00 ? 40 LEU A CB   1  
ATOM 628   C CG   . LEU A 1 40 ? -7.070  -3.855  1.306   1.00 0.00 ? 40 LEU A CG   1  
ATOM 629   C CD1  . LEU A 1 40 ? -5.729  -3.298  1.759   1.00 0.00 ? 40 LEU A CD1  1  
ATOM 630   C CD2  . LEU A 1 40 ? -8.162  -3.501  2.305   1.00 0.00 ? 40 LEU A CD2  1  
ATOM 631   H H    . LEU A 1 40 ? -8.721  -5.516  0.039   1.00 0.00 ? 40 LEU A H    1  
ATOM 632   H HA   . LEU A 1 40 ? -9.490  -2.782  0.065   1.00 0.00 ? 40 LEU A HA   1  
ATOM 633   H HB2  . LEU A 1 40 ? -6.823  -3.866  -0.804  1.00 0.00 ? 40 LEU A HB2  1  
ATOM 634   H HB3  . LEU A 1 40 ? -7.177  -2.281  -0.120  1.00 0.00 ? 40 LEU A HB3  1  
ATOM 635   H HG   . LEU A 1 40 ? -6.987  -4.933  1.268   1.00 0.00 ? 40 LEU A HG   1  
ATOM 636   H HD11 . LEU A 1 40 ? -5.140  -3.032  0.894   1.00 0.00 ? 40 LEU A HD11 1  
ATOM 637   H HD12 . LEU A 1 40 ? -5.205  -4.045  2.336   1.00 0.00 ? 40 LEU A HD12 1  
ATOM 638   H HD13 . LEU A 1 40 ? -5.892  -2.421  2.369   1.00 0.00 ? 40 LEU A HD13 1  
ATOM 639   H HD21 . LEU A 1 40 ? -8.030  -4.084  3.204   1.00 0.00 ? 40 LEU A HD21 1  
ATOM 640   H HD22 . LEU A 1 40 ? -9.128  -3.718  1.874   1.00 0.00 ? 40 LEU A HD22 1  
ATOM 641   H HD23 . LEU A 1 40 ? -8.102  -2.450  2.545   1.00 0.00 ? 40 LEU A HD23 1  
ATOM 642   N N    . ALA A 1 41 ? -8.771  -4.148  -2.831  1.00 0.00 ? 41 ALA A N    1  
ATOM 643   C CA   . ALA A 1 41 ? -8.882  -3.974  -4.274  1.00 0.00 ? 41 ALA A CA   1  
ATOM 644   C C    . ALA A 1 41 ? -10.341 -3.856  -4.703  1.00 0.00 ? 41 ALA A C    1  
ATOM 645   O O    . ALA A 1 41 ? -10.669 -3.107  -5.622  1.00 0.00 ? 41 ALA A O    1  
ATOM 646   C CB   . ALA A 1 41 ? -8.208  -5.129  -4.999  1.00 0.00 ? 41 ALA A CB   1  
ATOM 647   H H    . ALA A 1 41 ? -8.492  -5.017  -2.475  1.00 0.00 ? 41 ALA A H    1  
ATOM 648   H HA   . ALA A 1 41 ? -8.365  -3.063  -4.541  1.00 0.00 ? 41 ALA A HA   1  
ATOM 649   H HB1  . ALA A 1 41 ? -7.267  -4.796  -5.410  1.00 0.00 ? 41 ALA A HB1  1  
ATOM 650   H HB2  . ALA A 1 41 ? -8.032  -5.936  -4.303  1.00 0.00 ? 41 ALA A HB2  1  
ATOM 651   H HB3  . ALA A 1 41 ? -8.848  -5.475  -5.797  1.00 0.00 ? 41 ALA A HB3  1  
ATOM 652   N N    . ALA A 1 42 ? -11.212 -4.602  -4.031  1.00 0.00 ? 42 ALA A N    1  
ATOM 653   C CA   . ALA A 1 42 ? -12.636 -4.580  -4.342  1.00 0.00 ? 42 ALA A CA   1  
ATOM 654   C C    . ALA A 1 42 ? -13.323 -3.388  -3.684  1.00 0.00 ? 42 ALA A C    1  
ATOM 655   O O    . ALA A 1 42 ? -14.281 -2.836  -4.224  1.00 0.00 ? 42 ALA A O    1  
ATOM 656   C CB   . ALA A 1 42 ? -13.292 -5.880  -3.901  1.00 0.00 ? 42 ALA A CB   1  
ATOM 657   H H    . ALA A 1 42 ? -10.889 -5.179  -3.308  1.00 0.00 ? 42 ALA A H    1  
ATOM 658   H HA   . ALA A 1 42 ? -12.742 -4.497  -5.414  1.00 0.00 ? 42 ALA A HA   1  
ATOM 659   H HB1  . ALA A 1 42 ? -14.366 -5.773  -3.945  1.00 0.00 ? 42 ALA A HB1  1  
ATOM 660   H HB2  . ALA A 1 42 ? -12.983 -6.680  -4.557  1.00 0.00 ? 42 ALA A HB2  1  
ATOM 661   H HB3  . ALA A 1 42 ? -12.994 -6.108  -2.888  1.00 0.00 ? 42 ALA A HB3  1  
ATOM 662   N N    . SER A 1 43 ? -12.828 -2.998  -2.513  1.00 0.00 ? 43 SER A N    1  
ATOM 663   C CA   . SER A 1 43 ? -13.398 -1.874  -1.779  1.00 0.00 ? 43 SER A CA   1  
ATOM 664   C C    . SER A 1 43 ? -12.848 -0.550  -2.300  1.00 0.00 ? 43 SER A C    1  
ATOM 665   O O    . SER A 1 43 ? -13.600 0.308   -2.766  1.00 0.00 ? 43 SER A O    1  
ATOM 666   C CB   . SER A 1 43 ? -13.101 -2.010  -0.285  1.00 0.00 ? 43 SER A CB   1  
ATOM 667   O OG   . SER A 1 43 ? -13.746 -0.991  0.458   1.00 0.00 ? 43 SER A OG   1  
ATOM 668   H H    . SER A 1 43 ? -12.063 -3.479  -2.134  1.00 0.00 ? 43 SER A H    1  
ATOM 669   H HA   . SER A 1 43 ? -14.468 -1.889  -1.928  1.00 0.00 ? 43 SER A HA   1  
ATOM 670   H HB2  . SER A 1 43 ? -13.451 -2.970  0.063   1.00 0.00 ? 43 SER A HB2  1  
ATOM 671   H HB3  . SER A 1 43 ? -12.035 -1.937  -0.125  1.00 0.00 ? 43 SER A HB3  1  
ATOM 672   H HG   . SER A 1 43 ? -13.284 -0.859  1.290   1.00 0.00 ? 43 SER A HG   1  
ATOM 673   N N    . LEU A 1 44 ? -11.532 -0.390  -2.219  1.00 0.00 ? 44 LEU A N    1  
ATOM 674   C CA   . LEU A 1 44 ? -10.879 0.829   -2.682  1.00 0.00 ? 44 LEU A CA   1  
ATOM 675   C C    . LEU A 1 44 ? -10.992 0.967   -4.196  1.00 0.00 ? 44 LEU A C    1  
ATOM 676   O O    . LEU A 1 44 ? -10.774 2.043   -4.751  1.00 0.00 ? 44 LEU A O    1  
ATOM 677   C CB   . LEU A 1 44 ? -9.406  0.832   -2.267  1.00 0.00 ? 44 LEU A CB   1  
ATOM 678   C CG   . LEU A 1 44 ? -9.117  0.450   -0.815  1.00 0.00 ? 44 LEU A CG   1  
ATOM 679   C CD1  . LEU A 1 44 ? -7.662  0.726   -0.470  1.00 0.00 ? 44 LEU A CD1  1  
ATOM 680   C CD2  . LEU A 1 44 ? -10.043 1.203   0.129   1.00 0.00 ? 44 LEU A CD2  1  
ATOM 681   H H    . LEU A 1 44 ? -10.985 -1.109  -1.838  1.00 0.00 ? 44 LEU A H    1  
ATOM 682   H HA   . LEU A 1 44 ? -11.376 1.668   -2.218  1.00 0.00 ? 44 LEU A HA   1  
ATOM 683   H HB2  . LEU A 1 44 ? -8.883  0.135   -2.902  1.00 0.00 ? 44 LEU A HB2  1  
ATOM 684   H HB3  . LEU A 1 44 ? -9.019  1.827   -2.432  1.00 0.00 ? 44 LEU A HB3  1  
ATOM 685   H HG   . LEU A 1 44 ? -9.296  -0.609  -0.685  1.00 0.00 ? 44 LEU A HG   1  
ATOM 686   H HD11 . LEU A 1 44 ? -7.037  -0.034  -0.913  1.00 0.00 ? 44 LEU A HD11 1  
ATOM 687   H HD12 . LEU A 1 44 ? -7.538  0.713   0.603   1.00 0.00 ? 44 LEU A HD12 1  
ATOM 688   H HD13 . LEU A 1 44 ? -7.379  1.695   -0.853  1.00 0.00 ? 44 LEU A HD13 1  
ATOM 689   H HD21 . LEU A 1 44 ? -9.829  0.916   1.148   1.00 0.00 ? 44 LEU A HD21 1  
ATOM 690   H HD22 . LEU A 1 44 ? -11.070 0.961   -0.104  1.00 0.00 ? 44 LEU A HD22 1  
ATOM 691   H HD23 . LEU A 1 44 ? -9.888  2.266   0.014   1.00 0.00 ? 44 LEU A HD23 1  
ATOM 692   N N    . GLY A 1 45 ? -11.338 -0.132  -4.861  1.00 0.00 ? 45 GLY A N    1  
ATOM 693   C CA   . GLY A 1 45 ? -11.477 -0.113  -6.305  1.00 0.00 ? 45 GLY A CA   1  
ATOM 694   C C    . GLY A 1 45 ? -10.168 -0.390  -7.018  1.00 0.00 ? 45 GLY A C    1  
ATOM 695   O O    . GLY A 1 45 ? -10.035 -0.127  -8.214  1.00 0.00 ? 45 GLY A O    1  
ATOM 696   H H    . GLY A 1 45 ? -11.500 -0.963  -4.366  1.00 0.00 ? 45 GLY A H    1  
ATOM 697   H HA2  . GLY A 1 45 ? -12.199 -0.861  -6.597  1.00 0.00 ? 45 GLY A HA2  1  
ATOM 698   H HA3  . GLY A 1 45 ? -11.838 0.859   -6.608  1.00 0.00 ? 45 GLY A HA3  1  
ATOM 699   N N    . LEU A 1 46 ? -9.197  -0.921  -6.282  1.00 0.00 ? 46 LEU A N    1  
ATOM 700   C CA   . LEU A 1 46 ? -7.890  -1.233  -6.850  1.00 0.00 ? 46 LEU A CA   1  
ATOM 701   C C    . LEU A 1 46 ? -7.783  -2.717  -7.187  1.00 0.00 ? 46 LEU A C    1  
ATOM 702   O O    . LEU A 1 46 ? -8.722  -3.483  -6.973  1.00 0.00 ? 46 LEU A O    1  
ATOM 703   C CB   . LEU A 1 46 ? -6.780  -0.838  -5.874  1.00 0.00 ? 46 LEU A CB   1  
ATOM 704   C CG   . LEU A 1 46 ? -6.818  0.603   -5.363  1.00 0.00 ? 46 LEU A CG   1  
ATOM 705   C CD1  . LEU A 1 46 ? -6.218  0.689   -3.968  1.00 0.00 ? 46 LEU A CD1  1  
ATOM 706   C CD2  . LEU A 1 46 ? -6.082  1.528   -6.320  1.00 0.00 ? 46 LEU A CD2  1  
ATOM 707   H H    . LEU A 1 46 ? -9.362  -1.108  -5.335  1.00 0.00 ? 46 LEU A H    1  
ATOM 708   H HA   . LEU A 1 46 ? -7.779  -0.661  -7.759  1.00 0.00 ? 46 LEU A HA   1  
ATOM 709   H HB2  . LEU A 1 46 ? -6.843  -1.494  -5.020  1.00 0.00 ? 46 LEU A HB2  1  
ATOM 710   H HB3  . LEU A 1 46 ? -5.833  -0.989  -6.373  1.00 0.00 ? 46 LEU A HB3  1  
ATOM 711   H HG   . LEU A 1 46 ? -7.846  0.931   -5.304  1.00 0.00 ? 46 LEU A HG   1  
ATOM 712   H HD11 . LEU A 1 46 ? -6.449  -0.211  -3.420  1.00 0.00 ? 46 LEU A HD11 1  
ATOM 713   H HD12 . LEU A 1 46 ? -6.631  1.542   -3.451  1.00 0.00 ? 46 LEU A HD12 1  
ATOM 714   H HD13 . LEU A 1 46 ? -5.146  0.800   -4.044  1.00 0.00 ? 46 LEU A HD13 1  
ATOM 715   H HD21 . LEU A 1 46 ? -6.017  2.516   -5.888  1.00 0.00 ? 46 LEU A HD21 1  
ATOM 716   H HD22 . LEU A 1 46 ? -6.620  1.579   -7.256  1.00 0.00 ? 46 LEU A HD22 1  
ATOM 717   H HD23 . LEU A 1 46 ? -5.087  1.146   -6.497  1.00 0.00 ? 46 LEU A HD23 1  
ATOM 718   N N    . THR A 1 47 ? -6.630  -3.117  -7.714  1.00 0.00 ? 47 THR A N    1  
ATOM 719   C CA   . THR A 1 47 ? -6.398  -4.509  -8.079  1.00 0.00 ? 47 THR A CA   1  
ATOM 720   C C    . THR A 1 47 ? -5.353  -5.148  -7.173  1.00 0.00 ? 47 THR A C    1  
ATOM 721   O O    . THR A 1 47 ? -4.552  -4.454  -6.548  1.00 0.00 ? 47 THR A O    1  
ATOM 722   C CB   . THR A 1 47 ? -5.938  -4.636  -9.544  1.00 0.00 ? 47 THR A CB   1  
ATOM 723   O OG1  . THR A 1 47 ? -5.885  -6.016  -9.922  1.00 0.00 ? 47 THR A OG1  1  
ATOM 724   C CG2  . THR A 1 47 ? -4.571  -3.998  -9.739  1.00 0.00 ? 47 THR A CG2  1  
ATOM 725   H H    . THR A 1 47 ? -5.918  -2.459  -7.861  1.00 0.00 ? 47 THR A H    1  
ATOM 726   H HA   . THR A 1 47 ? -7.331  -5.042  -7.969  1.00 0.00 ? 47 THR A HA   1  
ATOM 727   H HB   . THR A 1 47 ? -6.651  -4.124  -10.175 1.00 0.00 ? 47 THR A HB   1  
ATOM 728   H HG1  . THR A 1 47 ? -5.242  -6.130  -10.626 1.00 0.00 ? 47 THR A HG1  1  
ATOM 729   H HG21 . THR A 1 47 ? -3.857  -4.757  -10.024 1.00 0.00 ? 47 THR A HG21 1  
ATOM 730   H HG22 . THR A 1 47 ? -4.255  -3.535  -8.816  1.00 0.00 ? 47 THR A HG22 1  
ATOM 731   H HG23 . THR A 1 47 ? -4.630  -3.251  -10.516 1.00 0.00 ? 47 THR A HG23 1  
ATOM 732   N N    . GLN A 1 48 ? -5.367  -6.476  -7.107  1.00 0.00 ? 48 GLN A N    1  
ATOM 733   C CA   . GLN A 1 48 ? -4.419  -7.209  -6.276  1.00 0.00 ? 48 GLN A CA   1  
ATOM 734   C C    . GLN A 1 48 ? -2.983  -6.840  -6.633  1.00 0.00 ? 48 GLN A C    1  
ATOM 735   O O    . GLN A 1 48 ? -2.090  -6.884  -5.787  1.00 0.00 ? 48 GLN A O    1  
ATOM 736   C CB   . GLN A 1 48 ? -4.626  -8.716  -6.436  1.00 0.00 ? 48 GLN A CB   1  
ATOM 737   C CG   . GLN A 1 48 ? -5.757  -9.269  -5.584  1.00 0.00 ? 48 GLN A CG   1  
ATOM 738   C CD   . GLN A 1 48 ? -6.081  -10.713 -5.911  1.00 0.00 ? 48 GLN A CD   1  
ATOM 739   O OE1  . GLN A 1 48 ? -5.187  -11.518 -6.173  1.00 0.00 ? 48 GLN A OE1  1  
ATOM 740   N NE2  . GLN A 1 48 ? -7.366  -11.049 -5.896  1.00 0.00 ? 48 GLN A NE2  1  
ATOM 741   H H    . GLN A 1 48 ? -6.030  -6.974  -7.628  1.00 0.00 ? 48 GLN A H    1  
ATOM 742   H HA   . GLN A 1 48 ? -4.602  -6.937  -5.247  1.00 0.00 ? 48 GLN A HA   1  
ATOM 743   H HB2  . GLN A 1 48 ? -4.848  -8.928  -7.472  1.00 0.00 ? 48 GLN A HB2  1  
ATOM 744   H HB3  . GLN A 1 48 ? -3.714  -9.224  -6.160  1.00 0.00 ? 48 GLN A HB3  1  
ATOM 745   H HG2  . GLN A 1 48 ? -5.470  -9.207  -4.544  1.00 0.00 ? 48 GLN A HG2  1  
ATOM 746   H HG3  . GLN A 1 48 ? -6.640  -8.670  -5.748  1.00 0.00 ? 48 GLN A HG3  1  
ATOM 747   H HE21 . GLN A 1 48 ? -8.023  -10.355 -5.679  1.00 0.00 ? 48 GLN A HE21 1  
ATOM 748   H HE22 . GLN A 1 48 ? -7.604  -11.976 -6.104  1.00 0.00 ? 48 GLN A HE22 1  
ATOM 749   N N    . THR A 1 49 ? -2.767  -6.476  -7.893  1.00 0.00 ? 49 THR A N    1  
ATOM 750   C CA   . THR A 1 49 ? -1.439  -6.100  -8.363  1.00 0.00 ? 49 THR A CA   1  
ATOM 751   C C    . THR A 1 49 ? -1.028  -4.738  -7.819  1.00 0.00 ? 49 THR A C    1  
ATOM 752   O O    . THR A 1 49 ? 0.159   -4.421  -7.747  1.00 0.00 ? 49 THR A O    1  
ATOM 753   C CB   . THR A 1 49 ? -1.377  -6.066  -9.902  1.00 0.00 ? 49 THR A CB   1  
ATOM 754   O OG1  . THR A 1 49 ? -2.011  -7.230  -10.444 1.00 0.00 ? 49 THR A OG1  1  
ATOM 755   C CG2  . THR A 1 49 ? 0.064   -5.995  -10.384 1.00 0.00 ? 49 THR A CG2  1  
ATOM 756   H H    . THR A 1 49 ? -3.519  -6.460  -8.521  1.00 0.00 ? 49 THR A H    1  
ATOM 757   H HA   . THR A 1 49 ? -0.739  -6.844  -8.012  1.00 0.00 ? 49 THR A HA   1  
ATOM 758   H HB   . THR A 1 49 ? -1.901  -5.186  -10.248 1.00 0.00 ? 49 THR A HB   1  
ATOM 759   H HG1  . THR A 1 49 ? -2.601  -7.609  -9.788  1.00 0.00 ? 49 THR A HG1  1  
ATOM 760   H HG21 . THR A 1 49 ? 0.151   -6.503  -11.333 1.00 0.00 ? 49 THR A HG21 1  
ATOM 761   H HG22 . THR A 1 49 ? 0.709   -6.470  -9.660  1.00 0.00 ? 49 THR A HG22 1  
ATOM 762   H HG23 . THR A 1 49 ? 0.353   -4.962  -10.502 1.00 0.00 ? 49 THR A HG23 1  
ATOM 763   N N    . GLN A 1 50 ? -2.016  -3.935  -7.436  1.00 0.00 ? 50 GLN A N    1  
ATOM 764   C CA   . GLN A 1 50 ? -1.755  -2.606  -6.897  1.00 0.00 ? 50 GLN A CA   1  
ATOM 765   C C    . GLN A 1 50 ? -1.585  -2.656  -5.383  1.00 0.00 ? 50 GLN A C    1  
ATOM 766   O O    . GLN A 1 50 ? -0.610  -2.137  -4.839  1.00 0.00 ? 50 GLN A O    1  
ATOM 767   C CB   . GLN A 1 50 ? -2.893  -1.652  -7.264  1.00 0.00 ? 50 GLN A CB   1  
ATOM 768   C CG   . GLN A 1 50 ? -2.821  -1.140  -8.694  1.00 0.00 ? 50 GLN A CG   1  
ATOM 769   C CD   . GLN A 1 50 ? -3.530  0.188   -8.875  1.00 0.00 ? 50 GLN A CD   1  
ATOM 770   O OE1  . GLN A 1 50 ? -4.748  0.281   -8.718  1.00 0.00 ? 50 GLN A OE1  1  
ATOM 771   N NE2  . GLN A 1 50 ? -2.770  1.225   -9.206  1.00 0.00 ? 50 GLN A NE2  1  
ATOM 772   H H    . GLN A 1 50 ? -2.942  -4.245  -7.518  1.00 0.00 ? 50 GLN A H    1  
ATOM 773   H HA   . GLN A 1 50 ? -0.839  -2.244  -7.338  1.00 0.00 ? 50 GLN A HA   1  
ATOM 774   H HB2  . GLN A 1 50 ? -3.834  -2.166  -7.135  1.00 0.00 ? 50 GLN A HB2  1  
ATOM 775   H HB3  . GLN A 1 50 ? -2.862  -0.801  -6.599  1.00 0.00 ? 50 GLN A HB3  1  
ATOM 776   H HG2  . GLN A 1 50 ? -1.784  -1.016  -8.967  1.00 0.00 ? 50 GLN A HG2  1  
ATOM 777   H HG3  . GLN A 1 50 ? -3.280  -1.868  -9.346  1.00 0.00 ? 50 GLN A HG3  1  
ATOM 778   H HE21 . GLN A 1 50 ? -1.807  1.076   -9.315  1.00 0.00 ? 50 GLN A HE21 1  
ATOM 779   H HE22 . GLN A 1 50 ? -3.202  2.095   -9.330  1.00 0.00 ? 50 GLN A HE22 1  
ATOM 780   N N    . VAL A 1 51 ? -2.542  -3.283  -4.705  1.00 0.00 ? 51 VAL A N    1  
ATOM 781   C CA   . VAL A 1 51 ? -2.498  -3.401  -3.253  1.00 0.00 ? 51 VAL A CA   1  
ATOM 782   C C    . VAL A 1 51 ? -1.303  -4.234  -2.805  1.00 0.00 ? 51 VAL A C    1  
ATOM 783   O O    . VAL A 1 51 ? -0.845  -4.123  -1.667  1.00 0.00 ? 51 VAL A O    1  
ATOM 784   C CB   . VAL A 1 51 ? -3.789  -4.037  -2.702  1.00 0.00 ? 51 VAL A CB   1  
ATOM 785   C CG1  . VAL A 1 51 ? -3.562  -4.576  -1.298  1.00 0.00 ? 51 VAL A CG1  1  
ATOM 786   C CG2  . VAL A 1 51 ? -4.928  -3.029  -2.718  1.00 0.00 ? 51 VAL A CG2  1  
ATOM 787   H H    . VAL A 1 51 ? -3.295  -3.676  -5.194  1.00 0.00 ? 51 VAL A H    1  
ATOM 788   H HA   . VAL A 1 51 ? -2.407  -2.407  -2.839  1.00 0.00 ? 51 VAL A HA   1  
ATOM 789   H HB   . VAL A 1 51 ? -4.059  -4.865  -3.342  1.00 0.00 ? 51 VAL A HB   1  
ATOM 790   H HG11 . VAL A 1 51 ? -3.196  -3.782  -0.663  1.00 0.00 ? 51 VAL A HG11 1  
ATOM 791   H HG12 . VAL A 1 51 ? -4.492  -4.955  -0.903  1.00 0.00 ? 51 VAL A HG12 1  
ATOM 792   H HG13 . VAL A 1 51 ? -2.833  -5.372  -1.332  1.00 0.00 ? 51 VAL A HG13 1  
ATOM 793   H HG21 . VAL A 1 51 ? -5.853  -3.536  -2.948  1.00 0.00 ? 51 VAL A HG21 1  
ATOM 794   H HG22 . VAL A 1 51 ? -5.007  -2.559  -1.748  1.00 0.00 ? 51 VAL A HG22 1  
ATOM 795   H HG23 . VAL A 1 51 ? -4.733  -2.277  -3.467  1.00 0.00 ? 51 VAL A HG23 1  
ATOM 796   N N    . LYS A 1 52 ? -0.799  -5.070  -3.707  1.00 0.00 ? 52 LYS A N    1  
ATOM 797   C CA   . LYS A 1 52 ? 0.345   -5.922  -3.408  1.00 0.00 ? 52 LYS A CA   1  
ATOM 798   C C    . LYS A 1 52 ? 1.637   -5.111  -3.390  1.00 0.00 ? 52 LYS A C    1  
ATOM 799   O O    . LYS A 1 52 ? 2.403   -5.168  -2.428  1.00 0.00 ? 52 LYS A O    1  
ATOM 800   C CB   . LYS A 1 52 ? 0.451   -7.049  -4.437  1.00 0.00 ? 52 LYS A CB   1  
ATOM 801   C CG   . LYS A 1 52 ? -0.312  -8.303  -4.047  1.00 0.00 ? 52 LYS A CG   1  
ATOM 802   C CD   . LYS A 1 52 ? -0.472  -9.248  -5.227  1.00 0.00 ? 52 LYS A CD   1  
ATOM 803   C CE   . LYS A 1 52 ? 0.854   -9.880  -5.618  1.00 0.00 ? 52 LYS A CE   1  
ATOM 804   N NZ   . LYS A 1 52 ? 0.688   -10.899 -6.692  1.00 0.00 ? 52 LYS A NZ   1  
ATOM 805   H H    . LYS A 1 52 ? -1.208  -5.113  -4.598  1.00 0.00 ? 52 LYS A H    1  
ATOM 806   H HA   . LYS A 1 52 ? 0.191   -6.352  -2.430  1.00 0.00 ? 52 LYS A HA   1  
ATOM 807   H HB2  . LYS A 1 52 ? 0.064   -6.696  -5.381  1.00 0.00 ? 52 LYS A HB2  1  
ATOM 808   H HB3  . LYS A 1 52 ? 1.492   -7.311  -4.561  1.00 0.00 ? 52 LYS A HB3  1  
ATOM 809   H HG2  . LYS A 1 52 ? 0.227   -8.812  -3.263  1.00 0.00 ? 52 LYS A HG2  1  
ATOM 810   H HG3  . LYS A 1 52 ? -1.292  -8.020  -3.689  1.00 0.00 ? 52 LYS A HG3  1  
ATOM 811   H HD2  . LYS A 1 52 ? -1.166  -10.030 -4.959  1.00 0.00 ? 52 LYS A HD2  1  
ATOM 812   H HD3  . LYS A 1 52 ? -0.860  -8.694  -6.070  1.00 0.00 ? 52 LYS A HD3  1  
ATOM 813   H HE2  . LYS A 1 52 ? 1.518   -9.105  -5.969  1.00 0.00 ? 52 LYS A HE2  1  
ATOM 814   H HE3  . LYS A 1 52 ? 1.283   -10.354 -4.747  1.00 0.00 ? 52 LYS A HE3  1  
ATOM 815   H HZ1  . LYS A 1 52 ? -0.266  -10.833 -7.101  1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 816   H HZ2  . LYS A 1 52 ? 0.821   -11.854 -6.302  1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 817   H HZ3  . LYS A 1 52 ? 1.388   -10.743 -7.444  1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 818   N N    . ILE A 1 53 ? 1.872   -4.358  -4.460  1.00 0.00 ? 53 ILE A N    1  
ATOM 819   C CA   . ILE A 1 53 ? 3.070   -3.535  -4.565  1.00 0.00 ? 53 ILE A CA   1  
ATOM 820   C C    . ILE A 1 53 ? 3.077   -2.436  -3.507  1.00 0.00 ? 53 ILE A C    1  
ATOM 821   O O    . ILE A 1 53 ? 4.136   -2.011  -3.047  1.00 0.00 ? 53 ILE A O    1  
ATOM 822   C CB   . ILE A 1 53 ? 3.190   -2.890  -5.959  1.00 0.00 ? 53 ILE A CB   1  
ATOM 823   C CG1  . ILE A 1 53 ? 3.179   -3.967  -7.045  1.00 0.00 ? 53 ILE A CG1  1  
ATOM 824   C CG2  . ILE A 1 53 ? 4.457   -2.053  -6.048  1.00 0.00 ? 53 ILE A CG2  1  
ATOM 825   C CD1  . ILE A 1 53 ? 3.091   -3.409  -8.448  1.00 0.00 ? 53 ILE A CD1  1  
ATOM 826   H H    . ILE A 1 53 ? 1.224   -4.356  -5.194  1.00 0.00 ? 53 ILE A H    1  
ATOM 827   H HA   . ILE A 1 53 ? 3.928   -4.174  -4.411  1.00 0.00 ? 53 ILE A HA   1  
ATOM 828   H HB   . ILE A 1 53 ? 2.344   -2.236  -6.102  1.00 0.00 ? 53 ILE A HB   1  
ATOM 829   H HG12 . ILE A 1 53 ? 4.084   -4.549  -6.976  1.00 0.00 ? 53 ILE A HG12 1  
ATOM 830   H HG13 . ILE A 1 53 ? 2.327   -4.615  -6.891  1.00 0.00 ? 53 ILE A HG13 1  
ATOM 831   H HG21 . ILE A 1 53 ? 4.673   -1.837  -7.084  1.00 0.00 ? 53 ILE A HG21 1  
ATOM 832   H HG22 . ILE A 1 53 ? 4.315   -1.127  -5.510  1.00 0.00 ? 53 ILE A HG22 1  
ATOM 833   H HG23 . ILE A 1 53 ? 5.281   -2.599  -5.615  1.00 0.00 ? 53 ILE A HG23 1  
ATOM 834   H HD11 . ILE A 1 53 ? 2.826   -4.200  -9.135  1.00 0.00 ? 53 ILE A HD11 1  
ATOM 835   H HD12 . ILE A 1 53 ? 2.341   -2.634  -8.482  1.00 0.00 ? 53 ILE A HD12 1  
ATOM 836   H HD13 . ILE A 1 53 ? 4.049   -2.995  -8.731  1.00 0.00 ? 53 ILE A HD13 1  
ATOM 837   N N    . TRP A 1 54 ? 1.888   -1.983  -3.125  1.00 0.00 ? 54 TRP A N    1  
ATOM 838   C CA   . TRP A 1 54 ? 1.757   -0.935  -2.119  1.00 0.00 ? 54 TRP A CA   1  
ATOM 839   C C    . TRP A 1 54 ? 2.186   -1.442  -0.746  1.00 0.00 ? 54 TRP A C    1  
ATOM 840   O O    . TRP A 1 54 ? 2.887   -0.748  -0.009  1.00 0.00 ? 54 TRP A O    1  
ATOM 841   C CB   . TRP A 1 54 ? 0.314   -0.432  -2.063  1.00 0.00 ? 54 TRP A CB   1  
ATOM 842   C CG   . TRP A 1 54 ? 0.144   0.791   -1.213  1.00 0.00 ? 54 TRP A CG   1  
ATOM 843   C CD1  . TRP A 1 54 ? 0.091   2.086   -1.642  1.00 0.00 ? 54 TRP A CD1  1  
ATOM 844   C CD2  . TRP A 1 54 ? 0.008   0.832   0.212   1.00 0.00 ? 54 TRP A CD2  1  
ATOM 845   N NE1  . TRP A 1 54 ? -0.070  2.931   -0.570  1.00 0.00 ? 54 TRP A NE1  1  
ATOM 846   C CE2  . TRP A 1 54 ? -0.125  2.186   0.578   1.00 0.00 ? 54 TRP A CE2  1  
ATOM 847   C CE3  . TRP A 1 54 ? -0.018  -0.142  1.213   1.00 0.00 ? 54 TRP A CE3  1  
ATOM 848   C CZ2  . TRP A 1 54 ? -0.280  2.587   1.903   1.00 0.00 ? 54 TRP A CZ2  1  
ATOM 849   C CZ3  . TRP A 1 54 ? -0.171  0.257   2.527   1.00 0.00 ? 54 TRP A CZ3  1  
ATOM 850   C CH2  . TRP A 1 54 ? -0.301  1.611   2.863   1.00 0.00 ? 54 TRP A CH2  1  
ATOM 851   H H    . TRP A 1 54 ? 1.079   -2.363  -3.529  1.00 0.00 ? 54 TRP A H    1  
ATOM 852   H HA   . TRP A 1 54 ? 2.403   -0.119  -2.407  1.00 0.00 ? 54 TRP A HA   1  
ATOM 853   H HB2  . TRP A 1 54 ? -0.016  -0.192  -3.062  1.00 0.00 ? 54 TRP A HB2  1  
ATOM 854   H HB3  . TRP A 1 54 ? -0.315  -1.211  -1.657  1.00 0.00 ? 54 TRP A HB3  1  
ATOM 855   H HD1  . TRP A 1 54 ? 0.168   2.388   -2.676  1.00 0.00 ? 54 TRP A HD1  1  
ATOM 856   H HE1  . TRP A 1 54 ? -0.137  3.907   -0.621  1.00 0.00 ? 54 TRP A HE1  1  
ATOM 857   H HE3  . TRP A 1 54 ? 0.081   -1.191  0.974   1.00 0.00 ? 54 TRP A HE3  1  
ATOM 858   H HZ2  . TRP A 1 54 ? -0.382  3.626   2.177   1.00 0.00 ? 54 TRP A HZ2  1  
ATOM 859   H HZ3  . TRP A 1 54 ? -0.192  -0.482  3.315   1.00 0.00 ? 54 TRP A HZ3  1  
ATOM 860   H HH2  . TRP A 1 54 ? -0.418  1.877   3.902   1.00 0.00 ? 54 TRP A HH2  1  
ATOM 861   N N    . PHE A 1 55 ? 1.762   -2.655  -0.408  1.00 0.00 ? 55 PHE A N    1  
ATOM 862   C CA   . PHE A 1 55 ? 2.102   -3.253  0.877   1.00 0.00 ? 55 PHE A CA   1  
ATOM 863   C C    . PHE A 1 55 ? 3.578   -3.637  0.924   1.00 0.00 ? 55 PHE A C    1  
ATOM 864   O O    . PHE A 1 55 ? 4.221   -3.539  1.969   1.00 0.00 ? 55 PHE A O    1  
ATOM 865   C CB   . PHE A 1 55 ? 1.234   -4.486  1.135   1.00 0.00 ? 55 PHE A CB   1  
ATOM 866   C CG   . PHE A 1 55 ? -0.049  -4.177  1.853   1.00 0.00 ? 55 PHE A CG   1  
ATOM 867   C CD1  . PHE A 1 55 ? -1.027  -3.402  1.249   1.00 0.00 ? 55 PHE A CD1  1  
ATOM 868   C CD2  . PHE A 1 55 ? -0.277  -4.660  3.131   1.00 0.00 ? 55 PHE A CD2  1  
ATOM 869   C CE1  . PHE A 1 55 ? -2.207  -3.115  1.908   1.00 0.00 ? 55 PHE A CE1  1  
ATOM 870   C CE2  . PHE A 1 55 ? -1.456  -4.377  3.795   1.00 0.00 ? 55 PHE A CE2  1  
ATOM 871   C CZ   . PHE A 1 55 ? -2.423  -3.604  3.182   1.00 0.00 ? 55 PHE A CZ   1  
ATOM 872   H H    . PHE A 1 55 ? 1.205   -3.159  -1.039  1.00 0.00 ? 55 PHE A H    1  
ATOM 873   H HA   . PHE A 1 55 ? 1.908   -2.520  1.645   1.00 0.00 ? 55 PHE A HA   1  
ATOM 874   H HB2  . PHE A 1 55 ? 0.982   -4.945  0.191   1.00 0.00 ? 55 PHE A HB2  1  
ATOM 875   H HB3  . PHE A 1 55 ? 1.790   -5.190  1.736   1.00 0.00 ? 55 PHE A HB3  1  
ATOM 876   H HD1  . PHE A 1 55 ? -0.860  -3.020  0.253   1.00 0.00 ? 55 PHE A HD1  1  
ATOM 877   H HD2  . PHE A 1 55 ? 0.479   -5.265  3.612   1.00 0.00 ? 55 PHE A HD2  1  
ATOM 878   H HE1  . PHE A 1 55 ? -2.962  -2.511  1.427   1.00 0.00 ? 55 PHE A HE1  1  
ATOM 879   H HE2  . PHE A 1 55 ? -1.621  -4.761  4.791   1.00 0.00 ? 55 PHE A HE2  1  
ATOM 880   H HZ   . PHE A 1 55 ? -3.344  -3.381  3.699   1.00 0.00 ? 55 PHE A HZ   1  
ATOM 881   N N    . GLN A 1 56 ? 4.106   -4.076  -0.214  1.00 0.00 ? 56 GLN A N    1  
ATOM 882   C CA   . GLN A 1 56 ? 5.505   -4.476  -0.302  1.00 0.00 ? 56 GLN A CA   1  
ATOM 883   C C    . GLN A 1 56 ? 6.426   -3.266  -0.183  1.00 0.00 ? 56 GLN A C    1  
ATOM 884   O O    . GLN A 1 56 ? 7.287   -3.213  0.695   1.00 0.00 ? 56 GLN A O    1  
ATOM 885   C CB   . GLN A 1 56 ? 5.767   -5.204  -1.622  1.00 0.00 ? 56 GLN A CB   1  
ATOM 886   C CG   . GLN A 1 56 ? 7.079   -5.972  -1.643  1.00 0.00 ? 56 GLN A CG   1  
ATOM 887   C CD   . GLN A 1 56 ? 7.183   -6.917  -2.824  1.00 0.00 ? 56 GLN A CD   1  
ATOM 888   O OE1  . GLN A 1 56 ? 6.281   -7.717  -3.074  1.00 0.00 ? 56 GLN A OE1  1  
ATOM 889   N NE2  . GLN A 1 56 ? 8.286   -6.829  -3.557  1.00 0.00 ? 56 GLN A NE2  1  
ATOM 890   H H    . GLN A 1 56 ? 3.542   -4.131  -1.012  1.00 0.00 ? 56 GLN A H    1  
ATOM 891   H HA   . GLN A 1 56 ? 5.709   -5.150  0.516   1.00 0.00 ? 56 GLN A HA   1  
ATOM 892   H HB2  . GLN A 1 56 ? 4.963   -5.902  -1.800  1.00 0.00 ? 56 GLN A HB2  1  
ATOM 893   H HB3  . GLN A 1 56 ? 5.787   -4.478  -2.421  1.00 0.00 ? 56 GLN A HB3  1  
ATOM 894   H HG2  . GLN A 1 56 ? 7.894   -5.265  -1.695  1.00 0.00 ? 56 GLN A HG2  1  
ATOM 895   H HG3  . GLN A 1 56 ? 7.159   -6.546  -0.732  1.00 0.00 ? 56 GLN A HG3  1  
ATOM 896   H HE21 . GLN A 1 56 ? 8.963   -6.168  -3.298  1.00 0.00 ? 56 GLN A HE21 1  
ATOM 897   H HE22 . GLN A 1 56 ? 8.380   -7.428  -4.326  1.00 0.00 ? 56 GLN A HE22 1  
ATOM 898   N N    . ASN A 1 57 ? 6.239   -2.297  -1.073  1.00 0.00 ? 57 ASN A N    1  
ATOM 899   C CA   . ASN A 1 57 ? 7.054   -1.087  -1.068  1.00 0.00 ? 57 ASN A CA   1  
ATOM 900   C C    . ASN A 1 57 ? 7.099   -0.467  0.325   1.00 0.00 ? 57 ASN A C    1  
ATOM 901   O O    . ASN A 1 57 ? 8.173   -0.234  0.880   1.00 0.00 ? 57 ASN A O    1  
ATOM 902   C CB   . ASN A 1 57 ? 6.505   -0.073  -2.073  1.00 0.00 ? 57 ASN A CB   1  
ATOM 903   C CG   . ASN A 1 57 ? 7.100   -0.248  -3.456  1.00 0.00 ? 57 ASN A CG   1  
ATOM 904   O OD1  . ASN A 1 57 ? 8.184   -0.811  -3.610  1.00 0.00 ? 57 ASN A OD1  1  
ATOM 905   N ND2  . ASN A 1 57 ? 6.392   0.234   -4.471  1.00 0.00 ? 57 ASN A ND2  1  
ATOM 906   H H    . ASN A 1 57 ? 5.537   -2.397  -1.749  1.00 0.00 ? 57 ASN A H    1  
ATOM 907   H HA   . ASN A 1 57 ? 8.057   -1.362  -1.359  1.00 0.00 ? 57 ASN A HA   1  
ATOM 908   H HB2  . ASN A 1 57 ? 5.433   -0.192  -2.146  1.00 0.00 ? 57 ASN A HB2  1  
ATOM 909   H HB3  . ASN A 1 57 ? 6.729   0.925   -1.728  1.00 0.00 ? 57 ASN A HB3  1  
ATOM 910   H HD21 . ASN A 1 57 ? 5.537   0.670   -4.273  1.00 0.00 ? 57 ASN A HD21 1  
ATOM 911   H HD22 . ASN A 1 57 ? 6.754   0.134   -5.376  1.00 0.00 ? 57 ASN A HD22 1  
ATOM 912   N N    . LYS A 1 58 ? 5.924   -0.202  0.887   1.00 0.00 ? 58 LYS A N    1  
ATOM 913   C CA   . LYS A 1 58 ? 5.827   0.390   2.216   1.00 0.00 ? 58 LYS A CA   1  
ATOM 914   C C    . LYS A 1 58 ? 6.810   -0.269  3.178   1.00 0.00 ? 58 LYS A C    1  
ATOM 915   O O    . LYS A 1 58 ? 7.633   0.405   3.797   1.00 0.00 ? 58 LYS A O    1  
ATOM 916   C CB   . LYS A 1 58 ? 4.401   0.253   2.754   1.00 0.00 ? 58 LYS A CB   1  
ATOM 917   C CG   . LYS A 1 58 ? 3.997   1.373   3.698   1.00 0.00 ? 58 LYS A CG   1  
ATOM 918   C CD   . LYS A 1 58 ? 3.779   2.679   2.953   1.00 0.00 ? 58 LYS A CD   1  
ATOM 919   C CE   . LYS A 1 58 ? 2.697   2.542   1.893   1.00 0.00 ? 58 LYS A CE   1  
ATOM 920   N NZ   . LYS A 1 58 ? 3.258   2.122   0.579   1.00 0.00 ? 58 LYS A NZ   1  
ATOM 921   H H    . LYS A 1 58 ? 5.101   -0.410  0.395   1.00 0.00 ? 58 LYS A H    1  
ATOM 922   H HA   . LYS A 1 58 ? 6.072   1.438   2.132   1.00 0.00 ? 58 LYS A HA   1  
ATOM 923   H HB2  . LYS A 1 58 ? 3.713   0.247   1.921   1.00 0.00 ? 58 LYS A HB2  1  
ATOM 924   H HB3  . LYS A 1 58 ? 4.317   -0.684  3.285   1.00 0.00 ? 58 LYS A HB3  1  
ATOM 925   H HG2  . LYS A 1 58 ? 3.079   1.098   4.197   1.00 0.00 ? 58 LYS A HG2  1  
ATOM 926   H HG3  . LYS A 1 58 ? 4.779   1.513   4.431   1.00 0.00 ? 58 LYS A HG3  1  
ATOM 927   H HD2  . LYS A 1 58 ? 3.482   3.441   3.658   1.00 0.00 ? 58 LYS A HD2  1  
ATOM 928   H HD3  . LYS A 1 58 ? 4.704   2.969   2.475   1.00 0.00 ? 58 LYS A HD3  1  
ATOM 929   H HE2  . LYS A 1 58 ? 1.981   1.805   2.221   1.00 0.00 ? 58 LYS A HE2  1  
ATOM 930   H HE3  . LYS A 1 58 ? 2.204   3.496   1.776   1.00 0.00 ? 58 LYS A HE3  1  
ATOM 931   H HZ1  . LYS A 1 58 ? 3.016   1.129   0.389   1.00 0.00 ? 58 LYS A HZ1  1  
ATOM 932   H HZ2  . LYS A 1 58 ? 4.293   2.221   0.584   1.00 0.00 ? 58 LYS A HZ2  1  
ATOM 933   H HZ3  . LYS A 1 58 ? 2.867   2.714   -0.182  1.00 0.00 ? 58 LYS A HZ3  1  
ATOM 934   N N    . ARG A 1 59 ? 6.719   -1.590  3.297   1.00 0.00 ? 59 ARG A N    1  
ATOM 935   C CA   . ARG A 1 59 ? 7.601   -2.340  4.184   1.00 0.00 ? 59 ARG A CA   1  
ATOM 936   C C    . ARG A 1 59 ? 9.034   -1.824  4.088   1.00 0.00 ? 59 ARG A C    1  
ATOM 937   O O    . ARG A 1 59 ? 9.750   -1.764  5.088   1.00 0.00 ? 59 ARG A O    1  
ATOM 938   C CB   . ARG A 1 59 ? 7.560   -3.829  3.839   1.00 0.00 ? 59 ARG A CB   1  
ATOM 939   C CG   . ARG A 1 59 ? 6.463   -4.592  4.563   1.00 0.00 ? 59 ARG A CG   1  
ATOM 940   C CD   . ARG A 1 59 ? 6.454   -6.062  4.171   1.00 0.00 ? 59 ARG A CD   1  
ATOM 941   N NE   . ARG A 1 59 ? 7.673   -6.748  4.591   1.00 0.00 ? 59 ARG A NE   1  
ATOM 942   C CZ   . ARG A 1 59 ? 8.103   -7.881  4.049   1.00 0.00 ? 59 ARG A CZ   1  
ATOM 943   N NH1  . ARG A 1 59 ? 7.416   -8.453  3.069   1.00 0.00 ? 59 ARG A NH1  1  
ATOM 944   N NH2  . ARG A 1 59 ? 9.222   -8.445  4.485   1.00 0.00 ? 59 ARG A NH2  1  
ATOM 945   H H    . ARG A 1 59 ? 6.042   -2.072  2.777   1.00 0.00 ? 59 ARG A H    1  
ATOM 946   H HA   . ARG A 1 59 ? 7.248   -2.204  5.195   1.00 0.00 ? 59 ARG A HA   1  
ATOM 947   H HB2  . ARG A 1 59 ? 7.400   -3.937  2.776   1.00 0.00 ? 59 ARG A HB2  1  
ATOM 948   H HB3  . ARG A 1 59 ? 8.509   -4.273  4.098   1.00 0.00 ? 59 ARG A HB3  1  
ATOM 949   H HG2  . ARG A 1 59 ? 6.628   -4.517  5.628   1.00 0.00 ? 59 ARG A HG2  1  
ATOM 950   H HG3  . ARG A 1 59 ? 5.508   -4.156  4.313   1.00 0.00 ? 59 ARG A HG3  1  
ATOM 951   H HD2  . ARG A 1 59 ? 5.605   -6.540  4.637   1.00 0.00 ? 59 ARG A HD2  1  
ATOM 952   H HD3  . ARG A 1 59 ? 6.364   -6.133  3.098   1.00 0.00 ? 59 ARG A HD3  1  
ATOM 953   H HE   . ARG A 1 59 ? 8.196   -6.343  5.314   1.00 0.00 ? 59 ARG A HE   1  
ATOM 954   H HH11 . ARG A 1 59 ? 6.573   -8.030  2.737   1.00 0.00 ? 59 ARG A HH11 1  
ATOM 955   H HH12 . ARG A 1 59 ? 7.742   -9.306  2.661   1.00 0.00 ? 59 ARG A HH12 1  
ATOM 956   H HH21 . ARG A 1 59 ? 9.742   -8.017  5.223   1.00 0.00 ? 59 ARG A HH21 1  
ATOM 957   H HH22 . ARG A 1 59 ? 9.544   -9.299  4.076   1.00 0.00 ? 59 ARG A HH22 1  
ATOM 958   N N    . SER A 1 60 ? 9.445   -1.453  2.880   1.00 0.00 ? 60 SER A N    1  
ATOM 959   C CA   . SER A 1 60 ? 10.793  -0.947  2.653   1.00 0.00 ? 60 SER A CA   1  
ATOM 960   C C    . SER A 1 60 ? 10.915  0.501   3.119   1.00 0.00 ? 60 SER A C    1  
ATOM 961   O O    . SER A 1 60 ? 11.959  0.919   3.620   1.00 0.00 ? 60 SER A O    1  
ATOM 962   C CB   . SER A 1 60 ? 11.157  -1.050  1.171   1.00 0.00 ? 60 SER A CB   1  
ATOM 963   O OG   . SER A 1 60 ? 12.560  -1.139  0.995   1.00 0.00 ? 60 SER A OG   1  
ATOM 964   H H    . SER A 1 60 ? 8.827   -1.525  2.123   1.00 0.00 ? 60 SER A H    1  
ATOM 965   H HA   . SER A 1 60 ? 11.477  -1.555  3.226   1.00 0.00 ? 60 SER A HA   1  
ATOM 966   H HB2  . SER A 1 60 ? 10.697  -1.931  0.750   1.00 0.00 ? 60 SER A HB2  1  
ATOM 967   H HB3  . SER A 1 60 ? 10.796  -0.173  0.653   1.00 0.00 ? 60 SER A HB3  1  
ATOM 968   H HG   . SER A 1 60 ? 12.986  -0.404  1.442   1.00 0.00 ? 60 SER A HG   1  
ATOM 969   N N    . LYS A 1 61 ? 9.840   1.263   2.949   1.00 0.00 ? 61 LYS A N    1  
ATOM 970   C CA   . LYS A 1 61 ? 9.823   2.664   3.352   1.00 0.00 ? 61 LYS A CA   1  
ATOM 971   C C    . LYS A 1 61 ? 8.925   2.870   4.567   1.00 0.00 ? 61 LYS A C    1  
ATOM 972   O O    . LYS A 1 61 ? 8.124   3.805   4.607   1.00 0.00 ? 61 LYS A O    1  
ATOM 973   C CB   . LYS A 1 61 ? 9.343   3.543   2.195   1.00 0.00 ? 61 LYS A CB   1  
ATOM 974   C CG   . LYS A 1 61 ? 10.407  3.795   1.140   1.00 0.00 ? 61 LYS A CG   1  
ATOM 975   C CD   . LYS A 1 61 ? 11.268  4.997   1.493   1.00 0.00 ? 61 LYS A CD   1  
ATOM 976   C CE   . LYS A 1 61 ? 12.445  5.138   0.540   1.00 0.00 ? 61 LYS A CE   1  
ATOM 977   N NZ   . LYS A 1 61 ? 12.000  5.422   -0.853  1.00 0.00 ? 61 LYS A NZ   1  
ATOM 978   H H    . LYS A 1 61 ? 9.037   0.873   2.543   1.00 0.00 ? 61 LYS A H    1  
ATOM 979   H HA   . LYS A 1 61 ? 10.832  2.947   3.613   1.00 0.00 ? 61 LYS A HA   1  
ATOM 980   H HB2  . LYS A 1 61 ? 8.501   3.063   1.719   1.00 0.00 ? 61 LYS A HB2  1  
ATOM 981   H HB3  . LYS A 1 61 ? 9.026   4.497   2.591   1.00 0.00 ? 61 LYS A HB3  1  
ATOM 982   H HG2  . LYS A 1 61 ? 11.039  2.923   1.064   1.00 0.00 ? 61 LYS A HG2  1  
ATOM 983   H HG3  . LYS A 1 61 ? 9.924   3.977   0.191   1.00 0.00 ? 61 LYS A HG3  1  
ATOM 984   H HD2  . LYS A 1 61 ? 10.664  5.891   1.437   1.00 0.00 ? 61 LYS A HD2  1  
ATOM 985   H HD3  . LYS A 1 61 ? 11.643  4.877   2.500   1.00 0.00 ? 61 LYS A HD3  1  
ATOM 986   H HE2  . LYS A 1 61 ? 13.072  5.948   0.880   1.00 0.00 ? 61 LYS A HE2  1  
ATOM 987   H HE3  . LYS A 1 61 ? 13.010  4.218   0.548   1.00 0.00 ? 61 LYS A HE3  1  
ATOM 988   H HZ1  . LYS A 1 61 ? 12.505  4.806   -1.521  1.00 0.00 ? 61 LYS A HZ1  1  
ATOM 989   H HZ2  . LYS A 1 61 ? 12.197  6.414   -1.096  1.00 0.00 ? 61 LYS A HZ2  1  
ATOM 990   H HZ3  . LYS A 1 61 ? 10.978  5.251   -0.943  1.00 0.00 ? 61 LYS A HZ3  1  
ATOM 991   N N    . ILE A 1 62 ? 9.064   1.994   5.556   1.00 0.00 ? 62 ILE A N    1  
ATOM 992   C CA   . ILE A 1 62 ? 8.267   2.082   6.773   1.00 0.00 ? 62 ILE A CA   1  
ATOM 993   C C    . ILE A 1 62 ? 8.701   3.266   7.629   1.00 0.00 ? 62 ILE A C    1  
ATOM 994   O O    . ILE A 1 62 ? 9.769   3.247   8.241   1.00 0.00 ? 62 ILE A O    1  
ATOM 995   C CB   . ILE A 1 62 ? 8.371   0.793   7.609   1.00 0.00 ? 62 ILE A CB   1  
ATOM 996   C CG1  . ILE A 1 62 ? 7.797   -0.394  6.831   1.00 0.00 ? 62 ILE A CG1  1  
ATOM 997   C CG2  . ILE A 1 62 ? 7.648   0.962   8.936   1.00 0.00 ? 62 ILE A CG2  1  
ATOM 998   C CD1  . ILE A 1 62 ? 6.285   -0.414  6.789   1.00 0.00 ? 62 ILE A CD1  1  
ATOM 999   H H    . ILE A 1 62 ? 9.720   1.271   5.465   1.00 0.00 ? 62 ILE A H    1  
ATOM 1000  H HA   . ILE A 1 62 ? 7.234   2.218   6.485   1.00 0.00 ? 62 ILE A HA   1  
ATOM 1001  H HB   . ILE A 1 62 ? 9.414   0.608   7.816   1.00 0.00 ? 62 ILE A HB   1  
ATOM 1002  H HG12 . ILE A 1 62 ? 8.157   -0.357  5.815   1.00 0.00 ? 62 ILE A HG12 1  
ATOM 1003  H HG13 . ILE A 1 62 ? 8.129   -1.312  7.293   1.00 0.00 ? 62 ILE A HG13 1  
ATOM 1004  H HG21 . ILE A 1 62 ? 6.930   0.165   9.059   1.00 0.00 ? 62 ILE A HG21 1  
ATOM 1005  H HG22 . ILE A 1 62 ? 8.364   0.928   9.743   1.00 0.00 ? 62 ILE A HG22 1  
ATOM 1006  H HG23 . ILE A 1 62 ? 7.136   1.913   8.949   1.00 0.00 ? 62 ILE A HG23 1  
ATOM 1007  H HD11 . ILE A 1 62 ? 5.908   0.591   6.906   1.00 0.00 ? 62 ILE A HD11 1  
ATOM 1008  H HD12 . ILE A 1 62 ? 5.957   -0.814  5.842   1.00 0.00 ? 62 ILE A HD12 1  
ATOM 1009  H HD13 . ILE A 1 62 ? 5.911   -1.033  7.591   1.00 0.00 ? 62 ILE A HD13 1  
ATOM 1010  N N    . LYS A 1 63 ? 7.864   4.298   7.670   1.00 0.00 ? 63 LYS A N    1  
ATOM 1011  C CA   . LYS A 1 63 ? 8.158   5.491   8.455   1.00 0.00 ? 63 LYS A CA   1  
ATOM 1012  C C    . LYS A 1 63 ? 8.890   5.129   9.743   1.00 0.00 ? 63 LYS A C    1  
ATOM 1013  O O    . LYS A 1 63 ? 9.759   5.869   10.204  1.00 0.00 ? 63 LYS A O    1  
ATOM 1014  C CB   . LYS A 1 63 ? 6.865   6.241   8.784   1.00 0.00 ? 63 LYS A CB   1  
ATOM 1015  C CG   . LYS A 1 63 ? 5.947   5.485   9.729   1.00 0.00 ? 63 LYS A CG   1  
ATOM 1016  C CD   . LYS A 1 63 ? 6.244   5.820   11.181  1.00 0.00 ? 63 LYS A CD   1  
ATOM 1017  C CE   . LYS A 1 63 ? 5.618   7.145   11.587  1.00 0.00 ? 63 LYS A CE   1  
ATOM 1018  N NZ   . LYS A 1 63 ? 5.447   7.249   13.063  1.00 0.00 ? 63 LYS A NZ   1  
ATOM 1019  H H    . LYS A 1 63 ? 7.027   4.254   7.161   1.00 0.00 ? 63 LYS A H    1  
ATOM 1020  H HA   . LYS A 1 63 ? 8.793   6.130   7.860   1.00 0.00 ? 63 LYS A HA   1  
ATOM 1021  H HB2  . LYS A 1 63 ? 7.118   7.187   9.240   1.00 0.00 ? 63 LYS A HB2  1  
ATOM 1022  H HB3  . LYS A 1 63 ? 6.327   6.427   7.865   1.00 0.00 ? 63 LYS A HB3  1  
ATOM 1023  H HG2  . LYS A 1 63 ? 4.923   5.751   9.512   1.00 0.00 ? 63 LYS A HG2  1  
ATOM 1024  H HG3  . LYS A 1 63 ? 6.085   4.424   9.578   1.00 0.00 ? 63 LYS A HG3  1  
ATOM 1025  H HD2  . LYS A 1 63 ? 5.845   5.038   11.810  1.00 0.00 ? 63 LYS A HD2  1  
ATOM 1026  H HD3  . LYS A 1 63 ? 7.315   5.881   11.315  1.00 0.00 ? 63 LYS A HD3  1  
ATOM 1027  H HE2  . LYS A 1 63 ? 6.255   7.948   11.250  1.00 0.00 ? 63 LYS A HE2  1  
ATOM 1028  H HE3  . LYS A 1 63 ? 4.650   7.231   11.114  1.00 0.00 ? 63 LYS A HE3  1  
ATOM 1029  H HZ1  . LYS A 1 63 ? 4.938   6.416   13.423  1.00 0.00 ? 63 LYS A HZ1  1  
ATOM 1030  H HZ2  . LYS A 1 63 ? 4.904   8.103   13.300  1.00 0.00 ? 63 LYS A HZ2  1  
ATOM 1031  H HZ3  . LYS A 1 63 ? 6.376   7.301   13.527  1.00 0.00 ? 63 LYS A HZ3  1  
ATOM 1032  N N    . LYS A 1 64 ? 8.535   3.986   10.319  1.00 0.00 ? 64 LYS A N    1  
ATOM 1033  C CA   . LYS A 1 64 ? 9.159   3.524   11.552  1.00 0.00 ? 64 LYS A CA   1  
ATOM 1034  C C    . LYS A 1 64 ? 10.570  3.008   11.288  1.00 0.00 ? 64 LYS A C    1  
ATOM 1035  O O    . LYS A 1 64 ? 10.792  2.226   10.364  1.00 0.00 ? 64 LYS A O    1  
ATOM 1036  C CB   . LYS A 1 64 ? 8.314   2.421   12.194  1.00 0.00 ? 64 LYS A CB   1  
ATOM 1037  C CG   . LYS A 1 64 ? 8.460   2.344   13.704  1.00 0.00 ? 64 LYS A CG   1  
ATOM 1038  C CD   . LYS A 1 64 ? 9.792   1.733   14.105  1.00 0.00 ? 64 LYS A CD   1  
ATOM 1039  C CE   . LYS A 1 64 ? 9.790   1.301   15.564  1.00 0.00 ? 64 LYS A CE   1  
ATOM 1040  N NZ   . LYS A 1 64 ? 9.286   -0.091  15.729  1.00 0.00 ? 64 LYS A NZ   1  
ATOM 1041  H H    . LYS A 1 64 ? 7.835   3.439   9.903   1.00 0.00 ? 64 LYS A H    1  
ATOM 1042  H HA   . LYS A 1 64 ? 9.217   4.362   12.230  1.00 0.00 ? 64 LYS A HA   1  
ATOM 1043  H HB2  . LYS A 1 64 ? 7.275   2.600   11.962  1.00 0.00 ? 64 LYS A HB2  1  
ATOM 1044  H HB3  . LYS A 1 64 ? 8.609   1.469   11.776  1.00 0.00 ? 64 LYS A HB3  1  
ATOM 1045  H HG2  . LYS A 1 64 ? 8.395   3.341   14.114  1.00 0.00 ? 64 LYS A HG2  1  
ATOM 1046  H HG3  . LYS A 1 64 ? 7.660   1.736   14.103  1.00 0.00 ? 64 LYS A HG3  1  
ATOM 1047  H HD2  . LYS A 1 64 ? 9.984   0.870   13.486  1.00 0.00 ? 64 LYS A HD2  1  
ATOM 1048  H HD3  . LYS A 1 64 ? 10.573  2.465   13.957  1.00 0.00 ? 64 LYS A HD3  1  
ATOM 1049  H HE2  . LYS A 1 64 ? 10.799  1.357   15.943  1.00 0.00 ? 64 LYS A HE2  1  
ATOM 1050  H HE3  . LYS A 1 64 ? 9.157   1.973   16.124  1.00 0.00 ? 64 LYS A HE3  1  
ATOM 1051  H HZ1  . LYS A 1 64 ? 8.316   -0.165  15.361  1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 1052  H HZ2  . LYS A 1 64 ? 9.285   -0.353  16.735  1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 1053  H HZ3  . LYS A 1 64 ? 9.894   -0.755  15.209  1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 1054  N N    . SER A 1 65 ? 11.521  3.451   12.105  1.00 0.00 ? 65 SER A N    1  
ATOM 1055  C CA   . SER A 1 65 ? 12.911  3.035   11.957  1.00 0.00 ? 65 SER A CA   1  
ATOM 1056  C C    . SER A 1 65 ? 13.196  1.788   12.787  1.00 0.00 ? 65 SER A C    1  
ATOM 1057  O O    . SER A 1 65 ? 12.680  1.633   13.893  1.00 0.00 ? 65 SER A O    1  
ATOM 1058  C CB   . SER A 1 65 ? 13.850  4.167   12.377  1.00 0.00 ? 65 SER A CB   1  
ATOM 1059  O OG   . SER A 1 65 ? 15.117  4.035   11.756  1.00 0.00 ? 65 SER A OG   1  
ATOM 1060  H H    . SER A 1 65 ? 11.281  4.074   12.823  1.00 0.00 ? 65 SER A H    1  
ATOM 1061  H HA   . SER A 1 65 ? 13.079  2.807   10.915  1.00 0.00 ? 65 SER A HA   1  
ATOM 1062  H HB2  . SER A 1 65 ? 13.420  5.114   12.090  1.00 0.00 ? 65 SER A HB2  1  
ATOM 1063  H HB3  . SER A 1 65 ? 13.983  4.142   13.449  1.00 0.00 ? 65 SER A HB3  1  
ATOM 1064  H HG   . SER A 1 65 ? 15.473  3.161   11.937  1.00 0.00 ? 65 SER A HG   1  
ATOM 1065  N N    . GLY A 1 66 ? 14.022  0.899   12.244  1.00 0.00 ? 66 GLY A N    1  
ATOM 1066  C CA   . GLY A 1 66 ? 14.363  -0.324  12.946  1.00 0.00 ? 66 GLY A CA   1  
ATOM 1067  C C    . GLY A 1 66 ? 14.566  -1.496  12.006  1.00 0.00 ? 66 GLY A C    1  
ATOM 1068  O O    . GLY A 1 66 ? 15.692  -1.909  11.730  1.00 0.00 ? 66 GLY A O    1  
ATOM 1069  H H    . GLY A 1 66 ? 14.404  1.076   11.358  1.00 0.00 ? 66 GLY A H    1  
ATOM 1070  H HA2  . GLY A 1 66 ? 15.272  -0.164  13.507  1.00 0.00 ? 66 GLY A HA2  1  
ATOM 1071  H HA3  . GLY A 1 66 ? 13.565  -0.564  13.635  1.00 0.00 ? 66 GLY A HA3  1  
ATOM 1072  N N    . PRO A 1 67 ? 13.456  -2.052  11.499  1.00 0.00 ? 67 PRO A N    1  
ATOM 1073  C CA   . PRO A 1 67 ? 13.491  -3.191  10.577  1.00 0.00 ? 67 PRO A CA   1  
ATOM 1074  C C    . PRO A 1 67 ? 14.045  -2.813  9.208   1.00 0.00 ? 67 PRO A C    1  
ATOM 1075  O O    . PRO A 1 67 ? 14.658  -3.635  8.527   1.00 0.00 ? 67 PRO A O    1  
ATOM 1076  C CB   . PRO A 1 67 ? 12.021  -3.602  10.464  1.00 0.00 ? 67 PRO A CB   1  
ATOM 1077  C CG   . PRO A 1 67 ? 11.256  -2.362  10.777  1.00 0.00 ? 67 PRO A CG   1  
ATOM 1078  C CD   . PRO A 1 67 ? 12.080  -1.610  11.785  1.00 0.00 ? 67 PRO A CD   1  
ATOM 1079  H HA   . PRO A 1 67 ? 14.066  -4.011  10.983  1.00 0.00 ? 67 PRO A HA   1  
ATOM 1080  H HB2  . PRO A 1 67 ? 11.818  -3.950  9.461   1.00 0.00 ? 67 PRO A HB2  1  
ATOM 1081  H HB3  . PRO A 1 67 ? 11.807  -4.387  11.174  1.00 0.00 ? 67 PRO A HB3  1  
ATOM 1082  H HG2  . PRO A 1 67 ? 11.130  -1.773  9.881   1.00 0.00 ? 67 PRO A HG2  1  
ATOM 1083  H HG3  . PRO A 1 67 ? 10.295  -2.620  11.196  1.00 0.00 ? 67 PRO A HG3  1  
ATOM 1084  H HD2  . PRO A 1 67 ? 11.978  -0.545  11.637  1.00 0.00 ? 67 PRO A HD2  1  
ATOM 1085  H HD3  . PRO A 1 67 ? 11.790  -1.883  12.789  1.00 0.00 ? 67 PRO A HD3  1  
ATOM 1086  N N    . SER A 1 68 ? 13.826  -1.563  8.811   1.00 0.00 ? 68 SER A N    1  
ATOM 1087  C CA   . SER A 1 68 ? 14.301  -1.077  7.521   1.00 0.00 ? 68 SER A CA   1  
ATOM 1088  C C    . SER A 1 68 ? 15.822  -1.160  7.435   1.00 0.00 ? 68 SER A C    1  
ATOM 1089  O O    . SER A 1 68 ? 16.521  -0.971  8.430   1.00 0.00 ? 68 SER A O    1  
ATOM 1090  C CB   . SER A 1 68 ? 13.844  0.366   7.296   1.00 0.00 ? 68 SER A CB   1  
ATOM 1091  O OG   . SER A 1 68 ? 12.435  0.477   7.405   1.00 0.00 ? 68 SER A OG   1  
ATOM 1092  H H    . SER A 1 68 ? 13.330  -0.955  9.399   1.00 0.00 ? 68 SER A H    1  
ATOM 1093  H HA   . SER A 1 68 ? 13.874  -1.705  6.752   1.00 0.00 ? 68 SER A HA   1  
ATOM 1094  H HB2  . SER A 1 68 ? 14.302  1.005   8.036   1.00 0.00 ? 68 SER A HB2  1  
ATOM 1095  H HB3  . SER A 1 68 ? 14.144  0.686   6.309   1.00 0.00 ? 68 SER A HB3  1  
ATOM 1096  H HG   . SER A 1 68 ? 12.169  0.298   8.309   1.00 0.00 ? 68 SER A HG   1  
ATOM 1097  N N    . SER A 1 69 ? 16.326  -1.444  6.239   1.00 0.00 ? 69 SER A N    1  
ATOM 1098  C CA   . SER A 1 69 ? 17.764  -1.556  6.023   1.00 0.00 ? 69 SER A CA   1  
ATOM 1099  C C    . SER A 1 69 ? 18.419  -0.178  5.997   1.00 0.00 ? 69 SER A C    1  
ATOM 1100  O O    . SER A 1 69 ? 17.745  0.844   6.116   1.00 0.00 ? 69 SER A O    1  
ATOM 1101  C CB   . SER A 1 69 ? 18.048  -2.292  4.712   1.00 0.00 ? 69 SER A CB   1  
ATOM 1102  O OG   . SER A 1 69 ? 17.513  -1.588  3.605   1.00 0.00 ? 69 SER A OG   1  
ATOM 1103  H H    . SER A 1 69 ? 15.717  -1.583  5.484   1.00 0.00 ? 69 SER A H    1  
ATOM 1104  H HA   . SER A 1 69 ? 18.179  -2.124  6.842   1.00 0.00 ? 69 SER A HA   1  
ATOM 1105  H HB2  . SER A 1 69 ? 19.115  -2.388  4.580   1.00 0.00 ? 69 SER A HB2  1  
ATOM 1106  H HB3  . SER A 1 69 ? 17.600  -3.274  4.750   1.00 0.00 ? 69 SER A HB3  1  
ATOM 1107  H HG   . SER A 1 69 ? 17.105  -2.208  2.997   1.00 0.00 ? 69 SER A HG   1  
ATOM 1108  N N    . GLY A 1 70 ? 19.739  -0.160  5.841   1.00 0.00 ? 70 GLY A N    1  
ATOM 1109  C CA   . GLY A 1 70 ? 20.464  1.097   5.803   1.00 0.00 ? 70 GLY A CA   1  
ATOM 1110  C C    . GLY A 1 70 ? 21.836  0.956   5.174   1.00 0.00 ? 70 GLY A C    1  
ATOM 1111  O O    . GLY A 1 70 ? 22.812  0.649   5.858   1.00 0.00 ? 70 GLY A O    1  
ATOM 1112  H H    . GLY A 1 70 ? 20.225  -1.006  5.751   1.00 0.00 ? 70 GLY A H    1  
ATOM 1113  H HA2  . GLY A 1 70 ? 19.891  1.814   5.235   1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1114  H HA3  . GLY A 1 70 ? 20.580  1.463   6.813   1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1115  N N    . GLY A 1 1  ? 14.020  -1.177  -8.270  1.00 0.00 ? 1  GLY A N    2  
ATOM 1116  C CA   . GLY A 1 1  ? 12.955  -0.860  -9.202  1.00 0.00 ? 1  GLY A CA   2  
ATOM 1117  C C    . GLY A 1 1  ? 13.310  -1.218  -10.632 1.00 0.00 ? 1  GLY A C    2  
ATOM 1118  O O    . GLY A 1 1  ? 14.124  -2.109  -10.872 1.00 0.00 ? 1  GLY A O    2  
ATOM 1119  H H1   . GLY A 1 1  ? 14.565  -0.458  -7.888  1.00 0.00 ? 1  GLY A H1   2  
ATOM 1120  H HA2  . GLY A 1 1  ? 12.067  -1.403  -8.916  1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1121  H HA3  . GLY A 1 1  ? 12.750  0.200   -9.149  1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1122  N N    . SER A 1 2  ? 12.695  -0.523  -11.584 1.00 0.00 ? 2  SER A N    2  
ATOM 1123  C CA   . SER A 1 2  ? 12.947  -0.776  -12.998 1.00 0.00 ? 2  SER A CA   2  
ATOM 1124  C C    . SER A 1 2  ? 13.875  0.283   -13.583 1.00 0.00 ? 2  SER A C    2  
ATOM 1125  O O    . SER A 1 2  ? 13.660  0.768   -14.694 1.00 0.00 ? 2  SER A O    2  
ATOM 1126  C CB   . SER A 1 2  ? 11.629  -0.802  -13.775 1.00 0.00 ? 2  SER A CB   2  
ATOM 1127  O OG   . SER A 1 2  ? 11.844  -1.150  -15.132 1.00 0.00 ? 2  SER A OG   2  
ATOM 1128  H H    . SER A 1 2  ? 12.056  0.175   -11.329 1.00 0.00 ? 2  SER A H    2  
ATOM 1129  H HA   . SER A 1 2  ? 13.423  -1.742  -13.082 1.00 0.00 ? 2  SER A HA   2  
ATOM 1130  H HB2  . SER A 1 2  ? 10.966  -1.528  -13.331 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1131  H HB3  . SER A 1 2  ? 11.172  0.176   -13.735 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1132  H HG   . SER A 1 2  ? 11.000  -1.218  -15.583 1.00 0.00 ? 2  SER A HG   2  
ATOM 1133  N N    . SER A 1 3  ? 14.909  0.639   -12.826 1.00 0.00 ? 3  SER A N    2  
ATOM 1134  C CA   . SER A 1 3  ? 15.869  1.644   -13.267 1.00 0.00 ? 3  SER A CA   2  
ATOM 1135  C C    . SER A 1 3  ? 15.164  2.792   -13.983 1.00 0.00 ? 3  SER A C    2  
ATOM 1136  O O    . SER A 1 3  ? 15.640  3.288   -15.003 1.00 0.00 ? 3  SER A O    2  
ATOM 1137  C CB   . SER A 1 3  ? 16.910  1.013   -14.193 1.00 0.00 ? 3  SER A CB   2  
ATOM 1138  O OG   . SER A 1 3  ? 16.328  0.622   -15.425 1.00 0.00 ? 3  SER A OG   2  
ATOM 1139  H H    . SER A 1 3  ? 15.026  0.216   -11.950 1.00 0.00 ? 3  SER A H    2  
ATOM 1140  H HA   . SER A 1 3  ? 16.367  2.033   -12.391 1.00 0.00 ? 3  SER A HA   2  
ATOM 1141  H HB2  . SER A 1 3  ? 17.693  1.729   -14.391 1.00 0.00 ? 3  SER A HB2  2  
ATOM 1142  H HB3  . SER A 1 3  ? 17.332  0.141   -13.715 1.00 0.00 ? 3  SER A HB3  2  
ATOM 1143  H HG   . SER A 1 3  ? 17.018  0.353   -16.035 1.00 0.00 ? 3  SER A HG   2  
ATOM 1144  N N    . GLY A 1 4  ? 14.024  3.209   -13.439 1.00 0.00 ? 4  GLY A N    2  
ATOM 1145  C CA   . GLY A 1 4  ? 13.271  4.295   -14.038 1.00 0.00 ? 4  GLY A CA   2  
ATOM 1146  C C    . GLY A 1 4  ? 12.492  5.095   -13.013 1.00 0.00 ? 4  GLY A C    2  
ATOM 1147  O O    . GLY A 1 4  ? 11.800  4.527   -12.167 1.00 0.00 ? 4  GLY A O    2  
ATOM 1148  H H    . GLY A 1 4  ? 13.692  2.776   -12.625 1.00 0.00 ? 4  GLY A H    2  
ATOM 1149  H HA2  . GLY A 1 4  ? 13.956  4.955   -14.549 1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1150  H HA3  . GLY A 1 4  ? 12.578  3.883   -14.758 1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1151  N N    . SER A 1 5  ? 12.606  6.417   -13.085 1.00 0.00 ? 5  SER A N    2  
ATOM 1152  C CA   . SER A 1 5  ? 11.911  7.296   -12.152 1.00 0.00 ? 5  SER A CA   2  
ATOM 1153  C C    . SER A 1 5  ? 11.424  8.560   -12.856 1.00 0.00 ? 5  SER A C    2  
ATOM 1154  O O    . SER A 1 5  ? 11.970  8.961   -13.884 1.00 0.00 ? 5  SER A O    2  
ATOM 1155  C CB   . SER A 1 5  ? 12.831  7.670   -10.988 1.00 0.00 ? 5  SER A CB   2  
ATOM 1156  O OG   . SER A 1 5  ? 12.106  8.301   -9.947  1.00 0.00 ? 5  SER A OG   2  
ATOM 1157  H H    . SER A 1 5  ? 13.172  6.810   -13.781 1.00 0.00 ? 5  SER A H    2  
ATOM 1158  H HA   . SER A 1 5  ? 11.056  6.761   -11.766 1.00 0.00 ? 5  SER A HA   2  
ATOM 1159  H HB2  . SER A 1 5  ? 13.294  6.776   -10.598 1.00 0.00 ? 5  SER A HB2  2  
ATOM 1160  H HB3  . SER A 1 5  ? 13.596  8.347   -11.341 1.00 0.00 ? 5  SER A HB3  2  
ATOM 1161  H HG   . SER A 1 5  ? 12.057  9.245   -10.118 1.00 0.00 ? 5  SER A HG   2  
ATOM 1162  N N    . SER A 1 6  ? 10.392  9.182   -12.295 1.00 0.00 ? 6  SER A N    2  
ATOM 1163  C CA   . SER A 1 6  ? 9.828   10.398  -12.869 1.00 0.00 ? 6  SER A CA   2  
ATOM 1164  C C    . SER A 1 6  ? 10.119  11.604  -11.981 1.00 0.00 ? 6  SER A C    2  
ATOM 1165  O O    . SER A 1 6  ? 10.806  12.539  -12.390 1.00 0.00 ? 6  SER A O    2  
ATOM 1166  C CB   . SER A 1 6  ? 8.318   10.243  -13.061 1.00 0.00 ? 6  SER A CB   2  
ATOM 1167  O OG   . SER A 1 6  ? 7.786   11.322  -13.811 1.00 0.00 ? 6  SER A OG   2  
ATOM 1168  H H    . SER A 1 6  ? 10.000  8.813   -11.476 1.00 0.00 ? 6  SER A H    2  
ATOM 1169  H HA   . SER A 1 6  ? 10.291  10.555  -13.832 1.00 0.00 ? 6  SER A HA   2  
ATOM 1170  H HB2  . SER A 1 6  ? 8.117   9.322   -13.587 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1171  H HB3  . SER A 1 6  ? 7.836   10.219  -12.095 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1172  H HG   . SER A 1 6  ? 6.860   11.440  -13.589 1.00 0.00 ? 6  SER A HG   2  
ATOM 1173  N N    . GLY A 1 7  ? 9.589   11.575  -10.762 1.00 0.00 ? 7  GLY A N    2  
ATOM 1174  C CA   . GLY A 1 7  ? 9.802   12.670  -9.834  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1175  C C    . GLY A 1 7  ? 8.525   13.431  -9.533  1.00 0.00 ? 7  GLY A C    2  
ATOM 1176  O O    . GLY A 1 7  ? 7.516   12.837  -9.154  1.00 0.00 ? 7  GLY A O    2  
ATOM 1177  H H    . GLY A 1 7  ? 9.050   10.803  -10.490 1.00 0.00 ? 7  GLY A H    2  
ATOM 1178  H HA2  . GLY A 1 7  ? 10.199  12.274  -8.912  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1179  H HA3  . GLY A 1 7  ? 10.521  13.353  -10.261 1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1180  N N    . ARG A 1 8  ? 8.570   14.748  -9.701  1.00 0.00 ? 8  ARG A N    2  
ATOM 1181  C CA   . ARG A 1 8  ? 7.409   15.591  -9.441  1.00 0.00 ? 8  ARG A CA   2  
ATOM 1182  C C    . ARG A 1 8  ? 6.131   14.926  -9.943  1.00 0.00 ? 8  ARG A C    2  
ATOM 1183  O O    . ARG A 1 8  ? 6.165   14.099  -10.855 1.00 0.00 ? 8  ARG A O    2  
ATOM 1184  C CB   . ARG A 1 8  ? 7.583   16.956  -10.110 1.00 0.00 ? 8  ARG A CB   2  
ATOM 1185  C CG   . ARG A 1 8  ? 7.412   16.920  -11.620 1.00 0.00 ? 8  ARG A CG   2  
ATOM 1186  C CD   . ARG A 1 8  ? 8.735   16.659  -12.324 1.00 0.00 ? 8  ARG A CD   2  
ATOM 1187  N NE   . ARG A 1 8  ? 9.445   17.898  -12.631 1.00 0.00 ? 8  ARG A NE   2  
ATOM 1188  C CZ   . ARG A 1 8  ? 10.530  17.953  -13.396 1.00 0.00 ? 8  ARG A CZ   2  
ATOM 1189  N NH1  . ARG A 1 8  ? 11.026  16.845  -13.929 1.00 0.00 ? 8  ARG A NH1  2  
ATOM 1190  N NH2  . ARG A 1 8  ? 11.120  19.118  -13.629 1.00 0.00 ? 8  ARG A NH2  2  
ATOM 1191  H H    . ARG A 1 8  ? 9.404   15.164  -10.005 1.00 0.00 ? 8  ARG A H    2  
ATOM 1192  H HA   . ARG A 1 8  ? 7.333   15.731  -8.373  1.00 0.00 ? 8  ARG A HA   2  
ATOM 1193  H HB2  . ARG A 1 8  ? 6.852   17.639  -9.703  1.00 0.00 ? 8  ARG A HB2  2  
ATOM 1194  H HB3  . ARG A 1 8  ? 8.573   17.327  -9.890  1.00 0.00 ? 8  ARG A HB3  2  
ATOM 1195  H HG2  . ARG A 1 8  ? 6.719   16.132  -11.876 1.00 0.00 ? 8  ARG A HG2  2  
ATOM 1196  H HG3  . ARG A 1 8  ? 7.019   17.870  -11.951 1.00 0.00 ? 8  ARG A HG3  2  
ATOM 1197  H HD2  . ARG A 1 8  ? 9.354   16.050  -11.684 1.00 0.00 ? 8  ARG A HD2  2  
ATOM 1198  H HD3  . ARG A 1 8  ? 8.538   16.130  -13.245 1.00 0.00 ? 8  ARG A HD3  2  
ATOM 1199  H HE   . ARG A 1 8  ? 9.095   18.729  -12.248 1.00 0.00 ? 8  ARG A HE   2  
ATOM 1200  H HH11 . ARG A 1 8  ? 10.582  15.966  -13.756 1.00 0.00 ? 8  ARG A HH11 2  
ATOM 1201  H HH12 . ARG A 1 8  ? 11.842  16.889  -14.505 1.00 0.00 ? 8  ARG A HH12 2  
ATOM 1202  H HH21 . ARG A 1 8  ? 10.749  19.955  -13.229 1.00 0.00 ? 8  ARG A HH21 2  
ATOM 1203  H HH22 . ARG A 1 8  ? 11.936  19.158  -14.205 1.00 0.00 ? 8  ARG A HH22 2  
ATOM 1204  N N    . LYS A 1 9  ? 5.004   15.292  -9.342  1.00 0.00 ? 9  LYS A N    2  
ATOM 1205  C CA   . LYS A 1 9  ? 3.714   14.732  -9.727  1.00 0.00 ? 9  LYS A CA   2  
ATOM 1206  C C    . LYS A 1 9  ? 2.572   15.480  -9.047  1.00 0.00 ? 9  LYS A C    2  
ATOM 1207  O O    . LYS A 1 9  ? 2.686   15.934  -7.908  1.00 0.00 ? 9  LYS A O    2  
ATOM 1208  C CB   . LYS A 1 9  ? 3.651   13.246  -9.366  1.00 0.00 ? 9  LYS A CB   2  
ATOM 1209  C CG   . LYS A 1 9  ? 4.126   12.942  -7.956  1.00 0.00 ? 9  LYS A CG   2  
ATOM 1210  C CD   . LYS A 1 9  ? 4.393   11.459  -7.764  1.00 0.00 ? 9  LYS A CD   2  
ATOM 1211  C CE   . LYS A 1 9  ? 3.100   10.657  -7.752  1.00 0.00 ? 9  LYS A CE   2  
ATOM 1212  N NZ   . LYS A 1 9  ? 2.700   10.229  -9.120  1.00 0.00 ? 9  LYS A NZ   2  
ATOM 1213  H H    . LYS A 1 9  ? 5.041   15.956  -8.621  1.00 0.00 ? 9  LYS A H    2  
ATOM 1214  H HA   . LYS A 1 9  ? 3.612   14.839  -10.796 1.00 0.00 ? 9  LYS A HA   2  
ATOM 1215  H HB2  . LYS A 1 9  ? 2.630   12.908  -9.460  1.00 0.00 ? 9  LYS A HB2  2  
ATOM 1216  H HB3  . LYS A 1 9  ? 4.270   12.694  -10.058 1.00 0.00 ? 9  LYS A HB3  2  
ATOM 1217  H HG2  . LYS A 1 9  ? 5.039   13.488  -7.767  1.00 0.00 ? 9  LYS A HG2  2  
ATOM 1218  H HG3  . LYS A 1 9  ? 3.366   13.256  -7.254  1.00 0.00 ? 9  LYS A HG3  2  
ATOM 1219  H HD2  . LYS A 1 9  ? 5.014   11.106  -8.574  1.00 0.00 ? 9  LYS A HD2  2  
ATOM 1220  H HD3  . LYS A 1 9  ? 4.907   11.312  -6.825  1.00 0.00 ? 9  LYS A HD3  2  
ATOM 1221  H HE2  . LYS A 1 9  ? 3.241   9.782   -7.136  1.00 0.00 ? 9  LYS A HE2  2  
ATOM 1222  H HE3  . LYS A 1 9  ? 2.316   11.271  -7.331  1.00 0.00 ? 9  LYS A HE3  2  
ATOM 1223  H HZ1  . LYS A 1 9  ? 2.935   9.226   -9.264  1.00 0.00 ? 9  LYS A HZ1  2  
ATOM 1224  H HZ2  . LYS A 1 9  ? 3.201   10.796  -9.833  1.00 0.00 ? 9  LYS A HZ2  2  
ATOM 1225  H HZ3  . LYS A 1 9  ? 1.676   10.355  -9.249  1.00 0.00 ? 9  LYS A HZ3  2  
ATOM 1226  N N    . PRO A 1 10 ? 1.443   15.612  -9.759  1.00 0.00 ? 10 PRO A N    2  
ATOM 1227  C CA   . PRO A 1 10 ? 0.257   16.302  -9.243  1.00 0.00 ? 10 PRO A CA   2  
ATOM 1228  C C    . PRO A 1 10 ? -0.425  15.525  -8.122  1.00 0.00 ? 10 PRO A C    2  
ATOM 1229  O O    . PRO A 1 10 ? -0.699  16.071  -7.054  1.00 0.00 ? 10 PRO A O    2  
ATOM 1230  C CB   . PRO A 1 10 ? -0.660  16.393  -10.465 1.00 0.00 ? 10 PRO A CB   2  
ATOM 1231  C CG   . PRO A 1 10 ? -0.243  15.260  -11.338 1.00 0.00 ? 10 PRO A CG   2  
ATOM 1232  C CD   . PRO A 1 10 ? 1.236   15.096  -11.123 1.00 0.00 ? 10 PRO A CD   2  
ATOM 1233  H HA   . PRO A 1 10 ? 0.497   17.296  -8.896  1.00 0.00 ? 10 PRO A HA   2  
ATOM 1234  H HB2  . PRO A 1 10 ? -1.691  16.294  -10.153 1.00 0.00 ? 10 PRO A HB2  2  
ATOM 1235  H HB3  . PRO A 1 10 ? -0.517  17.344  -10.957 1.00 0.00 ? 10 PRO A HB3  2  
ATOM 1236  H HG2  . PRO A 1 10 ? -0.766  14.362  -11.048 1.00 0.00 ? 10 PRO A HG2  2  
ATOM 1237  H HG3  . PRO A 1 10 ? -0.447  15.499  -12.371 1.00 0.00 ? 10 PRO A HG3  2  
ATOM 1238  H HD2  . PRO A 1 10 ? 1.513   14.054  -11.187 1.00 0.00 ? 10 PRO A HD2  2  
ATOM 1239  H HD3  . PRO A 1 10 ? 1.790   15.680  -11.843 1.00 0.00 ? 10 PRO A HD3  2  
ATOM 1240  N N    . ARG A 1 11 ? -0.694  14.248  -8.373  1.00 0.00 ? 11 ARG A N    2  
ATOM 1241  C CA   . ARG A 1 11 ? -1.344  13.396  -7.384  1.00 0.00 ? 11 ARG A CA   2  
ATOM 1242  C C    . ARG A 1 11 ? -0.461  12.204  -7.028  1.00 0.00 ? 11 ARG A C    2  
ATOM 1243  O O    . ARG A 1 11 ? 0.219   11.642  -7.888  1.00 0.00 ? 11 ARG A O    2  
ATOM 1244  C CB   . ARG A 1 11 ? -2.694  12.905  -7.912  1.00 0.00 ? 11 ARG A CB   2  
ATOM 1245  C CG   . ARG A 1 11 ? -3.803  13.937  -7.803  1.00 0.00 ? 11 ARG A CG   2  
ATOM 1246  C CD   . ARG A 1 11 ? -3.622  15.059  -8.814  1.00 0.00 ? 11 ARG A CD   2  
ATOM 1247  N NE   . ARG A 1 11 ? -4.845  15.836  -8.994  1.00 0.00 ? 11 ARG A NE   2  
ATOM 1248  C CZ   . ARG A 1 11 ? -5.105  16.557  -10.079 1.00 0.00 ? 11 ARG A CZ   2  
ATOM 1249  N NH1  . ARG A 1 11 ? -4.232  16.599  -11.075 1.00 0.00 ? 11 ARG A NH1  2  
ATOM 1250  N NH2  . ARG A 1 11 ? -6.241  17.238  -10.168 1.00 0.00 ? 11 ARG A NH2  2  
ATOM 1251  H H    . ARG A 1 11 ? -0.451  13.870  -9.244  1.00 0.00 ? 11 ARG A H    2  
ATOM 1252  H HA   . ARG A 1 11 ? -1.509  13.986  -6.495  1.00 0.00 ? 11 ARG A HA   2  
ATOM 1253  H HB2  . ARG A 1 11 ? -2.584  12.635  -8.952  1.00 0.00 ? 11 ARG A HB2  2  
ATOM 1254  H HB3  . ARG A 1 11 ? -2.989  12.030  -7.352  1.00 0.00 ? 11 ARG A HB3  2  
ATOM 1255  H HG2  . ARG A 1 11 ? -4.752  13.454  -7.984  1.00 0.00 ? 11 ARG A HG2  2  
ATOM 1256  H HG3  . ARG A 1 11 ? -3.795  14.357  -6.808  1.00 0.00 ? 11 ARG A HG3  2  
ATOM 1257  H HD2  . ARG A 1 11 ? -2.838  15.715  -8.467  1.00 0.00 ? 11 ARG A HD2  2  
ATOM 1258  H HD3  . ARG A 1 11 ? -3.338  14.628  -9.762  1.00 0.00 ? 11 ARG A HD3  2  
ATOM 1259  H HE   . ARG A 1 11 ? -5.505  15.819  -8.269  1.00 0.00 ? 11 ARG A HE   2  
ATOM 1260  H HH11 . ARG A 1 11 ? -3.376  16.086  -11.011 1.00 0.00 ? 11 ARG A HH11 2  
ATOM 1261  H HH12 . ARG A 1 11 ? -4.430  17.142  -11.892 1.00 0.00 ? 11 ARG A HH12 2  
ATOM 1262  H HH21 . ARG A 1 11 ? -6.901  17.209  -9.419  1.00 0.00 ? 11 ARG A HH21 2  
ATOM 1263  H HH22 . ARG A 1 11 ? -6.435  17.780  -10.985 1.00 0.00 ? 11 ARG A HH22 2  
ATOM 1264  N N    . THR A 1 12 ? -0.474  11.823  -5.755  1.00 0.00 ? 12 THR A N    2  
ATOM 1265  C CA   . THR A 1 12 ? 0.326   10.700  -5.284  1.00 0.00 ? 12 THR A CA   2  
ATOM 1266  C C    . THR A 1 12 ? -0.080  9.406   -5.980  1.00 0.00 ? 12 THR A C    2  
ATOM 1267  O O    . THR A 1 12 ? -1.189  9.293   -6.503  1.00 0.00 ? 12 THR A O    2  
ATOM 1268  C CB   . THR A 1 12 ? 0.193   10.514  -3.761  1.00 0.00 ? 12 THR A CB   2  
ATOM 1269  O OG1  . THR A 1 12 ? 0.548   11.727  -3.086  1.00 0.00 ? 12 THR A OG1  2  
ATOM 1270  C CG2  . THR A 1 12 ? 1.080   9.379   -3.274  1.00 0.00 ? 12 THR A CG2  2  
ATOM 1271  H H    . THR A 1 12 ? -1.037  12.311  -5.117  1.00 0.00 ? 12 THR A H    2  
ATOM 1272  H HA   . THR A 1 12 ? 1.361   10.910  -5.511  1.00 0.00 ? 12 THR A HA   2  
ATOM 1273  H HB   . THR A 1 12 ? -0.835  10.272  -3.532  1.00 0.00 ? 12 THR A HB   2  
ATOM 1274  H HG1  . THR A 1 12 ? 0.443   11.609  -2.139  1.00 0.00 ? 12 THR A HG1  2  
ATOM 1275  H HG21 . THR A 1 12 ? 1.004   9.296   -2.200  1.00 0.00 ? 12 THR A HG21 2  
ATOM 1276  H HG22 . THR A 1 12 ? 2.105   9.581   -3.548  1.00 0.00 ? 12 THR A HG22 2  
ATOM 1277  H HG23 . THR A 1 12 ? 0.762   8.453   -3.730  1.00 0.00 ? 12 THR A HG23 2  
ATOM 1278  N N    . ILE A 1 13 ? 0.824   8.432   -5.981  1.00 0.00 ? 13 ILE A N    2  
ATOM 1279  C CA   . ILE A 1 13 ? 0.558   7.145   -6.612  1.00 0.00 ? 13 ILE A CA   2  
ATOM 1280  C C    . ILE A 1 13 ? -0.793  6.588   -6.176  1.00 0.00 ? 13 ILE A C    2  
ATOM 1281  O O    . ILE A 1 13 ? -1.357  5.714   -6.834  1.00 0.00 ? 13 ILE A O    2  
ATOM 1282  C CB   . ILE A 1 13 ? 1.656   6.117   -6.278  1.00 0.00 ? 13 ILE A CB   2  
ATOM 1283  C CG1  . ILE A 1 13 ? 3.026   6.643   -6.712  1.00 0.00 ? 13 ILE A CG1  2  
ATOM 1284  C CG2  . ILE A 1 13 ? 1.356   4.785   -6.949  1.00 0.00 ? 13 ILE A CG2  2  
ATOM 1285  C CD1  . ILE A 1 13 ? 4.184   5.878   -6.111  1.00 0.00 ? 13 ILE A CD1  2  
ATOM 1286  H H    . ILE A 1 13 ? 1.690   8.582   -5.548  1.00 0.00 ? 13 ILE A H    2  
ATOM 1287  H HA   . ILE A 1 13 ? 0.546   7.294   -7.682  1.00 0.00 ? 13 ILE A HA   2  
ATOM 1288  H HB   . ILE A 1 13 ? 1.660   5.962   -5.210  1.00 0.00 ? 13 ILE A HB   2  
ATOM 1289  H HG12 . ILE A 1 13 ? 3.107   6.576   -7.785  1.00 0.00 ? 13 ILE A HG12 2  
ATOM 1290  H HG13 . ILE A 1 13 ? 3.118   7.676   -6.412  1.00 0.00 ? 13 ILE A HG13 2  
ATOM 1291  H HG21 . ILE A 1 13 ? 2.138   4.079   -6.712  1.00 0.00 ? 13 ILE A HG21 2  
ATOM 1292  H HG22 . ILE A 1 13 ? 0.410   4.408   -6.592  1.00 0.00 ? 13 ILE A HG22 2  
ATOM 1293  H HG23 . ILE A 1 13 ? 1.308   4.924   -8.019  1.00 0.00 ? 13 ILE A HG23 2  
ATOM 1294  H HD11 . ILE A 1 13 ? 4.880   6.572   -5.662  1.00 0.00 ? 13 ILE A HD11 2  
ATOM 1295  H HD12 . ILE A 1 13 ? 3.816   5.198   -5.358  1.00 0.00 ? 13 ILE A HD12 2  
ATOM 1296  H HD13 . ILE A 1 13 ? 4.687   5.317   -6.886  1.00 0.00 ? 13 ILE A HD13 2  
ATOM 1297  N N    . TYR A 1 14 ? -1.307  7.102   -5.065  1.00 0.00 ? 14 TYR A N    2  
ATOM 1298  C CA   . TYR A 1 14 ? -2.593  6.656   -4.540  1.00 0.00 ? 14 TYR A CA   2  
ATOM 1299  C C    . TYR A 1 14 ? -3.404  7.835   -4.011  1.00 0.00 ? 14 TYR A C    2  
ATOM 1300  O O    . TYR A 1 14 ? -2.846  8.820   -3.528  1.00 0.00 ? 14 TYR A O    2  
ATOM 1301  C CB   . TYR A 1 14 ? -2.384  5.626   -3.429  1.00 0.00 ? 14 TYR A CB   2  
ATOM 1302  C CG   . TYR A 1 14 ? -2.025  4.249   -3.939  1.00 0.00 ? 14 TYR A CG   2  
ATOM 1303  C CD1  . TYR A 1 14 ? -0.733  3.956   -4.359  1.00 0.00 ? 14 TYR A CD1  2  
ATOM 1304  C CD2  . TYR A 1 14 ? -2.978  3.239   -4.001  1.00 0.00 ? 14 TYR A CD2  2  
ATOM 1305  C CE1  . TYR A 1 14 ? -0.401  2.700   -4.826  1.00 0.00 ? 14 TYR A CE1  2  
ATOM 1306  C CE2  . TYR A 1 14 ? -2.655  1.979   -4.466  1.00 0.00 ? 14 TYR A CE2  2  
ATOM 1307  C CZ   . TYR A 1 14 ? -1.365  1.714   -4.878  1.00 0.00 ? 14 TYR A CZ   2  
ATOM 1308  O OH   . TYR A 1 14 ? -1.038  0.461   -5.342  1.00 0.00 ? 14 TYR A OH   2  
ATOM 1309  H H    . TYR A 1 14 ? -0.811  7.796   -4.584  1.00 0.00 ? 14 TYR A H    2  
ATOM 1310  H HA   . TYR A 1 14 ? -3.138  6.193   -5.349  1.00 0.00 ? 14 TYR A HA   2  
ATOM 1311  H HB2  . TYR A 1 14 ? -1.586  5.958   -2.784  1.00 0.00 ? 14 TYR A HB2  2  
ATOM 1312  H HB3  . TYR A 1 14 ? -3.294  5.539   -2.852  1.00 0.00 ? 14 TYR A HB3  2  
ATOM 1313  H HD1  . TYR A 1 14 ? 0.019   4.730   -4.316  1.00 0.00 ? 14 TYR A HD1  2  
ATOM 1314  H HD2  . TYR A 1 14 ? -3.988  3.449   -3.678  1.00 0.00 ? 14 TYR A HD2  2  
ATOM 1315  H HE1  . TYR A 1 14 ? 0.608   2.492   -5.148  1.00 0.00 ? 14 TYR A HE1  2  
ATOM 1316  H HE2  . TYR A 1 14 ? -3.409  1.207   -4.507  1.00 0.00 ? 14 TYR A HE2  2  
ATOM 1317  H HH   . TYR A 1 14 ? -0.169  0.488   -5.750  1.00 0.00 ? 14 TYR A HH   2  
ATOM 1318  N N    . SER A 1 15 ? -4.725  7.725   -4.105  1.00 0.00 ? 15 SER A N    2  
ATOM 1319  C CA   . SER A 1 15 ? -5.615  8.782   -3.639  1.00 0.00 ? 15 SER A CA   2  
ATOM 1320  C C    . SER A 1 15 ? -5.713  8.778   -2.117  1.00 0.00 ? 15 SER A C    2  
ATOM 1321  O O    . SER A 1 15 ? -5.388  7.785   -1.466  1.00 0.00 ? 15 SER A O    2  
ATOM 1322  C CB   . SER A 1 15 ? -7.007  8.613   -4.251  1.00 0.00 ? 15 SER A CB   2  
ATOM 1323  O OG   . SER A 1 15 ? -7.817  9.748   -3.997  1.00 0.00 ? 15 SER A OG   2  
ATOM 1324  H H    . SER A 1 15 ? -5.110  6.915   -4.500  1.00 0.00 ? 15 SER A H    2  
ATOM 1325  H HA   . SER A 1 15 ? -5.203  9.728   -3.959  1.00 0.00 ? 15 SER A HA   2  
ATOM 1326  H HB2  . SER A 1 15 ? -6.914  8.485   -5.319  1.00 0.00 ? 15 SER A HB2  2  
ATOM 1327  H HB3  . SER A 1 15 ? -7.482  7.743   -3.823  1.00 0.00 ? 15 SER A HB3  2  
ATOM 1328  H HG   . SER A 1 15 ? -7.616  10.435  -4.636  1.00 0.00 ? 15 SER A HG   2  
ATOM 1329  N N    . SER A 1 16 ? -6.162  9.897   -1.556  1.00 0.00 ? 16 SER A N    2  
ATOM 1330  C CA   . SER A 1 16 ? -6.299  10.025  -0.110  1.00 0.00 ? 16 SER A CA   2  
ATOM 1331  C C    . SER A 1 16 ? -7.265  8.979   0.439   1.00 0.00 ? 16 SER A C    2  
ATOM 1332  O O    . SER A 1 16 ? -6.997  8.345   1.460   1.00 0.00 ? 16 SER A O    2  
ATOM 1333  C CB   . SER A 1 16 ? -6.788  11.428  0.255   1.00 0.00 ? 16 SER A CB   2  
ATOM 1334  O OG   . SER A 1 16 ? -8.026  11.715  -0.371  1.00 0.00 ? 16 SER A OG   2  
ATOM 1335  H H    . SER A 1 16 ? -6.404  10.654  -2.129  1.00 0.00 ? 16 SER A H    2  
ATOM 1336  H HA   . SER A 1 16 ? -5.326  9.866   0.331   1.00 0.00 ? 16 SER A HA   2  
ATOM 1337  H HB2  . SER A 1 16 ? -6.915  11.495  1.324   1.00 0.00 ? 16 SER A HB2  2  
ATOM 1338  H HB3  . SER A 1 16 ? -6.057  12.156  -0.068  1.00 0.00 ? 16 SER A HB3  2  
ATOM 1339  H HG   . SER A 1 16 ? -8.451  12.449  0.080   1.00 0.00 ? 16 SER A HG   2  
ATOM 1340  N N    . PHE A 1 17 ? -8.390  8.804   -0.247  1.00 0.00 ? 17 PHE A N    2  
ATOM 1341  C CA   . PHE A 1 17 ? -9.397  7.836   0.171   1.00 0.00 ? 17 PHE A CA   2  
ATOM 1342  C C    . PHE A 1 17 ? -8.818  6.425   0.196   1.00 0.00 ? 17 PHE A C    2  
ATOM 1343  O O    . PHE A 1 17 ? -8.826  5.757   1.230   1.00 0.00 ? 17 PHE A O    2  
ATOM 1344  C CB   . PHE A 1 17 ? -10.605 7.888   -0.766  1.00 0.00 ? 17 PHE A CB   2  
ATOM 1345  C CG   . PHE A 1 17 ? -11.587 6.774   -0.541  1.00 0.00 ? 17 PHE A CG   2  
ATOM 1346  C CD1  . PHE A 1 17 ? -11.326 5.497   -1.012  1.00 0.00 ? 17 PHE A CD1  2  
ATOM 1347  C CD2  . PHE A 1 17 ? -12.771 7.003   0.140   1.00 0.00 ? 17 PHE A CD2  2  
ATOM 1348  C CE1  . PHE A 1 17 ? -12.227 4.469   -0.807  1.00 0.00 ? 17 PHE A CE1  2  
ATOM 1349  C CE2  . PHE A 1 17 ? -13.676 5.979   0.349   1.00 0.00 ? 17 PHE A CE2  2  
ATOM 1350  C CZ   . PHE A 1 17 ? -13.404 4.711   -0.126  1.00 0.00 ? 17 PHE A CZ   2  
ATOM 1351  H H    . PHE A 1 17 ? -8.546  9.339   -1.053  1.00 0.00 ? 17 PHE A H    2  
ATOM 1352  H HA   . PHE A 1 17 ? -9.715  8.099   1.169   1.00 0.00 ? 17 PHE A HA   2  
ATOM 1353  H HB2  . PHE A 1 17 ? -11.126 8.822   -0.620  1.00 0.00 ? 17 PHE A HB2  2  
ATOM 1354  H HB3  . PHE A 1 17 ? -10.261 7.828   -1.788  1.00 0.00 ? 17 PHE A HB3  2  
ATOM 1355  H HD1  . PHE A 1 17 ? -10.404 5.307   -1.545  1.00 0.00 ? 17 PHE A HD1  2  
ATOM 1356  H HD2  . PHE A 1 17 ? -12.986 7.995   0.511   1.00 0.00 ? 17 PHE A HD2  2  
ATOM 1357  H HE1  . PHE A 1 17 ? -12.011 3.479   -1.179  1.00 0.00 ? 17 PHE A HE1  2  
ATOM 1358  H HE2  . PHE A 1 17 ? -14.596 6.171   0.881   1.00 0.00 ? 17 PHE A HE2  2  
ATOM 1359  H HZ   . PHE A 1 17 ? -14.109 3.910   0.036   1.00 0.00 ? 17 PHE A HZ   2  
ATOM 1360  N N    . GLN A 1 18 ? -8.317  5.977   -0.951  1.00 0.00 ? 18 GLN A N    2  
ATOM 1361  C CA   . GLN A 1 18 ? -7.735  4.645   -1.062  1.00 0.00 ? 18 GLN A CA   2  
ATOM 1362  C C    . GLN A 1 18 ? -6.627  4.447   -0.033  1.00 0.00 ? 18 GLN A C    2  
ATOM 1363  O O    . GLN A 1 18 ? -6.507  3.380   0.568   1.00 0.00 ? 18 GLN A O    2  
ATOM 1364  C CB   . GLN A 1 18 ? -7.185  4.421   -2.472  1.00 0.00 ? 18 GLN A CB   2  
ATOM 1365  C CG   . GLN A 1 18 ? -8.238  4.541   -3.562  1.00 0.00 ? 18 GLN A CG   2  
ATOM 1366  C CD   . GLN A 1 18 ? -7.788  3.934   -4.877  1.00 0.00 ? 18 GLN A CD   2  
ATOM 1367  O OE1  . GLN A 1 18 ? -6.600  3.937   -5.200  1.00 0.00 ? 18 GLN A OE1  2  
ATOM 1368  N NE2  . GLN A 1 18 ? -8.737  3.410   -5.643  1.00 0.00 ? 18 GLN A NE2  2  
ATOM 1369  H H    . GLN A 1 18 ? -8.340  6.556   -1.741  1.00 0.00 ? 18 GLN A H    2  
ATOM 1370  H HA   . GLN A 1 18 ? -8.517  3.925   -0.873  1.00 0.00 ? 18 GLN A HA   2  
ATOM 1371  H HB2  . GLN A 1 18 ? -6.413  5.152   -2.664  1.00 0.00 ? 18 GLN A HB2  2  
ATOM 1372  H HB3  . GLN A 1 18 ? -6.754  3.432   -2.525  1.00 0.00 ? 18 GLN A HB3  2  
ATOM 1373  H HG2  . GLN A 1 18 ? -9.133  4.032   -3.237  1.00 0.00 ? 18 GLN A HG2  2  
ATOM 1374  H HG3  . GLN A 1 18 ? -8.456  5.586   -3.720  1.00 0.00 ? 18 GLN A HG3  2  
ATOM 1375  H HE21 . GLN A 1 18 ? -9.663  3.445   -5.321  1.00 0.00 ? 18 GLN A HE21 2  
ATOM 1376  H HE22 . GLN A 1 18 ? -8.475  3.012   -6.498  1.00 0.00 ? 18 GLN A HE22 2  
ATOM 1377  N N    . LEU A 1 19 ? -5.818  5.483   0.163   1.00 0.00 ? 19 LEU A N    2  
ATOM 1378  C CA   . LEU A 1 19 ? -4.718  5.424   1.120   1.00 0.00 ? 19 LEU A CA   2  
ATOM 1379  C C    . LEU A 1 19 ? -5.242  5.272   2.544   1.00 0.00 ? 19 LEU A C    2  
ATOM 1380  O O    . LEU A 1 19 ? -4.929  4.301   3.231   1.00 0.00 ? 19 LEU A O    2  
ATOM 1381  C CB   . LEU A 1 19 ? -3.855  6.682   1.013   1.00 0.00 ? 19 LEU A CB   2  
ATOM 1382  C CG   . LEU A 1 19 ? -2.692  6.616   0.023   1.00 0.00 ? 19 LEU A CG   2  
ATOM 1383  C CD1  . LEU A 1 19 ? -1.787  7.828   0.181   1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1384  C CD2  . LEU A 1 19 ? -1.902  5.330   0.213   1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1385  H H    . LEU A 1 19 ? -5.963  6.307   -0.346  1.00 0.00 ? 19 LEU A H    2  
ATOM 1386  H HA   . LEU A 1 19 ? -4.115  4.562   0.877   1.00 0.00 ? 19 LEU A HA   2  
ATOM 1387  H HB2  . LEU A 1 19 ? -4.496  7.498   0.716   1.00 0.00 ? 19 LEU A HB2  2  
ATOM 1388  H HB3  . LEU A 1 19 ? -3.446  6.886   1.992   1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1389  H HG   . LEU A 1 19 ? -3.084  6.623   -0.985  1.00 0.00 ? 19 LEU A HG   2  
ATOM 1390  H HD11 . LEU A 1 19 ? -1.125  7.897   -0.669  1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1391  H HD12 . LEU A 1 19 ? -1.203  7.725   1.084   1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1392  H HD13 . LEU A 1 19 ? -2.390  8.722   0.243   1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1393  H HD21 . LEU A 1 19 ? -2.090  4.935   1.200   1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1394  H HD22 . LEU A 1 19 ? -0.847  5.535   0.103   1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1395  H HD23 . LEU A 1 19 ? -2.208  4.607   -0.529  1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1396  N N    . ALA A 1 20 ? -6.044  6.238   2.980   1.00 0.00 ? 20 ALA A N    2  
ATOM 1397  C CA   . ALA A 1 20 ? -6.616  6.210   4.321   1.00 0.00 ? 20 ALA A CA   2  
ATOM 1398  C C    . ALA A 1 20 ? -6.918  4.781   4.758   1.00 0.00 ? 20 ALA A C    2  
ATOM 1399  O O    . ALA A 1 20 ? -6.469  4.337   5.814   1.00 0.00 ? 20 ALA A O    2  
ATOM 1400  C CB   . ALA A 1 20 ? -7.877  7.059   4.374   1.00 0.00 ? 20 ALA A CB   2  
ATOM 1401  H H    . ALA A 1 20 ? -6.257  6.987   2.385   1.00 0.00 ? 20 ALA A H    2  
ATOM 1402  H HA   . ALA A 1 20 ? -5.893  6.639   5.000   1.00 0.00 ? 20 ALA A HA   2  
ATOM 1403  H HB1  . ALA A 1 20 ? -8.302  7.134   3.384   1.00 0.00 ? 20 ALA A HB1  2  
ATOM 1404  H HB2  . ALA A 1 20 ? -8.592  6.600   5.040   1.00 0.00 ? 20 ALA A HB2  2  
ATOM 1405  H HB3  . ALA A 1 20 ? -7.631  8.047   4.736   1.00 0.00 ? 20 ALA A HB3  2  
ATOM 1406  N N    . ALA A 1 21 ? -7.684  4.066   3.940   1.00 0.00 ? 21 ALA A N    2  
ATOM 1407  C CA   . ALA A 1 21 ? -8.046  2.687   4.243   1.00 0.00 ? 21 ALA A CA   2  
ATOM 1408  C C    . ALA A 1 21 ? -6.832  1.769   4.151   1.00 0.00 ? 21 ALA A C    2  
ATOM 1409  O O    . ALA A 1 21 ? -6.621  0.913   5.012   1.00 0.00 ? 21 ALA A O    2  
ATOM 1410  C CB   . ALA A 1 21 ? -9.143  2.211   3.303   1.00 0.00 ? 21 ALA A CB   2  
ATOM 1411  H H    . ALA A 1 21 ? -8.012  4.476   3.113   1.00 0.00 ? 21 ALA A H    2  
ATOM 1412  H HA   . ALA A 1 21 ? -8.432  2.657   5.252   1.00 0.00 ? 21 ALA A HA   2  
ATOM 1413  H HB1  . ALA A 1 21 ? -8.859  1.263   2.870   1.00 0.00 ? 21 ALA A HB1  2  
ATOM 1414  H HB2  . ALA A 1 21 ? -10.064 2.093   3.855   1.00 0.00 ? 21 ALA A HB2  2  
ATOM 1415  H HB3  . ALA A 1 21 ? -9.285  2.938   2.517   1.00 0.00 ? 21 ALA A HB3  2  
ATOM 1416  N N    . LEU A 1 22 ? -6.037  1.950   3.102   1.00 0.00 ? 22 LEU A N    2  
ATOM 1417  C CA   . LEU A 1 22 ? -4.844  1.136   2.897   1.00 0.00 ? 22 LEU A CA   2  
ATOM 1418  C C    . LEU A 1 22 ? -3.982  1.107   4.155   1.00 0.00 ? 22 LEU A C    2  
ATOM 1419  O O    . LEU A 1 22 ? -3.758  0.048   4.740   1.00 0.00 ? 22 LEU A O    2  
ATOM 1420  C CB   . LEU A 1 22 ? -4.030  1.677   1.720   1.00 0.00 ? 22 LEU A CB   2  
ATOM 1421  C CG   . LEU A 1 22 ? -4.450  1.188   0.333   1.00 0.00 ? 22 LEU A CG   2  
ATOM 1422  C CD1  . LEU A 1 22 ? -3.684  1.933   -0.749  1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1423  C CD2  . LEU A 1 22 ? -4.230  -0.313  0.208   1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1424  H H    . LEU A 1 22 ? -6.257  2.647   2.450   1.00 0.00 ? 22 LEU A H    2  
ATOM 1425  H HA   . LEU A 1 22 ? -5.164  0.130   2.671   1.00 0.00 ? 22 LEU A HA   2  
ATOM 1426  H HB2  . LEU A 1 22 ? -4.111  2.753   1.729   1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1427  H HB3  . LEU A 1 22 ? -2.999  1.393   1.874   1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1428  H HG   . LEU A 1 22 ? -5.503  1.385   0.192   1.00 0.00 ? 22 LEU A HG   2  
ATOM 1429  H HD11 . LEU A 1 22 ? -4.350  2.164   -1.567  1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1430  H HD12 . LEU A 1 22 ? -2.875  1.314   -1.108  1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1431  H HD13 . LEU A 1 22 ? -3.283  2.849   -0.341  1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1432  H HD21 . LEU A 1 22 ? -3.187  -0.538  0.371   1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1433  H HD22 . LEU A 1 22 ? -4.518  -0.637  -0.782  1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1434  H HD23 . LEU A 1 22 ? -4.829  -0.827  0.944   1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1435  N N    . GLN A 1 23 ? -3.504  2.277   4.566   1.00 0.00 ? 23 GLN A N    2  
ATOM 1436  C CA   . GLN A 1 23 ? -2.668  2.385   5.756   1.00 0.00 ? 23 GLN A CA   2  
ATOM 1437  C C    . GLN A 1 23 ? -3.372  1.790   6.971   1.00 0.00 ? 23 GLN A C    2  
ATOM 1438  O O    . GLN A 1 23 ? -2.763  1.069   7.762   1.00 0.00 ? 23 GLN A O    2  
ATOM 1439  C CB   . GLN A 1 23 ? -2.312  3.848   6.024   1.00 0.00 ? 23 GLN A CB   2  
ATOM 1440  C CG   . GLN A 1 23 ? -1.149  4.354   5.187   1.00 0.00 ? 23 GLN A CG   2  
ATOM 1441  C CD   . GLN A 1 23 ? -0.489  5.581   5.785   1.00 0.00 ? 23 GLN A CD   2  
ATOM 1442  O OE1  . GLN A 1 23 ? -1.131  6.613   5.979   1.00 0.00 ? 23 GLN A OE1  2  
ATOM 1443  N NE2  . GLN A 1 23 ? 0.801   5.474   6.082   1.00 0.00 ? 23 GLN A NE2  2  
ATOM 1444  H H    . GLN A 1 23 ? -3.719  3.086   4.058   1.00 0.00 ? 23 GLN A H    2  
ATOM 1445  H HA   . GLN A 1 23 ? -1.760  1.830   5.574   1.00 0.00 ? 23 GLN A HA   2  
ATOM 1446  H HB2  . GLN A 1 23 ? -3.175  4.461   5.811   1.00 0.00 ? 23 GLN A HB2  2  
ATOM 1447  H HB3  . GLN A 1 23 ? -2.051  3.958   7.066   1.00 0.00 ? 23 GLN A HB3  2  
ATOM 1448  H HG2  . GLN A 1 23 ? -0.410  3.570   5.108   1.00 0.00 ? 23 GLN A HG2  2  
ATOM 1449  H HG3  . GLN A 1 23 ? -1.513  4.604   4.201   1.00 0.00 ? 23 GLN A HG3  2  
ATOM 1450  H HE21 . GLN A 1 23 ? 1.249   4.621   5.899   1.00 0.00 ? 23 GLN A HE21 2  
ATOM 1451  H HE22 . GLN A 1 23 ? 1.253   6.251   6.469   1.00 0.00 ? 23 GLN A HE22 2  
ATOM 1452  N N    . ARG A 1 24 ? -4.657  2.097   7.114   1.00 0.00 ? 24 ARG A N    2  
ATOM 1453  C CA   . ARG A 1 24 ? -5.443  1.594   8.234   1.00 0.00 ? 24 ARG A CA   2  
ATOM 1454  C C    . ARG A 1 24 ? -5.322  0.077   8.345   1.00 0.00 ? 24 ARG A C    2  
ATOM 1455  O O    . ARG A 1 24 ? -5.340  -0.478  9.444   1.00 0.00 ? 24 ARG A O    2  
ATOM 1456  C CB   . ARG A 1 24 ? -6.912  1.988   8.072   1.00 0.00 ? 24 ARG A CB   2  
ATOM 1457  C CG   . ARG A 1 24 ? -7.650  2.146   9.391   1.00 0.00 ? 24 ARG A CG   2  
ATOM 1458  C CD   . ARG A 1 24 ? -9.135  1.860   9.237   1.00 0.00 ? 24 ARG A CD   2  
ATOM 1459  N NE   . ARG A 1 24 ? -9.780  2.794   8.318   1.00 0.00 ? 24 ARG A NE   2  
ATOM 1460  C CZ   . ARG A 1 24 ? -10.093 4.044   8.641   1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1461  N NH1  . ARG A 1 24 ? -9.821  4.508   9.853   1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1462  N NH2  . ARG A 1 24 ? -10.679 4.834   7.749   1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1463  H H    . ARG A 1 24 ? -5.087  2.676   6.451   1.00 0.00 ? 24 ARG A H    2  
ATOM 1464  H HA   . ARG A 1 24 ? -5.057  2.041   9.138   1.00 0.00 ? 24 ARG A HA   2  
ATOM 1465  H HB2  . ARG A 1 24 ? -6.965  2.927   7.541   1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1466  H HB3  . ARG A 1 24 ? -7.414  1.228   7.493   1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1467  H HG2  . ARG A 1 24 ? -7.235  1.456   10.110  1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1468  H HG3  . ARG A 1 24 ? -7.522  3.158   9.745   1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1469  H HD2  . ARG A 1 24 ? -9.258  0.856   8.859   1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1470  H HD3  . ARG A 1 24 ? -9.606  1.939   10.206  1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1471  H HE   . ARG A 1 24 ? -9.990  2.472   7.417   1.00 0.00 ? 24 ARG A HE   2  
ATOM 1472  H HH11 . ARG A 1 24 ? -9.379  3.915   10.526  1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1473  H HH12 . ARG A 1 24 ? -10.057 5.450   10.092  1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1474  H HH21 . ARG A 1 24 ? -10.885 4.488   6.834   1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1475  H HH22 . ARG A 1 24 ? -10.914 5.774   7.993   1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1476  N N    . ARG A 1 25 ? -5.199  -0.587  7.201   1.00 0.00 ? 25 ARG A N    2  
ATOM 1477  C CA   . ARG A 1 25 ? -5.076  -2.040  7.170   1.00 0.00 ? 25 ARG A CA   2  
ATOM 1478  C C    . ARG A 1 25 ? -3.616  -2.465  7.292   1.00 0.00 ? 25 ARG A C    2  
ATOM 1479  O O    . ARG A 1 25 ? -3.305  -3.485  7.907   1.00 0.00 ? 25 ARG A O    2  
ATOM 1480  C CB   . ARG A 1 25 ? -5.673  -2.596  5.875   1.00 0.00 ? 25 ARG A CB   2  
ATOM 1481  C CG   . ARG A 1 25 ? -6.020  -4.074  5.950   1.00 0.00 ? 25 ARG A CG   2  
ATOM 1482  C CD   . ARG A 1 25 ? -7.252  -4.314  6.808   1.00 0.00 ? 25 ARG A CD   2  
ATOM 1483  N NE   . ARG A 1 25 ? -8.484  -3.952  6.111   1.00 0.00 ? 25 ARG A NE   2  
ATOM 1484  C CZ   . ARG A 1 25 ? -9.029  -4.690  5.151   1.00 0.00 ? 25 ARG A CZ   2  
ATOM 1485  N NH1  . ARG A 1 25 ? -8.456  -5.825  4.777   1.00 0.00 ? 25 ARG A NH1  2  
ATOM 1486  N NH2  . ARG A 1 25 ? -10.151 -4.293  4.565   1.00 0.00 ? 25 ARG A NH2  2  
ATOM 1487  H H    . ARG A 1 25 ? -5.191  -0.089  6.357   1.00 0.00 ? 25 ARG A H    2  
ATOM 1488  H HA   . ARG A 1 25 ? -5.626  -2.437  8.009   1.00 0.00 ? 25 ARG A HA   2  
ATOM 1489  H HB2  . ARG A 1 25 ? -6.575  -2.048  5.644   1.00 0.00 ? 25 ARG A HB2  2  
ATOM 1490  H HB3  . ARG A 1 25 ? -4.962  -2.455  5.076   1.00 0.00 ? 25 ARG A HB3  2  
ATOM 1491  H HG2  . ARG A 1 25 ? -6.213  -4.440  4.953   1.00 0.00 ? 25 ARG A HG2  2  
ATOM 1492  H HG3  . ARG A 1 25 ? -5.185  -4.608  6.377   1.00 0.00 ? 25 ARG A HG3  2  
ATOM 1493  H HD2  . ARG A 1 25 ? -7.293  -5.361  7.071   1.00 0.00 ? 25 ARG A HD2  2  
ATOM 1494  H HD3  . ARG A 1 25 ? -7.170  -3.721  7.707   1.00 0.00 ? 25 ARG A HD3  2  
ATOM 1495  H HE   . ARG A 1 25 ? -8.924  -3.117  6.373   1.00 0.00 ? 25 ARG A HE   2  
ATOM 1496  H HH11 . ARG A 1 25 ? -7.611  -6.127  5.218   1.00 0.00 ? 25 ARG A HH11 2  
ATOM 1497  H HH12 . ARG A 1 25 ? -8.869  -6.380  4.054   1.00 0.00 ? 25 ARG A HH12 2  
ATOM 1498  H HH21 . ARG A 1 25 ? -10.587 -3.438  4.845   1.00 0.00 ? 25 ARG A HH21 2  
ATOM 1499  H HH22 . ARG A 1 25 ? -10.561 -4.849  3.842   1.00 0.00 ? 25 ARG A HH22 2  
ATOM 1500  N N    . PHE A 1 26 ? -2.724  -1.676  6.703   1.00 0.00 ? 26 PHE A N    2  
ATOM 1501  C CA   . PHE A 1 26 ? -1.296  -1.971  6.745   1.00 0.00 ? 26 PHE A CA   2  
ATOM 1502  C C    . PHE A 1 26 ? -0.770  -1.910  8.175   1.00 0.00 ? 26 PHE A C    2  
ATOM 1503  O O    . PHE A 1 26 ? 0.038   -2.743  8.586   1.00 0.00 ? 26 PHE A O    2  
ATOM 1504  C CB   . PHE A 1 26 ? -0.524  -0.988  5.863   1.00 0.00 ? 26 PHE A CB   2  
ATOM 1505  C CG   . PHE A 1 26 ? 0.951   -1.262  5.808   1.00 0.00 ? 26 PHE A CG   2  
ATOM 1506  C CD1  . PHE A 1 26 ? 1.426   -2.493  5.385   1.00 0.00 ? 26 PHE A CD1  2  
ATOM 1507  C CD2  . PHE A 1 26 ? 1.864   -0.289  6.181   1.00 0.00 ? 26 PHE A CD2  2  
ATOM 1508  C CE1  . PHE A 1 26 ? 2.783   -2.749  5.333   1.00 0.00 ? 26 PHE A CE1  2  
ATOM 1509  C CE2  . PHE A 1 26 ? 3.223   -0.538  6.132   1.00 0.00 ? 26 PHE A CE2  2  
ATOM 1510  C CZ   . PHE A 1 26 ? 3.683   -1.770  5.708   1.00 0.00 ? 26 PHE A CZ   2  
ATOM 1511  H H    . PHE A 1 26 ? -3.033  -0.876  6.227   1.00 0.00 ? 26 PHE A H    2  
ATOM 1512  H HA   . PHE A 1 26 ? -1.154  -2.971  6.364   1.00 0.00 ? 26 PHE A HA   2  
ATOM 1513  H HB2  . PHE A 1 26 ? -0.908  -1.041  4.855   1.00 0.00 ? 26 PHE A HB2  2  
ATOM 1514  H HB3  . PHE A 1 26 ? -0.664  0.012   6.245   1.00 0.00 ? 26 PHE A HB3  2  
ATOM 1515  H HD1  . PHE A 1 26 ? 0.722   -3.260  5.092   1.00 0.00 ? 26 PHE A HD1  2  
ATOM 1516  H HD2  . PHE A 1 26 ? 1.506   0.675   6.514   1.00 0.00 ? 26 PHE A HD2  2  
ATOM 1517  H HE1  . PHE A 1 26 ? 3.139   -3.713  5.002   1.00 0.00 ? 26 PHE A HE1  2  
ATOM 1518  H HE2  . PHE A 1 26 ? 3.924   0.228   6.425   1.00 0.00 ? 26 PHE A HE2  2  
ATOM 1519  H HZ   . PHE A 1 26 ? 4.743   -1.967  5.668   1.00 0.00 ? 26 PHE A HZ   2  
ATOM 1520  N N    . GLN A 1 27 ? -1.234  -0.918  8.928   1.00 0.00 ? 27 GLN A N    2  
ATOM 1521  C CA   . GLN A 1 27 ? -0.809  -0.747  10.313  1.00 0.00 ? 27 GLN A CA   2  
ATOM 1522  C C    . GLN A 1 27 ? -1.237  -1.937  11.164  1.00 0.00 ? 27 GLN A C    2  
ATOM 1523  O O    . GLN A 1 27 ? -0.531  -2.339  12.089  1.00 0.00 ? 27 GLN A O    2  
ATOM 1524  C CB   . GLN A 1 27 ? -1.390  0.545   10.891  1.00 0.00 ? 27 GLN A CB   2  
ATOM 1525  C CG   . GLN A 1 27 ? -2.900  0.510   11.059  1.00 0.00 ? 27 GLN A CG   2  
ATOM 1526  C CD   . GLN A 1 27 ? -3.479  1.864   11.419  1.00 0.00 ? 27 GLN A CD   2  
ATOM 1527  O OE1  . GLN A 1 27 ? -2.752  2.852   11.534  1.00 0.00 ? 27 GLN A OE1  2  
ATOM 1528  N NE2  . GLN A 1 27 ? -4.793  1.919   11.597  1.00 0.00 ? 27 GLN A NE2  2  
ATOM 1529  H H    . GLN A 1 27 ? -1.876  -0.286  8.544   1.00 0.00 ? 27 GLN A H    2  
ATOM 1530  H HA   . GLN A 1 27 ? 0.269   -0.682  10.323  1.00 0.00 ? 27 GLN A HA   2  
ATOM 1531  H HB2  . GLN A 1 27 ? -0.945  0.724   11.858  1.00 0.00 ? 27 GLN A HB2  2  
ATOM 1532  H HB3  . GLN A 1 27 ? -1.142  1.364   10.232  1.00 0.00 ? 27 GLN A HB3  2  
ATOM 1533  H HG2  . GLN A 1 27 ? -3.346  0.180   10.133  1.00 0.00 ? 27 GLN A HG2  2  
ATOM 1534  H HG3  . GLN A 1 27 ? -3.146  -0.190  11.844  1.00 0.00 ? 27 GLN A HG3  2  
ATOM 1535  H HE21 . GLN A 1 27 ? -5.309  1.092   11.490  1.00 0.00 ? 27 GLN A HE21 2  
ATOM 1536  H HE22 . GLN A 1 27 ? -5.194  2.781   11.831  1.00 0.00 ? 27 GLN A HE22 2  
ATOM 1537  N N    . LYS A 1 28 ? -2.399  -2.498  10.847  1.00 0.00 ? 28 LYS A N    2  
ATOM 1538  C CA   . LYS A 1 28 ? -2.922  -3.644  11.582  1.00 0.00 ? 28 LYS A CA   2  
ATOM 1539  C C    . LYS A 1 28 ? -2.087  -4.891  11.312  1.00 0.00 ? 28 LYS A C    2  
ATOM 1540  O O    . LYS A 1 28 ? -1.710  -5.611  12.237  1.00 0.00 ? 28 LYS A O    2  
ATOM 1541  C CB   . LYS A 1 28 ? -4.381  -3.900  11.195  1.00 0.00 ? 28 LYS A CB   2  
ATOM 1542  C CG   . LYS A 1 28 ? -5.134  -4.756  12.198  1.00 0.00 ? 28 LYS A CG   2  
ATOM 1543  C CD   . LYS A 1 28 ? -6.638  -4.635  12.016  1.00 0.00 ? 28 LYS A CD   2  
ATOM 1544  C CE   . LYS A 1 28 ? -7.375  -5.784  12.688  1.00 0.00 ? 28 LYS A CE   2  
ATOM 1545  N NZ   . LYS A 1 28 ? -8.763  -5.404  13.070  1.00 0.00 ? 28 LYS A NZ   2  
ATOM 1546  H H    . LYS A 1 28 ? -2.917  -2.133  10.098  1.00 0.00 ? 28 LYS A H    2  
ATOM 1547  H HA   . LYS A 1 28 ? -2.873  -3.413  12.635  1.00 0.00 ? 28 LYS A HA   2  
ATOM 1548  H HB2  . LYS A 1 28 ? -4.890  -2.952  11.108  1.00 0.00 ? 28 LYS A HB2  2  
ATOM 1549  H HB3  . LYS A 1 28 ? -4.404  -4.401  10.238  1.00 0.00 ? 28 LYS A HB3  2  
ATOM 1550  H HG2  . LYS A 1 28 ? -4.848  -5.789  12.064  1.00 0.00 ? 28 LYS A HG2  2  
ATOM 1551  H HG3  . LYS A 1 28 ? -4.875  -4.436  13.198  1.00 0.00 ? 28 LYS A HG3  2  
ATOM 1552  H HD2  . LYS A 1 28 ? -6.971  -3.705  12.452  1.00 0.00 ? 28 LYS A HD2  2  
ATOM 1553  H HD3  . LYS A 1 28 ? -6.865  -4.642  10.960  1.00 0.00 ? 28 LYS A HD3  2  
ATOM 1554  H HE2  . LYS A 1 28 ? -7.414  -6.618  12.005  1.00 0.00 ? 28 LYS A HE2  2  
ATOM 1555  H HE3  . LYS A 1 28 ? -6.832  -6.071  13.577  1.00 0.00 ? 28 LYS A HE3  2  
ATOM 1556  H HZ1  . LYS A 1 28 ? -9.001  -5.808  13.998  1.00 0.00 ? 28 LYS A HZ1  2  
ATOM 1557  H HZ2  . LYS A 1 28 ? -9.438  -5.763  12.365  1.00 0.00 ? 28 LYS A HZ2  2  
ATOM 1558  H HZ3  . LYS A 1 28 ? -8.850  -4.369  13.121  1.00 0.00 ? 28 LYS A HZ3  2  
ATOM 1559  N N    . THR A 1 29 ? -1.799  -5.141  10.038  1.00 0.00 ? 29 THR A N    2  
ATOM 1560  C CA   . THR A 1 29 ? -1.007  -6.301  9.647   1.00 0.00 ? 29 THR A CA   2  
ATOM 1561  C C    . THR A 1 29 ? -0.217  -6.023  8.373   1.00 0.00 ? 29 THR A C    2  
ATOM 1562  O O    . THR A 1 29 ? -0.758  -5.502  7.399   1.00 0.00 ? 29 THR A O    2  
ATOM 1563  C CB   . THR A 1 29 ? -1.897  -7.539  9.427   1.00 0.00 ? 29 THR A CB   2  
ATOM 1564  O OG1  . THR A 1 29 ? -1.081  -8.693  9.195   1.00 0.00 ? 29 THR A OG1  2  
ATOM 1565  C CG2  . THR A 1 29 ? -2.834  -7.329  8.247   1.00 0.00 ? 29 THR A CG2  2  
ATOM 1566  H H    . THR A 1 29 ? -2.128  -4.530  9.346   1.00 0.00 ? 29 THR A H    2  
ATOM 1567  H HA   . THR A 1 29 ? -0.316  -6.518  10.448  1.00 0.00 ? 29 THR A HA   2  
ATOM 1568  H HB   . THR A 1 29 ? -2.490  -7.700  10.315  1.00 0.00 ? 29 THR A HB   2  
ATOM 1569  H HG1  . THR A 1 29 ? -0.232  -8.419  8.839   1.00 0.00 ? 29 THR A HG1  2  
ATOM 1570  H HG21 . THR A 1 29 ? -2.740  -6.314  7.889   1.00 0.00 ? 29 THR A HG21 2  
ATOM 1571  H HG22 . THR A 1 29 ? -3.852  -7.508  8.560   1.00 0.00 ? 29 THR A HG22 2  
ATOM 1572  H HG23 . THR A 1 29 ? -2.575  -8.015  7.455   1.00 0.00 ? 29 THR A HG23 2  
ATOM 1573  N N    . GLN A 1 30 ? 1.064   -6.376  8.389   1.00 0.00 ? 30 GLN A N    2  
ATOM 1574  C CA   . GLN A 1 30 ? 1.928   -6.164  7.233   1.00 0.00 ? 30 GLN A CA   2  
ATOM 1575  C C    . GLN A 1 30 ? 1.533   -7.084  6.082   1.00 0.00 ? 30 GLN A C    2  
ATOM 1576  O O    . GLN A 1 30 ? 1.664   -6.722  4.913   1.00 0.00 ? 30 GLN A O    2  
ATOM 1577  C CB   . GLN A 1 30 ? 3.390   -6.402  7.613   1.00 0.00 ? 30 GLN A CB   2  
ATOM 1578  C CG   . GLN A 1 30 ? 4.013   -5.251  8.387   1.00 0.00 ? 30 GLN A CG   2  
ATOM 1579  C CD   . GLN A 1 30 ? 3.837   -5.393  9.886   1.00 0.00 ? 30 GLN A CD   2  
ATOM 1580  O OE1  . GLN A 1 30 ? 2.791   -5.047  10.435  1.00 0.00 ? 30 GLN A OE1  2  
ATOM 1581  N NE2  . GLN A 1 30 ? 4.863   -5.904  10.557  1.00 0.00 ? 30 GLN A NE2  2  
ATOM 1582  H H    . GLN A 1 30 ? 1.437   -6.787  9.195   1.00 0.00 ? 30 GLN A H    2  
ATOM 1583  H HA   . GLN A 1 30 ? 1.810   -5.139  6.915   1.00 0.00 ? 30 GLN A HA   2  
ATOM 1584  H HB2  . GLN A 1 30 ? 3.452   -7.291  8.222   1.00 0.00 ? 30 GLN A HB2  2  
ATOM 1585  H HB3  . GLN A 1 30 ? 3.964   -6.552  6.711   1.00 0.00 ? 30 GLN A HB3  2  
ATOM 1586  H HG2  . GLN A 1 30 ? 5.069   -5.215  8.166   1.00 0.00 ? 30 GLN A HG2  2  
ATOM 1587  H HG3  . GLN A 1 30 ? 3.549   -4.328  8.070   1.00 0.00 ? 30 GLN A HG3  2  
ATOM 1588  H HE21 . GLN A 1 30 ? 5.665   -6.156  10.053  1.00 0.00 ? 30 GLN A HE21 2  
ATOM 1589  H HE22 . GLN A 1 30 ? 4.777   -6.006  11.527  1.00 0.00 ? 30 GLN A HE22 2  
ATOM 1590  N N    . TYR A 1 31 ? 1.049   -8.273  6.422   1.00 0.00 ? 31 TYR A N    2  
ATOM 1591  C CA   . TYR A 1 31 ? 0.638   -9.246  5.417   1.00 0.00 ? 31 TYR A CA   2  
ATOM 1592  C C    . TYR A 1 31 ? -0.870  -9.471  5.461   1.00 0.00 ? 31 TYR A C    2  
ATOM 1593  O O    . TYR A 1 31 ? -1.442  -9.717  6.524   1.00 0.00 ? 31 TYR A O    2  
ATOM 1594  C CB   . TYR A 1 31 ? 1.369   -10.572 5.631   1.00 0.00 ? 31 TYR A CB   2  
ATOM 1595  C CG   . TYR A 1 31 ? 2.720   -10.636 4.955   1.00 0.00 ? 31 TYR A CG   2  
ATOM 1596  C CD1  . TYR A 1 31 ? 3.666   -9.638  5.154   1.00 0.00 ? 31 TYR A CD1  2  
ATOM 1597  C CD2  . TYR A 1 31 ? 3.051   -11.694 4.118   1.00 0.00 ? 31 TYR A CD2  2  
ATOM 1598  C CE1  . TYR A 1 31 ? 4.901   -9.691  4.538   1.00 0.00 ? 31 TYR A CE1  2  
ATOM 1599  C CE2  . TYR A 1 31 ? 4.284   -11.756 3.498   1.00 0.00 ? 31 TYR A CE2  2  
ATOM 1600  C CZ   . TYR A 1 31 ? 5.206   -10.753 3.711   1.00 0.00 ? 31 TYR A CZ   2  
ATOM 1601  O OH   . TYR A 1 31 ? 6.435   -10.810 3.097   1.00 0.00 ? 31 TYR A OH   2  
ATOM 1602  H H    . TYR A 1 31 ? 0.969   -8.504  7.371   1.00 0.00 ? 31 TYR A H    2  
ATOM 1603  H HA   . TYR A 1 31 ? 0.904   -8.853  4.446   1.00 0.00 ? 31 TYR A HA   2  
ATOM 1604  H HB2  . TYR A 1 31 ? 1.521   -10.725 6.688   1.00 0.00 ? 31 TYR A HB2  2  
ATOM 1605  H HB3  . TYR A 1 31 ? 0.764   -11.377 5.239   1.00 0.00 ? 31 TYR A HB3  2  
ATOM 1606  H HD1  . TYR A 1 31 ? 3.424   -8.808  5.803   1.00 0.00 ? 31 TYR A HD1  2  
ATOM 1607  H HD2  . TYR A 1 31 ? 2.327   -12.479 3.953   1.00 0.00 ? 31 TYR A HD2  2  
ATOM 1608  H HE1  . TYR A 1 31 ? 5.623   -8.906  4.705   1.00 0.00 ? 31 TYR A HE1  2  
ATOM 1609  H HE2  . TYR A 1 31 ? 4.523   -12.587 2.850   1.00 0.00 ? 31 TYR A HE2  2  
ATOM 1610  H HH   . TYR A 1 31 ? 6.794   -9.923  3.016   1.00 0.00 ? 31 TYR A HH   2  
ATOM 1611  N N    . LEU A 1 32 ? -1.509  -9.384  4.300   1.00 0.00 ? 32 LEU A N    2  
ATOM 1612  C CA   . LEU A 1 32 ? -2.952  -9.579  4.203   1.00 0.00 ? 32 LEU A CA   2  
ATOM 1613  C C    . LEU A 1 32 ? -3.278  -10.908 3.531   1.00 0.00 ? 32 LEU A C    2  
ATOM 1614  O O    . LEU A 1 32 ? -2.723  -11.239 2.484   1.00 0.00 ? 32 LEU A O    2  
ATOM 1615  C CB   . LEU A 1 32 ? -3.590  -8.429  3.422   1.00 0.00 ? 32 LEU A CB   2  
ATOM 1616  C CG   . LEU A 1 32 ? -3.930  -7.176  4.230   1.00 0.00 ? 32 LEU A CG   2  
ATOM 1617  C CD1  . LEU A 1 32 ? -4.369  -6.049  3.308   1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1618  C CD2  . LEU A 1 32 ? -5.012  -7.480  5.256   1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1619  H H    . LEU A 1 32 ? -0.999  -9.185  3.487   1.00 0.00 ? 32 LEU A H    2  
ATOM 1620  H HA   . LEU A 1 32 ? -3.352  -9.588  5.206   1.00 0.00 ? 32 LEU A HA   2  
ATOM 1621  H HB2  . LEU A 1 32 ? -2.906  -8.141  2.639   1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1622  H HB3  . LEU A 1 32 ? -4.505  -8.798  2.981   1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1623  H HG   . LEU A 1 32 ? -3.047  -6.847  4.761   1.00 0.00 ? 32 LEU A HG   2  
ATOM 1624  H HD11 . LEU A 1 32 ? -3.798  -5.160  3.530   1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1625  H HD12 . LEU A 1 32 ? -5.419  -5.849  3.459   1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1626  H HD13 . LEU A 1 32 ? -4.202  -6.339  2.281   1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1627  H HD21 . LEU A 1 32 ? -4.785  -6.968  6.180   1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1628  H HD22 . LEU A 1 32 ? -5.049  -8.545  5.435   1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1629  H HD23 . LEU A 1 32 ? -5.967  -7.143  4.883   1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1630  N N    . ALA A 1 33 ? -4.185  -11.666 4.139   1.00 0.00 ? 33 ALA A N    2  
ATOM 1631  C CA   . ALA A 1 33 ? -4.589  -12.957 3.597   1.00 0.00 ? 33 ALA A CA   2  
ATOM 1632  C C    . ALA A 1 33 ? -5.066  -12.823 2.155   1.00 0.00 ? 33 ALA A C    2  
ATOM 1633  O O    . ALA A 1 33 ? -5.134  -11.718 1.614   1.00 0.00 ? 33 ALA A O    2  
ATOM 1634  C CB   . ALA A 1 33 ? -5.680  -13.574 4.460   1.00 0.00 ? 33 ALA A CB   2  
ATOM 1635  H H    . ALA A 1 33 ? -4.593  -11.348 4.971   1.00 0.00 ? 33 ALA A H    2  
ATOM 1636  H HA   . ALA A 1 33 ? -3.731  -13.613 3.622   1.00 0.00 ? 33 ALA A HA   2  
ATOM 1637  H HB1  . ALA A 1 33 ? -5.844  -14.597 4.155   1.00 0.00 ? 33 ALA A HB1  2  
ATOM 1638  H HB2  . ALA A 1 33 ? -5.375  -13.551 5.496   1.00 0.00 ? 33 ALA A HB2  2  
ATOM 1639  H HB3  . ALA A 1 33 ? -6.594  -13.012 4.341   1.00 0.00 ? 33 ALA A HB3  2  
ATOM 1640  N N    . LEU A 1 34 ? -5.394  -13.952 1.537   1.00 0.00 ? 34 LEU A N    2  
ATOM 1641  C CA   . LEU A 1 34 ? -5.864  -13.960 0.156   1.00 0.00 ? 34 LEU A CA   2  
ATOM 1642  C C    . LEU A 1 34 ? -7.076  -13.051 -0.011  1.00 0.00 ? 34 LEU A C    2  
ATOM 1643  O O    . LEU A 1 34 ? -7.060  -12.088 -0.779  1.00 0.00 ? 34 LEU A O    2  
ATOM 1644  C CB   . LEU A 1 34 ? -6.217  -15.385 -0.274  1.00 0.00 ? 34 LEU A CB   2  
ATOM 1645  C CG   . LEU A 1 34 ? -7.372  -15.519 -1.268  1.00 0.00 ? 34 LEU A CG   2  
ATOM 1646  C CD1  . LEU A 1 34 ? -6.999  -14.901 -2.606  1.00 0.00 ? 34 LEU A CD1  2  
ATOM 1647  C CD2  . LEU A 1 34 ? -7.758  -16.980 -1.442  1.00 0.00 ? 34 LEU A CD2  2  
ATOM 1648  H H    . LEU A 1 34 ? -5.318  -14.801 2.020   1.00 0.00 ? 34 LEU A H    2  
ATOM 1649  H HA   . LEU A 1 34 ? -5.063  -13.592 -0.468  1.00 0.00 ? 34 LEU A HA   2  
ATOM 1650  H HB2  . LEU A 1 34 ? -5.339  -15.821 -0.727  1.00 0.00 ? 34 LEU A HB2  2  
ATOM 1651  H HB3  . LEU A 1 34 ? -6.476  -15.943 0.614   1.00 0.00 ? 34 LEU A HB3  2  
ATOM 1652  H HG   . LEU A 1 34 ? -8.232  -14.988 -0.884  1.00 0.00 ? 34 LEU A HG   2  
ATOM 1653  H HD11 . LEU A 1 34 ? -7.166  -13.835 -2.569  1.00 0.00 ? 34 LEU A HD11 2  
ATOM 1654  H HD12 . LEU A 1 34 ? -7.609  -15.334 -3.385  1.00 0.00 ? 34 LEU A HD12 2  
ATOM 1655  H HD13 . LEU A 1 34 ? -5.957  -15.096 -2.815  1.00 0.00 ? 34 LEU A HD13 2  
ATOM 1656  H HD21 . LEU A 1 34 ? -8.415  -17.277 -0.638  1.00 0.00 ? 34 LEU A HD21 2  
ATOM 1657  H HD22 . LEU A 1 34 ? -6.868  -17.593 -1.424  1.00 0.00 ? 34 LEU A HD22 2  
ATOM 1658  H HD23 . LEU A 1 34 ? -8.265  -17.108 -2.387  1.00 0.00 ? 34 LEU A HD23 2  
ATOM 1659  N N    . PRO A 1 35 ? -8.155  -13.360 0.724   1.00 0.00 ? 35 PRO A N    2  
ATOM 1660  C CA   . PRO A 1 35 ? -9.395  -12.581 0.676   1.00 0.00 ? 35 PRO A CA   2  
ATOM 1661  C C    . PRO A 1 35 ? -9.239  -11.202 1.308   1.00 0.00 ? 35 PRO A C    2  
ATOM 1662  O O    . PRO A 1 35 ? -9.919  -10.252 0.922   1.00 0.00 ? 35 PRO A O    2  
ATOM 1663  C CB   . PRO A 1 35 ? -10.379 -13.430 1.484   1.00 0.00 ? 35 PRO A CB   2  
ATOM 1664  C CG   . PRO A 1 35 ? -9.523  -14.227 2.407   1.00 0.00 ? 35 PRO A CG   2  
ATOM 1665  C CD   . PRO A 1 35 ? -8.245  -14.494 1.659   1.00 0.00 ? 35 PRO A CD   2  
ATOM 1666  H HA   . PRO A 1 35 ? -9.757  -12.473 -0.336  1.00 0.00 ? 35 PRO A HA   2  
ATOM 1667  H HB2  . PRO A 1 35 ? -11.054 -12.785 2.029   1.00 0.00 ? 35 PRO A HB2  2  
ATOM 1668  H HB3  . PRO A 1 35 ? -10.941 -14.068 0.819   1.00 0.00 ? 35 PRO A HB3  2  
ATOM 1669  H HG2  . PRO A 1 35 ? -9.321  -13.660 3.303   1.00 0.00 ? 35 PRO A HG2  2  
ATOM 1670  H HG3  . PRO A 1 35 ? -10.014 -15.157 2.652   1.00 0.00 ? 35 PRO A HG3  2  
ATOM 1671  H HD2  . PRO A 1 35 ? -7.405  -14.502 2.338   1.00 0.00 ? 35 PRO A HD2  2  
ATOM 1672  H HD3  . PRO A 1 35 ? -8.309  -15.430 1.124   1.00 0.00 ? 35 PRO A HD3  2  
ATOM 1673  N N    . GLU A 1 36 ? -8.338  -11.100 2.280   1.00 0.00 ? 36 GLU A N    2  
ATOM 1674  C CA   . GLU A 1 36 ? -8.093  -9.836  2.964   1.00 0.00 ? 36 GLU A CA   2  
ATOM 1675  C C    . GLU A 1 36 ? -7.483  -8.811  2.012   1.00 0.00 ? 36 GLU A C    2  
ATOM 1676  O O    . GLU A 1 36 ? -7.867  -7.641  2.014   1.00 0.00 ? 36 GLU A O    2  
ATOM 1677  C CB   . GLU A 1 36 ? -7.167  -10.050 4.163   1.00 0.00 ? 36 GLU A CB   2  
ATOM 1678  C CG   . GLU A 1 36 ? -7.900  -10.428 5.439   1.00 0.00 ? 36 GLU A CG   2  
ATOM 1679  C CD   . GLU A 1 36 ? -9.017  -11.425 5.196   1.00 0.00 ? 36 GLU A CD   2  
ATOM 1680  O OE1  . GLU A 1 36 ? -9.991  -11.068 4.501   1.00 0.00 ? 36 GLU A OE1  2  
ATOM 1681  O OE2  . GLU A 1 36 ? -8.916  -12.563 5.702   1.00 0.00 ? 36 GLU A OE2  2  
ATOM 1682  H H    . GLU A 1 36 ? -7.826  -11.893 2.543   1.00 0.00 ? 36 GLU A H    2  
ATOM 1683  H HA   . GLU A 1 36 ? -9.042  -9.461  3.317   1.00 0.00 ? 36 GLU A HA   2  
ATOM 1684  H HB2  . GLU A 1 36 ? -6.468  -10.839 3.926   1.00 0.00 ? 36 GLU A HB2  2  
ATOM 1685  H HB3  . GLU A 1 36 ? -6.618  -9.138  4.345   1.00 0.00 ? 36 GLU A HB3  2  
ATOM 1686  H HG2  . GLU A 1 36 ? -7.193  -10.864 6.129   1.00 0.00 ? 36 GLU A HG2  2  
ATOM 1687  H HG3  . GLU A 1 36 ? -8.323  -9.535  5.874   1.00 0.00 ? 36 GLU A HG3  2  
ATOM 1688  N N    . ARG A 1 37 ? -6.529  -9.259  1.202   1.00 0.00 ? 37 ARG A N    2  
ATOM 1689  C CA   . ARG A 1 37 ? -5.864  -8.382  0.246   1.00 0.00 ? 37 ARG A CA   2  
ATOM 1690  C C    . ARG A 1 37 ? -6.830  -7.939  -0.849  1.00 0.00 ? 37 ARG A C    2  
ATOM 1691  O O    . ARG A 1 37 ? -6.796  -6.791  -1.293  1.00 0.00 ? 37 ARG A O    2  
ATOM 1692  C CB   . ARG A 1 37 ? -4.660  -9.091  -0.377  1.00 0.00 ? 37 ARG A CB   2  
ATOM 1693  C CG   . ARG A 1 37 ? -3.782  -8.177  -1.216  1.00 0.00 ? 37 ARG A CG   2  
ATOM 1694  C CD   . ARG A 1 37 ? -2.425  -8.805  -1.490  1.00 0.00 ? 37 ARG A CD   2  
ATOM 1695  N NE   . ARG A 1 37 ? -1.829  -9.370  -0.282  1.00 0.00 ? 37 ARG A NE   2  
ATOM 1696  C CZ   . ARG A 1 37 ? -0.916  -10.334 -0.294  1.00 0.00 ? 37 ARG A CZ   2  
ATOM 1697  N NH1  . ARG A 1 37 ? -0.494  -10.837 -1.446  1.00 0.00 ? 37 ARG A NH1  2  
ATOM 1698  N NH2  . ARG A 1 37 ? -0.421  -10.795 0.847   1.00 0.00 ? 37 ARG A NH2  2  
ATOM 1699  H H    . ARG A 1 37 ? -6.267  -10.202 1.248   1.00 0.00 ? 37 ARG A H    2  
ATOM 1700  H HA   . ARG A 1 37 ? -5.520  -7.509  0.781   1.00 0.00 ? 37 ARG A HA   2  
ATOM 1701  H HB2  . ARG A 1 37 ? -4.054  -9.509  0.414   1.00 0.00 ? 37 ARG A HB2  2  
ATOM 1702  H HB3  . ARG A 1 37 ? -5.016  -9.891  -1.008  1.00 0.00 ? 37 ARG A HB3  2  
ATOM 1703  H HG2  . ARG A 1 37 ? -4.275  -7.985  -2.158  1.00 0.00 ? 37 ARG A HG2  2  
ATOM 1704  H HG3  . ARG A 1 37 ? -3.639  -7.246  -0.687  1.00 0.00 ? 37 ARG A HG3  2  
ATOM 1705  H HD2  . ARG A 1 37 ? -2.548  -9.591  -2.220  1.00 0.00 ? 37 ARG A HD2  2  
ATOM 1706  H HD3  . ARG A 1 37 ? -1.766  -8.047  -1.885  1.00 0.00 ? 37 ARG A HD3  2  
ATOM 1707  H HE   . ARG A 1 37 ? -2.126  -9.012  0.580   1.00 0.00 ? 37 ARG A HE   2  
ATOM 1708  H HH11 . ARG A 1 37 ? -0.865  -10.491 -2.308  1.00 0.00 ? 37 ARG A HH11 2  
ATOM 1709  H HH12 . ARG A 1 37 ? 0.195   -11.562 -1.453  1.00 0.00 ? 37 ARG A HH12 2  
ATOM 1710  H HH21 . ARG A 1 37 ? -0.736  -10.418 1.717   1.00 0.00 ? 37 ARG A HH21 2  
ATOM 1711  H HH22 . ARG A 1 37 ? 0.267   -11.521 0.837   1.00 0.00 ? 37 ARG A HH22 2  
ATOM 1712  N N    . ALA A 1 38 ? -7.689  -8.856  -1.280  1.00 0.00 ? 38 ALA A N    2  
ATOM 1713  C CA   . ALA A 1 38 ? -8.665  -8.560  -2.321  1.00 0.00 ? 38 ALA A CA   2  
ATOM 1714  C C    . ALA A 1 38 ? -9.678  -7.524  -1.846  1.00 0.00 ? 38 ALA A C    2  
ATOM 1715  O O    . ALA A 1 38 ? -10.066 -6.631  -2.599  1.00 0.00 ? 38 ALA A O    2  
ATOM 1716  C CB   . ALA A 1 38 ? -9.375  -9.833  -2.757  1.00 0.00 ? 38 ALA A CB   2  
ATOM 1717  H H    . ALA A 1 38 ? -7.667  -9.753  -0.887  1.00 0.00 ? 38 ALA A H    2  
ATOM 1718  H HA   . ALA A 1 38 ? -8.133  -8.163  -3.174  1.00 0.00 ? 38 ALA A HA   2  
ATOM 1719  H HB1  . ALA A 1 38 ? -8.937  -10.191 -3.678  1.00 0.00 ? 38 ALA A HB1  2  
ATOM 1720  H HB2  . ALA A 1 38 ? -9.267  -10.586 -1.991  1.00 0.00 ? 38 ALA A HB2  2  
ATOM 1721  H HB3  . ALA A 1 38 ? -10.423 -9.625  -2.913  1.00 0.00 ? 38 ALA A HB3  2  
ATOM 1722  N N    . GLU A 1 39 ? -10.102 -7.649  -0.592  1.00 0.00 ? 39 GLU A N    2  
ATOM 1723  C CA   . GLU A 1 39 ? -11.071 -6.723  -0.018  1.00 0.00 ? 39 GLU A CA   2  
ATOM 1724  C C    . GLU A 1 39 ? -10.683 -5.277  -0.312  1.00 0.00 ? 39 GLU A C    2  
ATOM 1725  O O    . GLU A 1 39 ? -11.533 -4.449  -0.644  1.00 0.00 ? 39 GLU A O    2  
ATOM 1726  C CB   . GLU A 1 39 ? -11.180 -6.936  1.494   1.00 0.00 ? 39 GLU A CB   2  
ATOM 1727  C CG   . GLU A 1 39 ? -11.981 -8.168  1.879   1.00 0.00 ? 39 GLU A CG   2  
ATOM 1728  C CD   . GLU A 1 39 ? -13.476 -7.913  1.883   1.00 0.00 ? 39 GLU A CD   2  
ATOM 1729  O OE1  . GLU A 1 39 ? -14.104 -8.049  0.812   1.00 0.00 ? 39 GLU A OE1  2  
ATOM 1730  O OE2  . GLU A 1 39 ? -14.018 -7.578  2.957   1.00 0.00 ? 39 GLU A OE2  2  
ATOM 1731  H H    . GLU A 1 39 ? -9.755  -8.381  -0.041  1.00 0.00 ? 39 GLU A H    2  
ATOM 1732  H HA   . GLU A 1 39 ? -12.030 -6.925  -0.470  1.00 0.00 ? 39 GLU A HA   2  
ATOM 1733  H HB2  . GLU A 1 39 ? -10.185 -7.036  1.903   1.00 0.00 ? 39 GLU A HB2  2  
ATOM 1734  H HB3  . GLU A 1 39 ? -11.655 -6.071  1.933   1.00 0.00 ? 39 GLU A HB3  2  
ATOM 1735  H HG2  . GLU A 1 39 ? -11.768 -8.956  1.172   1.00 0.00 ? 39 GLU A HG2  2  
ATOM 1736  H HG3  . GLU A 1 39 ? -11.681 -8.482  2.868   1.00 0.00 ? 39 GLU A HG3  2  
ATOM 1737  N N    . LEU A 1 40 ? -9.394  -4.980  -0.188  1.00 0.00 ? 40 LEU A N    2  
ATOM 1738  C CA   . LEU A 1 40 ? -8.891  -3.634  -0.440  1.00 0.00 ? 40 LEU A CA   2  
ATOM 1739  C C    . LEU A 1 40 ? -9.071  -3.251  -1.906  1.00 0.00 ? 40 LEU A C    2  
ATOM 1740  O O    . LEU A 1 40 ? -9.462  -2.128  -2.221  1.00 0.00 ? 40 LEU A O    2  
ATOM 1741  C CB   . LEU A 1 40 ? -7.414  -3.539  -0.054  1.00 0.00 ? 40 LEU A CB   2  
ATOM 1742  C CG   . LEU A 1 40 ? -7.039  -4.118  1.311   1.00 0.00 ? 40 LEU A CG   2  
ATOM 1743  C CD1  . LEU A 1 40 ? -5.598  -3.777  1.657   1.00 0.00 ? 40 LEU A CD1  2  
ATOM 1744  C CD2  . LEU A 1 40 ? -7.984  -3.603  2.386   1.00 0.00 ? 40 LEU A CD2  2  
ATOM 1745  H H    . LEU A 1 40 ? -8.765  -5.682  0.079   1.00 0.00 ? 40 LEU A H    2  
ATOM 1746  H HA   . LEU A 1 40 ? -9.460  -2.948  0.170   1.00 0.00 ? 40 LEU A HA   2  
ATOM 1747  H HB2  . LEU A 1 40 ? -6.842  -4.063  -0.804  1.00 0.00 ? 40 LEU A HB2  2  
ATOM 1748  H HB3  . LEU A 1 40 ? -7.139  -2.494  -0.059  1.00 0.00 ? 40 LEU A HB3  2  
ATOM 1749  H HG   . LEU A 1 40 ? -7.127  -5.195  1.275   1.00 0.00 ? 40 LEU A HG   2  
ATOM 1750  H HD11 . LEU A 1 40 ? -4.946  -4.556  1.293   1.00 0.00 ? 40 LEU A HD11 2  
ATOM 1751  H HD12 . LEU A 1 40 ? -5.496  -3.693  2.729   1.00 0.00 ? 40 LEU A HD12 2  
ATOM 1752  H HD13 . LEU A 1 40 ? -5.330  -2.837  1.196   1.00 0.00 ? 40 LEU A HD13 2  
ATOM 1753  H HD21 . LEU A 1 40 ? -8.608  -4.413  2.735   1.00 0.00 ? 40 LEU A HD21 2  
ATOM 1754  H HD22 . LEU A 1 40 ? -8.607  -2.821  1.975   1.00 0.00 ? 40 LEU A HD22 2  
ATOM 1755  H HD23 . LEU A 1 40 ? -7.410  -3.209  3.212   1.00 0.00 ? 40 LEU A HD23 2  
ATOM 1756  N N    . ALA A 1 41 ? -8.785  -4.194  -2.798  1.00 0.00 ? 41 ALA A N    2  
ATOM 1757  C CA   . ALA A 1 41 ? -8.919  -3.957  -4.230  1.00 0.00 ? 41 ALA A CA   2  
ATOM 1758  C C    . ALA A 1 41 ? -10.386 -3.866  -4.636  1.00 0.00 ? 41 ALA A C    2  
ATOM 1759  O O    . ALA A 1 41 ? -10.722 -3.250  -5.647  1.00 0.00 ? 41 ALA A O    2  
ATOM 1760  C CB   . ALA A 1 41 ? -8.219  -5.057  -5.014  1.00 0.00 ? 41 ALA A CB   2  
ATOM 1761  H H    . ALA A 1 41 ? -8.478  -5.070  -2.485  1.00 0.00 ? 41 ALA A H    2  
ATOM 1762  H HA   . ALA A 1 41 ? -8.433  -3.020  -4.460  1.00 0.00 ? 41 ALA A HA   2  
ATOM 1763  H HB1  . ALA A 1 41 ? -8.824  -5.330  -5.867  1.00 0.00 ? 41 ALA A HB1  2  
ATOM 1764  H HB2  . ALA A 1 41 ? -7.257  -4.701  -5.353  1.00 0.00 ? 41 ALA A HB2  2  
ATOM 1765  H HB3  . ALA A 1 41 ? -8.081  -5.920  -4.380  1.00 0.00 ? 41 ALA A HB3  2  
ATOM 1766  N N    . ALA A 1 42 ? -11.254 -4.484  -3.842  1.00 0.00 ? 42 ALA A N    2  
ATOM 1767  C CA   . ALA A 1 42 ? -12.685 -4.471  -4.119  1.00 0.00 ? 42 ALA A CA   2  
ATOM 1768  C C    . ALA A 1 42 ? -13.340 -3.209  -3.567  1.00 0.00 ? 42 ALA A C    2  
ATOM 1769  O O    . ALA A 1 42 ? -14.167 -2.585  -4.232  1.00 0.00 ? 42 ALA A O    2  
ATOM 1770  C CB   . ALA A 1 42 ? -13.347 -5.710  -3.535  1.00 0.00 ? 42 ALA A CB   2  
ATOM 1771  H H    . ALA A 1 42 ? -10.925 -4.958  -3.051  1.00 0.00 ? 42 ALA A H    2  
ATOM 1772  H HA   . ALA A 1 42 ? -12.818 -4.493  -5.191  1.00 0.00 ? 42 ALA A HA   2  
ATOM 1773  H HB1  . ALA A 1 42 ? -13.714 -6.333  -4.338  1.00 0.00 ? 42 ALA A HB1  2  
ATOM 1774  H HB2  . ALA A 1 42 ? -12.626 -6.262  -2.951  1.00 0.00 ? 42 ALA A HB2  2  
ATOM 1775  H HB3  . ALA A 1 42 ? -14.172 -5.414  -2.904  1.00 0.00 ? 42 ALA A HB3  2  
ATOM 1776  N N    . SER A 1 43 ? -12.965 -2.839  -2.347  1.00 0.00 ? 43 SER A N    2  
ATOM 1777  C CA   . SER A 1 43 ? -13.520 -1.654  -1.703  1.00 0.00 ? 43 SER A CA   2  
ATOM 1778  C C    . SER A 1 43 ? -12.908 -0.383  -2.286  1.00 0.00 ? 43 SER A C    2  
ATOM 1779  O O    . SER A 1 43 ? -13.611 0.459   -2.845  1.00 0.00 ? 43 SER A O    2  
ATOM 1780  C CB   . SER A 1 43 ? -13.276 -1.705  -0.194  1.00 0.00 ? 43 SER A CB   2  
ATOM 1781  O OG   . SER A 1 43 ? -13.801 -2.896  0.367   1.00 0.00 ? 43 SER A OG   2  
ATOM 1782  H H    . SER A 1 43 ? -12.301 -3.377  -1.867  1.00 0.00 ? 43 SER A H    2  
ATOM 1783  H HA   . SER A 1 43 ? -14.584 -1.644  -1.887  1.00 0.00 ? 43 SER A HA   2  
ATOM 1784  H HB2  . SER A 1 43 ? -12.214 -1.670  -0.002  1.00 0.00 ? 43 SER A HB2  2  
ATOM 1785  H HB3  . SER A 1 43 ? -13.755 -0.858  0.275   1.00 0.00 ? 43 SER A HB3  2  
ATOM 1786  H HG   . SER A 1 43 ? -13.615 -2.916  1.309   1.00 0.00 ? 43 SER A HG   2  
ATOM 1787  N N    . LEU A 1 44 ? -11.593 -0.251  -2.149  1.00 0.00 ? 44 LEU A N    2  
ATOM 1788  C CA   . LEU A 1 44 ? -10.884 0.917   -2.661  1.00 0.00 ? 44 LEU A CA   2  
ATOM 1789  C C    . LEU A 1 44 ? -10.962 0.977   -4.183  1.00 0.00 ? 44 LEU A C    2  
ATOM 1790  O O    . LEU A 1 44 ? -10.583 1.975   -4.795  1.00 0.00 ? 44 LEU A O    2  
ATOM 1791  C CB   . LEU A 1 44 ? -9.421  0.886   -2.216  1.00 0.00 ? 44 LEU A CB   2  
ATOM 1792  C CG   . LEU A 1 44 ? -9.169  0.463   -0.768  1.00 0.00 ? 44 LEU A CG   2  
ATOM 1793  C CD1  . LEU A 1 44 ? -7.701  0.633   -0.410  1.00 0.00 ? 44 LEU A CD1  2  
ATOM 1794  C CD2  . LEU A 1 44 ? -10.048 1.265   0.182   1.00 0.00 ? 44 LEU A CD2  2  
ATOM 1795  H H    . LEU A 1 44 ? -11.086 -0.955  -1.694  1.00 0.00 ? 44 LEU A H    2  
ATOM 1796  H HA   . LEU A 1 44 ? -11.358 1.797   -2.253  1.00 0.00 ? 44 LEU A HA   2  
ATOM 1797  H HB2  . LEU A 1 44 ? -8.895  0.196   -2.857  1.00 0.00 ? 44 LEU A HB2  2  
ATOM 1798  H HB3  . LEU A 1 44 ? -9.015  1.878   -2.347  1.00 0.00 ? 44 LEU A HB3  2  
ATOM 1799  H HG   . LEU A 1 44 ? -9.421  -0.582  -0.655  1.00 0.00 ? 44 LEU A HG   2  
ATOM 1800  H HD11 . LEU A 1 44 ? -7.545  0.341   0.618   1.00 0.00 ? 44 LEU A HD11 2  
ATOM 1801  H HD12 . LEU A 1 44 ? -7.417  1.668   -0.536  1.00 0.00 ? 44 LEU A HD12 2  
ATOM 1802  H HD13 . LEU A 1 44 ? -7.099  0.013   -1.057  1.00 0.00 ? 44 LEU A HD13 2  
ATOM 1803  H HD21 . LEU A 1 44 ? -10.818 0.624   0.586   1.00 0.00 ? 44 LEU A HD21 2  
ATOM 1804  H HD22 . LEU A 1 44 ? -10.506 2.083   -0.355  1.00 0.00 ? 44 LEU A HD22 2  
ATOM 1805  H HD23 . LEU A 1 44 ? -9.444  1.656   0.987   1.00 0.00 ? 44 LEU A HD23 2  
ATOM 1806  N N    . GLY A 1 45 ? -11.460 -0.097  -4.789  1.00 0.00 ? 45 GLY A N    2  
ATOM 1807  C CA   . GLY A 1 45 ? -11.581 -0.145  -6.234  1.00 0.00 ? 45 GLY A CA   2  
ATOM 1808  C C    . GLY A 1 45 ? -10.248 -0.361  -6.921  1.00 0.00 ? 45 GLY A C    2  
ATOM 1809  O O    . GLY A 1 45 ? -10.092 -0.049  -8.102  1.00 0.00 ? 45 GLY A O    2  
ATOM 1810  H H    . GLY A 1 45 ? -11.747 -0.864  -4.249  1.00 0.00 ? 45 GLY A H    2  
ATOM 1811  H HA2  . GLY A 1 45 ? -12.248 -0.951  -6.502  1.00 0.00 ? 45 GLY A HA2  2  
ATOM 1812  H HA3  . GLY A 1 45 ? -12.004 0.788   -6.579  1.00 0.00 ? 45 GLY A HA3  2  
ATOM 1813  N N    . LEU A 1 46 ? -9.283  -0.895  -6.181  1.00 0.00 ? 46 LEU A N    2  
ATOM 1814  C CA   . LEU A 1 46 ? -7.954  -1.152  -6.726  1.00 0.00 ? 46 LEU A CA   2  
ATOM 1815  C C    . LEU A 1 46 ? -7.802  -2.616  -7.125  1.00 0.00 ? 46 LEU A C    2  
ATOM 1816  O O    . LEU A 1 46 ? -8.730  -3.412  -6.974  1.00 0.00 ? 46 LEU A O    2  
ATOM 1817  C CB   . LEU A 1 46 ? -6.881  -0.776  -5.702  1.00 0.00 ? 46 LEU A CB   2  
ATOM 1818  C CG   . LEU A 1 46 ? -6.905  0.669   -5.204  1.00 0.00 ? 46 LEU A CG   2  
ATOM 1819  C CD1  . LEU A 1 46 ? -6.388  0.750   -3.776  1.00 0.00 ? 46 LEU A CD1  2  
ATOM 1820  C CD2  . LEU A 1 46 ? -6.084  1.564   -6.121  1.00 0.00 ? 46 LEU A CD2  2  
ATOM 1821  H H    . LEU A 1 46 ? -9.467  -1.123  -5.246  1.00 0.00 ? 46 LEU A H    2  
ATOM 1822  H HA   . LEU A 1 46 ? -7.832  -0.537  -7.605  1.00 0.00 ? 46 LEU A HA   2  
ATOM 1823  H HB2  . LEU A 1 46 ? -6.999  -1.423  -4.847  1.00 0.00 ? 46 LEU A HB2  2  
ATOM 1824  H HB3  . LEU A 1 46 ? -5.916  -0.955  -6.156  1.00 0.00 ? 46 LEU A HB3  2  
ATOM 1825  H HG   . LEU A 1 46 ? -7.925  1.028   -5.210  1.00 0.00 ? 46 LEU A HG   2  
ATOM 1826  H HD11 . LEU A 1 46 ? -6.910  1.533   -3.248  1.00 0.00 ? 46 LEU A HD11 2  
ATOM 1827  H HD12 . LEU A 1 46 ? -5.330  0.967   -3.788  1.00 0.00 ? 46 LEU A HD12 2  
ATOM 1828  H HD13 . LEU A 1 46 ? -6.556  -0.194  -3.278  1.00 0.00 ? 46 LEU A HD13 2  
ATOM 1829  H HD21 . LEU A 1 46 ? -6.740  2.254   -6.631  1.00 0.00 ? 46 LEU A HD21 2  
ATOM 1830  H HD22 . LEU A 1 46 ? -5.567  0.955   -6.849  1.00 0.00 ? 46 LEU A HD22 2  
ATOM 1831  H HD23 . LEU A 1 46 ? -5.364  2.116   -5.536  1.00 0.00 ? 46 LEU A HD23 2  
ATOM 1832  N N    . THR A 1 47 ? -6.625  -2.967  -7.633  1.00 0.00 ? 47 THR A N    2  
ATOM 1833  C CA   . THR A 1 47 ? -6.351  -4.335  -8.053  1.00 0.00 ? 47 THR A CA   2  
ATOM 1834  C C    . THR A 1 47 ? -5.282  -4.976  -7.175  1.00 0.00 ? 47 THR A C    2  
ATOM 1835  O O    . THR A 1 47 ? -4.428  -4.286  -6.620  1.00 0.00 ? 47 THR A O    2  
ATOM 1836  C CB   . THR A 1 47 ? -5.893  -4.391  -9.523  1.00 0.00 ? 47 THR A CB   2  
ATOM 1837  O OG1  . THR A 1 47 ? -5.876  -5.748  -9.979  1.00 0.00 ? 47 THR A OG1  2  
ATOM 1838  C CG2  . THR A 1 47 ? -4.510  -3.779  -9.682  1.00 0.00 ? 47 THR A CG2  2  
ATOM 1839  H H    . THR A 1 47 ? -5.925  -2.287  -7.729  1.00 0.00 ? 47 THR A H    2  
ATOM 1840  H HA   . THR A 1 47 ? -7.266  -4.902  -7.961  1.00 0.00 ? 47 THR A HA   2  
ATOM 1841  H HB   . THR A 1 47 ? -6.592  -3.826  -10.123 1.00 0.00 ? 47 THR A HB   2  
ATOM 1842  H HG1  . THR A 1 47 ? -6.555  -6.249  -9.521  1.00 0.00 ? 47 THR A HG1  2  
ATOM 1843  H HG21 . THR A 1 47 ? -4.129  -3.493  -8.713  1.00 0.00 ? 47 THR A HG21 2  
ATOM 1844  H HG22 . THR A 1 47 ? -4.573  -2.907  -10.316 1.00 0.00 ? 47 THR A HG22 2  
ATOM 1845  H HG23 . THR A 1 47 ? -3.846  -4.503  -10.130 1.00 0.00 ? 47 THR A HG23 2  
ATOM 1846  N N    . GLN A 1 48 ? -5.336  -6.298  -7.055  1.00 0.00 ? 48 GLN A N    2  
ATOM 1847  C CA   . GLN A 1 48 ? -4.371  -7.032  -6.244  1.00 0.00 ? 48 GLN A CA   2  
ATOM 1848  C C    . GLN A 1 48 ? -2.945  -6.612  -6.583  1.00 0.00 ? 48 GLN A C    2  
ATOM 1849  O O    . GLN A 1 48 ? -2.121  -6.397  -5.693  1.00 0.00 ? 48 GLN A O    2  
ATOM 1850  C CB   . GLN A 1 48 ? -4.536  -8.538  -6.454  1.00 0.00 ? 48 GLN A CB   2  
ATOM 1851  C CG   . GLN A 1 48 ? -5.833  -9.093  -5.888  1.00 0.00 ? 48 GLN A CG   2  
ATOM 1852  C CD   . GLN A 1 48 ? -6.325  -10.312 -6.644  1.00 0.00 ? 48 GLN A CD   2  
ATOM 1853  O OE1  . GLN A 1 48 ? -5.901  -10.571 -7.770  1.00 0.00 ? 48 GLN A OE1  2  
ATOM 1854  N NE2  . GLN A 1 48 ? -7.226  -11.067 -6.026  1.00 0.00 ? 48 GLN A NE2  2  
ATOM 1855  H H    . GLN A 1 48 ? -6.041  -6.792  -7.522  1.00 0.00 ? 48 GLN A H    2  
ATOM 1856  H HA   . GLN A 1 48 ? -4.565  -6.799  -5.208  1.00 0.00 ? 48 GLN A HA   2  
ATOM 1857  H HB2  . GLN A 1 48 ? -4.512  -8.746  -7.513  1.00 0.00 ? 48 GLN A HB2  2  
ATOM 1858  H HB3  . GLN A 1 48 ? -3.713  -9.048  -5.976  1.00 0.00 ? 48 GLN A HB3  2  
ATOM 1859  H HG2  . GLN A 1 48 ? -5.672  -9.369  -4.857  1.00 0.00 ? 48 GLN A HG2  2  
ATOM 1860  H HG3  . GLN A 1 48 ? -6.591  -8.325  -5.940  1.00 0.00 ? 48 GLN A HG3  2  
ATOM 1861  H HE21 . GLN A 1 48 ? -7.519  -10.798 -5.130  1.00 0.00 ? 48 GLN A HE21 2  
ATOM 1862  H HE22 . GLN A 1 48 ? -7.562  -11.861 -6.492  1.00 0.00 ? 48 GLN A HE22 2  
ATOM 1863  N N    . THR A 1 49 ? -2.658  -6.497  -7.876  1.00 0.00 ? 49 THR A N    2  
ATOM 1864  C CA   . THR A 1 49 ? -1.331  -6.104  -8.332  1.00 0.00 ? 49 THR A CA   2  
ATOM 1865  C C    . THR A 1 49 ? -0.944  -4.735  -7.785  1.00 0.00 ? 49 THR A C    2  
ATOM 1866  O O    . THR A 1 49 ? 0.238   -4.405  -7.695  1.00 0.00 ? 49 THR A O    2  
ATOM 1867  C CB   . THR A 1 49 ? -1.254  -6.070  -9.871  1.00 0.00 ? 49 THR A CB   2  
ATOM 1868  O OG1  . THR A 1 49 ? -1.940  -7.200  -10.421 1.00 0.00 ? 49 THR A OG1  2  
ATOM 1869  C CG2  . THR A 1 49 ? 0.193   -6.072  -10.340 1.00 0.00 ? 49 THR A CG2  2  
ATOM 1870  H H    . THR A 1 49 ? -3.357  -6.681  -8.537  1.00 0.00 ? 49 THR A H    2  
ATOM 1871  H HA   . THR A 1 49 ? -0.624  -6.838  -7.973  1.00 0.00 ? 49 THR A HA   2  
ATOM 1872  H HB   . THR A 1 49 ? -1.729  -5.165  -10.220 1.00 0.00 ? 49 THR A HB   2  
ATOM 1873  H HG1  . THR A 1 49 ? -1.658  -7.335  -11.329 1.00 0.00 ? 49 THR A HG1  2  
ATOM 1874  H HG21 . THR A 1 49 ? 0.607   -5.080  -10.233 1.00 0.00 ? 49 THR A HG21 2  
ATOM 1875  H HG22 . THR A 1 49 ? 0.235   -6.371  -11.376 1.00 0.00 ? 49 THR A HG22 2  
ATOM 1876  H HG23 . THR A 1 49 ? 0.764   -6.766  -9.741  1.00 0.00 ? 49 THR A HG23 2  
ATOM 1877  N N    . GLN A 1 50 ? -1.947  -3.943  -7.420  1.00 0.00 ? 50 GLN A N    2  
ATOM 1878  C CA   . GLN A 1 50 ? -1.710  -2.610  -6.881  1.00 0.00 ? 50 GLN A CA   2  
ATOM 1879  C C    . GLN A 1 50 ? -1.557  -2.654  -5.364  1.00 0.00 ? 50 GLN A C    2  
ATOM 1880  O O    . GLN A 1 50 ? -0.548  -2.208  -4.818  1.00 0.00 ? 50 GLN A O    2  
ATOM 1881  C CB   . GLN A 1 50 ? -2.855  -1.671  -7.263  1.00 0.00 ? 50 GLN A CB   2  
ATOM 1882  C CG   . GLN A 1 50 ? -2.737  -1.107  -8.670  1.00 0.00 ? 50 GLN A CG   2  
ATOM 1883  C CD   . GLN A 1 50 ? -3.386  0.256   -8.809  1.00 0.00 ? 50 GLN A CD   2  
ATOM 1884  O OE1  . GLN A 1 50 ? -4.401  0.406   -9.490  1.00 0.00 ? 50 GLN A OE1  2  
ATOM 1885  N NE2  . GLN A 1 50 ? -2.803  1.259   -8.163  1.00 0.00 ? 50 GLN A NE2  2  
ATOM 1886  H H    . GLN A 1 50 ? -2.868  -4.263  -7.516  1.00 0.00 ? 50 GLN A H    2  
ATOM 1887  H HA   . GLN A 1 50 ? -0.792  -2.237  -7.312  1.00 0.00 ? 50 GLN A HA   2  
ATOM 1888  H HB2  . GLN A 1 50 ? -3.787  -2.212  -7.192  1.00 0.00 ? 50 GLN A HB2  2  
ATOM 1889  H HB3  . GLN A 1 50 ? -2.875  -0.844  -6.568  1.00 0.00 ? 50 GLN A HB3  2  
ATOM 1890  H HG2  . GLN A 1 50 ? -1.690  -1.017  -8.921  1.00 0.00 ? 50 GLN A HG2  2  
ATOM 1891  H HG3  . GLN A 1 50 ? -3.214  -1.789  -9.358  1.00 0.00 ? 50 GLN A HG3  2  
ATOM 1892  H HE21 . GLN A 1 50 ? -1.996  1.065   -7.640  1.00 0.00 ? 50 GLN A HE21 2  
ATOM 1893  H HE22 . GLN A 1 50 ? -3.200  2.150   -8.236  1.00 0.00 ? 50 GLN A HE22 2  
ATOM 1894  N N    . VAL A 1 51 ? -2.566  -3.196  -4.689  1.00 0.00 ? 51 VAL A N    2  
ATOM 1895  C CA   . VAL A 1 51 ? -2.544  -3.300  -3.235  1.00 0.00 ? 51 VAL A CA   2  
ATOM 1896  C C    . VAL A 1 51 ? -1.400  -4.191  -2.765  1.00 0.00 ? 51 VAL A C    2  
ATOM 1897  O O    . VAL A 1 51 ? -0.933  -4.076  -1.631  1.00 0.00 ? 51 VAL A O    2  
ATOM 1898  C CB   . VAL A 1 51 ? -3.872  -3.859  -2.692  1.00 0.00 ? 51 VAL A CB   2  
ATOM 1899  C CG1  . VAL A 1 51 ? -3.686  -4.409  -1.286  1.00 0.00 ? 51 VAL A CG1  2  
ATOM 1900  C CG2  . VAL A 1 51 ? -4.951  -2.786  -2.714  1.00 0.00 ? 51 VAL A CG2  2  
ATOM 1901  H H    . VAL A 1 51 ? -3.343  -3.534  -5.181  1.00 0.00 ? 51 VAL A H    2  
ATOM 1902  H HA   . VAL A 1 51 ? -2.404  -2.307  -2.831  1.00 0.00 ? 51 VAL A HA   2  
ATOM 1903  H HB   . VAL A 1 51 ? -4.187  -4.669  -3.333  1.00 0.00 ? 51 VAL A HB   2  
ATOM 1904  H HG11 . VAL A 1 51 ? -4.626  -4.799  -0.925  1.00 0.00 ? 51 VAL A HG11 2  
ATOM 1905  H HG12 . VAL A 1 51 ? -2.949  -5.199  -1.303  1.00 0.00 ? 51 VAL A HG12 2  
ATOM 1906  H HG13 . VAL A 1 51 ? -3.350  -3.618  -0.632  1.00 0.00 ? 51 VAL A HG13 2  
ATOM 1907  H HG21 . VAL A 1 51 ? -5.596  -2.907  -1.857  1.00 0.00 ? 51 VAL A HG21 2  
ATOM 1908  H HG22 . VAL A 1 51 ? -4.488  -1.810  -2.682  1.00 0.00 ? 51 VAL A HG22 2  
ATOM 1909  H HG23 . VAL A 1 51 ? -5.532  -2.878  -3.619  1.00 0.00 ? 51 VAL A HG23 2  
ATOM 1910  N N    . LYS A 1 52 ? -0.951  -5.081  -3.644  1.00 0.00 ? 52 LYS A N    2  
ATOM 1911  C CA   . LYS A 1 52 ? 0.140   -5.992  -3.321  1.00 0.00 ? 52 LYS A CA   2  
ATOM 1912  C C    . LYS A 1 52 ? 1.473   -5.252  -3.281  1.00 0.00 ? 52 LYS A C    2  
ATOM 1913  O O    . LYS A 1 52 ? 2.226   -5.362  -2.312  1.00 0.00 ? 52 LYS A O    2  
ATOM 1914  C CB   . LYS A 1 52 ? 0.205   -7.126  -4.347  1.00 0.00 ? 52 LYS A CB   2  
ATOM 1915  C CG   . LYS A 1 52 ? -0.804  -8.232  -4.096  1.00 0.00 ? 52 LYS A CG   2  
ATOM 1916  C CD   . LYS A 1 52 ? -0.952  -9.138  -5.307  1.00 0.00 ? 52 LYS A CD   2  
ATOM 1917  C CE   . LYS A 1 52 ? 0.364   -9.811  -5.664  1.00 0.00 ? 52 LYS A CE   2  
ATOM 1918  N NZ   . LYS A 1 52 ? 0.234   -10.684 -6.863  1.00 0.00 ? 52 LYS A NZ   2  
ATOM 1919  H H    . LYS A 1 52 ? -1.364  -5.125  -4.532  1.00 0.00 ? 52 LYS A H    2  
ATOM 1920  H HA   . LYS A 1 52 ? -0.055  -6.411  -2.346  1.00 0.00 ? 52 LYS A HA   2  
ATOM 1921  H HB2  . LYS A 1 52 ? 0.023   -6.717  -5.330  1.00 0.00 ? 52 LYS A HB2  2  
ATOM 1922  H HB3  . LYS A 1 52 ? 1.195   -7.559  -4.325  1.00 0.00 ? 52 LYS A HB3  2  
ATOM 1923  H HG2  . LYS A 1 52 ? -0.474  -8.825  -3.255  1.00 0.00 ? 52 LYS A HG2  2  
ATOM 1924  H HG3  . LYS A 1 52 ? -1.763  -7.788  -3.870  1.00 0.00 ? 52 LYS A HG3  2  
ATOM 1925  H HD2  . LYS A 1 52 ? -1.685  -9.901  -5.088  1.00 0.00 ? 52 LYS A HD2  2  
ATOM 1926  H HD3  . LYS A 1 52 ? -1.285  -8.548  -6.148  1.00 0.00 ? 52 LYS A HD3  2  
ATOM 1927  H HE2  . LYS A 1 52 ? 1.101   -9.047  -5.864  1.00 0.00 ? 52 LYS A HE2  2  
ATOM 1928  H HE3  . LYS A 1 52 ? 0.686   -10.410 -4.825  1.00 0.00 ? 52 LYS A HE3  2  
ATOM 1929  H HZ1  . LYS A 1 52 ? 0.334   -11.683 -6.590  1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 1930  H HZ2  . LYS A 1 52 ? 0.972   -10.451 -7.557  1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 1931  H HZ3  . LYS A 1 52 ? -0.698  -10.548 -7.304  1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 1932  N N    . ILE A 1 53 ? 1.759   -4.498  -4.337  1.00 0.00 ? 53 ILE A N    2  
ATOM 1933  C CA   . ILE A 1 53 ? 3.000   -3.738  -4.419  1.00 0.00 ? 53 ILE A CA   2  
ATOM 1934  C C    . ILE A 1 53 ? 3.049   -2.649  -3.353  1.00 0.00 ? 53 ILE A C    2  
ATOM 1935  O O    . ILE A 1 53 ? 4.084   -2.430  -2.723  1.00 0.00 ? 53 ILE A O    2  
ATOM 1936  C CB   . ILE A 1 53 ? 3.172   -3.091  -5.806  1.00 0.00 ? 53 ILE A CB   2  
ATOM 1937  C CG1  . ILE A 1 53 ? 3.121   -4.158  -6.901  1.00 0.00 ? 53 ILE A CG1  2  
ATOM 1938  C CG2  . ILE A 1 53 ? 4.482   -2.320  -5.871  1.00 0.00 ? 53 ILE A CG2  2  
ATOM 1939  C CD1  . ILE A 1 53 ? 2.943   -3.590  -8.291  1.00 0.00 ? 53 ILE A CD1  2  
ATOM 1940  H H    . ILE A 1 53 ? 1.119   -4.451  -5.077  1.00 0.00 ? 53 ILE A H    2  
ATOM 1941  H HA   . ILE A 1 53 ? 3.820   -4.422  -4.259  1.00 0.00 ? 53 ILE A HA   2  
ATOM 1942  H HB   . ILE A 1 53 ? 2.363   -2.392  -5.956  1.00 0.00 ? 53 ILE A HB   2  
ATOM 1943  H HG12 . ILE A 1 53 ? 4.040   -4.722  -6.889  1.00 0.00 ? 53 ILE A HG12 2  
ATOM 1944  H HG13 . ILE A 1 53 ? 2.293   -4.824  -6.705  1.00 0.00 ? 53 ILE A HG13 2  
ATOM 1945  H HG21 . ILE A 1 53 ? 4.620   -1.928  -6.868  1.00 0.00 ? 53 ILE A HG21 2  
ATOM 1946  H HG22 . ILE A 1 53 ? 4.455   -1.504  -5.165  1.00 0.00 ? 53 ILE A HG22 2  
ATOM 1947  H HG23 . ILE A 1 53 ? 5.301   -2.980  -5.628  1.00 0.00 ? 53 ILE A HG23 2  
ATOM 1948  H HD11 . ILE A 1 53 ? 3.883   -3.630  -8.820  1.00 0.00 ? 53 ILE A HD11 2  
ATOM 1949  H HD12 . ILE A 1 53 ? 2.203   -4.167  -8.825  1.00 0.00 ? 53 ILE A HD12 2  
ATOM 1950  H HD13 . ILE A 1 53 ? 2.614   -2.562  -8.220  1.00 0.00 ? 53 ILE A HD13 2  
ATOM 1951  N N    . TRP A 1 54 ? 1.925   -1.971  -3.154  1.00 0.00 ? 54 TRP A N    2  
ATOM 1952  C CA   . TRP A 1 54 ? 1.839   -0.906  -2.162  1.00 0.00 ? 54 TRP A CA   2  
ATOM 1953  C C    . TRP A 1 54 ? 2.304   -1.396  -0.795  1.00 0.00 ? 54 TRP A C    2  
ATOM 1954  O O    . TRP A 1 54 ? 2.996   -0.681  -0.070  1.00 0.00 ? 54 TRP A O    2  
ATOM 1955  C CB   . TRP A 1 54 ? 0.406   -0.381  -2.069  1.00 0.00 ? 54 TRP A CB   2  
ATOM 1956  C CG   . TRP A 1 54 ? 0.255   0.770   -1.121  1.00 0.00 ? 54 TRP A CG   2  
ATOM 1957  C CD1  . TRP A 1 54 ? 0.112   2.088   -1.448  1.00 0.00 ? 54 TRP A CD1  2  
ATOM 1958  C CD2  . TRP A 1 54 ? 0.234   0.705   0.310   1.00 0.00 ? 54 TRP A CD2  2  
ATOM 1959  N NE1  . TRP A 1 54 ? 0.004   2.846   -0.307  1.00 0.00 ? 54 TRP A NE1  2  
ATOM 1960  C CE2  . TRP A 1 54 ? 0.075   2.021   0.784   1.00 0.00 ? 54 TRP A CE2  2  
ATOM 1961  C CE3  . TRP A 1 54 ? 0.332   -0.337  1.235   1.00 0.00 ? 54 TRP A CE3  2  
ATOM 1962  C CZ2  . TRP A 1 54 ? 0.013   2.320   2.143   1.00 0.00 ? 54 TRP A CZ2  2  
ATOM 1963  C CZ3  . TRP A 1 54 ? 0.271   -0.039  2.583   1.00 0.00 ? 54 TRP A CZ3  2  
ATOM 1964  C CH2  . TRP A 1 54 ? 0.112   1.281   3.027   1.00 0.00 ? 54 TRP A CH2  2  
ATOM 1965  H H    . TRP A 1 54 ? 1.132   -2.193  -3.688  1.00 0.00 ? 54 TRP A H    2  
ATOM 1966  H HA   . TRP A 1 54 ? 2.487   -0.103  -2.483  1.00 0.00 ? 54 TRP A HA   2  
ATOM 1967  H HB2  . TRP A 1 54 ? 0.085   -0.052  -3.046  1.00 0.00 ? 54 TRP A HB2  2  
ATOM 1968  H HB3  . TRP A 1 54 ? -0.240  -1.179  -1.731  1.00 0.00 ? 54 TRP A HB3  2  
ATOM 1969  H HD1  . TRP A 1 54 ? 0.091   2.464   -2.459  1.00 0.00 ? 54 TRP A HD1  2  
ATOM 1970  H HE1  . TRP A 1 54 ? -0.108  3.820   -0.280  1.00 0.00 ? 54 TRP A HE1  2  
ATOM 1971  H HE3  . TRP A 1 54 ? 0.455   -1.361  0.913   1.00 0.00 ? 54 TRP A HE3  2  
ATOM 1972  H HZ2  . TRP A 1 54 ? -0.110  3.332   2.500   1.00 0.00 ? 54 TRP A HZ2  2  
ATOM 1973  H HZ3  . TRP A 1 54 ? 0.346   -0.831  3.313   1.00 0.00 ? 54 TRP A HZ3  2  
ATOM 1974  H HH2  . TRP A 1 54 ? 0.070   1.467   4.089   1.00 0.00 ? 54 TRP A HH2  2  
ATOM 1975  N N    . PHE A 1 55 ? 1.921   -2.621  -0.449  1.00 0.00 ? 55 PHE A N    2  
ATOM 1976  C CA   . PHE A 1 55 ? 2.298   -3.206  0.832   1.00 0.00 ? 55 PHE A CA   2  
ATOM 1977  C C    . PHE A 1 55 ? 3.768   -3.618  0.830   1.00 0.00 ? 55 PHE A C    2  
ATOM 1978  O O    . PHE A 1 55 ? 4.456   -3.501  1.843   1.00 0.00 ? 55 PHE A O    2  
ATOM 1979  C CB   . PHE A 1 55 ? 1.418   -4.419  1.142   1.00 0.00 ? 55 PHE A CB   2  
ATOM 1980  C CG   . PHE A 1 55 ? 0.167   -4.074  1.897   1.00 0.00 ? 55 PHE A CG   2  
ATOM 1981  C CD1  . PHE A 1 55 ? -0.836  -3.328  1.299   1.00 0.00 ? 55 PHE A CD1  2  
ATOM 1982  C CD2  . PHE A 1 55 ? -0.008  -4.496  3.205   1.00 0.00 ? 55 PHE A CD2  2  
ATOM 1983  C CE1  . PHE A 1 55 ? -1.988  -3.008  1.992   1.00 0.00 ? 55 PHE A CE1  2  
ATOM 1984  C CE2  . PHE A 1 55 ? -1.158  -4.180  3.903   1.00 0.00 ? 55 PHE A CE2  2  
ATOM 1985  C CZ   . PHE A 1 55 ? -2.150  -3.436  3.295   1.00 0.00 ? 55 PHE A CZ   2  
ATOM 1986  H H    . PHE A 1 55 ? 1.370   -3.143  -1.070  1.00 0.00 ? 55 PHE A H    2  
ATOM 1987  H HA   . PHE A 1 55 ? 2.147   -2.458  1.595   1.00 0.00 ? 55 PHE A HA   2  
ATOM 1988  H HB2  . PHE A 1 55 ? 1.126   -4.889  0.215   1.00 0.00 ? 55 PHE A HB2  2  
ATOM 1989  H HB3  . PHE A 1 55 ? 1.983   -5.122  1.736   1.00 0.00 ? 55 PHE A HB3  2  
ATOM 1990  H HD1  . PHE A 1 55 ? -0.711  -2.994  0.279   1.00 0.00 ? 55 PHE A HD1  2  
ATOM 1991  H HD2  . PHE A 1 55 ? 0.768   -5.079  3.682   1.00 0.00 ? 55 PHE A HD2  2  
ATOM 1992  H HE1  . PHE A 1 55 ? -2.762  -2.427  1.514   1.00 0.00 ? 55 PHE A HE1  2  
ATOM 1993  H HE2  . PHE A 1 55 ? -1.281  -4.516  4.922   1.00 0.00 ? 55 PHE A HE2  2  
ATOM 1994  H HZ   . PHE A 1 55 ? -3.049  -3.187  3.839   1.00 0.00 ? 55 PHE A HZ   2  
ATOM 1995  N N    . GLN A 1 56 ? 4.240   -4.100  -0.315  1.00 0.00 ? 56 GLN A N    2  
ATOM 1996  C CA   . GLN A 1 56 ? 5.627   -4.530  -0.449  1.00 0.00 ? 56 GLN A CA   2  
ATOM 1997  C C    . GLN A 1 56 ? 6.579   -3.345  -0.321  1.00 0.00 ? 56 GLN A C    2  
ATOM 1998  O O    . GLN A 1 56 ? 7.586   -3.419  0.381   1.00 0.00 ? 56 GLN A O    2  
ATOM 1999  C CB   . GLN A 1 56 ? 5.839   -5.228  -1.793  1.00 0.00 ? 56 GLN A CB   2  
ATOM 2000  C CG   . GLN A 1 56 ? 7.049   -6.147  -1.817  1.00 0.00 ? 56 GLN A CG   2  
ATOM 2001  C CD   . GLN A 1 56 ? 7.573   -6.386  -3.219  1.00 0.00 ? 56 GLN A CD   2  
ATOM 2002  O OE1  . GLN A 1 56 ? 8.382   -5.613  -3.733  1.00 0.00 ? 56 GLN A OE1  2  
ATOM 2003  N NE2  . GLN A 1 56 ? 7.113   -7.462  -3.848  1.00 0.00 ? 56 GLN A NE2  2  
ATOM 2004  H H    . GLN A 1 56 ? 3.641   -4.169  -1.087  1.00 0.00 ? 56 GLN A H    2  
ATOM 2005  H HA   . GLN A 1 56 ? 5.834   -5.230  0.347   1.00 0.00 ? 56 GLN A HA   2  
ATOM 2006  H HB2  . GLN A 1 56 ? 4.963   -5.815  -2.023  1.00 0.00 ? 56 GLN A HB2  2  
ATOM 2007  H HB3  . GLN A 1 56 ? 5.970   -4.477  -2.558  1.00 0.00 ? 56 GLN A HB3  2  
ATOM 2008  H HG2  . GLN A 1 56 ? 7.836   -5.701  -1.227  1.00 0.00 ? 56 GLN A HG2  2  
ATOM 2009  H HG3  . GLN A 1 56 ? 6.772   -7.097  -1.385  1.00 0.00 ? 56 GLN A HG3  2  
ATOM 2010  H HE21 . GLN A 1 56 ? 6.469   -8.033  -3.377  1.00 0.00 ? 56 GLN A HE21 2  
ATOM 2011  H HE22 . GLN A 1 56 ? 7.434   -7.641  -4.755  1.00 0.00 ? 56 GLN A HE22 2  
ATOM 2012  N N    . ASN A 1 57 ? 6.252   -2.254  -1.005  1.00 0.00 ? 57 ASN A N    2  
ATOM 2013  C CA   . ASN A 1 57 ? 7.079   -1.053  -0.969  1.00 0.00 ? 57 ASN A CA   2  
ATOM 2014  C C    . ASN A 1 57 ? 7.190   -0.512  0.453   1.00 0.00 ? 57 ASN A C    2  
ATOM 2015  O O    . ASN A 1 57 ? 8.280   -0.448  1.022   1.00 0.00 ? 57 ASN A O    2  
ATOM 2016  C CB   . ASN A 1 57 ? 6.497   0.021   -1.891  1.00 0.00 ? 57 ASN A CB   2  
ATOM 2017  C CG   . ASN A 1 57 ? 6.664   -0.325  -3.358  1.00 0.00 ? 57 ASN A CG   2  
ATOM 2018  O OD1  . ASN A 1 57 ? 7.248   -1.352  -3.703  1.00 0.00 ? 57 ASN A OD1  2  
ATOM 2019  N ND2  . ASN A 1 57 ? 6.150   0.535   -4.230  1.00 0.00 ? 57 ASN A ND2  2  
ATOM 2020  H H    . ASN A 1 57 ? 5.435   -2.255  -1.547  1.00 0.00 ? 57 ASN A H    2  
ATOM 2021  H HA   . ASN A 1 57 ? 8.065   -1.319  -1.319  1.00 0.00 ? 57 ASN A HA   2  
ATOM 2022  H HB2  . ASN A 1 57 ? 5.442   0.130   -1.685  1.00 0.00 ? 57 ASN A HB2  2  
ATOM 2023  H HB3  . ASN A 1 57 ? 6.995   0.959   -1.701  1.00 0.00 ? 57 ASN A HB3  2  
ATOM 2024  H HD21 . ASN A 1 57 ? 5.699   1.333   -3.883  1.00 0.00 ? 57 ASN A HD21 2  
ATOM 2025  H HD22 . ASN A 1 57 ? 6.244   0.336   -5.185  1.00 0.00 ? 57 ASN A HD22 2  
ATOM 2026  N N    . LYS A 1 58 ? 6.054   -0.124  1.023   1.00 0.00 ? 58 LYS A N    2  
ATOM 2027  C CA   . LYS A 1 58 ? 6.022   0.410   2.380   1.00 0.00 ? 58 LYS A CA   2  
ATOM 2028  C C    . LYS A 1 58 ? 6.993   -0.342  3.284   1.00 0.00 ? 58 LYS A C    2  
ATOM 2029  O O    . LYS A 1 58 ? 7.907   0.250   3.858   1.00 0.00 ? 58 LYS A O    2  
ATOM 2030  C CB   . LYS A 1 58 ? 4.605   0.322   2.951   1.00 0.00 ? 58 LYS A CB   2  
ATOM 2031  C CG   . LYS A 1 58 ? 4.283   1.420   3.951   1.00 0.00 ? 58 LYS A CG   2  
ATOM 2032  C CD   . LYS A 1 58 ? 4.039   2.750   3.259   1.00 0.00 ? 58 LYS A CD   2  
ATOM 2033  C CE   . LYS A 1 58 ? 2.692   2.773   2.552   1.00 0.00 ? 58 LYS A CE   2  
ATOM 2034  N NZ   . LYS A 1 58 ? 2.699   3.684   1.375   1.00 0.00 ? 58 LYS A NZ   2  
ATOM 2035  H H    . LYS A 1 58 ? 5.217   -0.199  0.519   1.00 0.00 ? 58 LYS A H    2  
ATOM 2036  H HA   . LYS A 1 58 ? 6.320   1.447   2.336   1.00 0.00 ? 58 LYS A HA   2  
ATOM 2037  H HB2  . LYS A 1 58 ? 3.897   0.386   2.137   1.00 0.00 ? 58 LYS A HB2  2  
ATOM 2038  H HB3  . LYS A 1 58 ? 4.487   -0.631  3.445   1.00 0.00 ? 58 LYS A HB3  2  
ATOM 2039  H HG2  . LYS A 1 58 ? 3.395   1.144   4.500   1.00 0.00 ? 58 LYS A HG2  2  
ATOM 2040  H HG3  . LYS A 1 58 ? 5.113   1.526   4.634   1.00 0.00 ? 58 LYS A HG3  2  
ATOM 2041  H HD2  . LYS A 1 58 ? 4.059   3.539   3.996   1.00 0.00 ? 58 LYS A HD2  2  
ATOM 2042  H HD3  . LYS A 1 58 ? 4.821   2.916   2.530   1.00 0.00 ? 58 LYS A HD3  2  
ATOM 2043  H HE2  . LYS A 1 58 ? 2.457   1.773   2.222   1.00 0.00 ? 58 LYS A HE2  2  
ATOM 2044  H HE3  . LYS A 1 58 ? 1.940   3.107   3.251   1.00 0.00 ? 58 LYS A HE3  2  
ATOM 2045  H HZ1  . LYS A 1 58 ? 3.020   4.632   1.659   1.00 0.00 ? 58 LYS A HZ1  2  
ATOM 2046  H HZ2  . LYS A 1 58 ? 1.741   3.761   0.977   1.00 0.00 ? 58 LYS A HZ2  2  
ATOM 2047  H HZ3  . LYS A 1 58 ? 3.338   3.317   0.642   1.00 0.00 ? 58 LYS A HZ3  2  
ATOM 2048  N N    . ARG A 1 59 ? 6.790   -1.650  3.406   1.00 0.00 ? 59 ARG A N    2  
ATOM 2049  C CA   . ARG A 1 59 ? 7.648   -2.482  4.240   1.00 0.00 ? 59 ARG A CA   2  
ATOM 2050  C C    . ARG A 1 59 ? 9.112   -2.085  4.080   1.00 0.00 ? 59 ARG A C    2  
ATOM 2051  O O    . ARG A 1 59 ? 9.871   -2.071  5.049   1.00 0.00 ? 59 ARG A O    2  
ATOM 2052  C CB   . ARG A 1 59 ? 7.467   -3.958  3.881   1.00 0.00 ? 59 ARG A CB   2  
ATOM 2053  C CG   . ARG A 1 59 ? 6.392   -4.656  4.698   1.00 0.00 ? 59 ARG A CG   2  
ATOM 2054  C CD   . ARG A 1 59 ? 6.974   -5.311  5.941   1.00 0.00 ? 59 ARG A CD   2  
ATOM 2055  N NE   . ARG A 1 59 ? 7.545   -4.330  6.859   1.00 0.00 ? 59 ARG A NE   2  
ATOM 2056  C CZ   . ARG A 1 59 ? 8.497   -4.615  7.741   1.00 0.00 ? 59 ARG A CZ   2  
ATOM 2057  N NH1  . ARG A 1 59 ? 8.982   -5.846  7.822   1.00 0.00 ? 59 ARG A NH1  2  
ATOM 2058  N NH2  . ARG A 1 59 ? 8.966   -3.668  8.543   1.00 0.00 ? 59 ARG A NH2  2  
ATOM 2059  H H    . ARG A 1 59 ? 6.044   -2.065  2.923   1.00 0.00 ? 59 ARG A H    2  
ATOM 2060  H HA   . ARG A 1 59 ? 7.357   -2.333  5.269   1.00 0.00 ? 59 ARG A HA   2  
ATOM 2061  H HB2  . ARG A 1 59 ? 7.200   -4.033  2.837   1.00 0.00 ? 59 ARG A HB2  2  
ATOM 2062  H HB3  . ARG A 1 59 ? 8.402   -4.473  4.043   1.00 0.00 ? 59 ARG A HB3  2  
ATOM 2063  H HG2  . ARG A 1 59 ? 5.653   -3.929  5.000   1.00 0.00 ? 59 ARG A HG2  2  
ATOM 2064  H HG3  . ARG A 1 59 ? 5.925   -5.415  4.087   1.00 0.00 ? 59 ARG A HG3  2  
ATOM 2065  H HD2  . ARG A 1 59 ? 6.188   -5.850  6.449   1.00 0.00 ? 59 ARG A HD2  2  
ATOM 2066  H HD3  . ARG A 1 59 ? 7.747   -6.001  5.639   1.00 0.00 ? 59 ARG A HD3  2  
ATOM 2067  H HE   . ARG A 1 59 ? 7.201   -3.413  6.817   1.00 0.00 ? 59 ARG A HE   2  
ATOM 2068  H HH11 . ARG A 1 59 ? 8.631   -6.562  7.218   1.00 0.00 ? 59 ARG A HH11 2  
ATOM 2069  H HH12 . ARG A 1 59 ? 9.700   -6.059  8.485   1.00 0.00 ? 59 ARG A HH12 2  
ATOM 2070  H HH21 . ARG A 1 59 ? 8.603   -2.738  8.484   1.00 0.00 ? 59 ARG A HH21 2  
ATOM 2071  H HH22 . ARG A 1 59 ? 9.683   -3.884  9.205   1.00 0.00 ? 59 ARG A HH22 2  
ATOM 2072  N N    . SER A 1 60 ? 9.502   -1.763  2.851   1.00 0.00 ? 60 SER A N    2  
ATOM 2073  C CA   . SER A 1 60 ? 10.876  -1.369  2.563   1.00 0.00 ? 60 SER A CA   2  
ATOM 2074  C C    . SER A 1 60 ? 11.210  -0.037  3.227   1.00 0.00 ? 60 SER A C    2  
ATOM 2075  O O    . SER A 1 60 ? 12.313  0.156   3.739   1.00 0.00 ? 60 SER A O    2  
ATOM 2076  C CB   . SER A 1 60 ? 11.095  -1.268  1.052   1.00 0.00 ? 60 SER A CB   2  
ATOM 2077  O OG   . SER A 1 60 ? 12.453  -1.491  0.717   1.00 0.00 ? 60 SER A OG   2  
ATOM 2078  H H    . SER A 1 60 ? 8.850   -1.793  2.120   1.00 0.00 ? 60 SER A H    2  
ATOM 2079  H HA   . SER A 1 60 ? 11.530  -2.131  2.962   1.00 0.00 ? 60 SER A HA   2  
ATOM 2080  H HB2  . SER A 1 60 ? 10.487  -2.007  0.553   1.00 0.00 ? 60 SER A HB2  2  
ATOM 2081  H HB3  . SER A 1 60 ? 10.811  -0.281  0.716   1.00 0.00 ? 60 SER A HB3  2  
ATOM 2082  H HG   . SER A 1 60 ? 12.684  -2.404  0.906   1.00 0.00 ? 60 SER A HG   2  
ATOM 2083  N N    . LYS A 1 61 ? 10.249  0.880   3.216   1.00 0.00 ? 61 LYS A N    2  
ATOM 2084  C CA   . LYS A 1 61 ? 10.438  2.195   3.817   1.00 0.00 ? 61 LYS A CA   2  
ATOM 2085  C C    . LYS A 1 61 ? 10.390  2.109   5.339   1.00 0.00 ? 61 LYS A C    2  
ATOM 2086  O O    . LYS A 1 61 ? 10.623  3.098   6.034   1.00 0.00 ? 61 LYS A O    2  
ATOM 2087  C CB   . LYS A 1 61 ? 9.366   3.166   3.317   1.00 0.00 ? 61 LYS A CB   2  
ATOM 2088  C CG   . LYS A 1 61 ? 9.264   3.232   1.803   1.00 0.00 ? 61 LYS A CG   2  
ATOM 2089  C CD   . LYS A 1 61 ? 10.468  3.929   1.193   1.00 0.00 ? 61 LYS A CD   2  
ATOM 2090  C CE   . LYS A 1 61 ? 11.579  2.941   0.870   1.00 0.00 ? 61 LYS A CE   2  
ATOM 2091  N NZ   . LYS A 1 61 ? 12.925  3.570   0.966   1.00 0.00 ? 61 LYS A NZ   2  
ATOM 2092  H H    . LYS A 1 61 ? 9.390   0.667   2.792   1.00 0.00 ? 61 LYS A H    2  
ATOM 2093  H HA   . LYS A 1 61 ? 11.409  2.560   3.519   1.00 0.00 ? 61 LYS A HA   2  
ATOM 2094  H HB2  . LYS A 1 61 ? 8.407   2.858   3.709   1.00 0.00 ? 61 LYS A HB2  2  
ATOM 2095  H HB3  . LYS A 1 61 ? 9.594   4.156   3.685   1.00 0.00 ? 61 LYS A HB3  2  
ATOM 2096  H HG2  . LYS A 1 61 ? 9.206   2.227   1.411   1.00 0.00 ? 61 LYS A HG2  2  
ATOM 2097  H HG3  . LYS A 1 61 ? 8.370   3.777   1.535   1.00 0.00 ? 61 LYS A HG3  2  
ATOM 2098  H HD2  . LYS A 1 61 ? 10.164  4.422   0.281   1.00 0.00 ? 61 LYS A HD2  2  
ATOM 2099  H HD3  . LYS A 1 61 ? 10.842  4.662   1.893   1.00 0.00 ? 61 LYS A HD3  2  
ATOM 2100  H HE2  . LYS A 1 61 ? 11.525  2.118   1.566   1.00 0.00 ? 61 LYS A HE2  2  
ATOM 2101  H HE3  . LYS A 1 61 ? 11.434  2.573   -0.135  1.00 0.00 ? 61 LYS A HE3  2  
ATOM 2102  H HZ1  . LYS A 1 61 ? 13.322  3.712   0.015   1.00 0.00 ? 61 LYS A HZ1  2  
ATOM 2103  H HZ2  . LYS A 1 61 ? 13.567  2.959   1.509   1.00 0.00 ? 61 LYS A HZ2  2  
ATOM 2104  H HZ3  . LYS A 1 61 ? 12.856  4.492   1.443   1.00 0.00 ? 61 LYS A HZ3  2  
ATOM 2105  N N    . ILE A 1 62 ? 10.088  0.920   5.851   1.00 0.00 ? 62 ILE A N    2  
ATOM 2106  C CA   . ILE A 1 62 ? 10.013  0.706   7.291   1.00 0.00 ? 62 ILE A CA   2  
ATOM 2107  C C    . ILE A 1 62 ? 11.362  0.272   7.853   1.00 0.00 ? 62 ILE A C    2  
ATOM 2108  O O    . ILE A 1 62 ? 11.869  -0.801  7.524   1.00 0.00 ? 62 ILE A O    2  
ATOM 2109  C CB   . ILE A 1 62 ? 8.955   -0.356  7.647   1.00 0.00 ? 62 ILE A CB   2  
ATOM 2110  C CG1  . ILE A 1 62 ? 7.617   -0.015  6.989   1.00 0.00 ? 62 ILE A CG1  2  
ATOM 2111  C CG2  . ILE A 1 62 ? 8.798   -0.461  9.157   1.00 0.00 ? 62 ILE A CG2  2  
ATOM 2112  C CD1  . ILE A 1 62 ? 6.430   -0.674  7.657   1.00 0.00 ? 62 ILE A CD1  2  
ATOM 2113  H H    . ILE A 1 62 ? 9.912   0.170   5.246   1.00 0.00 ? 62 ILE A H    2  
ATOM 2114  H HA   . ILE A 1 62 ? 9.726   1.640   7.752   1.00 0.00 ? 62 ILE A HA   2  
ATOM 2115  H HB   . ILE A 1 62 ? 9.297   -1.311  7.278   1.00 0.00 ? 62 ILE A HB   2  
ATOM 2116  H HG12 . ILE A 1 62 ? 7.467   1.052   7.025   1.00 0.00 ? 62 ILE A HG12 2  
ATOM 2117  H HG13 . ILE A 1 62 ? 7.639   -0.337  5.958   1.00 0.00 ? 62 ILE A HG13 2  
ATOM 2118  H HG21 . ILE A 1 62 ? 8.527   0.505   9.558   1.00 0.00 ? 62 ILE A HG21 2  
ATOM 2119  H HG22 . ILE A 1 62 ? 8.024   -1.176  9.389   1.00 0.00 ? 62 ILE A HG22 2  
ATOM 2120  H HG23 . ILE A 1 62 ? 9.731   -0.783  9.595   1.00 0.00 ? 62 ILE A HG23 2  
ATOM 2121  H HD11 . ILE A 1 62 ? 6.147   -0.106  8.531   1.00 0.00 ? 62 ILE A HD11 2  
ATOM 2122  H HD12 . ILE A 1 62 ? 5.602   -0.710  6.966   1.00 0.00 ? 62 ILE A HD12 2  
ATOM 2123  H HD13 . ILE A 1 62 ? 6.696   -1.679  7.952   1.00 0.00 ? 62 ILE A HD13 2  
ATOM 2124  N N    . LYS A 1 63 ? 11.940  1.112   8.705   1.00 0.00 ? 63 LYS A N    2  
ATOM 2125  C CA   . LYS A 1 63 ? 13.229  0.815   9.317   1.00 0.00 ? 63 LYS A CA   2  
ATOM 2126  C C    . LYS A 1 63 ? 14.362  0.988   8.310   1.00 0.00 ? 63 LYS A C    2  
ATOM 2127  O O    . LYS A 1 63 ? 15.263  0.153   8.224   1.00 0.00 ? 63 LYS A O    2  
ATOM 2128  C CB   . LYS A 1 63 ? 13.238  -0.612  9.871   1.00 0.00 ? 63 LYS A CB   2  
ATOM 2129  C CG   . LYS A 1 63 ? 14.250  -0.826  10.983  1.00 0.00 ? 63 LYS A CG   2  
ATOM 2130  C CD   . LYS A 1 63 ? 13.741  -0.291  12.311  1.00 0.00 ? 63 LYS A CD   2  
ATOM 2131  C CE   . LYS A 1 63 ? 12.795  -1.274  12.983  1.00 0.00 ? 63 LYS A CE   2  
ATOM 2132  N NZ   . LYS A 1 63 ? 12.767  -1.096  14.461  1.00 0.00 ? 63 LYS A NZ   2  
ATOM 2133  H H    . LYS A 1 63 ? 11.486  1.952   8.929   1.00 0.00 ? 63 LYS A H    2  
ATOM 2134  H HA   . LYS A 1 63 ? 13.378  1.509   10.131  1.00 0.00 ? 63 LYS A HA   2  
ATOM 2135  H HB2  . LYS A 1 63 ? 12.256  -0.841  10.257  1.00 0.00 ? 63 LYS A HB2  2  
ATOM 2136  H HB3  . LYS A 1 63 ? 13.468  -1.296  9.067   1.00 0.00 ? 63 LYS A HB3  2  
ATOM 2137  H HG2  . LYS A 1 63 ? 14.443  -1.884  11.084  1.00 0.00 ? 63 LYS A HG2  2  
ATOM 2138  H HG3  . LYS A 1 63 ? 15.167  -0.314  10.727  1.00 0.00 ? 63 LYS A HG3  2  
ATOM 2139  H HD2  . LYS A 1 63 ? 14.583  -0.115  12.965  1.00 0.00 ? 63 LYS A HD2  2  
ATOM 2140  H HD3  . LYS A 1 63 ? 13.217  0.638   12.138  1.00 0.00 ? 63 LYS A HD3  2  
ATOM 2141  H HE2  . LYS A 1 63 ? 11.801  -1.121  12.592  1.00 0.00 ? 63 LYS A HE2  2  
ATOM 2142  H HE3  . LYS A 1 63 ? 13.120  -2.279  12.755  1.00 0.00 ? 63 LYS A HE3  2  
ATOM 2143  H HZ1  . LYS A 1 63 ? 13.024  -1.987  14.932  1.00 0.00 ? 63 LYS A HZ1  2  
ATOM 2144  H HZ2  . LYS A 1 63 ? 11.814  -0.816  14.769  1.00 0.00 ? 63 LYS A HZ2  2  
ATOM 2145  H HZ3  . LYS A 1 63 ? 13.443  -0.359  14.745  1.00 0.00 ? 63 LYS A HZ3  2  
ATOM 2146  N N    . LYS A 1 64 ? 14.312  2.077   7.552   1.00 0.00 ? 64 LYS A N    2  
ATOM 2147  C CA   . LYS A 1 64 ? 15.335  2.362   6.552   1.00 0.00 ? 64 LYS A CA   2  
ATOM 2148  C C    . LYS A 1 64 ? 16.500  3.129   7.170   1.00 0.00 ? 64 LYS A C    2  
ATOM 2149  O O    . LYS A 1 64 ? 16.335  3.829   8.169   1.00 0.00 ? 64 LYS A O    2  
ATOM 2150  C CB   . LYS A 1 64 ? 14.737  3.166   5.395   1.00 0.00 ? 64 LYS A CB   2  
ATOM 2151  C CG   . LYS A 1 64 ? 15.684  3.337   4.220   1.00 0.00 ? 64 LYS A CG   2  
ATOM 2152  C CD   . LYS A 1 64 ? 15.232  4.456   3.297   1.00 0.00 ? 64 LYS A CD   2  
ATOM 2153  C CE   . LYS A 1 64 ? 15.511  5.823   3.902   1.00 0.00 ? 64 LYS A CE   2  
ATOM 2154  N NZ   . LYS A 1 64 ? 16.917  6.255   3.671   1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2155  H H    . LYS A 1 64 ? 13.569  2.706   7.667   1.00 0.00 ? 64 LYS A H    2  
ATOM 2156  H HA   . LYS A 1 64 ? 15.701  1.420   6.174   1.00 0.00 ? 64 LYS A HA   2  
ATOM 2157  H HB2  . LYS A 1 64 ? 13.848  2.663   5.045   1.00 0.00 ? 64 LYS A HB2  2  
ATOM 2158  H HB3  . LYS A 1 64 ? 14.466  4.147   5.757   1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2159  H HG2  . LYS A 1 64 ? 16.670  3.570   4.594   1.00 0.00 ? 64 LYS A HG2  2  
ATOM 2160  H HG3  . LYS A 1 64 ? 15.719  2.413   3.660   1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2161  H HD2  . LYS A 1 64 ? 15.761  4.374   2.360   1.00 0.00 ? 64 LYS A HD2  2  
ATOM 2162  H HD3  . LYS A 1 64 ? 14.169  4.359   3.123   1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2163  H HE2  . LYS A 1 64 ? 14.844  6.544   3.453   1.00 0.00 ? 64 LYS A HE2  2  
ATOM 2164  H HE3  . LYS A 1 64 ? 15.327  5.777   4.965   1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2165  H HZ1  . LYS A 1 64 ? 17.417  5.549   3.094   1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2166  H HZ2  . LYS A 1 64 ? 17.413  6.356   4.580   1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2167  H HZ3  . LYS A 1 64 ? 16.934  7.169   3.175   1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2168  N N    . SER A 1 65 ? 17.677  2.994   6.568   1.00 0.00 ? 65 SER A N    2  
ATOM 2169  C CA   . SER A 1 65 ? 18.870  3.673   7.060   1.00 0.00 ? 65 SER A CA   2  
ATOM 2170  C C    . SER A 1 65 ? 18.659  5.183   7.097   1.00 0.00 ? 65 SER A C    2  
ATOM 2171  O O    . SER A 1 65 ? 18.753  5.860   6.074   1.00 0.00 ? 65 SER A O    2  
ATOM 2172  C CB   . SER A 1 65 ? 20.075  3.336   6.178   1.00 0.00 ? 65 SER A CB   2  
ATOM 2173  O OG   . SER A 1 65 ? 19.927  3.888   4.881   1.00 0.00 ? 65 SER A OG   2  
ATOM 2174  H H    . SER A 1 65 ? 17.745  2.422   5.774   1.00 0.00 ? 65 SER A H    2  
ATOM 2175  H HA   . SER A 1 65 ? 19.060  3.323   8.063   1.00 0.00 ? 65 SER A HA   2  
ATOM 2176  H HB2  . SER A 1 65 ? 20.970  3.738   6.628   1.00 0.00 ? 65 SER A HB2  2  
ATOM 2177  H HB3  . SER A 1 65 ? 20.165  2.263   6.092   1.00 0.00 ? 65 SER A HB3  2  
ATOM 2178  H HG   . SER A 1 65 ? 20.537  3.456   4.278   1.00 0.00 ? 65 SER A HG   2  
ATOM 2179  N N    . GLY A 1 66 ? 18.374  5.705   8.286   1.00 0.00 ? 66 GLY A N    2  
ATOM 2180  C CA   . GLY A 1 66 ? 18.154  7.132   8.436   1.00 0.00 ? 66 GLY A CA   2  
ATOM 2181  C C    . GLY A 1 66 ? 16.842  7.447   9.129   1.00 0.00 ? 66 GLY A C    2  
ATOM 2182  O O    . GLY A 1 66 ? 15.831  7.732   8.488   1.00 0.00 ? 66 GLY A O    2  
ATOM 2183  H H    . GLY A 1 66 ? 18.312  5.117   9.068   1.00 0.00 ? 66 GLY A H    2  
ATOM 2184  H HA2  . GLY A 1 66 ? 18.964  7.551   9.015   1.00 0.00 ? 66 GLY A HA2  2  
ATOM 2185  H HA3  . GLY A 1 66 ? 18.149  7.589   7.458   1.00 0.00 ? 66 GLY A HA3  2  
ATOM 2186  N N    . PRO A 1 67 ? 16.849  7.394   10.469  1.00 0.00 ? 67 PRO A N    2  
ATOM 2187  C CA   . PRO A 1 67 ? 15.658  7.672   11.278  1.00 0.00 ? 67 PRO A CA   2  
ATOM 2188  C C    . PRO A 1 67 ? 15.262  9.144   11.239  1.00 0.00 ? 67 PRO A C    2  
ATOM 2189  O O    . PRO A 1 67 ? 14.083  9.476   11.110  1.00 0.00 ? 67 PRO A O    2  
ATOM 2190  C CB   . PRO A 1 67 ? 16.088  7.270   12.691  1.00 0.00 ? 67 PRO A CB   2  
ATOM 2191  C CG   . PRO A 1 67 ? 17.571  7.410   12.690  1.00 0.00 ? 67 PRO A CG   2  
ATOM 2192  C CD   . PRO A 1 67 ? 18.019  7.061   11.298  1.00 0.00 ? 67 PRO A CD   2  
ATOM 2193  H HA   . PRO A 1 67 ? 14.819  7.066   10.969  1.00 0.00 ? 67 PRO A HA   2  
ATOM 2194  H HB2  . PRO A 1 67 ? 15.628  7.932   13.411  1.00 0.00 ? 67 PRO A HB2  2  
ATOM 2195  H HB3  . PRO A 1 67 ? 15.788  6.252   12.887  1.00 0.00 ? 67 PRO A HB3  2  
ATOM 2196  H HG2  . PRO A 1 67 ? 17.844  8.427   12.928  1.00 0.00 ? 67 PRO A HG2  2  
ATOM 2197  H HG3  . PRO A 1 67 ? 18.004  6.727   13.406  1.00 0.00 ? 67 PRO A HG3  2  
ATOM 2198  H HD2  . PRO A 1 67 ? 18.874  7.657   11.016  1.00 0.00 ? 67 PRO A HD2  2  
ATOM 2199  H HD3  . PRO A 1 67 ? 18.252  6.008   11.230  1.00 0.00 ? 67 PRO A HD3  2  
ATOM 2200  N N    . SER A 1 68 ? 16.253  10.022  11.352  1.00 0.00 ? 68 SER A N    2  
ATOM 2201  C CA   . SER A 1 68 ? 16.007  11.459  11.334  1.00 0.00 ? 68 SER A CA   2  
ATOM 2202  C C    . SER A 1 68 ? 14.710  11.798  12.064  1.00 0.00 ? 68 SER A C    2  
ATOM 2203  O O    . SER A 1 68 ? 13.923  12.624  11.602  1.00 0.00 ? 68 SER A O    2  
ATOM 2204  C CB   . SER A 1 68 ? 15.942  11.969  9.893   1.00 0.00 ? 68 SER A CB   2  
ATOM 2205  O OG   . SER A 1 68 ? 15.054  11.185  9.114   1.00 0.00 ? 68 SER A OG   2  
ATOM 2206  H H    . SER A 1 68 ? 17.172  9.695   11.453  1.00 0.00 ? 68 SER A H    2  
ATOM 2207  H HA   . SER A 1 68 ? 16.828  11.943  11.841  1.00 0.00 ? 68 SER A HA   2  
ATOM 2208  H HB2  . SER A 1 68 ? 15.597  12.991  9.890   1.00 0.00 ? 68 SER A HB2  2  
ATOM 2209  H HB3  . SER A 1 68 ? 16.927  11.920  9.452   1.00 0.00 ? 68 SER A HB3  2  
ATOM 2210  H HG   . SER A 1 68 ? 15.232  11.330  8.182   1.00 0.00 ? 68 SER A HG   2  
ATOM 2211  N N    . SER A 1 69 ? 14.496  11.153  13.206  1.00 0.00 ? 69 SER A N    2  
ATOM 2212  C CA   . SER A 1 69 ? 13.293  11.381  13.999  1.00 0.00 ? 69 SER A CA   2  
ATOM 2213  C C    . SER A 1 69 ? 13.393  12.694  14.769  1.00 0.00 ? 69 SER A C    2  
ATOM 2214  O O    . SER A 1 69 ? 13.762  12.712  15.943  1.00 0.00 ? 69 SER A O    2  
ATOM 2215  C CB   . SER A 1 69 ? 13.070  10.221  14.971  1.00 0.00 ? 69 SER A CB   2  
ATOM 2216  O OG   . SER A 1 69 ? 14.152  10.101  15.878  1.00 0.00 ? 69 SER A OG   2  
ATOM 2217  H H    . SER A 1 69 ? 15.161  10.506  13.521  1.00 0.00 ? 69 SER A H    2  
ATOM 2218  H HA   . SER A 1 69 ? 12.455  11.438  13.321  1.00 0.00 ? 69 SER A HA   2  
ATOM 2219  H HB2  . SER A 1 69 ? 12.164  10.394  15.531  1.00 0.00 ? 69 SER A HB2  2  
ATOM 2220  H HB3  . SER A 1 69 ? 12.978  9.301   14.413  1.00 0.00 ? 69 SER A HB3  2  
ATOM 2221  H HG   . SER A 1 69 ? 14.443  10.975  16.147  1.00 0.00 ? 69 SER A HG   2  
ATOM 2222  N N    . GLY A 1 70 ? 13.060  13.793  14.099  1.00 0.00 ? 70 GLY A N    2  
ATOM 2223  C CA   . GLY A 1 70 ? 13.118  15.096  14.736  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2224  C C    . GLY A 1 70 ? 12.219  15.188  15.953  1.00 0.00 ? 70 GLY A C    2  
ATOM 2225  O O    . GLY A 1 70 ? 12.359  16.098  16.769  1.00 0.00 ? 70 GLY A O    2  
ATOM 2226  H H    . GLY A 1 70 ? 12.773  13.719  13.165  1.00 0.00 ? 70 GLY A H    2  
ATOM 2227  H HA2  . GLY A 1 70 ? 14.136  15.292  15.038  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2228  H HA3  . GLY A 1 70 ? 12.814  15.847  14.021  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2229  N N    . GLY A 1 1  ? 10.147  11.293  -13.382 1.00 0.00 ? 1  GLY A N    3  
ATOM 2230  C CA   . GLY A 1 1  ? 8.777   11.639  -13.051 1.00 0.00 ? 1  GLY A CA   3  
ATOM 2231  C C    . GLY A 1 1  ? 8.596   11.947  -11.578 1.00 0.00 ? 1  GLY A C    3  
ATOM 2232  O O    . GLY A 1 1  ? 8.066   11.128  -10.827 1.00 0.00 ? 1  GLY A O    3  
ATOM 2233  H H1   . GLY A 1 1  ? 10.342  10.440  -13.824 1.00 0.00 ? 1  GLY A H1   3  
ATOM 2234  H HA2  . GLY A 1 1  ? 8.487   12.505  -13.627 1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2235  H HA3  . GLY A 1 1  ? 8.135   10.812  -13.316 1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2236  N N    . SER A 1 2  ? 9.039   13.129  -11.163 1.00 0.00 ? 2  SER A N    3  
ATOM 2237  C CA   . SER A 1 2  ? 8.928   13.541  -9.768  1.00 0.00 ? 2  SER A CA   3  
ATOM 2238  C C    . SER A 1 2  ? 7.480   13.865  -9.411  1.00 0.00 ? 2  SER A C    3  
ATOM 2239  O O    . SER A 1 2  ? 6.927   13.317  -8.457  1.00 0.00 ? 2  SER A O    3  
ATOM 2240  C CB   . SER A 1 2  ? 9.816   14.758  -9.502  1.00 0.00 ? 2  SER A CB   3  
ATOM 2241  O OG   . SER A 1 2  ? 9.555   15.309  -8.222  1.00 0.00 ? 2  SER A OG   3  
ATOM 2242  H H    . SER A 1 2  ? 9.452   13.738  -11.810 1.00 0.00 ? 2  SER A H    3  
ATOM 2243  H HA   . SER A 1 2  ? 9.263   12.719  -9.153  1.00 0.00 ? 2  SER A HA   3  
ATOM 2244  H HB2  . SER A 1 2  ? 10.852  14.461  -9.547  1.00 0.00 ? 2  SER A HB2  3  
ATOM 2245  H HB3  . SER A 1 2  ? 9.623   15.511  -10.251 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2246  H HG   . SER A 1 2  ? 10.163  14.933  -7.581  1.00 0.00 ? 2  SER A HG   3  
ATOM 2247  N N    . SER A 1 3  ? 6.873   14.759  -10.184 1.00 0.00 ? 3  SER A N    3  
ATOM 2248  C CA   . SER A 1 3  ? 5.491   15.160  -9.948  1.00 0.00 ? 3  SER A CA   3  
ATOM 2249  C C    . SER A 1 3  ? 4.992   16.074  -11.064 1.00 0.00 ? 3  SER A C    3  
ATOM 2250  O O    . SER A 1 3  ? 5.743   16.433  -11.969 1.00 0.00 ? 3  SER A O    3  
ATOM 2251  C CB   . SER A 1 3  ? 5.367   15.870  -8.599  1.00 0.00 ? 3  SER A CB   3  
ATOM 2252  O OG   . SER A 1 3  ? 6.213   17.005  -8.540  1.00 0.00 ? 3  SER A OG   3  
ATOM 2253  H H    . SER A 1 3  ? 7.367   15.160  -10.930 1.00 0.00 ? 3  SER A H    3  
ATOM 2254  H HA   . SER A 1 3  ? 4.884   14.267  -9.932  1.00 0.00 ? 3  SER A HA   3  
ATOM 2255  H HB2  . SER A 1 3  ? 4.346   16.189  -8.455  1.00 0.00 ? 3  SER A HB2  3  
ATOM 2256  H HB3  . SER A 1 3  ? 5.645   15.187  -7.809  1.00 0.00 ? 3  SER A HB3  3  
ATOM 2257  H HG   . SER A 1 3  ? 7.065   16.751  -8.176  1.00 0.00 ? 3  SER A HG   3  
ATOM 2258  N N    . GLY A 1 4  ? 3.718   16.446  -10.990 1.00 0.00 ? 4  GLY A N    3  
ATOM 2259  C CA   . GLY A 1 4  ? 3.139   17.314  -11.999 1.00 0.00 ? 4  GLY A CA   3  
ATOM 2260  C C    . GLY A 1 4  ? 1.714   16.930  -12.347 1.00 0.00 ? 4  GLY A C    3  
ATOM 2261  O O    . GLY A 1 4  ? 1.482   15.934  -13.031 1.00 0.00 ? 4  GLY A O    3  
ATOM 2262  H H    . GLY A 1 4  ? 3.166   16.128  -10.245 1.00 0.00 ? 4  GLY A H    3  
ATOM 2263  H HA2  . GLY A 1 4  ? 3.148   18.329  -11.633 1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2264  H HA3  . GLY A 1 4  ? 3.742   17.259  -12.894 1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2265  N N    . SER A 1 5  ? 0.757   17.721  -11.872 1.00 0.00 ? 5  SER A N    3  
ATOM 2266  C CA   . SER A 1 5  ? -0.653  17.456  -12.132 1.00 0.00 ? 5  SER A CA   3  
ATOM 2267  C C    . SER A 1 5  ? -1.523  18.605  -11.633 1.00 0.00 ? 5  SER A C    3  
ATOM 2268  O O    . SER A 1 5  ? -1.271  19.172  -10.569 1.00 0.00 ? 5  SER A O    3  
ATOM 2269  C CB   . SER A 1 5  ? -1.080  16.149  -11.460 1.00 0.00 ? 5  SER A CB   3  
ATOM 2270  O OG   . SER A 1 5  ? -0.882  15.043  -12.324 1.00 0.00 ? 5  SER A OG   3  
ATOM 2271  H H    . SER A 1 5  ? 1.006   18.501  -11.332 1.00 0.00 ? 5  SER A H    3  
ATOM 2272  H HA   . SER A 1 5  ? -0.781  17.360  -13.200 1.00 0.00 ? 5  SER A HA   3  
ATOM 2273  H HB2  . SER A 1 5  ? -0.496  16.000  -10.565 1.00 0.00 ? 5  SER A HB2  3  
ATOM 2274  H HB3  . SER A 1 5  ? -2.127  16.206  -11.201 1.00 0.00 ? 5  SER A HB3  3  
ATOM 2275  H HG   . SER A 1 5  ? -1.441  15.138  -13.099 1.00 0.00 ? 5  SER A HG   3  
ATOM 2276  N N    . SER A 1 6  ? -2.547  18.944  -12.409 1.00 0.00 ? 6  SER A N    3  
ATOM 2277  C CA   . SER A 1 6  ? -3.453  20.028  -12.049 1.00 0.00 ? 6  SER A CA   3  
ATOM 2278  C C    . SER A 1 6  ? -4.907  19.573  -12.136 1.00 0.00 ? 6  SER A C    3  
ATOM 2279  O O    . SER A 1 6  ? -5.460  19.430  -13.225 1.00 0.00 ? 6  SER A O    3  
ATOM 2280  C CB   . SER A 1 6  ? -3.229  21.234  -12.964 1.00 0.00 ? 6  SER A CB   3  
ATOM 2281  O OG   . SER A 1 6  ? -3.776  22.412  -12.398 1.00 0.00 ? 6  SER A OG   3  
ATOM 2282  H H    . SER A 1 6  ? -2.695  18.454  -13.245 1.00 0.00 ? 6  SER A H    3  
ATOM 2283  H HA   . SER A 1 6  ? -3.239  20.315  -11.030 1.00 0.00 ? 6  SER A HA   3  
ATOM 2284  H HB2  . SER A 1 6  ? -2.170  21.378  -13.112 1.00 0.00 ? 6  SER A HB2  3  
ATOM 2285  H HB3  . SER A 1 6  ? -3.704  21.052  -13.917 1.00 0.00 ? 6  SER A HB3  3  
ATOM 2286  H HG   . SER A 1 6  ? -4.511  22.182  -11.826 1.00 0.00 ? 6  SER A HG   3  
ATOM 2287  N N    . GLY A 1 7  ? -5.520  19.347  -10.978 1.00 0.00 ? 7  GLY A N    3  
ATOM 2288  C CA   . GLY A 1 7  ? -6.904  18.910  -10.944 1.00 0.00 ? 7  GLY A CA   3  
ATOM 2289  C C    . GLY A 1 7  ? -7.436  18.780  -9.531  1.00 0.00 ? 7  GLY A C    3  
ATOM 2290  O O    . GLY A 1 7  ? -7.004  19.498  -8.629  1.00 0.00 ? 7  GLY A O    3  
ATOM 2291  H H    . GLY A 1 7  ? -5.029  19.478  -10.140 1.00 0.00 ? 7  GLY A H    3  
ATOM 2292  H HA2  . GLY A 1 7  ? -7.509  19.625  -11.481 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2293  H HA3  . GLY A 1 7  ? -6.978  17.950  -11.434 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2294  N N    . ARG A 1 8  ? -8.378  17.863  -9.337  1.00 0.00 ? 8  ARG A N    3  
ATOM 2295  C CA   . ARG A 1 8  ? -8.972  17.643  -8.024  1.00 0.00 ? 8  ARG A CA   3  
ATOM 2296  C C    . ARG A 1 8  ? -8.387  16.398  -7.364  1.00 0.00 ? 8  ARG A C    3  
ATOM 2297  O O    . ARG A 1 8  ? -9.115  15.579  -6.802  1.00 0.00 ? 8  ARG A O    3  
ATOM 2298  C CB   . ARG A 1 8  ? -10.491 17.503  -8.145  1.00 0.00 ? 8  ARG A CB   3  
ATOM 2299  C CG   . ARG A 1 8  ? -10.928 16.334  -9.011  1.00 0.00 ? 8  ARG A CG   3  
ATOM 2300  C CD   . ARG A 1 8  ? -12.386 16.460  -9.424  1.00 0.00 ? 8  ARG A CD   3  
ATOM 2301  N NE   . ARG A 1 8  ? -13.295 16.106  -8.337  1.00 0.00 ? 8  ARG A NE   3  
ATOM 2302  C CZ   . ARG A 1 8  ? -14.613 16.259  -8.403  1.00 0.00 ? 8  ARG A CZ   3  
ATOM 2303  N NH1  . ARG A 1 8  ? -15.173 16.757  -9.496  1.00 0.00 ? 8  ARG A NH1  3  
ATOM 2304  N NH2  . ARG A 1 8  ? -15.374 15.913  -7.372  1.00 0.00 ? 8  ARG A NH2  3  
ATOM 2305  H H    . ARG A 1 8  ? -8.682  17.321  -10.095 1.00 0.00 ? 8  ARG A H    3  
ATOM 2306  H HA   . ARG A 1 8  ? -8.746  18.502  -7.410  1.00 0.00 ? 8  ARG A HA   3  
ATOM 2307  H HB2  . ARG A 1 8  ? -10.908 17.367  -7.158  1.00 0.00 ? 8  ARG A HB2  3  
ATOM 2308  H HB3  . ARG A 1 8  ? -10.891 18.410  -8.574  1.00 0.00 ? 8  ARG A HB3  3  
ATOM 2309  H HG2  . ARG A 1 8  ? -10.315 16.307  -9.900  1.00 0.00 ? 8  ARG A HG2  3  
ATOM 2310  H HG3  . ARG A 1 8  ? -10.799 15.418  -8.454  1.00 0.00 ? 8  ARG A HG3  3  
ATOM 2311  H HD2  . ARG A 1 8  ? -12.575 17.481  -9.720  1.00 0.00 ? 8  ARG A HD2  3  
ATOM 2312  H HD3  . ARG A 1 8  ? -12.567 15.804  -10.262 1.00 0.00 ? 8  ARG A HD3  3  
ATOM 2313  H HE   . ARG A 1 8  ? -12.903 15.736  -7.520  1.00 0.00 ? 8  ARG A HE   3  
ATOM 2314  H HH11 . ARG A 1 8  ? -14.602 17.018  -10.275 1.00 0.00 ? 8  ARG A HH11 3  
ATOM 2315  H HH12 . ARG A 1 8  ? -16.165 16.871  -9.543  1.00 0.00 ? 8  ARG A HH12 3  
ATOM 2316  H HH21 . ARG A 1 8  ? -14.956 15.537  -6.546  1.00 0.00 ? 8  ARG A HH21 3  
ATOM 2317  H HH22 . ARG A 1 8  ? -16.366 16.029  -7.422  1.00 0.00 ? 8  ARG A HH22 3  
ATOM 2318  N N    . LYS A 1 9  ? -7.067  16.262  -7.435  1.00 0.00 ? 9  LYS A N    3  
ATOM 2319  C CA   . LYS A 1 9  ? -6.383  15.118  -6.845  1.00 0.00 ? 9  LYS A CA   3  
ATOM 2320  C C    . LYS A 1 9  ? -5.363  15.571  -5.805  1.00 0.00 ? 9  LYS A C    3  
ATOM 2321  O O    . LYS A 1 9  ? -4.825  16.677  -5.870  1.00 0.00 ? 9  LYS A O    3  
ATOM 2322  C CB   . LYS A 1 9  ? -5.687  14.296  -7.933  1.00 0.00 ? 9  LYS A CB   3  
ATOM 2323  C CG   . LYS A 1 9  ? -4.582  15.050  -8.651  1.00 0.00 ? 9  LYS A CG   3  
ATOM 2324  C CD   . LYS A 1 9  ? -4.303  14.459  -10.023 1.00 0.00 ? 9  LYS A CD   3  
ATOM 2325  C CE   . LYS A 1 9  ? -5.291  14.970  -11.060 1.00 0.00 ? 9  LYS A CE   3  
ATOM 2326  N NZ   . LYS A 1 9  ? -4.846  16.257  -11.663 1.00 0.00 ? 9  LYS A NZ   3  
ATOM 2327  H H    . LYS A 1 9  ? -6.540  16.948  -7.897  1.00 0.00 ? 9  LYS A H    3  
ATOM 2328  H HA   . LYS A 1 9  ? -7.124  14.502  -6.359  1.00 0.00 ? 9  LYS A HA   3  
ATOM 2329  H HB2  . LYS A 1 9  ? -5.259  13.413  -7.481  1.00 0.00 ? 9  LYS A HB2  3  
ATOM 2330  H HB3  . LYS A 1 9  ? -6.423  13.995  -8.665  1.00 0.00 ? 9  LYS A HB3  3  
ATOM 2331  H HG2  . LYS A 1 9  ? -4.879  16.081  -8.769  1.00 0.00 ? 9  LYS A HG2  3  
ATOM 2332  H HG3  . LYS A 1 9  ? -3.680  14.999  -8.057  1.00 0.00 ? 9  LYS A HG3  3  
ATOM 2333  H HD2  . LYS A 1 9  ? -3.304  14.733  -10.328 1.00 0.00 ? 9  LYS A HD2  3  
ATOM 2334  H HD3  . LYS A 1 9  ? -4.381  13.382  -9.964  1.00 0.00 ? 9  LYS A HD3  3  
ATOM 2335  H HE2  . LYS A 1 9  ? -5.387  14.231  -11.841 1.00 0.00 ? 9  LYS A HE2  3  
ATOM 2336  H HE3  . LYS A 1 9  ? -6.249  15.117  -10.584 1.00 0.00 ? 9  LYS A HE3  3  
ATOM 2337  H HZ1  . LYS A 1 9  ? -4.071  16.087  -12.336 1.00 0.00 ? 9  LYS A HZ1  3  
ATOM 2338  H HZ2  . LYS A 1 9  ? -4.509  16.902  -10.920 1.00 0.00 ? 9  LYS A HZ2  3  
ATOM 2339  H HZ3  . LYS A 1 9  ? -5.636  16.708  -12.166 1.00 0.00 ? 9  LYS A HZ3  3  
ATOM 2340  N N    . PRO A 1 10 ? -5.088  14.699  -4.824  1.00 0.00 ? 10 PRO A N    3  
ATOM 2341  C CA   . PRO A 1 10 ? -4.130  14.988  -3.754  1.00 0.00 ? 10 PRO A CA   3  
ATOM 2342  C C    . PRO A 1 10 ? -2.691  15.023  -4.258  1.00 0.00 ? 10 PRO A C    3  
ATOM 2343  O O    . PRO A 1 10 ? -1.766  15.326  -3.504  1.00 0.00 ? 10 PRO A O    3  
ATOM 2344  C CB   . PRO A 1 10 ? -4.326  13.824  -2.778  1.00 0.00 ? 10 PRO A CB   3  
ATOM 2345  C CG   . PRO A 1 10 ? -4.858  12.713  -3.617  1.00 0.00 ? 10 PRO A CG   3  
ATOM 2346  C CD   . PRO A 1 10 ? -5.693  13.363  -4.685  1.00 0.00 ? 10 PRO A CD   3  
ATOM 2347  H HA   . PRO A 1 10 ? -4.359  15.919  -3.256  1.00 0.00 ? 10 PRO A HA   3  
ATOM 2348  H HB2  . PRO A 1 10 ? -3.377  13.563  -2.330  1.00 0.00 ? 10 PRO A HB2  3  
ATOM 2349  H HB3  . PRO A 1 10 ? -5.028  14.109  -2.009  1.00 0.00 ? 10 PRO A HB3  3  
ATOM 2350  H HG2  . PRO A 1 10 ? -4.041  12.165  -4.061  1.00 0.00 ? 10 PRO A HG2  3  
ATOM 2351  H HG3  . PRO A 1 10 ? -5.467  12.057  -3.012  1.00 0.00 ? 10 PRO A HG3  3  
ATOM 2352  H HD2  . PRO A 1 10 ? -5.621  12.809  -5.609  1.00 0.00 ? 10 PRO A HD2  3  
ATOM 2353  H HD3  . PRO A 1 10 ? -6.722  13.438  -4.366  1.00 0.00 ? 10 PRO A HD3  3  
ATOM 2354  N N    . ARG A 1 11 ? -2.509  14.712  -5.537  1.00 0.00 ? 11 ARG A N    3  
ATOM 2355  C CA   . ARG A 1 11 ? -1.183  14.708  -6.141  1.00 0.00 ? 11 ARG A CA   3  
ATOM 2356  C C    . ARG A 1 11 ? -0.309  13.617  -5.528  1.00 0.00 ? 11 ARG A C    3  
ATOM 2357  O O    . ARG A 1 11 ? 0.824   13.871  -5.118  1.00 0.00 ? 11 ARG A O    3  
ATOM 2358  C CB   . ARG A 1 11 ? -0.514  16.072  -5.964  1.00 0.00 ? 11 ARG A CB   3  
ATOM 2359  C CG   . ARG A 1 11 ? 0.666   16.297  -6.895  1.00 0.00 ? 11 ARG A CG   3  
ATOM 2360  C CD   . ARG A 1 11 ? 1.006   17.775  -7.016  1.00 0.00 ? 11 ARG A CD   3  
ATOM 2361  N NE   . ARG A 1 11 ? 2.035   18.019  -8.023  1.00 0.00 ? 11 ARG A NE   3  
ATOM 2362  C CZ   . ARG A 1 11 ? 2.610   19.201  -8.214  1.00 0.00 ? 11 ARG A CZ   3  
ATOM 2363  N NH1  . ARG A 1 11 ? 2.258   20.241  -7.471  1.00 0.00 ? 11 ARG A NH1  3  
ATOM 2364  N NH2  . ARG A 1 11 ? 3.539   19.345  -9.150  1.00 0.00 ? 11 ARG A NH2  3  
ATOM 2365  H H    . ARG A 1 11 ? -3.286  14.479  -6.088  1.00 0.00 ? 11 ARG A H    3  
ATOM 2366  H HA   . ARG A 1 11 ? -1.299  14.508  -7.196  1.00 0.00 ? 11 ARG A HA   3  
ATOM 2367  H HB2  . ARG A 1 11 ? -1.244  16.845  -6.150  1.00 0.00 ? 11 ARG A HB2  3  
ATOM 2368  H HB3  . ARG A 1 11 ? -0.163  16.157  -4.947  1.00 0.00 ? 11 ARG A HB3  3  
ATOM 2369  H HG2  . ARG A 1 11 ? 1.526   15.772  -6.506  1.00 0.00 ? 11 ARG A HG2  3  
ATOM 2370  H HG3  . ARG A 1 11 ? 0.419   15.913  -7.874  1.00 0.00 ? 11 ARG A HG3  3  
ATOM 2371  H HD2  . ARG A 1 11 ? 0.112   18.315  -7.290  1.00 0.00 ? 11 ARG A HD2  3  
ATOM 2372  H HD3  . ARG A 1 11 ? 1.360   18.128  -6.059  1.00 0.00 ? 11 ARG A HD3  3  
ATOM 2373  H HE   . ARG A 1 11 ? 2.310   17.265  -8.583  1.00 0.00 ? 11 ARG A HE   3  
ATOM 2374  H HH11 . ARG A 1 11 ? 1.559   20.136  -6.763  1.00 0.00 ? 11 ARG A HH11 3  
ATOM 2375  H HH12 . ARG A 1 11 ? 2.694   21.130  -7.616  1.00 0.00 ? 11 ARG A HH12 3  
ATOM 2376  H HH21 . ARG A 1 11 ? 3.807   18.563  -9.713  1.00 0.00 ? 11 ARG A HH21 3  
ATOM 2377  H HH22 . ARG A 1 11 ? 3.971   20.235  -9.294  1.00 0.00 ? 11 ARG A HH22 3  
ATOM 2378  N N    . THR A 1 12 ? -0.844  12.402  -5.467  1.00 0.00 ? 12 THR A N    3  
ATOM 2379  C CA   . THR A 1 12 ? -0.116  11.273  -4.902  1.00 0.00 ? 12 THR A CA   3  
ATOM 2380  C C    . THR A 1 12 ? -0.349  10.005  -5.716  1.00 0.00 ? 12 THR A C    3  
ATOM 2381  O O    . THR A 1 12 ? -1.397  9.842   -6.342  1.00 0.00 ? 12 THR A O    3  
ATOM 2382  C CB   . THR A 1 12 ? -0.526  11.014  -3.440  1.00 0.00 ? 12 THR A CB   3  
ATOM 2383  O OG1  . THR A 1 12 ? -0.418  12.222  -2.680  1.00 0.00 ? 12 THR A OG1  3  
ATOM 2384  C CG2  . THR A 1 12 ? 0.347   9.936   -2.816  1.00 0.00 ? 12 THR A CG2  3  
ATOM 2385  H H    . THR A 1 12 ? -1.752  12.262  -5.810  1.00 0.00 ? 12 THR A H    3  
ATOM 2386  H HA   . THR A 1 12 ? 0.938   11.513  -4.921  1.00 0.00 ? 12 THR A HA   3  
ATOM 2387  H HB   . THR A 1 12 ? -1.553  10.678  -3.425  1.00 0.00 ? 12 THR A HB   3  
ATOM 2388  H HG1  . THR A 1 12 ? -1.130  12.260  -2.037  1.00 0.00 ? 12 THR A HG1  3  
ATOM 2389  H HG21 . THR A 1 12 ? 1.347   10.319  -2.677  1.00 0.00 ? 12 THR A HG21 3  
ATOM 2390  H HG22 . THR A 1 12 ? 0.378   9.076   -3.468  1.00 0.00 ? 12 THR A HG22 3  
ATOM 2391  H HG23 . THR A 1 12 ? -0.064  9.649   -1.860  1.00 0.00 ? 12 THR A HG23 3  
ATOM 2392  N N    . ILE A 1 13 ? 0.633   9.110   -5.703  1.00 0.00 ? 13 ILE A N    3  
ATOM 2393  C CA   . ILE A 1 13 ? 0.533   7.856   -6.438  1.00 0.00 ? 13 ILE A CA   3  
ATOM 2394  C C    . ILE A 1 13 ? -0.760  7.122   -6.100  1.00 0.00 ? 13 ILE A C    3  
ATOM 2395  O O    . ILE A 1 13 ? -1.177  6.213   -6.818  1.00 0.00 ? 13 ILE A O    3  
ATOM 2396  C CB   . ILE A 1 13 ? 1.728   6.931   -6.141  1.00 0.00 ? 13 ILE A CB   3  
ATOM 2397  C CG1  . ILE A 1 13 ? 3.045   7.657   -6.424  1.00 0.00 ? 13 ILE A CG1  3  
ATOM 2398  C CG2  . ILE A 1 13 ? 1.630   5.657   -6.966  1.00 0.00 ? 13 ILE A CG2  3  
ATOM 2399  C CD1  . ILE A 1 13 ? 3.255   7.978   -7.887  1.00 0.00 ? 13 ILE A CD1  3  
ATOM 2400  H H    . ILE A 1 13 ? 1.444   9.297   -5.185  1.00 0.00 ? 13 ILE A H    3  
ATOM 2401  H HA   . ILE A 1 13 ? 0.536   8.088   -7.494  1.00 0.00 ? 13 ILE A HA   3  
ATOM 2402  H HB   . ILE A 1 13 ? 1.692   6.659   -5.097  1.00 0.00 ? 13 ILE A HB   3  
ATOM 2403  H HG12 . ILE A 1 13 ? 3.062   8.585   -5.876  1.00 0.00 ? 13 ILE A HG12 3  
ATOM 2404  H HG13 . ILE A 1 13 ? 3.866   7.036   -6.098  1.00 0.00 ? 13 ILE A HG13 3  
ATOM 2405  H HG21 . ILE A 1 13 ? 1.342   4.835   -6.328  1.00 0.00 ? 13 ILE A HG21 3  
ATOM 2406  H HG22 . ILE A 1 13 ? 0.890   5.787   -7.741  1.00 0.00 ? 13 ILE A HG22 3  
ATOM 2407  H HG23 . ILE A 1 13 ? 2.589   5.445   -7.416  1.00 0.00 ? 13 ILE A HG23 3  
ATOM 2408  H HD11 . ILE A 1 13 ? 2.789   7.216   -8.494  1.00 0.00 ? 13 ILE A HD11 3  
ATOM 2409  H HD12 . ILE A 1 13 ? 2.816   8.938   -8.112  1.00 0.00 ? 13 ILE A HD12 3  
ATOM 2410  H HD13 . ILE A 1 13 ? 4.314   8.008   -8.100  1.00 0.00 ? 13 ILE A HD13 3  
ATOM 2411  N N    . TYR A 1 14 ? -1.391  7.523   -5.002  1.00 0.00 ? 14 TYR A N    3  
ATOM 2412  C CA   . TYR A 1 14 ? -2.637  6.903   -4.567  1.00 0.00 ? 14 TYR A CA   3  
ATOM 2413  C C    . TYR A 1 14 ? -3.613  7.951   -4.040  1.00 0.00 ? 14 TYR A C    3  
ATOM 2414  O O    . TYR A 1 14 ? -3.205  8.971   -3.484  1.00 0.00 ? 14 TYR A O    3  
ATOM 2415  C CB   . TYR A 1 14 ? -2.361  5.858   -3.485  1.00 0.00 ? 14 TYR A CB   3  
ATOM 2416  C CG   . TYR A 1 14 ? -1.801  4.561   -4.025  1.00 0.00 ? 14 TYR A CG   3  
ATOM 2417  C CD1  . TYR A 1 14 ? -0.448  4.434   -4.316  1.00 0.00 ? 14 TYR A CD1  3  
ATOM 2418  C CD2  . TYR A 1 14 ? -2.624  3.463   -4.242  1.00 0.00 ? 14 TYR A CD2  3  
ATOM 2419  C CE1  . TYR A 1 14 ? 0.068   3.251   -4.810  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 2420  C CE2  . TYR A 1 14 ? -2.116  2.276   -4.735  1.00 0.00 ? 14 TYR A CE2  3  
ATOM 2421  C CZ   . TYR A 1 14 ? -0.770  2.175   -5.017  1.00 0.00 ? 14 TYR A CZ   3  
ATOM 2422  O OH   . TYR A 1 14 ? -0.260  0.995   -5.508  1.00 0.00 ? 14 TYR A OH   3  
ATOM 2423  H H    . TYR A 1 14 ? -1.010  8.252   -4.470  1.00 0.00 ? 14 TYR A H    3  
ATOM 2424  H HA   . TYR A 1 14 ? -3.080  6.413   -5.422  1.00 0.00 ? 14 TYR A HA   3  
ATOM 2425  H HB2  . TYR A 1 14 ? -1.648  6.258   -2.781  1.00 0.00 ? 14 TYR A HB2  3  
ATOM 2426  H HB3  . TYR A 1 14 ? -3.282  5.632   -2.968  1.00 0.00 ? 14 TYR A HB3  3  
ATOM 2427  H HD1  . TYR A 1 14 ? 0.206   5.278   -4.152  1.00 0.00 ? 14 TYR A HD1  3  
ATOM 2428  H HD2  . TYR A 1 14 ? -3.678  3.545   -4.020  1.00 0.00 ? 14 TYR A HD2  3  
ATOM 2429  H HE1  . TYR A 1 14 ? 1.122   3.172   -5.031  1.00 0.00 ? 14 TYR A HE1  3  
ATOM 2430  H HE2  . TYR A 1 14 ? -2.772  1.434   -4.897  1.00 0.00 ? 14 TYR A HE2  3  
ATOM 2431  H HH   . TYR A 1 14 ? 0.699   1.017   -5.461  1.00 0.00 ? 14 TYR A HH   3  
ATOM 2432  N N    . SER A 1 15 ? -4.904  7.691   -4.218  1.00 0.00 ? 15 SER A N    3  
ATOM 2433  C CA   . SER A 1 15 ? -5.939  8.613   -3.764  1.00 0.00 ? 15 SER A CA   3  
ATOM 2434  C C    . SER A 1 15 ? -6.044  8.604   -2.242  1.00 0.00 ? 15 SER A C    3  
ATOM 2435  O O    . SER A 1 15 ? -5.731  7.606   -1.592  1.00 0.00 ? 15 SER A O    3  
ATOM 2436  C CB   . SER A 1 15 ? -7.288  8.242   -4.381  1.00 0.00 ? 15 SER A CB   3  
ATOM 2437  O OG   . SER A 1 15 ? -8.243  9.269   -4.176  1.00 0.00 ? 15 SER A OG   3  
ATOM 2438  H H    . SER A 1 15 ? -5.166  6.861   -4.668  1.00 0.00 ? 15 SER A H    3  
ATOM 2439  H HA   . SER A 1 15 ? -5.664  9.605   -4.088  1.00 0.00 ? 15 SER A HA   3  
ATOM 2440  H HB2  . SER A 1 15 ? -7.165  8.088   -5.443  1.00 0.00 ? 15 SER A HB2  3  
ATOM 2441  H HB3  . SER A 1 15 ? -7.652  7.332   -3.926  1.00 0.00 ? 15 SER A HB3  3  
ATOM 2442  H HG   . SER A 1 15 ? -7.791  10.110  -4.073  1.00 0.00 ? 15 SER A HG   3  
ATOM 2443  N N    . SER A 1 16 ? -6.486  9.724   -1.679  1.00 0.00 ? 16 SER A N    3  
ATOM 2444  C CA   . SER A 1 16 ? -6.630  9.848   -0.233  1.00 0.00 ? 16 SER A CA   3  
ATOM 2445  C C    . SER A 1 16 ? -7.588  8.793   0.311   1.00 0.00 ? 16 SER A C    3  
ATOM 2446  O O    . SER A 1 16 ? -7.372  8.236   1.387   1.00 0.00 ? 16 SER A O    3  
ATOM 2447  C CB   . SER A 1 16 ? -7.131  11.246  0.133   1.00 0.00 ? 16 SER A CB   3  
ATOM 2448  O OG   . SER A 1 16 ? -8.359  11.533  -0.514  1.00 0.00 ? 16 SER A OG   3  
ATOM 2449  H H    . SER A 1 16 ? -6.719  10.486  -2.250  1.00 0.00 ? 16 SER A H    3  
ATOM 2450  H HA   . SER A 1 16 ? -5.657  9.696   0.211   1.00 0.00 ? 16 SER A HA   3  
ATOM 2451  H HB2  . SER A 1 16 ? -7.278  11.305  1.201   1.00 0.00 ? 16 SER A HB2  3  
ATOM 2452  H HB3  . SER A 1 16 ? -6.398  11.979  -0.170  1.00 0.00 ? 16 SER A HB3  3  
ATOM 2453  H HG   . SER A 1 16 ? -8.305  11.269  -1.435  1.00 0.00 ? 16 SER A HG   3  
ATOM 2454  N N    . PHE A 1 17 ? -8.650  8.523   -0.442  1.00 0.00 ? 17 PHE A N    3  
ATOM 2455  C CA   . PHE A 1 17 ? -9.644  7.536   -0.037  1.00 0.00 ? 17 PHE A CA   3  
ATOM 2456  C C    . PHE A 1 17 ? -9.034  6.138   0.011   1.00 0.00 ? 17 PHE A C    3  
ATOM 2457  O O    . PHE A 1 17 ? -9.303  5.364   0.929   1.00 0.00 ? 17 PHE A O    3  
ATOM 2458  C CB   . PHE A 1 17 ? -10.832 7.553   -1.000  1.00 0.00 ? 17 PHE A CB   3  
ATOM 2459  C CG   . PHE A 1 17 ? -11.739 6.364   -0.855  1.00 0.00 ? 17 PHE A CG   3  
ATOM 2460  C CD1  . PHE A 1 17 ? -12.436 6.148   0.323   1.00 0.00 ? 17 PHE A CD1  3  
ATOM 2461  C CD2  . PHE A 1 17 ? -11.894 5.463   -1.896  1.00 0.00 ? 17 PHE A CD2  3  
ATOM 2462  C CE1  . PHE A 1 17 ? -13.270 5.055   0.460   1.00 0.00 ? 17 PHE A CE1  3  
ATOM 2463  C CE2  . PHE A 1 17 ? -12.727 4.368   -1.765  1.00 0.00 ? 17 PHE A CE2  3  
ATOM 2464  C CZ   . PHE A 1 17 ? -13.416 4.164   -0.586  1.00 0.00 ? 17 PHE A CZ   3  
ATOM 2465  H H    . PHE A 1 17 ? -8.768  9.000   -1.291  1.00 0.00 ? 17 PHE A H    3  
ATOM 2466  H HA   . PHE A 1 17 ? -9.988  7.800   0.951   1.00 0.00 ? 17 PHE A HA   3  
ATOM 2467  H HB2  . PHE A 1 17 ? -11.420 8.441   -0.820  1.00 0.00 ? 17 PHE A HB2  3  
ATOM 2468  H HB3  . PHE A 1 17 ? -10.464 7.569   -2.015  1.00 0.00 ? 17 PHE A HB3  3  
ATOM 2469  H HD1  . PHE A 1 17 ? -12.324 6.844   1.141   1.00 0.00 ? 17 PHE A HD1  3  
ATOM 2470  H HD2  . PHE A 1 17 ? -11.354 5.622   -2.819  1.00 0.00 ? 17 PHE A HD2  3  
ATOM 2471  H HE1  . PHE A 1 17 ? -13.809 4.897   1.382   1.00 0.00 ? 17 PHE A HE1  3  
ATOM 2472  H HE2  . PHE A 1 17 ? -12.839 3.674   -2.585  1.00 0.00 ? 17 PHE A HE2  3  
ATOM 2473  H HZ   . PHE A 1 17 ? -14.067 3.309   -0.482  1.00 0.00 ? 17 PHE A HZ   3  
ATOM 2474  N N    . GLN A 1 18 ? -8.211  5.824   -0.985  1.00 0.00 ? 18 GLN A N    3  
ATOM 2475  C CA   . GLN A 1 18 ? -7.564  4.519   -1.057  1.00 0.00 ? 18 GLN A CA   3  
ATOM 2476  C C    . GLN A 1 18 ? -6.463  4.399   -0.009  1.00 0.00 ? 18 GLN A C    3  
ATOM 2477  O O    . GLN A 1 18 ? -6.278  3.341   0.594   1.00 0.00 ? 18 GLN A O    3  
ATOM 2478  C CB   . GLN A 1 18 ? -6.982  4.291   -2.453  1.00 0.00 ? 18 GLN A CB   3  
ATOM 2479  C CG   . GLN A 1 18 ? -8.016  4.376   -3.564  1.00 0.00 ? 18 GLN A CG   3  
ATOM 2480  C CD   . GLN A 1 18 ? -7.405  4.222   -4.943  1.00 0.00 ? 18 GLN A CD   3  
ATOM 2481  O OE1  . GLN A 1 18 ? -6.277  4.650   -5.186  1.00 0.00 ? 18 GLN A OE1  3  
ATOM 2482  N NE2  . GLN A 1 18 ? -8.149  3.606   -5.855  1.00 0.00 ? 18 GLN A NE2  3  
ATOM 2483  H H    . GLN A 1 18 ? -8.036  6.483   -1.687  1.00 0.00 ? 18 GLN A H    3  
ATOM 2484  H HA   . GLN A 1 18 ? -8.313  3.766   -0.862  1.00 0.00 ? 18 GLN A HA   3  
ATOM 2485  H HB2  . GLN A 1 18 ? -6.223  5.036   -2.640  1.00 0.00 ? 18 GLN A HB2  3  
ATOM 2486  H HB3  . GLN A 1 18 ? -6.530  3.311   -2.486  1.00 0.00 ? 18 GLN A HB3  3  
ATOM 2487  H HG2  . GLN A 1 18 ? -8.745  3.592   -3.421  1.00 0.00 ? 18 GLN A HG2  3  
ATOM 2488  H HG3  . GLN A 1 18 ? -8.507  5.337   -3.509  1.00 0.00 ? 18 GLN A HG3  3  
ATOM 2489  H HE21 . GLN A 1 18 ? -9.040  3.292   -5.590  1.00 0.00 ? 18 GLN A HE21 3  
ATOM 2490  H HE22 . GLN A 1 18 ? -7.780  3.494   -6.755  1.00 0.00 ? 18 GLN A HE22 3  
ATOM 2491  N N    . LEU A 1 19 ? -5.734  5.489   0.204   1.00 0.00 ? 19 LEU A N    3  
ATOM 2492  C CA   . LEU A 1 19 ? -4.650  5.506   1.180   1.00 0.00 ? 19 LEU A CA   3  
ATOM 2493  C C    . LEU A 1 19 ? -5.196  5.426   2.602   1.00 0.00 ? 19 LEU A C    3  
ATOM 2494  O O    . LEU A 1 19 ? -4.738  4.618   3.409   1.00 0.00 ? 19 LEU A O    3  
ATOM 2495  C CB   . LEU A 1 19 ? -3.808  6.773   1.015   1.00 0.00 ? 19 LEU A CB   3  
ATOM 2496  C CG   . LEU A 1 19 ? -2.670  6.694   -0.004  1.00 0.00 ? 19 LEU A CG   3  
ATOM 2497  C CD1  . LEU A 1 19 ? -1.896  8.003   -0.041  1.00 0.00 ? 19 LEU A CD1  3  
ATOM 2498  C CD2  . LEU A 1 19 ? -1.743  5.533   0.321   1.00 0.00 ? 19 LEU A CD2  3  
ATOM 2499  H H    . LEU A 1 19 ? -5.929  6.302   -0.307  1.00 0.00 ? 19 LEU A H    3  
ATOM 2500  H HA   . LEU A 1 19 ? -4.027  4.643   0.998   1.00 0.00 ? 19 LEU A HA   3  
ATOM 2501  H HB2  . LEU A 1 19 ? -4.468  7.571   0.712   1.00 0.00 ? 19 LEU A HB2  3  
ATOM 2502  H HB3  . LEU A 1 19 ? -3.377  7.010   1.977   1.00 0.00 ? 19 LEU A HB3  3  
ATOM 2503  H HG   . LEU A 1 19 ? -3.087  6.526   -0.987  1.00 0.00 ? 19 LEU A HG   3  
ATOM 2504  H HD11 . LEU A 1 19 ? -2.572  8.826   0.133   1.00 0.00 ? 19 LEU A HD11 3  
ATOM 2505  H HD12 . LEU A 1 19 ? -1.429  8.118   -1.008  1.00 0.00 ? 19 LEU A HD12 3  
ATOM 2506  H HD13 . LEU A 1 19 ? -1.136  7.993   0.727   1.00 0.00 ? 19 LEU A HD13 3  
ATOM 2507  H HD21 . LEU A 1 19 ? -1.554  5.510   1.384   1.00 0.00 ? 19 LEU A HD21 3  
ATOM 2508  H HD22 . LEU A 1 19 ? -0.809  5.659   -0.207  1.00 0.00 ? 19 LEU A HD22 3  
ATOM 2509  H HD23 . LEU A 1 19 ? -2.207  4.606   0.018   1.00 0.00 ? 19 LEU A HD23 3  
ATOM 2510  N N    . ALA A 1 20 ? -6.179  6.270   2.901   1.00 0.00 ? 20 ALA A N    3  
ATOM 2511  C CA   . ALA A 1 20 ? -6.790  6.292   4.224   1.00 0.00 ? 20 ALA A CA   3  
ATOM 2512  C C    . ALA A 1 20 ? -7.047  4.878   4.734   1.00 0.00 ? 20 ALA A C    3  
ATOM 2513  O O    . ALA A 1 20 ? -6.726  4.552   5.876   1.00 0.00 ? 20 ALA A O    3  
ATOM 2514  C CB   . ALA A 1 20 ? -8.087  7.087   4.192   1.00 0.00 ? 20 ALA A CB   3  
ATOM 2515  H H    . ALA A 1 20 ? -6.501  6.891   2.215   1.00 0.00 ? 20 ALA A H    3  
ATOM 2516  H HA   . ALA A 1 20 ? -6.108  6.789   4.899   1.00 0.00 ? 20 ALA A HA   3  
ATOM 2517  H HB1  . ALA A 1 20 ? -8.874  6.475   3.777   1.00 0.00 ? 20 ALA A HB1  3  
ATOM 2518  H HB2  . ALA A 1 20 ? -8.352  7.383   5.197   1.00 0.00 ? 20 ALA A HB2  3  
ATOM 2519  H HB3  . ALA A 1 20 ? -7.954  7.967   3.581   1.00 0.00 ? 20 ALA A HB3  3  
ATOM 2520  N N    . ALA A 1 21 ? -7.629  4.042   3.879   1.00 0.00 ? 21 ALA A N    3  
ATOM 2521  C CA   . ALA A 1 21 ? -7.927  2.663   4.244   1.00 0.00 ? 21 ALA A CA   3  
ATOM 2522  C C    . ALA A 1 21 ? -6.665  1.807   4.233   1.00 0.00 ? 21 ALA A C    3  
ATOM 2523  O O    . ALA A 1 21 ? -6.448  0.992   5.131   1.00 0.00 ? 21 ALA A O    3  
ATOM 2524  C CB   . ALA A 1 21 ? -8.970  2.082   3.300   1.00 0.00 ? 21 ALA A CB   3  
ATOM 2525  H H    . ALA A 1 21 ? -7.861  4.361   2.983   1.00 0.00 ? 21 ALA A H    3  
ATOM 2526  H HA   . ALA A 1 21 ? -8.342  2.663   5.241   1.00 0.00 ? 21 ALA A HA   3  
ATOM 2527  H HB1  . ALA A 1 21 ? -9.941  2.488   3.543   1.00 0.00 ? 21 ALA A HB1  3  
ATOM 2528  H HB2  . ALA A 1 21 ? -8.716  2.338   2.282   1.00 0.00 ? 21 ALA A HB2  3  
ATOM 2529  H HB3  . ALA A 1 21 ? -8.992  1.007   3.406   1.00 0.00 ? 21 ALA A HB3  3  
ATOM 2530  N N    . LEU A 1 22 ? -5.837  1.995   3.212   1.00 0.00 ? 22 LEU A N    3  
ATOM 2531  C CA   . LEU A 1 22 ? -4.596  1.240   3.084   1.00 0.00 ? 22 LEU A CA   3  
ATOM 2532  C C    . LEU A 1 22 ? -3.718  1.422   4.318   1.00 0.00 ? 22 LEU A C    3  
ATOM 2533  O O    . LEU A 1 22 ? -3.437  0.464   5.038   1.00 0.00 ? 22 LEU A O    3  
ATOM 2534  C CB   . LEU A 1 22 ? -3.834  1.680   1.833   1.00 0.00 ? 22 LEU A CB   3  
ATOM 2535  C CG   . LEU A 1 22 ? -4.355  1.133   0.503   1.00 0.00 ? 22 LEU A CG   3  
ATOM 2536  C CD1  . LEU A 1 22 ? -3.687  1.843   -0.664  1.00 0.00 ? 22 LEU A CD1  3  
ATOM 2537  C CD2  . LEU A 1 22 ? -4.127  -0.369  0.418   1.00 0.00 ? 22 LEU A CD2  3  
ATOM 2538  H H    . LEU A 1 22 ? -6.064  2.658   2.527   1.00 0.00 ? 22 LEU A H    3  
ATOM 2539  H HA   . LEU A 1 22 ? -4.852  0.195   2.991   1.00 0.00 ? 22 LEU A HA   3  
ATOM 2540  H HB2  . LEU A 1 22 ? -3.871  2.757   1.785   1.00 0.00 ? 22 LEU A HB2  3  
ATOM 2541  H HB3  . LEU A 1 22 ? -2.807  1.361   1.943   1.00 0.00 ? 22 LEU A HB3  3  
ATOM 2542  H HG   . LEU A 1 22 ? -5.419  1.315   0.439   1.00 0.00 ? 22 LEU A HG   3  
ATOM 2543  H HD11 . LEU A 1 22 ? -2.870  1.241   -1.031  1.00 0.00 ? 22 LEU A HD11 3  
ATOM 2544  H HD12 . LEU A 1 22 ? -3.310  2.800   -0.335  1.00 0.00 ? 22 LEU A HD12 3  
ATOM 2545  H HD13 . LEU A 1 22 ? -4.408  1.993   -1.454  1.00 0.00 ? 22 LEU A HD13 3  
ATOM 2546  H HD21 . LEU A 1 22 ? -4.923  -0.821  -0.155  1.00 0.00 ? 22 LEU A HD21 3  
ATOM 2547  H HD22 . LEU A 1 22 ? -4.116  -0.789  1.413   1.00 0.00 ? 22 LEU A HD22 3  
ATOM 2548  H HD23 . LEU A 1 22 ? -3.181  -0.562  -0.065  1.00 0.00 ? 22 LEU A HD23 3  
ATOM 2549  N N    . GLN A 1 23 ? -3.290  2.657   4.557   1.00 0.00 ? 23 GLN A N    3  
ATOM 2550  C CA   . GLN A 1 23 ? -2.445  2.965   5.705   1.00 0.00 ? 23 GLN A CA   3  
ATOM 2551  C C    . GLN A 1 23 ? -3.072  2.447   6.995   1.00 0.00 ? 23 GLN A C    3  
ATOM 2552  O O    . GLN A 1 23 ? -2.374  2.191   7.977   1.00 0.00 ? 23 GLN A O    3  
ATOM 2553  C CB   . GLN A 1 23 ? -2.214  4.473   5.805   1.00 0.00 ? 23 GLN A CB   3  
ATOM 2554  C CG   . GLN A 1 23 ? -1.042  4.966   4.972   1.00 0.00 ? 23 GLN A CG   3  
ATOM 2555  C CD   . GLN A 1 23 ? -0.472  6.274   5.483   1.00 0.00 ? 23 GLN A CD   3  
ATOM 2556  O OE1  . GLN A 1 23 ? 0.395   6.288   6.358   1.00 0.00 ? 23 GLN A OE1  3  
ATOM 2557  N NE2  . GLN A 1 23 ? -0.956  7.384   4.938   1.00 0.00 ? 23 GLN A NE2  3  
ATOM 2558  H H    . GLN A 1 23 ? -3.548  3.379   3.946   1.00 0.00 ? 23 GLN A H    3  
ATOM 2559  H HA   . GLN A 1 23 ? -1.495  2.473   5.558   1.00 0.00 ? 23 GLN A HA   3  
ATOM 2560  H HB2  . GLN A 1 23 ? -3.105  4.985   5.472   1.00 0.00 ? 23 GLN A HB2  3  
ATOM 2561  H HB3  . GLN A 1 23 ? -2.026  4.729   6.838   1.00 0.00 ? 23 GLN A HB3  3  
ATOM 2562  H HG2  . GLN A 1 23 ? -0.262  4.219   4.994   1.00 0.00 ? 23 GLN A HG2  3  
ATOM 2563  H HG3  . GLN A 1 23 ? -1.374  5.108   3.955   1.00 0.00 ? 23 GLN A HG3  3  
ATOM 2564  H HE21 . GLN A 1 23 ? -1.646  7.297   4.247   1.00 0.00 ? 23 GLN A HE21 3  
ATOM 2565  H HE22 . GLN A 1 23 ? -0.606  8.244   5.250   1.00 0.00 ? 23 GLN A HE22 3  
ATOM 2566  N N    . ARG A 1 24 ? -4.392  2.296   6.987   1.00 0.00 ? 24 ARG A N    3  
ATOM 2567  C CA   . ARG A 1 24 ? -5.113  1.811   8.158   1.00 0.00 ? 24 ARG A CA   3  
ATOM 2568  C C    . ARG A 1 24 ? -4.986  0.296   8.285   1.00 0.00 ? 24 ARG A C    3  
ATOM 2569  O O    . ARG A 1 24 ? -4.891  -0.239  9.390   1.00 0.00 ? 24 ARG A O    3  
ATOM 2570  C CB   . ARG A 1 24 ? -6.589  2.205   8.075   1.00 0.00 ? 24 ARG A CB   3  
ATOM 2571  C CG   . ARG A 1 24 ? -7.472  1.472   9.071   1.00 0.00 ? 24 ARG A CG   3  
ATOM 2572  C CD   . ARG A 1 24 ? -8.644  2.333   9.515   1.00 0.00 ? 24 ARG A CD   3  
ATOM 2573  N NE   . ARG A 1 24 ? -8.203  3.593   10.109  1.00 0.00 ? 24 ARG A NE   3  
ATOM 2574  C CZ   . ARG A 1 24 ? -8.991  4.378   10.836  1.00 0.00 ? 24 ARG A CZ   3  
ATOM 2575  N NH1  . ARG A 1 24 ? -10.252 4.034   11.058  1.00 0.00 ? 24 ARG A NH1  3  
ATOM 2576  N NH2  . ARG A 1 24 ? -8.517  5.508   11.343  1.00 0.00 ? 24 ARG A NH2  3  
ATOM 2577  H H    . ARG A 1 24 ? -4.894  2.517   6.175   1.00 0.00 ? 24 ARG A H    3  
ATOM 2578  H HA   . ARG A 1 24 ? -4.675  2.271   9.031   1.00 0.00 ? 24 ARG A HA   3  
ATOM 2579  H HB2  . ARG A 1 24 ? -6.677  3.265   8.261   1.00 0.00 ? 24 ARG A HB2  3  
ATOM 2580  H HB3  . ARG A 1 24 ? -6.950  1.991   7.080   1.00 0.00 ? 24 ARG A HB3  3  
ATOM 2581  H HG2  . ARG A 1 24 ? -7.855  0.575   8.607   1.00 0.00 ? 24 ARG A HG2  3  
ATOM 2582  H HG3  . ARG A 1 24 ? -6.881  1.209   9.936   1.00 0.00 ? 24 ARG A HG3  3  
ATOM 2583  H HD2  . ARG A 1 24 ? -9.262  2.549   8.656   1.00 0.00 ? 24 ARG A HD2  3  
ATOM 2584  H HD3  . ARG A 1 24 ? -9.220  1.784   10.245  1.00 0.00 ? 24 ARG A HD3  3  
ATOM 2585  H HE   . ARG A 1 24 ? -7.275  3.866   9.958   1.00 0.00 ? 24 ARG A HE   3  
ATOM 2586  H HH11 . ARG A 1 24 ? -10.612 3.182   10.678  1.00 0.00 ? 24 ARG A HH11 3  
ATOM 2587  H HH12 . ARG A 1 24 ? -10.842 4.626   11.607  1.00 0.00 ? 24 ARG A HH12 3  
ATOM 2588  H HH21 . ARG A 1 24 ? -7.566  5.770   11.178  1.00 0.00 ? 24 ARG A HH21 3  
ATOM 2589  H HH22 . ARG A 1 24 ? -9.110  6.098   11.890  1.00 0.00 ? 24 ARG A HH22 3  
ATOM 2590  N N    . ARG A 1 25 ? -4.986  -0.390  7.147   1.00 0.00 ? 25 ARG A N    3  
ATOM 2591  C CA   . ARG A 1 25 ? -4.874  -1.844  7.130   1.00 0.00 ? 25 ARG A CA   3  
ATOM 2592  C C    . ARG A 1 25 ? -3.429  -2.279  7.359   1.00 0.00 ? 25 ARG A C    3  
ATOM 2593  O O    . ARG A 1 25 ? -3.168  -3.250  8.071   1.00 0.00 ? 25 ARG A O    3  
ATOM 2594  C CB   . ARG A 1 25 ? -5.381  -2.401  5.799   1.00 0.00 ? 25 ARG A CB   3  
ATOM 2595  C CG   . ARG A 1 25 ? -5.489  -3.917  5.775   1.00 0.00 ? 25 ARG A CG   3  
ATOM 2596  C CD   . ARG A 1 25 ? -6.675  -4.403  6.594   1.00 0.00 ? 25 ARG A CD   3  
ATOM 2597  N NE   . ARG A 1 25 ? -7.915  -4.393  5.823   1.00 0.00 ? 25 ARG A NE   3  
ATOM 2598  C CZ   . ARG A 1 25 ? -9.099  -4.715  6.331   1.00 0.00 ? 25 ARG A CZ   3  
ATOM 2599  N NH1  . ARG A 1 25 ? -9.203  -5.071  7.604   1.00 0.00 ? 25 ARG A NH1  3  
ATOM 2600  N NH2  . ARG A 1 25 ? -10.182 -4.681  5.565   1.00 0.00 ? 25 ARG A NH2  3  
ATOM 2601  H H    . ARG A 1 25 ? -5.065  0.092   6.297   1.00 0.00 ? 25 ARG A H    3  
ATOM 2602  H HA   . ARG A 1 25 ? -5.486  -2.233  7.930   1.00 0.00 ? 25 ARG A HA   3  
ATOM 2603  H HB2  . ARG A 1 25 ? -6.359  -1.989  5.599   1.00 0.00 ? 25 ARG A HB2  3  
ATOM 2604  H HB3  . ARG A 1 25 ? -4.704  -2.098  5.015   1.00 0.00 ? 25 ARG A HB3  3  
ATOM 2605  H HG2  . ARG A 1 25 ? -5.614  -4.244  4.753   1.00 0.00 ? 25 ARG A HG2  3  
ATOM 2606  H HG3  . ARG A 1 25 ? -4.583  -4.340  6.182   1.00 0.00 ? 25 ARG A HG3  3  
ATOM 2607  H HD2  . ARG A 1 25 ? -6.477  -5.412  6.925   1.00 0.00 ? 25 ARG A HD2  3  
ATOM 2608  H HD3  . ARG A 1 25 ? -6.790  -3.759  7.453   1.00 0.00 ? 25 ARG A HD3  3  
ATOM 2609  H HE   . ARG A 1 25 ? -7.860  -4.132  4.880   1.00 0.00 ? 25 ARG A HE   3  
ATOM 2610  H HH11 . ARG A 1 25 ? -8.389  -5.097  8.183   1.00 0.00 ? 25 ARG A HH11 3  
ATOM 2611  H HH12 . ARG A 1 25 ? -10.097 -5.313  7.984   1.00 0.00 ? 25 ARG A HH12 3  
ATOM 2612  H HH21 . ARG A 1 25 ? -10.107 -4.413  4.605   1.00 0.00 ? 25 ARG A HH21 3  
ATOM 2613  H HH22 . ARG A 1 25 ? -11.073 -4.924  5.948   1.00 0.00 ? 25 ARG A HH22 3  
ATOM 2614  N N    . PHE A 1 26 ? -2.495  -1.556  6.751   1.00 0.00 ? 26 PHE A N    3  
ATOM 2615  C CA   . PHE A 1 26 ? -1.077  -1.869  6.887   1.00 0.00 ? 26 PHE A CA   3  
ATOM 2616  C C    . PHE A 1 26 ? -0.694  -2.029  8.355   1.00 0.00 ? 26 PHE A C    3  
ATOM 2617  O O    . PHE A 1 26 ? 0.000   -2.976  8.726   1.00 0.00 ? 26 PHE A O    3  
ATOM 2618  C CB   . PHE A 1 26 ? -0.227  -0.771  6.244   1.00 0.00 ? 26 PHE A CB   3  
ATOM 2619  C CG   . PHE A 1 26 ? 1.208   -1.165  6.043   1.00 0.00 ? 26 PHE A CG   3  
ATOM 2620  C CD1  . PHE A 1 26 ? 1.536   -2.277  5.284   1.00 0.00 ? 26 PHE A CD1  3  
ATOM 2621  C CD2  . PHE A 1 26 ? 2.230   -0.423  6.614   1.00 0.00 ? 26 PHE A CD2  3  
ATOM 2622  C CE1  . PHE A 1 26 ? 2.856   -2.641  5.097   1.00 0.00 ? 26 PHE A CE1  3  
ATOM 2623  C CE2  . PHE A 1 26 ? 3.552   -0.782  6.430   1.00 0.00 ? 26 PHE A CE2  3  
ATOM 2624  C CZ   . PHE A 1 26 ? 3.865   -1.894  5.672   1.00 0.00 ? 26 PHE A CZ   3  
ATOM 2625  H H    . PHE A 1 26 ? -2.766  -0.794  6.197   1.00 0.00 ? 26 PHE A H    3  
ATOM 2626  H HA   . PHE A 1 26 ? -0.893  -2.801  6.375   1.00 0.00 ? 26 PHE A HA   3  
ATOM 2627  H HB2  . PHE A 1 26 ? -0.641  -0.525  5.278   1.00 0.00 ? 26 PHE A HB2  3  
ATOM 2628  H HB3  . PHE A 1 26 ? -0.248  0.105   6.874   1.00 0.00 ? 26 PHE A HB3  3  
ATOM 2629  H HD1  . PHE A 1 26 ? 0.747   -2.863  4.835   1.00 0.00 ? 26 PHE A HD1  3  
ATOM 2630  H HD2  . PHE A 1 26 ? 1.987   0.446   7.208   1.00 0.00 ? 26 PHE A HD2  3  
ATOM 2631  H HE1  . PHE A 1 26 ? 3.097   -3.511  4.504   1.00 0.00 ? 26 PHE A HE1  3  
ATOM 2632  H HE2  . PHE A 1 26 ? 4.339   -0.196  6.880   1.00 0.00 ? 26 PHE A HE2  3  
ATOM 2633  H HZ   . PHE A 1 26 ? 4.897   -2.176  5.527   1.00 0.00 ? 26 PHE A HZ   3  
ATOM 2634  N N    . GLN A 1 27 ? -1.151  -1.097  9.185   1.00 0.00 ? 27 GLN A N    3  
ATOM 2635  C CA   . GLN A 1 27 ? -0.855  -1.134  10.612  1.00 0.00 ? 27 GLN A CA   3  
ATOM 2636  C C    . GLN A 1 27 ? -1.277  -2.468  11.221  1.00 0.00 ? 27 GLN A C    3  
ATOM 2637  O O    . GLN A 1 27 ? -0.516  -3.093  11.960  1.00 0.00 ? 27 GLN A O    3  
ATOM 2638  C CB   . GLN A 1 27 ? -1.564  0.015   11.332  1.00 0.00 ? 27 GLN A CB   3  
ATOM 2639  C CG   . GLN A 1 27 ? -1.166  1.390   10.820  1.00 0.00 ? 27 GLN A CG   3  
ATOM 2640  C CD   . GLN A 1 27 ? 0.264   1.752   11.171  1.00 0.00 ? 27 GLN A CD   3  
ATOM 2641  O OE1  . GLN A 1 27 ? 1.106   1.925   10.290  1.00 0.00 ? 27 GLN A OE1  3  
ATOM 2642  N NE2  . GLN A 1 27 ? 0.545   1.870   12.463  1.00 0.00 ? 27 GLN A NE2  3  
ATOM 2643  H H    . GLN A 1 27 ? -1.699  -0.367  8.830   1.00 0.00 ? 27 GLN A H    3  
ATOM 2644  H HA   . GLN A 1 27 ? 0.211   -1.019  10.733  1.00 0.00 ? 27 GLN A HA   3  
ATOM 2645  H HB2  . GLN A 1 27 ? -2.630  -0.099  11.204  1.00 0.00 ? 27 GLN A HB2  3  
ATOM 2646  H HB3  . GLN A 1 27 ? -1.328  -0.036  12.385  1.00 0.00 ? 27 GLN A HB3  3  
ATOM 2647  H HG2  . GLN A 1 27 ? -1.271  1.404   9.746   1.00 0.00 ? 27 GLN A HG2  3  
ATOM 2648  H HG3  . GLN A 1 27 ? -1.826  2.126   11.255  1.00 0.00 ? 27 GLN A HG3  3  
ATOM 2649  H HE21 . GLN A 1 27 ? -0.177  1.716   13.109  1.00 0.00 ? 27 GLN A HE21 3  
ATOM 2650  H HE22 . GLN A 1 27 ? 1.461   2.102   12.719  1.00 0.00 ? 27 GLN A HE22 3  
ATOM 2651  N N    . LYS A 1 28 ? -2.493  -2.898  10.906  1.00 0.00 ? 28 LYS A N    3  
ATOM 2652  C CA   . LYS A 1 28 ? -3.017  -4.158  11.420  1.00 0.00 ? 28 LYS A CA   3  
ATOM 2653  C C    . LYS A 1 28 ? -2.074  -5.312  11.097  1.00 0.00 ? 28 LYS A C    3  
ATOM 2654  O O    . LYS A 1 28 ? -1.694  -6.083  11.979  1.00 0.00 ? 28 LYS A O    3  
ATOM 2655  C CB   . LYS A 1 28 ? -4.402  -4.437  10.831  1.00 0.00 ? 28 LYS A CB   3  
ATOM 2656  C CG   . LYS A 1 28 ? -5.008  -5.749  11.297  1.00 0.00 ? 28 LYS A CG   3  
ATOM 2657  C CD   . LYS A 1 28 ? -5.501  -5.657  12.732  1.00 0.00 ? 28 LYS A CD   3  
ATOM 2658  C CE   . LYS A 1 28 ? -6.902  -5.068  12.803  1.00 0.00 ? 28 LYS A CE   3  
ATOM 2659  N NZ   . LYS A 1 28 ? -7.171  -4.436  14.124  1.00 0.00 ? 28 LYS A NZ   3  
ATOM 2660  H H    . LYS A 1 28 ? -3.053  -2.355  10.312  1.00 0.00 ? 28 LYS A H    3  
ATOM 2661  H HA   . LYS A 1 28 ? -3.103  -4.068  12.493  1.00 0.00 ? 28 LYS A HA   3  
ATOM 2662  H HB2  . LYS A 1 28 ? -5.068  -3.636  11.114  1.00 0.00 ? 28 LYS A HB2  3  
ATOM 2663  H HB3  . LYS A 1 28 ? -4.322  -4.464  9.754   1.00 0.00 ? 28 LYS A HB3  3  
ATOM 2664  H HG2  . LYS A 1 28 ? -5.841  -5.998  10.657  1.00 0.00 ? 28 LYS A HG2  3  
ATOM 2665  H HG3  . LYS A 1 28 ? -4.258  -6.525  11.233  1.00 0.00 ? 28 LYS A HG3  3  
ATOM 2666  H HD2  . LYS A 1 28 ? -5.517  -6.647  13.162  1.00 0.00 ? 28 LYS A HD2  3  
ATOM 2667  H HD3  . LYS A 1 28 ? -4.826  -5.028  13.295  1.00 0.00 ? 28 LYS A HD3  3  
ATOM 2668  H HE2  . LYS A 1 28 ? -7.004  -4.322  12.030  1.00 0.00 ? 28 LYS A HE2  3  
ATOM 2669  H HE3  . LYS A 1 28 ? -7.619  -5.858  12.638  1.00 0.00 ? 28 LYS A HE3  3  
ATOM 2670  H HZ1  . LYS A 1 28 ? -7.311  -5.169  14.849  1.00 0.00 ? 28 LYS A HZ1  3  
ATOM 2671  H HZ2  . LYS A 1 28 ? -8.028  -3.849  14.072  1.00 0.00 ? 28 LYS A HZ2  3  
ATOM 2672  H HZ3  . LYS A 1 28 ? -6.369  -3.836  14.404  1.00 0.00 ? 28 LYS A HZ3  3  
ATOM 2673  N N    . THR A 1 29 ? -1.696  -5.424  9.828   1.00 0.00 ? 29 THR A N    3  
ATOM 2674  C CA   . THR A 1 29 ? -0.796  -6.483  9.388   1.00 0.00 ? 29 THR A CA   3  
ATOM 2675  C C    . THR A 1 29 ? -0.092  -6.104  8.091   1.00 0.00 ? 29 THR A C    3  
ATOM 2676  O O    . THR A 1 29 ? -0.699  -5.521  7.193   1.00 0.00 ? 29 THR A O    3  
ATOM 2677  C CB   . THR A 1 29 ? -1.550  -7.810  9.181   1.00 0.00 ? 29 THR A CB   3  
ATOM 2678  O OG1  . THR A 1 29 ? -0.623  -8.858  8.876   1.00 0.00 ? 29 THR A OG1  3  
ATOM 2679  C CG2  . THR A 1 29 ? -2.568  -7.684  8.057   1.00 0.00 ? 29 THR A CG2  3  
ATOM 2680  H H    . THR A 1 29 ? -2.032  -4.779  9.171   1.00 0.00 ? 29 THR A H    3  
ATOM 2681  H HA   . THR A 1 29 ? -0.055  -6.632  10.160  1.00 0.00 ? 29 THR A HA   3  
ATOM 2682  H HB   . THR A 1 29 ? -2.073  -8.057  10.094  1.00 0.00 ? 29 THR A HB   3  
ATOM 2683  H HG1  . THR A 1 29 ? 0.150   -8.775  9.440   1.00 0.00 ? 29 THR A HG1  3  
ATOM 2684  H HG21 . THR A 1 29 ? -2.099  -7.232  7.196   1.00 0.00 ? 29 THR A HG21 3  
ATOM 2685  H HG22 . THR A 1 29 ? -3.391  -7.067  8.385   1.00 0.00 ? 29 THR A HG22 3  
ATOM 2686  H HG23 . THR A 1 29 ? -2.936  -8.664  7.794   1.00 0.00 ? 29 THR A HG23 3  
ATOM 2687  N N    . GLN A 1 30 ? 1.191   -6.438  8.000   1.00 0.00 ? 30 GLN A N    3  
ATOM 2688  C CA   . GLN A 1 30 ? 1.978   -6.132  6.811   1.00 0.00 ? 30 GLN A CA   3  
ATOM 2689  C C    . GLN A 1 30 ? 1.647   -7.096  5.676   1.00 0.00 ? 30 GLN A C    3  
ATOM 2690  O O    . GLN A 1 30 ? 1.859   -6.786  4.504   1.00 0.00 ? 30 GLN A O    3  
ATOM 2691  C CB   . GLN A 1 30 ? 3.472   -6.195  7.132   1.00 0.00 ? 30 GLN A CB   3  
ATOM 2692  C CG   . GLN A 1 30 ? 4.015   -4.921  7.758   1.00 0.00 ? 30 GLN A CG   3  
ATOM 2693  C CD   . GLN A 1 30 ? 3.558   -4.735  9.192   1.00 0.00 ? 30 GLN A CD   3  
ATOM 2694  O OE1  . GLN A 1 30 ? 3.456   -5.698  9.953   1.00 0.00 ? 30 GLN A OE1  3  
ATOM 2695  N NE2  . GLN A 1 30 ? 3.281   -3.493  9.569   1.00 0.00 ? 30 GLN A NE2  3  
ATOM 2696  H H    . GLN A 1 30 ? 1.619   -6.901  8.750   1.00 0.00 ? 30 GLN A H    3  
ATOM 2697  H HA   . GLN A 1 30 ? 1.728   -5.129  6.499   1.00 0.00 ? 30 GLN A HA   3  
ATOM 2698  H HB2  . GLN A 1 30 ? 3.646   -7.011  7.817   1.00 0.00 ? 30 GLN A HB2  3  
ATOM 2699  H HB3  . GLN A 1 30 ? 4.016   -6.381  6.218   1.00 0.00 ? 30 GLN A HB3  3  
ATOM 2700  H HG2  . GLN A 1 30 ? 5.094   -4.959  7.743   1.00 0.00 ? 30 GLN A HG2  3  
ATOM 2701  H HG3  . GLN A 1 30 ? 3.676   -4.077  7.176   1.00 0.00 ? 30 GLN A HG3  3  
ATOM 2702  H HE21 . GLN A 1 30 ? 3.384   -2.775  8.908   1.00 0.00 ? 30 GLN A HE21 3  
ATOM 2703  H HE22 . GLN A 1 30 ? 2.983   -3.344  10.489  1.00 0.00 ? 30 GLN A HE22 3  
ATOM 2704  N N    . TYR A 1 31 ? 1.129   -8.265  6.033   1.00 0.00 ? 31 TYR A N    3  
ATOM 2705  C CA   . TYR A 1 31 ? 0.772   -9.276  5.045   1.00 0.00 ? 31 TYR A CA   3  
ATOM 2706  C C    . TYR A 1 31 ? -0.724  -9.572  5.084   1.00 0.00 ? 31 TYR A C    3  
ATOM 2707  O O    . TYR A 1 31 ? -1.286  -9.857  6.142   1.00 0.00 ? 31 TYR A O    3  
ATOM 2708  C CB   . TYR A 1 31 ? 1.564   -10.562 5.290   1.00 0.00 ? 31 TYR A CB   3  
ATOM 2709  C CG   . TYR A 1 31 ? 2.962   -10.530 4.717   1.00 0.00 ? 31 TYR A CG   3  
ATOM 2710  C CD1  . TYR A 1 31 ? 3.866   -9.544  5.091   1.00 0.00 ? 31 TYR A CD1  3  
ATOM 2711  C CD2  . TYR A 1 31 ? 3.380   -11.489 3.802   1.00 0.00 ? 31 TYR A CD2  3  
ATOM 2712  C CE1  . TYR A 1 31 ? 5.144   -9.511  4.569   1.00 0.00 ? 31 TYR A CE1  3  
ATOM 2713  C CE2  . TYR A 1 31 ? 4.658   -11.465 3.275   1.00 0.00 ? 31 TYR A CE2  3  
ATOM 2714  C CZ   . TYR A 1 31 ? 5.536   -10.474 3.662   1.00 0.00 ? 31 TYR A CZ   3  
ATOM 2715  O OH   . TYR A 1 31 ? 6.809   -10.445 3.140   1.00 0.00 ? 31 TYR A OH   3  
ATOM 2716  H H    . TYR A 1 31 ? 0.984   -8.455  6.983   1.00 0.00 ? 31 TYR A H    3  
ATOM 2717  H HA   . TYR A 1 31 ? 1.026   -8.890  4.068   1.00 0.00 ? 31 TYR A HA   3  
ATOM 2718  H HB2  . TYR A 1 31 ? 1.645   -10.728 6.353   1.00 0.00 ? 31 TYR A HB2  3  
ATOM 2719  H HB3  . TYR A 1 31 ? 1.039   -11.391 4.840   1.00 0.00 ? 31 TYR A HB3  3  
ATOM 2720  H HD1  . TYR A 1 31 ? 3.556   -8.791  5.802   1.00 0.00 ? 31 TYR A HD1  3  
ATOM 2721  H HD2  . TYR A 1 31 ? 2.690   -12.264 3.501   1.00 0.00 ? 31 TYR A HD2  3  
ATOM 2722  H HE1  . TYR A 1 31 ? 5.832   -8.735  4.871   1.00 0.00 ? 31 TYR A HE1  3  
ATOM 2723  H HE2  . TYR A 1 31 ? 4.964   -12.218 2.565   1.00 0.00 ? 31 TYR A HE2  3  
ATOM 2724  H HH   . TYR A 1 31 ? 7.374   -9.914  3.706   1.00 0.00 ? 31 TYR A HH   3  
ATOM 2725  N N    . LEU A 1 32 ? -1.365  -9.503  3.922   1.00 0.00 ? 32 LEU A N    3  
ATOM 2726  C CA   . LEU A 1 32 ? -2.796  -9.764  3.820   1.00 0.00 ? 32 LEU A CA   3  
ATOM 2727  C C    . LEU A 1 32 ? -3.059  -11.112 3.157   1.00 0.00 ? 32 LEU A C    3  
ATOM 2728  O O    . LEU A 1 32 ? -2.295  -11.551 2.297   1.00 0.00 ? 32 LEU A O    3  
ATOM 2729  C CB   . LEU A 1 32 ? -3.483  -8.650  3.028   1.00 0.00 ? 32 LEU A CB   3  
ATOM 2730  C CG   . LEU A 1 32 ? -3.216  -7.223  3.508   1.00 0.00 ? 32 LEU A CG   3  
ATOM 2731  C CD1  . LEU A 1 32 ? -3.687  -6.215  2.471   1.00 0.00 ? 32 LEU A CD1  3  
ATOM 2732  C CD2  . LEU A 1 32 ? -3.899  -6.973  4.845   1.00 0.00 ? 32 LEU A CD2  3  
ATOM 2733  H H    . LEU A 1 32 ? -0.864  -9.271  3.112   1.00 0.00 ? 32 LEU A H    3  
ATOM 2734  H HA   . LEU A 1 32 ? -3.201  -9.784  4.822   1.00 0.00 ? 32 LEU A HA   3  
ATOM 2735  H HB2  . LEU A 1 32 ? -3.152  -8.721  2.003   1.00 0.00 ? 32 LEU A HB2  3  
ATOM 2736  H HB3  . LEU A 1 32 ? -4.549  -8.822  3.073   1.00 0.00 ? 32 LEU A HB3  3  
ATOM 2737  H HG   . LEU A 1 32 ? -2.152  -7.088  3.644   1.00 0.00 ? 32 LEU A HG   3  
ATOM 2738  H HD11 . LEU A 1 32 ? -2.938  -5.447  2.349   1.00 0.00 ? 32 LEU A HD11 3  
ATOM 2739  H HD12 . LEU A 1 32 ? -4.613  -5.765  2.800   1.00 0.00 ? 32 LEU A HD12 3  
ATOM 2740  H HD13 . LEU A 1 32 ? -3.847  -6.716  1.528   1.00 0.00 ? 32 LEU A HD13 3  
ATOM 2741  H HD21 . LEU A 1 32 ? -4.799  -6.399  4.687   1.00 0.00 ? 32 LEU A HD21 3  
ATOM 2742  H HD22 . LEU A 1 32 ? -3.230  -6.425  5.493   1.00 0.00 ? 32 LEU A HD22 3  
ATOM 2743  H HD23 . LEU A 1 32 ? -4.149  -7.919  5.303   1.00 0.00 ? 32 LEU A HD23 3  
ATOM 2744  N N    . ALA A 1 33 ? -4.145  -11.763 3.560   1.00 0.00 ? 33 ALA A N    3  
ATOM 2745  C CA   . ALA A 1 33 ? -4.510  -13.058 3.001   1.00 0.00 ? 33 ALA A CA   3  
ATOM 2746  C C    . ALA A 1 33 ? -5.121  -12.905 1.612   1.00 0.00 ? 33 ALA A C    3  
ATOM 2747  O O    . ALA A 1 33 ? -5.168  -11.804 1.062   1.00 0.00 ? 33 ALA A O    3  
ATOM 2748  C CB   . ALA A 1 33 ? -5.478  -13.779 3.928   1.00 0.00 ? 33 ALA A CB   3  
ATOM 2749  H H    . ALA A 1 33 ? -4.715  -11.361 4.249   1.00 0.00 ? 33 ALA A H    3  
ATOM 2750  H HA   . ALA A 1 33 ? -3.612  -13.654 2.925   1.00 0.00 ? 33 ALA A HA   3  
ATOM 2751  H HB1  . ALA A 1 33 ? -6.408  -13.230 3.973   1.00 0.00 ? 33 ALA A HB1  3  
ATOM 2752  H HB2  . ALA A 1 33 ? -5.664  -14.773 3.552   1.00 0.00 ? 33 ALA A HB2  3  
ATOM 2753  H HB3  . ALA A 1 33 ? -5.049  -13.842 4.917   1.00 0.00 ? 33 ALA A HB3  3  
ATOM 2754  N N    . LEU A 1 34 ? -5.586  -14.015 1.050   1.00 0.00 ? 34 LEU A N    3  
ATOM 2755  C CA   . LEU A 1 34 ? -6.194  -14.004 -0.276  1.00 0.00 ? 34 LEU A CA   3  
ATOM 2756  C C    . LEU A 1 34 ? -7.354  -13.015 -0.336  1.00 0.00 ? 34 LEU A C    3  
ATOM 2757  O O    . LEU A 1 34 ? -7.350  -12.062 -1.116  1.00 0.00 ? 34 LEU A O    3  
ATOM 2758  C CB   . LEU A 1 34 ? -6.683  -15.405 -0.646  1.00 0.00 ? 34 LEU A CB   3  
ATOM 2759  C CG   . LEU A 1 34 ? -7.941  -15.469 -1.514  1.00 0.00 ? 34 LEU A CG   3  
ATOM 2760  C CD1  . LEU A 1 34 ? -7.663  -14.905 -2.899  1.00 0.00 ? 34 LEU A CD1  3  
ATOM 2761  C CD2  . LEU A 1 34 ? -8.450  -16.900 -1.611  1.00 0.00 ? 34 LEU A CD2  3  
ATOM 2762  H H    . LEU A 1 34 ? -5.521  -14.862 1.537   1.00 0.00 ? 34 LEU A H    3  
ATOM 2763  H HA   . LEU A 1 34 ? -5.438  -13.697 -0.984  1.00 0.00 ? 34 LEU A HA   3  
ATOM 2764  H HB2  . LEU A 1 34 ? -5.888  -15.903 -1.180  1.00 0.00 ? 34 LEU A HB2  3  
ATOM 2765  H HB3  . LEU A 1 34 ? -6.887  -15.936 0.272   1.00 0.00 ? 34 LEU A HB3  3  
ATOM 2766  H HG   . LEU A 1 34 ? -8.716  -14.867 -1.059  1.00 0.00 ? 34 LEU A HG   3  
ATOM 2767  H HD11 . LEU A 1 34 ? -8.014  -13.886 -2.949  1.00 0.00 ? 34 LEU A HD11 3  
ATOM 2768  H HD12 . LEU A 1 34 ? -8.178  -15.500 -3.639  1.00 0.00 ? 34 LEU A HD12 3  
ATOM 2769  H HD13 . LEU A 1 34 ? -6.601  -14.931 -3.092  1.00 0.00 ? 34 LEU A HD13 3  
ATOM 2770  H HD21 . LEU A 1 34 ? -7.870  -17.532 -0.954  1.00 0.00 ? 34 LEU A HD21 3  
ATOM 2771  H HD22 . LEU A 1 34 ? -8.350  -17.249 -2.628  1.00 0.00 ? 34 LEU A HD22 3  
ATOM 2772  H HD23 . LEU A 1 34 ? -9.489  -16.933 -1.319  1.00 0.00 ? 34 LEU A HD23 3  
ATOM 2773  N N    . PRO A 1 35 ? -8.370  -13.244 0.508   1.00 0.00 ? 35 PRO A N    3  
ATOM 2774  C CA   . PRO A 1 35 ? -9.555  -12.382 0.573   1.00 0.00 ? 35 PRO A CA   3  
ATOM 2775  C C    . PRO A 1 35 ? -9.243  -11.012 1.164   1.00 0.00 ? 35 PRO A C    3  
ATOM 2776  O O    . PRO A 1 35 ? -9.653  -9.985  0.623   1.00 0.00 ? 35 PRO A O    3  
ATOM 2777  C CB   . PRO A 1 35 ? -10.507 -13.156 1.488   1.00 0.00 ? 35 PRO A CB   3  
ATOM 2778  C CG   . PRO A 1 35 ? -9.617  -14.001 2.332   1.00 0.00 ? 35 PRO A CG   3  
ATOM 2779  C CD   . PRO A 1 35 ? -8.442  -14.361 1.465   1.00 0.00 ? 35 PRO A CD   3  
ATOM 2780  H HA   . PRO A 1 35 ? -10.009 -12.259 -0.400  1.00 0.00 ? 35 PRO A HA   3  
ATOM 2781  H HB2  . PRO A 1 35 ? -11.078 -12.461 2.087   1.00 0.00 ? 35 PRO A HB2  3  
ATOM 2782  H HB3  . PRO A 1 35 ? -11.175 -13.759 0.892   1.00 0.00 ? 35 PRO A HB3  3  
ATOM 2783  H HG2  . PRO A 1 35 ? -9.289  -13.442 3.195   1.00 0.00 ? 35 PRO A HG2  3  
ATOM 2784  H HG3  . PRO A 1 35 ? -10.142 -14.894 2.640   1.00 0.00 ? 35 PRO A HG3  3  
ATOM 2785  H HD2  . PRO A 1 35 ? -7.541  -14.420 2.057   1.00 0.00 ? 35 PRO A HD2  3  
ATOM 2786  H HD3  . PRO A 1 35 ? -8.622  -15.295 0.954   1.00 0.00 ? 35 PRO A HD3  3  
ATOM 2787  N N    . GLU A 1 36 ? -8.516  -11.004 2.277   1.00 0.00 ? 36 GLU A N    3  
ATOM 2788  C CA   . GLU A 1 36 ? -8.151  -9.758  2.941   1.00 0.00 ? 36 GLU A CA   3  
ATOM 2789  C C    . GLU A 1 36 ? -7.534  -8.774  1.951   1.00 0.00 ? 36 GLU A C    3  
ATOM 2790  O O    . GLU A 1 36 ? -7.838  -7.582  1.974   1.00 0.00 ? 36 GLU A O    3  
ATOM 2791  C CB   . GLU A 1 36 ? -7.170  -10.032 4.083   1.00 0.00 ? 36 GLU A CB   3  
ATOM 2792  C CG   . GLU A 1 36 ? -7.849  -10.317 5.413   1.00 0.00 ? 36 GLU A CG   3  
ATOM 2793  C CD   . GLU A 1 36 ? -8.747  -11.537 5.359   1.00 0.00 ? 36 GLU A CD   3  
ATOM 2794  O OE1  . GLU A 1 36 ? -8.215  -12.667 5.380   1.00 0.00 ? 36 GLU A OE1  3  
ATOM 2795  O OE2  . GLU A 1 36 ? -9.982  -11.363 5.296   1.00 0.00 ? 36 GLU A OE2  3  
ATOM 2796  H H    . GLU A 1 36 ? -8.220  -11.855 2.661   1.00 0.00 ? 36 GLU A H    3  
ATOM 2797  H HA   . GLU A 1 36 ? -9.051  -9.323  3.349   1.00 0.00 ? 36 GLU A HA   3  
ATOM 2798  H HB2  . GLU A 1 36 ? -6.561  -10.885 3.822   1.00 0.00 ? 36 GLU A HB2  3  
ATOM 2799  H HB3  . GLU A 1 36 ? -6.532  -9.170  4.207   1.00 0.00 ? 36 GLU A HB3  3  
ATOM 2800  H HG2  . GLU A 1 36 ? -7.089  -10.482 6.162   1.00 0.00 ? 36 GLU A HG2  3  
ATOM 2801  H HG3  . GLU A 1 36 ? -8.445  -9.461  5.689   1.00 0.00 ? 36 GLU A HG3  3  
ATOM 2802  N N    . ARG A 1 37 ? -6.666  -9.283  1.083   1.00 0.00 ? 37 ARG A N    3  
ATOM 2803  C CA   . ARG A 1 37 ? -6.005  -8.450  0.086   1.00 0.00 ? 37 ARG A CA   3  
ATOM 2804  C C    . ARG A 1 37 ? -7.000  -7.966  -0.964  1.00 0.00 ? 37 ARG A C    3  
ATOM 2805  O O    . ARG A 1 37 ? -6.959  -6.811  -1.386  1.00 0.00 ? 37 ARG A O    3  
ATOM 2806  C CB   . ARG A 1 37 ? -4.872  -9.227  -0.588  1.00 0.00 ? 37 ARG A CB   3  
ATOM 2807  C CG   . ARG A 1 37 ? -4.316  -8.541  -1.825  1.00 0.00 ? 37 ARG A CG   3  
ATOM 2808  C CD   . ARG A 1 37 ? -3.113  -9.286  -2.382  1.00 0.00 ? 37 ARG A CD   3  
ATOM 2809  N NE   . ARG A 1 37 ? -3.210  -10.726 -2.159  1.00 0.00 ? 37 ARG A NE   3  
ATOM 2810  C CZ   . ARG A 1 37 ? -3.949  -11.537 -2.907  1.00 0.00 ? 37 ARG A CZ   3  
ATOM 2811  N NH1  . ARG A 1 37 ? -4.652  -11.052 -3.921  1.00 0.00 ? 37 ARG A NH1  3  
ATOM 2812  N NH2  . ARG A 1 37 ? -3.986  -12.837 -2.641  1.00 0.00 ? 37 ARG A NH2  3  
ATOM 2813  H H    . ARG A 1 37 ? -6.465  -10.242 1.115   1.00 0.00 ? 37 ARG A H    3  
ATOM 2814  H HA   . ARG A 1 37 ? -5.589  -7.593  0.594   1.00 0.00 ? 37 ARG A HA   3  
ATOM 2815  H HB2  . ARG A 1 37 ? -4.066  -9.353  0.120   1.00 0.00 ? 37 ARG A HB2  3  
ATOM 2816  H HB3  . ARG A 1 37 ? -5.242  -10.199 -0.877  1.00 0.00 ? 37 ARG A HB3  3  
ATOM 2817  H HG2  . ARG A 1 37 ? -5.085  -8.506  -2.583  1.00 0.00 ? 37 ARG A HG2  3  
ATOM 2818  H HG3  . ARG A 1 37 ? -4.018  -7.536  -1.565  1.00 0.00 ? 37 ARG A HG3  3  
ATOM 2819  H HD2  . ARG A 1 37 ? -3.050  -9.099  -3.443  1.00 0.00 ? 37 ARG A HD2  3  
ATOM 2820  H HD3  . ARG A 1 37 ? -2.222  -8.915  -1.897  1.00 0.00 ? 37 ARG A HD3  3  
ATOM 2821  H HE   . ARG A 1 37 ? -2.698  -11.106 -1.415  1.00 0.00 ? 37 ARG A HE   3  
ATOM 2822  H HH11 . ARG A 1 37 ? -4.626  -10.074 -4.124  1.00 0.00 ? 37 ARG A HH11 3  
ATOM 2823  H HH12 . ARG A 1 37 ? -5.208  -11.665 -4.483  1.00 0.00 ? 37 ARG A HH12 3  
ATOM 2824  H HH21 . ARG A 1 37 ? -3.457  -13.206 -1.878  1.00 0.00 ? 37 ARG A HH21 3  
ATOM 2825  H HH22 . ARG A 1 37 ? -4.543  -13.446 -3.205  1.00 0.00 ? 37 ARG A HH22 3  
ATOM 2826  N N    . ALA A 1 38 ? -7.892  -8.858  -1.382  1.00 0.00 ? 38 ALA A N    3  
ATOM 2827  C CA   . ALA A 1 38 ? -8.898  -8.521  -2.381  1.00 0.00 ? 38 ALA A CA   3  
ATOM 2828  C C    . ALA A 1 38 ? -9.867  -7.468  -1.853  1.00 0.00 ? 38 ALA A C    3  
ATOM 2829  O O    . ALA A 1 38 ? -10.326 -6.605  -2.599  1.00 0.00 ? 38 ALA A O    3  
ATOM 2830  C CB   . ALA A 1 38 ? -9.655  -9.770  -2.809  1.00 0.00 ? 38 ALA A CB   3  
ATOM 2831  H H    . ALA A 1 38 ? -7.874  -9.763  -1.008  1.00 0.00 ? 38 ALA A H    3  
ATOM 2832  H HA   . ALA A 1 38 ? -8.389  -8.124  -3.248  1.00 0.00 ? 38 ALA A HA   3  
ATOM 2833  H HB1  . ALA A 1 38 ? -9.720  -10.454 -1.976  1.00 0.00 ? 38 ALA A HB1  3  
ATOM 2834  H HB2  . ALA A 1 38 ? -10.650 -9.496  -3.128  1.00 0.00 ? 38 ALA A HB2  3  
ATOM 2835  H HB3  . ALA A 1 38 ? -9.133  -10.245 -3.626  1.00 0.00 ? 38 ALA A HB3  3  
ATOM 2836  N N    . GLU A 1 39 ? -10.172 -7.547  -0.561  1.00 0.00 ? 39 GLU A N    3  
ATOM 2837  C CA   . GLU A 1 39 ? -11.088 -6.601  0.065   1.00 0.00 ? 39 GLU A CA   3  
ATOM 2838  C C    . GLU A 1 39 ? -10.700 -5.164  -0.271  1.00 0.00 ? 39 GLU A C    3  
ATOM 2839  O O    . GLU A 1 39 ? -11.553 -4.339  -0.598  1.00 0.00 ? 39 GLU A O    3  
ATOM 2840  C CB   . GLU A 1 39 ? -11.098 -6.796  1.583   1.00 0.00 ? 39 GLU A CB   3  
ATOM 2841  C CG   . GLU A 1 39 ? -11.844 -8.041  2.032   1.00 0.00 ? 39 GLU A CG   3  
ATOM 2842  C CD   . GLU A 1 39 ? -13.325 -7.792  2.239   1.00 0.00 ? 39 GLU A CD   3  
ATOM 2843  O OE1  . GLU A 1 39 ? -13.700 -7.315  3.330   1.00 0.00 ? 39 GLU A OE1  3  
ATOM 2844  O OE2  . GLU A 1 39 ? -14.109 -8.072  1.308   1.00 0.00 ? 39 GLU A OE2  3  
ATOM 2845  H H    . GLU A 1 39 ? -9.774  -8.259  -0.018  1.00 0.00 ? 39 GLU A H    3  
ATOM 2846  H HA   . GLU A 1 39 ? -12.078 -6.793  -0.319  1.00 0.00 ? 39 GLU A HA   3  
ATOM 2847  H HB2  . GLU A 1 39 ? -10.078 -6.867  1.932   1.00 0.00 ? 39 GLU A HB2  3  
ATOM 2848  H HB3  . GLU A 1 39 ? -11.566 -5.937  2.041   1.00 0.00 ? 39 GLU A HB3  3  
ATOM 2849  H HG2  . GLU A 1 39 ? -11.725 -8.807  1.280   1.00 0.00 ? 39 GLU A HG2  3  
ATOM 2850  H HG3  . GLU A 1 39 ? -11.418 -8.385  2.963   1.00 0.00 ? 39 GLU A HG3  3  
ATOM 2851  N N    . LEU A 1 40 ? -9.406  -4.872  -0.188  1.00 0.00 ? 40 LEU A N    3  
ATOM 2852  C CA   . LEU A 1 40 ? -8.903  -3.535  -0.483  1.00 0.00 ? 40 LEU A CA   3  
ATOM 2853  C C    . LEU A 1 40 ? -9.051  -3.213  -1.967  1.00 0.00 ? 40 LEU A C    3  
ATOM 2854  O O    . LEU A 1 40 ? -9.369  -2.083  -2.338  1.00 0.00 ? 40 LEU A O    3  
ATOM 2855  C CB   . LEU A 1 40 ? -7.436  -3.418  -0.068  1.00 0.00 ? 40 LEU A CB   3  
ATOM 2856  C CG   . LEU A 1 40 ? -7.046  -4.130  1.228   1.00 0.00 ? 40 LEU A CG   3  
ATOM 2857  C CD1  . LEU A 1 40 ? -5.616  -3.787  1.616   1.00 0.00 ? 40 LEU A CD1  3  
ATOM 2858  C CD2  . LEU A 1 40 ? -8.007  -3.762  2.348   1.00 0.00 ? 40 LEU A CD2  3  
ATOM 2859  H H    . LEU A 1 40 ? -8.774  -5.572  0.078   1.00 0.00 ? 40 LEU A H    3  
ATOM 2860  H HA   . LEU A 1 40 ? -9.488  -2.828  0.086   1.00 0.00 ? 40 LEU A HA   3  
ATOM 2861  H HB2  . LEU A 1 40 ? -6.833  -3.827  -0.864  1.00 0.00 ? 40 LEU A HB2  3  
ATOM 2862  H HB3  . LEU A 1 40 ? -7.209  -2.367  0.049   1.00 0.00 ? 40 LEU A HB3  3  
ATOM 2863  H HG   . LEU A 1 40 ? -7.102  -5.199  1.075   1.00 0.00 ? 40 LEU A HG   3  
ATOM 2864  H HD11 . LEU A 1 40 ? -5.477  -3.964  2.672   1.00 0.00 ? 40 LEU A HD11 3  
ATOM 2865  H HD12 . LEU A 1 40 ? -5.423  -2.747  1.397   1.00 0.00 ? 40 LEU A HD12 3  
ATOM 2866  H HD13 . LEU A 1 40 ? -4.932  -4.406  1.053   1.00 0.00 ? 40 LEU A HD13 3  
ATOM 2867  H HD21 . LEU A 1 40 ? -8.918  -3.366  1.925   1.00 0.00 ? 40 LEU A HD21 3  
ATOM 2868  H HD22 . LEU A 1 40 ? -7.552  -3.016  2.984   1.00 0.00 ? 40 LEU A HD22 3  
ATOM 2869  H HD23 . LEU A 1 40 ? -8.234  -4.643  2.931   1.00 0.00 ? 40 LEU A HD23 3  
ATOM 2870  N N    . ALA A 1 41 ? -8.820  -4.214  -2.810  1.00 0.00 ? 41 ALA A N    3  
ATOM 2871  C CA   . ALA A 1 41 ? -8.932  -4.038  -4.253  1.00 0.00 ? 41 ALA A CA   3  
ATOM 2872  C C    . ALA A 1 41 ? -10.392 -3.940  -4.683  1.00 0.00 ? 41 ALA A C    3  
ATOM 2873  O O    . ALA A 1 41 ? -10.701 -3.407  -5.748  1.00 0.00 ? 41 ALA A O    3  
ATOM 2874  C CB   . ALA A 1 41 ? -8.242  -5.183  -4.979  1.00 0.00 ? 41 ALA A CB   3  
ATOM 2875  H H    . ALA A 1 41 ? -8.571  -5.091  -2.454  1.00 0.00 ? 41 ALA A H    3  
ATOM 2876  H HA   . ALA A 1 41 ? -8.427  -3.120  -4.518  1.00 0.00 ? 41 ALA A HA   3  
ATOM 2877  H HB1  . ALA A 1 41 ? -8.829  -5.467  -5.841  1.00 0.00 ? 41 ALA A HB1  3  
ATOM 2878  H HB2  . ALA A 1 41 ? -7.261  -4.866  -5.300  1.00 0.00 ? 41 ALA A HB2  3  
ATOM 2879  H HB3  . ALA A 1 41 ? -8.149  -6.027  -4.313  1.00 0.00 ? 41 ALA A HB3  3  
ATOM 2880  N N    . ALA A 1 42 ? -11.286 -4.457  -3.847  1.00 0.00 ? 42 ALA A N    3  
ATOM 2881  C CA   . ALA A 1 42 ? -12.714 -4.426  -4.140  1.00 0.00 ? 42 ALA A CA   3  
ATOM 2882  C C    . ALA A 1 42 ? -13.368 -3.181  -3.552  1.00 0.00 ? 42 ALA A C    3  
ATOM 2883  O O    . ALA A 1 42 ? -14.252 -2.584  -4.166  1.00 0.00 ? 42 ALA A O    3  
ATOM 2884  C CB   . ALA A 1 42 ? -13.389 -5.681  -3.607  1.00 0.00 ? 42 ALA A CB   3  
ATOM 2885  H H    . ALA A 1 42 ? -10.978 -4.868  -3.012  1.00 0.00 ? 42 ALA A H    3  
ATOM 2886  H HA   . ALA A 1 42 ? -12.834 -4.411  -5.214  1.00 0.00 ? 42 ALA A HA   3  
ATOM 2887  H HB1  . ALA A 1 42 ? -14.298 -5.408  -3.090  1.00 0.00 ? 42 ALA A HB1  3  
ATOM 2888  H HB2  . ALA A 1 42 ? -13.626 -6.339  -4.430  1.00 0.00 ? 42 ALA A HB2  3  
ATOM 2889  H HB3  . ALA A 1 42 ? -12.723 -6.185  -2.922  1.00 0.00 ? 42 ALA A HB3  3  
ATOM 2890  N N    . SER A 1 43 ? -12.928 -2.794  -2.359  1.00 0.00 ? 43 SER A N    3  
ATOM 2891  C CA   . SER A 1 43 ? -13.475 -1.621  -1.686  1.00 0.00 ? 43 SER A CA   3  
ATOM 2892  C C    . SER A 1 43 ? -12.816 -0.344  -2.199  1.00 0.00 ? 43 SER A C    3  
ATOM 2893  O O    . SER A 1 43 ? -13.492 0.567   -2.678  1.00 0.00 ? 43 SER A O    3  
ATOM 2894  C CB   . SER A 1 43 ? -13.279 -1.738  -0.173  1.00 0.00 ? 43 SER A CB   3  
ATOM 2895  O OG   . SER A 1 43 ? -14.194 -2.662  0.390   1.00 0.00 ? 43 SER A OG   3  
ATOM 2896  H H    . SER A 1 43 ? -12.221 -3.311  -1.920  1.00 0.00 ? 43 SER A H    3  
ATOM 2897  H HA   . SER A 1 43 ? -14.532 -1.579  -1.901  1.00 0.00 ? 43 SER A HA   3  
ATOM 2898  H HB2  . SER A 1 43 ? -12.274 -2.074  0.033   1.00 0.00 ? 43 SER A HB2  3  
ATOM 2899  H HB3  . SER A 1 43 ? -13.436 -0.771  0.283   1.00 0.00 ? 43 SER A HB3  3  
ATOM 2900  H HG   . SER A 1 43 ? -13.877 -2.942  1.252   1.00 0.00 ? 43 SER A HG   3  
ATOM 2901  N N    . LEU A 1 44 ? -11.493 -0.286  -2.094  1.00 0.00 ? 44 LEU A N    3  
ATOM 2902  C CA   . LEU A 1 44 ? -10.741 0.879   -2.547  1.00 0.00 ? 44 LEU A CA   3  
ATOM 2903  C C    . LEU A 1 44 ? -10.838 1.035   -4.061  1.00 0.00 ? 44 LEU A C    3  
ATOM 2904  O O    . LEU A 1 44 ? -10.617 2.119   -4.599  1.00 0.00 ? 44 LEU A O    3  
ATOM 2905  C CB   . LEU A 1 44 ? -9.275  0.758   -2.128  1.00 0.00 ? 44 LEU A CB   3  
ATOM 2906  C CG   . LEU A 1 44 ? -9.023  0.354   -0.675  1.00 0.00 ? 44 LEU A CG   3  
ATOM 2907  C CD1  . LEU A 1 44 ? -7.538  0.421   -0.352  1.00 0.00 ? 44 LEU A CD1  3  
ATOM 2908  C CD2  . LEU A 1 44 ? -9.817  1.243   0.271   1.00 0.00 ? 44 LEU A CD2  3  
ATOM 2909  H H    . LEU A 1 44 ? -11.010 -1.043  -1.704  1.00 0.00 ? 44 LEU A H    3  
ATOM 2910  H HA   . LEU A 1 44 ? -11.170 1.752   -2.079  1.00 0.00 ? 44 LEU A HA   3  
ATOM 2911  H HB2  . LEU A 1 44 ? -8.810  0.018   -2.762  1.00 0.00 ? 44 LEU A HB2  3  
ATOM 2912  H HB3  . LEU A 1 44 ? -8.804  1.717   -2.292  1.00 0.00 ? 44 LEU A HB3  3  
ATOM 2913  H HG   . LEU A 1 44 ? -9.349  -0.667  -0.530  1.00 0.00 ? 44 LEU A HG   3  
ATOM 2914  H HD11 . LEU A 1 44 ? -6.998  -0.252  -1.000  1.00 0.00 ? 44 LEU A HD11 3  
ATOM 2915  H HD12 . LEU A 1 44 ? -7.381  0.135   0.677   1.00 0.00 ? 44 LEU A HD12 3  
ATOM 2916  H HD13 . LEU A 1 44 ? -7.183  1.430   -0.502  1.00 0.00 ? 44 LEU A HD13 3  
ATOM 2917  H HD21 . LEU A 1 44 ? -10.839 1.309   -0.072  1.00 0.00 ? 44 LEU A HD21 3  
ATOM 2918  H HD22 . LEU A 1 44 ? -9.380  2.230   0.290   1.00 0.00 ? 44 LEU A HD22 3  
ATOM 2919  H HD23 . LEU A 1 44 ? -9.797  0.820   1.264   1.00 0.00 ? 44 LEU A HD23 3  
ATOM 2920  N N    . GLY A 1 45 ? -11.172 -0.056  -4.743  1.00 0.00 ? 45 GLY A N    3  
ATOM 2921  C CA   . GLY A 1 45 ? -11.295 -0.019  -6.189  1.00 0.00 ? 45 GLY A CA   3  
ATOM 2922  C C    . GLY A 1 45 ? -9.980  -0.298  -6.890  1.00 0.00 ? 45 GLY A C    3  
ATOM 2923  O O    . GLY A 1 45 ? -9.819  0.014   -8.071  1.00 0.00 ? 45 GLY A O    3  
ATOM 2924  H H    . GLY A 1 45 ? -11.337 -0.894  -4.261  1.00 0.00 ? 45 GLY A H    3  
ATOM 2925  H HA2  . GLY A 1 45 ? -12.019 -0.758  -6.497  1.00 0.00 ? 45 GLY A HA2  3  
ATOM 2926  H HA3  . GLY A 1 45 ? -11.646 0.959   -6.484  1.00 0.00 ? 45 GLY A HA3  3  
ATOM 2927  N N    . LEU A 1 46 ? -9.036  -0.884  -6.162  1.00 0.00 ? 46 LEU A N    3  
ATOM 2928  C CA   . LEU A 1 46 ? -7.727  -1.204  -6.720  1.00 0.00 ? 46 LEU A CA   3  
ATOM 2929  C C    . LEU A 1 46 ? -7.644  -2.678  -7.104  1.00 0.00 ? 46 LEU A C    3  
ATOM 2930  O O    . LEU A 1 46 ? -8.584  -3.442  -6.886  1.00 0.00 ? 46 LEU A O    3  
ATOM 2931  C CB   . LEU A 1 46 ? -6.625  -0.863  -5.716  1.00 0.00 ? 46 LEU A CB   3  
ATOM 2932  C CG   . LEU A 1 46 ? -6.631  0.566   -5.172  1.00 0.00 ? 46 LEU A CG   3  
ATOM 2933  C CD1  . LEU A 1 46 ? -5.983  0.616   -3.797  1.00 0.00 ? 46 LEU A CD1  3  
ATOM 2934  C CD2  . LEU A 1 46 ? -5.918  1.505   -6.134  1.00 0.00 ? 46 LEU A CD2  3  
ATOM 2935  H H    . LEU A 1 46 ? -9.223  -1.109  -5.227  1.00 0.00 ? 46 LEU A H    3  
ATOM 2936  H HA   . LEU A 1 46 ? -7.591  -0.605  -7.609  1.00 0.00 ? 46 LEU A HA   3  
ATOM 2937  H HB2  . LEU A 1 46 ? -6.723  -1.536  -4.877  1.00 0.00 ? 46 LEU A HB2  3  
ATOM 2938  H HB3  . LEU A 1 46 ? -5.674  -1.030  -6.200  1.00 0.00 ? 46 LEU A HB3  3  
ATOM 2939  H HG   . LEU A 1 46 ? -7.654  0.902   -5.071  1.00 0.00 ? 46 LEU A HG   3  
ATOM 2940  H HD11 . LEU A 1 46 ? -5.297  1.448   -3.752  1.00 0.00 ? 46 LEU A HD11 3  
ATOM 2941  H HD12 . LEU A 1 46 ? -5.446  -0.304  -3.618  1.00 0.00 ? 46 LEU A HD12 3  
ATOM 2942  H HD13 . LEU A 1 46 ? -6.748  0.738   -3.043  1.00 0.00 ? 46 LEU A HD13 3  
ATOM 2943  H HD21 . LEU A 1 46 ? -5.775  2.465   -5.659  1.00 0.00 ? 46 LEU A HD21 3  
ATOM 2944  H HD22 . LEU A 1 46 ? -6.517  1.630   -7.024  1.00 0.00 ? 46 LEU A HD22 3  
ATOM 2945  H HD23 . LEU A 1 46 ? -4.959  1.088   -6.400  1.00 0.00 ? 46 LEU A HD23 3  
ATOM 2946  N N    . THR A 1 47 ? -6.510  -3.072  -7.676  1.00 0.00 ? 47 THR A N    3  
ATOM 2947  C CA   . THR A 1 47 ? -6.303  -4.454  -8.089  1.00 0.00 ? 47 THR A CA   3  
ATOM 2948  C C    . THR A 1 47 ? -5.297  -5.154  -7.182  1.00 0.00 ? 47 THR A C    3  
ATOM 2949  O O    . THR A 1 47 ? -4.481  -4.504  -6.529  1.00 0.00 ? 47 THR A O    3  
ATOM 2950  C CB   . THR A 1 47 ? -5.808  -4.537  -9.546  1.00 0.00 ? 47 THR A CB   3  
ATOM 2951  O OG1  . THR A 1 47 ? -6.000  -5.862  -10.053 1.00 0.00 ? 47 THR A OG1  3  
ATOM 2952  C CG2  . THR A 1 47 ? -4.338  -4.159  -9.640  1.00 0.00 ? 47 THR A CG2  3  
ATOM 2953  H H    . THR A 1 47 ? -5.797  -2.416  -7.823  1.00 0.00 ? 47 THR A H    3  
ATOM 2954  H HA   . THR A 1 47 ? -7.251  -4.968  -8.023  1.00 0.00 ? 47 THR A HA   3  
ATOM 2955  H HB   . THR A 1 47 ? -6.382  -3.844  -10.144 1.00 0.00 ? 47 THR A HB   3  
ATOM 2956  H HG1  . THR A 1 47 ? -6.925  -6.106  -9.971  1.00 0.00 ? 47 THR A HG1  3  
ATOM 2957  H HG21 . THR A 1 47 ? -4.181  -3.537  -10.509 1.00 0.00 ? 47 THR A HG21 3  
ATOM 2958  H HG22 . THR A 1 47 ? -3.741  -5.055  -9.726  1.00 0.00 ? 47 THR A HG22 3  
ATOM 2959  H HG23 . THR A 1 47 ? -4.048  -3.617  -8.753  1.00 0.00 ? 47 THR A HG23 3  
ATOM 2960  N N    . GLN A 1 48 ? -5.361  -6.481  -7.149  1.00 0.00 ? 48 GLN A N    3  
ATOM 2961  C CA   . GLN A 1 48 ? -4.454  -7.268  -6.321  1.00 0.00 ? 48 GLN A CA   3  
ATOM 2962  C C    . GLN A 1 48 ? -3.001  -6.907  -6.611  1.00 0.00 ? 48 GLN A C    3  
ATOM 2963  O O    . GLN A 1 48 ? -2.145  -6.974  -5.728  1.00 0.00 ? 48 GLN A O    3  
ATOM 2964  C CB   . GLN A 1 48 ? -4.678  -8.762  -6.561  1.00 0.00 ? 48 GLN A CB   3  
ATOM 2965  C CG   . GLN A 1 48 ? -6.053  -9.248  -6.130  1.00 0.00 ? 48 GLN A CG   3  
ATOM 2966  C CD   . GLN A 1 48 ? -6.368  -10.639 -6.643  1.00 0.00 ? 48 GLN A CD   3  
ATOM 2967  O OE1  . GLN A 1 48 ? -5.946  -11.021 -7.735  1.00 0.00 ? 48 GLN A OE1  3  
ATOM 2968  N NE2  . GLN A 1 48 ? -7.113  -11.406 -5.856  1.00 0.00 ? 48 GLN A NE2  3  
ATOM 2969  H H    . GLN A 1 48 ? -6.033  -6.941  -7.692  1.00 0.00 ? 48 GLN A H    3  
ATOM 2970  H HA   . GLN A 1 48 ? -4.669  -7.043  -5.288  1.00 0.00 ? 48 GLN A HA   3  
ATOM 2971  H HB2  . GLN A 1 48 ? -4.561  -8.967  -7.615  1.00 0.00 ? 48 GLN A HB2  3  
ATOM 2972  H HB3  . GLN A 1 48 ? -3.935  -9.318  -6.009  1.00 0.00 ? 48 GLN A HB3  3  
ATOM 2973  H HG2  . GLN A 1 48 ? -6.094  -9.261  -5.051  1.00 0.00 ? 48 GLN A HG2  3  
ATOM 2974  H HG3  . GLN A 1 48 ? -6.797  -8.563  -6.509  1.00 0.00 ? 48 GLN A HG3  3  
ATOM 2975  H HE21 . GLN A 1 48 ? -7.415  -11.035 -5.000  1.00 0.00 ? 48 GLN A HE21 3  
ATOM 2976  H HE22 . GLN A 1 48 ? -7.332  -12.310 -6.164  1.00 0.00 ? 48 GLN A HE22 3  
ATOM 2977  N N    . THR A 1 49 ? -2.728  -6.524  -7.854  1.00 0.00 ? 49 THR A N    3  
ATOM 2978  C CA   . THR A 1 49 ? -1.378  -6.154  -8.261  1.00 0.00 ? 49 THR A CA   3  
ATOM 2979  C C    . THR A 1 49 ? -0.994  -4.785  -7.711  1.00 0.00 ? 49 THR A C    3  
ATOM 2980  O O    . THR A 1 49 ? 0.186   -4.444  -7.640  1.00 0.00 ? 49 THR A O    3  
ATOM 2981  C CB   . THR A 1 49 ? -1.239  -6.136  -9.795  1.00 0.00 ? 49 THR A CB   3  
ATOM 2982  O OG1  . THR A 1 49 ? -1.892  -7.278  -10.360 1.00 0.00 ? 49 THR A OG1  3  
ATOM 2983  C CG2  . THR A 1 49 ? 0.226   -6.129  -10.205 1.00 0.00 ? 49 THR A CG2  3  
ATOM 2984  H H    . THR A 1 49 ? -3.452  -6.491  -8.513  1.00 0.00 ? 49 THR A H    3  
ATOM 2985  H HA   . THR A 1 49 ? -0.696  -6.894  -7.867  1.00 0.00 ? 49 THR A HA   3  
ATOM 2986  H HB   . THR A 1 49 ? -1.707  -5.239  -10.173 1.00 0.00 ? 49 THR A HB   3  
ATOM 2987  H HG1  . THR A 1 49 ? -2.320  -7.028  -11.182 1.00 0.00 ? 49 THR A HG1  3  
ATOM 2988  H HG21 . THR A 1 49 ? 0.566   -5.109  -10.311 1.00 0.00 ? 49 THR A HG21 3  
ATOM 2989  H HG22 . THR A 1 49 ? 0.339   -6.645  -11.146 1.00 0.00 ? 49 THR A HG22 3  
ATOM 2990  H HG23 . THR A 1 49 ? 0.814   -6.627  -9.448  1.00 0.00 ? 49 THR A HG23 3  
ATOM 2991  N N    . GLN A 1 50 ? -1.998  -4.005  -7.323  1.00 0.00 ? 50 GLN A N    3  
ATOM 2992  C CA   . GLN A 1 50 ? -1.764  -2.673  -6.779  1.00 0.00 ? 50 GLN A CA   3  
ATOM 2993  C C    . GLN A 1 50 ? -1.593  -2.725  -5.265  1.00 0.00 ? 50 GLN A C    3  
ATOM 2994  O O    . GLN A 1 50 ? -0.596  -2.246  -4.725  1.00 0.00 ? 50 GLN A O    3  
ATOM 2995  C CB   . GLN A 1 50 ? -2.920  -1.740  -7.142  1.00 0.00 ? 50 GLN A CB   3  
ATOM 2996  C CG   . GLN A 1 50 ? -2.815  -1.157  -8.542  1.00 0.00 ? 50 GLN A CG   3  
ATOM 2997  C CD   . GLN A 1 50 ? -3.447  0.217   -8.650  1.00 0.00 ? 50 GLN A CD   3  
ATOM 2998  O OE1  . GLN A 1 50 ? -2.994  1.173   -8.018  1.00 0.00 ? 50 GLN A OE1  3  
ATOM 2999  N NE2  . GLN A 1 50 ? -4.498  0.324   -9.454  1.00 0.00 ? 50 GLN A NE2  3  
ATOM 3000  H H    . GLN A 1 50 ? -2.917  -4.333  -7.405  1.00 0.00 ? 50 GLN A H    3  
ATOM 3001  H HA   . GLN A 1 50 ? -0.854  -2.291  -7.218  1.00 0.00 ? 50 GLN A HA   3  
ATOM 3002  H HB2  . GLN A 1 50 ? -3.847  -2.291  -7.073  1.00 0.00 ? 50 GLN A HB2  3  
ATOM 3003  H HB3  . GLN A 1 50 ? -2.944  -0.923  -6.436  1.00 0.00 ? 50 GLN A HB3  3  
ATOM 3004  H HG2  . GLN A 1 50 ? -1.772  -1.078  -8.808  1.00 0.00 ? 50 GLN A HG2  3  
ATOM 3005  H HG3  . GLN A 1 50 ? -3.313  -1.821  -9.233  1.00 0.00 ? 50 GLN A HG3  3  
ATOM 3006  H HE21 . GLN A 1 50 ? -4.804  -0.480  -9.925  1.00 0.00 ? 50 GLN A HE21 3  
ATOM 3007  H HE22 . GLN A 1 50 ? -4.926  1.200   -9.542  1.00 0.00 ? 50 GLN A HE22 3  
ATOM 3008  N N    . VAL A 1 51 ? -2.573  -3.311  -4.583  1.00 0.00 ? 51 VAL A N    3  
ATOM 3009  C CA   . VAL A 1 51 ? -2.531  -3.427  -3.131  1.00 0.00 ? 51 VAL A CA   3  
ATOM 3010  C C    . VAL A 1 51 ? -1.317  -4.229  -2.678  1.00 0.00 ? 51 VAL A C    3  
ATOM 3011  O O    . VAL A 1 51 ? -0.822  -4.054  -1.565  1.00 0.00 ? 51 VAL A O    3  
ATOM 3012  C CB   . VAL A 1 51 ? -3.807  -4.094  -2.584  1.00 0.00 ? 51 VAL A CB   3  
ATOM 3013  C CG1  . VAL A 1 51 ? -3.571  -4.629  -1.180  1.00 0.00 ? 51 VAL A CG1  3  
ATOM 3014  C CG2  . VAL A 1 51 ? -4.970  -3.114  -2.601  1.00 0.00 ? 51 VAL A CG2  3  
ATOM 3015  H H    . VAL A 1 51 ? -3.343  -3.674  -5.070  1.00 0.00 ? 51 VAL A H    3  
ATOM 3016  H HA   . VAL A 1 51 ? -2.467  -2.430  -2.718  1.00 0.00 ? 51 VAL A HA   3  
ATOM 3017  H HB   . VAL A 1 51 ? -4.056  -4.927  -3.225  1.00 0.00 ? 51 VAL A HB   3  
ATOM 3018  H HG11 . VAL A 1 51 ? -2.813  -5.398  -1.211  1.00 0.00 ? 51 VAL A HG11 3  
ATOM 3019  H HG12 . VAL A 1 51 ? -3.242  -3.824  -0.538  1.00 0.00 ? 51 VAL A HG12 3  
ATOM 3020  H HG13 . VAL A 1 51 ? -4.490  -5.045  -0.794  1.00 0.00 ? 51 VAL A HG13 3  
ATOM 3021  H HG21 . VAL A 1 51 ? -4.781  -2.345  -3.335  1.00 0.00 ? 51 VAL A HG21 3  
ATOM 3022  H HG22 . VAL A 1 51 ? -5.880  -3.638  -2.856  1.00 0.00 ? 51 VAL A HG22 3  
ATOM 3023  H HG23 . VAL A 1 51 ? -5.076  -2.663  -1.626  1.00 0.00 ? 51 VAL A HG23 3  
ATOM 3024  N N    . LYS A 1 52 ? -0.840  -5.112  -3.549  1.00 0.00 ? 52 LYS A N    3  
ATOM 3025  C CA   . LYS A 1 52 ? 0.319   -5.942  -3.242  1.00 0.00 ? 52 LYS A CA   3  
ATOM 3026  C C    . LYS A 1 52 ? 1.596   -5.109  -3.228  1.00 0.00 ? 52 LYS A C    3  
ATOM 3027  O O    . LYS A 1 52 ? 2.313   -5.072  -2.227  1.00 0.00 ? 52 LYS A O    3  
ATOM 3028  C CB   . LYS A 1 52 ? 0.446   -7.074  -4.264  1.00 0.00 ? 52 LYS A CB   3  
ATOM 3029  C CG   . LYS A 1 52 ? -0.293  -8.339  -3.865  1.00 0.00 ? 52 LYS A CG   3  
ATOM 3030  C CD   . LYS A 1 52 ? 0.203   -9.544  -4.646  1.00 0.00 ? 52 LYS A CD   3  
ATOM 3031  C CE   . LYS A 1 52 ? -0.580  -9.734  -5.937  1.00 0.00 ? 52 LYS A CE   3  
ATOM 3032  N NZ   . LYS A 1 52 ? -1.769  -10.609 -5.740  1.00 0.00 ? 52 LYS A NZ   3  
ATOM 3033  H H    . LYS A 1 52 ? -1.278  -5.206  -4.422  1.00 0.00 ? 52 LYS A H    3  
ATOM 3034  H HA   . LYS A 1 52 ? 0.170   -6.368  -2.261  1.00 0.00 ? 52 LYS A HA   3  
ATOM 3035  H HB2  . LYS A 1 52 ? 0.053   -6.734  -5.210  1.00 0.00 ? 52 LYS A HB2  3  
ATOM 3036  H HB3  . LYS A 1 52 ? 1.492   -7.316  -4.385  1.00 0.00 ? 52 LYS A HB3  3  
ATOM 3037  H HG2  . LYS A 1 52 ? -0.140  -8.519  -2.812  1.00 0.00 ? 52 LYS A HG2  3  
ATOM 3038  H HG3  . LYS A 1 52 ? -1.348  -8.205  -4.060  1.00 0.00 ? 52 LYS A HG3  3  
ATOM 3039  H HD2  . LYS A 1 52 ? 1.245   -9.401  -4.889  1.00 0.00 ? 52 LYS A HD2  3  
ATOM 3040  H HD3  . LYS A 1 52 ? 0.092   -10.429 -4.035  1.00 0.00 ? 52 LYS A HD3  3  
ATOM 3041  H HE2  . LYS A 1 52 ? -0.909  -8.768  -6.288  1.00 0.00 ? 52 LYS A HE2  3  
ATOM 3042  H HE3  . LYS A 1 52 ? 0.069   -10.183 -6.674  1.00 0.00 ? 52 LYS A HE3  3  
ATOM 3043  H HZ1  . LYS A 1 52 ? -1.484  -11.504 -5.296  1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 3044  H HZ2  . LYS A 1 52 ? -2.215  -10.816 -6.657  1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 3045  H HZ3  . LYS A 1 52 ? -2.464  -10.136 -5.128  1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 3046  N N    . ILE A 1 53 ? 1.875   -4.442  -4.342  1.00 0.00 ? 53 ILE A N    3  
ATOM 3047  C CA   . ILE A 1 53 ? 3.065   -3.608  -4.456  1.00 0.00 ? 53 ILE A CA   3  
ATOM 3048  C C    . ILE A 1 53 ? 3.069   -2.509  -3.398  1.00 0.00 ? 53 ILE A C    3  
ATOM 3049  O O    . ILE A 1 53 ? 4.118   -2.157  -2.859  1.00 0.00 ? 53 ILE A O    3  
ATOM 3050  C CB   . ILE A 1 53 ? 3.169   -2.962  -5.850  1.00 0.00 ? 53 ILE A CB   3  
ATOM 3051  C CG1  . ILE A 1 53 ? 3.149   -4.039  -6.937  1.00 0.00 ? 53 ILE A CG1  3  
ATOM 3052  C CG2  . ILE A 1 53 ? 4.433   -2.122  -5.952  1.00 0.00 ? 53 ILE A CG2  3  
ATOM 3053  C CD1  . ILE A 1 53 ? 2.932   -3.489  -8.329  1.00 0.00 ? 53 ILE A CD1  3  
ATOM 3054  H H    . ILE A 1 53 ? 1.265   -4.511  -5.106  1.00 0.00 ? 53 ILE A H    3  
ATOM 3055  H HA   . ILE A 1 53 ? 3.929   -4.239  -4.308  1.00 0.00 ? 53 ILE A HA   3  
ATOM 3056  H HB   . ILE A 1 53 ? 2.320   -2.309  -5.985  1.00 0.00 ? 53 ILE A HB   3  
ATOM 3057  H HG12 . ILE A 1 53 ? 4.092   -4.564  -6.932  1.00 0.00 ? 53 ILE A HG12 3  
ATOM 3058  H HG13 . ILE A 1 53 ? 2.352   -4.737  -6.727  1.00 0.00 ? 53 ILE A HG13 3  
ATOM 3059  H HG21 . ILE A 1 53 ? 4.698   -1.995  -6.991  1.00 0.00 ? 53 ILE A HG21 3  
ATOM 3060  H HG22 . ILE A 1 53 ? 4.260   -1.155  -5.504  1.00 0.00 ? 53 ILE A HG22 3  
ATOM 3061  H HG23 . ILE A 1 53 ? 5.239   -2.620  -5.434  1.00 0.00 ? 53 ILE A HG23 3  
ATOM 3062  H HD11 . ILE A 1 53 ? 3.758   -3.774  -8.963  1.00 0.00 ? 53 ILE A HD11 3  
ATOM 3063  H HD12 . ILE A 1 53 ? 2.013   -3.884  -8.734  1.00 0.00 ? 53 ILE A HD12 3  
ATOM 3064  H HD13 . ILE A 1 53 ? 2.870   -2.410  -8.284  1.00 0.00 ? 53 ILE A HD13 3  
ATOM 3065  N N    . TRP A 1 54 ? 1.890   -1.973  -3.105  1.00 0.00 ? 54 TRP A N    3  
ATOM 3066  C CA   . TRP A 1 54 ? 1.757   -0.916  -2.110  1.00 0.00 ? 54 TRP A CA   3  
ATOM 3067  C C    . TRP A 1 54 ? 2.230   -1.393  -0.741  1.00 0.00 ? 54 TRP A C    3  
ATOM 3068  O O    . TRP A 1 54 ? 3.024   -0.724  -0.080  1.00 0.00 ? 54 TRP A O    3  
ATOM 3069  C CB   . TRP A 1 54 ? 0.304   -0.446  -2.025  1.00 0.00 ? 54 TRP A CB   3  
ATOM 3070  C CG   . TRP A 1 54 ? 0.120   0.765   -1.161  1.00 0.00 ? 54 TRP A CG   3  
ATOM 3071  C CD1  . TRP A 1 54 ? 0.017   2.061   -1.578  1.00 0.00 ? 54 TRP A CD1  3  
ATOM 3072  C CD2  . TRP A 1 54 ? 0.020   0.791   0.267   1.00 0.00 ? 54 TRP A CD2  3  
ATOM 3073  N NE1  . TRP A 1 54 ? -0.141  2.892   -0.495  1.00 0.00 ? 54 TRP A NE1  3  
ATOM 3074  C CE2  . TRP A 1 54 ? -0.143  2.137   0.648   1.00 0.00 ? 54 TRP A CE2  3  
ATOM 3075  C CE3  . TRP A 1 54 ? 0.051   -0.191  1.260   1.00 0.00 ? 54 TRP A CE3  3  
ATOM 3076  C CZ2  . TRP A 1 54 ? -0.274  2.523   1.980   1.00 0.00 ? 54 TRP A CZ2  3  
ATOM 3077  C CZ3  . TRP A 1 54 ? -0.078  0.193   2.582   1.00 0.00 ? 54 TRP A CZ3  3  
ATOM 3078  C CH2  . TRP A 1 54 ? -0.240  1.540   2.932   1.00 0.00 ? 54 TRP A CH2  3  
ATOM 3079  H H    . TRP A 1 54 ? 1.089   -2.296  -3.569  1.00 0.00 ? 54 TRP A H    3  
ATOM 3080  H HA   . TRP A 1 54 ? 2.376   -0.087  -2.423  1.00 0.00 ? 54 TRP A HA   3  
ATOM 3081  H HB2  . TRP A 1 54 ? -0.048  -0.204  -3.017  1.00 0.00 ? 54 TRP A HB2  3  
ATOM 3082  H HB3  . TRP A 1 54 ? -0.301  -1.243  -1.617  1.00 0.00 ? 54 TRP A HB3  3  
ATOM 3083  H HD1  . TRP A 1 54 ? 0.057   2.373   -2.610  1.00 0.00 ? 54 TRP A HD1  3  
ATOM 3084  H HE1  . TRP A 1 54 ? -0.239  3.867   -0.535  1.00 0.00 ? 54 TRP A HE1  3  
ATOM 3085  H HE3  . TRP A 1 54 ? 0.175   -1.235  1.010   1.00 0.00 ? 54 TRP A HE3  3  
ATOM 3086  H HZ2  . TRP A 1 54 ? -0.400  3.557   2.266   1.00 0.00 ? 54 TRP A HZ2  3  
ATOM 3087  H HZ3  . TRP A 1 54 ? -0.056  -0.552  3.363   1.00 0.00 ? 54 TRP A HZ3  3  
ATOM 3088  H HH2  . TRP A 1 54 ? -0.337  1.794   3.976   1.00 0.00 ? 54 TRP A HH2  3  
ATOM 3089  N N    . PHE A 1 55 ? 1.739   -2.554  -0.322  1.00 0.00 ? 55 PHE A N    3  
ATOM 3090  C CA   . PHE A 1 55 ? 2.112   -3.121  0.969   1.00 0.00 ? 55 PHE A CA   3  
ATOM 3091  C C    . PHE A 1 55 ? 3.587   -3.508  0.987   1.00 0.00 ? 55 PHE A C    3  
ATOM 3092  O O    . PHE A 1 55 ? 4.287   -3.276  1.972   1.00 0.00 ? 55 PHE A O    3  
ATOM 3093  C CB   . PHE A 1 55 ? 1.248   -4.345  1.281   1.00 0.00 ? 55 PHE A CB   3  
ATOM 3094  C CG   . PHE A 1 55 ? -0.021  -4.012  2.012   1.00 0.00 ? 55 PHE A CG   3  
ATOM 3095  C CD1  . PHE A 1 55 ? -1.028  -3.294  1.388   1.00 0.00 ? 55 PHE A CD1  3  
ATOM 3096  C CD2  . PHE A 1 55 ? -0.208  -4.419  3.324   1.00 0.00 ? 55 PHE A CD2  3  
ATOM 3097  C CE1  . PHE A 1 55 ? -2.197  -2.986  2.059   1.00 0.00 ? 55 PHE A CE1  3  
ATOM 3098  C CE2  . PHE A 1 55 ? -1.374  -4.114  4.000   1.00 0.00 ? 55 PHE A CE2  3  
ATOM 3099  C CZ   . PHE A 1 55 ? -2.370  -3.398  3.366   1.00 0.00 ? 55 PHE A CZ   3  
ATOM 3100  H H    . PHE A 1 55 ? 1.109   -3.042  -0.895  1.00 0.00 ? 55 PHE A H    3  
ATOM 3101  H HA   . PHE A 1 55 ? 1.940   -2.368  1.722   1.00 0.00 ? 55 PHE A HA   3  
ATOM 3102  H HB2  . PHE A 1 55 ? 0.979   -4.832  0.356   1.00 0.00 ? 55 PHE A HB2  3  
ATOM 3103  H HB3  . PHE A 1 55 ? 1.815   -5.030  1.893   1.00 0.00 ? 55 PHE A HB3  3  
ATOM 3104  H HD1  . PHE A 1 55 ? -0.894  -2.973  0.365   1.00 0.00 ? 55 PHE A HD1  3  
ATOM 3105  H HD2  . PHE A 1 55 ? 0.572   -4.980  3.821   1.00 0.00 ? 55 PHE A HD2  3  
ATOM 3106  H HE1  . PHE A 1 55 ? -2.974  -2.426  1.561   1.00 0.00 ? 55 PHE A HE1  3  
ATOM 3107  H HE2  . PHE A 1 55 ? -1.506  -4.437  5.021   1.00 0.00 ? 55 PHE A HE2  3  
ATOM 3108  H HZ   . PHE A 1 55 ? -3.282  -3.158  3.892   1.00 0.00 ? 55 PHE A HZ   3  
ATOM 3109  N N    . GLN A 1 56 ? 4.052   -4.098  -0.109  1.00 0.00 ? 56 GLN A N    3  
ATOM 3110  C CA   . GLN A 1 56 ? 5.444   -4.519  -0.219  1.00 0.00 ? 56 GLN A CA   3  
ATOM 3111  C C    . GLN A 1 56 ? 6.382   -3.319  -0.142  1.00 0.00 ? 56 GLN A C    3  
ATOM 3112  O O    . GLN A 1 56 ? 7.355   -3.327  0.610   1.00 0.00 ? 56 GLN A O    3  
ATOM 3113  C CB   . GLN A 1 56 ? 5.669   -5.275  -1.529  1.00 0.00 ? 56 GLN A CB   3  
ATOM 3114  C CG   . GLN A 1 56 ? 6.867   -6.209  -1.495  1.00 0.00 ? 56 GLN A CG   3  
ATOM 3115  C CD   . GLN A 1 56 ? 8.142   -5.508  -1.067  1.00 0.00 ? 56 GLN A CD   3  
ATOM 3116  O OE1  . GLN A 1 56 ? 8.716   -4.723  -1.822  1.00 0.00 ? 56 GLN A OE1  3  
ATOM 3117  N NE2  . GLN A 1 56 ? 8.591   -5.789  0.151   1.00 0.00 ? 56 GLN A NE2  3  
ATOM 3118  H H    . GLN A 1 56 ? 3.444   -4.256  -0.861  1.00 0.00 ? 56 GLN A H    3  
ATOM 3119  H HA   . GLN A 1 56 ? 5.656   -5.179  0.608   1.00 0.00 ? 56 GLN A HA   3  
ATOM 3120  H HB2  . GLN A 1 56 ? 4.789   -5.861  -1.749  1.00 0.00 ? 56 GLN A HB2  3  
ATOM 3121  H HB3  . GLN A 1 56 ? 5.822   -4.558  -2.323  1.00 0.00 ? 56 GLN A HB3  3  
ATOM 3122  H HG2  . GLN A 1 56 ? 6.664   -7.009  -0.798  1.00 0.00 ? 56 GLN A HG2  3  
ATOM 3123  H HG3  . GLN A 1 56 ? 7.014   -6.622  -2.482  1.00 0.00 ? 56 GLN A HG3  3  
ATOM 3124  H HE21 . GLN A 1 56 ? 8.083   -6.425  0.697   1.00 0.00 ? 56 GLN A HE21 3  
ATOM 3125  H HE22 . GLN A 1 56 ? 9.413   -5.351  0.453   1.00 0.00 ? 56 GLN A HE22 3  
ATOM 3126  N N    . ASN A 1 57 ? 6.083   -2.289  -0.928  1.00 0.00 ? 57 ASN A N    3  
ATOM 3127  C CA   . ASN A 1 57 ? 6.901   -1.082  -0.950  1.00 0.00 ? 57 ASN A CA   3  
ATOM 3128  C C    . ASN A 1 57 ? 7.004   -0.469  0.444   1.00 0.00 ? 57 ASN A C    3  
ATOM 3129  O O    . ASN A 1 57 ? 8.101   -0.231  0.950   1.00 0.00 ? 57 ASN A O    3  
ATOM 3130  C CB   . ASN A 1 57 ? 6.314   -0.061  -1.926  1.00 0.00 ? 57 ASN A CB   3  
ATOM 3131  C CG   . ASN A 1 57 ? 6.479   -0.483  -3.373  1.00 0.00 ? 57 ASN A CG   3  
ATOM 3132  O OD1  . ASN A 1 57 ? 6.598   -1.670  -3.675  1.00 0.00 ? 57 ASN A OD1  3  
ATOM 3133  N ND2  . ASN A 1 57 ? 6.488   0.491   -4.276  1.00 0.00 ? 57 ASN A ND2  3  
ATOM 3134  H H    . ASN A 1 57 ? 5.294   -2.342  -1.506  1.00 0.00 ? 57 ASN A H    3  
ATOM 3135  H HA   . ASN A 1 57 ? 7.890   -1.358  -1.283  1.00 0.00 ? 57 ASN A HA   3  
ATOM 3136  H HB2  . ASN A 1 57 ? 5.259   0.056   -1.724  1.00 0.00 ? 57 ASN A HB2  3  
ATOM 3137  H HB3  . ASN A 1 57 ? 6.810   0.888   -1.787  1.00 0.00 ? 57 ASN A HB3  3  
ATOM 3138  H HD21 . ASN A 1 57 ? 6.388   1.415   -3.962  1.00 0.00 ? 57 ASN A HD21 3  
ATOM 3139  H HD22 . ASN A 1 57 ? 6.593   0.247   -5.219  1.00 0.00 ? 57 ASN A HD22 3  
ATOM 3140  N N    . LYS A 1 58 ? 5.854   -0.217  1.060   1.00 0.00 ? 58 LYS A N    3  
ATOM 3141  C CA   . LYS A 1 58 ? 5.813   0.366   2.396   1.00 0.00 ? 58 LYS A CA   3  
ATOM 3142  C C    . LYS A 1 58 ? 6.773   -0.358  3.335   1.00 0.00 ? 58 LYS A C    3  
ATOM 3143  O O    . LYS A 1 58 ? 7.552   0.274   4.048   1.00 0.00 ? 58 LYS A O    3  
ATOM 3144  C CB   . LYS A 1 58 ? 4.391   0.305   2.957   1.00 0.00 ? 58 LYS A CB   3  
ATOM 3145  C CG   . LYS A 1 58 ? 4.067   1.437   3.917   1.00 0.00 ? 58 LYS A CG   3  
ATOM 3146  C CD   . LYS A 1 58 ? 3.919   2.762   3.187   1.00 0.00 ? 58 LYS A CD   3  
ATOM 3147  C CE   . LYS A 1 58 ? 2.909   2.664   2.055   1.00 0.00 ? 58 LYS A CE   3  
ATOM 3148  N NZ   . LYS A 1 58 ? 3.543   2.218   0.783   1.00 0.00 ? 58 LYS A NZ   3  
ATOM 3149  H H    . LYS A 1 58 ? 5.012   -0.430  0.605   1.00 0.00 ? 58 LYS A H    3  
ATOM 3150  H HA   . LYS A 1 58 ? 6.116   1.399   2.317   1.00 0.00 ? 58 LYS A HA   3  
ATOM 3151  H HB2  . LYS A 1 58 ? 3.690   0.346   2.136   1.00 0.00 ? 58 LYS A HB2  3  
ATOM 3152  H HB3  . LYS A 1 58 ? 4.263   -0.631  3.482   1.00 0.00 ? 58 LYS A HB3  3  
ATOM 3153  H HG2  . LYS A 1 58 ? 3.141   1.213   4.425   1.00 0.00 ? 58 LYS A HG2  3  
ATOM 3154  H HG3  . LYS A 1 58 ? 4.866   1.523   4.641   1.00 0.00 ? 58 LYS A HG3  3  
ATOM 3155  H HD2  . LYS A 1 58 ? 3.586   3.514   3.888   1.00 0.00 ? 58 LYS A HD2  3  
ATOM 3156  H HD3  . LYS A 1 58 ? 4.878   3.048   2.779   1.00 0.00 ? 58 LYS A HD3  3  
ATOM 3157  H HE2  . LYS A 1 58 ? 2.143   1.956   2.333   1.00 0.00 ? 58 LYS A HE2  3  
ATOM 3158  H HE3  . LYS A 1 58 ? 2.463   3.636   1.903   1.00 0.00 ? 58 LYS A HE3  3  
ATOM 3159  H HZ1  . LYS A 1 58 ? 3.567   3.003   0.101   1.00 0.00 ? 58 LYS A HZ1  3  
ATOM 3160  H HZ2  . LYS A 1 58 ? 3.001   1.432   0.370   1.00 0.00 ? 58 LYS A HZ2  3  
ATOM 3161  H HZ3  . LYS A 1 58 ? 4.516   1.898   0.962   1.00 0.00 ? 58 LYS A HZ3  3  
ATOM 3162  N N    . ARG A 1 59 ? 6.711   -1.686  3.329   1.00 0.00 ? 59 ARG A N    3  
ATOM 3163  C CA   . ARG A 1 59 ? 7.575   -2.494  4.180   1.00 0.00 ? 59 ARG A CA   3  
ATOM 3164  C C    . ARG A 1 59 ? 9.018   -2.002  4.116   1.00 0.00 ? 59 ARG A C    3  
ATOM 3165  O O    . ARG A 1 59 ? 9.683   -1.861  5.142   1.00 0.00 ? 59 ARG A O    3  
ATOM 3166  C CB   . ARG A 1 59 ? 7.508   -3.964  3.761   1.00 0.00 ? 59 ARG A CB   3  
ATOM 3167  C CG   . ARG A 1 59 ? 6.440   -4.758  4.495   1.00 0.00 ? 59 ARG A CG   3  
ATOM 3168  C CD   . ARG A 1 59 ? 6.514   -6.239  4.156   1.00 0.00 ? 59 ARG A CD   3  
ATOM 3169  N NE   . ARG A 1 59 ? 7.710   -6.868  4.710   1.00 0.00 ? 59 ARG A NE   3  
ATOM 3170  C CZ   . ARG A 1 59 ? 7.801   -7.295  5.964   1.00 0.00 ? 59 ARG A CZ   3  
ATOM 3171  N NH1  . ARG A 1 59 ? 6.772   -7.162  6.790   1.00 0.00 ? 59 ARG A NH1  3  
ATOM 3172  N NH2  . ARG A 1 59 ? 8.923   -7.858  6.395   1.00 0.00 ? 59 ARG A NH2  3  
ATOM 3173  H H    . ARG A 1 59 ? 6.069   -2.132  2.738   1.00 0.00 ? 59 ARG A H    3  
ATOM 3174  H HA   . ARG A 1 59 ? 7.221   -2.402  5.196   1.00 0.00 ? 59 ARG A HA   3  
ATOM 3175  H HB2  . ARG A 1 59 ? 7.300   -4.016  2.703   1.00 0.00 ? 59 ARG A HB2  3  
ATOM 3176  H HB3  . ARG A 1 59 ? 8.465   -4.425  3.955   1.00 0.00 ? 59 ARG A HB3  3  
ATOM 3177  H HG2  . ARG A 1 59 ? 6.581   -4.637  5.559   1.00 0.00 ? 59 ARG A HG2  3  
ATOM 3178  H HG3  . ARG A 1 59 ? 5.468   -4.382  4.214   1.00 0.00 ? 59 ARG A HG3  3  
ATOM 3179  H HD2  . ARG A 1 59 ? 5.641   -6.731  4.557   1.00 0.00 ? 59 ARG A HD2  3  
ATOM 3180  H HD3  . ARG A 1 59 ? 6.526   -6.348  3.081   1.00 0.00 ? 59 ARG A HD3  3  
ATOM 3181  H HE   . ARG A 1 59 ? 8.482   -6.977  4.117   1.00 0.00 ? 59 ARG A HE   3  
ATOM 3182  H HH11 . ARG A 1 59 ? 5.925   -6.739  6.468   1.00 0.00 ? 59 ARG A HH11 3  
ATOM 3183  H HH12 . ARG A 1 59 ? 6.843   -7.486  7.734   1.00 0.00 ? 59 ARG A HH12 3  
ATOM 3184  H HH21 . ARG A 1 59 ? 9.700   -7.960  5.775   1.00 0.00 ? 59 ARG A HH21 3  
ATOM 3185  H HH22 . ARG A 1 59 ? 8.991   -8.179  7.339   1.00 0.00 ? 59 ARG A HH22 3  
ATOM 3186  N N    . SER A 1 60 ? 9.495   -1.742  2.903   1.00 0.00 ? 60 SER A N    3  
ATOM 3187  C CA   . SER A 1 60 ? 10.860  -1.269  2.704   1.00 0.00 ? 60 SER A CA   3  
ATOM 3188  C C    . SER A 1 60 ? 11.051  0.114   3.319   1.00 0.00 ? 60 SER A C    3  
ATOM 3189  O O    . SER A 1 60 ? 12.166  0.503   3.668   1.00 0.00 ? 60 SER A O    3  
ATOM 3190  C CB   . SER A 1 60 ? 11.195  -1.226  1.211   1.00 0.00 ? 60 SER A CB   3  
ATOM 3191  O OG   . SER A 1 60 ? 12.564  -0.925  1.004   1.00 0.00 ? 60 SER A OG   3  
ATOM 3192  H H    . SER A 1 60 ? 8.916   -1.874  2.123   1.00 0.00 ? 60 SER A H    3  
ATOM 3193  H HA   . SER A 1 60 ? 11.526  -1.963  3.194   1.00 0.00 ? 60 SER A HA   3  
ATOM 3194  H HB2  . SER A 1 60 ? 10.979  -2.187  0.769   1.00 0.00 ? 60 SER A HB2  3  
ATOM 3195  H HB3  . SER A 1 60 ? 10.595  -0.466  0.732   1.00 0.00 ? 60 SER A HB3  3  
ATOM 3196  H HG   . SER A 1 60 ? 13.107  -1.556  1.484   1.00 0.00 ? 60 SER A HG   3  
ATOM 3197  N N    . LYS A 1 61 ? 9.955   0.853   3.449   1.00 0.00 ? 61 LYS A N    3  
ATOM 3198  C CA   . LYS A 1 61 ? 9.998   2.193   4.023   1.00 0.00 ? 61 LYS A CA   3  
ATOM 3199  C C    . LYS A 1 61 ? 9.626   2.163   5.502   1.00 0.00 ? 61 LYS A C    3  
ATOM 3200  O O    . LYS A 1 61 ? 8.763   2.918   5.950   1.00 0.00 ? 61 LYS A O    3  
ATOM 3201  C CB   . LYS A 1 61 ? 9.049   3.125   3.267   1.00 0.00 ? 61 LYS A CB   3  
ATOM 3202  C CG   . LYS A 1 61 ? 9.537   4.562   3.196   1.00 0.00 ? 61 LYS A CG   3  
ATOM 3203  C CD   . LYS A 1 61 ? 9.306   5.295   4.507   1.00 0.00 ? 61 LYS A CD   3  
ATOM 3204  C CE   . LYS A 1 61 ? 7.823   5.424   4.819   1.00 0.00 ? 61 LYS A CE   3  
ATOM 3205  N NZ   . LYS A 1 61 ? 7.573   6.383   5.931   1.00 0.00 ? 61 LYS A NZ   3  
ATOM 3206  H H    . LYS A 1 61 ? 9.094   0.488   3.153   1.00 0.00 ? 61 LYS A H    3  
ATOM 3207  H HA   . LYS A 1 61 ? 11.007  2.563   3.926   1.00 0.00 ? 61 LYS A HA   3  
ATOM 3208  H HB2  . LYS A 1 61 ? 8.930   2.757   2.258   1.00 0.00 ? 61 LYS A HB2  3  
ATOM 3209  H HB3  . LYS A 1 61 ? 8.088   3.118   3.759   1.00 0.00 ? 61 LYS A HB3  3  
ATOM 3210  H HG2  . LYS A 1 61 ? 10.594  4.563   2.976   1.00 0.00 ? 61 LYS A HG2  3  
ATOM 3211  H HG3  . LYS A 1 61 ? 9.003   5.075   2.408   1.00 0.00 ? 61 LYS A HG3  3  
ATOM 3212  H HD2  . LYS A 1 61 ? 9.784   4.746   5.305   1.00 0.00 ? 61 LYS A HD2  3  
ATOM 3213  H HD3  . LYS A 1 61 ? 9.739   6.283   4.438   1.00 0.00 ? 61 LYS A HD3  3  
ATOM 3214  H HE2  . LYS A 1 61 ? 7.311   5.770   3.935   1.00 0.00 ? 61 LYS A HE2  3  
ATOM 3215  H HE3  . LYS A 1 61 ? 7.442   4.453   5.099   1.00 0.00 ? 61 LYS A HE3  3  
ATOM 3216  H HZ1  . LYS A 1 61 ? 6.992   5.932   6.667   1.00 0.00 ? 61 LYS A HZ1  3  
ATOM 3217  H HZ2  . LYS A 1 61 ? 7.070   7.220   5.574   1.00 0.00 ? 61 LYS A HZ2  3  
ATOM 3218  H HZ3  . LYS A 1 61 ? 8.474   6.686   6.352   1.00 0.00 ? 61 LYS A HZ3  3  
ATOM 3219  N N    . ILE A 1 62 ? 10.284  1.288   6.256   1.00 0.00 ? 62 ILE A N    3  
ATOM 3220  C CA   . ILE A 1 62 ? 10.024  1.163   7.684   1.00 0.00 ? 62 ILE A CA   3  
ATOM 3221  C C    . ILE A 1 62 ? 11.324  1.052   8.473   1.00 0.00 ? 62 ILE A C    3  
ATOM 3222  O O    . ILE A 1 62 ? 12.317  0.514   7.981   1.00 0.00 ? 62 ILE A O    3  
ATOM 3223  C CB   . ILE A 1 62 ? 9.143   -0.063  7.991   1.00 0.00 ? 62 ILE A CB   3  
ATOM 3224  C CG1  . ILE A 1 62 ? 7.942   -0.105  7.045   1.00 0.00 ? 62 ILE A CG1  3  
ATOM 3225  C CG2  . ILE A 1 62 ? 8.682   -0.034  9.441   1.00 0.00 ? 62 ILE A CG2  3  
ATOM 3226  C CD1  . ILE A 1 62 ? 6.827   -1.008  7.524   1.00 0.00 ? 62 ILE A CD1  3  
ATOM 3227  H H    . ILE A 1 62 ? 10.961  0.714   5.841   1.00 0.00 ? 62 ILE A H    3  
ATOM 3228  H HA   . ILE A 1 62 ? 9.496   2.050   8.006   1.00 0.00 ? 62 ILE A HA   3  
ATOM 3229  H HB   . ILE A 1 62 ? 9.739   -0.951  7.846   1.00 0.00 ? 62 ILE A HB   3  
ATOM 3230  H HG12 . ILE A 1 62 ? 7.540   0.890   6.939   1.00 0.00 ? 62 ILE A HG12 3  
ATOM 3231  H HG13 . ILE A 1 62 ? 8.267   -0.462  6.078   1.00 0.00 ? 62 ILE A HG13 3  
ATOM 3232  H HG21 . ILE A 1 62 ? 9.542   -0.070  10.093  1.00 0.00 ? 62 ILE A HG21 3  
ATOM 3233  H HG22 . ILE A 1 62 ? 8.130   0.875   9.625   1.00 0.00 ? 62 ILE A HG22 3  
ATOM 3234  H HG23 . ILE A 1 62 ? 8.048   -0.886  9.634   1.00 0.00 ? 62 ILE A HG23 3  
ATOM 3235  H HD11 . ILE A 1 62 ? 6.351   -0.566  8.387   1.00 0.00 ? 62 ILE A HD11 3  
ATOM 3236  H HD12 . ILE A 1 62 ? 6.100   -1.133  6.736   1.00 0.00 ? 62 ILE A HD12 3  
ATOM 3237  H HD13 . ILE A 1 62 ? 7.235   -1.971  7.794   1.00 0.00 ? 62 ILE A HD13 3  
ATOM 3238  N N    . LYS A 1 63 ? 11.312  1.561   9.700   1.00 0.00 ? 63 LYS A N    3  
ATOM 3239  C CA   . LYS A 1 63 ? 12.489  1.516   10.559  1.00 0.00 ? 63 LYS A CA   3  
ATOM 3240  C C    . LYS A 1 63 ? 13.559  2.484   10.066  1.00 0.00 ? 63 LYS A C    3  
ATOM 3241  O O    . LYS A 1 63 ? 14.750  2.172   10.088  1.00 0.00 ? 63 LYS A O    3  
ATOM 3242  C CB   . LYS A 1 63 ? 13.055  0.095   10.610  1.00 0.00 ? 63 LYS A CB   3  
ATOM 3243  C CG   . LYS A 1 63 ? 14.025  -0.132  11.756  1.00 0.00 ? 63 LYS A CG   3  
ATOM 3244  C CD   . LYS A 1 63 ? 14.541  -1.562  11.775  1.00 0.00 ? 63 LYS A CD   3  
ATOM 3245  C CE   . LYS A 1 63 ? 13.586  -2.488  12.512  1.00 0.00 ? 63 LYS A CE   3  
ATOM 3246  N NZ   . LYS A 1 63 ? 14.018  -3.911  12.427  1.00 0.00 ? 63 LYS A NZ   3  
ATOM 3247  H H    . LYS A 1 63 ? 10.490  1.976   10.036  1.00 0.00 ? 63 LYS A H    3  
ATOM 3248  H HA   . LYS A 1 63 ? 12.185  1.809   11.553  1.00 0.00 ? 63 LYS A HA   3  
ATOM 3249  H HB2  . LYS A 1 63 ? 12.237  -0.602  10.715  1.00 0.00 ? 63 LYS A HB2  3  
ATOM 3250  H HB3  . LYS A 1 63 ? 13.572  -0.106  9.683   1.00 0.00 ? 63 LYS A HB3  3  
ATOM 3251  H HG2  . LYS A 1 63 ? 14.863  0.540   11.645  1.00 0.00 ? 63 LYS A HG2  3  
ATOM 3252  H HG3  . LYS A 1 63 ? 13.520  0.071   12.689  1.00 0.00 ? 63 LYS A HG3  3  
ATOM 3253  H HD2  . LYS A 1 63 ? 14.649  -1.910  10.759  1.00 0.00 ? 63 LYS A HD2  3  
ATOM 3254  H HD3  . LYS A 1 63 ? 15.502  -1.582  12.269  1.00 0.00 ? 63 LYS A HD3  3  
ATOM 3255  H HE2  . LYS A 1 63 ? 13.549  -2.194  13.550  1.00 0.00 ? 63 LYS A HE2  3  
ATOM 3256  H HE3  . LYS A 1 63 ? 12.603  -2.392  12.076  1.00 0.00 ? 63 LYS A HE3  3  
ATOM 3257  H HZ1  . LYS A 1 63 ? 13.694  -4.433  13.267  1.00 0.00 ? 63 LYS A HZ1  3  
ATOM 3258  H HZ2  . LYS A 1 63 ? 15.055  -3.967  12.376  1.00 0.00 ? 63 LYS A HZ2  3  
ATOM 3259  H HZ3  . LYS A 1 63 ? 13.615  -4.357  11.578  1.00 0.00 ? 63 LYS A HZ3  3  
ATOM 3260  N N    . LYS A 1 64 ? 13.128  3.660   9.624   1.00 0.00 ? 64 LYS A N    3  
ATOM 3261  C CA   . LYS A 1 64 ? 14.050  4.676   9.128   1.00 0.00 ? 64 LYS A CA   3  
ATOM 3262  C C    . LYS A 1 64 ? 14.411  5.667   10.229  1.00 0.00 ? 64 LYS A C    3  
ATOM 3263  O O    . LYS A 1 64 ? 13.624  5.905   11.146  1.00 0.00 ? 64 LYS A O    3  
ATOM 3264  C CB   . LYS A 1 64 ? 13.432  5.419   7.941   1.00 0.00 ? 64 LYS A CB   3  
ATOM 3265  C CG   . LYS A 1 64 ? 13.525  4.656   6.631   1.00 0.00 ? 64 LYS A CG   3  
ATOM 3266  C CD   . LYS A 1 64 ? 14.806  4.988   5.883   1.00 0.00 ? 64 LYS A CD   3  
ATOM 3267  C CE   . LYS A 1 64 ? 14.972  4.116   4.648   1.00 0.00 ? 64 LYS A CE   3  
ATOM 3268  N NZ   . LYS A 1 64 ? 16.394  4.035   4.213   1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3269  H H    . LYS A 1 64 ? 12.166  3.851   9.631   1.00 0.00 ? 64 LYS A H    3  
ATOM 3270  H HA   . LYS A 1 64 ? 14.949  4.177   8.800   1.00 0.00 ? 64 LYS A HA   3  
ATOM 3271  H HB2  . LYS A 1 64 ? 12.389  5.605   8.152   1.00 0.00 ? 64 LYS A HB2  3  
ATOM 3272  H HB3  . LYS A 1 64 ? 13.940  6.365   7.820   1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3273  H HG2  . LYS A 1 64 ? 13.507  3.597   6.839   1.00 0.00 ? 64 LYS A HG2  3  
ATOM 3274  H HG3  . LYS A 1 64 ? 12.680  4.919   6.011   1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3275  H HD2  . LYS A 1 64 ? 14.777  6.023   5.578   1.00 0.00 ? 64 LYS A HD2  3  
ATOM 3276  H HD3  . LYS A 1 64 ? 15.648  4.828   6.542   1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3277  H HE2  . LYS A 1 64 ? 14.617  3.122   4.875   1.00 0.00 ? 64 LYS A HE2  3  
ATOM 3278  H HE3  . LYS A 1 64 ? 14.382  4.535   3.846   1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3279  H HZ1  . LYS A 1 64 ? 16.647  3.048   4.003   1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3280  H HZ2  . LYS A 1 64 ? 17.018  4.388   4.966   1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3281  H HZ3  . LYS A 1 64 ? 16.540  4.609   3.358   1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3282  N N    . SER A 1 65 ? 15.604  6.244   10.132  1.00 0.00 ? 65 SER A N    3  
ATOM 3283  C CA   . SER A 1 65 ? 16.070  7.209   11.122  1.00 0.00 ? 65 SER A CA   3  
ATOM 3284  C C    . SER A 1 65 ? 15.402  8.565   10.916  1.00 0.00 ? 65 SER A C    3  
ATOM 3285  O O    . SER A 1 65 ? 15.803  9.342   10.050  1.00 0.00 ? 65 SER A O    3  
ATOM 3286  C CB   . SER A 1 65 ? 17.590  7.359   11.042  1.00 0.00 ? 65 SER A CB   3  
ATOM 3287  O OG   . SER A 1 65 ? 18.244  6.225   11.585  1.00 0.00 ? 65 SER A OG   3  
ATOM 3288  H H    . SER A 1 65 ? 16.186  6.014   9.378   1.00 0.00 ? 65 SER A H    3  
ATOM 3289  H HA   . SER A 1 65 ? 15.805  6.835   12.100  1.00 0.00 ? 65 SER A HA   3  
ATOM 3290  H HB2  . SER A 1 65 ? 17.885  7.470   10.010  1.00 0.00 ? 65 SER A HB2  3  
ATOM 3291  H HB3  . SER A 1 65 ? 17.892  8.235   11.598  1.00 0.00 ? 65 SER A HB3  3  
ATOM 3292  H HG   . SER A 1 65 ? 17.706  5.850   12.285  1.00 0.00 ? 65 SER A HG   3  
ATOM 3293  N N    . GLY A 1 66 ? 14.379  8.842   11.719  1.00 0.00 ? 66 GLY A N    3  
ATOM 3294  C CA   . GLY A 1 66 ? 13.670  10.103  11.609  1.00 0.00 ? 66 GLY A CA   3  
ATOM 3295  C C    . GLY A 1 66 ? 13.989  11.048  12.751  1.00 0.00 ? 66 GLY A C    3  
ATOM 3296  O O    . GLY A 1 66 ? 14.356  10.629  13.848  1.00 0.00 ? 66 GLY A O    3  
ATOM 3297  H H    . GLY A 1 66 ? 14.103  8.184   12.391  1.00 0.00 ? 66 GLY A H    3  
ATOM 3298  H HA2  . GLY A 1 66 ? 13.942  10.576  10.677  1.00 0.00 ? 66 GLY A HA2  3  
ATOM 3299  H HA3  . GLY A 1 66 ? 12.608  9.907   11.606  1.00 0.00 ? 66 GLY A HA3  3  
ATOM 3300  N N    . PRO A 1 67 ? 13.851  12.358  12.496  1.00 0.00 ? 67 PRO A N    3  
ATOM 3301  C CA   . PRO A 1 67 ? 14.123  13.392  13.498  1.00 0.00 ? 67 PRO A CA   3  
ATOM 3302  C C    . PRO A 1 67 ? 13.089  13.401  14.618  1.00 0.00 ? 67 PRO A C    3  
ATOM 3303  O O    . PRO A 1 67 ? 13.235  14.121  15.606  1.00 0.00 ? 67 PRO A O    3  
ATOM 3304  C CB   . PRO A 1 67 ? 14.052  14.693  12.694  1.00 0.00 ? 67 PRO A CB   3  
ATOM 3305  C CG   . PRO A 1 67 ? 13.168  14.376  11.538  1.00 0.00 ? 67 PRO A CG   3  
ATOM 3306  C CD   . PRO A 1 67 ? 13.418  12.930  11.210  1.00 0.00 ? 67 PRO A CD   3  
ATOM 3307  H HA   . PRO A 1 67 ? 15.111  13.283  13.923  1.00 0.00 ? 67 PRO A HA   3  
ATOM 3308  H HB2  . PRO A 1 67 ? 13.634  15.477  13.309  1.00 0.00 ? 67 PRO A HB2  3  
ATOM 3309  H HB3  . PRO A 1 67 ? 15.043  14.973  12.368  1.00 0.00 ? 67 PRO A HB3  3  
ATOM 3310  H HG2  . PRO A 1 67 ? 12.135  14.524  11.814  1.00 0.00 ? 67 PRO A HG2  3  
ATOM 3311  H HG3  . PRO A 1 67 ? 13.426  15.001  10.696  1.00 0.00 ? 67 PRO A HG3  3  
ATOM 3312  H HD2  . PRO A 1 67 ? 12.510  12.459  10.865  1.00 0.00 ? 67 PRO A HD2  3  
ATOM 3313  H HD3  . PRO A 1 67 ? 14.197  12.841  10.467  1.00 0.00 ? 67 PRO A HD3  3  
ATOM 3314  N N    . SER A 1 68 ? 12.042  12.598  14.457  1.00 0.00 ? 68 SER A N    3  
ATOM 3315  C CA   . SER A 1 68 ? 10.981  12.516  15.454  1.00 0.00 ? 68 SER A CA   3  
ATOM 3316  C C    . SER A 1 68 ? 10.164  11.239  15.274  1.00 0.00 ? 68 SER A C    3  
ATOM 3317  O O    . SER A 1 68 ? 9.919   10.799  14.151  1.00 0.00 ? 68 SER A O    3  
ATOM 3318  C CB   . SER A 1 68 ? 10.066  13.738  15.357  1.00 0.00 ? 68 SER A CB   3  
ATOM 3319  O OG   . SER A 1 68 ? 9.332   13.731  14.144  1.00 0.00 ? 68 SER A OG   3  
ATOM 3320  H H    . SER A 1 68 ? 11.982  12.048  13.647  1.00 0.00 ? 68 SER A H    3  
ATOM 3321  H HA   . SER A 1 68 ? 11.443  12.499  16.429  1.00 0.00 ? 68 SER A HA   3  
ATOM 3322  H HB2  . SER A 1 68 ? 9.372   13.731  16.183  1.00 0.00 ? 68 SER A HB2  3  
ATOM 3323  H HB3  . SER A 1 68 ? 10.665  14.636  15.397  1.00 0.00 ? 68 SER A HB3  3  
ATOM 3324  H HG   . SER A 1 68 ? 9.830   13.260  13.472  1.00 0.00 ? 68 SER A HG   3  
ATOM 3325  N N    . SER A 1 69 ? 9.746   10.650  16.389  1.00 0.00 ? 69 SER A N    3  
ATOM 3326  C CA   . SER A 1 69 ? 8.960   9.422   16.357  1.00 0.00 ? 69 SER A CA   3  
ATOM 3327  C C    . SER A 1 69 ? 7.467   9.734   16.303  1.00 0.00 ? 69 SER A C    3  
ATOM 3328  O O    . SER A 1 69 ? 6.738   9.193   15.473  1.00 0.00 ? 69 SER A O    3  
ATOM 3329  C CB   . SER A 1 69 ? 9.269   8.561   17.583  1.00 0.00 ? 69 SER A CB   3  
ATOM 3330  O OG   . SER A 1 69 ? 10.661  8.322   17.700  1.00 0.00 ? 69 SER A OG   3  
ATOM 3331  H H    . SER A 1 69 ? 9.973   11.050  17.255  1.00 0.00 ? 69 SER A H    3  
ATOM 3332  H HA   . SER A 1 69 ? 9.234   8.877   15.466  1.00 0.00 ? 69 SER A HA   3  
ATOM 3333  H HB2  . SER A 1 69 ? 8.927   9.069   18.472  1.00 0.00 ? 69 SER A HB2  3  
ATOM 3334  H HB3  . SER A 1 69 ? 8.759   7.613   17.491  1.00 0.00 ? 69 SER A HB3  3  
ATOM 3335  H HG   . SER A 1 69 ? 10.807  7.426   18.012  1.00 0.00 ? 69 SER A HG   3  
ATOM 3336  N N    . GLY A 1 70 ? 7.020   10.610  17.197  1.00 0.00 ? 70 GLY A N    3  
ATOM 3337  C CA   . GLY A 1 70 ? 5.617   10.979  17.236  1.00 0.00 ? 70 GLY A CA   3  
ATOM 3338  C C    . GLY A 1 70 ? 4.936   10.538  18.516  1.00 0.00 ? 70 GLY A C    3  
ATOM 3339  O O    . GLY A 1 70 ? 3.890   9.891   18.480  1.00 0.00 ? 70 GLY A O    3  
ATOM 3340  H H    . GLY A 1 70 ? 7.647   11.010  17.835  1.00 0.00 ? 70 GLY A H    3  
ATOM 3341  H HA2  . GLY A 1 70 ? 5.535   12.053  17.148  1.00 0.00 ? 70 GLY A HA2  3  
ATOM 3342  H HA3  . GLY A 1 70 ? 5.113   10.521  16.398  1.00 0.00 ? 70 GLY A HA3  3  
ATOM 3343  N N    . GLY A 1 1  ? 14.959  3.204   -10.652 1.00 0.00 ? 1  GLY A N    4  
ATOM 3344  C CA   . GLY A 1 1  ? 14.485  4.249   -9.764  1.00 0.00 ? 1  GLY A CA   4  
ATOM 3345  C C    . GLY A 1 1  ? 13.809  5.382   -10.511 1.00 0.00 ? 1  GLY A C    4  
ATOM 3346  O O    . GLY A 1 1  ? 14.478  6.253   -11.068 1.00 0.00 ? 1  GLY A O    4  
ATOM 3347  H H1   . GLY A 1 1  ? 15.628  3.412   -11.338 1.00 0.00 ? 1  GLY A H1   4  
ATOM 3348  H HA2  . GLY A 1 1  ? 13.781  3.821   -9.066  1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3349  H HA3  . GLY A 1 1  ? 15.325  4.647   -9.214  1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3350  N N    . SER A 1 2  ? 12.480  5.370   -10.524 1.00 0.00 ? 2  SER A N    4  
ATOM 3351  C CA   . SER A 1 2  ? 11.714  6.402   -11.213 1.00 0.00 ? 2  SER A CA   4  
ATOM 3352  C C    . SER A 1 2  ? 12.057  7.786   -10.672 1.00 0.00 ? 2  SER A C    4  
ATOM 3353  O O    . SER A 1 2  ? 12.257  8.731   -11.435 1.00 0.00 ? 2  SER A O    4  
ATOM 3354  C CB   . SER A 1 2  ? 10.214  6.140   -11.061 1.00 0.00 ? 2  SER A CB   4  
ATOM 3355  O OG   . SER A 1 2  ? 9.807   6.277   -9.711  1.00 0.00 ? 2  SER A OG   4  
ATOM 3356  H H    . SER A 1 2  ? 12.004  4.649   -10.061 1.00 0.00 ? 2  SER A H    4  
ATOM 3357  H HA   . SER A 1 2  ? 11.973  6.363   -12.261 1.00 0.00 ? 2  SER A HA   4  
ATOM 3358  H HB2  . SER A 1 2  ? 9.665   6.847   -11.664 1.00 0.00 ? 2  SER A HB2  4  
ATOM 3359  H HB3  . SER A 1 2  ? 9.992   5.136   -11.392 1.00 0.00 ? 2  SER A HB3  4  
ATOM 3360  H HG   . SER A 1 2  ? 9.688   5.407   -9.322  1.00 0.00 ? 2  SER A HG   4  
ATOM 3361  N N    . SER A 1 3  ? 12.123  7.898   -9.349  1.00 0.00 ? 3  SER A N    4  
ATOM 3362  C CA   . SER A 1 3  ? 12.438  9.167   -8.704  1.00 0.00 ? 3  SER A CA   4  
ATOM 3363  C C    . SER A 1 3  ? 12.707  8.968   -7.215  1.00 0.00 ? 3  SER A C    4  
ATOM 3364  O O    . SER A 1 3  ? 12.101  8.112   -6.573  1.00 0.00 ? 3  SER A O    4  
ATOM 3365  C CB   . SER A 1 3  ? 11.291  10.161  -8.898  1.00 0.00 ? 3  SER A CB   4  
ATOM 3366  O OG   . SER A 1 3  ? 10.105  9.699   -8.275  1.00 0.00 ? 3  SER A OG   4  
ATOM 3367  H H    . SER A 1 3  ? 11.953  7.108   -8.794  1.00 0.00 ? 3  SER A H    4  
ATOM 3368  H HA   . SER A 1 3  ? 13.329  9.563   -9.169  1.00 0.00 ? 3  SER A HA   4  
ATOM 3369  H HB2  . SER A 1 3  ? 11.564  11.111  -8.465  1.00 0.00 ? 3  SER A HB2  4  
ATOM 3370  H HB3  . SER A 1 3  ? 11.103  10.287  -9.954  1.00 0.00 ? 3  SER A HB3  4  
ATOM 3371  H HG   . SER A 1 3  ? 9.982   8.767   -8.471  1.00 0.00 ? 3  SER A HG   4  
ATOM 3372  N N    . GLY A 1 4  ? 13.623  9.766   -6.674  1.00 0.00 ? 4  GLY A N    4  
ATOM 3373  C CA   . GLY A 1 4  ? 13.957  9.662   -5.265  1.00 0.00 ? 4  GLY A CA   4  
ATOM 3374  C C    . GLY A 1 4  ? 13.732  10.962  -4.519  1.00 0.00 ? 4  GLY A C    4  
ATOM 3375  O O    . GLY A 1 4  ? 14.686  11.648  -4.151  1.00 0.00 ? 4  GLY A O    4  
ATOM 3376  H H    . GLY A 1 4  ? 14.075  10.431  -7.235  1.00 0.00 ? 4  GLY A H    4  
ATOM 3377  H HA2  . GLY A 1 4  ? 13.348  8.891   -4.818  1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3378  H HA3  . GLY A 1 4  ? 14.997  9.384   -5.174  1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3379  N N    . SER A 1 5  ? 12.467  11.303  -4.295  1.00 0.00 ? 5  SER A N    4  
ATOM 3380  C CA   . SER A 1 5  ? 12.119  12.532  -3.592  1.00 0.00 ? 5  SER A CA   4  
ATOM 3381  C C    . SER A 1 5  ? 11.116  12.255  -2.477  1.00 0.00 ? 5  SER A C    4  
ATOM 3382  O O    . SER A 1 5  ? 10.377  11.272  -2.522  1.00 0.00 ? 5  SER A O    4  
ATOM 3383  C CB   . SER A 1 5  ? 11.541  13.557  -4.570  1.00 0.00 ? 5  SER A CB   4  
ATOM 3384  O OG   . SER A 1 5  ? 12.562  14.134  -5.367  1.00 0.00 ? 5  SER A OG   4  
ATOM 3385  H H    . SER A 1 5  ? 11.750  10.714  -4.613  1.00 0.00 ? 5  SER A H    4  
ATOM 3386  H HA   . SER A 1 5  ? 13.023  12.932  -3.157  1.00 0.00 ? 5  SER A HA   4  
ATOM 3387  H HB2  . SER A 1 5  ? 10.827  13.071  -5.217  1.00 0.00 ? 5  SER A HB2  4  
ATOM 3388  H HB3  . SER A 1 5  ? 11.048  14.342  -4.014  1.00 0.00 ? 5  SER A HB3  4  
ATOM 3389  H HG   . SER A 1 5  ? 12.780  15.005  -5.027  1.00 0.00 ? 5  SER A HG   4  
ATOM 3390  N N    . SER A 1 6  ? 11.097  13.129  -1.476  1.00 0.00 ? 6  SER A N    4  
ATOM 3391  C CA   . SER A 1 6  ? 10.189  12.977  -0.345  1.00 0.00 ? 6  SER A CA   4  
ATOM 3392  C C    . SER A 1 6  ? 9.793   14.338  0.220   1.00 0.00 ? 6  SER A C    4  
ATOM 3393  O O    . SER A 1 6  ? 10.629  15.068  0.752   1.00 0.00 ? 6  SER A O    4  
ATOM 3394  C CB   . SER A 1 6  ? 10.838  12.127  0.748   1.00 0.00 ? 6  SER A CB   4  
ATOM 3395  O OG   . SER A 1 6  ? 9.980   11.993  1.868   1.00 0.00 ? 6  SER A OG   4  
ATOM 3396  H H    . SER A 1 6  ? 11.712  13.892  -1.497  1.00 0.00 ? 6  SER A H    4  
ATOM 3397  H HA   . SER A 1 6  ? 9.300   12.476  -0.699  1.00 0.00 ? 6  SER A HA   4  
ATOM 3398  H HB2  . SER A 1 6  ? 11.054  11.145  0.356   1.00 0.00 ? 6  SER A HB2  4  
ATOM 3399  H HB3  . SER A 1 6  ? 11.757  12.597  1.068   1.00 0.00 ? 6  SER A HB3  4  
ATOM 3400  H HG   . SER A 1 6  ? 9.066   12.048  1.579   1.00 0.00 ? 6  SER A HG   4  
ATOM 3401  N N    . GLY A 1 7  ? 8.512   14.672  0.100   1.00 0.00 ? 7  GLY A N    4  
ATOM 3402  C CA   . GLY A 1 7  ? 8.027   15.944  0.604   1.00 0.00 ? 7  GLY A CA   4  
ATOM 3403  C C    . GLY A 1 7  ? 6.516   16.052  0.547   1.00 0.00 ? 7  GLY A C    4  
ATOM 3404  O O    . GLY A 1 7  ? 5.806   15.122  0.928   1.00 0.00 ? 7  GLY A O    4  
ATOM 3405  H H    . GLY A 1 7  ? 7.891   14.050  -0.333  1.00 0.00 ? 7  GLY A H    4  
ATOM 3406  H HA2  . GLY A 1 7  ? 8.348   16.059  1.628   1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3407  H HA3  . GLY A 1 7  ? 8.456   16.739  0.011   1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3408  N N    . ARG A 1 8  ? 6.024   17.191  0.070   1.00 0.00 ? 8  ARG A N    4  
ATOM 3409  C CA   . ARG A 1 8  ? 4.587   17.418  -0.032  1.00 0.00 ? 8  ARG A CA   4  
ATOM 3410  C C    . ARG A 1 8  ? 4.166   17.587  -1.489  1.00 0.00 ? 8  ARG A C    4  
ATOM 3411  O O    . ARG A 1 8  ? 4.640   18.487  -2.184  1.00 0.00 ? 8  ARG A O    4  
ATOM 3412  C CB   . ARG A 1 8  ? 4.186   18.656  0.773   1.00 0.00 ? 8  ARG A CB   4  
ATOM 3413  C CG   . ARG A 1 8  ? 2.720   18.673  1.173   1.00 0.00 ? 8  ARG A CG   4  
ATOM 3414  C CD   . ARG A 1 8  ? 1.813   18.819  -0.039  1.00 0.00 ? 8  ARG A CD   4  
ATOM 3415  N NE   . ARG A 1 8  ? 0.570   19.513  0.288   1.00 0.00 ? 8  ARG A NE   4  
ATOM 3416  C CZ   . ARG A 1 8  ? 0.522   20.761  0.739   1.00 0.00 ? 8  ARG A CZ   4  
ATOM 3417  N NH1  . ARG A 1 8  ? 1.642   21.449  0.916   1.00 0.00 ? 8  ARG A NH1  4  
ATOM 3418  N NH2  . ARG A 1 8  ? -0.647  21.324  1.014   1.00 0.00 ? 8  ARG A NH2  4  
ATOM 3419  H H    . ARG A 1 8  ? 6.641   17.896  -0.218  1.00 0.00 ? 8  ARG A H    4  
ATOM 3420  H HA   . ARG A 1 8  ? 4.084   16.555  0.377   1.00 0.00 ? 8  ARG A HA   4  
ATOM 3421  H HB2  . ARG A 1 8  ? 4.783   18.695  1.672   1.00 0.00 ? 8  ARG A HB2  4  
ATOM 3422  H HB3  . ARG A 1 8  ? 4.385   19.536  0.180   1.00 0.00 ? 8  ARG A HB3  4  
ATOM 3423  H HG2  . ARG A 1 8  ? 2.483   17.747  1.677   1.00 0.00 ? 8  ARG A HG2  4  
ATOM 3424  H HG3  . ARG A 1 8  ? 2.549   19.503  1.842   1.00 0.00 ? 8  ARG A HG3  4  
ATOM 3425  H HD2  . ARG A 1 8  ? 2.338   19.379  -0.799  1.00 0.00 ? 8  ARG A HD2  4  
ATOM 3426  H HD3  . ARG A 1 8  ? 1.577   17.835  -0.415  1.00 0.00 ? 8  ARG A HD3  4  
ATOM 3427  H HE   . ARG A 1 8  ? -0.269  19.023  0.165   1.00 0.00 ? 8  ARG A HE   4  
ATOM 3428  H HH11 . ARG A 1 8  ? 2.525   21.028  0.709   1.00 0.00 ? 8  ARG A HH11 4  
ATOM 3429  H HH12 . ARG A 1 8  ? 1.603   22.389  1.255   1.00 0.00 ? 8  ARG A HH12 4  
ATOM 3430  H HH21 . ARG A 1 8  ? -1.493  20.809  0.882   1.00 0.00 ? 8  ARG A HH21 4  
ATOM 3431  H HH22 . ARG A 1 8  ? -0.682  22.263  1.354   1.00 0.00 ? 8  ARG A HH22 4  
ATOM 3432  N N    . LYS A 1 9  ? 3.273   16.716  -1.947  1.00 0.00 ? 9  LYS A N    4  
ATOM 3433  C CA   . LYS A 1 9  ? 2.787   16.769  -3.320  1.00 0.00 ? 9  LYS A CA   4  
ATOM 3434  C C    . LYS A 1 9  ? 1.262   16.812  -3.357  1.00 0.00 ? 9  LYS A C    4  
ATOM 3435  O O    . LYS A 1 9  ? 0.580   16.188  -2.543  1.00 0.00 ? 9  LYS A O    4  
ATOM 3436  C CB   . LYS A 1 9  ? 3.292   15.558  -4.108  1.00 0.00 ? 9  LYS A CB   4  
ATOM 3437  C CG   . LYS A 1 9  ? 4.807   15.472  -4.187  1.00 0.00 ? 9  LYS A CG   4  
ATOM 3438  C CD   . LYS A 1 9  ? 5.270   14.057  -4.487  1.00 0.00 ? 9  LYS A CD   4  
ATOM 3439  C CE   . LYS A 1 9  ? 5.309   13.789  -5.984  1.00 0.00 ? 9  LYS A CE   4  
ATOM 3440  N NZ   . LYS A 1 9  ? 6.368   14.587  -6.663  1.00 0.00 ? 9  LYS A NZ   4  
ATOM 3441  H H    . LYS A 1 9  ? 2.932   16.021  -1.345  1.00 0.00 ? 9  LYS A H    4  
ATOM 3442  H HA   . LYS A 1 9  ? 3.171   17.669  -3.774  1.00 0.00 ? 9  LYS A HA   4  
ATOM 3443  H HB2  . LYS A 1 9  ? 2.925   14.658  -3.637  1.00 0.00 ? 9  LYS A HB2  4  
ATOM 3444  H HB3  . LYS A 1 9  ? 2.903   15.611  -5.115  1.00 0.00 ? 9  LYS A HB3  4  
ATOM 3445  H HG2  . LYS A 1 9  ? 5.155   16.128  -4.971  1.00 0.00 ? 9  LYS A HG2  4  
ATOM 3446  H HG3  . LYS A 1 9  ? 5.225   15.785  -3.241  1.00 0.00 ? 9  LYS A HG3  4  
ATOM 3447  H HD2  . LYS A 1 9  ? 6.262   13.919  -4.083  1.00 0.00 ? 9  LYS A HD2  4  
ATOM 3448  H HD3  . LYS A 1 9  ? 4.589   13.358  -4.023  1.00 0.00 ? 9  LYS A HD3  4  
ATOM 3449  H HE2  . LYS A 1 9  ? 5.503   12.740  -6.144  1.00 0.00 ? 9  LYS A HE2  4  
ATOM 3450  H HE3  . LYS A 1 9  ? 4.349   14.046  -6.407  1.00 0.00 ? 9  LYS A HE3  4  
ATOM 3451  H HZ1  . LYS A 1 9  ? 5.943   15.203  -7.385  1.00 0.00 ? 9  LYS A HZ1  4  
ATOM 3452  H HZ2  . LYS A 1 9  ? 7.052   13.954  -7.123  1.00 0.00 ? 9  LYS A HZ2  4  
ATOM 3453  H HZ3  . LYS A 1 9  ? 6.870   15.178  -5.970  1.00 0.00 ? 9  LYS A HZ3  4  
ATOM 3454  N N    . PRO A 1 10 ? 0.714   17.563  -4.322  1.00 0.00 ? 10 PRO A N    4  
ATOM 3455  C CA   . PRO A 1 10 ? -0.736  17.703  -4.489  1.00 0.00 ? 10 PRO A CA   4  
ATOM 3456  C C    . PRO A 1 10 ? -1.390  16.417  -4.982  1.00 0.00 ? 10 PRO A C    4  
ATOM 3457  O O    . PRO A 1 10 ? -2.570  16.173  -4.729  1.00 0.00 ? 10 PRO A O    4  
ATOM 3458  C CB   . PRO A 1 10 ? -0.867  18.808  -5.541  1.00 0.00 ? 10 PRO A CB   4  
ATOM 3459  C CG   . PRO A 1 10 ? 0.407   18.752  -6.310  1.00 0.00 ? 10 PRO A CG   4  
ATOM 3460  C CD   . PRO A 1 10 ? 1.466   18.334  -5.327  1.00 0.00 ? 10 PRO A CD   4  
ATOM 3461  H HA   . PRO A 1 10 ? -1.212  18.019  -3.572  1.00 0.00 ? 10 PRO A HA   4  
ATOM 3462  H HB2  . PRO A 1 10 ? -1.721  18.606  -6.173  1.00 0.00 ? 10 PRO A HB2  4  
ATOM 3463  H HB3  . PRO A 1 10 ? -0.992  19.762  -5.052  1.00 0.00 ? 10 PRO A HB3  4  
ATOM 3464  H HG2  . PRO A 1 10 ? 0.325   18.026  -7.104  1.00 0.00 ? 10 PRO A HG2  4  
ATOM 3465  H HG3  . PRO A 1 10 ? 0.635   19.727  -6.713  1.00 0.00 ? 10 PRO A HG3  4  
ATOM 3466  H HD2  . PRO A 1 10 ? 2.207   17.715  -5.811  1.00 0.00 ? 10 PRO A HD2  4  
ATOM 3467  H HD3  . PRO A 1 10 ? 1.929   19.201  -4.879  1.00 0.00 ? 10 PRO A HD3  4  
ATOM 3468  N N    . ARG A 1 11 ? -0.616  15.598  -5.687  1.00 0.00 ? 11 ARG A N    4  
ATOM 3469  C CA   . ARG A 1 11 ? -1.121  14.337  -6.217  1.00 0.00 ? 11 ARG A CA   4  
ATOM 3470  C C    . ARG A 1 11 ? -0.203  13.180  -5.834  1.00 0.00 ? 11 ARG A C    4  
ATOM 3471  O O    . ARG A 1 11 ? 1.002   13.221  -6.084  1.00 0.00 ? 11 ARG A O    4  
ATOM 3472  C CB   . ARG A 1 11 ? -1.254  14.416  -7.739  1.00 0.00 ? 11 ARG A CB   4  
ATOM 3473  C CG   . ARG A 1 11 ? -2.276  13.446  -8.311  1.00 0.00 ? 11 ARG A CG   4  
ATOM 3474  C CD   . ARG A 1 11 ? -3.662  14.069  -8.372  1.00 0.00 ? 11 ARG A CD   4  
ATOM 3475  N NE   . ARG A 1 11 ? -3.785  15.026  -9.469  1.00 0.00 ? 11 ARG A NE   4  
ATOM 3476  C CZ   . ARG A 1 11 ? -4.945  15.515  -9.890  1.00 0.00 ? 11 ARG A CZ   4  
ATOM 3477  N NH1  . ARG A 1 11 ? -6.077  15.141  -9.309  1.00 0.00 ? 11 ARG A NH1  4  
ATOM 3478  N NH2  . ARG A 1 11 ? -4.976  16.382  -10.894 1.00 0.00 ? 11 ARG A NH2  4  
ATOM 3479  H H    . ARG A 1 11 ? 0.316   15.848  -5.856  1.00 0.00 ? 11 ARG A H    4  
ATOM 3480  H HA   . ARG A 1 11 ? -2.097  14.164  -5.787  1.00 0.00 ? 11 ARG A HA   4  
ATOM 3481  H HB2  . ARG A 1 11 ? -1.550  15.418  -8.012  1.00 0.00 ? 11 ARG A HB2  4  
ATOM 3482  H HB3  . ARG A 1 11 ? -0.295  14.198  -8.183  1.00 0.00 ? 11 ARG A HB3  4  
ATOM 3483  H HG2  . ARG A 1 11 ? -1.974  13.169  -9.311  1.00 0.00 ? 11 ARG A HG2  4  
ATOM 3484  H HG3  . ARG A 1 11 ? -2.312  12.566  -7.687  1.00 0.00 ? 11 ARG A HG3  4  
ATOM 3485  H HD2  . ARG A 1 11 ? -4.389  13.283  -8.510  1.00 0.00 ? 11 ARG A HD2  4  
ATOM 3486  H HD3  . ARG A 1 11 ? -3.854  14.578  -7.439  1.00 0.00 ? 11 ARG A HD3  4  
ATOM 3487  H HE   . ARG A 1 11 ? -2.961  15.316  -9.912  1.00 0.00 ? 11 ARG A HE   4  
ATOM 3488  H HH11 . ARG A 1 11 ? -6.057  14.488  -8.552  1.00 0.00 ? 11 ARG A HH11 4  
ATOM 3489  H HH12 . ARG A 1 11 ? -6.949  15.512  -9.627  1.00 0.00 ? 11 ARG A HH12 4  
ATOM 3490  H HH21 . ARG A 1 11 ? -4.125  16.667  -11.334 1.00 0.00 ? 11 ARG A HH21 4  
ATOM 3491  H HH22 . ARG A 1 11 ? -5.849  16.750  -11.210 1.00 0.00 ? 11 ARG A HH22 4  
ATOM 3492  N N    . THR A 1 12 ? -0.780  12.149  -5.226  1.00 0.00 ? 12 THR A N    4  
ATOM 3493  C CA   . THR A 1 12 ? -0.015  10.982  -4.808  1.00 0.00 ? 12 THR A CA   4  
ATOM 3494  C C    . THR A 1 12 ? -0.380  9.757   -5.639  1.00 0.00 ? 12 THR A C    4  
ATOM 3495  O O    . THR A 1 12 ? -1.453  9.702   -6.241  1.00 0.00 ? 12 THR A O    4  
ATOM 3496  C CB   . THR A 1 12 ? -0.244  10.664  -3.318  1.00 0.00 ? 12 THR A CB   4  
ATOM 3497  O OG1  . THR A 1 12 ? 0.047   11.816  -2.520  1.00 0.00 ? 12 THR A OG1  4  
ATOM 3498  C CG2  . THR A 1 12 ? 0.628   9.499   -2.873  1.00 0.00 ? 12 THR A CG2  4  
ATOM 3499  H H    . THR A 1 12 ? -1.745  12.175  -5.055  1.00 0.00 ? 12 THR A H    4  
ATOM 3500  H HA   . THR A 1 12 ? 1.034   11.202  -4.950  1.00 0.00 ? 12 THR A HA   4  
ATOM 3501  H HB   . THR A 1 12 ? -1.281  10.392  -3.180  1.00 0.00 ? 12 THR A HB   4  
ATOM 3502  H HG1  . THR A 1 12 ? -0.719  12.395  -2.502  1.00 0.00 ? 12 THR A HG1  4  
ATOM 3503  H HG21 . THR A 1 12 ? 0.485   9.326   -1.817  1.00 0.00 ? 12 THR A HG21 4  
ATOM 3504  H HG22 . THR A 1 12 ? 1.665   9.733   -3.063  1.00 0.00 ? 12 THR A HG22 4  
ATOM 3505  H HG23 . THR A 1 12 ? 0.351   8.612   -3.423  1.00 0.00 ? 12 THR A HG23 4  
ATOM 3506  N N    . ILE A 1 13 ? 0.518   8.778   -5.668  1.00 0.00 ? 13 ILE A N    4  
ATOM 3507  C CA   . ILE A 1 13 ? 0.288   7.554   -6.425  1.00 0.00 ? 13 ILE A CA   4  
ATOM 3508  C C    . ILE A 1 13 ? -1.068  6.944   -6.086  1.00 0.00 ? 13 ILE A C    4  
ATOM 3509  O O    . ILE A 1 13 ? -1.592  6.117   -6.832  1.00 0.00 ? 13 ILE A O    4  
ATOM 3510  C CB   . ILE A 1 13 ? 1.389   6.511   -6.156  1.00 0.00 ? 13 ILE A CB   4  
ATOM 3511  C CG1  . ILE A 1 13 ? 2.766   7.096   -6.476  1.00 0.00 ? 13 ILE A CG1  4  
ATOM 3512  C CG2  . ILE A 1 13 ? 1.139   5.253   -6.975  1.00 0.00 ? 13 ILE A CG2  4  
ATOM 3513  C CD1  . ILE A 1 13 ? 3.907   6.348   -5.824  1.00 0.00 ? 13 ILE A CD1  4  
ATOM 3514  H H    . ILE A 1 13 ? 1.354   8.881   -5.168  1.00 0.00 ? 13 ILE A H    4  
ATOM 3515  H HA   . ILE A 1 13 ? 0.306   7.804   -7.476  1.00 0.00 ? 13 ILE A HA   4  
ATOM 3516  H HB   . ILE A 1 13 ? 1.353   6.244   -5.111  1.00 0.00 ? 13 ILE A HB   4  
ATOM 3517  H HG12 . ILE A 1 13 ? 2.921   7.072   -7.543  1.00 0.00 ? 13 ILE A HG12 4  
ATOM 3518  H HG13 . ILE A 1 13 ? 2.802   8.121   -6.134  1.00 0.00 ? 13 ILE A HG13 4  
ATOM 3519  H HG21 . ILE A 1 13 ? 2.035   4.651   -6.993  1.00 0.00 ? 13 ILE A HG21 4  
ATOM 3520  H HG22 . ILE A 1 13 ? 0.335   4.688   -6.528  1.00 0.00 ? 13 ILE A HG22 4  
ATOM 3521  H HG23 . ILE A 1 13 ? 0.869   5.528   -7.983  1.00 0.00 ? 13 ILE A HG23 4  
ATOM 3522  H HD11 . ILE A 1 13 ? 3.535   5.433   -5.386  1.00 0.00 ? 13 ILE A HD11 4  
ATOM 3523  H HD12 . ILE A 1 13 ? 4.656   6.114   -6.566  1.00 0.00 ? 13 ILE A HD12 4  
ATOM 3524  H HD13 . ILE A 1 13 ? 4.346   6.963   -5.052  1.00 0.00 ? 13 ILE A HD13 4  
ATOM 3525  N N    . TYR A 1 14 ? -1.631  7.359   -4.957  1.00 0.00 ? 14 TYR A N    4  
ATOM 3526  C CA   . TYR A 1 14 ? -2.926  6.854   -4.518  1.00 0.00 ? 14 TYR A CA   4  
ATOM 3527  C C    . TYR A 1 14 ? -3.775  7.974   -3.923  1.00 0.00 ? 14 TYR A C    4  
ATOM 3528  O O    . TYR A 1 14 ? -3.252  8.911   -3.321  1.00 0.00 ? 14 TYR A O    4  
ATOM 3529  C CB   . TYR A 1 14 ? -2.740  5.738   -3.489  1.00 0.00 ? 14 TYR A CB   4  
ATOM 3530  C CG   . TYR A 1 14 ? -2.341  4.413   -4.098  1.00 0.00 ? 14 TYR A CG   4  
ATOM 3531  C CD1  . TYR A 1 14 ? -1.046  4.196   -4.552  1.00 0.00 ? 14 TYR A CD1  4  
ATOM 3532  C CD2  . TYR A 1 14 ? -3.260  3.377   -4.219  1.00 0.00 ? 14 TYR A CD2  4  
ATOM 3533  C CE1  . TYR A 1 14 ? -0.678  2.987   -5.110  1.00 0.00 ? 14 TYR A CE1  4  
ATOM 3534  C CE2  . TYR A 1 14 ? -2.901  2.165   -4.775  1.00 0.00 ? 14 TYR A CE2  4  
ATOM 3535  C CZ   . TYR A 1 14 ? -1.609  1.974   -5.219  1.00 0.00 ? 14 TYR A CZ   4  
ATOM 3536  O OH   . TYR A 1 14 ? -1.246  0.768   -5.773  1.00 0.00 ? 14 TYR A OH   4  
ATOM 3537  H H    . TYR A 1 14 ? -1.164  8.020   -4.404  1.00 0.00 ? 14 TYR A H    4  
ATOM 3538  H HA   . TYR A 1 14 ? -3.436  6.452   -5.382  1.00 0.00 ? 14 TYR A HA   4  
ATOM 3539  H HB2  . TYR A 1 14 ? -1.969  6.026   -2.791  1.00 0.00 ? 14 TYR A HB2  4  
ATOM 3540  H HB3  . TYR A 1 14 ? -3.667  5.592   -2.954  1.00 0.00 ? 14 TYR A HB3  4  
ATOM 3541  H HD1  . TYR A 1 14 ? -0.320  4.990   -4.464  1.00 0.00 ? 14 TYR A HD1  4  
ATOM 3542  H HD2  . TYR A 1 14 ? -4.272  3.530   -3.871  1.00 0.00 ? 14 TYR A HD2  4  
ATOM 3543  H HE1  . TYR A 1 14 ? 0.333   2.837   -5.457  1.00 0.00 ? 14 TYR A HE1  4  
ATOM 3544  H HE2  . TYR A 1 14 ? -3.629  1.372   -4.861  1.00 0.00 ? 14 TYR A HE2  4  
ATOM 3545  H HH   . TYR A 1 14 ? -0.299  0.762   -5.934  1.00 0.00 ? 14 TYR A HH   4  
ATOM 3546  N N    . SER A 1 15 ? -5.088  7.868   -4.096  1.00 0.00 ? 15 SER A N    4  
ATOM 3547  C CA   . SER A 1 15 ? -6.011  8.872   -3.580  1.00 0.00 ? 15 SER A CA   4  
ATOM 3548  C C    . SER A 1 15 ? -6.075  8.818   -2.056  1.00 0.00 ? 15 SER A C    4  
ATOM 3549  O O    . SER A 1 15 ? -5.813  7.779   -1.449  1.00 0.00 ? 15 SER A O    4  
ATOM 3550  C CB   . SER A 1 15 ? -7.408  8.663   -4.168  1.00 0.00 ? 15 SER A CB   4  
ATOM 3551  O OG   . SER A 1 15 ? -8.195  9.834   -4.042  1.00 0.00 ? 15 SER A OG   4  
ATOM 3552  H H    . SER A 1 15 ? -5.445  7.097   -4.585  1.00 0.00 ? 15 SER A H    4  
ATOM 3553  H HA   . SER A 1 15 ? -5.645  9.843   -3.878  1.00 0.00 ? 15 SER A HA   4  
ATOM 3554  H HB2  . SER A 1 15 ? -7.321  8.413   -5.214  1.00 0.00 ? 15 SER A HB2  4  
ATOM 3555  H HB3  . SER A 1 15 ? -7.899  7.855   -3.644  1.00 0.00 ? 15 SER A HB3  4  
ATOM 3556  H HG   . SER A 1 15 ? -8.819  9.725   -3.321  1.00 0.00 ? 15 SER A HG   4  
ATOM 3557  N N    . SER A 1 16 ? -6.426  9.945   -1.445  1.00 0.00 ? 16 SER A N    4  
ATOM 3558  C CA   . SER A 1 16 ? -6.522  10.028  0.008   1.00 0.00 ? 16 SER A CA   4  
ATOM 3559  C C    . SER A 1 16 ? -7.475  8.968   0.552   1.00 0.00 ? 16 SER A C    4  
ATOM 3560  O O    . SER A 1 16 ? -7.247  8.402   1.621   1.00 0.00 ? 16 SER A O    4  
ATOM 3561  C CB   . SER A 1 16 ? -6.995  11.420  0.430   1.00 0.00 ? 16 SER A CB   4  
ATOM 3562  O OG   . SER A 1 16 ? -8.285  11.699  -0.087  1.00 0.00 ? 16 SER A OG   4  
ATOM 3563  H H    . SER A 1 16 ? -6.623  10.739  -1.984  1.00 0.00 ? 16 SER A H    4  
ATOM 3564  H HA   . SER A 1 16 ? -5.537  9.853   0.416   1.00 0.00 ? 16 SER A HA   4  
ATOM 3565  H HB2  . SER A 1 16 ? -7.034  11.474  1.507   1.00 0.00 ? 16 SER A HB2  4  
ATOM 3566  H HB3  . SER A 1 16 ? -6.303  12.161  0.057   1.00 0.00 ? 16 SER A HB3  4  
ATOM 3567  H HG   . SER A 1 16 ? -8.618  12.510  0.304   1.00 0.00 ? 16 SER A HG   4  
ATOM 3568  N N    . PHE A 1 17 ? -8.544  8.705   -0.193  1.00 0.00 ? 17 PHE A N    4  
ATOM 3569  C CA   . PHE A 1 17 ? -9.533  7.714   0.213   1.00 0.00 ? 17 PHE A CA   4  
ATOM 3570  C C    . PHE A 1 17 ? -8.934  6.310   0.202   1.00 0.00 ? 17 PHE A C    4  
ATOM 3571  O O    . PHE A 1 17 ? -9.063  5.562   1.171   1.00 0.00 ? 17 PHE A O    4  
ATOM 3572  C CB   . PHE A 1 17 ? -10.750 7.768   -0.712  1.00 0.00 ? 17 PHE A CB   4  
ATOM 3573  C CG   . PHE A 1 17 ? -11.614 6.541   -0.639  1.00 0.00 ? 17 PHE A CG   4  
ATOM 3574  C CD1  . PHE A 1 17 ? -12.628 6.447   0.300   1.00 0.00 ? 17 PHE A CD1  4  
ATOM 3575  C CD2  . PHE A 1 17 ? -11.412 5.483   -1.511  1.00 0.00 ? 17 PHE A CD2  4  
ATOM 3576  C CE1  . PHE A 1 17 ? -13.423 5.319   0.370   1.00 0.00 ? 17 PHE A CE1  4  
ATOM 3577  C CE2  . PHE A 1 17 ? -12.205 4.353   -1.446  1.00 0.00 ? 17 PHE A CE2  4  
ATOM 3578  C CZ   . PHE A 1 17 ? -13.213 4.271   -0.505  1.00 0.00 ? 17 PHE A CZ   4  
ATOM 3579  H H    . PHE A 1 17 ? -8.670  9.189   -1.036  1.00 0.00 ? 17 PHE A H    4  
ATOM 3580  H HA   . PHE A 1 17 ? -9.845  7.951   1.219   1.00 0.00 ? 17 PHE A HA   4  
ATOM 3581  H HB2  . PHE A 1 17 ? -11.359 8.618   -0.444  1.00 0.00 ? 17 PHE A HB2  4  
ATOM 3582  H HB3  . PHE A 1 17 ? -10.413 7.878   -1.732  1.00 0.00 ? 17 PHE A HB3  4  
ATOM 3583  H HD1  . PHE A 1 17 ? -12.795 7.265   0.985   1.00 0.00 ? 17 PHE A HD1  4  
ATOM 3584  H HD2  . PHE A 1 17 ? -10.624 5.546   -2.248  1.00 0.00 ? 17 PHE A HD2  4  
ATOM 3585  H HE1  . PHE A 1 17 ? -14.211 5.257   1.107   1.00 0.00 ? 17 PHE A HE1  4  
ATOM 3586  H HE2  . PHE A 1 17 ? -12.037 3.536   -2.132  1.00 0.00 ? 17 PHE A HE2  4  
ATOM 3587  H HZ   . PHE A 1 17 ? -13.833 3.388   -0.452  1.00 0.00 ? 17 PHE A HZ   4  
ATOM 3588  N N    . GLN A 1 18 ? -8.279  5.962   -0.901  1.00 0.00 ? 18 GLN A N    4  
ATOM 3589  C CA   . GLN A 1 18 ? -7.661  4.649   -1.039  1.00 0.00 ? 18 GLN A CA   4  
ATOM 3590  C C    . GLN A 1 18 ? -6.530  4.471   -0.032  1.00 0.00 ? 18 GLN A C    4  
ATOM 3591  O O    . GLN A 1 18 ? -6.314  3.375   0.488   1.00 0.00 ? 18 GLN A O    4  
ATOM 3592  C CB   . GLN A 1 18 ? -7.129  4.459   -2.460  1.00 0.00 ? 18 GLN A CB   4  
ATOM 3593  C CG   . GLN A 1 18 ? -8.222  4.276   -3.500  1.00 0.00 ? 18 GLN A CG   4  
ATOM 3594  C CD   . GLN A 1 18 ? -7.672  3.946   -4.874  1.00 0.00 ? 18 GLN A CD   4  
ATOM 3595  O OE1  . GLN A 1 18 ? -6.458  3.914   -5.078  1.00 0.00 ? 18 GLN A OE1  4  
ATOM 3596  N NE2  . GLN A 1 18 ? -8.565  3.699   -5.825  1.00 0.00 ? 18 GLN A NE2  4  
ATOM 3597  H H    . GLN A 1 18 ? -8.210  6.603   -1.638  1.00 0.00 ? 18 GLN A H    4  
ATOM 3598  H HA   . GLN A 1 18 ? -8.418  3.904   -0.846  1.00 0.00 ? 18 GLN A HA   4  
ATOM 3599  H HB2  . GLN A 1 18 ? -6.545  5.326   -2.732  1.00 0.00 ? 18 GLN A HB2  4  
ATOM 3600  H HB3  . GLN A 1 18 ? -6.493  3.586   -2.480  1.00 0.00 ? 18 GLN A HB3  4  
ATOM 3601  H HG2  . GLN A 1 18 ? -8.869  3.470   -3.186  1.00 0.00 ? 18 GLN A HG2  4  
ATOM 3602  H HG3  . GLN A 1 18 ? -8.794  5.190   -3.567  1.00 0.00 ? 18 GLN A HG3  4  
ATOM 3603  H HE21 . GLN A 1 18 ? -9.516  3.743   -5.590  1.00 0.00 ? 18 GLN A HE21 4  
ATOM 3604  H HE22 . GLN A 1 18 ? -8.237  3.484   -6.723  1.00 0.00 ? 18 GLN A HE22 4  
ATOM 3605  N N    . LEU A 1 19 ? -5.810  5.554   0.240   1.00 0.00 ? 19 LEU A N    4  
ATOM 3606  C CA   . LEU A 1 19 ? -4.700  5.518   1.185   1.00 0.00 ? 19 LEU A CA   4  
ATOM 3607  C C    . LEU A 1 19 ? -5.208  5.387   2.617   1.00 0.00 ? 19 LEU A C    4  
ATOM 3608  O O    . LEU A 1 19 ? -4.814  4.476   3.345   1.00 0.00 ? 19 LEU A O    4  
ATOM 3609  C CB   . LEU A 1 19 ? -3.846  6.780   1.048   1.00 0.00 ? 19 LEU A CB   4  
ATOM 3610  C CG   . LEU A 1 19 ? -2.753  6.738   -0.020  1.00 0.00 ? 19 LEU A CG   4  
ATOM 3611  C CD1  . LEU A 1 19 ? -1.900  7.996   0.040   1.00 0.00 ? 19 LEU A CD1  4  
ATOM 3612  C CD2  . LEU A 1 19 ? -1.889  5.497   0.149   1.00 0.00 ? 19 LEU A CD2  4  
ATOM 3613  H H    . LEU A 1 19 ? -6.030  6.398   -0.206  1.00 0.00 ? 19 LEU A H    4  
ATOM 3614  H HA   . LEU A 1 19 ? -4.093  4.656   0.951   1.00 0.00 ? 19 LEU A HA   4  
ATOM 3615  H HB2  . LEU A 1 19 ? -4.506  7.601   0.814   1.00 0.00 ? 19 LEU A HB2  4  
ATOM 3616  H HB3  . LEU A 1 19 ? -3.372  6.962   2.002   1.00 0.00 ? 19 LEU A HB3  4  
ATOM 3617  H HG   . LEU A 1 19 ? -3.215  6.695   -0.997  1.00 0.00 ? 19 LEU A HG   4  
ATOM 3618  H HD11 . LEU A 1 19 ? -1.266  7.959   0.913   1.00 0.00 ? 19 LEU A HD11 4  
ATOM 3619  H HD12 . LEU A 1 19 ? -2.540  8.863   0.096   1.00 0.00 ? 19 LEU A HD12 4  
ATOM 3620  H HD13 . LEU A 1 19 ? -1.287  8.058   -0.848  1.00 0.00 ? 19 LEU A HD13 4  
ATOM 3621  H HD21 . LEU A 1 19 ? -2.316  4.682   -0.418  1.00 0.00 ? 19 LEU A HD21 4  
ATOM 3622  H HD22 . LEU A 1 19 ? -1.849  5.226   1.194   1.00 0.00 ? 19 LEU A HD22 4  
ATOM 3623  H HD23 . LEU A 1 19 ? -0.891  5.701   -0.209  1.00 0.00 ? 19 LEU A HD23 4  
ATOM 3624  N N    . ALA A 1 20 ? -6.087  6.302   3.014   1.00 0.00 ? 20 ALA A N    4  
ATOM 3625  C CA   . ALA A 1 20 ? -6.652  6.286   4.357   1.00 0.00 ? 20 ALA A CA   4  
ATOM 3626  C C    . ALA A 1 20 ? -6.890  4.858   4.836   1.00 0.00 ? 20 ALA A C    4  
ATOM 3627  O O    . ALA A 1 20 ? -6.547  4.507   5.965   1.00 0.00 ? 20 ALA A O    4  
ATOM 3628  C CB   . ALA A 1 20 ? -7.950  7.079   4.393   1.00 0.00 ? 20 ALA A CB   4  
ATOM 3629  H H    . ALA A 1 20 ? -6.362  7.003   2.387   1.00 0.00 ? 20 ALA A H    4  
ATOM 3630  H HA   . ALA A 1 20 ? -5.948  6.765   5.022   1.00 0.00 ? 20 ALA A HA   4  
ATOM 3631  H HB1  . ALA A 1 20 ? -8.168  7.365   5.411   1.00 0.00 ? 20 ALA A HB1  4  
ATOM 3632  H HB2  . ALA A 1 20 ? -7.847  7.965   3.784   1.00 0.00 ? 20 ALA A HB2  4  
ATOM 3633  H HB3  . ALA A 1 20 ? -8.755  6.469   4.010   1.00 0.00 ? 20 ALA A HB3  4  
ATOM 3634  N N    . ALA A 1 21 ? -7.478  4.038   3.971   1.00 0.00 ? 21 ALA A N    4  
ATOM 3635  C CA   . ALA A 1 21 ? -7.760  2.648   4.306   1.00 0.00 ? 21 ALA A CA   4  
ATOM 3636  C C    . ALA A 1 21 ? -6.492  1.803   4.254   1.00 0.00 ? 21 ALA A C    4  
ATOM 3637  O O    . ALA A 1 21 ? -6.185  1.067   5.193   1.00 0.00 ? 21 ALA A O    4  
ATOM 3638  C CB   . ALA A 1 21 ? -8.813  2.081   3.364   1.00 0.00 ? 21 ALA A CB   4  
ATOM 3639  H H    . ALA A 1 21 ? -7.728  4.377   3.086   1.00 0.00 ? 21 ALA A H    4  
ATOM 3640  H HA   . ALA A 1 21 ? -8.158  2.621   5.310   1.00 0.00 ? 21 ALA A HA   4  
ATOM 3641  H HB1  . ALA A 1 21 ? -9.781  2.125   3.841   1.00 0.00 ? 21 ALA A HB1  4  
ATOM 3642  H HB2  . ALA A 1 21 ? -8.832  2.663   2.455   1.00 0.00 ? 21 ALA A HB2  4  
ATOM 3643  H HB3  . ALA A 1 21 ? -8.572  1.055   3.131   1.00 0.00 ? 21 ALA A HB3  4  
ATOM 3644  N N    . LEU A 1 22 ? -5.758  1.912   3.152   1.00 0.00 ? 22 LEU A N    4  
ATOM 3645  C CA   . LEU A 1 22 ? -4.522  1.157   2.977   1.00 0.00 ? 22 LEU A CA   4  
ATOM 3646  C C    . LEU A 1 22 ? -3.616  1.308   4.194   1.00 0.00 ? 22 LEU A C    4  
ATOM 3647  O O    . LEU A 1 22 ? -3.263  0.322   4.842   1.00 0.00 ? 22 LEU A O    4  
ATOM 3648  C CB   . LEU A 1 22 ? -3.788  1.626   1.719   1.00 0.00 ? 22 LEU A CB   4  
ATOM 3649  C CG   . LEU A 1 22 ? -4.377  1.162   0.387   1.00 0.00 ? 22 LEU A CG   4  
ATOM 3650  C CD1  . LEU A 1 22 ? -3.755  1.931   -0.768  1.00 0.00 ? 22 LEU A CD1  4  
ATOM 3651  C CD2  . LEU A 1 22 ? -4.172  -0.335  0.205   1.00 0.00 ? 22 LEU A CD2  4  
ATOM 3652  H H    . LEU A 1 22 ? -6.054  2.514   2.438   1.00 0.00 ? 22 LEU A H    4  
ATOM 3653  H HA   . LEU A 1 22 ? -4.784  0.116   2.864   1.00 0.00 ? 22 LEU A HA   4  
ATOM 3654  H HB2  . LEU A 1 22 ? -3.785  2.705   1.722   1.00 0.00 ? 22 LEU A HB2  4  
ATOM 3655  H HB3  . LEU A 1 22 ? -2.771  1.264   1.777   1.00 0.00 ? 22 LEU A HB3  4  
ATOM 3656  H HG   . LEU A 1 22 ? -5.441  1.358   0.383   1.00 0.00 ? 22 LEU A HG   4  
ATOM 3657  H HD11 . LEU A 1 22 ? -4.524  2.476   -1.294  1.00 0.00 ? 22 LEU A HD11 4  
ATOM 3658  H HD12 . LEU A 1 22 ? -3.277  1.239   -1.446  1.00 0.00 ? 22 LEU A HD12 4  
ATOM 3659  H HD13 . LEU A 1 22 ? -3.020  2.624   -0.385  1.00 0.00 ? 22 LEU A HD13 4  
ATOM 3660  H HD21 . LEU A 1 22 ? -4.907  -0.871  0.787   1.00 0.00 ? 22 LEU A HD21 4  
ATOM 3661  H HD22 . LEU A 1 22 ? -3.181  -0.605  0.539   1.00 0.00 ? 22 LEU A HD22 4  
ATOM 3662  H HD23 . LEU A 1 22 ? -4.283  -0.589  -0.839  1.00 0.00 ? 22 LEU A HD23 4  
ATOM 3663  N N    . GLN A 1 23 ? -3.245  2.547   4.500   1.00 0.00 ? 23 GLN A N    4  
ATOM 3664  C CA   . GLN A 1 23 ? -2.381  2.825   5.641   1.00 0.00 ? 23 GLN A CA   4  
ATOM 3665  C C    . GLN A 1 23 ? -3.002  2.306   6.934   1.00 0.00 ? 23 GLN A C    4  
ATOM 3666  O O    . GLN A 1 23 ? -2.306  1.770   7.796   1.00 0.00 ? 23 GLN A O    4  
ATOM 3667  C CB   . GLN A 1 23 ? -2.119  4.328   5.755   1.00 0.00 ? 23 GLN A CB   4  
ATOM 3668  C CG   . GLN A 1 23 ? -1.078  4.840   4.772   1.00 0.00 ? 23 GLN A CG   4  
ATOM 3669  C CD   . GLN A 1 23 ? -0.698  6.285   5.026   1.00 0.00 ? 23 GLN A CD   4  
ATOM 3670  O OE1  . GLN A 1 23 ? -1.554  7.126   5.302   1.00 0.00 ? 23 GLN A OE1  4  
ATOM 3671  N NE2  . GLN A 1 23 ? 0.593   6.583   4.933   1.00 0.00 ? 23 GLN A NE2  4  
ATOM 3672  H H    . GLN A 1 23 ? -3.559  3.290   3.946   1.00 0.00 ? 23 GLN A H    4  
ATOM 3673  H HA   . GLN A 1 23 ? -1.443  2.317   5.478   1.00 0.00 ? 23 GLN A HA   4  
ATOM 3674  H HB2  . GLN A 1 23 ? -3.043  4.857   5.576   1.00 0.00 ? 23 GLN A HB2  4  
ATOM 3675  H HB3  . GLN A 1 23 ? -1.776  4.547   6.755   1.00 0.00 ? 23 GLN A HB3  4  
ATOM 3676  H HG2  . GLN A 1 23 ? -0.191  4.231   4.857   1.00 0.00 ? 23 GLN A HG2  4  
ATOM 3677  H HG3  . GLN A 1 23 ? -1.476  4.758   3.771   1.00 0.00 ? 23 GLN A HG3  4  
ATOM 3678  H HE21 . GLN A 1 23 ? 1.219   5.862   4.707   1.00 0.00 ? 23 GLN A HE21 4  
ATOM 3679  H HE22 . GLN A 1 23 ? 0.867   7.510   5.091   1.00 0.00 ? 23 GLN A HE22 4  
ATOM 3680  N N    . ARG A 1 24 ? -4.315  2.471   7.062   1.00 0.00 ? 24 ARG A N    4  
ATOM 3681  C CA   . ARG A 1 24 ? -5.029  2.020   8.250   1.00 0.00 ? 24 ARG A CA   4  
ATOM 3682  C C    . ARG A 1 24 ? -4.961  0.502   8.382   1.00 0.00 ? 24 ARG A C    4  
ATOM 3683  O O    . ARG A 1 24 ? -5.042  -0.039  9.485   1.00 0.00 ? 24 ARG A O    4  
ATOM 3684  C CB   . ARG A 1 24 ? -6.489  2.473   8.196   1.00 0.00 ? 24 ARG A CB   4  
ATOM 3685  C CG   . ARG A 1 24 ? -6.729  3.833   8.830   1.00 0.00 ? 24 ARG A CG   4  
ATOM 3686  C CD   . ARG A 1 24 ? -8.205  4.061   9.118   1.00 0.00 ? 24 ARG A CD   4  
ATOM 3687  N NE   . ARG A 1 24 ? -8.739  3.072   10.050  1.00 0.00 ? 24 ARG A NE   4  
ATOM 3688  C CZ   . ARG A 1 24 ? -9.955  3.145   10.581  1.00 0.00 ? 24 ARG A CZ   4  
ATOM 3689  N NH1  . ARG A 1 24 ? -10.757 4.155   10.274  1.00 0.00 ? 24 ARG A NH1  4  
ATOM 3690  N NH2  . ARG A 1 24 ? -10.370 2.206   11.422  1.00 0.00 ? 24 ARG A NH2  4  
ATOM 3691  H H    . ARG A 1 24 ? -4.815  2.906   6.340   1.00 0.00 ? 24 ARG A H    4  
ATOM 3692  H HA   . ARG A 1 24 ? -4.555  2.467   9.111   1.00 0.00 ? 24 ARG A HA   4  
ATOM 3693  H HB2  . ARG A 1 24 ? -6.801  2.522   7.162   1.00 0.00 ? 24 ARG A HB2  4  
ATOM 3694  H HB3  . ARG A 1 24 ? -7.098  1.747   8.713   1.00 0.00 ? 24 ARG A HB3  4  
ATOM 3695  H HG2  . ARG A 1 24 ? -6.180  3.890   9.758   1.00 0.00 ? 24 ARG A HG2  4  
ATOM 3696  H HG3  . ARG A 1 24 ? -6.380  4.601   8.155   1.00 0.00 ? 24 ARG A HG3  4  
ATOM 3697  H HD2  . ARG A 1 24 ? -8.327  5.046   9.544   1.00 0.00 ? 24 ARG A HD2  4  
ATOM 3698  H HD3  . ARG A 1 24 ? -8.752  4.001   8.189   1.00 0.00 ? 24 ARG A HD3  4  
ATOM 3699  H HE   . ARG A 1 24 ? -8.163  2.318   10.291  1.00 0.00 ? 24 ARG A HE   4  
ATOM 3700  H HH11 . ARG A 1 24 ? -10.447 4.863   9.640   1.00 0.00 ? 24 ARG A HH11 4  
ATOM 3701  H HH12 . ARG A 1 24 ? -11.672 4.207   10.675  1.00 0.00 ? 24 ARG A HH12 4  
ATOM 3702  H HH21 . ARG A 1 24 ? -9.768  1.443   11.656  1.00 0.00 ? 24 ARG A HH21 4  
ATOM 3703  H HH22 . ARG A 1 24 ? -11.284 2.262   11.822  1.00 0.00 ? 24 ARG A HH22 4  
ATOM 3704  N N    . ARG A 1 25 ? -4.812  -0.180  7.251   1.00 0.00 ? 25 ARG A N    4  
ATOM 3705  C CA   . ARG A 1 25 ? -4.735  -1.635  7.240   1.00 0.00 ? 25 ARG A CA   4  
ATOM 3706  C C    . ARG A 1 25 ? -3.301  -2.105  7.465   1.00 0.00 ? 25 ARG A C    4  
ATOM 3707  O O    . ARG A 1 25 ? -3.065  -3.123  8.117   1.00 0.00 ? 25 ARG A O    4  
ATOM 3708  C CB   . ARG A 1 25 ? -5.261  -2.186  5.914   1.00 0.00 ? 25 ARG A CB   4  
ATOM 3709  C CG   . ARG A 1 25 ? -5.605  -3.665  5.961   1.00 0.00 ? 25 ARG A CG   4  
ATOM 3710  C CD   . ARG A 1 25 ? -6.858  -3.920  6.785   1.00 0.00 ? 25 ARG A CD   4  
ATOM 3711  N NE   . ARG A 1 25 ? -8.071  -3.536  6.068   1.00 0.00 ? 25 ARG A NE   4  
ATOM 3712  C CZ   . ARG A 1 25 ? -9.267  -3.455  6.640   1.00 0.00 ? 25 ARG A CZ   4  
ATOM 3713  N NH1  . ARG A 1 25 ? -9.410  -3.729  7.929   1.00 0.00 ? 25 ARG A NH1  4  
ATOM 3714  N NH2  . ARG A 1 25 ? -10.324 -3.098  5.921   1.00 0.00 ? 25 ARG A NH2  4  
ATOM 3715  H H    . ARG A 1 25 ? -4.754  0.308   6.403   1.00 0.00 ? 25 ARG A H    4  
ATOM 3716  H HA   . ARG A 1 25 ? -5.353  -2.006  8.044   1.00 0.00 ? 25 ARG A HA   4  
ATOM 3717  H HB2  . ARG A 1 25 ? -6.152  -1.641  5.639   1.00 0.00 ? 25 ARG A HB2  4  
ATOM 3718  H HB3  . ARG A 1 25 ? -4.509  -2.037  5.153   1.00 0.00 ? 25 ARG A HB3  4  
ATOM 3719  H HG2  . ARG A 1 25 ? -5.771  -4.020  4.955   1.00 0.00 ? 25 ARG A HG2  4  
ATOM 3720  H HG3  . ARG A 1 25 ? -4.779  -4.203  6.403   1.00 0.00 ? 25 ARG A HG3  4  
ATOM 3721  H HD2  . ARG A 1 25 ? -6.909  -4.972  7.022   1.00 0.00 ? 25 ARG A HD2  4  
ATOM 3722  H HD3  . ARG A 1 25 ? -6.794  -3.348  7.698   1.00 0.00 ? 25 ARG A HD3  4  
ATOM 3723  H HE   . ARG A 1 25 ? -7.988  -3.329  5.114   1.00 0.00 ? 25 ARG A HE   4  
ATOM 3724  H HH11 . ARG A 1 25 ? -8.615  -3.996  8.473   1.00 0.00 ? 25 ARG A HH11 4  
ATOM 3725  H HH12 . ARG A 1 25 ? -10.311 -3.665  8.358   1.00 0.00 ? 25 ARG A HH12 4  
ATOM 3726  H HH21 . ARG A 1 25 ? -10.221 -2.891  4.949   1.00 0.00 ? 25 ARG A HH21 4  
ATOM 3727  H HH22 . ARG A 1 25 ? -11.224 -3.037  6.352   1.00 0.00 ? 25 ARG A HH22 4  
ATOM 3728  N N    . PHE A 1 26 ? -2.346  -1.358  6.921   1.00 0.00 ? 26 PHE A N    4  
ATOM 3729  C CA   . PHE A 1 26 ? -0.935  -1.698  7.061   1.00 0.00 ? 26 PHE A CA   4  
ATOM 3730  C C    . PHE A 1 26 ? -0.541  -1.789  8.532   1.00 0.00 ? 26 PHE A C    4  
ATOM 3731  O O    . PHE A 1 26 ? 0.157   -2.716  8.942   1.00 0.00 ? 26 PHE A O    4  
ATOM 3732  C CB   . PHE A 1 26 ? -0.065  -0.659  6.351   1.00 0.00 ? 26 PHE A CB   4  
ATOM 3733  C CG   . PHE A 1 26 ? 1.408   -0.877  6.546   1.00 0.00 ? 26 PHE A CG   4  
ATOM 3734  C CD1  . PHE A 1 26 ? 2.056   -1.929  5.919   1.00 0.00 ? 26 PHE A CD1  4  
ATOM 3735  C CD2  . PHE A 1 26 ? 2.145   -0.029  7.357   1.00 0.00 ? 26 PHE A CD2  4  
ATOM 3736  C CE1  . PHE A 1 26 ? 3.411   -2.132  6.096   1.00 0.00 ? 26 PHE A CE1  4  
ATOM 3737  C CE2  . PHE A 1 26 ? 3.501   -0.227  7.537   1.00 0.00 ? 26 PHE A CE2  4  
ATOM 3738  C CZ   . PHE A 1 26 ? 4.135   -1.280  6.907   1.00 0.00 ? 26 PHE A CZ   4  
ATOM 3739  H H    . PHE A 1 26 ? -2.597  -0.558  6.413   1.00 0.00 ? 26 PHE A H    4  
ATOM 3740  H HA   . PHE A 1 26 ? -0.780  -2.661  6.599   1.00 0.00 ? 26 PHE A HA   4  
ATOM 3741  H HB2  . PHE A 1 26 ? -0.268  -0.695  5.291   1.00 0.00 ? 26 PHE A HB2  4  
ATOM 3742  H HB3  . PHE A 1 26 ? -0.310  0.322   6.727   1.00 0.00 ? 26 PHE A HB3  4  
ATOM 3743  H HD1  . PHE A 1 26 ? 1.490   -2.597  5.283   1.00 0.00 ? 26 PHE A HD1  4  
ATOM 3744  H HD2  . PHE A 1 26 ? 1.652   0.794   7.851   1.00 0.00 ? 26 PHE A HD2  4  
ATOM 3745  H HE1  . PHE A 1 26 ? 3.903   -2.957  5.601   1.00 0.00 ? 26 PHE A HE1  4  
ATOM 3746  H HE2  . PHE A 1 26 ? 4.065   0.440   8.173   1.00 0.00 ? 26 PHE A HE2  4  
ATOM 3747  H HZ   . PHE A 1 26 ? 5.194   -1.436  7.046   1.00 0.00 ? 26 PHE A HZ   4  
ATOM 3748  N N    . GLN A 1 27 ? -0.992  -0.819  9.320   1.00 0.00 ? 27 GLN A N    4  
ATOM 3749  C CA   . GLN A 1 27 ? -0.685  -0.788  10.745  1.00 0.00 ? 27 GLN A CA   4  
ATOM 3750  C C    . GLN A 1 27 ? -1.151  -2.068  11.430  1.00 0.00 ? 27 GLN A C    4  
ATOM 3751  O O    . GLN A 1 27 ? -0.385  -2.719  12.142  1.00 0.00 ? 27 GLN A O    4  
ATOM 3752  C CB   . GLN A 1 27 ? -1.344  0.426   11.404  1.00 0.00 ? 27 GLN A CB   4  
ATOM 3753  C CG   . GLN A 1 27 ? -0.555  1.713   11.234  1.00 0.00 ? 27 GLN A CG   4  
ATOM 3754  C CD   . GLN A 1 27 ? 0.817   1.647   11.877  1.00 0.00 ? 27 GLN A CD   4  
ATOM 3755  O OE1  . GLN A 1 27 ? 1.804   1.300   11.228  1.00 0.00 ? 27 GLN A OE1  4  
ATOM 3756  N NE2  . GLN A 1 27 ? 0.885   1.980   13.161  1.00 0.00 ? 27 GLN A NE2  4  
ATOM 3757  H H    . GLN A 1 27 ? -1.544  -0.107  8.935   1.00 0.00 ? 27 GLN A H    4  
ATOM 3758  H HA   . GLN A 1 27 ? 0.386   -0.706  10.852  1.00 0.00 ? 27 GLN A HA   4  
ATOM 3759  H HB2  . GLN A 1 27 ? -2.323  0.568   10.971  1.00 0.00 ? 27 GLN A HB2  4  
ATOM 3760  H HB3  . GLN A 1 27 ? -1.451  0.232   12.461  1.00 0.00 ? 27 GLN A HB3  4  
ATOM 3761  H HG2  . GLN A 1 27 ? -0.431  1.908   10.179  1.00 0.00 ? 27 GLN A HG2  4  
ATOM 3762  H HG3  . GLN A 1 27 ? -1.109  2.523   11.686  1.00 0.00 ? 27 GLN A HG3  4  
ATOM 3763  H HE21 . GLN A 1 27 ? 0.057   2.245   13.615  1.00 0.00 ? 27 GLN A HE21 4  
ATOM 3764  H HE22 . GLN A 1 27 ? 1.759   1.945   13.602  1.00 0.00 ? 27 GLN A HE22 4  
ATOM 3765  N N    . LYS A 1 28 ? -2.412  -2.425  11.212  1.00 0.00 ? 28 LYS A N    4  
ATOM 3766  C CA   . LYS A 1 28 ? -2.981  -3.629  11.807  1.00 0.00 ? 28 LYS A CA   4  
ATOM 3767  C C    . LYS A 1 28 ? -2.105  -4.844  11.521  1.00 0.00 ? 28 LYS A C    4  
ATOM 3768  O O    . LYS A 1 28 ? -1.595  -5.486  12.440  1.00 0.00 ? 28 LYS A O    4  
ATOM 3769  C CB   . LYS A 1 28 ? -4.394  -3.868  11.271  1.00 0.00 ? 28 LYS A CB   4  
ATOM 3770  C CG   . LYS A 1 28 ? -5.374  -2.762  11.623  1.00 0.00 ? 28 LYS A CG   4  
ATOM 3771  C CD   . LYS A 1 28 ? -6.001  -2.986  12.989  1.00 0.00 ? 28 LYS A CD   4  
ATOM 3772  C CE   . LYS A 1 28 ? -5.181  -2.334  14.092  1.00 0.00 ? 28 LYS A CE   4  
ATOM 3773  N NZ   . LYS A 1 28 ? -6.020  -1.974  15.268  1.00 0.00 ? 28 LYS A NZ   4  
ATOM 3774  H H    . LYS A 1 28 ? -2.974  -1.866  10.635  1.00 0.00 ? 28 LYS A H    4  
ATOM 3775  H HA   . LYS A 1 28 ? -3.031  -3.479  12.875  1.00 0.00 ? 28 LYS A HA   4  
ATOM 3776  H HB2  . LYS A 1 28 ? -4.349  -3.952  10.195  1.00 0.00 ? 28 LYS A HB2  4  
ATOM 3777  H HB3  . LYS A 1 28 ? -4.769  -4.796  11.680  1.00 0.00 ? 28 LYS A HB3  4  
ATOM 3778  H HG2  . LYS A 1 28 ? -4.850  -1.818  11.630  1.00 0.00 ? 28 LYS A HG2  4  
ATOM 3779  H HG3  . LYS A 1 28 ? -6.157  -2.736  10.878  1.00 0.00 ? 28 LYS A HG3  4  
ATOM 3780  H HD2  . LYS A 1 28 ? -6.993  -2.561  12.995  1.00 0.00 ? 28 LYS A HD2  4  
ATOM 3781  H HD3  . LYS A 1 28 ? -6.061  -4.049  13.178  1.00 0.00 ? 28 LYS A HD3  4  
ATOM 3782  H HE2  . LYS A 1 28 ? -4.412  -3.023  14.407  1.00 0.00 ? 28 LYS A HE2  4  
ATOM 3783  H HE3  . LYS A 1 28 ? -4.723  -1.438  13.700  1.00 0.00 ? 28 LYS A HE3  4  
ATOM 3784  H HZ1  . LYS A 1 28 ? -6.904  -2.523  15.257  1.00 0.00 ? 28 LYS A HZ1  4  
ATOM 3785  H HZ2  . LYS A 1 28 ? -6.254  -0.962  15.244  1.00 0.00 ? 28 LYS A HZ2  4  
ATOM 3786  H HZ3  . LYS A 1 28 ? -5.508  -2.180  16.150  1.00 0.00 ? 28 LYS A HZ3  4  
ATOM 3787  N N    . THR A 1 29 ? -1.932  -5.155  10.240  1.00 0.00 ? 29 THR A N    4  
ATOM 3788  C CA   . THR A 1 29 ? -1.117  -6.292  9.832   1.00 0.00 ? 29 THR A CA   4  
ATOM 3789  C C    . THR A 1 29 ? -0.231  -5.937  8.644   1.00 0.00 ? 29 THR A C    4  
ATOM 3790  O O    . THR A 1 29 ? -0.553  -5.038  7.866   1.00 0.00 ? 29 THR A O    4  
ATOM 3791  C CB   . THR A 1 29 ? -1.991  -7.505  9.462   1.00 0.00 ? 29 THR A CB   4  
ATOM 3792  O OG1  . THR A 1 29 ? -1.186  -8.523  8.856   1.00 0.00 ? 29 THR A OG1  4  
ATOM 3793  C CG2  . THR A 1 29 ? -3.105  -7.099  8.510   1.00 0.00 ? 29 THR A CG2  4  
ATOM 3794  H H    . THR A 1 29 ? -2.364  -4.605  9.553   1.00 0.00 ? 29 THR A H    4  
ATOM 3795  H HA   . THR A 1 29 ? -0.489  -6.568  10.667  1.00 0.00 ? 29 THR A HA   4  
ATOM 3796  H HB   . THR A 1 29 ? -2.435  -7.899  10.366  1.00 0.00 ? 29 THR A HB   4  
ATOM 3797  H HG1  . THR A 1 29 ? -1.690  -9.338  8.799   1.00 0.00 ? 29 THR A HG1  4  
ATOM 3798  H HG21 . THR A 1 29 ? -2.944  -7.564  7.548   1.00 0.00 ? 29 THR A HG21 4  
ATOM 3799  H HG22 . THR A 1 29 ? -3.107  -6.025  8.395   1.00 0.00 ? 29 THR A HG22 4  
ATOM 3800  H HG23 . THR A 1 29 ? -4.055  -7.421  8.910   1.00 0.00 ? 29 THR A HG23 4  
ATOM 3801  N N    . GLN A 1 30 ? 0.883   -6.648  8.508   1.00 0.00 ? 30 GLN A N    4  
ATOM 3802  C CA   . GLN A 1 30 ? 1.815   -6.406  7.413   1.00 0.00 ? 30 GLN A CA   4  
ATOM 3803  C C    . GLN A 1 30 ? 1.429   -7.218  6.181   1.00 0.00 ? 30 GLN A C    4  
ATOM 3804  O O    . GLN A 1 30 ? 1.652   -6.790  5.048   1.00 0.00 ? 30 GLN A O    4  
ATOM 3805  C CB   . GLN A 1 30 ? 3.241   -6.755  7.842   1.00 0.00 ? 30 GLN A CB   4  
ATOM 3806  C CG   . GLN A 1 30 ? 3.888   -5.696  8.721   1.00 0.00 ? 30 GLN A CG   4  
ATOM 3807  C CD   . GLN A 1 30 ? 5.167   -6.181  9.373   1.00 0.00 ? 30 GLN A CD   4  
ATOM 3808  O OE1  . GLN A 1 30 ? 6.248   -6.093  8.789   1.00 0.00 ? 30 GLN A OE1  4  
ATOM 3809  N NE2  . GLN A 1 30 ? 5.053   -6.697  10.591  1.00 0.00 ? 30 GLN A NE2  4  
ATOM 3810  H H    . GLN A 1 30 ? 1.084   -7.351  9.160   1.00 0.00 ? 30 GLN A H    4  
ATOM 3811  H HA   . GLN A 1 30 ? 1.770   -5.356  7.165   1.00 0.00 ? 30 GLN A HA   4  
ATOM 3812  H HB2  . GLN A 1 30 ? 3.222   -7.685  8.390   1.00 0.00 ? 30 GLN A HB2  4  
ATOM 3813  H HB3  . GLN A 1 30 ? 3.850   -6.879  6.959   1.00 0.00 ? 30 GLN A HB3  4  
ATOM 3814  H HG2  . GLN A 1 30 ? 4.117   -4.833  8.114   1.00 0.00 ? 30 GLN A HG2  4  
ATOM 3815  H HG3  . GLN A 1 30 ? 3.190   -5.415  9.496   1.00 0.00 ? 30 GLN A HG3  4  
ATOM 3816  H HE21 . GLN A 1 30 ? 4.160   -6.737  10.994  1.00 0.00 ? 30 GLN A HE21 4  
ATOM 3817  H HE22 . GLN A 1 30 ? 5.863   -7.020  11.036  1.00 0.00 ? 30 GLN A HE22 4  
ATOM 3818  N N    . TYR A 1 31 ? 0.850   -8.391  6.410   1.00 0.00 ? 31 TYR A N    4  
ATOM 3819  C CA   . TYR A 1 31 ? 0.435   -9.265  5.318   1.00 0.00 ? 31 TYR A CA   4  
ATOM 3820  C C    . TYR A 1 31 ? -1.073  -9.492  5.345   1.00 0.00 ? 31 TYR A C    4  
ATOM 3821  O O    . TYR A 1 31 ? -1.700  -9.457  6.404   1.00 0.00 ? 31 TYR A O    4  
ATOM 3822  C CB   . TYR A 1 31 ? 1.166   -10.606 5.405   1.00 0.00 ? 31 TYR A CB   4  
ATOM 3823  C CG   . TYR A 1 31 ? 2.672   -10.478 5.380   1.00 0.00 ? 31 TYR A CG   4  
ATOM 3824  C CD1  . TYR A 1 31 ? 3.340   -10.137 4.210   1.00 0.00 ? 31 TYR A CD1  4  
ATOM 3825  C CD2  . TYR A 1 31 ? 3.427   -10.698 6.525   1.00 0.00 ? 31 TYR A CD2  4  
ATOM 3826  C CE1  . TYR A 1 31 ? 4.717   -10.019 4.182   1.00 0.00 ? 31 TYR A CE1  4  
ATOM 3827  C CE2  . TYR A 1 31 ? 4.803   -10.581 6.507   1.00 0.00 ? 31 TYR A CE2  4  
ATOM 3828  C CZ   . TYR A 1 31 ? 5.443   -10.242 5.333   1.00 0.00 ? 31 TYR A CZ   4  
ATOM 3829  O OH   . TYR A 1 31 ? 6.815   -10.126 5.310   1.00 0.00 ? 31 TYR A OH   4  
ATOM 3830  H H    . TYR A 1 31 ? 0.698   -8.678  7.334   1.00 0.00 ? 31 TYR A H    4  
ATOM 3831  H HA   . TYR A 1 31 ? 0.699   -8.782  4.389   1.00 0.00 ? 31 TYR A HA   4  
ATOM 3832  H HB2  . TYR A 1 31 ? 0.891   -11.099 6.324   1.00 0.00 ? 31 TYR A HB2  4  
ATOM 3833  H HB3  . TYR A 1 31 ? 0.871   -11.223 4.569   1.00 0.00 ? 31 TYR A HB3  4  
ATOM 3834  H HD1  . TYR A 1 31 ? 2.768   -9.963  3.310   1.00 0.00 ? 31 TYR A HD1  4  
ATOM 3835  H HD2  . TYR A 1 31 ? 2.922   -10.964 7.443   1.00 0.00 ? 31 TYR A HD2  4  
ATOM 3836  H HE1  . TYR A 1 31 ? 5.218   -9.753  3.263   1.00 0.00 ? 31 TYR A HE1  4  
ATOM 3837  H HE2  . TYR A 1 31 ? 5.373   -10.756 7.408   1.00 0.00 ? 31 TYR A HE2  4  
ATOM 3838  H HH   . TYR A 1 31 ? 7.210   -10.937 5.639   1.00 0.00 ? 31 TYR A HH   4  
ATOM 3839  N N    . LEU A 1 32 ? -1.650  -9.724  4.171   1.00 0.00 ? 32 LEU A N    4  
ATOM 3840  C CA   . LEU A 1 32 ? -3.086  -9.958  4.057   1.00 0.00 ? 32 LEU A CA   4  
ATOM 3841  C C    . LEU A 1 32 ? -3.368  -11.285 3.361   1.00 0.00 ? 32 LEU A C    4  
ATOM 3842  O O    . LEU A 1 32 ? -2.660  -11.672 2.431   1.00 0.00 ? 32 LEU A O    4  
ATOM 3843  C CB   . LEU A 1 32 ? -3.749  -8.814  3.288   1.00 0.00 ? 32 LEU A CB   4  
ATOM 3844  C CG   . LEU A 1 32 ? -3.714  -7.442  3.962   1.00 0.00 ? 32 LEU A CG   4  
ATOM 3845  C CD1  . LEU A 1 32 ? -4.205  -6.365  3.007   1.00 0.00 ? 32 LEU A CD1  4  
ATOM 3846  C CD2  . LEU A 1 32 ? -4.551  -7.451  5.233   1.00 0.00 ? 32 LEU A CD2  4  
ATOM 3847  H H    . LEU A 1 32 ? -1.099  -9.739  3.361   1.00 0.00 ? 32 LEU A H    4  
ATOM 3848  H HA   . LEU A 1 32 ? -3.495  -9.995  5.056   1.00 0.00 ? 32 LEU A HA   4  
ATOM 3849  H HB2  . LEU A 1 32 ? -3.253  -8.726  2.333   1.00 0.00 ? 32 LEU A HB2  4  
ATOM 3850  H HB3  . LEU A 1 32 ? -4.785  -9.080  3.130   1.00 0.00 ? 32 LEU A HB3  4  
ATOM 3851  H HG   . LEU A 1 32 ? -2.694  -7.208  4.234   1.00 0.00 ? 32 LEU A HG   4  
ATOM 3852  H HD11 . LEU A 1 32 ? -4.373  -6.798  2.032   1.00 0.00 ? 32 LEU A HD11 4  
ATOM 3853  H HD12 . LEU A 1 32 ? -3.461  -5.586  2.930   1.00 0.00 ? 32 LEU A HD12 4  
ATOM 3854  H HD13 . LEU A 1 32 ? -5.128  -5.946  3.380   1.00 0.00 ? 32 LEU A HD13 4  
ATOM 3855  H HD21 . LEU A 1 32 ? -5.592  -7.586  4.977   1.00 0.00 ? 32 LEU A HD21 4  
ATOM 3856  H HD22 . LEU A 1 32 ? -4.427  -6.512  5.752   1.00 0.00 ? 32 LEU A HD22 4  
ATOM 3857  H HD23 . LEU A 1 32 ? -4.229  -8.261  5.870   1.00 0.00 ? 32 LEU A HD23 4  
ATOM 3858  N N    . ALA A 1 33 ? -4.407  -11.977 3.816   1.00 0.00 ? 33 ALA A N    4  
ATOM 3859  C CA   . ALA A 1 33 ? -4.785  -13.259 3.234   1.00 0.00 ? 33 ALA A CA   4  
ATOM 3860  C C    . ALA A 1 33 ? -5.257  -13.091 1.794   1.00 0.00 ? 33 ALA A C    4  
ATOM 3861  O O    . ALA A 1 33 ? -5.251  -11.984 1.254   1.00 0.00 ? 33 ALA A O    4  
ATOM 3862  C CB   . ALA A 1 33 ? -5.869  -13.920 4.073   1.00 0.00 ? 33 ALA A CB   4  
ATOM 3863  H H    . ALA A 1 33 ? -4.932  -11.616 4.560   1.00 0.00 ? 33 ALA A H    4  
ATOM 3864  H HA   . ALA A 1 33 ? -3.915  -13.900 3.245   1.00 0.00 ? 33 ALA A HA   4  
ATOM 3865  H HB1  . ALA A 1 33 ? -5.820  -14.992 3.944   1.00 0.00 ? 33 ALA A HB1  4  
ATOM 3866  H HB2  . ALA A 1 33 ? -5.718  -13.675 5.114   1.00 0.00 ? 33 ALA A HB2  4  
ATOM 3867  H HB3  . ALA A 1 33 ? -6.837  -13.563 3.755   1.00 0.00 ? 33 ALA A HB3  4  
ATOM 3868  N N    . LEU A 1 34 ? -5.664  -14.194 1.177   1.00 0.00 ? 34 LEU A N    4  
ATOM 3869  C CA   . LEU A 1 34 ? -6.139  -14.169 -0.202  1.00 0.00 ? 34 LEU A CA   4  
ATOM 3870  C C    . LEU A 1 34 ? -7.340  -13.240 -0.347  1.00 0.00 ? 34 LEU A C    4  
ATOM 3871  O O    . LEU A 1 34 ? -7.314  -12.263 -1.096  1.00 0.00 ? 34 LEU A O    4  
ATOM 3872  C CB   . LEU A 1 34 ? -6.512  -15.580 -0.660  1.00 0.00 ? 34 LEU A CB   4  
ATOM 3873  C CG   . LEU A 1 34 ? -7.673  -15.679 -1.650  1.00 0.00 ? 34 LEU A CG   4  
ATOM 3874  C CD1  . LEU A 1 34 ? -7.276  -15.096 -2.998  1.00 0.00 ? 34 LEU A CD1  4  
ATOM 3875  C CD2  . LEU A 1 34 ? -8.121  -17.126 -1.804  1.00 0.00 ? 34 LEU A CD2  4  
ATOM 3876  H H    . LEU A 1 34 ? -5.646  -15.047 1.659   1.00 0.00 ? 34 LEU A H    4  
ATOM 3877  H HA   . LEU A 1 34 ? -5.336  -13.799 -0.822  1.00 0.00 ? 34 LEU A HA   4  
ATOM 3878  H HB2  . LEU A 1 34 ? -5.642  -16.017 -1.125  1.00 0.00 ? 34 LEU A HB2  4  
ATOM 3879  H HB3  . LEU A 1 34 ? -6.775  -16.153 0.218   1.00 0.00 ? 34 LEU A HB3  4  
ATOM 3880  H HG   . LEU A 1 34 ? -8.509  -15.107 -1.274  1.00 0.00 ? 34 LEU A HG   4  
ATOM 3881  H HD11 . LEU A 1 34 ? -6.725  -15.835 -3.561  1.00 0.00 ? 34 LEU A HD11 4  
ATOM 3882  H HD12 . LEU A 1 34 ? -6.656  -14.225 -2.845  1.00 0.00 ? 34 LEU A HD12 4  
ATOM 3883  H HD13 . LEU A 1 34 ? -8.164  -14.815 -3.544  1.00 0.00 ? 34 LEU A HD13 4  
ATOM 3884  H HD21 . LEU A 1 34 ? -8.174  -17.376 -2.853  1.00 0.00 ? 34 LEU A HD21 4  
ATOM 3885  H HD22 . LEU A 1 34 ? -9.095  -17.250 -1.354  1.00 0.00 ? 34 LEU A HD22 4  
ATOM 3886  H HD23 . LEU A 1 34 ? -7.411  -17.776 -1.314  1.00 0.00 ? 34 LEU A HD23 4  
ATOM 3887  N N    . PRO A 1 35 ? -8.420  -13.550 0.386   1.00 0.00 ? 35 PRO A N    4  
ATOM 3888  C CA   . PRO A 1 35 ? -9.650  -12.754 0.358   1.00 0.00 ? 35 PRO A CA   4  
ATOM 3889  C C    . PRO A 1 35 ? -9.473  -11.389 1.016   1.00 0.00 ? 35 PRO A C    4  
ATOM 3890  O O    . PRO A 1 35 ? -10.157 -10.428 0.665   1.00 0.00 ? 35 PRO A O    4  
ATOM 3891  C CB   . PRO A 1 35 ? -10.642 -13.606 1.154   1.00 0.00 ? 35 PRO A CB   4  
ATOM 3892  C CG   . PRO A 1 35 ? -9.792  -14.431 2.058   1.00 0.00 ? 35 PRO A CG   4  
ATOM 3893  C CD   . PRO A 1 35 ? -8.522  -14.700 1.300   1.00 0.00 ? 35 PRO A CD   4  
ATOM 3894  H HA   . PRO A 1 35 ? -10.015 -12.622 -0.650  1.00 0.00 ? 35 PRO A HA   4  
ATOM 3895  H HB2  . PRO A 1 35 ? -11.306 -12.962 1.714   1.00 0.00 ? 35 PRO A HB2  4  
ATOM 3896  H HB3  . PRO A 1 35 ? -11.215 -14.223 0.479   1.00 0.00 ? 35 PRO A HB3  4  
ATOM 3897  H HG2  . PRO A 1 35 ? -9.580  -13.884 2.964   1.00 0.00 ? 35 PRO A HG2  4  
ATOM 3898  H HG3  . PRO A 1 35 ? -10.295 -15.359 2.287   1.00 0.00 ? 35 PRO A HG3  4  
ATOM 3899  H HD2  . PRO A 1 35 ? -7.679  -14.732 1.975   1.00 0.00 ? 35 PRO A HD2  4  
ATOM 3900  H HD3  . PRO A 1 35 ? -8.600  -15.625 0.748   1.00 0.00 ? 35 PRO A HD3  4  
ATOM 3901  N N    . GLU A 1 36 ? -8.551  -11.312 1.970   1.00 0.00 ? 36 GLU A N    4  
ATOM 3902  C CA   . GLU A 1 36 ? -8.285  -10.064 2.676   1.00 0.00 ? 36 GLU A CA   4  
ATOM 3903  C C    . GLU A 1 36 ? -7.686  -9.024  1.734   1.00 0.00 ? 36 GLU A C    4  
ATOM 3904  O O    . GLU A 1 36 ? -8.187  -7.904  1.630   1.00 0.00 ? 36 GLU A O    4  
ATOM 3905  C CB   . GLU A 1 36 ? -7.338  -10.309 3.852   1.00 0.00 ? 36 GLU A CB   4  
ATOM 3906  C CG   . GLU A 1 36 ? -8.025  -10.890 5.077   1.00 0.00 ? 36 GLU A CG   4  
ATOM 3907  C CD   . GLU A 1 36 ? -9.263  -10.109 5.476   1.00 0.00 ? 36 GLU A CD   4  
ATOM 3908  O OE1  . GLU A 1 36 ? -9.124  -9.119  6.224   1.00 0.00 ? 36 GLU A OE1  4  
ATOM 3909  O OE2  . GLU A 1 36 ? -10.369 -10.489 5.040   1.00 0.00 ? 36 GLU A OE2  4  
ATOM 3910  H H    . GLU A 1 36 ? -8.038  -12.113 2.205   1.00 0.00 ? 36 GLU A H    4  
ATOM 3911  H HA   . GLU A 1 36 ? -9.225  -9.691  3.054   1.00 0.00 ? 36 GLU A HA   4  
ATOM 3912  H HB2  . GLU A 1 36 ? -6.565  -10.996 3.539   1.00 0.00 ? 36 GLU A HB2  4  
ATOM 3913  H HB3  . GLU A 1 36 ? -6.882  -9.371  4.132   1.00 0.00 ? 36 GLU A HB3  4  
ATOM 3914  H HG2  . GLU A 1 36 ? -8.315  -11.908 4.863   1.00 0.00 ? 36 GLU A HG2  4  
ATOM 3915  H HG3  . GLU A 1 36 ? -7.330  -10.881 5.903   1.00 0.00 ? 36 GLU A HG3  4  
ATOM 3916  N N    . ARG A 1 37 ? -6.610  -9.402  1.052   1.00 0.00 ? 37 ARG A N    4  
ATOM 3917  C CA   . ARG A 1 37 ? -5.941  -8.502  0.120   1.00 0.00 ? 37 ARG A CA   4  
ATOM 3918  C C    . ARG A 1 37 ? -6.912  -8.001  -0.945  1.00 0.00 ? 37 ARG A C    4  
ATOM 3919  O O    . ARG A 1 37 ? -6.886  -6.830  -1.321  1.00 0.00 ? 37 ARG A O    4  
ATOM 3920  C CB   . ARG A 1 37 ? -4.759  -9.209  -0.545  1.00 0.00 ? 37 ARG A CB   4  
ATOM 3921  C CG   . ARG A 1 37 ? -4.185  -8.451  -1.731  1.00 0.00 ? 37 ARG A CG   4  
ATOM 3922  C CD   . ARG A 1 37 ? -3.340  -9.356  -2.614  1.00 0.00 ? 37 ARG A CD   4  
ATOM 3923  N NE   . ARG A 1 37 ? -3.977  -10.652 -2.838  1.00 0.00 ? 37 ARG A NE   4  
ATOM 3924  C CZ   . ARG A 1 37 ? -3.307  -11.754 -3.158  1.00 0.00 ? 37 ARG A CZ   4  
ATOM 3925  N NH1  . ARG A 1 37 ? -1.989  -11.717 -3.291  1.00 0.00 ? 37 ARG A NH1  4  
ATOM 3926  N NH2  . ARG A 1 37 ? -3.957  -12.895 -3.346  1.00 0.00 ? 37 ARG A NH2  4  
ATOM 3927  H H    . ARG A 1 37 ? -6.258  -10.308 1.178   1.00 0.00 ? 37 ARG A H    4  
ATOM 3928  H HA   . ARG A 1 37 ? -5.574  -7.656  0.682   1.00 0.00 ? 37 ARG A HA   4  
ATOM 3929  H HB2  . ARG A 1 37 ? -3.973  -9.337  0.186   1.00 0.00 ? 37 ARG A HB2  4  
ATOM 3930  H HB3  . ARG A 1 37 ? -5.082  -10.180 -0.888  1.00 0.00 ? 37 ARG A HB3  4  
ATOM 3931  H HG2  . ARG A 1 37 ? -4.999  -8.052  -2.319  1.00 0.00 ? 37 ARG A HG2  4  
ATOM 3932  H HG3  . ARG A 1 37 ? -3.570  -7.642  -1.367  1.00 0.00 ? 37 ARG A HG3  4  
ATOM 3933  H HD2  . ARG A 1 37 ? -3.191  -8.870  -3.567  1.00 0.00 ? 37 ARG A HD2  4  
ATOM 3934  H HD3  . ARG A 1 37 ? -2.385  -9.513  -2.137  1.00 0.00 ? 37 ARG A HD3  4  
ATOM 3935  H HE   . ARG A 1 37 ? -4.950  -10.701 -2.745  1.00 0.00 ? 37 ARG A HE   4  
ATOM 3936  H HH11 . ARG A 1 37 ? -1.496  -10.859 -3.149  1.00 0.00 ? 37 ARG A HH11 4  
ATOM 3937  H HH12 . ARG A 1 37 ? -1.487  -12.549 -3.531  1.00 0.00 ? 37 ARG A HH12 4  
ATOM 3938  H HH21 . ARG A 1 37 ? -4.952  -12.926 -3.247  1.00 0.00 ? 37 ARG A HH21 4  
ATOM 3939  H HH22 . ARG A 1 37 ? -3.453  -13.724 -3.587  1.00 0.00 ? 37 ARG A HH22 4  
ATOM 3940  N N    . ALA A 1 38 ? -7.768  -8.896  -1.426  1.00 0.00 ? 38 ALA A N    4  
ATOM 3941  C CA   . ALA A 1 38 ? -8.748  -8.545  -2.446  1.00 0.00 ? 38 ALA A CA   4  
ATOM 3942  C C    . ALA A 1 38 ? -9.723  -7.491  -1.931  1.00 0.00 ? 38 ALA A C    4  
ATOM 3943  O O    . ALA A 1 38 ? -10.018 -6.517  -2.621  1.00 0.00 ? 38 ALA A O    4  
ATOM 3944  C CB   . ALA A 1 38 ? -9.502  -9.785  -2.903  1.00 0.00 ? 38 ALA A CB   4  
ATOM 3945  H H    . ALA A 1 38 ? -7.740  -9.815  -1.086  1.00 0.00 ? 38 ALA A H    4  
ATOM 3946  H HA   . ALA A 1 38 ? -8.216  -8.144  -3.296  1.00 0.00 ? 38 ALA A HA   4  
ATOM 3947  H HB1  . ALA A 1 38 ? -10.460 -9.494  -3.308  1.00 0.00 ? 38 ALA A HB1  4  
ATOM 3948  H HB2  . ALA A 1 38 ? -8.929  -10.295 -3.663  1.00 0.00 ? 38 ALA A HB2  4  
ATOM 3949  H HB3  . ALA A 1 38 ? -9.653  -10.445 -2.061  1.00 0.00 ? 38 ALA A HB3  4  
ATOM 3950  N N    . GLU A 1 39 ? -10.219 -7.695  -0.715  1.00 0.00 ? 39 GLU A N    4  
ATOM 3951  C CA   . GLU A 1 39 ? -11.161 -6.761  -0.109  1.00 0.00 ? 39 GLU A CA   4  
ATOM 3952  C C    . GLU A 1 39 ? -10.747 -5.318  -0.379  1.00 0.00 ? 39 GLU A C    4  
ATOM 3953  O O    . GLU A 1 39 ? -11.582 -4.469  -0.693  1.00 0.00 ? 39 GLU A O    4  
ATOM 3954  C CB   . GLU A 1 39 ? -11.255 -7.003  1.399   1.00 0.00 ? 39 GLU A CB   4  
ATOM 3955  C CG   . GLU A 1 39 ? -12.034 -8.255  1.767   1.00 0.00 ? 39 GLU A CG   4  
ATOM 3956  C CD   . GLU A 1 39 ? -13.525 -8.002  1.883   1.00 0.00 ? 39 GLU A CD   4  
ATOM 3957  O OE1  . GLU A 1 39 ? -13.922 -7.166  2.723   1.00 0.00 ? 39 GLU A OE1  4  
ATOM 3958  O OE2  . GLU A 1 39 ? -14.294 -8.639  1.134   1.00 0.00 ? 39 GLU A OE2  4  
ATOM 3959  H H    . GLU A 1 39 ? -9.945  -8.491  -0.213  1.00 0.00 ? 39 GLU A H    4  
ATOM 3960  H HA   . GLU A 1 39 ? -12.130 -6.934  -0.553  1.00 0.00 ? 39 GLU A HA   4  
ATOM 3961  H HB2  . GLU A 1 39 ? -10.257 -7.094  1.800   1.00 0.00 ? 39 GLU A HB2  4  
ATOM 3962  H HB3  . GLU A 1 39 ? -11.741 -6.155  1.857   1.00 0.00 ? 39 GLU A HB3  4  
ATOM 3963  H HG2  . GLU A 1 39 ? -11.870 -9.003  1.006   1.00 0.00 ? 39 GLU A HG2  4  
ATOM 3964  H HG3  . GLU A 1 39 ? -11.671 -8.623  2.716   1.00 0.00 ? 39 GLU A HG3  4  
ATOM 3965  N N    . LEU A 1 40 ? -9.453  -5.047  -0.254  1.00 0.00 ? 40 LEU A N    4  
ATOM 3966  C CA   . LEU A 1 40 ? -8.926  -3.706  -0.483  1.00 0.00 ? 40 LEU A CA   4  
ATOM 3967  C C    . LEU A 1 40 ? -9.032  -3.324  -1.956  1.00 0.00 ? 40 LEU A C    4  
ATOM 3968  O O    . LEU A 1 40 ? -9.355  -2.185  -2.290  1.00 0.00 ? 40 LEU A O    4  
ATOM 3969  C CB   . LEU A 1 40 ? -7.468  -3.624  -0.027  1.00 0.00 ? 40 LEU A CB   4  
ATOM 3970  C CG   . LEU A 1 40 ? -7.176  -4.140  1.383   1.00 0.00 ? 40 LEU A CG   4  
ATOM 3971  C CD1  . LEU A 1 40 ? -5.848  -3.596  1.886   1.00 0.00 ? 40 LEU A CD1  4  
ATOM 3972  C CD2  . LEU A 1 40 ? -8.303  -3.763  2.333   1.00 0.00 ? 40 LEU A CD2  4  
ATOM 3973  H H    . LEU A 1 40 ? -8.836  -5.765  -0.001  1.00 0.00 ? 40 LEU A H    4  
ATOM 3974  H HA   . LEU A 1 40 ? -9.516  -3.014  0.099   1.00 0.00 ? 40 LEU A HA   4  
ATOM 3975  H HB2  . LEU A 1 40 ? -6.872  -4.199  -0.719  1.00 0.00 ? 40 LEU A HB2  4  
ATOM 3976  H HB3  . LEU A 1 40 ? -7.167  -2.587  -0.070  1.00 0.00 ? 40 LEU A HB3  4  
ATOM 3977  H HG   . LEU A 1 40 ? -7.106  -5.219  1.357   1.00 0.00 ? 40 LEU A HG   4  
ATOM 3978  H HD11 . LEU A 1 40 ? -5.523  -2.790  1.245   1.00 0.00 ? 40 LEU A HD11 4  
ATOM 3979  H HD12 . LEU A 1 40 ? -5.109  -4.384  1.875   1.00 0.00 ? 40 LEU A HD12 4  
ATOM 3980  H HD13 . LEU A 1 40 ? -5.968  -3.229  2.894   1.00 0.00 ? 40 LEU A HD13 4  
ATOM 3981  H HD21 . LEU A 1 40 ? -8.485  -2.700  2.271   1.00 0.00 ? 40 LEU A HD21 4  
ATOM 3982  H HD22 . LEU A 1 40 ? -8.024  -4.022  3.344   1.00 0.00 ? 40 LEU A HD22 4  
ATOM 3983  H HD23 . LEU A 1 40 ? -9.200  -4.298  2.058   1.00 0.00 ? 40 LEU A HD23 4  
ATOM 3984  N N    . ALA A 1 41 ? -8.759  -4.286  -2.832  1.00 0.00 ? 41 ALA A N    4  
ATOM 3985  C CA   . ALA A 1 41 ? -8.828  -4.051  -4.269  1.00 0.00 ? 41 ALA A CA   4  
ATOM 3986  C C    . ALA A 1 41 ? -10.263 -3.789  -4.715  1.00 0.00 ? 41 ALA A C    4  
ATOM 3987  O O    . ALA A 1 41 ? -10.519 -2.892  -5.518  1.00 0.00 ? 41 ALA A O    4  
ATOM 3988  C CB   . ALA A 1 41 ? -8.247  -5.237  -5.026  1.00 0.00 ? 41 ALA A CB   4  
ATOM 3989  H H    . ALA A 1 41 ? -8.507  -5.174  -2.504  1.00 0.00 ? 41 ALA A H    4  
ATOM 3990  H HA   . ALA A 1 41 ? -8.227  -3.182  -4.495  1.00 0.00 ? 41 ALA A HA   4  
ATOM 3991  H HB1  . ALA A 1 41 ? -7.221  -5.025  -5.291  1.00 0.00 ? 41 ALA A HB1  4  
ATOM 3992  H HB2  . ALA A 1 41 ? -8.283  -6.116  -4.400  1.00 0.00 ? 41 ALA A HB2  4  
ATOM 3993  H HB3  . ALA A 1 41 ? -8.823  -5.408  -5.923  1.00 0.00 ? 41 ALA A HB3  4  
ATOM 3994  N N    . ALA A 1 42 ? -11.194 -4.578  -4.189  1.00 0.00 ? 42 ALA A N    4  
ATOM 3995  C CA   . ALA A 1 42 ? -12.603 -4.430  -4.532  1.00 0.00 ? 42 ALA A CA   4  
ATOM 3996  C C    . ALA A 1 42 ? -13.217 -3.226  -3.824  1.00 0.00 ? 42 ALA A C    4  
ATOM 3997  O O    . ALA A 1 42 ? -14.033 -2.506  -4.399  1.00 0.00 ? 42 ALA A O    4  
ATOM 3998  C CB   . ALA A 1 42 ? -13.368 -5.697  -4.181  1.00 0.00 ? 42 ALA A CB   4  
ATOM 3999  H H    . ALA A 1 42 ? -10.927 -5.275  -3.554  1.00 0.00 ? 42 ALA A H    4  
ATOM 4000  H HA   . ALA A 1 42 ? -12.673 -4.281  -5.600  1.00 0.00 ? 42 ALA A HA   4  
ATOM 4001  H HB1  . ALA A 1 42 ? -13.629 -6.223  -5.088  1.00 0.00 ? 42 ALA A HB1  4  
ATOM 4002  H HB2  . ALA A 1 42 ? -12.750 -6.331  -3.562  1.00 0.00 ? 42 ALA A HB2  4  
ATOM 4003  H HB3  . ALA A 1 42 ? -14.268 -5.437  -3.644  1.00 0.00 ? 42 ALA A HB3  4  
ATOM 4004  N N    . SER A 1 43 ? -12.819 -3.015  -2.574  1.00 0.00 ? 43 SER A N    4  
ATOM 4005  C CA   . SER A 1 43 ? -13.333 -1.900  -1.786  1.00 0.00 ? 43 SER A CA   4  
ATOM 4006  C C    . SER A 1 43 ? -12.732 -0.579  -2.257  1.00 0.00 ? 43 SER A C    4  
ATOM 4007  O O    . SER A 1 43 ? -13.451 0.326   -2.682  1.00 0.00 ? 43 SER A O    4  
ATOM 4008  C CB   . SER A 1 43 ? -13.027 -2.113  -0.302  1.00 0.00 ? 43 SER A CB   4  
ATOM 4009  O OG   . SER A 1 43 ? -13.762 -3.207  0.218   1.00 0.00 ? 43 SER A OG   4  
ATOM 4010  H H    . SER A 1 43 ? -12.165 -3.624  -2.171  1.00 0.00 ? 43 SER A H    4  
ATOM 4011  H HA   . SER A 1 43 ? -14.404 -1.865  -1.923  1.00 0.00 ? 43 SER A HA   4  
ATOM 4012  H HB2  . SER A 1 43 ? -11.973 -2.312  -0.180  1.00 0.00 ? 43 SER A HB2  4  
ATOM 4013  H HB3  . SER A 1 43 ? -13.292 -1.222  0.248   1.00 0.00 ? 43 SER A HB3  4  
ATOM 4014  H HG   . SER A 1 43 ? -14.464 -2.880  0.786   1.00 0.00 ? 43 SER A HG   4  
ATOM 4015  N N    . LEU A 1 44 ? -11.410 -0.476  -2.177  1.00 0.00 ? 44 LEU A N    4  
ATOM 4016  C CA   . LEU A 1 44 ? -10.711 0.734   -2.595  1.00 0.00 ? 44 LEU A CA   4  
ATOM 4017  C C    . LEU A 1 44 ? -10.815 0.930   -4.104  1.00 0.00 ? 44 LEU A C    4  
ATOM 4018  O O    . LEU A 1 44 ? -10.503 2.000   -4.624  1.00 0.00 ? 44 LEU A O    4  
ATOM 4019  C CB   . LEU A 1 44 ? -9.241  0.666   -2.178  1.00 0.00 ? 44 LEU A CB   4  
ATOM 4020  C CG   . LEU A 1 44 ? -8.969  0.184   -0.752  1.00 0.00 ? 44 LEU A CG   4  
ATOM 4021  C CD1  . LEU A 1 44 ? -7.476  -0.004  -0.528  1.00 0.00 ? 44 LEU A CD1  4  
ATOM 4022  C CD2  . LEU A 1 44 ? -9.543  1.163   0.261   1.00 0.00 ? 44 LEU A CD2  4  
ATOM 4023  H H    . LEU A 1 44 ? -10.892 -1.231  -1.830  1.00 0.00 ? 44 LEU A H    4  
ATOM 4024  H HA   . LEU A 1 44 ? -11.178 1.573   -2.102  1.00 0.00 ? 44 LEU A HA   4  
ATOM 4025  H HB2  . LEU A 1 44 ? -8.735  -0.004  -2.855  1.00 0.00 ? 44 LEU A HB2  4  
ATOM 4026  H HB3  . LEU A 1 44 ? -8.823  1.658   -2.278  1.00 0.00 ? 44 LEU A HB3  4  
ATOM 4027  H HG   . LEU A 1 44 ? -9.451  -0.773  -0.605  1.00 0.00 ? 44 LEU A HG   4  
ATOM 4028  H HD11 . LEU A 1 44 ? -7.290  -0.183  0.520   1.00 0.00 ? 44 LEU A HD11 4  
ATOM 4029  H HD12 . LEU A 1 44 ? -6.951  0.886   -0.840  1.00 0.00 ? 44 LEU A HD12 4  
ATOM 4030  H HD13 . LEU A 1 44 ? -7.129  -0.848  -1.106  1.00 0.00 ? 44 LEU A HD13 4  
ATOM 4031  H HD21 . LEU A 1 44 ? -9.509  2.163   -0.146  1.00 0.00 ? 44 LEU A HD21 4  
ATOM 4032  H HD22 . LEU A 1 44 ? -8.960  1.124   1.170   1.00 0.00 ? 44 LEU A HD22 4  
ATOM 4033  H HD23 . LEU A 1 44 ? -10.567 0.897   0.478   1.00 0.00 ? 44 LEU A HD23 4  
ATOM 4034  N N    . GLY A 1 45 ? -11.257 -0.112  -4.802  1.00 0.00 ? 45 GLY A N    4  
ATOM 4035  C CA   . GLY A 1 45 ? -11.397 -0.033  -6.244  1.00 0.00 ? 45 GLY A CA   4  
ATOM 4036  C C    . GLY A 1 45 ? -10.094 -0.311  -6.968  1.00 0.00 ? 45 GLY A C    4  
ATOM 4037  O O    . GLY A 1 45 ? -9.951  0.010   -8.149  1.00 0.00 ? 45 GLY A O    4  
ATOM 4038  H H    . GLY A 1 45 ? -11.491 -0.941  -4.333  1.00 0.00 ? 45 GLY A H    4  
ATOM 4039  H HA2  . GLY A 1 45 ? -12.135 -0.753  -6.563  1.00 0.00 ? 45 GLY A HA2  4  
ATOM 4040  H HA3  . GLY A 1 45 ? -11.737 0.958   -6.508  1.00 0.00 ? 45 GLY A HA3  4  
ATOM 4041  N N    . LEU A 1 46 ? -9.141  -0.907  -6.261  1.00 0.00 ? 46 LEU A N    4  
ATOM 4042  C CA   . LEU A 1 46 ? -7.842  -1.226  -6.843  1.00 0.00 ? 46 LEU A CA   4  
ATOM 4043  C C    . LEU A 1 46 ? -7.758  -2.705  -7.207  1.00 0.00 ? 46 LEU A C    4  
ATOM 4044  O O    . LEU A 1 46 ? -8.689  -3.472  -6.957  1.00 0.00 ? 46 LEU A O    4  
ATOM 4045  C CB   . LEU A 1 46 ? -6.721  -0.865  -5.867  1.00 0.00 ? 46 LEU A CB   4  
ATOM 4046  C CG   . LEU A 1 46 ? -6.780  0.541   -5.268  1.00 0.00 ? 46 LEU A CG   4  
ATOM 4047  C CD1  . LEU A 1 46 ? -6.163  0.555   -3.879  1.00 0.00 ? 46 LEU A CD1  4  
ATOM 4048  C CD2  . LEU A 1 46 ? -6.075  1.538   -6.177  1.00 0.00 ? 46 LEU A CD2  4  
ATOM 4049  H H    . LEU A 1 46 ? -9.314  -1.138  -5.324  1.00 0.00 ? 46 LEU A H    4  
ATOM 4050  H HA   . LEU A 1 46 ? -7.729  -0.639  -7.742  1.00 0.00 ? 46 LEU A HA   4  
ATOM 4051  H HB2  . LEU A 1 46 ? -6.751  -1.572  -5.053  1.00 0.00 ? 46 LEU A HB2  4  
ATOM 4052  H HB3  . LEU A 1 46 ? -5.782  -0.963  -6.393  1.00 0.00 ? 46 LEU A HB3  4  
ATOM 4053  H HG   . LEU A 1 46 ? -7.814  0.844   -5.177  1.00 0.00 ? 46 LEU A HG   4  
ATOM 4054  H HD11 . LEU A 1 46 ? -5.118  0.291   -3.946  1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4055  H HD12 . LEU A 1 46 ? -6.675  -0.158  -3.250  1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4056  H HD13 . LEU A 1 46 ? -6.258  1.543   -3.453  1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4057  H HD21 . LEU A 1 46 ? -6.801  2.221   -6.593  1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4058  H HD22 . LEU A 1 46 ? -5.580  1.007   -6.978  1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4059  H HD23 . LEU A 1 46 ? -5.345  2.091   -5.606  1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4060  N N    . THR A 1 47 ? -6.634  -3.101  -7.798  1.00 0.00 ? 47 THR A N    4  
ATOM 4061  C CA   . THR A 1 47 ? -6.427  -4.487  -8.195  1.00 0.00 ? 47 THR A CA   4  
ATOM 4062  C C    . THR A 1 47 ? -5.425  -5.179  -7.278  1.00 0.00 ? 47 THR A C    4  
ATOM 4063  O O    . THR A 1 47 ? -4.653  -4.521  -6.581  1.00 0.00 ? 47 THR A O    4  
ATOM 4064  C CB   . THR A 1 47 ? -5.929  -4.587  -9.649  1.00 0.00 ? 47 THR A CB   4  
ATOM 4065  O OG1  . THR A 1 47 ? -6.034  -5.937  -10.112 1.00 0.00 ? 47 THR A OG1  4  
ATOM 4066  C CG2  . THR A 1 47 ? -4.485  -4.118  -9.760  1.00 0.00 ? 47 THR A CG2  4  
ATOM 4067  H H    . THR A 1 47 ? -5.929  -2.443  -7.970  1.00 0.00 ? 47 THR A H    4  
ATOM 4068  H HA   . THR A 1 47 ? -7.376  -4.999  -8.126  1.00 0.00 ? 47 THR A HA   4  
ATOM 4069  H HB   . THR A 1 47 ? -6.546  -3.952  -10.269 1.00 0.00 ? 47 THR A HB   4  
ATOM 4070  H HG1  . THR A 1 47 ? -6.129  -5.942  -11.068 1.00 0.00 ? 47 THR A HG1  4  
ATOM 4071  H HG21 . THR A 1 47 ? -3.857  -4.952  -10.034 1.00 0.00 ? 47 THR A HG21 4  
ATOM 4072  H HG22 . THR A 1 47 ? -4.162  -3.721  -8.809  1.00 0.00 ? 47 THR A HG22 4  
ATOM 4073  H HG23 . THR A 1 47 ? -4.414  -3.350  -10.514 1.00 0.00 ? 47 THR A HG23 4  
ATOM 4074  N N    . GLN A 1 48 ? -5.442  -6.507  -7.285  1.00 0.00 ? 48 GLN A N    4  
ATOM 4075  C CA   . GLN A 1 48 ? -4.533  -7.287  -6.452  1.00 0.00 ? 48 GLN A CA   4  
ATOM 4076  C C    . GLN A 1 48 ? -3.081  -6.938  -6.758  1.00 0.00 ? 48 GLN A C    4  
ATOM 4077  O O    . GLN A 1 48 ? -2.200  -7.098  -5.912  1.00 0.00 ? 48 GLN A O    4  
ATOM 4078  C CB   . GLN A 1 48 ? -4.767  -8.783  -6.668  1.00 0.00 ? 48 GLN A CB   4  
ATOM 4079  C CG   . GLN A 1 48 ? -6.048  -9.297  -6.029  1.00 0.00 ? 48 GLN A CG   4  
ATOM 4080  C CD   . GLN A 1 48 ? -6.440  -10.672 -6.534  1.00 0.00 ? 48 GLN A CD   4  
ATOM 4081  O OE1  . GLN A 1 48 ? -5.634  -11.376 -7.143  1.00 0.00 ? 48 GLN A OE1  4  
ATOM 4082  N NE2  . GLN A 1 48 ? -7.684  -11.062 -6.282  1.00 0.00 ? 48 GLN A NE2  4  
ATOM 4083  H H    . GLN A 1 48 ? -6.081  -6.974  -7.862  1.00 0.00 ? 48 GLN A H    4  
ATOM 4084  H HA   . GLN A 1 48 ? -4.739  -7.045  -5.421  1.00 0.00 ? 48 GLN A HA   4  
ATOM 4085  H HB2  . GLN A 1 48 ? -4.815  -8.979  -7.729  1.00 0.00 ? 48 GLN A HB2  4  
ATOM 4086  H HB3  . GLN A 1 48 ? -3.936  -9.330  -6.246  1.00 0.00 ? 48 GLN A HB3  4  
ATOM 4087  H HG2  . GLN A 1 48 ? -5.906  -9.350  -4.960  1.00 0.00 ? 48 GLN A HG2  4  
ATOM 4088  H HG3  . GLN A 1 48 ? -6.847  -8.606  -6.251  1.00 0.00 ? 48 GLN A HG3  4  
ATOM 4089  H HE21 . GLN A 1 48 ? -8.271  -10.448 -5.792  1.00 0.00 ? 48 GLN A HE21 4  
ATOM 4090  H HE22 . GLN A 1 48 ? -7.965  -11.945 -6.597  1.00 0.00 ? 48 GLN A HE22 4  
ATOM 4091  N N    . THR A 1 49 ? -2.835  -6.460  -7.974  1.00 0.00 ? 49 THR A N    4  
ATOM 4092  C CA   . THR A 1 49 ? -1.489  -6.090  -8.393  1.00 0.00 ? 49 THR A CA   4  
ATOM 4093  C C    . THR A 1 49 ? -1.122  -4.697  -7.895  1.00 0.00 ? 49 THR A C    4  
ATOM 4094  O O    . THR A 1 49 ? 0.042   -4.299  -7.939  1.00 0.00 ? 49 THR A O    4  
ATOM 4095  C CB   . THR A 1 49 ? -1.346  -6.130  -9.926  1.00 0.00 ? 49 THR A CB   4  
ATOM 4096  O OG1  . THR A 1 49 ? -2.032  -7.271  -10.453 1.00 0.00 ? 49 THR A OG1  4  
ATOM 4097  C CG2  . THR A 1 49 ? 0.119   -6.180  -10.332 1.00 0.00 ? 49 THR A CG2  4  
ATOM 4098  H H    . THR A 1 49 ? -3.578  -6.355  -8.604  1.00 0.00 ? 49 THR A H    4  
ATOM 4099  H HA   . THR A 1 49 ? -0.799  -6.806  -7.969  1.00 0.00 ? 49 THR A HA   4  
ATOM 4100  H HB   . THR A 1 49 ? -1.788  -5.233  -10.336 1.00 0.00 ? 49 THR A HB   4  
ATOM 4101  H HG1  . THR A 1 49 ? -1.667  -7.496  -11.312 1.00 0.00 ? 49 THR A HG1  4  
ATOM 4102  H HG21 . THR A 1 49 ? 0.679   -6.732  -9.592  1.00 0.00 ? 49 THR A HG21 4  
ATOM 4103  H HG22 . THR A 1 49 ? 0.507   -5.175  -10.403 1.00 0.00 ? 49 THR A HG22 4  
ATOM 4104  H HG23 . THR A 1 49 ? 0.210   -6.670  -11.290 1.00 0.00 ? 49 THR A HG23 4  
ATOM 4105  N N    . GLN A 1 50 ? -2.122  -3.960  -7.423  1.00 0.00 ? 50 GLN A N    4  
ATOM 4106  C CA   . GLN A 1 50 ? -1.903  -2.610  -6.917  1.00 0.00 ? 50 GLN A CA   4  
ATOM 4107  C C    . GLN A 1 50 ? -1.743  -2.616  -5.400  1.00 0.00 ? 50 GLN A C    4  
ATOM 4108  O O    . GLN A 1 50 ? -0.874  -1.936  -4.855  1.00 0.00 ? 50 GLN A O    4  
ATOM 4109  C CB   . GLN A 1 50 ? -3.065  -1.698  -7.315  1.00 0.00 ? 50 GLN A CB   4  
ATOM 4110  C CG   . GLN A 1 50 ? -2.993  -1.214  -8.754  1.00 0.00 ? 50 GLN A CG   4  
ATOM 4111  C CD   . GLN A 1 50 ? -3.625  0.151   -8.943  1.00 0.00 ? 50 GLN A CD   4  
ATOM 4112  O OE1  . GLN A 1 50 ? -3.243  1.120   -8.287  1.00 0.00 ? 50 GLN A OE1  4  
ATOM 4113  N NE2  . GLN A 1 50 ? -4.597  0.235   -9.844  1.00 0.00 ? 50 GLN A NE2  4  
ATOM 4114  H H    . GLN A 1 50 ? -3.028  -4.332  -7.415  1.00 0.00 ? 50 GLN A H    4  
ATOM 4115  H HA   . GLN A 1 50 ? -0.994  -2.233  -7.361  1.00 0.00 ? 50 GLN A HA   4  
ATOM 4116  H HB2  . GLN A 1 50 ? -3.992  -2.238  -7.186  1.00 0.00 ? 50 GLN A HB2  4  
ATOM 4117  H HB3  . GLN A 1 50 ? -3.068  -0.834  -6.667  1.00 0.00 ? 50 GLN A HB3  4  
ATOM 4118  H HG2  . GLN A 1 50 ? -1.956  -1.158  -9.050  1.00 0.00 ? 50 GLN A HG2  4  
ATOM 4119  H HG3  . GLN A 1 50 ? -3.508  -1.924  -9.385  1.00 0.00 ? 50 GLN A HG3  4  
ATOM 4120  H HE21 . GLN A 1 50 ? -4.849  -0.580  -10.329 1.00 0.00 ? 50 GLN A HE21 4  
ATOM 4121  H HE22 . GLN A 1 50 ? -5.023  1.105   -9.986  1.00 0.00 ? 50 GLN A HE22 4  
ATOM 4122  N N    . VAL A 1 51 ? -2.587  -3.389  -4.724  1.00 0.00 ? 51 VAL A N    4  
ATOM 4123  C CA   . VAL A 1 51 ? -2.539  -3.484  -3.270  1.00 0.00 ? 51 VAL A CA   4  
ATOM 4124  C C    . VAL A 1 51 ? -1.352  -4.324  -2.814  1.00 0.00 ? 51 VAL A C    4  
ATOM 4125  O O    . VAL A 1 51 ? -0.907  -4.221  -1.670  1.00 0.00 ? 51 VAL A O    4  
ATOM 4126  C CB   . VAL A 1 51 ? -3.835  -4.096  -2.705  1.00 0.00 ? 51 VAL A CB   4  
ATOM 4127  C CG1  . VAL A 1 51 ? -3.757  -4.204  -1.189  1.00 0.00 ? 51 VAL A CG1  4  
ATOM 4128  C CG2  . VAL A 1 51 ? -5.042  -3.272  -3.128  1.00 0.00 ? 51 VAL A CG2  4  
ATOM 4129  H H    . VAL A 1 51 ? -3.258  -3.908  -5.215  1.00 0.00 ? 51 VAL A H    4  
ATOM 4130  H HA   . VAL A 1 51 ? -2.435  -2.485  -2.873  1.00 0.00 ? 51 VAL A HA   4  
ATOM 4131  H HB   . VAL A 1 51 ? -3.945  -5.092  -3.109  1.00 0.00 ? 51 VAL A HB   4  
ATOM 4132  H HG11 . VAL A 1 51 ? -4.724  -4.487  -0.799  1.00 0.00 ? 51 VAL A HG11 4  
ATOM 4133  H HG12 . VAL A 1 51 ? -3.026  -4.951  -0.918  1.00 0.00 ? 51 VAL A HG12 4  
ATOM 4134  H HG13 . VAL A 1 51 ? -3.468  -3.249  -0.775  1.00 0.00 ? 51 VAL A HG13 4  
ATOM 4135  H HG21 . VAL A 1 51 ? -5.293  -3.504  -4.152  1.00 0.00 ? 51 VAL A HG21 4  
ATOM 4136  H HG22 . VAL A 1 51 ? -5.881  -3.508  -2.489  1.00 0.00 ? 51 VAL A HG22 4  
ATOM 4137  H HG23 . VAL A 1 51 ? -4.809  -2.222  -3.042  1.00 0.00 ? 51 VAL A HG23 4  
ATOM 4138  N N    . LYS A 1 52 ? -0.842  -5.157  -3.715  1.00 0.00 ? 52 LYS A N    4  
ATOM 4139  C CA   . LYS A 1 52 ? 0.296   -6.015  -3.407  1.00 0.00 ? 52 LYS A CA   4  
ATOM 4140  C C    . LYS A 1 52 ? 1.590   -5.209  -3.366  1.00 0.00 ? 52 LYS A C    4  
ATOM 4141  O O    . LYS A 1 52 ? 2.378   -5.329  -2.428  1.00 0.00 ? 52 LYS A O    4  
ATOM 4142  C CB   . LYS A 1 52 ? 0.412   -7.134  -4.444  1.00 0.00 ? 52 LYS A CB   4  
ATOM 4143  C CG   . LYS A 1 52 ? -0.359  -8.389  -4.074  1.00 0.00 ? 52 LYS A CG   4  
ATOM 4144  C CD   . LYS A 1 52 ? -0.496  -9.330  -5.260  1.00 0.00 ? 52 LYS A CD   4  
ATOM 4145  C CE   . LYS A 1 52 ? 0.805   -10.065 -5.541  1.00 0.00 ? 52 LYS A CE   4  
ATOM 4146  N NZ   . LYS A 1 52 ? 0.980   -11.244 -4.647  1.00 0.00 ? 52 LYS A NZ   4  
ATOM 4147  H H    . LYS A 1 52 ? -1.240  -5.194  -4.610  1.00 0.00 ? 52 LYS A H    4  
ATOM 4148  H HA   . LYS A 1 52 ? 0.128   -6.453  -2.435  1.00 0.00 ? 52 LYS A HA   4  
ATOM 4149  H HB2  . LYS A 1 52 ? 0.037   -6.772  -5.390  1.00 0.00 ? 52 LYS A HB2  4  
ATOM 4150  H HB3  . LYS A 1 52 ? 1.454   -7.398  -4.557  1.00 0.00 ? 52 LYS A HB3  4  
ATOM 4151  H HG2  . LYS A 1 52 ? 0.164   -8.902  -3.281  1.00 0.00 ? 52 LYS A HG2  4  
ATOM 4152  H HG3  . LYS A 1 52 ? -1.345  -8.107  -3.734  1.00 0.00 ? 52 LYS A HG3  4  
ATOM 4153  H HD2  . LYS A 1 52 ? -1.267  -10.055 -5.046  1.00 0.00 ? 52 LYS A HD2  4  
ATOM 4154  H HD3  . LYS A 1 52 ? -0.771  -8.756  -6.133  1.00 0.00 ? 52 LYS A HD3  4  
ATOM 4155  H HE2  . LYS A 1 52 ? 0.800   -10.400 -6.567  1.00 0.00 ? 52 LYS A HE2  4  
ATOM 4156  H HE3  . LYS A 1 52 ? 1.629   -9.383  -5.389  1.00 0.00 ? 52 LYS A HE3  4  
ATOM 4157  H HZ1  . LYS A 1 52 ? 1.347   -10.939 -3.723  1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 4158  H HZ2  . LYS A 1 52 ? 1.653   -11.915 -5.069  1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 4159  H HZ3  . LYS A 1 52 ? 0.069   -11.724 -4.506  1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 4160  N N    . ILE A 1 53 ? 1.802   -4.387  -4.389  1.00 0.00 ? 53 ILE A N    4  
ATOM 4161  C CA   . ILE A 1 53 ? 3.000   -3.559  -4.467  1.00 0.00 ? 53 ILE A CA   4  
ATOM 4162  C C    . ILE A 1 53 ? 3.003   -2.493  -3.377  1.00 0.00 ? 53 ILE A C    4  
ATOM 4163  O O    . ILE A 1 53 ? 4.030   -2.239  -2.746  1.00 0.00 ? 53 ILE A O    4  
ATOM 4164  C CB   . ILE A 1 53 ? 3.121   -2.874  -5.841  1.00 0.00 ? 53 ILE A CB   4  
ATOM 4165  C CG1  . ILE A 1 53 ? 3.053   -3.913  -6.962  1.00 0.00 ? 53 ILE A CG1  4  
ATOM 4166  C CG2  . ILE A 1 53 ? 4.417   -2.081  -5.924  1.00 0.00 ? 53 ILE A CG2  4  
ATOM 4167  C CD1  . ILE A 1 53 ? 2.645   -3.335  -8.299  1.00 0.00 ? 53 ILE A CD1  4  
ATOM 4168  H H    . ILE A 1 53 ? 1.138   -4.335  -5.106  1.00 0.00 ? 53 ILE A H    4  
ATOM 4169  H HA   . ILE A 1 53 ? 3.858   -4.202  -4.330  1.00 0.00 ? 53 ILE A HA   4  
ATOM 4170  H HB   . ILE A 1 53 ? 2.298   -2.185  -5.948  1.00 0.00 ? 53 ILE A HB   4  
ATOM 4171  H HG12 . ILE A 1 53 ? 4.023   -4.370  -7.081  1.00 0.00 ? 53 ILE A HG12 4  
ATOM 4172  H HG13 . ILE A 1 53 ? 2.333   -4.673  -6.694  1.00 0.00 ? 53 ILE A HG13 4  
ATOM 4173  H HG21 . ILE A 1 53 ? 4.251   -1.080  -5.554  1.00 0.00 ? 53 ILE A HG21 4  
ATOM 4174  H HG22 . ILE A 1 53 ? 5.174   -2.565  -5.326  1.00 0.00 ? 53 ILE A HG22 4  
ATOM 4175  H HG23 . ILE A 1 53 ? 4.745   -2.034  -6.952  1.00 0.00 ? 53 ILE A HG23 4  
ATOM 4176  H HD11 . ILE A 1 53 ? 3.521   -2.973  -8.817  1.00 0.00 ? 53 ILE A HD11 4  
ATOM 4177  H HD12 . ILE A 1 53 ? 2.165   -4.099  -8.891  1.00 0.00 ? 53 ILE A HD12 4  
ATOM 4178  H HD13 . ILE A 1 53 ? 1.958   -2.516  -8.141  1.00 0.00 ? 53 ILE A HD13 4  
ATOM 4179  N N    . TRP A 1 54 ? 1.849   -1.873  -3.160  1.00 0.00 ? 54 TRP A N    4  
ATOM 4180  C CA   . TRP A 1 54 ? 1.719   -0.834  -2.145  1.00 0.00 ? 54 TRP A CA   4  
ATOM 4181  C C    . TRP A 1 54 ? 2.170   -1.347  -0.781  1.00 0.00 ? 54 TRP A C    4  
ATOM 4182  O O    . TRP A 1 54 ? 2.916   -0.673  -0.070  1.00 0.00 ? 54 TRP A O    4  
ATOM 4183  C CB   . TRP A 1 54 ? 0.271   -0.348  -2.066  1.00 0.00 ? 54 TRP A CB   4  
ATOM 4184  C CG   . TRP A 1 54 ? 0.089   0.831   -1.160  1.00 0.00 ? 54 TRP A CG   4  
ATOM 4185  C CD1  . TRP A 1 54 ? -0.060  2.137   -1.533  1.00 0.00 ? 54 TRP A CD1  4  
ATOM 4186  C CD2  . TRP A 1 54 ? 0.038   0.813   0.271   1.00 0.00 ? 54 TRP A CD2  4  
ATOM 4187  N NE1  . TRP A 1 54 ? -0.200  2.931   -0.420  1.00 0.00 ? 54 TRP A NE1  4  
ATOM 4188  C CE2  . TRP A 1 54 ? -0.144  2.142   0.699   1.00 0.00 ? 54 TRP A CE2  4  
ATOM 4189  C CE3  . TRP A 1 54 ? 0.127   -0.198  1.232   1.00 0.00 ? 54 TRP A CE3  4  
ATOM 4190  C CZ2  . TRP A 1 54 ? -0.238  2.485   2.045   1.00 0.00 ? 54 TRP A CZ2  4  
ATOM 4191  C CZ3  . TRP A 1 54 ? 0.034   0.143   2.568   1.00 0.00 ? 54 TRP A CZ3  4  
ATOM 4192  C CH2  . TRP A 1 54 ? -0.147  1.475   2.965   1.00 0.00 ? 54 TRP A CH2  4  
ATOM 4193  H H    . TRP A 1 54 ? 1.066   -2.119  -3.696  1.00 0.00 ? 54 TRP A H    4  
ATOM 4194  H HA   . TRP A 1 54 ? 2.351   -0.008  -2.434  1.00 0.00 ? 54 TRP A HA   4  
ATOM 4195  H HB2  . TRP A 1 54 ? -0.061  -0.064  -3.054  1.00 0.00 ? 54 TRP A HB2  4  
ATOM 4196  H HB3  . TRP A 1 54 ? -0.352  -1.151  -1.699  1.00 0.00 ? 54 TRP A HB3  4  
ATOM 4197  H HD1  . TRP A 1 54 ? -0.063  2.480   -2.556  1.00 0.00 ? 54 TRP A HD1  4  
ATOM 4198  H HE1  . TRP A 1 54 ? -0.322  3.903   -0.427  1.00 0.00 ? 54 TRP A HE1  4  
ATOM 4199  H HE3  . TRP A 1 54 ? 0.267   -1.230  0.946   1.00 0.00 ? 54 TRP A HE3  4  
ATOM 4200  H HZ2  . TRP A 1 54 ? -0.378  3.506   2.367   1.00 0.00 ? 54 TRP A HZ2  4  
ATOM 4201  H HZ3  . TRP A 1 54 ? 0.101   -0.624  3.325   1.00 0.00 ? 54 TRP A HZ3  4  
ATOM 4202  H HH2  . TRP A 1 54 ? -0.214  1.696   4.019   1.00 0.00 ? 54 TRP A HH2  4  
ATOM 4203  N N    . PHE A 1 55 ? 1.715   -2.542  -0.423  1.00 0.00 ? 55 PHE A N    4  
ATOM 4204  C CA   . PHE A 1 55 ? 2.072   -3.144  0.857   1.00 0.00 ? 55 PHE A CA   4  
ATOM 4205  C C    . PHE A 1 55 ? 3.548   -3.529  0.883   1.00 0.00 ? 55 PHE A C    4  
ATOM 4206  O O    . PHE A 1 55 ? 4.288   -3.127  1.781   1.00 0.00 ? 55 PHE A O    4  
ATOM 4207  C CB   . PHE A 1 55 ? 1.207   -4.378  1.123   1.00 0.00 ? 55 PHE A CB   4  
ATOM 4208  C CG   . PHE A 1 55 ? -0.064  -4.070  1.863   1.00 0.00 ? 55 PHE A CG   4  
ATOM 4209  C CD1  . PHE A 1 55 ? -1.098  -3.392  1.238   1.00 0.00 ? 55 PHE A CD1  4  
ATOM 4210  C CD2  . PHE A 1 55 ? -0.225  -4.460  3.182   1.00 0.00 ? 55 PHE A CD2  4  
ATOM 4211  C CE1  . PHE A 1 55 ? -2.268  -3.107  1.916   1.00 0.00 ? 55 PHE A CE1  4  
ATOM 4212  C CE2  . PHE A 1 55 ? -1.393  -4.179  3.866   1.00 0.00 ? 55 PHE A CE2  4  
ATOM 4213  C CZ   . PHE A 1 55 ? -2.416  -3.502  3.231   1.00 0.00 ? 55 PHE A CZ   4  
ATOM 4214  H H    . PHE A 1 55 ? 1.124   -3.031  -1.033  1.00 0.00 ? 55 PHE A H    4  
ATOM 4215  H HA   . PHE A 1 55 ? 1.889   -2.413  1.629   1.00 0.00 ? 55 PHE A HA   4  
ATOM 4216  H HB2  . PHE A 1 55 ? 0.940   -4.832  0.181   1.00 0.00 ? 55 PHE A HB2  4  
ATOM 4217  H HB3  . PHE A 1 55 ? 1.772   -5.084  1.712   1.00 0.00 ? 55 PHE A HB3  4  
ATOM 4218  H HD1  . PHE A 1 55 ? -0.984  -3.083  0.209   1.00 0.00 ? 55 PHE A HD1  4  
ATOM 4219  H HD2  . PHE A 1 55 ? 0.575   -4.991  3.680   1.00 0.00 ? 55 PHE A HD2  4  
ATOM 4220  H HE1  . PHE A 1 55 ? -3.066  -2.578  1.417   1.00 0.00 ? 55 PHE A HE1  4  
ATOM 4221  H HE2  . PHE A 1 55 ? -1.506  -4.489  4.894   1.00 0.00 ? 55 PHE A HE2  4  
ATOM 4222  H HZ   . PHE A 1 55 ? -3.329  -3.280  3.763   1.00 0.00 ? 55 PHE A HZ   4  
ATOM 4223  N N    . GLN A 1 56 ? 3.968   -4.310  -0.106  1.00 0.00 ? 56 GLN A N    4  
ATOM 4224  C CA   . GLN A 1 56 ? 5.355   -4.751  -0.196  1.00 0.00 ? 56 GLN A CA   4  
ATOM 4225  C C    . GLN A 1 56 ? 6.312   -3.584  0.025   1.00 0.00 ? 56 GLN A C    4  
ATOM 4226  O O    . GLN A 1 56 ? 7.074   -3.568  0.991   1.00 0.00 ? 56 GLN A O    4  
ATOM 4227  C CB   . GLN A 1 56 ? 5.622   -5.393  -1.558  1.00 0.00 ? 56 GLN A CB   4  
ATOM 4228  C CG   . GLN A 1 56 ? 7.020   -5.973  -1.694  1.00 0.00 ? 56 GLN A CG   4  
ATOM 4229  C CD   . GLN A 1 56 ? 7.245   -6.647  -3.033  1.00 0.00 ? 56 GLN A CD   4  
ATOM 4230  O OE1  . GLN A 1 56 ? 7.249   -5.994  -4.077  1.00 0.00 ? 56 GLN A OE1  4  
ATOM 4231  N NE2  . GLN A 1 56 ? 7.433   -7.961  -3.011  1.00 0.00 ? 56 GLN A NE2  4  
ATOM 4232  H H    . GLN A 1 56 ? 3.330   -4.598  -0.792  1.00 0.00 ? 56 GLN A H    4  
ATOM 4233  H HA   . GLN A 1 56 ? 5.520   -5.486  0.577   1.00 0.00 ? 56 GLN A HA   4  
ATOM 4234  H HB2  . GLN A 1 56 ? 4.908   -6.189  -1.713  1.00 0.00 ? 56 GLN A HB2  4  
ATOM 4235  H HB3  . GLN A 1 56 ? 5.489   -4.647  -2.327  1.00 0.00 ? 56 GLN A HB3  4  
ATOM 4236  H HG2  . GLN A 1 56 ? 7.739   -5.175  -1.585  1.00 0.00 ? 56 GLN A HG2  4  
ATOM 4237  H HG3  . GLN A 1 56 ? 7.171   -6.702  -0.911  1.00 0.00 ? 56 GLN A HG3  4  
ATOM 4238  H HE21 . GLN A 1 56 ? 7.415   -8.416  -2.143  1.00 0.00 ? 56 GLN A HE21 4  
ATOM 4239  H HE22 . GLN A 1 56 ? 7.580   -8.423  -3.862  1.00 0.00 ? 56 GLN A HE22 4  
ATOM 4240  N N    . ASN A 1 57 ? 6.266   -2.609  -0.877  1.00 0.00 ? 57 ASN A N    4  
ATOM 4241  C CA   . ASN A 1 57 ? 7.130   -1.438  -0.781  1.00 0.00 ? 57 ASN A CA   4  
ATOM 4242  C C    . ASN A 1 57 ? 7.066   -0.828  0.616   1.00 0.00 ? 57 ASN A C    4  
ATOM 4243  O O    . ASN A 1 57 ? 8.095   -0.534  1.226   1.00 0.00 ? 57 ASN A O    4  
ATOM 4244  C CB   . ASN A 1 57 ? 6.728   -0.394  -1.824  1.00 0.00 ? 57 ASN A CB   4  
ATOM 4245  C CG   . ASN A 1 57 ? 7.416   -0.614  -3.157  1.00 0.00 ? 57 ASN A CG   4  
ATOM 4246  O OD1  . ASN A 1 57 ? 8.547   -1.097  -3.212  1.00 0.00 ? 57 ASN A OD1  4  
ATOM 4247  N ND2  . ASN A 1 57 ? 6.736   -0.258  -4.241  1.00 0.00 ? 57 ASN A ND2  4  
ATOM 4248  H H    . ASN A 1 57 ? 5.637   -2.678  -1.625  1.00 0.00 ? 57 ASN A H    4  
ATOM 4249  H HA   . ASN A 1 57 ? 8.143   -1.756  -0.976  1.00 0.00 ? 57 ASN A HA   4  
ATOM 4250  H HB2  . ASN A 1 57 ? 5.660   -0.443  -1.981  1.00 0.00 ? 57 ASN A HB2  4  
ATOM 4251  H HB3  . ASN A 1 57 ? 6.989   0.589   -1.462  1.00 0.00 ? 57 ASN A HB3  4  
ATOM 4252  H HD21 . ASN A 1 57 ? 5.839   0.121   -4.121  1.00 0.00 ? 57 ASN A HD21 4  
ATOM 4253  H HD22 . ASN A 1 57 ? 7.157   -0.390  -5.116  1.00 0.00 ? 57 ASN A HD22 4  
ATOM 4254  N N    . LYS A 1 58 ? 5.851   -0.639  1.118   1.00 0.00 ? 58 LYS A N    4  
ATOM 4255  C CA   . LYS A 1 58 ? 5.650   -0.066  2.444   1.00 0.00 ? 58 LYS A CA   4  
ATOM 4256  C C    . LYS A 1 58 ? 6.520   -0.772  3.479   1.00 0.00 ? 58 LYS A C    4  
ATOM 4257  O O    . LYS A 1 58 ? 7.167   -0.126  4.304   1.00 0.00 ? 58 LYS A O    4  
ATOM 4258  C CB   . LYS A 1 58 ? 4.177   -0.165  2.847   1.00 0.00 ? 58 LYS A CB   4  
ATOM 4259  C CG   . LYS A 1 58 ? 3.730   0.938   3.791   1.00 0.00 ? 58 LYS A CG   4  
ATOM 4260  C CD   . LYS A 1 58 ? 3.722   2.292   3.103   1.00 0.00 ? 58 LYS A CD   4  
ATOM 4261  C CE   . LYS A 1 58 ? 2.673   3.216   3.703   1.00 0.00 ? 58 LYS A CE   4  
ATOM 4262  N NZ   . LYS A 1 58 ? 3.021   4.651   3.506   1.00 0.00 ? 58 LYS A NZ   4  
ATOM 4263  H H    . LYS A 1 58 ? 5.068   -0.893  0.584   1.00 0.00 ? 58 LYS A H    4  
ATOM 4264  H HA   . LYS A 1 58 ? 5.934   0.974   2.402   1.00 0.00 ? 58 LYS A HA   4  
ATOM 4265  H HB2  . LYS A 1 58 ? 3.568   -0.117  1.957   1.00 0.00 ? 58 LYS A HB2  4  
ATOM 4266  H HB3  . LYS A 1 58 ? 4.013   -1.115  3.334   1.00 0.00 ? 58 LYS A HB3  4  
ATOM 4267  H HG2  . LYS A 1 58 ? 2.732   0.717   4.141   1.00 0.00 ? 58 LYS A HG2  4  
ATOM 4268  H HG3  . LYS A 1 58 ? 4.407   0.976   4.633   1.00 0.00 ? 58 LYS A HG3  4  
ATOM 4269  H HD2  . LYS A 1 58 ? 4.694   2.749   3.214   1.00 0.00 ? 58 LYS A HD2  4  
ATOM 4270  H HD3  . LYS A 1 58 ? 3.506   2.151   2.053   1.00 0.00 ? 58 LYS A HD3  4  
ATOM 4271  H HE2  . LYS A 1 58 ? 1.724   3.017   3.231   1.00 0.00 ? 58 LYS A HE2  4  
ATOM 4272  H HE3  . LYS A 1 58 ? 2.599   3.015   4.762   1.00 0.00 ? 58 LYS A HE3  4  
ATOM 4273  H HZ1  . LYS A 1 58 ? 3.668   4.754   2.698   1.00 0.00 ? 58 LYS A HZ1  4  
ATOM 4274  H HZ2  . LYS A 1 58 ? 3.485   5.026   4.358   1.00 0.00 ? 58 LYS A HZ2  4  
ATOM 4275  H HZ3  . LYS A 1 58 ? 2.160   5.205   3.320   1.00 0.00 ? 58 LYS A HZ3  4  
ATOM 4276  N N    . ARG A 1 59 ? 6.532   -2.100  3.429   1.00 0.00 ? 59 ARG A N    4  
ATOM 4277  C CA   . ARG A 1 59 ? 7.323   -2.892  4.363   1.00 0.00 ? 59 ARG A CA   4  
ATOM 4278  C C    . ARG A 1 59 ? 8.794   -2.490  4.307   1.00 0.00 ? 59 ARG A C    4  
ATOM 4279  O O    . ARG A 1 59 ? 9.474   -2.441  5.332   1.00 0.00 ? 59 ARG A O    4  
ATOM 4280  C CB   . ARG A 1 59 ? 7.178   -4.383  4.049   1.00 0.00 ? 59 ARG A CB   4  
ATOM 4281  C CG   . ARG A 1 59 ? 5.956   -5.023  4.687   1.00 0.00 ? 59 ARG A CG   4  
ATOM 4282  C CD   . ARG A 1 59 ? 5.824   -6.486  4.292   1.00 0.00 ? 59 ARG A CD   4  
ATOM 4283  N NE   . ARG A 1 59 ? 6.678   -7.351  5.101   1.00 0.00 ? 59 ARG A NE   4  
ATOM 4284  C CZ   . ARG A 1 59 ? 7.952   -7.599  4.817   1.00 0.00 ? 59 ARG A CZ   4  
ATOM 4285  N NH1  . ARG A 1 59 ? 8.515   -7.051  3.749   1.00 0.00 ? 59 ARG A NH1  4  
ATOM 4286  N NH2  . ARG A 1 59 ? 8.665   -8.397  5.602   1.00 0.00 ? 59 ARG A NH2  4  
ATOM 4287  H H    . ARG A 1 59 ? 5.995   -2.558  2.749   1.00 0.00 ? 59 ARG A H    4  
ATOM 4288  H HA   . ARG A 1 59 ? 6.948   -2.705  5.358   1.00 0.00 ? 59 ARG A HA   4  
ATOM 4289  H HB2  . ARG A 1 59 ? 7.106   -4.509  2.979   1.00 0.00 ? 59 ARG A HB2  4  
ATOM 4290  H HB3  . ARG A 1 59 ? 8.056   -4.900  4.406   1.00 0.00 ? 59 ARG A HB3  4  
ATOM 4291  H HG2  . ARG A 1 59 ? 6.046   -4.959  5.761   1.00 0.00 ? 59 ARG A HG2  4  
ATOM 4292  H HG3  . ARG A 1 59 ? 5.073   -4.491  4.365   1.00 0.00 ? 59 ARG A HG3  4  
ATOM 4293  H HD2  . ARG A 1 59 ? 4.796   -6.789  4.423   1.00 0.00 ? 59 ARG A HD2  4  
ATOM 4294  H HD3  . ARG A 1 59 ? 6.101   -6.591  3.254   1.00 0.00 ? 59 ARG A HD3  4  
ATOM 4295  H HE   . ARG A 1 59 ? 6.282   -7.766  5.895   1.00 0.00 ? 59 ARG A HE   4  
ATOM 4296  H HH11 . ARG A 1 59 ? 7.981   -6.449  3.157   1.00 0.00 ? 59 ARG A HH11 4  
ATOM 4297  H HH12 . ARG A 1 59 ? 9.475   -7.239  3.538   1.00 0.00 ? 59 ARG A HH12 4  
ATOM 4298  H HH21 . ARG A 1 59 ? 8.243   -8.812  6.408   1.00 0.00 ? 59 ARG A HH21 4  
ATOM 4299  H HH22 . ARG A 1 59 ? 9.623   -8.584  5.387   1.00 0.00 ? 59 ARG A HH22 4  
ATOM 4300  N N    . SER A 1 60 ? 9.279   -2.205  3.102   1.00 0.00 ? 60 SER A N    4  
ATOM 4301  C CA   . SER A 1 60 ? 10.670  -1.812  2.912   1.00 0.00 ? 60 SER A CA   4  
ATOM 4302  C C    . SER A 1 60 ? 10.998  -0.564  3.725   1.00 0.00 ? 60 SER A C    4  
ATOM 4303  O O    . SER A 1 60 ? 12.059  -0.472  4.343   1.00 0.00 ? 60 SER A O    4  
ATOM 4304  C CB   . SER A 1 60 ? 10.951  -1.557  1.430   1.00 0.00 ? 60 SER A CB   4  
ATOM 4305  O OG   . SER A 1 60 ? 12.332  -1.693  1.142   1.00 0.00 ? 60 SER A OG   4  
ATOM 4306  H H    . SER A 1 60 ? 8.687   -2.263  2.323   1.00 0.00 ? 60 SER A H    4  
ATOM 4307  H HA   . SER A 1 60 ? 11.294  -2.624  3.253   1.00 0.00 ? 60 SER A HA   4  
ATOM 4308  H HB2  . SER A 1 60 ? 10.400  -2.268  0.833   1.00 0.00 ? 60 SER A HB2  4  
ATOM 4309  H HB3  . SER A 1 60 ? 10.639  -0.554  1.174   1.00 0.00 ? 60 SER A HB3  4  
ATOM 4310  H HG   . SER A 1 60 ? 12.444  -2.229  0.353   1.00 0.00 ? 60 SER A HG   4  
ATOM 4311  N N    . LYS A 1 61 ? 10.079  0.396   3.721   1.00 0.00 ? 61 LYS A N    4  
ATOM 4312  C CA   . LYS A 1 61 ? 10.267  1.639   4.459   1.00 0.00 ? 61 LYS A CA   4  
ATOM 4313  C C    . LYS A 1 61 ? 10.447  1.366   5.949   1.00 0.00 ? 61 LYS A C    4  
ATOM 4314  O O    . LYS A 1 61 ? 11.135  2.111   6.647   1.00 0.00 ? 61 LYS A O    4  
ATOM 4315  C CB   . LYS A 1 61 ? 9.074   2.572   4.241   1.00 0.00 ? 61 LYS A CB   4  
ATOM 4316  C CG   . LYS A 1 61 ? 9.229   3.488   3.039   1.00 0.00 ? 61 LYS A CG   4  
ATOM 4317  C CD   . LYS A 1 61 ? 8.699   2.839   1.771   1.00 0.00 ? 61 LYS A CD   4  
ATOM 4318  C CE   . LYS A 1 61 ? 9.031   3.668   0.540   1.00 0.00 ? 61 LYS A CE   4  
ATOM 4319  N NZ   . LYS A 1 61 ? 10.445  3.481   0.110   1.00 0.00 ? 61 LYS A NZ   4  
ATOM 4320  H H    . LYS A 1 61 ? 9.253   0.264   3.209   1.00 0.00 ? 61 LYS A H    4  
ATOM 4321  H HA   . LYS A 1 61 ? 11.159  2.117   4.083   1.00 0.00 ? 61 LYS A HA   4  
ATOM 4322  H HB2  . LYS A 1 61 ? 8.186   1.973   4.099   1.00 0.00 ? 61 LYS A HB2  4  
ATOM 4323  H HB3  . LYS A 1 61 ? 8.946   3.186   5.121   1.00 0.00 ? 61 LYS A HB3  4  
ATOM 4324  H HG2  . LYS A 1 61 ? 8.680   4.400   3.220   1.00 0.00 ? 61 LYS A HG2  4  
ATOM 4325  H HG3  . LYS A 1 61 ? 10.276  3.716   2.905   1.00 0.00 ? 61 LYS A HG3  4  
ATOM 4326  H HD2  . LYS A 1 61 ? 9.145   1.861   1.664   1.00 0.00 ? 61 LYS A HD2  4  
ATOM 4327  H HD3  . LYS A 1 61 ? 7.625   2.740   1.849   1.00 0.00 ? 61 LYS A HD3  4  
ATOM 4328  H HE2  . LYS A 1 61 ? 8.377   3.371   -0.265  1.00 0.00 ? 61 LYS A HE2  4  
ATOM 4329  H HE3  . LYS A 1 61 ? 8.869   4.711   0.770   1.00 0.00 ? 61 LYS A HE3  4  
ATOM 4330  H HZ1  . LYS A 1 61 ? 10.523  2.647   -0.506  1.00 0.00 ? 61 LYS A HZ1  4  
ATOM 4331  H HZ2  . LYS A 1 61 ? 11.055  3.342   0.941   1.00 0.00 ? 61 LYS A HZ2  4  
ATOM 4332  H HZ3  . LYS A 1 61 ? 10.773  4.317   -0.413  1.00 0.00 ? 61 LYS A HZ3  4  
ATOM 4333  N N    . ILE A 1 62 ? 9.826   0.293   6.428   1.00 0.00 ? 62 ILE A N    4  
ATOM 4334  C CA   . ILE A 1 62 ? 9.920   -0.079  7.834   1.00 0.00 ? 62 ILE A CA   4  
ATOM 4335  C C    . ILE A 1 62 ? 11.340  0.109   8.359   1.00 0.00 ? 62 ILE A C    4  
ATOM 4336  O O    . ILE A 1 62 ? 12.238  -0.672  8.045   1.00 0.00 ? 62 ILE A O    4  
ATOM 4337  C CB   . ILE A 1 62 ? 9.491   -1.540  8.060   1.00 0.00 ? 62 ILE A CB   4  
ATOM 4338  C CG1  . ILE A 1 62 ? 8.020   -1.727  7.682   1.00 0.00 ? 62 ILE A CG1  4  
ATOM 4339  C CG2  . ILE A 1 62 ? 9.727   -1.944  9.508   1.00 0.00 ? 62 ILE A CG2  4  
ATOM 4340  C CD1  . ILE A 1 62 ? 7.584   -3.175  7.648   1.00 0.00 ? 62 ILE A CD1  4  
ATOM 4341  H H    . ILE A 1 62 ? 9.293   -0.261  5.822   1.00 0.00 ? 62 ILE A H    4  
ATOM 4342  H HA   . ILE A 1 62 ? 9.254   0.562   8.393   1.00 0.00 ? 62 ILE A HA   4  
ATOM 4343  H HB   . ILE A 1 62 ? 10.100  -2.172  7.431   1.00 0.00 ? 62 ILE A HB   4  
ATOM 4344  H HG12 . ILE A 1 62 ? 7.402   -1.212  8.400   1.00 0.00 ? 62 ILE A HG12 4  
ATOM 4345  H HG13 . ILE A 1 62 ? 7.852   -1.306  6.701   1.00 0.00 ? 62 ILE A HG13 4  
ATOM 4346  H HG21 . ILE A 1 62 ? 9.568   -3.007  9.615   1.00 0.00 ? 62 ILE A HG21 4  
ATOM 4347  H HG22 . ILE A 1 62 ? 10.741  -1.702  9.788   1.00 0.00 ? 62 ILE A HG22 4  
ATOM 4348  H HG23 . ILE A 1 62 ? 9.039   -1.411  10.147  1.00 0.00 ? 62 ILE A HG23 4  
ATOM 4349  H HD11 . ILE A 1 62 ? 7.999   -3.656  6.775   1.00 0.00 ? 62 ILE A HD11 4  
ATOM 4350  H HD12 . ILE A 1 62 ? 7.932   -3.677  8.537   1.00 0.00 ? 62 ILE A HD12 4  
ATOM 4351  H HD13 . ILE A 1 62 ? 6.505   -3.224  7.606   1.00 0.00 ? 62 ILE A HD13 4  
ATOM 4352  N N    . LYS A 1 63 ? 11.535  1.150   9.161   1.00 0.00 ? 63 LYS A N    4  
ATOM 4353  C CA   . LYS A 1 63 ? 12.845  1.440   9.733   1.00 0.00 ? 63 LYS A CA   4  
ATOM 4354  C C    . LYS A 1 63 ? 12.984  0.817   11.118  1.00 0.00 ? 63 LYS A C    4  
ATOM 4355  O O    . LYS A 1 63 ? 12.057  0.862   11.927  1.00 0.00 ? 63 LYS A O    4  
ATOM 4356  C CB   . LYS A 1 63 ? 13.063  2.953   9.819   1.00 0.00 ? 63 LYS A CB   4  
ATOM 4357  C CG   . LYS A 1 63 ? 12.033  3.668   10.677  1.00 0.00 ? 63 LYS A CG   4  
ATOM 4358  C CD   . LYS A 1 63 ? 12.481  3.757   12.126  1.00 0.00 ? 63 LYS A CD   4  
ATOM 4359  C CE   . LYS A 1 63 ? 13.492  4.876   12.329  1.00 0.00 ? 63 LYS A CE   4  
ATOM 4360  N NZ   . LYS A 1 63 ? 12.828  6.191   12.546  1.00 0.00 ? 63 LYS A NZ   4  
ATOM 4361  H H    . LYS A 1 63 ? 10.780  1.737   9.375   1.00 0.00 ? 63 LYS A H    4  
ATOM 4362  H HA   . LYS A 1 63 ? 13.593  1.013   9.083   1.00 0.00 ? 63 LYS A HA   4  
ATOM 4363  H HB2  . LYS A 1 63 ? 14.041  3.140   10.236  1.00 0.00 ? 63 LYS A HB2  4  
ATOM 4364  H HB3  . LYS A 1 63 ? 13.020  3.367   8.822   1.00 0.00 ? 63 LYS A HB3  4  
ATOM 4365  H HG2  . LYS A 1 63 ? 11.890  4.667   10.294  1.00 0.00 ? 63 LYS A HG2  4  
ATOM 4366  H HG3  . LYS A 1 63 ? 11.100  3.125   10.631  1.00 0.00 ? 63 LYS A HG3  4  
ATOM 4367  H HD2  . LYS A 1 63 ? 11.620  3.949   12.749  1.00 0.00 ? 63 LYS A HD2  4  
ATOM 4368  H HD3  . LYS A 1 63 ? 12.934  2.818   12.413  1.00 0.00 ? 63 LYS A HD3  4  
ATOM 4369  H HE2  . LYS A 1 63 ? 14.099  4.643   13.190  1.00 0.00 ? 63 LYS A HE2  4  
ATOM 4370  H HE3  . LYS A 1 63 ? 14.120  4.939   11.453  1.00 0.00 ? 63 LYS A HE3  4  
ATOM 4371  H HZ1  . LYS A 1 63 ? 13.347  6.940   12.043  1.00 0.00 ? 63 LYS A HZ1  4  
ATOM 4372  H HZ2  . LYS A 1 63 ? 12.809  6.419   13.560  1.00 0.00 ? 63 LYS A HZ2  4  
ATOM 4373  H HZ3  . LYS A 1 63 ? 11.851  6.161   12.190  1.00 0.00 ? 63 LYS A HZ3  4  
ATOM 4374  N N    . LYS A 1 64 ? 14.148  0.235   11.386  1.00 0.00 ? 64 LYS A N    4  
ATOM 4375  C CA   . LYS A 1 64 ? 14.410  -0.396  12.674  1.00 0.00 ? 64 LYS A CA   4  
ATOM 4376  C C    . LYS A 1 64 ? 14.186  0.589   13.818  1.00 0.00 ? 64 LYS A C    4  
ATOM 4377  O O    . LYS A 1 64 ? 14.415  1.789   13.670  1.00 0.00 ? 64 LYS A O    4  
ATOM 4378  C CB   . LYS A 1 64 ? 15.843  -0.930  12.721  1.00 0.00 ? 64 LYS A CB   4  
ATOM 4379  C CG   . LYS A 1 64 ? 16.888  0.149   12.943  1.00 0.00 ? 64 LYS A CG   4  
ATOM 4380  C CD   . LYS A 1 64 ? 17.414  0.696   11.626  1.00 0.00 ? 64 LYS A CD   4  
ATOM 4381  C CE   . LYS A 1 64 ? 18.330  -0.303  10.934  1.00 0.00 ? 64 LYS A CE   4  
ATOM 4382  N NZ   . LYS A 1 64 ? 18.497  0.008   9.488   1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4383  H H    . LYS A 1 64 ? 14.849  0.231   10.700  1.00 0.00 ? 64 LYS A H    4  
ATOM 4384  H HA   . LYS A 1 64 ? 13.723  -1.221  12.786  1.00 0.00 ? 64 LYS A HA   4  
ATOM 4385  H HB2  . LYS A 1 64 ? 15.921  -1.648  13.525  1.00 0.00 ? 64 LYS A HB2  4  
ATOM 4386  H HB3  . LYS A 1 64 ? 16.061  -1.425  11.786  1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4387  H HG2  . LYS A 1 64 ? 16.444  0.958   13.504  1.00 0.00 ? 64 LYS A HG2  4  
ATOM 4388  H HG3  . LYS A 1 64 ? 17.712  -0.270  13.503  1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4389  H HD2  . LYS A 1 64 ? 16.579  0.911   10.977  1.00 0.00 ? 64 LYS A HD2  4  
ATOM 4390  H HD3  . LYS A 1 64 ? 17.967  1.604   11.818  1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4391  H HE2  . LYS A 1 64 ? 19.296  -0.277  11.414  1.00 0.00 ? 64 LYS A HE2  4  
ATOM 4392  H HE3  . LYS A 1 64 ? 17.904  -1.290  11.035  1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4393  H HZ1  . LYS A 1 64 ? 18.180  0.980   9.293   1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4394  H HZ2  . LYS A 1 64 ? 17.934  -0.650  8.913   1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4395  H HZ3  . LYS A 1 64 ? 19.497  -0.080  9.217   1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4396  N N    . SER A 1 65 ? 13.738  0.073   14.958  1.00 0.00 ? 65 SER A N    4  
ATOM 4397  C CA   . SER A 1 65 ? 13.481  0.907   16.126  1.00 0.00 ? 65 SER A CA   4  
ATOM 4398  C C    . SER A 1 65 ? 14.768  1.165   16.903  1.00 0.00 ? 65 SER A C    4  
ATOM 4399  O O    . SER A 1 65 ? 15.504  0.236   17.233  1.00 0.00 ? 65 SER A O    4  
ATOM 4400  C CB   . SER A 1 65 ? 12.447  0.242   17.036  1.00 0.00 ? 65 SER A CB   4  
ATOM 4401  O OG   . SER A 1 65 ? 11.790  1.201   17.847  1.00 0.00 ? 65 SER A OG   4  
ATOM 4402  H H    . SER A 1 65 ? 13.575  -0.892  15.014  1.00 0.00 ? 65 SER A H    4  
ATOM 4403  H HA   . SER A 1 65 ? 13.089  1.851   15.779  1.00 0.00 ? 65 SER A HA   4  
ATOM 4404  H HB2  . SER A 1 65 ? 11.710  -0.264  16.430  1.00 0.00 ? 65 SER A HB2  4  
ATOM 4405  H HB3  . SER A 1 65 ? 12.941  -0.474  17.675  1.00 0.00 ? 65 SER A HB3  4  
ATOM 4406  H HG   . SER A 1 65 ? 11.776  0.895   18.757  1.00 0.00 ? 65 SER A HG   4  
ATOM 4407  N N    . GLY A 1 66 ? 15.033  2.435   17.193  1.00 0.00 ? 66 GLY A N    4  
ATOM 4408  C CA   . GLY A 1 66 ? 16.231  2.794   17.929  1.00 0.00 ? 66 GLY A CA   4  
ATOM 4409  C C    . GLY A 1 66 ? 17.036  3.875   17.235  1.00 0.00 ? 66 GLY A C    4  
ATOM 4410  O O    . GLY A 1 66 ? 17.097  3.941   16.007  1.00 0.00 ? 66 GLY A O    4  
ATOM 4411  H H    . GLY A 1 66 ? 14.410  3.135   16.905  1.00 0.00 ? 66 GLY A H    4  
ATOM 4412  H HA2  . GLY A 1 66 ? 15.946  3.145   18.910  1.00 0.00 ? 66 GLY A HA2  4  
ATOM 4413  H HA3  . GLY A 1 66 ? 16.849  1.915   18.038  1.00 0.00 ? 66 GLY A HA3  4  
ATOM 4414  N N    . PRO A 1 67 ? 17.672  4.748   18.031  1.00 0.00 ? 67 PRO A N    4  
ATOM 4415  C CA   . PRO A 1 67 ? 18.488  5.847   17.507  1.00 0.00 ? 67 PRO A CA   4  
ATOM 4416  C C    . PRO A 1 67 ? 19.775  5.354   16.855  1.00 0.00 ? 67 PRO A C    4  
ATOM 4417  O O    . PRO A 1 67 ? 20.101  5.741   15.733  1.00 0.00 ? 67 PRO A O    4  
ATOM 4418  C CB   . PRO A 1 67 ? 18.803  6.679   18.752  1.00 0.00 ? 67 PRO A CB   4  
ATOM 4419  C CG   . PRO A 1 67 ? 18.711  5.716   19.885  1.00 0.00 ? 67 PRO A CG   4  
ATOM 4420  C CD   . PRO A 1 67 ? 17.643  4.728   19.503  1.00 0.00 ? 67 PRO A CD   4  
ATOM 4421  H HA   . PRO A 1 67 ? 17.935  6.449   16.800  1.00 0.00 ? 67 PRO A HA   4  
ATOM 4422  H HB2  . PRO A 1 67 ? 19.797  7.096   18.667  1.00 0.00 ? 67 PRO A HB2  4  
ATOM 4423  H HB3  . PRO A 1 67 ? 18.080  7.475   18.851  1.00 0.00 ? 67 PRO A HB3  4  
ATOM 4424  H HG2  . PRO A 1 67 ? 19.657  5.213   20.017  1.00 0.00 ? 67 PRO A HG2  4  
ATOM 4425  H HG3  . PRO A 1 67 ? 18.433  6.237   20.788  1.00 0.00 ? 67 PRO A HG3  4  
ATOM 4426  H HD2  . PRO A 1 67 ? 17.885  3.746   19.880  1.00 0.00 ? 67 PRO A HD2  4  
ATOM 4427  H HD3  . PRO A 1 67 ? 16.681  5.051   19.873  1.00 0.00 ? 67 PRO A HD3  4  
ATOM 4428  N N    . SER A 1 68 ? 20.503  4.498   17.565  1.00 0.00 ? 68 SER A N    4  
ATOM 4429  C CA   . SER A 1 68 ? 21.757  3.955   17.057  1.00 0.00 ? 68 SER A CA   4  
ATOM 4430  C C    . SER A 1 68 ? 21.519  3.130   15.796  1.00 0.00 ? 68 SER A C    4  
ATOM 4431  O O    . SER A 1 68 ? 20.464  2.519   15.630  1.00 0.00 ? 68 SER A O    4  
ATOM 4432  C CB   . SER A 1 68 ? 22.434  3.093   18.124  1.00 0.00 ? 68 SER A CB   4  
ATOM 4433  O OG   . SER A 1 68 ? 21.715  1.891   18.340  1.00 0.00 ? 68 SER A OG   4  
ATOM 4434  H H    . SER A 1 68 ? 20.189  4.228   18.454  1.00 0.00 ? 68 SER A H    4  
ATOM 4435  H HA   . SER A 1 68 ? 22.403  4.785   16.813  1.00 0.00 ? 68 SER A HA   4  
ATOM 4436  H HB2  . SER A 1 68 ? 23.434  2.847   17.803  1.00 0.00 ? 68 SER A HB2  4  
ATOM 4437  H HB3  . SER A 1 68 ? 22.478  3.644   19.052  1.00 0.00 ? 68 SER A HB3  4  
ATOM 4438  H HG   . SER A 1 68 ? 22.327  1.151   18.359  1.00 0.00 ? 68 SER A HG   4  
ATOM 4439  N N    . SER A 1 69 ? 22.509  3.117   14.909  1.00 0.00 ? 69 SER A N    4  
ATOM 4440  C CA   . SER A 1 69 ? 22.408  2.371   13.661  1.00 0.00 ? 69 SER A CA   4  
ATOM 4441  C C    . SER A 1 69 ? 23.254  1.102   13.716  1.00 0.00 ? 69 SER A C    4  
ATOM 4442  O O    . SER A 1 69 ? 24.336  1.089   14.301  1.00 0.00 ? 69 SER A O    4  
ATOM 4443  C CB   . SER A 1 69 ? 22.851  3.242   12.484  1.00 0.00 ? 69 SER A CB   4  
ATOM 4444  O OG   . SER A 1 69 ? 22.841  2.507   11.272  1.00 0.00 ? 69 SER A OG   4  
ATOM 4445  H H    . SER A 1 69 ? 23.327  3.625   15.098  1.00 0.00 ? 69 SER A H    4  
ATOM 4446  H HA   . SER A 1 69 ? 21.374  2.094   13.523  1.00 0.00 ? 69 SER A HA   4  
ATOM 4447  H HB2  . SER A 1 69 ? 22.180  4.081   12.387  1.00 0.00 ? 69 SER A HB2  4  
ATOM 4448  H HB3  . SER A 1 69 ? 23.854  3.602   12.663  1.00 0.00 ? 69 SER A HB3  4  
ATOM 4449  H HG   . SER A 1 69 ? 23.301  1.674   11.399  1.00 0.00 ? 69 SER A HG   4  
ATOM 4450  N N    . GLY A 1 70 ? 22.751  0.036   13.102  1.00 0.00 ? 70 GLY A N    4  
ATOM 4451  C CA   . GLY A 1 70 ? 23.472  -1.224  13.092  1.00 0.00 ? 70 GLY A CA   4  
ATOM 4452  C C    . GLY A 1 70 ? 22.798  -2.284  13.940  1.00 0.00 ? 70 GLY A C    4  
ATOM 4453  O O    . GLY A 1 70 ? 22.315  -3.289  13.419  1.00 0.00 ? 70 GLY A O    4  
ATOM 4454  H H    . GLY A 1 70 ? 21.884  0.104   12.651  1.00 0.00 ? 70 GLY A H    4  
ATOM 4455  H HA2  . GLY A 1 70 ? 23.540  -1.580  12.075  1.00 0.00 ? 70 GLY A HA2  4  
ATOM 4456  H HA3  . GLY A 1 70 ? 24.470  -1.057  13.472  1.00 0.00 ? 70 GLY A HA3  4  
ATOM 4457  N N    . GLY A 1 1  ? 11.196  -4.705  -11.018 1.00 0.00 ? 1  GLY A N    5  
ATOM 4458  C CA   . GLY A 1 1  ? 12.221  -3.835  -11.565 1.00 0.00 ? 1  GLY A CA   5  
ATOM 4459  C C    . GLY A 1 1  ? 12.902  -3.000  -10.498 1.00 0.00 ? 1  GLY A C    5  
ATOM 4460  O O    . GLY A 1 1  ? 13.272  -3.512  -9.442  1.00 0.00 ? 1  GLY A O    5  
ATOM 4461  H H1   . GLY A 1 1  ? 11.414  -5.635  -10.795 1.00 0.00 ? 1  GLY A H1   5  
ATOM 4462  H HA2  . GLY A 1 1  ? 12.964  -4.440  -12.063 1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4463  H HA3  . GLY A 1 1  ? 11.766  -3.173  -12.287 1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4464  N N    . SER A 1 2  ? 13.070  -1.711  -10.775 1.00 0.00 ? 2  SER A N    5  
ATOM 4465  C CA   . SER A 1 2  ? 13.716  -0.804  -9.834  1.00 0.00 ? 2  SER A CA   5  
ATOM 4466  C C    . SER A 1 2  ? 12.683  0.048   -9.103  1.00 0.00 ? 2  SER A C    5  
ATOM 4467  O O    . SER A 1 2  ? 11.497  0.025   -9.434  1.00 0.00 ? 2  SER A O    5  
ATOM 4468  C CB   . SER A 1 2  ? 14.713  0.097   -10.564 1.00 0.00 ? 2  SER A CB   5  
ATOM 4469  O OG   . SER A 1 2  ? 15.591  0.732   -9.650  1.00 0.00 ? 2  SER A OG   5  
ATOM 4470  H H    . SER A 1 2  ? 12.753  -1.362  -11.635 1.00 0.00 ? 2  SER A H    5  
ATOM 4471  H HA   . SER A 1 2  ? 14.248  -1.403  -9.110  1.00 0.00 ? 2  SER A HA   5  
ATOM 4472  H HB2  . SER A 1 2  ? 15.296  -0.497  -11.250 1.00 0.00 ? 2  SER A HB2  5  
ATOM 4473  H HB3  . SER A 1 2  ? 14.174  0.856   -11.113 1.00 0.00 ? 2  SER A HB3  5  
ATOM 4474  H HG   . SER A 1 2  ? 16.452  0.844   -10.059 1.00 0.00 ? 2  SER A HG   5  
ATOM 4475  N N    . SER A 1 3  ? 13.142  0.799   -8.108  1.00 0.00 ? 3  SER A N    5  
ATOM 4476  C CA   . SER A 1 3  ? 12.258  1.657   -7.327  1.00 0.00 ? 3  SER A CA   5  
ATOM 4477  C C    . SER A 1 3  ? 12.591  3.129   -7.551  1.00 0.00 ? 3  SER A C    5  
ATOM 4478  O O    . SER A 1 3  ? 13.725  3.477   -7.878  1.00 0.00 ? 3  SER A O    5  
ATOM 4479  C CB   . SER A 1 3  ? 12.368  1.319   -5.839  1.00 0.00 ? 3  SER A CB   5  
ATOM 4480  O OG   . SER A 1 3  ? 13.664  1.606   -5.345  1.00 0.00 ? 3  SER A OG   5  
ATOM 4481  H H    . SER A 1 3  ? 14.097  0.774   -7.892  1.00 0.00 ? 3  SER A H    5  
ATOM 4482  H HA   . SER A 1 3  ? 11.245  1.475   -7.655  1.00 0.00 ? 3  SER A HA   5  
ATOM 4483  H HB2  . SER A 1 3  ? 11.647  1.902   -5.286  1.00 0.00 ? 3  SER A HB2  5  
ATOM 4484  H HB3  . SER A 1 3  ? 12.166  0.267   -5.696  1.00 0.00 ? 3  SER A HB3  5  
ATOM 4485  H HG   . SER A 1 3  ? 13.678  1.487   -4.393  1.00 0.00 ? 3  SER A HG   5  
ATOM 4486  N N    . GLY A 1 4  ? 11.593  3.989   -7.374  1.00 0.00 ? 4  GLY A N    5  
ATOM 4487  C CA   . GLY A 1 4  ? 11.799  5.413   -7.561  1.00 0.00 ? 4  GLY A CA   5  
ATOM 4488  C C    . GLY A 1 4  ? 11.103  6.244   -6.501  1.00 0.00 ? 4  GLY A C    5  
ATOM 4489  O O    . GLY A 1 4  ? 9.900   6.487   -6.584  1.00 0.00 ? 4  GLY A O    5  
ATOM 4490  H H    . GLY A 1 4  ? 10.709  3.654   -7.113  1.00 0.00 ? 4  GLY A H    5  
ATOM 4491  H HA2  . GLY A 1 4  ? 12.858  5.620   -7.528  1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4492  H HA3  . GLY A 1 4  ? 11.417  5.696   -8.531  1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4493  N N    . SER A 1 5  ? 11.862  6.679   -5.500  1.00 0.00 ? 5  SER A N    5  
ATOM 4494  C CA   . SER A 1 5  ? 11.310  7.483   -4.416  1.00 0.00 ? 5  SER A CA   5  
ATOM 4495  C C    . SER A 1 5  ? 10.824  8.833   -4.933  1.00 0.00 ? 5  SER A C    5  
ATOM 4496  O O    . SER A 1 5  ? 9.691   9.239   -4.672  1.00 0.00 ? 5  SER A O    5  
ATOM 4497  C CB   . SER A 1 5  ? 12.360  7.692   -3.322  1.00 0.00 ? 5  SER A CB   5  
ATOM 4498  O OG   . SER A 1 5  ? 11.907  8.620   -2.352  1.00 0.00 ? 5  SER A OG   5  
ATOM 4499  H H    . SER A 1 5  ? 12.816  6.452   -5.490  1.00 0.00 ? 5  SER A H    5  
ATOM 4500  H HA   . SER A 1 5  ? 10.471  6.946   -3.999  1.00 0.00 ? 5  SER A HA   5  
ATOM 4501  H HB2  . SER A 1 5  ? 12.560  6.750   -2.835  1.00 0.00 ? 5  SER A HB2  5  
ATOM 4502  H HB3  . SER A 1 5  ? 13.269  8.068   -3.767  1.00 0.00 ? 5  SER A HB3  5  
ATOM 4503  H HG   . SER A 1 5  ? 12.096  9.513   -2.651  1.00 0.00 ? 5  SER A HG   5  
ATOM 4504  N N    . SER A 1 6  ? 11.688  9.524   -5.669  1.00 0.00 ? 6  SER A N    5  
ATOM 4505  C CA   . SER A 1 6  ? 11.349  10.830  -6.222  1.00 0.00 ? 6  SER A CA   5  
ATOM 4506  C C    . SER A 1 6  ? 9.882   10.880  -6.637  1.00 0.00 ? 6  SER A C    5  
ATOM 4507  O O    . SER A 1 6  ? 9.334   9.901   -7.142  1.00 0.00 ? 6  SER A O    5  
ATOM 4508  C CB   . SER A 1 6  ? 12.242  11.147  -7.422  1.00 0.00 ? 6  SER A CB   5  
ATOM 4509  O OG   . SER A 1 6  ? 13.588  11.336  -7.021  1.00 0.00 ? 6  SER A OG   5  
ATOM 4510  H H    . SER A 1 6  ? 12.576  9.147   -5.843  1.00 0.00 ? 6  SER A H    5  
ATOM 4511  H HA   . SER A 1 6  ? 11.519  11.569  -5.453  1.00 0.00 ? 6  SER A HA   5  
ATOM 4512  H HB2  . SER A 1 6  ? 12.200  10.329  -8.125  1.00 0.00 ? 6  SER A HB2  5  
ATOM 4513  H HB3  . SER A 1 6  ? 11.891  12.051  -7.900  1.00 0.00 ? 6  SER A HB3  5  
ATOM 4514  H HG   . SER A 1 6  ? 14.081  10.524  -7.163  1.00 0.00 ? 6  SER A HG   5  
ATOM 4515  N N    . GLY A 1 7  ? 9.251   12.031  -6.421  1.00 0.00 ? 7  GLY A N    5  
ATOM 4516  C CA   . GLY A 1 7  ? 7.853   12.188  -6.778  1.00 0.00 ? 7  GLY A CA   5  
ATOM 4517  C C    . GLY A 1 7  ? 7.207   13.369  -6.081  1.00 0.00 ? 7  GLY A C    5  
ATOM 4518  O O    . GLY A 1 7  ? 6.335   13.195  -5.229  1.00 0.00 ? 7  GLY A O    5  
ATOM 4519  H H    . GLY A 1 7  ? 9.738   12.778  -6.015  1.00 0.00 ? 7  GLY A H    5  
ATOM 4520  H HA2  . GLY A 1 7  ? 7.779   12.329  -7.846  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4521  H HA3  . GLY A 1 7  ? 7.320   11.289  -6.506  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4522  N N    . ARG A 1 8  ? 7.634   14.574  -6.443  1.00 0.00 ? 8  ARG A N    5  
ATOM 4523  C CA   . ARG A 1 8  ? 7.093   15.789  -5.845  1.00 0.00 ? 8  ARG A CA   5  
ATOM 4524  C C    . ARG A 1 8  ? 5.978   16.370  -6.709  1.00 0.00 ? 8  ARG A C    5  
ATOM 4525  O O    . ARG A 1 8  ? 6.231   17.150  -7.627  1.00 0.00 ? 8  ARG A O    5  
ATOM 4526  C CB   . ARG A 1 8  ? 8.200   16.827  -5.656  1.00 0.00 ? 8  ARG A CB   5  
ATOM 4527  C CG   . ARG A 1 8  ? 7.822   17.956  -4.711  1.00 0.00 ? 8  ARG A CG   5  
ATOM 4528  C CD   . ARG A 1 8  ? 8.904   19.023  -4.657  1.00 0.00 ? 8  ARG A CD   5  
ATOM 4529  N NE   . ARG A 1 8  ? 10.147  18.514  -4.082  1.00 0.00 ? 8  ARG A NE   5  
ATOM 4530  C CZ   . ARG A 1 8  ? 11.221  19.267  -3.871  1.00 0.00 ? 8  ARG A CZ   5  
ATOM 4531  N NH1  . ARG A 1 8  ? 11.204  20.555  -4.185  1.00 0.00 ? 8  ARG A NH1  5  
ATOM 4532  N NH2  . ARG A 1 8  ? 12.314  18.731  -3.344  1.00 0.00 ? 8  ARG A NH2  5  
ATOM 4533  H H    . ARG A 1 8  ? 8.331   14.649  -7.128  1.00 0.00 ? 8  ARG A H    5  
ATOM 4534  H HA   . ARG A 1 8  ? 6.686   15.530  -4.879  1.00 0.00 ? 8  ARG A HA   5  
ATOM 4535  H HB2  . ARG A 1 8  ? 9.077   16.334  -5.261  1.00 0.00 ? 8  ARG A HB2  5  
ATOM 4536  H HB3  . ARG A 1 8  ? 8.442   17.257  -6.617  1.00 0.00 ? 8  ARG A HB3  5  
ATOM 4537  H HG2  . ARG A 1 8  ? 6.903   18.408  -5.054  1.00 0.00 ? 8  ARG A HG2  5  
ATOM 4538  H HG3  . ARG A 1 8  ? 7.678   17.550  -3.721  1.00 0.00 ? 8  ARG A HG3  5  
ATOM 4539  H HD2  . ARG A 1 8  ? 9.099   19.371  -5.661  1.00 0.00 ? 8  ARG A HD2  5  
ATOM 4540  H HD3  . ARG A 1 8  ? 8.549   19.846  -4.054  1.00 0.00 ? 8  ARG A HD3  5  
ATOM 4541  H HE   . ARG A 1 8  ? 10.181  17.565  -3.843  1.00 0.00 ? 8  ARG A HE   5  
ATOM 4542  H HH11 . ARG A 1 8  ? 10.381  20.961  -4.581  1.00 0.00 ? 8  ARG A HH11 5  
ATOM 4543  H HH12 . ARG A 1 8  ? 12.014  21.119  -4.024  1.00 0.00 ? 8  ARG A HH12 5  
ATOM 4544  H HH21 . ARG A 1 8  ? 12.330  17.760  -3.106  1.00 0.00 ? 8  ARG A HH21 5  
ATOM 4545  H HH22 . ARG A 1 8  ? 13.122  19.298  -3.186  1.00 0.00 ? 8  ARG A HH22 5  
ATOM 4546  N N    . LYS A 1 9  ? 4.742   15.984  -6.409  1.00 0.00 ? 9  LYS A N    5  
ATOM 4547  C CA   . LYS A 1 9  ? 3.587   16.467  -7.156  1.00 0.00 ? 9  LYS A CA   5  
ATOM 4548  C C    . LYS A 1 9  ? 2.365   16.587  -6.251  1.00 0.00 ? 9  LYS A C    5  
ATOM 4549  O O    . LYS A 1 9  ? 2.294   15.985  -5.180  1.00 0.00 ? 9  LYS A O    5  
ATOM 4550  C CB   . LYS A 1 9  ? 3.279   15.526  -8.323  1.00 0.00 ? 9  LYS A CB   5  
ATOM 4551  C CG   . LYS A 1 9  ? 4.031   15.871  -9.597  1.00 0.00 ? 9  LYS A CG   5  
ATOM 4552  C CD   . LYS A 1 9  ? 4.027   14.711  -10.579 1.00 0.00 ? 9  LYS A CD   5  
ATOM 4553  C CE   . LYS A 1 9  ? 5.171   13.746  -10.305 1.00 0.00 ? 9  LYS A CE   5  
ATOM 4554  N NZ   . LYS A 1 9  ? 4.970   12.439  -10.989 1.00 0.00 ? 9  LYS A NZ   5  
ATOM 4555  H H    . LYS A 1 9  ? 4.603   15.360  -5.665  1.00 0.00 ? 9  LYS A H    5  
ATOM 4556  H HA   . LYS A 1 9  ? 3.828   17.444  -7.547  1.00 0.00 ? 9  LYS A HA   5  
ATOM 4557  H HB2  . LYS A 1 9  ? 3.542   14.518  -8.037  1.00 0.00 ? 9  LYS A HB2  5  
ATOM 4558  H HB3  . LYS A 1 9  ? 2.220   15.566  -8.533  1.00 0.00 ? 9  LYS A HB3  5  
ATOM 4559  H HG2  . LYS A 1 9  ? 3.560   16.724  -10.063 1.00 0.00 ? 9  LYS A HG2  5  
ATOM 4560  H HG3  . LYS A 1 9  ? 5.053   16.115  -9.346  1.00 0.00 ? 9  LYS A HG3  5  
ATOM 4561  H HD2  . LYS A 1 9  ? 3.093   14.178  -10.489 1.00 0.00 ? 9  LYS A HD2  5  
ATOM 4562  H HD3  . LYS A 1 9  ? 4.128   15.100  -11.582 1.00 0.00 ? 9  LYS A HD3  5  
ATOM 4563  H HE2  . LYS A 1 9  ? 6.090   14.189  -10.657 1.00 0.00 ? 9  LYS A HE2  5  
ATOM 4564  H HE3  . LYS A 1 9  ? 5.237   13.579  -9.240  1.00 0.00 ? 9  LYS A HE3  5  
ATOM 4565  H HZ1  . LYS A 1 9  ? 4.078   12.005  -10.675 1.00 0.00 ? 9  LYS A HZ1  5  
ATOM 4566  H HZ2  . LYS A 1 9  ? 5.754   11.794  -10.765 1.00 0.00 ? 9  LYS A HZ2  5  
ATOM 4567  H HZ3  . LYS A 1 9  ? 4.932   12.576  -12.019 1.00 0.00 ? 9  LYS A HZ3  5  
ATOM 4568  N N    . PRO A 1 10 ? 1.378   17.382  -6.691  1.00 0.00 ? 10 PRO A N    5  
ATOM 4569  C CA   . PRO A 1 10 ? 0.140   17.598  -5.936  1.00 0.00 ? 10 PRO A CA   5  
ATOM 4570  C C    . PRO A 1 10 ? -0.743  16.355  -5.903  1.00 0.00 ? 10 PRO A C    5  
ATOM 4571  O O    . PRO A 1 10 ? -1.715  16.292  -5.149  1.00 0.00 ? 10 PRO A O    5  
ATOM 4572  C CB   . PRO A 1 10 ? -0.553  18.725  -6.706  1.00 0.00 ? 10 PRO A CB   5  
ATOM 4573  C CG   . PRO A 1 10 ? -0.022  18.618  -8.094  1.00 0.00 ? 10 PRO A CG   5  
ATOM 4574  C CD   . PRO A 1 10 ? 1.394   18.130  -7.959  1.00 0.00 ? 10 PRO A CD   5  
ATOM 4575  H HA   . PRO A 1 10 ? 0.342   17.921  -4.926  1.00 0.00 ? 10 PRO A HA   5  
ATOM 4576  H HB2  . PRO A 1 10 ? -1.623  18.578  -6.679  1.00 0.00 ? 10 PRO A HB2  5  
ATOM 4577  H HB3  . PRO A 1 10 ? -0.303  19.676  -6.260  1.00 0.00 ? 10 PRO A HB3  5  
ATOM 4578  H HG2  . PRO A 1 10 ? -0.610  17.911  -8.658  1.00 0.00 ? 10 PRO A HG2  5  
ATOM 4579  H HG3  . PRO A 1 10 ? -0.040  19.587  -8.569  1.00 0.00 ? 10 PRO A HG3  5  
ATOM 4580  H HD2  . PRO A 1 10 ? 1.651   17.484  -8.785  1.00 0.00 ? 10 PRO A HD2  5  
ATOM 4581  H HD3  . PRO A 1 10 ? 2.077   18.965  -7.904  1.00 0.00 ? 10 PRO A HD3  5  
ATOM 4582  N N    . ARG A 1 11 ? -0.399  15.368  -6.723  1.00 0.00 ? 11 ARG A N    5  
ATOM 4583  C CA   . ARG A 1 11 ? -1.161  14.127  -6.788  1.00 0.00 ? 11 ARG A CA   5  
ATOM 4584  C C    . ARG A 1 11 ? -0.282  12.930  -6.434  1.00 0.00 ? 11 ARG A C    5  
ATOM 4585  O O    . ARG A 1 11 ? 0.656   12.598  -7.160  1.00 0.00 ? 11 ARG A O    5  
ATOM 4586  C CB   . ARG A 1 11 ? -1.757  13.941  -8.184  1.00 0.00 ? 11 ARG A CB   5  
ATOM 4587  C CG   . ARG A 1 11 ? -3.058  13.156  -8.192  1.00 0.00 ? 11 ARG A CG   5  
ATOM 4588  C CD   . ARG A 1 11 ? -2.808  11.662  -8.054  1.00 0.00 ? 11 ARG A CD   5  
ATOM 4589  N NE   . ARG A 1 11 ? -3.980  10.874  -8.428  1.00 0.00 ? 11 ARG A NE   5  
ATOM 4590  C CZ   . ARG A 1 11 ? -4.379  10.700  -9.683  1.00 0.00 ? 11 ARG A CZ   5  
ATOM 4591  N NH1  . ARG A 1 11 ? -3.703  11.254  -10.680 1.00 0.00 ? 11 ARG A NH1  5  
ATOM 4592  N NH2  . ARG A 1 11 ? -5.455  9.969   -9.943  1.00 0.00 ? 11 ARG A NH2  5  
ATOM 4593  H H    . ARG A 1 11 ? 0.386   15.477  -7.300  1.00 0.00 ? 11 ARG A H    5  
ATOM 4594  H HA   . ARG A 1 11 ? -1.964  14.193  -6.069  1.00 0.00 ? 11 ARG A HA   5  
ATOM 4595  H HB2  . ARG A 1 11 ? -1.946  14.913  -8.615  1.00 0.00 ? 11 ARG A HB2  5  
ATOM 4596  H HB3  . ARG A 1 11 ? -1.042  13.417  -8.800  1.00 0.00 ? 11 ARG A HB3  5  
ATOM 4597  H HG2  . ARG A 1 11 ? -3.671  13.484  -7.366  1.00 0.00 ? 11 ARG A HG2  5  
ATOM 4598  H HG3  . ARG A 1 11 ? -3.574  13.342  -9.122  1.00 0.00 ? 11 ARG A HG3  5  
ATOM 4599  H HD2  . ARG A 1 11 ? -1.983  11.388  -8.695  1.00 0.00 ? 11 ARG A HD2  5  
ATOM 4600  H HD3  . ARG A 1 11 ? -2.553  11.447  -7.027  1.00 0.00 ? 11 ARG A HD3  5  
ATOM 4601  H HE   . ARG A 1 11 ? -4.494  10.456  -7.707  1.00 0.00 ? 11 ARG A HE   5  
ATOM 4602  H HH11 . ARG A 1 11 ? -2.891  11.805  -10.487 1.00 0.00 ? 11 ARG A HH11 5  
ATOM 4603  H HH12 . ARG A 1 11 ? -4.005  11.121  -11.624 1.00 0.00 ? 11 ARG A HH12 5  
ATOM 4604  H HH21 . ARG A 1 11 ? -5.967  9.550   -9.194  1.00 0.00 ? 11 ARG A HH21 5  
ATOM 4605  H HH22 . ARG A 1 11 ? -5.755  9.839   -10.887 1.00 0.00 ? 11 ARG A HH22 5  
ATOM 4606  N N    . THR A 1 12 ? -0.592  12.285  -5.314  1.00 0.00 ? 12 THR A N    5  
ATOM 4607  C CA   . THR A 1 12 ? 0.169   11.127  -4.863  1.00 0.00 ? 12 THR A CA   5  
ATOM 4608  C C    . THR A 1 12 ? -0.196  9.883   -5.664  1.00 0.00 ? 12 THR A C    5  
ATOM 4609  O O    . THR A 1 12 ? -1.288  9.795   -6.227  1.00 0.00 ? 12 THR A O    5  
ATOM 4610  C CB   . THR A 1 12 ? -0.067  10.848  -3.366  1.00 0.00 ? 12 THR A CB   5  
ATOM 4611  O OG1  . THR A 1 12 ? 0.226   12.020  -2.597  1.00 0.00 ? 12 THR A OG1  5  
ATOM 4612  C CG2  . THR A 1 12 ? 0.800   9.692   -2.889  1.00 0.00 ? 12 THR A CG2  5  
ATOM 4613  H H    . THR A 1 12 ? -1.351  12.598  -4.778  1.00 0.00 ? 12 THR A H    5  
ATOM 4614  H HA   . THR A 1 12 ? 1.218   11.341  -5.007  1.00 0.00 ? 12 THR A HA   5  
ATOM 4615  H HB   . THR A 1 12 ? -1.105  10.583  -3.224  1.00 0.00 ? 12 THR A HB   5  
ATOM 4616  H HG1  . THR A 1 12 ? -0.592  12.393  -2.259  1.00 0.00 ? 12 THR A HG1  5  
ATOM 4617  H HG21 . THR A 1 12 ? 1.842   9.949   -3.012  1.00 0.00 ? 12 THR A HG21 5  
ATOM 4618  H HG22 . THR A 1 12 ? 0.575   8.810   -3.469  1.00 0.00 ? 12 THR A HG22 5  
ATOM 4619  H HG23 . THR A 1 12 ? 0.598   9.499   -1.846  1.00 0.00 ? 12 THR A HG23 5  
ATOM 4620  N N    . ILE A 1 13 ? 0.722   8.924   -5.711  1.00 0.00 ? 13 ILE A N    5  
ATOM 4621  C CA   . ILE A 1 13 ? 0.495   7.684   -6.442  1.00 0.00 ? 13 ILE A CA   5  
ATOM 4622  C C    . ILE A 1 13 ? -0.858  7.077   -6.087  1.00 0.00 ? 13 ILE A C    5  
ATOM 4623  O O    . ILE A 1 13 ? -1.387  6.242   -6.821  1.00 0.00 ? 13 ILE A O    5  
ATOM 4624  C CB   . ILE A 1 13 ? 1.600   6.651   -6.155  1.00 0.00 ? 13 ILE A CB   5  
ATOM 4625  C CG1  . ILE A 1 13 ? 2.979   7.264   -6.405  1.00 0.00 ? 13 ILE A CG1  5  
ATOM 4626  C CG2  . ILE A 1 13 ? 1.402   5.411   -7.015  1.00 0.00 ? 13 ILE A CG2  5  
ATOM 4627  C CD1  . ILE A 1 13 ? 3.150   7.820   -7.801  1.00 0.00 ? 13 ILE A CD1  5  
ATOM 4628  H H    . ILE A 1 13 ? 1.573   9.053   -5.241  1.00 0.00 ? 13 ILE A H    5  
ATOM 4629  H HA   . ILE A 1 13 ? 0.509   7.913   -7.498  1.00 0.00 ? 13 ILE A HA   5  
ATOM 4630  H HB   . ILE A 1 13 ? 1.527   6.356   -5.120  1.00 0.00 ? 13 ILE A HB   5  
ATOM 4631  H HG12 . ILE A 1 13 ? 3.140   8.070   -5.706  1.00 0.00 ? 13 ILE A HG12 5  
ATOM 4632  H HG13 . ILE A 1 13 ? 3.735   6.506   -6.254  1.00 0.00 ? 13 ILE A HG13 5  
ATOM 4633  H HG21 . ILE A 1 13 ? 2.252   4.754   -6.900  1.00 0.00 ? 13 ILE A HG21 5  
ATOM 4634  H HG22 . ILE A 1 13 ? 0.506   4.897   -6.704  1.00 0.00 ? 13 ILE A HG22 5  
ATOM 4635  H HG23 . ILE A 1 13 ? 1.310   5.702   -8.051  1.00 0.00 ? 13 ILE A HG23 5  
ATOM 4636  H HD11 . ILE A 1 13 ? 2.918   8.875   -7.800  1.00 0.00 ? 13 ILE A HD11 5  
ATOM 4637  H HD12 . ILE A 1 13 ? 4.169   7.675   -8.125  1.00 0.00 ? 13 ILE A HD12 5  
ATOM 4638  H HD13 . ILE A 1 13 ? 2.481   7.307   -8.477  1.00 0.00 ? 13 ILE A HD13 5  
ATOM 4639  N N    . TYR A 1 14 ? -1.413  7.502   -4.958  1.00 0.00 ? 14 TYR A N    5  
ATOM 4640  C CA   . TYR A 1 14 ? -2.705  7.000   -4.504  1.00 0.00 ? 14 TYR A CA   5  
ATOM 4641  C C    . TYR A 1 14 ? -3.550  8.125   -3.913  1.00 0.00 ? 14 TYR A C    5  
ATOM 4642  O O    . TYR A 1 14 ? -3.024  9.063   -3.315  1.00 0.00 ? 14 TYR A O    5  
ATOM 4643  C CB   . TYR A 1 14 ? -2.509  5.894   -3.465  1.00 0.00 ? 14 TYR A CB   5  
ATOM 4644  C CG   . TYR A 1 14 ? -2.101  4.567   -4.063  1.00 0.00 ? 14 TYR A CG   5  
ATOM 4645  C CD1  . TYR A 1 14 ? -0.813  4.366   -4.545  1.00 0.00 ? 14 TYR A CD1  5  
ATOM 4646  C CD2  . TYR A 1 14 ? -3.003  3.513   -4.145  1.00 0.00 ? 14 TYR A CD2  5  
ATOM 4647  C CE1  . TYR A 1 14 ? -0.436  3.156   -5.093  1.00 0.00 ? 14 TYR A CE1  5  
ATOM 4648  C CE2  . TYR A 1 14 ? -2.634  2.298   -4.690  1.00 0.00 ? 14 TYR A CE2  5  
ATOM 4649  C CZ   . TYR A 1 14 ? -1.350  2.125   -5.163  1.00 0.00 ? 14 TYR A CZ   5  
ATOM 4650  O OH   . TYR A 1 14 ? -0.977  0.917   -5.707  1.00 0.00 ? 14 TYR A OH   5  
ATOM 4651  H H    . TYR A 1 14 ? -0.943  8.169   -4.415  1.00 0.00 ? 14 TYR A H    5  
ATOM 4652  H HA   . TYR A 1 14 ? -3.220  6.589   -5.360  1.00 0.00 ? 14 TYR A HA   5  
ATOM 4653  H HB2  . TYR A 1 14 ? -1.741  6.195   -2.770  1.00 0.00 ? 14 TYR A HB2  5  
ATOM 4654  H HB3  . TYR A 1 14 ? -3.435  5.746   -2.929  1.00 0.00 ? 14 TYR A HB3  5  
ATOM 4655  H HD1  . TYR A 1 14 ? -0.100  5.176   -4.488  1.00 0.00 ? 14 TYR A HD1  5  
ATOM 4656  H HD2  . TYR A 1 14 ? -4.008  3.652   -3.774  1.00 0.00 ? 14 TYR A HD2  5  
ATOM 4657  H HE1  . TYR A 1 14 ? 0.569   3.019   -5.463  1.00 0.00 ? 14 TYR A HE1  5  
ATOM 4658  H HE2  . TYR A 1 14 ? -3.349  1.491   -4.745  1.00 0.00 ? 14 TYR A HE2  5  
ATOM 4659  H HH   . TYR A 1 14 ? -1.699  0.290   -5.617  1.00 0.00 ? 14 TYR A HH   5  
ATOM 4660  N N    . SER A 1 15 ? -4.864  8.022   -4.086  1.00 0.00 ? 15 SER A N    5  
ATOM 4661  C CA   . SER A 1 15 ? -5.783  9.031   -3.574  1.00 0.00 ? 15 SER A CA   5  
ATOM 4662  C C    . SER A 1 15 ? -5.923  8.919   -2.059  1.00 0.00 ? 15 SER A C    5  
ATOM 4663  O O    . SER A 1 15 ? -5.751  7.843   -1.486  1.00 0.00 ? 15 SER A O    5  
ATOM 4664  C CB   . SER A 1 15 ? -7.155  8.885   -4.236  1.00 0.00 ? 15 SER A CB   5  
ATOM 4665  O OG   . SER A 1 15 ? -7.087  9.185   -5.619  1.00 0.00 ? 15 SER A OG   5  
ATOM 4666  H H    . SER A 1 15 ? -5.223  7.250   -4.572  1.00 0.00 ? 15 SER A H    5  
ATOM 4667  H HA   . SER A 1 15 ? -5.378  10.002  -3.815  1.00 0.00 ? 15 SER A HA   5  
ATOM 4668  H HB2  . SER A 1 15 ? -7.503  7.871   -4.116  1.00 0.00 ? 15 SER A HB2  5  
ATOM 4669  H HB3  . SER A 1 15 ? -7.852  9.563   -3.766  1.00 0.00 ? 15 SER A HB3  5  
ATOM 4670  H HG   . SER A 1 15 ? -6.381  8.676   -6.024  1.00 0.00 ? 15 SER A HG   5  
ATOM 4671  N N    . SER A 1 16 ? -6.236  10.040  -1.415  1.00 0.00 ? 16 SER A N    5  
ATOM 4672  C CA   . SER A 1 16 ? -6.396  10.070  0.034   1.00 0.00 ? 16 SER A CA   5  
ATOM 4673  C C    . SER A 1 16 ? -7.398  9.015   0.492   1.00 0.00 ? 16 SER A C    5  
ATOM 4674  O O    . SER A 1 16 ? -7.208  8.368   1.522   1.00 0.00 ? 16 SER A O    5  
ATOM 4675  C CB   . SER A 1 16 ? -6.854  11.457  0.489   1.00 0.00 ? 16 SER A CB   5  
ATOM 4676  O OG   . SER A 1 16 ? -8.028  11.857  -0.197  1.00 0.00 ? 16 SER A OG   5  
ATOM 4677  H H    . SER A 1 16 ? -6.360  10.866  -1.928  1.00 0.00 ? 16 SER A H    5  
ATOM 4678  H HA   . SER A 1 16 ? -5.435  9.854   0.477   1.00 0.00 ? 16 SER A HA   5  
ATOM 4679  H HB2  . SER A 1 16 ? -7.060  11.435  1.548   1.00 0.00 ? 16 SER A HB2  5  
ATOM 4680  H HB3  . SER A 1 16 ? -6.072  12.175  0.289   1.00 0.00 ? 16 SER A HB3  5  
ATOM 4681  H HG   . SER A 1 16 ? -8.431  12.596  0.263   1.00 0.00 ? 16 SER A HG   5  
ATOM 4682  N N    . PHE A 1 17 ? -8.466  8.847   -0.281  1.00 0.00 ? 17 PHE A N    5  
ATOM 4683  C CA   . PHE A 1 17 ? -9.500  7.872   0.045   1.00 0.00 ? 17 PHE A CA   5  
ATOM 4684  C C    . PHE A 1 17 ? -8.932  6.456   0.042   1.00 0.00 ? 17 PHE A C    5  
ATOM 4685  O O    . PHE A 1 17 ? -9.141  5.691   0.983   1.00 0.00 ? 17 PHE A O    5  
ATOM 4686  C CB   . PHE A 1 17 ? -10.657 7.971   -0.951  1.00 0.00 ? 17 PHE A CB   5  
ATOM 4687  C CG   . PHE A 1 17 ? -11.531 6.750   -0.979  1.00 0.00 ? 17 PHE A CG   5  
ATOM 4688  C CD1  . PHE A 1 17 ? -11.190 5.655   -1.756  1.00 0.00 ? 17 PHE A CD1  5  
ATOM 4689  C CD2  . PHE A 1 17 ? -12.694 6.698   -0.228  1.00 0.00 ? 17 PHE A CD2  5  
ATOM 4690  C CE1  . PHE A 1 17 ? -11.992 4.530   -1.783  1.00 0.00 ? 17 PHE A CE1  5  
ATOM 4691  C CE2  . PHE A 1 17 ? -13.500 5.575   -0.251  1.00 0.00 ? 17 PHE A CE2  5  
ATOM 4692  C CZ   . PHE A 1 17 ? -13.149 4.490   -1.030  1.00 0.00 ? 17 PHE A CZ   5  
ATOM 4693  H H    . PHE A 1 17 ? -8.561  9.393   -1.089  1.00 0.00 ? 17 PHE A H    5  
ATOM 4694  H HA   . PHE A 1 17 ? -9.867  8.098   1.034   1.00 0.00 ? 17 PHE A HA   5  
ATOM 4695  H HB2  . PHE A 1 17 ? -11.276 8.816   -0.690  1.00 0.00 ? 17 PHE A HB2  5  
ATOM 4696  H HB3  . PHE A 1 17 ? -10.256 8.117   -1.943  1.00 0.00 ? 17 PHE A HB3  5  
ATOM 4697  H HD1  . PHE A 1 17 ? -10.284 5.685   -2.346  1.00 0.00 ? 17 PHE A HD1  5  
ATOM 4698  H HD2  . PHE A 1 17 ? -12.971 7.546   0.382   1.00 0.00 ? 17 PHE A HD2  5  
ATOM 4699  H HE1  . PHE A 1 17 ? -11.714 3.683   -2.394  1.00 0.00 ? 17 PHE A HE1  5  
ATOM 4700  H HE2  . PHE A 1 17 ? -14.404 5.547   0.339   1.00 0.00 ? 17 PHE A HE2  5  
ATOM 4701  H HZ   . PHE A 1 17 ? -13.776 3.612   -1.049  1.00 0.00 ? 17 PHE A HZ   5  
ATOM 4702  N N    . GLN A 1 18 ? -8.213  6.115   -1.022  1.00 0.00 ? 18 GLN A N    5  
ATOM 4703  C CA   . GLN A 1 18 ? -7.616  4.791   -1.148  1.00 0.00 ? 18 GLN A CA   5  
ATOM 4704  C C    . GLN A 1 18 ? -6.525  4.583   -0.102  1.00 0.00 ? 18 GLN A C    5  
ATOM 4705  O O    . GLN A 1 18 ? -6.381  3.492   0.452   1.00 0.00 ? 18 GLN A O    5  
ATOM 4706  C CB   . GLN A 1 18 ? -7.036  4.601   -2.551  1.00 0.00 ? 18 GLN A CB   5  
ATOM 4707  C CG   . GLN A 1 18 ? -8.094  4.466   -3.634  1.00 0.00 ? 18 GLN A CG   5  
ATOM 4708  C CD   . GLN A 1 18 ? -7.497  4.222   -5.006  1.00 0.00 ? 18 GLN A CD   5  
ATOM 4709  O OE1  . GLN A 1 18 ? -6.406  4.701   -5.315  1.00 0.00 ? 18 GLN A OE1  5  
ATOM 4710  N NE2  . GLN A 1 18 ? -8.212  3.473   -5.838  1.00 0.00 ? 18 GLN A NE2  5  
ATOM 4711  H H    . GLN A 1 18 ? -8.081  6.769   -1.739  1.00 0.00 ? 18 GLN A H    5  
ATOM 4712  H HA   . GLN A 1 18 ? -8.394  4.060   -0.988  1.00 0.00 ? 18 GLN A HA   5  
ATOM 4713  H HB2  . GLN A 1 18 ? -6.414  5.451   -2.788  1.00 0.00 ? 18 GLN A HB2  5  
ATOM 4714  H HB3  . GLN A 1 18 ? -6.428  3.708   -2.558  1.00 0.00 ? 18 GLN A HB3  5  
ATOM 4715  H HG2  . GLN A 1 18 ? -8.740  3.637   -3.387  1.00 0.00 ? 18 GLN A HG2  5  
ATOM 4716  H HG3  . GLN A 1 18 ? -8.675  5.376   -3.666  1.00 0.00 ? 18 GLN A HG3  5  
ATOM 4717  H HE21 . GLN A 1 18 ? -9.073  3.126   -5.523  1.00 0.00 ? 18 GLN A HE21 5  
ATOM 4718  H HE22 . GLN A 1 18 ? -7.851  3.300   -6.731  1.00 0.00 ? 18 GLN A HE22 5  
ATOM 4719  N N    . LEU A 1 19 ? -5.760  5.636   0.165   1.00 0.00 ? 19 LEU A N    5  
ATOM 4720  C CA   . LEU A 1 19 ? -4.682  5.570   1.145   1.00 0.00 ? 19 LEU A CA   5  
ATOM 4721  C C    . LEU A 1 19 ? -5.237  5.389   2.554   1.00 0.00 ? 19 LEU A C    5  
ATOM 4722  O O    . LEU A 1 19 ? -4.919  4.417   3.238   1.00 0.00 ? 19 LEU A O    5  
ATOM 4723  C CB   . LEU A 1 19 ? -3.828  6.837   1.079   1.00 0.00 ? 19 LEU A CB   5  
ATOM 4724  C CG   . LEU A 1 19 ? -2.667  6.814   0.084   1.00 0.00 ? 19 LEU A CG   5  
ATOM 4725  C CD1  . LEU A 1 19 ? -1.771  8.026   0.281   1.00 0.00 ? 19 LEU A CD1  5  
ATOM 4726  C CD2  . LEU A 1 19 ? -1.867  5.528   0.229   1.00 0.00 ? 19 LEU A CD2  5  
ATOM 4727  H H    . LEU A 1 19 ? -5.924  6.478   -0.308  1.00 0.00 ? 19 LEU A H    5  
ATOM 4728  H HA   . LEU A 1 19 ? -4.066  4.717   0.902   1.00 0.00 ? 19 LEU A HA   5  
ATOM 4729  H HB2  . LEU A 1 19 ? -4.475  7.658   0.813   1.00 0.00 ? 19 LEU A HB2  5  
ATOM 4730  H HB3  . LEU A 1 19 ? -3.418  7.010   2.064   1.00 0.00 ? 19 LEU A HB3  5  
ATOM 4731  H HG   . LEU A 1 19 ? -3.063  6.851   -0.921  1.00 0.00 ? 19 LEU A HG   5  
ATOM 4732  H HD11 . LEU A 1 19 ? -1.177  7.894   1.172   1.00 0.00 ? 19 LEU A HD11 5  
ATOM 4733  H HD12 . LEU A 1 19 ? -2.381  8.912   0.382   1.00 0.00 ? 19 LEU A HD12 5  
ATOM 4734  H HD13 . LEU A 1 19 ? -1.120  8.135   -0.574  1.00 0.00 ? 19 LEU A HD13 5  
ATOM 4735  H HD21 . LEU A 1 19 ? -2.394  4.719   -0.256  1.00 0.00 ? 19 LEU A HD21 5  
ATOM 4736  H HD22 . LEU A 1 19 ? -1.742  5.297   1.278   1.00 0.00 ? 19 LEU A HD22 5  
ATOM 4737  H HD23 . LEU A 1 19 ? -0.898  5.653   -0.230  1.00 0.00 ? 19 LEU A HD23 5  
ATOM 4738  N N    . ALA A 1 20 ? -6.072  6.332   2.981   1.00 0.00 ? 20 ALA A N    5  
ATOM 4739  C CA   . ALA A 1 20 ? -6.675  6.275   4.306   1.00 0.00 ? 20 ALA A CA   5  
ATOM 4740  C C    . ALA A 1 20 ? -6.948  4.834   4.724   1.00 0.00 ? 20 ALA A C    5  
ATOM 4741  O O    . ALA A 1 20 ? -6.547  4.404   5.805   1.00 0.00 ? 20 ALA A O    5  
ATOM 4742  C CB   . ALA A 1 20 ? -7.961  7.087   4.336   1.00 0.00 ? 20 ALA A CB   5  
ATOM 4743  H H    . ALA A 1 20 ? -6.287  7.083   2.389   1.00 0.00 ? 20 ALA A H    5  
ATOM 4744  H HA   . ALA A 1 20 ? -5.982  6.717   5.008   1.00 0.00 ? 20 ALA A HA   5  
ATOM 4745  H HB1  . ALA A 1 20 ? -7.770  8.077   3.946   1.00 0.00 ? 20 ALA A HB1  5  
ATOM 4746  H HB2  . ALA A 1 20 ? -8.709  6.599   3.730   1.00 0.00 ? 20 ALA A HB2  5  
ATOM 4747  H HB3  . ALA A 1 20 ? -8.315  7.163   5.354   1.00 0.00 ? 20 ALA A HB3  5  
ATOM 4748  N N    . ALA A 1 21 ? -7.633  4.092   3.860   1.00 0.00 ? 21 ALA A N    5  
ATOM 4749  C CA   . ALA A 1 21 ? -7.957  2.699   4.139   1.00 0.00 ? 21 ALA A CA   5  
ATOM 4750  C C    . ALA A 1 21 ? -6.709  1.824   4.095   1.00 0.00 ? 21 ALA A C    5  
ATOM 4751  O O    . ALA A 1 21 ? -6.459  1.035   5.007   1.00 0.00 ? 21 ALA A O    5  
ATOM 4752  C CB   . ALA A 1 21 ? -8.995  2.190   3.149   1.00 0.00 ? 21 ALA A CB   5  
ATOM 4753  H H    . ALA A 1 21 ? -7.925  4.491   3.014   1.00 0.00 ? 21 ALA A H    5  
ATOM 4754  H HA   . ALA A 1 21 ? -8.386  2.648   5.130   1.00 0.00 ? 21 ALA A HA   5  
ATOM 4755  H HB1  . ALA A 1 21 ? -8.878  2.709   2.208   1.00 0.00 ? 21 ALA A HB1  5  
ATOM 4756  H HB2  . ALA A 1 21 ? -8.857  1.130   2.996   1.00 0.00 ? 21 ALA A HB2  5  
ATOM 4757  H HB3  . ALA A 1 21 ? -9.985  2.372   3.540   1.00 0.00 ? 21 ALA A HB3  5  
ATOM 4758  N N    . LEU A 1 22 ? -5.928  1.969   3.030   1.00 0.00 ? 22 LEU A N    5  
ATOM 4759  C CA   . LEU A 1 22 ? -4.705  1.191   2.867   1.00 0.00 ? 22 LEU A CA   5  
ATOM 4760  C C    . LEU A 1 22 ? -3.860  1.232   4.137   1.00 0.00 ? 22 LEU A C    5  
ATOM 4761  O O    . LEU A 1 22 ? -3.616  0.201   4.763   1.00 0.00 ? 22 LEU A O    5  
ATOM 4762  C CB   . LEU A 1 22 ? -3.893  1.723   1.684   1.00 0.00 ? 22 LEU A CB   5  
ATOM 4763  C CG   . LEU A 1 22 ? -4.266  1.166   0.310   1.00 0.00 ? 22 LEU A CG   5  
ATOM 4764  C CD1  . LEU A 1 22 ? -3.419  1.812   -0.776  1.00 0.00 ? 22 LEU A CD1  5  
ATOM 4765  C CD2  . LEU A 1 22 ? -4.106  -0.347  0.285   1.00 0.00 ? 22 LEU A CD2  5  
ATOM 4766  H H    . LEU A 1 22 ? -6.179  2.614   2.337   1.00 0.00 ? 22 LEU A H    5  
ATOM 4767  H HA   . LEU A 1 22 ? -4.987  0.168   2.669   1.00 0.00 ? 22 LEU A HA   5  
ATOM 4768  H HB2  . LEU A 1 22 ? -4.018  2.794   1.652   1.00 0.00 ? 22 LEU A HB2  5  
ATOM 4769  H HB3  . LEU A 1 22 ? -2.854  1.489   1.866   1.00 0.00 ? 22 LEU A HB3  5  
ATOM 4770  H HG   . LEU A 1 22 ? -5.303  1.397   0.105   1.00 0.00 ? 22 LEU A HG   5  
ATOM 4771  H HD11 . LEU A 1 22 ? -3.114  2.797   -0.456  1.00 0.00 ? 22 LEU A HD11 5  
ATOM 4772  H HD12 . LEU A 1 22 ? -3.998  1.891   -1.684  1.00 0.00 ? 22 LEU A HD12 5  
ATOM 4773  H HD13 . LEU A 1 22 ? -2.544  1.205   -0.958  1.00 0.00 ? 22 LEU A HD13 5  
ATOM 4774  H HD21 . LEU A 1 22 ? -3.831  -0.695  1.270   1.00 0.00 ? 22 LEU A HD21 5  
ATOM 4775  H HD22 . LEU A 1 22 ? -3.332  -0.615  -0.420  1.00 0.00 ? 22 LEU A HD22 5  
ATOM 4776  H HD23 . LEU A 1 22 ? -5.038  -0.803  -0.011  1.00 0.00 ? 22 LEU A HD23 5  
ATOM 4777  N N    . GLN A 1 23 ? -3.421  2.429   4.511   1.00 0.00 ? 23 GLN A N    5  
ATOM 4778  C CA   . GLN A 1 23 ? -2.605  2.603   5.707   1.00 0.00 ? 23 GLN A CA   5  
ATOM 4779  C C    . GLN A 1 23 ? -3.296  2.004   6.928   1.00 0.00 ? 23 GLN A C    5  
ATOM 4780  O O    . GLN A 1 23 ? -2.669  1.312   7.731   1.00 0.00 ? 23 GLN A O    5  
ATOM 4781  C CB   . GLN A 1 23 ? -2.320  4.087   5.944   1.00 0.00 ? 23 GLN A CB   5  
ATOM 4782  C CG   . GLN A 1 23 ? -1.206  4.640   5.070   1.00 0.00 ? 23 GLN A CG   5  
ATOM 4783  C CD   . GLN A 1 23 ? -0.723  6.000   5.531   1.00 0.00 ? 23 GLN A CD   5  
ATOM 4784  O OE1  . GLN A 1 23 ? -1.460  6.748   6.175   1.00 0.00 ? 23 GLN A OE1  5  
ATOM 4785  N NE2  . GLN A 1 23 ? 0.522   6.329   5.205   1.00 0.00 ? 23 GLN A NE2  5  
ATOM 4786  H H    . GLN A 1 23 ? -3.649  3.213   3.970   1.00 0.00 ? 23 GLN A H    5  
ATOM 4787  H HA   . GLN A 1 23 ? -1.670  2.087   5.549   1.00 0.00 ? 23 GLN A HA   5  
ATOM 4788  H HB2  . GLN A 1 23 ? -3.219  4.650   5.744   1.00 0.00 ? 23 GLN A HB2  5  
ATOM 4789  H HB3  . GLN A 1 23 ? -2.040  4.227   6.978   1.00 0.00 ? 23 GLN A HB3  5  
ATOM 4790  H HG2  . GLN A 1 23 ? -0.373  3.953   5.093   1.00 0.00 ? 23 GLN A HG2  5  
ATOM 4791  H HG3  . GLN A 1 23 ? -1.571  4.727   4.057   1.00 0.00 ? 23 GLN A HG3  5  
ATOM 4792  H HE21 . GLN A 1 23 ? 1.050   5.684   4.690   1.00 0.00 ? 23 GLN A HE21 5  
ATOM 4793  H HE22 . GLN A 1 23 ? 0.859   7.203   5.489   1.00 0.00 ? 23 GLN A HE22 5  
ATOM 4794  N N    . ARG A 1 24 ? -4.590  2.276   7.063   1.00 0.00 ? 24 ARG A N    5  
ATOM 4795  C CA   . ARG A 1 24 ? -5.364  1.765   8.187   1.00 0.00 ? 24 ARG A CA   5  
ATOM 4796  C C    . ARG A 1 24 ? -5.138  0.267   8.368   1.00 0.00 ? 24 ARG A C    5  
ATOM 4797  O O    . ARG A 1 24 ? -5.142  -0.240  9.490   1.00 0.00 ? 24 ARG A O    5  
ATOM 4798  C CB   . ARG A 1 24 ? -6.854  2.045   7.977   1.00 0.00 ? 24 ARG A CB   5  
ATOM 4799  C CG   . ARG A 1 24 ? -7.636  2.188   9.272   1.00 0.00 ? 24 ARG A CG   5  
ATOM 4800  C CD   . ARG A 1 24 ? -8.921  2.974   9.064   1.00 0.00 ? 24 ARG A CD   5  
ATOM 4801  N NE   . ARG A 1 24 ? -8.665  4.308   8.527   1.00 0.00 ? 24 ARG A NE   5  
ATOM 4802  C CZ   . ARG A 1 24 ? -9.605  5.073   7.983   1.00 0.00 ? 24 ARG A CZ   5  
ATOM 4803  N NH1  . ARG A 1 24 ? -10.855 4.638   7.903   1.00 0.00 ? 24 ARG A NH1  5  
ATOM 4804  N NH2  . ARG A 1 24 ? -9.294  6.276   7.517   1.00 0.00 ? 24 ARG A NH2  5  
ATOM 4805  H H    . ARG A 1 24 ? -5.034  2.834   6.391   1.00 0.00 ? 24 ARG A H    5  
ATOM 4806  H HA   . ARG A 1 24 ? -5.034  2.277   9.078   1.00 0.00 ? 24 ARG A HA   5  
ATOM 4807  H HB2  . ARG A 1 24 ? -6.960  2.962   7.415   1.00 0.00 ? 24 ARG A HB2  5  
ATOM 4808  H HB3  . ARG A 1 24 ? -7.283  1.233   7.410   1.00 0.00 ? 24 ARG A HB3  5  
ATOM 4809  H HG2  . ARG A 1 24 ? -7.885  1.204   9.642   1.00 0.00 ? 24 ARG A HG2  5  
ATOM 4810  H HG3  . ARG A 1 24 ? -7.022  2.702   9.997   1.00 0.00 ? 24 ARG A HG3  5  
ATOM 4811  H HD2  . ARG A 1 24 ? -9.550  2.433   8.372   1.00 0.00 ? 24 ARG A HD2  5  
ATOM 4812  H HD3  . ARG A 1 24 ? -9.427  3.068   10.013  1.00 0.00 ? 24 ARG A HD3  5  
ATOM 4813  H HE   . ARG A 1 24 ? -7.748  4.649   8.576   1.00 0.00 ? 24 ARG A HE   5  
ATOM 4814  H HH11 . ARG A 1 24 ? -11.092 3.733   8.254   1.00 0.00 ? 24 ARG A HH11 5  
ATOM 4815  H HH12 . ARG A 1 24 ? -11.560 5.217   7.493   1.00 0.00 ? 24 ARG A HH12 5  
ATOM 4816  H HH21 . ARG A 1 24 ? -8.353  6.607   7.575   1.00 0.00 ? 24 ARG A HH21 5  
ATOM 4817  H HH22 . ARG A 1 24 ? -10.002 6.851   7.107   1.00 0.00 ? 24 ARG A HH22 5  
ATOM 4818  N N    . ARG A 1 25 ? -4.941  -0.435  7.257   1.00 0.00 ? 25 ARG A N    5  
ATOM 4819  C CA   . ARG A 1 25 ? -4.715  -1.874  7.292   1.00 0.00 ? 25 ARG A CA   5  
ATOM 4820  C C    . ARG A 1 25 ? -3.249  -2.187  7.576   1.00 0.00 ? 25 ARG A C    5  
ATOM 4821  O O    . ARG A 1 25 ? -2.935  -3.093  8.348   1.00 0.00 ? 25 ARG A O    5  
ATOM 4822  C CB   . ARG A 1 25 ? -5.137  -2.511  5.967   1.00 0.00 ? 25 ARG A CB   5  
ATOM 4823  C CG   . ARG A 1 25 ? -5.208  -4.029  6.016   1.00 0.00 ? 25 ARG A CG   5  
ATOM 4824  C CD   . ARG A 1 25 ? -6.398  -4.505  6.834   1.00 0.00 ? 25 ARG A CD   5  
ATOM 4825  N NE   . ARG A 1 25 ? -6.206  -5.860  7.344   1.00 0.00 ? 25 ARG A NE   5  
ATOM 4826  C CZ   . ARG A 1 25 ? -7.192  -6.615  7.814   1.00 0.00 ? 25 ARG A CZ   5  
ATOM 4827  N NH1  . ARG A 1 25 ? -8.434  -6.151  7.838   1.00 0.00 ? 25 ARG A NH1  5  
ATOM 4828  N NH2  . ARG A 1 25 ? -6.937  -7.839  8.260   1.00 0.00 ? 25 ARG A NH2  5  
ATOM 4829  H H    . ARG A 1 25 ? -4.950  0.027   6.392   1.00 0.00 ? 25 ARG A H    5  
ATOM 4830  H HA   . ARG A 1 25 ? -5.319  -2.286  8.088   1.00 0.00 ? 25 ARG A HA   5  
ATOM 4831  H HB2  . ARG A 1 25 ? -6.112  -2.136  5.695   1.00 0.00 ? 25 ARG A HB2  5  
ATOM 4832  H HB3  . ARG A 1 25 ? -4.426  -2.230  5.205   1.00 0.00 ? 25 ARG A HB3  5  
ATOM 4833  H HG2  . ARG A 1 25 ? -5.303  -4.408  5.009   1.00 0.00 ? 25 ARG A HG2  5  
ATOM 4834  H HG3  . ARG A 1 25 ? -4.301  -4.408  6.462   1.00 0.00 ? 25 ARG A HG3  5  
ATOM 4835  H HD2  . ARG A 1 25 ? -6.536  -3.833  7.669   1.00 0.00 ? 25 ARG A HD2  5  
ATOM 4836  H HD3  . ARG A 1 25 ? -7.278  -4.487  6.209   1.00 0.00 ? 25 ARG A HD3  5  
ATOM 4837  H HE   . ARG A 1 25 ? -5.296  -6.223  7.335   1.00 0.00 ? 25 ARG A HE   5  
ATOM 4838  H HH11 . ARG A 1 25 ? -8.628  -5.230  7.502   1.00 0.00 ? 25 ARG A HH11 5  
ATOM 4839  H HH12 . ARG A 1 25 ? -9.175  -6.722  8.191   1.00 0.00 ? 25 ARG A HH12 5  
ATOM 4840  H HH21 . ARG A 1 25 ? -6.003  -8.192  8.243   1.00 0.00 ? 25 ARG A HH21 5  
ATOM 4841  H HH22 . ARG A 1 25 ? -7.680  -8.406  8.614   1.00 0.00 ? 25 ARG A HH22 5  
ATOM 4842  N N    . PHE A 1 26 ? -2.355  -1.432  6.946   1.00 0.00 ? 26 PHE A N    5  
ATOM 4843  C CA   . PHE A 1 26 ? -0.922  -1.630  7.128   1.00 0.00 ? 26 PHE A CA   5  
ATOM 4844  C C    . PHE A 1 26 ? -0.576  -1.762  8.609   1.00 0.00 ? 26 PHE A C    5  
ATOM 4845  O O    . PHE A 1 26 ? 0.176   -2.652  9.003   1.00 0.00 ? 26 PHE A O    5  
ATOM 4846  C CB   . PHE A 1 26 ? -0.143  -0.466  6.513   1.00 0.00 ? 26 PHE A CB   5  
ATOM 4847  C CG   . PHE A 1 26 ? 1.347   -0.653  6.555   1.00 0.00 ? 26 PHE A CG   5  
ATOM 4848  C CD1  . PHE A 1 26 ? 1.936   -1.764  5.973   1.00 0.00 ? 26 PHE A CD1  5  
ATOM 4849  C CD2  . PHE A 1 26 ? 2.158   0.282   7.177   1.00 0.00 ? 26 PHE A CD2  5  
ATOM 4850  C CE1  . PHE A 1 26 ? 3.306   -1.939  6.010   1.00 0.00 ? 26 PHE A CE1  5  
ATOM 4851  C CE2  . PHE A 1 26 ? 3.529   0.113   7.217   1.00 0.00 ? 26 PHE A CE2  5  
ATOM 4852  C CZ   . PHE A 1 26 ? 4.104   -1.000  6.634   1.00 0.00 ? 26 PHE A CZ   5  
ATOM 4853  H H    . PHE A 1 26 ? -2.668  -0.725  6.342   1.00 0.00 ? 26 PHE A H    5  
ATOM 4854  H HA   . PHE A 1 26 ? -0.647  -2.543  6.624   1.00 0.00 ? 26 PHE A HA   5  
ATOM 4855  H HB2  . PHE A 1 26 ? -0.433  -0.354  5.479   1.00 0.00 ? 26 PHE A HB2  5  
ATOM 4856  H HB3  . PHE A 1 26 ? -0.380  0.441   7.049   1.00 0.00 ? 26 PHE A HB3  5  
ATOM 4857  H HD1  . PHE A 1 26 ? 1.312   -2.500  5.485   1.00 0.00 ? 26 PHE A HD1  5  
ATOM 4858  H HD2  . PHE A 1 26 ? 1.710   1.152   7.635   1.00 0.00 ? 26 PHE A HD2  5  
ATOM 4859  H HE1  . PHE A 1 26 ? 3.752   -2.810  5.553   1.00 0.00 ? 26 PHE A HE1  5  
ATOM 4860  H HE2  . PHE A 1 26 ? 4.151   0.848   7.705   1.00 0.00 ? 26 PHE A HE2  5  
ATOM 4861  H HZ   . PHE A 1 26 ? 5.175   -1.134  6.663   1.00 0.00 ? 26 PHE A HZ   5  
ATOM 4862  N N    . GLN A 1 27 ? -1.130  -0.868  9.422   1.00 0.00 ? 27 GLN A N    5  
ATOM 4863  C CA   . GLN A 1 27 ? -0.879  -0.884  10.858  1.00 0.00 ? 27 GLN A CA   5  
ATOM 4864  C C    . GLN A 1 27 ? -1.453  -2.144  11.497  1.00 0.00 ? 27 GLN A C    5  
ATOM 4865  O O    . GLN A 1 27 ? -0.842  -2.735  12.388  1.00 0.00 ? 27 GLN A O    5  
ATOM 4866  C CB   . GLN A 1 27 ? -1.484  0.357   11.517  1.00 0.00 ? 27 GLN A CB   5  
ATOM 4867  C CG   . GLN A 1 27 ? -2.968  0.532   11.237  1.00 0.00 ? 27 GLN A CG   5  
ATOM 4868  C CD   . GLN A 1 27 ? -3.583  1.663   12.036  1.00 0.00 ? 27 GLN A CD   5  
ATOM 4869  O OE1  . GLN A 1 27 ? -2.980  2.170   12.982  1.00 0.00 ? 27 GLN A OE1  5  
ATOM 4870  N NE2  . GLN A 1 27 ? -4.791  2.067   11.658  1.00 0.00 ? 27 GLN A NE2  5  
ATOM 4871  H H    . GLN A 1 27 ? -1.721  -0.183  9.047   1.00 0.00 ? 27 GLN A H    5  
ATOM 4872  H HA   . GLN A 1 27 ? 0.190   -0.874  11.008  1.00 0.00 ? 27 GLN A HA   5  
ATOM 4873  H HB2  . GLN A 1 27 ? -1.347  0.286   12.585  1.00 0.00 ? 27 GLN A HB2  5  
ATOM 4874  H HB3  . GLN A 1 27 ? -0.966  1.232   11.152  1.00 0.00 ? 27 GLN A HB3  5  
ATOM 4875  H HG2  . GLN A 1 27 ? -3.101  0.740   10.186  1.00 0.00 ? 27 GLN A HG2  5  
ATOM 4876  H HG3  . GLN A 1 27 ? -3.479  -0.386  11.488  1.00 0.00 ? 27 GLN A HG3  5  
ATOM 4877  H HE21 . GLN A 1 27 ? -5.212  1.616   10.896  1.00 0.00 ? 27 GLN A HE21 5  
ATOM 4878  H HE22 . GLN A 1 27 ? -5.212  2.796   12.157  1.00 0.00 ? 27 GLN A HE22 5  
ATOM 4879  N N    . LYS A 1 28 ? -2.631  -2.552  11.037  1.00 0.00 ? 28 LYS A N    5  
ATOM 4880  C CA   . LYS A 1 28 ? -3.288  -3.743  11.562  1.00 0.00 ? 28 LYS A CA   5  
ATOM 4881  C C    . LYS A 1 28 ? -2.394  -4.969  11.408  1.00 0.00 ? 28 LYS A C    5  
ATOM 4882  O O    . LYS A 1 28 ? -2.149  -5.697  12.372  1.00 0.00 ? 28 LYS A O    5  
ATOM 4883  C CB   . LYS A 1 28 ? -4.619  -3.975  10.843  1.00 0.00 ? 28 LYS A CB   5  
ATOM 4884  C CG   . LYS A 1 28 ? -5.752  -3.111  11.369  1.00 0.00 ? 28 LYS A CG   5  
ATOM 4885  C CD   . LYS A 1 28 ? -6.552  -3.832  12.441  1.00 0.00 ? 28 LYS A CD   5  
ATOM 4886  C CE   . LYS A 1 28 ? -6.066  -3.469  13.836  1.00 0.00 ? 28 LYS A CE   5  
ATOM 4887  N NZ   . LYS A 1 28 ? -6.247  -4.594  14.796  1.00 0.00 ? 28 LYS A NZ   5  
ATOM 4888  H H    . LYS A 1 28 ? -3.068  -2.039  10.325  1.00 0.00 ? 28 LYS A H    5  
ATOM 4889  H HA   . LYS A 1 28 ? -3.479  -3.580  12.612  1.00 0.00 ? 28 LYS A HA   5  
ATOM 4890  H HB2  . LYS A 1 28 ? -4.489  -3.762  9.792   1.00 0.00 ? 28 LYS A HB2  5  
ATOM 4891  H HB3  . LYS A 1 28 ? -4.901  -5.011  10.959  1.00 0.00 ? 28 LYS A HB3  5  
ATOM 4892  H HG2  . LYS A 1 28 ? -5.339  -2.207  11.790  1.00 0.00 ? 28 LYS A HG2  5  
ATOM 4893  H HG3  . LYS A 1 28 ? -6.411  -2.860  10.549  1.00 0.00 ? 28 LYS A HG3  5  
ATOM 4894  H HD2  . LYS A 1 28 ? -7.591  -3.554  12.351  1.00 0.00 ? 28 LYS A HD2  5  
ATOM 4895  H HD3  . LYS A 1 28 ? -6.448  -4.898  12.299  1.00 0.00 ? 28 LYS A HD3  5  
ATOM 4896  H HE2  . LYS A 1 28 ? -5.018  -3.217  13.784  1.00 0.00 ? 28 LYS A HE2  5  
ATOM 4897  H HE3  . LYS A 1 28 ? -6.625  -2.614  14.187  1.00 0.00 ? 28 LYS A HE3  5  
ATOM 4898  H HZ1  . LYS A 1 28 ? -6.869  -4.301  15.576  1.00 0.00 ? 28 LYS A HZ1  5  
ATOM 4899  H HZ2  . LYS A 1 28 ? -5.327  -4.878  15.190  1.00 0.00 ? 28 LYS A HZ2  5  
ATOM 4900  H HZ3  . LYS A 1 28 ? -6.673  -5.410  14.314  1.00 0.00 ? 28 LYS A HZ3  5  
ATOM 4901  N N    . THR A 1 29 ? -1.909  -5.194  10.191  1.00 0.00 ? 29 THR A N    5  
ATOM 4902  C CA   . THR A 1 29 ? -1.043  -6.332  9.912   1.00 0.00 ? 29 THR A CA   5  
ATOM 4903  C C    . THR A 1 29 ? -0.153  -6.063  8.704   1.00 0.00 ? 29 THR A C    5  
ATOM 4904  O O    . THR A 1 29 ? -0.609  -5.529  7.693   1.00 0.00 ? 29 THR A O    5  
ATOM 4905  C CB   . THR A 1 29 ? -1.861  -7.612  9.657   1.00 0.00 ? 29 THR A CB   5  
ATOM 4906  O OG1  . THR A 1 29 ? -1.031  -8.613  9.058   1.00 0.00 ? 29 THR A OG1  5  
ATOM 4907  C CG2  . THR A 1 29 ? -3.049  -7.323  8.752   1.00 0.00 ? 29 THR A CG2  5  
ATOM 4908  H H    . THR A 1 29 ? -2.141  -4.579  9.464   1.00 0.00 ? 29 THR A H    5  
ATOM 4909  H HA   . THR A 1 29 ? -0.417  -6.496  10.778  1.00 0.00 ? 29 THR A HA   5  
ATOM 4910  H HB   . THR A 1 29 ? -2.230  -7.980  10.604  1.00 0.00 ? 29 THR A HB   5  
ATOM 4911  H HG1  . THR A 1 29 ? -0.202  -8.672  9.540   1.00 0.00 ? 29 THR A HG1  5  
ATOM 4912  H HG21 . THR A 1 29 ? -3.619  -8.229  8.606   1.00 0.00 ? 29 THR A HG21 5  
ATOM 4913  H HG22 . THR A 1 29 ? -2.695  -6.963  7.798   1.00 0.00 ? 29 THR A HG22 5  
ATOM 4914  H HG23 . THR A 1 29 ? -3.676  -6.574  9.210   1.00 0.00 ? 29 THR A HG23 5  
ATOM 4915  N N    . GLN A 1 30 ? 1.118   -6.436  8.815   1.00 0.00 ? 30 GLN A N    5  
ATOM 4916  C CA   . GLN A 1 30 ? 2.071   -6.234  7.730   1.00 0.00 ? 30 GLN A CA   5  
ATOM 4917  C C    . GLN A 1 30 ? 1.715   -7.098  6.525   1.00 0.00 ? 30 GLN A C    5  
ATOM 4918  O O    . GLN A 1 30 ? 1.960   -6.716  5.380   1.00 0.00 ? 30 GLN A O    5  
ATOM 4919  C CB   . GLN A 1 30 ? 3.489   -6.557  8.202   1.00 0.00 ? 30 GLN A CB   5  
ATOM 4920  C CG   . GLN A 1 30 ? 4.081   -5.497  9.118   1.00 0.00 ? 30 GLN A CG   5  
ATOM 4921  C CD   . GLN A 1 30 ? 5.332   -5.975  9.831   1.00 0.00 ? 30 GLN A CD   5  
ATOM 4922  O OE1  . GLN A 1 30 ? 6.054   -6.838  9.331   1.00 0.00 ? 30 GLN A OE1  5  
ATOM 4923  N NE2  . GLN A 1 30 ? 5.594   -5.414  11.005  1.00 0.00 ? 30 GLN A NE2  5  
ATOM 4924  H H    . GLN A 1 30 ? 1.421   -6.857  9.646   1.00 0.00 ? 30 GLN A H    5  
ATOM 4925  H HA   . GLN A 1 30 ? 2.026   -5.196  7.439   1.00 0.00 ? 30 GLN A HA   5  
ATOM 4926  H HB2  . GLN A 1 30 ? 3.474   -7.495  8.736   1.00 0.00 ? 30 GLN A HB2  5  
ATOM 4927  H HB3  . GLN A 1 30 ? 4.130   -6.653  7.338   1.00 0.00 ? 30 GLN A HB3  5  
ATOM 4928  H HG2  . GLN A 1 30 ? 4.332   -4.629  8.528   1.00 0.00 ? 30 GLN A HG2  5  
ATOM 4929  H HG3  . GLN A 1 30 ? 3.343   -5.227  9.859   1.00 0.00 ? 30 GLN A HG3  5  
ATOM 4930  H HE21 . GLN A 1 30 ? 4.974   -4.734  11.342  1.00 0.00 ? 30 GLN A HE21 5  
ATOM 4931  H HE22 . GLN A 1 30 ? 6.395   -5.704  11.488  1.00 0.00 ? 30 GLN A HE22 5  
ATOM 4932  N N    . TYR A 1 31 ? 1.135   -8.263  6.789   1.00 0.00 ? 31 TYR A N    5  
ATOM 4933  C CA   . TYR A 1 31 ? 0.748   -9.183  5.726   1.00 0.00 ? 31 TYR A CA   5  
ATOM 4934  C C    . TYR A 1 31 ? -0.770  -9.320  5.650   1.00 0.00 ? 31 TYR A C    5  
ATOM 4935  O O    . TYR A 1 31 ? -1.470  -9.170  6.653   1.00 0.00 ? 31 TYR A O    5  
ATOM 4936  C CB   . TYR A 1 31 ? 1.384   -10.555 5.953   1.00 0.00 ? 31 TYR A CB   5  
ATOM 4937  C CG   . TYR A 1 31 ? 2.813   -10.647 5.469   1.00 0.00 ? 31 TYR A CG   5  
ATOM 4938  C CD1  . TYR A 1 31 ? 3.768   -9.726  5.882   1.00 0.00 ? 31 TYR A CD1  5  
ATOM 4939  C CD2  . TYR A 1 31 ? 3.210   -11.656 4.600   1.00 0.00 ? 31 TYR A CD2  5  
ATOM 4940  C CE1  . TYR A 1 31 ? 5.075   -9.806  5.442   1.00 0.00 ? 31 TYR A CE1  5  
ATOM 4941  C CE2  . TYR A 1 31 ? 4.515   -11.745 4.156   1.00 0.00 ? 31 TYR A CE2  5  
ATOM 4942  C CZ   . TYR A 1 31 ? 5.444   -10.817 4.579   1.00 0.00 ? 31 TYR A CZ   5  
ATOM 4943  O OH   . TYR A 1 31 ? 6.745   -10.901 4.140   1.00 0.00 ? 31 TYR A OH   5  
ATOM 4944  H H    . TYR A 1 31 ? 0.965   -8.512  7.721   1.00 0.00 ? 31 TYR A H    5  
ATOM 4945  H HA   . TYR A 1 31 ? 1.109   -8.780  4.791   1.00 0.00 ? 31 TYR A HA   5  
ATOM 4946  H HB2  . TYR A 1 31 ? 1.377   -10.777 7.009   1.00 0.00 ? 31 TYR A HB2  5  
ATOM 4947  H HB3  . TYR A 1 31 ? 0.807   -11.303 5.428   1.00 0.00 ? 31 TYR A HB3  5  
ATOM 4948  H HD1  . TYR A 1 31 ? 3.476   -8.935  6.558   1.00 0.00 ? 31 TYR A HD1  5  
ATOM 4949  H HD2  . TYR A 1 31 ? 2.480   -12.382 4.270   1.00 0.00 ? 31 TYR A HD2  5  
ATOM 4950  H HE1  . TYR A 1 31 ? 5.803   -9.080  5.774   1.00 0.00 ? 31 TYR A HE1  5  
ATOM 4951  H HE2  . TYR A 1 31 ? 4.804   -12.537 3.480   1.00 0.00 ? 31 TYR A HE2  5  
ATOM 4952  H HH   . TYR A 1 31 ? 7.213   -11.565 4.652   1.00 0.00 ? 31 TYR A HH   5  
ATOM 4953  N N    . LEU A 1 32 ? -1.272  -9.605  4.454   1.00 0.00 ? 32 LEU A N    5  
ATOM 4954  C CA   . LEU A 1 32 ? -2.707  -9.764  4.245   1.00 0.00 ? 32 LEU A CA   5  
ATOM 4955  C C    . LEU A 1 32 ? -3.018  -11.109 3.596   1.00 0.00 ? 32 LEU A C    5  
ATOM 4956  O O    . LEU A 1 32 ? -2.298  -11.561 2.706   1.00 0.00 ? 32 LEU A O    5  
ATOM 4957  C CB   . LEU A 1 32 ? -3.244  -8.627  3.372   1.00 0.00 ? 32 LEU A CB   5  
ATOM 4958  C CG   . LEU A 1 32 ? -3.585  -7.326  4.100   1.00 0.00 ? 32 LEU A CG   5  
ATOM 4959  C CD1  . LEU A 1 32 ? -4.261  -6.347  3.153   1.00 0.00 ? 32 LEU A CD1  5  
ATOM 4960  C CD2  . LEU A 1 32 ? -4.473  -7.606  5.304   1.00 0.00 ? 32 LEU A CD2  5  
ATOM 4961  H H    . LEU A 1 32 ? -0.665  -9.712  3.693   1.00 0.00 ? 32 LEU A H    5  
ATOM 4962  H HA   . LEU A 1 32 ? -3.189  -9.724  5.210   1.00 0.00 ? 32 LEU A HA   5  
ATOM 4963  H HB2  . LEU A 1 32 ? -2.498  -8.403  2.626   1.00 0.00 ? 32 LEU A HB2  5  
ATOM 4964  H HB3  . LEU A 1 32 ? -4.142  -8.981  2.886   1.00 0.00 ? 32 LEU A HB3  5  
ATOM 4965  H HG   . LEU A 1 32 ? -2.672  -6.870  4.455   1.00 0.00 ? 32 LEU A HG   5  
ATOM 4966  H HD11 . LEU A 1 32 ? -5.085  -5.868  3.658   1.00 0.00 ? 32 LEU A HD11 5  
ATOM 4967  H HD12 . LEU A 1 32 ? -4.629  -6.878  2.288   1.00 0.00 ? 32 LEU A HD12 5  
ATOM 4968  H HD13 . LEU A 1 32 ? -3.547  -5.599  2.839   1.00 0.00 ? 32 LEU A HD13 5  
ATOM 4969  H HD21 . LEU A 1 32 ? -5.049  -8.502  5.126   1.00 0.00 ? 32 LEU A HD21 5  
ATOM 4970  H HD22 . LEU A 1 32 ? -5.144  -6.772  5.457   1.00 0.00 ? 32 LEU A HD22 5  
ATOM 4971  H HD23 . LEU A 1 32 ? -3.858  -7.741  6.181   1.00 0.00 ? 32 LEU A HD23 5  
ATOM 4972  N N    . ALA A 1 33 ? -4.096  -11.742 4.046   1.00 0.00 ? 33 ALA A N    5  
ATOM 4973  C CA   . ALA A 1 33 ? -4.505  -13.033 3.506   1.00 0.00 ? 33 ALA A CA   5  
ATOM 4974  C C    . ALA A 1 33 ? -4.985  -12.898 2.066   1.00 0.00 ? 33 ALA A C    5  
ATOM 4975  O O    . ALA A 1 33 ? -5.083  -11.792 1.534   1.00 0.00 ? 33 ALA A O    5  
ATOM 4976  C CB   . ALA A 1 33 ? -5.594  -13.647 4.373   1.00 0.00 ? 33 ALA A CB   5  
ATOM 4977  H H    . ALA A 1 33 ? -4.630  -11.331 4.757   1.00 0.00 ? 33 ALA A H    5  
ATOM 4978  H HA   . ALA A 1 33 ? -3.647  -13.691 3.529   1.00 0.00 ? 33 ALA A HA   5  
ATOM 4979  H HB1  . ALA A 1 33 ? -5.598  -13.164 5.340   1.00 0.00 ? 33 ALA A HB1  5  
ATOM 4980  H HB2  . ALA A 1 33 ? -6.553  -13.509 3.897   1.00 0.00 ? 33 ALA A HB2  5  
ATOM 4981  H HB3  . ALA A 1 33 ? -5.402  -14.702 4.499   1.00 0.00 ? 33 ALA A HB3  5  
ATOM 4982  N N    . LEU A 1 34 ? -5.284  -14.031 1.438   1.00 0.00 ? 34 LEU A N    5  
ATOM 4983  C CA   . LEU A 1 34 ? -5.755  -14.039 0.058   1.00 0.00 ? 34 LEU A CA   5  
ATOM 4984  C C    . LEU A 1 34 ? -6.989  -13.157 -0.103  1.00 0.00 ? 34 LEU A C    5  
ATOM 4985  O O    . LEU A 1 34 ? -6.995  -12.187 -0.861  1.00 0.00 ? 34 LEU A O    5  
ATOM 4986  C CB   . LEU A 1 34 ? -6.074  -15.469 -0.384  1.00 0.00 ? 34 LEU A CB   5  
ATOM 4987  C CG   . LEU A 1 34 ? -7.229  -15.622 -1.375  1.00 0.00 ? 34 LEU A CG   5  
ATOM 4988  C CD1  . LEU A 1 34 ? -6.831  -15.092 -2.744  1.00 0.00 ? 34 LEU A CD1  5  
ATOM 4989  C CD2  . LEU A 1 34 ? -7.659  -17.079 -1.470  1.00 0.00 ? 34 LEU A CD2  5  
ATOM 4990  H H    . LEU A 1 34 ? -5.186  -14.881 1.914   1.00 0.00 ? 34 LEU A H    5  
ATOM 4991  H HA   . LEU A 1 34 ? -4.964  -13.647 -0.564  1.00 0.00 ? 34 LEU A HA   5  
ATOM 4992  H HB2  . LEU A 1 34 ? -5.188  -15.879 -0.843  1.00 0.00 ? 34 LEU A HB2  5  
ATOM 4993  H HB3  . LEU A 1 34 ? -6.318  -16.040 0.500   1.00 0.00 ? 34 LEU A HB3  5  
ATOM 4994  H HG   . LEU A 1 34 ? -8.074  -15.045 -1.027  1.00 0.00 ? 34 LEU A HG   5  
ATOM 4995  H HD11 . LEU A 1 34 ? -6.789  -14.014 -2.714  1.00 0.00 ? 34 LEU A HD11 5  
ATOM 4996  H HD12 . LEU A 1 34 ? -7.561  -15.403 -3.476  1.00 0.00 ? 34 LEU A HD12 5  
ATOM 4997  H HD13 . LEU A 1 34 ? -5.861  -15.483 -3.014  1.00 0.00 ? 34 LEU A HD13 5  
ATOM 4998  H HD21 . LEU A 1 34 ? -8.402  -17.284 -0.714  1.00 0.00 ? 34 LEU A HD21 5  
ATOM 4999  H HD22 . LEU A 1 34 ? -6.802  -17.718 -1.316  1.00 0.00 ? 34 LEU A HD22 5  
ATOM 5000  H HD23 . LEU A 1 34 ? -8.079  -17.267 -2.447  1.00 0.00 ? 34 LEU A HD23 5  
ATOM 5001  N N    . PRO A 1 35 ? -8.060  -13.499 0.630   1.00 0.00 ? 35 PRO A N    5  
ATOM 5002  C CA   . PRO A 1 35 ? -9.318  -12.749 0.588   1.00 0.00 ? 35 PRO A CA   5  
ATOM 5003  C C    . PRO A 1 35 ? -9.195  -11.372 1.232   1.00 0.00 ? 35 PRO A C    5  
ATOM 5004  O O    . PRO A 1 35 ? -9.945  -10.454 0.903   1.00 0.00 ? 35 PRO A O    5  
ATOM 5005  C CB   . PRO A 1 35 ? -10.282 -13.629 1.388   1.00 0.00 ? 35 PRO A CB   5  
ATOM 5006  C CG   . PRO A 1 35 ? -9.407  -14.413 2.304   1.00 0.00 ? 35 PRO A CG   5  
ATOM 5007  C CD   . PRO A 1 35 ? -8.123  -14.642 1.555   1.00 0.00 ? 35 PRO A CD   5  
ATOM 5008  H HA   . PRO A 1 35 ? -9.683  -12.641 -0.423  1.00 0.00 ? 35 PRO A HA   5  
ATOM 5009  H HB2  . PRO A 1 35 ? -10.972 -13.004 1.938   1.00 0.00 ? 35 PRO A HB2  5  
ATOM 5010  H HB3  . PRO A 1 35 ? -10.829 -14.274 0.717   1.00 0.00 ? 35 PRO A HB3  5  
ATOM 5011  H HG2  . PRO A 1 35 ? -9.219  -13.849 3.205   1.00 0.00 ? 35 PRO A HG2  5  
ATOM 5012  H HG3  . PRO A 1 35 ? -9.876  -15.357 2.541   1.00 0.00 ? 35 PRO A HG3  5  
ATOM 5013  H HD2  . PRO A 1 35 ? -7.284  -14.637 2.234   1.00 0.00 ? 35 PRO A HD2  5  
ATOM 5014  H HD3  . PRO A 1 35 ? -8.165  -15.575 1.011   1.00 0.00 ? 35 PRO A HD3  5  
ATOM 5015  N N    . GLU A 1 36 ? -8.244  -11.237 2.151   1.00 0.00 ? 36 GLU A N    5  
ATOM 5016  C CA   . GLU A 1 36 ? -8.023  -9.971  2.840   1.00 0.00 ? 36 GLU A CA   5  
ATOM 5017  C C    . GLU A 1 36 ? -7.453  -8.924  1.887   1.00 0.00 ? 36 GLU A C    5  
ATOM 5018  O O    . GLU A 1 36 ? -7.871  -7.766  1.898   1.00 0.00 ? 36 GLU A O    5  
ATOM 5019  C CB   . GLU A 1 36 ? -7.075  -10.168 4.025   1.00 0.00 ? 36 GLU A CB   5  
ATOM 5020  C CG   . GLU A 1 36 ? -7.691  -10.951 5.173   1.00 0.00 ? 36 GLU A CG   5  
ATOM 5021  C CD   . GLU A 1 36 ? -8.847  -10.218 5.825   1.00 0.00 ? 36 GLU A CD   5  
ATOM 5022  O OE1  . GLU A 1 36 ? -8.827  -8.969  5.838   1.00 0.00 ? 36 GLU A OE1  5  
ATOM 5023  O OE2  . GLU A 1 36 ? -9.773  -10.893 6.321   1.00 0.00 ? 36 GLU A OE2  5  
ATOM 5024  H H    . GLU A 1 36 ? -7.677  -12.006 2.370   1.00 0.00 ? 36 GLU A H    5  
ATOM 5025  H HA   . GLU A 1 36 ? -8.977  -9.623  3.208   1.00 0.00 ? 36 GLU A HA   5  
ATOM 5026  H HB2  . GLU A 1 36 ? -6.198  -10.698 3.684   1.00 0.00 ? 36 GLU A HB2  5  
ATOM 5027  H HB3  . GLU A 1 36 ? -6.777  -9.199  4.397   1.00 0.00 ? 36 GLU A HB3  5  
ATOM 5028  H HG2  . GLU A 1 36 ? -8.051  -11.896 4.796   1.00 0.00 ? 36 GLU A HG2  5  
ATOM 5029  H HG3  . GLU A 1 36 ? -6.930  -11.129 5.919   1.00 0.00 ? 36 GLU A HG3  5  
ATOM 5030  N N    . ARG A 1 37 ? -6.495  -9.341  1.065   1.00 0.00 ? 37 ARG A N    5  
ATOM 5031  C CA   . ARG A 1 37 ? -5.866  -8.440  0.107   1.00 0.00 ? 37 ARG A CA   5  
ATOM 5032  C C    . ARG A 1 37 ? -6.855  -8.020  -0.976  1.00 0.00 ? 37 ARG A C    5  
ATOM 5033  O O    . ARG A 1 37 ? -6.880  -6.863  -1.393  1.00 0.00 ? 37 ARG A O    5  
ATOM 5034  C CB   . ARG A 1 37 ? -4.648  -9.110  -0.531  1.00 0.00 ? 37 ARG A CB   5  
ATOM 5035  C CG   . ARG A 1 37 ? -3.887  -8.206  -1.487  1.00 0.00 ? 37 ARG A CG   5  
ATOM 5036  C CD   . ARG A 1 37 ? -2.410  -8.568  -1.539  1.00 0.00 ? 37 ARG A CD   5  
ATOM 5037  N NE   . ARG A 1 37 ? -1.820  -8.650  -0.206  1.00 0.00 ? 37 ARG A NE   5  
ATOM 5038  C CZ   . ARG A 1 37 ? -0.728  -9.354  0.073   1.00 0.00 ? 37 ARG A CZ   5  
ATOM 5039  N NH1  . ARG A 1 37 ? -0.111  -10.032 -0.885  1.00 0.00 ? 37 ARG A NH1  5  
ATOM 5040  N NH2  . ARG A 1 37 ? -0.252  -9.380  1.311   1.00 0.00 ? 37 ARG A NH2  5  
ATOM 5041  H H    . ARG A 1 37 ? -6.204  -10.276 1.104   1.00 0.00 ? 37 ARG A H    5  
ATOM 5042  H HA   . ARG A 1 37 ? -5.542  -7.560  0.643   1.00 0.00 ? 37 ARG A HA   5  
ATOM 5043  H HB2  . ARG A 1 37 ? -3.971  -9.421  0.251   1.00 0.00 ? 37 ARG A HB2  5  
ATOM 5044  H HB3  . ARG A 1 37 ? -4.977  -9.981  -1.078  1.00 0.00 ? 37 ARG A HB3  5  
ATOM 5045  H HG2  . ARG A 1 37 ? -4.306  -8.310  -2.477  1.00 0.00 ? 37 ARG A HG2  5  
ATOM 5046  H HG3  . ARG A 1 37 ? -3.987  -7.183  -1.157  1.00 0.00 ? 37 ARG A HG3  5  
ATOM 5047  H HD2  . ARG A 1 37 ? -2.304  -9.524  -2.029  1.00 0.00 ? 37 ARG A HD2  5  
ATOM 5048  H HD3  . ARG A 1 37 ? -1.889  -7.812  -2.108  1.00 0.00 ? 37 ARG A HD3  5  
ATOM 5049  H HE   . ARG A 1 37 ? -2.260  -8.156  0.517   1.00 0.00 ? 37 ARG A HE   5  
ATOM 5050  H HH11 . ARG A 1 37 ? -0.468  -10.014 -1.819  1.00 0.00 ? 37 ARG A HH11 5  
ATOM 5051  H HH12 . ARG A 1 37 ? 0.711   -10.561 -0.673  1.00 0.00 ? 37 ARG A HH12 5  
ATOM 5052  H HH21 . ARG A 1 37 ? -0.714  -8.869  2.035   1.00 0.00 ? 37 ARG A HH21 5  
ATOM 5053  H HH22 . ARG A 1 37 ? 0.570   -9.910  1.519   1.00 0.00 ? 37 ARG A HH22 5  
ATOM 5054  N N    . ALA A 1 38 ? -7.668  -8.970  -1.427  1.00 0.00 ? 38 ALA A N    5  
ATOM 5055  C CA   . ALA A 1 38 ? -8.660  -8.699  -2.460  1.00 0.00 ? 38 ALA A CA   5  
ATOM 5056  C C    . ALA A 1 38 ? -9.701  -7.697  -1.972  1.00 0.00 ? 38 ALA A C    5  
ATOM 5057  O O    . ALA A 1 38 ? -10.249 -6.925  -2.759  1.00 0.00 ? 38 ALA A O    5  
ATOM 5058  C CB   . ALA A 1 38 ? -9.333  -9.991  -2.898  1.00 0.00 ? 38 ALA A CB   5  
ATOM 5059  H H    . ALA A 1 38 ? -7.600  -9.874  -1.055  1.00 0.00 ? 38 ALA A H    5  
ATOM 5060  H HA   . ALA A 1 38 ? -8.147  -8.282  -3.315  1.00 0.00 ? 38 ALA A HA   5  
ATOM 5061  H HB1  . ALA A 1 38 ? -10.401 -9.838  -2.957  1.00 0.00 ? 38 ALA A HB1  5  
ATOM 5062  H HB2  . ALA A 1 38 ? -8.956  -10.282 -3.867  1.00 0.00 ? 38 ALA A HB2  5  
ATOM 5063  H HB3  . ALA A 1 38 ? -9.120  -10.768 -2.180  1.00 0.00 ? 38 ALA A HB3  5  
ATOM 5064  N N    . GLU A 1 39 ? -9.970  -7.716  -0.670  1.00 0.00 ? 39 GLU A N    5  
ATOM 5065  C CA   . GLU A 1 39 ? -10.947 -6.809  -0.079  1.00 0.00 ? 39 GLU A CA   5  
ATOM 5066  C C    . GLU A 1 39 ? -10.579 -5.355  -0.359  1.00 0.00 ? 39 GLU A C    5  
ATOM 5067  O O    . GLU A 1 39 ? -11.431 -4.548  -0.733  1.00 0.00 ? 39 GLU A O    5  
ATOM 5068  C CB   . GLU A 1 39 ? -11.043 -7.041  1.430   1.00 0.00 ? 39 GLU A CB   5  
ATOM 5069  C CG   . GLU A 1 39 ? -12.221 -6.335  2.081   1.00 0.00 ? 39 GLU A CG   5  
ATOM 5070  C CD   . GLU A 1 39 ? -12.066 -6.206  3.583   1.00 0.00 ? 39 GLU A CD   5  
ATOM 5071  O OE1  . GLU A 1 39 ? -12.394 -7.175  4.300   1.00 0.00 ? 39 GLU A OE1  5  
ATOM 5072  O OE2  . GLU A 1 39 ? -11.616 -5.135  4.043   1.00 0.00 ? 39 GLU A OE2  5  
ATOM 5073  H H    . GLU A 1 39 ? -9.500  -8.355  -0.094  1.00 0.00 ? 39 GLU A H    5  
ATOM 5074  H HA   . GLU A 1 39 ? -11.906 -7.018  -0.528  1.00 0.00 ? 39 GLU A HA   5  
ATOM 5075  H HB2  . GLU A 1 39 ? -11.139 -8.101  1.614   1.00 0.00 ? 39 GLU A HB2  5  
ATOM 5076  H HB3  . GLU A 1 39 ? -10.135 -6.685  1.895   1.00 0.00 ? 39 GLU A HB3  5  
ATOM 5077  H HG2  . GLU A 1 39 ? -12.309 -5.346  1.657   1.00 0.00 ? 39 GLU A HG2  5  
ATOM 5078  H HG3  . GLU A 1 39 ? -13.120 -6.896  1.873   1.00 0.00 ? 39 GLU A HG3  5  
ATOM 5079  N N    . LEU A 1 40 ? -9.305  -5.028  -0.175  1.00 0.00 ? 40 LEU A N    5  
ATOM 5080  C CA   . LEU A 1 40 ? -8.822  -3.671  -0.407  1.00 0.00 ? 40 LEU A CA   5  
ATOM 5081  C C    . LEU A 1 40 ? -8.972  -3.283  -1.874  1.00 0.00 ? 40 LEU A C    5  
ATOM 5082  O O    . LEU A 1 40 ? -9.260  -2.130  -2.195  1.00 0.00 ? 40 LEU A O    5  
ATOM 5083  C CB   . LEU A 1 40 ? -7.357  -3.550  0.018   1.00 0.00 ? 40 LEU A CB   5  
ATOM 5084  C CG   . LEU A 1 40 ? -7.009  -4.115  1.395   1.00 0.00 ? 40 LEU A CG   5  
ATOM 5085  C CD1  . LEU A 1 40 ? -5.609  -3.688  1.809   1.00 0.00 ? 40 LEU A CD1  5  
ATOM 5086  C CD2  . LEU A 1 40 ? -8.032  -3.668  2.430   1.00 0.00 ? 40 LEU A CD2  5  
ATOM 5087  H H    . LEU A 1 40 ? -8.672  -5.714  0.124   1.00 0.00 ? 40 LEU A H    5  
ATOM 5088  H HA   . LEU A 1 40 ? -9.419  -3.000  0.193   1.00 0.00 ? 40 LEU A HA   5  
ATOM 5089  H HB2  . LEU A 1 40 ? -6.757  -4.069  -0.713  1.00 0.00 ? 40 LEU A HB2  5  
ATOM 5090  H HB3  . LEU A 1 40 ? -7.099  -2.500  0.015   1.00 0.00 ? 40 LEU A HB3  5  
ATOM 5091  H HG   . LEU A 1 40 ? -7.028  -5.195  1.350   1.00 0.00 ? 40 LEU A HG   5  
ATOM 5092  H HD11 . LEU A 1 40 ? -5.530  -3.708  2.885   1.00 0.00 ? 40 LEU A HD11 5  
ATOM 5093  H HD12 . LEU A 1 40 ? -5.418  -2.687  1.452   1.00 0.00 ? 40 LEU A HD12 5  
ATOM 5094  H HD13 . LEU A 1 40 ? -4.885  -4.367  1.382   1.00 0.00 ? 40 LEU A HD13 5  
ATOM 5095  H HD21 . LEU A 1 40 ? -8.621  -2.858  2.025   1.00 0.00 ? 40 LEU A HD21 5  
ATOM 5096  H HD22 . LEU A 1 40 ? -7.520  -3.331  3.320   1.00 0.00 ? 40 LEU A HD22 5  
ATOM 5097  H HD23 . LEU A 1 40 ? -8.679  -4.496  2.677   1.00 0.00 ? 40 LEU A HD23 5  
ATOM 5098  N N    . ALA A 1 41 ? -8.776  -4.253  -2.760  1.00 0.00 ? 41 ALA A N    5  
ATOM 5099  C CA   . ALA A 1 41 ? -8.893  -4.014  -4.194  1.00 0.00 ? 41 ALA A CA   5  
ATOM 5100  C C    . ALA A 1 41 ? -10.352 -3.841  -4.604  1.00 0.00 ? 41 ALA A C    5  
ATOM 5101  O O    . ALA A 1 41 ? -10.655 -3.148  -5.574  1.00 0.00 ? 41 ALA A O    5  
ATOM 5102  C CB   . ALA A 1 41 ? -8.256  -5.155  -4.973  1.00 0.00 ? 41 ALA A CB   5  
ATOM 5103  H H    . ALA A 1 41 ? -8.549  -5.152  -2.443  1.00 0.00 ? 41 ALA A H    5  
ATOM 5104  H HA   . ALA A 1 41 ? -8.354  -3.107  -4.426  1.00 0.00 ? 41 ALA A HA   5  
ATOM 5105  H HB1  . ALA A 1 41 ? -8.893  -5.423  -5.804  1.00 0.00 ? 41 ALA A HB1  5  
ATOM 5106  H HB2  . ALA A 1 41 ? -7.291  -4.843  -5.344  1.00 0.00 ? 41 ALA A HB2  5  
ATOM 5107  H HB3  . ALA A 1 41 ? -8.133  -6.009  -4.324  1.00 0.00 ? 41 ALA A HB3  5  
ATOM 5108  N N    . ALA A 1 42 ? -11.251 -4.475  -3.858  1.00 0.00 ? 42 ALA A N    5  
ATOM 5109  C CA   . ALA A 1 42 ? -12.677 -4.390  -4.144  1.00 0.00 ? 42 ALA A CA   5  
ATOM 5110  C C    . ALA A 1 42 ? -13.280 -3.119  -3.554  1.00 0.00 ? 42 ALA A C    5  
ATOM 5111  O O    . ALA A 1 42 ? -14.059 -2.428  -4.211  1.00 0.00 ? 42 ALA A O    5  
ATOM 5112  C CB   . ALA A 1 42 ? -13.398 -5.617  -3.605  1.00 0.00 ? 42 ALA A CB   5  
ATOM 5113  H H    . ALA A 1 42 ? -10.947 -5.012  -3.097  1.00 0.00 ? 42 ALA A H    5  
ATOM 5114  H HA   . ALA A 1 42 ? -12.802 -4.371  -5.217  1.00 0.00 ? 42 ALA A HA   5  
ATOM 5115  H HB1  . ALA A 1 42 ? -14.036 -6.026  -4.376  1.00 0.00 ? 42 ALA A HB1  5  
ATOM 5116  H HB2  . ALA A 1 42 ? -12.672 -6.358  -3.307  1.00 0.00 ? 42 ALA A HB2  5  
ATOM 5117  H HB3  . ALA A 1 42 ? -13.998 -5.336  -2.752  1.00 0.00 ? 42 ALA A HB3  5  
ATOM 5118  N N    . SER A 1 43 ? -12.914 -2.817  -2.313  1.00 0.00 ? 43 SER A N    5  
ATOM 5119  C CA   . SER A 1 43 ? -13.423 -1.631  -1.633  1.00 0.00 ? 43 SER A CA   5  
ATOM 5120  C C    . SER A 1 43 ? -12.795 -0.364  -2.208  1.00 0.00 ? 43 SER A C    5  
ATOM 5121  O O    . SER A 1 43 ? -13.496 0.534   -2.674  1.00 0.00 ? 43 SER A O    5  
ATOM 5122  C CB   . SER A 1 43 ? -13.141 -1.717  -0.132  1.00 0.00 ? 43 SER A CB   5  
ATOM 5123  O OG   . SER A 1 43 ? -13.822 -2.814  0.452   1.00 0.00 ? 43 SER A OG   5  
ATOM 5124  H H    . SER A 1 43 ? -12.289 -3.407  -1.842  1.00 0.00 ? 43 SER A H    5  
ATOM 5125  H HA   . SER A 1 43 ? -14.490 -1.592  -1.789  1.00 0.00 ? 43 SER A HA   5  
ATOM 5126  H HB2  . SER A 1 43 ? -12.081 -1.841  0.026   1.00 0.00 ? 43 SER A HB2  5  
ATOM 5127  H HB3  . SER A 1 43 ? -13.473 -0.807  0.346   1.00 0.00 ? 43 SER A HB3  5  
ATOM 5128  H HG   . SER A 1 43 ? -13.497 -2.955  1.344   1.00 0.00 ? 43 SER A HG   5  
ATOM 5129  N N    . LEU A 1 44 ? -11.468 -0.300  -2.171  1.00 0.00 ? 44 LEU A N    5  
ATOM 5130  C CA   . LEU A 1 44 ? -10.744 0.855   -2.688  1.00 0.00 ? 44 LEU A CA   5  
ATOM 5131  C C    . LEU A 1 44 ? -10.877 0.948   -4.205  1.00 0.00 ? 44 LEU A C    5  
ATOM 5132  O O    . LEU A 1 44 ? -10.545 1.969   -4.806  1.00 0.00 ? 44 LEU A O    5  
ATOM 5133  C CB   . LEU A 1 44 ? -9.266  0.771   -2.299  1.00 0.00 ? 44 LEU A CB   5  
ATOM 5134  C CG   . LEU A 1 44 ? -8.976  0.447   -0.833  1.00 0.00 ? 44 LEU A CG   5  
ATOM 5135  C CD1  . LEU A 1 44 ? -7.491  0.593   -0.539  1.00 0.00 ? 44 LEU A CD1  5  
ATOM 5136  C CD2  . LEU A 1 44 ? -9.794  1.344   0.084   1.00 0.00 ? 44 LEU A CD2  5  
ATOM 5137  H H    . LEU A 1 44 ? -10.964 -1.047  -1.788  1.00 0.00 ? 44 LEU A H    5  
ATOM 5138  H HA   . LEU A 1 44 ? -11.174 1.741   -2.246  1.00 0.00 ? 44 LEU A HA   5  
ATOM 5139  H HB2  . LEU A 1 44 ? -8.808  0.004   -2.904  1.00 0.00 ? 44 LEU A HB2  5  
ATOM 5140  H HB3  . LEU A 1 44 ? -8.811  1.725   -2.525  1.00 0.00 ? 44 LEU A HB3  5  
ATOM 5141  H HG   . LEU A 1 44 ? -9.256  -0.579  -0.636  1.00 0.00 ? 44 LEU A HG   5  
ATOM 5142  H HD11 . LEU A 1 44 ? -7.214  -0.081  0.258   1.00 0.00 ? 44 LEU A HD11 5  
ATOM 5143  H HD12 . LEU A 1 44 ? -7.281  1.609   -0.241  1.00 0.00 ? 44 LEU A HD12 5  
ATOM 5144  H HD13 . LEU A 1 44 ? -6.923  0.354   -1.426  1.00 0.00 ? 44 LEU A HD13 5  
ATOM 5145  H HD21 . LEU A 1 44 ? -9.785  0.938   1.085   1.00 0.00 ? 44 LEU A HD21 5  
ATOM 5146  H HD22 . LEU A 1 44 ? -10.812 1.394   -0.276  1.00 0.00 ? 44 LEU A HD22 5  
ATOM 5147  H HD23 . LEU A 1 44 ? -9.366  2.335   0.093   1.00 0.00 ? 44 LEU A HD23 5  
ATOM 5148  N N    . GLY A 1 45 ? -11.369 -0.124  -4.817  1.00 0.00 ? 45 GLY A N    5  
ATOM 5149  C CA   . GLY A 1 45 ? -11.540 -0.142  -6.258  1.00 0.00 ? 45 GLY A CA   5  
ATOM 5150  C C    . GLY A 1 45 ? -10.237 -0.378  -6.995  1.00 0.00 ? 45 GLY A C    5  
ATOM 5151  O O    . GLY A 1 45 ? -10.094 0.002   -8.157  1.00 0.00 ? 45 GLY A O    5  
ATOM 5152  H H    . GLY A 1 45 ? -11.617 -0.910  -4.287  1.00 0.00 ? 45 GLY A H    5  
ATOM 5153  H HA2  . GLY A 1 45 ? -12.236 -0.926  -6.518  1.00 0.00 ? 45 GLY A HA2  5  
ATOM 5154  H HA3  . GLY A 1 45 ? -11.950 0.807   -6.572  1.00 0.00 ? 45 GLY A HA3  5  
ATOM 5155  N N    . LEU A 1 46 ? -9.282  -1.006  -6.317  1.00 0.00 ? 46 LEU A N    5  
ATOM 5156  C CA   . LEU A 1 46 ? -7.982  -1.292  -6.913  1.00 0.00 ? 46 LEU A CA   5  
ATOM 5157  C C    . LEU A 1 46 ? -7.849  -2.774  -7.246  1.00 0.00 ? 46 LEU A C    5  
ATOM 5158  O O    . LEU A 1 46 ? -8.752  -3.566  -6.976  1.00 0.00 ? 46 LEU A O    5  
ATOM 5159  C CB   . LEU A 1 46 ? -6.859  -0.868  -5.964  1.00 0.00 ? 46 LEU A CB   5  
ATOM 5160  C CG   . LEU A 1 46 ? -6.926  0.568   -5.444  1.00 0.00 ? 46 LEU A CG   5  
ATOM 5161  C CD1  . LEU A 1 46 ? -6.300  0.665   -4.062  1.00 0.00 ? 46 LEU A CD1  5  
ATOM 5162  C CD2  . LEU A 1 46 ? -6.236  1.518   -6.412  1.00 0.00 ? 46 LEU A CD2  5  
ATOM 5163  H H    . LEU A 1 46 ? -9.455  -1.285  -5.394  1.00 0.00 ? 46 LEU A H    5  
ATOM 5164  H HA   . LEU A 1 46 ? -7.904  -0.721  -7.827  1.00 0.00 ? 46 LEU A HA   5  
ATOM 5165  H HB2  . LEU A 1 46 ? -6.880  -1.529  -5.111  1.00 0.00 ? 46 LEU A HB2  5  
ATOM 5166  H HB3  . LEU A 1 46 ? -5.921  -0.989  -6.488  1.00 0.00 ? 46 LEU A HB3  5  
ATOM 5167  H HG   . LEU A 1 46 ? -7.962  0.867   -5.363  1.00 0.00 ? 46 LEU A HG   5  
ATOM 5168  H HD11 . LEU A 1 46 ? -6.540  -0.221  -3.495  1.00 0.00 ? 46 LEU A HD11 5  
ATOM 5169  H HD12 . LEU A 1 46 ? -6.687  1.535   -3.552  1.00 0.00 ? 46 LEU A HD12 5  
ATOM 5170  H HD13 . LEU A 1 46 ? -5.227  0.753   -4.158  1.00 0.00 ? 46 LEU A HD13 5  
ATOM 5171  H HD21 . LEU A 1 46 ? -5.236  1.162   -6.614  1.00 0.00 ? 46 LEU A HD21 5  
ATOM 5172  H HD22 . LEU A 1 46 ? -6.184  2.504   -5.974  1.00 0.00 ? 46 LEU A HD22 5  
ATOM 5173  H HD23 . LEU A 1 46 ? -6.796  1.562   -7.334  1.00 0.00 ? 46 LEU A HD23 5  
ATOM 5174  N N    . THR A 1 47 ? -6.715  -3.145  -7.834  1.00 0.00 ? 47 THR A N    5  
ATOM 5175  C CA   . THR A 1 47 ? -6.463  -4.532  -8.203  1.00 0.00 ? 47 THR A CA   5  
ATOM 5176  C C    . THR A 1 47 ? -5.416  -5.161  -7.292  1.00 0.00 ? 47 THR A C    5  
ATOM 5177  O O    . THR A 1 47 ? -4.624  -4.459  -6.664  1.00 0.00 ? 47 THR A O    5  
ATOM 5178  C CB   . THR A 1 47 ? -5.992  -4.647  -9.665  1.00 0.00 ? 47 THR A CB   5  
ATOM 5179  O OG1  . THR A 1 47 ? -5.725  -6.017  -9.987  1.00 0.00 ? 47 THR A OG1  5  
ATOM 5180  C CG2  . THR A 1 47 ? -4.741  -3.813  -9.898  1.00 0.00 ? 47 THR A CG2  5  
ATOM 5181  H H    . THR A 1 47 ? -6.033  -2.467  -8.024  1.00 0.00 ? 47 THR A H    5  
ATOM 5182  H HA   . THR A 1 47 ? -7.390  -5.078  -8.101  1.00 0.00 ? 47 THR A HA   5  
ATOM 5183  H HB   . THR A 1 47 ? -6.777  -4.280  -10.310 1.00 0.00 ? 47 THR A HB   5  
ATOM 5184  H HG1  . THR A 1 47 ? -6.544  -6.452  -10.237 1.00 0.00 ? 47 THR A HG1  5  
ATOM 5185  H HG21 . THR A 1 47 ? -4.074  -4.343  -10.562 1.00 0.00 ? 47 THR A HG21 5  
ATOM 5186  H HG22 . THR A 1 47 ? -4.246  -3.636  -8.955  1.00 0.00 ? 47 THR A HG22 5  
ATOM 5187  H HG23 . THR A 1 47 ? -5.017  -2.869  -10.343 1.00 0.00 ? 47 THR A HG23 5  
ATOM 5188  N N    . GLN A 1 48 ? -5.417  -6.489  -7.226  1.00 0.00 ? 48 GLN A N    5  
ATOM 5189  C CA   . GLN A 1 48 ? -4.465  -7.213  -6.391  1.00 0.00 ? 48 GLN A CA   5  
ATOM 5190  C C    . GLN A 1 48 ? -3.032  -6.821  -6.735  1.00 0.00 ? 48 GLN A C    5  
ATOM 5191  O O    . GLN A 1 48 ? -2.145  -6.856  -5.881  1.00 0.00 ? 48 GLN A O    5  
ATOM 5192  C CB   . GLN A 1 48 ? -4.649  -8.721  -6.562  1.00 0.00 ? 48 GLN A CB   5  
ATOM 5193  C CG   . GLN A 1 48 ? -5.945  -9.248  -5.967  1.00 0.00 ? 48 GLN A CG   5  
ATOM 5194  C CD   . GLN A 1 48 ? -6.342  -10.596 -6.534  1.00 0.00 ? 48 GLN A CD   5  
ATOM 5195  O OE1  . GLN A 1 48 ? -5.553  -11.254 -7.214  1.00 0.00 ? 48 GLN A OE1  5  
ATOM 5196  N NE2  . GLN A 1 48 ? -7.571  -11.017 -6.257  1.00 0.00 ? 48 GLN A NE2  5  
ATOM 5197  H H    . GLN A 1 48 ? -6.073  -6.993  -7.750  1.00 0.00 ? 48 GLN A H    5  
ATOM 5198  H HA   . GLN A 1 48 ? -4.660  -6.950  -5.363  1.00 0.00 ? 48 GLN A HA   5  
ATOM 5199  H HB2  . GLN A 1 48 ? -4.640  -8.956  -7.616  1.00 0.00 ? 48 GLN A HB2  5  
ATOM 5200  H HB3  . GLN A 1 48 ? -3.825  -9.229  -6.082  1.00 0.00 ? 48 GLN A HB3  5  
ATOM 5201  H HG2  . GLN A 1 48 ? -5.821  -9.347  -4.898  1.00 0.00 ? 48 GLN A HG2  5  
ATOM 5202  H HG3  . GLN A 1 48 ? -6.734  -8.540  -6.173  1.00 0.00 ? 48 GLN A HG3  5  
ATOM 5203  H HE21 . GLN A 1 48 ? -8.145  -10.439 -5.710  1.00 0.00 ? 48 GLN A HE21 5  
ATOM 5204  H HE22 . GLN A 1 48 ? -7.854  -11.884 -6.612  1.00 0.00 ? 48 GLN A HE22 5  
ATOM 5205  N N    . THR A 1 49 ? -2.810  -6.447  -7.991  1.00 0.00 ? 49 THR A N    5  
ATOM 5206  C CA   . THR A 1 49 ? -1.485  -6.050  -8.448  1.00 0.00 ? 49 THR A CA   5  
ATOM 5207  C C    . THR A 1 49 ? -1.107  -4.674  -7.912  1.00 0.00 ? 49 THR A C    5  
ATOM 5208  O O    . THR A 1 49 ? 0.063   -4.294  -7.920  1.00 0.00 ? 49 THR A O    5  
ATOM 5209  C CB   . THR A 1 49 ? -1.404  -6.028  -9.986  1.00 0.00 ? 49 THR A CB   5  
ATOM 5210  O OG1  . THR A 1 49 ? -1.969  -7.230  -10.523 1.00 0.00 ? 49 THR A OG1  5  
ATOM 5211  C CG2  . THR A 1 49 ? 0.039   -5.889  -10.450 1.00 0.00 ? 49 THR A CG2  5  
ATOM 5212  H H    . THR A 1 49 ? -3.558  -6.439  -8.625  1.00 0.00 ? 49 THR A H    5  
ATOM 5213  H HA   . THR A 1 49 ? -0.774  -6.776  -8.081  1.00 0.00 ? 49 THR A HA   5  
ATOM 5214  H HB   . THR A 1 49 ? -1.967  -5.181  -10.349 1.00 0.00 ? 49 THR A HB   5  
ATOM 5215  H HG1  . THR A 1 49 ? -1.599  -7.396  -11.394 1.00 0.00 ? 49 THR A HG1  5  
ATOM 5216  H HG21 . THR A 1 49 ? 0.107   -6.149  -11.496 1.00 0.00 ? 49 THR A HG21 5  
ATOM 5217  H HG22 . THR A 1 49 ? 0.668   -6.550  -9.873  1.00 0.00 ? 49 THR A HG22 5  
ATOM 5218  H HG23 . THR A 1 49 ? 0.364   -4.869  -10.311 1.00 0.00 ? 49 THR A HG23 5  
ATOM 5219  N N    . GLN A 1 50 ? -2.106  -3.931  -7.445  1.00 0.00 ? 50 GLN A N    5  
ATOM 5220  C CA   . GLN A 1 50 ? -1.878  -2.597  -6.904  1.00 0.00 ? 50 GLN A CA   5  
ATOM 5221  C C    . GLN A 1 50 ? -1.689  -2.647  -5.392  1.00 0.00 ? 50 GLN A C    5  
ATOM 5222  O O    . GLN A 1 50 ? -0.743  -2.071  -4.854  1.00 0.00 ? 50 GLN A O    5  
ATOM 5223  C CB   . GLN A 1 50 ? -3.047  -1.674  -7.254  1.00 0.00 ? 50 GLN A CB   5  
ATOM 5224  C CG   . GLN A 1 50 ? -2.989  -1.130  -8.673  1.00 0.00 ? 50 GLN A CG   5  
ATOM 5225  C CD   . GLN A 1 50 ? -3.629  0.239   -8.799  1.00 0.00 ? 50 GLN A CD   5  
ATOM 5226  O OE1  . GLN A 1 50 ? -3.315  1.156   -8.040  1.00 0.00 ? 50 GLN A OE1  5  
ATOM 5227  N NE2  . GLN A 1 50 ? -4.532  0.384   -9.761  1.00 0.00 ? 50 GLN A NE2  5  
ATOM 5228  H H    . GLN A 1 50 ? -3.018  -4.289  -7.465  1.00 0.00 ? 50 GLN A H    5  
ATOM 5229  H HA   . GLN A 1 50 ? -0.977  -2.207  -7.354  1.00 0.00 ? 50 GLN A HA   5  
ATOM 5230  H HB2  . GLN A 1 50 ? -3.970  -2.223  -7.139  1.00 0.00 ? 50 GLN A HB2  5  
ATOM 5231  H HB3  . GLN A 1 50 ? -3.047  -0.838  -6.571  1.00 0.00 ? 50 GLN A HB3  5  
ATOM 5232  H HG2  . GLN A 1 50 ? -1.955  -1.056  -8.974  1.00 0.00 ? 50 GLN A HG2  5  
ATOM 5233  H HG3  . GLN A 1 50 ? -3.506  -1.815  -9.328  1.00 0.00 ? 50 GLN A HG3  5  
ATOM 5234  H HE21 . GLN A 1 50 ? -4.733  -0.391  -10.327 1.00 0.00 ? 50 GLN A HE21 5  
ATOM 5235  H HE22 . GLN A 1 50 ? -4.962  1.257   -9.865  1.00 0.00 ? 50 GLN A HE22 5  
ATOM 5236  N N    . VAL A 1 51 ? -2.596  -3.339  -4.710  1.00 0.00 ? 51 VAL A N    5  
ATOM 5237  C CA   . VAL A 1 51 ? -2.530  -3.465  -3.259  1.00 0.00 ? 51 VAL A CA   5  
ATOM 5238  C C    . VAL A 1 51 ? -1.345  -4.326  -2.836  1.00 0.00 ? 51 VAL A C    5  
ATOM 5239  O O    . VAL A 1 51 ? -0.844  -4.207  -1.718  1.00 0.00 ? 51 VAL A O    5  
ATOM 5240  C CB   . VAL A 1 51 ? -3.824  -4.075  -2.689  1.00 0.00 ? 51 VAL A CB   5  
ATOM 5241  C CG1  . VAL A 1 51 ? -3.604  -4.555  -1.262  1.00 0.00 ? 51 VAL A CG1  5  
ATOM 5242  C CG2  . VAL A 1 51 ? -4.961  -3.067  -2.752  1.00 0.00 ? 51 VAL A CG2  5  
ATOM 5243  H H    . VAL A 1 51 ? -3.328  -3.776  -5.195  1.00 0.00 ? 51 VAL A H    5  
ATOM 5244  H HA   . VAL A 1 51 ? -2.410  -2.475  -2.843  1.00 0.00 ? 51 VAL A HA   5  
ATOM 5245  H HB   . VAL A 1 51 ? -4.093  -4.928  -3.294  1.00 0.00 ? 51 VAL A HB   5  
ATOM 5246  H HG11 . VAL A 1 51 ? -2.850  -5.328  -1.255  1.00 0.00 ? 51 VAL A HG11 5  
ATOM 5247  H HG12 . VAL A 1 51 ? -3.279  -3.727  -0.649  1.00 0.00 ? 51 VAL A HG12 5  
ATOM 5248  H HG13 . VAL A 1 51 ? -4.529  -4.952  -0.870  1.00 0.00 ? 51 VAL A HG13 5  
ATOM 5249  H HG21 . VAL A 1 51 ? -4.598  -2.142  -3.176  1.00 0.00 ? 51 VAL A HG21 5  
ATOM 5250  H HG22 . VAL A 1 51 ? -5.756  -3.458  -3.370  1.00 0.00 ? 51 VAL A HG22 5  
ATOM 5251  H HG23 . VAL A 1 51 ? -5.337  -2.884  -1.756  1.00 0.00 ? 51 VAL A HG23 5  
ATOM 5252  N N    . LYS A 1 52 ? -0.900  -5.195  -3.738  1.00 0.00 ? 52 LYS A N    5  
ATOM 5253  C CA   . LYS A 1 52 ? 0.227   -6.076  -3.461  1.00 0.00 ? 52 LYS A CA   5  
ATOM 5254  C C    . LYS A 1 52 ? 1.528   -5.284  -3.371  1.00 0.00 ? 52 LYS A C    5  
ATOM 5255  O O    . LYS A 1 52 ? 2.312   -5.464  -2.438  1.00 0.00 ? 52 LYS A O    5  
ATOM 5256  C CB   . LYS A 1 52 ? 0.344   -7.146  -4.548  1.00 0.00 ? 52 LYS A CB   5  
ATOM 5257  C CG   . LYS A 1 52 ? -0.482  -8.390  -4.269  1.00 0.00 ? 52 LYS A CG   5  
ATOM 5258  C CD   . LYS A 1 52 ? -0.490  -9.334  -5.460  1.00 0.00 ? 52 LYS A CD   5  
ATOM 5259  C CE   . LYS A 1 52 ? 0.896   -9.896  -5.735  1.00 0.00 ? 52 LYS A CE   5  
ATOM 5260  N NZ   . LYS A 1 52 ? 1.323   -10.859 -4.681  1.00 0.00 ? 52 LYS A NZ   5  
ATOM 5261  H H    . LYS A 1 52 ? -1.341  -5.243  -4.613  1.00 0.00 ? 52 LYS A H    5  
ATOM 5262  H HA   . LYS A 1 52 ? 0.047   -6.558  -2.512  1.00 0.00 ? 52 LYS A HA   5  
ATOM 5263  H HB2  . LYS A 1 52 ? 0.017   -6.725  -5.488  1.00 0.00 ? 52 LYS A HB2  5  
ATOM 5264  H HB3  . LYS A 1 52 ? 1.380   -7.441  -4.638  1.00 0.00 ? 52 LYS A HB3  5  
ATOM 5265  H HG2  . LYS A 1 52 ? -0.064  -8.906  -3.418  1.00 0.00 ? 52 LYS A HG2  5  
ATOM 5266  H HG3  . LYS A 1 52 ? -1.498  -8.094  -4.049  1.00 0.00 ? 52 LYS A HG3  5  
ATOM 5267  H HD2  . LYS A 1 52 ? -1.164  -10.152 -5.256  1.00 0.00 ? 52 LYS A HD2  5  
ATOM 5268  H HD3  . LYS A 1 52 ? -0.829  -8.794  -6.334  1.00 0.00 ? 52 LYS A HD3  5  
ATOM 5269  H HE2  . LYS A 1 52 ? 0.883   -10.402 -6.688  1.00 0.00 ? 52 LYS A HE2  5  
ATOM 5270  H HE3  . LYS A 1 52 ? 1.602   -9.079  -5.770  1.00 0.00 ? 52 LYS A HE3  5  
ATOM 5271  H HZ1  . LYS A 1 52 ? 2.315   -10.687 -4.421  1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 5272  H HZ2  . LYS A 1 52 ? 1.232   -11.834 -5.031  1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 5273  H HZ3  . LYS A 1 52 ? 0.729   -10.748 -3.835  1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 5274  N N    . ILE A 1 53 ? 1.750   -4.407  -4.344  1.00 0.00 ? 53 ILE A N    5  
ATOM 5275  C CA   . ILE A 1 53 ? 2.954   -3.587  -4.372  1.00 0.00 ? 53 ILE A CA   5  
ATOM 5276  C C    . ILE A 1 53 ? 2.943   -2.556  -3.247  1.00 0.00 ? 53 ILE A C    5  
ATOM 5277  O O    . ILE A 1 53 ? 3.944   -2.368  -2.555  1.00 0.00 ? 53 ILE A O    5  
ATOM 5278  C CB   . ILE A 1 53 ? 3.107   -2.857  -5.719  1.00 0.00 ? 53 ILE A CB   5  
ATOM 5279  C CG1  . ILE A 1 53 ? 3.067   -3.860  -6.874  1.00 0.00 ? 53 ILE A CG1  5  
ATOM 5280  C CG2  . ILE A 1 53 ? 4.403   -2.061  -5.747  1.00 0.00 ? 53 ILE A CG2  5  
ATOM 5281  C CD1  . ILE A 1 53 ? 2.983   -3.209  -8.237  1.00 0.00 ? 53 ILE A CD1  5  
ATOM 5282  H H    . ILE A 1 53 ? 1.088   -4.309  -5.059  1.00 0.00 ? 53 ILE A H    5  
ATOM 5283  H HA   . ILE A 1 53 ? 3.805   -4.239  -4.239  1.00 0.00 ? 53 ILE A HA   5  
ATOM 5284  H HB   . ILE A 1 53 ? 2.286   -2.165  -5.824  1.00 0.00 ? 53 ILE A HB   5  
ATOM 5285  H HG12 . ILE A 1 53 ? 3.961   -4.463  -6.850  1.00 0.00 ? 53 ILE A HG12 5  
ATOM 5286  H HG13 . ILE A 1 53 ? 2.204   -4.499  -6.756  1.00 0.00 ? 53 ILE A HG13 5  
ATOM 5287  H HG21 . ILE A 1 53 ? 4.242   -1.095  -5.291  1.00 0.00 ? 53 ILE A HG21 5  
ATOM 5288  H HG22 . ILE A 1 53 ? 5.164   -2.594  -5.197  1.00 0.00 ? 53 ILE A HG22 5  
ATOM 5289  H HG23 . ILE A 1 53 ? 4.723   -1.928  -6.769  1.00 0.00 ? 53 ILE A HG23 5  
ATOM 5290  H HD11 . ILE A 1 53 ? 3.895   -2.666  -8.434  1.00 0.00 ? 53 ILE A HD11 5  
ATOM 5291  H HD12 . ILE A 1 53 ? 2.845   -3.969  -8.991  1.00 0.00 ? 53 ILE A HD12 5  
ATOM 5292  H HD13 . ILE A 1 53 ? 2.146   -2.526  -8.258  1.00 0.00 ? 53 ILE A HD13 5  
ATOM 5293  N N    . TRP A 1 54 ? 1.806   -1.894  -3.070  1.00 0.00 ? 54 TRP A N    5  
ATOM 5294  C CA   . TRP A 1 54 ? 1.664   -0.884  -2.028  1.00 0.00 ? 54 TRP A CA   5  
ATOM 5295  C C    . TRP A 1 54 ? 2.127   -1.424  -0.679  1.00 0.00 ? 54 TRP A C    5  
ATOM 5296  O O    . TRP A 1 54 ? 2.764   -0.714  0.099   1.00 0.00 ? 54 TRP A O    5  
ATOM 5297  C CB   . TRP A 1 54 ? 0.210   -0.420  -1.933  1.00 0.00 ? 54 TRP A CB   5  
ATOM 5298  C CG   . TRP A 1 54 ? 0.019   0.752   -1.019  1.00 0.00 ? 54 TRP A CG   5  
ATOM 5299  C CD1  . TRP A 1 54 ? -0.137  2.059   -1.383  1.00 0.00 ? 54 TRP A CD1  5  
ATOM 5300  C CD2  . TRP A 1 54 ? -0.035  0.723   0.412   1.00 0.00 ? 54 TRP A CD2  5  
ATOM 5301  N NE1  . TRP A 1 54 ? -0.284  2.845   -0.265  1.00 0.00 ? 54 TRP A NE1  5  
ATOM 5302  C CE2  . TRP A 1 54 ? -0.226  2.049   0.848   1.00 0.00 ? 54 TRP A CE2  5  
ATOM 5303  C CE3  . TRP A 1 54 ? 0.058   -0.293  1.366   1.00 0.00 ? 54 TRP A CE3  5  
ATOM 5304  C CZ2  . TRP A 1 54 ? -0.325  2.381   2.197   1.00 0.00 ? 54 TRP A CZ2  5  
ATOM 5305  C CZ3  . TRP A 1 54 ? -0.040  0.038   2.704   1.00 0.00 ? 54 TRP A CZ3  5  
ATOM 5306  C CH2  . TRP A 1 54 ? -0.230  1.366   3.109   1.00 0.00 ? 54 TRP A CH2  5  
ATOM 5307  H H    . TRP A 1 54 ? 1.043   -2.089  -3.654  1.00 0.00 ? 54 TRP A H    5  
ATOM 5308  H HA   . TRP A 1 54 ? 2.285   -0.042  -2.297  1.00 0.00 ? 54 TRP A HA   5  
ATOM 5309  H HB2  . TRP A 1 54 ? -0.136  -0.135  -2.916  1.00 0.00 ? 54 TRP A HB2  5  
ATOM 5310  H HB3  . TRP A 1 54 ? -0.397  -1.234  -1.564  1.00 0.00 ? 54 TRP A HB3  5  
ATOM 5311  H HD1  . TRP A 1 54 ? -0.140  2.410   -2.404  1.00 0.00 ? 54 TRP A HD1  5  
ATOM 5312  H HE1  . TRP A 1 54 ? -0.412  3.817   -0.266  1.00 0.00 ? 54 TRP A HE1  5  
ATOM 5313  H HE3  . TRP A 1 54 ? 0.204   -1.323  1.073   1.00 0.00 ? 54 TRP A HE3  5  
ATOM 5314  H HZ2  . TRP A 1 54 ? -0.472  3.400   2.525   1.00 0.00 ? 54 TRP A HZ2  5  
ATOM 5315  H HZ3  . TRP A 1 54 ? 0.030   -0.734  3.456   1.00 0.00 ? 54 TRP A HZ3  5  
ATOM 5316  H HH2  . TRP A 1 54 ? -0.301  1.579   4.165   1.00 0.00 ? 54 TRP A HH2  5  
ATOM 5317  N N    . PHE A 1 55 ? 1.803   -2.684  -0.409  1.00 0.00 ? 55 PHE A N    5  
ATOM 5318  C CA   . PHE A 1 55 ? 2.185   -3.319  0.847   1.00 0.00 ? 55 PHE A CA   5  
ATOM 5319  C C    . PHE A 1 55 ? 3.659   -3.716  0.829   1.00 0.00 ? 55 PHE A C    5  
ATOM 5320  O O    . PHE A 1 55 ? 4.380   -3.506  1.803   1.00 0.00 ? 55 PHE A O    5  
ATOM 5321  C CB   . PHE A 1 55 ? 1.317   -4.552  1.105   1.00 0.00 ? 55 PHE A CB   5  
ATOM 5322  C CG   . PHE A 1 55 ? 0.067   -4.252  1.883   1.00 0.00 ? 55 PHE A CG   5  
ATOM 5323  C CD1  . PHE A 1 55 ? -0.985  -3.570  1.293   1.00 0.00 ? 55 PHE A CD1  5  
ATOM 5324  C CD2  . PHE A 1 55 ? -0.056  -4.653  3.203   1.00 0.00 ? 55 PHE A CD2  5  
ATOM 5325  C CE1  . PHE A 1 55 ? -2.135  -3.292  2.007   1.00 0.00 ? 55 PHE A CE1  5  
ATOM 5326  C CE2  . PHE A 1 55 ? -1.204  -4.379  3.922   1.00 0.00 ? 55 PHE A CE2  5  
ATOM 5327  C CZ   . PHE A 1 55 ? -2.246  -3.698  3.322   1.00 0.00 ? 55 PHE A CZ   5  
ATOM 5328  H H    . PHE A 1 55 ? 1.294   -3.199  -1.070  1.00 0.00 ? 55 PHE A H    5  
ATOM 5329  H HA   . PHE A 1 55 ? 2.027   -2.605  1.640   1.00 0.00 ? 55 PHE A HA   5  
ATOM 5330  H HB2  . PHE A 1 55 ? 1.023   -4.981  0.159   1.00 0.00 ? 55 PHE A HB2  5  
ATOM 5331  H HB3  . PHE A 1 55 ? 1.890   -5.277  1.662   1.00 0.00 ? 55 PHE A HB3  5  
ATOM 5332  H HD1  . PHE A 1 55 ? -0.901  -3.253  0.264   1.00 0.00 ? 55 PHE A HD1  5  
ATOM 5333  H HD2  . PHE A 1 55 ? 0.759   -5.186  3.673   1.00 0.00 ? 55 PHE A HD2  5  
ATOM 5334  H HE1  . PHE A 1 55 ? -2.948  -2.760  1.535   1.00 0.00 ? 55 PHE A HE1  5  
ATOM 5335  H HE2  . PHE A 1 55 ? -1.287  -4.698  4.950   1.00 0.00 ? 55 PHE A HE2  5  
ATOM 5336  H HZ   . PHE A 1 55 ? -3.143  -3.482  3.882   1.00 0.00 ? 55 PHE A HZ   5  
ATOM 5337  N N    . GLN A 1 56 ? 4.097   -4.292  -0.286  1.00 0.00 ? 56 GLN A N    5  
ATOM 5338  C CA   . GLN A 1 56 ? 5.483   -4.720  -0.431  1.00 0.00 ? 56 GLN A CA   5  
ATOM 5339  C C    . GLN A 1 56 ? 6.436   -3.540  -0.271  1.00 0.00 ? 56 GLN A C    5  
ATOM 5340  O O    . GLN A 1 56 ? 7.294   -3.538  0.611   1.00 0.00 ? 56 GLN A O    5  
ATOM 5341  C CB   . GLN A 1 56 ? 5.695   -5.381  -1.794  1.00 0.00 ? 56 GLN A CB   5  
ATOM 5342  C CG   . GLN A 1 56 ? 6.835   -6.387  -1.811  1.00 0.00 ? 56 GLN A CG   5  
ATOM 5343  C CD   . GLN A 1 56 ? 6.699   -7.404  -2.927  1.00 0.00 ? 56 GLN A CD   5  
ATOM 5344  O OE1  . GLN A 1 56 ? 5.631   -7.551  -3.522  1.00 0.00 ? 56 GLN A OE1  5  
ATOM 5345  N NE2  . GLN A 1 56 ? 7.784   -8.112  -3.218  1.00 0.00 ? 56 GLN A NE2  5  
ATOM 5346  H H    . GLN A 1 56 ? 3.473   -4.432  -1.028  1.00 0.00 ? 56 GLN A H    5  
ATOM 5347  H HA   . GLN A 1 56 ? 5.690   -5.441  0.345   1.00 0.00 ? 56 GLN A HA   5  
ATOM 5348  H HB2  . GLN A 1 56 ? 4.788   -5.892  -2.078  1.00 0.00 ? 56 GLN A HB2  5  
ATOM 5349  H HB3  . GLN A 1 56 ? 5.911   -4.614  -2.523  1.00 0.00 ? 56 GLN A HB3  5  
ATOM 5350  H HG2  . GLN A 1 56 ? 7.766   -5.856  -1.940  1.00 0.00 ? 56 GLN A HG2  5  
ATOM 5351  H HG3  . GLN A 1 56 ? 6.849   -6.911  -0.866  1.00 0.00 ? 56 GLN A HG3  5  
ATOM 5352  H HE21 . GLN A 1 56 ? 8.600   -7.942  -2.701  1.00 0.00 ? 56 GLN A HE21 5  
ATOM 5353  H HE22 . GLN A 1 56 ? 7.724   -8.777  -3.934  1.00 0.00 ? 56 GLN A HE22 5  
ATOM 5354  N N    . ASN A 1 57 ? 6.280   -2.538  -1.131  1.00 0.00 ? 57 ASN A N    5  
ATOM 5355  C CA   . ASN A 1 57 ? 7.128   -1.353  -1.085  1.00 0.00 ? 57 ASN A CA   5  
ATOM 5356  C C    . ASN A 1 57 ? 7.173   -0.770  0.324   1.00 0.00 ? 57 ASN A C    5  
ATOM 5357  O O    . ASN A 1 57 ? 8.234   -0.697  0.944   1.00 0.00 ? 57 ASN A O    5  
ATOM 5358  C CB   . ASN A 1 57 ? 6.618   -0.298  -2.069  1.00 0.00 ? 57 ASN A CB   5  
ATOM 5359  C CG   . ASN A 1 57 ? 7.217   -0.460  -3.453  1.00 0.00 ? 57 ASN A CG   5  
ATOM 5360  O OD1  . ASN A 1 57 ? 7.892   0.437   -3.958  1.00 0.00 ? 57 ASN A OD1  5  
ATOM 5361  N ND2  . ASN A 1 57 ? 6.971   -1.608  -4.073  1.00 0.00 ? 57 ASN A ND2  5  
ATOM 5362  H H    . ASN A 1 57 ? 5.578   -2.598  -1.812  1.00 0.00 ? 57 ASN A H    5  
ATOM 5363  H HA   . ASN A 1 57 ? 8.125   -1.648  -1.373  1.00 0.00 ? 57 ASN A HA   5  
ATOM 5364  H HB2  . ASN A 1 57 ? 5.544   -0.380  -2.151  1.00 0.00 ? 57 ASN A HB2  5  
ATOM 5365  H HB3  . ASN A 1 57 ? 6.872   0.684   -1.699  1.00 0.00 ? 57 ASN A HB3  5  
ATOM 5366  H HD21 . ASN A 1 57 ? 6.425   -2.277  -3.610  1.00 0.00 ? 57 ASN A HD21 5  
ATOM 5367  H HD22 . ASN A 1 57 ? 7.347   -1.740  -4.968  1.00 0.00 ? 57 ASN A HD22 5  
ATOM 5368  N N    . LYS A 1 58 ? 6.014   -0.357  0.825   1.00 0.00 ? 58 LYS A N    5  
ATOM 5369  C CA   . LYS A 1 58 ? 5.919   0.218   2.162   1.00 0.00 ? 58 LYS A CA   5  
ATOM 5370  C C    . LYS A 1 58 ? 6.885   -0.472  3.120   1.00 0.00 ? 58 LYS A C    5  
ATOM 5371  O O    . LYS A 1 58 ? 7.632   0.187   3.844   1.00 0.00 ? 58 LYS A O    5  
ATOM 5372  C CB   . LYS A 1 58 ? 4.488   0.098   2.690   1.00 0.00 ? 58 LYS A CB   5  
ATOM 5373  C CG   . LYS A 1 58 ? 4.096   1.214   3.643   1.00 0.00 ? 58 LYS A CG   5  
ATOM 5374  C CD   . LYS A 1 58 ? 3.490   2.394   2.902   1.00 0.00 ? 58 LYS A CD   5  
ATOM 5375  C CE   . LYS A 1 58 ? 2.475   3.131   3.762   1.00 0.00 ? 58 LYS A CE   5  
ATOM 5376  N NZ   . LYS A 1 58 ? 3.125   3.855   4.890   1.00 0.00 ? 58 LYS A NZ   5  
ATOM 5377  H H    . LYS A 1 58 ? 5.202   -0.441  0.282   1.00 0.00 ? 58 LYS A H    5  
ATOM 5378  H HA   . LYS A 1 58 ? 6.183   1.262   2.094   1.00 0.00 ? 58 LYS A HA   5  
ATOM 5379  H HB2  . LYS A 1 58 ? 3.806   0.112   1.853   1.00 0.00 ? 58 LYS A HB2  5  
ATOM 5380  H HB3  . LYS A 1 58 ? 4.386   -0.843  3.211   1.00 0.00 ? 58 LYS A HB3  5  
ATOM 5381  H HG2  . LYS A 1 58 ? 3.372   0.836   4.349   1.00 0.00 ? 58 LYS A HG2  5  
ATOM 5382  H HG3  . LYS A 1 58 ? 4.977   1.548   4.173   1.00 0.00 ? 58 LYS A HG3  5  
ATOM 5383  H HD2  . LYS A 1 58 ? 4.278   3.080   2.628   1.00 0.00 ? 58 LYS A HD2  5  
ATOM 5384  H HD3  . LYS A 1 58 ? 2.998   2.033   2.010   1.00 0.00 ? 58 LYS A HD3  5  
ATOM 5385  H HE2  . LYS A 1 58 ? 1.949   3.843   3.145   1.00 0.00 ? 58 LYS A HE2  5  
ATOM 5386  H HE3  . LYS A 1 58 ? 1.774   2.414   4.163   1.00 0.00 ? 58 LYS A HE3  5  
ATOM 5387  H HZ1  . LYS A 1 58 ? 3.270   4.854   4.637   1.00 0.00 ? 58 LYS A HZ1  5  
ATOM 5388  H HZ2  . LYS A 1 58 ? 4.048   3.427   5.104   1.00 0.00 ? 58 LYS A HZ2  5  
ATOM 5389  H HZ3  . LYS A 1 58 ? 2.527   3.806   5.739   1.00 0.00 ? 58 LYS A HZ3  5  
ATOM 5390  N N    . ARG A 1 59 ? 6.866   -1.800  3.119   1.00 0.00 ? 59 ARG A N    5  
ATOM 5391  C CA   . ARG A 1 59 ? 7.740   -2.578  3.988   1.00 0.00 ? 59 ARG A CA   5  
ATOM 5392  C C    . ARG A 1 59 ? 9.203   -2.209  3.758   1.00 0.00 ? 59 ARG A C    5  
ATOM 5393  O O    . ARG A 1 59 ? 9.965   -2.033  4.709   1.00 0.00 ? 59 ARG A O    5  
ATOM 5394  C CB   . ARG A 1 59 ? 7.536   -4.075  3.745   1.00 0.00 ? 59 ARG A CB   5  
ATOM 5395  C CG   . ARG A 1 59 ? 6.463   -4.694  4.624   1.00 0.00 ? 59 ARG A CG   5  
ATOM 5396  C CD   . ARG A 1 59 ? 6.648   -6.198  4.754   1.00 0.00 ? 59 ARG A CD   5  
ATOM 5397  N NE   . ARG A 1 59 ? 7.947   -6.542  5.327   1.00 0.00 ? 59 ARG A NE   5  
ATOM 5398  C CZ   . ARG A 1 59 ? 8.534   -7.721  5.161   1.00 0.00 ? 59 ARG A CZ   5  
ATOM 5399  N NH1  . ARG A 1 59 ? 7.942   -8.665  4.443   1.00 0.00 ? 59 ARG A NH1  5  
ATOM 5400  N NH2  . ARG A 1 59 ? 9.717   -7.959  5.714   1.00 0.00 ? 59 ARG A NH2  5  
ATOM 5401  H H    . ARG A 1 59 ? 6.248   -2.269  2.519   1.00 0.00 ? 59 ARG A H    5  
ATOM 5402  H HA   . ARG A 1 59 ? 7.480   -2.350  5.011   1.00 0.00 ? 59 ARG A HA   5  
ATOM 5403  H HB2  . ARG A 1 59 ? 7.256   -4.225  2.712   1.00 0.00 ? 59 ARG A HB2  5  
ATOM 5404  H HB3  . ARG A 1 59 ? 8.467   -4.588  3.935   1.00 0.00 ? 59 ARG A HB3  5  
ATOM 5405  H HG2  . ARG A 1 59 ? 6.515   -4.250  5.607   1.00 0.00 ? 59 ARG A HG2  5  
ATOM 5406  H HG3  . ARG A 1 59 ? 5.495   -4.496  4.188   1.00 0.00 ? 59 ARG A HG3  5  
ATOM 5407  H HD2  . ARG A 1 59 ? 5.869   -6.590  5.392   1.00 0.00 ? 59 ARG A HD2  5  
ATOM 5408  H HD3  . ARG A 1 59 ? 6.568   -6.643  3.774   1.00 0.00 ? 59 ARG A HD3  5  
ATOM 5409  H HE   . ARG A 1 59 ? 8.402   -5.859  5.862   1.00 0.00 ? 59 ARG A HE   5  
ATOM 5410  H HH11 . ARG A 1 59 ? 7.051   -8.489  4.024   1.00 0.00 ? 59 ARG A HH11 5  
ATOM 5411  H HH12 . ARG A 1 59 ? 8.387   -9.552  4.318   1.00 0.00 ? 59 ARG A HH12 5  
ATOM 5412  H HH21 . ARG A 1 59 ? 10.167  -7.250  6.256   1.00 0.00 ? 59 ARG A HH21 5  
ATOM 5413  H HH22 . ARG A 1 59 ? 10.158  -8.847  5.588   1.00 0.00 ? 59 ARG A HH22 5  
ATOM 5414  N N    . SER A 1 60 ? 9.587   -2.095  2.491   1.00 0.00 ? 60 SER A N    5  
ATOM 5415  C CA   . SER A 1 60 ? 10.959  -1.752  2.137   1.00 0.00 ? 60 SER A CA   5  
ATOM 5416  C C    . SER A 1 60 ? 11.321  -0.361  2.650   1.00 0.00 ? 60 SER A C    5  
ATOM 5417  O O    . SER A 1 60 ? 12.468  -0.099  3.013   1.00 0.00 ? 60 SER A O    5  
ATOM 5418  C CB   . SER A 1 60 ? 11.147  -1.812  0.619   1.00 0.00 ? 60 SER A CB   5  
ATOM 5419  O OG   . SER A 1 60 ? 10.564  -0.685  -0.012  1.00 0.00 ? 60 SER A OG   5  
ATOM 5420  H H    . SER A 1 60 ? 8.933   -2.248  1.778   1.00 0.00 ? 60 SER A H    5  
ATOM 5421  H HA   . SER A 1 60 ? 11.613  -2.475  2.601   1.00 0.00 ? 60 SER A HA   5  
ATOM 5422  H HB2  . SER A 1 60 ? 12.201  -1.832  0.390   1.00 0.00 ? 60 SER A HB2  5  
ATOM 5423  H HB3  . SER A 1 60 ? 10.677  -2.707  0.237   1.00 0.00 ? 60 SER A HB3  5  
ATOM 5424  H HG   . SER A 1 60 ? 9.725   -0.936  -0.405  1.00 0.00 ? 60 SER A HG   5  
ATOM 5425  N N    . LYS A 1 61 ? 10.334  0.528   2.679   1.00 0.00 ? 61 LYS A N    5  
ATOM 5426  C CA   . LYS A 1 61 ? 10.545  1.892   3.148   1.00 0.00 ? 61 LYS A CA   5  
ATOM 5427  C C    . LYS A 1 61 ? 10.812  1.915   4.650   1.00 0.00 ? 61 LYS A C    5  
ATOM 5428  O O    . LYS A 1 61 ? 11.576  2.747   5.141   1.00 0.00 ? 61 LYS A O    5  
ATOM 5429  C CB   . LYS A 1 61 ? 9.327   2.759   2.823   1.00 0.00 ? 61 LYS A CB   5  
ATOM 5430  C CG   . LYS A 1 61 ? 9.523   4.229   3.151   1.00 0.00 ? 61 LYS A CG   5  
ATOM 5431  C CD   . LYS A 1 61 ? 8.594   5.111   2.333   1.00 0.00 ? 61 LYS A CD   5  
ATOM 5432  C CE   . LYS A 1 61 ? 7.216   5.210   2.969   1.00 0.00 ? 61 LYS A CE   5  
ATOM 5433  N NZ   . LYS A 1 61 ? 6.377   4.018   2.661   1.00 0.00 ? 61 LYS A NZ   5  
ATOM 5434  H H    . LYS A 1 61 ? 9.440   0.259   2.377   1.00 0.00 ? 61 LYS A H    5  
ATOM 5435  H HA   . LYS A 1 61 ? 11.407  2.290   2.635   1.00 0.00 ? 61 LYS A HA   5  
ATOM 5436  H HB2  . LYS A 1 61 ? 9.110   2.673   1.769   1.00 0.00 ? 61 LYS A HB2  5  
ATOM 5437  H HB3  . LYS A 1 61 ? 8.480   2.396   3.388   1.00 0.00 ? 61 LYS A HB3  5  
ATOM 5438  H HG2  . LYS A 1 61 ? 9.319   4.386   4.200   1.00 0.00 ? 61 LYS A HG2  5  
ATOM 5439  H HG3  . LYS A 1 61 ? 10.546  4.504   2.937   1.00 0.00 ? 61 LYS A HG3  5  
ATOM 5440  H HD2  . LYS A 1 61 ? 9.018   6.102   2.266   1.00 0.00 ? 61 LYS A HD2  5  
ATOM 5441  H HD3  . LYS A 1 61 ? 8.494   4.692   1.342   1.00 0.00 ? 61 LYS A HD3  5  
ATOM 5442  H HE2  . LYS A 1 61 ? 7.332   5.291   4.039   1.00 0.00 ? 61 LYS A HE2  5  
ATOM 5443  H HE3  . LYS A 1 61 ? 6.722   6.094   2.593   1.00 0.00 ? 61 LYS A HE3  5  
ATOM 5444  H HZ1  . LYS A 1 61 ? 6.979   3.225   2.362   1.00 0.00 ? 61 LYS A HZ1  5  
ATOM 5445  H HZ2  . LYS A 1 61 ? 5.709   4.240   1.896   1.00 0.00 ? 61 LYS A HZ2  5  
ATOM 5446  H HZ3  . LYS A 1 61 ? 5.839   3.732   3.504   1.00 0.00 ? 61 LYS A HZ3  5  
ATOM 5447  N N    . ILE A 1 62 ? 10.181  0.996   5.373   1.00 0.00 ? 62 ILE A N    5  
ATOM 5448  C CA   . ILE A 1 62 ? 10.353  0.910   6.818   1.00 0.00 ? 62 ILE A CA   5  
ATOM 5449  C C    . ILE A 1 62 ? 11.810  1.128   7.211   1.00 0.00 ? 62 ILE A C    5  
ATOM 5450  O O    . ILE A 1 62 ? 12.650  0.245   7.040   1.00 0.00 ? 62 ILE A O    5  
ATOM 5451  C CB   . ILE A 1 62 ? 9.885   -0.453  7.361   1.00 0.00 ? 62 ILE A CB   5  
ATOM 5452  C CG1  . ILE A 1 62 ? 8.404   -0.671  7.045   1.00 0.00 ? 62 ILE A CG1  5  
ATOM 5453  C CG2  . ILE A 1 62 ? 10.131  -0.539  8.860   1.00 0.00 ? 62 ILE A CG2  5  
ATOM 5454  C CD1  . ILE A 1 62 ? 7.919   -2.070  7.354   1.00 0.00 ? 62 ILE A CD1  5  
ATOM 5455  H H    . ILE A 1 62 ? 9.585   0.361   4.924   1.00 0.00 ? 62 ILE A H    5  
ATOM 5456  H HA   . ILE A 1 62 ? 9.749   1.683   7.272   1.00 0.00 ? 62 ILE A HA   5  
ATOM 5457  H HB   . ILE A 1 62 ? 10.466  -1.225  6.880   1.00 0.00 ? 62 ILE A HB   5  
ATOM 5458  H HG12 . ILE A 1 62 ? 7.813   0.020   7.625   1.00 0.00 ? 62 ILE A HG12 5  
ATOM 5459  H HG13 . ILE A 1 62 ? 8.237   -0.486  5.994   1.00 0.00 ? 62 ILE A HG13 5  
ATOM 5460  H HG21 . ILE A 1 62 ? 9.189   -0.668  9.372   1.00 0.00 ? 62 ILE A HG21 5  
ATOM 5461  H HG22 . ILE A 1 62 ? 10.773  -1.380  9.071   1.00 0.00 ? 62 ILE A HG22 5  
ATOM 5462  H HG23 . ILE A 1 62 ? 10.604  0.370   9.200   1.00 0.00 ? 62 ILE A HG23 5  
ATOM 5463  H HD11 . ILE A 1 62 ? 8.479   -2.783  6.768   1.00 0.00 ? 62 ILE A HD11 5  
ATOM 5464  H HD12 . ILE A 1 62 ? 8.060   -2.276  8.405   1.00 0.00 ? 62 ILE A HD12 5  
ATOM 5465  H HD13 . ILE A 1 62 ? 6.870   -2.149  7.110   1.00 0.00 ? 62 ILE A HD13 5  
ATOM 5466  N N    . LYS A 1 63 ? 12.103  2.311   7.741   1.00 0.00 ? 63 LYS A N    5  
ATOM 5467  C CA   . LYS A 1 63 ? 13.458  2.646   8.163   1.00 0.00 ? 63 LYS A CA   5  
ATOM 5468  C C    . LYS A 1 63 ? 14.118  1.463   8.864   1.00 0.00 ? 63 LYS A C    5  
ATOM 5469  O O    . LYS A 1 63 ? 15.295  1.175   8.644   1.00 0.00 ? 63 LYS A O    5  
ATOM 5470  C CB   . LYS A 1 63 ? 13.439  3.859   9.097   1.00 0.00 ? 63 LYS A CB   5  
ATOM 5471  C CG   . LYS A 1 63 ? 12.658  3.626   10.379  1.00 0.00 ? 63 LYS A CG   5  
ATOM 5472  C CD   . LYS A 1 63 ? 12.845  4.771   11.361  1.00 0.00 ? 63 LYS A CD   5  
ATOM 5473  C CE   . LYS A 1 63 ? 11.890  5.918   11.067  1.00 0.00 ? 63 LYS A CE   5  
ATOM 5474  N NZ   . LYS A 1 63 ? 11.851  6.906   12.180  1.00 0.00 ? 63 LYS A NZ   5  
ATOM 5475  H H    . LYS A 1 63 ? 11.390  2.975   7.853   1.00 0.00 ? 63 LYS A H    5  
ATOM 5476  H HA   . LYS A 1 63 ? 14.029  2.891   7.281   1.00 0.00 ? 63 LYS A HA   5  
ATOM 5477  H HB2  . LYS A 1 63 ? 14.455  4.112   9.360   1.00 0.00 ? 63 LYS A HB2  5  
ATOM 5478  H HB3  . LYS A 1 63 ? 12.992  4.693   8.575   1.00 0.00 ? 63 LYS A HB3  5  
ATOM 5479  H HG2  . LYS A 1 63 ? 11.609  3.538   10.141  1.00 0.00 ? 63 LYS A HG2  5  
ATOM 5480  H HG3  . LYS A 1 63 ? 13.003  2.711   10.839  1.00 0.00 ? 63 LYS A HG3  5  
ATOM 5481  H HD2  . LYS A 1 63 ? 12.659  4.410   12.361  1.00 0.00 ? 63 LYS A HD2  5  
ATOM 5482  H HD3  . LYS A 1 63 ? 13.861  5.133   11.290  1.00 0.00 ? 63 LYS A HD3  5  
ATOM 5483  H HE2  . LYS A 1 63 ? 12.213  6.416   10.166  1.00 0.00 ? 63 LYS A HE2  5  
ATOM 5484  H HE3  . LYS A 1 63 ? 10.899  5.515   10.920  1.00 0.00 ? 63 LYS A HE3  5  
ATOM 5485  H HZ1  . LYS A 1 63 ? 11.732  6.415   13.090  1.00 0.00 ? 63 LYS A HZ1  5  
ATOM 5486  H HZ2  . LYS A 1 63 ? 11.056  7.563   12.047  1.00 0.00 ? 63 LYS A HZ2  5  
ATOM 5487  H HZ3  . LYS A 1 63 ? 12.737  7.451   12.206  1.00 0.00 ? 63 LYS A HZ3  5  
ATOM 5488  N N    . LYS A 1 64 ? 13.353  0.778   9.707   1.00 0.00 ? 64 LYS A N    5  
ATOM 5489  C CA   . LYS A 1 64 ? 13.862  -0.376  10.438  1.00 0.00 ? 64 LYS A CA   5  
ATOM 5490  C C    . LYS A 1 64 ? 14.299  -1.478  9.479   1.00 0.00 ? 64 LYS A C    5  
ATOM 5491  O O    . LYS A 1 64 ? 13.514  -1.940  8.651   1.00 0.00 ? 64 LYS A O    5  
ATOM 5492  C CB   . LYS A 1 64 ? 12.794  -0.911  11.395  1.00 0.00 ? 64 LYS A CB   5  
ATOM 5493  C CG   . LYS A 1 64 ? 12.720  -0.154  12.709  1.00 0.00 ? 64 LYS A CG   5  
ATOM 5494  C CD   . LYS A 1 64 ? 12.171  -1.026  13.825  1.00 0.00 ? 64 LYS A CD   5  
ATOM 5495  C CE   . LYS A 1 64 ? 13.277  -1.808  14.518  1.00 0.00 ? 64 LYS A CE   5  
ATOM 5496  N NZ   . LYS A 1 64 ? 13.539  -3.111  13.846  1.00 0.00 ? 64 LYS A NZ   5  
ATOM 5497  H H    . LYS A 1 64 ? 12.422  1.056   9.841   1.00 0.00 ? 64 LYS A H    5  
ATOM 5498  H HA   . LYS A 1 64 ? 14.718  -0.054  11.012  1.00 0.00 ? 64 LYS A HA   5  
ATOM 5499  H HB2  . LYS A 1 64 ? 11.831  -0.847  10.911  1.00 0.00 ? 64 LYS A HB2  5  
ATOM 5500  H HB3  . LYS A 1 64 ? 13.010  -1.948  11.612  1.00 0.00 ? 64 LYS A HB3  5  
ATOM 5501  H HG2  . LYS A 1 64 ? 13.712  0.177   12.981  1.00 0.00 ? 64 LYS A HG2  5  
ATOM 5502  H HG3  . LYS A 1 64 ? 12.075  0.704   12.584  1.00 0.00 ? 64 LYS A HG3  5  
ATOM 5503  H HD2  . LYS A 1 64 ? 11.680  -0.398  14.554  1.00 0.00 ? 64 LYS A HD2  5  
ATOM 5504  H HD3  . LYS A 1 64 ? 11.457  -1.722  13.408  1.00 0.00 ? 64 LYS A HD3  5  
ATOM 5505  H HE2  . LYS A 1 64 ? 14.180  -1.218  14.504  1.00 0.00 ? 64 LYS A HE2  5  
ATOM 5506  H HE3  . LYS A 1 64 ? 12.983  -1.993  15.540  1.00 0.00 ? 64 LYS A HE3  5  
ATOM 5507  H HZ1  . LYS A 1 64 ? 13.744  -3.844  14.555  1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 5508  H HZ2  . LYS A 1 64 ? 14.355  -3.025  13.207  1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 5509  H HZ3  . LYS A 1 64 ? 12.708  -3.402  13.292  1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 5510  N N    . SER A 1 65 ? 15.555  -1.896  9.597   1.00 0.00 ? 65 SER A N    5  
ATOM 5511  C CA   . SER A 1 65 ? 16.097  -2.943  8.738   1.00 0.00 ? 65 SER A CA   5  
ATOM 5512  C C    . SER A 1 65 ? 15.942  -4.314  9.389   1.00 0.00 ? 65 SER A C    5  
ATOM 5513  O O    . SER A 1 65 ? 16.105  -4.460  10.600  1.00 0.00 ? 65 SER A O    5  
ATOM 5514  C CB   . SER A 1 65 ? 17.572  -2.672  8.436   1.00 0.00 ? 65 SER A CB   5  
ATOM 5515  O OG   . SER A 1 65 ? 17.720  -1.555  7.576   1.00 0.00 ? 65 SER A OG   5  
ATOM 5516  H H    . SER A 1 65 ? 16.132  -1.488  10.276  1.00 0.00 ? 65 SER A H    5  
ATOM 5517  H HA   . SER A 1 65 ? 15.541  -2.933  7.812   1.00 0.00 ? 65 SER A HA   5  
ATOM 5518  H HB2  . SER A 1 65 ? 18.095  -2.472  9.359   1.00 0.00 ? 65 SER A HB2  5  
ATOM 5519  H HB3  . SER A 1 65 ? 18.004  -3.540  7.958   1.00 0.00 ? 65 SER A HB3  5  
ATOM 5520  H HG   . SER A 1 65 ? 18.622  -1.520  7.250   1.00 0.00 ? 65 SER A HG   5  
ATOM 5521  N N    . GLY A 1 66 ? 15.627  -5.317  8.575   1.00 0.00 ? 66 GLY A N    5  
ATOM 5522  C CA   . GLY A 1 66 ? 15.456  -6.663  9.089   1.00 0.00 ? 66 GLY A CA   5  
ATOM 5523  C C    . GLY A 1 66 ? 16.483  -7.630  8.536   1.00 0.00 ? 66 GLY A C    5  
ATOM 5524  O O    . GLY A 1 66 ? 17.298  -7.282  7.681   1.00 0.00 ? 66 GLY A O    5  
ATOM 5525  H H    . GLY A 1 66 ? 15.510  -5.141  7.618   1.00 0.00 ? 66 GLY A H    5  
ATOM 5526  H HA2  . GLY A 1 66 ? 15.541  -6.640  10.165  1.00 0.00 ? 66 GLY A HA2  5  
ATOM 5527  H HA3  . GLY A 1 66 ? 14.469  -7.014  8.824   1.00 0.00 ? 66 GLY A HA3  5  
ATOM 5528  N N    . PRO A 1 67 ? 16.454  -8.877  9.030   1.00 0.00 ? 67 PRO A N    5  
ATOM 5529  C CA   . PRO A 1 67 ? 17.385  -9.923  8.594   1.00 0.00 ? 67 PRO A CA   5  
ATOM 5530  C C    . PRO A 1 67 ? 17.118  -10.378 7.163   1.00 0.00 ? 67 PRO A C    5  
ATOM 5531  O O    . PRO A 1 67 ? 16.211  -11.172 6.914   1.00 0.00 ? 67 PRO A O    5  
ATOM 5532  C CB   . PRO A 1 67 ? 17.120  -11.066 9.577   1.00 0.00 ? 67 PRO A CB   5  
ATOM 5533  C CG   . PRO A 1 67 ? 15.719  -10.851 10.038  1.00 0.00 ? 67 PRO A CG   5  
ATOM 5534  C CD   . PRO A 1 67 ? 15.510  -9.362  10.050  1.00 0.00 ? 67 PRO A CD   5  
ATOM 5535  H HA   . PRO A 1 67 ? 18.413  -9.601  8.682   1.00 0.00 ? 67 PRO A HA   5  
ATOM 5536  H HB2  . PRO A 1 67 ? 17.229  -12.013 9.069   1.00 0.00 ? 67 PRO A HB2  5  
ATOM 5537  H HB3  . PRO A 1 67 ? 17.818  -11.008 10.398  1.00 0.00 ? 67 PRO A HB3  5  
ATOM 5538  H HG2  . PRO A 1 67 ? 15.031  -11.321 9.352   1.00 0.00 ? 67 PRO A HG2  5  
ATOM 5539  H HG3  . PRO A 1 67 ? 15.594  -11.255 11.032  1.00 0.00 ? 67 PRO A HG3  5  
ATOM 5540  H HD2  . PRO A 1 67 ? 14.493  -9.122  9.780   1.00 0.00 ? 67 PRO A HD2  5  
ATOM 5541  H HD3  . PRO A 1 67 ? 15.751  -8.956  11.021  1.00 0.00 ? 67 PRO A HD3  5  
ATOM 5542  N N    . SER A 1 68 ? 17.913  -9.870  6.227   1.00 0.00 ? 68 SER A N    5  
ATOM 5543  C CA   . SER A 1 68 ? 17.759  -10.222 4.821   1.00 0.00 ? 68 SER A CA   5  
ATOM 5544  C C    . SER A 1 68 ? 19.039  -9.927  4.044   1.00 0.00 ? 68 SER A C    5  
ATOM 5545  O O    . SER A 1 68 ? 19.465  -8.777  3.941   1.00 0.00 ? 68 SER A O    5  
ATOM 5546  C CB   . SER A 1 68 ? 16.588  -9.453  4.206   1.00 0.00 ? 68 SER A CB   5  
ATOM 5547  O OG   . SER A 1 68 ? 16.058  -10.142 3.086   1.00 0.00 ? 68 SER A OG   5  
ATOM 5548  H H    . SER A 1 68 ? 18.618  -9.241  6.489   1.00 0.00 ? 68 SER A H    5  
ATOM 5549  H HA   . SER A 1 68 ? 17.554  -11.280 4.764   1.00 0.00 ? 68 SER A HA   5  
ATOM 5550  H HB2  . SER A 1 68 ? 15.809  -9.338  4.944   1.00 0.00 ? 68 SER A HB2  5  
ATOM 5551  H HB3  . SER A 1 68 ? 16.929  -8.479  3.886   1.00 0.00 ? 68 SER A HB3  5  
ATOM 5552  H HG   . SER A 1 68 ? 15.230  -10.560 3.330   1.00 0.00 ? 68 SER A HG   5  
ATOM 5553  N N    . SER A 1 69 ? 19.648  -10.976 3.499   1.00 0.00 ? 69 SER A N    5  
ATOM 5554  C CA   . SER A 1 69 ? 20.882  -10.832 2.735   1.00 0.00 ? 69 SER A CA   5  
ATOM 5555  C C    . SER A 1 69 ? 20.746  -11.475 1.358   1.00 0.00 ? 69 SER A C    5  
ATOM 5556  O O    . SER A 1 69 ? 21.660  -12.146 0.882   1.00 0.00 ? 69 SER A O    5  
ATOM 5557  C CB   . SER A 1 69 ? 22.052  -11.462 3.492   1.00 0.00 ? 69 SER A CB   5  
ATOM 5558  O OG   . SER A 1 69 ? 22.449  -10.652 4.584   1.00 0.00 ? 69 SER A OG   5  
ATOM 5559  H H    . SER A 1 69 ? 19.259  -11.868 3.617   1.00 0.00 ? 69 SER A H    5  
ATOM 5560  H HA   . SER A 1 69 ? 21.072  -9.776  2.609   1.00 0.00 ? 69 SER A HA   5  
ATOM 5561  H HB2  . SER A 1 69 ? 21.755  -12.430 3.867   1.00 0.00 ? 69 SER A HB2  5  
ATOM 5562  H HB3  . SER A 1 69 ? 22.891  -11.578 2.821   1.00 0.00 ? 69 SER A HB3  5  
ATOM 5563  H HG   . SER A 1 69 ? 21.927  -10.877 5.358   1.00 0.00 ? 69 SER A HG   5  
ATOM 5564  N N    . GLY A 1 70 ? 19.596  -11.264 0.724   1.00 0.00 ? 70 GLY A N    5  
ATOM 5565  C CA   . GLY A 1 70 ? 19.361  -11.829 -0.592  1.00 0.00 ? 70 GLY A CA   5  
ATOM 5566  C C    . GLY A 1 70 ? 20.504  -11.564 -1.550  1.00 0.00 ? 70 GLY A C    5  
ATOM 5567  O O    . GLY A 1 70 ? 20.613  -12.211 -2.592  1.00 0.00 ? 70 GLY A O    5  
ATOM 5568  H H    . GLY A 1 70 ? 18.903  -10.720 1.153   1.00 0.00 ? 70 GLY A H    5  
ATOM 5569  H HA2  . GLY A 1 70 ? 19.227  -12.896 -0.494  1.00 0.00 ? 70 GLY A HA2  5  
ATOM 5570  H HA3  . GLY A 1 70 ? 18.457  -11.399 -0.999  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 5571  N N    . GLY A 1 1  ? 23.155  11.542  7.559   1.00 0.00 ? 1  GLY A N    6  
ATOM 5572  C CA   . GLY A 1 1  ? 21.741  11.766  7.795   1.00 0.00 ? 1  GLY A CA   6  
ATOM 5573  C C    . GLY A 1 1  ? 21.323  13.194  7.505   1.00 0.00 ? 1  GLY A C    6  
ATOM 5574  O O    . GLY A 1 1  ? 21.874  14.137  8.073   1.00 0.00 ? 1  GLY A O    6  
ATOM 5575  H H1   . GLY A 1 1  ? 23.454  11.173  6.701   1.00 0.00 ? 1  GLY A H1   6  
ATOM 5576  H HA2  . GLY A 1 1  ? 21.172  11.100  7.164   1.00 0.00 ? 1  GLY A HA2  6  
ATOM 5577  H HA3  . GLY A 1 1  ? 21.521  11.542  8.829   1.00 0.00 ? 1  GLY A HA3  6  
ATOM 5578  N N    . SER A 1 2  ? 20.347  13.354  6.617   1.00 0.00 ? 2  SER A N    6  
ATOM 5579  C CA   . SER A 1 2  ? 19.859  14.678  6.248   1.00 0.00 ? 2  SER A CA   6  
ATOM 5580  C C    . SER A 1 2  ? 18.485  14.588  5.591   1.00 0.00 ? 2  SER A C    6  
ATOM 5581  O O    . SER A 1 2  ? 18.322  13.947  4.553   1.00 0.00 ? 2  SER A O    6  
ATOM 5582  C CB   . SER A 1 2  ? 20.846  15.362  5.300   1.00 0.00 ? 2  SER A CB   6  
ATOM 5583  O OG   . SER A 1 2  ? 21.130  14.542  4.180   1.00 0.00 ? 2  SER A OG   6  
ATOM 5584  H H    . SER A 1 2  ? 19.947  12.563  6.198   1.00 0.00 ? 2  SER A H    6  
ATOM 5585  H HA   . SER A 1 2  ? 19.776  15.264  7.151   1.00 0.00 ? 2  SER A HA   6  
ATOM 5586  H HB2  . SER A 1 2  ? 20.421  16.291  4.951   1.00 0.00 ? 2  SER A HB2  6  
ATOM 5587  H HB3  . SER A 1 2  ? 21.768  15.563  5.827   1.00 0.00 ? 2  SER A HB3  6  
ATOM 5588  H HG   . SER A 1 2  ? 21.798  13.894  4.419   1.00 0.00 ? 2  SER A HG   6  
ATOM 5589  N N    . SER A 1 3  ? 17.499  15.234  6.205   1.00 0.00 ? 3  SER A N    6  
ATOM 5590  C CA   . SER A 1 3  ? 16.138  15.224  5.683   1.00 0.00 ? 3  SER A CA   6  
ATOM 5591  C C    . SER A 1 3  ? 15.429  16.540  5.989   1.00 0.00 ? 3  SER A C    6  
ATOM 5592  O O    . SER A 1 3  ? 15.624  17.131  7.050   1.00 0.00 ? 3  SER A O    6  
ATOM 5593  C CB   . SER A 1 3  ? 15.349  14.056  6.280   1.00 0.00 ? 3  SER A CB   6  
ATOM 5594  O OG   . SER A 1 3  ? 15.515  12.881  5.507   1.00 0.00 ? 3  SER A OG   6  
ATOM 5595  H H    . SER A 1 3  ? 17.692  15.727  7.030   1.00 0.00 ? 3  SER A H    6  
ATOM 5596  H HA   . SER A 1 3  ? 16.194  15.099  4.612   1.00 0.00 ? 3  SER A HA   6  
ATOM 5597  H HB2  . SER A 1 3  ? 15.698  13.865  7.283   1.00 0.00 ? 3  SER A HB2  6  
ATOM 5598  H HB3  . SER A 1 3  ? 14.299  14.311  6.306   1.00 0.00 ? 3  SER A HB3  6  
ATOM 5599  H HG   . SER A 1 3  ? 16.451  12.711  5.379   1.00 0.00 ? 3  SER A HG   6  
ATOM 5600  N N    . GLY A 1 4  ? 14.605  16.993  5.049   1.00 0.00 ? 4  GLY A N    6  
ATOM 5601  C CA   . GLY A 1 4  ? 13.879  18.236  5.236   1.00 0.00 ? 4  GLY A CA   6  
ATOM 5602  C C    . GLY A 1 4  ? 12.667  18.341  4.331   1.00 0.00 ? 4  GLY A C    6  
ATOM 5603  O O    . GLY A 1 4  ? 11.612  18.817  4.749   1.00 0.00 ? 4  GLY A O    6  
ATOM 5604  H H    . GLY A 1 4  ? 14.488  16.479  4.223   1.00 0.00 ? 4  GLY A H    6  
ATOM 5605  H HA2  . GLY A 1 4  ? 13.555  18.300  6.264   1.00 0.00 ? 4  GLY A HA2  6  
ATOM 5606  H HA3  . GLY A 1 4  ? 14.543  19.062  5.026   1.00 0.00 ? 4  GLY A HA3  6  
ATOM 5607  N N    . SER A 1 5  ? 12.819  17.897  3.088   1.00 0.00 ? 5  SER A N    6  
ATOM 5608  C CA   . SER A 1 5  ? 11.729  17.949  2.120   1.00 0.00 ? 5  SER A CA   6  
ATOM 5609  C C    . SER A 1 5  ? 10.783  16.766  2.303   1.00 0.00 ? 5  SER A C    6  
ATOM 5610  O O    . SER A 1 5  ? 10.883  15.762  1.597   1.00 0.00 ? 5  SER A O    6  
ATOM 5611  C CB   . SER A 1 5  ? 12.285  17.956  0.694   1.00 0.00 ? 5  SER A CB   6  
ATOM 5612  O OG   . SER A 1 5  ? 13.089  19.101  0.467   1.00 0.00 ? 5  SER A OG   6  
ATOM 5613  H H    . SER A 1 5  ? 13.685  17.529  2.814   1.00 0.00 ? 5  SER A H    6  
ATOM 5614  H HA   . SER A 1 5  ? 11.180  18.863  2.288   1.00 0.00 ? 5  SER A HA   6  
ATOM 5615  H HB2  . SER A 1 5  ? 12.886  17.073  0.540   1.00 0.00 ? 5  SER A HB2  6  
ATOM 5616  H HB3  . SER A 1 5  ? 11.465  17.961  -0.009  1.00 0.00 ? 5  SER A HB3  6  
ATOM 5617  H HG   . SER A 1 5  ? 13.663  18.944  -0.287  1.00 0.00 ? 5  SER A HG   6  
ATOM 5618  N N    . SER A 1 6  ? 9.866   16.892  3.256   1.00 0.00 ? 6  SER A N    6  
ATOM 5619  C CA   . SER A 1 6  ? 8.904   15.832  3.536   1.00 0.00 ? 6  SER A CA   6  
ATOM 5620  C C    . SER A 1 6  ? 8.473   15.136  2.249   1.00 0.00 ? 6  SER A C    6  
ATOM 5621  O O    . SER A 1 6  ? 8.395   13.909  2.189   1.00 0.00 ? 6  SER A O    6  
ATOM 5622  C CB   . SER A 1 6  ? 7.679   16.403  4.254   1.00 0.00 ? 6  SER A CB   6  
ATOM 5623  O OG   . SER A 1 6  ? 6.987   17.323  3.429   1.00 0.00 ? 6  SER A OG   6  
ATOM 5624  H H    . SER A 1 6  ? 9.837   17.717  3.785   1.00 0.00 ? 6  SER A H    6  
ATOM 5625  H HA   . SER A 1 6  ? 9.384   15.110  4.179   1.00 0.00 ? 6  SER A HA   6  
ATOM 5626  H HB2  . SER A 1 6  ? 7.010   15.597  4.515   1.00 0.00 ? 6  SER A HB2  6  
ATOM 5627  H HB3  . SER A 1 6  ? 7.997   16.912  5.153   1.00 0.00 ? 6  SER A HB3  6  
ATOM 5628  H HG   . SER A 1 6  ? 7.569   18.053  3.203   1.00 0.00 ? 6  SER A HG   6  
ATOM 5629  N N    . GLY A 1 7  ? 8.195   15.929  1.218   1.00 0.00 ? 7  GLY A N    6  
ATOM 5630  C CA   . GLY A 1 7  ? 7.775   15.372  -0.054  1.00 0.00 ? 7  GLY A CA   6  
ATOM 5631  C C    . GLY A 1 7  ? 6.271   15.412  -0.237  1.00 0.00 ? 7  GLY A C    6  
ATOM 5632  O O    . GLY A 1 7  ? 5.596   14.391  -0.107  1.00 0.00 ? 7  GLY A O    6  
ATOM 5633  H H    . GLY A 1 7  ? 8.274   16.900  1.323   1.00 0.00 ? 7  GLY A H    6  
ATOM 5634  H HA2  . GLY A 1 7  ? 8.240   15.933  -0.851  1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5635  H HA3  . GLY A 1 7  ? 8.106   14.345  -0.111  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5636  N N    . ARG A 1 8  ? 5.744   16.594  -0.539  1.00 0.00 ? 8  ARG A N    6  
ATOM 5637  C CA   . ARG A 1 8  ? 4.310   16.764  -0.737  1.00 0.00 ? 8  ARG A CA   6  
ATOM 5638  C C    . ARG A 1 8  ? 3.999   17.110  -2.190  1.00 0.00 ? 8  ARG A C    6  
ATOM 5639  O O    . ARG A 1 8  ? 4.178   18.250  -2.620  1.00 0.00 ? 8  ARG A O    6  
ATOM 5640  C CB   . ARG A 1 8  ? 3.772   17.859  0.186   1.00 0.00 ? 8  ARG A CB   6  
ATOM 5641  C CG   . ARG A 1 8  ? 3.950   17.551  1.664   1.00 0.00 ? 8  ARG A CG   6  
ATOM 5642  C CD   . ARG A 1 8  ? 2.767   16.772  2.217   1.00 0.00 ? 8  ARG A CD   6  
ATOM 5643  N NE   . ARG A 1 8  ? 2.665   16.890  3.669   1.00 0.00 ? 8  ARG A NE   6  
ATOM 5644  C CZ   . ARG A 1 8  ? 1.590   16.530  4.362   1.00 0.00 ? 8  ARG A CZ   6  
ATOM 5645  N NH1  . ARG A 1 8  ? 0.532   16.031  3.738   1.00 0.00 ? 8  ARG A NH1  6  
ATOM 5646  N NH2  . ARG A 1 8  ? 1.573   16.667  5.682   1.00 0.00 ? 8  ARG A NH2  6  
ATOM 5647  H H    . ARG A 1 8  ? 6.334   17.371  -0.630  1.00 0.00 ? 8  ARG A H    6  
ATOM 5648  H HA   . ARG A 1 8  ? 3.828   15.829  -0.491  1.00 0.00 ? 8  ARG A HA   6  
ATOM 5649  H HB2  . ARG A 1 8  ? 4.288   18.782  -0.031  1.00 0.00 ? 8  ARG A HB2  6  
ATOM 5650  H HB3  . ARG A 1 8  ? 2.718   17.990  -0.008  1.00 0.00 ? 8  ARG A HB3  6  
ATOM 5651  H HG2  . ARG A 1 8  ? 4.846   16.963  1.794   1.00 0.00 ? 8  ARG A HG2  6  
ATOM 5652  H HG3  . ARG A 1 8  ? 4.044   18.480  2.206   1.00 0.00 ? 8  ARG A HG3  6  
ATOM 5653  H HD2  . ARG A 1 8  ? 1.861   17.154  1.770   1.00 0.00 ? 8  ARG A HD2  6  
ATOM 5654  H HD3  . ARG A 1 8  ? 2.885   15.731  1.957   1.00 0.00 ? 8  ARG A HD3  6  
ATOM 5655  H HE   . ARG A 1 8  ? 3.436   17.256  4.150   1.00 0.00 ? 8  ARG A HE   6  
ATOM 5656  H HH11 . ARG A 1 8  ? 0.542   15.925  2.744   1.00 0.00 ? 8  ARG A HH11 6  
ATOM 5657  H HH12 . ARG A 1 8  ? -0.276  15.759  4.263   1.00 0.00 ? 8  ARG A HH12 6  
ATOM 5658  H HH21 . ARG A 1 8  ? 2.369   17.043  6.155   1.00 0.00 ? 8  ARG A HH21 6  
ATOM 5659  H HH22 . ARG A 1 8  ? 0.764   16.396  6.202   1.00 0.00 ? 8  ARG A HH22 6  
ATOM 5660  N N    . LYS A 1 9  ? 3.533   16.119  -2.943  1.00 0.00 ? 9  LYS A N    6  
ATOM 5661  C CA   . LYS A 1 9  ? 3.196   16.318  -4.347  1.00 0.00 ? 9  LYS A CA   6  
ATOM 5662  C C    . LYS A 1 9  ? 1.723   16.016  -4.601  1.00 0.00 ? 9  LYS A C    6  
ATOM 5663  O O    . LYS A 1 9  ? 1.139   15.110  -4.007  1.00 0.00 ? 9  LYS A O    6  
ATOM 5664  C CB   . LYS A 1 9  ? 4.071   15.428  -5.234  1.00 0.00 ? 9  LYS A CB   6  
ATOM 5665  C CG   . LYS A 1 9  ? 5.559   15.677  -5.065  1.00 0.00 ? 9  LYS A CG   6  
ATOM 5666  C CD   . LYS A 1 9  ? 6.374   14.441  -5.407  1.00 0.00 ? 9  LYS A CD   6  
ATOM 5667  C CE   . LYS A 1 9  ? 7.852   14.769  -5.550  1.00 0.00 ? 9  LYS A CE   6  
ATOM 5668  N NZ   . LYS A 1 9  ? 8.457   15.180  -4.253  1.00 0.00 ? 9  LYS A NZ   6  
ATOM 5669  H H    . LYS A 1 9  ? 3.412   15.232  -2.543  1.00 0.00 ? 9  LYS A H    6  
ATOM 5670  H HA   . LYS A 1 9  ? 3.386   17.352  -4.591  1.00 0.00 ? 9  LYS A HA   6  
ATOM 5671  H HB2  . LYS A 1 9  ? 3.870   14.394  -4.994  1.00 0.00 ? 9  LYS A HB2  6  
ATOM 5672  H HB3  . LYS A 1 9  ? 3.812   15.605  -6.268  1.00 0.00 ? 9  LYS A HB3  6  
ATOM 5673  H HG2  . LYS A 1 9  ? 5.857   16.483  -5.720  1.00 0.00 ? 9  LYS A HG2  6  
ATOM 5674  H HG3  . LYS A 1 9  ? 5.755   15.954  -4.039  1.00 0.00 ? 9  LYS A HG3  6  
ATOM 5675  H HD2  . LYS A 1 9  ? 6.253   13.712  -4.619  1.00 0.00 ? 9  LYS A HD2  6  
ATOM 5676  H HD3  . LYS A 1 9  ? 6.013   14.029  -6.339  1.00 0.00 ? 9  LYS A HD3  6  
ATOM 5677  H HE2  . LYS A 1 9  ? 8.368   13.895  -5.917  1.00 0.00 ? 9  LYS A HE2  6  
ATOM 5678  H HE3  . LYS A 1 9  ? 7.961   15.575  -6.260  1.00 0.00 ? 9  LYS A HE3  6  
ATOM 5679  H HZ1  . LYS A 1 9  ? 9.143   14.465  -3.936  1.00 0.00 ? 9  LYS A HZ1  6  
ATOM 5680  H HZ2  . LYS A 1 9  ? 7.717   15.278  -3.528  1.00 0.00 ? 9  LYS A HZ2  6  
ATOM 5681  H HZ3  . LYS A 1 9  ? 8.946   16.092  -4.359  1.00 0.00 ? 9  LYS A HZ3  6  
ATOM 5682  N N    . PRO A 1 10 ? 1.107   16.790  -5.507  1.00 0.00 ? 10 PRO A N    6  
ATOM 5683  C CA   . PRO A 1 10 ? -0.306  16.622  -5.861  1.00 0.00 ? 10 PRO A CA   6  
ATOM 5684  C C    . PRO A 1 10 ? -0.559  15.338  -6.643  1.00 0.00 ? 10 PRO A C    6  
ATOM 5685  O O    . PRO A 1 10 ? 0.310   14.866  -7.377  1.00 0.00 ? 10 PRO A O    6  
ATOM 5686  C CB   . PRO A 1 10 ? -0.600  17.846  -6.733  1.00 0.00 ? 10 PRO A CB   6  
ATOM 5687  C CG   . PRO A 1 10 ? 0.721   18.231  -7.304  1.00 0.00 ? 10 PRO A CG   6  
ATOM 5688  C CD   . PRO A 1 10 ? 1.741   17.889  -6.254  1.00 0.00 ? 10 PRO A CD   6  
ATOM 5689  H HA   . PRO A 1 10 ? -0.939  16.641  -4.987  1.00 0.00 ? 10 PRO A HA   6  
ATOM 5690  H HB2  . PRO A 1 10 ? -1.304  17.577  -7.508  1.00 0.00 ? 10 PRO A HB2  6  
ATOM 5691  H HB3  . PRO A 1 10 ? -1.012  18.636  -6.123  1.00 0.00 ? 10 PRO A HB3  6  
ATOM 5692  H HG2  . PRO A 1 10 ? 0.908   17.670  -8.207  1.00 0.00 ? 10 PRO A HG2  6  
ATOM 5693  H HG3  . PRO A 1 10 ? 0.736   19.291  -7.510  1.00 0.00 ? 10 PRO A HG3  6  
ATOM 5694  H HD2  . PRO A 1 10 ? 2.661   17.561  -6.715  1.00 0.00 ? 10 PRO A HD2  6  
ATOM 5695  H HD3  . PRO A 1 10 ? 1.921   18.738  -5.611  1.00 0.00 ? 10 PRO A HD3  6  
ATOM 5696  N N    . ARG A 1 11 ? -1.753  14.778  -6.482  1.00 0.00 ? 11 ARG A N    6  
ATOM 5697  C CA   . ARG A 1 11 ? -2.119  13.547  -7.173  1.00 0.00 ? 11 ARG A CA   6  
ATOM 5698  C C    . ARG A 1 11 ? -1.189  12.404  -6.778  1.00 0.00 ? 11 ARG A C    6  
ATOM 5699  O O    . ARG A 1 11 ? -0.703  11.661  -7.631  1.00 0.00 ? 11 ARG A O    6  
ATOM 5700  C CB   . ARG A 1 11 ? -2.075  13.755  -8.688  1.00 0.00 ? 11 ARG A CB   6  
ATOM 5701  C CG   . ARG A 1 11 ? -2.688  12.611  -9.478  1.00 0.00 ? 11 ARG A CG   6  
ATOM 5702  C CD   . ARG A 1 11 ? -2.837  12.966  -10.949 1.00 0.00 ? 11 ARG A CD   6  
ATOM 5703  N NE   . ARG A 1 11 ? -3.759  12.068  -11.639 1.00 0.00 ? 11 ARG A NE   6  
ATOM 5704  C CZ   . ARG A 1 11 ? -4.315  12.344  -12.813 1.00 0.00 ? 11 ARG A CZ   6  
ATOM 5705  N NH1  . ARG A 1 11 ? -4.043  13.489  -13.425 1.00 0.00 ? 11 ARG A NH1  6  
ATOM 5706  N NH2  . ARG A 1 11 ? -5.143  11.476  -13.377 1.00 0.00 ? 11 ARG A NH2  6  
ATOM 5707  H H    . ARG A 1 11 ? -2.403  15.202  -5.884  1.00 0.00 ? 11 ARG A H    6  
ATOM 5708  H HA   . ARG A 1 11 ? -3.127  13.292  -6.883  1.00 0.00 ? 11 ARG A HA   6  
ATOM 5709  H HB2  . ARG A 1 11 ? -2.612  14.660  -8.932  1.00 0.00 ? 11 ARG A HB2  6  
ATOM 5710  H HB3  . ARG A 1 11 ? -1.045  13.864  -8.994  1.00 0.00 ? 11 ARG A HB3  6  
ATOM 5711  H HG2  . ARG A 1 11 ? -2.050  11.743  -9.392  1.00 0.00 ? 11 ARG A HG2  6  
ATOM 5712  H HG3  . ARG A 1 11 ? -3.662  12.386  -9.070  1.00 0.00 ? 11 ARG A HG3  6  
ATOM 5713  H HD2  . ARG A 1 11 ? -3.210  13.977  -11.025 1.00 0.00 ? 11 ARG A HD2  6  
ATOM 5714  H HD3  . ARG A 1 11 ? -1.868  12.904  -11.420 1.00 0.00 ? 11 ARG A HD3  6  
ATOM 5715  H HE   . ARG A 1 11 ? -3.973  11.216  -11.204 1.00 0.00 ? 11 ARG A HE   6  
ATOM 5716  H HH11 . ARG A 1 11 ? -3.418  14.145  -13.003 1.00 0.00 ? 11 ARG A HH11 6  
ATOM 5717  H HH12 . ARG A 1 11 ? -4.462  13.694  -14.310 1.00 0.00 ? 11 ARG A HH12 6  
ATOM 5718  H HH21 . ARG A 1 11 ? -5.350  10.612  -12.919 1.00 0.00 ? 11 ARG A HH21 6  
ATOM 5719  H HH22 . ARG A 1 11 ? -5.561  11.685  -14.261 1.00 0.00 ? 11 ARG A HH22 6  
ATOM 5720  N N    . THR A 1 12 ? -0.943  12.270  -5.478  1.00 0.00 ? 12 THR A N    6  
ATOM 5721  C CA   . THR A 1 12 ? -0.070  11.220  -4.970  1.00 0.00 ? 12 THR A CA   6  
ATOM 5722  C C    . THR A 1 12 ? -0.294  9.910   -5.716  1.00 0.00 ? 12 THR A C    6  
ATOM 5723  O O    . THR A 1 12 ? -1.355  9.691   -6.300  1.00 0.00 ? 12 THR A O    6  
ATOM 5724  C CB   . THR A 1 12 ? -0.293  10.984  -3.464  1.00 0.00 ? 12 THR A CB   6  
ATOM 5725  O OG1  . THR A 1 12 ? -0.121  12.211  -2.745  1.00 0.00 ? 12 THR A OG1  6  
ATOM 5726  C CG2  . THR A 1 12 ? 0.674   9.938   -2.931  1.00 0.00 ? 12 THR A CG2  6  
ATOM 5727  H H    . THR A 1 12 ? -1.360  12.894  -4.847  1.00 0.00 ? 12 THR A H    6  
ATOM 5728  H HA   . THR A 1 12 ? 0.952   11.537  -5.115  1.00 0.00 ? 12 THR A HA   6  
ATOM 5729  H HB   . THR A 1 12 ? -1.303  10.628  -3.316  1.00 0.00 ? 12 THR A HB   6  
ATOM 5730  H HG1  . THR A 1 12 ? 0.483   12.781  -3.226  1.00 0.00 ? 12 THR A HG1  6  
ATOM 5731  H HG21 . THR A 1 12 ? 0.517   9.004   -3.451  1.00 0.00 ? 12 THR A HG21 6  
ATOM 5732  H HG22 . THR A 1 12 ? 0.503   9.795   -1.874  1.00 0.00 ? 12 THR A HG22 6  
ATOM 5733  H HG23 . THR A 1 12 ? 1.688   10.272  -3.090  1.00 0.00 ? 12 THR A HG23 6  
ATOM 5734  N N    . ILE A 1 13 ? 0.712   9.042   -5.692  1.00 0.00 ? 13 ILE A N    6  
ATOM 5735  C CA   . ILE A 1 13 ? 0.624   7.752   -6.366  1.00 0.00 ? 13 ILE A CA   6  
ATOM 5736  C C    . ILE A 1 13 ? -0.676  7.036   -6.014  1.00 0.00 ? 13 ILE A C    6  
ATOM 5737  O O    . ILE A 1 13 ? -1.103  6.121   -6.718  1.00 0.00 ? 13 ILE A O    6  
ATOM 5738  C CB   . ILE A 1 13 ? 1.813   6.844   -6.002  1.00 0.00 ? 13 ILE A CB   6  
ATOM 5739  C CG1  . ILE A 1 13 ? 3.134   7.534   -6.347  1.00 0.00 ? 13 ILE A CG1  6  
ATOM 5740  C CG2  . ILE A 1 13 ? 1.701   5.510   -6.724  1.00 0.00 ? 13 ILE A CG2  6  
ATOM 5741  C CD1  . ILE A 1 13 ? 3.665   8.413   -5.236  1.00 0.00 ? 13 ILE A CD1  6  
ATOM 5742  H H    . ILE A 1 13 ? 1.533   9.274   -5.210  1.00 0.00 ? 13 ILE A H    6  
ATOM 5743  H HA   . ILE A 1 13 ? 0.646   7.931   -7.432  1.00 0.00 ? 13 ILE A HA   6  
ATOM 5744  H HB   . ILE A 1 13 ? 1.780   6.655   -4.940  1.00 0.00 ? 13 ILE A HB   6  
ATOM 5745  H HG12 . ILE A 1 13 ? 3.879   6.784   -6.560  1.00 0.00 ? 13 ILE A HG12 6  
ATOM 5746  H HG13 . ILE A 1 13 ? 2.991   8.153   -7.221  1.00 0.00 ? 13 ILE A HG13 6  
ATOM 5747  H HG21 . ILE A 1 13 ? 1.536   5.683   -7.777  1.00 0.00 ? 13 ILE A HG21 6  
ATOM 5748  H HG22 . ILE A 1 13 ? 2.615   4.951   -6.591  1.00 0.00 ? 13 ILE A HG22 6  
ATOM 5749  H HG23 . ILE A 1 13 ? 0.873   4.948   -6.317  1.00 0.00 ? 13 ILE A HG23 6  
ATOM 5750  H HD11 . ILE A 1 13 ? 4.712   8.199   -5.077  1.00 0.00 ? 13 ILE A HD11 6  
ATOM 5751  H HD12 . ILE A 1 13 ? 3.546   9.450   -5.509  1.00 0.00 ? 13 ILE A HD12 6  
ATOM 5752  H HD13 . ILE A 1 13 ? 3.116   8.214   -4.327  1.00 0.00 ? 13 ILE A HD13 6  
ATOM 5753  N N    . TYR A 1 14 ? -1.300  7.459   -4.920  1.00 0.00 ? 14 TYR A N    6  
ATOM 5754  C CA   . TYR A 1 14 ? -2.551  6.858   -4.473  1.00 0.00 ? 14 TYR A CA   6  
ATOM 5755  C C    . TYR A 1 14 ? -3.514  7.923   -3.959  1.00 0.00 ? 14 TYR A C    6  
ATOM 5756  O O    . TYR A 1 14 ? -3.103  8.892   -3.320  1.00 0.00 ? 14 TYR A O    6  
ATOM 5757  C CB   . TYR A 1 14 ? -2.282  5.826   -3.377  1.00 0.00 ? 14 TYR A CB   6  
ATOM 5758  C CG   . TYR A 1 14 ? -1.739  4.515   -3.899  1.00 0.00 ? 14 TYR A CG   6  
ATOM 5759  C CD1  . TYR A 1 14 ? -0.399  4.380   -4.238  1.00 0.00 ? 14 TYR A CD1  6  
ATOM 5760  C CD2  . TYR A 1 14 ? -2.568  3.410   -4.054  1.00 0.00 ? 14 TYR A CD2  6  
ATOM 5761  C CE1  . TYR A 1 14 ? 0.101   3.185   -4.717  1.00 0.00 ? 14 TYR A CE1  6  
ATOM 5762  C CE2  . TYR A 1 14 ? -2.076  2.210   -4.530  1.00 0.00 ? 14 TYR A CE2  6  
ATOM 5763  C CZ   . TYR A 1 14 ? -0.742  2.102   -4.861  1.00 0.00 ? 14 TYR A CZ   6  
ATOM 5764  O OH   . TYR A 1 14 ? -0.247  0.909   -5.336  1.00 0.00 ? 14 TYR A OH   6  
ATOM 5765  H H    . TYR A 1 14 ? -0.910  8.192   -4.400  1.00 0.00 ? 14 TYR A H    6  
ATOM 5766  H HA   . TYR A 1 14 ? -3.001  6.360   -5.320  1.00 0.00 ? 14 TYR A HA   6  
ATOM 5767  H HB2  . TYR A 1 14 ? -1.561  6.228   -2.682  1.00 0.00 ? 14 TYR A HB2  6  
ATOM 5768  H HB3  . TYR A 1 14 ? -3.203  5.618   -2.853  1.00 0.00 ? 14 TYR A HB3  6  
ATOM 5769  H HD1  . TYR A 1 14 ? 0.259   5.230   -4.124  1.00 0.00 ? 14 TYR A HD1  6  
ATOM 5770  H HD2  . TYR A 1 14 ? -3.613  3.497   -3.794  1.00 0.00 ? 14 TYR A HD2  6  
ATOM 5771  H HE1  . TYR A 1 14 ? 1.146   3.100   -4.975  1.00 0.00 ? 14 TYR A HE1  6  
ATOM 5772  H HE2  . TYR A 1 14 ? -2.736  1.362   -4.643  1.00 0.00 ? 14 TYR A HE2  6  
ATOM 5773  H HH   . TYR A 1 14 ? 0.700   0.873   -5.186  1.00 0.00 ? 14 TYR A HH   6  
ATOM 5774  N N    . SER A 1 15 ? -4.799  7.736   -4.242  1.00 0.00 ? 15 SER A N    6  
ATOM 5775  C CA   . SER A 1 15 ? -5.823  8.681   -3.812  1.00 0.00 ? 15 SER A CA   6  
ATOM 5776  C C    . SER A 1 15 ? -5.955  8.684   -2.292  1.00 0.00 ? 15 SER A C    6  
ATOM 5777  O O    . SER A 1 15 ? -5.806  7.649   -1.643  1.00 0.00 ? 15 SER A O    6  
ATOM 5778  C CB   . SER A 1 15 ? -7.168  8.335   -4.451  1.00 0.00 ? 15 SER A CB   6  
ATOM 5779  O OG   . SER A 1 15 ? -8.089  9.403   -4.312  1.00 0.00 ? 15 SER A OG   6  
ATOM 5780  H H    . SER A 1 15 ? -5.065  6.944   -4.755  1.00 0.00 ? 15 SER A H    6  
ATOM 5781  H HA   . SER A 1 15 ? -5.522  9.666   -4.137  1.00 0.00 ? 15 SER A HA   6  
ATOM 5782  H HB2  . SER A 1 15 ? -7.024  8.135   -5.502  1.00 0.00 ? 15 SER A HB2  6  
ATOM 5783  H HB3  . SER A 1 15 ? -7.577  7.458   -3.970  1.00 0.00 ? 15 SER A HB3  6  
ATOM 5784  H HG   . SER A 1 15 ? -8.963  9.051   -4.129  1.00 0.00 ? 15 SER A HG   6  
ATOM 5785  N N    . SER A 1 16 ? -6.235  9.856   -1.731  1.00 0.00 ? 16 SER A N    6  
ATOM 5786  C CA   . SER A 1 16 ? -6.384  9.996   -0.287  1.00 0.00 ? 16 SER A CA   6  
ATOM 5787  C C    . SER A 1 16 ? -7.334  8.939   0.267   1.00 0.00 ? 16 SER A C    6  
ATOM 5788  O O    . SER A 1 16 ? -7.038  8.283   1.266   1.00 0.00 ? 16 SER A O    6  
ATOM 5789  C CB   . SER A 1 16 ? -6.899  11.394  0.061   1.00 0.00 ? 16 SER A CB   6  
ATOM 5790  O OG   . SER A 1 16 ? -8.050  11.717  -0.701  1.00 0.00 ? 16 SER A OG   6  
ATOM 5791  H H    . SER A 1 16 ? -6.342  10.646  -2.302  1.00 0.00 ? 16 SER A H    6  
ATOM 5792  H HA   . SER A 1 16 ? -5.411  9.859   0.161   1.00 0.00 ? 16 SER A HA   6  
ATOM 5793  H HB2  . SER A 1 16 ? -7.155  11.430  1.109   1.00 0.00 ? 16 SER A HB2  6  
ATOM 5794  H HB3  . SER A 1 16 ? -6.128  12.121  -0.147  1.00 0.00 ? 16 SER A HB3  6  
ATOM 5795  H HG   . SER A 1 16 ? -7.984  11.311  -1.569  1.00 0.00 ? 16 SER A HG   6  
ATOM 5796  N N    . PHE A 1 17 ? -8.478  8.779   -0.390  1.00 0.00 ? 17 PHE A N    6  
ATOM 5797  C CA   . PHE A 1 17 ? -9.474  7.803   0.035   1.00 0.00 ? 17 PHE A CA   6  
ATOM 5798  C C    . PHE A 1 17 ? -8.891  6.392   0.028   1.00 0.00 ? 17 PHE A C    6  
ATOM 5799  O O    . PHE A 1 17 ? -9.113  5.614   0.955   1.00 0.00 ? 17 PHE A O    6  
ATOM 5800  C CB   . PHE A 1 17 ? -10.702 7.864   -0.876  1.00 0.00 ? 17 PHE A CB   6  
ATOM 5801  C CG   . PHE A 1 17 ? -11.630 6.695   -0.711  1.00 0.00 ? 17 PHE A CG   6  
ATOM 5802  C CD1  . PHE A 1 17 ? -12.496 6.628   0.368   1.00 0.00 ? 17 PHE A CD1  6  
ATOM 5803  C CD2  . PHE A 1 17 ? -11.636 5.663   -1.636  1.00 0.00 ? 17 PHE A CD2  6  
ATOM 5804  C CE1  . PHE A 1 17 ? -13.351 5.553   0.522   1.00 0.00 ? 17 PHE A CE1  6  
ATOM 5805  C CE2  . PHE A 1 17 ? -12.489 4.585   -1.487  1.00 0.00 ? 17 PHE A CE2  6  
ATOM 5806  C CZ   . PHE A 1 17 ? -13.348 4.530   -0.407  1.00 0.00 ? 17 PHE A CZ   6  
ATOM 5807  H H    . PHE A 1 17 ? -8.657  9.332   -1.180  1.00 0.00 ? 17 PHE A H    6  
ATOM 5808  H HA   . PHE A 1 17 ? -9.772  8.051   1.042   1.00 0.00 ? 17 PHE A HA   6  
ATOM 5809  H HB2  . PHE A 1 17 ? -11.259 8.762   -0.658  1.00 0.00 ? 17 PHE A HB2  6  
ATOM 5810  H HB3  . PHE A 1 17 ? -10.376 7.888   -1.905  1.00 0.00 ? 17 PHE A HB3  6  
ATOM 5811  H HD1  . PHE A 1 17 ? -12.501 7.427   1.095   1.00 0.00 ? 17 PHE A HD1  6  
ATOM 5812  H HD2  . PHE A 1 17 ? -10.964 5.704   -2.482  1.00 0.00 ? 17 PHE A HD2  6  
ATOM 5813  H HE1  . PHE A 1 17 ? -14.022 5.513   1.367   1.00 0.00 ? 17 PHE A HE1  6  
ATOM 5814  H HE2  . PHE A 1 17 ? -12.484 3.788   -2.215  1.00 0.00 ? 17 PHE A HE2  6  
ATOM 5815  H HZ   . PHE A 1 17 ? -14.014 3.689   -0.288  1.00 0.00 ? 17 PHE A HZ   6  
ATOM 5816  N N    . GLN A 1 18 ? -8.146  6.072   -1.025  1.00 0.00 ? 18 GLN A N    6  
ATOM 5817  C CA   . GLN A 1 18 ? -7.532  4.756   -1.154  1.00 0.00 ? 18 GLN A CA   6  
ATOM 5818  C C    . GLN A 1 18 ? -6.455  4.551   -0.093  1.00 0.00 ? 18 GLN A C    6  
ATOM 5819  O O    . GLN A 1 18 ? -6.305  3.456   0.451   1.00 0.00 ? 18 GLN A O    6  
ATOM 5820  C CB   . GLN A 1 18 ? -6.929  4.586   -2.549  1.00 0.00 ? 18 GLN A CB   6  
ATOM 5821  C CG   . GLN A 1 18 ? -7.969  4.427   -3.646  1.00 0.00 ? 18 GLN A CG   6  
ATOM 5822  C CD   . GLN A 1 18 ? -7.357  4.405   -5.033  1.00 0.00 ? 18 GLN A CD   6  
ATOM 5823  O OE1  . GLN A 1 18 ? -6.195  4.769   -5.217  1.00 0.00 ? 18 GLN A OE1  6  
ATOM 5824  N NE2  . GLN A 1 18 ? -8.137  3.977   -6.018  1.00 0.00 ? 18 GLN A NE2  6  
ATOM 5825  H H    . GLN A 1 18 ? -8.006  6.736   -1.731  1.00 0.00 ? 18 GLN A H    6  
ATOM 5826  H HA   . GLN A 1 18 ? -8.304  4.015   -1.013  1.00 0.00 ? 18 GLN A HA   6  
ATOM 5827  H HB2  . GLN A 1 18 ? -6.327  5.453   -2.777  1.00 0.00 ? 18 GLN A HB2  6  
ATOM 5828  H HB3  . GLN A 1 18 ? -6.299  3.709   -2.552  1.00 0.00 ? 18 GLN A HB3  6  
ATOM 5829  H HG2  . GLN A 1 18 ? -8.500  3.500   -3.490  1.00 0.00 ? 18 GLN A HG2  6  
ATOM 5830  H HG3  . GLN A 1 18 ? -8.663  5.252   -3.588  1.00 0.00 ? 18 GLN A HG3  6  
ATOM 5831  H HE21 . GLN A 1 18 ? -9.052  3.704   -5.798  1.00 0.00 ? 18 GLN A HE21 6  
ATOM 5832  H HE22 . GLN A 1 18 ? -7.767  3.953   -6.925  1.00 0.00 ? 18 GLN A HE22 6  
ATOM 5833  N N    . LEU A 1 19 ? -5.707  5.611   0.196   1.00 0.00 ? 19 LEU A N    6  
ATOM 5834  C CA   . LEU A 1 19 ? -4.643  5.547   1.192   1.00 0.00 ? 19 LEU A CA   6  
ATOM 5835  C C    . LEU A 1 19 ? -5.219  5.373   2.593   1.00 0.00 ? 19 LEU A C    6  
ATOM 5836  O O    . LEU A 1 19 ? -4.874  4.430   3.304   1.00 0.00 ? 19 LEU A O    6  
ATOM 5837  C CB   . LEU A 1 19 ? -3.787  6.813   1.133   1.00 0.00 ? 19 LEU A CB   6  
ATOM 5838  C CG   . LEU A 1 19 ? -2.645  6.805   0.116   1.00 0.00 ? 19 LEU A CG   6  
ATOM 5839  C CD1  . LEU A 1 19 ? -1.760  8.028   0.297   1.00 0.00 ? 19 LEU A CD1  6  
ATOM 5840  C CD2  . LEU A 1 19 ? -1.827  5.529   0.244   1.00 0.00 ? 19 LEU A CD2  6  
ATOM 5841  H H    . LEU A 1 19 ? -5.874  6.456   -0.271  1.00 0.00 ? 19 LEU A H    6  
ATOM 5842  H HA   . LEU A 1 19 ? -4.024  4.693   0.961   1.00 0.00 ? 19 LEU A HA   6  
ATOM 5843  H HB2  . LEU A 1 19 ? -4.437  7.641   0.893   1.00 0.00 ? 19 LEU A HB2  6  
ATOM 5844  H HB3  . LEU A 1 19 ? -3.358  6.967   2.113   1.00 0.00 ? 19 LEU A HB3  6  
ATOM 5845  H HG   . LEU A 1 19 ? -3.060  6.839   -0.882  1.00 0.00 ? 19 LEU A HG   6  
ATOM 5846  H HD11 . LEU A 1 19 ? -2.355  8.852   0.662   1.00 0.00 ? 19 LEU A HD11 6  
ATOM 5847  H HD12 . LEU A 1 19 ? -1.318  8.296   -0.651  1.00 0.00 ? 19 LEU A HD12 6  
ATOM 5848  H HD13 . LEU A 1 19 ? -0.978  7.805   1.009   1.00 0.00 ? 19 LEU A HD13 6  
ATOM 5849  H HD21 . LEU A 1 19 ? -2.191  4.796   -0.462  1.00 0.00 ? 19 LEU A HD21 6  
ATOM 5850  H HD22 . LEU A 1 19 ? -1.921  5.140   1.247   1.00 0.00 ? 19 LEU A HD22 6  
ATOM 5851  H HD23 . LEU A 1 19 ? -0.789  5.744   0.036   1.00 0.00 ? 19 LEU A HD23 6  
ATOM 5852  N N    . ALA A 1 20 ? -6.099  6.289   2.984   1.00 0.00 ? 20 ALA A N    6  
ATOM 5853  C CA   . ALA A 1 20 ? -6.726  6.235   4.298   1.00 0.00 ? 20 ALA A CA   6  
ATOM 5854  C C    . ALA A 1 20 ? -6.964  4.793   4.734   1.00 0.00 ? 20 ALA A C    6  
ATOM 5855  O O    . ALA A 1 20 ? -6.587  4.398   5.837   1.00 0.00 ? 20 ALA A O    6  
ATOM 5856  C CB   . ALA A 1 20 ? -8.037  7.008   4.291   1.00 0.00 ? 20 ALA A CB   6  
ATOM 5857  H H    . ALA A 1 20 ? -6.334  7.018   2.372   1.00 0.00 ? 20 ALA A H    6  
ATOM 5858  H HA   . ALA A 1 20 ? -6.061  6.709   5.005   1.00 0.00 ? 20 ALA A HA   6  
ATOM 5859  H HB1  . ALA A 1 20 ? -8.659  6.668   5.105   1.00 0.00 ? 20 ALA A HB1  6  
ATOM 5860  H HB2  . ALA A 1 20 ? -7.833  8.062   4.408   1.00 0.00 ? 20 ALA A HB2  6  
ATOM 5861  H HB3  . ALA A 1 20 ? -8.547  6.842   3.354   1.00 0.00 ? 20 ALA A HB3  6  
ATOM 5862  N N    . ALA A 1 21 ? -7.591  4.011   3.861   1.00 0.00 ? 21 ALA A N    6  
ATOM 5863  C CA   . ALA A 1 21 ? -7.877  2.613   4.156   1.00 0.00 ? 21 ALA A CA   6  
ATOM 5864  C C    . ALA A 1 21 ? -6.602  1.777   4.142   1.00 0.00 ? 21 ALA A C    6  
ATOM 5865  O O    . ALA A 1 21 ? -6.328  1.028   5.081   1.00 0.00 ? 21 ALA A O    6  
ATOM 5866  C CB   . ALA A 1 21 ? -8.885  2.059   3.160   1.00 0.00 ? 21 ALA A CB   6  
ATOM 5867  H H    . ALA A 1 21 ? -7.867  4.384   2.998   1.00 0.00 ? 21 ALA A H    6  
ATOM 5868  H HA   . ALA A 1 21 ? -8.318  2.563   5.142   1.00 0.00 ? 21 ALA A HA   6  
ATOM 5869  H HB1  . ALA A 1 21 ? -8.804  2.601   2.228   1.00 0.00 ? 21 ALA A HB1  6  
ATOM 5870  H HB2  . ALA A 1 21 ? -8.682  1.013   2.987   1.00 0.00 ? 21 ALA A HB2  6  
ATOM 5871  H HB3  . ALA A 1 21 ? -9.883  2.172   3.556   1.00 0.00 ? 21 ALA A HB3  6  
ATOM 5872  N N    . LEU A 1 22 ? -5.826  1.909   3.072   1.00 0.00 ? 22 LEU A N    6  
ATOM 5873  C CA   . LEU A 1 22 ? -4.578  1.165   2.936   1.00 0.00 ? 22 LEU A CA   6  
ATOM 5874  C C    . LEU A 1 22 ? -3.743  1.263   4.208   1.00 0.00 ? 22 LEU A C    6  
ATOM 5875  O O    . LEU A 1 22 ? -3.416  0.251   4.826   1.00 0.00 ? 22 LEU A O    6  
ATOM 5876  C CB   . LEU A 1 22 ? -3.776  1.689   1.744   1.00 0.00 ? 22 LEU A CB   6  
ATOM 5877  C CG   . LEU A 1 22 ? -4.205  1.177   0.368   1.00 0.00 ? 22 LEU A CG   6  
ATOM 5878  C CD1  . LEU A 1 22 ? -3.365  1.818   -0.726  1.00 0.00 ? 22 LEU A CD1  6  
ATOM 5879  C CD2  . LEU A 1 22 ? -4.098  -0.339  0.306   1.00 0.00 ? 22 LEU A CD2  6  
ATOM 5880  H H    . LEU A 1 22 ? -6.096  2.521   2.357   1.00 0.00 ? 22 LEU A H    6  
ATOM 5881  H HA   . LEU A 1 22 ? -4.828  0.128   2.763   1.00 0.00 ? 22 LEU A HA   6  
ATOM 5882  H HB2  . LEU A 1 22 ? -3.860  2.765   1.737   1.00 0.00 ? 22 LEU A HB2  6  
ATOM 5883  H HB3  . LEU A 1 22 ? -2.742  1.412   1.894   1.00 0.00 ? 22 LEU A HB3  6  
ATOM 5884  H HG   . LEU A 1 22 ? -5.238  1.448   0.196   1.00 0.00 ? 22 LEU A HG   6  
ATOM 5885  H HD11 . LEU A 1 22 ? -3.671  1.432   -1.686  1.00 0.00 ? 22 LEU A HD11 6  
ATOM 5886  H HD12 . LEU A 1 22 ? -2.323  1.588   -0.560  1.00 0.00 ? 22 LEU A HD12 6  
ATOM 5887  H HD13 . LEU A 1 22 ? -3.504  2.889   -0.706  1.00 0.00 ? 22 LEU A HD13 6  
ATOM 5888  H HD21 . LEU A 1 22 ? -3.533  -0.624  -0.568  1.00 0.00 ? 22 LEU A HD21 6  
ATOM 5889  H HD22 . LEU A 1 22 ? -5.089  -0.768  0.250   1.00 0.00 ? 22 LEU A HD22 6  
ATOM 5890  H HD23 . LEU A 1 22 ? -3.598  -0.701  1.192   1.00 0.00 ? 22 LEU A HD23 6  
ATOM 5891  N N    . GLN A 1 23 ? -3.404  2.489   4.594   1.00 0.00 ? 23 GLN A N    6  
ATOM 5892  C CA   . GLN A 1 23 ? -2.609  2.719   5.794   1.00 0.00 ? 23 GLN A CA   6  
ATOM 5893  C C    . GLN A 1 23 ? -3.295  2.131   7.023   1.00 0.00 ? 23 GLN A C    6  
ATOM 5894  O O    . GLN A 1 23 ? -2.639  1.583   7.909   1.00 0.00 ? 23 GLN A O    6  
ATOM 5895  C CB   . GLN A 1 23 ? -2.372  4.217   5.995   1.00 0.00 ? 23 GLN A CB   6  
ATOM 5896  C CG   . GLN A 1 23 ? -1.262  4.780   5.123   1.00 0.00 ? 23 GLN A CG   6  
ATOM 5897  C CD   . GLN A 1 23 ? -0.780  6.138   5.595   1.00 0.00 ? 23 GLN A CD   6  
ATOM 5898  O OE1  . GLN A 1 23 ? -0.157  6.255   6.650   1.00 0.00 ? 23 GLN A OE1  6  
ATOM 5899  N NE2  . GLN A 1 23 ? -1.068  7.173   4.814   1.00 0.00 ? 23 GLN A NE2  6  
ATOM 5900  H H    . GLN A 1 23 ? -3.696  3.256   4.059   1.00 0.00 ? 23 GLN A H    6  
ATOM 5901  H HA   . GLN A 1 23 ? -1.657  2.229   5.660   1.00 0.00 ? 23 GLN A HA   6  
ATOM 5902  H HB2  . GLN A 1 23 ? -3.285  4.747   5.767   1.00 0.00 ? 23 GLN A HB2  6  
ATOM 5903  H HB3  . GLN A 1 23 ? -2.112  4.393   7.029   1.00 0.00 ? 23 GLN A HB3  6  
ATOM 5904  H HG2  . GLN A 1 23 ? -0.428  4.095   5.137   1.00 0.00 ? 23 GLN A HG2  6  
ATOM 5905  H HG3  . GLN A 1 23 ? -1.631  4.877   4.112   1.00 0.00 ? 23 GLN A HG3  6  
ATOM 5906  H HE21 . GLN A 1 23 ? -1.569  7.004   3.989   1.00 0.00 ? 23 GLN A HE21 6  
ATOM 5907  H HE22 . GLN A 1 23 ? -0.769  8.062   5.096   1.00 0.00 ? 23 GLN A HE22 6  
ATOM 5908  N N    . ARG A 1 24 ? -4.618  2.250   7.070   1.00 0.00 ? 24 ARG A N    6  
ATOM 5909  C CA   . ARG A 1 24 ? -5.392  1.731   8.191   1.00 0.00 ? 24 ARG A CA   6  
ATOM 5910  C C    . ARG A 1 24 ? -5.117  0.245   8.401   1.00 0.00 ? 24 ARG A C    6  
ATOM 5911  O O    . ARG A 1 24 ? -4.851  -0.195  9.519   1.00 0.00 ? 24 ARG A O    6  
ATOM 5912  C CB   . ARG A 1 24 ? -6.887  1.955   7.953   1.00 0.00 ? 24 ARG A CB   6  
ATOM 5913  C CG   . ARG A 1 24 ? -7.688  2.125   9.233   1.00 0.00 ? 24 ARG A CG   6  
ATOM 5914  C CD   . ARG A 1 24 ? -9.130  2.511   8.940   1.00 0.00 ? 24 ARG A CD   6  
ATOM 5915  N NE   . ARG A 1 24 ? -10.004 2.271   10.085  1.00 0.00 ? 24 ARG A NE   6  
ATOM 5916  C CZ   . ARG A 1 24 ? -11.318 2.465   10.060  1.00 0.00 ? 24 ARG A CZ   6  
ATOM 5917  N NH1  . ARG A 1 24 ? -11.906 2.899   8.954   1.00 0.00 ? 24 ARG A NH1  6  
ATOM 5918  N NH2  . ARG A 1 24 ? -12.046 2.224   11.143  1.00 0.00 ? 24 ARG A NH2  6  
ATOM 5919  H H    . ARG A 1 24 ? -5.084  2.697   6.333   1.00 0.00 ? 24 ARG A H    6  
ATOM 5920  H HA   . ARG A 1 24 ? -5.093  2.269   9.078   1.00 0.00 ? 24 ARG A HA   6  
ATOM 5921  H HB2  . ARG A 1 24 ? -7.015  2.844   7.353   1.00 0.00 ? 24 ARG A HB2  6  
ATOM 5922  H HB3  . ARG A 1 24 ? -7.284  1.108   7.415   1.00 0.00 ? 24 ARG A HB3  6  
ATOM 5923  H HG2  . ARG A 1 24 ? -7.681  1.193   9.778   1.00 0.00 ? 24 ARG A HG2  6  
ATOM 5924  H HG3  . ARG A 1 24 ? -7.232  2.899   9.832   1.00 0.00 ? 24 ARG A HG3  6  
ATOM 5925  H HD2  . ARG A 1 24 ? -9.163  3.561   8.688   1.00 0.00 ? 24 ARG A HD2  6  
ATOM 5926  H HD3  . ARG A 1 24 ? -9.481  1.929   8.102   1.00 0.00 ? 24 ARG A HD3  6  
ATOM 5927  H HE   . ARG A 1 24 ? -9.590  1.950   10.913  1.00 0.00 ? 24 ARG A HE   6  
ATOM 5928  H HH11 . ARG A 1 24 ? -11.360 3.081   8.137   1.00 0.00 ? 24 ARG A HH11 6  
ATOM 5929  H HH12 . ARG A 1 24 ? -12.896 3.043   8.937   1.00 0.00 ? 24 ARG A HH12 6  
ATOM 5930  H HH21 . ARG A 1 24 ? -11.606 1.896   11.978  1.00 0.00 ? 24 ARG A HH21 6  
ATOM 5931  H HH22 . ARG A 1 24 ? -13.035 2.370   11.123  1.00 0.00 ? 24 ARG A HH22 6  
ATOM 5932  N N    . ARG A 1 25 ? -5.183  -0.523  7.318   1.00 0.00 ? 25 ARG A N    6  
ATOM 5933  C CA   . ARG A 1 25 ? -4.942  -1.959  7.384   1.00 0.00 ? 25 ARG A CA   6  
ATOM 5934  C C    . ARG A 1 25 ? -3.461  -2.253  7.598   1.00 0.00 ? 25 ARG A C    6  
ATOM 5935  O O    . ARG A 1 25 ? -3.097  -3.113  8.401   1.00 0.00 ? 25 ARG A O    6  
ATOM 5936  C CB   . ARG A 1 25 ? -5.427  -2.638  6.101   1.00 0.00 ? 25 ARG A CB   6  
ATOM 5937  C CG   . ARG A 1 25 ? -5.418  -4.156  6.175   1.00 0.00 ? 25 ARG A CG   6  
ATOM 5938  C CD   . ARG A 1 25 ? -6.541  -4.678  7.058   1.00 0.00 ? 25 ARG A CD   6  
ATOM 5939  N NE   . ARG A 1 25 ? -7.804  -4.782  6.333   1.00 0.00 ? 25 ARG A NE   6  
ATOM 5940  C CZ   . ARG A 1 25 ? -8.985  -4.908  6.929   1.00 0.00 ? 25 ARG A CZ   6  
ATOM 5941  N NH1  . ARG A 1 25 ? -9.063  -4.945  8.252   1.00 0.00 ? 25 ARG A NH1  6  
ATOM 5942  N NH2  . ARG A 1 25 ? -10.090 -4.997  6.200   1.00 0.00 ? 25 ARG A NH2  6  
ATOM 5943  H H    . ARG A 1 25 ? -5.399  -0.113  6.454   1.00 0.00 ? 25 ARG A H    6  
ATOM 5944  H HA   . ARG A 1 25 ? -5.500  -2.351  8.221   1.00 0.00 ? 25 ARG A HA   6  
ATOM 5945  H HB2  . ARG A 1 25 ? -6.438  -2.316  5.897   1.00 0.00 ? 25 ARG A HB2  6  
ATOM 5946  H HB3  . ARG A 1 25 ? -4.790  -2.335  5.285   1.00 0.00 ? 25 ARG A HB3  6  
ATOM 5947  H HG2  . ARG A 1 25 ? -5.542  -4.557  5.180   1.00 0.00 ? 25 ARG A HG2  6  
ATOM 5948  H HG3  . ARG A 1 25 ? -4.472  -4.481  6.581   1.00 0.00 ? 25 ARG A HG3  6  
ATOM 5949  H HD2  . ARG A 1 25 ? -6.266  -5.655  7.427   1.00 0.00 ? 25 ARG A HD2  6  
ATOM 5950  H HD3  . ARG A 1 25 ? -6.669  -4.003  7.891   1.00 0.00 ? 25 ARG A HD3  6  
ATOM 5951  H HE   . ARG A 1 25 ? -7.769  -4.757  5.355   1.00 0.00 ? 25 ARG A HE   6  
ATOM 5952  H HH11 . ARG A 1 25 ? -8.232  -4.877  8.803   1.00 0.00 ? 25 ARG A HH11 6  
ATOM 5953  H HH12 . ARG A 1 25 ? -9.954  -5.039  8.697   1.00 0.00 ? 25 ARG A HH12 6  
ATOM 5954  H HH21 . ARG A 1 25 ? -10.035 -4.970  5.202   1.00 0.00 ? 25 ARG A HH21 6  
ATOM 5955  H HH22 . ARG A 1 25 ? -10.978 -5.092  6.649   1.00 0.00 ? 25 ARG A HH22 6  
ATOM 5956  N N    . PHE A 1 26 ? -2.609  -1.533  6.875   1.00 0.00 ? 26 PHE A N    6  
ATOM 5957  C CA   . PHE A 1 26 ? -1.167  -1.717  6.985   1.00 0.00 ? 26 PHE A CA   6  
ATOM 5958  C C    . PHE A 1 26 ? -0.748  -1.873  8.444   1.00 0.00 ? 26 PHE A C    6  
ATOM 5959  O O    . PHE A 1 26 ? -0.010  -2.794  8.793   1.00 0.00 ? 26 PHE A O    6  
ATOM 5960  C CB   . PHE A 1 26 ? -0.430  -0.533  6.355   1.00 0.00 ? 26 PHE A CB   6  
ATOM 5961  C CG   . PHE A 1 26 ? 1.030   -0.792  6.119   1.00 0.00 ? 26 PHE A CG   6  
ATOM 5962  C CD1  . PHE A 1 26 ? 1.440   -1.850  5.324   1.00 0.00 ? 26 PHE A CD1  6  
ATOM 5963  C CD2  . PHE A 1 26 ? 1.993   0.021   6.694   1.00 0.00 ? 26 PHE A CD2  6  
ATOM 5964  C CE1  . PHE A 1 26 ? 2.783   -2.091  5.104   1.00 0.00 ? 26 PHE A CE1  6  
ATOM 5965  C CE2  . PHE A 1 26 ? 3.338   -0.215  6.478   1.00 0.00 ? 26 PHE A CE2  6  
ATOM 5966  C CZ   . PHE A 1 26 ? 3.733   -1.273  5.683   1.00 0.00 ? 26 PHE A CZ   6  
ATOM 5967  H H    . PHE A 1 26 ? -2.959  -0.862  6.252   1.00 0.00 ? 26 PHE A H    6  
ATOM 5968  H HA   . PHE A 1 26 ? -0.907  -2.618  6.450   1.00 0.00 ? 26 PHE A HA   6  
ATOM 5969  H HB2  . PHE A 1 26 ? -0.884  -0.302  5.403   1.00 0.00 ? 26 PHE A HB2  6  
ATOM 5970  H HB3  . PHE A 1 26 ? -0.516  0.322   7.008   1.00 0.00 ? 26 PHE A HB3  6  
ATOM 5971  H HD1  . PHE A 1 26 ? 0.697   -2.491  4.870   1.00 0.00 ? 26 PHE A HD1  6  
ATOM 5972  H HD2  . PHE A 1 26 ? 1.686   0.848   7.317   1.00 0.00 ? 26 PHE A HD2  6  
ATOM 5973  H HE1  . PHE A 1 26 ? 3.089   -2.919  4.482   1.00 0.00 ? 26 PHE A HE1  6  
ATOM 5974  H HE2  . PHE A 1 26 ? 4.079   0.426   6.932   1.00 0.00 ? 26 PHE A HE2  6  
ATOM 5975  H HZ   . PHE A 1 26 ? 4.783   -1.459  5.512   1.00 0.00 ? 26 PHE A HZ   6  
ATOM 5976  N N    . GLN A 1 27 ? -1.225  -0.966  9.291   1.00 0.00 ? 27 GLN A N    6  
ATOM 5977  C CA   . GLN A 1 27 ? -0.899  -1.002  10.711  1.00 0.00 ? 27 GLN A CA   6  
ATOM 5978  C C    . GLN A 1 27 ? -1.328  -2.326  11.335  1.00 0.00 ? 27 GLN A C    6  
ATOM 5979  O O    . GLN A 1 27 ? -0.558  -2.966  12.051  1.00 0.00 ? 27 GLN A O    6  
ATOM 5980  C CB   . GLN A 1 27 ? -1.573  0.161   11.440  1.00 0.00 ? 27 GLN A CB   6  
ATOM 5981  C CG   . GLN A 1 27 ? -1.029  1.525   11.044  1.00 0.00 ? 27 GLN A CG   6  
ATOM 5982  C CD   . GLN A 1 27 ? 0.486   1.563   11.018  1.00 0.00 ? 27 GLN A CD   6  
ATOM 5983  O OE1  . GLN A 1 27 ? 1.148   1.029   11.908  1.00 0.00 ? 27 GLN A OE1  6  
ATOM 5984  N NE2  . GLN A 1 27 ? 1.044   2.197   9.993   1.00 0.00 ? 27 GLN A NE2  6  
ATOM 5985  H H    . GLN A 1 27 ? -1.808  -0.256  8.952   1.00 0.00 ? 27 GLN A H    6  
ATOM 5986  H HA   . GLN A 1 27 ? 0.172   -0.904  10.808  1.00 0.00 ? 27 GLN A HA   6  
ATOM 5987  H HB2  . GLN A 1 27 ? -2.630  0.142   11.223  1.00 0.00 ? 27 GLN A HB2  6  
ATOM 5988  H HB3  . GLN A 1 27 ? -1.430  0.036   12.503  1.00 0.00 ? 27 GLN A HB3  6  
ATOM 5989  H HG2  . GLN A 1 27 ? -1.397  1.773   10.060  1.00 0.00 ? 27 GLN A HG2  6  
ATOM 5990  H HG3  . GLN A 1 27 ? -1.381  2.258   11.755  1.00 0.00 ? 27 GLN A HG3  6  
ATOM 5991  H HE21 . GLN A 1 27 ? 0.454   2.600   9.321   1.00 0.00 ? 27 GLN A HE21 6  
ATOM 5992  H HE22 . GLN A 1 27 ? 2.022   2.238   9.951   1.00 0.00 ? 27 GLN A HE22 6  
ATOM 5993  N N    . LYS A 1 28 ? -2.563  -2.731  11.059  1.00 0.00 ? 28 LYS A N    6  
ATOM 5994  C CA   . LYS A 1 28 ? -3.097  -3.979  11.592  1.00 0.00 ? 28 LYS A CA   6  
ATOM 5995  C C    . LYS A 1 28 ? -2.147  -5.140  11.313  1.00 0.00 ? 28 LYS A C    6  
ATOM 5996  O O    . LYS A 1 28 ? -1.678  -5.807  12.236  1.00 0.00 ? 28 LYS A O    6  
ATOM 5997  C CB   . LYS A 1 28 ? -4.469  -4.273  10.982  1.00 0.00 ? 28 LYS A CB   6  
ATOM 5998  C CG   . LYS A 1 28 ? -5.383  -5.069  11.897  1.00 0.00 ? 28 LYS A CG   6  
ATOM 5999  C CD   . LYS A 1 28 ? -6.656  -5.492  11.183  1.00 0.00 ? 28 LYS A CD   6  
ATOM 6000  C CE   . LYS A 1 28 ? -7.805  -5.686  12.160  1.00 0.00 ? 28 LYS A CE   6  
ATOM 6001  N NZ   . LYS A 1 28 ? -8.557  -4.422  12.392  1.00 0.00 ? 28 LYS A NZ   6  
ATOM 6002  H H    . LYS A 1 28 ? -3.130  -2.177  10.482  1.00 0.00 ? 28 LYS A H    6  
ATOM 6003  H HA   . LYS A 1 28 ? -3.203  -3.865  12.660  1.00 0.00 ? 28 LYS A HA   6  
ATOM 6004  H HB2  . LYS A 1 28 ? -4.954  -3.336  10.750  1.00 0.00 ? 28 LYS A HB2  6  
ATOM 6005  H HB3  . LYS A 1 28 ? -4.332  -4.833  10.069  1.00 0.00 ? 28 LYS A HB3  6  
ATOM 6006  H HG2  . LYS A 1 28 ? -4.861  -5.953  12.233  1.00 0.00 ? 28 LYS A HG2  6  
ATOM 6007  H HG3  . LYS A 1 28 ? -5.645  -4.458  12.750  1.00 0.00 ? 28 LYS A HG3  6  
ATOM 6008  H HD2  . LYS A 1 28 ? -6.930  -4.728  10.471  1.00 0.00 ? 28 LYS A HD2  6  
ATOM 6009  H HD3  . LYS A 1 28 ? -6.475  -6.422  10.664  1.00 0.00 ? 28 LYS A HD3  6  
ATOM 6010  H HE2  . LYS A 1 28 ? -8.480  -6.427  11.760  1.00 0.00 ? 28 LYS A HE2  6  
ATOM 6011  H HE3  . LYS A 1 28 ? -7.405  -6.035  13.101  1.00 0.00 ? 28 LYS A HE3  6  
ATOM 6012  H HZ1  . LYS A 1 28 ? -9.531  -4.634  12.689  1.00 0.00 ? 28 LYS A HZ1  6  
ATOM 6013  H HZ2  . LYS A 1 28 ? -8.588  -3.859  11.518  1.00 0.00 ? 28 LYS A HZ2  6  
ATOM 6014  H HZ3  . LYS A 1 28 ? -8.093  -3.862  13.136  1.00 0.00 ? 28 LYS A HZ3  6  
ATOM 6015  N N    . THR A 1 29 ? -1.865  -5.374  10.035  1.00 0.00 ? 29 THR A N    6  
ATOM 6016  C CA   . THR A 1 29 ? -0.970  -6.453  9.636   1.00 0.00 ? 29 THR A CA   6  
ATOM 6017  C C    . THR A 1 29 ? -0.274  -6.131  8.318   1.00 0.00 ? 29 THR A C    6  
ATOM 6018  O O    . THR A 1 29 ? -0.891  -5.603  7.394   1.00 0.00 ? 29 THR A O    6  
ATOM 6019  C CB   . THR A 1 29 ? -1.729  -7.786  9.490   1.00 0.00 ? 29 THR A CB   6  
ATOM 6020  O OG1  . THR A 1 29 ? -0.816  -8.834  9.143   1.00 0.00 ? 29 THR A OG1  6  
ATOM 6021  C CG2  . THR A 1 29 ? -2.812  -7.679  8.428   1.00 0.00 ? 29 THR A CG2  6  
ATOM 6022  H H    . THR A 1 29 ? -2.270  -4.808  9.346   1.00 0.00 ? 29 THR A H    6  
ATOM 6023  H HA   . THR A 1 29 ? -0.224  -6.571  10.407  1.00 0.00 ? 29 THR A HA   6  
ATOM 6024  H HB   . THR A 1 29 ? -2.194  -8.024  10.436  1.00 0.00 ? 29 THR A HB   6  
ATOM 6025  H HG1  . THR A 1 29 ? 0.057   -8.625  9.485   1.00 0.00 ? 29 THR A HG1  6  
ATOM 6026  H HG21 . THR A 1 29 ? -3.523  -6.918  8.714   1.00 0.00 ? 29 THR A HG21 6  
ATOM 6027  H HG22 . THR A 1 29 ? -3.319  -8.628  8.334   1.00 0.00 ? 29 THR A HG22 6  
ATOM 6028  H HG23 . THR A 1 29 ? -2.364  -7.415  7.482   1.00 0.00 ? 29 THR A HG23 6  
ATOM 6029  N N    . GLN A 1 30 ? 1.013   -6.453  8.240   1.00 0.00 ? 30 GLN A N    6  
ATOM 6030  C CA   . GLN A 1 30 ? 1.792   -6.197  7.035   1.00 0.00 ? 30 GLN A CA   6  
ATOM 6031  C C    . GLN A 1 30 ? 1.369   -7.129  5.905   1.00 0.00 ? 30 GLN A C    6  
ATOM 6032  O O    . GLN A 1 30 ? 1.385   -6.749  4.734   1.00 0.00 ? 30 GLN A O    6  
ATOM 6033  C CB   . GLN A 1 30 ? 3.285   -6.369  7.321   1.00 0.00 ? 30 GLN A CB   6  
ATOM 6034  C CG   . GLN A 1 30 ? 3.948   -5.116  7.870   1.00 0.00 ? 30 GLN A CG   6  
ATOM 6035  C CD   . GLN A 1 30 ? 3.904   -5.047  9.383   1.00 0.00 ? 30 GLN A CD   6  
ATOM 6036  O OE1  . GLN A 1 30 ? 3.324   -4.124  9.958   1.00 0.00 ? 30 GLN A OE1  6  
ATOM 6037  N NE2  . GLN A 1 30 ? 4.517   -6.025  10.039  1.00 0.00 ? 30 GLN A NE2  6  
ATOM 6038  H H    . GLN A 1 30 ? 1.448   -6.872  9.011   1.00 0.00 ? 30 GLN A H    6  
ATOM 6039  H HA   . GLN A 1 30 ? 1.608   -5.178  6.732   1.00 0.00 ? 30 GLN A HA   6  
ATOM 6040  H HB2  . GLN A 1 30 ? 3.412   -7.163  8.042   1.00 0.00 ? 30 GLN A HB2  6  
ATOM 6041  H HB3  . GLN A 1 30 ? 3.786   -6.643  6.404   1.00 0.00 ? 30 GLN A HB3  6  
ATOM 6042  H HG2  . GLN A 1 30 ? 4.980   -5.102  7.554   1.00 0.00 ? 30 GLN A HG2  6  
ATOM 6043  H HG3  . GLN A 1 30 ? 3.439   -4.251  7.469   1.00 0.00 ? 30 GLN A HG3  6  
ATOM 6044  H HE21 . GLN A 1 30 ? 4.959   -6.727  9.515   1.00 0.00 ? 30 GLN A HE21 6  
ATOM 6045  H HE22 . GLN A 1 30 ? 4.505   -6.006  11.018  1.00 0.00 ? 30 GLN A HE22 6  
ATOM 6046  N N    . TYR A 1 31 ? 0.989   -8.351  6.263   1.00 0.00 ? 31 TYR A N    6  
ATOM 6047  C CA   . TYR A 1 31 ? 0.564   -9.339  5.278   1.00 0.00 ? 31 TYR A CA   6  
ATOM 6048  C C    . TYR A 1 31 ? -0.949  -9.531  5.318   1.00 0.00 ? 31 TYR A C    6  
ATOM 6049  O O    . TYR A 1 31 ? -1.564  -9.494  6.385   1.00 0.00 ? 31 TYR A O    6  
ATOM 6050  C CB   . TYR A 1 31 ? 1.266   -10.674 5.529   1.00 0.00 ? 31 TYR A CB   6  
ATOM 6051  C CG   . TYR A 1 31 ? 2.765   -10.551 5.685   1.00 0.00 ? 31 TYR A CG   6  
ATOM 6052  C CD1  . TYR A 1 31 ? 3.328   -10.182 6.900   1.00 0.00 ? 31 TYR A CD1  6  
ATOM 6053  C CD2  . TYR A 1 31 ? 3.617   -10.805 4.618   1.00 0.00 ? 31 TYR A CD2  6  
ATOM 6054  C CE1  . TYR A 1 31 ? 4.697   -10.067 7.048   1.00 0.00 ? 31 TYR A CE1  6  
ATOM 6055  C CE2  . TYR A 1 31 ? 4.987   -10.694 4.756   1.00 0.00 ? 31 TYR A CE2  6  
ATOM 6056  C CZ   . TYR A 1 31 ? 5.522   -10.324 5.973   1.00 0.00 ? 31 TYR A CZ   6  
ATOM 6057  O OH   . TYR A 1 31 ? 6.886   -10.213 6.116   1.00 0.00 ? 31 TYR A OH   6  
ATOM 6058  H H    . TYR A 1 31 ? 0.997   -8.595  7.212   1.00 0.00 ? 31 TYR A H    6  
ATOM 6059  H HA   . TYR A 1 31 ? 0.843   -8.974  4.300   1.00 0.00 ? 31 TYR A HA   6  
ATOM 6060  H HB2  . TYR A 1 31 ? 0.874   -11.115 6.432   1.00 0.00 ? 31 TYR A HB2  6  
ATOM 6061  H HB3  . TYR A 1 31 ? 1.072   -11.336 4.697   1.00 0.00 ? 31 TYR A HB3  6  
ATOM 6062  H HD1  . TYR A 1 31 ? 2.678   -9.981  7.740   1.00 0.00 ? 31 TYR A HD1  6  
ATOM 6063  H HD2  . TYR A 1 31 ? 3.195   -11.094 3.666   1.00 0.00 ? 31 TYR A HD2  6  
ATOM 6064  H HE1  . TYR A 1 31 ? 5.116   -9.778  8.000   1.00 0.00 ? 31 TYR A HE1  6  
ATOM 6065  H HE2  . TYR A 1 31 ? 5.634   -10.895 3.915   1.00 0.00 ? 31 TYR A HE2  6  
ATOM 6066  H HH   . TYR A 1 31 ? 7.173   -10.739 6.866   1.00 0.00 ? 31 TYR A HH   6  
ATOM 6067  N N    . LEU A 1 32 ? -1.543  -9.737  4.148   1.00 0.00 ? 32 LEU A N    6  
ATOM 6068  C CA   . LEU A 1 32 ? -2.985  -9.936  4.047   1.00 0.00 ? 32 LEU A CA   6  
ATOM 6069  C C    . LEU A 1 32 ? -3.305  -11.251 3.342   1.00 0.00 ? 32 LEU A C    6  
ATOM 6070  O O    . LEU A 1 32 ? -2.665  -11.608 2.354   1.00 0.00 ? 32 LEU A O    6  
ATOM 6071  C CB   . LEU A 1 32 ? -3.629  -8.771  3.294   1.00 0.00 ? 32 LEU A CB   6  
ATOM 6072  C CG   . LEU A 1 32 ? -3.502  -7.396  3.951   1.00 0.00 ? 32 LEU A CG   6  
ATOM 6073  C CD1  . LEU A 1 32 ? -4.037  -6.312  3.027   1.00 0.00 ? 32 LEU A CD1  6  
ATOM 6074  C CD2  . LEU A 1 32 ? -4.235  -7.372  5.284   1.00 0.00 ? 32 LEU A CD2  6  
ATOM 6075  H H    . LEU A 1 32 ? -1.001  -9.756  3.333   1.00 0.00 ? 32 LEU A H    6  
ATOM 6076  H HA   . LEU A 1 32 ? -3.386  -9.973  5.049   1.00 0.00 ? 32 LEU A HA   6  
ATOM 6077  H HB2  . LEU A 1 32 ? -3.172  -8.715  2.319   1.00 0.00 ? 32 LEU A HB2  6  
ATOM 6078  H HB3  . LEU A 1 32 ? -4.682  -8.991  3.185   1.00 0.00 ? 32 LEU A HB3  6  
ATOM 6079  H HG   . LEU A 1 32 ? -2.458  -7.189  4.139   1.00 0.00 ? 32 LEU A HG   6  
ATOM 6080  H HD11 . LEU A 1 32 ? -4.970  -5.935  3.417   1.00 0.00 ? 32 LEU A HD11 6  
ATOM 6081  H HD12 . LEU A 1 32 ? -4.198  -6.726  2.043   1.00 0.00 ? 32 LEU A HD12 6  
ATOM 6082  H HD13 . LEU A 1 32 ? -3.319  -5.506  2.966   1.00 0.00 ? 32 LEU A HD13 6  
ATOM 6083  H HD21 . LEU A 1 32 ? -3.650  -7.895  6.026   1.00 0.00 ? 32 LEU A HD21 6  
ATOM 6084  H HD22 . LEU A 1 32 ? -5.195  -7.857  5.176   1.00 0.00 ? 32 LEU A HD22 6  
ATOM 6085  H HD23 . LEU A 1 32 ? -4.382  -6.348  5.596   1.00 0.00 ? 32 LEU A HD23 6  
ATOM 6086  N N    . ALA A 1 33 ? -4.301  -11.965 3.857   1.00 0.00 ? 33 ALA A N    6  
ATOM 6087  C CA   . ALA A 1 33 ? -4.708  -13.238 3.274   1.00 0.00 ? 33 ALA A CA   6  
ATOM 6088  C C    . ALA A 1 33 ? -5.251  -13.046 1.862   1.00 0.00 ? 33 ALA A C    6  
ATOM 6089  O O    . ALA A 1 33 ? -5.481  -11.919 1.422   1.00 0.00 ? 33 ALA A O    6  
ATOM 6090  C CB   . ALA A 1 33 ? -5.750  -13.912 4.155   1.00 0.00 ? 33 ALA A CB   6  
ATOM 6091  H H    . ALA A 1 33 ? -4.773  -11.627 4.646   1.00 0.00 ? 33 ALA A H    6  
ATOM 6092  H HA   . ALA A 1 33 ? -3.839  -13.879 3.231   1.00 0.00 ? 33 ALA A HA   6  
ATOM 6093  H HB1  . ALA A 1 33 ? -5.618  -13.590 5.178   1.00 0.00 ? 33 ALA A HB1  6  
ATOM 6094  H HB2  . ALA A 1 33 ? -6.738  -13.640 3.816   1.00 0.00 ? 33 ALA A HB2  6  
ATOM 6095  H HB3  . ALA A 1 33 ? -5.631  -14.983 4.097   1.00 0.00 ? 33 ALA A HB3  6  
ATOM 6096  N N    . LEU A 1 34 ? -5.454  -14.153 1.156   1.00 0.00 ? 34 LEU A N    6  
ATOM 6097  C CA   . LEU A 1 34 ? -5.969  -14.107 -0.208  1.00 0.00 ? 34 LEU A CA   6  
ATOM 6098  C C    . LEU A 1 34 ? -7.124  -13.116 -0.320  1.00 0.00 ? 34 LEU A C    6  
ATOM 6099  O O    . LEU A 1 34 ? -7.069  -12.143 -1.073  1.00 0.00 ? 34 LEU A O    6  
ATOM 6100  C CB   . LEU A 1 34 ? -6.431  -15.498 -0.647  1.00 0.00 ? 34 LEU A CB   6  
ATOM 6101  C CG   . LEU A 1 34 ? -7.625  -15.539 -1.600  1.00 0.00 ? 34 LEU A CG   6  
ATOM 6102  C CD1  . LEU A 1 34 ? -7.224  -15.042 -2.981  1.00 0.00 ? 34 LEU A CD1  6  
ATOM 6103  C CD2  . LEU A 1 34 ? -8.194  -16.948 -1.683  1.00 0.00 ? 34 LEU A CD2  6  
ATOM 6104  H H    . LEU A 1 34 ? -5.252  -15.022 1.560   1.00 0.00 ? 34 LEU A H    6  
ATOM 6105  H HA   . LEU A 1 34 ? -5.168  -13.781 -0.854  1.00 0.00 ? 34 LEU A HA   6  
ATOM 6106  H HB2  . LEU A 1 34 ? -5.600  -15.982 -1.137  1.00 0.00 ? 34 LEU A HB2  6  
ATOM 6107  H HB3  . LEU A 1 34 ? -6.695  -16.053 0.241   1.00 0.00 ? 34 LEU A HB3  6  
ATOM 6108  H HG   . LEU A 1 34 ? -8.401  -14.886 -1.224  1.00 0.00 ? 34 LEU A HG   6  
ATOM 6109  H HD11 . LEU A 1 34 ? -6.157  -15.144 -3.104  1.00 0.00 ? 34 LEU A HD11 6  
ATOM 6110  H HD12 . LEU A 1 34 ? -7.501  -14.003 -3.084  1.00 0.00 ? 34 LEU A HD12 6  
ATOM 6111  H HD13 . LEU A 1 34 ? -7.732  -15.625 -3.735  1.00 0.00 ? 34 LEU A HD13 6  
ATOM 6112  H HD21 . LEU A 1 34 ? -8.550  -17.134 -2.686  1.00 0.00 ? 34 LEU A HD21 6  
ATOM 6113  H HD22 . LEU A 1 34 ? -9.013  -17.047 -0.986  1.00 0.00 ? 34 LEU A HD22 6  
ATOM 6114  H HD23 . LEU A 1 34 ? -7.422  -17.662 -1.436  1.00 0.00 ? 34 LEU A HD23 6  
ATOM 6115  N N    . PRO A 1 35 ? -8.196  -13.367 0.447   1.00 0.00 ? 35 PRO A N    6  
ATOM 6116  C CA   . PRO A 1 35 ? -9.383  -12.508 0.453   1.00 0.00 ? 35 PRO A CA   6  
ATOM 6117  C C    . PRO A 1 35 ? -9.115  -11.153 1.100   1.00 0.00 ? 35 PRO A C    6  
ATOM 6118  O O    . PRO A 1 35 ? -9.584  -10.122 0.620   1.00 0.00 ? 35 PRO A O    6  
ATOM 6119  C CB   . PRO A 1 35 ? -10.394 -13.305 1.281   1.00 0.00 ? 35 PRO A CB   6  
ATOM 6120  C CG   . PRO A 1 35 ? -9.562  -14.172 2.161   1.00 0.00 ? 35 PRO A CG   6  
ATOM 6121  C CD   . PRO A 1 35 ? -8.330  -14.509 1.367   1.00 0.00 ? 35 PRO A CD   6  
ATOM 6122  H HA   . PRO A 1 35 ? -9.770  -12.358 -0.544  1.00 0.00 ? 35 PRO A HA   6  
ATOM 6123  H HB2  . PRO A 1 35 ? -11.006 -12.626 1.858   1.00 0.00 ? 35 PRO A HB2  6  
ATOM 6124  H HB3  . PRO A 1 35 ? -11.019 -13.892 0.625   1.00 0.00 ? 35 PRO A HB3  6  
ATOM 6125  H HG2  . PRO A 1 35 ? -9.294  -13.636 3.059   1.00 0.00 ? 35 PRO A HG2  6  
ATOM 6126  H HG3  . PRO A 1 35 ? -10.105 -15.072 2.409   1.00 0.00 ? 35 PRO A HG3  6  
ATOM 6127  H HD2  . PRO A 1 35 ? -7.471  -14.584 2.017   1.00 0.00 ? 35 PRO A HD2  6  
ATOM 6128  H HD3  . PRO A 1 35 ? -8.474  -15.429 0.820   1.00 0.00 ? 35 PRO A HD3  6  
ATOM 6129  N N    . GLU A 1 36 ? -8.357  -11.164 2.192   1.00 0.00 ? 36 GLU A N    6  
ATOM 6130  C CA   . GLU A 1 36 ? -8.027  -9.935  2.904   1.00 0.00 ? 36 GLU A CA   6  
ATOM 6131  C C    . GLU A 1 36 ? -7.456  -8.890  1.950   1.00 0.00 ? 36 GLU A C    6  
ATOM 6132  O O    . GLU A 1 36 ? -7.833  -7.719  1.997   1.00 0.00 ? 36 GLU A O    6  
ATOM 6133  C CB   . GLU A 1 36 ? -7.024  -10.221 4.024   1.00 0.00 ? 36 GLU A CB   6  
ATOM 6134  C CG   . GLU A 1 36 ? -7.608  -11.027 5.172   1.00 0.00 ? 36 GLU A CG   6  
ATOM 6135  C CD   . GLU A 1 36 ? -8.486  -10.192 6.084   1.00 0.00 ? 36 GLU A CD   6  
ATOM 6136  O OE1  . GLU A 1 36 ? -8.047  -9.097  6.491   1.00 0.00 ? 36 GLU A OE1  6  
ATOM 6137  O OE2  . GLU A 1 36 ? -9.613  -10.635 6.389   1.00 0.00 ? 36 GLU A OE2  6  
ATOM 6138  H H    . GLU A 1 36 ? -8.012  -12.018 2.526   1.00 0.00 ? 36 GLU A H    6  
ATOM 6139  H HA   . GLU A 1 36 ? -8.937  -9.549  3.339   1.00 0.00 ? 36 GLU A HA   6  
ATOM 6140  H HB2  . GLU A 1 36 ? -6.190  -10.771 3.612   1.00 0.00 ? 36 GLU A HB2  6  
ATOM 6141  H HB3  . GLU A 1 36 ? -6.665  -9.282  4.417   1.00 0.00 ? 36 GLU A HB3  6  
ATOM 6142  H HG2  . GLU A 1 36 ? -8.201  -11.832 4.765   1.00 0.00 ? 36 GLU A HG2  6  
ATOM 6143  H HG3  . GLU A 1 36 ? -6.797  -11.438 5.755   1.00 0.00 ? 36 GLU A HG3  6  
ATOM 6144  N N    . ARG A 1 37 ? -6.544  -9.322  1.086   1.00 0.00 ? 37 ARG A N    6  
ATOM 6145  C CA   . ARG A 1 37 ? -5.919  -8.424  0.122   1.00 0.00 ? 37 ARG A CA   6  
ATOM 6146  C C    . ARG A 1 37 ? -6.931  -7.954  -0.919  1.00 0.00 ? 37 ARG A C    6  
ATOM 6147  O O    . ARG A 1 37 ? -7.006  -6.767  -1.235  1.00 0.00 ? 37 ARG A O    6  
ATOM 6148  C CB   . ARG A 1 37 ? -4.746  -9.121  -0.571  1.00 0.00 ? 37 ARG A CB   6  
ATOM 6149  C CG   . ARG A 1 37 ? -4.213  -8.364  -1.776  1.00 0.00 ? 37 ARG A CG   6  
ATOM 6150  C CD   . ARG A 1 37 ? -3.431  -9.278  -2.706  1.00 0.00 ? 37 ARG A CD   6  
ATOM 6151  N NE   . ARG A 1 37 ? -4.147  -10.520 -2.984  1.00 0.00 ? 37 ARG A NE   6  
ATOM 6152  C CZ   . ARG A 1 37 ? -3.548  -11.647 -3.352  1.00 0.00 ? 37 ARG A CZ   6  
ATOM 6153  N NH1  . ARG A 1 37 ? -2.230  -11.688 -3.487  1.00 0.00 ? 37 ARG A NH1  6  
ATOM 6154  N NH2  . ARG A 1 37 ? -4.269  -12.737 -3.587  1.00 0.00 ? 37 ARG A NH2  6  
ATOM 6155  H H    . ARG A 1 37 ? -6.284  -10.267 1.097   1.00 0.00 ? 37 ARG A H    6  
ATOM 6156  H HA   . ARG A 1 37 ? -5.548  -7.565  0.660   1.00 0.00 ? 37 ARG A HA   6  
ATOM 6157  H HB2  . ARG A 1 37 ? -3.940  -9.235  0.140   1.00 0.00 ? 37 ARG A HB2  6  
ATOM 6158  H HB3  . ARG A 1 37 ? -5.067  -10.098 -0.899  1.00 0.00 ? 37 ARG A HB3  6  
ATOM 6159  H HG2  . ARG A 1 37 ? -5.045  -7.942  -2.321  1.00 0.00 ? 37 ARG A HG2  6  
ATOM 6160  H HG3  . ARG A 1 37 ? -3.565  -7.572  -1.434  1.00 0.00 ? 37 ARG A HG3  6  
ATOM 6161  H HD2  . ARG A 1 37 ? -3.257  -8.759  -3.637  1.00 0.00 ? 37 ARG A HD2  6  
ATOM 6162  H HD3  . ARG A 1 37 ? -2.484  -9.514  -2.244  1.00 0.00 ? 37 ARG A HD3  6  
ATOM 6163  H HE   . ARG A 1 37 ? -5.122  -10.512 -2.890  1.00 0.00 ? 37 ARG A HE   6  
ATOM 6164  H HH11 . ARG A 1 37 ? -1.684  -10.869 -3.310  1.00 0.00 ? 37 ARG A HH11 6  
ATOM 6165  H HH12 . ARG A 1 37 ? -1.781  -12.538 -3.763  1.00 0.00 ? 37 ARG A HH12 6  
ATOM 6166  H HH21 . ARG A 1 37 ? -5.263  -12.710 -3.486  1.00 0.00 ? 37 ARG A HH21 6  
ATOM 6167  H HH22 . ARG A 1 37 ? -3.817  -13.584 -3.864  1.00 0.00 ? 37 ARG A HH22 6  
ATOM 6168  N N    . ALA A 1 38 ? -7.707  -8.894  -1.449  1.00 0.00 ? 38 ALA A N    6  
ATOM 6169  C CA   . ALA A 1 38 ? -8.715  -8.576  -2.452  1.00 0.00 ? 38 ALA A CA   6  
ATOM 6170  C C    . ALA A 1 38 ? -9.708  -7.545  -1.925  1.00 0.00 ? 38 ALA A C    6  
ATOM 6171  O O    . ALA A 1 38 ? -10.131 -6.649  -2.655  1.00 0.00 ? 38 ALA A O    6  
ATOM 6172  C CB   . ALA A 1 38 ? -9.443  -9.839  -2.887  1.00 0.00 ? 38 ALA A CB   6  
ATOM 6173  H H    . ALA A 1 38 ? -7.600  -9.823  -1.156  1.00 0.00 ? 38 ALA A H    6  
ATOM 6174  H HA   . ALA A 1 38 ? -8.210  -8.166  -3.315  1.00 0.00 ? 38 ALA A HA   6  
ATOM 6175  H HB1  . ALA A 1 38 ? -10.420 -9.577  -3.268  1.00 0.00 ? 38 ALA A HB1  6  
ATOM 6176  H HB2  . ALA A 1 38 ? -8.875  -10.333 -3.661  1.00 0.00 ? 38 ALA A HB2  6  
ATOM 6177  H HB3  . ALA A 1 38 ? -9.553  -10.501 -2.041  1.00 0.00 ? 38 ALA A HB3  6  
ATOM 6178  N N    . GLU A 1 39 ? -10.076 -7.680  -0.655  1.00 0.00 ? 39 GLU A N    6  
ATOM 6179  C CA   . GLU A 1 39 ? -11.021 -6.761  -0.032  1.00 0.00 ? 39 GLU A CA   6  
ATOM 6180  C C    . GLU A 1 39 ? -10.642 -5.311  -0.324  1.00 0.00 ? 39 GLU A C    6  
ATOM 6181  O O    . GLU A 1 39 ? -11.481 -4.510  -0.738  1.00 0.00 ? 39 GLU A O    6  
ATOM 6182  C CB   . GLU A 1 39 ? -11.072 -6.992  1.479   1.00 0.00 ? 39 GLU A CB   6  
ATOM 6183  C CG   . GLU A 1 39 ? -12.113 -8.014  1.904   1.00 0.00 ? 39 GLU A CG   6  
ATOM 6184  C CD   . GLU A 1 39 ? -11.948 -9.344  1.195   1.00 0.00 ? 39 GLU A CD   6  
ATOM 6185  O OE1  . GLU A 1 39 ? -12.090 -9.378  -0.045  1.00 0.00 ? 39 GLU A OE1  6  
ATOM 6186  O OE2  . GLU A 1 39 ? -11.677 -10.352 1.881   1.00 0.00 ? 39 GLU A OE2  6  
ATOM 6187  H H    . GLU A 1 39 ? -9.704  -8.416  -0.125  1.00 0.00 ? 39 GLU A H    6  
ATOM 6188  H HA   . GLU A 1 39 ? -11.998 -6.956  -0.450  1.00 0.00 ? 39 GLU A HA   6  
ATOM 6189  H HB2  . GLU A 1 39 ? -10.103 -7.336  1.811   1.00 0.00 ? 39 GLU A HB2  6  
ATOM 6190  H HB3  . GLU A 1 39 ? -11.298 -6.056  1.967   1.00 0.00 ? 39 GLU A HB3  6  
ATOM 6191  H HG2  . GLU A 1 39 ? -12.026 -8.178  2.968   1.00 0.00 ? 39 GLU A HG2  6  
ATOM 6192  H HG3  . GLU A 1 39 ? -13.095 -7.623  1.681   1.00 0.00 ? 39 GLU A HG3  6  
ATOM 6193  N N    . LEU A 1 40 ? -9.374  -4.982  -0.103  1.00 0.00 ? 40 LEU A N    6  
ATOM 6194  C CA   . LEU A 1 40 ? -8.883  -3.630  -0.341  1.00 0.00 ? 40 LEU A CA   6  
ATOM 6195  C C    . LEU A 1 40 ? -8.996  -3.260  -1.817  1.00 0.00 ? 40 LEU A C    6  
ATOM 6196  O O    . LEU A 1 40 ? -9.252  -2.107  -2.160  1.00 0.00 ? 40 LEU A O    6  
ATOM 6197  C CB   . LEU A 1 40 ? -7.428  -3.506  0.116   1.00 0.00 ? 40 LEU A CB   6  
ATOM 6198  C CG   . LEU A 1 40 ? -7.101  -4.111  1.482   1.00 0.00 ? 40 LEU A CG   6  
ATOM 6199  C CD1  . LEU A 1 40 ? -5.709  -3.694  1.931   1.00 0.00 ? 40 LEU A CD1  6  
ATOM 6200  C CD2  . LEU A 1 40 ? -8.141  -3.695  2.512   1.00 0.00 ? 40 LEU A CD2  6  
ATOM 6201  H H    . LEU A 1 40 ? -8.753  -5.664  0.227   1.00 0.00 ? 40 LEU A H    6  
ATOM 6202  H HA   . LEU A 1 40 ? -9.492  -2.950  0.236   1.00 0.00 ? 40 LEU A HA   6  
ATOM 6203  H HB2  . LEU A 1 40 ? -6.808  -3.996  -0.618  1.00 0.00 ? 40 LEU A HB2  6  
ATOM 6204  H HB3  . LEU A 1 40 ? -7.181  -2.455  0.151   1.00 0.00 ? 40 LEU A HB3  6  
ATOM 6205  H HG   . LEU A 1 40 ? -7.117  -5.189  1.405   1.00 0.00 ? 40 LEU A HG   6  
ATOM 6206  H HD11 . LEU A 1 40 ? -5.701  -3.558  3.001   1.00 0.00 ? 40 LEU A HD11 6  
ATOM 6207  H HD12 . LEU A 1 40 ? -5.438  -2.767  1.448   1.00 0.00 ? 40 LEU A HD12 6  
ATOM 6208  H HD13 . LEU A 1 40 ? -4.999  -4.462  1.660   1.00 0.00 ? 40 LEU A HD13 6  
ATOM 6209  H HD21 . LEU A 1 40 ? -8.653  -2.808  2.169   1.00 0.00 ? 40 LEU A HD21 6  
ATOM 6210  H HD22 . LEU A 1 40 ? -7.653  -3.488  3.454   1.00 0.00 ? 40 LEU A HD22 6  
ATOM 6211  H HD23 . LEU A 1 40 ? -8.856  -4.494  2.645   1.00 0.00 ? 40 LEU A HD23 6  
ATOM 6212  N N    . ALA A 1 41 ? -8.806  -4.249  -2.685  1.00 0.00 ? 41 ALA A N    6  
ATOM 6213  C CA   . ALA A 1 41 ? -8.892  -4.029  -4.123  1.00 0.00 ? 41 ALA A CA   6  
ATOM 6214  C C    . ALA A 1 41 ? -10.334 -3.786  -4.557  1.00 0.00 ? 41 ALA A C    6  
ATOM 6215  O O    . ALA A 1 41 ? -10.601 -2.938  -5.408  1.00 0.00 ? 41 ALA A O    6  
ATOM 6216  C CB   . ALA A 1 41 ? -8.306  -5.215  -4.874  1.00 0.00 ? 41 ALA A CB   6  
ATOM 6217  H H    . ALA A 1 41 ? -8.605  -5.147  -2.350  1.00 0.00 ? 41 ALA A H    6  
ATOM 6218  H HA   . ALA A 1 41 ? -8.302  -3.155  -4.363  1.00 0.00 ? 41 ALA A HA   6  
ATOM 6219  H HB1  . ALA A 1 41 ? -7.308  -4.970  -5.210  1.00 0.00 ? 41 ALA A HB1  6  
ATOM 6220  H HB2  . ALA A 1 41 ? -8.265  -6.072  -4.218  1.00 0.00 ? 41 ALA A HB2  6  
ATOM 6221  H HB3  . ALA A 1 41 ? -8.927  -5.443  -5.727  1.00 0.00 ? 41 ALA A HB3  6  
ATOM 6222  N N    . ALA A 1 42 ? -11.259 -4.535  -3.966  1.00 0.00 ? 42 ALA A N    6  
ATOM 6223  C CA   . ALA A 1 42 ? -12.673 -4.400  -4.291  1.00 0.00 ? 42 ALA A CA   6  
ATOM 6224  C C    . ALA A 1 42 ? -13.297 -3.224  -3.547  1.00 0.00 ? 42 ALA A C    6  
ATOM 6225  O O    . ALA A 1 42 ? -14.283 -2.643  -4.001  1.00 0.00 ? 42 ALA A O    6  
ATOM 6226  C CB   . ALA A 1 42 ? -13.415 -5.687  -3.963  1.00 0.00 ? 42 ALA A CB   6  
ATOM 6227  H H    . ALA A 1 42 ? -10.983 -5.194  -3.295  1.00 0.00 ? 42 ALA A H    6  
ATOM 6228  H HA   . ALA A 1 42 ? -12.756 -4.226  -5.354  1.00 0.00 ? 42 ALA A HA   6  
ATOM 6229  H HB1  . ALA A 1 42 ? -14.059 -5.951  -4.790  1.00 0.00 ? 42 ALA A HB1  6  
ATOM 6230  H HB2  . ALA A 1 42 ? -12.702 -6.480  -3.794  1.00 0.00 ? 42 ALA A HB2  6  
ATOM 6231  H HB3  . ALA A 1 42 ? -14.011 -5.543  -3.074  1.00 0.00 ? 42 ALA A HB3  6  
ATOM 6232  N N    . SER A 1 43 ? -12.716 -2.878  -2.403  1.00 0.00 ? 43 SER A N    6  
ATOM 6233  C CA   . SER A 1 43 ? -13.218 -1.773  -1.594  1.00 0.00 ? 43 SER A CA   6  
ATOM 6234  C C    . SER A 1 43 ? -12.665 -0.441  -2.090  1.00 0.00 ? 43 SER A C    6  
ATOM 6235  O O    . SER A 1 43 ? -13.420 0.475   -2.418  1.00 0.00 ? 43 SER A O    6  
ATOM 6236  C CB   . SER A 1 43 ? -12.844 -1.978  -0.125  1.00 0.00 ? 43 SER A CB   6  
ATOM 6237  O OG   . SER A 1 43 ? -13.505 -3.109  0.417   1.00 0.00 ? 43 SER A OG   6  
ATOM 6238  H H    . SER A 1 43 ? -11.933 -3.379  -2.094  1.00 0.00 ? 43 SER A H    6  
ATOM 6239  H HA   . SER A 1 43 ? -14.294 -1.759  -1.684  1.00 0.00 ? 43 SER A HA   6  
ATOM 6240  H HB2  . SER A 1 43 ? -11.778 -2.126  -0.045  1.00 0.00 ? 43 SER A HB2  6  
ATOM 6241  H HB3  . SER A 1 43 ? -13.130 -1.103  0.442   1.00 0.00 ? 43 SER A HB3  6  
ATOM 6242  H HG   . SER A 1 43 ? -14.438 -3.072  0.194   1.00 0.00 ? 43 SER A HG   6  
ATOM 6243  N N    . LEU A 1 44 ? -11.342 -0.340  -2.143  1.00 0.00 ? 44 LEU A N    6  
ATOM 6244  C CA   . LEU A 1 44 ? -10.685 0.880   -2.599  1.00 0.00 ? 44 LEU A CA   6  
ATOM 6245  C C    . LEU A 1 44 ? -10.800 1.027   -4.113  1.00 0.00 ? 44 LEU A C    6  
ATOM 6246  O O    . LEU A 1 44 ? -10.487 2.078   -4.671  1.00 0.00 ? 44 LEU A O    6  
ATOM 6247  C CB   . LEU A 1 44 ? -9.212  0.875   -2.187  1.00 0.00 ? 44 LEU A CB   6  
ATOM 6248  C CG   . LEU A 1 44 ? -8.923  0.501   -0.732  1.00 0.00 ? 44 LEU A CG   6  
ATOM 6249  C CD1  . LEU A 1 44 ? -7.434  0.604   -0.440  1.00 0.00 ? 44 LEU A CD1  6  
ATOM 6250  C CD2  . LEU A 1 44 ? -9.717  1.390   0.214   1.00 0.00 ? 44 LEU A CD2  6  
ATOM 6251  H H    . LEU A 1 44 ? -10.792 -1.103  -1.869  1.00 0.00 ? 44 LEU A H    6  
ATOM 6252  H HA   . LEU A 1 44 ? -11.179 1.717   -2.130  1.00 0.00 ? 44 LEU A HA   6  
ATOM 6253  H HB2  . LEU A 1 44 ? -8.694  0.168   -2.818  1.00 0.00 ? 44 LEU A HB2  6  
ATOM 6254  H HB3  . LEU A 1 44 ? -8.817  1.866   -2.360  1.00 0.00 ? 44 LEU A HB3  6  
ATOM 6255  H HG   . LEU A 1 44 ? -9.226  -0.523  -0.564  1.00 0.00 ? 44 LEU A HG   6  
ATOM 6256  H HD11 . LEU A 1 44 ? -7.114  -0.271  0.105   1.00 0.00 ? 44 LEU A HD11 6  
ATOM 6257  H HD12 . LEU A 1 44 ? -7.244  1.487   0.151   1.00 0.00 ? 44 LEU A HD12 6  
ATOM 6258  H HD13 . LEU A 1 44 ? -6.889  0.669   -1.370  1.00 0.00 ? 44 LEU A HD13 6  
ATOM 6259  H HD21 . LEU A 1 44 ? -9.756  0.931   1.191   1.00 0.00 ? 44 LEU A HD21 6  
ATOM 6260  H HD22 . LEU A 1 44 ? -10.721 1.514   -0.166  1.00 0.00 ? 44 LEU A HD22 6  
ATOM 6261  H HD23 . LEU A 1 44 ? -9.238  2.355   0.288   1.00 0.00 ? 44 LEU A HD23 6  
ATOM 6262  N N    . GLY A 1 45 ? -11.254 -0.035  -4.773  1.00 0.00 ? 45 GLY A N    6  
ATOM 6263  C CA   . GLY A 1 45 ? -11.405 -0.003  -6.216  1.00 0.00 ? 45 GLY A CA   6  
ATOM 6264  C C    . GLY A 1 45 ? -10.112 -0.318  -6.941  1.00 0.00 ? 45 GLY A C    6  
ATOM 6265  O O    . GLY A 1 45 ? -9.983  -0.059  -8.139  1.00 0.00 ? 45 GLY A O    6  
ATOM 6266  H H    . GLY A 1 45 ? -11.488 -0.846  -4.276  1.00 0.00 ? 45 GLY A H    6  
ATOM 6267  H HA2  . GLY A 1 45 ? -12.153 -0.725  -6.505  1.00 0.00 ? 45 GLY A HA2  6  
ATOM 6268  H HA3  . GLY A 1 45 ? -11.738 0.982   -6.510  1.00 0.00 ? 45 GLY A HA3  6  
ATOM 6269  N N    . LEU A 1 46 ? -9.150  -0.878  -6.216  1.00 0.00 ? 46 LEU A N    6  
ATOM 6270  C CA   . LEU A 1 46 ? -7.859  -1.229  -6.797  1.00 0.00 ? 46 LEU A CA   6  
ATOM 6271  C C    . LEU A 1 46 ? -7.784  -2.722  -7.099  1.00 0.00 ? 46 LEU A C    6  
ATOM 6272  O O    . LEU A 1 46 ? -8.699  -3.479  -6.773  1.00 0.00 ? 46 LEU A O    6  
ATOM 6273  C CB   . LEU A 1 46 ? -6.726  -0.831  -5.850  1.00 0.00 ? 46 LEU A CB   6  
ATOM 6274  C CG   . LEU A 1 46 ? -6.731  0.621   -5.369  1.00 0.00 ? 46 LEU A CG   6  
ATOM 6275  C CD1  . LEU A 1 46 ? -6.115  0.726   -3.983  1.00 0.00 ? 46 LEU A CD1  6  
ATOM 6276  C CD2  . LEU A 1 46 ? -5.988  1.511   -6.354  1.00 0.00 ? 46 LEU A CD2  6  
ATOM 6277  H H    . LEU A 1 46 ? -9.311  -1.061  -5.267  1.00 0.00 ? 46 LEU A H    6  
ATOM 6278  H HA   . LEU A 1 46 ? -7.753  -0.681  -7.722  1.00 0.00 ? 46 LEU A HA   6  
ATOM 6279  H HB2  . LEU A 1 46 ? -6.784  -1.467  -4.980  1.00 0.00 ? 46 LEU A HB2  6  
ATOM 6280  H HB3  . LEU A 1 46 ? -5.790  -1.008  -6.361  1.00 0.00 ? 46 LEU A HB3  6  
ATOM 6281  H HG   . LEU A 1 46 ? -7.753  0.969   -5.307  1.00 0.00 ? 46 LEU A HG   6  
ATOM 6282  H HD11 . LEU A 1 46 ? -5.087  0.400   -4.020  1.00 0.00 ? 46 LEU A HD11 6  
ATOM 6283  H HD12 . LEU A 1 46 ? -6.667  0.102   -3.295  1.00 0.00 ? 46 LEU A HD12 6  
ATOM 6284  H HD13 . LEU A 1 46 ? -6.157  1.753   -3.648  1.00 0.00 ? 46 LEU A HD13 6  
ATOM 6285  H HD21 . LEU A 1 46 ? -6.170  2.547   -6.110  1.00 0.00 ? 46 LEU A HD21 6  
ATOM 6286  H HD22 . LEU A 1 46 ? -6.339  1.311   -7.356  1.00 0.00 ? 46 LEU A HD22 6  
ATOM 6287  H HD23 . LEU A 1 46 ? -4.929  1.308   -6.295  1.00 0.00 ? 46 LEU A HD23 6  
ATOM 6288  N N    . THR A 1 47 ? -6.687  -3.141  -7.722  1.00 0.00 ? 47 THR A N    6  
ATOM 6289  C CA   . THR A 1 47 ? -6.492  -4.543  -8.066  1.00 0.00 ? 47 THR A CA   6  
ATOM 6290  C C    . THR A 1 47 ? -5.456  -5.194  -7.156  1.00 0.00 ? 47 THR A C    6  
ATOM 6291  O O    . THR A 1 47 ? -4.661  -4.507  -6.517  1.00 0.00 ? 47 THR A O    6  
ATOM 6292  C CB   . THR A 1 47 ? -6.045  -4.705  -9.531  1.00 0.00 ? 47 THR A CB   6  
ATOM 6293  O OG1  . THR A 1 47 ? -5.896  -6.094  -9.848  1.00 0.00 ? 47 THR A OG1  6  
ATOM 6294  C CG2  . THR A 1 47 ? -4.732  -3.979  -9.780  1.00 0.00 ? 47 THR A CG2  6  
ATOM 6295  H H    . THR A 1 47 ? -5.993  -2.489  -7.955  1.00 0.00 ? 47 THR A H    6  
ATOM 6296  H HA   . THR A 1 47 ? -7.437  -5.052  -7.941  1.00 0.00 ? 47 THR A HA   6  
ATOM 6297  H HB   . THR A 1 47 ? -6.803  -4.277  -10.172 1.00 0.00 ? 47 THR A HB   6  
ATOM 6298  H HG1  . THR A 1 47 ? -4.970  -6.340  -9.779  1.00 0.00 ? 47 THR A HG1  6  
ATOM 6299  H HG21 . THR A 1 47 ? -4.210  -3.849  -8.844  1.00 0.00 ? 47 THR A HG21 6  
ATOM 6300  H HG22 . THR A 1 47 ? -4.932  -3.013  -10.219 1.00 0.00 ? 47 THR A HG22 6  
ATOM 6301  H HG23 . THR A 1 47 ? -4.121  -4.561  -10.454 1.00 0.00 ? 47 THR A HG23 6  
ATOM 6302  N N    . GLN A 1 48 ? -5.472  -6.522  -7.104  1.00 0.00 ? 48 GLN A N    6  
ATOM 6303  C CA   . GLN A 1 48 ? -4.533  -7.265  -6.272  1.00 0.00 ? 48 GLN A CA   6  
ATOM 6304  C C    . GLN A 1 48 ? -3.094  -6.877  -6.596  1.00 0.00 ? 48 GLN A C    6  
ATOM 6305  O O    . GLN A 1 48 ? -2.226  -6.883  -5.722  1.00 0.00 ? 48 GLN A O    6  
ATOM 6306  C CB   . GLN A 1 48 ? -4.724  -8.770  -6.468  1.00 0.00 ? 48 GLN A CB   6  
ATOM 6307  C CG   . GLN A 1 48 ? -5.902  -9.339  -5.693  1.00 0.00 ? 48 GLN A CG   6  
ATOM 6308  C CD   . GLN A 1 48 ? -6.273  -10.739 -6.141  1.00 0.00 ? 48 GLN A CD   6  
ATOM 6309  O OE1  . GLN A 1 48 ? -5.436  -11.480 -6.658  1.00 0.00 ? 48 GLN A OE1  6  
ATOM 6310  N NE2  . GLN A 1 48 ? -7.533  -11.109 -5.945  1.00 0.00 ? 48 GLN A NE2  6  
ATOM 6311  H H    . GLN A 1 48 ? -6.130  -7.013  -7.637  1.00 0.00 ? 48 GLN A H    6  
ATOM 6312  H HA   . GLN A 1 48 ? -4.736  -7.017  -5.241  1.00 0.00 ? 48 GLN A HA   6  
ATOM 6313  H HB2  . GLN A 1 48 ? -4.882  -8.966  -7.518  1.00 0.00 ? 48 GLN A HB2  6  
ATOM 6314  H HB3  . GLN A 1 48 ? -3.829  -9.279  -6.145  1.00 0.00 ? 48 GLN A HB3  6  
ATOM 6315  H HG2  . GLN A 1 48 ? -5.645  -9.370  -4.645  1.00 0.00 ? 48 GLN A HG2  6  
ATOM 6316  H HG3  . GLN A 1 48 ? -6.756  -8.693  -5.835  1.00 0.00 ? 48 GLN A HG3  6  
ATOM 6317  H HE21 . GLN A 1 48 ? -8.144  -10.466 -5.529  1.00 0.00 ? 48 GLN A HE21 6  
ATOM 6318  H HE22 . GLN A 1 48 ? -7.800  -12.008 -6.226  1.00 0.00 ? 48 GLN A HE22 6  
ATOM 6319  N N    . THR A 1 49 ? -2.847  -6.540  -7.858  1.00 0.00 ? 49 THR A N    6  
ATOM 6320  C CA   . THR A 1 49 ? -1.513  -6.151  -8.298  1.00 0.00 ? 49 THR A CA   6  
ATOM 6321  C C    . THR A 1 49 ? -1.144  -4.767  -7.776  1.00 0.00 ? 49 THR A C    6  
ATOM 6322  O O    . THR A 1 49 ? 0.029   -4.395  -7.755  1.00 0.00 ? 49 THR A O    6  
ATOM 6323  C CB   . THR A 1 49 ? -1.405  -6.153  -9.834  1.00 0.00 ? 49 THR A CB   6  
ATOM 6324  O OG1  . THR A 1 49 ? -1.965  -7.360  -10.363 1.00 0.00 ? 49 THR A OG1  6  
ATOM 6325  C CG2  . THR A 1 49 ? 0.045   -6.026  -10.275 1.00 0.00 ? 49 THR A CG2  6  
ATOM 6326  H H    . THR A 1 49 ? -3.580  -6.554  -8.508  1.00 0.00 ? 49 THR A H    6  
ATOM 6327  H HA   . THR A 1 49 ? -0.809  -6.871  -7.907  1.00 0.00 ? 49 THR A HA   6  
ATOM 6328  H HB   . THR A 1 49 ? -1.959  -5.309  -10.220 1.00 0.00 ? 49 THR A HB   6  
ATOM 6329  H HG1  . THR A 1 49 ? -1.572  -7.547  -11.219 1.00 0.00 ? 49 THR A HG1  6  
ATOM 6330  H HG21 . THR A 1 49 ? 0.154   -6.419  -11.275 1.00 0.00 ? 49 THR A HG21 6  
ATOM 6331  H HG22 . THR A 1 49 ? 0.677   -6.582  -9.599  1.00 0.00 ? 49 THR A HG22 6  
ATOM 6332  H HG23 . THR A 1 49 ? 0.334   -4.985  -10.265 1.00 0.00 ? 49 THR A HG23 6  
ATOM 6333  N N    . GLN A 1 50 ? -2.152  -4.009  -7.356  1.00 0.00 ? 50 GLN A N    6  
ATOM 6334  C CA   . GLN A 1 50 ? -1.932  -2.666  -6.834  1.00 0.00 ? 50 GLN A CA   6  
ATOM 6335  C C    . GLN A 1 50 ? -1.729  -2.695  -5.323  1.00 0.00 ? 50 GLN A C    6  
ATOM 6336  O O    . GLN A 1 50 ? -0.735  -2.183  -4.809  1.00 0.00 ? 50 GLN A O    6  
ATOM 6337  C CB   . GLN A 1 50 ? -3.113  -1.760  -7.184  1.00 0.00 ? 50 GLN A CB   6  
ATOM 6338  C CG   . GLN A 1 50 ? -3.065  -1.219  -8.605  1.00 0.00 ? 50 GLN A CG   6  
ATOM 6339  C CD   . GLN A 1 50 ? -3.743  0.130   -8.739  1.00 0.00 ? 50 GLN A CD   6  
ATOM 6340  O OE1  . GLN A 1 50 ? -4.858  0.230   -9.251  1.00 0.00 ? 50 GLN A OE1  6  
ATOM 6341  N NE2  . GLN A 1 50 ? -3.071  1.179   -8.278  1.00 0.00 ? 50 GLN A NE2  6  
ATOM 6342  H H    . GLN A 1 50 ? -3.065  -4.362  -7.398  1.00 0.00 ? 50 GLN A H    6  
ATOM 6343  H HA   . GLN A 1 50 ? -1.039  -2.273  -7.297  1.00 0.00 ? 50 GLN A HA   6  
ATOM 6344  H HB2  . GLN A 1 50 ? -4.029  -2.320  -7.066  1.00 0.00 ? 50 GLN A HB2  6  
ATOM 6345  H HB3  . GLN A 1 50 ? -3.123  -0.921  -6.504  1.00 0.00 ? 50 GLN A HB3  6  
ATOM 6346  H HG2  . GLN A 1 50 ? -2.032  -1.117  -8.903  1.00 0.00 ? 50 GLN A HG2  6  
ATOM 6347  H HG3  . GLN A 1 50 ? -3.560  -1.921  -9.260  1.00 0.00 ? 50 GLN A HG3  6  
ATOM 6348  H HE21 . GLN A 1 50 ? -2.187  1.024   -7.883  1.00 0.00 ? 50 GLN A HE21 6  
ATOM 6349  H HE22 . GLN A 1 50 ? -3.485  2.063   -8.352  1.00 0.00 ? 50 GLN A HE22 6  
ATOM 6350  N N    . VAL A 1 51 ? -2.679  -3.299  -4.615  1.00 0.00 ? 51 VAL A N    6  
ATOM 6351  C CA   . VAL A 1 51 ? -2.604  -3.396  -3.162  1.00 0.00 ? 51 VAL A CA   6  
ATOM 6352  C C    . VAL A 1 51 ? -1.380  -4.193  -2.727  1.00 0.00 ? 51 VAL A C    6  
ATOM 6353  O O    . VAL A 1 51 ? -0.872  -4.016  -1.619  1.00 0.00 ? 51 VAL A O    6  
ATOM 6354  C CB   . VAL A 1 51 ? -3.867  -4.056  -2.578  1.00 0.00 ? 51 VAL A CB   6  
ATOM 6355  C CG1  . VAL A 1 51 ? -3.603  -4.561  -1.168  1.00 0.00 ? 51 VAL A CG1  6  
ATOM 6356  C CG2  . VAL A 1 51 ? -5.034  -3.081  -2.594  1.00 0.00 ? 51 VAL A CG2  6  
ATOM 6357  H H    . VAL A 1 51 ? -3.448  -3.689  -5.081  1.00 0.00 ? 51 VAL A H    6  
ATOM 6358  H HA   . VAL A 1 51 ? -2.531  -2.394  -2.764  1.00 0.00 ? 51 VAL A HA   6  
ATOM 6359  H HB   . VAL A 1 51 ? -4.125  -4.903  -3.197  1.00 0.00 ? 51 VAL A HB   6  
ATOM 6360  H HG11 . VAL A 1 51 ? -3.315  -3.732  -0.537  1.00 0.00 ? 51 VAL A HG11 6  
ATOM 6361  H HG12 . VAL A 1 51 ? -4.498  -5.020  -0.775  1.00 0.00 ? 51 VAL A HG12 6  
ATOM 6362  H HG13 . VAL A 1 51 ? -2.805  -5.289  -1.190  1.00 0.00 ? 51 VAL A HG13 6  
ATOM 6363  H HG21 . VAL A 1 51 ? -5.887  -3.548  -3.064  1.00 0.00 ? 51 VAL A HG21 6  
ATOM 6364  H HG22 . VAL A 1 51 ? -5.288  -2.805  -1.580  1.00 0.00 ? 51 VAL A HG22 6  
ATOM 6365  H HG23 . VAL A 1 51 ? -4.757  -2.196  -3.148  1.00 0.00 ? 51 VAL A HG23 6  
ATOM 6366  N N    . LYS A 1 52 ? -0.909  -5.071  -3.605  1.00 0.00 ? 52 LYS A N    6  
ATOM 6367  C CA   . LYS A 1 52 ? 0.258   -5.896  -3.314  1.00 0.00 ? 52 LYS A CA   6  
ATOM 6368  C C    . LYS A 1 52 ? 1.529   -5.054  -3.303  1.00 0.00 ? 52 LYS A C    6  
ATOM 6369  O O    . LYS A 1 52 ? 2.261   -5.031  -2.313  1.00 0.00 ? 52 LYS A O    6  
ATOM 6370  C CB   . LYS A 1 52 ? 0.385   -7.018  -4.347  1.00 0.00 ? 52 LYS A CB   6  
ATOM 6371  C CG   . LYS A 1 52 ? -0.348  -8.289  -3.957  1.00 0.00 ? 52 LYS A CG   6  
ATOM 6372  C CD   . LYS A 1 52 ? 0.086   -9.468  -4.812  1.00 0.00 ? 52 LYS A CD   6  
ATOM 6373  C CE   . LYS A 1 52 ? -0.754  -9.580  -6.075  1.00 0.00 ? 52 LYS A CE   6  
ATOM 6374  N NZ   . LYS A 1 52 ? -0.532  -10.875 -6.776  1.00 0.00 ? 52 LYS A NZ   6  
ATOM 6375  H H    . LYS A 1 52 ? -1.358  -5.167  -4.472  1.00 0.00 ? 52 LYS A H    6  
ATOM 6376  H HA   . LYS A 1 52 ? 0.120   -6.332  -2.336  1.00 0.00 ? 52 LYS A HA   6  
ATOM 6377  H HB2  . LYS A 1 52 ? -0.013  -6.671  -5.289  1.00 0.00 ? 52 LYS A HB2  6  
ATOM 6378  H HB3  . LYS A 1 52 ? 1.432   -7.256  -4.474  1.00 0.00 ? 52 LYS A HB3  6  
ATOM 6379  H HG2  . LYS A 1 52 ? -0.138  -8.513  -2.922  1.00 0.00 ? 52 LYS A HG2  6  
ATOM 6380  H HG3  . LYS A 1 52 ? -1.410  -8.135  -4.086  1.00 0.00 ? 52 LYS A HG3  6  
ATOM 6381  H HD2  . LYS A 1 52 ? 1.121   -9.337  -5.092  1.00 0.00 ? 52 LYS A HD2  6  
ATOM 6382  H HD3  . LYS A 1 52 ? -0.020  -10.377 -4.237  1.00 0.00 ? 52 LYS A HD3  6  
ATOM 6383  H HE2  . LYS A 1 52 ? -1.796  -9.500  -5.807  1.00 0.00 ? 52 LYS A HE2  6  
ATOM 6384  H HE3  . LYS A 1 52 ? -0.490  -8.771  -6.740  1.00 0.00 ? 52 LYS A HE3  6  
ATOM 6385  H HZ1  . LYS A 1 52 ? 0.089   -10.735 -7.598  1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 6386  H HZ2  . LYS A 1 52 ? -1.439  -11.265 -7.103  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 6387  H HZ3  . LYS A 1 52 ? -0.086  -11.559 -6.131  1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 6388  N N    . ILE A 1 53 ? 1.786   -4.362  -4.408  1.00 0.00 ? 53 ILE A N    6  
ATOM 6389  C CA   . ILE A 1 53 ? 2.968   -3.517  -4.523  1.00 0.00 ? 53 ILE A CA   6  
ATOM 6390  C C    . ILE A 1 53 ? 2.981   -2.441  -3.443  1.00 0.00 ? 53 ILE A C    6  
ATOM 6391  O O    . ILE A 1 53 ? 4.029   -2.130  -2.875  1.00 0.00 ? 53 ILE A O    6  
ATOM 6392  C CB   . ILE A 1 53 ? 3.045   -2.842  -5.905  1.00 0.00 ? 53 ILE A CB   6  
ATOM 6393  C CG1  . ILE A 1 53 ? 3.020   -3.896  -7.014  1.00 0.00 ? 53 ILE A CG1  6  
ATOM 6394  C CG2  . ILE A 1 53 ? 4.299   -1.987  -6.007  1.00 0.00 ? 53 ILE A CG2  6  
ATOM 6395  C CD1  . ILE A 1 53 ? 2.710   -3.328  -8.381  1.00 0.00 ? 53 ILE A CD1  6  
ATOM 6396  H H    . ILE A 1 53 ? 1.165   -4.421  -5.163  1.00 0.00 ? 53 ILE A H    6  
ATOM 6397  H HA   . ILE A 1 53 ? 3.839   -4.144  -4.402  1.00 0.00 ? 53 ILE A HA   6  
ATOM 6398  H HB   . ILE A 1 53 ? 2.188   -2.195  -6.014  1.00 0.00 ? 53 ILE A HB   6  
ATOM 6399  H HG12 . ILE A 1 53 ? 3.984   -4.377  -7.066  1.00 0.00 ? 53 ILE A HG12 6  
ATOM 6400  H HG13 . ILE A 1 53 ? 2.266   -4.634  -6.781  1.00 0.00 ? 53 ILE A HG13 6  
ATOM 6401  H HG21 . ILE A 1 53 ? 5.138   -2.527  -5.595  1.00 0.00 ? 53 ILE A HG21 6  
ATOM 6402  H HG22 . ILE A 1 53 ? 4.495   -1.758  -7.044  1.00 0.00 ? 53 ILE A HG22 6  
ATOM 6403  H HG23 . ILE A 1 53 ? 4.156   -1.069  -5.457  1.00 0.00 ? 53 ILE A HG23 6  
ATOM 6404  H HD11 . ILE A 1 53 ? 3.306   -2.442  -8.547  1.00 0.00 ? 53 ILE A HD11 6  
ATOM 6405  H HD12 . ILE A 1 53 ? 2.938   -4.063  -9.137  1.00 0.00 ? 53 ILE A HD12 6  
ATOM 6406  H HD13 . ILE A 1 53 ? 1.662   -3.070  -8.434  1.00 0.00 ? 53 ILE A HD13 6  
ATOM 6407  N N    . TRP A 1 54 ? 1.812   -1.877  -3.162  1.00 0.00 ? 54 TRP A N    6  
ATOM 6408  C CA   . TRP A 1 54 ? 1.689   -0.837  -2.148  1.00 0.00 ? 54 TRP A CA   6  
ATOM 6409  C C    . TRP A 1 54 ? 2.219   -1.322  -0.803  1.00 0.00 ? 54 TRP A C    6  
ATOM 6410  O O    . TRP A 1 54 ? 3.051   -0.664  -0.178  1.00 0.00 ? 54 TRP A O    6  
ATOM 6411  C CB   . TRP A 1 54 ? 0.229   -0.402  -2.008  1.00 0.00 ? 54 TRP A CB   6  
ATOM 6412  C CG   . TRP A 1 54 ? 0.041   0.759   -1.079  1.00 0.00 ? 54 TRP A CG   6  
ATOM 6413  C CD1  . TRP A 1 54 ? -0.108  2.071   -1.428  1.00 0.00 ? 54 TRP A CD1  6  
ATOM 6414  C CD2  . TRP A 1 54 ? -0.016  0.713   0.351   1.00 0.00 ? 54 TRP A CD2  6  
ATOM 6415  N NE1  . TRP A 1 54 ? -0.254  2.843   -0.301  1.00 0.00 ? 54 TRP A NE1  6  
ATOM 6416  C CE2  . TRP A 1 54 ? -0.202  2.034   0.803   1.00 0.00 ? 54 TRP A CE2  6  
ATOM 6417  C CE3  . TRP A 1 54 ? 0.070   -0.316  1.292   1.00 0.00 ? 54 TRP A CE3  6  
ATOM 6418  C CZ2  . TRP A 1 54 ? -0.302  2.350   2.155   1.00 0.00 ? 54 TRP A CZ2  6  
ATOM 6419  C CZ3  . TRP A 1 54 ? -0.029  0.000   2.634   1.00 0.00 ? 54 TRP A CZ3  6  
ATOM 6420  C CH2  . TRP A 1 54 ? -0.214  1.323   3.056   1.00 0.00 ? 54 TRP A CH2  6  
ATOM 6421  H H    . TRP A 1 54 ? 1.012   -2.168  -3.649  1.00 0.00 ? 54 TRP A H    6  
ATOM 6422  H HA   . TRP A 1 54 ? 2.277   0.010   -2.469  1.00 0.00 ? 54 TRP A HA   6  
ATOM 6423  H HB2  . TRP A 1 54 ? -0.150  -0.118  -2.978  1.00 0.00 ? 54 TRP A HB2  6  
ATOM 6424  H HB3  . TRP A 1 54 ? -0.351  -1.231  -1.627  1.00 0.00 ? 54 TRP A HB3  6  
ATOM 6425  H HD1  . TRP A 1 54 ? -0.107  2.434   -2.444  1.00 0.00 ? 54 TRP A HD1  6  
ATOM 6426  H HE1  . TRP A 1 54 ? -0.377  3.816   -0.290  1.00 0.00 ? 54 TRP A HE1  6  
ATOM 6427  H HE3  . TRP A 1 54 ? 0.212   -1.342  0.987   1.00 0.00 ? 54 TRP A HE3  6  
ATOM 6428  H HZ2  . TRP A 1 54 ? -0.445  3.365   2.496   1.00 0.00 ? 54 TRP A HZ2  6  
ATOM 6429  H HZ3  . TRP A 1 54 ? 0.035   -0.782  3.377   1.00 0.00 ? 54 TRP A HZ3  6  
ATOM 6430  H HH2  . TRP A 1 54 ? -0.286  1.523   4.113   1.00 0.00 ? 54 TRP A HH2  6  
ATOM 6431  N N    . PHE A 1 55 ? 1.732   -2.477  -0.362  1.00 0.00 ? 55 PHE A N    6  
ATOM 6432  C CA   . PHE A 1 55 ? 2.157   -3.050  0.910   1.00 0.00 ? 55 PHE A CA   6  
ATOM 6433  C C    . PHE A 1 55 ? 3.638   -3.417  0.874   1.00 0.00 ? 55 PHE A C    6  
ATOM 6434  O O    . PHE A 1 55 ? 4.394   -3.075  1.783   1.00 0.00 ? 55 PHE A O    6  
ATOM 6435  C CB   . PHE A 1 55 ? 1.321   -4.289  1.240   1.00 0.00 ? 55 PHE A CB   6  
ATOM 6436  C CG   . PHE A 1 55 ? 0.074   -3.980  2.018   1.00 0.00 ? 55 PHE A CG   6  
ATOM 6437  C CD1  . PHE A 1 55 ? -0.998  -3.345  1.410   1.00 0.00 ? 55 PHE A CD1  6  
ATOM 6438  C CD2  . PHE A 1 55 ? -0.028  -4.326  3.355   1.00 0.00 ? 55 PHE A CD2  6  
ATOM 6439  C CE1  . PHE A 1 55 ? -2.146  -3.059  2.123   1.00 0.00 ? 55 PHE A CE1  6  
ATOM 6440  C CE2  . PHE A 1 55 ? -1.175  -4.043  4.074   1.00 0.00 ? 55 PHE A CE2  6  
ATOM 6441  C CZ   . PHE A 1 55 ? -2.236  -3.410  3.457   1.00 0.00 ? 55 PHE A CZ   6  
ATOM 6442  H H    . PHE A 1 55 ? 1.071   -2.956  -0.905  1.00 0.00 ? 55 PHE A H    6  
ATOM 6443  H HA   . PHE A 1 55 ? 2.001   -2.306  1.676   1.00 0.00 ? 55 PHE A HA   6  
ATOM 6444  H HB2  . PHE A 1 55 ? 1.028   -4.772  0.321   1.00 0.00 ? 55 PHE A HB2  6  
ATOM 6445  H HB3  . PHE A 1 55 ? 1.918   -4.971  1.826   1.00 0.00 ? 55 PHE A HB3  6  
ATOM 6446  H HD1  . PHE A 1 55 ? -0.930  -3.071  0.367   1.00 0.00 ? 55 PHE A HD1  6  
ATOM 6447  H HD2  . PHE A 1 55 ? 0.802   -4.822  3.839   1.00 0.00 ? 55 PHE A HD2  6  
ATOM 6448  H HE1  . PHE A 1 55 ? -2.975  -2.564  1.638   1.00 0.00 ? 55 PHE A HE1  6  
ATOM 6449  H HE2  . PHE A 1 55 ? -1.241  -4.319  5.116   1.00 0.00 ? 55 PHE A HE2  6  
ATOM 6450  H HZ   . PHE A 1 55 ? -3.132  -3.187  4.016   1.00 0.00 ? 55 PHE A HZ   6  
ATOM 6451  N N    . GLN A 1 56 ? 4.043   -4.115  -0.182  1.00 0.00 ? 56 GLN A N    6  
ATOM 6452  C CA   . GLN A 1 56 ? 5.432   -4.529  -0.336  1.00 0.00 ? 56 GLN A CA   6  
ATOM 6453  C C    . GLN A 1 56 ? 6.373   -3.335  -0.214  1.00 0.00 ? 56 GLN A C    6  
ATOM 6454  O O    . GLN A 1 56 ? 7.195   -3.271  0.699   1.00 0.00 ? 56 GLN A O    6  
ATOM 6455  C CB   . GLN A 1 56 ? 5.635   -5.217  -1.688  1.00 0.00 ? 56 GLN A CB   6  
ATOM 6456  C CG   . GLN A 1 56 ? 6.882   -6.084  -1.748  1.00 0.00 ? 56 GLN A CG   6  
ATOM 6457  C CD   . GLN A 1 56 ? 7.350   -6.334  -3.168  1.00 0.00 ? 56 GLN A CD   6  
ATOM 6458  O OE1  . GLN A 1 56 ? 7.429   -5.412  -3.980  1.00 0.00 ? 56 GLN A OE1  6  
ATOM 6459  N NE2  . GLN A 1 56 ? 7.664   -7.587  -3.476  1.00 0.00 ? 56 GLN A NE2  6  
ATOM 6460  H H    . GLN A 1 56 ? 3.392   -4.357  -0.873  1.00 0.00 ? 56 GLN A H    6  
ATOM 6461  H HA   . GLN A 1 56 ? 5.658   -5.231  0.452   1.00 0.00 ? 56 GLN A HA   6  
ATOM 6462  H HB2  . GLN A 1 56 ? 4.778   -5.841  -1.892  1.00 0.00 ? 56 GLN A HB2  6  
ATOM 6463  H HB3  . GLN A 1 56 ? 5.711   -4.460  -2.455  1.00 0.00 ? 56 GLN A HB3  6  
ATOM 6464  H HG2  . GLN A 1 56 ? 7.675   -5.590  -1.207  1.00 0.00 ? 56 GLN A HG2  6  
ATOM 6465  H HG3  . GLN A 1 56 ? 6.667   -7.034  -1.282  1.00 0.00 ? 56 GLN A HG3  6  
ATOM 6466  H HE21 . GLN A 1 56 ? 7.575   -8.271  -2.778  1.00 0.00 ? 56 GLN A HE21 6  
ATOM 6467  H HE22 . GLN A 1 56 ? 7.968   -7.778  -4.387  1.00 0.00 ? 56 GLN A HE22 6  
ATOM 6468  N N    . ASN A 1 57 ? 6.246   -2.390  -1.140  1.00 0.00 ? 57 ASN A N    6  
ATOM 6469  C CA   . ASN A 1 57 ? 7.086   -1.198  -1.137  1.00 0.00 ? 57 ASN A CA   6  
ATOM 6470  C C    . ASN A 1 57 ? 7.049   -0.511  0.225   1.00 0.00 ? 57 ASN A C    6  
ATOM 6471  O O    . ASN A 1 57 ? 8.032   0.093   0.655   1.00 0.00 ? 57 ASN A O    6  
ATOM 6472  C CB   . ASN A 1 57 ? 6.629   -0.224  -2.225  1.00 0.00 ? 57 ASN A CB   6  
ATOM 6473  C CG   . ASN A 1 57 ? 7.105   -0.634  -3.605  1.00 0.00 ? 57 ASN A CG   6  
ATOM 6474  O OD1  . ASN A 1 57 ? 7.498   -1.780  -3.823  1.00 0.00 ? 57 ASN A OD1  6  
ATOM 6475  N ND2  . ASN A 1 57 ? 7.073   0.304   -4.545  1.00 0.00 ? 57 ASN A ND2  6  
ATOM 6476  H H    . ASN A 1 57 ? 5.571   -2.497  -1.843  1.00 0.00 ? 57 ASN A H    6  
ATOM 6477  H HA   . ASN A 1 57 ? 8.099   -1.506  -1.344  1.00 0.00 ? 57 ASN A HA   6  
ATOM 6478  H HB2  . ASN A 1 57 ? 5.549   -0.185  -2.235  1.00 0.00 ? 57 ASN A HB2  6  
ATOM 6479  H HB3  . ASN A 1 57 ? 7.019   0.759   -2.006  1.00 0.00 ? 57 ASN A HB3  6  
ATOM 6480  H HD21 . ASN A 1 57 ? 6.748   1.195   -4.299  1.00 0.00 ? 57 ASN A HD21 6  
ATOM 6481  H HD22 . ASN A 1 57 ? 7.374   0.066   -5.446  1.00 0.00 ? 57 ASN A HD22 6  
ATOM 6482  N N    . LYS A 1 58 ? 5.908   -0.607  0.899   1.00 0.00 ? 58 LYS A N    6  
ATOM 6483  C CA   . LYS A 1 58 ? 5.742   0.003   2.213   1.00 0.00 ? 58 LYS A CA   6  
ATOM 6484  C C    . LYS A 1 58 ? 6.562   -0.738  3.265   1.00 0.00 ? 58 LYS A C    6  
ATOM 6485  O O    . LYS A 1 58 ? 7.244   -0.120  4.082   1.00 0.00 ? 58 LYS A O    6  
ATOM 6486  C CB   . LYS A 1 58 ? 4.265   0.007   2.613   1.00 0.00 ? 58 LYS A CB   6  
ATOM 6487  C CG   . LYS A 1 58 ? 3.533   1.279   2.224   1.00 0.00 ? 58 LYS A CG   6  
ATOM 6488  C CD   . LYS A 1 58 ? 3.616   2.328   3.320   1.00 0.00 ? 58 LYS A CD   6  
ATOM 6489  C CE   . LYS A 1 58 ? 2.804   3.565   2.971   1.00 0.00 ? 58 LYS A CE   6  
ATOM 6490  N NZ   . LYS A 1 58 ? 3.071   4.689   3.911   1.00 0.00 ? 58 LYS A NZ   6  
ATOM 6491  H H    . LYS A 1 58 ? 5.159   -1.102  0.504   1.00 0.00 ? 58 LYS A H    6  
ATOM 6492  H HA   . LYS A 1 58 ? 6.092   1.022   2.153   1.00 0.00 ? 58 LYS A HA   6  
ATOM 6493  H HB2  . LYS A 1 58 ? 3.773   -0.828  2.135   1.00 0.00 ? 58 LYS A HB2  6  
ATOM 6494  H HB3  . LYS A 1 58 ? 4.194   -0.111  3.685   1.00 0.00 ? 58 LYS A HB3  6  
ATOM 6495  H HG2  . LYS A 1 58 ? 3.976   1.678   1.324   1.00 0.00 ? 58 LYS A HG2  6  
ATOM 6496  H HG3  . LYS A 1 58 ? 2.493   1.044   2.042   1.00 0.00 ? 58 LYS A HG3  6  
ATOM 6497  H HD2  . LYS A 1 58 ? 3.234   1.908   4.239   1.00 0.00 ? 58 LYS A HD2  6  
ATOM 6498  H HD3  . LYS A 1 58 ? 4.650   2.613   3.455   1.00 0.00 ? 58 LYS A HD3  6  
ATOM 6499  H HE2  . LYS A 1 58 ? 3.059   3.877   1.970   1.00 0.00 ? 58 LYS A HE2  6  
ATOM 6500  H HE3  . LYS A 1 58 ? 1.754   3.314   3.013   1.00 0.00 ? 58 LYS A HE3  6  
ATOM 6501  H HZ1  . LYS A 1 58 ? 3.370   4.317   4.836   1.00 0.00 ? 58 LYS A HZ1  6  
ATOM 6502  H HZ2  . LYS A 1 58 ? 2.211   5.258   4.041   1.00 0.00 ? 58 LYS A HZ2  6  
ATOM 6503  H HZ3  . LYS A 1 58 ? 3.825   5.298   3.535   1.00 0.00 ? 58 LYS A HZ3  6  
ATOM 6504  N N    . ARG A 1 59 ? 6.492   -2.065  3.237   1.00 0.00 ? 59 ARG A N    6  
ATOM 6505  C CA   . ARG A 1 59 ? 7.228   -2.889  4.187   1.00 0.00 ? 59 ARG A CA   6  
ATOM 6506  C C    . ARG A 1 59 ? 8.680   -2.432  4.293   1.00 0.00 ? 59 ARG A C    6  
ATOM 6507  O O    . ARG A 1 59 ? 9.203   -2.241  5.391   1.00 0.00 ? 59 ARG A O    6  
ATOM 6508  C CB   . ARG A 1 59 ? 7.174   -4.360  3.769   1.00 0.00 ? 59 ARG A CB   6  
ATOM 6509  C CG   . ARG A 1 59 ? 5.975   -5.108  4.327   1.00 0.00 ? 59 ARG A CG   6  
ATOM 6510  C CD   . ARG A 1 59 ? 6.074   -6.601  4.056   1.00 0.00 ? 59 ARG A CD   6  
ATOM 6511  N NE   . ARG A 1 59 ? 7.324   -7.166  4.557   1.00 0.00 ? 59 ARG A NE   6  
ATOM 6512  C CZ   . ARG A 1 59 ? 7.511   -7.533  5.820   1.00 0.00 ? 59 ARG A CZ   6  
ATOM 6513  N NH1  . ARG A 1 59 ? 6.534   -7.395  6.705   1.00 0.00 ? 59 ARG A NH1  6  
ATOM 6514  N NH2  . ARG A 1 59 ? 8.677   -8.039  6.200   1.00 0.00 ? 59 ARG A NH2  6  
ATOM 6515  H H    . ARG A 1 59 ? 5.930   -2.500  2.561   1.00 0.00 ? 59 ARG A H    6  
ATOM 6516  H HA   . ARG A 1 59 ? 6.758   -2.782  5.154   1.00 0.00 ? 59 ARG A HA   6  
ATOM 6517  H HB2  . ARG A 1 59 ? 7.135   -4.414  2.691   1.00 0.00 ? 59 ARG A HB2  6  
ATOM 6518  H HB3  . ARG A 1 59 ? 8.071   -4.852  4.113   1.00 0.00 ? 59 ARG A HB3  6  
ATOM 6519  H HG2  . ARG A 1 59 ? 5.928   -4.950  5.394   1.00 0.00 ? 59 ARG A HG2  6  
ATOM 6520  H HG3  . ARG A 1 59 ? 5.077   -4.726  3.864   1.00 0.00 ? 59 ARG A HG3  6  
ATOM 6521  H HD2  . ARG A 1 59 ? 5.247   -7.098  4.540   1.00 0.00 ? 59 ARG A HD2  6  
ATOM 6522  H HD3  . ARG A 1 59 ? 6.018   -6.764  2.990   1.00 0.00 ? 59 ARG A HD3  6  
ATOM 6523  H HE   . ARG A 1 59 ? 8.060   -7.277  3.919   1.00 0.00 ? 59 ARG A HE   6  
ATOM 6524  H HH11 . ARG A 1 59 ? 5.653   -7.014  6.421   1.00 0.00 ? 59 ARG A HH11 6  
ATOM 6525  H HH12 . ARG A 1 59 ? 6.676   -7.673  7.655   1.00 0.00 ? 59 ARG A HH12 6  
ATOM 6526  H HH21 . ARG A 1 59 ? 9.416   -8.145  5.535   1.00 0.00 ? 59 ARG A HH21 6  
ATOM 6527  H HH22 . ARG A 1 59 ? 8.817   -8.315  7.150   1.00 0.00 ? 59 ARG A HH22 6  
ATOM 6528  N N    . SER A 1 60 ? 9.325   -2.259  3.144   1.00 0.00 ? 60 SER A N    6  
ATOM 6529  C CA   . SER A 1 60 ? 10.718  -1.829  3.107   1.00 0.00 ? 60 SER A CA   6  
ATOM 6530  C C    . SER A 1 60 ? 10.929  -0.596  3.980   1.00 0.00 ? 60 SER A C    6  
ATOM 6531  O O    . SER A 1 60 ? 11.900  -0.512  4.733   1.00 0.00 ? 60 SER A O    6  
ATOM 6532  C CB   . SER A 1 60 ? 11.143  -1.528  1.668   1.00 0.00 ? 60 SER A CB   6  
ATOM 6533  O OG   . SER A 1 60 ? 12.465  -1.019  1.622   1.00 0.00 ? 60 SER A OG   6  
ATOM 6534  H H    . SER A 1 60 ? 8.854   -2.428  2.301   1.00 0.00 ? 60 SER A H    6  
ATOM 6535  H HA   . SER A 1 60 ? 11.325  -2.636  3.491   1.00 0.00 ? 60 SER A HA   6  
ATOM 6536  H HB2  . SER A 1 60 ? 11.099  -2.435  1.085   1.00 0.00 ? 60 SER A HB2  6  
ATOM 6537  H HB3  . SER A 1 60 ? 10.472  -0.795  1.244   1.00 0.00 ? 60 SER A HB3  6  
ATOM 6538  H HG   . SER A 1 60 ? 13.010  -1.592  1.078   1.00 0.00 ? 60 SER A HG   6  
ATOM 6539  N N    . LYS A 1 61 ? 10.013  0.360   3.873   1.00 0.00 ? 61 LYS A N    6  
ATOM 6540  C CA   . LYS A 1 61 ? 10.096  1.590   4.653   1.00 0.00 ? 61 LYS A CA   6  
ATOM 6541  C C    . LYS A 1 61 ? 10.180  1.284   6.145   1.00 0.00 ? 61 LYS A C    6  
ATOM 6542  O O    . LYS A 1 61 ? 10.862  1.984   6.894   1.00 0.00 ? 61 LYS A O    6  
ATOM 6543  C CB   . LYS A 1 61 ? 8.882   2.479   4.372   1.00 0.00 ? 61 LYS A CB   6  
ATOM 6544  C CG   . LYS A 1 61 ? 8.707   2.822   2.902   1.00 0.00 ? 61 LYS A CG   6  
ATOM 6545  C CD   . LYS A 1 61 ? 9.597   3.982   2.491   1.00 0.00 ? 61 LYS A CD   6  
ATOM 6546  C CE   . LYS A 1 61 ? 8.974   4.789   1.362   1.00 0.00 ? 61 LYS A CE   6  
ATOM 6547  N NZ   . LYS A 1 61 ? 9.583   6.143   1.247   1.00 0.00 ? 61 LYS A NZ   6  
ATOM 6548  H H    . LYS A 1 61 ? 9.262   0.236   3.255   1.00 0.00 ? 61 LYS A H    6  
ATOM 6549  H HA   . LYS A 1 61 ? 10.991  2.113   4.354   1.00 0.00 ? 61 LYS A HA   6  
ATOM 6550  H HB2  . LYS A 1 61 ? 7.992   1.969   4.710   1.00 0.00 ? 61 LYS A HB2  6  
ATOM 6551  H HB3  . LYS A 1 61 ? 8.990   3.401   4.924   1.00 0.00 ? 61 LYS A HB3  6  
ATOM 6552  H HG2  . LYS A 1 61 ? 8.962   1.958   2.307   1.00 0.00 ? 61 LYS A HG2  6  
ATOM 6553  H HG3  . LYS A 1 61 ? 7.675   3.091   2.726   1.00 0.00 ? 61 LYS A HG3  6  
ATOM 6554  H HD2  . LYS A 1 61 ? 9.746   4.630   3.342   1.00 0.00 ? 61 LYS A HD2  6  
ATOM 6555  H HD3  . LYS A 1 61 ? 10.550  3.594   2.161   1.00 0.00 ? 61 LYS A HD3  6  
ATOM 6556  H HE2  . LYS A 1 61 ? 9.120   4.258   0.434   1.00 0.00 ? 61 LYS A HE2  6  
ATOM 6557  H HE3  . LYS A 1 61 ? 7.916   4.895   1.554   1.00 0.00 ? 61 LYS A HE3  6  
ATOM 6558  H HZ1  . LYS A 1 61 ? 8.840   6.859   1.111   1.00 0.00 ? 61 LYS A HZ1  6  
ATOM 6559  H HZ2  . LYS A 1 61 ? 10.231  6.176   0.435   1.00 0.00 ? 61 LYS A HZ2  6  
ATOM 6560  H HZ3  . LYS A 1 61 ? 10.115  6.371   2.111   1.00 0.00 ? 61 LYS A HZ3  6  
ATOM 6561  N N    . ILE A 1 62 ? 9.484   0.234   6.569   1.00 0.00 ? 62 ILE A N    6  
ATOM 6562  C CA   . ILE A 1 62 ? 9.484   -0.165  7.971   1.00 0.00 ? 62 ILE A CA   6  
ATOM 6563  C C    . ILE A 1 62 ? 10.904  -0.245  8.520   1.00 0.00 ? 62 ILE A C    6  
ATOM 6564  O O    . ILE A 1 62 ? 11.602  -1.241  8.327   1.00 0.00 ? 62 ILE A O    6  
ATOM 6565  C CB   . ILE A 1 62 ? 8.792   -1.527  8.168   1.00 0.00 ? 62 ILE A CB   6  
ATOM 6566  C CG1  . ILE A 1 62 ? 7.363   -1.481  7.624   1.00 0.00 ? 62 ILE A CG1  6  
ATOM 6567  C CG2  . ILE A 1 62 ? 8.793   -1.914  9.639   1.00 0.00 ? 62 ILE A CG2  6  
ATOM 6568  C CD1  . ILE A 1 62 ? 6.648   -2.813  7.689   1.00 0.00 ? 62 ILE A CD1  6  
ATOM 6569  H H    . ILE A 1 62 ? 8.960   -0.285  5.924   1.00 0.00 ? 62 ILE A H    6  
ATOM 6570  H HA   . ILE A 1 62 ? 8.934   0.579   8.529   1.00 0.00 ? 62 ILE A HA   6  
ATOM 6571  H HB   . ILE A 1 62 ? 9.353   -2.273  7.624   1.00 0.00 ? 62 ILE A HB   6  
ATOM 6572  H HG12 . ILE A 1 62 ? 6.789   -0.769  8.196   1.00 0.00 ? 62 ILE A HG12 6  
ATOM 6573  H HG13 . ILE A 1 62 ? 7.389   -1.169  6.590   1.00 0.00 ? 62 ILE A HG13 6  
ATOM 6574  H HG21 . ILE A 1 62 ? 9.668   -2.508  9.855   1.00 0.00 ? 62 ILE A HG21 6  
ATOM 6575  H HG22 . ILE A 1 62 ? 8.807   -1.020  10.245  1.00 0.00 ? 62 ILE A HG22 6  
ATOM 6576  H HG23 . ILE A 1 62 ? 7.905   -2.487  9.862   1.00 0.00 ? 62 ILE A HG23 6  
ATOM 6577  H HD11 . ILE A 1 62 ? 5.788   -2.793  7.037   1.00 0.00 ? 62 ILE A HD11 6  
ATOM 6578  H HD12 . ILE A 1 62 ? 7.320   -3.598  7.377   1.00 0.00 ? 62 ILE A HD12 6  
ATOM 6579  H HD13 . ILE A 1 62 ? 6.325   -2.998  8.704   1.00 0.00 ? 62 ILE A HD13 6  
ATOM 6580  N N    . LYS A 1 63 ? 11.326  0.810   9.209   1.00 0.00 ? 63 LYS A N    6  
ATOM 6581  C CA   . LYS A 1 63 ? 12.662  0.861   9.790   1.00 0.00 ? 63 LYS A CA   6  
ATOM 6582  C C    . LYS A 1 63 ? 12.810  -0.173  10.902  1.00 0.00 ? 63 LYS A C    6  
ATOM 6583  O O    . LYS A 1 63 ? 12.055  -0.167  11.874  1.00 0.00 ? 63 LYS A O    6  
ATOM 6584  C CB   . LYS A 1 63 ? 12.949  2.260   10.339  1.00 0.00 ? 63 LYS A CB   6  
ATOM 6585  C CG   . LYS A 1 63 ? 14.430  2.584   10.434  1.00 0.00 ? 63 LYS A CG   6  
ATOM 6586  C CD   . LYS A 1 63 ? 14.660  4.020   10.873  1.00 0.00 ? 63 LYS A CD   6  
ATOM 6587  C CE   . LYS A 1 63 ? 14.447  4.186   12.370  1.00 0.00 ? 63 LYS A CE   6  
ATOM 6588  N NZ   . LYS A 1 63 ? 14.818  5.551   12.835  1.00 0.00 ? 63 LYS A NZ   6  
ATOM 6589  H H    . LYS A 1 63 ? 10.723  1.575   9.329   1.00 0.00 ? 63 LYS A H    6  
ATOM 6590  H HA   . LYS A 1 63 ? 13.372  0.636   9.009   1.00 0.00 ? 63 LYS A HA   6  
ATOM 6591  H HB2  . LYS A 1 63 ? 12.483  2.990   9.693   1.00 0.00 ? 63 LYS A HB2  6  
ATOM 6592  H HB3  . LYS A 1 63 ? 12.520  2.341   11.327  1.00 0.00 ? 63 LYS A HB3  6  
ATOM 6593  H HG2  . LYS A 1 63 ? 14.889  1.921   11.153  1.00 0.00 ? 63 LYS A HG2  6  
ATOM 6594  H HG3  . LYS A 1 63 ? 14.885  2.436   9.465   1.00 0.00 ? 63 LYS A HG3  6  
ATOM 6595  H HD2  . LYS A 1 63 ? 15.674  4.304   10.632  1.00 0.00 ? 63 LYS A HD2  6  
ATOM 6596  H HD3  . LYS A 1 63 ? 13.969  4.663   10.346  1.00 0.00 ? 63 LYS A HD3  6  
ATOM 6597  H HE2  . LYS A 1 63 ? 13.406  4.010   12.594  1.00 0.00 ? 63 LYS A HE2  6  
ATOM 6598  H HE3  . LYS A 1 63 ? 15.055  3.460   12.890  1.00 0.00 ? 63 LYS A HE3  6  
ATOM 6599  H HZ1  . LYS A 1 63 ? 14.053  6.222   12.619  1.00 0.00 ? 63 LYS A HZ1  6  
ATOM 6600  H HZ2  . LYS A 1 63 ? 15.685  5.868   12.358  1.00 0.00 ? 63 LYS A HZ2  6  
ATOM 6601  H HZ3  . LYS A 1 63 ? 14.981  5.547   13.862  1.00 0.00 ? 63 LYS A HZ3  6  
ATOM 6602  N N    . LYS A 1 64 ? 13.790  -1.059  10.753  1.00 0.00 ? 64 LYS A N    6  
ATOM 6603  C CA   . LYS A 1 64 ? 14.040  -2.097  11.746  1.00 0.00 ? 64 LYS A CA   6  
ATOM 6604  C C    . LYS A 1 64 ? 15.141  -1.673  12.712  1.00 0.00 ? 64 LYS A C    6  
ATOM 6605  O O    . LYS A 1 64 ? 15.891  -0.735  12.440  1.00 0.00 ? 64 LYS A O    6  
ATOM 6606  C CB   . LYS A 1 64 ? 14.429  -3.407  11.056  1.00 0.00 ? 64 LYS A CB   6  
ATOM 6607  C CG   . LYS A 1 64 ? 13.269  -4.092  10.354  1.00 0.00 ? 64 LYS A CG   6  
ATOM 6608  C CD   . LYS A 1 64 ? 12.328  -4.754  11.347  1.00 0.00 ? 64 LYS A CD   6  
ATOM 6609  C CE   . LYS A 1 64 ? 12.902  -6.061  11.873  1.00 0.00 ? 64 LYS A CE   6  
ATOM 6610  N NZ   . LYS A 1 64 ? 12.975  -7.101  10.810  1.00 0.00 ? 64 LYS A NZ   6  
ATOM 6611  H H    . LYS A 1 64 ? 14.359  -1.012  9.956   1.00 0.00 ? 64 LYS A H    6  
ATOM 6612  H HA   . LYS A 1 64 ? 13.128  -2.251  12.303  1.00 0.00 ? 64 LYS A HA   6  
ATOM 6613  H HB2  . LYS A 1 64 ? 15.195  -3.201  10.324  1.00 0.00 ? 64 LYS A HB2  6  
ATOM 6614  H HB3  . LYS A 1 64 ? 14.825  -4.086  11.797  1.00 0.00 ? 64 LYS A HB3  6  
ATOM 6615  H HG2  . LYS A 1 64 ? 12.718  -3.357  9.787   1.00 0.00 ? 64 LYS A HG2  6  
ATOM 6616  H HG3  . LYS A 1 64 ? 13.660  -4.846  9.685   1.00 0.00 ? 64 LYS A HG3  6  
ATOM 6617  H HD2  . LYS A 1 64 ? 12.168  -4.084  12.179  1.00 0.00 ? 64 LYS A HD2  6  
ATOM 6618  H HD3  . LYS A 1 64 ? 11.386  -4.955  10.858  1.00 0.00 ? 64 LYS A HD3  6  
ATOM 6619  H HE2  . LYS A 1 64 ? 13.894  -5.876  12.253  1.00 0.00 ? 64 LYS A HE2  6  
ATOM 6620  H HE3  . LYS A 1 64 ? 12.271  -6.419  12.673  1.00 0.00 ? 64 LYS A HE3  6  
ATOM 6621  H HZ1  . LYS A 1 64 ? 13.925  -7.524  10.790  1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 6622  H HZ2  . LYS A 1 64 ? 12.777  -6.678  9.881   1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 6623  H HZ3  . LYS A 1 64 ? 12.278  -7.850  10.994  1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 6624  N N    . SER A 1 65 ? 15.233  -2.369  13.840  1.00 0.00 ? 65 SER A N    6  
ATOM 6625  C CA   . SER A 1 65 ? 16.241  -2.062  14.848  1.00 0.00 ? 65 SER A CA   6  
ATOM 6626  C C    . SER A 1 65 ? 17.580  -2.701  14.489  1.00 0.00 ? 65 SER A C    6  
ATOM 6627  O O    . SER A 1 65 ? 17.632  -3.834  14.013  1.00 0.00 ? 65 SER A O    6  
ATOM 6628  C CB   . SER A 1 65 ? 15.783  -2.550  16.224  1.00 0.00 ? 65 SER A CB   6  
ATOM 6629  O OG   . SER A 1 65 ? 15.549  -3.947  16.218  1.00 0.00 ? 65 SER A OG   6  
ATOM 6630  H H    . SER A 1 65 ? 14.606  -3.105  14.000  1.00 0.00 ? 65 SER A H    6  
ATOM 6631  H HA   . SER A 1 65 ? 16.364  -0.990  14.878  1.00 0.00 ? 65 SER A HA   6  
ATOM 6632  H HB2  . SER A 1 65 ? 16.546  -2.328  16.954  1.00 0.00 ? 65 SER A HB2  6  
ATOM 6633  H HB3  . SER A 1 65 ? 14.867  -2.044  16.495  1.00 0.00 ? 65 SER A HB3  6  
ATOM 6634  H HG   . SER A 1 65 ? 14.605  -4.114  16.168  1.00 0.00 ? 65 SER A HG   6  
ATOM 6635  N N    . GLY A 1 66 ? 18.662  -1.964  14.722  1.00 0.00 ? 66 GLY A N    6  
ATOM 6636  C CA   . GLY A 1 66 ? 19.986  -2.474  14.418  1.00 0.00 ? 66 GLY A CA   6  
ATOM 6637  C C    . GLY A 1 66 ? 20.819  -2.702  15.663  1.00 0.00 ? 66 GLY A C    6  
ATOM 6638  O O    . GLY A 1 66 ? 21.620  -1.857  16.064  1.00 0.00 ? 66 GLY A O    6  
ATOM 6639  H H    . GLY A 1 66 ? 18.560  -1.067  15.103  1.00 0.00 ? 66 GLY A H    6  
ATOM 6640  H HA2  . GLY A 1 66 ? 19.887  -3.409  13.887  1.00 0.00 ? 66 GLY A HA2  6  
ATOM 6641  H HA3  . GLY A 1 66 ? 20.496  -1.763  13.783  1.00 0.00 ? 66 GLY A HA3  6  
ATOM 6642  N N    . PRO A 1 67 ? 20.634  -3.869  16.298  1.00 0.00 ? 67 PRO A N    6  
ATOM 6643  C CA   . PRO A 1 67 ? 21.365  -4.233  17.515  1.00 0.00 ? 67 PRO A CA   6  
ATOM 6644  C C    . PRO A 1 67 ? 22.842  -4.502  17.246  1.00 0.00 ? 67 PRO A C    6  
ATOM 6645  O O    . PRO A 1 67 ? 23.300  -4.417  16.107  1.00 0.00 ? 67 PRO A O    6  
ATOM 6646  C CB   . PRO A 1 67 ? 20.665  -5.512  17.981  1.00 0.00 ? 67 PRO A CB   6  
ATOM 6647  C CG   . PRO A 1 67 ? 20.075  -6.093  16.742  1.00 0.00 ? 67 PRO A CG   6  
ATOM 6648  C CD   . PRO A 1 67 ? 19.697  -4.923  15.876  1.00 0.00 ? 67 PRO A CD   6  
ATOM 6649  H HA   . PRO A 1 67 ? 21.272  -3.472  18.276  1.00 0.00 ? 67 PRO A HA   6  
ATOM 6650  H HB2  . PRO A 1 67 ? 21.389  -6.180  18.425  1.00 0.00 ? 67 PRO A HB2  6  
ATOM 6651  H HB3  . PRO A 1 67 ? 19.902  -5.266  18.704  1.00 0.00 ? 67 PRO A HB3  6  
ATOM 6652  H HG2  . PRO A 1 67 ? 20.805  -6.710  16.242  1.00 0.00 ? 67 PRO A HG2  6  
ATOM 6653  H HG3  . PRO A 1 67 ? 19.198  -6.673  16.991  1.00 0.00 ? 67 PRO A HG3  6  
ATOM 6654  H HD2  . PRO A 1 67 ? 19.834  -5.167  14.833  1.00 0.00 ? 67 PRO A HD2  6  
ATOM 6655  H HD3  . PRO A 1 67 ? 18.675  -4.628  16.065  1.00 0.00 ? 67 PRO A HD3  6  
ATOM 6656  N N    . SER A 1 68 ? 23.582  -4.827  18.301  1.00 0.00 ? 68 SER A N    6  
ATOM 6657  C CA   . SER A 1 68 ? 25.008  -5.105  18.178  1.00 0.00 ? 68 SER A CA   6  
ATOM 6658  C C    . SER A 1 68 ? 25.242  -6.450  17.496  1.00 0.00 ? 68 SER A C    6  
ATOM 6659  O O    . SER A 1 68 ? 24.442  -7.375  17.631  1.00 0.00 ? 68 SER A O    6  
ATOM 6660  C CB   . SER A 1 68 ? 25.671  -5.098  19.557  1.00 0.00 ? 68 SER A CB   6  
ATOM 6661  O OG   . SER A 1 68 ? 25.170  -6.146  20.370  1.00 0.00 ? 68 SER A OG   6  
ATOM 6662  H H    . SER A 1 68 ? 23.158  -4.879  19.184  1.00 0.00 ? 68 SER A H    6  
ATOM 6663  H HA   . SER A 1 68 ? 25.447  -4.326  17.573  1.00 0.00 ? 68 SER A HA   6  
ATOM 6664  H HB2  . SER A 1 68 ? 26.736  -5.226  19.442  1.00 0.00 ? 68 SER A HB2  6  
ATOM 6665  H HB3  . SER A 1 68 ? 25.472  -4.154  20.044  1.00 0.00 ? 68 SER A HB3  6  
ATOM 6666  H HG   . SER A 1 68 ? 24.872  -6.868  19.812  1.00 0.00 ? 68 SER A HG   6  
ATOM 6667  N N    . SER A 1 69 ? 26.346  -6.549  16.763  1.00 0.00 ? 69 SER A N    6  
ATOM 6668  C CA   . SER A 1 69 ? 26.686  -7.779  16.055  1.00 0.00 ? 69 SER A CA   6  
ATOM 6669  C C    . SER A 1 69 ? 27.655  -8.626  16.874  1.00 0.00 ? 69 SER A C    6  
ATOM 6670  O O    . SER A 1 69 ? 28.545  -8.102  17.541  1.00 0.00 ? 69 SER A O    6  
ATOM 6671  C CB   . SER A 1 69 ? 27.299  -7.455  14.692  1.00 0.00 ? 69 SER A CB   6  
ATOM 6672  O OG   . SER A 1 69 ? 27.422  -8.622  13.898  1.00 0.00 ? 69 SER A OG   6  
ATOM 6673  H H    . SER A 1 69 ? 26.945  -5.777  16.694  1.00 0.00 ? 69 SER A H    6  
ATOM 6674  H HA   . SER A 1 69 ? 25.774  -8.338  15.907  1.00 0.00 ? 69 SER A HA   6  
ATOM 6675  H HB2  . SER A 1 69 ? 26.669  -6.747  14.175  1.00 0.00 ? 69 SER A HB2  6  
ATOM 6676  H HB3  . SER A 1 69 ? 28.281  -7.026  14.835  1.00 0.00 ? 69 SER A HB3  6  
ATOM 6677  H HG   . SER A 1 69 ? 26.703  -9.225  14.101  1.00 0.00 ? 69 SER A HG   6  
ATOM 6678  N N    . GLY A 1 70 ? 27.474  -9.942  16.816  1.00 0.00 ? 70 GLY A N    6  
ATOM 6679  C CA   . GLY A 1 70 ? 28.339  -10.843 17.556  1.00 0.00 ? 70 GLY A CA   6  
ATOM 6680  C C    . GLY A 1 70 ? 28.167  -10.710 19.056  1.00 0.00 ? 70 GLY A C    6  
ATOM 6681  O O    . GLY A 1 70 ? 27.053  -10.809 19.571  1.00 0.00 ? 70 GLY A O    6  
ATOM 6682  H H    . GLY A 1 70 ? 26.748  -10.305 16.267  1.00 0.00 ? 70 GLY A H    6  
ATOM 6683  H HA2  . GLY A 1 70 ? 28.115  -11.859 17.267  1.00 0.00 ? 70 GLY A HA2  6  
ATOM 6684  H HA3  . GLY A 1 70 ? 29.367  -10.626 17.303  1.00 0.00 ? 70 GLY A HA3  6  
ATOM 6685  N N    . GLY A 1 1  ? 10.529  -5.243  -9.942  1.00 0.00 ? 1  GLY A N    7  
ATOM 6686  C CA   . GLY A 1 1  ? 11.269  -4.067  -9.525  1.00 0.00 ? 1  GLY A CA   7  
ATOM 6687  C C    . GLY A 1 1  ? 12.170  -3.530  -10.619 1.00 0.00 ? 1  GLY A C    7  
ATOM 6688  O O    . GLY A 1 1  ? 11.910  -3.738  -11.804 1.00 0.00 ? 1  GLY A O    7  
ATOM 6689  H H1   . GLY A 1 1  ? 9.579   -5.328  -9.716  1.00 0.00 ? 1  GLY A H1   7  
ATOM 6690  H HA2  . GLY A 1 1  ? 10.568  -3.297  -9.239  1.00 0.00 ? 1  GLY A HA2  7  
ATOM 6691  H HA3  . GLY A 1 1  ? 11.876  -4.322  -8.668  1.00 0.00 ? 1  GLY A HA3  7  
ATOM 6692  N N    . SER A 1 2  ? 13.231  -2.835  -10.222 1.00 0.00 ? 2  SER A N    7  
ATOM 6693  C CA   . SER A 1 2  ? 14.171  -2.262  -11.178 1.00 0.00 ? 2  SER A CA   7  
ATOM 6694  C C    . SER A 1 2  ? 13.488  -1.210  -12.047 1.00 0.00 ? 2  SER A C    7  
ATOM 6695  O O    . SER A 1 2  ? 13.703  -1.154  -13.258 1.00 0.00 ? 2  SER A O    7  
ATOM 6696  C CB   . SER A 1 2  ? 14.767  -3.360  -12.061 1.00 0.00 ? 2  SER A CB   7  
ATOM 6697  O OG   . SER A 1 2  ? 15.927  -3.917  -11.469 1.00 0.00 ? 2  SER A OG   7  
ATOM 6698  H H    . SER A 1 2  ? 13.385  -2.704  -9.263  1.00 0.00 ? 2  SER A H    7  
ATOM 6699  H HA   . SER A 1 2  ? 14.966  -1.790  -10.620 1.00 0.00 ? 2  SER A HA   7  
ATOM 6700  H HB2  . SER A 1 2  ? 14.037  -4.143  -12.199 1.00 0.00 ? 2  SER A HB2  7  
ATOM 6701  H HB3  . SER A 1 2  ? 15.032  -2.942  -13.021 1.00 0.00 ? 2  SER A HB3  7  
ATOM 6702  H HG   . SER A 1 2  ? 16.598  -4.053  -12.143 1.00 0.00 ? 2  SER A HG   7  
ATOM 6703  N N    . SER A 1 3  ? 12.664  -0.377  -11.419 1.00 0.00 ? 3  SER A N    7  
ATOM 6704  C CA   . SER A 1 3  ? 11.946  0.671   -12.134 1.00 0.00 ? 3  SER A CA   7  
ATOM 6705  C C    . SER A 1 3  ? 12.287  2.046   -11.568 1.00 0.00 ? 3  SER A C    7  
ATOM 6706  O O    . SER A 1 3  ? 11.941  2.366   -10.432 1.00 0.00 ? 3  SER A O    7  
ATOM 6707  C CB   . SER A 1 3  ? 10.437  0.433   -12.050 1.00 0.00 ? 3  SER A CB   7  
ATOM 6708  O OG   . SER A 1 3  ? 10.000  0.401   -10.702 1.00 0.00 ? 3  SER A OG   7  
ATOM 6709  H H    . SER A 1 3  ? 12.534  -0.473  -10.452 1.00 0.00 ? 3  SER A H    7  
ATOM 6710  H HA   . SER A 1 3  ? 12.250  0.635   -13.169 1.00 0.00 ? 3  SER A HA   7  
ATOM 6711  H HB2  . SER A 1 3  ? 9.920   1.229   -12.564 1.00 0.00 ? 3  SER A HB2  7  
ATOM 6712  H HB3  . SER A 1 3  ? 10.198  -0.512  -12.516 1.00 0.00 ? 3  SER A HB3  7  
ATOM 6713  H HG   . SER A 1 3  ? 9.314   1.060   -10.572 1.00 0.00 ? 3  SER A HG   7  
ATOM 6714  N N    . GLY A 1 4  ? 12.970  2.856   -12.372 1.00 0.00 ? 4  GLY A N    7  
ATOM 6715  C CA   . GLY A 1 4  ? 13.348  4.188   -11.935 1.00 0.00 ? 4  GLY A CA   7  
ATOM 6716  C C    . GLY A 1 4  ? 12.282  5.222   -12.238 1.00 0.00 ? 4  GLY A C    7  
ATOM 6717  O O    . GLY A 1 4  ? 11.921  5.430   -13.396 1.00 0.00 ? 4  GLY A O    7  
ATOM 6718  H H    . GLY A 1 4  ? 13.219  2.548   -13.268 1.00 0.00 ? 4  GLY A H    7  
ATOM 6719  H HA2  . GLY A 1 4  ? 13.524  4.169   -10.870 1.00 0.00 ? 4  GLY A HA2  7  
ATOM 6720  H HA3  . GLY A 1 4  ? 14.262  4.473   -12.436 1.00 0.00 ? 4  GLY A HA3  7  
ATOM 6721  N N    . SER A 1 5  ? 11.776  5.871   -11.195 1.00 0.00 ? 5  SER A N    7  
ATOM 6722  C CA   . SER A 1 5  ? 10.740  6.885   -11.354 1.00 0.00 ? 5  SER A CA   7  
ATOM 6723  C C    . SER A 1 5  ? 10.548  7.674   -10.062 1.00 0.00 ? 5  SER A C    7  
ATOM 6724  O O    . SER A 1 5  ? 10.375  7.096   -8.989  1.00 0.00 ? 5  SER A O    7  
ATOM 6725  C CB   . SER A 1 5  ? 9.419   6.235   -11.770 1.00 0.00 ? 5  SER A CB   7  
ATOM 6726  O OG   . SER A 1 5  ? 9.089   5.157   -10.911 1.00 0.00 ? 5  SER A OG   7  
ATOM 6727  H H    . SER A 1 5  ? 12.105  5.661   -10.295 1.00 0.00 ? 5  SER A H    7  
ATOM 6728  H HA   . SER A 1 5  ? 11.058  7.564   -12.132 1.00 0.00 ? 5  SER A HA   7  
ATOM 6729  H HB2  . SER A 1 5  ? 8.630   6.969   -11.725 1.00 0.00 ? 5  SER A HB2  7  
ATOM 6730  H HB3  . SER A 1 5  ? 9.507   5.861   -12.780 1.00 0.00 ? 5  SER A HB3  7  
ATOM 6731  H HG   . SER A 1 5  ? 9.742   5.095   -10.209 1.00 0.00 ? 5  SER A HG   7  
ATOM 6732  N N    . SER A 1 6  ? 10.580  8.998   -10.174 1.00 0.00 ? 6  SER A N    7  
ATOM 6733  C CA   . SER A 1 6  ? 10.413  9.867   -9.015  1.00 0.00 ? 6  SER A CA   7  
ATOM 6734  C C    . SER A 1 6  ? 9.007   10.458  -8.977  1.00 0.00 ? 6  SER A C    7  
ATOM 6735  O O    . SER A 1 6  ? 8.190   10.203  -9.861  1.00 0.00 ? 6  SER A O    7  
ATOM 6736  C CB   . SER A 1 6  ? 11.451  10.991  -9.041  1.00 0.00 ? 6  SER A CB   7  
ATOM 6737  O OG   . SER A 1 6  ? 11.347  11.754  -10.230 1.00 0.00 ? 6  SER A OG   7  
ATOM 6738  H H    . SER A 1 6  ? 10.721  9.399   -11.057 1.00 0.00 ? 6  SER A H    7  
ATOM 6739  H HA   . SER A 1 6  ? 10.564  9.269   -8.128  1.00 0.00 ? 6  SER A HA   7  
ATOM 6740  H HB2  . SER A 1 6  ? 11.293  11.642  -8.195  1.00 0.00 ? 6  SER A HB2  7  
ATOM 6741  H HB3  . SER A 1 6  ? 12.441  10.564  -8.986  1.00 0.00 ? 6  SER A HB3  7  
ATOM 6742  H HG   . SER A 1 6  ? 11.824  11.313  -10.937 1.00 0.00 ? 6  SER A HG   7  
ATOM 6743  N N    . GLY A 1 7  ? 8.733   11.251  -7.946  1.00 0.00 ? 7  GLY A N    7  
ATOM 6744  C CA   . GLY A 1 7  ? 7.425   11.866  -7.810  1.00 0.00 ? 7  GLY A CA   7  
ATOM 6745  C C    . GLY A 1 7  ? 7.439   13.340  -8.166  1.00 0.00 ? 7  GLY A C    7  
ATOM 6746  O O    . GLY A 1 7  ? 8.210   14.115  -7.600  1.00 0.00 ? 7  GLY A O    7  
ATOM 6747  H H    . GLY A 1 7  ? 9.424   11.419  -7.271  1.00 0.00 ? 7  GLY A H    7  
ATOM 6748  H HA2  . GLY A 1 7  ? 6.730   11.356  -8.460  1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6749  H HA3  . GLY A 1 7  ? 7.093   11.758  -6.788  1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6750  N N    . ARG A 1 8  ? 6.584   13.727  -9.107  1.00 0.00 ? 8  ARG A N    7  
ATOM 6751  C CA   . ARG A 1 8  ? 6.503   15.117  -9.540  1.00 0.00 ? 8  ARG A CA   7  
ATOM 6752  C C    . ARG A 1 8  ? 5.058   15.608  -9.523  1.00 0.00 ? 8  ARG A C    7  
ATOM 6753  O O    . ARG A 1 8  ? 4.769   16.705  -9.044  1.00 0.00 ? 8  ARG A O    7  
ATOM 6754  C CB   . ARG A 1 8  ? 7.089   15.271  -10.944 1.00 0.00 ? 8  ARG A CB   7  
ATOM 6755  C CG   . ARG A 1 8  ? 6.336   14.488  -12.008 1.00 0.00 ? 8  ARG A CG   7  
ATOM 6756  C CD   . ARG A 1 8  ? 7.221   14.185  -13.207 1.00 0.00 ? 8  ARG A CD   7  
ATOM 6757  N NE   . ARG A 1 8  ? 7.446   15.367  -14.035 1.00 0.00 ? 8  ARG A NE   7  
ATOM 6758  C CZ   . ARG A 1 8  ? 7.768   15.312  -15.322 1.00 0.00 ? 8  ARG A CZ   7  
ATOM 6759  N NH1  . ARG A 1 8  ? 7.904   14.139  -15.925 1.00 0.00 ? 8  ARG A NH1  7  
ATOM 6760  N NH2  . ARG A 1 8  ? 7.956   16.431  -16.009 1.00 0.00 ? 8  ARG A NH2  7  
ATOM 6761  H H    . ARG A 1 8  ? 5.995   13.063  -9.521  1.00 0.00 ? 8  ARG A H    7  
ATOM 6762  H HA   . ARG A 1 8  ? 7.081   15.714  -8.851  1.00 0.00 ? 8  ARG A HA   7  
ATOM 6763  H HB2  . ARG A 1 8  ? 7.069   16.316  -11.218 1.00 0.00 ? 8  ARG A HB2  7  
ATOM 6764  H HB3  . ARG A 1 8  ? 8.113   14.930  -10.934 1.00 0.00 ? 8  ARG A HB3  7  
ATOM 6765  H HG2  . ARG A 1 8  ? 5.995   13.556  -11.581 1.00 0.00 ? 8  ARG A HG2  7  
ATOM 6766  H HG3  . ARG A 1 8  ? 5.487   15.069  -12.335 1.00 0.00 ? 8  ARG A HG3  7  
ATOM 6767  H HD2  . ARG A 1 8  ? 8.174   13.820  -12.851 1.00 0.00 ? 8  ARG A HD2  7  
ATOM 6768  H HD3  . ARG A 1 8  ? 6.745   13.422  -13.805 1.00 0.00 ? 8  ARG A HD3  7  
ATOM 6769  H HE   . ARG A 1 8  ? 7.351   16.244  -13.609 1.00 0.00 ? 8  ARG A HE   7  
ATOM 6770  H HH11 . ARG A 1 8  ? 7.762   13.293  -15.411 1.00 0.00 ? 8  ARG A HH11 7  
ATOM 6771  H HH12 . ARG A 1 8  ? 8.145   14.100  -16.895 1.00 0.00 ? 8  ARG A HH12 7  
ATOM 6772  H HH21 . ARG A 1 8  ? 7.855   17.317  -15.557 1.00 0.00 ? 8  ARG A HH21 7  
ATOM 6773  H HH22 . ARG A 1 8  ? 8.199   16.389  -16.977 1.00 0.00 ? 8  ARG A HH22 7  
ATOM 6774  N N    . LYS A 1 9  ? 4.154   14.789  -10.050 1.00 0.00 ? 9  LYS A N    7  
ATOM 6775  C CA   . LYS A 1 9  ? 2.739   15.138  -10.095 1.00 0.00 ? 9  LYS A CA   7  
ATOM 6776  C C    . LYS A 1 9  ? 2.253   15.616  -8.731  1.00 0.00 ? 9  LYS A C    7  
ATOM 6777  O O    . LYS A 1 9  ? 2.796   15.252  -7.688  1.00 0.00 ? 9  LYS A O    7  
ATOM 6778  C CB   . LYS A 1 9  ? 1.911   13.935  -10.551 1.00 0.00 ? 9  LYS A CB   7  
ATOM 6779  C CG   . LYS A 1 9  ? 2.237   13.469  -11.959 1.00 0.00 ? 9  LYS A CG   7  
ATOM 6780  C CD   . LYS A 1 9  ? 1.768   14.472  -13.000 1.00 0.00 ? 9  LYS A CD   7  
ATOM 6781  C CE   . LYS A 1 9  ? 0.271   14.362  -13.246 1.00 0.00 ? 9  LYS A CE   7  
ATOM 6782  N NZ   . LYS A 1 9  ? -0.133  15.025  -14.516 1.00 0.00 ? 9  LYS A NZ   7  
ATOM 6783  H H    . LYS A 1 9  ? 4.446   13.927  -10.416 1.00 0.00 ? 9  LYS A H    7  
ATOM 6784  H HA   . LYS A 1 9  ? 2.618   15.939  -10.809 1.00 0.00 ? 9  LYS A HA   7  
ATOM 6785  H HB2  . LYS A 1 9  ? 2.088   13.113  -9.872  1.00 0.00 ? 9  LYS A HB2  7  
ATOM 6786  H HB3  . LYS A 1 9  ? 0.864   14.200  -10.515 1.00 0.00 ? 9  LYS A HB3  7  
ATOM 6787  H HG2  . LYS A 1 9  ? 3.306   13.347  -12.050 1.00 0.00 ? 9  LYS A HG2  7  
ATOM 6788  H HG3  . LYS A 1 9  ? 1.748   12.523  -12.138 1.00 0.00 ? 9  LYS A HG3  7  
ATOM 6789  H HD2  . LYS A 1 9  ? 1.991   15.470  -12.653 1.00 0.00 ? 9  LYS A HD2  7  
ATOM 6790  H HD3  . LYS A 1 9  ? 2.291   14.286  -13.928 1.00 0.00 ? 9  LYS A HD3  7  
ATOM 6791  H HE2  . LYS A 1 9  ? 0.003   13.317  -13.295 1.00 0.00 ? 9  LYS A HE2  7  
ATOM 6792  H HE3  . LYS A 1 9  ? -0.251  14.829  -12.424 1.00 0.00 ? 9  LYS A HE3  7  
ATOM 6793  H HZ1  . LYS A 1 9  ? -0.482  15.986  -14.322 1.00 0.00 ? 9  LYS A HZ1  7  
ATOM 6794  H HZ2  . LYS A 1 9  ? -0.890  14.482  -14.978 1.00 0.00 ? 9  LYS A HZ2  7  
ATOM 6795  H HZ3  . LYS A 1 9  ? 0.679   15.087  -15.162 1.00 0.00 ? 9  LYS A HZ3  7  
ATOM 6796  N N    . PRO A 1 10 ? 1.203   16.451  -8.736  1.00 0.00 ? 10 PRO A N    7  
ATOM 6797  C CA   . PRO A 1 10 ? 0.619   16.996  -7.506  1.00 0.00 ? 10 PRO A CA   7  
ATOM 6798  C C    . PRO A 1 10 ? -0.106  15.932  -6.689  1.00 0.00 ? 10 PRO A C    7  
ATOM 6799  O O    . PRO A 1 10 ? 0.004   15.897  -5.463  1.00 0.00 ? 10 PRO A O    7  
ATOM 6800  C CB   . PRO A 1 10 ? -0.372  18.044  -8.019  1.00 0.00 ? 10 PRO A CB   7  
ATOM 6801  C CG   . PRO A 1 10 ? -0.728  17.590  -9.392  1.00 0.00 ? 10 PRO A CG   7  
ATOM 6802  C CD   . PRO A 1 10 ? 0.505   16.928  -9.942  1.00 0.00 ? 10 PRO A CD   7  
ATOM 6803  H HA   . PRO A 1 10 ? 1.366   17.475  -6.891  1.00 0.00 ? 10 PRO A HA   7  
ATOM 6804  H HB2  . PRO A 1 10 ? -1.239  18.070  -7.373  1.00 0.00 ? 10 PRO A HB2  7  
ATOM 6805  H HB3  . PRO A 1 10 ? 0.101   19.014  -8.034  1.00 0.00 ? 10 PRO A HB3  7  
ATOM 6806  H HG2  . PRO A 1 10 ? -1.544  16.884  -9.345  1.00 0.00 ? 10 PRO A HG2  7  
ATOM 6807  H HG3  . PRO A 1 10 ? -1.000  18.440  -10.000 1.00 0.00 ? 10 PRO A HG3  7  
ATOM 6808  H HD2  . PRO A 1 10 ? 0.235   16.102  -10.583 1.00 0.00 ? 10 PRO A HD2  7  
ATOM 6809  H HD3  . PRO A 1 10 ? 1.110   17.643  -10.479 1.00 0.00 ? 10 PRO A HD3  7  
ATOM 6810  N N    . ARG A 1 11 ? -0.846  15.067  -7.374  1.00 0.00 ? 11 ARG A N    7  
ATOM 6811  C CA   . ARG A 1 11 ? -1.589  14.003  -6.711  1.00 0.00 ? 11 ARG A CA   7  
ATOM 6812  C C    . ARG A 1 11 ? -0.686  12.808  -6.422  1.00 0.00 ? 11 ARG A C    7  
ATOM 6813  O O    . ARG A 1 11 ? 0.138   12.423  -7.252  1.00 0.00 ? 11 ARG A O    7  
ATOM 6814  C CB   . ARG A 1 11 ? -2.774  13.564  -7.574  1.00 0.00 ? 11 ARG A CB   7  
ATOM 6815  C CG   . ARG A 1 11 ? -2.401  12.566  -8.657  1.00 0.00 ? 11 ARG A CG   7  
ATOM 6816  C CD   . ARG A 1 11 ? -1.594  13.222  -9.766  1.00 0.00 ? 11 ARG A CD   7  
ATOM 6817  N NE   . ARG A 1 11 ? -1.422  12.338  -10.915 1.00 0.00 ? 11 ARG A NE   7  
ATOM 6818  C CZ   . ARG A 1 11 ? -2.420  11.959  -11.707 1.00 0.00 ? 11 ARG A CZ   7  
ATOM 6819  N NH1  . ARG A 1 11 ? -3.653  12.386  -11.475 1.00 0.00 ? 11 ARG A NH1  7  
ATOM 6820  N NH2  . ARG A 1 11 ? -2.184  11.152  -12.733 1.00 0.00 ? 11 ARG A NH2  7  
ATOM 6821  H H    . ARG A 1 11 ? -0.894  15.147  -8.350  1.00 0.00 ? 11 ARG A H    7  
ATOM 6822  H HA   . ARG A 1 11 ? -1.962  14.392  -5.775  1.00 0.00 ? 11 ARG A HA   7  
ATOM 6823  H HB2  . ARG A 1 11 ? -3.519  13.110  -6.938  1.00 0.00 ? 11 ARG A HB2  7  
ATOM 6824  H HB3  . ARG A 1 11 ? -3.200  14.435  -8.048  1.00 0.00 ? 11 ARG A HB3  7  
ATOM 6825  H HG2  . ARG A 1 11 ? -1.811  11.775  -8.218  1.00 0.00 ? 11 ARG A HG2  7  
ATOM 6826  H HG3  . ARG A 1 11 ? -3.305  12.152  -9.078  1.00 0.00 ? 11 ARG A HG3  7  
ATOM 6827  H HD2  . ARG A 1 11 ? -2.107  14.117  -10.086 1.00 0.00 ? 11 ARG A HD2  7  
ATOM 6828  H HD3  . ARG A 1 11 ? -0.621  13.485  -9.377  1.00 0.00 ? 11 ARG A HD3  7  
ATOM 6829  H HE   . ARG A 1 11 ? -0.519  12.010  -11.105 1.00 0.00 ? 11 ARG A HE   7  
ATOM 6830  H HH11 . ARG A 1 11 ? -3.833  12.995  -10.702 1.00 0.00 ? 11 ARG A HH11 7  
ATOM 6831  H HH12 . ARG A 1 11 ? -4.402  12.101  -12.073 1.00 0.00 ? 11 ARG A HH12 7  
ATOM 6832  H HH21 . ARG A 1 11 ? -1.255  10.829  -12.912 1.00 0.00 ? 11 ARG A HH21 7  
ATOM 6833  H HH22 . ARG A 1 11 ? -2.935  10.868  -13.328 1.00 0.00 ? 11 ARG A HH22 7  
ATOM 6834  N N    . THR A 1 12 ? -0.847  12.224  -5.238  1.00 0.00 ? 12 THR A N    7  
ATOM 6835  C CA   . THR A 1 12 ? -0.046  11.074  -4.839  1.00 0.00 ? 12 THR A CA   7  
ATOM 6836  C C    . THR A 1 12 ? -0.429  9.832   -5.636  1.00 0.00 ? 12 THR A C    7  
ATOM 6837  O O    . THR A 1 12 ? -1.542  9.735   -6.153  1.00 0.00 ? 12 THR A O    7  
ATOM 6838  C CB   . THR A 1 12 ? -0.204  10.773  -3.336  1.00 0.00 ? 12 THR A CB   7  
ATOM 6839  O OG1  . THR A 1 12 ? 0.090   11.946  -2.569  1.00 0.00 ? 12 THR A OG1  7  
ATOM 6840  C CG2  . THR A 1 12 ? 0.717   9.639   -2.911  1.00 0.00 ? 12 THR A CG2  7  
ATOM 6841  H H    . THR A 1 12 ? -1.520  12.576  -4.620  1.00 0.00 ? 12 THR A H    7  
ATOM 6842  H HA   . THR A 1 12 ? 0.992   11.307  -5.031  1.00 0.00 ? 12 THR A HA   7  
ATOM 6843  H HB   . THR A 1 12 ? -1.226  10.477  -3.150  1.00 0.00 ? 12 THR A HB   7  
ATOM 6844  H HG1  . THR A 1 12 ? -0.081  12.728  -3.100  1.00 0.00 ? 12 THR A HG1  7  
ATOM 6845  H HG21 . THR A 1 12 ? 1.741   9.910   -3.118  1.00 0.00 ? 12 THR A HG21 7  
ATOM 6846  H HG22 . THR A 1 12 ? 0.463   8.745   -3.460  1.00 0.00 ? 12 THR A HG22 7  
ATOM 6847  H HG23 . THR A 1 12 ? 0.600   9.459   -1.853  1.00 0.00 ? 12 THR A HG23 7  
ATOM 6848  N N    . ILE A 1 13 ? 0.499   8.886   -5.732  1.00 0.00 ? 13 ILE A N    7  
ATOM 6849  C CA   . ILE A 1 13 ? 0.256   7.650   -6.465  1.00 0.00 ? 13 ILE A CA   7  
ATOM 6850  C C    . ILE A 1 13 ? -1.052  6.999   -6.027  1.00 0.00 ? 13 ILE A C    7  
ATOM 6851  O O    . ILE A 1 13 ? -1.594  6.141   -6.724  1.00 0.00 ? 13 ILE A O    7  
ATOM 6852  C CB   . ILE A 1 13 ? 1.407   6.645   -6.272  1.00 0.00 ? 13 ILE A CB   7  
ATOM 6853  C CG1  . ILE A 1 13 ? 2.741   7.284   -6.661  1.00 0.00 ? 13 ILE A CG1  7  
ATOM 6854  C CG2  . ILE A 1 13 ? 1.155   5.388   -7.091  1.00 0.00 ? 13 ILE A CG2  7  
ATOM 6855  C CD1  . ILE A 1 13 ? 2.822   7.671   -8.121  1.00 0.00 ? 13 ILE A CD1  7  
ATOM 6856  H H    . ILE A 1 13 ? 1.366   9.022   -5.298  1.00 0.00 ? 13 ILE A H    7  
ATOM 6857  H HA   . ILE A 1 13 ? 0.190   7.894   -7.516  1.00 0.00 ? 13 ILE A HA   7  
ATOM 6858  H HB   . ILE A 1 13 ? 1.440   6.366   -5.230  1.00 0.00 ? 13 ILE A HB   7  
ATOM 6859  H HG12 . ILE A 1 13 ? 2.892   8.175   -6.074  1.00 0.00 ? 13 ILE A HG12 7  
ATOM 6860  H HG13 . ILE A 1 13 ? 3.539   6.584   -6.458  1.00 0.00 ? 13 ILE A HG13 7  
ATOM 6861  H HG21 . ILE A 1 13 ? 0.991   5.658   -8.124  1.00 0.00 ? 13 ILE A HG21 7  
ATOM 6862  H HG22 . ILE A 1 13 ? 2.014   4.737   -7.022  1.00 0.00 ? 13 ILE A HG22 7  
ATOM 6863  H HG23 . ILE A 1 13 ? 0.284   4.877   -6.709  1.00 0.00 ? 13 ILE A HG23 7  
ATOM 6864  H HD11 . ILE A 1 13 ? 2.192   8.529   -8.302  1.00 0.00 ? 13 ILE A HD11 7  
ATOM 6865  H HD12 . ILE A 1 13 ? 3.844   7.914   -8.374  1.00 0.00 ? 13 ILE A HD12 7  
ATOM 6866  H HD13 . ILE A 1 13 ? 2.488   6.844   -8.732  1.00 0.00 ? 13 ILE A HD13 7  
ATOM 6867  N N    . TYR A 1 14 ? -1.555  7.414   -4.870  1.00 0.00 ? 14 TYR A N    7  
ATOM 6868  C CA   . TYR A 1 14 ? -2.799  6.871   -4.338  1.00 0.00 ? 14 TYR A CA   7  
ATOM 6869  C C    . TYR A 1 14 ? -3.653  7.973   -3.719  1.00 0.00 ? 14 TYR A C    7  
ATOM 6870  O O    . TYR A 1 14 ? -3.168  8.778   -2.924  1.00 0.00 ? 14 TYR A O    7  
ATOM 6871  C CB   . TYR A 1 14 ? -2.504  5.791   -3.296  1.00 0.00 ? 14 TYR A CB   7  
ATOM 6872  C CG   . TYR A 1 14 ? -2.107  4.462   -3.896  1.00 0.00 ? 14 TYR A CG   7  
ATOM 6873  C CD1  . TYR A 1 14 ? -0.821  4.251   -4.379  1.00 0.00 ? 14 TYR A CD1  7  
ATOM 6874  C CD2  . TYR A 1 14 ? -3.018  3.415   -3.980  1.00 0.00 ? 14 TYR A CD2  7  
ATOM 6875  C CE1  . TYR A 1 14 ? -0.454  3.039   -4.929  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 6876  C CE2  . TYR A 1 14 ? -2.659  2.199   -4.528  1.00 0.00 ? 14 TYR A CE2  7  
ATOM 6877  C CZ   . TYR A 1 14 ? -1.376  2.015   -5.001  1.00 0.00 ? 14 TYR A CZ   7  
ATOM 6878  O OH   . TYR A 1 14 ? -1.014  0.805   -5.547  1.00 0.00 ? 14 TYR A OH   7  
ATOM 6879  H H    . TYR A 1 14 ? -1.077  8.101   -4.360  1.00 0.00 ? 14 TYR A H    7  
ATOM 6880  H HA   . TYR A 1 14 ? -3.344  6.427   -5.158  1.00 0.00 ? 14 TYR A HA   7  
ATOM 6881  H HB2  . TYR A 1 14 ? -1.696  6.123   -2.662  1.00 0.00 ? 14 TYR A HB2  7  
ATOM 6882  H HB3  . TYR A 1 14 ? -3.386  5.633   -2.693  1.00 0.00 ? 14 TYR A HB3  7  
ATOM 6883  H HD1  . TYR A 1 14 ? -0.101  5.055   -4.321  1.00 0.00 ? 14 TYR A HD1  7  
ATOM 6884  H HD2  . TYR A 1 14 ? -4.021  3.562   -3.609  1.00 0.00 ? 14 TYR A HD2  7  
ATOM 6885  H HE1  . TYR A 1 14 ? 0.550   2.895   -5.299  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 6886  H HE2  . TYR A 1 14 ? -3.381  1.397   -4.585  1.00 0.00 ? 14 TYR A HE2  7  
ATOM 6887  H HH   . TYR A 1 14 ? -0.569  0.953   -6.385  1.00 0.00 ? 14 TYR A HH   7  
ATOM 6888  N N    . SER A 1 15 ? -4.930  8.001   -4.088  1.00 0.00 ? 15 SER A N    7  
ATOM 6889  C CA   . SER A 1 15 ? -5.853  9.005   -3.572  1.00 0.00 ? 15 SER A CA   7  
ATOM 6890  C C    . SER A 1 15 ? -5.940  8.931   -2.051  1.00 0.00 ? 15 SER A C    7  
ATOM 6891  O O    . SER A 1 15 ? -5.813  7.858   -1.462  1.00 0.00 ? 15 SER A O    7  
ATOM 6892  C CB   . SER A 1 15 ? -7.242  8.813   -4.184  1.00 0.00 ? 15 SER A CB   7  
ATOM 6893  O OG   . SER A 1 15 ? -7.296  9.334   -5.500  1.00 0.00 ? 15 SER A OG   7  
ATOM 6894  H H    . SER A 1 15 ? -5.258  7.332   -4.725  1.00 0.00 ? 15 SER A H    7  
ATOM 6895  H HA   . SER A 1 15 ? -5.476  9.977   -3.853  1.00 0.00 ? 15 SER A HA   7  
ATOM 6896  H HB2  . SER A 1 15 ? -7.476  7.760   -4.217  1.00 0.00 ? 15 SER A HB2  7  
ATOM 6897  H HB3  . SER A 1 15 ? -7.974  9.326   -3.576  1.00 0.00 ? 15 SER A HB3  7  
ATOM 6898  H HG   . SER A 1 15 ? -6.707  8.833   -6.068  1.00 0.00 ? 15 SER A HG   7  
ATOM 6899  N N    . SER A 1 16 ? -6.158  10.081  -1.421  1.00 0.00 ? 16 SER A N    7  
ATOM 6900  C CA   . SER A 1 16 ? -6.259  10.150  0.032   1.00 0.00 ? 16 SER A CA   7  
ATOM 6901  C C    . SER A 1 16 ? -7.303  9.166   0.552   1.00 0.00 ? 16 SER A C    7  
ATOM 6902  O O    . SER A 1 16 ? -7.207  8.678   1.678   1.00 0.00 ? 16 SER A O    7  
ATOM 6903  C CB   . SER A 1 16 ? -6.616  11.570  0.474   1.00 0.00 ? 16 SER A CB   7  
ATOM 6904  O OG   . SER A 1 16 ? -7.918  11.926  0.042   1.00 0.00 ? 16 SER A OG   7  
ATOM 6905  H H    . SER A 1 16 ? -6.251  10.904  -1.946  1.00 0.00 ? 16 SER A H    7  
ATOM 6906  H HA   . SER A 1 16 ? -5.296  9.886   0.444   1.00 0.00 ? 16 SER A HA   7  
ATOM 6907  H HB2  . SER A 1 16 ? -6.579  11.630  1.551   1.00 0.00 ? 16 SER A HB2  7  
ATOM 6908  H HB3  . SER A 1 16 ? -5.907  12.266  0.049   1.00 0.00 ? 16 SER A HB3  7  
ATOM 6909  H HG   . SER A 1 16 ? -8.480  11.147  0.042   1.00 0.00 ? 16 SER A HG   7  
ATOM 6910  N N    . PHE A 1 17 ? -8.301  8.879   -0.278  1.00 0.00 ? 17 PHE A N    7  
ATOM 6911  C CA   . PHE A 1 17 ? -9.364  7.955   0.096   1.00 0.00 ? 17 PHE A CA   7  
ATOM 6912  C C    . PHE A 1 17 ? -8.868  6.512   0.063   1.00 0.00 ? 17 PHE A C    7  
ATOM 6913  O O    . PHE A 1 17 ? -9.169  5.721   0.956   1.00 0.00 ? 17 PHE A O    7  
ATOM 6914  C CB   . PHE A 1 17 ? -10.562 8.115   -0.842  1.00 0.00 ? 17 PHE A CB   7  
ATOM 6915  C CG   . PHE A 1 17 ? -11.498 6.940   -0.826  1.00 0.00 ? 17 PHE A CG   7  
ATOM 6916  C CD1  . PHE A 1 17 ? -11.223 5.808   -1.576  1.00 0.00 ? 17 PHE A CD1  7  
ATOM 6917  C CD2  . PHE A 1 17 ? -12.653 6.969   -0.061  1.00 0.00 ? 17 PHE A CD2  7  
ATOM 6918  C CE1  . PHE A 1 17 ? -12.082 4.725   -1.563  1.00 0.00 ? 17 PHE A CE1  7  
ATOM 6919  C CE2  . PHE A 1 17 ? -13.515 5.889   -0.043  1.00 0.00 ? 17 PHE A CE2  7  
ATOM 6920  C CZ   . PHE A 1 17 ? -13.230 4.766   -0.796  1.00 0.00 ? 17 PHE A CZ   7  
ATOM 6921  H H    . PHE A 1 17 ? -8.322  9.301   -1.163  1.00 0.00 ? 17 PHE A H    7  
ATOM 6922  H HA   . PHE A 1 17 ? -9.672  8.194   1.102   1.00 0.00 ? 17 PHE A HA   7  
ATOM 6923  H HB2  . PHE A 1 17 ? -11.124 8.990   -0.551  1.00 0.00 ? 17 PHE A HB2  7  
ATOM 6924  H HB3  . PHE A 1 17 ? -10.204 8.242   -1.853  1.00 0.00 ? 17 PHE A HB3  7  
ATOM 6925  H HD1  . PHE A 1 17 ? -10.325 5.775   -2.176  1.00 0.00 ? 17 PHE A HD1  7  
ATOM 6926  H HD2  . PHE A 1 17 ? -12.878 7.846   0.528   1.00 0.00 ? 17 PHE A HD2  7  
ATOM 6927  H HE1  . PHE A 1 17 ? -11.856 3.849   -2.153  1.00 0.00 ? 17 PHE A HE1  7  
ATOM 6928  H HE2  . PHE A 1 17 ? -14.412 5.923   0.557   1.00 0.00 ? 17 PHE A HE2  7  
ATOM 6929  H HZ   . PHE A 1 17 ? -13.902 3.921   -0.784  1.00 0.00 ? 17 PHE A HZ   7  
ATOM 6930  N N    . GLN A 1 18 ? -8.106  6.179   -0.974  1.00 0.00 ? 18 GLN A N    7  
ATOM 6931  C CA   . GLN A 1 18 ? -7.568  4.832   -1.124  1.00 0.00 ? 18 GLN A CA   7  
ATOM 6932  C C    . GLN A 1 18 ? -6.509  4.547   -0.064  1.00 0.00 ? 18 GLN A C    7  
ATOM 6933  O O    . GLN A 1 18 ? -6.363  3.413   0.393   1.00 0.00 ? 18 GLN A O    7  
ATOM 6934  C CB   . GLN A 1 18 ? -6.971  4.651   -2.521  1.00 0.00 ? 18 GLN A CB   7  
ATOM 6935  C CG   . GLN A 1 18 ? -8.015  4.566   -3.622  1.00 0.00 ? 18 GLN A CG   7  
ATOM 6936  C CD   . GLN A 1 18 ? -7.401  4.366   -4.994  1.00 0.00 ? 18 GLN A CD   7  
ATOM 6937  O OE1  . GLN A 1 18 ? -6.239  4.702   -5.221  1.00 0.00 ? 18 GLN A OE1  7  
ATOM 6938  N NE2  . GLN A 1 18 ? -8.181  3.816   -5.917  1.00 0.00 ? 18 GLN A NE2  7  
ATOM 6939  H H    . GLN A 1 18 ? -7.901  6.854   -1.653  1.00 0.00 ? 18 GLN A H    7  
ATOM 6940  H HA   . GLN A 1 18 ? -8.382  4.134   -0.998  1.00 0.00 ? 18 GLN A HA   7  
ATOM 6941  H HB2  . GLN A 1 18 ? -6.322  5.488   -2.733  1.00 0.00 ? 18 GLN A HB2  7  
ATOM 6942  H HB3  . GLN A 1 18 ? -6.389  3.741   -2.535  1.00 0.00 ? 18 GLN A HB3  7  
ATOM 6943  H HG2  . GLN A 1 18 ? -8.672  3.734   -3.415  1.00 0.00 ? 18 GLN A HG2  7  
ATOM 6944  H HG3  . GLN A 1 18 ? -8.587  5.482   -3.630  1.00 0.00 ? 18 GLN A HG3  7  
ATOM 6945  H HE21 . GLN A 1 18 ? -9.097  3.574   -5.665  1.00 0.00 ? 18 GLN A HE21 7  
ATOM 6946  H HE22 . GLN A 1 18 ? -7.810  3.676   -6.813  1.00 0.00 ? 18 GLN A HE22 7  
ATOM 6947  N N    . LEU A 1 19 ? -5.772  5.582   0.321   1.00 0.00 ? 19 LEU A N    7  
ATOM 6948  C CA   . LEU A 1 19 ? -4.725  5.444   1.328   1.00 0.00 ? 19 LEU A CA   7  
ATOM 6949  C C    . LEU A 1 19 ? -5.325  5.316   2.724   1.00 0.00 ? 19 LEU A C    7  
ATOM 6950  O O    . LEU A 1 19 ? -5.059  4.350   3.439   1.00 0.00 ? 19 LEU A O    7  
ATOM 6951  C CB   . LEU A 1 19 ? -3.777  6.643   1.275   1.00 0.00 ? 19 LEU A CB   7  
ATOM 6952  C CG   . LEU A 1 19 ? -2.660  6.571   0.234   1.00 0.00 ? 19 LEU A CG   7  
ATOM 6953  C CD1  . LEU A 1 19 ? -1.701  7.740   0.397   1.00 0.00 ? 19 LEU A CD1  7  
ATOM 6954  C CD2  . LEU A 1 19 ? -1.914  5.248   0.342   1.00 0.00 ? 19 LEU A CD2  7  
ATOM 6955  H H    . LEU A 1 19 ? -5.935  6.461   -0.079  1.00 0.00 ? 19 LEU A H    7  
ATOM 6956  H HA   . LEU A 1 19 ? -4.168  4.546   1.105   1.00 0.00 ? 19 LEU A HA   7  
ATOM 6957  H HB2  . LEU A 1 19 ? -4.368  7.522   1.065   1.00 0.00 ? 19 LEU A HB2  7  
ATOM 6958  H HB3  . LEU A 1 19 ? -3.318  6.744   2.248   1.00 0.00 ? 19 LEU A HB3  7  
ATOM 6959  H HG   . LEU A 1 19 ? -3.093  6.631   -0.755  1.00 0.00 ? 19 LEU A HG   7  
ATOM 6960  H HD11 . LEU A 1 19 ? -2.264  8.653   0.515   1.00 0.00 ? 19 LEU A HD11 7  
ATOM 6961  H HD12 . LEU A 1 19 ? -1.072  7.814   -0.477  1.00 0.00 ? 19 LEU A HD12 7  
ATOM 6962  H HD13 . LEU A 1 19 ? -1.085  7.581   1.270   1.00 0.00 ? 19 LEU A HD13 7  
ATOM 6963  H HD21 . LEU A 1 19 ? -2.150  4.780   1.286   1.00 0.00 ? 19 LEU A HD21 7  
ATOM 6964  H HD22 . LEU A 1 19 ? -0.851  5.429   0.286   1.00 0.00 ? 19 LEU A HD22 7  
ATOM 6965  H HD23 . LEU A 1 19 ? -2.213  4.599   -0.467  1.00 0.00 ? 19 LEU A HD23 7  
ATOM 6966  N N    . ALA A 1 20 ? -6.137  6.297   3.105   1.00 0.00 ? 20 ALA A N    7  
ATOM 6967  C CA   . ALA A 1 20 ? -6.778  6.292   4.414   1.00 0.00 ? 20 ALA A CA   7  
ATOM 6968  C C    . ALA A 1 20 ? -7.110  4.871   4.858   1.00 0.00 ? 20 ALA A C    7  
ATOM 6969  O O    . ALA A 1 20 ? -6.950  4.523   6.027   1.00 0.00 ? 20 ALA A O    7  
ATOM 6970  C CB   . ALA A 1 20 ? -8.037  7.146   4.388   1.00 0.00 ? 20 ALA A CB   7  
ATOM 6971  H H    . ALA A 1 20 ? -6.310  7.040   2.491   1.00 0.00 ? 20 ALA A H    7  
ATOM 6972  H HA   . ALA A 1 20 ? -6.091  6.729   5.124   1.00 0.00 ? 20 ALA A HA   7  
ATOM 6973  H HB1  . ALA A 1 20 ? -8.903  6.507   4.296   1.00 0.00 ? 20 ALA A HB1  7  
ATOM 6974  H HB2  . ALA A 1 20 ? -8.105  7.716   5.303   1.00 0.00 ? 20 ALA A HB2  7  
ATOM 6975  H HB3  . ALA A 1 20 ? -7.997  7.821   3.546   1.00 0.00 ? 20 ALA A HB3  7  
ATOM 6976  N N    . ALA A 1 21 ? -7.573  4.055   3.917   1.00 0.00 ? 21 ALA A N    7  
ATOM 6977  C CA   . ALA A 1 21 ? -7.926  2.672   4.211   1.00 0.00 ? 21 ALA A CA   7  
ATOM 6978  C C    . ALA A 1 21 ? -6.696  1.771   4.169   1.00 0.00 ? 21 ALA A C    7  
ATOM 6979  O O    . ALA A 1 21 ? -6.468  0.972   5.079   1.00 0.00 ? 21 ALA A O    7  
ATOM 6980  C CB   . ALA A 1 21 ? -8.979  2.176   3.231   1.00 0.00 ? 21 ALA A CB   7  
ATOM 6981  H H    . ALA A 1 21 ? -7.678  4.391   3.002   1.00 0.00 ? 21 ALA A H    7  
ATOM 6982  H HA   . ALA A 1 21 ? -8.350  2.640   5.204   1.00 0.00 ? 21 ALA A HA   7  
ATOM 6983  H HB1  . ALA A 1 21 ? -8.871  1.110   3.096   1.00 0.00 ? 21 ALA A HB1  7  
ATOM 6984  H HB2  . ALA A 1 21 ? -9.963  2.392   3.621   1.00 0.00 ? 21 ALA A HB2  7  
ATOM 6985  H HB3  . ALA A 1 21 ? -8.850  2.674   2.282   1.00 0.00 ? 21 ALA A HB3  7  
ATOM 6986  N N    . LEU A 1 22 ? -5.907  1.904   3.109   1.00 0.00 ? 22 LEU A N    7  
ATOM 6987  C CA   . LEU A 1 22 ? -4.700  1.101   2.949   1.00 0.00 ? 22 LEU A CA   7  
ATOM 6988  C C    . LEU A 1 22 ? -3.839  1.155   4.207   1.00 0.00 ? 22 LEU A C    7  
ATOM 6989  O O    . LEU A 1 22 ? -3.488  0.121   4.775   1.00 0.00 ? 22 LEU A O    7  
ATOM 6990  C CB   . LEU A 1 22 ? -3.894  1.590   1.744   1.00 0.00 ? 22 LEU A CB   7  
ATOM 6991  C CG   . LEU A 1 22 ? -4.406  1.152   0.372   1.00 0.00 ? 22 LEU A CG   7  
ATOM 6992  C CD1  . LEU A 1 22 ? -3.696  1.919   -0.733  1.00 0.00 ? 22 LEU A CD1  7  
ATOM 6993  C CD2  . LEU A 1 22 ? -4.220  -0.347  0.187   1.00 0.00 ? 22 LEU A CD2  7  
ATOM 6994  H H    . LEU A 1 22 ? -6.140  2.557   2.418   1.00 0.00 ? 22 LEU A H    7  
ATOM 6995  H HA   . LEU A 1 22 ? -5.002  0.078   2.778   1.00 0.00 ? 22 LEU A HA   7  
ATOM 6996  H HB2  . LEU A 1 22 ? -3.889  2.669   1.766   1.00 0.00 ? 22 LEU A HB2  7  
ATOM 6997  H HB3  . LEU A 1 22 ? -2.883  1.225   1.853   1.00 0.00 ? 22 LEU A HB3  7  
ATOM 6998  H HG   . LEU A 1 22 ? -5.463  1.369   0.302   1.00 0.00 ? 22 LEU A HG   7  
ATOM 6999  H HD11 . LEU A 1 22 ? -2.838  1.356   -1.068  1.00 0.00 ? 22 LEU A HD11 7  
ATOM 7000  H HD12 . LEU A 1 22 ? -3.372  2.878   -0.354  1.00 0.00 ? 22 LEU A HD12 7  
ATOM 7001  H HD13 . LEU A 1 22 ? -4.374  2.070   -1.560  1.00 0.00 ? 22 LEU A HD13 7  
ATOM 7002  H HD21 . LEU A 1 22 ? -3.825  -0.541  -0.800  1.00 0.00 ? 22 LEU A HD21 7  
ATOM 7003  H HD22 . LEU A 1 22 ? -5.172  -0.845  0.298   1.00 0.00 ? 22 LEU A HD22 7  
ATOM 7004  H HD23 . LEU A 1 22 ? -3.530  -0.718  0.930   1.00 0.00 ? 22 LEU A HD23 7  
ATOM 7005  N N    . GLN A 1 23 ? -3.504  2.367   4.637   1.00 0.00 ? 23 GLN A N    7  
ATOM 7006  C CA   . GLN A 1 23 ? -2.685  2.555   5.829   1.00 0.00 ? 23 GLN A CA   7  
ATOM 7007  C C    . GLN A 1 23 ? -3.372  1.972   7.059   1.00 0.00 ? 23 GLN A C    7  
ATOM 7008  O O    . GLN A 1 23 ? -2.749  1.270   7.856   1.00 0.00 ? 23 GLN A O    7  
ATOM 7009  C CB   . GLN A 1 23 ? -2.398  4.042   6.047   1.00 0.00 ? 23 GLN A CB   7  
ATOM 7010  C CG   . GLN A 1 23 ? -1.302  4.589   5.147   1.00 0.00 ? 23 GLN A CG   7  
ATOM 7011  C CD   . GLN A 1 23 ? -0.569  5.762   5.766   1.00 0.00 ? 23 GLN A CD   7  
ATOM 7012  O OE1  . GLN A 1 23 ? -1.023  6.341   6.753   1.00 0.00 ? 23 GLN A OE1  7  
ATOM 7013  N NE2  . GLN A 1 23 ? 0.572   6.118   5.189   1.00 0.00 ? 23 GLN A NE2  7  
ATOM 7014  H H    . GLN A 1 23 ? -3.814  3.153   4.141   1.00 0.00 ? 23 GLN A H    7  
ATOM 7015  H HA   . GLN A 1 23 ? -1.751  2.037   5.674   1.00 0.00 ? 23 GLN A HA   7  
ATOM 7016  H HB2  . GLN A 1 23 ? -3.302  4.602   5.859   1.00 0.00 ? 23 GLN A HB2  7  
ATOM 7017  H HB3  . GLN A 1 23 ? -2.098  4.191   7.074   1.00 0.00 ? 23 GLN A HB3  7  
ATOM 7018  H HG2  . GLN A 1 23 ? -0.589  3.802   4.950   1.00 0.00 ? 23 GLN A HG2  7  
ATOM 7019  H HG3  . GLN A 1 23 ? -1.746  4.911   4.216   1.00 0.00 ? 23 GLN A HG3  7  
ATOM 7020  H HE21 . GLN A 1 23 ? 0.872   5.612   4.405   1.00 0.00 ? 23 GLN A HE21 7  
ATOM 7021  H HE22 . GLN A 1 23 ? 1.067   6.874   5.568   1.00 0.00 ? 23 GLN A HE22 7  
ATOM 7022  N N    . ARG A 1 24 ? -4.660  2.267   7.207   1.00 0.00 ? 24 ARG A N    7  
ATOM 7023  C CA   . ARG A 1 24 ? -5.431  1.773   8.341   1.00 0.00 ? 24 ARG A CA   7  
ATOM 7024  C C    . ARG A 1 24 ? -5.308  0.257   8.464   1.00 0.00 ? 24 ARG A C    7  
ATOM 7025  O O    . ARG A 1 24 ? -5.443  -0.301  9.553   1.00 0.00 ? 24 ARG A O    7  
ATOM 7026  C CB   . ARG A 1 24 ? -6.902  2.165   8.194   1.00 0.00 ? 24 ARG A CB   7  
ATOM 7027  C CG   . ARG A 1 24 ? -7.660  2.191   9.512   1.00 0.00 ? 24 ARG A CG   7  
ATOM 7028  C CD   . ARG A 1 24 ? -8.240  0.826   9.847   1.00 0.00 ? 24 ARG A CD   7  
ATOM 7029  N NE   . ARG A 1 24 ? -9.338  0.918   10.805  1.00 0.00 ? 24 ARG A NE   7  
ATOM 7030  C CZ   . ARG A 1 24 ? -10.087 -0.118  11.167  1.00 0.00 ? 24 ARG A CZ   7  
ATOM 7031  N NH1  . ARG A 1 24 ? -9.857  -1.318  10.652  1.00 0.00 ? 24 ARG A NH1  7  
ATOM 7032  N NH2  . ARG A 1 24 ? -11.068 0.045   12.045  1.00 0.00 ? 24 ARG A NH2  7  
ATOM 7033  H H    . ARG A 1 24 ? -5.101  2.831   6.538   1.00 0.00 ? 24 ARG A H    7  
ATOM 7034  H HA   . ARG A 1 24 ? -5.034  2.228   9.236   1.00 0.00 ? 24 ARG A HA   7  
ATOM 7035  H HB2  . ARG A 1 24 ? -6.958  3.150   7.754   1.00 0.00 ? 24 ARG A HB2  7  
ATOM 7036  H HB3  . ARG A 1 24 ? -7.387  1.458   7.539   1.00 0.00 ? 24 ARG A HB3  7  
ATOM 7037  H HG2  . ARG A 1 24 ? -6.984  2.485   10.300  1.00 0.00 ? 24 ARG A HG2  7  
ATOM 7038  H HG3  . ARG A 1 24 ? -8.465  2.907   9.439   1.00 0.00 ? 24 ARG A HG3  7  
ATOM 7039  H HD2  . ARG A 1 24 ? -8.606  0.372   8.938   1.00 0.00 ? 24 ARG A HD2  7  
ATOM 7040  H HD3  . ARG A 1 24 ? -7.459  0.211   10.266  1.00 0.00 ? 24 ARG A HD3  7  
ATOM 7041  H HE   . ARG A 1 24 ? -9.526  1.796   11.198  1.00 0.00 ? 24 ARG A HE   7  
ATOM 7042  H HH11 . ARG A 1 24 ? -9.118  -1.445  9.991   1.00 0.00 ? 24 ARG A HH11 7  
ATOM 7043  H HH12 . ARG A 1 24 ? -10.422 -2.097  10.927  1.00 0.00 ? 24 ARG A HH12 7  
ATOM 7044  H HH21 . ARG A 1 24 ? -11.244 0.949   12.435  1.00 0.00 ? 24 ARG A HH21 7  
ATOM 7045  H HH22 . ARG A 1 24 ? -11.631 -0.735  12.316  1.00 0.00 ? 24 ARG A HH22 7  
ATOM 7046  N N    . ARG A 1 25 ? -5.051  -0.403  7.339   1.00 0.00 ? 25 ARG A N    7  
ATOM 7047  C CA   . ARG A 1 25 ? -4.911  -1.854  7.320   1.00 0.00 ? 25 ARG A CA   7  
ATOM 7048  C C    . ARG A 1 25 ? -3.461  -2.264  7.560   1.00 0.00 ? 25 ARG A C    7  
ATOM 7049  O O    . ARG A 1 25 ? -3.187  -3.223  8.283   1.00 0.00 ? 25 ARG A O    7  
ATOM 7050  C CB   . ARG A 1 25 ? -5.397  -2.417  5.983   1.00 0.00 ? 25 ARG A CB   7  
ATOM 7051  C CG   . ARG A 1 25 ? -5.577  -3.927  5.987   1.00 0.00 ? 25 ARG A CG   7  
ATOM 7052  C CD   . ARG A 1 25 ? -6.767  -4.344  6.837   1.00 0.00 ? 25 ARG A CD   7  
ATOM 7053  N NE   . ARG A 1 25 ? -8.010  -4.355  6.070   1.00 0.00 ? 25 ARG A NE   7  
ATOM 7054  C CZ   . ARG A 1 25 ? -9.210  -4.504  6.619   1.00 0.00 ? 25 ARG A CZ   7  
ATOM 7055  N NH1  . ARG A 1 25 ? -9.330  -4.652  7.931   1.00 0.00 ? 25 ARG A NH1  7  
ATOM 7056  N NH2  . ARG A 1 25 ? -10.295 -4.504  5.854   1.00 0.00 ? 25 ARG A NH2  7  
ATOM 7057  H H    . ARG A 1 25 ? -4.954  0.097   6.502   1.00 0.00 ? 25 ARG A H    7  
ATOM 7058  H HA   . ARG A 1 25 ? -5.523  -2.257  8.114   1.00 0.00 ? 25 ARG A HA   7  
ATOM 7059  H HB2  . ARG A 1 25 ? -6.347  -1.965  5.739   1.00 0.00 ? 25 ARG A HB2  7  
ATOM 7060  H HB3  . ARG A 1 25 ? -4.679  -2.164  5.218   1.00 0.00 ? 25 ARG A HB3  7  
ATOM 7061  H HG2  . ARG A 1 25 ? -5.737  -4.263  4.974   1.00 0.00 ? 25 ARG A HG2  7  
ATOM 7062  H HG3  . ARG A 1 25 ? -4.683  -4.385  6.384   1.00 0.00 ? 25 ARG A HG3  7  
ATOM 7063  H HD2  . ARG A 1 25 ? -6.585  -5.335  7.225   1.00 0.00 ? 25 ARG A HD2  7  
ATOM 7064  H HD3  . ARG A 1 25 ? -6.867  -3.649  7.657   1.00 0.00 ? 25 ARG A HD3  7  
ATOM 7065  H HE   . ARG A 1 25 ? -7.945  -4.248  5.099   1.00 0.00 ? 25 ARG A HE   7  
ATOM 7066  H HH11 . ARG A 1 25 ? -8.514  -4.651  8.509   1.00 0.00 ? 25 ARG A HH11 7  
ATOM 7067  H HH12 . ARG A 1 25 ? -10.235 -4.762  8.342   1.00 0.00 ? 25 ARG A HH12 7  
ATOM 7068  H HH21 . ARG A 1 25 ? -10.209 -4.393  4.865   1.00 0.00 ? 25 ARG A HH21 7  
ATOM 7069  H HH22 . ARG A 1 25 ? -11.198 -4.616  6.268   1.00 0.00 ? 25 ARG A HH22 7  
ATOM 7070  N N    . PHE A 1 26 ? -2.536  -1.532  6.949   1.00 0.00 ? 26 PHE A N    7  
ATOM 7071  C CA   . PHE A 1 26 ? -1.114  -1.820  7.095   1.00 0.00 ? 26 PHE A CA   7  
ATOM 7072  C C    . PHE A 1 26 ? -0.720  -1.883  8.568   1.00 0.00 ? 26 PHE A C    7  
ATOM 7073  O O    . PHE A 1 26 ? -0.153  -2.874  9.026   1.00 0.00 ? 26 PHE A O    7  
ATOM 7074  C CB   . PHE A 1 26 ? -0.280  -0.756  6.377   1.00 0.00 ? 26 PHE A CB   7  
ATOM 7075  C CG   . PHE A 1 26 ? 1.200   -0.929  6.563   1.00 0.00 ? 26 PHE A CG   7  
ATOM 7076  C CD1  . PHE A 1 26 ? 1.926   -1.753  5.718   1.00 0.00 ? 26 PHE A CD1  7  
ATOM 7077  C CD2  . PHE A 1 26 ? 1.866   -0.268  7.582   1.00 0.00 ? 26 PHE A CD2  7  
ATOM 7078  C CE1  . PHE A 1 26 ? 3.289   -1.914  5.885   1.00 0.00 ? 26 PHE A CE1  7  
ATOM 7079  C CE2  . PHE A 1 26 ? 3.228   -0.425  7.754   1.00 0.00 ? 26 PHE A CE2  7  
ATOM 7080  C CZ   . PHE A 1 26 ? 3.940   -1.250  6.906   1.00 0.00 ? 26 PHE A CZ   7  
ATOM 7081  H H    . PHE A 1 26 ? -2.816  -0.780  6.386   1.00 0.00 ? 26 PHE A H    7  
ATOM 7082  H HA   . PHE A 1 26 ? -0.923  -2.781  6.642   1.00 0.00 ? 26 PHE A HA   7  
ATOM 7083  H HB2  . PHE A 1 26 ? -0.489  -0.799  5.319   1.00 0.00 ? 26 PHE A HB2  7  
ATOM 7084  H HB3  . PHE A 1 26 ? -0.552  0.218   6.755   1.00 0.00 ? 26 PHE A HB3  7  
ATOM 7085  H HD1  . PHE A 1 26 ? 1.417   -2.274  4.919   1.00 0.00 ? 26 PHE A HD1  7  
ATOM 7086  H HD2  . PHE A 1 26 ? 1.311   0.377   8.247   1.00 0.00 ? 26 PHE A HD2  7  
ATOM 7087  H HE1  . PHE A 1 26 ? 3.842   -2.560  5.220   1.00 0.00 ? 26 PHE A HE1  7  
ATOM 7088  H HE2  . PHE A 1 26 ? 3.736   0.096   8.553   1.00 0.00 ? 26 PHE A HE2  7  
ATOM 7089  H HZ   . PHE A 1 26 ? 5.005   -1.374  7.038   1.00 0.00 ? 26 PHE A HZ   7  
ATOM 7090  N N    . GLN A 1 27 ? -1.024  -0.818  9.302   1.00 0.00 ? 27 GLN A N    7  
ATOM 7091  C CA   . GLN A 1 27 ? -0.701  -0.752  10.722  1.00 0.00 ? 27 GLN A CA   7  
ATOM 7092  C C    . GLN A 1 27 ? -1.195  -1.997  11.451  1.00 0.00 ? 27 GLN A C    7  
ATOM 7093  O O    . GLN A 1 27 ? -0.473  -2.586  12.256  1.00 0.00 ? 27 GLN A O    7  
ATOM 7094  C CB   . GLN A 1 27 ? -1.318  0.500   11.349  1.00 0.00 ? 27 GLN A CB   7  
ATOM 7095  C CG   . GLN A 1 27 ? -2.838  0.501   11.337  1.00 0.00 ? 27 GLN A CG   7  
ATOM 7096  C CD   . GLN A 1 27 ? -3.423  1.874   11.600  1.00 0.00 ? 27 GLN A CD   7  
ATOM 7097  O OE1  . GLN A 1 27 ? -3.176  2.820   10.851  1.00 0.00 ? 27 GLN A OE1  7  
ATOM 7098  N NE2  . GLN A 1 27 ? -4.203  1.991   12.668  1.00 0.00 ? 27 GLN A NE2  7  
ATOM 7099  H H    . GLN A 1 27 ? -1.476  -0.059  8.878   1.00 0.00 ? 27 GLN A H    7  
ATOM 7100  H HA   . GLN A 1 27 ? 0.373   -0.698  10.815  1.00 0.00 ? 27 GLN A HA   7  
ATOM 7101  H HB2  . GLN A 1 27 ? -0.987  0.574   12.374  1.00 0.00 ? 27 GLN A HB2  7  
ATOM 7102  H HB3  . GLN A 1 27 ? -0.975  1.367   10.804  1.00 0.00 ? 27 GLN A HB3  7  
ATOM 7103  H HG2  . GLN A 1 27 ? -3.178  0.161   10.370  1.00 0.00 ? 27 GLN A HG2  7  
ATOM 7104  H HG3  . GLN A 1 27 ? -3.191  -0.178  12.100  1.00 0.00 ? 27 GLN A HG3  7  
ATOM 7105  H HE21 . GLN A 1 27 ? -4.354  1.194   13.220  1.00 0.00 ? 27 GLN A HE21 7  
ATOM 7106  H HE22 . GLN A 1 27 ? -4.593  2.868   12.862  1.00 0.00 ? 27 GLN A HE22 7  
ATOM 7107  N N    . LYS A 1 28 ? -2.431  -2.392  11.165  1.00 0.00 ? 28 LYS A N    7  
ATOM 7108  C CA   . LYS A 1 28 ? -3.023  -3.568  11.793  1.00 0.00 ? 28 LYS A CA   7  
ATOM 7109  C C    . LYS A 1 28 ? -2.155  -4.801  11.565  1.00 0.00 ? 28 LYS A C    7  
ATOM 7110  O O    . LYS A 1 28 ? -1.747  -5.471  12.515  1.00 0.00 ? 28 LYS A O    7  
ATOM 7111  C CB   . LYS A 1 28 ? -4.430  -3.812  11.241  1.00 0.00 ? 28 LYS A CB   7  
ATOM 7112  C CG   . LYS A 1 28 ? -5.136  -4.995  11.880  1.00 0.00 ? 28 LYS A CG   7  
ATOM 7113  C CD   . LYS A 1 28 ? -6.646  -4.825  11.850  1.00 0.00 ? 28 LYS A CD   7  
ATOM 7114  C CE   . LYS A 1 28 ? -7.108  -3.771  12.845  1.00 0.00 ? 28 LYS A CE   7  
ATOM 7115  N NZ   . LYS A 1 28 ? -8.358  -3.098  12.399  1.00 0.00 ? 28 LYS A NZ   7  
ATOM 7116  H H    . LYS A 1 28 ? -2.958  -1.881  10.515  1.00 0.00 ? 28 LYS A H    7  
ATOM 7117  H HA   . LYS A 1 28 ? -3.089  -3.380  12.854  1.00 0.00 ? 28 LYS A HA   7  
ATOM 7118  H HB2  . LYS A 1 28 ? -5.027  -2.928  11.410  1.00 0.00 ? 28 LYS A HB2  7  
ATOM 7119  H HB3  . LYS A 1 28 ? -4.360  -3.992  10.178  1.00 0.00 ? 28 LYS A HB3  7  
ATOM 7120  H HG2  . LYS A 1 28 ? -4.875  -5.893  11.339  1.00 0.00 ? 28 LYS A HG2  7  
ATOM 7121  H HG3  . LYS A 1 28 ? -4.813  -5.084  12.907  1.00 0.00 ? 28 LYS A HG3  7  
ATOM 7122  H HD2  . LYS A 1 28 ? -6.946  -4.523  10.858  1.00 0.00 ? 28 LYS A HD2  7  
ATOM 7123  H HD3  . LYS A 1 28 ? -7.111  -5.769  12.098  1.00 0.00 ? 28 LYS A HD3  7  
ATOM 7124  H HE2  . LYS A 1 28 ? -7.285  -4.247  13.797  1.00 0.00 ? 28 LYS A HE2  7  
ATOM 7125  H HE3  . LYS A 1 28 ? -6.328  -3.031  12.952  1.00 0.00 ? 28 LYS A HE3  7  
ATOM 7126  H HZ1  . LYS A 1 28 ? -9.187  -3.652  12.695  1.00 0.00 ? 28 LYS A HZ1  7  
ATOM 7127  H HZ2  . LYS A 1 28 ? -8.367  -3.010  11.363  1.00 0.00 ? 28 LYS A HZ2  7  
ATOM 7128  H HZ3  . LYS A 1 28 ? -8.422  -2.148  12.817  1.00 0.00 ? 28 LYS A HZ3  7  
ATOM 7129  N N    . THR A 1 29 ? -1.874  -5.096  10.299  1.00 0.00 ? 29 THR A N    7  
ATOM 7130  C CA   . THR A 1 29 ? -1.055  -6.249  9.947   1.00 0.00 ? 29 THR A CA   7  
ATOM 7131  C C    . THR A 1 29 ? -0.155  -5.940  8.756   1.00 0.00 ? 29 THR A C    7  
ATOM 7132  O O    . THR A 1 29 ? -0.618  -5.439  7.731   1.00 0.00 ? 29 THR A O    7  
ATOM 7133  C CB   . THR A 1 29 ? -1.924  -7.476  9.615   1.00 0.00 ? 29 THR A CB   7  
ATOM 7134  O OG1  . THR A 1 29 ? -1.100  -8.547  9.141   1.00 0.00 ? 29 THR A OG1  7  
ATOM 7135  C CG2  . THR A 1 29 ? -2.969  -7.131  8.564   1.00 0.00 ? 29 THR A CG2  7  
ATOM 7136  H H    . THR A 1 29 ? -2.228  -4.525  9.587   1.00 0.00 ? 29 THR A H    7  
ATOM 7137  H HA   . THR A 1 29 ? -0.437  -6.492  10.799  1.00 0.00 ? 29 THR A HA   7  
ATOM 7138  H HB   . THR A 1 29 ? -2.431  -7.793  10.515  1.00 0.00 ? 29 THR A HB   7  
ATOM 7139  H HG1  . THR A 1 29 ? -1.654  -9.289  8.886   1.00 0.00 ? 29 THR A HG1  7  
ATOM 7140  H HG21 . THR A 1 29 ? -2.507  -7.119  7.588   1.00 0.00 ? 29 THR A HG21 7  
ATOM 7141  H HG22 . THR A 1 29 ? -3.386  -6.158  8.778   1.00 0.00 ? 29 THR A HG22 7  
ATOM 7142  H HG23 . THR A 1 29 ? -3.754  -7.871  8.582   1.00 0.00 ? 29 THR A HG23 7  
ATOM 7143  N N    . GLN A 1 30 ? 1.131   -6.243  8.897   1.00 0.00 ? 30 GLN A N    7  
ATOM 7144  C CA   . GLN A 1 30 ? 2.095   -5.997  7.831   1.00 0.00 ? 30 GLN A CA   7  
ATOM 7145  C C    . GLN A 1 30 ? 1.726   -6.778  6.573   1.00 0.00 ? 30 GLN A C    7  
ATOM 7146  O O    . GLN A 1 30 ? 1.953   -6.315  5.455   1.00 0.00 ? 30 GLN A O    7  
ATOM 7147  C CB   . GLN A 1 30 ? 3.503   -6.381  8.289   1.00 0.00 ? 30 GLN A CB   7  
ATOM 7148  C CG   . GLN A 1 30 ? 4.262   -5.238  8.944   1.00 0.00 ? 30 GLN A CG   7  
ATOM 7149  C CD   . GLN A 1 30 ? 5.713   -5.581  9.216   1.00 0.00 ? 30 GLN A CD   7  
ATOM 7150  O OE1  . GLN A 1 30 ? 6.044   -6.725  9.532   1.00 0.00 ? 30 GLN A OE1  7  
ATOM 7151  N NE2  . GLN A 1 30 ? 6.589   -4.591  9.095   1.00 0.00 ? 30 GLN A NE2  7  
ATOM 7152  H H    . GLN A 1 30 ? 1.439   -6.641  9.737   1.00 0.00 ? 30 GLN A H    7  
ATOM 7153  H HA   . GLN A 1 30 ? 2.075   -4.942  7.603   1.00 0.00 ? 30 GLN A HA   7  
ATOM 7154  H HB2  . GLN A 1 30 ? 3.430   -7.190  9.000   1.00 0.00 ? 30 GLN A HB2  7  
ATOM 7155  H HB3  . GLN A 1 30 ? 4.069   -6.715  7.432   1.00 0.00 ? 30 GLN A HB3  7  
ATOM 7156  H HG2  . GLN A 1 30 ? 4.228   -4.379  8.291   1.00 0.00 ? 30 GLN A HG2  7  
ATOM 7157  H HG3  . GLN A 1 30 ? 3.782   -4.995  9.881   1.00 0.00 ? 30 GLN A HG3  7  
ATOM 7158  H HE21 . GLN A 1 30 ? 6.253   -3.705  8.841   1.00 0.00 ? 30 GLN A HE21 7  
ATOM 7159  H HE22 . GLN A 1 30 ? 7.533   -4.784  9.266   1.00 0.00 ? 30 GLN A HE22 7  
ATOM 7160  N N    . TYR A 1 31 ? 1.158   -7.963  6.764   1.00 0.00 ? 31 TYR A N    7  
ATOM 7161  C CA   . TYR A 1 31 ? 0.760   -8.809  5.645   1.00 0.00 ? 31 TYR A CA   7  
ATOM 7162  C C    . TYR A 1 31 ? -0.754  -8.992  5.611   1.00 0.00 ? 31 TYR A C    7  
ATOM 7163  O O    . TYR A 1 31 ? -1.416  -8.979  6.649   1.00 0.00 ? 31 TYR A O    7  
ATOM 7164  C CB   . TYR A 1 31 ? 1.448   -10.172 5.740   1.00 0.00 ? 31 TYR A CB   7  
ATOM 7165  C CG   . TYR A 1 31 ? 2.897   -10.092 6.164   1.00 0.00 ? 31 TYR A CG   7  
ATOM 7166  C CD1  . TYR A 1 31 ? 3.895   -9.799  5.242   1.00 0.00 ? 31 TYR A CD1  7  
ATOM 7167  C CD2  . TYR A 1 31 ? 3.269   -10.309 7.485   1.00 0.00 ? 31 TYR A CD2  7  
ATOM 7168  C CE1  . TYR A 1 31 ? 5.221   -9.725  5.624   1.00 0.00 ? 31 TYR A CE1  7  
ATOM 7169  C CE2  . TYR A 1 31 ? 4.591   -10.235 7.876   1.00 0.00 ? 31 TYR A CE2  7  
ATOM 7170  C CZ   . TYR A 1 31 ? 5.564   -9.943  6.942   1.00 0.00 ? 31 TYR A CZ   7  
ATOM 7171  O OH   . TYR A 1 31 ? 6.883   -9.870  7.328   1.00 0.00 ? 31 TYR A OH   7  
ATOM 7172  H H    . TYR A 1 31 ? 1.003   -8.278  7.679   1.00 0.00 ? 31 TYR A H    7  
ATOM 7173  H HA   . TYR A 1 31 ? 1.074   -8.322  4.733   1.00 0.00 ? 31 TYR A HA   7  
ATOM 7174  H HB2  . TYR A 1 31 ? 0.926   -10.782 6.461   1.00 0.00 ? 31 TYR A HB2  7  
ATOM 7175  H HB3  . TYR A 1 31 ? 1.411   -10.655 4.774   1.00 0.00 ? 31 TYR A HB3  7  
ATOM 7176  H HD1  . TYR A 1 31 ? 3.623   -9.629  4.210   1.00 0.00 ? 31 TYR A HD1  7  
ATOM 7177  H HD2  . TYR A 1 31 ? 2.504   -10.537 8.213   1.00 0.00 ? 31 TYR A HD2  7  
ATOM 7178  H HE1  . TYR A 1 31 ? 5.982   -9.496  4.893   1.00 0.00 ? 31 TYR A HE1  7  
ATOM 7179  H HE2  . TYR A 1 31 ? 4.860   -10.406 8.908   1.00 0.00 ? 31 TYR A HE2  7  
ATOM 7180  H HH   . TYR A 1 31 ? 7.393   -9.435  6.641   1.00 0.00 ? 31 TYR A HH   7  
ATOM 7181  N N    . LEU A 1 32 ? -1.295  -9.163  4.410   1.00 0.00 ? 32 LEU A N    7  
ATOM 7182  C CA   . LEU A 1 32 ? -2.732  -9.350  4.238   1.00 0.00 ? 32 LEU A CA   7  
ATOM 7183  C C    . LEU A 1 32 ? -3.035  -10.716 3.632   1.00 0.00 ? 32 LEU A C    7  
ATOM 7184  O O    . LEU A 1 32 ? -2.360  -11.156 2.702   1.00 0.00 ? 32 LEU A O    7  
ATOM 7185  C CB   . LEU A 1 32 ? -3.307  -8.245  3.349   1.00 0.00 ? 32 LEU A CB   7  
ATOM 7186  C CG   . LEU A 1 32 ? -3.200  -6.821  3.895   1.00 0.00 ? 32 LEU A CG   7  
ATOM 7187  C CD1  . LEU A 1 32 ? -3.715  -5.818  2.874   1.00 0.00 ? 32 LEU A CD1  7  
ATOM 7188  C CD2  . LEU A 1 32 ? -3.964  -6.692  5.204   1.00 0.00 ? 32 LEU A CD2  7  
ATOM 7189  H H    . LEU A 1 32 ? -0.717  -9.164  3.620   1.00 0.00 ? 32 LEU A H    7  
ATOM 7190  H HA   . LEU A 1 32 ? -3.192  -9.292  5.213   1.00 0.00 ? 32 LEU A HA   7  
ATOM 7191  H HB2  . LEU A 1 32 ? -2.787  -8.278  2.404   1.00 0.00 ? 32 LEU A HB2  7  
ATOM 7192  H HB3  . LEU A 1 32 ? -4.354  -8.462  3.190   1.00 0.00 ? 32 LEU A HB3  7  
ATOM 7193  H HG   . LEU A 1 32 ? -2.160  -6.594  4.089   1.00 0.00 ? 32 LEU A HG   7  
ATOM 7194  H HD11 . LEU A 1 32 ? -4.531  -6.257  2.319   1.00 0.00 ? 32 LEU A HD11 7  
ATOM 7195  H HD12 . LEU A 1 32 ? -2.919  -5.554  2.194   1.00 0.00 ? 32 LEU A HD12 7  
ATOM 7196  H HD13 . LEU A 1 32 ? -4.062  -4.931  3.384   1.00 0.00 ? 32 LEU A HD13 7  
ATOM 7197  H HD21 . LEU A 1 32 ? -4.313  -7.666  5.514   1.00 0.00 ? 32 LEU A HD21 7  
ATOM 7198  H HD22 . LEU A 1 32 ? -4.809  -6.034  5.065   1.00 0.00 ? 32 LEU A HD22 7  
ATOM 7199  H HD23 . LEU A 1 32 ? -3.311  -6.286  5.963   1.00 0.00 ? 32 LEU A HD23 7  
ATOM 7200  N N    . ALA A 1 33 ? -4.055  -11.381 4.164   1.00 0.00 ? 33 ALA A N    7  
ATOM 7201  C CA   . ALA A 1 33 ? -4.451  -12.695 3.672   1.00 0.00 ? 33 ALA A CA   7  
ATOM 7202  C C    . ALA A 1 33 ? -4.960  -12.613 2.237   1.00 0.00 ? 33 ALA A C    7  
ATOM 7203  O O    . ALA A 1 33 ? -5.271  -11.531 1.738   1.00 0.00 ? 33 ALA A O    7  
ATOM 7204  C CB   . ALA A 1 33 ? -5.513  -13.300 4.578   1.00 0.00 ? 33 ALA A CB   7  
ATOM 7205  H H    . ALA A 1 33 ? -4.555  -10.977 4.903   1.00 0.00 ? 33 ALA A H    7  
ATOM 7206  H HA   . ALA A 1 33 ? -3.582  -13.336 3.699   1.00 0.00 ? 33 ALA A HA   7  
ATOM 7207  H HB1  . ALA A 1 33 ? -6.446  -13.372 4.039   1.00 0.00 ? 33 ALA A HB1  7  
ATOM 7208  H HB2  . ALA A 1 33 ? -5.200  -14.285 4.890   1.00 0.00 ? 33 ALA A HB2  7  
ATOM 7209  H HB3  . ALA A 1 33 ? -5.645  -12.671 5.446   1.00 0.00 ? 33 ALA A HB3  7  
ATOM 7210  N N    . LEU A 1 34 ? -5.044  -13.764 1.578   1.00 0.00 ? 34 LEU A N    7  
ATOM 7211  C CA   . LEU A 1 34 ? -5.515  -13.823 0.199   1.00 0.00 ? 34 LEU A CA   7  
ATOM 7212  C C    . LEU A 1 34 ? -6.826  -13.059 0.038   1.00 0.00 ? 34 LEU A C    7  
ATOM 7213  O O    . LEU A 1 34 ? -6.924  -12.097 -0.724  1.00 0.00 ? 34 LEU A O    7  
ATOM 7214  C CB   . LEU A 1 34 ? -5.703  -15.278 -0.235  1.00 0.00 ? 34 LEU A CB   7  
ATOM 7215  C CG   . LEU A 1 34 ? -6.841  -15.542 -1.221  1.00 0.00 ? 34 LEU A CG   7  
ATOM 7216  C CD1  . LEU A 1 34 ? -6.506  -14.969 -2.590  1.00 0.00 ? 34 LEU A CD1  7  
ATOM 7217  C CD2  . LEU A 1 34 ? -7.124  -17.034 -1.321  1.00 0.00 ? 34 LEU A CD2  7  
ATOM 7218  H H    . LEU A 1 34 ? -4.782  -14.593 2.028   1.00 0.00 ? 34 LEU A H    7  
ATOM 7219  H HA   . LEU A 1 34 ? -4.766  -13.363 -0.428  1.00 0.00 ? 34 LEU A HA   7  
ATOM 7220  H HB2  . LEU A 1 34 ? -4.784  -15.607 -0.695  1.00 0.00 ? 34 LEU A HB2  7  
ATOM 7221  H HB3  . LEU A 1 34 ? -5.890  -15.865 0.653   1.00 0.00 ? 34 LEU A HB3  7  
ATOM 7222  H HG   . LEU A 1 34 ? -7.738  -15.054 -0.866  1.00 0.00 ? 34 LEU A HG   7  
ATOM 7223  H HD11 . LEU A 1 34 ? -7.151  -14.128 -2.795  1.00 0.00 ? 34 LEU A HD11 7  
ATOM 7224  H HD12 . LEU A 1 34 ? -6.653  -15.728 -3.344  1.00 0.00 ? 34 LEU A HD12 7  
ATOM 7225  H HD13 . LEU A 1 34 ? -5.476  -14.645 -2.601  1.00 0.00 ? 34 LEU A HD13 7  
ATOM 7226  H HD21 . LEU A 1 34 ? -6.824  -17.519 -0.404  1.00 0.00 ? 34 LEU A HD21 7  
ATOM 7227  H HD22 . LEU A 1 34 ? -6.567  -17.452 -2.148  1.00 0.00 ? 34 LEU A HD22 7  
ATOM 7228  H HD23 . LEU A 1 34 ? -8.180  -17.190 -1.483  1.00 0.00 ? 34 LEU A HD23 7  
ATOM 7229  N N    . PRO A 1 35 ? -7.859  -13.495 0.775   1.00 0.00 ? 35 PRO A N    7  
ATOM 7230  C CA   . PRO A 1 35 ? -9.182  -12.864 0.734   1.00 0.00 ? 35 PRO A CA   7  
ATOM 7231  C C    . PRO A 1 35 ? -9.184  -11.479 1.372   1.00 0.00 ? 35 PRO A C    7  
ATOM 7232  O O    . PRO A 1 35 ? -10.097 -10.685 1.148   1.00 0.00 ? 35 PRO A O    7  
ATOM 7233  C CB   . PRO A 1 35 ? -10.058 -13.826 1.542   1.00 0.00 ? 35 PRO A CB   7  
ATOM 7234  C CG   . PRO A 1 35 ? -9.111  -14.522 2.458   1.00 0.00 ? 35 PRO A CG   7  
ATOM 7235  C CD   . PRO A 1 35 ? -7.814  -14.635 1.706   1.00 0.00 ? 35 PRO A CD   7  
ATOM 7236  H HA   . PRO A 1 35 ? -9.557  -12.795 -0.276  1.00 0.00 ? 35 PRO A HA   7  
ATOM 7237  H HB2  . PRO A 1 35 ? -10.801 -13.265 2.091   1.00 0.00 ? 35 PRO A HB2  7  
ATOM 7238  H HB3  . PRO A 1 35 ? -10.544 -14.521 0.875   1.00 0.00 ? 35 PRO A HB3  7  
ATOM 7239  H HG2  . PRO A 1 35 ? -8.974  -13.939 3.356   1.00 0.00 ? 35 PRO A HG2  7  
ATOM 7240  H HG3  . PRO A 1 35 ? -9.491  -15.504 2.700   1.00 0.00 ? 35 PRO A HG3  7  
ATOM 7241  H HD2  . PRO A 1 35 ? -6.977  -14.548 2.382   1.00 0.00 ? 35 PRO A HD2  7  
ATOM 7242  H HD3  . PRO A 1 35 ? -7.771  -15.570 1.167   1.00 0.00 ? 35 PRO A HD3  7  
ATOM 7243  N N    . GLU A 1 36 ? -8.156  -11.196 2.166   1.00 0.00 ? 36 GLU A N    7  
ATOM 7244  C CA   . GLU A 1 36 ? -8.042  -9.906  2.836   1.00 0.00 ? 36 GLU A CA   7  
ATOM 7245  C C    . GLU A 1 36 ? -7.645  -8.813  1.847   1.00 0.00 ? 36 GLU A C    7  
ATOM 7246  O O    . GLU A 1 36 ? -8.343  -7.810  1.703   1.00 0.00 ? 36 GLU A O    7  
ATOM 7247  C CB   . GLU A 1 36 ? -7.014  -9.983  3.967   1.00 0.00 ? 36 GLU A CB   7  
ATOM 7248  C CG   . GLU A 1 36 ? -7.610  -10.389 5.304   1.00 0.00 ? 36 GLU A CG   7  
ATOM 7249  C CD   . GLU A 1 36 ? -8.740  -9.478  5.740   1.00 0.00 ? 36 GLU A CD   7  
ATOM 7250  O OE1  . GLU A 1 36 ? -8.495  -8.264  5.904   1.00 0.00 ? 36 GLU A OE1  7  
ATOM 7251  O OE2  . GLU A 1 36 ? -9.871  -9.978  5.916   1.00 0.00 ? 36 GLU A OE2  7  
ATOM 7252  H H    . GLU A 1 36 ? -7.459  -11.871 2.306   1.00 0.00 ? 36 GLU A H    7  
ATOM 7253  H HA   . GLU A 1 36 ? -9.006  -9.663  3.255   1.00 0.00 ? 36 GLU A HA   7  
ATOM 7254  H HB2  . GLU A 1 36 ? -6.255  -10.705 3.700   1.00 0.00 ? 36 GLU A HB2  7  
ATOM 7255  H HB3  . GLU A 1 36 ? -6.551  -9.014  4.082   1.00 0.00 ? 36 GLU A HB3  7  
ATOM 7256  H HG2  . GLU A 1 36 ? -7.991  -11.396 5.224   1.00 0.00 ? 36 GLU A HG2  7  
ATOM 7257  H HG3  . GLU A 1 36 ? -6.833  -10.358 6.054   1.00 0.00 ? 36 GLU A HG3  7  
ATOM 7258  N N    . ARG A 1 37 ? -6.520  -9.016  1.170   1.00 0.00 ? 37 ARG A N    7  
ATOM 7259  C CA   . ARG A 1 37 ? -6.030  -8.048  0.196   1.00 0.00 ? 37 ARG A CA   7  
ATOM 7260  C C    . ARG A 1 37 ? -7.055  -7.824  -0.912  1.00 0.00 ? 37 ARG A C    7  
ATOM 7261  O O    . ARG A 1 37 ? -7.237  -6.703  -1.384  1.00 0.00 ? 37 ARG A O    7  
ATOM 7262  C CB   . ARG A 1 37 ? -4.707  -8.525  -0.407  1.00 0.00 ? 37 ARG A CB   7  
ATOM 7263  C CG   . ARG A 1 37 ? -4.282  -7.743  -1.639  1.00 0.00 ? 37 ARG A CG   7  
ATOM 7264  C CD   . ARG A 1 37 ? -2.851  -8.066  -2.038  1.00 0.00 ? 37 ARG A CD   7  
ATOM 7265  N NE   . ARG A 1 37 ? -2.025  -8.408  -0.884  1.00 0.00 ? 37 ARG A NE   7  
ATOM 7266  C CZ   . ARG A 1 37 ? -1.962  -9.627  -0.359  1.00 0.00 ? 37 ARG A CZ   7  
ATOM 7267  N NH1  . ARG A 1 37 ? -2.674  -10.615 -0.884  1.00 0.00 ? 37 ARG A NH1  7  
ATOM 7268  N NH2  . ARG A 1 37 ? -1.187  -9.860  0.692   1.00 0.00 ? 37 ARG A NH2  7  
ATOM 7269  H H    . ARG A 1 37 ? -6.007  -9.836  1.329   1.00 0.00 ? 37 ARG A H    7  
ATOM 7270  H HA   . ARG A 1 37 ? -5.864  -7.114  0.712   1.00 0.00 ? 37 ARG A HA   7  
ATOM 7271  H HB2  . ARG A 1 37 ? -3.930  -8.431  0.338   1.00 0.00 ? 37 ARG A HB2  7  
ATOM 7272  H HB3  . ARG A 1 37 ? -4.806  -9.564  -0.684  1.00 0.00 ? 37 ARG A HB3  7  
ATOM 7273  H HG2  . ARG A 1 37 ? -4.939  -7.995  -2.459  1.00 0.00 ? 37 ARG A HG2  7  
ATOM 7274  H HG3  . ARG A 1 37 ? -4.358  -6.687  -1.427  1.00 0.00 ? 37 ARG A HG3  7  
ATOM 7275  H HD2  . ARG A 1 37 ? -2.862  -8.903  -2.721  1.00 0.00 ? 37 ARG A HD2  7  
ATOM 7276  H HD3  . ARG A 1 37 ? -2.426  -7.205  -2.531  1.00 0.00 ? 37 ARG A HD3  7  
ATOM 7277  H HE   . ARG A 1 37 ? -1.491  -7.693  -0.480  1.00 0.00 ? 37 ARG A HE   7  
ATOM 7278  H HH11 . ARG A 1 37 ? -3.258  -10.443 -1.677  1.00 0.00 ? 37 ARG A HH11 7  
ATOM 7279  H HH12 . ARG A 1 37 ? -2.624  -11.533 -0.488  1.00 0.00 ? 37 ARG A HH12 7  
ATOM 7280  H HH21 . ARG A 1 37 ? -0.649  -9.118  1.090   1.00 0.00 ? 37 ARG A HH21 7  
ATOM 7281  H HH22 . ARG A 1 37 ? -1.141  -10.777 1.086   1.00 0.00 ? 37 ARG A HH22 7  
ATOM 7282  N N    . ALA A 1 38 ? -7.721  -8.899  -1.321  1.00 0.00 ? 38 ALA A N    7  
ATOM 7283  C CA   . ALA A 1 38 ? -8.728  -8.819  -2.371  1.00 0.00 ? 38 ALA A CA   7  
ATOM 7284  C C    . ALA A 1 38 ? -9.794  -7.783  -2.032  1.00 0.00 ? 38 ALA A C    7  
ATOM 7285  O O    . ALA A 1 38 ? -10.228 -7.021  -2.895  1.00 0.00 ? 38 ALA A O    7  
ATOM 7286  C CB   . ALA A 1 38 ? -9.366  -10.182 -2.595  1.00 0.00 ? 38 ALA A CB   7  
ATOM 7287  H H    . ALA A 1 38 ? -7.531  -9.766  -0.905  1.00 0.00 ? 38 ALA A H    7  
ATOM 7288  H HA   . ALA A 1 38 ? -8.234  -8.526  -3.286  1.00 0.00 ? 38 ALA A HA   7  
ATOM 7289  H HB1  . ALA A 1 38 ? -9.621  -10.292 -3.639  1.00 0.00 ? 38 ALA A HB1  7  
ATOM 7290  H HB2  . ALA A 1 38 ? -8.670  -10.956 -2.310  1.00 0.00 ? 38 ALA A HB2  7  
ATOM 7291  H HB3  . ALA A 1 38 ? -10.261 -10.263 -1.996  1.00 0.00 ? 38 ALA A HB3  7  
ATOM 7292  N N    . GLU A 1 39 ? -10.212 -7.762  -0.770  1.00 0.00 ? 39 GLU A N    7  
ATOM 7293  C CA   . GLU A 1 39 ? -11.229 -6.819  -0.319  1.00 0.00 ? 39 GLU A CA   7  
ATOM 7294  C C    . GLU A 1 39 ? -10.803 -5.382  -0.603  1.00 0.00 ? 39 GLU A C    7  
ATOM 7295  O O    . GLU A 1 39 ? -11.579 -4.586  -1.135  1.00 0.00 ? 39 GLU A O    7  
ATOM 7296  C CB   . GLU A 1 39 ? -11.494 -6.998  1.177   1.00 0.00 ? 39 GLU A CB   7  
ATOM 7297  C CG   . GLU A 1 39 ? -12.591 -8.003  1.485   1.00 0.00 ? 39 GLU A CG   7  
ATOM 7298  C CD   . GLU A 1 39 ? -12.881 -8.114  2.970   1.00 0.00 ? 39 GLU A CD   7  
ATOM 7299  O OE1  . GLU A 1 39 ? -13.073 -7.062  3.616   1.00 0.00 ? 39 GLU A OE1  7  
ATOM 7300  O OE2  . GLU A 1 39 ? -12.916 -9.250  3.485   1.00 0.00 ? 39 GLU A OE2  7  
ATOM 7301  H H    . GLU A 1 39 ? -9.828  -8.395  -0.129  1.00 0.00 ? 39 GLU A H    7  
ATOM 7302  H HA   . GLU A 1 39 ? -12.138 -7.027  -0.863  1.00 0.00 ? 39 GLU A HA   7  
ATOM 7303  H HB2  . GLU A 1 39 ? -10.584 -7.332  1.654   1.00 0.00 ? 39 GLU A HB2  7  
ATOM 7304  H HB3  . GLU A 1 39 ? -11.781 -6.045  1.596   1.00 0.00 ? 39 GLU A HB3  7  
ATOM 7305  H HG2  . GLU A 1 39 ? -13.495 -7.697  0.980   1.00 0.00 ? 39 GLU A HG2  7  
ATOM 7306  H HG3  . GLU A 1 39 ? -12.287 -8.973  1.120   1.00 0.00 ? 39 GLU A HG3  7  
ATOM 7307  N N    . LEU A 1 40 ? -9.567  -5.056  -0.244  1.00 0.00 ? 40 LEU A N    7  
ATOM 7308  C CA   . LEU A 1 40 ? -9.036  -3.714  -0.459  1.00 0.00 ? 40 LEU A CA   7  
ATOM 7309  C C    . LEU A 1 40 ? -9.138  -3.317  -1.928  1.00 0.00 ? 40 LEU A C    7  
ATOM 7310  O O    . LEU A 1 40 ? -9.462  -2.175  -2.252  1.00 0.00 ? 40 LEU A O    7  
ATOM 7311  C CB   . LEU A 1 40 ? -7.579  -3.641  0.001   1.00 0.00 ? 40 LEU A CB   7  
ATOM 7312  C CG   . LEU A 1 40 ? -7.297  -4.137  1.419   1.00 0.00 ? 40 LEU A CG   7  
ATOM 7313  C CD1  . LEU A 1 40 ? -5.968  -3.594  1.921   1.00 0.00 ? 40 LEU A CD1  7  
ATOM 7314  C CD2  . LEU A 1 40 ? -8.427  -3.740  2.358   1.00 0.00 ? 40 LEU A CD2  7  
ATOM 7315  H H    . LEU A 1 40 ? -8.996  -5.733  0.176   1.00 0.00 ? 40 LEU A H    7  
ATOM 7316  H HA   . LEU A 1 40 ? -9.626  -3.027  0.129   1.00 0.00 ? 40 LEU A HA   7  
ATOM 7317  H HB2  . LEU A 1 40 ? -6.987  -4.232  -0.680  1.00 0.00 ? 40 LEU A HB2  7  
ATOM 7318  H HB3  . LEU A 1 40 ? -7.266  -2.608  -0.057  1.00 0.00 ? 40 LEU A HB3  7  
ATOM 7319  H HG   . LEU A 1 40 ? -7.233  -5.217  1.410   1.00 0.00 ? 40 LEU A HG   7  
ATOM 7320  H HD11 . LEU A 1 40 ? -5.768  -2.643  1.451   1.00 0.00 ? 40 LEU A HD11 7  
ATOM 7321  H HD12 . LEU A 1 40 ? -5.179  -4.290  1.677   1.00 0.00 ? 40 LEU A HD12 7  
ATOM 7322  H HD13 . LEU A 1 40 ? -6.014  -3.464  2.993   1.00 0.00 ? 40 LEU A HD13 7  
ATOM 7323  H HD21 . LEU A 1 40 ? -8.025  -3.541  3.340   1.00 0.00 ? 40 LEU A HD21 7  
ATOM 7324  H HD22 . LEU A 1 40 ? -9.144  -4.546  2.420   1.00 0.00 ? 40 LEU A HD22 7  
ATOM 7325  H HD23 . LEU A 1 40 ? -8.913  -2.853  1.981   1.00 0.00 ? 40 LEU A HD23 7  
ATOM 7326  N N    . ALA A 1 41 ? -8.861  -4.269  -2.813  1.00 0.00 ? 41 ALA A N    7  
ATOM 7327  C CA   . ALA A 1 41 ? -8.926  -4.020  -4.248  1.00 0.00 ? 41 ALA A CA   7  
ATOM 7328  C C    . ALA A 1 41 ? -10.368 -3.839  -4.709  1.00 0.00 ? 41 ALA A C    7  
ATOM 7329  O O    . ALA A 1 41 ? -10.656 -3.000  -5.562  1.00 0.00 ? 41 ALA A O    7  
ATOM 7330  C CB   . ALA A 1 41 ? -8.264  -5.158  -5.012  1.00 0.00 ? 41 ALA A CB   7  
ATOM 7331  H H    . ALA A 1 41 ? -8.608  -5.160  -2.494  1.00 0.00 ? 41 ALA A H    7  
ATOM 7332  H HA   . ALA A 1 41 ? -8.376  -3.113  -4.455  1.00 0.00 ? 41 ALA A HA   7  
ATOM 7333  H HB1  . ALA A 1 41 ? -8.775  -5.304  -5.952  1.00 0.00 ? 41 ALA A HB1  7  
ATOM 7334  H HB2  . ALA A 1 41 ? -7.229  -4.912  -5.198  1.00 0.00 ? 41 ALA A HB2  7  
ATOM 7335  H HB3  . ALA A 1 41 ? -8.320  -6.063  -4.427  1.00 0.00 ? 41 ALA A HB3  7  
ATOM 7336  N N    . ALA A 1 42 ? -11.270 -4.632  -4.141  1.00 0.00 ? 42 ALA A N    7  
ATOM 7337  C CA   . ALA A 1 42 ? -12.683 -4.558  -4.493  1.00 0.00 ? 42 ALA A CA   7  
ATOM 7338  C C    . ALA A 1 42 ? -13.363 -3.388  -3.791  1.00 0.00 ? 42 ALA A C    7  
ATOM 7339  O O    . ALA A 1 42 ? -14.407 -2.908  -4.233  1.00 0.00 ? 42 ALA A O    7  
ATOM 7340  C CB   . ALA A 1 42 ? -13.382 -5.863  -4.145  1.00 0.00 ? 42 ALA A CB   7  
ATOM 7341  H H    . ALA A 1 42 ? -10.979 -5.281  -3.467  1.00 0.00 ? 42 ALA A H    7  
ATOM 7342  H HA   . ALA A 1 42 ? -12.753 -4.414  -5.561  1.00 0.00 ? 42 ALA A HA   7  
ATOM 7343  H HB1  . ALA A 1 42 ? -13.243 -6.571  -4.950  1.00 0.00 ? 42 ALA A HB1  7  
ATOM 7344  H HB2  . ALA A 1 42 ? -12.963 -6.265  -3.235  1.00 0.00 ? 42 ALA A HB2  7  
ATOM 7345  H HB3  . ALA A 1 42 ? -14.437 -5.680  -4.005  1.00 0.00 ? 42 ALA A HB3  7  
ATOM 7346  N N    . SER A 1 43 ? -12.765 -2.932  -2.694  1.00 0.00 ? 43 SER A N    7  
ATOM 7347  C CA   . SER A 1 43 ? -13.316 -1.821  -1.928  1.00 0.00 ? 43 SER A CA   7  
ATOM 7348  C C    . SER A 1 43 ? -12.739 -0.492  -2.407  1.00 0.00 ? 43 SER A C    7  
ATOM 7349  O O    . SER A 1 43 ? -13.474 0.404   -2.825  1.00 0.00 ? 43 SER A O    7  
ATOM 7350  C CB   . SER A 1 43 ? -13.027 -2.008  -0.438  1.00 0.00 ? 43 SER A CB   7  
ATOM 7351  O OG   . SER A 1 43 ? -13.771 -1.090  0.345   1.00 0.00 ? 43 SER A OG   7  
ATOM 7352  H H    . SER A 1 43 ? -11.934 -3.357  -2.392  1.00 0.00 ? 43 SER A H    7  
ATOM 7353  H HA   . SER A 1 43 ? -14.385 -1.811  -2.081  1.00 0.00 ? 43 SER A HA   7  
ATOM 7354  H HB2  . SER A 1 43 ? -13.295 -3.012  -0.145  1.00 0.00 ? 43 SER A HB2  7  
ATOM 7355  H HB3  . SER A 1 43 ? -11.974 -1.848  -0.255  1.00 0.00 ? 43 SER A HB3  7  
ATOM 7356  H HG   . SER A 1 43 ? -13.198 -0.375  0.630   1.00 0.00 ? 43 SER A HG   7  
ATOM 7357  N N    . LEU A 1 44 ? -11.417 -0.371  -2.343  1.00 0.00 ? 44 LEU A N    7  
ATOM 7358  C CA   . LEU A 1 44 ? -10.739 0.847   -2.770  1.00 0.00 ? 44 LEU A CA   7  
ATOM 7359  C C    . LEU A 1 44 ? -10.813 1.010   -4.285  1.00 0.00 ? 44 LEU A C    7  
ATOM 7360  O O    . LEU A 1 44 ? -10.390 2.028   -4.831  1.00 0.00 ? 44 LEU A O    7  
ATOM 7361  C CB   . LEU A 1 44 ? -9.277  0.826   -2.319  1.00 0.00 ? 44 LEU A CB   7  
ATOM 7362  C CG   . LEU A 1 44 ? -9.030  0.427   -0.864  1.00 0.00 ? 44 LEU A CG   7  
ATOM 7363  C CD1  . LEU A 1 44 ? -7.551  0.532   -0.526  1.00 0.00 ? 44 LEU A CD1  7  
ATOM 7364  C CD2  . LEU A 1 44 ? -9.856  1.294   0.075   1.00 0.00 ? 44 LEU A CD2  7  
ATOM 7365  H H    . LEU A 1 44 ? -10.884 -1.119  -2.002  1.00 0.00 ? 44 LEU A H    7  
ATOM 7366  H HA   . LEU A 1 44 ? -11.238 1.684   -2.305  1.00 0.00 ? 44 LEU A HA   7  
ATOM 7367  H HB2  . LEU A 1 44 ? -8.748  0.127   -2.948  1.00 0.00 ? 44 LEU A HB2  7  
ATOM 7368  H HB3  . LEU A 1 44 ? -8.872  1.817   -2.465  1.00 0.00 ? 44 LEU A HB3  7  
ATOM 7369  H HG   . LEU A 1 44 ? -9.331  -0.602  -0.723  1.00 0.00 ? 44 LEU A HG   7  
ATOM 7370  H HD11 . LEU A 1 44 ? -6.982  -0.088  -1.202  1.00 0.00 ? 44 LEU A HD11 7  
ATOM 7371  H HD12 . LEU A 1 44 ? -7.389  0.200   0.489   1.00 0.00 ? 44 LEU A HD12 7  
ATOM 7372  H HD13 . LEU A 1 44 ? -7.231  1.559   -0.623  1.00 0.00 ? 44 LEU A HD13 7  
ATOM 7373  H HD21 . LEU A 1 44 ? -9.698  2.335   -0.165  1.00 0.00 ? 44 LEU A HD21 7  
ATOM 7374  H HD22 . LEU A 1 44 ? -9.553  1.109   1.095   1.00 0.00 ? 44 LEU A HD22 7  
ATOM 7375  H HD23 . LEU A 1 44 ? -10.902 1.053   -0.040  1.00 0.00 ? 44 LEU A HD23 7  
ATOM 7376  N N    . GLY A 1 45 ? -11.356 0.000   -4.958  1.00 0.00 ? 45 GLY A N    7  
ATOM 7377  C CA   . GLY A 1 45 ? -11.478 0.052   -6.403  1.00 0.00 ? 45 GLY A CA   7  
ATOM 7378  C C    . GLY A 1 45 ? -10.173 -0.260  -7.107  1.00 0.00 ? 45 GLY A C    7  
ATOM 7379  O O    . GLY A 1 45 ? -10.015 0.026   -8.294  1.00 0.00 ? 45 GLY A O    7  
ATOM 7380  H H    . GLY A 1 45 ? -11.677 -0.786  -4.469  1.00 0.00 ? 45 GLY A H    7  
ATOM 7381  H HA2  . GLY A 1 45 ? -12.224 -0.663  -6.716  1.00 0.00 ? 45 GLY A HA2  7  
ATOM 7382  H HA3  . GLY A 1 45 ? -11.800 1.043   -6.690  1.00 0.00 ? 45 GLY A HA3  7  
ATOM 7383  N N    . LEU A 1 46 ? -9.233  -0.847  -6.373  1.00 0.00 ? 46 LEU A N    7  
ATOM 7384  C CA   . LEU A 1 46 ? -7.933  -1.198  -6.934  1.00 0.00 ? 46 LEU A CA   7  
ATOM 7385  C C    . LEU A 1 46 ? -7.870  -2.683  -7.278  1.00 0.00 ? 46 LEU A C    7  
ATOM 7386  O O    . LEU A 1 46 ? -8.838  -3.419  -7.080  1.00 0.00 ? 46 LEU A O    7  
ATOM 7387  C CB   . LEU A 1 46 ? -6.818  -0.844  -5.948  1.00 0.00 ? 46 LEU A CB   7  
ATOM 7388  C CG   . LEU A 1 46 ? -6.843  0.580   -5.390  1.00 0.00 ? 46 LEU A CG   7  
ATOM 7389  C CD1  . LEU A 1 46 ? -6.224  0.619   -4.001  1.00 0.00 ? 46 LEU A CD1  7  
ATOM 7390  C CD2  . LEU A 1 46 ? -6.117  1.533   -6.327  1.00 0.00 ? 46 LEU A CD2  7  
ATOM 7391  H H    . LEU A 1 46 ? -9.417  -1.051  -5.433  1.00 0.00 ? 46 LEU A H    7  
ATOM 7392  H HA   . LEU A 1 46 ? -7.797  -0.625  -7.839  1.00 0.00 ? 46 LEU A HA   7  
ATOM 7393  H HB2  . LEU A 1 46 ? -6.884  -1.527  -5.115  1.00 0.00 ? 46 LEU A HB2  7  
ATOM 7394  H HB3  . LEU A 1 46 ? -5.873  -0.985  -6.454  1.00 0.00 ? 46 LEU A HB3  7  
ATOM 7395  H HG   . LEU A 1 46 ? -7.870  0.909   -5.307  1.00 0.00 ? 46 LEU A HG   7  
ATOM 7396  H HD11 . LEU A 1 46 ? -5.892  -0.371  -3.727  1.00 0.00 ? 46 LEU A HD11 7  
ATOM 7397  H HD12 . LEU A 1 46 ? -6.960  0.962   -3.289  1.00 0.00 ? 46 LEU A HD12 7  
ATOM 7398  H HD13 . LEU A 1 46 ? -5.382  1.295   -4.002  1.00 0.00 ? 46 LEU A HD13 7  
ATOM 7399  H HD21 . LEU A 1 46 ? -6.080  2.516   -5.882  1.00 0.00 ? 46 LEU A HD21 7  
ATOM 7400  H HD22 . LEU A 1 46 ? -6.644  1.584   -7.269  1.00 0.00 ? 46 LEU A HD22 7  
ATOM 7401  H HD23 . LEU A 1 46 ? -5.111  1.176   -6.495  1.00 0.00 ? 46 LEU A HD23 7  
ATOM 7402  N N    . THR A 1 47 ? -6.725  -3.118  -7.792  1.00 0.00 ? 47 THR A N    7  
ATOM 7403  C CA   . THR A 1 47 ? -6.535  -4.515  -8.163  1.00 0.00 ? 47 THR A CA   7  
ATOM 7404  C C    . THR A 1 47 ? -5.524  -5.194  -7.246  1.00 0.00 ? 47 THR A C    7  
ATOM 7405  O O    . THR A 1 47 ? -4.754  -4.528  -6.555  1.00 0.00 ? 47 THR A O    7  
ATOM 7406  C CB   . THR A 1 47 ? -6.059  -4.650  -9.622  1.00 0.00 ? 47 THR A CB   7  
ATOM 7407  O OG1  . THR A 1 47 ? -6.040  -6.029  -10.005 1.00 0.00 ? 47 THR A OG1  7  
ATOM 7408  C CG2  . THR A 1 47 ? -4.673  -4.050  -9.796  1.00 0.00 ? 47 THR A CG2  7  
ATOM 7409  H H    . THR A 1 47 ? -5.990  -2.483  -7.926  1.00 0.00 ? 47 THR A H    7  
ATOM 7410  H HA   . THR A 1 47 ? -7.487  -5.017  -8.068  1.00 0.00 ? 47 THR A HA   7  
ATOM 7411  H HB   . THR A 1 47 ? -6.750  -4.117  -10.260 1.00 0.00 ? 47 THR A HB   7  
ATOM 7412  H HG1  . THR A 1 47 ? -6.044  -6.096  -10.963 1.00 0.00 ? 47 THR A HG1  7  
ATOM 7413  H HG21 . THR A 1 47 ? -4.234  -3.867  -8.826  1.00 0.00 ? 47 THR A HG21 7  
ATOM 7414  H HG22 . THR A 1 47 ? -4.749  -3.119  -10.339 1.00 0.00 ? 47 THR A HG22 7  
ATOM 7415  H HG23 . THR A 1 47 ? -4.050  -4.738  -10.348 1.00 0.00 ? 47 THR A HG23 7  
ATOM 7416  N N    . GLN A 1 48 ? -5.532  -6.524  -7.246  1.00 0.00 ? 48 GLN A N    7  
ATOM 7417  C CA   . GLN A 1 48 ? -4.614  -7.292  -6.413  1.00 0.00 ? 48 GLN A CA   7  
ATOM 7418  C C    . GLN A 1 48 ? -3.165  -6.932  -6.724  1.00 0.00 ? 48 GLN A C    7  
ATOM 7419  O O    . GLN A 1 48 ? -2.281  -7.085  -5.880  1.00 0.00 ? 48 GLN A O    7  
ATOM 7420  C CB   . GLN A 1 48 ? -4.836  -8.791  -6.623  1.00 0.00 ? 48 GLN A CB   7  
ATOM 7421  C CG   . GLN A 1 48 ? -5.954  -9.367  -5.768  1.00 0.00 ? 48 GLN A CG   7  
ATOM 7422  C CD   . GLN A 1 48 ? -6.382  -10.749 -6.220  1.00 0.00 ? 48 GLN A CD   7  
ATOM 7423  O OE1  . GLN A 1 48 ? -5.935  -11.242 -7.256  1.00 0.00 ? 48 GLN A OE1  7  
ATOM 7424  N NE2  . GLN A 1 48 ? -7.253  -11.382 -5.443  1.00 0.00 ? 48 GLN A NE2  7  
ATOM 7425  H H    . GLN A 1 48 ? -6.169  -6.998  -7.819  1.00 0.00 ? 48 GLN A H    7  
ATOM 7426  H HA   . GLN A 1 48 ? -4.820  -7.048  -5.382  1.00 0.00 ? 48 GLN A HA   7  
ATOM 7427  H HB2  . GLN A 1 48 ? -5.080  -8.965  -7.660  1.00 0.00 ? 48 GLN A HB2  7  
ATOM 7428  H HB3  . GLN A 1 48 ? -3.923  -9.315  -6.383  1.00 0.00 ? 48 GLN A HB3  7  
ATOM 7429  H HG2  . GLN A 1 48 ? -5.611  -9.430  -4.745  1.00 0.00 ? 48 GLN A HG2  7  
ATOM 7430  H HG3  . GLN A 1 48 ? -6.806  -8.706  -5.820  1.00 0.00 ? 48 GLN A HG3  7  
ATOM 7431  H HE21 . GLN A 1 48 ? -7.566  -10.927 -4.633  1.00 0.00 ? 48 GLN A HE21 7  
ATOM 7432  H HE22 . GLN A 1 48 ? -7.547  -12.277 -5.711  1.00 0.00 ? 48 GLN A HE22 7  
ATOM 7433  N N    . THR A 1 49 ? -2.928  -6.453  -7.941  1.00 0.00 ? 49 THR A N    7  
ATOM 7434  C CA   . THR A 1 49 ? -1.586  -6.073  -8.364  1.00 0.00 ? 49 THR A CA   7  
ATOM 7435  C C    . THR A 1 49 ? -1.213  -4.693  -7.835  1.00 0.00 ? 49 THR A C    7  
ATOM 7436  O O    . THR A 1 49 ? -0.057  -4.278  -7.918  1.00 0.00 ? 49 THR A O    7  
ATOM 7437  C CB   . THR A 1 49 ? -1.459  -6.073  -9.899  1.00 0.00 ? 49 THR A CB   7  
ATOM 7438  O OG1  . THR A 1 49 ? -2.126  -7.217  -10.446 1.00 0.00 ? 49 THR A OG1  7  
ATOM 7439  C CG2  . THR A 1 49 ? 0.002   -6.082  -10.322 1.00 0.00 ? 49 THR A CG2  7  
ATOM 7440  H H    . THR A 1 49 ? -3.673  -6.355  -8.569  1.00 0.00 ? 49 THR A H    7  
ATOM 7441  H HA   . THR A 1 49 ? -0.892  -6.800  -7.967  1.00 0.00 ? 49 THR A HA   7  
ATOM 7442  H HB   . THR A 1 49 ? -1.925  -5.177  -10.284 1.00 0.00 ? 49 THR A HB   7  
ATOM 7443  H HG1  . THR A 1 49 ? -2.790  -6.930  -11.077 1.00 0.00 ? 49 THR A HG1  7  
ATOM 7444  H HG21 . THR A 1 49 ? 0.072   -6.323  -11.372 1.00 0.00 ? 49 THR A HG21 7  
ATOM 7445  H HG22 . THR A 1 49 ? 0.539   -6.820  -9.746  1.00 0.00 ? 49 THR A HG22 7  
ATOM 7446  H HG23 . THR A 1 49 ? 0.432   -5.107  -10.148 1.00 0.00 ? 49 THR A HG23 7  
ATOM 7447  N N    . GLN A 1 50 ? -2.199  -3.987  -7.291  1.00 0.00 ? 50 GLN A N    7  
ATOM 7448  C CA   . GLN A 1 50 ? -1.973  -2.652  -6.749  1.00 0.00 ? 50 GLN A CA   7  
ATOM 7449  C C    . GLN A 1 50 ? -1.737  -2.710  -5.243  1.00 0.00 ? 50 GLN A C    7  
ATOM 7450  O O    . GLN A 1 50 ? -0.773  -2.139  -4.733  1.00 0.00 ? 50 GLN A O    7  
ATOM 7451  C CB   . GLN A 1 50 ? -3.165  -1.745  -7.056  1.00 0.00 ? 50 GLN A CB   7  
ATOM 7452  C CG   . GLN A 1 50 ? -3.191  -1.239  -8.489  1.00 0.00 ? 50 GLN A CG   7  
ATOM 7453  C CD   . GLN A 1 50 ? -3.913  0.087   -8.627  1.00 0.00 ? 50 GLN A CD   7  
ATOM 7454  O OE1  . GLN A 1 50 ? -4.921  0.189   -9.328  1.00 0.00 ? 50 GLN A OE1  7  
ATOM 7455  N NE2  . GLN A 1 50 ? -3.401  1.113   -7.957  1.00 0.00 ? 50 GLN A NE2  7  
ATOM 7456  H H    . GLN A 1 50 ? -3.099  -4.372  -7.254  1.00 0.00 ? 50 GLN A H    7  
ATOM 7457  H HA   . GLN A 1 50 ? -1.092  -2.247  -7.223  1.00 0.00 ? 50 GLN A HA   7  
ATOM 7458  H HB2  . GLN A 1 50 ? -4.077  -2.295  -6.874  1.00 0.00 ? 50 GLN A HB2  7  
ATOM 7459  H HB3  . GLN A 1 50 ? -3.132  -0.891  -6.396  1.00 0.00 ? 50 GLN A HB3  7  
ATOM 7460  H HG2  . GLN A 1 50 ? -2.175  -1.115  -8.832  1.00 0.00 ? 50 GLN A HG2  7  
ATOM 7461  H HG3  . GLN A 1 50 ? -3.692  -1.971  -9.106  1.00 0.00 ? 50 GLN A HG3  7  
ATOM 7462  H HE21 . GLN A 1 50 ? -2.595  0.958   -7.419  1.00 0.00 ? 50 GLN A HE21 7  
ATOM 7463  H HE22 . GLN A 1 50 ? -3.847  1.981   -8.028  1.00 0.00 ? 50 GLN A HE22 7  
ATOM 7464  N N    . VAL A 1 51 ? -2.625  -3.402  -4.536  1.00 0.00 ? 51 VAL A N    7  
ATOM 7465  C CA   . VAL A 1 51 ? -2.513  -3.534  -3.088  1.00 0.00 ? 51 VAL A CA   7  
ATOM 7466  C C    . VAL A 1 51 ? -1.286  -4.353  -2.704  1.00 0.00 ? 51 VAL A C    7  
ATOM 7467  O O    . VAL A 1 51 ? -0.771  -4.237  -1.592  1.00 0.00 ? 51 VAL A O    7  
ATOM 7468  C CB   . VAL A 1 51 ? -3.767  -4.197  -2.487  1.00 0.00 ? 51 VAL A CB   7  
ATOM 7469  C CG1  . VAL A 1 51 ? -3.576  -4.450  -0.999  1.00 0.00 ? 51 VAL A CG1  7  
ATOM 7470  C CG2  . VAL A 1 51 ? -4.996  -3.334  -2.735  1.00 0.00 ? 51 VAL A CG2  7  
ATOM 7471  H H    . VAL A 1 51 ? -3.372  -3.834  -4.999  1.00 0.00 ? 51 VAL A H    7  
ATOM 7472  H HA   . VAL A 1 51 ? -2.419  -2.543  -2.668  1.00 0.00 ? 51 VAL A HA   7  
ATOM 7473  H HB   . VAL A 1 51 ? -3.916  -5.148  -2.975  1.00 0.00 ? 51 VAL A HB   7  
ATOM 7474  H HG11 . VAL A 1 51 ? -2.985  -5.344  -0.860  1.00 0.00 ? 51 VAL A HG11 7  
ATOM 7475  H HG12 . VAL A 1 51 ? -3.068  -3.608  -0.552  1.00 0.00 ? 51 VAL A HG12 7  
ATOM 7476  H HG13 . VAL A 1 51 ? -4.540  -4.580  -0.530  1.00 0.00 ? 51 VAL A HG13 7  
ATOM 7477  H HG21 . VAL A 1 51 ? -5.565  -3.249  -1.822  1.00 0.00 ? 51 VAL A HG21 7  
ATOM 7478  H HG22 . VAL A 1 51 ? -4.686  -2.351  -3.060  1.00 0.00 ? 51 VAL A HG22 7  
ATOM 7479  H HG23 . VAL A 1 51 ? -5.607  -3.790  -3.500  1.00 0.00 ? 51 VAL A HG23 7  
ATOM 7480  N N    . LYS A 1 52 ? -0.821  -5.182  -3.633  1.00 0.00 ? 52 LYS A N    7  
ATOM 7481  C CA   . LYS A 1 52 ? 0.348   -6.021  -3.394  1.00 0.00 ? 52 LYS A CA   7  
ATOM 7482  C C    . LYS A 1 52 ? 1.620   -5.180  -3.346  1.00 0.00 ? 52 LYS A C    7  
ATOM 7483  O O    . LYS A 1 52 ? 2.344   -5.190  -2.350  1.00 0.00 ? 52 LYS A O    7  
ATOM 7484  C CB   . LYS A 1 52 ? 0.469   -7.086  -4.486  1.00 0.00 ? 52 LYS A CB   7  
ATOM 7485  C CG   . LYS A 1 52 ? -0.238  -8.387  -4.147  1.00 0.00 ? 52 LYS A CG   7  
ATOM 7486  C CD   . LYS A 1 52 ? -0.298  -9.318  -5.347  1.00 0.00 ? 52 LYS A CD   7  
ATOM 7487  C CE   . LYS A 1 52 ? 1.059   -9.445  -6.022  1.00 0.00 ? 52 LYS A CE   7  
ATOM 7488  N NZ   . LYS A 1 52 ? 1.227   -8.455  -7.122  1.00 0.00 ? 52 LYS A NZ   7  
ATOM 7489  H H    . LYS A 1 52 ? -1.275  -5.231  -4.501  1.00 0.00 ? 52 LYS A H    7  
ATOM 7490  H HA   . LYS A 1 52 ? 0.217   -6.509  -2.440  1.00 0.00 ? 52 LYS A HA   7  
ATOM 7491  H HB2  . LYS A 1 52 ? 0.044   -6.697  -5.400  1.00 0.00 ? 52 LYS A HB2  7  
ATOM 7492  H HB3  . LYS A 1 52 ? 1.515   -7.301  -4.649  1.00 0.00 ? 52 LYS A HB3  7  
ATOM 7493  H HG2  . LYS A 1 52 ? 0.298   -8.880  -3.349  1.00 0.00 ? 52 LYS A HG2  7  
ATOM 7494  H HG3  . LYS A 1 52 ? -1.245  -8.166  -3.824  1.00 0.00 ? 52 LYS A HG3  7  
ATOM 7495  H HD2  . LYS A 1 52 ? -0.616  -10.296 -5.017  1.00 0.00 ? 52 LYS A HD2  7  
ATOM 7496  H HD3  . LYS A 1 52 ? -1.010  -8.927  -6.060  1.00 0.00 ? 52 LYS A HD3  7  
ATOM 7497  H HE2  . LYS A 1 52 ? 1.830   -9.285  -5.284  1.00 0.00 ? 52 LYS A HE2  7  
ATOM 7498  H HE3  . LYS A 1 52 ? 1.152   -10.442 -6.429  1.00 0.00 ? 52 LYS A HE3  7  
ATOM 7499  H HZ1  . LYS A 1 52 ? 1.091   -7.490  -6.757  1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 7500  H HZ2  . LYS A 1 52 ? 0.527   -8.631  -7.871  1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 7501  H HZ3  . LYS A 1 52 ? 2.181   -8.530  -7.528  1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 7502  N N    . ILE A 1 53 ? 1.884   -4.454  -4.427  1.00 0.00 ? 53 ILE A N    7  
ATOM 7503  C CA   . ILE A 1 53 ? 3.067   -3.606  -4.506  1.00 0.00 ? 53 ILE A CA   7  
ATOM 7504  C C    . ILE A 1 53 ? 3.089   -2.585  -3.374  1.00 0.00 ? 53 ILE A C    7  
ATOM 7505  O O    . ILE A 1 53 ? 4.107   -2.403  -2.707  1.00 0.00 ? 53 ILE A O    7  
ATOM 7506  C CB   . ILE A 1 53 ? 3.139   -2.863  -5.853  1.00 0.00 ? 53 ILE A CB   7  
ATOM 7507  C CG1  . ILE A 1 53 ? 3.021   -3.854  -7.013  1.00 0.00 ? 53 ILE A CG1  7  
ATOM 7508  C CG2  . ILE A 1 53 ? 4.435   -2.073  -5.954  1.00 0.00 ? 53 ILE A CG2  7  
ATOM 7509  C CD1  . ILE A 1 53 ? 2.456   -3.242  -8.276  1.00 0.00 ? 53 ILE A CD1  7  
ATOM 7510  H H    . ILE A 1 53 ? 1.269   -4.488  -5.188  1.00 0.00 ? 53 ILE A H    7  
ATOM 7511  H HA   . ILE A 1 53 ? 3.938   -4.240  -4.420  1.00 0.00 ? 53 ILE A HA   7  
ATOM 7512  H HB   . ILE A 1 53 ? 2.316   -2.167  -5.899  1.00 0.00 ? 53 ILE A HB   7  
ATOM 7513  H HG12 . ILE A 1 53 ? 3.999   -4.246  -7.244  1.00 0.00 ? 53 ILE A HG12 7  
ATOM 7514  H HG13 . ILE A 1 53 ? 2.373   -4.667  -6.718  1.00 0.00 ? 53 ILE A HG13 7  
ATOM 7515  H HG21 . ILE A 1 53 ? 4.309   -1.113  -5.475  1.00 0.00 ? 53 ILE A HG21 7  
ATOM 7516  H HG22 . ILE A 1 53 ? 5.227   -2.617  -5.463  1.00 0.00 ? 53 ILE A HG22 7  
ATOM 7517  H HG23 . ILE A 1 53 ? 4.688   -1.926  -6.993  1.00 0.00 ? 53 ILE A HG23 7  
ATOM 7518  H HD11 . ILE A 1 53 ? 1.936   -4.001  -8.843  1.00 0.00 ? 53 ILE A HD11 7  
ATOM 7519  H HD12 . ILE A 1 53 ? 1.769   -2.451  -8.017  1.00 0.00 ? 53 ILE A HD12 7  
ATOM 7520  H HD13 . ILE A 1 53 ? 3.262   -2.838  -8.872  1.00 0.00 ? 53 ILE A HD13 7  
ATOM 7521  N N    . TRP A 1 54 ? 1.958   -1.922  -3.161  1.00 0.00 ? 54 TRP A N    7  
ATOM 7522  C CA   . TRP A 1 54 ? 1.845   -0.920  -2.108  1.00 0.00 ? 54 TRP A CA   7  
ATOM 7523  C C    . TRP A 1 54 ? 2.365   -1.463  -0.782  1.00 0.00 ? 54 TRP A C    7  
ATOM 7524  O O    . TRP A 1 54 ? 3.142   -0.803  -0.091  1.00 0.00 ? 54 TRP A O    7  
ATOM 7525  C CB   . TRP A 1 54 ? 0.391   -0.471  -1.954  1.00 0.00 ? 54 TRP A CB   7  
ATOM 7526  C CG   . TRP A 1 54 ? 0.217   0.658   -0.985  1.00 0.00 ? 54 TRP A CG   7  
ATOM 7527  C CD1  . TRP A 1 54 ? 0.049   1.979   -1.287  1.00 0.00 ? 54 TRP A CD1  7  
ATOM 7528  C CD2  . TRP A 1 54 ? 0.195   0.565   0.444   1.00 0.00 ? 54 TRP A CD2  7  
ATOM 7529  N NE1  . TRP A 1 54 ? -0.076  2.713   -0.132  1.00 0.00 ? 54 TRP A NE1  7  
ATOM 7530  C CE2  . TRP A 1 54 ? 0.009   1.869   0.943   1.00 0.00 ? 54 TRP A CE2  7  
ATOM 7531  C CE3  . TRP A 1 54 ? 0.312   -0.492  1.350   1.00 0.00 ? 54 TRP A CE3  7  
ATOM 7532  C CZ2  . TRP A 1 54 ? -0.060  2.141   2.307   1.00 0.00 ? 54 TRP A CZ2  7  
ATOM 7533  C CZ3  . TRP A 1 54 ? 0.244   -0.221  2.703   1.00 0.00 ? 54 TRP A CZ3  7  
ATOM 7534  C CH2  . TRP A 1 54 ? 0.058   1.086   3.171   1.00 0.00 ? 54 TRP A CH2  7  
ATOM 7535  H H    . TRP A 1 54 ? 1.179   -2.111  -3.726  1.00 0.00 ? 54 TRP A H    7  
ATOM 7536  H HA   . TRP A 1 54 ? 2.446   -0.069  -2.395  1.00 0.00 ? 54 TRP A HA   7  
ATOM 7537  H HB2  . TRP A 1 54 ? 0.018   -0.147  -2.914  1.00 0.00 ? 54 TRP A HB2  7  
ATOM 7538  H HB3  . TRP A 1 54 ? -0.200  -1.306  -1.605  1.00 0.00 ? 54 TRP A HB3  7  
ATOM 7539  H HD1  . TRP A 1 54 ? 0.022   2.374   -2.291  1.00 0.00 ? 54 TRP A HD1  7  
ATOM 7540  H HE1  . TRP A 1 54 ? -0.207  3.684   -0.087  1.00 0.00 ? 54 TRP A HE1  7  
ATOM 7541  H HE3  . TRP A 1 54 ? 0.456   -1.507  1.008   1.00 0.00 ? 54 TRP A HE3  7  
ATOM 7542  H HZ2  . TRP A 1 54 ? -0.203  3.143   2.684   1.00 0.00 ? 54 TRP A HZ2  7  
ATOM 7543  H HZ3  . TRP A 1 54 ? 0.333   -1.026  3.418   1.00 0.00 ? 54 TRP A HZ3  7  
ATOM 7544  H HH2  . TRP A 1 54 ? 0.011   1.252   4.236   1.00 0.00 ? 54 TRP A HH2  7  
ATOM 7545  N N    . PHE A 1 55 ? 1.932   -2.670  -0.431  1.00 0.00 ? 55 PHE A N    7  
ATOM 7546  C CA   . PHE A 1 55 ? 2.354   -3.302  0.814   1.00 0.00 ? 55 PHE A CA   7  
ATOM 7547  C C    . PHE A 1 55 ? 3.821   -3.718  0.743   1.00 0.00 ? 55 PHE A C    7  
ATOM 7548  O O    . PHE A 1 55 ? 4.561   -3.584  1.716   1.00 0.00 ? 55 PHE A O    7  
ATOM 7549  C CB   . PHE A 1 55 ? 1.480   -4.521  1.113   1.00 0.00 ? 55 PHE A CB   7  
ATOM 7550  C CG   . PHE A 1 55 ? 0.266   -4.201  1.937   1.00 0.00 ? 55 PHE A CG   7  
ATOM 7551  C CD1  . PHE A 1 55 ? -0.802  -3.514  1.382   1.00 0.00 ? 55 PHE A CD1  7  
ATOM 7552  C CD2  . PHE A 1 55 ? 0.192   -4.587  3.265   1.00 0.00 ? 55 PHE A CD2  7  
ATOM 7553  C CE1  . PHE A 1 55 ? -1.920  -3.218  2.139   1.00 0.00 ? 55 PHE A CE1  7  
ATOM 7554  C CE2  . PHE A 1 55 ? -0.924  -4.294  4.027   1.00 0.00 ? 55 PHE A CE2  7  
ATOM 7555  C CZ   . PHE A 1 55 ? -1.982  -3.609  3.462   1.00 0.00 ? 55 PHE A CZ   7  
ATOM 7556  H H    . PHE A 1 55 ? 1.314   -3.146  -1.024  1.00 0.00 ? 55 PHE A H    7  
ATOM 7557  H HA   . PHE A 1 55 ? 2.235   -2.580  1.607   1.00 0.00 ? 55 PHE A HA   7  
ATOM 7558  H HB2  . PHE A 1 55 ? 1.144   -4.952  0.182   1.00 0.00 ? 55 PHE A HB2  7  
ATOM 7559  H HB3  . PHE A 1 55 ? 2.066   -5.251  1.652   1.00 0.00 ? 55 PHE A HB3  7  
ATOM 7560  H HD1  . PHE A 1 55 ? -0.756  -3.209  0.347   1.00 0.00 ? 55 PHE A HD1  7  
ATOM 7561  H HD2  . PHE A 1 55 ? 1.020   -5.123  3.708   1.00 0.00 ? 55 PHE A HD2  7  
ATOM 7562  H HE1  . PHE A 1 55 ? -2.746  -2.682  1.695   1.00 0.00 ? 55 PHE A HE1  7  
ATOM 7563  H HE2  . PHE A 1 55 ? -0.968  -4.601  5.061   1.00 0.00 ? 55 PHE A HE2  7  
ATOM 7564  H HZ   . PHE A 1 55 ? -2.854  -3.378  4.055   1.00 0.00 ? 55 PHE A HZ   7  
ATOM 7565  N N    . GLN A 1 56 ? 4.231   -4.222  -0.416  1.00 0.00 ? 56 GLN A N    7  
ATOM 7566  C CA   . GLN A 1 56 ? 5.608   -4.659  -0.614  1.00 0.00 ? 56 GLN A CA   7  
ATOM 7567  C C    . GLN A 1 56 ? 6.578   -3.493  -0.451  1.00 0.00 ? 56 GLN A C    7  
ATOM 7568  O O    . GLN A 1 56 ? 7.403   -3.483  0.461   1.00 0.00 ? 56 GLN A O    7  
ATOM 7569  C CB   . GLN A 1 56 ? 5.773   -5.285  -2.000  1.00 0.00 ? 56 GLN A CB   7  
ATOM 7570  C CG   . GLN A 1 56 ? 7.062   -6.074  -2.162  1.00 0.00 ? 56 GLN A CG   7  
ATOM 7571  C CD   . GLN A 1 56 ? 7.362   -6.411  -3.610  1.00 0.00 ? 56 GLN A CD   7  
ATOM 7572  O OE1  . GLN A 1 56 ? 6.691   -5.929  -4.523  1.00 0.00 ? 56 GLN A OE1  7  
ATOM 7573  N NE2  . GLN A 1 56 ? 8.375   -7.242  -3.827  1.00 0.00 ? 56 GLN A NE2  7  
ATOM 7574  H H    . GLN A 1 56 ? 3.593   -4.303  -1.155  1.00 0.00 ? 56 GLN A H    7  
ATOM 7575  H HA   . GLN A 1 56 ? 5.830   -5.403  0.135   1.00 0.00 ? 56 GLN A HA   7  
ATOM 7576  H HB2  . GLN A 1 56 ? 4.943   -5.951  -2.182  1.00 0.00 ? 56 GLN A HB2  7  
ATOM 7577  H HB3  . GLN A 1 56 ? 5.762   -4.499  -2.741  1.00 0.00 ? 56 GLN A HB3  7  
ATOM 7578  H HG2  . GLN A 1 56 ? 7.879   -5.488  -1.769  1.00 0.00 ? 56 GLN A HG2  7  
ATOM 7579  H HG3  . GLN A 1 56 ? 6.978   -6.994  -1.603  1.00 0.00 ? 56 GLN A HG3  7  
ATOM 7580  H HE21 . GLN A 1 56 ? 8.864   -7.587  -3.050  1.00 0.00 ? 56 GLN A HE21 7  
ATOM 7581  H HE22 . GLN A 1 56 ? 8.590   -7.477  -4.752  1.00 0.00 ? 56 GLN A HE22 7  
ATOM 7582  N N    . ASN A 1 57 ? 6.471   -2.513  -1.342  1.00 0.00 ? 57 ASN A N    7  
ATOM 7583  C CA   . ASN A 1 57 ? 7.340   -1.342  -1.297  1.00 0.00 ? 57 ASN A CA   7  
ATOM 7584  C C    . ASN A 1 57 ? 7.399   -0.762  0.113   1.00 0.00 ? 57 ASN A C    7  
ATOM 7585  O O    . ASN A 1 57 ? 8.478   -0.487  0.639   1.00 0.00 ? 57 ASN A O    7  
ATOM 7586  C CB   . ASN A 1 57 ? 6.846   -0.277  -2.278  1.00 0.00 ? 57 ASN A CB   7  
ATOM 7587  C CG   . ASN A 1 57 ? 7.306   -0.542  -3.699  1.00 0.00 ? 57 ASN A CG   7  
ATOM 7588  O OD1  . ASN A 1 57 ? 7.934   -1.563  -3.979  1.00 0.00 ? 57 ASN A OD1  7  
ATOM 7589  N ND2  . ASN A 1 57 ? 6.995   0.380   -4.603  1.00 0.00 ? 57 ASN A ND2  7  
ATOM 7590  H H    . ASN A 1 57 ? 5.793   -2.578  -2.046  1.00 0.00 ? 57 ASN A H    7  
ATOM 7591  H HA   . ASN A 1 57 ? 8.332   -1.654  -1.587  1.00 0.00 ? 57 ASN A HA   7  
ATOM 7592  H HB2  . ASN A 1 57 ? 5.766   -0.260  -2.268  1.00 0.00 ? 57 ASN A HB2  7  
ATOM 7593  H HB3  . ASN A 1 57 ? 7.221   0.688   -1.972  1.00 0.00 ? 57 ASN A HB3  7  
ATOM 7594  H HD21 . ASN A 1 57 ? 6.493   1.168   -4.307  1.00 0.00 ? 57 ASN A HD21 7  
ATOM 7595  H HD22 . ASN A 1 57 ? 7.280   0.234   -5.529  1.00 0.00 ? 57 ASN A HD22 7  
ATOM 7596  N N    . LYS A 1 58 ? 6.232   -0.580  0.721   1.00 0.00 ? 58 LYS A N    7  
ATOM 7597  C CA   . LYS A 1 58 ? 6.149   -0.035  2.071   1.00 0.00 ? 58 LYS A CA   7  
ATOM 7598  C C    . LYS A 1 58 ? 7.053   -0.807  3.026   1.00 0.00 ? 58 LYS A C    7  
ATOM 7599  O O    . LYS A 1 58 ? 7.896   -0.222  3.708   1.00 0.00 ? 58 LYS A O    7  
ATOM 7600  C CB   . LYS A 1 58 ? 4.704   -0.078  2.573   1.00 0.00 ? 58 LYS A CB   7  
ATOM 7601  C CG   . LYS A 1 58 ? 4.380   1.002   3.590   1.00 0.00 ? 58 LYS A CG   7  
ATOM 7602  C CD   . LYS A 1 58 ? 4.187   2.355   2.925   1.00 0.00 ? 58 LYS A CD   7  
ATOM 7603  C CE   . LYS A 1 58 ? 3.048   2.323   1.918   1.00 0.00 ? 58 LYS A CE   7  
ATOM 7604  N NZ   . LYS A 1 58 ? 3.522   1.947   0.557   1.00 0.00 ? 58 LYS A NZ   7  
ATOM 7605  H H    . LYS A 1 58 ? 5.405   -0.818  0.250   1.00 0.00 ? 58 LYS A H    7  
ATOM 7606  H HA   . LYS A 1 58 ? 6.477   0.993   2.035   1.00 0.00 ? 58 LYS A HA   7  
ATOM 7607  H HB2  . LYS A 1 58 ? 4.039   0.040   1.730   1.00 0.00 ? 58 LYS A HB2  7  
ATOM 7608  H HB3  . LYS A 1 58 ? 4.523   -1.040  3.031   1.00 0.00 ? 58 LYS A HB3  7  
ATOM 7609  H HG2  . LYS A 1 58 ? 3.471   0.735   4.109   1.00 0.00 ? 58 LYS A HG2  7  
ATOM 7610  H HG3  . LYS A 1 58 ? 5.194   1.072   4.298   1.00 0.00 ? 58 LYS A HG3  7  
ATOM 7611  H HD2  . LYS A 1 58 ? 3.962   3.090   3.683   1.00 0.00 ? 58 LYS A HD2  7  
ATOM 7612  H HD3  . LYS A 1 58 ? 5.100   2.629   2.415   1.00 0.00 ? 58 LYS A HD3  7  
ATOM 7613  H HE2  . LYS A 1 58 ? 2.315   1.603   2.246   1.00 0.00 ? 58 LYS A HE2  7  
ATOM 7614  H HE3  . LYS A 1 58 ? 2.596   3.303   1.875   1.00 0.00 ? 58 LYS A HE3  7  
ATOM 7615  H HZ1  . LYS A 1 58 ? 3.384   2.741   -0.101  1.00 0.00 ? 58 LYS A HZ1  7  
ATOM 7616  H HZ2  . LYS A 1 58 ? 2.988   1.126   0.208   1.00 0.00 ? 58 LYS A HZ2  7  
ATOM 7617  H HZ3  . LYS A 1 58 ? 4.532   1.705   0.584   1.00 0.00 ? 58 LYS A HZ3  7  
ATOM 7618  N N    . ARG A 1 59 ? 6.874   -2.123  3.069   1.00 0.00 ? 59 ARG A N    7  
ATOM 7619  C CA   . ARG A 1 59 ? 7.674   -2.975  3.941   1.00 0.00 ? 59 ARG A CA   7  
ATOM 7620  C C    . ARG A 1 59 ? 9.135   -2.983  3.501   1.00 0.00 ? 59 ARG A C    7  
ATOM 7621  O O    . ARG A 1 59 ? 10.020  -3.386  4.256   1.00 0.00 ? 59 ARG A O    7  
ATOM 7622  C CB   . ARG A 1 59 ? 7.123   -4.402  3.942   1.00 0.00 ? 59 ARG A CB   7  
ATOM 7623  C CG   . ARG A 1 59 ? 5.948   -4.600  4.885   1.00 0.00 ? 59 ARG A CG   7  
ATOM 7624  C CD   . ARG A 1 59 ? 5.447   -6.035  4.857   1.00 0.00 ? 59 ARG A CD   7  
ATOM 7625  N NE   . ARG A 1 59 ? 4.886   -6.394  3.557   1.00 0.00 ? 59 ARG A NE   7  
ATOM 7626  C CZ   . ARG A 1 59 ? 5.614   -6.841  2.540   1.00 0.00 ? 59 ARG A CZ   7  
ATOM 7627  N NH1  . ARG A 1 59 ? 6.925   -6.985  2.673   1.00 0.00 ? 59 ARG A NH1  7  
ATOM 7628  N NH2  . ARG A 1 59 ? 5.031   -7.147  1.389   1.00 0.00 ? 59 ARG A NH2  7  
ATOM 7629  H H    . ARG A 1 59 ? 6.187   -2.531  2.502   1.00 0.00 ? 59 ARG A H    7  
ATOM 7630  H HA   . ARG A 1 59 ? 7.615   -2.575  4.942   1.00 0.00 ? 59 ARG A HA   7  
ATOM 7631  H HB2  . ARG A 1 59 ? 6.799   -4.651  2.942   1.00 0.00 ? 59 ARG A HB2  7  
ATOM 7632  H HB3  . ARG A 1 59 ? 7.911   -5.079  4.235   1.00 0.00 ? 59 ARG A HB3  7  
ATOM 7633  H HG2  . ARG A 1 59 ? 6.261   -4.360  5.891   1.00 0.00 ? 59 ARG A HG2  7  
ATOM 7634  H HG3  . ARG A 1 59 ? 5.145   -3.941  4.589   1.00 0.00 ? 59 ARG A HG3  7  
ATOM 7635  H HD2  . ARG A 1 59 ? 6.273   -6.695  5.076   1.00 0.00 ? 59 ARG A HD2  7  
ATOM 7636  H HD3  . ARG A 1 59 ? 4.684   -6.151  5.613   1.00 0.00 ? 59 ARG A HD3  7  
ATOM 7637  H HE   . ARG A 1 59 ? 3.919   -6.295  3.438   1.00 0.00 ? 59 ARG A HE   7  
ATOM 7638  H HH11 . ARG A 1 59 ? 7.368   -6.757  3.540   1.00 0.00 ? 59 ARG A HH11 7  
ATOM 7639  H HH12 . ARG A 1 59 ? 7.471   -7.324  1.906   1.00 0.00 ? 59 ARG A HH12 7  
ATOM 7640  H HH21 . ARG A 1 59 ? 4.042   -7.040  1.285   1.00 0.00 ? 59 ARG A HH21 7  
ATOM 7641  H HH22 . ARG A 1 59 ? 5.579   -7.483  0.624   1.00 0.00 ? 59 ARG A HH22 7  
ATOM 7642  N N    . SER A 1 60 ? 9.381   -2.536  2.273   1.00 0.00 ? 60 SER A N    7  
ATOM 7643  C CA   . SER A 1 60 ? 10.734  -2.495  1.731   1.00 0.00 ? 60 SER A CA   7  
ATOM 7644  C C    . SER A 1 60 ? 11.353  -1.114  1.918   1.00 0.00 ? 60 SER A C    7  
ATOM 7645  O O    . SER A 1 60 ? 12.556  -0.928  1.728   1.00 0.00 ? 60 SER A O    7  
ATOM 7646  C CB   . SER A 1 60 ? 10.721  -2.864  0.246   1.00 0.00 ? 60 SER A CB   7  
ATOM 7647  O OG   . SER A 1 60 ? 11.997  -3.312  -0.179  1.00 0.00 ? 60 SER A OG   7  
ATOM 7648  H H    . SER A 1 60 ? 8.633   -2.228  1.719   1.00 0.00 ? 60 SER A H    7  
ATOM 7649  H HA   . SER A 1 60 ? 11.328  -3.220  2.268   1.00 0.00 ? 60 SER A HA   7  
ATOM 7650  H HB2  . SER A 1 60 ? 10.003  -3.652  0.079   1.00 0.00 ? 60 SER A HB2  7  
ATOM 7651  H HB3  . SER A 1 60 ? 10.445  -1.996  -0.335  1.00 0.00 ? 60 SER A HB3  7  
ATOM 7652  H HG   . SER A 1 60 ? 12.117  -3.103  -1.108  1.00 0.00 ? 60 SER A HG   7  
ATOM 7653  N N    . LYS A 1 61 ? 10.524  -0.146  2.293   1.00 0.00 ? 61 LYS A N    7  
ATOM 7654  C CA   . LYS A 1 61 ? 10.987  1.219   2.508   1.00 0.00 ? 61 LYS A CA   7  
ATOM 7655  C C    . LYS A 1 61 ? 10.922  1.589   3.986   1.00 0.00 ? 61 LYS A C    7  
ATOM 7656  O O    . LYS A 1 61 ? 10.713  2.751   4.336   1.00 0.00 ? 61 LYS A O    7  
ATOM 7657  C CB   . LYS A 1 61 ? 10.146  2.201   1.688   1.00 0.00 ? 61 LYS A CB   7  
ATOM 7658  C CG   . LYS A 1 61 ? 10.692  2.451   0.293   1.00 0.00 ? 61 LYS A CG   7  
ATOM 7659  C CD   . LYS A 1 61 ? 11.906  3.364   0.325   1.00 0.00 ? 61 LYS A CD   7  
ATOM 7660  C CE   . LYS A 1 61 ? 11.502  4.830   0.297   1.00 0.00 ? 61 LYS A CE   7  
ATOM 7661  N NZ   . LYS A 1 61 ? 11.256  5.363   1.666   1.00 0.00 ? 61 LYS A NZ   7  
ATOM 7662  H H    . LYS A 1 61 ? 9.575   -0.356  2.429   1.00 0.00 ? 61 LYS A H    7  
ATOM 7663  H HA   . LYS A 1 61 ? 12.014  1.277   2.179   1.00 0.00 ? 61 LYS A HA   7  
ATOM 7664  H HB2  . LYS A 1 61 ? 9.145   1.807   1.595   1.00 0.00 ? 61 LYS A HB2  7  
ATOM 7665  H HB3  . LYS A 1 61 ? 10.106  3.145   2.211   1.00 0.00 ? 61 LYS A HB3  7  
ATOM 7666  H HG2  . LYS A 1 61 ? 10.976  1.507   -0.148  1.00 0.00 ? 61 LYS A HG2  7  
ATOM 7667  H HG3  . LYS A 1 61 ? 9.921   2.913   -0.308  1.00 0.00 ? 61 LYS A HG3  7  
ATOM 7668  H HD2  . LYS A 1 61 ? 12.466  3.174   1.228   1.00 0.00 ? 61 LYS A HD2  7  
ATOM 7669  H HD3  . LYS A 1 61 ? 12.526  3.154   -0.536  1.00 0.00 ? 61 LYS A HD3  7  
ATOM 7670  H HE2  . LYS A 1 61 ? 12.294  5.400   -0.165  1.00 0.00 ? 61 LYS A HE2  7  
ATOM 7671  H HE3  . LYS A 1 61 ? 10.599  4.930   -0.287  1.00 0.00 ? 61 LYS A HE3  7  
ATOM 7672  H HZ1  . LYS A 1 61 ? 11.739  6.277   1.785   1.00 0.00 ? 61 LYS A HZ1  7  
ATOM 7673  H HZ2  . LYS A 1 61 ? 11.617  4.698   2.379   1.00 0.00 ? 61 LYS A HZ2  7  
ATOM 7674  H HZ3  . LYS A 1 61 ? 10.237  5.500   1.818   1.00 0.00 ? 61 LYS A HZ3  7  
ATOM 7675  N N    . ILE A 1 62 ? 11.104  0.595   4.849   1.00 0.00 ? 62 ILE A N    7  
ATOM 7676  C CA   . ILE A 1 62 ? 11.068  0.818   6.289   1.00 0.00 ? 62 ILE A CA   7  
ATOM 7677  C C    . ILE A 1 62 ? 12.448  1.188   6.822   1.00 0.00 ? 62 ILE A C    7  
ATOM 7678  O O    . ILE A 1 62 ? 12.603  1.517   7.998   1.00 0.00 ? 62 ILE A O    7  
ATOM 7679  C CB   . ILE A 1 62 ? 10.557  -0.427  7.038   1.00 0.00 ? 62 ILE A CB   7  
ATOM 7680  C CG1  . ILE A 1 62 ? 9.316   -0.993  6.346   1.00 0.00 ? 62 ILE A CG1  7  
ATOM 7681  C CG2  . ILE A 1 62 ? 10.251  -0.083  8.488   1.00 0.00 ? 62 ILE A CG2  7  
ATOM 7682  C CD1  . ILE A 1 62 ? 8.762   -2.231  7.015   1.00 0.00 ? 62 ILE A CD1  7  
ATOM 7683  H H    . ILE A 1 62 ? 11.266  -0.309  4.509   1.00 0.00 ? 62 ILE A H    7  
ATOM 7684  H HA   . ILE A 1 62 ? 10.388  1.635   6.483   1.00 0.00 ? 62 ILE A HA   7  
ATOM 7685  H HB   . ILE A 1 62 ? 11.338  -1.172  7.028   1.00 0.00 ? 62 ILE A HB   7  
ATOM 7686  H HG12 . ILE A 1 62 ? 8.541   -0.243  6.341   1.00 0.00 ? 62 ILE A HG12 7  
ATOM 7687  H HG13 . ILE A 1 62 ? 9.568   -1.250  5.327   1.00 0.00 ? 62 ILE A HG13 7  
ATOM 7688  H HG21 . ILE A 1 62 ? 10.332  0.985   8.630   1.00 0.00 ? 62 ILE A HG21 7  
ATOM 7689  H HG22 . ILE A 1 62 ? 9.247   -0.401  8.729   1.00 0.00 ? 62 ILE A HG22 7  
ATOM 7690  H HG23 . ILE A 1 62 ? 10.953  -0.587  9.135   1.00 0.00 ? 62 ILE A HG23 7  
ATOM 7691  H HD11 . ILE A 1 62 ? 7.697   -2.118  7.157   1.00 0.00 ? 62 ILE A HD11 7  
ATOM 7692  H HD12 . ILE A 1 62 ? 8.954   -3.093  6.395   1.00 0.00 ? 62 ILE A HD12 7  
ATOM 7693  H HD13 . ILE A 1 62 ? 9.239   -2.365  7.976   1.00 0.00 ? 62 ILE A HD13 7  
ATOM 7694  N N    . LYS A 1 63 ? 13.448  1.134   5.949   1.00 0.00 ? 63 LYS A N    7  
ATOM 7695  C CA   . LYS A 1 63 ? 14.815  1.467   6.329   1.00 0.00 ? 63 LYS A CA   7  
ATOM 7696  C C    . LYS A 1 63 ? 14.843  2.679   7.254   1.00 0.00 ? 63 LYS A C    7  
ATOM 7697  O O    . LYS A 1 63 ? 15.288  2.590   8.399   1.00 0.00 ? 63 LYS A O    7  
ATOM 7698  C CB   . LYS A 1 63 ? 15.660  1.743   5.083   1.00 0.00 ? 63 LYS A CB   7  
ATOM 7699  C CG   . LYS A 1 63 ? 15.951  0.502   4.258   1.00 0.00 ? 63 LYS A CG   7  
ATOM 7700  C CD   . LYS A 1 63 ? 17.174  0.692   3.376   1.00 0.00 ? 63 LYS A CD   7  
ATOM 7701  C CE   . LYS A 1 63 ? 17.550  -0.595  2.659   1.00 0.00 ? 63 LYS A CE   7  
ATOM 7702  N NZ   . LYS A 1 63 ? 18.977  -0.597  2.234   1.00 0.00 ? 63 LYS A NZ   7  
ATOM 7703  H H    . LYS A 1 63 ? 13.261  0.865   5.025   1.00 0.00 ? 63 LYS A H    7  
ATOM 7704  H HA   . LYS A 1 63 ? 15.229  0.619   6.854   1.00 0.00 ? 63 LYS A HA   7  
ATOM 7705  H HB2  . LYS A 1 63 ? 15.137  2.451   4.458   1.00 0.00 ? 63 LYS A HB2  7  
ATOM 7706  H HB3  . LYS A 1 63 ? 16.602  2.175   5.390   1.00 0.00 ? 63 LYS A HB3  7  
ATOM 7707  H HG2  . LYS A 1 63 ? 16.128  -0.330  4.925   1.00 0.00 ? 63 LYS A HG2  7  
ATOM 7708  H HG3  . LYS A 1 63 ? 15.097  0.288   3.632   1.00 0.00 ? 63 LYS A HG3  7  
ATOM 7709  H HD2  . LYS A 1 63 ? 16.961  1.453   2.640   1.00 0.00 ? 63 LYS A HD2  7  
ATOM 7710  H HD3  . LYS A 1 63 ? 18.005  1.007   3.992   1.00 0.00 ? 63 LYS A HD3  7  
ATOM 7711  H HE2  . LYS A 1 63 ? 17.380  -1.427  3.326   1.00 0.00 ? 63 LYS A HE2  7  
ATOM 7712  H HE3  . LYS A 1 63 ? 16.923  -0.701  1.786   1.00 0.00 ? 63 LYS A HE3  7  
ATOM 7713  H HZ1  . LYS A 1 63 ? 19.130  -1.318  1.499   1.00 0.00 ? 63 LYS A HZ1  7  
ATOM 7714  H HZ2  . LYS A 1 63 ? 19.591  -0.811  3.046   1.00 0.00 ? 63 LYS A HZ2  7  
ATOM 7715  H HZ3  . LYS A 1 63 ? 19.238  0.334   1.851   1.00 0.00 ? 63 LYS A HZ3  7  
ATOM 7716  N N    . LYS A 1 64 ? 14.364  3.812   6.752   1.00 0.00 ? 64 LYS A N    7  
ATOM 7717  C CA   . LYS A 1 64 ? 14.331  5.043   7.534   1.00 0.00 ? 64 LYS A CA   7  
ATOM 7718  C C    . LYS A 1 64 ? 12.917  5.338   8.024   1.00 0.00 ? 64 LYS A C    7  
ATOM 7719  O O    . LYS A 1 64 ? 11.937  4.882   7.435   1.00 0.00 ? 64 LYS A O    7  
ATOM 7720  C CB   . LYS A 1 64 ? 14.848  6.216   6.698   1.00 0.00 ? 64 LYS A CB   7  
ATOM 7721  C CG   . LYS A 1 64 ? 16.360  6.244   6.559   1.00 0.00 ? 64 LYS A CG   7  
ATOM 7722  C CD   . LYS A 1 64 ? 16.839  5.282   5.485   1.00 0.00 ? 64 LYS A CD   7  
ATOM 7723  C CE   . LYS A 1 64 ? 16.618  5.848   4.090   1.00 0.00 ? 64 LYS A CE   7  
ATOM 7724  N NZ   . LYS A 1 64 ? 17.783  6.654   3.628   1.00 0.00 ? 64 LYS A NZ   7  
ATOM 7725  H H    . LYS A 1 64 ? 14.023  3.821   5.833   1.00 0.00 ? 64 LYS A H    7  
ATOM 7726  H HA   . LYS A 1 64 ? 14.975  4.910   8.389   1.00 0.00 ? 64 LYS A HA   7  
ATOM 7727  H HB2  . LYS A 1 64 ? 14.417  6.156   5.709   1.00 0.00 ? 64 LYS A HB2  7  
ATOM 7728  H HB3  . LYS A 1 64 ? 14.533  7.139   7.163   1.00 0.00 ? 64 LYS A HB3  7  
ATOM 7729  H HG2  . LYS A 1 64 ? 16.670  7.244   6.295   1.00 0.00 ? 64 LYS A HG2  7  
ATOM 7730  H HG3  . LYS A 1 64 ? 16.804  5.965   7.504   1.00 0.00 ? 64 LYS A HG3  7  
ATOM 7731  H HD2  . LYS A 1 64 ? 17.894  5.097   5.623   1.00 0.00 ? 64 LYS A HD2  7  
ATOM 7732  H HD3  . LYS A 1 64 ? 16.294  4.353   5.577   1.00 0.00 ? 64 LYS A HD3  7  
ATOM 7733  H HE2  . LYS A 1 64 ? 16.463  5.030   3.404   1.00 0.00 ? 64 LYS A HE2  7  
ATOM 7734  H HE3  . LYS A 1 64 ? 15.740  6.476   4.106   1.00 0.00 ? 64 LYS A HE3  7  
ATOM 7735  H HZ1  . LYS A 1 64 ? 18.516  6.676   4.366   1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 7736  H HZ2  . LYS A 1 64 ? 17.484  7.628   3.423   1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 7737  H HZ3  . LYS A 1 64 ? 18.186  6.236   2.766   1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 7738  N N    . SER A 1 65 ? 12.819  6.105   9.105   1.00 0.00 ? 65 SER A N    7  
ATOM 7739  C CA   . SER A 1 65 ? 11.524  6.459   9.676   1.00 0.00 ? 65 SER A CA   7  
ATOM 7740  C C    . SER A 1 65 ? 10.690  7.255   8.677   1.00 0.00 ? 65 SER A C    7  
ATOM 7741  O O    . SER A 1 65 ? 11.203  8.128   7.979   1.00 0.00 ? 65 SER A O    7  
ATOM 7742  C CB   . SER A 1 65 ? 11.714  7.269   10.960  1.00 0.00 ? 65 SER A CB   7  
ATOM 7743  O OG   . SER A 1 65 ? 10.466  7.678   11.493  1.00 0.00 ? 65 SER A OG   7  
ATOM 7744  H H    . SER A 1 65 ? 13.636  6.438   9.530   1.00 0.00 ? 65 SER A H    7  
ATOM 7745  H HA   . SER A 1 65 ? 11.004  5.543   9.912   1.00 0.00 ? 65 SER A HA   7  
ATOM 7746  H HB2  . SER A 1 65 ? 12.224  6.664   11.693  1.00 0.00 ? 65 SER A HB2  7  
ATOM 7747  H HB3  . SER A 1 65 ? 12.305  8.148   10.743  1.00 0.00 ? 65 SER A HB3  7  
ATOM 7748  H HG   . SER A 1 65 ? 10.333  8.612   11.318  1.00 0.00 ? 65 SER A HG   7  
ATOM 7749  N N    . GLY A 1 66 ? 9.398   6.946   8.615   1.00 0.00 ? 66 GLY A N    7  
ATOM 7750  C CA   . GLY A 1 66 ? 8.512   7.640   7.700   1.00 0.00 ? 66 GLY A CA   7  
ATOM 7751  C C    . GLY A 1 66 ? 7.961   8.924   8.288   1.00 0.00 ? 66 GLY A C    7  
ATOM 7752  O O    . GLY A 1 66 ? 8.190   9.247   9.453   1.00 0.00 ? 66 GLY A O    7  
ATOM 7753  H H    . GLY A 1 66 ? 9.044   6.240   9.196   1.00 0.00 ? 66 GLY A H    7  
ATOM 7754  H HA2  . GLY A 1 66 ? 9.056   7.875   6.797   1.00 0.00 ? 66 GLY A HA2  7  
ATOM 7755  H HA3  . GLY A 1 66 ? 7.687   6.989   7.451   1.00 0.00 ? 66 GLY A HA3  7  
ATOM 7756  N N    . PRO A 1 67 ? 7.216   9.682   7.470   1.00 0.00 ? 67 PRO A N    7  
ATOM 7757  C CA   . PRO A 1 67 ? 6.616   10.951  7.894   1.00 0.00 ? 67 PRO A CA   7  
ATOM 7758  C C    . PRO A 1 67 ? 5.486   10.751  8.898   1.00 0.00 ? 67 PRO A C    7  
ATOM 7759  O O    . PRO A 1 67 ? 4.698   9.813   8.781   1.00 0.00 ? 67 PRO A O    7  
ATOM 7760  C CB   . PRO A 1 67 ? 6.074   11.541  6.589   1.00 0.00 ? 67 PRO A CB   7  
ATOM 7761  C CG   . PRO A 1 67 ? 5.839   10.362  5.709   1.00 0.00 ? 67 PRO A CG   7  
ATOM 7762  C CD   . PRO A 1 67 ? 6.901   9.359   6.068   1.00 0.00 ? 67 PRO A CD   7  
ATOM 7763  H HA   . PRO A 1 67 ? 7.354   11.618  8.313   1.00 0.00 ? 67 PRO A HA   7  
ATOM 7764  H HB2  . PRO A 1 67 ? 5.156   12.076  6.787   1.00 0.00 ? 67 PRO A HB2  7  
ATOM 7765  H HB3  . PRO A 1 67 ? 6.804   12.212  6.163   1.00 0.00 ? 67 PRO A HB3  7  
ATOM 7766  H HG2  . PRO A 1 67 ? 4.858   9.953   5.897   1.00 0.00 ? 67 PRO A HG2  7  
ATOM 7767  H HG3  . PRO A 1 67 ? 5.934   10.653  4.674   1.00 0.00 ? 67 PRO A HG3  7  
ATOM 7768  H HD2  . PRO A 1 67 ? 6.516   8.354   5.981   1.00 0.00 ? 67 PRO A HD2  7  
ATOM 7769  H HD3  . PRO A 1 67 ? 7.769   9.488   5.439   1.00 0.00 ? 67 PRO A HD3  7  
ATOM 7770  N N    . SER A 1 68 ? 5.412   11.639  9.884   1.00 0.00 ? 68 SER A N    7  
ATOM 7771  C CA   . SER A 1 68 ? 4.380   11.557  10.911  1.00 0.00 ? 68 SER A CA   7  
ATOM 7772  C C    . SER A 1 68 ? 3.495   12.800  10.891  1.00 0.00 ? 68 SER A C    7  
ATOM 7773  O O    . SER A 1 68 ? 3.148   13.345  11.938  1.00 0.00 ? 68 SER A O    7  
ATOM 7774  C CB   . SER A 1 68 ? 5.016   11.393  12.292  1.00 0.00 ? 68 SER A CB   7  
ATOM 7775  O OG   . SER A 1 68 ? 5.829   12.508  12.615  1.00 0.00 ? 68 SER A OG   7  
ATOM 7776  H H    . SER A 1 68 ? 6.070   12.365  9.923   1.00 0.00 ? 68 SER A H    7  
ATOM 7777  H HA   . SER A 1 68 ? 3.770   10.692  10.699  1.00 0.00 ? 68 SER A HA   7  
ATOM 7778  H HB2  . SER A 1 68 ? 4.239   11.302  13.035  1.00 0.00 ? 68 SER A HB2  7  
ATOM 7779  H HB3  . SER A 1 68 ? 5.628   10.502  12.300  1.00 0.00 ? 68 SER A HB3  7  
ATOM 7780  H HG   . SER A 1 68 ? 6.116   12.940  11.808  1.00 0.00 ? 68 SER A HG   7  
ATOM 7781  N N    . SER A 1 69 ? 3.133   13.242  9.690   1.00 0.00 ? 69 SER A N    7  
ATOM 7782  C CA   . SER A 1 69 ? 2.291   14.422  9.532   1.00 0.00 ? 69 SER A CA   7  
ATOM 7783  C C    . SER A 1 69 ? 2.749   15.544  10.459  1.00 0.00 ? 69 SER A C    7  
ATOM 7784  O O    . SER A 1 69 ? 1.933   16.232  11.071  1.00 0.00 ? 69 SER A O    7  
ATOM 7785  C CB   . SER A 1 69 ? 0.829   14.074  9.818   1.00 0.00 ? 69 SER A CB   7  
ATOM 7786  O OG   . SER A 1 69 ? 0.378   13.032  8.970   1.00 0.00 ? 69 SER A OG   7  
ATOM 7787  H H    . SER A 1 69 ? 3.441   12.764  8.892   1.00 0.00 ? 69 SER A H    7  
ATOM 7788  H HA   . SER A 1 69 ? 2.379   14.757  8.510   1.00 0.00 ? 69 SER A HA   7  
ATOM 7789  H HB2  . SER A 1 69 ? 0.732   13.754  10.844  1.00 0.00 ? 69 SER A HB2  7  
ATOM 7790  H HB3  . SER A 1 69 ? 0.215   14.948  9.653   1.00 0.00 ? 69 SER A HB3  7  
ATOM 7791  H HG   . SER A 1 69 ? 0.109   13.400  8.125   1.00 0.00 ? 69 SER A HG   7  
ATOM 7792  N N    . GLY A 1 70 ? 4.063   15.723  10.557  1.00 0.00 ? 70 GLY A N    7  
ATOM 7793  C CA   . GLY A 1 70 ? 4.608   16.762  11.411  1.00 0.00 ? 70 GLY A CA   7  
ATOM 7794  C C    . GLY A 1 70 ? 5.944   16.375  12.015  1.00 0.00 ? 70 GLY A C    7  
ATOM 7795  O O    . GLY A 1 70 ? 6.541   17.147  12.765  1.00 0.00 ? 70 GLY A O    7  
ATOM 7796  H H    . GLY A 1 70 ? 4.667   15.144  10.046  1.00 0.00 ? 70 GLY A H    7  
ATOM 7797  H HA2  . GLY A 1 70 ? 4.736   17.662  10.828  1.00 0.00 ? 70 GLY A HA2  7  
ATOM 7798  H HA3  . GLY A 1 70 ? 3.909   16.959  12.211  1.00 0.00 ? 70 GLY A HA3  7  
ATOM 7799  N N    . GLY A 1 1  ? 23.926  15.283  2.910   1.00 0.00 ? 1  GLY A N    8  
ATOM 7800  C CA   . GLY A 1 1  ? 24.036  14.050  2.152   1.00 0.00 ? 1  GLY A CA   8  
ATOM 7801  C C    . GLY A 1 1  ? 23.856  14.268  0.663   1.00 0.00 ? 1  GLY A C    8  
ATOM 7802  O O    . GLY A 1 1  ? 24.406  15.213  0.096   1.00 0.00 ? 1  GLY A O    8  
ATOM 7803  H H1   . GLY A 1 1  ? 24.440  16.071  2.637   1.00 0.00 ? 1  GLY A H1   8  
ATOM 7804  H HA2  . GLY A 1 1  ? 25.009  13.618  2.327   1.00 0.00 ? 1  GLY A HA2  8  
ATOM 7805  H HA3  . GLY A 1 1  ? 23.279  13.361  2.497   1.00 0.00 ? 1  GLY A HA3  8  
ATOM 7806  N N    . SER A 1 2  ? 23.086  13.392  0.026   1.00 0.00 ? 2  SER A N    8  
ATOM 7807  C CA   . SER A 1 2  ? 22.840  13.489  -1.408  1.00 0.00 ? 2  SER A CA   8  
ATOM 7808  C C    . SER A 1 2  ? 21.445  12.979  -1.756  1.00 0.00 ? 2  SER A C    8  
ATOM 7809  O O    . SER A 1 2  ? 21.141  11.799  -1.578  1.00 0.00 ? 2  SER A O    8  
ATOM 7810  C CB   . SER A 1 2  ? 23.894  12.696  -2.183  1.00 0.00 ? 2  SER A CB   8  
ATOM 7811  O OG   . SER A 1 2  ? 25.184  13.255  -2.008  1.00 0.00 ? 2  SER A OG   8  
ATOM 7812  H H    . SER A 1 2  ? 22.675  12.660  0.534   1.00 0.00 ? 2  SER A H    8  
ATOM 7813  H HA   . SER A 1 2  ? 22.909  14.530  -1.686  1.00 0.00 ? 2  SER A HA   8  
ATOM 7814  H HB2  . SER A 1 2  ? 23.906  11.676  -1.828  1.00 0.00 ? 2  SER A HB2  8  
ATOM 7815  H HB3  . SER A 1 2  ? 23.648  12.708  -3.235  1.00 0.00 ? 2  SER A HB3  8  
ATOM 7816  H HG   . SER A 1 2  ? 25.583  12.898  -1.212  1.00 0.00 ? 2  SER A HG   8  
ATOM 7817  N N    . SER A 1 3  ? 20.600  13.877  -2.252  1.00 0.00 ? 3  SER A N    8  
ATOM 7818  C CA   . SER A 1 3  ? 19.235  13.520  -2.622  1.00 0.00 ? 3  SER A CA   8  
ATOM 7819  C C    . SER A 1 3  ? 18.616  14.592  -3.514  1.00 0.00 ? 3  SER A C    8  
ATOM 7820  O O    . SER A 1 3  ? 19.131  15.704  -3.616  1.00 0.00 ? 3  SER A O    8  
ATOM 7821  C CB   . SER A 1 3  ? 18.379  13.326  -1.369  1.00 0.00 ? 3  SER A CB   8  
ATOM 7822  O OG   . SER A 1 3  ? 18.523  12.015  -0.851  1.00 0.00 ? 3  SER A OG   8  
ATOM 7823  H H    . SER A 1 3  ? 20.901  14.802  -2.370  1.00 0.00 ? 3  SER A H    8  
ATOM 7824  H HA   . SER A 1 3  ? 19.273  12.590  -3.170  1.00 0.00 ? 3  SER A HA   8  
ATOM 7825  H HB2  . SER A 1 3  ? 18.685  14.034  -0.614  1.00 0.00 ? 3  SER A HB2  8  
ATOM 7826  H HB3  . SER A 1 3  ? 17.340  13.490  -1.617  1.00 0.00 ? 3  SER A HB3  8  
ATOM 7827  H HG   . SER A 1 3  ? 17.773  11.808  -0.288  1.00 0.00 ? 3  SER A HG   8  
ATOM 7828  N N    . GLY A 1 4  ? 17.505  14.247  -4.159  1.00 0.00 ? 4  GLY A N    8  
ATOM 7829  C CA   . GLY A 1 4  ? 16.833  15.189  -5.034  1.00 0.00 ? 4  GLY A CA   8  
ATOM 7830  C C    . GLY A 1 4  ? 15.336  14.960  -5.092  1.00 0.00 ? 4  GLY A C    8  
ATOM 7831  O O    . GLY A 1 4  ? 14.765  14.315  -4.213  1.00 0.00 ? 4  GLY A O    8  
ATOM 7832  H H    . GLY A 1 4  ? 17.140  13.345  -4.039  1.00 0.00 ? 4  GLY A H    8  
ATOM 7833  H HA2  . GLY A 1 4  ? 17.020  16.191  -4.678  1.00 0.00 ? 4  GLY A HA2  8  
ATOM 7834  H HA3  . GLY A 1 4  ? 17.239  15.090  -6.030  1.00 0.00 ? 4  GLY A HA3  8  
ATOM 7835  N N    . SER A 1 5  ? 14.697  15.492  -6.129  1.00 0.00 ? 5  SER A N    8  
ATOM 7836  C CA   . SER A 1 5  ? 13.256  15.347  -6.295  1.00 0.00 ? 5  SER A CA   8  
ATOM 7837  C C    . SER A 1 5  ? 12.519  15.750  -5.022  1.00 0.00 ? 5  SER A C    8  
ATOM 7838  O O    . SER A 1 5  ? 11.564  15.092  -4.609  1.00 0.00 ? 5  SER A O    8  
ATOM 7839  C CB   . SER A 1 5  ? 12.906  13.904  -6.666  1.00 0.00 ? 5  SER A CB   8  
ATOM 7840  O OG   . SER A 1 5  ? 11.661  13.838  -7.339  1.00 0.00 ? 5  SER A OG   8  
ATOM 7841  H H    . SER A 1 5  ? 15.208  15.996  -6.797  1.00 0.00 ? 5  SER A H    8  
ATOM 7842  H HA   . SER A 1 5  ? 12.947  16.001  -7.098  1.00 0.00 ? 5  SER A HA   8  
ATOM 7843  H HB2  . SER A 1 5  ? 13.673  13.506  -7.312  1.00 0.00 ? 5  SER A HB2  8  
ATOM 7844  H HB3  . SER A 1 5  ? 12.848  13.309  -5.766  1.00 0.00 ? 5  SER A HB3  8  
ATOM 7845  H HG   . SER A 1 5  ? 11.803  13.563  -8.248  1.00 0.00 ? 5  SER A HG   8  
ATOM 7846  N N    . SER A 1 6  ? 12.970  16.836  -4.402  1.00 0.00 ? 6  SER A N    8  
ATOM 7847  C CA   . SER A 1 6  ? 12.357  17.326  -3.173  1.00 0.00 ? 6  SER A CA   8  
ATOM 7848  C C    . SER A 1 6  ? 10.949  17.849  -3.439  1.00 0.00 ? 6  SER A C    8  
ATOM 7849  O O    . SER A 1 6  ? 10.515  17.940  -4.587  1.00 0.00 ? 6  SER A O    8  
ATOM 7850  C CB   . SER A 1 6  ? 13.216  18.431  -2.555  1.00 0.00 ? 6  SER A CB   8  
ATOM 7851  O OG   . SER A 1 6  ? 13.068  19.649  -3.265  1.00 0.00 ? 6  SER A OG   8  
ATOM 7852  H H    . SER A 1 6  ? 13.736  17.318  -4.780  1.00 0.00 ? 6  SER A H    8  
ATOM 7853  H HA   . SER A 1 6  ? 12.297  16.499  -2.481  1.00 0.00 ? 6  SER A HA   8  
ATOM 7854  H HB2  . SER A 1 6  ? 12.915  18.587  -1.531  1.00 0.00 ? 6  SER A HB2  8  
ATOM 7855  H HB3  . SER A 1 6  ? 14.255  18.135  -2.585  1.00 0.00 ? 6  SER A HB3  8  
ATOM 7856  H HG   . SER A 1 6  ? 13.615  20.325  -2.859  1.00 0.00 ? 6  SER A HG   8  
ATOM 7857  N N    . GLY A 1 7  ? 10.239  18.192  -2.368  1.00 0.00 ? 7  GLY A N    8  
ATOM 7858  C CA   . GLY A 1 7  ? 8.888   18.701  -2.506  1.00 0.00 ? 7  GLY A CA   8  
ATOM 7859  C C    . GLY A 1 7  ? 7.864   17.594  -2.660  1.00 0.00 ? 7  GLY A C    8  
ATOM 7860  O O    . GLY A 1 7  ? 8.171   16.421  -2.448  1.00 0.00 ? 7  GLY A O    8  
ATOM 7861  H H    . GLY A 1 7  ? 10.637  18.097  -1.477  1.00 0.00 ? 7  GLY A H    8  
ATOM 7862  H HA2  . GLY A 1 7  ? 8.644   19.284  -1.631  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 7863  H HA3  . GLY A 1 7  ? 8.843   19.340  -3.376  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 7864  N N    . ARG A 1 8  ? 6.643   17.967  -3.029  1.00 0.00 ? 8  ARG A N    8  
ATOM 7865  C CA   . ARG A 1 8  ? 5.569   16.997  -3.208  1.00 0.00 ? 8  ARG A CA   8  
ATOM 7866  C C    . ARG A 1 8  ? 4.728   17.337  -4.435  1.00 0.00 ? 8  ARG A C    8  
ATOM 7867  O O    . ARG A 1 8  ? 4.879   18.406  -5.028  1.00 0.00 ? 8  ARG A O    8  
ATOM 7868  C CB   . ARG A 1 8  ? 4.680   16.953  -1.964  1.00 0.00 ? 8  ARG A CB   8  
ATOM 7869  C CG   . ARG A 1 8  ? 3.847   18.209  -1.766  1.00 0.00 ? 8  ARG A CG   8  
ATOM 7870  C CD   . ARG A 1 8  ? 3.248   18.266  -0.369  1.00 0.00 ? 8  ARG A CD   8  
ATOM 7871  N NE   . ARG A 1 8  ? 2.460   19.477  -0.160  1.00 0.00 ? 8  ARG A NE   8  
ATOM 7872  C CZ   . ARG A 1 8  ? 2.989   20.654  0.155   1.00 0.00 ? 8  ARG A CZ   8  
ATOM 7873  N NH1  . ARG A 1 8  ? 4.302   20.777  0.296   1.00 0.00 ? 8  ARG A NH1  8  
ATOM 7874  N NH2  . ARG A 1 8  ? 2.206   21.711  0.328   1.00 0.00 ? 8  ARG A NH2  8  
ATOM 7875  H H    . ARG A 1 8  ? 6.459   18.917  -3.183  1.00 0.00 ? 8  ARG A H    8  
ATOM 7876  H HA   . ARG A 1 8  ? 6.019   16.027  -3.352  1.00 0.00 ? 8  ARG A HA   8  
ATOM 7877  H HB2  . ARG A 1 8  ? 4.008   16.111  -2.045  1.00 0.00 ? 8  ARG A HB2  8  
ATOM 7878  H HB3  . ARG A 1 8  ? 5.305   16.822  -1.094  1.00 0.00 ? 8  ARG A HB3  8  
ATOM 7879  H HG2  . ARG A 1 8  ? 4.476   19.074  -1.911  1.00 0.00 ? 8  ARG A HG2  8  
ATOM 7880  H HG3  . ARG A 1 8  ? 3.047   18.217  -2.492  1.00 0.00 ? 8  ARG A HG3  8  
ATOM 7881  H HD2  . ARG A 1 8  ? 2.611   17.405  -0.229  1.00 0.00 ? 8  ARG A HD2  8  
ATOM 7882  H HD3  . ARG A 1 8  ? 4.050   18.241  0.353   1.00 0.00 ? 8  ARG A HD3  8  
ATOM 7883  H HE   . ARG A 1 8  ? 1.488   19.409  -0.260  1.00 0.00 ? 8  ARG A HE   8  
ATOM 7884  H HH11 . ARG A 1 8  ? 4.895   19.983  0.165   1.00 0.00 ? 8  ARG A HH11 8  
ATOM 7885  H HH12 . ARG A 1 8  ? 4.699   21.665  0.532   1.00 0.00 ? 8  ARG A HH12 8  
ATOM 7886  H HH21 . ARG A 1 8  ? 1.216   21.622  0.222   1.00 0.00 ? 8  ARG A HH21 8  
ATOM 7887  H HH22 . ARG A 1 8  ? 2.606   22.596  0.565   1.00 0.00 ? 8  ARG A HH22 8  
ATOM 7888  N N    . LYS A 1 9  ? 3.843   16.421  -4.812  1.00 0.00 ? 9  LYS A N    8  
ATOM 7889  C CA   . LYS A 1 9  ? 2.977   16.622  -5.968  1.00 0.00 ? 9  LYS A CA   8  
ATOM 7890  C C    . LYS A 1 9  ? 1.517   16.729  -5.541  1.00 0.00 ? 9  LYS A C    8  
ATOM 7891  O O    . LYS A 1 9  ? 1.111   16.217  -4.498  1.00 0.00 ? 9  LYS A O    8  
ATOM 7892  C CB   . LYS A 1 9  ? 3.146   15.472  -6.963  1.00 0.00 ? 9  LYS A CB   8  
ATOM 7893  C CG   . LYS A 1 9  ? 4.235   15.715  -7.994  1.00 0.00 ? 9  LYS A CG   8  
ATOM 7894  C CD   . LYS A 1 9  ? 5.616   15.438  -7.422  1.00 0.00 ? 9  LYS A CD   8  
ATOM 7895  C CE   . LYS A 1 9  ? 5.977   13.964  -7.525  1.00 0.00 ? 9  LYS A CE   8  
ATOM 7896  N NZ   . LYS A 1 9  ? 7.165   13.625  -6.695  1.00 0.00 ? 9  LYS A NZ   8  
ATOM 7897  H H    . LYS A 1 9  ? 3.770   15.588  -4.299  1.00 0.00 ? 9  LYS A H    8  
ATOM 7898  H HA   . LYS A 1 9  ? 3.269   17.545  -6.444  1.00 0.00 ? 9  LYS A HA   8  
ATOM 7899  H HB2  . LYS A 1 9  ? 3.389   14.572  -6.418  1.00 0.00 ? 9  LYS A HB2  8  
ATOM 7900  H HB3  . LYS A 1 9  ? 2.212   15.325  -7.486  1.00 0.00 ? 9  LYS A HB3  8  
ATOM 7901  H HG2  . LYS A 1 9  ? 4.071   15.063  -8.839  1.00 0.00 ? 9  LYS A HG2  8  
ATOM 7902  H HG3  . LYS A 1 9  ? 4.189   16.745  -8.317  1.00 0.00 ? 9  LYS A HG3  8  
ATOM 7903  H HD2  . LYS A 1 9  ? 6.346   16.015  -7.970  1.00 0.00 ? 9  LYS A HD2  8  
ATOM 7904  H HD3  . LYS A 1 9  ? 5.630   15.731  -6.381  1.00 0.00 ? 9  LYS A HD3  8  
ATOM 7905  H HE2  . LYS A 1 9  ? 5.135   13.377  -7.191  1.00 0.00 ? 9  LYS A HE2  8  
ATOM 7906  H HE3  . LYS A 1 9  ? 6.191   13.731  -8.558  1.00 0.00 ? 9  LYS A HE3  8  
ATOM 7907  H HZ1  . LYS A 1 9  ? 7.925   13.248  -7.297  1.00 0.00 ? 9  LYS A HZ1  8  
ATOM 7908  H HZ2  . LYS A 1 9  ? 6.912   12.907  -5.986  1.00 0.00 ? 9  LYS A HZ2  8  
ATOM 7909  H HZ3  . LYS A 1 9  ? 7.514   14.473  -6.205  1.00 0.00 ? 9  LYS A HZ3  8  
ATOM 7910  N N    . PRO A 1 10 ? 0.707   17.408  -6.367  1.00 0.00 ? 10 PRO A N    8  
ATOM 7911  C CA   . PRO A 1 10 ? -0.722  17.596  -6.096  1.00 0.00 ? 10 PRO A CA   8  
ATOM 7912  C C    . PRO A 1 10 ? -1.513  16.299  -6.229  1.00 0.00 ? 10 PRO A C    8  
ATOM 7913  O O    . PRO A 1 10 ? -2.715  16.264  -5.969  1.00 0.00 ? 10 PRO A O    8  
ATOM 7914  C CB   . PRO A 1 10 ? -1.157  18.599  -7.167  1.00 0.00 ? 10 PRO A CB   8  
ATOM 7915  C CG   . PRO A 1 10 ? -0.182  18.414  -8.278  1.00 0.00 ? 10 PRO A CG   8  
ATOM 7916  C CD   . PRO A 1 10 ? 1.123   18.045  -7.627  1.00 0.00 ? 10 PRO A CD   8  
ATOM 7917  H HA   . PRO A 1 10 ? -0.888  18.018  -5.116  1.00 0.00 ? 10 PRO A HA   8  
ATOM 7918  H HB2  . PRO A 1 10 ? -2.166  18.377  -7.484  1.00 0.00 ? 10 PRO A HB2  8  
ATOM 7919  H HB3  . PRO A 1 10 ? -1.112  19.601  -6.767  1.00 0.00 ? 10 PRO A HB3  8  
ATOM 7920  H HG2  . PRO A 1 10 ? -0.514  17.620  -8.929  1.00 0.00 ? 10 PRO A HG2  8  
ATOM 7921  H HG3  . PRO A 1 10 ? -0.077  19.335  -8.832  1.00 0.00 ? 10 PRO A HG3  8  
ATOM 7922  H HD2  . PRO A 1 10 ? 1.671   17.351  -8.247  1.00 0.00 ? 10 PRO A HD2  8  
ATOM 7923  H HD3  . PRO A 1 10 ? 1.712   18.929  -7.436  1.00 0.00 ? 10 PRO A HD3  8  
ATOM 7924  N N    . ARG A 1 11 ? -0.829  15.234  -6.636  1.00 0.00 ? 11 ARG A N    8  
ATOM 7925  C CA   . ARG A 1 11 ? -1.468  13.934  -6.804  1.00 0.00 ? 11 ARG A CA   8  
ATOM 7926  C C    . ARG A 1 11 ? -0.523  12.807  -6.399  1.00 0.00 ? 11 ARG A C    8  
ATOM 7927  O O    . ARG A 1 11 ? 0.625   12.755  -6.841  1.00 0.00 ? 11 ARG A O    8  
ATOM 7928  C CB   . ARG A 1 11 ? -1.913  13.745  -8.255  1.00 0.00 ? 11 ARG A CB   8  
ATOM 7929  C CG   . ARG A 1 11 ? -0.941  14.324  -9.270  1.00 0.00 ? 11 ARG A CG   8  
ATOM 7930  C CD   . ARG A 1 11 ? -1.275  13.870  -10.683 1.00 0.00 ? 11 ARG A CD   8  
ATOM 7931  N NE   . ARG A 1 11 ? -2.202  14.783  -11.346 1.00 0.00 ? 11 ARG A NE   8  
ATOM 7932  C CZ   . ARG A 1 11 ? -2.671  14.590  -12.574 1.00 0.00 ? 11 ARG A CZ   8  
ATOM 7933  N NH1  . ARG A 1 11 ? -2.303  13.522  -13.268 1.00 0.00 ? 11 ARG A NH1  8  
ATOM 7934  N NH2  . ARG A 1 11 ? -3.512  15.467  -13.109 1.00 0.00 ? 11 ARG A NH2  8  
ATOM 7935  H H    . ARG A 1 11 ? 0.128   15.324  -6.828  1.00 0.00 ? 11 ARG A H    8  
ATOM 7936  H HA   . ARG A 1 11 ? -2.338  13.907  -6.164  1.00 0.00 ? 11 ARG A HA   8  
ATOM 7937  H HB2  . ARG A 1 11 ? -2.018  12.688  -8.453  1.00 0.00 ? 11 ARG A HB2  8  
ATOM 7938  H HB3  . ARG A 1 11 ? -2.870  14.225  -8.391  1.00 0.00 ? 11 ARG A HB3  8  
ATOM 7939  H HG2  . ARG A 1 11 ? -0.991  15.402  -9.229  1.00 0.00 ? 11 ARG A HG2  8  
ATOM 7940  H HG3  . ARG A 1 11 ? 0.059   13.998  -9.024  1.00 0.00 ? 11 ARG A HG3  8  
ATOM 7941  H HD2  . ARG A 1 11 ? -0.361  13.821  -11.256 1.00 0.00 ? 11 ARG A HD2  8  
ATOM 7942  H HD3  . ARG A 1 11 ? -1.723  12.889  -10.635 1.00 0.00 ? 11 ARG A HD3  8  
ATOM 7943  H HE   . ARG A 1 11 ? -2.487  15.579  -10.851 1.00 0.00 ? 11 ARG A HE   8  
ATOM 7944  H HH11 . ARG A 1 11 ? -1.671  12.860  -12.866 1.00 0.00 ? 11 ARG A HH11 8  
ATOM 7945  H HH12 . ARG A 1 11 ? -2.659  13.379  -14.192 1.00 0.00 ? 11 ARG A HH12 8  
ATOM 7946  H HH21 . ARG A 1 11 ? -3.792  16.273  -12.589 1.00 0.00 ? 11 ARG A HH21 8  
ATOM 7947  H HH22 . ARG A 1 11 ? -3.864  15.321  -14.033 1.00 0.00 ? 11 ARG A HH22 8  
ATOM 7948  N N    . THR A 1 12 ? -1.014  11.905  -5.555  1.00 0.00 ? 12 THR A N    8  
ATOM 7949  C CA   . THR A 1 12 ? -0.214  10.779  -5.088  1.00 0.00 ? 12 THR A CA   8  
ATOM 7950  C C    . THR A 1 12 ? -0.540  9.512   -5.869  1.00 0.00 ? 12 THR A C    8  
ATOM 7951  O O    . THR A 1 12 ? -1.589  9.418   -6.508  1.00 0.00 ? 12 THR A O    8  
ATOM 7952  C CB   . THR A 1 12 ? -0.436  10.516  -3.587  1.00 0.00 ? 12 THR A CB   8  
ATOM 7953  O OG1  . THR A 1 12 ? -0.217  11.718  -2.841  1.00 0.00 ? 12 THR A OG1  8  
ATOM 7954  C CG2  . THR A 1 12 ? 0.498   9.425   -3.085  1.00 0.00 ? 12 THR A CG2  8  
ATOM 7955  H H    . THR A 1 12 ? -1.936  12.000  -5.238  1.00 0.00 ? 12 THR A H    8  
ATOM 7956  H HA   . THR A 1 12 ? 0.827   11.026  -5.239  1.00 0.00 ? 12 THR A HA   8  
ATOM 7957  H HB   . THR A 1 12 ? -1.456  10.191  -3.441  1.00 0.00 ? 12 THR A HB   8  
ATOM 7958  H HG1  . THR A 1 12 ? -0.578  11.616  -1.957  1.00 0.00 ? 12 THR A HG1  8  
ATOM 7959  H HG21 . THR A 1 12 ? 0.386   9.319   -2.016  1.00 0.00 ? 12 THR A HG21 8  
ATOM 7960  H HG22 . THR A 1 12 ? 1.519   9.690   -3.317  1.00 0.00 ? 12 THR A HG22 8  
ATOM 7961  H HG23 . THR A 1 12 ? 0.251   8.491   -3.567  1.00 0.00 ? 12 THR A HG23 8  
ATOM 7962  N N    . ILE A 1 13 ? 0.363   8.539   -5.813  1.00 0.00 ? 13 ILE A N    8  
ATOM 7963  C CA   . ILE A 1 13 ? 0.169   7.276   -6.514  1.00 0.00 ? 13 ILE A CA   8  
ATOM 7964  C C    . ILE A 1 13 ? -1.142  6.614   -6.103  1.00 0.00 ? 13 ILE A C    8  
ATOM 7965  O O    . ILE A 1 13 ? -1.638  5.718   -6.786  1.00 0.00 ? 13 ILE A O    8  
ATOM 7966  C CB   . ILE A 1 13 ? 1.330   6.299   -6.247  1.00 0.00 ? 13 ILE A CB   8  
ATOM 7967  C CG1  . ILE A 1 13 ? 2.667   6.955   -6.598  1.00 0.00 ? 13 ILE A CG1  8  
ATOM 7968  C CG2  . ILE A 1 13 ? 1.137   5.017   -7.043  1.00 0.00 ? 13 ILE A CG2  8  
ATOM 7969  C CD1  . ILE A 1 13 ? 3.288   7.714   -5.446  1.00 0.00 ? 13 ILE A CD1  8  
ATOM 7970  H H    . ILE A 1 13 ? 1.179   8.673   -5.288  1.00 0.00 ? 13 ILE A H    8  
ATOM 7971  H HA   . ILE A 1 13 ? 0.137   7.484   -7.574  1.00 0.00 ? 13 ILE A HA   8  
ATOM 7972  H HB   . ILE A 1 13 ? 1.325   6.048   -5.198  1.00 0.00 ? 13 ILE A HB   8  
ATOM 7973  H HG12 . ILE A 1 13 ? 3.365   6.192   -6.906  1.00 0.00 ? 13 ILE A HG12 8  
ATOM 7974  H HG13 . ILE A 1 13 ? 2.517   7.649   -7.412  1.00 0.00 ? 13 ILE A HG13 8  
ATOM 7975  H HG21 . ILE A 1 13 ? 0.659   5.246   -7.984  1.00 0.00 ? 13 ILE A HG21 8  
ATOM 7976  H HG22 . ILE A 1 13 ? 2.098   4.562   -7.229  1.00 0.00 ? 13 ILE A HG22 8  
ATOM 7977  H HG23 . ILE A 1 13 ? 0.518   4.334   -6.481  1.00 0.00 ? 13 ILE A HG23 8  
ATOM 7978  H HD11 . ILE A 1 13 ? 3.093   8.769   -5.563  1.00 0.00 ? 13 ILE A HD11 8  
ATOM 7979  H HD12 . ILE A 1 13 ? 2.864   7.369   -4.516  1.00 0.00 ? 13 ILE A HD12 8  
ATOM 7980  H HD13 . ILE A 1 13 ? 4.356   7.546   -5.439  1.00 0.00 ? 13 ILE A HD13 8  
ATOM 7981  N N    . TYR A 1 14 ? -1.698  7.063   -4.983  1.00 0.00 ? 14 TYR A N    8  
ATOM 7982  C CA   . TYR A 1 14 ? -2.952  6.515   -4.480  1.00 0.00 ? 14 TYR A CA   8  
ATOM 7983  C C    . TYR A 1 14 ? -3.849  7.620   -3.932  1.00 0.00 ? 14 TYR A C    8  
ATOM 7984  O O    . TYR A 1 14 ? -3.387  8.521   -3.232  1.00 0.00 ? 14 TYR A O    8  
ATOM 7985  C CB   . TYR A 1 14 ? -2.678  5.478   -3.389  1.00 0.00 ? 14 TYR A CB   8  
ATOM 7986  C CG   . TYR A 1 14 ? -2.227  4.139   -3.927  1.00 0.00 ? 14 TYR A CG   8  
ATOM 7987  C CD1  . TYR A 1 14 ? -0.895  3.911   -4.253  1.00 0.00 ? 14 TYR A CD1  8  
ATOM 7988  C CD2  . TYR A 1 14 ? -3.132  3.100   -4.107  1.00 0.00 ? 14 TYR A CD2  8  
ATOM 7989  C CE1  . TYR A 1 14 ? -0.479  2.690   -4.745  1.00 0.00 ? 14 TYR A CE1  8  
ATOM 7990  C CE2  . TYR A 1 14 ? -2.724  1.874   -4.597  1.00 0.00 ? 14 TYR A CE2  8  
ATOM 7991  C CZ   . TYR A 1 14 ? -1.397  1.674   -4.915  1.00 0.00 ? 14 TYR A CZ   8  
ATOM 7992  O OH   . TYR A 1 14 ? -0.986  0.455   -5.404  1.00 0.00 ? 14 TYR A OH   8  
ATOM 7993  H H    . TYR A 1 14 ? -1.255  7.779   -4.482  1.00 0.00 ? 14 TYR A H    8  
ATOM 7994  H HA   . TYR A 1 14 ? -3.457  6.032   -5.303  1.00 0.00 ? 14 TYR A HA   8  
ATOM 7995  H HB2  . TYR A 1 14 ? -1.904  5.849   -2.735  1.00 0.00 ? 14 TYR A HB2  8  
ATOM 7996  H HB3  . TYR A 1 14 ? -3.581  5.319   -2.818  1.00 0.00 ? 14 TYR A HB3  8  
ATOM 7997  H HD1  . TYR A 1 14 ? -0.179  4.709   -4.119  1.00 0.00 ? 14 TYR A HD1  8  
ATOM 7998  H HD2  . TYR A 1 14 ? -4.171  3.259   -3.856  1.00 0.00 ? 14 TYR A HD2  8  
ATOM 7999  H HE1  . TYR A 1 14 ? 0.560   2.533   -4.994  1.00 0.00 ? 14 TYR A HE1  8  
ATOM 8000  H HE2  . TYR A 1 14 ? -3.443  1.079   -4.730  1.00 0.00 ? 14 TYR A HE2  8  
ATOM 8001  H HH   . TYR A 1 14 ? -0.977  -0.188  -4.691  1.00 0.00 ? 14 TYR A HH   8  
ATOM 8002  N N    . SER A 1 15 ? -5.136  7.544   -4.256  1.00 0.00 ? 15 SER A N    8  
ATOM 8003  C CA   . SER A 1 15 ? -6.100  8.539   -3.800  1.00 0.00 ? 15 SER A CA   8  
ATOM 8004  C C    . SER A 1 15 ? -6.185  8.554   -2.277  1.00 0.00 ? 15 SER A C    8  
ATOM 8005  O O    . SER A 1 15 ? -5.985  7.531   -1.623  1.00 0.00 ? 15 SER A O    8  
ATOM 8006  C CB   . SER A 1 15 ? -7.479  8.255   -4.397  1.00 0.00 ? 15 SER A CB   8  
ATOM 8007  O OG   . SER A 1 15 ? -8.359  9.347   -4.191  1.00 0.00 ? 15 SER A OG   8  
ATOM 8008  H H    . SER A 1 15 ? -5.444  6.802   -4.818  1.00 0.00 ? 15 SER A H    8  
ATOM 8009  H HA   . SER A 1 15 ? -5.762  9.507   -4.140  1.00 0.00 ? 15 SER A HA   8  
ATOM 8010  H HB2  . SER A 1 15 ? -7.381  8.082   -5.458  1.00 0.00 ? 15 SER A HB2  8  
ATOM 8011  H HB3  . SER A 1 15 ? -7.898  7.377   -3.926  1.00 0.00 ? 15 SER A HB3  8  
ATOM 8012  H HG   . SER A 1 15 ? -8.369  9.579   -3.260  1.00 0.00 ? 15 SER A HG   8  
ATOM 8013  N N    . SER A 1 16 ? -6.484  9.723   -1.719  1.00 0.00 ? 16 SER A N    8  
ATOM 8014  C CA   . SER A 1 16 ? -6.593  9.874   -0.273  1.00 0.00 ? 16 SER A CA   8  
ATOM 8015  C C    . SER A 1 16 ? -7.551  8.840   0.311   1.00 0.00 ? 16 SER A C    8  
ATOM 8016  O O    . SER A 1 16 ? -7.294  8.267   1.371   1.00 0.00 ? 16 SER A O    8  
ATOM 8017  C CB   . SER A 1 16 ? -7.070  11.284  0.080   1.00 0.00 ? 16 SER A CB   8  
ATOM 8018  O OG   . SER A 1 16 ? -8.286  11.591  -0.581  1.00 0.00 ? 16 SER A OG   8  
ATOM 8019  H H    . SER A 1 16 ? -6.633  10.503  -2.294  1.00 0.00 ? 16 SER A H    8  
ATOM 8020  H HA   . SER A 1 16 ? -5.612  9.719   0.151   1.00 0.00 ? 16 SER A HA   8  
ATOM 8021  H HB2  . SER A 1 16 ? -7.227  11.353  1.145   1.00 0.00 ? 16 SER A HB2  8  
ATOM 8022  H HB3  . SER A 1 16 ? -6.320  12.001  -0.221  1.00 0.00 ? 16 SER A HB3  8  
ATOM 8023  H HG   . SER A 1 16 ? -8.257  12.495  -0.902  1.00 0.00 ? 16 SER A HG   8  
ATOM 8024  N N    . PHE A 1 17 ? -8.656  8.606   -0.388  1.00 0.00 ? 17 PHE A N    8  
ATOM 8025  C CA   . PHE A 1 17 ? -9.654  7.642   0.060   1.00 0.00 ? 17 PHE A CA   8  
ATOM 8026  C C    . PHE A 1 17 ? -9.074  6.231   0.088   1.00 0.00 ? 17 PHE A C    8  
ATOM 8027  O O    . PHE A 1 17 ? -9.224  5.507   1.072   1.00 0.00 ? 17 PHE A O    8  
ATOM 8028  C CB   . PHE A 1 17 ? -10.881 7.683   -0.854  1.00 0.00 ? 17 PHE A CB   8  
ATOM 8029  C CG   . PHE A 1 17 ? -11.637 6.386   -0.900  1.00 0.00 ? 17 PHE A CG   8  
ATOM 8030  C CD1  . PHE A 1 17 ? -12.517 6.046   0.115   1.00 0.00 ? 17 PHE A CD1  8  
ATOM 8031  C CD2  . PHE A 1 17 ? -11.470 5.508   -1.958  1.00 0.00 ? 17 PHE A CD2  8  
ATOM 8032  C CE1  . PHE A 1 17 ? -13.214 4.853   0.075   1.00 0.00 ? 17 PHE A CE1  8  
ATOM 8033  C CE2  . PHE A 1 17 ? -12.164 4.314   -2.004  1.00 0.00 ? 17 PHE A CE2  8  
ATOM 8034  C CZ   . PHE A 1 17 ? -13.039 3.987   -0.986  1.00 0.00 ? 17 PHE A CZ   8  
ATOM 8035  H H    . PHE A 1 17 ? -8.805  9.094   -1.225  1.00 0.00 ? 17 PHE A H    8  
ATOM 8036  H HA   . PHE A 1 17 ? -9.952  7.915   1.061   1.00 0.00 ? 17 PHE A HA   8  
ATOM 8037  H HB2  . PHE A 1 17 ? -11.556 8.448   -0.504  1.00 0.00 ? 17 PHE A HB2  8  
ATOM 8038  H HB3  . PHE A 1 17 ? -10.564 7.919   -1.858  1.00 0.00 ? 17 PHE A HB3  8  
ATOM 8039  H HD1  . PHE A 1 17 ? -12.657 6.723   0.945   1.00 0.00 ? 17 PHE A HD1  8  
ATOM 8040  H HD2  . PHE A 1 17 ? -10.786 5.763   -2.756  1.00 0.00 ? 17 PHE A HD2  8  
ATOM 8041  H HE1  . PHE A 1 17 ? -13.897 4.600   0.872   1.00 0.00 ? 17 PHE A HE1  8  
ATOM 8042  H HE2  . PHE A 1 17 ? -12.024 3.639   -2.835  1.00 0.00 ? 17 PHE A HE2  8  
ATOM 8043  H HZ   . PHE A 1 17 ? -13.582 3.054   -1.019  1.00 0.00 ? 17 PHE A HZ   8  
ATOM 8044  N N    . GLN A 1 18 ? -8.411  5.849   -0.999  1.00 0.00 ? 18 GLN A N    8  
ATOM 8045  C CA   . GLN A 1 18 ? -7.809  4.525   -1.099  1.00 0.00 ? 18 GLN A CA   8  
ATOM 8046  C C    . GLN A 1 18 ? -6.706  4.348   -0.061  1.00 0.00 ? 18 GLN A C    8  
ATOM 8047  O O    . GLN A 1 18 ? -6.526  3.261   0.491   1.00 0.00 ? 18 GLN A O    8  
ATOM 8048  C CB   . GLN A 1 18 ? -7.245  4.303   -2.504  1.00 0.00 ? 18 GLN A CB   8  
ATOM 8049  C CG   . GLN A 1 18 ? -8.291  4.400   -3.602  1.00 0.00 ? 18 GLN A CG   8  
ATOM 8050  C CD   . GLN A 1 18 ? -7.722  4.109   -4.977  1.00 0.00 ? 18 GLN A CD   8  
ATOM 8051  O OE1  . GLN A 1 18 ? -6.513  4.191   -5.191  1.00 0.00 ? 18 GLN A OE1  8  
ATOM 8052  N NE2  . GLN A 1 18 ? -8.594  3.766   -5.918  1.00 0.00 ? 18 GLN A NE2  8  
ATOM 8053  H H    . GLN A 1 18 ? -8.326  6.471   -1.750  1.00 0.00 ? 18 GLN A H    8  
ATOM 8054  H HA   . GLN A 1 18 ? -8.582  3.794   -0.913  1.00 0.00 ? 18 GLN A HA   8  
ATOM 8055  H HB2  . GLN A 1 18 ? -6.484  5.045   -2.694  1.00 0.00 ? 18 GLN A HB2  8  
ATOM 8056  H HB3  . GLN A 1 18 ? -6.797  3.321   -2.548  1.00 0.00 ? 18 GLN A HB3  8  
ATOM 8057  H HG2  . GLN A 1 18 ? -9.077  3.688   -3.397  1.00 0.00 ? 18 GLN A HG2  8  
ATOM 8058  H HG3  . GLN A 1 18 ? -8.702  5.398   -3.602  1.00 0.00 ? 18 GLN A HG3  8  
ATOM 8059  H HE21 . GLN A 1 18 ? -9.543  3.722   -5.675  1.00 0.00 ? 18 GLN A HE21 8  
ATOM 8060  H HE22 . GLN A 1 18 ? -8.255  3.573   -6.816  1.00 0.00 ? 18 GLN A HE22 8  
ATOM 8061  N N    . LEU A 1 19 ? -5.969  5.422   0.200   1.00 0.00 ? 19 LEU A N    8  
ATOM 8062  C CA   . LEU A 1 19 ? -4.881  5.386   1.172   1.00 0.00 ? 19 LEU A CA   8  
ATOM 8063  C C    . LEU A 1 19 ? -5.425  5.266   2.592   1.00 0.00 ? 19 LEU A C    8  
ATOM 8064  O O    . LEU A 1 19 ? -5.003  4.400   3.358   1.00 0.00 ? 19 LEU A O    8  
ATOM 8065  C CB   . LEU A 1 19 ? -4.019  6.643   1.048   1.00 0.00 ? 19 LEU A CB   8  
ATOM 8066  C CG   . LEU A 1 19 ? -2.895  6.587   0.013   1.00 0.00 ? 19 LEU A CG   8  
ATOM 8067  C CD1  . LEU A 1 19 ? -2.005  7.815   0.123   1.00 0.00 ? 19 LEU A CD1  8  
ATOM 8068  C CD2  . LEU A 1 19 ? -2.076  5.315   0.183   1.00 0.00 ? 19 LEU A CD2  8  
ATOM 8069  H H    . LEU A 1 19 ? -6.159  6.259   -0.271  1.00 0.00 ? 19 LEU A H    8  
ATOM 8070  H HA   . LEU A 1 19 ? -4.274  4.519   0.958   1.00 0.00 ? 19 LEU A HA   8  
ATOM 8071  H HB2  . LEU A 1 19 ? -4.667  7.465   0.788   1.00 0.00 ? 19 LEU A HB2  8  
ATOM 8072  H HB3  . LEU A 1 19 ? -3.571  6.832   2.014   1.00 0.00 ? 19 LEU A HB3  8  
ATOM 8073  H HG   . LEU A 1 19 ? -3.328  6.577   -0.978  1.00 0.00 ? 19 LEU A HG   8  
ATOM 8074  H HD11 . LEU A 1 19 ? -1.253  7.648   0.879   1.00 0.00 ? 19 LEU A HD11 8  
ATOM 8075  H HD12 . LEU A 1 19 ? -2.605  8.671   0.395   1.00 0.00 ? 19 LEU A HD12 8  
ATOM 8076  H HD13 . LEU A 1 19 ? -1.527  7.999   -0.828  1.00 0.00 ? 19 LEU A HD13 8  
ATOM 8077  H HD21 . LEU A 1 19 ? -1.024  5.558   0.149   1.00 0.00 ? 19 LEU A HD21 8  
ATOM 8078  H HD22 . LEU A 1 19 ? -2.312  4.626   -0.615  1.00 0.00 ? 19 LEU A HD22 8  
ATOM 8079  H HD23 . LEU A 1 19 ? -2.311  4.861   1.134   1.00 0.00 ? 19 LEU A HD23 8  
ATOM 8080  N N    . ALA A 1 20 ? -6.365  6.140   2.936   1.00 0.00 ? 20 ALA A N    8  
ATOM 8081  C CA   . ALA A 1 20 ? -6.969  6.129   4.263   1.00 0.00 ? 20 ALA A CA   8  
ATOM 8082  C C    . ALA A 1 20 ? -7.180  4.702   4.759   1.00 0.00 ? 20 ALA A C    8  
ATOM 8083  O O    . ALA A 1 20 ? -7.023  4.418   5.946   1.00 0.00 ? 20 ALA A O    8  
ATOM 8084  C CB   . ALA A 1 20 ? -8.290  6.885   4.247   1.00 0.00 ? 20 ALA A CB   8  
ATOM 8085  H H    . ALA A 1 20 ? -6.660  6.807   2.282   1.00 0.00 ? 20 ALA A H    8  
ATOM 8086  H HA   . ALA A 1 20 ? -6.299  6.639   4.939   1.00 0.00 ? 20 ALA A HA   8  
ATOM 8087  H HB1  . ALA A 1 20 ? -8.924  6.483   3.470   1.00 0.00 ? 20 ALA A HB1  8  
ATOM 8088  H HB2  . ALA A 1 20 ? -8.778  6.775   5.204   1.00 0.00 ? 20 ALA A HB2  8  
ATOM 8089  H HB3  . ALA A 1 20 ? -8.103  7.931   4.055   1.00 0.00 ? 20 ALA A HB3  8  
ATOM 8090  N N    . ALA A 1 21 ? -7.536  3.809   3.842   1.00 0.00 ? 21 ALA A N    8  
ATOM 8091  C CA   . ALA A 1 21 ? -7.767  2.411   4.186   1.00 0.00 ? 21 ALA A CA   8  
ATOM 8092  C C    . ALA A 1 21 ? -6.468  1.614   4.142   1.00 0.00 ? 21 ALA A C    8  
ATOM 8093  O O    . ALA A 1 21 ? -6.174  0.837   5.052   1.00 0.00 ? 21 ALA A O    8  
ATOM 8094  C CB   . ALA A 1 21 ? -8.797  1.800   3.247   1.00 0.00 ? 21 ALA A CB   8  
ATOM 8095  H H    . ALA A 1 21 ? -7.646  4.096   2.911   1.00 0.00 ? 21 ALA A H    8  
ATOM 8096  H HA   . ALA A 1 21 ? -8.166  2.376   5.190   1.00 0.00 ? 21 ALA A HA   8  
ATOM 8097  H HB1  . ALA A 1 21 ? -8.648  2.187   2.250   1.00 0.00 ? 21 ALA A HB1  8  
ATOM 8098  H HB2  . ALA A 1 21 ? -8.682  0.726   3.238   1.00 0.00 ? 21 ALA A HB2  8  
ATOM 8099  H HB3  . ALA A 1 21 ? -9.789  2.053   3.588   1.00 0.00 ? 21 ALA A HB3  8  
ATOM 8100  N N    . LEU A 1 22 ? -5.695  1.809   3.080   1.00 0.00 ? 22 LEU A N    8  
ATOM 8101  C CA   . LEU A 1 22 ? -4.427  1.107   2.918   1.00 0.00 ? 22 LEU A CA   8  
ATOM 8102  C C    . LEU A 1 22 ? -3.551  1.271   4.156   1.00 0.00 ? 22 LEU A C    8  
ATOM 8103  O O    . LEU A 1 22 ? -3.043  0.292   4.701   1.00 0.00 ? 22 LEU A O    8  
ATOM 8104  C CB   . LEU A 1 22 ? -3.687  1.628   1.684   1.00 0.00 ? 22 LEU A CB   8  
ATOM 8105  C CG   . LEU A 1 22 ? -4.170  1.090   0.336   1.00 0.00 ? 22 LEU A CG   8  
ATOM 8106  C CD1  . LEU A 1 22 ? -3.550  1.879   -0.807  1.00 0.00 ? 22 LEU A CD1  8  
ATOM 8107  C CD2  . LEU A 1 22 ? -3.843  -0.390  0.204   1.00 0.00 ? 22 LEU A CD2  8  
ATOM 8108  H H    . LEU A 1 22 ? -5.982  2.441   2.389   1.00 0.00 ? 22 LEU A H    8  
ATOM 8109  H HA   . LEU A 1 22 ? -4.644  0.058   2.781   1.00 0.00 ? 22 LEU A HA   8  
ATOM 8110  H HB2  . LEU A 1 22 ? -3.788  2.702   1.667   1.00 0.00 ? 22 LEU A HB2  8  
ATOM 8111  H HB3  . LEU A 1 22 ? -2.644  1.367   1.790   1.00 0.00 ? 22 LEU A HB3  8  
ATOM 8112  H HG   . LEU A 1 22 ? -5.244  1.204   0.274   1.00 0.00 ? 22 LEU A HG   8  
ATOM 8113  H HD11 . LEU A 1 22 ? -3.253  2.854   -0.451  1.00 0.00 ? 22 LEU A HD11 8  
ATOM 8114  H HD12 . LEU A 1 22 ? -4.272  1.991   -1.601  1.00 0.00 ? 22 LEU A HD12 8  
ATOM 8115  H HD13 . LEU A 1 22 ? -2.684  1.352   -1.179  1.00 0.00 ? 22 LEU A HD13 8  
ATOM 8116  H HD21 . LEU A 1 22 ? -2.792  -0.544  0.397   1.00 0.00 ? 22 LEU A HD21 8  
ATOM 8117  H HD22 . LEU A 1 22 ? -4.077  -0.722  -0.798  1.00 0.00 ? 22 LEU A HD22 8  
ATOM 8118  H HD23 . LEU A 1 22 ? -4.428  -0.953  0.916   1.00 0.00 ? 22 LEU A HD23 8  
ATOM 8119  N N    . GLN A 1 23 ? -3.381  2.514   4.594   1.00 0.00 ? 23 GLN A N    8  
ATOM 8120  C CA   . GLN A 1 23 ? -2.568  2.805   5.769   1.00 0.00 ? 23 GLN A CA   8  
ATOM 8121  C C    . GLN A 1 23 ? -3.212  2.240   7.030   1.00 0.00 ? 23 GLN A C    8  
ATOM 8122  O O    . GLN A 1 23 ? -2.523  1.907   7.995   1.00 0.00 ? 23 GLN A O    8  
ATOM 8123  C CB   . GLN A 1 23 ? -2.369  4.315   5.916   1.00 0.00 ? 23 GLN A CB   8  
ATOM 8124  C CG   . GLN A 1 23 ? -1.240  4.866   5.059   1.00 0.00 ? 23 GLN A CG   8  
ATOM 8125  C CD   . GLN A 1 23 ? -0.866  6.287   5.431   1.00 0.00 ? 23 GLN A CD   8  
ATOM 8126  O OE1  . GLN A 1 23 ? -0.982  7.205   4.618   1.00 0.00 ? 23 GLN A OE1  8  
ATOM 8127  N NE2  . GLN A 1 23 ? -0.414  6.477   6.665   1.00 0.00 ? 23 GLN A NE2  8  
ATOM 8128  H H    . GLN A 1 23 ? -3.812  3.252   4.116   1.00 0.00 ? 23 GLN A H    8  
ATOM 8129  H HA   . GLN A 1 23 ? -1.605  2.336   5.630   1.00 0.00 ? 23 GLN A HA   8  
ATOM 8130  H HB2  . GLN A 1 23 ? -3.283  4.815   5.635   1.00 0.00 ? 23 GLN A HB2  8  
ATOM 8131  H HB3  . GLN A 1 23 ? -2.148  4.537   6.949   1.00 0.00 ? 23 GLN A HB3  8  
ATOM 8132  H HG2  . GLN A 1 23 ? -0.371  4.237   5.183   1.00 0.00 ? 23 GLN A HG2  8  
ATOM 8133  H HG3  . GLN A 1 23 ? -1.551  4.849   4.025   1.00 0.00 ? 23 GLN A HG3  8  
ATOM 8134  H HE21 . GLN A 1 23 ? -0.347  5.699   7.258   1.00 0.00 ? 23 GLN A HE21 8  
ATOM 8135  H HE22 . GLN A 1 23 ? -0.164  7.385   6.931   1.00 0.00 ? 23 GLN A HE22 8  
ATOM 8136  N N    . ARG A 1 24 ? -4.537  2.134   7.016   1.00 0.00 ? 24 ARG A N    8  
ATOM 8137  C CA   . ARG A 1 24 ? -5.274  1.610   8.159   1.00 0.00 ? 24 ARG A CA   8  
ATOM 8138  C C    . ARG A 1 24 ? -5.058  0.107   8.303   1.00 0.00 ? 24 ARG A C    8  
ATOM 8139  O O    . ARG A 1 24 ? -4.945  -0.411  9.415   1.00 0.00 ? 24 ARG A O    8  
ATOM 8140  C CB   . ARG A 1 24 ? -6.767  1.910   8.012   1.00 0.00 ? 24 ARG A CB   8  
ATOM 8141  C CG   . ARG A 1 24 ? -7.654  1.023   8.869   1.00 0.00 ? 24 ARG A CG   8  
ATOM 8142  C CD   . ARG A 1 24 ? -8.942  1.731   9.257   1.00 0.00 ? 24 ARG A CD   8  
ATOM 8143  N NE   . ARG A 1 24 ? -9.874  0.838   9.940   1.00 0.00 ? 24 ARG A NE   8  
ATOM 8144  C CZ   . ARG A 1 24 ? -11.052 1.227   10.413  1.00 0.00 ? 24 ARG A CZ   8  
ATOM 8145  N NH1  . ARG A 1 24 ? -11.441 2.488   10.277  1.00 0.00 ? 24 ARG A NH1  8  
ATOM 8146  N NH2  . ARG A 1 24 ? -11.845 0.355   11.023  1.00 0.00 ? 24 ARG A NH2  8  
ATOM 8147  H H    . ARG A 1 24 ? -5.030  2.416   6.217   1.00 0.00 ? 24 ARG A H    8  
ATOM 8148  H HA   . ARG A 1 24 ? -4.903  2.102   9.046   1.00 0.00 ? 24 ARG A HA   8  
ATOM 8149  H HB2  . ARG A 1 24 ? -6.945  2.938   8.292   1.00 0.00 ? 24 ARG A HB2  8  
ATOM 8150  H HB3  . ARG A 1 24 ? -7.048  1.773   6.979   1.00 0.00 ? 24 ARG A HB3  8  
ATOM 8151  H HG2  . ARG A 1 24 ? -7.900  0.131   8.312   1.00 0.00 ? 24 ARG A HG2  8  
ATOM 8152  H HG3  . ARG A 1 24 ? -7.117  0.753   9.766   1.00 0.00 ? 24 ARG A HG3  8  
ATOM 8153  H HD2  . ARG A 1 24 ? -8.701  2.554   9.913   1.00 0.00 ? 24 ARG A HD2  8  
ATOM 8154  H HD3  . ARG A 1 24 ? -9.412  2.110   8.362   1.00 0.00 ? 24 ARG A HD3  8  
ATOM 8155  H HE   . ARG A 1 24 ? -9.606  -0.098  10.052  1.00 0.00 ? 24 ARG A HE   8  
ATOM 8156  H HH11 . ARG A 1 24 ? -10.847 3.147   9.817   1.00 0.00 ? 24 ARG A HH11 8  
ATOM 8157  H HH12 . ARG A 1 24 ? -12.330 2.778   10.633  1.00 0.00 ? 24 ARG A HH12 8  
ATOM 8158  H HH21 . ARG A 1 24 ? -11.555 -0.596  11.128  1.00 0.00 ? 24 ARG A HH21 8  
ATOM 8159  H HH22 . ARG A 1 24 ? -12.731 0.649   11.379  1.00 0.00 ? 24 ARG A HH22 8  
ATOM 8160  N N    . ARG A 1 25 ? -5.002  -0.589  7.172   1.00 0.00 ? 25 ARG A N    8  
ATOM 8161  C CA   . ARG A 1 25 ? -4.802  -2.033  7.172   1.00 0.00 ? 25 ARG A CA   8  
ATOM 8162  C C    . ARG A 1 25 ? -3.325  -2.377  7.346   1.00 0.00 ? 25 ARG A C    8  
ATOM 8163  O O    . ARG A 1 25 ? -2.980  -3.375  7.978   1.00 0.00 ? 25 ARG A O    8  
ATOM 8164  C CB   . ARG A 1 25 ? -5.329  -2.642  5.872   1.00 0.00 ? 25 ARG A CB   8  
ATOM 8165  C CG   . ARG A 1 25 ? -5.603  -4.134  5.966   1.00 0.00 ? 25 ARG A CG   8  
ATOM 8166  C CD   . ARG A 1 25 ? -6.858  -4.421  6.775   1.00 0.00 ? 25 ARG A CD   8  
ATOM 8167  N NE   . ARG A 1 25 ? -8.074  -4.140  6.017   1.00 0.00 ? 25 ARG A NE   8  
ATOM 8168  C CZ   . ARG A 1 25 ? -9.290  -4.493  6.420   1.00 0.00 ? 25 ARG A CZ   8  
ATOM 8169  N NH1  . ARG A 1 25 ? -9.450  -5.135  7.569   1.00 0.00 ? 25 ARG A NH1  8  
ATOM 8170  N NH2  . ARG A 1 25 ? -10.348 -4.202  5.674   1.00 0.00 ? 25 ARG A NH2  8  
ATOM 8171  H H    . ARG A 1 25 ? -5.099  -0.120  6.317   1.00 0.00 ? 25 ARG A H    8  
ATOM 8172  H HA   . ARG A 1 25 ? -5.355  -2.444  8.003   1.00 0.00 ? 25 ARG A HA   8  
ATOM 8173  H HB2  . ARG A 1 25 ? -6.250  -2.146  5.603   1.00 0.00 ? 25 ARG A HB2  8  
ATOM 8174  H HB3  . ARG A 1 25 ? -4.601  -2.480  5.092   1.00 0.00 ? 25 ARG A HB3  8  
ATOM 8175  H HG2  . ARG A 1 25 ? -5.732  -4.531  4.969   1.00 0.00 ? 25 ARG A HG2  8  
ATOM 8176  H HG3  . ARG A 1 25 ? -4.761  -4.616  6.440   1.00 0.00 ? 25 ARG A HG3  8  
ATOM 8177  H HD2  . ARG A 1 25 ? -6.856  -5.462  7.061   1.00 0.00 ? 25 ARG A HD2  8  
ATOM 8178  H HD3  . ARG A 1 25 ? -6.847  -3.804  7.661   1.00 0.00 ? 25 ARG A HD3  8  
ATOM 8179  H HE   . ARG A 1 25 ? -7.979  -3.666  5.165   1.00 0.00 ? 25 ARG A HE   8  
ATOM 8180  H HH11 . ARG A 1 25 ? -8.655  -5.355  8.133   1.00 0.00 ? 25 ARG A HH11 8  
ATOM 8181  H HH12 . ARG A 1 25 ? -10.367 -5.399  7.871   1.00 0.00 ? 25 ARG A HH12 8  
ATOM 8182  H HH21 . ARG A 1 25 ? -10.231 -3.717  4.808   1.00 0.00 ? 25 ARG A HH21 8  
ATOM 8183  H HH22 . ARG A 1 25 ? -11.262 -4.468  5.979   1.00 0.00 ? 25 ARG A HH22 8  
ATOM 8184  N N    . PHE A 1 26 ? -2.459  -1.544  6.779   1.00 0.00 ? 26 PHE A N    8  
ATOM 8185  C CA   . PHE A 1 26 ? -1.019  -1.760  6.870   1.00 0.00 ? 26 PHE A CA   8  
ATOM 8186  C C    . PHE A 1 26 ? -0.571  -1.834  8.326   1.00 0.00 ? 26 PHE A C    8  
ATOM 8187  O O    . PHE A 1 26 ? 0.077   -2.796  8.738   1.00 0.00 ? 26 PHE A O    8  
ATOM 8188  C CB   . PHE A 1 26 ? -0.267  -0.639  6.149   1.00 0.00 ? 26 PHE A CB   8  
ATOM 8189  C CG   . PHE A 1 26 ? 1.194   -0.927  5.954   1.00 0.00 ? 26 PHE A CG   8  
ATOM 8190  C CD1  . PHE A 1 26 ? 1.606   -2.088  5.319   1.00 0.00 ? 26 PHE A CD1  8  
ATOM 8191  C CD2  . PHE A 1 26 ? 2.155   -0.036  6.405   1.00 0.00 ? 26 PHE A CD2  8  
ATOM 8192  C CE1  . PHE A 1 26 ? 2.950   -2.355  5.138   1.00 0.00 ? 26 PHE A CE1  8  
ATOM 8193  C CE2  . PHE A 1 26 ? 3.500   -0.298  6.225   1.00 0.00 ? 26 PHE A CE2  8  
ATOM 8194  C CZ   . PHE A 1 26 ? 3.898   -1.460  5.592   1.00 0.00 ? 26 PHE A CZ   8  
ATOM 8195  H H    . PHE A 1 26 ? -2.795  -0.765  6.288   1.00 0.00 ? 26 PHE A H    8  
ATOM 8196  H HA   . PHE A 1 26 ? -0.795  -2.700  6.388   1.00 0.00 ? 26 PHE A HA   8  
ATOM 8197  H HB2  . PHE A 1 26 ? -0.708  -0.488  5.175   1.00 0.00 ? 26 PHE A HB2  8  
ATOM 8198  H HB3  . PHE A 1 26 ? -0.354  0.270   6.724   1.00 0.00 ? 26 PHE A HB3  8  
ATOM 8199  H HD1  . PHE A 1 26 ? 0.865   -2.789  4.963   1.00 0.00 ? 26 PHE A HD1  8  
ATOM 8200  H HD2  . PHE A 1 26 ? 1.845   0.871   6.901   1.00 0.00 ? 26 PHE A HD2  8  
ATOM 8201  H HE1  . PHE A 1 26 ? 3.258   -3.264  4.642   1.00 0.00 ? 26 PHE A HE1  8  
ATOM 8202  H HE2  . PHE A 1 26 ? 4.239   0.403   6.582   1.00 0.00 ? 26 PHE A HE2  8  
ATOM 8203  H HZ   . PHE A 1 26 ? 4.948   -1.666  5.451   1.00 0.00 ? 26 PHE A HZ   8  
ATOM 8204  N N    . GLN A 1 27 ? -0.921  -0.811  9.099   1.00 0.00 ? 27 GLN A N    8  
ATOM 8205  C CA   . GLN A 1 27 ? -0.553  -0.759  10.509  1.00 0.00 ? 27 GLN A CA   8  
ATOM 8206  C C    . GLN A 1 27 ? -1.040  -2.003  11.245  1.00 0.00 ? 27 GLN A C    8  
ATOM 8207  O O    . GLN A 1 27 ? -0.319  -2.578  12.061  1.00 0.00 ? 27 GLN A O    8  
ATOM 8208  C CB   . GLN A 1 27 ? -1.135  0.495   11.164  1.00 0.00 ? 27 GLN A CB   8  
ATOM 8209  C CG   . GLN A 1 27 ? -2.652  0.569   11.097  1.00 0.00 ? 27 GLN A CG   8  
ATOM 8210  C CD   . GLN A 1 27 ? -3.199  1.864   11.665  1.00 0.00 ? 27 GLN A CD   8  
ATOM 8211  O OE1  . GLN A 1 27 ? -2.442  2.732   12.100  1.00 0.00 ? 27 GLN A OE1  8  
ATOM 8212  N NE2  . GLN A 1 27 ? -4.519  2.000   11.663  1.00 0.00 ? 27 GLN A NE2  8  
ATOM 8213  H H    . GLN A 1 27 ? -1.437  -0.074  8.712   1.00 0.00 ? 27 GLN A H    8  
ATOM 8214  H HA   . GLN A 1 27 ? 0.524   -0.719  10.570  1.00 0.00 ? 27 GLN A HA   8  
ATOM 8215  H HB2  . GLN A 1 27 ? -0.840  0.515   12.202  1.00 0.00 ? 27 GLN A HB2  8  
ATOM 8216  H HB3  . GLN A 1 27 ? -0.732  1.366   10.667  1.00 0.00 ? 27 GLN A HB3  8  
ATOM 8217  H HG2  . GLN A 1 27 ? -2.958  0.489   10.065  1.00 0.00 ? 27 GLN A HG2  8  
ATOM 8218  H HG3  . GLN A 1 27 ? -3.064  -0.256  11.659  1.00 0.00 ? 27 GLN A HG3  8  
ATOM 8219  H HE21 . GLN A 1 27 ? -5.059  1.266   11.301  1.00 0.00 ? 27 GLN A HE21 8  
ATOM 8220  H HE22 . GLN A 1 27 ? -4.900  2.827   12.024  1.00 0.00 ? 27 GLN A HE22 8  
ATOM 8221  N N    . LYS A 1 28 ? -2.269  -2.415  10.952  1.00 0.00 ? 28 LYS A N    8  
ATOM 8222  C CA   . LYS A 1 28 ? -2.854  -3.591  11.584  1.00 0.00 ? 28 LYS A CA   8  
ATOM 8223  C C    . LYS A 1 28 ? -2.015  -4.834  11.302  1.00 0.00 ? 28 LYS A C    8  
ATOM 8224  O O    . LYS A 1 28 ? -1.589  -5.531  12.223  1.00 0.00 ? 28 LYS A O    8  
ATOM 8225  C CB   . LYS A 1 28 ? -4.285  -3.805  11.086  1.00 0.00 ? 28 LYS A CB   8  
ATOM 8226  C CG   . LYS A 1 28 ? -5.258  -2.738  11.556  1.00 0.00 ? 28 LYS A CG   8  
ATOM 8227  C CD   . LYS A 1 28 ? -5.609  -2.910  13.024  1.00 0.00 ? 28 LYS A CD   8  
ATOM 8228  C CE   . LYS A 1 28 ? -6.658  -1.902  13.469  1.00 0.00 ? 28 LYS A CE   8  
ATOM 8229  N NZ   . LYS A 1 28 ? -8.039  -2.376  13.180  1.00 0.00 ? 28 LYS A NZ   8  
ATOM 8230  H H    . LYS A 1 28 ? -2.796  -1.915  10.293  1.00 0.00 ? 28 LYS A H    8  
ATOM 8231  H HA   . LYS A 1 28 ? -2.874  -3.420  12.649  1.00 0.00 ? 28 LYS A HA   8  
ATOM 8232  H HB2  . LYS A 1 28 ? -4.281  -3.809  10.006  1.00 0.00 ? 28 LYS A HB2  8  
ATOM 8233  H HB3  . LYS A 1 28 ? -4.637  -4.764  11.439  1.00 0.00 ? 28 LYS A HB3  8  
ATOM 8234  H HG2  . LYS A 1 28 ? -4.808  -1.766  11.416  1.00 0.00 ? 28 LYS A HG2  8  
ATOM 8235  H HG3  . LYS A 1 28 ? -6.163  -2.805  10.968  1.00 0.00 ? 28 LYS A HG3  8  
ATOM 8236  H HD2  . LYS A 1 28 ? -5.995  -3.907  13.179  1.00 0.00 ? 28 LYS A HD2  8  
ATOM 8237  H HD3  . LYS A 1 28 ? -4.715  -2.772  13.617  1.00 0.00 ? 28 LYS A HD3  8  
ATOM 8238  H HE2  . LYS A 1 28 ? -6.556  -1.742  14.531  1.00 0.00 ? 28 LYS A HE2  8  
ATOM 8239  H HE3  . LYS A 1 28 ? -6.488  -0.972  12.947  1.00 0.00 ? 28 LYS A HE3  8  
ATOM 8240  H HZ1  . LYS A 1 28 ? -8.402  -1.915  12.320  1.00 0.00 ? 28 LYS A HZ1  8  
ATOM 8241  H HZ2  . LYS A 1 28 ? -8.670  -2.146  13.974  1.00 0.00 ? 28 LYS A HZ2  8  
ATOM 8242  H HZ3  . LYS A 1 28 ? -8.042  -3.406  13.036  1.00 0.00 ? 28 LYS A HZ3  8  
ATOM 8243  N N    . THR A 1 29 ? -1.781  -5.106  10.021  1.00 0.00 ? 29 THR A N    8  
ATOM 8244  C CA   . THR A 1 29 ? -0.993  -6.264  9.618   1.00 0.00 ? 29 THR A CA   8  
ATOM 8245  C C    . THR A 1 29 ? -0.262  -6.002  8.306   1.00 0.00 ? 29 THR A C    8  
ATOM 8246  O O    . THR A 1 29 ? -0.826  -5.428  7.376   1.00 0.00 ? 29 THR A O    8  
ATOM 8247  C CB   . THR A 1 29 ? -1.875  -7.516  9.460   1.00 0.00 ? 29 THR A CB   8  
ATOM 8248  O OG1  . THR A 1 29 ? -1.063  -8.651  9.142   1.00 0.00 ? 29 THR A OG1  8  
ATOM 8249  C CG2  . THR A 1 29 ? -2.916  -7.310  8.369   1.00 0.00 ? 29 THR A CG2  8  
ATOM 8250  H H    . THR A 1 29 ? -2.147  -4.513  9.333   1.00 0.00 ? 29 THR A H    8  
ATOM 8251  H HA   . THR A 1 29 ? -0.265  -6.458  10.392  1.00 0.00 ? 29 THR A HA   8  
ATOM 8252  H HB   . THR A 1 29 ? -2.386  -7.699  10.394  1.00 0.00 ? 29 THR A HB   8  
ATOM 8253  H HG1  . THR A 1 29 ? -0.950  -8.708  8.190   1.00 0.00 ? 29 THR A HG1  8  
ATOM 8254  H HG21 . THR A 1 29 ? -3.538  -8.190  8.294   1.00 0.00 ? 29 THR A HG21 8  
ATOM 8255  H HG22 . THR A 1 29 ? -2.420  -7.138  7.426   1.00 0.00 ? 29 THR A HG22 8  
ATOM 8256  H HG23 . THR A 1 29 ? -3.529  -6.456  8.614   1.00 0.00 ? 29 THR A HG23 8  
ATOM 8257  N N    . GLN A 1 30 ? 0.996   -6.426  8.240   1.00 0.00 ? 30 GLN A N    8  
ATOM 8258  C CA   . GLN A 1 30 ? 1.803   -6.237  7.040   1.00 0.00 ? 30 GLN A CA   8  
ATOM 8259  C C    . GLN A 1 30 ? 1.375   -7.200  5.938   1.00 0.00 ? 30 GLN A C    8  
ATOM 8260  O O    . GLN A 1 30 ? 1.444   -6.873  4.753   1.00 0.00 ? 30 GLN A O    8  
ATOM 8261  C CB   . GLN A 1 30 ? 3.285   -6.437  7.361   1.00 0.00 ? 30 GLN A CB   8  
ATOM 8262  C CG   . GLN A 1 30 ? 3.972   -5.180  7.870   1.00 0.00 ? 30 GLN A CG   8  
ATOM 8263  C CD   . GLN A 1 30 ? 3.865   -5.024  9.374   1.00 0.00 ? 30 GLN A CD   8  
ATOM 8264  O OE1  . GLN A 1 30 ? 3.812   -6.011  10.110  1.00 0.00 ? 30 GLN A OE1  8  
ATOM 8265  N NE2  . GLN A 1 30 ? 3.831   -3.782  9.841   1.00 0.00 ? 30 GLN A NE2  8  
ATOM 8266  H H    . GLN A 1 30 ? 1.390   -6.877  9.015   1.00 0.00 ? 30 GLN A H    8  
ATOM 8267  H HA   . GLN A 1 30 ? 1.652   -5.225  6.696   1.00 0.00 ? 30 GLN A HA   8  
ATOM 8268  H HB2  . GLN A 1 30 ? 3.378   -7.203  8.116   1.00 0.00 ? 30 GLN A HB2  8  
ATOM 8269  H HB3  . GLN A 1 30 ? 3.794   -6.761  6.466   1.00 0.00 ? 30 GLN A HB3  8  
ATOM 8270  H HG2  . GLN A 1 30 ? 5.018   -5.223  7.603   1.00 0.00 ? 30 GLN A HG2  8  
ATOM 8271  H HG3  . GLN A 1 30 ? 3.517   -4.321  7.400   1.00 0.00 ? 30 GLN A HG3  8  
ATOM 8272  H HE21 . GLN A 1 30 ? 3.877   -3.044  9.195   1.00 0.00 ? 30 GLN A HE21 8  
ATOM 8273  H HE22 . GLN A 1 30 ? 3.761   -3.652  10.808  1.00 0.00 ? 30 GLN A HE22 8  
ATOM 8274  N N    . TYR A 1 31 ? 0.933   -8.388  6.336   1.00 0.00 ? 31 TYR A N    8  
ATOM 8275  C CA   . TYR A 1 31 ? 0.496   -9.400  5.381   1.00 0.00 ? 31 TYR A CA   8  
ATOM 8276  C C    . TYR A 1 31 ? -1.024  -9.520  5.373   1.00 0.00 ? 31 TYR A C    8  
ATOM 8277  O O    . TYR A 1 31 ? -1.672  -9.438  6.418   1.00 0.00 ? 31 TYR A O    8  
ATOM 8278  C CB   . TYR A 1 31 ? 1.125   -10.753 5.718   1.00 0.00 ? 31 TYR A CB   8  
ATOM 8279  C CG   . TYR A 1 31 ? 2.563   -10.881 5.268   1.00 0.00 ? 31 TYR A CG   8  
ATOM 8280  C CD1  . TYR A 1 31 ? 3.515   -9.942  5.644   1.00 0.00 ? 31 TYR A CD1  8  
ATOM 8281  C CD2  . TYR A 1 31 ? 2.969   -11.943 4.469   1.00 0.00 ? 31 TYR A CD2  8  
ATOM 8282  C CE1  . TYR A 1 31 ? 4.830   -10.056 5.235   1.00 0.00 ? 31 TYR A CE1  8  
ATOM 8283  C CE2  . TYR A 1 31 ? 4.282   -12.065 4.057   1.00 0.00 ? 31 TYR A CE2  8  
ATOM 8284  C CZ   . TYR A 1 31 ? 5.208   -11.119 4.442   1.00 0.00 ? 31 TYR A CZ   8  
ATOM 8285  O OH   . TYR A 1 31 ? 6.517   -11.236 4.034   1.00 0.00 ? 31 TYR A OH   8  
ATOM 8286  H H    . TYR A 1 31 ? 0.902   -8.590  7.294   1.00 0.00 ? 31 TYR A H    8  
ATOM 8287  H HA   . TYR A 1 31 ? 0.827   -9.094  4.399   1.00 0.00 ? 31 TYR A HA   8  
ATOM 8288  H HB2  . TYR A 1 31 ? 1.097   -10.899 6.786   1.00 0.00 ? 31 TYR A HB2  8  
ATOM 8289  H HB3  . TYR A 1 31 ? 0.555   -11.536 5.237   1.00 0.00 ? 31 TYR A HB3  8  
ATOM 8290  H HD1  . TYR A 1 31 ? 3.215   -9.111  6.266   1.00 0.00 ? 31 TYR A HD1  8  
ATOM 8291  H HD2  . TYR A 1 31 ? 2.241   -12.683 4.169   1.00 0.00 ? 31 TYR A HD2  8  
ATOM 8292  H HE1  . TYR A 1 31 ? 5.555   -9.315  5.537   1.00 0.00 ? 31 TYR A HE1  8  
ATOM 8293  H HE2  . TYR A 1 31 ? 4.579   -12.897 3.435   1.00 0.00 ? 31 TYR A HE2  8  
ATOM 8294  H HH   . TYR A 1 31 ? 6.662   -12.113 3.671   1.00 0.00 ? 31 TYR A HH   8  
ATOM 8295  N N    . LEU A 1 32 ? -1.589  -9.716  4.187   1.00 0.00 ? 32 LEU A N    8  
ATOM 8296  C CA   . LEU A 1 32 ? -3.034  -9.850  4.040   1.00 0.00 ? 32 LEU A CA   8  
ATOM 8297  C C    . LEU A 1 32 ? -3.395  -11.178 3.382   1.00 0.00 ? 32 LEU A C    8  
ATOM 8298  O O    . LEU A 1 32 ? -2.737  -11.612 2.437   1.00 0.00 ? 32 LEU A O    8  
ATOM 8299  C CB   . LEU A 1 32 ? -3.592  -8.690  3.213   1.00 0.00 ? 32 LEU A CB   8  
ATOM 8300  C CG   . LEU A 1 32 ? -3.661  -7.335  3.918   1.00 0.00 ? 32 LEU A CG   8  
ATOM 8301  C CD1  . LEU A 1 32 ? -4.259  -6.283  2.997   1.00 0.00 ? 32 LEU A CD1  8  
ATOM 8302  C CD2  . LEU A 1 32 ? -4.469  -7.443  5.203   1.00 0.00 ? 32 LEU A CD2  8  
ATOM 8303  H H    . LEU A 1 32 ? -1.022  -9.774  3.390   1.00 0.00 ? 32 LEU A H    8  
ATOM 8304  H HA   . LEU A 1 32 ? -3.472  -9.820  5.027   1.00 0.00 ? 32 LEU A HA   8  
ATOM 8305  H HB2  . LEU A 1 32 ? -2.968  -8.576  2.340   1.00 0.00 ? 32 LEU A HB2  8  
ATOM 8306  H HB3  . LEU A 1 32 ? -4.593  -8.955  2.905   1.00 0.00 ? 32 LEU A HB3  8  
ATOM 8307  H HG   . LEU A 1 32 ? -2.660  -7.020  4.178   1.00 0.00 ? 32 LEU A HG   8  
ATOM 8308  H HD11 . LEU A 1 32 ? -4.502  -6.734  2.047   1.00 0.00 ? 32 LEU A HD11 8  
ATOM 8309  H HD12 . LEU A 1 32 ? -3.545  -5.488  2.847   1.00 0.00 ? 32 LEU A HD12 8  
ATOM 8310  H HD13 . LEU A 1 32 ? -5.157  -5.881  3.445   1.00 0.00 ? 32 LEU A HD13 8  
ATOM 8311  H HD21 . LEU A 1 32 ? -3.798  -7.569  6.040   1.00 0.00 ? 32 LEU A HD21 8  
ATOM 8312  H HD22 . LEU A 1 32 ? -5.131  -8.295  5.141   1.00 0.00 ? 32 LEU A HD22 8  
ATOM 8313  H HD23 . LEU A 1 32 ? -5.051  -6.544  5.340   1.00 0.00 ? 32 LEU A HD23 8  
ATOM 8314  N N    . ALA A 1 33 ? -4.445  -11.817 3.887   1.00 0.00 ? 33 ALA A N    8  
ATOM 8315  C CA   . ALA A 1 33 ? -4.896  -13.093 3.345   1.00 0.00 ? 33 ALA A CA   8  
ATOM 8316  C C    . ALA A 1 33 ? -5.423  -12.930 1.924   1.00 0.00 ? 33 ALA A C    8  
ATOM 8317  O O    . ALA A 1 33 ? -5.507  -11.816 1.405   1.00 0.00 ? 33 ALA A O    8  
ATOM 8318  C CB   . ALA A 1 33 ? -5.966  -13.698 4.241   1.00 0.00 ? 33 ALA A CB   8  
ATOM 8319  H H    . ALA A 1 33 ? -4.929  -11.419 4.640   1.00 0.00 ? 33 ALA A H    8  
ATOM 8320  H HA   . ALA A 1 33 ? -4.051  -13.766 3.330   1.00 0.00 ? 33 ALA A HA   8  
ATOM 8321  H HB1  . ALA A 1 33 ? -5.937  -13.218 5.209   1.00 0.00 ? 33 ALA A HB1  8  
ATOM 8322  H HB2  . ALA A 1 33 ? -6.937  -13.548 3.794   1.00 0.00 ? 33 ALA A HB2  8  
ATOM 8323  H HB3  . ALA A 1 33 ? -5.782  -14.755 4.358   1.00 0.00 ? 33 ALA A HB3  8  
ATOM 8324  N N    . LEU A 1 34 ? -5.777  -14.047 1.298   1.00 0.00 ? 34 LEU A N    8  
ATOM 8325  C CA   . LEU A 1 34 ? -6.296  -14.029 -0.066  1.00 0.00 ? 34 LEU A CA   8  
ATOM 8326  C C    . LEU A 1 34 ? -7.447  -13.037 -0.196  1.00 0.00 ? 34 LEU A C    8  
ATOM 8327  O O    . LEU A 1 34 ? -7.390  -12.081 -0.970  1.00 0.00 ? 34 LEU A O    8  
ATOM 8328  C CB   . LEU A 1 34 ? -6.763  -15.427 -0.473  1.00 0.00 ? 34 LEU A CB   8  
ATOM 8329  C CG   . LEU A 1 34 ? -7.961  -15.485 -1.421  1.00 0.00 ? 34 LEU A CG   8  
ATOM 8330  C CD1  . LEU A 1 34 ? -7.583  -14.945 -2.792  1.00 0.00 ? 34 LEU A CD1  8  
ATOM 8331  C CD2  . LEU A 1 34 ? -8.486  -16.909 -1.533  1.00 0.00 ? 34 LEU A CD2  8  
ATOM 8332  H H    . LEU A 1 34 ? -5.687  -14.905 1.762   1.00 0.00 ? 34 LEU A H    8  
ATOM 8333  H HA   . LEU A 1 34 ? -5.495  -13.721 -0.721  1.00 0.00 ? 34 LEU A HA   8  
ATOM 8334  H HB2  . LEU A 1 34 ? -5.936  -15.925 -0.955  1.00 0.00 ? 34 LEU A HB2  8  
ATOM 8335  H HB3  . LEU A 1 34 ? -7.027  -15.963 0.428   1.00 0.00 ? 34 LEU A HB3  8  
ATOM 8336  H HG   . LEU A 1 34 ? -8.755  -14.865 -1.027  1.00 0.00 ? 34 LEU A HG   8  
ATOM 8337  H HD11 . LEU A 1 34 ? -8.355  -14.276 -3.141  1.00 0.00 ? 34 LEU A HD11 8  
ATOM 8338  H HD12 . LEU A 1 34 ? -7.478  -15.766 -3.486  1.00 0.00 ? 34 LEU A HD12 8  
ATOM 8339  H HD13 . LEU A 1 34 ? -6.647  -14.411 -2.723  1.00 0.00 ? 34 LEU A HD13 8  
ATOM 8340  H HD21 . LEU A 1 34 ? -7.774  -17.590 -1.089  1.00 0.00 ? 34 LEU A HD21 8  
ATOM 8341  H HD22 . LEU A 1 34 ? -8.623  -17.161 -2.574  1.00 0.00 ? 34 LEU A HD22 8  
ATOM 8342  H HD23 . LEU A 1 34 ? -9.430  -16.986 -1.015  1.00 0.00 ? 34 LEU A HD23 8  
ATOM 8343  N N    . PRO A 1 35 ? -8.518  -13.268 0.578   1.00 0.00 ? 35 PRO A N    8  
ATOM 8344  C CA   . PRO A 1 35 ? -9.702  -12.404 0.569   1.00 0.00 ? 35 PRO A CA   8  
ATOM 8345  C C    . PRO A 1 35 ? -9.428  -11.037 1.186   1.00 0.00 ? 35 PRO A C    8  
ATOM 8346  O O    . PRO A 1 35 ? -10.042 -10.040 0.807   1.00 0.00 ? 35 PRO A O    8  
ATOM 8347  C CB   . PRO A 1 35 ? -10.714 -13.180 1.416   1.00 0.00 ? 35 PRO A CB   8  
ATOM 8348  C CG   . PRO A 1 35 ? -9.883  -14.031 2.313   1.00 0.00 ? 35 PRO A CG   8  
ATOM 8349  C CD   . PRO A 1 35 ? -8.655  -14.389 1.523   1.00 0.00 ? 35 PRO A CD   8  
ATOM 8350  H HA   . PRO A 1 35 ? -10.091 -12.275 -0.431  1.00 0.00 ? 35 PRO A HA   8  
ATOM 8351  H HB2  . PRO A 1 35 ? -11.322 -12.486 1.980   1.00 0.00 ? 35 PRO A HB2  8  
ATOM 8352  H HB3  . PRO A 1 35 ? -11.342 -13.779 0.774   1.00 0.00 ? 35 PRO A HB3  8  
ATOM 8353  H HG2  . PRO A 1 35 ? -9.611  -13.476 3.198   1.00 0.00 ? 35 PRO A HG2  8  
ATOM 8354  H HG3  . PRO A 1 35 ? -10.429 -14.923 2.581   1.00 0.00 ? 35 PRO A HG3  8  
ATOM 8355  H HD2  . PRO A 1 35 ? -7.794  -14.453 2.172   1.00 0.00 ? 35 PRO A HD2  8  
ATOM 8356  H HD3  . PRO A 1 35 ? -8.803  -15.320 0.996   1.00 0.00 ? 35 PRO A HD3  8  
ATOM 8357  N N    . GLU A 1 36 ? -8.500  -10.998 2.138   1.00 0.00 ? 36 GLU A N    8  
ATOM 8358  C CA   . GLU A 1 36 ? -8.146  -9.752  2.807   1.00 0.00 ? 36 GLU A CA   8  
ATOM 8359  C C    . GLU A 1 36 ? -7.562  -8.749  1.816   1.00 0.00 ? 36 GLU A C    8  
ATOM 8360  O O    . GLU A 1 36 ? -7.961  -7.585  1.787   1.00 0.00 ? 36 GLU A O    8  
ATOM 8361  C CB   . GLU A 1 36 ? -7.142  -10.018 3.931   1.00 0.00 ? 36 GLU A CB   8  
ATOM 8362  C CG   . GLU A 1 36 ? -7.732  -10.780 5.106   1.00 0.00 ? 36 GLU A CG   8  
ATOM 8363  C CD   . GLU A 1 36 ? -8.633  -9.917  5.967   1.00 0.00 ? 36 GLU A CD   8  
ATOM 8364  O OE1  . GLU A 1 36 ? -9.568  -9.301  5.415   1.00 0.00 ? 36 GLU A OE1  8  
ATOM 8365  O OE2  . GLU A 1 36 ? -8.403  -9.858  7.193   1.00 0.00 ? 36 GLU A OE2  8  
ATOM 8366  H H    . GLU A 1 36 ? -8.045  -11.826 2.396   1.00 0.00 ? 36 GLU A H    8  
ATOM 8367  H HA   . GLU A 1 36 ? -9.046  -9.336  3.233   1.00 0.00 ? 36 GLU A HA   8  
ATOM 8368  H HB2  . GLU A 1 36 ? -6.318  -10.592 3.532   1.00 0.00 ? 36 GLU A HB2  8  
ATOM 8369  H HB3  . GLU A 1 36 ? -6.767  -9.072  4.294   1.00 0.00 ? 36 GLU A HB3  8  
ATOM 8370  H HG2  . GLU A 1 36 ? -8.309  -11.610 4.727   1.00 0.00 ? 36 GLU A HG2  8  
ATOM 8371  H HG3  . GLU A 1 36 ? -6.924  -11.155 5.717   1.00 0.00 ? 36 GLU A HG3  8  
ATOM 8372  N N    . ARG A 1 37 ? -6.614  -9.210  1.006   1.00 0.00 ? 37 ARG A N    8  
ATOM 8373  C CA   . ARG A 1 37 ? -5.974  -8.353  0.015   1.00 0.00 ? 37 ARG A CA   8  
ATOM 8374  C C    . ARG A 1 37 ? -6.981  -7.884  -1.030  1.00 0.00 ? 37 ARG A C    8  
ATOM 8375  O O    . ARG A 1 37 ? -6.964  -6.727  -1.447  1.00 0.00 ? 37 ARG A O    8  
ATOM 8376  C CB   . ARG A 1 37 ? -4.824  -9.098  -0.667  1.00 0.00 ? 37 ARG A CB   8  
ATOM 8377  C CG   . ARG A 1 37 ? -4.298  -8.399  -1.909  1.00 0.00 ? 37 ARG A CG   8  
ATOM 8378  C CD   . ARG A 1 37 ? -3.370  -9.303  -2.706  1.00 0.00 ? 37 ARG A CD   8  
ATOM 8379  N NE   . ARG A 1 37 ? -3.973  -10.605 -2.975  1.00 0.00 ? 37 ARG A NE   8  
ATOM 8380  C CZ   . ARG A 1 37 ? -3.270  -11.694 -3.267  1.00 0.00 ? 37 ARG A CZ   8  
ATOM 8381  N NH1  . ARG A 1 37 ? -1.947  -11.636 -3.328  1.00 0.00 ? 37 ARG A NH1  8  
ATOM 8382  N NH2  . ARG A 1 37 ? -3.891  -12.844 -3.499  1.00 0.00 ? 37 ARG A NH2  8  
ATOM 8383  H H    . ARG A 1 37 ? -6.338  -10.147 1.077   1.00 0.00 ? 37 ARG A H    8  
ATOM 8384  H HA   . ARG A 1 37 ? -5.577  -7.490  0.528   1.00 0.00 ? 37 ARG A HA   8  
ATOM 8385  H HB2  . ARG A 1 37 ? -4.009  -9.199  0.035   1.00 0.00 ? 37 ARG A HB2  8  
ATOM 8386  H HB3  . ARG A 1 37 ? -5.167  -10.081 -0.952  1.00 0.00 ? 37 ARG A HB3  8  
ATOM 8387  H HG2  . ARG A 1 37 ? -5.133  -8.118  -2.534  1.00 0.00 ? 37 ARG A HG2  8  
ATOM 8388  H HG3  . ARG A 1 37 ? -3.755  -7.514  -1.610  1.00 0.00 ? 37 ARG A HG3  8  
ATOM 8389  H HD2  . ARG A 1 37 ? -3.141  -8.822  -3.646  1.00 0.00 ? 37 ARG A HD2  8  
ATOM 8390  H HD3  . ARG A 1 37 ? -2.460  -9.446  -2.144  1.00 0.00 ? 37 ARG A HD3  8  
ATOM 8391  H HE   . ARG A 1 37 ? -4.950  -10.670 -2.935  1.00 0.00 ? 37 ARG A HE   8  
ATOM 8392  H HH11 . ARG A 1 37 ? -1.477  -10.772 -3.153  1.00 0.00 ? 37 ARG A HH11 8  
ATOM 8393  H HH12 . ARG A 1 37 ? -1.420  -12.458 -3.548  1.00 0.00 ? 37 ARG A HH12 8  
ATOM 8394  H HH21 . ARG A 1 37 ? -4.889  -12.891 -3.454  1.00 0.00 ? 37 ARG A HH21 8  
ATOM 8395  H HH22 . ARG A 1 37 ? -3.362  -13.662 -3.719  1.00 0.00 ? 37 ARG A HH22 8  
ATOM 8396  N N    . ALA A 1 38 ? -7.857  -8.792  -1.450  1.00 0.00 ? 38 ALA A N    8  
ATOM 8397  C CA   . ALA A 1 38 ? -8.872  -8.471  -2.445  1.00 0.00 ? 38 ALA A CA   8  
ATOM 8398  C C    . ALA A 1 38 ? -9.867  -7.448  -1.905  1.00 0.00 ? 38 ALA A C    8  
ATOM 8399  O O    . ALA A 1 38 ? -10.395 -6.628  -2.654  1.00 0.00 ? 38 ALA A O    8  
ATOM 8400  C CB   . ALA A 1 38 ? -9.598  -9.734  -2.885  1.00 0.00 ? 38 ALA A CB   8  
ATOM 8401  H H    . ALA A 1 38 ? -7.820  -9.698  -1.080  1.00 0.00 ? 38 ALA A H    8  
ATOM 8402  H HA   . ALA A 1 38 ? -8.374  -8.052  -3.308  1.00 0.00 ? 38 ALA A HA   8  
ATOM 8403  H HB1  . ALA A 1 38 ? -10.658 -9.535  -2.949  1.00 0.00 ? 38 ALA A HB1  8  
ATOM 8404  H HB2  . ALA A 1 38 ? -9.230  -10.041 -3.852  1.00 0.00 ? 38 ALA A HB2  8  
ATOM 8405  H HB3  . ALA A 1 38 ? -9.422  -10.519 -2.165  1.00 0.00 ? 38 ALA A HB3  8  
ATOM 8406  N N    . GLU A 1 39 ? -10.117 -7.505  -0.600  1.00 0.00 ? 39 GLU A N    8  
ATOM 8407  C CA   . GLU A 1 39 ? -11.049 -6.584  0.038   1.00 0.00 ? 39 GLU A CA   8  
ATOM 8408  C C    . GLU A 1 39 ? -10.657 -5.135  -0.236  1.00 0.00 ? 39 GLU A C    8  
ATOM 8409  O O    . GLU A 1 39 ? -11.515 -4.277  -0.449  1.00 0.00 ? 39 GLU A O    8  
ATOM 8410  C CB   . GLU A 1 39 ? -11.095 -6.834  1.547   1.00 0.00 ? 39 GLU A CB   8  
ATOM 8411  C CG   . GLU A 1 39 ? -12.440 -6.513  2.177   1.00 0.00 ? 39 GLU A CG   8  
ATOM 8412  C CD   . GLU A 1 39 ? -13.387 -7.697  2.165   1.00 0.00 ? 39 GLU A CD   8  
ATOM 8413  O OE1  . GLU A 1 39 ? -12.912 -8.838  2.342   1.00 0.00 ? 39 GLU A OE1  8  
ATOM 8414  O OE2  . GLU A 1 39 ? -14.603 -7.483  1.979   1.00 0.00 ? 39 GLU A OE2  8  
ATOM 8415  H H    . GLU A 1 39 ? -9.664  -8.182  -0.055  1.00 0.00 ? 39 GLU A H    8  
ATOM 8416  H HA   . GLU A 1 39 ? -12.030 -6.763  -0.377  1.00 0.00 ? 39 GLU A HA   8  
ATOM 8417  H HB2  . GLU A 1 39 ? -10.872 -7.874  1.734   1.00 0.00 ? 39 GLU A HB2  8  
ATOM 8418  H HB3  . GLU A 1 39 ? -10.343 -6.223  2.024   1.00 0.00 ? 39 GLU A HB3  8  
ATOM 8419  H HG2  . GLU A 1 39 ? -12.281 -6.209  3.201   1.00 0.00 ? 39 GLU A HG2  8  
ATOM 8420  H HG3  . GLU A 1 39 ? -12.895 -5.701  1.629   1.00 0.00 ? 39 GLU A HG3  8  
ATOM 8421  N N    . LEU A 1 40 ? -9.356  -4.869  -0.229  1.00 0.00 ? 40 LEU A N    8  
ATOM 8422  C CA   . LEU A 1 40 ? -8.848  -3.524  -0.477  1.00 0.00 ? 40 LEU A CA   8  
ATOM 8423  C C    . LEU A 1 40 ? -8.982  -3.154  -1.950  1.00 0.00 ? 40 LEU A C    8  
ATOM 8424  O O    . LEU A 1 40 ? -9.295  -2.013  -2.288  1.00 0.00 ? 40 LEU A O    8  
ATOM 8425  C CB   . LEU A 1 40 ? -7.384  -3.423  -0.045  1.00 0.00 ? 40 LEU A CB   8  
ATOM 8426  C CG   . LEU A 1 40 ? -7.043  -4.023  1.320   1.00 0.00 ? 40 LEU A CG   8  
ATOM 8427  C CD1  . LEU A 1 40 ? -5.724  -3.468  1.833   1.00 0.00 ? 40 LEU A CD1  8  
ATOM 8428  C CD2  . LEU A 1 40 ? -8.161  -3.752  2.315   1.00 0.00 ? 40 LEU A CD2  8  
ATOM 8429  H H    . LEU A 1 40 ? -8.720  -5.594  -0.053  1.00 0.00 ? 40 LEU A H    8  
ATOM 8430  H HA   . LEU A 1 40 ? -9.436  -2.835  0.110   1.00 0.00 ? 40 LEU A HA   8  
ATOM 8431  H HB2  . LEU A 1 40 ? -6.785  -3.928  -0.787  1.00 0.00 ? 40 LEU A HB2  8  
ATOM 8432  H HB3  . LEU A 1 40 ? -7.118  -2.376  -0.023  1.00 0.00 ? 40 LEU A HB3  8  
ATOM 8433  H HG   . LEU A 1 40 ? -6.937  -5.094  1.218   1.00 0.00 ? 40 LEU A HG   8  
ATOM 8434  H HD11 . LEU A 1 40 ? -5.669  -2.412  1.616   1.00 0.00 ? 40 LEU A HD11 8  
ATOM 8435  H HD12 . LEU A 1 40 ? -4.905  -3.979  1.347   1.00 0.00 ? 40 LEU A HD12 8  
ATOM 8436  H HD13 . LEU A 1 40 ? -5.660  -3.620  2.900   1.00 0.00 ? 40 LEU A HD13 8  
ATOM 8437  H HD21 . LEU A 1 40 ? -7.736  -3.541  3.286   1.00 0.00 ? 40 LEU A HD21 8  
ATOM 8438  H HD22 . LEU A 1 40 ? -8.801  -4.620  2.384   1.00 0.00 ? 40 LEU A HD22 8  
ATOM 8439  H HD23 . LEU A 1 40 ? -8.740  -2.902  1.984   1.00 0.00 ? 40 LEU A HD23 8  
ATOM 8440  N N    . ALA A 1 41 ? -8.744  -4.128  -2.823  1.00 0.00 ? 41 ALA A N    8  
ATOM 8441  C CA   . ALA A 1 41 ? -8.843  -3.905  -4.261  1.00 0.00 ? 41 ALA A CA   8  
ATOM 8442  C C    . ALA A 1 41 ? -10.294 -3.713  -4.688  1.00 0.00 ? 41 ALA A C    8  
ATOM 8443  O O    . ALA A 1 41 ? -10.578 -3.000  -5.651  1.00 0.00 ? 41 ALA A O    8  
ATOM 8444  C CB   . ALA A 1 41 ? -8.217  -5.067  -5.018  1.00 0.00 ? 41 ALA A CB   8  
ATOM 8445  H H    . ALA A 1 41 ? -8.498  -5.017  -2.493  1.00 0.00 ? 41 ALA A H    8  
ATOM 8446  H HA   . ALA A 1 41 ? -8.286  -3.011  -4.499  1.00 0.00 ? 41 ALA A HA   8  
ATOM 8447  H HB1  . ALA A 1 41 ? -8.216  -5.946  -4.390  1.00 0.00 ? 41 ALA A HB1  8  
ATOM 8448  H HB2  . ALA A 1 41 ? -8.790  -5.264  -5.912  1.00 0.00 ? 41 ALA A HB2  8  
ATOM 8449  H HB3  . ALA A 1 41 ? -7.203  -4.816  -5.288  1.00 0.00 ? 41 ALA A HB3  8  
ATOM 8450  N N    . ALA A 1 42 ? -11.208 -4.353  -3.967  1.00 0.00 ? 42 ALA A N    8  
ATOM 8451  C CA   . ALA A 1 42 ? -12.630 -4.250  -4.271  1.00 0.00 ? 42 ALA A CA   8  
ATOM 8452  C C    . ALA A 1 42 ? -13.257 -3.050  -3.568  1.00 0.00 ? 42 ALA A C    8  
ATOM 8453  O O    . ALA A 1 42 ? -14.032 -2.304  -4.166  1.00 0.00 ? 42 ALA A O    8  
ATOM 8454  C CB   . ALA A 1 42 ? -13.349 -5.531  -3.874  1.00 0.00 ? 42 ALA A CB   8  
ATOM 8455  H H    . ALA A 1 42 ? -10.920 -4.906  -3.211  1.00 0.00 ? 42 ALA A H    8  
ATOM 8456  H HA   . ALA A 1 42 ? -12.735 -4.124  -5.339  1.00 0.00 ? 42 ALA A HA   8  
ATOM 8457  H HB1  . ALA A 1 42 ? -13.877 -5.926  -4.729  1.00 0.00 ? 42 ALA A HB1  8  
ATOM 8458  H HB2  . ALA A 1 42 ? -12.627 -6.257  -3.530  1.00 0.00 ? 42 ALA A HB2  8  
ATOM 8459  H HB3  . ALA A 1 42 ? -14.052 -5.319  -3.083  1.00 0.00 ? 42 ALA A HB3  8  
ATOM 8460  N N    . SER A 1 43 ? -12.917 -2.871  -2.296  1.00 0.00 ? 43 SER A N    8  
ATOM 8461  C CA   . SER A 1 43 ? -13.450 -1.764  -1.511  1.00 0.00 ? 43 SER A CA   8  
ATOM 8462  C C    . SER A 1 43 ? -12.889 -0.432  -1.999  1.00 0.00 ? 43 SER A C    8  
ATOM 8463  O O    . SER A 1 43 ? -13.638 0.505   -2.279  1.00 0.00 ? 43 SER A O    8  
ATOM 8464  C CB   . SER A 1 43 ? -13.120 -1.957  -0.029  1.00 0.00 ? 43 SER A CB   8  
ATOM 8465  O OG   . SER A 1 43 ? -13.476 -0.812  0.726   1.00 0.00 ? 43 SER A OG   8  
ATOM 8466  H H    . SER A 1 43 ? -12.294 -3.501  -1.875  1.00 0.00 ? 43 SER A H    8  
ATOM 8467  H HA   . SER A 1 43 ? -14.523 -1.757  -1.634  1.00 0.00 ? 43 SER A HA   8  
ATOM 8468  H HB2  . SER A 1 43 ? -13.665 -2.808  0.351   1.00 0.00 ? 43 SER A HB2  8  
ATOM 8469  H HB3  . SER A 1 43 ? -12.059 -2.131  0.081   1.00 0.00 ? 43 SER A HB3  8  
ATOM 8470  H HG   . SER A 1 43 ? -13.683 -1.073  1.626   1.00 0.00 ? 43 SER A HG   8  
ATOM 8471  N N    . LEU A 1 44 ? -11.567 -0.355  -2.098  1.00 0.00 ? 44 LEU A N    8  
ATOM 8472  C CA   . LEU A 1 44 ? -10.903 0.862   -2.553  1.00 0.00 ? 44 LEU A CA   8  
ATOM 8473  C C    . LEU A 1 44 ? -11.042 1.027   -4.063  1.00 0.00 ? 44 LEU A C    8  
ATOM 8474  O O    . LEU A 1 44 ? -10.951 2.136   -4.588  1.00 0.00 ? 44 LEU A O    8  
ATOM 8475  C CB   . LEU A 1 44 ? -9.424  0.835   -2.166  1.00 0.00 ? 44 LEU A CB   8  
ATOM 8476  C CG   . LEU A 1 44 ? -9.112  0.382   -0.739  1.00 0.00 ? 44 LEU A CG   8  
ATOM 8477  C CD1  . LEU A 1 44 ? -7.609  0.303   -0.521  1.00 0.00 ? 44 LEU A CD1  8  
ATOM 8478  C CD2  . LEU A 1 44 ? -9.751  1.322   0.272   1.00 0.00 ? 44 LEU A CD2  8  
ATOM 8479  H H    . LEU A 1 44 ? -11.023 -1.134  -1.861  1.00 0.00 ? 44 LEU A H    8  
ATOM 8480  H HA   . LEU A 1 44 ? -11.379 1.700   -2.066  1.00 0.00 ? 44 LEU A HA   8  
ATOM 8481  H HB2  . LEU A 1 44 ? -8.917  0.166   -2.843  1.00 0.00 ? 44 LEU A HB2  8  
ATOM 8482  H HB3  . LEU A 1 44 ? -9.032  1.835   -2.289  1.00 0.00 ? 44 LEU A HB3  8  
ATOM 8483  H HG   . LEU A 1 44 ? -9.523  -0.607  -0.584  1.00 0.00 ? 44 LEU A HG   8  
ATOM 8484  H HD11 . LEU A 1 44 ? -7.188  1.297   -0.552  1.00 0.00 ? 44 LEU A HD11 8  
ATOM 8485  H HD12 . LEU A 1 44 ? -7.163  -0.301  -1.297  1.00 0.00 ? 44 LEU A HD12 8  
ATOM 8486  H HD13 . LEU A 1 44 ? -7.408  -0.143  0.442   1.00 0.00 ? 44 LEU A HD13 8  
ATOM 8487  H HD21 . LEU A 1 44 ? -9.753  0.856   1.246   1.00 0.00 ? 44 LEU A HD21 8  
ATOM 8488  H HD22 . LEU A 1 44 ? -10.768 1.535   -0.027  1.00 0.00 ? 44 LEU A HD22 8  
ATOM 8489  H HD23 . LEU A 1 44 ? -9.188  2.242   0.314   1.00 0.00 ? 44 LEU A HD23 8  
ATOM 8490  N N    . GLY A 1 45 ? -11.266 -0.086  -4.756  1.00 0.00 ? 45 GLY A N    8  
ATOM 8491  C CA   . GLY A 1 45 ? -11.416 -0.043  -6.199  1.00 0.00 ? 45 GLY A CA   8  
ATOM 8492  C C    . GLY A 1 45 ? -10.106 -0.271  -6.926  1.00 0.00 ? 45 GLY A C    8  
ATOM 8493  O O    . GLY A 1 45 ? -9.989  0.019   -8.117  1.00 0.00 ? 45 GLY A O    8  
ATOM 8494  H H    . GLY A 1 45 ? -11.329 -0.942  -4.284  1.00 0.00 ? 45 GLY A H    8  
ATOM 8495  H HA2  . GLY A 1 45 ? -12.120 -0.805  -6.500  1.00 0.00 ? 45 GLY A HA2  8  
ATOM 8496  H HA3  . GLY A 1 45 ? -11.807 0.924   -6.480  1.00 0.00 ? 45 GLY A HA3  8  
ATOM 8497  N N    . LEU A 1 46 ? -9.116  -0.791  -6.208  1.00 0.00 ? 46 LEU A N    8  
ATOM 8498  C CA   . LEU A 1 46 ? -7.806  -1.057  -6.791  1.00 0.00 ? 46 LEU A CA   8  
ATOM 8499  C C    . LEU A 1 46 ? -7.661  -2.530  -7.158  1.00 0.00 ? 46 LEU A C    8  
ATOM 8500  O O    . LEU A 1 46 ? -8.572  -3.329  -6.936  1.00 0.00 ? 46 LEU A O    8  
ATOM 8501  C CB   . LEU A 1 46 ? -6.700  -0.651  -5.816  1.00 0.00 ? 46 LEU A CB   8  
ATOM 8502  C CG   . LEU A 1 46 ? -6.761  0.784   -5.290  1.00 0.00 ? 46 LEU A CG   8  
ATOM 8503  C CD1  . LEU A 1 46 ? -6.171  0.865   -3.890  1.00 0.00 ? 46 LEU A CD1  8  
ATOM 8504  C CD2  . LEU A 1 46 ? -6.033  1.729   -6.234  1.00 0.00 ? 46 LEU A CD2  8  
ATOM 8505  H H    . LEU A 1 46 ? -9.269  -1.001  -5.264  1.00 0.00 ? 46 LEU A H    8  
ATOM 8506  H HA   . LEU A 1 46 ? -7.717  -0.464  -7.690  1.00 0.00 ? 46 LEU A HA   8  
ATOM 8507  H HB2  . LEU A 1 46 ? -6.747  -1.316  -4.967  1.00 0.00 ? 46 LEU A HB2  8  
ATOM 8508  H HB3  . LEU A 1 46 ? -5.752  -0.779  -6.319  1.00 0.00 ? 46 LEU A HB3  8  
ATOM 8509  H HG   . LEU A 1 46 ? -7.795  1.096   -5.234  1.00 0.00 ? 46 LEU A HG   8  
ATOM 8510  H HD11 . LEU A 1 46 ? -5.481  0.048   -3.743  1.00 0.00 ? 46 LEU A HD11 8  
ATOM 8511  H HD12 . LEU A 1 46 ? -6.965  0.801   -3.161  1.00 0.00 ? 46 LEU A HD12 8  
ATOM 8512  H HD13 . LEU A 1 46 ? -5.650  1.804   -3.774  1.00 0.00 ? 46 LEU A HD13 8  
ATOM 8513  H HD21 . LEU A 1 46 ? -5.248  2.240   -5.695  1.00 0.00 ? 46 LEU A HD21 8  
ATOM 8514  H HD22 . LEU A 1 46 ? -6.731  2.454   -6.626  1.00 0.00 ? 46 LEU A HD22 8  
ATOM 8515  H HD23 . LEU A 1 46 ? -5.603  1.165   -7.048  1.00 0.00 ? 46 LEU A HD23 8  
ATOM 8516  N N    . THR A 1 47 ? -6.509  -2.885  -7.718  1.00 0.00 ? 47 THR A N    8  
ATOM 8517  C CA   . THR A 1 47 ? -6.245  -4.263  -8.114  1.00 0.00 ? 47 THR A CA   8  
ATOM 8518  C C    . THR A 1 47 ? -5.211  -4.909  -7.199  1.00 0.00 ? 47 THR A C    8  
ATOM 8519  O O    . THR A 1 47 ? -4.356  -4.226  -6.635  1.00 0.00 ? 47 THR A O    8  
ATOM 8520  C CB   . THR A 1 47 ? -5.747  -4.343  -9.570  1.00 0.00 ? 47 THR A CB   8  
ATOM 8521  O OG1  . THR A 1 47 ? -5.524  -5.709  -9.937  1.00 0.00 ? 47 THR A OG1  8  
ATOM 8522  C CG2  . THR A 1 47 ? -4.462  -3.549  -9.747  1.00 0.00 ? 47 THR A CG2  8  
ATOM 8523  H H    . THR A 1 47 ? -5.822  -2.203  -7.870  1.00 0.00 ? 47 THR A H    8  
ATOM 8524  H HA   . THR A 1 47 ? -7.171  -4.815  -8.042  1.00 0.00 ? 47 THR A HA   8  
ATOM 8525  H HB   . THR A 1 47 ? -6.504  -3.924  -10.217 1.00 0.00 ? 47 THR A HB   8  
ATOM 8526  H HG1  . THR A 1 47 ? -5.191  -6.194  -9.178  1.00 0.00 ? 47 THR A HG1  8  
ATOM 8527  H HG21 . THR A 1 47 ? -4.313  -3.334  -10.795 1.00 0.00 ? 47 THR A HG21 8  
ATOM 8528  H HG22 . THR A 1 47 ? -3.628  -4.126  -9.376  1.00 0.00 ? 47 THR A HG22 8  
ATOM 8529  H HG23 . THR A 1 47 ? -4.533  -2.623  -9.197  1.00 0.00 ? 47 THR A HG23 8  
ATOM 8530  N N    . GLN A 1 48 ? -5.294  -6.228  -7.058  1.00 0.00 ? 48 GLN A N    8  
ATOM 8531  C CA   . GLN A 1 48 ? -4.364  -6.965  -6.211  1.00 0.00 ? 48 GLN A CA   8  
ATOM 8532  C C    . GLN A 1 48 ? -2.921  -6.603  -6.543  1.00 0.00 ? 48 GLN A C    8  
ATOM 8533  O O    . GLN A 1 48 ? -2.062  -6.554  -5.661  1.00 0.00 ? 48 GLN A O    8  
ATOM 8534  C CB   . GLN A 1 48 ? -4.575  -8.471  -6.376  1.00 0.00 ? 48 GLN A CB   8  
ATOM 8535  C CG   . GLN A 1 48 ? -5.742  -9.014  -5.566  1.00 0.00 ? 48 GLN A CG   8  
ATOM 8536  C CD   . GLN A 1 48 ? -6.079  -10.450 -5.919  1.00 0.00 ? 48 GLN A CD   8  
ATOM 8537  O OE1  . GLN A 1 48 ? -5.214  -11.326 -5.898  1.00 0.00 ? 48 GLN A OE1  8  
ATOM 8538  N NE2  . GLN A 1 48 ? -7.342  -10.698 -6.246  1.00 0.00 ? 48 GLN A NE2  8  
ATOM 8539  H H    . GLN A 1 48 ? -5.997  -6.716  -7.534  1.00 0.00 ? 48 GLN A H    8  
ATOM 8540  H HA   . GLN A 1 48 ? -4.564  -6.693  -5.186  1.00 0.00 ? 48 GLN A HA   8  
ATOM 8541  H HB2  . GLN A 1 48 ? -4.758  -8.685  -7.419  1.00 0.00 ? 48 GLN A HB2  8  
ATOM 8542  H HB3  . GLN A 1 48 ? -3.678  -8.985  -6.064  1.00 0.00 ? 48 GLN A HB3  8  
ATOM 8543  H HG2  . GLN A 1 48 ? -5.487  -8.968  -4.517  1.00 0.00 ? 48 GLN A HG2  8  
ATOM 8544  H HG3  . GLN A 1 48 ? -6.610  -8.399  -5.752  1.00 0.00 ? 48 GLN A HG3  8  
ATOM 8545  H HE21 . GLN A 1 48 ? -7.976  -9.950  -6.242  1.00 0.00 ? 48 GLN A HE21 8  
ATOM 8546  H HE22 . GLN A 1 48 ? -7.587  -11.617 -6.479  1.00 0.00 ? 48 GLN A HE22 8  
ATOM 8547  N N    . THR A 1 49 ? -2.658  -6.349  -7.822  1.00 0.00 ? 49 THR A N    8  
ATOM 8548  C CA   . THR A 1 49 ? -1.319  -5.992  -8.271  1.00 0.00 ? 49 THR A CA   8  
ATOM 8549  C C    . THR A 1 49 ? -0.887  -4.646  -7.701  1.00 0.00 ? 49 THR A C    8  
ATOM 8550  O O    . THR A 1 49 ? 0.302   -4.396  -7.508  1.00 0.00 ? 49 THR A O    8  
ATOM 8551  C CB   . THR A 1 49 ? -1.238  -5.936  -9.808  1.00 0.00 ? 49 THR A CB   8  
ATOM 8552  O OG1  . THR A 1 49 ? -1.890  -7.078  -10.375 1.00 0.00 ? 49 THR A OG1  8  
ATOM 8553  C CG2  . THR A 1 49 ? 0.210   -5.889  -10.273 1.00 0.00 ? 49 THR A CG2  8  
ATOM 8554  H H    . THR A 1 49 ? -3.384  -6.404  -8.477  1.00 0.00 ? 49 THR A H    8  
ATOM 8555  H HA   . THR A 1 49 ? -0.636  -6.755  -7.923  1.00 0.00 ? 49 THR A HA   8  
ATOM 8556  H HB   . THR A 1 49 ? -1.738  -5.040  -10.147 1.00 0.00 ? 49 THR A HB   8  
ATOM 8557  H HG1  . THR A 1 49 ? -1.679  -7.857  -9.856  1.00 0.00 ? 49 THR A HG1  8  
ATOM 8558  H HG21 . THR A 1 49 ? 0.789   -5.287  -9.588  1.00 0.00 ? 49 THR A HG21 8  
ATOM 8559  H HG22 . THR A 1 49 ? 0.257   -5.456  -11.261 1.00 0.00 ? 49 THR A HG22 8  
ATOM 8560  H HG23 . THR A 1 49 ? 0.612   -6.891  -10.299 1.00 0.00 ? 49 THR A HG23 8  
ATOM 8561  N N    . GLN A 1 50 ? -1.862  -3.783  -7.432  1.00 0.00 ? 50 GLN A N    8  
ATOM 8562  C CA   . GLN A 1 50 ? -1.582  -2.461  -6.884  1.00 0.00 ? 50 GLN A CA   8  
ATOM 8563  C C    . GLN A 1 50 ? -1.490  -2.512  -5.362  1.00 0.00 ? 50 GLN A C    8  
ATOM 8564  O O    . GLN A 1 50 ? -0.557  -1.972  -4.768  1.00 0.00 ? 50 GLN A O    8  
ATOM 8565  C CB   . GLN A 1 50 ? -2.665  -1.469  -7.309  1.00 0.00 ? 50 GLN A CB   8  
ATOM 8566  C CG   . GLN A 1 50 ? -2.431  -0.864  -8.683  1.00 0.00 ? 50 GLN A CG   8  
ATOM 8567  C CD   . GLN A 1 50 ? -2.991  0.539   -8.806  1.00 0.00 ? 50 GLN A CD   8  
ATOM 8568  O OE1  . GLN A 1 50 ? -3.945  0.777   -9.548  1.00 0.00 ? 50 GLN A OE1  8  
ATOM 8569  N NE2  . GLN A 1 50 ? -2.401  1.479   -8.077  1.00 0.00 ? 50 GLN A NE2  8  
ATOM 8570  H H    . GLN A 1 50 ? -2.790  -4.041  -7.607  1.00 0.00 ? 50 GLN A H    8  
ATOM 8571  H HA   . GLN A 1 50 ? -0.632  -2.134  -7.278  1.00 0.00 ? 50 GLN A HA   8  
ATOM 8572  H HB2  . GLN A 1 50 ? -3.618  -1.978  -7.321  1.00 0.00 ? 50 GLN A HB2  8  
ATOM 8573  H HB3  . GLN A 1 50 ? -2.704  -0.666  -6.587  1.00 0.00 ? 50 GLN A HB3  8  
ATOM 8574  H HG2  . GLN A 1 50 ? -1.368  -0.827  -8.870  1.00 0.00 ? 50 GLN A HG2  8  
ATOM 8575  H HG3  . GLN A 1 50 ? -2.904  -1.491  -9.424  1.00 0.00 ? 50 GLN A HG3  8  
ATOM 8576  H HE21 . GLN A 1 50 ? -1.645  1.217   -7.509  1.00 0.00 ? 50 GLN A HE21 8  
ATOM 8577  H HE22 . GLN A 1 50 ? -2.742  2.395   -8.138  1.00 0.00 ? 50 GLN A HE22 8  
ATOM 8578  N N    . VAL A 1 51 ? -2.465  -3.164  -4.737  1.00 0.00 ? 51 VAL A N    8  
ATOM 8579  C CA   . VAL A 1 51 ? -2.494  -3.286  -3.284  1.00 0.00 ? 51 VAL A CA   8  
ATOM 8580  C C    . VAL A 1 51 ? -1.335  -4.138  -2.781  1.00 0.00 ? 51 VAL A C    8  
ATOM 8581  O O    . VAL A 1 51 ? -0.896  -3.998  -1.639  1.00 0.00 ? 51 VAL A O    8  
ATOM 8582  C CB   . VAL A 1 51 ? -3.820  -3.903  -2.799  1.00 0.00 ? 51 VAL A CB   8  
ATOM 8583  C CG1  . VAL A 1 51 ? -3.660  -4.480  -1.401  1.00 0.00 ? 51 VAL A CG1  8  
ATOM 8584  C CG2  . VAL A 1 51 ? -4.933  -2.867  -2.834  1.00 0.00 ? 51 VAL A CG2  8  
ATOM 8585  H H    . VAL A 1 51 ? -3.181  -3.574  -5.265  1.00 0.00 ? 51 VAL A H    8  
ATOM 8586  H HA   . VAL A 1 51 ? -2.408  -2.294  -2.864  1.00 0.00 ? 51 VAL A HA   8  
ATOM 8587  H HB   . VAL A 1 51 ? -4.085  -4.708  -3.468  1.00 0.00 ? 51 VAL A HB   8  
ATOM 8588  H HG11 . VAL A 1 51 ? -2.897  -5.244  -1.412  1.00 0.00 ? 51 VAL A HG11 8  
ATOM 8589  H HG12 . VAL A 1 51 ? -3.374  -3.694  -0.717  1.00 0.00 ? 51 VAL A HG12 8  
ATOM 8590  H HG13 . VAL A 1 51 ? -4.597  -4.912  -1.081  1.00 0.00 ? 51 VAL A HG13 8  
ATOM 8591  H HG21 . VAL A 1 51 ? -5.845  -3.308  -2.460  1.00 0.00 ? 51 VAL A HG21 8  
ATOM 8592  H HG22 . VAL A 1 51 ? -4.661  -2.024  -2.215  1.00 0.00 ? 51 VAL A HG22 8  
ATOM 8593  H HG23 . VAL A 1 51 ? -5.084  -2.533  -3.850  1.00 0.00 ? 51 VAL A HG23 8  
ATOM 8594  N N    . LYS A 1 52 ? -0.842  -5.024  -3.640  1.00 0.00 ? 52 LYS A N    8  
ATOM 8595  C CA   . LYS A 1 52 ? 0.268   -5.899  -3.285  1.00 0.00 ? 52 LYS A CA   8  
ATOM 8596  C C    . LYS A 1 52 ? 1.569   -5.110  -3.170  1.00 0.00 ? 52 LYS A C    8  
ATOM 8597  O O    . LYS A 1 52 ? 2.241   -5.151  -2.140  1.00 0.00 ? 52 LYS A O    8  
ATOM 8598  C CB   . LYS A 1 52 ? 0.423   -7.009  -4.327  1.00 0.00 ? 52 LYS A CB   8  
ATOM 8599  C CG   . LYS A 1 52 ? -0.382  -8.258  -4.010  1.00 0.00 ? 52 LYS A CG   8  
ATOM 8600  C CD   . LYS A 1 52 ? -0.622  -9.097  -5.254  1.00 0.00 ? 52 LYS A CD   8  
ATOM 8601  C CE   . LYS A 1 52 ? 0.616   -9.893  -5.636  1.00 0.00 ? 52 LYS A CE   8  
ATOM 8602  N NZ   . LYS A 1 52 ? 0.871   -11.011 -4.686  1.00 0.00 ? 52 LYS A NZ   8  
ATOM 8603  H H    . LYS A 1 52 ? -1.234  -5.089  -4.537  1.00 0.00 ? 52 LYS A H    8  
ATOM 8604  H HA   . LYS A 1 52 ? 0.046   -6.345  -2.327  1.00 0.00 ? 52 LYS A HA   8  
ATOM 8605  H HB2  . LYS A 1 52 ? 0.101   -6.633  -5.287  1.00 0.00 ? 52 LYS A HB2  8  
ATOM 8606  H HB3  . LYS A 1 52 ? 1.466   -7.285  -4.389  1.00 0.00 ? 52 LYS A HB3  8  
ATOM 8607  H HG2  . LYS A 1 52 ? 0.159   -8.851  -3.288  1.00 0.00 ? 52 LYS A HG2  8  
ATOM 8608  H HG3  . LYS A 1 52 ? -1.336  -7.964  -3.595  1.00 0.00 ? 52 LYS A HG3  8  
ATOM 8609  H HD2  . LYS A 1 52 ? -1.434  -9.784  -5.063  1.00 0.00 ? 52 LYS A HD2  8  
ATOM 8610  H HD3  . LYS A 1 52 ? -0.887  -8.443  -6.073  1.00 0.00 ? 52 LYS A HD3  8  
ATOM 8611  H HE2  . LYS A 1 52 ? 0.475   -10.299 -6.627  1.00 0.00 ? 52 LYS A HE2  8  
ATOM 8612  H HE3  . LYS A 1 52 ? 1.468   -9.230  -5.637  1.00 0.00 ? 52 LYS A HE3  8  
ATOM 8613  H HZ1  . LYS A 1 52 ? 1.607   -11.641 -5.066  1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 8614  H HZ2  . LYS A 1 52 ? 0.002   -11.562 -4.541  1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 8615  H HZ3  . LYS A 1 52 ? 1.189   -10.636 -3.770  1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 8616  N N    . ILE A 1 53 ? 1.915   -4.392  -4.234  1.00 0.00 ? 53 ILE A N    8  
ATOM 8617  C CA   . ILE A 1 53 ? 3.133   -3.592  -4.250  1.00 0.00 ? 53 ILE A CA   8  
ATOM 8618  C C    . ILE A 1 53 ? 3.112   -2.536  -3.151  1.00 0.00 ? 53 ILE A C    8  
ATOM 8619  O O    . ILE A 1 53 ? 4.127   -2.280  -2.502  1.00 0.00 ? 53 ILE A O    8  
ATOM 8620  C CB   . ILE A 1 53 ? 3.332   -2.898  -5.610  1.00 0.00 ? 53 ILE A CB   8  
ATOM 8621  C CG1  . ILE A 1 53 ? 3.332   -3.930  -6.739  1.00 0.00 ? 53 ILE A CG1  8  
ATOM 8622  C CG2  . ILE A 1 53 ? 4.628   -2.101  -5.614  1.00 0.00 ? 53 ILE A CG2  8  
ATOM 8623  C CD1  . ILE A 1 53 ? 3.191   -3.320  -8.116  1.00 0.00 ? 53 ILE A CD1  8  
ATOM 8624  H H    . ILE A 1 53 ? 1.338   -4.400  -5.025  1.00 0.00 ? 53 ILE A H    8  
ATOM 8625  H HA   . ILE A 1 53 ? 3.970   -4.255  -4.081  1.00 0.00 ? 53 ILE A HA   8  
ATOM 8626  H HB   . ILE A 1 53 ? 2.514   -2.210  -5.761  1.00 0.00 ? 53 ILE A HB   8  
ATOM 8627  H HG12 . ILE A 1 53 ? 4.259   -4.481  -6.715  1.00 0.00 ? 53 ILE A HG12 8  
ATOM 8628  H HG13 . ILE A 1 53 ? 2.508   -4.613  -6.593  1.00 0.00 ? 53 ILE A HG13 8  
ATOM 8629  H HG21 . ILE A 1 53 ? 5.413   -2.689  -5.162  1.00 0.00 ? 53 ILE A HG21 8  
ATOM 8630  H HG22 . ILE A 1 53 ? 4.900   -1.861  -6.631  1.00 0.00 ? 53 ILE A HG22 8  
ATOM 8631  H HG23 . ILE A 1 53 ? 4.492   -1.189  -5.052  1.00 0.00 ? 53 ILE A HG23 8  
ATOM 8632  H HD11 . ILE A 1 53 ? 2.154   -3.341  -8.416  1.00 0.00 ? 53 ILE A HD11 8  
ATOM 8633  H HD12 . ILE A 1 53 ? 3.541   -2.298  -8.095  1.00 0.00 ? 53 ILE A HD12 8  
ATOM 8634  H HD13 . ILE A 1 53 ? 3.780   -3.887  -8.823  1.00 0.00 ? 53 ILE A HD13 8  
ATOM 8635  N N    . TRP A 1 54 ? 1.950   -1.926  -2.946  1.00 0.00 ? 54 TRP A N    8  
ATOM 8636  C CA   . TRP A 1 54 ? 1.796   -0.898  -1.923  1.00 0.00 ? 54 TRP A CA   8  
ATOM 8637  C C    . TRP A 1 54 ? 2.203   -1.428  -0.553  1.00 0.00 ? 54 TRP A C    8  
ATOM 8638  O O    . TRP A 1 54 ? 2.837   -0.723  0.233   1.00 0.00 ? 54 TRP A O    8  
ATOM 8639  C CB   . TRP A 1 54 ? 0.350   -0.402  -1.883  1.00 0.00 ? 54 TRP A CB   8  
ATOM 8640  C CG   . TRP A 1 54 ? 0.145   0.758   -0.957  1.00 0.00 ? 54 TRP A CG   8  
ATOM 8641  C CD1  . TRP A 1 54 ? -0.074  2.059   -1.309  1.00 0.00 ? 54 TRP A CD1  8  
ATOM 8642  C CD2  . TRP A 1 54 ? 0.143   0.722   0.474   1.00 0.00 ? 54 TRP A CD2  8  
ATOM 8643  N NE1  . TRP A 1 54 ? -0.213  2.835   -0.183  1.00 0.00 ? 54 TRP A NE1  8  
ATOM 8644  C CE2  . TRP A 1 54 ? -0.085  2.038   0.924   1.00 0.00 ? 54 TRP A CE2  8  
ATOM 8645  C CE3  . TRP A 1 54 ? 0.309   -0.293  1.420   1.00 0.00 ? 54 TRP A CE3  8  
ATOM 8646  C CZ2  . TRP A 1 54 ? -0.148  2.361   2.276   1.00 0.00 ? 54 TRP A CZ2  8  
ATOM 8647  C CZ3  . TRP A 1 54 ? 0.245   0.030   2.762   1.00 0.00 ? 54 TRP A CZ3  8  
ATOM 8648  C CH2  . TRP A 1 54 ? 0.018   1.348   3.180   1.00 0.00 ? 54 TRP A CH2  8  
ATOM 8649  H H    . TRP A 1 54 ? 1.177   -2.173  -3.496  1.00 0.00 ? 54 TRP A H    8  
ATOM 8650  H HA   . TRP A 1 54 ? 2.443   -0.073  -2.184  1.00 0.00 ? 54 TRP A HA   8  
ATOM 8651  H HB2  . TRP A 1 54 ? 0.054   -0.093  -2.875  1.00 0.00 ? 54 TRP A HB2  8  
ATOM 8652  H HB3  . TRP A 1 54 ? -0.290  -1.208  -1.555  1.00 0.00 ? 54 TRP A HB3  8  
ATOM 8653  H HD1  . TRP A 1 54 ? -0.127  2.413   -2.328  1.00 0.00 ? 54 TRP A HD1  8  
ATOM 8654  H HE1  . TRP A 1 54 ? -0.378  3.801   -0.175  1.00 0.00 ? 54 TRP A HE1  8  
ATOM 8655  H HE3  . TRP A 1 54 ? 0.485   -1.315  1.117   1.00 0.00 ? 54 TRP A HE3  8  
ATOM 8656  H HZ2  . TRP A 1 54 ? -0.324  3.372   2.615   1.00 0.00 ? 54 TRP A HZ2  8  
ATOM 8657  H HZ3  . TRP A 1 54 ? 0.372   -0.742  3.507   1.00 0.00 ? 54 TRP A HZ3  8  
ATOM 8658  H HH2  . TRP A 1 54 ? -0.024  1.554   4.238   1.00 0.00 ? 54 TRP A HH2  8  
ATOM 8659  N N    . PHE A 1 55 ? 1.835   -2.674  -0.272  1.00 0.00 ? 55 PHE A N    8  
ATOM 8660  C CA   . PHE A 1 55 ? 2.161   -3.298  1.005   1.00 0.00 ? 55 PHE A CA   8  
ATOM 8661  C C    . PHE A 1 55 ? 3.619   -3.748  1.033   1.00 0.00 ? 55 PHE A C    8  
ATOM 8662  O O    . PHE A 1 55 ? 4.340   -3.488  1.996   1.00 0.00 ? 55 PHE A O    8  
ATOM 8663  C CB   . PHE A 1 55 ? 1.242   -4.493  1.262   1.00 0.00 ? 55 PHE A CB   8  
ATOM 8664  C CG   . PHE A 1 55 ? -0.053  -4.121  1.926   1.00 0.00 ? 55 PHE A CG   8  
ATOM 8665  C CD1  . PHE A 1 55 ? -0.961  -3.291  1.288   1.00 0.00 ? 55 PHE A CD1  8  
ATOM 8666  C CD2  . PHE A 1 55 ? -0.364  -4.602  3.188   1.00 0.00 ? 55 PHE A CD2  8  
ATOM 8667  C CE1  . PHE A 1 55 ? -2.153  -2.947  1.897   1.00 0.00 ? 55 PHE A CE1  8  
ATOM 8668  C CE2  . PHE A 1 55 ? -1.554  -4.261  3.802   1.00 0.00 ? 55 PHE A CE2  8  
ATOM 8669  C CZ   . PHE A 1 55 ? -2.450  -3.433  3.154   1.00 0.00 ? 55 PHE A CZ   8  
ATOM 8670  H H    . PHE A 1 55 ? 1.331   -3.186  -0.940  1.00 0.00 ? 55 PHE A H    8  
ATOM 8671  H HA   . PHE A 1 55 ? 2.009   -2.564  1.780   1.00 0.00 ? 55 PHE A HA   8  
ATOM 8672  H HB2  . PHE A 1 55 ? 1.007   -4.967  0.321   1.00 0.00 ? 55 PHE A HB2  8  
ATOM 8673  H HB3  . PHE A 1 55 ? 1.752   -5.200  1.899   1.00 0.00 ? 55 PHE A HB3  8  
ATOM 8674  H HD1  . PHE A 1 55 ? -0.730  -2.910  0.303   1.00 0.00 ? 55 PHE A HD1  8  
ATOM 8675  H HD2  . PHE A 1 55 ? 0.337   -5.251  3.695   1.00 0.00 ? 55 PHE A HD2  8  
ATOM 8676  H HE1  . PHE A 1 55 ? -2.852  -2.299  1.388   1.00 0.00 ? 55 PHE A HE1  8  
ATOM 8677  H HE2  . PHE A 1 55 ? -1.784  -4.644  4.785   1.00 0.00 ? 55 PHE A HE2  8  
ATOM 8678  H HZ   . PHE A 1 55 ? -3.381  -3.165  3.632   1.00 0.00 ? 55 PHE A HZ   8  
ATOM 8679  N N    . GLN A 1 56 ? 4.044   -4.425  -0.029  1.00 0.00 ? 56 GLN A N    8  
ATOM 8680  C CA   . GLN A 1 56 ? 5.415   -4.913  -0.125  1.00 0.00 ? 56 GLN A CA   8  
ATOM 8681  C C    . GLN A 1 56 ? 6.408   -3.757  -0.077  1.00 0.00 ? 56 GLN A C    8  
ATOM 8682  O O    . GLN A 1 56 ? 7.192   -3.638  0.863   1.00 0.00 ? 56 GLN A O    8  
ATOM 8683  C CB   . GLN A 1 56 ? 5.605   -5.711  -1.416  1.00 0.00 ? 56 GLN A CB   8  
ATOM 8684  C CG   . GLN A 1 56 ? 6.859   -6.571  -1.421  1.00 0.00 ? 56 GLN A CG   8  
ATOM 8685  C CD   . GLN A 1 56 ? 7.311   -6.936  -2.821  1.00 0.00 ? 56 GLN A CD   8  
ATOM 8686  O OE1  . GLN A 1 56 ? 6.674   -6.566  -3.807  1.00 0.00 ? 56 GLN A OE1  8  
ATOM 8687  N NE2  . GLN A 1 56 ? 8.417   -7.665  -2.915  1.00 0.00 ? 56 GLN A NE2  8  
ATOM 8688  H H    . GLN A 1 56 ? 3.421   -4.601  -0.764  1.00 0.00 ? 56 GLN A H    8  
ATOM 8689  H HA   . GLN A 1 56 ? 5.595   -5.561  0.718   1.00 0.00 ? 56 GLN A HA   8  
ATOM 8690  H HB2  . GLN A 1 56 ? 4.751   -6.357  -1.555  1.00 0.00 ? 56 GLN A HB2  8  
ATOM 8691  H HB3  . GLN A 1 56 ? 5.664   -5.022  -2.246  1.00 0.00 ? 56 GLN A HB3  8  
ATOM 8692  H HG2  . GLN A 1 56 ? 7.654   -6.027  -0.933  1.00 0.00 ? 56 GLN A HG2  8  
ATOM 8693  H HG3  . GLN A 1 56 ? 6.657   -7.480  -0.874  1.00 0.00 ? 56 GLN A HG3  8  
ATOM 8694  H HE21 . GLN A 1 56 ? 8.872   -7.923  -2.086  1.00 0.00 ? 56 GLN A HE21 8  
ATOM 8695  H HE22 . GLN A 1 56 ? 8.731   -7.915  -3.807  1.00 0.00 ? 56 GLN A HE22 8  
ATOM 8696  N N    . ASN A 1 57 ? 6.369   -2.906  -1.098  1.00 0.00 ? 57 ASN A N    8  
ATOM 8697  C CA   . ASN A 1 57 ? 7.267   -1.760  -1.172  1.00 0.00 ? 57 ASN A CA   8  
ATOM 8698  C C    . ASN A 1 57 ? 7.262   -0.978  0.138   1.00 0.00 ? 57 ASN A C    8  
ATOM 8699  O O    . ASN A 1 57 ? 8.263   -0.369  0.515   1.00 0.00 ? 57 ASN A O    8  
ATOM 8700  C CB   . ASN A 1 57 ? 6.862   -0.842  -2.328  1.00 0.00 ? 57 ASN A CB   8  
ATOM 8701  C CG   . ASN A 1 57 ? 7.445   -1.291  -3.654  1.00 0.00 ? 57 ASN A CG   8  
ATOM 8702  O OD1  . ASN A 1 57 ? 8.300   -2.175  -3.702  1.00 0.00 ? 57 ASN A OD1  8  
ATOM 8703  N ND2  . ASN A 1 57 ? 6.983   -0.681  -4.740  1.00 0.00 ? 57 ASN A ND2  8  
ATOM 8704  H H    . ASN A 1 57 ? 5.721   -3.053  -1.819  1.00 0.00 ? 57 ASN A H    8  
ATOM 8705  H HA   . ASN A 1 57 ? 8.265   -2.131  -1.353  1.00 0.00 ? 57 ASN A HA   8  
ATOM 8706  H HB2  . ASN A 1 57 ? 5.785   -0.836  -2.414  1.00 0.00 ? 57 ASN A HB2  8  
ATOM 8707  H HB3  . ASN A 1 57 ? 7.208   0.160   -2.123  1.00 0.00 ? 57 ASN A HB3  8  
ATOM 8708  H HD21 . ASN A 1 57 ? 6.301   0.015   -4.626  1.00 0.00 ? 57 ASN A HD21 8  
ATOM 8709  H HD22 . ASN A 1 57 ? 7.342   -0.952  -5.610  1.00 0.00 ? 57 ASN A HD22 8  
ATOM 8710  N N    . LYS A 1 58 ? 6.127   -1.002  0.829   1.00 0.00 ? 58 LYS A N    8  
ATOM 8711  C CA   . LYS A 1 58 ? 5.990   -0.298  2.099   1.00 0.00 ? 58 LYS A CA   8  
ATOM 8712  C C    . LYS A 1 58 ? 6.856   -0.944  3.176   1.00 0.00 ? 58 LYS A C    8  
ATOM 8713  O O    . LYS A 1 58 ? 7.548   -0.255  3.925   1.00 0.00 ? 58 LYS A O    8  
ATOM 8714  C CB   . LYS A 1 58 ? 4.526   -0.289  2.545   1.00 0.00 ? 58 LYS A CB   8  
ATOM 8715  C CG   . LYS A 1 58 ? 3.755   0.933   2.075   1.00 0.00 ? 58 LYS A CG   8  
ATOM 8716  C CD   . LYS A 1 58 ? 3.853   2.073   3.075   1.00 0.00 ? 58 LYS A CD   8  
ATOM 8717  C CE   . LYS A 1 58 ? 3.168   3.328   2.557   1.00 0.00 ? 58 LYS A CE   8  
ATOM 8718  N NZ   . LYS A 1 58 ? 4.105   4.196   1.791   1.00 0.00 ? 58 LYS A NZ   8  
ATOM 8719  H H    . LYS A 1 58 ? 5.363   -1.505  0.477   1.00 0.00 ? 58 LYS A H    8  
ATOM 8720  H HA   . LYS A 1 58 ? 6.319   0.720   1.952   1.00 0.00 ? 58 LYS A HA   8  
ATOM 8721  H HB2  . LYS A 1 58 ? 4.038   -1.169  2.155   1.00 0.00 ? 58 LYS A HB2  8  
ATOM 8722  H HB3  . LYS A 1 58 ? 4.491   -0.317  3.625   1.00 0.00 ? 58 LYS A HB3  8  
ATOM 8723  H HG2  . LYS A 1 58 ? 4.160   1.261   1.130   1.00 0.00 ? 58 LYS A HG2  8  
ATOM 8724  H HG3  . LYS A 1 58 ? 2.716   0.664   1.950   1.00 0.00 ? 58 LYS A HG3  8  
ATOM 8725  H HD2  . LYS A 1 58 ? 3.380   1.773   3.998   1.00 0.00 ? 58 LYS A HD2  8  
ATOM 8726  H HD3  . LYS A 1 58 ? 4.896   2.291   3.257   1.00 0.00 ? 58 LYS A HD3  8  
ATOM 8727  H HE2  . LYS A 1 58 ? 2.352   3.038   1.914   1.00 0.00 ? 58 LYS A HE2  8  
ATOM 8728  H HE3  . LYS A 1 58 ? 2.783   3.885   3.399   1.00 0.00 ? 58 LYS A HE3  8  
ATOM 8729  H HZ1  . LYS A 1 58 ? 4.534   4.903   2.422   1.00 0.00 ? 58 LYS A HZ1  8  
ATOM 8730  H HZ2  . LYS A 1 58 ? 3.595   4.690   1.032   1.00 0.00 ? 58 LYS A HZ2  8  
ATOM 8731  H HZ3  . LYS A 1 58 ? 4.861   3.620   1.369   1.00 0.00 ? 58 LYS A HZ3  8  
ATOM 8732  N N    . ARG A 1 59 ? 6.815   -2.270  3.245   1.00 0.00 ? 59 ARG A N    8  
ATOM 8733  C CA   . ARG A 1 59 ? 7.596   -3.009  4.230   1.00 0.00 ? 59 ARG A CA   8  
ATOM 8734  C C    . ARG A 1 59 ? 9.075   -2.643  4.136   1.00 0.00 ? 59 ARG A C    8  
ATOM 8735  O O    . ARG A 1 59 ? 9.719   -2.357  5.145   1.00 0.00 ? 59 ARG A O    8  
ATOM 8736  C CB   . ARG A 1 59 ? 7.419   -4.515  4.028   1.00 0.00 ? 59 ARG A CB   8  
ATOM 8737  C CG   . ARG A 1 59 ? 6.188   -5.081  4.716   1.00 0.00 ? 59 ARG A CG   8  
ATOM 8738  C CD   . ARG A 1 59 ? 6.125   -6.595  4.589   1.00 0.00 ? 59 ARG A CD   8  
ATOM 8739  N NE   . ARG A 1 59 ? 7.291   -7.243  5.184   1.00 0.00 ? 59 ARG A NE   8  
ATOM 8740  C CZ   . ARG A 1 59 ? 8.440   -7.424  4.541   1.00 0.00 ? 59 ARG A CZ   8  
ATOM 8741  N NH1  . ARG A 1 59 ? 8.576   -7.007  3.290   1.00 0.00 ? 59 ARG A NH1  8  
ATOM 8742  N NH2  . ARG A 1 59 ? 9.455   -8.022  5.151   1.00 0.00 ? 59 ARG A NH2  8  
ATOM 8743  H H    . ARG A 1 59 ? 6.244   -2.765  2.620   1.00 0.00 ? 59 ARG A H    8  
ATOM 8744  H HA   . ARG A 1 59 ? 7.233   -2.741  5.210   1.00 0.00 ? 59 ARG A HA   8  
ATOM 8745  H HB2  . ARG A 1 59 ? 7.338   -4.717  2.970   1.00 0.00 ? 59 ARG A HB2  8  
ATOM 8746  H HB3  . ARG A 1 59 ? 8.288   -5.023  4.417   1.00 0.00 ? 59 ARG A HB3  8  
ATOM 8747  H HG2  . ARG A 1 59 ? 6.221   -4.820  5.764   1.00 0.00 ? 59 ARG A HG2  8  
ATOM 8748  H HG3  . ARG A 1 59 ? 5.306   -4.653  4.264   1.00 0.00 ? 59 ARG A HG3  8  
ATOM 8749  H HD2  . ARG A 1 59 ? 5.235   -6.948  5.088   1.00 0.00 ? 59 ARG A HD2  8  
ATOM 8750  H HD3  . ARG A 1 59 ? 6.077   -6.853  3.541   1.00 0.00 ? 59 ARG A HD3  8  
ATOM 8751  H HE   . ARG A 1 59 ? 7.212   -7.559  6.108   1.00 0.00 ? 59 ARG A HE   8  
ATOM 8752  H HH11 . ARG A 1 59 ? 7.812   -6.554  2.829   1.00 0.00 ? 59 ARG A HH11 8  
ATOM 8753  H HH12 . ARG A 1 59 ? 9.442   -7.143  2.809   1.00 0.00 ? 59 ARG A HH12 8  
ATOM 8754  H HH21 . ARG A 1 59 ? 9.356   -8.337  6.094   1.00 0.00 ? 59 ARG A HH21 8  
ATOM 8755  H HH22 . ARG A 1 59 ? 10.319  -8.157  4.666   1.00 0.00 ? 59 ARG A HH22 8  
ATOM 8756  N N    . SER A 1 60 ? 9.606   -2.654  2.917   1.00 0.00 ? 60 SER A N    8  
ATOM 8757  C CA   . SER A 1 60 ? 11.009  -2.328  2.692   1.00 0.00 ? 60 SER A CA   8  
ATOM 8758  C C    . SER A 1 60 ? 11.343  -0.949  3.254   1.00 0.00 ? 60 SER A C    8  
ATOM 8759  O O    . SER A 1 60 ? 12.452  -0.713  3.733   1.00 0.00 ? 60 SER A O    8  
ATOM 8760  C CB   . SER A 1 60 ? 11.331  -2.373  1.197   1.00 0.00 ? 60 SER A CB   8  
ATOM 8761  O OG   . SER A 1 60 ? 11.250  -3.697  0.698   1.00 0.00 ? 60 SER A OG   8  
ATOM 8762  H H    . SER A 1 60 ? 9.041   -2.891  2.152   1.00 0.00 ? 60 SER A H    8  
ATOM 8763  H HA   . SER A 1 60 ? 11.608  -3.067  3.203   1.00 0.00 ? 60 SER A HA   8  
ATOM 8764  H HB2  . SER A 1 60 ? 10.628  -1.755  0.661   1.00 0.00 ? 60 SER A HB2  8  
ATOM 8765  H HB3  . SER A 1 60 ? 12.333  -2.001  1.036   1.00 0.00 ? 60 SER A HB3  8  
ATOM 8766  H HG   . SER A 1 60 ? 11.974  -3.854  0.087   1.00 0.00 ? 60 SER A HG   8  
ATOM 8767  N N    . LYS A 1 61 ? 10.375  -0.042  3.192   1.00 0.00 ? 61 LYS A N    8  
ATOM 8768  C CA   . LYS A 1 61 ? 10.563  1.314   3.695   1.00 0.00 ? 61 LYS A CA   8  
ATOM 8769  C C    . LYS A 1 61 ? 10.735  1.313   5.211   1.00 0.00 ? 61 LYS A C    8  
ATOM 8770  O O    . LYS A 1 61 ? 11.551  2.059   5.753   1.00 0.00 ? 61 LYS A O    8  
ATOM 8771  C CB   . LYS A 1 61 ? 9.373   2.194   3.306   1.00 0.00 ? 61 LYS A CB   8  
ATOM 8772  C CG   . LYS A 1 61 ? 9.729   3.661   3.142   1.00 0.00 ? 61 LYS A CG   8  
ATOM 8773  C CD   . LYS A 1 61 ? 8.754   4.372   2.219   1.00 0.00 ? 61 LYS A CD   8  
ATOM 8774  C CE   . LYS A 1 61 ? 8.988   5.875   2.212   1.00 0.00 ? 61 LYS A CE   8  
ATOM 8775  N NZ   . LYS A 1 61 ? 8.463   6.524   3.445   1.00 0.00 ? 61 LYS A NZ   8  
ATOM 8776  H H    . LYS A 1 61 ? 9.512   -0.290  2.798   1.00 0.00 ? 61 LYS A H    8  
ATOM 8777  H HA   . LYS A 1 61 ? 11.458  1.714   3.244   1.00 0.00 ? 61 LYS A HA   8  
ATOM 8778  H HB2  . LYS A 1 61 ? 8.967   1.837   2.372   1.00 0.00 ? 61 LYS A HB2  8  
ATOM 8779  H HB3  . LYS A 1 61 ? 8.615   2.113   4.073   1.00 0.00 ? 61 LYS A HB3  8  
ATOM 8780  H HG2  . LYS A 1 61 ? 9.705   4.139   4.110   1.00 0.00 ? 61 LYS A HG2  8  
ATOM 8781  H HG3  . LYS A 1 61 ? 10.724  3.736   2.727   1.00 0.00 ? 61 LYS A HG3  8  
ATOM 8782  H HD2  . LYS A 1 61 ? 8.882   3.995   1.215   1.00 0.00 ? 61 LYS A HD2  8  
ATOM 8783  H HD3  . LYS A 1 61 ? 7.746   4.175   2.554   1.00 0.00 ? 61 LYS A HD3  8  
ATOM 8784  H HE2  . LYS A 1 61 ? 10.049  6.061   2.141   1.00 0.00 ? 61 LYS A HE2  8  
ATOM 8785  H HE3  . LYS A 1 61 ? 8.490   6.299   1.352   1.00 0.00 ? 61 LYS A HE3  8  
ATOM 8786  H HZ1  . LYS A 1 61 ? 8.215   5.801   4.151   1.00 0.00 ? 61 LYS A HZ1  8  
ATOM 8787  H HZ2  . LYS A 1 61 ? 7.613   7.080   3.222   1.00 0.00 ? 61 LYS A HZ2  8  
ATOM 8788  H HZ3  . LYS A 1 61 ? 9.182   7.156   3.850   1.00 0.00 ? 61 LYS A HZ3  8  
ATOM 8789  N N    . ILE A 1 62 ? 9.962   0.470   5.888   1.00 0.00 ? 62 ILE A N    8  
ATOM 8790  C CA   . ILE A 1 62 ? 10.032  0.371   7.341   1.00 0.00 ? 62 ILE A CA   8  
ATOM 8791  C C    . ILE A 1 62 ? 11.478  0.292   7.818   1.00 0.00 ? 62 ILE A C    8  
ATOM 8792  O O    . ILE A 1 62 ? 12.077  -0.783  7.844   1.00 0.00 ? 62 ILE A O    8  
ATOM 8793  C CB   . ILE A 1 62 ? 9.264   -0.860  7.858   1.00 0.00 ? 62 ILE A CB   8  
ATOM 8794  C CG1  . ILE A 1 62 ? 7.809   -0.815  7.388   1.00 0.00 ? 62 ILE A CG1  8  
ATOM 8795  C CG2  . ILE A 1 62 ? 9.334   -0.928  9.377   1.00 0.00 ? 62 ILE A CG2  8  
ATOM 8796  C CD1  . ILE A 1 62 ? 6.945   -1.901  7.992   1.00 0.00 ? 62 ILE A CD1  8  
ATOM 8797  H H    . ILE A 1 62 ? 9.332   -0.098  5.400   1.00 0.00 ? 62 ILE A H    8  
ATOM 8798  H HA   . ILE A 1 62 ? 9.574   1.257   7.757   1.00 0.00 ? 62 ILE A HA   8  
ATOM 8799  H HB   . ILE A 1 62 ? 9.737   -1.745  7.460   1.00 0.00 ? 62 ILE A HB   8  
ATOM 8800  H HG12 . ILE A 1 62 ? 7.379   0.137   7.656   1.00 0.00 ? 62 ILE A HG12 8  
ATOM 8801  H HG13 . ILE A 1 62 ? 7.782   -0.928  6.314   1.00 0.00 ? 62 ILE A HG13 8  
ATOM 8802  H HG21 . ILE A 1 62 ? 9.825   -0.043  9.754   1.00 0.00 ? 62 ILE A HG21 8  
ATOM 8803  H HG22 . ILE A 1 62 ? 8.334   -0.984  9.780   1.00 0.00 ? 62 ILE A HG22 8  
ATOM 8804  H HG23 . ILE A 1 62 ? 9.892   -1.803  9.673   1.00 0.00 ? 62 ILE A HG23 8  
ATOM 8805  H HD11 . ILE A 1 62 ? 7.564   -2.741  8.270   1.00 0.00 ? 62 ILE A HD11 8  
ATOM 8806  H HD12 . ILE A 1 62 ? 6.443   -1.517  8.867   1.00 0.00 ? 62 ILE A HD12 8  
ATOM 8807  H HD13 . ILE A 1 62 ? 6.211   -2.221  7.267   1.00 0.00 ? 62 ILE A HD13 8  
ATOM 8808  N N    . LYS A 1 63 ? 12.033  1.438   8.198   1.00 0.00 ? 63 LYS A N    8  
ATOM 8809  C CA   . LYS A 1 63 ? 13.408  1.500   8.678   1.00 0.00 ? 63 LYS A CA   8  
ATOM 8810  C C    . LYS A 1 63 ? 13.555  0.765   10.006  1.00 0.00 ? 63 LYS A C    8  
ATOM 8811  O O    . LYS A 1 63 ? 14.408  -0.110  10.153  1.00 0.00 ? 63 LYS A O    8  
ATOM 8812  C CB   . LYS A 1 63 ? 13.849  2.957   8.838   1.00 0.00 ? 63 LYS A CB   8  
ATOM 8813  C CG   . LYS A 1 63 ? 14.438  3.557   7.574   1.00 0.00 ? 63 LYS A CG   8  
ATOM 8814  C CD   . LYS A 1 63 ? 14.480  5.074   7.643   1.00 0.00 ? 63 LYS A CD   8  
ATOM 8815  C CE   . LYS A 1 63 ? 13.189  5.692   7.129   1.00 0.00 ? 63 LYS A CE   8  
ATOM 8816  N NZ   . LYS A 1 63 ? 13.395  7.085   6.645   1.00 0.00 ? 63 LYS A NZ   8  
ATOM 8817  H H    . LYS A 1 63 ? 11.504  2.263   8.155   1.00 0.00 ? 63 LYS A H    8  
ATOM 8818  H HA   . LYS A 1 63 ? 14.038  1.021   7.944   1.00 0.00 ? 63 LYS A HA   8  
ATOM 8819  H HB2  . LYS A 1 63 ? 12.994  3.550   9.128   1.00 0.00 ? 63 LYS A HB2  8  
ATOM 8820  H HB3  . LYS A 1 63 ? 14.595  3.011   9.619   1.00 0.00 ? 63 LYS A HB3  8  
ATOM 8821  H HG2  . LYS A 1 63 ? 15.444  3.186   7.444   1.00 0.00 ? 63 LYS A HG2  8  
ATOM 8822  H HG3  . LYS A 1 63 ? 13.832  3.261   6.729   1.00 0.00 ? 63 LYS A HG3  8  
ATOM 8823  H HD2  . LYS A 1 63 ? 14.626  5.375   8.670   1.00 0.00 ? 63 LYS A HD2  8  
ATOM 8824  H HD3  . LYS A 1 63 ? 15.304  5.431   7.041   1.00 0.00 ? 63 LYS A HD3  8  
ATOM 8825  H HE2  . LYS A 1 63 ? 12.815  5.089   6.316   1.00 0.00 ? 63 LYS A HE2  8  
ATOM 8826  H HE3  . LYS A 1 63 ? 12.466  5.702   7.931   1.00 0.00 ? 63 LYS A HE3  8  
ATOM 8827  H HZ1  . LYS A 1 63 ? 13.844  7.658   7.387   1.00 0.00 ? 63 LYS A HZ1  8  
ATOM 8828  H HZ2  . LYS A 1 63 ? 12.481  7.516   6.396   1.00 0.00 ? 63 LYS A HZ2  8  
ATOM 8829  H HZ3  . LYS A 1 63 ? 14.006  7.085   5.804   1.00 0.00 ? 63 LYS A HZ3  8  
ATOM 8830  N N    . LYS A 1 64 ? 12.716  1.125   10.972  1.00 0.00 ? 64 LYS A N    8  
ATOM 8831  C CA   . LYS A 1 64 ? 12.749  0.498   12.288  1.00 0.00 ? 64 LYS A CA   8  
ATOM 8832  C C    . LYS A 1 64 ? 12.281  -0.952  12.212  1.00 0.00 ? 64 LYS A C    8  
ATOM 8833  O O    . LYS A 1 64 ? 11.825  -1.413  11.165  1.00 0.00 ? 64 LYS A O    8  
ATOM 8834  C CB   . LYS A 1 64 ? 11.872  1.278   13.270  1.00 0.00 ? 64 LYS A CB   8  
ATOM 8835  C CG   . LYS A 1 64 ? 10.435  1.439   12.805  1.00 0.00 ? 64 LYS A CG   8  
ATOM 8836  C CD   . LYS A 1 64 ? 9.651   2.359   13.726  1.00 0.00 ? 64 LYS A CD   8  
ATOM 8837  C CE   . LYS A 1 64 ? 8.229   2.566   13.228  1.00 0.00 ? 64 LYS A CE   8  
ATOM 8838  N NZ   . LYS A 1 64 ? 8.186   3.427   12.014  1.00 0.00 ? 64 LYS A NZ   8  
ATOM 8839  H H    . LYS A 1 64 ? 12.057  1.829   10.795  1.00 0.00 ? 64 LYS A H    8  
ATOM 8840  H HA   . LYS A 1 64 ? 13.770  0.516   12.638  1.00 0.00 ? 64 LYS A HA   8  
ATOM 8841  H HB2  . LYS A 1 64 ? 11.866  0.761   14.218  1.00 0.00 ? 64 LYS A HB2  8  
ATOM 8842  H HB3  . LYS A 1 64 ? 12.295  2.262   13.409  1.00 0.00 ? 64 LYS A HB3  8  
ATOM 8843  H HG2  . LYS A 1 64 ? 10.432  1.856   11.810  1.00 0.00 ? 64 LYS A HG2  8  
ATOM 8844  H HG3  . LYS A 1 64 ? 9.959   0.468   12.792  1.00 0.00 ? 64 LYS A HG3  8  
ATOM 8845  H HD2  . LYS A 1 64 ? 9.614   1.921   14.713  1.00 0.00 ? 64 LYS A HD2  8  
ATOM 8846  H HD3  . LYS A 1 64 ? 10.150  3.316   13.774  1.00 0.00 ? 64 LYS A HD3  8  
ATOM 8847  H HE2  . LYS A 1 64 ? 7.800   1.604   12.992  1.00 0.00 ? 64 LYS A HE2  8  
ATOM 8848  H HE3  . LYS A 1 64 ? 7.652   3.035   14.012  1.00 0.00 ? 64 LYS A HE3  8  
ATOM 8849  H HZ1  . LYS A 1 64 ? 8.670   2.954   11.224  1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 8850  H HZ2  . LYS A 1 64 ? 8.660   4.334   12.202  1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 8851  H HZ3  . LYS A 1 64 ? 7.200   3.613   11.741  1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 8852  N N    . SER A 1 65 ? 12.394  -1.665  13.328  1.00 0.00 ? 65 SER A N    8  
ATOM 8853  C CA   . SER A 1 65 ? 11.984  -3.063  13.386  1.00 0.00 ? 65 SER A CA   8  
ATOM 8854  C C    . SER A 1 65 ? 10.645  -3.207  14.103  1.00 0.00 ? 65 SER A C    8  
ATOM 8855  O O    . SER A 1 65 ? 10.270  -2.365  14.917  1.00 0.00 ? 65 SER A O    8  
ATOM 8856  C CB   . SER A 1 65 ? 13.049  -3.900  14.099  1.00 0.00 ? 65 SER A CB   8  
ATOM 8857  O OG   . SER A 1 65 ? 14.188  -4.082  13.276  1.00 0.00 ? 65 SER A OG   8  
ATOM 8858  H H    . SER A 1 65 ? 12.765  -1.241  14.130  1.00 0.00 ? 65 SER A H    8  
ATOM 8859  H HA   . SER A 1 65 ? 11.877  -3.420  12.373  1.00 0.00 ? 65 SER A HA   8  
ATOM 8860  H HB2  . SER A 1 65 ? 13.351  -3.397  15.005  1.00 0.00 ? 65 SER A HB2  8  
ATOM 8861  H HB3  . SER A 1 65 ? 12.638  -4.868  14.344  1.00 0.00 ? 65 SER A HB3  8  
ATOM 8862  H HG   . SER A 1 65 ? 14.332  -3.294  12.748  1.00 0.00 ? 65 SER A HG   8  
ATOM 8863  N N    . GLY A 1 66 ? 9.927   -4.283  13.793  1.00 0.00 ? 66 GLY A N    8  
ATOM 8864  C CA   . GLY A 1 66 ? 8.638   -4.519  14.415  1.00 0.00 ? 66 GLY A CA   8  
ATOM 8865  C C    . GLY A 1 66 ? 8.380   -5.989  14.676  1.00 0.00 ? 66 GLY A C    8  
ATOM 8866  O O    . GLY A 1 66 ? 8.790   -6.541  15.698  1.00 0.00 ? 66 GLY A O    8  
ATOM 8867  H H    . GLY A 1 66 ? 10.276  -4.921  13.136  1.00 0.00 ? 66 GLY A H    8  
ATOM 8868  H HA2  . GLY A 1 66 ? 8.599   -3.985  15.352  1.00 0.00 ? 66 GLY A HA2  8  
ATOM 8869  H HA3  . GLY A 1 66 ? 7.863   -4.140  13.765  1.00 0.00 ? 66 GLY A HA3  8  
ATOM 8870  N N    . PRO A 1 67 ? 7.684   -6.648  13.738  1.00 0.00 ? 67 PRO A N    8  
ATOM 8871  C CA   . PRO A 1 67 ? 7.356   -8.073  13.851  1.00 0.00 ? 67 PRO A CA   8  
ATOM 8872  C C    . PRO A 1 67 ? 8.585   -8.964  13.704  1.00 0.00 ? 67 PRO A C    8  
ATOM 8873  O O    . PRO A 1 67 ? 8.526   -10.166 13.963  1.00 0.00 ? 67 PRO A O    8  
ATOM 8874  C CB   . PRO A 1 67 ? 6.385   -8.305  12.690  1.00 0.00 ? 67 PRO A CB   8  
ATOM 8875  C CG   . PRO A 1 67 ? 6.723   -7.248  11.696  1.00 0.00 ? 67 PRO A CG   8  
ATOM 8876  C CD   . PRO A 1 67 ? 7.164   -6.054  12.496  1.00 0.00 ? 67 PRO A CD   8  
ATOM 8877  H HA   . PRO A 1 67 ? 6.862   -8.293  14.786  1.00 0.00 ? 67 PRO A HA   8  
ATOM 8878  H HB2  . PRO A 1 67 ? 6.538   -9.295  12.283  1.00 0.00 ? 67 PRO A HB2  8  
ATOM 8879  H HB3  . PRO A 1 67 ? 5.369   -8.207  13.041  1.00 0.00 ? 67 PRO A HB3  8  
ATOM 8880  H HG2  . PRO A 1 67 ? 7.523   -7.588  11.056  1.00 0.00 ? 67 PRO A HG2  8  
ATOM 8881  H HG3  . PRO A 1 67 ? 5.849   -7.005  11.110  1.00 0.00 ? 67 PRO A HG3  8  
ATOM 8882  H HD2  . PRO A 1 67 ? 7.940   -5.515  11.972  1.00 0.00 ? 67 PRO A HD2  8  
ATOM 8883  H HD3  . PRO A 1 67 ? 6.324   -5.406  12.701  1.00 0.00 ? 67 PRO A HD3  8  
ATOM 8884  N N    . SER A 1 68 ? 9.697   -8.367  13.288  1.00 0.00 ? 68 SER A N    8  
ATOM 8885  C CA   . SER A 1 68 ? 10.939  -9.108  13.104  1.00 0.00 ? 68 SER A CA   8  
ATOM 8886  C C    . SER A 1 68 ? 11.969  -8.713  14.159  1.00 0.00 ? 68 SER A C    8  
ATOM 8887  O O    . SER A 1 68 ? 11.872  -7.648  14.768  1.00 0.00 ? 68 SER A O    8  
ATOM 8888  C CB   . SER A 1 68 ? 11.504  -8.858  11.705  1.00 0.00 ? 68 SER A CB   8  
ATOM 8889  O OG   . SER A 1 68 ? 12.747  -9.516  11.532  1.00 0.00 ? 68 SER A OG   8  
ATOM 8890  H H    . SER A 1 68 ? 9.680   -7.405  13.098  1.00 0.00 ? 68 SER A H    8  
ATOM 8891  H HA   . SER A 1 68 ? 10.717  -10.159 13.211  1.00 0.00 ? 68 SER A HA   8  
ATOM 8892  H HB2  . SER A 1 68 ? 10.809  -9.229  10.967  1.00 0.00 ? 68 SER A HB2  8  
ATOM 8893  H HB3  . SER A 1 68 ? 11.649  -7.797  11.562  1.00 0.00 ? 68 SER A HB3  8  
ATOM 8894  H HG   . SER A 1 68 ? 13.456  -8.948  11.843  1.00 0.00 ? 68 SER A HG   8  
ATOM 8895  N N    . SER A 1 69 ? 12.955  -9.579  14.368  1.00 0.00 ? 69 SER A N    8  
ATOM 8896  C CA   . SER A 1 69 ? 14.001  -9.323  15.351  1.00 0.00 ? 69 SER A CA   8  
ATOM 8897  C C    . SER A 1 69 ? 15.279  -10.077 14.993  1.00 0.00 ? 69 SER A C    8  
ATOM 8898  O O    . SER A 1 69 ? 15.233  -11.151 14.394  1.00 0.00 ? 69 SER A O    8  
ATOM 8899  C CB   . SER A 1 69 ? 13.529  -9.732  16.747  1.00 0.00 ? 69 SER A CB   8  
ATOM 8900  O OG   . SER A 1 69 ? 14.327  -9.130  17.752  1.00 0.00 ? 69 SER A OG   8  
ATOM 8901  H H    . SER A 1 69 ? 12.977  -10.411 13.850  1.00 0.00 ? 69 SER A H    8  
ATOM 8902  H HA   . SER A 1 69 ? 14.209  -8.264  15.346  1.00 0.00 ? 69 SER A HA   8  
ATOM 8903  H HB2  . SER A 1 69 ? 12.505  -9.421  16.884  1.00 0.00 ? 69 SER A HB2  8  
ATOM 8904  H HB3  . SER A 1 69 ? 13.595  -10.806 16.847  1.00 0.00 ? 69 SER A HB3  8  
ATOM 8905  H HG   . SER A 1 69 ? 13.771  -8.875  18.492  1.00 0.00 ? 69 SER A HG   8  
ATOM 8906  N N    . GLY A 1 70 ? 16.420  -9.504  15.364  1.00 0.00 ? 70 GLY A N    8  
ATOM 8907  C CA   . GLY A 1 70 ? 17.695  -10.134 15.074  1.00 0.00 ? 70 GLY A CA   8  
ATOM 8908  C C    . GLY A 1 70 ? 18.808  -9.124  14.876  1.00 0.00 ? 70 GLY A C    8  
ATOM 8909  O O    . GLY A 1 70 ? 19.987  -9.474  14.924  1.00 0.00 ? 70 GLY A O    8  
ATOM 8910  H H    . GLY A 1 70 ? 16.396  -8.647  15.839  1.00 0.00 ? 70 GLY A H    8  
ATOM 8911  H HA2  . GLY A 1 70 ? 17.956  -10.787 15.893  1.00 0.00 ? 70 GLY A HA2  8  
ATOM 8912  H HA3  . GLY A 1 70 ? 17.595  -10.723 14.174  1.00 0.00 ? 70 GLY A HA3  8  
ATOM 8913  N N    . GLY A 1 1  ? 20.607  20.608  -1.418  1.00 0.00 ? 1  GLY A N    9  
ATOM 8914  C CA   . GLY A 1 1  ? 20.268  19.219  -1.668  1.00 0.00 ? 1  GLY A CA   9  
ATOM 8915  C C    . GLY A 1 1  ? 19.382  19.049  -2.886  1.00 0.00 ? 1  GLY A C    9  
ATOM 8916  O O    . GLY A 1 1  ? 18.232  19.489  -2.892  1.00 0.00 ? 1  GLY A O    9  
ATOM 8917  H H1   . GLY A 1 1  ? 21.544  20.895  -1.448  1.00 0.00 ? 1  GLY A H1   9  
ATOM 8918  H HA2  . GLY A 1 1  ? 21.178  18.659  -1.817  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 8919  H HA3  . GLY A 1 1  ? 19.751  18.826  -0.804  1.00 0.00 ? 1  GLY A HA3  9  
ATOM 8920  N N    . SER A 1 2  ? 19.918  18.411  -3.921  1.00 0.00 ? 2  SER A N    9  
ATOM 8921  C CA   . SER A 1 2  ? 19.170  18.189  -5.153  1.00 0.00 ? 2  SER A CA   9  
ATOM 8922  C C    . SER A 1 2  ? 19.232  16.722  -5.569  1.00 0.00 ? 2  SER A C    9  
ATOM 8923  O O    . SER A 1 2  ? 19.379  16.406  -6.750  1.00 0.00 ? 2  SER A O    9  
ATOM 8924  C CB   . SER A 1 2  ? 19.720  19.072  -6.275  1.00 0.00 ? 2  SER A CB   9  
ATOM 8925  O OG   . SER A 1 2  ? 19.102  20.347  -6.269  1.00 0.00 ? 2  SER A OG   9  
ATOM 8926  H H    . SER A 1 2  ? 20.840  18.084  -3.856  1.00 0.00 ? 2  SER A H    9  
ATOM 8927  H HA   . SER A 1 2  ? 18.140  18.456  -4.969  1.00 0.00 ? 2  SER A HA   9  
ATOM 8928  H HB2  . SER A 1 2  ? 20.783  19.200  -6.141  1.00 0.00 ? 2  SER A HB2  9  
ATOM 8929  H HB3  . SER A 1 2  ? 19.532  18.598  -7.228  1.00 0.00 ? 2  SER A HB3  9  
ATOM 8930  H HG   . SER A 1 2  ? 18.847  20.576  -5.372  1.00 0.00 ? 2  SER A HG   9  
ATOM 8931  N N    . SER A 1 3  ? 19.118  15.831  -4.590  1.00 0.00 ? 3  SER A N    9  
ATOM 8932  C CA   . SER A 1 3  ? 19.164  14.397  -4.852  1.00 0.00 ? 3  SER A CA   9  
ATOM 8933  C C    . SER A 1 3  ? 17.862  13.918  -5.486  1.00 0.00 ? 3  SER A C    9  
ATOM 8934  O O    . SER A 1 3  ? 17.869  13.270  -6.532  1.00 0.00 ? 3  SER A O    9  
ATOM 8935  C CB   . SER A 1 3  ? 19.426  13.628  -3.556  1.00 0.00 ? 3  SER A CB   9  
ATOM 8936  O OG   . SER A 1 3  ? 19.801  12.288  -3.824  1.00 0.00 ? 3  SER A OG   9  
ATOM 8937  H H    . SER A 1 3  ? 19.002  16.145  -3.669  1.00 0.00 ? 3  SER A H    9  
ATOM 8938  H HA   . SER A 1 3  ? 19.975  14.212  -5.540  1.00 0.00 ? 3  SER A HA   9  
ATOM 8939  H HB2  . SER A 1 3  ? 20.222  14.110  -3.009  1.00 0.00 ? 3  SER A HB2  9  
ATOM 8940  H HB3  . SER A 1 3  ? 18.528  13.625  -2.955  1.00 0.00 ? 3  SER A HB3  9  
ATOM 8941  H HG   . SER A 1 3  ? 19.429  12.014  -4.665  1.00 0.00 ? 3  SER A HG   9  
ATOM 8942  N N    . GLY A 1 4  ? 16.744  14.244  -4.845  1.00 0.00 ? 4  GLY A N    9  
ATOM 8943  C CA   . GLY A 1 4  ? 15.448  13.840  -5.360  1.00 0.00 ? 4  GLY A CA   9  
ATOM 8944  C C    . GLY A 1 4  ? 14.496  15.009  -5.516  1.00 0.00 ? 4  GLY A C    9  
ATOM 8945  O O    . GLY A 1 4  ? 14.905  16.167  -5.435  1.00 0.00 ? 4  GLY A O    9  
ATOM 8946  H H    . GLY A 1 4  ? 16.799  14.763  -4.015  1.00 0.00 ? 4  GLY A H    9  
ATOM 8947  H HA2  . GLY A 1 4  ? 15.586  13.371  -6.323  1.00 0.00 ? 4  GLY A HA2  9  
ATOM 8948  H HA3  . GLY A 1 4  ? 15.011  13.123  -4.680  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 8949  N N    . SER A 1 5  ? 13.221  14.706  -5.741  1.00 0.00 ? 5  SER A N    9  
ATOM 8950  C CA   . SER A 1 5  ? 12.209  15.741  -5.914  1.00 0.00 ? 5  SER A CA   9  
ATOM 8951  C C    . SER A 1 5  ? 11.309  15.831  -4.686  1.00 0.00 ? 5  SER A C    9  
ATOM 8952  O O    . SER A 1 5  ? 11.085  16.913  -4.144  1.00 0.00 ? 5  SER A O    9  
ATOM 8953  C CB   . SER A 1 5  ? 11.365  15.456  -7.159  1.00 0.00 ? 5  SER A CB   9  
ATOM 8954  O OG   . SER A 1 5  ? 10.853  16.655  -7.713  1.00 0.00 ? 5  SER A OG   9  
ATOM 8955  H H    . SER A 1 5  ? 12.957  13.763  -5.795  1.00 0.00 ? 5  SER A H    9  
ATOM 8956  H HA   . SER A 1 5  ? 12.718  16.684  -6.043  1.00 0.00 ? 5  SER A HA   9  
ATOM 8957  H HB2  . SER A 1 5  ? 11.976  14.963  -7.899  1.00 0.00 ? 5  SER A HB2  9  
ATOM 8958  H HB3  . SER A 1 5  ? 10.538  14.815  -6.890  1.00 0.00 ? 5  SER A HB3  9  
ATOM 8959  H HG   . SER A 1 5  ? 10.130  16.449  -8.309  1.00 0.00 ? 5  SER A HG   9  
ATOM 8960  N N    . SER A 1 6  ? 10.795  14.684  -4.251  1.00 0.00 ? 6  SER A N    9  
ATOM 8961  C CA   . SER A 1 6  ? 9.915   14.633  -3.089  1.00 0.00 ? 6  SER A CA   9  
ATOM 8962  C C    . SER A 1 6  ? 8.579   15.305  -3.389  1.00 0.00 ? 6  SER A C    9  
ATOM 8963  O O    . SER A 1 6  ? 8.042   16.040  -2.561  1.00 0.00 ? 6  SER A O    9  
ATOM 8964  C CB   . SER A 1 6  ? 10.581  15.308  -1.889  1.00 0.00 ? 6  SER A CB   9  
ATOM 8965  O OG   . SER A 1 6  ? 9.899   14.998  -0.686  1.00 0.00 ? 6  SER A OG   9  
ATOM 8966  H H    . SER A 1 6  ? 11.010  13.854  -4.726  1.00 0.00 ? 6  SER A H    9  
ATOM 8967  H HA   . SER A 1 6  ? 9.738   13.594  -2.854  1.00 0.00 ? 6  SER A HA   9  
ATOM 8968  H HB2  . SER A 1 6  ? 11.602  14.968  -1.808  1.00 0.00 ? 6  SER A HB2  9  
ATOM 8969  H HB3  . SER A 1 6  ? 10.569  16.380  -2.030  1.00 0.00 ? 6  SER A HB3  9  
ATOM 8970  H HG   . SER A 1 6  ? 8.977   14.817  -0.878  1.00 0.00 ? 6  SER A HG   9  
ATOM 8971  N N    . GLY A 1 7  ? 8.048   15.047  -4.580  1.00 0.00 ? 7  GLY A N    9  
ATOM 8972  C CA   . GLY A 1 7  ? 6.779   15.634  -4.969  1.00 0.00 ? 7  GLY A CA   9  
ATOM 8973  C C    . GLY A 1 7  ? 6.718   15.954  -6.450  1.00 0.00 ? 7  GLY A C    9  
ATOM 8974  O O    . GLY A 1 7  ? 6.393   17.077  -6.836  1.00 0.00 ? 7  GLY A O    9  
ATOM 8975  H H    . GLY A 1 7  ? 8.521   14.453  -5.200  1.00 0.00 ? 7  GLY A H    9  
ATOM 8976  H HA2  . GLY A 1 7  ? 5.985   14.943  -4.728  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 8977  H HA3  . GLY A 1 7  ? 6.631   16.546  -4.410  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 8978  N N    . ARG A 1 8  ? 7.032   14.965  -7.280  1.00 0.00 ? 8  ARG A N    9  
ATOM 8979  C CA   . ARG A 1 8  ? 7.014   15.148  -8.727  1.00 0.00 ? 8  ARG A CA   9  
ATOM 8980  C C    . ARG A 1 8  ? 5.614   15.515  -9.211  1.00 0.00 ? 8  ARG A C    9  
ATOM 8981  O O    . ARG A 1 8  ? 5.410   16.570  -9.812  1.00 0.00 ? 8  ARG A O    9  
ATOM 8982  C CB   . ARG A 1 8  ? 7.491   13.875  -9.429  1.00 0.00 ? 8  ARG A CB   9  
ATOM 8983  C CG   . ARG A 1 8  ? 8.157   14.133  -10.770 1.00 0.00 ? 8  ARG A CG   9  
ATOM 8984  C CD   . ARG A 1 8  ? 9.626   14.492  -10.603 1.00 0.00 ? 8  ARG A CD   9  
ATOM 8985  N NE   . ARG A 1 8  ? 10.258  14.819  -11.878 1.00 0.00 ? 8  ARG A NE   9  
ATOM 8986  C CZ   . ARG A 1 8  ? 11.573  14.904  -12.046 1.00 0.00 ? 8  ARG A CZ   9  
ATOM 8987  N NH1  . ARG A 1 8  ? 12.390  14.687  -11.025 1.00 0.00 ? 8  ARG A NH1  9  
ATOM 8988  N NH2  . ARG A 1 8  ? 12.072  15.206  -13.237 1.00 0.00 ? 8  ARG A NH2  9  
ATOM 8989  H H    . ARG A 1 8  ? 7.283   14.092  -6.912  1.00 0.00 ? 8  ARG A H    9  
ATOM 8990  H HA   . ARG A 1 8  ? 7.689   15.956  -8.968  1.00 0.00 ? 8  ARG A HA   9  
ATOM 8991  H HB2  . ARG A 1 8  ? 8.201   13.370  -8.790  1.00 0.00 ? 8  ARG A HB2  9  
ATOM 8992  H HB3  . ARG A 1 8  ? 6.642   13.229  -9.592  1.00 0.00 ? 8  ARG A HB3  9  
ATOM 8993  H HG2  . ARG A 1 8  ? 8.083   13.242  -11.376 1.00 0.00 ? 8  ARG A HG2  9  
ATOM 8994  H HG3  . ARG A 1 8  ? 7.650   14.949  -11.263 1.00 0.00 ? 8  ARG A HG3  9  
ATOM 8995  H HD2  . ARG A 1 8  ? 9.701   15.345  -9.946  1.00 0.00 ? 8  ARG A HD2  9  
ATOM 8996  H HD3  . ARG A 1 8  ? 10.140  13.651  -10.162 1.00 0.00 ? 8  ARG A HD3  9  
ATOM 8997  H HE   . ARG A 1 8  ? 9.672   14.983  -12.646 1.00 0.00 ? 8  ARG A HE   9  
ATOM 8998  H HH11 . ARG A 1 8  ? 12.016  14.458  -10.126 1.00 0.00 ? 8  ARG A HH11 9  
ATOM 8999  H HH12 . ARG A 1 8  ? 13.380  14.750  -11.154 1.00 0.00 ? 8  ARG A HH12 9  
ATOM 9000  H HH21 . ARG A 1 8  ? 11.459  15.371  -14.010 1.00 0.00 ? 8  ARG A HH21 9  
ATOM 9001  H HH22 . ARG A 1 8  ? 13.062  15.270  -13.363 1.00 0.00 ? 8  ARG A HH22 9  
ATOM 9002  N N    . LYS A 1 9  ? 4.653   14.637  -8.946  1.00 0.00 ? 9  LYS A N    9  
ATOM 9003  C CA   . LYS A 1 9  ? 3.272   14.867  -9.354  1.00 0.00 ? 9  LYS A CA   9  
ATOM 9004  C C    . LYS A 1 9  ? 2.491   15.577  -8.252  1.00 0.00 ? 9  LYS A C    9  
ATOM 9005  O O    . LYS A 1 9  ? 2.814   15.480  -7.068  1.00 0.00 ? 9  LYS A O    9  
ATOM 9006  C CB   . LYS A 1 9  ? 2.593   13.541  -9.702  1.00 0.00 ? 9  LYS A CB   9  
ATOM 9007  C CG   . LYS A 1 9  ? 2.915   13.041  -11.100 1.00 0.00 ? 9  LYS A CG   9  
ATOM 9008  C CD   . LYS A 1 9  ? 4.150   12.156  -11.105 1.00 0.00 ? 9  LYS A CD   9  
ATOM 9009  C CE   . LYS A 1 9  ? 3.802   10.713  -10.772 1.00 0.00 ? 9  LYS A CE   9  
ATOM 9010  N NZ   . LYS A 1 9  ? 3.381   9.951   -11.980 1.00 0.00 ? 9  LYS A NZ   9  
ATOM 9011  H H    . LYS A 1 9  ? 4.878   13.814  -8.464  1.00 0.00 ? 9  LYS A H    9  
ATOM 9012  H HA   . LYS A 1 9  ? 3.286   15.496  -10.231 1.00 0.00 ? 9  LYS A HA   9  
ATOM 9013  H HB2  . LYS A 1 9  ? 2.910   12.791  -8.992  1.00 0.00 ? 9  LYS A HB2  9  
ATOM 9014  H HB3  . LYS A 1 9  ? 1.523   13.667  -9.625  1.00 0.00 ? 9  LYS A HB3  9  
ATOM 9015  H HG2  . LYS A 1 9  ? 2.076   12.472  -11.471 1.00 0.00 ? 9  LYS A HG2  9  
ATOM 9016  H HG3  . LYS A 1 9  ? 3.090   13.891  -11.744 1.00 0.00 ? 9  LYS A HG3  9  
ATOM 9017  H HD2  . LYS A 1 9  ? 4.602   12.188  -12.085 1.00 0.00 ? 9  LYS A HD2  9  
ATOM 9018  H HD3  . LYS A 1 9  ? 4.851   12.527  -10.371 1.00 0.00 ? 9  LYS A HD3  9  
ATOM 9019  H HE2  . LYS A 1 9  ? 4.670   10.237  -10.342 1.00 0.00 ? 9  LYS A HE2  9  
ATOM 9020  H HE3  . LYS A 1 9  ? 2.996   10.707  -10.054 1.00 0.00 ? 9  LYS A HE3  9  
ATOM 9021  H HZ1  . LYS A 1 9  ? 2.572   9.338   -11.751 1.00 0.00 ? 9  LYS A HZ1  9  
ATOM 9022  H HZ2  . LYS A 1 9  ? 4.164   9.359   -12.320 1.00 0.00 ? 9  LYS A HZ2  9  
ATOM 9023  H HZ3  . LYS A 1 9  ? 3.102   10.607  -12.737 1.00 0.00 ? 9  LYS A HZ3  9  
ATOM 9024  N N    . PRO A 1 10 ? 1.437   16.306  -8.648  1.00 0.00 ? 10 PRO A N    9  
ATOM 9025  C CA   . PRO A 1 10 ? 0.587   17.043  -7.709  1.00 0.00 ? 10 PRO A CA   9  
ATOM 9026  C C    . PRO A 1 10 ? -0.256  16.117  -6.840  1.00 0.00 ? 10 PRO A C    9  
ATOM 9027  O O    . PRO A 1 10 ? -0.841  16.546  -5.845  1.00 0.00 ? 10 PRO A O    9  
ATOM 9028  C CB   . PRO A 1 10 ? -0.310  17.881  -8.624  1.00 0.00 ? 10 PRO A CB   9  
ATOM 9029  C CG   . PRO A 1 10 ? -0.350  17.126  -9.908  1.00 0.00 ? 10 PRO A CG   9  
ATOM 9030  C CD   . PRO A 1 10 ? 0.994   16.465  -10.043 1.00 0.00 ? 10 PRO A CD   9  
ATOM 9031  H HA   . PRO A 1 10 ? 1.169   17.697  -7.076  1.00 0.00 ? 10 PRO A HA   9  
ATOM 9032  H HB2  . PRO A 1 10 ? -1.294  17.969  -8.186  1.00 0.00 ? 10 PRO A HB2  9  
ATOM 9033  H HB3  . PRO A 1 10 ? 0.121   18.862  -8.757  1.00 0.00 ? 10 PRO A HB3  9  
ATOM 9034  H HG2  . PRO A 1 10 ? -1.132  16.382  -9.872  1.00 0.00 ? 10 PRO A HG2  9  
ATOM 9035  H HG3  . PRO A 1 10 ? -0.517  17.807  -10.729 1.00 0.00 ? 10 PRO A HG3  9  
ATOM 9036  H HD2  . PRO A 1 10 ? 0.896   15.506  -10.529 1.00 0.00 ? 10 PRO A HD2  9  
ATOM 9037  H HD3  . PRO A 1 10 ? 1.673   17.101  -10.592 1.00 0.00 ? 10 PRO A HD3  9  
ATOM 9038  N N    . ARG A 1 11 ? -0.314  14.845  -7.221  1.00 0.00 ? 11 ARG A N    9  
ATOM 9039  C CA   . ARG A 1 11 ? -1.086  13.858  -6.476  1.00 0.00 ? 11 ARG A CA   9  
ATOM 9040  C C    . ARG A 1 11 ? -0.223  12.654  -6.112  1.00 0.00 ? 11 ARG A C    9  
ATOM 9041  O O    . ARG A 1 11 ? 0.708   12.301  -6.837  1.00 0.00 ? 11 ARG A O    9  
ATOM 9042  C CB   . ARG A 1 11 ? -2.296  13.403  -7.294  1.00 0.00 ? 11 ARG A CB   9  
ATOM 9043  C CG   . ARG A 1 11 ? -1.926  12.719  -8.600  1.00 0.00 ? 11 ARG A CG   9  
ATOM 9044  C CD   . ARG A 1 11 ? -1.767  11.218  -8.416  1.00 0.00 ? 11 ARG A CD   9  
ATOM 9045  N NE   . ARG A 1 11 ? -3.032  10.570  -8.081  1.00 0.00 ? 11 ARG A NE   9  
ATOM 9046  C CZ   . ARG A 1 11 ? -3.965  10.271  -8.978  1.00 0.00 ? 11 ARG A CZ   9  
ATOM 9047  N NH1  . ARG A 1 11 ? -3.775  10.559  -10.258 1.00 0.00 ? 11 ARG A NH1  9  
ATOM 9048  N NH2  . ARG A 1 11 ? -5.091  9.682   -8.595  1.00 0.00 ? 11 ARG A NH2  9  
ATOM 9049  H H    . ARG A 1 11 ? 0.174   14.564  -8.023  1.00 0.00 ? 11 ARG A H    9  
ATOM 9050  H HA   . ARG A 1 11 ? -1.433  14.326  -5.567  1.00 0.00 ? 11 ARG A HA   9  
ATOM 9051  H HB2  . ARG A 1 11 ? -2.877  12.711  -6.702  1.00 0.00 ? 11 ARG A HB2  9  
ATOM 9052  H HB3  . ARG A 1 11 ? -2.904  14.265  -7.525  1.00 0.00 ? 11 ARG A HB3  9  
ATOM 9053  H HG2  . ARG A 1 11 ? -2.706  12.901  -9.325  1.00 0.00 ? 11 ARG A HG2  9  
ATOM 9054  H HG3  . ARG A 1 11 ? -0.994  13.130  -8.959  1.00 0.00 ? 11 ARG A HG3  9  
ATOM 9055  H HD2  . ARG A 1 11 ? -1.389  10.794  -9.335  1.00 0.00 ? 11 ARG A HD2  9  
ATOM 9056  H HD3  . ARG A 1 11 ? -1.060  11.039  -7.620  1.00 0.00 ? 11 ARG A HD3  9  
ATOM 9057  H HE   . ARG A 1 11 ? -3.194  10.348  -7.140  1.00 0.00 ? 11 ARG A HE   9  
ATOM 9058  H HH11 . ARG A 1 11 ? -2.927  11.002  -10.549 1.00 0.00 ? 11 ARG A HH11 9  
ATOM 9059  H HH12 . ARG A 1 11 ? -4.479  10.332  -10.932 1.00 0.00 ? 11 ARG A HH12 9  
ATOM 9060  H HH21 . ARG A 1 11 ? -5.237  9.463   -7.631  1.00 0.00 ? 11 ARG A HH21 9  
ATOM 9061  H HH22 . ARG A 1 11 ? -5.792  9.457   -9.271  1.00 0.00 ? 11 ARG A HH22 9  
ATOM 9062  N N    . THR A 1 12 ? -0.538  12.027  -4.983  1.00 0.00 ? 12 THR A N    9  
ATOM 9063  C CA   . THR A 1 12 ? 0.209   10.863  -4.521  1.00 0.00 ? 12 THR A CA   9  
ATOM 9064  C C    . THR A 1 12 ? -0.122  9.631   -5.355  1.00 0.00 ? 12 THR A C    9  
ATOM 9065  O O    . THR A 1 12 ? -1.191  9.549   -5.960  1.00 0.00 ? 12 THR A O    9  
ATOM 9066  C CB   . THR A 1 12 ? -0.082  10.561  -3.039  1.00 0.00 ? 12 THR A CB   9  
ATOM 9067  O OG1  . THR A 1 12 ? 0.181   11.720  -2.241  1.00 0.00 ? 12 THR A OG1  9  
ATOM 9068  C CG2  . THR A 1 12 ? 0.766   9.398   -2.548  1.00 0.00 ? 12 THR A CG2  9  
ATOM 9069  H H    . THR A 1 12 ? -1.290  12.355  -4.448  1.00 0.00 ? 12 THR A H    9  
ATOM 9070  H HA   . THR A 1 12 ? 1.263   11.082  -4.622  1.00 0.00 ? 12 THR A HA   9  
ATOM 9071  H HB   . THR A 1 12 ? -1.124  10.294  -2.940  1.00 0.00 ? 12 THR A HB   9  
ATOM 9072  H HG1  . THR A 1 12 ? -0.392  11.716  -1.471  1.00 0.00 ? 12 THR A HG1  9  
ATOM 9073  H HG21 . THR A 1 12 ? 0.563   8.524   -3.149  1.00 0.00 ? 12 THR A HG21 9  
ATOM 9074  H HG22 . THR A 1 12 ? 0.527   9.189   -1.515  1.00 0.00 ? 12 THR A HG22 9  
ATOM 9075  H HG23 . THR A 1 12 ? 1.812   9.655   -2.630  1.00 0.00 ? 12 THR A HG23 9  
ATOM 9076  N N    . ILE A 1 13 ? 0.800   8.674   -5.380  1.00 0.00 ? 13 ILE A N    9  
ATOM 9077  C CA   . ILE A 1 13 ? 0.604   7.445   -6.138  1.00 0.00 ? 13 ILE A CA   9  
ATOM 9078  C C    . ILE A 1 13 ? -0.763  6.833   -5.849  1.00 0.00 ? 13 ILE A C    9  
ATOM 9079  O O    . ILE A 1 13 ? -1.262  6.011   -6.618  1.00 0.00 ? 13 ILE A O    9  
ATOM 9080  C CB   . ILE A 1 13 ? 1.696   6.407   -5.821  1.00 0.00 ? 13 ILE A CB   9  
ATOM 9081  C CG1  . ILE A 1 13 ? 3.083   6.993   -6.095  1.00 0.00 ? 13 ILE A CG1  9  
ATOM 9082  C CG2  . ILE A 1 13 ? 1.479   5.142   -6.637  1.00 0.00 ? 13 ILE A CG2  9  
ATOM 9083  C CD1  . ILE A 1 13 ? 3.324   7.316   -7.553  1.00 0.00 ? 13 ILE A CD1  9  
ATOM 9084  H H    . ILE A 1 13 ? 1.631   8.798   -4.877  1.00 0.00 ? 13 ILE A H    9  
ATOM 9085  H HA   . ILE A 1 13 ? 0.662   7.689   -7.189  1.00 0.00 ? 13 ILE A HA   9  
ATOM 9086  H HB   . ILE A 1 13 ? 1.623   6.149   -4.775  1.00 0.00 ? 13 ILE A HB   9  
ATOM 9087  H HG12 . ILE A 1 13 ? 3.200   7.905   -5.531  1.00 0.00 ? 13 ILE A HG12 9  
ATOM 9088  H HG13 . ILE A 1 13 ? 3.834   6.282   -5.783  1.00 0.00 ? 13 ILE A HG13 9  
ATOM 9089  H HG21 . ILE A 1 13 ? 1.510   5.383   -7.689  1.00 0.00 ? 13 ILE A HG21 9  
ATOM 9090  H HG22 . ILE A 1 13 ? 2.257   4.429   -6.409  1.00 0.00 ? 13 ILE A HG22 9  
ATOM 9091  H HG23 . ILE A 1 13 ? 0.517   4.717   -6.393  1.00 0.00 ? 13 ILE A HG23 9  
ATOM 9092  H HD11 . ILE A 1 13 ? 3.262   6.410   -8.138  1.00 0.00 ? 13 ILE A HD11 9  
ATOM 9093  H HD12 . ILE A 1 13 ? 2.579   8.019   -7.895  1.00 0.00 ? 13 ILE A HD12 9  
ATOM 9094  H HD13 . ILE A 1 13 ? 4.307   7.750   -7.668  1.00 0.00 ? 13 ILE A HD13 9  
ATOM 9095  N N    . TYR A 1 14 ? -1.363  7.240   -4.737  1.00 0.00 ? 14 TYR A N    9  
ATOM 9096  C CA   . TYR A 1 14 ? -2.672  6.731   -4.345  1.00 0.00 ? 14 TYR A CA   9  
ATOM 9097  C C    . TYR A 1 14 ? -3.541  7.847   -3.771  1.00 0.00 ? 14 TYR A C    9  
ATOM 9098  O O    . TYR A 1 14 ? -3.051  8.729   -3.065  1.00 0.00 ? 14 TYR A O    9  
ATOM 9099  C CB   . TYR A 1 14 ? -2.520  5.608   -3.318  1.00 0.00 ? 14 TYR A CB   9  
ATOM 9100  C CG   . TYR A 1 14 ? -2.087  4.291   -3.920  1.00 0.00 ? 14 TYR A CG   9  
ATOM 9101  C CD1  . TYR A 1 14 ? -0.766  4.073   -4.288  1.00 0.00 ? 14 TYR A CD1  9  
ATOM 9102  C CD2  . TYR A 1 14 ? -3.001  3.263   -4.121  1.00 0.00 ? 14 TYR A CD2  9  
ATOM 9103  C CE1  . TYR A 1 14 ? -0.366  2.872   -4.840  1.00 0.00 ? 14 TYR A CE1  9  
ATOM 9104  C CE2  . TYR A 1 14 ? -2.610  2.058   -4.671  1.00 0.00 ? 14 TYR A CE2  9  
ATOM 9105  C CZ   . TYR A 1 14 ? -1.292  1.867   -5.029  1.00 0.00 ? 14 TYR A CZ   9  
ATOM 9106  O OH   . TYR A 1 14 ? -0.898  0.668   -5.577  1.00 0.00 ? 14 TYR A OH   9  
ATOM 9107  H H    . TYR A 1 14 ? -0.915  7.897   -4.164  1.00 0.00 ? 14 TYR A H    9  
ATOM 9108  H HA   . TYR A 1 14 ? -3.152  6.335   -5.228  1.00 0.00 ? 14 TYR A HA   9  
ATOM 9109  H HB2  . TYR A 1 14 ? -1.781  5.896   -2.586  1.00 0.00 ? 14 TYR A HB2  9  
ATOM 9110  H HB3  . TYR A 1 14 ? -3.467  5.452   -2.822  1.00 0.00 ? 14 TYR A HB3  9  
ATOM 9111  H HD1  . TYR A 1 14 ? -0.043  4.862   -4.139  1.00 0.00 ? 14 TYR A HD1  9  
ATOM 9112  H HD2  . TYR A 1 14 ? -4.033  3.416   -3.840  1.00 0.00 ? 14 TYR A HD2  9  
ATOM 9113  H HE1  . TYR A 1 14 ? 0.666   2.722   -5.120  1.00 0.00 ? 14 TYR A HE1  9  
ATOM 9114  H HE2  . TYR A 1 14 ? -3.335  1.270   -4.819  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 9115  H HH   . TYR A 1 14 ? -0.066  0.394   -5.184  1.00 0.00 ? 14 TYR A HH   9  
ATOM 9116  N N    . SER A 1 15 ? -4.833  7.799   -4.078  1.00 0.00 ? 15 SER A N    9  
ATOM 9117  C CA   . SER A 1 15 ? -5.771  8.807   -3.596  1.00 0.00 ? 15 SER A CA   9  
ATOM 9118  C C    . SER A 1 15 ? -5.907  8.740   -2.078  1.00 0.00 ? 15 SER A C    9  
ATOM 9119  O O    . SER A 1 15 ? -5.712  7.686   -1.472  1.00 0.00 ? 15 SER A O    9  
ATOM 9120  C CB   . SER A 1 15 ? -7.140  8.615   -4.251  1.00 0.00 ? 15 SER A CB   9  
ATOM 9121  O OG   . SER A 1 15 ? -7.988  9.720   -3.993  1.00 0.00 ? 15 SER A OG   9  
ATOM 9122  H H    . SER A 1 15 ? -5.163  7.071   -4.645  1.00 0.00 ? 15 SER A H    9  
ATOM 9123  H HA   . SER A 1 15 ? -5.384  9.777   -3.869  1.00 0.00 ? 15 SER A HA   9  
ATOM 9124  H HB2  . SER A 1 15 ? -7.014  8.514   -5.318  1.00 0.00 ? 15 SER A HB2  9  
ATOM 9125  H HB3  . SER A 1 15 ? -7.602  7.721   -3.857  1.00 0.00 ? 15 SER A HB3  9  
ATOM 9126  H HG   . SER A 1 15 ? -8.511  9.545   -3.207  1.00 0.00 ? 15 SER A HG   9  
ATOM 9127  N N    . SER A 1 16 ? -6.242  9.873   -1.470  1.00 0.00 ? 16 SER A N    9  
ATOM 9128  C CA   . SER A 1 16 ? -6.401  9.946   -0.022  1.00 0.00 ? 16 SER A CA   9  
ATOM 9129  C C    . SER A 1 16 ? -7.414  8.915   0.466   1.00 0.00 ? 16 SER A C    9  
ATOM 9130  O O    . SER A 1 16 ? -7.255  8.330   1.537   1.00 0.00 ? 16 SER A O    9  
ATOM 9131  C CB   . SER A 1 16 ? -6.844  11.350  0.394   1.00 0.00 ? 16 SER A CB   9  
ATOM 9132  O OG   . SER A 1 16 ? -8.033  11.729  -0.277  1.00 0.00 ? 16 SER A OG   9  
ATOM 9133  H H    . SER A 1 16 ? -6.384  10.681  -2.008  1.00 0.00 ? 16 SER A H    9  
ATOM 9134  H HA   . SER A 1 16 ? -5.443  9.732   0.427   1.00 0.00 ? 16 SER A HA   9  
ATOM 9135  H HB2  . SER A 1 16 ? -7.024  11.368  1.458   1.00 0.00 ? 16 SER A HB2  9  
ATOM 9136  H HB3  . SER A 1 16 ? -6.065  12.058  0.149   1.00 0.00 ? 16 SER A HB3  9  
ATOM 9137  H HG   . SER A 1 16 ? -8.153  12.679  -0.204  1.00 0.00 ? 16 SER A HG   9  
ATOM 9138  N N    . PHE A 1 17 ? -8.458  8.699   -0.328  1.00 0.00 ? 17 PHE A N    9  
ATOM 9139  C CA   . PHE A 1 17 ? -9.499  7.740   0.021   1.00 0.00 ? 17 PHE A CA   9  
ATOM 9140  C C    . PHE A 1 17 ? -8.947  6.318   0.033   1.00 0.00 ? 17 PHE A C    9  
ATOM 9141  O O    . PHE A 1 17 ? -9.226  5.541   0.945   1.00 0.00 ? 17 PHE A O    9  
ATOM 9142  C CB   . PHE A 1 17 ? -10.665 7.839   -0.964  1.00 0.00 ? 17 PHE A CB   9  
ATOM 9143  C CG   . PHE A 1 17 ? -11.437 6.559   -1.110  1.00 0.00 ? 17 PHE A CG   9  
ATOM 9144  C CD1  . PHE A 1 17 ? -12.291 6.131   -0.106  1.00 0.00 ? 17 PHE A CD1  9  
ATOM 9145  C CD2  . PHE A 1 17 ? -11.309 5.783   -2.251  1.00 0.00 ? 17 PHE A CD2  9  
ATOM 9146  C CE1  . PHE A 1 17 ? -13.002 4.953   -0.237  1.00 0.00 ? 17 PHE A CE1  9  
ATOM 9147  C CE2  . PHE A 1 17 ? -12.018 4.604   -2.388  1.00 0.00 ? 17 PHE A CE2  9  
ATOM 9148  C CZ   . PHE A 1 17 ? -12.866 4.189   -1.380  1.00 0.00 ? 17 PHE A CZ   9  
ATOM 9149  H H    . PHE A 1 17 ? -8.529  9.197   -1.170  1.00 0.00 ? 17 PHE A H    9  
ATOM 9150  H HA   . PHE A 1 17 ? -9.854  7.984   1.011   1.00 0.00 ? 17 PHE A HA   9  
ATOM 9151  H HB2  . PHE A 1 17 ? -11.350 8.602   -0.626  1.00 0.00 ? 17 PHE A HB2  9  
ATOM 9152  H HB3  . PHE A 1 17 ? -10.283 8.110   -1.937  1.00 0.00 ? 17 PHE A HB3  9  
ATOM 9153  H HD1  . PHE A 1 17 ? -12.399 6.728   0.788   1.00 0.00 ? 17 PHE A HD1  9  
ATOM 9154  H HD2  . PHE A 1 17 ? -10.646 6.107   -3.041  1.00 0.00 ? 17 PHE A HD2  9  
ATOM 9155  H HE1  . PHE A 1 17 ? -13.664 4.631   0.552   1.00 0.00 ? 17 PHE A HE1  9  
ATOM 9156  H HE2  . PHE A 1 17 ? -11.909 4.010   -3.283  1.00 0.00 ? 17 PHE A HE2  9  
ATOM 9157  H HZ   . PHE A 1 17 ? -13.420 3.268   -1.485  1.00 0.00 ? 17 PHE A HZ   9  
ATOM 9158  N N    . GLN A 1 18 ? -8.163  5.985   -0.988  1.00 0.00 ? 18 GLN A N    9  
ATOM 9159  C CA   . GLN A 1 18 ? -7.573  4.656   -1.096  1.00 0.00 ? 18 GLN A CA   9  
ATOM 9160  C C    . GLN A 1 18 ? -6.497  4.451   -0.035  1.00 0.00 ? 18 GLN A C    9  
ATOM 9161  O O    . GLN A 1 18 ? -6.386  3.373   0.550   1.00 0.00 ? 18 GLN A O    9  
ATOM 9162  C CB   . GLN A 1 18 ? -6.978  4.452   -2.490  1.00 0.00 ? 18 GLN A CB   9  
ATOM 9163  C CG   . GLN A 1 18 ? -8.012  4.477   -3.604  1.00 0.00 ? 18 GLN A CG   9  
ATOM 9164  C CD   . GLN A 1 18 ? -7.387  4.416   -4.983  1.00 0.00 ? 18 GLN A CD   9  
ATOM 9165  O OE1  . GLN A 1 18 ? -6.316  4.978   -5.217  1.00 0.00 ? 18 GLN A OE1  9  
ATOM 9166  N NE2  . GLN A 1 18 ? -8.053  3.732   -5.906  1.00 0.00 ? 18 GLN A NE2  9  
ATOM 9167  H H    . GLN A 1 18 ? -7.978  6.649   -1.684  1.00 0.00 ? 18 GLN A H    9  
ATOM 9168  H HA   . GLN A 1 18 ? -8.358  3.932   -0.940  1.00 0.00 ? 18 GLN A HA   9  
ATOM 9169  H HB2  . GLN A 1 18 ? -6.258  5.234   -2.680  1.00 0.00 ? 18 GLN A HB2  9  
ATOM 9170  H HB3  . GLN A 1 18 ? -6.475  3.496   -2.517  1.00 0.00 ? 18 GLN A HB3  9  
ATOM 9171  H HG2  . GLN A 1 18 ? -8.670  3.628   -3.486  1.00 0.00 ? 18 GLN A HG2  9  
ATOM 9172  H HG3  . GLN A 1 18 ? -8.586  5.388   -3.524  1.00 0.00 ? 18 GLN A HG3  9  
ATOM 9173  H HE21 . GLN A 1 18 ? -8.901  3.312   -5.648  1.00 0.00 ? 18 GLN A HE21 9  
ATOM 9174  H HE22 . GLN A 1 18 ? -7.672  3.677   -6.806  1.00 0.00 ? 18 GLN A HE22 9  
ATOM 9175  N N    . LEU A 1 19 ? -5.706  5.490   0.207   1.00 0.00 ? 19 LEU A N    9  
ATOM 9176  C CA   . LEU A 1 19 ? -4.638  5.424   1.198   1.00 0.00 ? 19 LEU A CA   9  
ATOM 9177  C C    . LEU A 1 19 ? -5.208  5.262   2.604   1.00 0.00 ? 19 LEU A C    9  
ATOM 9178  O O    . LEU A 1 19 ? -4.829  4.349   3.336   1.00 0.00 ? 19 LEU A O    9  
ATOM 9179  C CB   . LEU A 1 19 ? -3.771  6.682   1.128   1.00 0.00 ? 19 LEU A CB   9  
ATOM 9180  C CG   . LEU A 1 19 ? -2.684  6.690   0.053   1.00 0.00 ? 19 LEU A CG   9  
ATOM 9181  C CD1  . LEU A 1 19 ? -1.768  7.891   0.228   1.00 0.00 ? 19 LEU A CD1  9  
ATOM 9182  C CD2  . LEU A 1 19 ? -1.884  5.396   0.093   1.00 0.00 ? 19 LEU A CD2  9  
ATOM 9183  H H    . LEU A 1 19 ? -5.843  6.322   -0.291  1.00 0.00 ? 19 LEU A H    9  
ATOM 9184  H HA   . LEU A 1 19 ? -4.027  4.563   0.969   1.00 0.00 ? 19 LEU A HA   9  
ATOM 9185  H HB2  . LEU A 1 19 ? -4.423  7.522   0.945   1.00 0.00 ? 19 LEU A HB2  9  
ATOM 9186  H HB3  . LEU A 1 19 ? -3.290  6.805   2.088   1.00 0.00 ? 19 LEU A HB3  9  
ATOM 9187  H HG   . LEU A 1 19 ? -3.150  6.766   -0.920  1.00 0.00 ? 19 LEU A HG   9  
ATOM 9188  H HD11 . LEU A 1 19 ? -1.002  7.657   0.952   1.00 0.00 ? 19 LEU A HD11 9  
ATOM 9189  H HD12 . LEU A 1 19 ? -2.345  8.736   0.575   1.00 0.00 ? 19 LEU A HD12 9  
ATOM 9190  H HD13 . LEU A 1 19 ? -1.308  8.135   -0.719  1.00 0.00 ? 19 LEU A HD13 9  
ATOM 9191  H HD21 . LEU A 1 19 ? -1.930  4.977   1.088   1.00 0.00 ? 19 LEU A HD21 9  
ATOM 9192  H HD22 . LEU A 1 19 ? -0.855  5.601   -0.164  1.00 0.00 ? 19 LEU A HD22 9  
ATOM 9193  H HD23 . LEU A 1 19 ? -2.300  4.694   -0.614  1.00 0.00 ? 19 LEU A HD23 9  
ATOM 9194  N N    . ALA A 1 20 ? -6.121  6.155   2.972   1.00 0.00 ? 20 ALA A N    9  
ATOM 9195  C CA   . ALA A 1 20 ? -6.746  6.109   4.288   1.00 0.00 ? 20 ALA A CA   9  
ATOM 9196  C C    . ALA A 1 20 ? -6.990  4.670   4.730   1.00 0.00 ? 20 ALA A C    9  
ATOM 9197  O O    . ALA A 1 20 ? -6.610  4.276   5.832   1.00 0.00 ? 20 ALA A O    9  
ATOM 9198  C CB   . ALA A 1 20 ? -8.052  6.889   4.279   1.00 0.00 ? 20 ALA A CB   9  
ATOM 9199  H H    . ALA A 1 20 ? -6.381  6.860   2.344   1.00 0.00 ? 20 ALA A H    9  
ATOM 9200  H HA   . ALA A 1 20 ? -6.077  6.582   4.992   1.00 0.00 ? 20 ALA A HA   9  
ATOM 9201  H HB1  . ALA A 1 20 ? -7.932  7.784   3.686   1.00 0.00 ? 20 ALA A HB1  9  
ATOM 9202  H HB2  . ALA A 1 20 ? -8.834  6.277   3.854   1.00 0.00 ? 20 ALA A HB2  9  
ATOM 9203  H HB3  . ALA A 1 20 ? -8.317  7.159   5.290   1.00 0.00 ? 20 ALA A HB3  9  
ATOM 9204  N N    . ALA A 1 21 ? -7.627  3.889   3.863   1.00 0.00 ? 21 ALA A N    9  
ATOM 9205  C CA   . ALA A 1 21 ? -7.920  2.493   4.164   1.00 0.00 ? 21 ALA A CA   9  
ATOM 9206  C C    . ALA A 1 21 ? -6.652  1.647   4.134   1.00 0.00 ? 21 ALA A C    9  
ATOM 9207  O O    . ALA A 1 21 ? -6.375  0.892   5.067   1.00 0.00 ? 21 ALA A O    9  
ATOM 9208  C CB   . ALA A 1 21 ? -8.946  1.946   3.182   1.00 0.00 ? 21 ALA A CB   9  
ATOM 9209  H H    . ALA A 1 21 ? -7.905  4.261   3.000   1.00 0.00 ? 21 ALA A H    9  
ATOM 9210  H HA   . ALA A 1 21 ? -8.347  2.448   5.156   1.00 0.00 ? 21 ALA A HA   9  
ATOM 9211  H HB1  . ALA A 1 21 ? -9.010  2.603   2.327   1.00 0.00 ? 21 ALA A HB1  9  
ATOM 9212  H HB2  . ALA A 1 21 ? -8.645  0.961   2.859   1.00 0.00 ? 21 ALA A HB2  9  
ATOM 9213  H HB3  . ALA A 1 21 ? -9.910  1.889   3.665   1.00 0.00 ? 21 ALA A HB3  9  
ATOM 9214  N N    . LEU A 1 22 ? -5.886  1.776   3.056   1.00 0.00 ? 22 LEU A N    9  
ATOM 9215  C CA   . LEU A 1 22 ? -4.646  1.022   2.904   1.00 0.00 ? 22 LEU A CA   9  
ATOM 9216  C C    . LEU A 1 22 ? -3.797  1.110   4.168   1.00 0.00 ? 22 LEU A C    9  
ATOM 9217  O O    . LEU A 1 22 ? -3.509  0.097   4.804   1.00 0.00 ? 22 LEU A O    9  
ATOM 9218  C CB   . LEU A 1 22 ? -3.853  1.544   1.705   1.00 0.00 ? 22 LEU A CB   9  
ATOM 9219  C CG   . LEU A 1 22 ? -4.223  0.950   0.345   1.00 0.00 ? 22 LEU A CG   9  
ATOM 9220  C CD1  . LEU A 1 22 ? -3.548  1.724   -0.777  1.00 0.00 ? 22 LEU A CD1  9  
ATOM 9221  C CD2  . LEU A 1 22 ? -3.842  -0.521  0.285   1.00 0.00 ? 22 LEU A CD2  9  
ATOM 9222  H H    . LEU A 1 22 ? -6.159  2.393   2.346   1.00 0.00 ? 22 LEU A H    9  
ATOM 9223  H HA   . LEU A 1 22 ? -4.907  -0.011  2.731   1.00 0.00 ? 22 LEU A HA   9  
ATOM 9224  H HB2  . LEU A 1 22 ? -4.000  2.612   1.650   1.00 0.00 ? 22 LEU A HB2  9  
ATOM 9225  H HB3  . LEU A 1 22 ? -2.808  1.336   1.885   1.00 0.00 ? 22 LEU A HB3  9  
ATOM 9226  H HG   . LEU A 1 22 ? -5.293  1.026   0.206   1.00 0.00 ? 22 LEU A HG   9  
ATOM 9227  H HD11 . LEU A 1 22 ? -3.186  2.667   -0.396  1.00 0.00 ? 22 LEU A HD11 9  
ATOM 9228  H HD12 . LEU A 1 22 ? -4.261  1.905   -1.568  1.00 0.00 ? 22 LEU A HD12 9  
ATOM 9229  H HD13 . LEU A 1 22 ? -2.720  1.149   -1.163  1.00 0.00 ? 22 LEU A HD13 9  
ATOM 9230  H HD21 . LEU A 1 22 ? -3.002  -0.703  0.939   1.00 0.00 ? 22 LEU A HD21 9  
ATOM 9231  H HD22 . LEU A 1 22 ? -3.570  -0.781  -0.729  1.00 0.00 ? 22 LEU A HD22 9  
ATOM 9232  H HD23 . LEU A 1 22 ? -4.681  -1.124  0.599   1.00 0.00 ? 22 LEU A HD23 9  
ATOM 9233  N N    . GLN A 1 23 ? -3.401  2.328   4.525   1.00 0.00 ? 23 GLN A N    9  
ATOM 9234  C CA   . GLN A 1 23 ? -2.586  2.547   5.714   1.00 0.00 ? 23 GLN A CA   9  
ATOM 9235  C C    . GLN A 1 23 ? -3.248  1.942   6.947   1.00 0.00 ? 23 GLN A C    9  
ATOM 9236  O O    . GLN A 1 23 ? -2.607  1.232   7.722   1.00 0.00 ? 23 GLN A O    9  
ATOM 9237  C CB   . GLN A 1 23 ? -2.353  4.044   5.929   1.00 0.00 ? 23 GLN A CB   9  
ATOM 9238  C CG   . GLN A 1 23 ? -1.232  4.614   5.074   1.00 0.00 ? 23 GLN A CG   9  
ATOM 9239  C CD   . GLN A 1 23 ? -0.841  6.019   5.486   1.00 0.00 ? 23 GLN A CD   9  
ATOM 9240  O OE1  . GLN A 1 23 ? -1.469  6.620   6.358   1.00 0.00 ? 23 GLN A OE1  9  
ATOM 9241  N NE2  . GLN A 1 23 ? 0.201   6.552   4.859   1.00 0.00 ? 23 GLN A NE2  9  
ATOM 9242  H H    . GLN A 1 23 ? -3.663  3.096   3.977   1.00 0.00 ? 23 GLN A H    9  
ATOM 9243  H HA   . GLN A 1 23 ? -1.634  2.063   5.557   1.00 0.00 ? 23 GLN A HA   9  
ATOM 9244  H HB2  . GLN A 1 23 ? -3.262  4.575   5.693   1.00 0.00 ? 23 GLN A HB2  9  
ATOM 9245  H HB3  . GLN A 1 23 ? -2.105  4.212   6.967   1.00 0.00 ? 23 GLN A HB3  9  
ATOM 9246  H HG2  . GLN A 1 23 ? -0.366  3.975   5.166   1.00 0.00 ? 23 GLN A HG2  9  
ATOM 9247  H HG3  . GLN A 1 23 ? -1.557  4.633   4.044   1.00 0.00 ? 23 GLN A HG3  9  
ATOM 9248  H HE21 . GLN A 1 23 ? 0.652   6.015   4.174   1.00 0.00 ? 23 GLN A HE21 9  
ATOM 9249  H HE22 . GLN A 1 23 ? 0.475   7.459   5.104   1.00 0.00 ? 23 GLN A HE22 9  
ATOM 9250  N N    . ARG A 1 24 ? -4.534  2.228   7.123   1.00 0.00 ? 24 ARG A N    9  
ATOM 9251  C CA   . ARG A 1 24 ? -5.282  1.712   8.264   1.00 0.00 ? 24 ARG A CA   9  
ATOM 9252  C C    . ARG A 1 24 ? -5.043  0.215   8.439   1.00 0.00 ? 24 ARG A C    9  
ATOM 9253  O O    . ARG A 1 24 ? -4.830  -0.263  9.553   1.00 0.00 ? 24 ARG A O    9  
ATOM 9254  C CB   . ARG A 1 24 ? -6.777  1.983   8.085   1.00 0.00 ? 24 ARG A CB   9  
ATOM 9255  C CG   . ARG A 1 24 ? -7.531  2.127   9.396   1.00 0.00 ? 24 ARG A CG   9  
ATOM 9256  C CD   . ARG A 1 24 ? -8.793  2.958   9.226   1.00 0.00 ? 24 ARG A CD   9  
ATOM 9257  N NE   . ARG A 1 24 ? -9.451  3.222   10.502  1.00 0.00 ? 24 ARG A NE   9  
ATOM 9258  C CZ   . ARG A 1 24 ? -10.410 4.127   10.661  1.00 0.00 ? 24 ARG A CZ   9  
ATOM 9259  N NH1  . ARG A 1 24 ? -10.820 4.851   9.629   1.00 0.00 ? 24 ARG A NH1  9  
ATOM 9260  N NH2  . ARG A 1 24 ? -10.961 4.310   11.854  1.00 0.00 ? 24 ARG A NH2  9  
ATOM 9261  H H    . ARG A 1 24 ? -4.990  2.799   6.471   1.00 0.00 ? 24 ARG A H    9  
ATOM 9262  H HA   . ARG A 1 24 ? -4.935  2.226   9.148   1.00 0.00 ? 24 ARG A HA   9  
ATOM 9263  H HB2  . ARG A 1 24 ? -6.900  2.898   7.522   1.00 0.00 ? 24 ARG A HB2  9  
ATOM 9264  H HB3  . ARG A 1 24 ? -7.214  1.167   7.530   1.00 0.00 ? 24 ARG A HB3  9  
ATOM 9265  H HG2  . ARG A 1 24 ? -7.806  1.144   9.752   1.00 0.00 ? 24 ARG A HG2  9  
ATOM 9266  H HG3  . ARG A 1 24 ? -6.889  2.607   10.119  1.00 0.00 ? 24 ARG A HG3  9  
ATOM 9267  H HD2  . ARG A 1 24 ? -8.529  3.899   8.766   1.00 0.00 ? 24 ARG A HD2  9  
ATOM 9268  H HD3  . ARG A 1 24 ? -9.476  2.423   8.583   1.00 0.00 ? 24 ARG A HD3  9  
ATOM 9269  H HE   . ARG A 1 24 ? -9.163  2.698   11.278  1.00 0.00 ? 24 ARG A HE   9  
ATOM 9270  H HH11 . ARG A 1 24 ? -10.408 4.715   8.728   1.00 0.00 ? 24 ARG A HH11 9  
ATOM 9271  H HH12 . ARG A 1 24 ? -11.544 5.532   9.751   1.00 0.00 ? 24 ARG A HH12 9  
ATOM 9272  H HH21 . ARG A 1 24 ? -10.654 3.766   12.635  1.00 0.00 ? 24 ARG A HH21 9  
ATOM 9273  H HH22 . ARG A 1 24 ? -11.682 4.991   11.973  1.00 0.00 ? 24 ARG A HH22 9  
ATOM 9274  N N    . ARG A 1 25 ? -5.081  -0.518  7.331   1.00 0.00 ? 25 ARG A N    9  
ATOM 9275  C CA   . ARG A 1 25 ? -4.871  -1.961  7.362   1.00 0.00 ? 25 ARG A CA   9  
ATOM 9276  C C    . ARG A 1 25 ? -3.393  -2.291  7.549   1.00 0.00 ? 25 ARG A C    9  
ATOM 9277  O O    . ARG A 1 25 ? -3.040  -3.213  8.284   1.00 0.00 ? 25 ARG A O    9  
ATOM 9278  C CB   . ARG A 1 25 ? -5.389  -2.601  6.073   1.00 0.00 ? 25 ARG A CB   9  
ATOM 9279  C CG   . ARG A 1 25 ? -5.548  -4.110  6.164   1.00 0.00 ? 25 ARG A CG   9  
ATOM 9280  C CD   . ARG A 1 25 ? -6.723  -4.494  7.050   1.00 0.00 ? 25 ARG A CD   9  
ATOM 9281  N NE   . ARG A 1 25 ? -7.991  -4.447  6.327   1.00 0.00 ? 25 ARG A NE   9  
ATOM 9282  C CZ   . ARG A 1 25 ? -9.151  -4.825  6.853   1.00 0.00 ? 25 ARG A CZ   9  
ATOM 9283  N NH1  . ARG A 1 25 ? -9.202  -5.274  8.100   1.00 0.00 ? 25 ARG A NH1  9  
ATOM 9284  N NH2  . ARG A 1 25 ? -10.263 -4.753  6.132   1.00 0.00 ? 25 ARG A NH2  9  
ATOM 9285  H H    . ARG A 1 25 ? -5.256  -0.080  6.472   1.00 0.00 ? 25 ARG A H    9  
ATOM 9286  H HA   . ARG A 1 25 ? -5.425  -2.359  8.199   1.00 0.00 ? 25 ARG A HA   9  
ATOM 9287  H HB2  . ARG A 1 25 ? -6.351  -2.174  5.834   1.00 0.00 ? 25 ARG A HB2  9  
ATOM 9288  H HB3  . ARG A 1 25 ? -4.697  -2.381  5.274   1.00 0.00 ? 25 ARG A HB3  9  
ATOM 9289  H HG2  . ARG A 1 25 ? -5.714  -4.506  5.173   1.00 0.00 ? 25 ARG A HG2  9  
ATOM 9290  H HG3  . ARG A 1 25 ? -4.644  -4.534  6.576   1.00 0.00 ? 25 ARG A HG3  9  
ATOM 9291  H HD2  . ARG A 1 25 ? -6.566  -5.497  7.418   1.00 0.00 ? 25 ARG A HD2  9  
ATOM 9292  H HD3  . ARG A 1 25 ? -6.768  -3.808  7.882   1.00 0.00 ? 25 ARG A HD3  9  
ATOM 9293  H HE   . ARG A 1 25 ? -7.976  -4.119  5.405   1.00 0.00 ? 25 ARG A HE   9  
ATOM 9294  H HH11 . ARG A 1 25 ? -8.367  -5.328  8.646   1.00 0.00 ? 25 ARG A HH11 9  
ATOM 9295  H HH12 . ARG A 1 25 ? -10.077 -5.556  8.494   1.00 0.00 ? 25 ARG A HH12 9  
ATOM 9296  H HH21 . ARG A 1 25 ? -10.228 -4.415  5.193   1.00 0.00 ? 25 ARG A HH21 9  
ATOM 9297  H HH22 . ARG A 1 25 ? -11.135 -5.037  6.529   1.00 0.00 ? 25 ARG A HH22 9  
ATOM 9298  N N    . PHE A 1 26 ? -2.533  -1.531  6.879   1.00 0.00 ? 26 PHE A N    9  
ATOM 9299  C CA   . PHE A 1 26 ? -1.093  -1.743  6.969   1.00 0.00 ? 26 PHE A CA   9  
ATOM 9300  C C    . PHE A 1 26 ? -0.644  -1.813  8.426   1.00 0.00 ? 26 PHE A C    9  
ATOM 9301  O O    . PHE A 1 26 ? -0.011  -2.781  8.845   1.00 0.00 ? 26 PHE A O    9  
ATOM 9302  C CB   . PHE A 1 26 ? -0.345  -0.622  6.246   1.00 0.00 ? 26 PHE A CB   9  
ATOM 9303  C CG   . PHE A 1 26 ? 1.074   -0.975  5.899   1.00 0.00 ? 26 PHE A CG   9  
ATOM 9304  C CD1  . PHE A 1 26 ? 1.349   -2.015  5.026   1.00 0.00 ? 26 PHE A CD1  9  
ATOM 9305  C CD2  . PHE A 1 26 ? 2.131   -0.267  6.446   1.00 0.00 ? 26 PHE A CD2  9  
ATOM 9306  C CE1  . PHE A 1 26 ? 2.652   -2.343  4.704   1.00 0.00 ? 26 PHE A CE1  9  
ATOM 9307  C CE2  . PHE A 1 26 ? 3.437   -0.590  6.128   1.00 0.00 ? 26 PHE A CE2  9  
ATOM 9308  C CZ   . PHE A 1 26 ? 3.698   -1.629  5.256   1.00 0.00 ? 26 PHE A CZ   9  
ATOM 9309  H H    . PHE A 1 26 ? -2.876  -0.810  6.309   1.00 0.00 ? 26 PHE A H    9  
ATOM 9310  H HA   . PHE A 1 26 ? -0.867  -2.683  6.490   1.00 0.00 ? 26 PHE A HA   9  
ATOM 9311  H HB2  . PHE A 1 26 ? -0.862  -0.388  5.328   1.00 0.00 ? 26 PHE A HB2  9  
ATOM 9312  H HB3  . PHE A 1 26 ? -0.325  0.253   6.877   1.00 0.00 ? 26 PHE A HB3  9  
ATOM 9313  H HD1  . PHE A 1 26 ? 0.531   -2.574  4.593   1.00 0.00 ? 26 PHE A HD1  9  
ATOM 9314  H HD2  . PHE A 1 26 ? 1.929   0.545   7.128   1.00 0.00 ? 26 PHE A HD2  9  
ATOM 9315  H HE1  . PHE A 1 26 ? 2.853   -3.156  4.022   1.00 0.00 ? 26 PHE A HE1  9  
ATOM 9316  H HE2  . PHE A 1 26 ? 4.253   -0.031  6.561   1.00 0.00 ? 26 PHE A HE2  9  
ATOM 9317  H HZ   . PHE A 1 26 ? 4.717   -1.883  5.006   1.00 0.00 ? 26 PHE A HZ   9  
ATOM 9318  N N    . GLN A 1 27 ? -0.977  -0.778  9.191   1.00 0.00 ? 27 GLN A N    9  
ATOM 9319  C CA   . GLN A 1 27 ? -0.607  -0.720  10.601  1.00 0.00 ? 27 GLN A CA   9  
ATOM 9320  C C    . GLN A 1 27 ? -1.067  -1.975  11.336  1.00 0.00 ? 27 GLN A C    9  
ATOM 9321  O O    . GLN A 1 27 ? -0.289  -2.610  12.049  1.00 0.00 ? 27 GLN A O    9  
ATOM 9322  C CB   . GLN A 1 27 ? -1.212  0.521   11.258  1.00 0.00 ? 27 GLN A CB   9  
ATOM 9323  C CG   . GLN A 1 27 ? -0.611  1.826   10.763  1.00 0.00 ? 27 GLN A CG   9  
ATOM 9324  C CD   . GLN A 1 27 ? 0.876   1.926   11.040  1.00 0.00 ? 27 GLN A CD   9  
ATOM 9325  O OE1  . GLN A 1 27 ? 1.295   2.106   12.184  1.00 0.00 ? 27 GLN A OE1  9  
ATOM 9326  N NE2  . GLN A 1 27 ? 1.683   1.809   9.992   1.00 0.00 ? 27 GLN A NE2  9  
ATOM 9327  H H    . GLN A 1 27 ? -1.482  -0.036  8.799   1.00 0.00 ? 27 GLN A H    9  
ATOM 9328  H HA   . GLN A 1 27 ? 0.469   -0.659  10.658  1.00 0.00 ? 27 GLN A HA   9  
ATOM 9329  H HB2  . GLN A 1 27 ? -2.273  0.539   11.058  1.00 0.00 ? 27 GLN A HB2  9  
ATOM 9330  H HB3  . GLN A 1 27 ? -1.057  0.460   12.325  1.00 0.00 ? 27 GLN A HB3  9  
ATOM 9331  H HG2  . GLN A 1 27 ? -0.768  1.899   9.697   1.00 0.00 ? 27 GLN A HG2  9  
ATOM 9332  H HG3  . GLN A 1 27 ? -1.110  2.647   11.256  1.00 0.00 ? 27 GLN A HG3  9  
ATOM 9333  H HE21 . GLN A 1 27 ? 1.278   1.667   9.111   1.00 0.00 ? 27 GLN A HE21 9  
ATOM 9334  H HE22 . GLN A 1 27 ? 2.649   1.870   10.143  1.00 0.00 ? 27 GLN A HE22 9  
ATOM 9335  N N    . LYS A 1 28 ? -2.335  -2.328  11.158  1.00 0.00 ? 28 LYS A N    9  
ATOM 9336  C CA   . LYS A 1 28 ? -2.900  -3.507  11.803  1.00 0.00 ? 28 LYS A CA   9  
ATOM 9337  C C    . LYS A 1 28 ? -2.082  -4.752  11.473  1.00 0.00 ? 28 LYS A C    9  
ATOM 9338  O O    . LYS A 1 28 ? -1.604  -5.449  12.369  1.00 0.00 ? 28 LYS A O    9  
ATOM 9339  C CB   . LYS A 1 28 ? -4.352  -3.708  11.364  1.00 0.00 ? 28 LYS A CB   9  
ATOM 9340  C CG   . LYS A 1 28 ? -5.326  -2.747  12.025  1.00 0.00 ? 28 LYS A CG   9  
ATOM 9341  C CD   . LYS A 1 28 ? -6.744  -3.293  12.013  1.00 0.00 ? 28 LYS A CD   9  
ATOM 9342  C CE   . LYS A 1 28 ? -7.468  -2.932  10.724  1.00 0.00 ? 28 LYS A CE   9  
ATOM 9343  N NZ   . LYS A 1 28 ? -7.916  -1.512  10.719  1.00 0.00 ? 28 LYS A NZ   9  
ATOM 9344  H H    . LYS A 1 28 ? -2.906  -1.781  10.577  1.00 0.00 ? 28 LYS A H    9  
ATOM 9345  H HA   . LYS A 1 28 ? -2.874  -3.346  12.870  1.00 0.00 ? 28 LYS A HA   9  
ATOM 9346  H HB2  . LYS A 1 28 ? -4.415  -3.571  10.295  1.00 0.00 ? 28 LYS A HB2  9  
ATOM 9347  H HB3  . LYS A 1 28 ? -4.654  -4.716  11.608  1.00 0.00 ? 28 LYS A HB3  9  
ATOM 9348  H HG2  . LYS A 1 28 ? -5.022  -2.588  13.049  1.00 0.00 ? 28 LYS A HG2  9  
ATOM 9349  H HG3  . LYS A 1 28 ? -5.307  -1.806  11.493  1.00 0.00 ? 28 LYS A HG3  9  
ATOM 9350  H HD2  . LYS A 1 28 ? -6.707  -4.368  12.103  1.00 0.00 ? 28 LYS A HD2  9  
ATOM 9351  H HD3  . LYS A 1 28 ? -7.287  -2.877  12.849  1.00 0.00 ? 28 LYS A HD3  9  
ATOM 9352  H HE2  . LYS A 1 28 ? -6.798  -3.093  9.893   1.00 0.00 ? 28 LYS A HE2  9  
ATOM 9353  H HE3  . LYS A 1 28 ? -8.331  -3.574  10.621  1.00 0.00 ? 28 LYS A HE3  9  
ATOM 9354  H HZ1  . LYS A 1 28 ? -7.110  -0.883  10.911  1.00 0.00 ? 28 LYS A HZ1  9  
ATOM 9355  H HZ2  . LYS A 1 28 ? -8.640  -1.363  11.450  1.00 0.00 ? 28 LYS A HZ2  9  
ATOM 9356  H HZ3  . LYS A 1 28 ? -8.320  -1.268  9.792   1.00 0.00 ? 28 LYS A HZ3  9  
ATOM 9357  N N    . THR A 1 29 ? -1.923  -5.025  10.182  1.00 0.00 ? 29 THR A N    9  
ATOM 9358  C CA   . THR A 1 29 ? -1.163  -6.185  9.734   1.00 0.00 ? 29 THR A CA   9  
ATOM 9359  C C    . THR A 1 29 ? -0.441  -5.896  8.423   1.00 0.00 ? 29 THR A C    9  
ATOM 9360  O O    . THR A 1 29 ? -0.967  -5.201  7.555   1.00 0.00 ? 29 THR A O    9  
ATOM 9361  C CB   . THR A 1 29 ? -2.071  -7.414  9.547   1.00 0.00 ? 29 THR A CB   9  
ATOM 9362  O OG1  . THR A 1 29 ? -1.299  -8.530  9.090   1.00 0.00 ? 29 THR A OG1  9  
ATOM 9363  C CG2  . THR A 1 29 ? -3.183  -7.119  8.551   1.00 0.00 ? 29 THR A CG2  9  
ATOM 9364  H H    . THR A 1 29 ? -2.328  -4.432  9.515   1.00 0.00 ? 29 THR A H    9  
ATOM 9365  H HA   . THR A 1 29 ? -0.430  -6.417  10.494  1.00 0.00 ? 29 THR A HA   9  
ATOM 9366  H HB   . THR A 1 29 ? -2.518  -7.661  10.500  1.00 0.00 ? 29 THR A HB   9  
ATOM 9367  H HG1  . THR A 1 29 ? -1.300  -8.548  8.130   1.00 0.00 ? 29 THR A HG1  9  
ATOM 9368  H HG21 . THR A 1 29 ? -3.377  -7.999  7.956   1.00 0.00 ? 29 THR A HG21 9  
ATOM 9369  H HG22 . THR A 1 29 ? -2.882  -6.307  7.906   1.00 0.00 ? 29 THR A HG22 9  
ATOM 9370  H HG23 . THR A 1 29 ? -4.079  -6.842  9.085   1.00 0.00 ? 29 THR A HG23 9  
ATOM 9371  N N    . GLN A 1 30 ? 0.766   -6.436  8.286   1.00 0.00 ? 30 GLN A N    9  
ATOM 9372  C CA   . GLN A 1 30 ? 1.560   -6.235  7.079   1.00 0.00 ? 30 GLN A CA   9  
ATOM 9373  C C    . GLN A 1 30 ? 1.196   -7.262  6.012   1.00 0.00 ? 30 GLN A C    9  
ATOM 9374  O O    . GLN A 1 30 ? 1.265   -6.979  4.815   1.00 0.00 ? 30 GLN A O    9  
ATOM 9375  C CB   . GLN A 1 30 ? 3.052   -6.326  7.403   1.00 0.00 ? 30 GLN A CB   9  
ATOM 9376  C CG   . GLN A 1 30 ? 3.607   -5.076  8.067   1.00 0.00 ? 30 GLN A CG   9  
ATOM 9377  C CD   . GLN A 1 30 ? 3.407   -5.076  9.570   1.00 0.00 ? 30 GLN A CD   9  
ATOM 9378  O OE1  . GLN A 1 30 ? 4.050   -5.837  10.294  1.00 0.00 ? 30 GLN A OE1  9  
ATOM 9379  N NE2  . GLN A 1 30 ? 2.513   -4.219  10.048  1.00 0.00 ? 30 GLN A NE2  9  
ATOM 9380  H H    . GLN A 1 30 ? 1.132   -6.980  9.013   1.00 0.00 ? 30 GLN A H    9  
ATOM 9381  H HA   . GLN A 1 30 ? 1.343   -5.248  6.700   1.00 0.00 ? 30 GLN A HA   9  
ATOM 9382  H HB2  . GLN A 1 30 ? 3.214   -7.162  8.067   1.00 0.00 ? 30 GLN A HB2  9  
ATOM 9383  H HB3  . GLN A 1 30 ? 3.598   -6.493  6.486   1.00 0.00 ? 30 GLN A HB3  9  
ATOM 9384  H HG2  . GLN A 1 30 ? 4.666   -5.015  7.861   1.00 0.00 ? 30 GLN A HG2  9  
ATOM 9385  H HG3  . GLN A 1 30 ? 3.110   -4.212  7.652   1.00 0.00 ? 30 GLN A HG3  9  
ATOM 9386  H HE21 . GLN A 1 30 ? 2.037   -3.644  9.412   1.00 0.00 ? 30 GLN A HE21 9  
ATOM 9387  H HE22 . GLN A 1 30 ? 2.363   -4.198  11.015  1.00 0.00 ? 30 GLN A HE22 9  
ATOM 9388  N N    . TYR A 1 31 ? 0.808   -8.453  6.452   1.00 0.00 ? 31 TYR A N    9  
ATOM 9389  C CA   . TYR A 1 31 ? 0.436   -9.523  5.534   1.00 0.00 ? 31 TYR A CA   9  
ATOM 9390  C C    . TYR A 1 31 ? -1.075  -9.737  5.530   1.00 0.00 ? 31 TYR A C    9  
ATOM 9391  O O    . TYR A 1 31 ? -1.693  -9.907  6.581   1.00 0.00 ? 31 TYR A O    9  
ATOM 9392  C CB   . TYR A 1 31 ? 1.144   -10.823 5.919   1.00 0.00 ? 31 TYR A CB   9  
ATOM 9393  C CG   . TYR A 1 31 ? 2.648   -10.689 6.010   1.00 0.00 ? 31 TYR A CG   9  
ATOM 9394  C CD1  . TYR A 1 31 ? 3.260   -10.314 7.200   1.00 0.00 ? 31 TYR A CD1  9  
ATOM 9395  C CD2  . TYR A 1 31 ? 3.456   -10.939 4.908   1.00 0.00 ? 31 TYR A CD2  9  
ATOM 9396  C CE1  . TYR A 1 31 ? 4.633   -10.189 7.288   1.00 0.00 ? 31 TYR A CE1  9  
ATOM 9397  C CE2  . TYR A 1 31 ? 4.830   -10.818 4.987   1.00 0.00 ? 31 TYR A CE2  9  
ATOM 9398  C CZ   . TYR A 1 31 ? 5.414   -10.443 6.179   1.00 0.00 ? 31 TYR A CZ   9  
ATOM 9399  O OH   . TYR A 1 31 ? 6.782   -10.321 6.263   1.00 0.00 ? 31 TYR A OH   9  
ATOM 9400  H H    . TYR A 1 31 ? 0.773   -8.619  7.417   1.00 0.00 ? 31 TYR A H    9  
ATOM 9401  H HA   . TYR A 1 31 ? 0.750   -9.234  4.542   1.00 0.00 ? 31 TYR A HA   9  
ATOM 9402  H HB2  . TYR A 1 31 ? 0.782   -11.152 6.880   1.00 0.00 ? 31 TYR A HB2  9  
ATOM 9403  H HB3  . TYR A 1 31 ? 0.923   -11.578 5.179   1.00 0.00 ? 31 TYR A HB3  9  
ATOM 9404  H HD1  . TYR A 1 31 ? 2.646   -10.116 8.066   1.00 0.00 ? 31 TYR A HD1  9  
ATOM 9405  H HD2  . TYR A 1 31 ? 2.995   -11.233 3.976   1.00 0.00 ? 31 TYR A HD2  9  
ATOM 9406  H HE1  . TYR A 1 31 ? 5.091   -9.896  8.221   1.00 0.00 ? 31 TYR A HE1  9  
ATOM 9407  H HE2  . TYR A 1 31 ? 5.441   -11.017 4.119   1.00 0.00 ? 31 TYR A HE2  9  
ATOM 9408  H HH   . TYR A 1 31 ? 7.195   -10.916 5.633   1.00 0.00 ? 31 TYR A HH   9  
ATOM 9409  N N    . LEU A 1 32 ? -1.663  -9.726  4.339   1.00 0.00 ? 32 LEU A N    9  
ATOM 9410  C CA   . LEU A 1 32 ? -3.102  -9.919  4.195   1.00 0.00 ? 32 LEU A CA   9  
ATOM 9411  C C    . LEU A 1 32 ? -3.409  -11.262 3.541   1.00 0.00 ? 32 LEU A C    9  
ATOM 9412  O O    . LEU A 1 32 ? -2.672  -11.722 2.669   1.00 0.00 ? 32 LEU A O    9  
ATOM 9413  C CB   . LEU A 1 32 ? -3.708  -8.785  3.366   1.00 0.00 ? 32 LEU A CB   9  
ATOM 9414  C CG   . LEU A 1 32 ? -3.789  -7.421  4.052   1.00 0.00 ? 32 LEU A CG   9  
ATOM 9415  C CD1  . LEU A 1 32 ? -4.269  -6.359  3.075   1.00 0.00 ? 32 LEU A CD1  9  
ATOM 9416  C CD2  . LEU A 1 32 ? -4.707  -7.487  5.264   1.00 0.00 ? 32 LEU A CD2  9  
ATOM 9417  H H    . LEU A 1 32 ? -1.119  -9.586  3.537   1.00 0.00 ? 32 LEU A H    9  
ATOM 9418  H HA   . LEU A 1 32 ? -3.539  -9.905  5.183   1.00 0.00 ? 32 LEU A HA   9  
ATOM 9419  H HB2  . LEU A 1 32 ? -3.111  -8.672  2.474   1.00 0.00 ? 32 LEU A HB2  9  
ATOM 9420  H HB3  . LEU A 1 32 ? -4.712  -9.078  3.090   1.00 0.00 ? 32 LEU A HB3  9  
ATOM 9421  H HG   . LEU A 1 32 ? -2.803  -7.138  4.394   1.00 0.00 ? 32 LEU A HG   9  
ATOM 9422  H HD11 . LEU A 1 32 ? -5.333  -6.221  3.188   1.00 0.00 ? 32 LEU A HD11 9  
ATOM 9423  H HD12 . LEU A 1 32 ? -4.052  -6.676  2.065   1.00 0.00 ? 32 LEU A HD12 9  
ATOM 9424  H HD13 . LEU A 1 32 ? -3.760  -5.428  3.277   1.00 0.00 ? 32 LEU A HD13 9  
ATOM 9425  H HD21 . LEU A 1 32 ? -4.348  -8.243  5.946   1.00 0.00 ? 32 LEU A HD21 9  
ATOM 9426  H HD22 . LEU A 1 32 ? -5.708  -7.737  4.944   1.00 0.00 ? 32 LEU A HD22 9  
ATOM 9427  H HD23 . LEU A 1 32 ? -4.717  -6.528  5.761   1.00 0.00 ? 32 LEU A HD23 9  
ATOM 9428  N N    . ALA A 1 33 ? -4.502  -11.886 3.967   1.00 0.00 ? 33 ALA A N    9  
ATOM 9429  C CA   . ALA A 1 33 ? -4.909  -13.175 3.420   1.00 0.00 ? 33 ALA A CA   9  
ATOM 9430  C C    . ALA A 1 33 ? -5.451  -13.023 2.003   1.00 0.00 ? 33 ALA A C    9  
ATOM 9431  O O    . ALA A 1 33 ? -5.620  -11.908 1.508   1.00 0.00 ? 33 ALA A O    9  
ATOM 9432  C CB   . ALA A 1 33 ? -5.950  -13.825 4.320   1.00 0.00 ? 33 ALA A CB   9  
ATOM 9433  H H    . ALA A 1 33 ? -5.049  -11.470 4.666   1.00 0.00 ? 33 ALA A H    9  
ATOM 9434  H HA   . ALA A 1 33 ? -4.039  -13.816 3.395   1.00 0.00 ? 33 ALA A HA   9  
ATOM 9435  H HB1  . ALA A 1 33 ? -5.794  -13.504 5.339   1.00 0.00 ? 33 ALA A HB1  9  
ATOM 9436  H HB2  . ALA A 1 33 ? -6.937  -13.533 3.996   1.00 0.00 ? 33 ALA A HB2  9  
ATOM 9437  H HB3  . ALA A 1 33 ? -5.854  -14.899 4.262   1.00 0.00 ? 33 ALA A HB3  9  
ATOM 9438  N N    . LEU A 1 34 ? -5.723  -14.150 1.355   1.00 0.00 ? 34 LEU A N    9  
ATOM 9439  C CA   . LEU A 1 34 ? -6.246  -14.143 -0.007  1.00 0.00 ? 34 LEU A CA   9  
ATOM 9440  C C    . LEU A 1 34 ? -7.471  -13.240 -0.114  1.00 0.00 ? 34 LEU A C    9  
ATOM 9441  O O    . LEU A 1 34 ? -7.490  -12.266 -0.868  1.00 0.00 ? 34 LEU A O    9  
ATOM 9442  C CB   . LEU A 1 34 ? -6.606  -15.564 -0.443  1.00 0.00 ? 34 LEU A CB   9  
ATOM 9443  C CG   . LEU A 1 34 ? -7.799  -15.693 -1.392  1.00 0.00 ? 34 LEU A CG   9  
ATOM 9444  C CD1  . LEU A 1 34 ? -7.445  -15.159 -2.771  1.00 0.00 ? 34 LEU A CD1  9  
ATOM 9445  C CD2  . LEU A 1 34 ? -8.256  -17.141 -1.480  1.00 0.00 ? 34 LEU A CD2  9  
ATOM 9446  H H    . LEU A 1 34 ? -5.568  -15.008 1.802   1.00 0.00 ? 34 LEU A H    9  
ATOM 9447  H HA   . LEU A 1 34 ? -5.473  -13.760 -0.656  1.00 0.00 ? 34 LEU A HA   9  
ATOM 9448  H HB2  . LEU A 1 34 ? -5.745  -15.986 -0.937  1.00 0.00 ? 34 LEU A HB2  9  
ATOM 9449  H HB3  . LEU A 1 34 ? -6.826  -16.137 0.446   1.00 0.00 ? 34 LEU A HB3  9  
ATOM 9450  H HG   . LEU A 1 34 ? -8.621  -15.104 -1.008  1.00 0.00 ? 34 LEU A HG   9  
ATOM 9451  H HD11 . LEU A 1 34 ? -7.680  -15.903 -3.516  1.00 0.00 ? 34 LEU A HD11 9  
ATOM 9452  H HD12 . LEU A 1 34 ? -6.389  -14.932 -2.809  1.00 0.00 ? 34 LEU A HD12 9  
ATOM 9453  H HD13 . LEU A 1 34 ? -8.012  -14.260 -2.966  1.00 0.00 ? 34 LEU A HD13 9  
ATOM 9454  H HD21 . LEU A 1 34 ? -7.397  -17.782 -1.612  1.00 0.00 ? 34 LEU A HD21 9  
ATOM 9455  H HD22 . LEU A 1 34 ? -8.924  -17.257 -2.321  1.00 0.00 ? 34 LEU A HD22 9  
ATOM 9456  H HD23 . LEU A 1 34 ? -8.771  -17.412 -0.570  1.00 0.00 ? 34 LEU A HD23 9  
ATOM 9457  N N    . PRO A 1 35 ? -8.517  -13.567 0.658   1.00 0.00 ? 35 PRO A N    9  
ATOM 9458  C CA   . PRO A 1 35 ? -9.764  -12.797 0.670   1.00 0.00 ? 35 PRO A CA   9  
ATOM 9459  C C    . PRO A 1 35 ? -9.593  -11.425 1.314   1.00 0.00 ? 35 PRO A C    9  
ATOM 9460  O O    . PRO A 1 35 ? -10.414 -10.530 1.117   1.00 0.00 ? 35 PRO A O    9  
ATOM 9461  C CB   . PRO A 1 35 ? -10.710 -13.665 1.504   1.00 0.00 ? 35 PRO A CB   9  
ATOM 9462  C CG   . PRO A 1 35 ? -9.813  -14.468 2.381   1.00 0.00 ? 35 PRO A CG   9  
ATOM 9463  C CD   . PRO A 1 35 ? -8.564  -14.714 1.580   1.00 0.00 ? 35 PRO A CD   9  
ATOM 9464  H HA   . PRO A 1 35 ? -10.166 -12.677 -0.326  1.00 0.00 ? 35 PRO A HA   9  
ATOM 9465  H HB2  . PRO A 1 35 ? -11.367 -13.031 2.083   1.00 0.00 ? 35 PRO A HB2  9  
ATOM 9466  H HB3  . PRO A 1 35 ? -11.293 -14.297 0.851   1.00 0.00 ? 35 PRO A HB3  9  
ATOM 9467  H HG2  . PRO A 1 35 ? -9.581  -13.911 3.276   1.00 0.00 ? 35 PRO A HG2  9  
ATOM 9468  H HG3  . PRO A 1 35 ? -10.288 -15.404 2.632   1.00 0.00 ? 35 PRO A HG3  9  
ATOM 9469  H HD2  . PRO A 1 35 ? -7.698  -14.725 2.226   1.00 0.00 ? 35 PRO A HD2  9  
ATOM 9470  H HD3  . PRO A 1 35 ? -8.642  -15.643 1.035   1.00 0.00 ? 35 PRO A HD3  9  
ATOM 9471  N N    . GLU A 1 36 ? -8.520  -11.268 2.084   1.00 0.00 ? 36 GLU A N    9  
ATOM 9472  C CA   . GLU A 1 36 ? -8.242  -10.005 2.757   1.00 0.00 ? 36 GLU A CA   9  
ATOM 9473  C C    . GLU A 1 36 ? -7.684  -8.977  1.777   1.00 0.00 ? 36 GLU A C    9  
ATOM 9474  O O    . GLU A 1 36 ? -8.180  -7.854  1.690   1.00 0.00 ? 36 GLU A O    9  
ATOM 9475  C CB   . GLU A 1 36 ? -7.254  -10.220 3.905   1.00 0.00 ? 36 GLU A CB   9  
ATOM 9476  C CG   . GLU A 1 36 ? -7.922  -10.545 5.231   1.00 0.00 ? 36 GLU A CG   9  
ATOM 9477  C CD   . GLU A 1 36 ? -8.821  -11.764 5.147   1.00 0.00 ? 36 GLU A CD   9  
ATOM 9478  O OE1  . GLU A 1 36 ? -9.786  -11.737 4.356   1.00 0.00 ? 36 GLU A OE1  9  
ATOM 9479  O OE2  . GLU A 1 36 ? -8.557  -12.745 5.874   1.00 0.00 ? 36 GLU A OE2  9  
ATOM 9480  H H    . GLU A 1 36 ? -7.902  -12.019 2.202   1.00 0.00 ? 36 GLU A H    9  
ATOM 9481  H HA   . GLU A 1 36 ? -9.172  -9.632  3.160   1.00 0.00 ? 36 GLU A HA   9  
ATOM 9482  H HB2  . GLU A 1 36 ? -6.594  -11.035 3.648   1.00 0.00 ? 36 GLU A HB2  9  
ATOM 9483  H HB3  . GLU A 1 36 ? -6.669  -9.321  4.033   1.00 0.00 ? 36 GLU A HB3  9  
ATOM 9484  H HG2  . GLU A 1 36 ? -7.157  -10.732 5.969   1.00 0.00 ? 36 GLU A HG2  9  
ATOM 9485  H HG3  . GLU A 1 36 ? -8.518  -9.698  5.537   1.00 0.00 ? 36 GLU A HG3  9  
ATOM 9486  N N    . ARG A 1 37 ? -6.649  -9.371  1.041   1.00 0.00 ? 37 ARG A N    9  
ATOM 9487  C CA   . ARG A 1 37 ? -6.022  -8.485  0.069   1.00 0.00 ? 37 ARG A CA   9  
ATOM 9488  C C    . ARG A 1 37 ? -7.036  -8.011  -0.969  1.00 0.00 ? 37 ARG A C    9  
ATOM 9489  O O    . ARG A 1 37 ? -6.998  -6.863  -1.409  1.00 0.00 ? 37 ARG A O    9  
ATOM 9490  C CB   . ARG A 1 37 ? -4.860  -9.196  -0.626  1.00 0.00 ? 37 ARG A CB   9  
ATOM 9491  C CG   . ARG A 1 37 ? -4.154  -8.339  -1.664  1.00 0.00 ? 37 ARG A CG   9  
ATOM 9492  C CD   . ARG A 1 37 ? -3.175  -9.158  -2.491  1.00 0.00 ? 37 ARG A CD   9  
ATOM 9493  N NE   . ARG A 1 37 ? -3.645  -10.525 -2.699  1.00 0.00 ? 37 ARG A NE   9  
ATOM 9494  C CZ   . ARG A 1 37 ? -3.446  -11.510 -1.830  1.00 0.00 ? 37 ARG A CZ   9  
ATOM 9495  N NH1  . ARG A 1 37 ? -2.791  -11.281 -0.701  1.00 0.00 ? 37 ARG A NH1  9  
ATOM 9496  N NH2  . ARG A 1 37 ? -3.904  -12.728 -2.090  1.00 0.00 ? 37 ARG A NH2  9  
ATOM 9497  H H    . ARG A 1 37 ? -6.299  -10.279 1.156   1.00 0.00 ? 37 ARG A H    9  
ATOM 9498  H HA   . ARG A 1 37 ? -5.641  -7.626  0.600   1.00 0.00 ? 37 ARG A HA   9  
ATOM 9499  H HB2  . ARG A 1 37 ? -4.135  -9.490  0.119   1.00 0.00 ? 37 ARG A HB2  9  
ATOM 9500  H HB3  . ARG A 1 37 ? -5.237  -10.080 -1.118  1.00 0.00 ? 37 ARG A HB3  9  
ATOM 9501  H HG2  . ARG A 1 37 ? -4.892  -7.907  -2.323  1.00 0.00 ? 37 ARG A HG2  9  
ATOM 9502  H HG3  . ARG A 1 37 ? -3.614  -7.551  -1.159  1.00 0.00 ? 37 ARG A HG3  9  
ATOM 9503  H HD2  . ARG A 1 37 ? -3.049  -8.681  -3.451  1.00 0.00 ? 37 ARG A HD2  9  
ATOM 9504  H HD3  . ARG A 1 37 ? -2.226  -9.187  -1.976  1.00 0.00 ? 37 ARG A HD3  9  
ATOM 9505  H HE   . ARG A 1 37 ? -4.131  -10.717 -3.527  1.00 0.00 ? 37 ARG A HE   9  
ATOM 9506  H HH11 . ARG A 1 37 ? -2.446  -10.364 -0.501  1.00 0.00 ? 37 ARG A HH11 9  
ATOM 9507  H HH12 . ARG A 1 37 ? -2.644  -12.024 -0.047  1.00 0.00 ? 37 ARG A HH12 9  
ATOM 9508  H HH21 . ARG A 1 37 ? -4.399  -12.905 -2.941  1.00 0.00 ? 37 ARG A HH21 9  
ATOM 9509  H HH22 . ARG A 1 37 ? -3.754  -13.469 -1.436  1.00 0.00 ? 37 ARG A HH22 9  
ATOM 9510  N N    . ALA A 1 38 ? -7.941  -8.905  -1.355  1.00 0.00 ? 38 ALA A N    9  
ATOM 9511  C CA   . ALA A 1 38 ? -8.966  -8.578  -2.338  1.00 0.00 ? 38 ALA A CA   9  
ATOM 9512  C C    . ALA A 1 38 ? -9.880  -7.468  -1.832  1.00 0.00 ? 38 ALA A C    9  
ATOM 9513  O O    . ALA A 1 38 ? -10.129 -6.488  -2.534  1.00 0.00 ? 38 ALA A O    9  
ATOM 9514  C CB   . ALA A 1 38 ? -9.779  -9.817  -2.684  1.00 0.00 ? 38 ALA A CB   9  
ATOM 9515  H H    . ALA A 1 38 ? -7.920  -9.804  -0.967  1.00 0.00 ? 38 ALA A H    9  
ATOM 9516  H HA   . ALA A 1 38 ? -8.470  -8.241  -3.237  1.00 0.00 ? 38 ALA A HA   9  
ATOM 9517  H HB1  . ALA A 1 38 ? -9.465  -10.195 -3.646  1.00 0.00 ? 38 ALA A HB1  9  
ATOM 9518  H HB2  . ALA A 1 38 ? -9.621  -10.573 -1.930  1.00 0.00 ? 38 ALA A HB2  9  
ATOM 9519  H HB3  . ALA A 1 38 ? -10.827 -9.560  -2.723  1.00 0.00 ? 38 ALA A HB3  9  
ATOM 9520  N N    . GLU A 1 39 ? -10.376 -7.628  -0.609  1.00 0.00 ? 39 GLU A N    9  
ATOM 9521  C CA   . GLU A 1 39 ? -11.264 -6.638  -0.010  1.00 0.00 ? 39 GLU A CA   9  
ATOM 9522  C C    . GLU A 1 39 ? -10.805 -5.222  -0.346  1.00 0.00 ? 39 GLU A C    9  
ATOM 9523  O O    . GLU A 1 39 ? -11.610 -4.369  -0.722  1.00 0.00 ? 39 GLU A O    9  
ATOM 9524  C CB   . GLU A 1 39 ? -11.319 -6.822  1.508   1.00 0.00 ? 39 GLU A CB   9  
ATOM 9525  C CG   . GLU A 1 39 ? -12.202 -7.976  1.950   1.00 0.00 ? 39 GLU A CG   9  
ATOM 9526  C CD   . GLU A 1 39 ? -12.777 -7.773  3.338   1.00 0.00 ? 39 GLU A CD   9  
ATOM 9527  O OE1  . GLU A 1 39 ? -13.506 -6.779  3.538   1.00 0.00 ? 39 GLU A OE1  9  
ATOM 9528  O OE2  . GLU A 1 39 ? -12.498 -8.607  4.225   1.00 0.00 ? 39 GLU A OE2  9  
ATOM 9529  H H    . GLU A 1 39 ? -10.141 -8.430  -0.098  1.00 0.00 ? 39 GLU A H    9  
ATOM 9530  H HA   . GLU A 1 39 ? -12.252 -6.789  -0.417  1.00 0.00 ? 39 GLU A HA   9  
ATOM 9531  H HB2  . GLU A 1 39 ? -10.318 -7.000  1.873   1.00 0.00 ? 39 GLU A HB2  9  
ATOM 9532  H HB3  . GLU A 1 39 ? -11.698 -5.915  1.954   1.00 0.00 ? 39 GLU A HB3  9  
ATOM 9533  H HG2  . GLU A 1 39 ? -13.018 -8.077  1.250   1.00 0.00 ? 39 GLU A HG2  9  
ATOM 9534  H HG3  . GLU A 1 39 ? -11.615 -8.883  1.949   1.00 0.00 ? 39 GLU A HG3  9  
ATOM 9535  N N    . LEU A 1 40 ? -9.507  -4.978  -0.206  1.00 0.00 ? 40 LEU A N    9  
ATOM 9536  C CA   . LEU A 1 40 ? -8.939  -3.666  -0.494  1.00 0.00 ? 40 LEU A CA   9  
ATOM 9537  C C    . LEU A 1 40 ? -9.101  -3.314  -1.969  1.00 0.00 ? 40 LEU A C    9  
ATOM 9538  O O    . LEU A 1 40 ? -9.464  -2.190  -2.314  1.00 0.00 ? 40 LEU A O    9  
ATOM 9539  C CB   . LEU A 1 40 ? -7.459  -3.633  -0.109  1.00 0.00 ? 40 LEU A CB   9  
ATOM 9540  C CG   . LEU A 1 40 ? -7.119  -4.136  1.295   1.00 0.00 ? 40 LEU A CG   9  
ATOM 9541  C CD1  . LEU A 1 40 ? -5.797  -3.551  1.766   1.00 0.00 ? 40 LEU A CD1  9  
ATOM 9542  C CD2  . LEU A 1 40 ? -8.235  -3.790  2.270   1.00 0.00 ? 40 LEU A CD2  9  
ATOM 9543  H H    . LEU A 1 40 ? -8.915  -5.698  0.097   1.00 0.00 ? 40 LEU A H    9  
ATOM 9544  H HA   . LEU A 1 40 ? -9.473  -2.937  0.098   1.00 0.00 ? 40 LEU A HA   9  
ATOM 9545  H HB2  . LEU A 1 40 ? -6.920  -4.241  -0.818  1.00 0.00 ? 40 LEU A HB2  9  
ATOM 9546  H HB3  . LEU A 1 40 ? -7.121  -2.609  -0.185  1.00 0.00 ? 40 LEU A HB3  9  
ATOM 9547  H HG   . LEU A 1 40 ? -7.017  -5.212  1.269   1.00 0.00 ? 40 LEU A HG   9  
ATOM 9548  H HD11 . LEU A 1 40 ? -4.991  -3.961  1.176   1.00 0.00 ? 40 LEU A HD11 9  
ATOM 9549  H HD12 . LEU A 1 40 ? -5.644  -3.799  2.806   1.00 0.00 ? 40 LEU A HD12 9  
ATOM 9550  H HD13 . LEU A 1 40 ? -5.818  -2.477  1.651   1.00 0.00 ? 40 LEU A HD13 9  
ATOM 9551  H HD21 . LEU A 1 40 ? -9.051  -4.487  2.144   1.00 0.00 ? 40 LEU A HD21 9  
ATOM 9552  H HD22 . LEU A 1 40 ? -8.586  -2.787  2.075   1.00 0.00 ? 40 LEU A HD22 9  
ATOM 9553  H HD23 . LEU A 1 40 ? -7.861  -3.851  3.281   1.00 0.00 ? 40 LEU A HD23 9  
ATOM 9554  N N    . ALA A 1 41 ? -8.829  -4.284  -2.836  1.00 0.00 ? 41 ALA A N    9  
ATOM 9555  C CA   . ALA A 1 41 ? -8.948  -4.078  -4.275  1.00 0.00 ? 41 ALA A CA   9  
ATOM 9556  C C    . ALA A 1 41 ? -10.411 -4.007  -4.700  1.00 0.00 ? 41 ALA A C    9  
ATOM 9557  O O    . ALA A 1 41 ? -10.729 -3.521  -5.784  1.00 0.00 ? 41 ALA A O    9  
ATOM 9558  C CB   . ALA A 1 41 ? -8.231  -5.189  -5.028  1.00 0.00 ? 41 ALA A CB   9  
ATOM 9559  H H    . ALA A 1 41 ? -8.544  -5.159  -2.501  1.00 0.00 ? 41 ALA A H    9  
ATOM 9560  H HA   . ALA A 1 41 ? -8.467  -3.142  -4.519  1.00 0.00 ? 41 ALA A HA   9  
ATOM 9561  H HB1  . ALA A 1 41 ? -8.780  -5.425  -5.928  1.00 0.00 ? 41 ALA A HB1  9  
ATOM 9562  H HB2  . ALA A 1 41 ? -7.235  -4.862  -5.288  1.00 0.00 ? 41 ALA A HB2  9  
ATOM 9563  H HB3  . ALA A 1 41 ? -8.171  -6.067  -4.402  1.00 0.00 ? 41 ALA A HB3  9  
ATOM 9564  N N    . ALA A 1 42 ? -11.297 -4.496  -3.838  1.00 0.00 ? 42 ALA A N    9  
ATOM 9565  C CA   . ALA A 1 42 ? -12.726 -4.486  -4.124  1.00 0.00 ? 42 ALA A CA   9  
ATOM 9566  C C    . ALA A 1 42 ? -13.408 -3.285  -3.477  1.00 0.00 ? 42 ALA A C    9  
ATOM 9567  O O    . ALA A 1 42 ? -14.445 -2.819  -3.950  1.00 0.00 ? 42 ALA A O    9  
ATOM 9568  C CB   . ALA A 1 42 ? -13.369 -5.781  -3.647  1.00 0.00 ? 42 ALA A CB   9  
ATOM 9569  H H    . ALA A 1 42 ? -10.982 -4.870  -2.989  1.00 0.00 ? 42 ALA A H    9  
ATOM 9570  H HA   . ALA A 1 42 ? -12.852 -4.425  -5.196  1.00 0.00 ? 42 ALA A HA   9  
ATOM 9571  H HB1  . ALA A 1 42 ? -14.341 -5.565  -3.227  1.00 0.00 ? 42 ALA A HB1  9  
ATOM 9572  H HB2  . ALA A 1 42 ? -13.479 -6.457  -4.482  1.00 0.00 ? 42 ALA A HB2  9  
ATOM 9573  H HB3  . ALA A 1 42 ? -12.744 -6.236  -2.894  1.00 0.00 ? 42 ALA A HB3  9  
ATOM 9574  N N    . SER A 1 43 ? -12.819 -2.789  -2.394  1.00 0.00 ? 43 SER A N    9  
ATOM 9575  C CA   . SER A 1 43 ? -13.372 -1.645  -1.680  1.00 0.00 ? 43 SER A CA   9  
ATOM 9576  C C    . SER A 1 43 ? -12.777 -0.340  -2.200  1.00 0.00 ? 43 SER A C    9  
ATOM 9577  O O    . SER A 1 43 ? -13.504 0.580   -2.578  1.00 0.00 ? 43 SER A O    9  
ATOM 9578  C CB   . SER A 1 43 ? -13.106 -1.777  -0.179  1.00 0.00 ? 43 SER A CB   9  
ATOM 9579  O OG   . SER A 1 43 ? -13.810 -0.787  0.553   1.00 0.00 ? 43 SER A OG   9  
ATOM 9580  H H    . SER A 1 43 ? -11.994 -3.205  -2.066  1.00 0.00 ? 43 SER A H    9  
ATOM 9581  H HA   . SER A 1 43 ? -14.439 -1.633  -1.848  1.00 0.00 ? 43 SER A HA   9  
ATOM 9582  H HB2  . SER A 1 43 ? -13.427 -2.751  0.157   1.00 0.00 ? 43 SER A HB2  9  
ATOM 9583  H HB3  . SER A 1 43 ? -12.048 -1.662  0.008   1.00 0.00 ? 43 SER A HB3  9  
ATOM 9584  H HG   . SER A 1 43 ? -14.712 -1.080  0.702   1.00 0.00 ? 43 SER A HG   9  
ATOM 9585  N N    . LEU A 1 44 ? -11.451 -0.267  -2.218  1.00 0.00 ? 44 LEU A N    9  
ATOM 9586  C CA   . LEU A 1 44 ? -10.756 0.924   -2.692  1.00 0.00 ? 44 LEU A CA   9  
ATOM 9587  C C    . LEU A 1 44 ? -10.872 1.055   -4.208  1.00 0.00 ? 44 LEU A C    9  
ATOM 9588  O O    . LEU A 1 44 ? -10.642 2.126   -4.768  1.00 0.00 ? 44 LEU A O    9  
ATOM 9589  C CB   . LEU A 1 44 ? -9.283  0.876   -2.284  1.00 0.00 ? 44 LEU A CB   9  
ATOM 9590  C CG   . LEU A 1 44 ? -8.996  0.402   -0.859  1.00 0.00 ? 44 LEU A CG   9  
ATOM 9591  C CD1  . LEU A 1 44 ? -7.510  0.502   -0.552  1.00 0.00 ? 44 LEU A CD1  9  
ATOM 9592  C CD2  . LEU A 1 44 ? -9.806  1.209   0.145   1.00 0.00 ? 44 LEU A CD2  9  
ATOM 9593  H H    . LEU A 1 44 ? -10.926 -1.033  -1.905  1.00 0.00 ? 44 LEU A H    9  
ATOM 9594  H HA   . LEU A 1 44 ? -11.221 1.784   -2.232  1.00 0.00 ? 44 LEU A HA   9  
ATOM 9595  H HB2  . LEU A 1 44 ? -8.774  0.210   -2.963  1.00 0.00 ? 44 LEU A HB2  9  
ATOM 9596  H HB3  . LEU A 1 44 ? -8.878  1.873   -2.390  1.00 0.00 ? 44 LEU A HB3  9  
ATOM 9597  H HG   . LEU A 1 44 ? -9.286  -0.636  -0.767  1.00 0.00 ? 44 LEU A HG   9  
ATOM 9598  H HD11 . LEU A 1 44 ? -7.186  1.524   -0.673  1.00 0.00 ? 44 LEU A HD11 9  
ATOM 9599  H HD12 . LEU A 1 44 ? -6.959  -0.133  -1.229  1.00 0.00 ? 44 LEU A HD12 9  
ATOM 9600  H HD13 . LEU A 1 44 ? -7.331  0.184   0.465   1.00 0.00 ? 44 LEU A HD13 9  
ATOM 9601  H HD21 . LEU A 1 44 ? -9.356  2.183   0.269   1.00 0.00 ? 44 LEU A HD21 9  
ATOM 9602  H HD22 . LEU A 1 44 ? -9.818  0.694   1.095   1.00 0.00 ? 44 LEU A HD22 9  
ATOM 9603  H HD23 . LEU A 1 44 ? -10.817 1.323   -0.217  1.00 0.00 ? 44 LEU A HD23 9  
ATOM 9604  N N    . GLY A 1 45 ? -11.233 -0.042  -4.866  1.00 0.00 ? 45 GLY A N    9  
ATOM 9605  C CA   . GLY A 1 45 ? -11.375 -0.029  -6.310  1.00 0.00 ? 45 GLY A CA   9  
ATOM 9606  C C    . GLY A 1 45 ? -10.065 -0.296  -7.024  1.00 0.00 ? 45 GLY A C    9  
ATOM 9607  O O    . GLY A 1 45 ? -9.898  0.070   -8.188  1.00 0.00 ? 45 GLY A O    9  
ATOM 9608  H H    . GLY A 1 45 ? -11.404 -0.868  -4.366  1.00 0.00 ? 45 GLY A H    9  
ATOM 9609  H HA2  . GLY A 1 45 ? -12.091 -0.784  -6.597  1.00 0.00 ? 45 GLY A HA2  9  
ATOM 9610  H HA3  . GLY A 1 45 ? -11.746 0.939   -6.614  1.00 0.00 ? 45 GLY A HA3  9  
ATOM 9611  N N    . LEU A 1 46 ? -9.133  -0.935  -6.326  1.00 0.00 ? 46 LEU A N    9  
ATOM 9612  C CA   . LEU A 1 46 ? -7.829  -1.251  -6.900  1.00 0.00 ? 46 LEU A CA   9  
ATOM 9613  C C    . LEU A 1 46 ? -7.726  -2.736  -7.233  1.00 0.00 ? 46 LEU A C    9  
ATOM 9614  O O    . LEU A 1 46 ? -8.659  -3.503  -6.996  1.00 0.00 ? 46 LEU A O    9  
ATOM 9615  C CB   . LEU A 1 46 ? -6.714  -0.854  -5.932  1.00 0.00 ? 46 LEU A CB   9  
ATOM 9616  C CG   . LEU A 1 46 ? -6.773  0.574   -5.388  1.00 0.00 ? 46 LEU A CG   9  
ATOM 9617  C CD1  . LEU A 1 46 ? -6.161  0.642   -3.998  1.00 0.00 ? 46 LEU A CD1  9  
ATOM 9618  C CD2  . LEU A 1 46 ? -6.064  1.534   -6.333  1.00 0.00 ? 46 LEU A CD2  9  
ATOM 9619  H H    . LEU A 1 46 ? -9.324  -1.202  -5.403  1.00 0.00 ? 46 LEU A H    9  
ATOM 9620  H HA   . LEU A 1 46 ? -7.723  -0.682  -7.812  1.00 0.00 ? 46 LEU A HA   9  
ATOM 9621  H HB2  . LEU A 1 46 ? -6.751  -1.529  -5.091  1.00 0.00 ? 46 LEU A HB2  9  
ATOM 9622  H HB3  . LEU A 1 46 ? -5.772  -0.974  -6.447  1.00 0.00 ? 46 LEU A HB3  9  
ATOM 9623  H HG   . LEU A 1 46 ? -7.807  0.881   -5.312  1.00 0.00 ? 46 LEU A HG   9  
ATOM 9624  H HD11 . LEU A 1 46 ? -5.093  0.504   -4.068  1.00 0.00 ? 46 LEU A HD11 9  
ATOM 9625  H HD12 . LEU A 1 46 ? -6.585  -0.136  -3.380  1.00 0.00 ? 46 LEU A HD12 9  
ATOM 9626  H HD13 . LEU A 1 46 ? -6.372  1.606   -3.559  1.00 0.00 ? 46 LEU A HD13 9  
ATOM 9627  H HD21 . LEU A 1 46 ? -6.143  2.540   -5.948  1.00 0.00 ? 46 LEU A HD21 9  
ATOM 9628  H HD22 . LEU A 1 46 ? -6.526  1.485   -7.309  1.00 0.00 ? 46 LEU A HD22 9  
ATOM 9629  H HD23 . LEU A 1 46 ? -5.024  1.258   -6.412  1.00 0.00 ? 46 LEU A HD23 9  
ATOM 9630  N N    . THR A 1 47 ? -6.583  -3.136  -7.781  1.00 0.00 ? 47 THR A N    9  
ATOM 9631  C CA   . THR A 1 47 ? -6.356  -4.529  -8.144  1.00 0.00 ? 47 THR A CA   9  
ATOM 9632  C C    . THR A 1 47 ? -5.318  -5.174  -7.232  1.00 0.00 ? 47 THR A C    9  
ATOM 9633  O O    . THR A 1 47 ? -4.515  -4.483  -6.607  1.00 0.00 ? 47 THR A O    9  
ATOM 9634  C CB   . THR A 1 47 ? -5.889  -4.659  -9.606  1.00 0.00 ? 47 THR A CB   9  
ATOM 9635  O OG1  . THR A 1 47 ? -5.462  -6.001  -9.867  1.00 0.00 ? 47 THR A OG1  9  
ATOM 9636  C CG2  . THR A 1 47 ? -4.750  -3.694  -9.899  1.00 0.00 ? 47 THR A CG2  9  
ATOM 9637  H H    . THR A 1 47 ? -5.876  -2.477  -7.945  1.00 0.00 ? 47 THR A H    9  
ATOM 9638  H HA   . THR A 1 47 ? -7.292  -5.058  -8.039  1.00 0.00 ? 47 THR A HA   9  
ATOM 9639  H HB   . THR A 1 47 ? -6.719  -4.421  -10.256 1.00 0.00 ? 47 THR A HB   9  
ATOM 9640  H HG1  . THR A 1 47 ? -6.219  -6.534  -10.123 1.00 0.00 ? 47 THR A HG1  9  
ATOM 9641  H HG21 . THR A 1 47 ? -4.280  -3.965  -10.832 1.00 0.00 ? 47 THR A HG21 9  
ATOM 9642  H HG22 . THR A 1 47 ? -4.024  -3.742  -9.102  1.00 0.00 ? 47 THR A HG22 9  
ATOM 9643  H HG23 . THR A 1 47 ? -5.140  -2.690  -9.971  1.00 0.00 ? 47 THR A HG23 9  
ATOM 9644  N N    . GLN A 1 48 ? -5.341  -6.501  -7.162  1.00 0.00 ? 48 GLN A N    9  
ATOM 9645  C CA   . GLN A 1 48 ? -4.401  -7.238  -6.326  1.00 0.00 ? 48 GLN A CA   9  
ATOM 9646  C C    . GLN A 1 48 ? -2.963  -6.856  -6.658  1.00 0.00 ? 48 GLN A C    9  
ATOM 9647  O O    . GLN A 1 48 ? -2.078  -6.924  -5.804  1.00 0.00 ? 48 GLN A O    9  
ATOM 9648  C CB   . GLN A 1 48 ? -4.597  -8.744  -6.507  1.00 0.00 ? 48 GLN A CB   9  
ATOM 9649  C CG   . GLN A 1 48 ? -5.886  -9.268  -5.895  1.00 0.00 ? 48 GLN A CG   9  
ATOM 9650  C CD   . GLN A 1 48 ? -6.336  -10.577 -6.513  1.00 0.00 ? 48 GLN A CD   9  
ATOM 9651  O OE1  . GLN A 1 48 ? -5.868  -10.964 -7.585  1.00 0.00 ? 48 GLN A OE1  9  
ATOM 9652  N NE2  . GLN A 1 48 ? -7.248  -11.268 -5.840  1.00 0.00 ? 48 GLN A NE2  9  
ATOM 9653  H H    . GLN A 1 48 ? -6.006  -6.995  -7.685  1.00 0.00 ? 48 GLN A H    9  
ATOM 9654  H HA   . GLN A 1 48 ? -4.601  -6.979  -5.297  1.00 0.00 ? 48 GLN A HA   9  
ATOM 9655  H HB2  . GLN A 1 48 ? -4.607  -8.969  -7.563  1.00 0.00 ? 48 GLN A HB2  9  
ATOM 9656  H HB3  . GLN A 1 48 ? -3.769  -9.261  -6.045  1.00 0.00 ? 48 GLN A HB3  9  
ATOM 9657  H HG2  . GLN A 1 48 ? -5.731  -9.422  -4.838  1.00 0.00 ? 48 GLN A HG2  9  
ATOM 9658  H HG3  . GLN A 1 48 ? -6.663  -8.532  -6.040  1.00 0.00 ? 48 GLN A HG3  9  
ATOM 9659  H HE21 . GLN A 1 48 ? -7.576  -10.897 -4.993  1.00 0.00 ? 48 GLN A HE21 9  
ATOM 9660  H HE22 . GLN A 1 48 ? -7.557  -12.117 -6.216  1.00 0.00 ? 48 GLN A HE22 9  
ATOM 9661  N N    . THR A 1 49 ? -2.734  -6.455  -7.905  1.00 0.00 ? 49 THR A N    9  
ATOM 9662  C CA   . THR A 1 49 ? -1.403  -6.064  -8.350  1.00 0.00 ? 49 THR A CA   9  
ATOM 9663  C C    . THR A 1 49 ? -1.030  -4.683  -7.824  1.00 0.00 ? 49 THR A C    9  
ATOM 9664  O O    . THR A 1 49 ? 0.146   -4.325  -7.774  1.00 0.00 ? 49 THR A O    9  
ATOM 9665  C CB   . THR A 1 49 ? -1.304  -6.059  -9.887  1.00 0.00 ? 49 THR A CB   9  
ATOM 9666  O OG1  . THR A 1 49 ? -1.814  -7.289  -10.415 1.00 0.00 ? 49 THR A OG1  9  
ATOM 9667  C CG2  . THR A 1 49 ? 0.137   -5.868  -10.336 1.00 0.00 ? 49 THR A CG2  9  
ATOM 9668  H H    . THR A 1 49 ? -3.480  -6.422  -8.539  1.00 0.00 ? 49 THR A H    9  
ATOM 9669  H HA   . THR A 1 49 ? -0.697  -6.787  -7.967  1.00 0.00 ? 49 THR A HA   9  
ATOM 9670  H HB   . THR A 1 49 ? -1.896  -5.240  -10.269 1.00 0.00 ? 49 THR A HB   9  
ATOM 9671  H HG1  . THR A 1 49 ? -1.122  -7.955  -10.400 1.00 0.00 ? 49 THR A HG1  9  
ATOM 9672  H HG21 . THR A 1 49 ? 0.380   -4.815  -10.330 1.00 0.00 ? 49 THR A HG21 9  
ATOM 9673  H HG22 . THR A 1 49 ? 0.258   -6.259  -11.335 1.00 0.00 ? 49 THR A HG22 9  
ATOM 9674  H HG23 . THR A 1 49 ? 0.796   -6.393  -9.661  1.00 0.00 ? 49 THR A HG23 9  
ATOM 9675  N N    . GLN A 1 50 ? -2.040  -3.912  -7.432  1.00 0.00 ? 50 GLN A N    9  
ATOM 9676  C CA   . GLN A 1 50 ? -1.816  -2.569  -6.910  1.00 0.00 ? 50 GLN A CA   9  
ATOM 9677  C C    . GLN A 1 50 ? -1.633  -2.598  -5.396  1.00 0.00 ? 50 GLN A C    9  
ATOM 9678  O O    . GLN A 1 50 ? -0.678  -2.030  -4.865  1.00 0.00 ? 50 GLN A O    9  
ATOM 9679  C CB   . GLN A 1 50 ? -2.987  -1.655  -7.276  1.00 0.00 ? 50 GLN A CB   9  
ATOM 9680  C CG   . GLN A 1 50 ? -2.907  -1.099  -8.688  1.00 0.00 ? 50 GLN A CG   9  
ATOM 9681  C CD   . GLN A 1 50 ? -3.557  0.264   -8.817  1.00 0.00 ? 50 GLN A CD   9  
ATOM 9682  O OE1  . GLN A 1 50 ? -3.044  1.260   -8.307  1.00 0.00 ? 50 GLN A OE1  9  
ATOM 9683  N NE2  . GLN A 1 50 ? -4.694  0.316   -9.502  1.00 0.00 ? 50 GLN A NE2  9  
ATOM 9684  H H    . GLN A 1 50 ? -2.955  -4.254  -7.496  1.00 0.00 ? 50 GLN A H    9  
ATOM 9685  H HA   . GLN A 1 50 ? -0.916  -2.183  -7.362  1.00 0.00 ? 50 GLN A HA   9  
ATOM 9686  H HB2  . GLN A 1 50 ? -3.907  -2.214  -7.183  1.00 0.00 ? 50 GLN A HB2  9  
ATOM 9687  H HB3  . GLN A 1 50 ? -3.009  -0.824  -6.586  1.00 0.00 ? 50 GLN A HB3  9  
ATOM 9688  H HG2  . GLN A 1 50 ? -1.867  -1.013  -8.969  1.00 0.00 ? 50 GLN A HG2  9  
ATOM 9689  H HG3  . GLN A 1 50 ? -3.404  -1.784  -9.359  1.00 0.00 ? 50 GLN A HG3  9  
ATOM 9690  H HE21 . GLN A 1 50 ? -5.044  -0.518  -9.879  1.00 0.00 ? 50 GLN A HE21 9  
ATOM 9691  H HE22 . GLN A 1 50 ? -5.136  1.184   -9.600  1.00 0.00 ? 50 GLN A HE22 9  
ATOM 9692  N N    . VAL A 1 51 ? -2.554  -3.262  -4.705  1.00 0.00 ? 51 VAL A N    9  
ATOM 9693  C CA   . VAL A 1 51 ? -2.493  -3.365  -3.252  1.00 0.00 ? 51 VAL A CA   9  
ATOM 9694  C C    . VAL A 1 51 ? -1.267  -4.156  -2.808  1.00 0.00 ? 51 VAL A C    9  
ATOM 9695  O O    . VAL A 1 51 ? -0.791  -4.006  -1.683  1.00 0.00 ? 51 VAL A O    9  
ATOM 9696  C CB   . VAL A 1 51 ? -3.757  -4.037  -2.684  1.00 0.00 ? 51 VAL A CB   9  
ATOM 9697  C CG1  . VAL A 1 51 ? -3.503  -4.547  -1.273  1.00 0.00 ? 51 VAL A CG1  9  
ATOM 9698  C CG2  . VAL A 1 51 ? -4.930  -3.069  -2.706  1.00 0.00 ? 51 VAL A CG2  9  
ATOM 9699  H H    . VAL A 1 51 ? -3.291  -3.694  -5.184  1.00 0.00 ? 51 VAL A H    9  
ATOM 9700  H HA   . VAL A 1 51 ? -2.429  -2.365  -2.848  1.00 0.00 ? 51 VAL A HA   9  
ATOM 9701  H HB   . VAL A 1 51 ? -4.003  -4.882  -3.309  1.00 0.00 ? 51 VAL A HB   9  
ATOM 9702  H HG11 . VAL A 1 51 ? -3.187  -3.727  -0.646  1.00 0.00 ? 51 VAL A HG11 9  
ATOM 9703  H HG12 . VAL A 1 51 ? -4.410  -4.977  -0.877  1.00 0.00 ? 51 VAL A HG12 9  
ATOM 9704  H HG13 . VAL A 1 51 ? -2.728  -5.299  -1.297  1.00 0.00 ? 51 VAL A HG13 9  
ATOM 9705  H HG21 . VAL A 1 51 ? -5.842  -3.614  -2.899  1.00 0.00 ? 51 VAL A HG21 9  
ATOM 9706  H HG22 . VAL A 1 51 ? -5.004  -2.570  -1.750  1.00 0.00 ? 51 VAL A HG22 9  
ATOM 9707  H HG23 . VAL A 1 51 ? -4.777  -2.335  -3.483  1.00 0.00 ? 51 VAL A HG23 9  
ATOM 9708  N N    . LYS A 1 52 ? -0.759  -5.000  -3.701  1.00 0.00 ? 52 LYS A N    9  
ATOM 9709  C CA   . LYS A 1 52 ? 0.413   -5.814  -3.403  1.00 0.00 ? 52 LYS A CA   9  
ATOM 9710  C C    . LYS A 1 52 ? 1.678   -4.963  -3.389  1.00 0.00 ? 52 LYS A C    9  
ATOM 9711  O O    . LYS A 1 52 ? 2.413   -4.942  -2.401  1.00 0.00 ? 52 LYS A O    9  
ATOM 9712  C CB   . LYS A 1 52 ? 0.553   -6.938  -4.433  1.00 0.00 ? 52 LYS A CB   9  
ATOM 9713  C CG   . LYS A 1 52 ? -0.170  -8.215  -4.042  1.00 0.00 ? 52 LYS A CG   9  
ATOM 9714  C CD   . LYS A 1 52 ? -0.302  -9.164  -5.221  1.00 0.00 ? 52 LYS A CD   9  
ATOM 9715  C CE   . LYS A 1 52 ? 1.042   -9.761  -5.609  1.00 0.00 ? 52 LYS A CE   9  
ATOM 9716  N NZ   . LYS A 1 52 ? 1.534   -10.729 -4.591  1.00 0.00 ? 52 LYS A NZ   9  
ATOM 9717  H H    . LYS A 1 52 ? -1.183  -5.076  -4.582  1.00 0.00 ? 52 LYS A H    9  
ATOM 9718  H HA   . LYS A 1 52 ? 0.275   -6.249  -2.425  1.00 0.00 ? 52 LYS A HA   9  
ATOM 9719  H HB2  . LYS A 1 52 ? 0.154   -6.597  -5.377  1.00 0.00 ? 52 LYS A HB2  9  
ATOM 9720  H HB3  . LYS A 1 52 ? 1.602   -7.167  -4.558  1.00 0.00 ? 52 LYS A HB3  9  
ATOM 9721  H HG2  . LYS A 1 52 ? 0.386   -8.707  -3.258  1.00 0.00 ? 52 LYS A HG2  9  
ATOM 9722  H HG3  . LYS A 1 52 ? -1.157  -7.963  -3.682  1.00 0.00 ? 52 LYS A HG3  9  
ATOM 9723  H HD2  . LYS A 1 52 ? -0.975  -9.965  -4.954  1.00 0.00 ? 52 LYS A HD2  9  
ATOM 9724  H HD3  . LYS A 1 52 ? -0.703  -8.622  -6.066  1.00 0.00 ? 52 LYS A HD3  9  
ATOM 9725  H HE2  . LYS A 1 52 ? 0.935   -10.270 -6.555  1.00 0.00 ? 52 LYS A HE2  9  
ATOM 9726  H HE3  . LYS A 1 52 ? 1.760   -8.961  -5.710  1.00 0.00 ? 52 LYS A HE3  9  
ATOM 9727  H HZ1  . LYS A 1 52 ? 2.421   -10.386 -4.171  1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 9728  H HZ2  . LYS A 1 52 ? 1.708   -11.655 -5.032  1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 9729  H HZ3  . LYS A 1 52 ? 0.828   -10.844 -3.836  1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 9730  N N    . ILE A 1 53 ? 1.926   -4.260  -4.490  1.00 0.00 ? 53 ILE A N    9  
ATOM 9731  C CA   . ILE A 1 53 ? 3.101   -3.405  -4.602  1.00 0.00 ? 53 ILE A CA   9  
ATOM 9732  C C    . ILE A 1 53 ? 3.108   -2.337  -3.514  1.00 0.00 ? 53 ILE A C    9  
ATOM 9733  O O    . ILE A 1 53 ? 4.169   -1.895  -3.071  1.00 0.00 ? 53 ILE A O    9  
ATOM 9734  C CB   . ILE A 1 53 ? 3.169   -2.720  -5.979  1.00 0.00 ? 53 ILE A CB   9  
ATOM 9735  C CG1  . ILE A 1 53 ? 3.181   -3.768  -7.094  1.00 0.00 ? 53 ILE A CG1  9  
ATOM 9736  C CG2  . ILE A 1 53 ? 4.400   -1.831  -6.068  1.00 0.00 ? 53 ILE A CG2  9  
ATOM 9737  C CD1  . ILE A 1 53 ? 3.217   -3.171  -8.484  1.00 0.00 ? 53 ILE A CD1  9  
ATOM 9738  H H    . ILE A 1 53 ? 1.303   -4.318  -5.244  1.00 0.00 ? 53 ILE A H    9  
ATOM 9739  H HA   . ILE A 1 53 ? 3.977   -4.027  -4.487  1.00 0.00 ? 53 ILE A HA   9  
ATOM 9740  H HB   . ILE A 1 53 ? 2.295   -2.096  -6.090  1.00 0.00 ? 53 ILE A HB   9  
ATOM 9741  H HG12 . ILE A 1 53 ? 4.051   -4.395  -6.981  1.00 0.00 ? 53 ILE A HG12 9  
ATOM 9742  H HG13 . ILE A 1 53 ? 2.291   -4.376  -7.016  1.00 0.00 ? 53 ILE A HG13 9  
ATOM 9743  H HG21 . ILE A 1 53 ? 4.562   -1.542  -7.096  1.00 0.00 ? 53 ILE A HG21 9  
ATOM 9744  H HG22 . ILE A 1 53 ? 4.249   -0.947  -5.466  1.00 0.00 ? 53 ILE A HG22 9  
ATOM 9745  H HG23 . ILE A 1 53 ? 5.262   -2.370  -5.705  1.00 0.00 ? 53 ILE A HG23 9  
ATOM 9746  H HD11 . ILE A 1 53 ? 2.940   -2.128  -8.435  1.00 0.00 ? 53 ILE A HD11 9  
ATOM 9747  H HD12 . ILE A 1 53 ? 4.213   -3.262  -8.890  1.00 0.00 ? 53 ILE A HD12 9  
ATOM 9748  H HD13 . ILE A 1 53 ? 2.520   -3.698  -9.120  1.00 0.00 ? 53 ILE A HD13 9  
ATOM 9749  N N    . TRP A 1 54 ? 1.919   -1.927  -3.087  1.00 0.00 ? 54 TRP A N    9  
ATOM 9750  C CA   . TRP A 1 54 ? 1.789   -0.911  -2.048  1.00 0.00 ? 54 TRP A CA   9  
ATOM 9751  C C    . TRP A 1 54 ? 2.294   -1.434  -0.708  1.00 0.00 ? 54 TRP A C    9  
ATOM 9752  O O    . TRP A 1 54 ? 3.115   -0.794  -0.051  1.00 0.00 ? 54 TRP A O    9  
ATOM 9753  C CB   . TRP A 1 54 ? 0.331   -0.467  -1.920  1.00 0.00 ? 54 TRP A CB   9  
ATOM 9754  C CG   . TRP A 1 54 ? 0.148   0.721   -1.026  1.00 0.00 ? 54 TRP A CG   9  
ATOM 9755  C CD1  . TRP A 1 54 ? -0.008  2.022   -1.412  1.00 0.00 ? 54 TRP A CD1  9  
ATOM 9756  C CD2  . TRP A 1 54 ? 0.104   0.717   0.406   1.00 0.00 ? 54 TRP A CD2  9  
ATOM 9757  N NE1  . TRP A 1 54 ? -0.147  2.827   -0.307  1.00 0.00 ? 54 TRP A NE1  9  
ATOM 9758  C CE2  . TRP A 1 54 ? -0.082  2.051   0.820   1.00 0.00 ? 54 TRP A CE2  9  
ATOM 9759  C CE3  . TRP A 1 54 ? 0.201   -0.282  1.377   1.00 0.00 ? 54 TRP A CE3  9  
ATOM 9760  C CZ2  . TRP A 1 54 ? -0.171  2.407   2.163   1.00 0.00 ? 54 TRP A CZ2  9  
ATOM 9761  C CZ3  . TRP A 1 54 ? 0.113   0.073   2.710   1.00 0.00 ? 54 TRP A CZ3  9  
ATOM 9762  C CH2  . TRP A 1 54 ? -0.072  1.408   3.093   1.00 0.00 ? 54 TRP A CH2  9  
ATOM 9763  H H    . TRP A 1 54 ? 1.110   -2.317  -3.478  1.00 0.00 ? 54 TRP A H    9  
ATOM 9764  H HA   . TRP A 1 54 ? 2.390   -0.062  -2.340  1.00 0.00 ? 54 TRP A HA   9  
ATOM 9765  H HB2  . TRP A 1 54 ? -0.048  -0.210  -2.898  1.00 0.00 ? 54 TRP A HB2  9  
ATOM 9766  H HB3  . TRP A 1 54 ? -0.251  -1.283  -1.516  1.00 0.00 ? 54 TRP A HB3  9  
ATOM 9767  H HD1  . TRP A 1 54 ? -0.018  2.354   -2.439  1.00 0.00 ? 54 TRP A HD1  9  
ATOM 9768  H HE1  . TRP A 1 54 ? -0.273  3.799   -0.324  1.00 0.00 ? 54 TRP A HE1  9  
ATOM 9769  H HE3  . TRP A 1 54 ? 0.344   -1.317  1.102   1.00 0.00 ? 54 TRP A HE3  9  
ATOM 9770  H HZ2  . TRP A 1 54 ? -0.315  3.432   2.474   1.00 0.00 ? 54 TRP A HZ2  9  
ATOM 9771  H HZ3  . TRP A 1 54 ? 0.187   -0.686  3.475   1.00 0.00 ? 54 TRP A HZ3  9  
ATOM 9772  H HH2  . TRP A 1 54 ? -0.135  1.640   4.145   1.00 0.00 ? 54 TRP A HH2  9  
ATOM 9773  N N    . PHE A 1 55 ? 1.798   -2.600  -0.308  1.00 0.00 ? 55 PHE A N    9  
ATOM 9774  C CA   . PHE A 1 55 ? 2.199   -3.209  0.955   1.00 0.00 ? 55 PHE A CA   9  
ATOM 9775  C C    . PHE A 1 55 ? 3.681   -3.572  0.937   1.00 0.00 ? 55 PHE A C    9  
ATOM 9776  O O    . PHE A 1 55 ? 4.388   -3.385  1.927   1.00 0.00 ? 55 PHE A O    9  
ATOM 9777  C CB   . PHE A 1 55 ? 1.360   -4.457  1.233   1.00 0.00 ? 55 PHE A CB   9  
ATOM 9778  C CG   . PHE A 1 55 ? 0.102   -4.175  2.002   1.00 0.00 ? 55 PHE A CG   9  
ATOM 9779  C CD1  . PHE A 1 55 ? -0.962  -3.522  1.401   1.00 0.00 ? 55 PHE A CD1  9  
ATOM 9780  C CD2  . PHE A 1 55 ? -0.018  -4.563  3.327   1.00 0.00 ? 55 PHE A CD2  9  
ATOM 9781  C CE1  . PHE A 1 55 ? -2.121  -3.260  2.107   1.00 0.00 ? 55 PHE A CE1  9  
ATOM 9782  C CE2  . PHE A 1 55 ? -1.174  -4.304  4.038   1.00 0.00 ? 55 PHE A CE2  9  
ATOM 9783  C CZ   . PHE A 1 55 ? -2.228  -3.652  3.427   1.00 0.00 ? 55 PHE A CZ   9  
ATOM 9784  H H    . PHE A 1 55 ? 1.147   -3.063  -0.877  1.00 0.00 ? 55 PHE A H    9  
ATOM 9785  H HA   . PHE A 1 55 ? 2.027   -2.487  1.739   1.00 0.00 ? 55 PHE A HA   9  
ATOM 9786  H HB2  . PHE A 1 55 ? 1.079   -4.910  0.294   1.00 0.00 ? 55 PHE A HB2  9  
ATOM 9787  H HB3  . PHE A 1 55 ? 1.950   -5.159  1.804   1.00 0.00 ? 55 PHE A HB3  9  
ATOM 9788  H HD1  . PHE A 1 55 ? -0.881  -3.215  0.368   1.00 0.00 ? 55 PHE A HD1  9  
ATOM 9789  H HD2  . PHE A 1 55 ? 0.806   -5.073  3.807   1.00 0.00 ? 55 PHE A HD2  9  
ATOM 9790  H HE1  . PHE A 1 55 ? -2.943  -2.751  1.627   1.00 0.00 ? 55 PHE A HE1  9  
ATOM 9791  H HE2  . PHE A 1 55 ? -1.254  -4.612  5.070   1.00 0.00 ? 55 PHE A HE2  9  
ATOM 9792  H HZ   . PHE A 1 55 ? -3.132  -3.449  3.981   1.00 0.00 ? 55 PHE A HZ   9  
ATOM 9793  N N    . GLN A 1 56 ? 4.144   -4.092  -0.195  1.00 0.00 ? 56 GLN A N    9  
ATOM 9794  C CA   . GLN A 1 56 ? 5.541   -4.482  -0.341  1.00 0.00 ? 56 GLN A CA   9  
ATOM 9795  C C    . GLN A 1 56 ? 6.460   -3.270  -0.229  1.00 0.00 ? 56 GLN A C    9  
ATOM 9796  O O    . GLN A 1 56 ? 7.264   -3.172  0.697   1.00 0.00 ? 56 GLN A O    9  
ATOM 9797  C CB   . GLN A 1 56 ? 5.760   -5.180  -1.685  1.00 0.00 ? 56 GLN A CB   9  
ATOM 9798  C CG   . GLN A 1 56 ? 6.923   -6.159  -1.680  1.00 0.00 ? 56 GLN A CG   9  
ATOM 9799  C CD   . GLN A 1 56 ? 7.240   -6.695  -3.062  1.00 0.00 ? 56 GLN A CD   9  
ATOM 9800  O OE1  . GLN A 1 56 ? 7.030   -7.874  -3.346  1.00 0.00 ? 56 GLN A OE1  9  
ATOM 9801  N NE2  . GLN A 1 56 ? 7.749   -5.829  -3.931  1.00 0.00 ? 56 GLN A NE2  9  
ATOM 9802  H H    . GLN A 1 56 ? 3.531   -4.216  -0.949  1.00 0.00 ? 56 GLN A H    9  
ATOM 9803  H HA   . GLN A 1 56 ? 5.777   -5.172  0.455   1.00 0.00 ? 56 GLN A HA   9  
ATOM 9804  H HB2  . GLN A 1 56 ? 4.863   -5.721  -1.946  1.00 0.00 ? 56 GLN A HB2  9  
ATOM 9805  H HB3  . GLN A 1 56 ? 5.952   -4.431  -2.439  1.00 0.00 ? 56 GLN A HB3  9  
ATOM 9806  H HG2  . GLN A 1 56 ? 7.798   -5.656  -1.296  1.00 0.00 ? 56 GLN A HG2  9  
ATOM 9807  H HG3  . GLN A 1 56 ? 6.674   -6.989  -1.036  1.00 0.00 ? 56 GLN A HG3  9  
ATOM 9808  H HE21 . GLN A 1 56 ? 7.891   -4.905  -3.634  1.00 0.00 ? 56 GLN A HE21 9  
ATOM 9809  H HE22 . GLN A 1 56 ? 7.965   -6.149  -4.831  1.00 0.00 ? 56 GLN A HE22 9  
ATOM 9810  N N    . ASN A 1 57 ? 6.334   -2.348  -1.178  1.00 0.00 ? 57 ASN A N    9  
ATOM 9811  C CA   . ASN A 1 57 ? 7.154   -1.142  -1.186  1.00 0.00 ? 57 ASN A CA   9  
ATOM 9812  C C    . ASN A 1 57 ? 7.128   -0.458  0.177   1.00 0.00 ? 57 ASN A C    9  
ATOM 9813  O O    . ASN A 1 57 ? 8.128   0.108   0.619   1.00 0.00 ? 57 ASN A O    9  
ATOM 9814  C CB   . ASN A 1 57 ? 6.663   -0.174  -2.265  1.00 0.00 ? 57 ASN A CB   9  
ATOM 9815  C CG   . ASN A 1 57 ? 7.313   -0.431  -3.611  1.00 0.00 ? 57 ASN A CG   9  
ATOM 9816  O OD1  . ASN A 1 57 ? 7.819   0.489   -4.254  1.00 0.00 ? 57 ASN A OD1  9  
ATOM 9817  N ND2  . ASN A 1 57 ? 7.300   -1.686  -4.044  1.00 0.00 ? 57 ASN A ND2  9  
ATOM 9818  H H    . ASN A 1 57 ? 5.674   -2.482  -1.891  1.00 0.00 ? 57 ASN A H    9  
ATOM 9819  H HA   . ASN A 1 57 ? 8.169   -1.433  -1.411  1.00 0.00 ? 57 ASN A HA   9  
ATOM 9820  H HB2  . ASN A 1 57 ? 5.594   -0.281  -2.376  1.00 0.00 ? 57 ASN A HB2  9  
ATOM 9821  H HB3  . ASN A 1 57 ? 6.890   0.837   -1.963  1.00 0.00 ? 57 ASN A HB3  9  
ATOM 9822  H HD21 . ASN A 1 57 ? 6.879   -2.367  -3.479  1.00 0.00 ? 57 ASN A HD21 9  
ATOM 9823  H HD22 . ASN A 1 57 ? 7.714   -1.880  -4.911  1.00 0.00 ? 57 ASN A HD22 9  
ATOM 9824  N N    . LYS A 1 58 ? 5.978   -0.514  0.839   1.00 0.00 ? 58 LYS A N    9  
ATOM 9825  C CA   . LYS A 1 58 ? 5.820   0.098   2.154   1.00 0.00 ? 58 LYS A CA   9  
ATOM 9826  C C    . LYS A 1 58 ? 6.622   -0.661  3.207   1.00 0.00 ? 58 LYS A C    9  
ATOM 9827  O O    . LYS A 1 58 ? 7.299   -0.057  4.039   1.00 0.00 ? 58 LYS A O    9  
ATOM 9828  C CB   . LYS A 1 58 ? 4.342   0.132   2.549   1.00 0.00 ? 58 LYS A CB   9  
ATOM 9829  C CG   . LYS A 1 58 ? 3.638   1.420   2.159   1.00 0.00 ? 58 LYS A CG   9  
ATOM 9830  C CD   . LYS A 1 58 ? 4.002   2.560   3.096   1.00 0.00 ? 58 LYS A CD   9  
ATOM 9831  C CE   . LYS A 1 58 ? 3.054   2.630   4.283   1.00 0.00 ? 58 LYS A CE   9  
ATOM 9832  N NZ   . LYS A 1 58 ? 3.567   3.534   5.350   1.00 0.00 ? 58 LYS A NZ   9  
ATOM 9833  H H    . LYS A 1 58 ? 5.215   -0.980  0.434   1.00 0.00 ? 58 LYS A H    9  
ATOM 9834  H HA   . LYS A 1 58 ? 6.192   1.109   2.095   1.00 0.00 ? 58 LYS A HA   9  
ATOM 9835  H HB2  . LYS A 1 58 ? 3.834   -0.691  2.069   1.00 0.00 ? 58 LYS A HB2  9  
ATOM 9836  H HB3  . LYS A 1 58 ? 4.266   0.015   3.620   1.00 0.00 ? 58 LYS A HB3  9  
ATOM 9837  H HG2  . LYS A 1 58 ? 3.928   1.689   1.154   1.00 0.00 ? 58 LYS A HG2  9  
ATOM 9838  H HG3  . LYS A 1 58 ? 2.570   1.262   2.198   1.00 0.00 ? 58 LYS A HG3  9  
ATOM 9839  H HD2  . LYS A 1 58 ? 5.007   2.408   3.461   1.00 0.00 ? 58 LYS A HD2  9  
ATOM 9840  H HD3  . LYS A 1 58 ? 3.952   3.492   2.551   1.00 0.00 ? 58 LYS A HD3  9  
ATOM 9841  H HE2  . LYS A 1 58 ? 2.098   2.996   3.943   1.00 0.00 ? 58 LYS A HE2  9  
ATOM 9842  H HE3  . LYS A 1 58 ? 2.935   1.637   4.691   1.00 0.00 ? 58 LYS A HE3  9  
ATOM 9843  H HZ1  . LYS A 1 58 ? 2.873   3.604   6.122   1.00 0.00 ? 58 LYS A HZ1  9  
ATOM 9844  H HZ2  . LYS A 1 58 ? 3.734   4.484   4.963   1.00 0.00 ? 58 LYS A HZ2  9  
ATOM 9845  H HZ3  . LYS A 1 58 ? 4.460   3.164   5.733   1.00 0.00 ? 58 LYS A HZ3  9  
ATOM 9846  N N    . ARG A 1 59 ? 6.541   -1.987  3.163   1.00 0.00 ? 59 ARG A N    9  
ATOM 9847  C CA   . ARG A 1 59 ? 7.259   -2.827  4.114   1.00 0.00 ? 59 ARG A CA   9  
ATOM 9848  C C    . ARG A 1 59 ? 8.758   -2.547  4.063   1.00 0.00 ? 59 ARG A C    9  
ATOM 9849  O O    . ARG A 1 59 ? 9.443   -2.593  5.084   1.00 0.00 ? 59 ARG A O    9  
ATOM 9850  C CB   . ARG A 1 59 ? 6.996   -4.305  3.820   1.00 0.00 ? 59 ARG A CB   9  
ATOM 9851  C CG   . ARG A 1 59 ? 5.770   -4.858  4.529   1.00 0.00 ? 59 ARG A CG   9  
ATOM 9852  C CD   . ARG A 1 59 ? 5.634   -6.358  4.320   1.00 0.00 ? 59 ARG A CD   9  
ATOM 9853  N NE   . ARG A 1 59 ? 6.799   -7.087  4.816   1.00 0.00 ? 59 ARG A NE   9  
ATOM 9854  C CZ   . ARG A 1 59 ? 7.904   -7.279  4.104   1.00 0.00 ? 59 ARG A CZ   9  
ATOM 9855  N NH1  . ARG A 1 59 ? 7.994   -6.798  2.871   1.00 0.00 ? 59 ARG A NH1  9  
ATOM 9856  N NH2  . ARG A 1 59 ? 8.921   -7.953  4.624   1.00 0.00 ? 59 ARG A NH2  9  
ATOM 9857  H H    . ARG A 1 59 ? 5.984   -2.410  2.476   1.00 0.00 ? 59 ARG A H    9  
ATOM 9858  H HA   . ARG A 1 59 ? 6.895   -2.595  5.103   1.00 0.00 ? 59 ARG A HA   9  
ATOM 9859  H HB2  . ARG A 1 59 ? 6.856   -4.430  2.757   1.00 0.00 ? 59 ARG A HB2  9  
ATOM 9860  H HB3  . ARG A 1 59 ? 7.854   -4.880  4.132   1.00 0.00 ? 59 ARG A HB3  9  
ATOM 9861  H HG2  . ARG A 1 59 ? 5.857   -4.660  5.587   1.00 0.00 ? 59 ARG A HG2  9  
ATOM 9862  H HG3  . ARG A 1 59 ? 4.890   -4.368  4.140   1.00 0.00 ? 59 ARG A HG3  9  
ATOM 9863  H HD2  . ARG A 1 59 ? 4.756   -6.703  4.845   1.00 0.00 ? 59 ARG A HD2  9  
ATOM 9864  H HD3  . ARG A 1 59 ? 5.522   -6.552  3.264   1.00 0.00 ? 59 ARG A HD3  9  
ATOM 9865  H HE   . ARG A 1 59 ? 6.754   -7.451  5.724   1.00 0.00 ? 59 ARG A HE   9  
ATOM 9866  H HH11 . ARG A 1 59 ? 7.229   -6.289  2.477   1.00 0.00 ? 59 ARG A HH11 9  
ATOM 9867  H HH12 . ARG A 1 59 ? 8.827   -6.943  2.337   1.00 0.00 ? 59 ARG A HH12 9  
ATOM 9868  H HH21 . ARG A 1 59 ? 8.857   -8.316  5.553   1.00 0.00 ? 59 ARG A HH21 9  
ATOM 9869  H HH22 . ARG A 1 59 ? 9.752   -8.097  4.087   1.00 0.00 ? 59 ARG A HH22 9  
ATOM 9870  N N    . SER A 1 60 ? 9.260   -2.257  2.867   1.00 0.00 ? 60 SER A N    9  
ATOM 9871  C CA   . SER A 1 60 ? 10.679  -1.973  2.682   1.00 0.00 ? 60 SER A CA   9  
ATOM 9872  C C    . SER A 1 60 ? 11.043  -0.615  3.274   1.00 0.00 ? 60 SER A C    9  
ATOM 9873  O O    . SER A 1 60 ? 12.219  -0.269  3.387   1.00 0.00 ? 60 SER A O    9  
ATOM 9874  C CB   . SER A 1 60 ? 11.038  -2.007  1.195   1.00 0.00 ? 60 SER A CB   9  
ATOM 9875  O OG   . SER A 1 60 ? 12.430  -1.826  1.002   1.00 0.00 ? 60 SER A OG   9  
ATOM 9876  H H    . SER A 1 60 ? 8.663   -2.235  2.090   1.00 0.00 ? 60 SER A H    9  
ATOM 9877  H HA   . SER A 1 60 ? 11.240  -2.739  3.197   1.00 0.00 ? 60 SER A HA   9  
ATOM 9878  H HB2  . SER A 1 60 ? 10.751  -2.961  0.780   1.00 0.00 ? 60 SER A HB2  9  
ATOM 9879  H HB3  . SER A 1 60 ? 10.509  -1.217  0.682   1.00 0.00 ? 60 SER A HB3  9  
ATOM 9880  H HG   . SER A 1 60 ? 12.579  -1.319  0.201   1.00 0.00 ? 60 SER A HG   9  
ATOM 9881  N N    . LYS A 1 61 ? 10.025  0.152   3.649   1.00 0.00 ? 61 LYS A N    9  
ATOM 9882  C CA   . LYS A 1 61 ? 10.235  1.473   4.231   1.00 0.00 ? 61 LYS A CA   9  
ATOM 9883  C C    . LYS A 1 61 ? 10.025  1.442   5.741   1.00 0.00 ? 61 LYS A C    9  
ATOM 9884  O O    . LYS A 1 61 ? 9.700   2.460   6.353   1.00 0.00 ? 61 LYS A O    9  
ATOM 9885  C CB   . LYS A 1 61 ? 9.285   2.489   3.594   1.00 0.00 ? 61 LYS A CB   9  
ATOM 9886  C CG   . LYS A 1 61 ? 9.696   3.933   3.823   1.00 0.00 ? 61 LYS A CG   9  
ATOM 9887  C CD   . LYS A 1 61 ? 10.943  4.290   3.031   1.00 0.00 ? 61 LYS A CD   9  
ATOM 9888  C CE   . LYS A 1 61 ? 10.591  4.822   1.650   1.00 0.00 ? 61 LYS A CE   9  
ATOM 9889  N NZ   . LYS A 1 61 ? 9.824   6.096   1.724   1.00 0.00 ? 61 LYS A NZ   9  
ATOM 9890  H H    . LYS A 1 61 ? 9.109   -0.179  3.533   1.00 0.00 ? 61 LYS A H    9  
ATOM 9891  H HA   . LYS A 1 61 ? 11.253  1.767   4.026   1.00 0.00 ? 61 LYS A HA   9  
ATOM 9892  H HB2  . LYS A 1 61 ? 9.248   2.312   2.529   1.00 0.00 ? 61 LYS A HB2  9  
ATOM 9893  H HB3  . LYS A 1 61 ? 8.296   2.349   4.008   1.00 0.00 ? 61 LYS A HB3  9  
ATOM 9894  H HG2  . LYS A 1 61 ? 8.889   4.582   3.516   1.00 0.00 ? 61 LYS A HG2  9  
ATOM 9895  H HG3  . LYS A 1 61 ? 9.896   4.078   4.876   1.00 0.00 ? 61 LYS A HG3  9  
ATOM 9896  H HD2  . LYS A 1 61 ? 11.494  5.049   3.566   1.00 0.00 ? 61 LYS A HD2  9  
ATOM 9897  H HD3  . LYS A 1 61 ? 11.555  3.406   2.922   1.00 0.00 ? 61 LYS A HD3  9  
ATOM 9898  H HE2  . LYS A 1 61 ? 11.505  4.993   1.101   1.00 0.00 ? 61 LYS A HE2  9  
ATOM 9899  H HE3  . LYS A 1 61 ? 9.996   4.082   1.135   1.00 0.00 ? 61 LYS A HE3  9  
ATOM 9900  H HZ1  . LYS A 1 61 ? 8.866   5.959   1.343   1.00 0.00 ? 61 LYS A HZ1  9  
ATOM 9901  H HZ2  . LYS A 1 61 ? 10.303  6.834   1.169   1.00 0.00 ? 61 LYS A HZ2  9  
ATOM 9902  H HZ3  . LYS A 1 61 ? 9.751   6.412   2.712   1.00 0.00 ? 61 LYS A HZ3  9  
ATOM 9903  N N    . ILE A 1 62 ? 10.214  0.269   6.336   1.00 0.00 ? 62 ILE A N    9  
ATOM 9904  C CA   . ILE A 1 62 ? 10.048  0.107   7.775   1.00 0.00 ? 62 ILE A CA   9  
ATOM 9905  C C    . ILE A 1 62 ? 11.293  -0.506  8.407   1.00 0.00 ? 62 ILE A C    9  
ATOM 9906  O O    . ILE A 1 62 ? 12.211  -0.936  7.707   1.00 0.00 ? 62 ILE A O    9  
ATOM 9907  C CB   . ILE A 1 62 ? 8.831   -0.776  8.106   1.00 0.00 ? 62 ILE A CB   9  
ATOM 9908  C CG1  . ILE A 1 62 ? 7.678   -0.473  7.147   1.00 0.00 ? 62 ILE A CG1  9  
ATOM 9909  C CG2  . ILE A 1 62 ? 8.397   -0.563  9.548   1.00 0.00 ? 62 ILE A CG2  9  
ATOM 9910  C CD1  . ILE A 1 62 ? 6.403   -1.216  7.480   1.00 0.00 ? 62 ILE A CD1  9  
ATOM 9911  H H    . ILE A 1 62 ? 10.472  -0.506  5.795   1.00 0.00 ? 62 ILE A H    9  
ATOM 9912  H HA   . ILE A 1 62 ? 9.885   1.086   8.203   1.00 0.00 ? 62 ILE A HA   9  
ATOM 9913  H HB   . ILE A 1 62 ? 9.122   -1.809  7.992   1.00 0.00 ? 62 ILE A HB   9  
ATOM 9914  H HG12 . ILE A 1 62 ? 7.462   0.583   7.176   1.00 0.00 ? 62 ILE A HG12 9  
ATOM 9915  H HG13 . ILE A 1 62 ? 7.971   -0.749  6.144   1.00 0.00 ? 62 ILE A HG13 9  
ATOM 9916  H HG21 . ILE A 1 62 ? 7.345   -0.786  9.645   1.00 0.00 ? 62 ILE A HG21 9  
ATOM 9917  H HG22 . ILE A 1 62 ? 8.964   -1.216  10.195  1.00 0.00 ? 62 ILE A HG22 9  
ATOM 9918  H HG23 . ILE A 1 62 ? 8.575   0.465   9.830   1.00 0.00 ? 62 ILE A HG23 9  
ATOM 9919  H HD11 . ILE A 1 62 ? 5.793   -1.302  6.593   1.00 0.00 ? 62 ILE A HD11 9  
ATOM 9920  H HD12 . ILE A 1 62 ? 6.646   -2.202  7.848   1.00 0.00 ? 62 ILE A HD12 9  
ATOM 9921  H HD13 . ILE A 1 62 ? 5.858   -0.674  8.239   1.00 0.00 ? 62 ILE A HD13 9  
ATOM 9922  N N    . LYS A 1 63 ? 11.319  -0.544  9.735   1.00 0.00 ? 63 LYS A N    9  
ATOM 9923  C CA   . LYS A 1 63 ? 12.449  -1.107  10.463  1.00 0.00 ? 63 LYS A CA   9  
ATOM 9924  C C    . LYS A 1 63 ? 12.395  -2.631  10.458  1.00 0.00 ? 63 LYS A C    9  
ATOM 9925  O O    . LYS A 1 63 ? 12.521  -3.271  11.502  1.00 0.00 ? 63 LYS A O    9  
ATOM 9926  C CB   . LYS A 1 63 ? 12.462  -0.591  11.904  1.00 0.00 ? 63 LYS A CB   9  
ATOM 9927  C CG   . LYS A 1 63 ? 13.072  0.792   12.050  1.00 0.00 ? 63 LYS A CG   9  
ATOM 9928  C CD   . LYS A 1 63 ? 12.607  1.475   13.325  1.00 0.00 ? 63 LYS A CD   9  
ATOM 9929  C CE   . LYS A 1 63 ? 13.318  0.918   14.548  1.00 0.00 ? 63 LYS A CE   9  
ATOM 9930  N NZ   . LYS A 1 63 ? 12.695  1.389   15.815  1.00 0.00 ? 63 LYS A NZ   9  
ATOM 9931  H H    . LYS A 1 63 ? 10.557  -0.185  10.238  1.00 0.00 ? 63 LYS A H    9  
ATOM 9932  H HA   . LYS A 1 63 ? 13.355  -0.789  9.968   1.00 0.00 ? 63 LYS A HA   9  
ATOM 9933  H HB2  . LYS A 1 63 ? 11.446  -0.554  12.269  1.00 0.00 ? 63 LYS A HB2  9  
ATOM 9934  H HB3  . LYS A 1 63 ? 13.030  -1.279  12.514  1.00 0.00 ? 63 LYS A HB3  9  
ATOM 9935  H HG2  . LYS A 1 63 ? 14.148  0.700   12.076  1.00 0.00 ? 63 LYS A HG2  9  
ATOM 9936  H HG3  . LYS A 1 63 ? 12.781  1.395   11.202  1.00 0.00 ? 63 LYS A HG3  9  
ATOM 9937  H HD2  . LYS A 1 63 ? 12.814  2.533   13.253  1.00 0.00 ? 63 LYS A HD2  9  
ATOM 9938  H HD3  . LYS A 1 63 ? 11.543  1.322   13.437  1.00 0.00 ? 63 LYS A HD3  9  
ATOM 9939  H HE2  . LYS A 1 63 ? 13.274  -0.160  14.514  1.00 0.00 ? 63 LYS A HE2  9  
ATOM 9940  H HE3  . LYS A 1 63 ? 14.350  1.236   14.524  1.00 0.00 ? 63 LYS A HE3  9  
ATOM 9941  H HZ1  . LYS A 1 63 ? 13.355  2.007   16.330  1.00 0.00 ? 63 LYS A HZ1  9  
ATOM 9942  H HZ2  . LYS A 1 63 ? 12.455  0.577   16.419  1.00 0.00 ? 63 LYS A HZ2  9  
ATOM 9943  H HZ3  . LYS A 1 63 ? 11.826  1.923   15.610  1.00 0.00 ? 63 LYS A HZ3  9  
ATOM 9944  N N    . LYS A 1 64 ? 12.209  -3.208  9.275   1.00 0.00 ? 64 LYS A N    9  
ATOM 9945  C CA   . LYS A 1 64 ? 12.141  -4.657  9.133   1.00 0.00 ? 64 LYS A CA   9  
ATOM 9946  C C    . LYS A 1 64 ? 13.380  -5.193  8.421   1.00 0.00 ? 64 LYS A C    9  
ATOM 9947  O O    . LYS A 1 64 ? 13.787  -4.667  7.385   1.00 0.00 ? 64 LYS A O    9  
ATOM 9948  C CB   . LYS A 1 64 ? 10.883  -5.056  8.359   1.00 0.00 ? 64 LYS A CB   9  
ATOM 9949  C CG   . LYS A 1 64 ? 10.417  -6.473  8.643   1.00 0.00 ? 64 LYS A CG   9  
ATOM 9950  C CD   . LYS A 1 64 ? 9.803   -6.591  10.029  1.00 0.00 ? 64 LYS A CD   9  
ATOM 9951  C CE   . LYS A 1 64 ? 9.762   -8.036  10.499  1.00 0.00 ? 64 LYS A CE   9  
ATOM 9952  N NZ   . LYS A 1 64 ? 11.090  -8.498  10.990  1.00 0.00 ? 64 LYS A NZ   9  
ATOM 9953  H H    . LYS A 1 64 ? 12.116  -2.644  8.478   1.00 0.00 ? 64 LYS A H    9  
ATOM 9954  H HA   . LYS A 1 64 ? 12.096  -5.086  10.122  1.00 0.00 ? 64 LYS A HA   9  
ATOM 9955  H HB2  . LYS A 1 64 ? 10.084  -4.377  8.619   1.00 0.00 ? 64 LYS A HB2  9  
ATOM 9956  H HB3  . LYS A 1 64 ? 11.084  -4.972  7.300   1.00 0.00 ? 64 LYS A HB3  9  
ATOM 9957  H HG2  . LYS A 1 64 ? 9.677   -6.754  7.909   1.00 0.00 ? 64 LYS A HG2  9  
ATOM 9958  H HG3  . LYS A 1 64 ? 11.264  -7.141  8.577   1.00 0.00 ? 64 LYS A HG3  9  
ATOM 9959  H HD2  . LYS A 1 64 ? 10.394  -6.014  10.725  1.00 0.00 ? 64 LYS A HD2  9  
ATOM 9960  H HD3  . LYS A 1 64 ? 8.795   -6.202  10.000  1.00 0.00 ? 64 LYS A HD3  9  
ATOM 9961  H HE2  . LYS A 1 64 ? 9.043   -8.120  11.300  1.00 0.00 ? 64 LYS A HE2  9  
ATOM 9962  H HE3  . LYS A 1 64 ? 9.456   -8.661  9.673   1.00 0.00 ? 64 LYS A HE3  9  
ATOM 9963  H HZ1  . LYS A 1 64 ? 10.969  -9.270  11.676  1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 9964  H HZ2  . LYS A 1 64 ? 11.592  -7.714  11.453  1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 9965  H HZ3  . LYS A 1 64 ? 11.665  -8.842  10.195  1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 9966  N N    . SER A 1 65 ? 13.973  -6.241  8.983   1.00 0.00 ? 65 SER A N    9  
ATOM 9967  C CA   . SER A 1 65 ? 15.166  -6.846  8.403   1.00 0.00 ? 65 SER A CA   9  
ATOM 9968  C C    . SER A 1 65 ? 14.826  -7.594  7.117   1.00 0.00 ? 65 SER A C    9  
ATOM 9969  O O    . SER A 1 65 ? 13.883  -8.383  7.076   1.00 0.00 ? 65 SER A O    9  
ATOM 9970  C CB   . SER A 1 65 ? 15.819  -7.800  9.404   1.00 0.00 ? 65 SER A CB   9  
ATOM 9971  O OG   . SER A 1 65 ? 14.980  -8.911  9.670   1.00 0.00 ? 65 SER A OG   9  
ATOM 9972  H H    . SER A 1 65 ? 13.600  -6.615  9.809   1.00 0.00 ? 65 SER A H    9  
ATOM 9973  H HA   . SER A 1 65 ? 15.861  -6.052  8.170   1.00 0.00 ? 65 SER A HA   9  
ATOM 9974  H HB2  . SER A 1 65 ? 16.753  -8.158  9.001   1.00 0.00 ? 65 SER A HB2  9  
ATOM 9975  H HB3  . SER A 1 65 ? 16.004  -7.274  10.330  1.00 0.00 ? 65 SER A HB3  9  
ATOM 9976  H HG   . SER A 1 65 ? 14.991  -9.508  8.918   1.00 0.00 ? 65 SER A HG   9  
ATOM 9977  N N    . GLY A 1 66 ? 15.602  -7.339  6.068   1.00 0.00 ? 66 GLY A N    9  
ATOM 9978  C CA   . GLY A 1 66 ? 15.368  -7.995  4.795   1.00 0.00 ? 66 GLY A CA   9  
ATOM 9979  C C    . GLY A 1 66 ? 16.140  -7.352  3.660   1.00 0.00 ? 66 GLY A C    9  
ATOM 9980  O O    . GLY A 1 66 ? 16.357  -6.141  3.637   1.00 0.00 ? 66 GLY A O    9  
ATOM 9981  H H    . GLY A 1 66 ? 16.339  -6.700  6.159   1.00 0.00 ? 66 GLY A H    9  
ATOM 9982  H HA2  . GLY A 1 66 ? 15.663  -9.031  4.877   1.00 0.00 ? 66 GLY A HA2  9  
ATOM 9983  H HA3  . GLY A 1 66 ? 14.313  -7.949  4.568   1.00 0.00 ? 66 GLY A HA3  9  
ATOM 9984  N N    . PRO A 1 67 ? 16.572  -8.175  2.693   1.00 0.00 ? 67 PRO A N    9  
ATOM 9985  C CA   . PRO A 1 67 ? 17.333  -7.701  1.533   1.00 0.00 ? 67 PRO A CA   9  
ATOM 9986  C C    . PRO A 1 67 ? 16.481  -6.869  0.581   1.00 0.00 ? 67 PRO A C    9  
ATOM 9987  O O    . PRO A 1 67 ? 15.386  -7.279  0.194   1.00 0.00 ? 67 PRO A O    9  
ATOM 9988  C CB   . PRO A 1 67 ? 17.785  -8.996  0.853   1.00 0.00 ? 67 PRO A CB   9  
ATOM 9989  C CG   . PRO A 1 67 ? 16.778  -10.013 1.267   1.00 0.00 ? 67 PRO A CG   9  
ATOM 9990  C CD   . PRO A 1 67 ? 16.350  -9.630  2.656   1.00 0.00 ? 67 PRO A CD   9  
ATOM 9991  H HA   . PRO A 1 67 ? 18.199  -7.129  1.833   1.00 0.00 ? 67 PRO A HA   9  
ATOM 9992  H HB2  . PRO A 1 67 ? 17.792  -8.859  -0.219  1.00 0.00 ? 67 PRO A HB2  9  
ATOM 9993  H HB3  . PRO A 1 67 ? 18.775  -9.259  1.194   1.00 0.00 ? 67 PRO A HB3  9  
ATOM 9994  H HG2  . PRO A 1 67 ? 15.934  -9.989  0.594   1.00 0.00 ? 67 PRO A HG2  9  
ATOM 9995  H HG3  . PRO A 1 67 ? 17.229  -10.995 1.271   1.00 0.00 ? 67 PRO A HG3  9  
ATOM 9996  H HD2  . PRO A 1 67 ? 15.307  -9.865  2.808   1.00 0.00 ? 67 PRO A HD2  9  
ATOM 9997  H HD3  . PRO A 1 67 ? 16.962  -10.131 3.392   1.00 0.00 ? 67 PRO A HD3  9  
ATOM 9998  N N    . SER A 1 68 ? 16.990  -5.700  0.206   1.00 0.00 ? 68 SER A N    9  
ATOM 9999  C CA   . SER A 1 68 ? 16.273  -4.809  -0.698  1.00 0.00 ? 68 SER A CA   9  
ATOM 10000 C C    . SER A 1 68 ? 17.147  -4.426  -1.889  1.00 0.00 ? 68 SER A C    9  
ATOM 10001 O O    . SER A 1 68 ? 18.365  -4.600  -1.860  1.00 0.00 ? 68 SER A O    9  
ATOM 10002 C CB   . SER A 1 68 ? 15.823  -3.549  0.044   1.00 0.00 ? 68 SER A CB   9  
ATOM 10003 O OG   . SER A 1 68 ? 14.693  -3.813  0.858   1.00 0.00 ? 68 SER A OG   9  
ATOM 10004 H H    . SER A 1 68 ? 17.867  -5.429  0.549   1.00 0.00 ? 68 SER A H    9  
ATOM 10005 H HA   . SER A 1 68 ? 15.402  -5.334  -1.060  1.00 0.00 ? 68 SER A HA   9  
ATOM 10006 H HB2  . SER A 1 68 ? 16.628  -3.196  0.670   1.00 0.00 ? 68 SER A HB2  9  
ATOM 10007 H HB3  . SER A 1 68 ? 15.563  -2.785  -0.675  1.00 0.00 ? 68 SER A HB3  9  
ATOM 10008 H HG   . SER A 1 68 ? 14.983  -4.147  1.709   1.00 0.00 ? 68 SER A HG   9  
ATOM 10009 N N    . SER A 1 69 ? 16.514  -3.905  -2.936  1.00 0.00 ? 69 SER A N    9  
ATOM 10010 C CA   . SER A 1 69 ? 17.232  -3.501  -4.139  1.00 0.00 ? 69 SER A CA   9  
ATOM 10011 C C    . SER A 1 69 ? 18.567  -2.853  -3.784  1.00 0.00 ? 69 SER A C    9  
ATOM 10012 O O    . SER A 1 69 ? 19.610  -3.218  -4.322  1.00 0.00 ? 69 SER A O    9  
ATOM 10013 C CB   . SER A 1 69 ? 16.384  -2.530  -4.963  1.00 0.00 ? 69 SER A CB   9  
ATOM 10014 O OG   . SER A 1 69 ? 16.884  -2.409  -6.283  1.00 0.00 ? 69 SER A OG   9  
ATOM 10015 H H    . SER A 1 69 ? 15.541  -3.792  -2.898  1.00 0.00 ? 69 SER A H    9  
ATOM 10016 H HA   . SER A 1 69 ? 17.421  -4.388  -4.726  1.00 0.00 ? 69 SER A HA   9  
ATOM 10017 H HB2  . SER A 1 69 ? 15.368  -2.893  -5.008  1.00 0.00 ? 69 SER A HB2  9  
ATOM 10018 H HB3  . SER A 1 69 ? 16.398  -1.557  -4.494  1.00 0.00 ? 69 SER A HB3  9  
ATOM 10019 H HG   . SER A 1 69 ? 16.155  -2.443  -6.906  1.00 0.00 ? 69 SER A HG   9  
ATOM 10020 N N    . GLY A 1 70 ? 18.524  -1.886  -2.872  1.00 0.00 ? 70 GLY A N    9  
ATOM 10021 C CA   . GLY A 1 70 ? 19.735  -1.201  -2.459  1.00 0.00 ? 70 GLY A CA   9  
ATOM 10022 C C    . GLY A 1 70 ? 19.731  0.265   -2.843  1.00 0.00 ? 70 GLY A C    9  
ATOM 10023 O O    . GLY A 1 70 ? 18.673  0.851   -3.074  1.00 0.00 ? 70 GLY A O    9  
ATOM 10024 H H    . GLY A 1 70 ? 17.662  -1.636  -2.476  1.00 0.00 ? 70 GLY A H    9  
ATOM 10025 H HA2  . GLY A 1 70 ? 19.833  -1.281  -1.387  1.00 0.00 ? 70 GLY A HA2  9  
ATOM 10026 H HA3  . GLY A 1 70 ? 20.583  -1.681  -2.925  1.00 0.00 ? 70 GLY A HA3  9  
ATOM 10027 N N    . GLY A 1 1  ? 20.813  18.156  6.843   1.00 0.00 ? 1  GLY A N    10 
ATOM 10028 C CA   . GLY A 1 1  ? 20.743  18.313  5.402   1.00 0.00 ? 1  GLY A CA   10 
ATOM 10029 C C    . GLY A 1 1  ? 19.347  18.076  4.861   1.00 0.00 ? 1  GLY A C    10 
ATOM 10030 O O    . GLY A 1 1  ? 19.050  17.002  4.338   1.00 0.00 ? 1  GLY A O    10 
ATOM 10031 H H1   . GLY A 1 1  ? 20.123  18.557  7.412   1.00 0.00 ? 1  GLY A H1   10 
ATOM 10032 H HA2  . GLY A 1 1  ? 21.053  19.314  5.144   1.00 0.00 ? 1  GLY A HA2  10 
ATOM 10033 H HA3  . GLY A 1 1  ? 21.419  17.608  4.941   1.00 0.00 ? 1  GLY A HA3  10 
ATOM 10034 N N    . SER A 1 2  ? 18.487  19.082  4.986   1.00 0.00 ? 2  SER A N    10 
ATOM 10035 C CA   . SER A 1 2  ? 17.112  18.977  4.510   1.00 0.00 ? 2  SER A CA   10 
ATOM 10036 C C    . SER A 1 2  ? 16.888  19.871  3.295   1.00 0.00 ? 2  SER A C    10 
ATOM 10037 O O    . SER A 1 2  ? 17.247  21.049  3.303   1.00 0.00 ? 2  SER A O    10 
ATOM 10038 C CB   . SER A 1 2  ? 16.134  19.355  5.624   1.00 0.00 ? 2  SER A CB   10 
ATOM 10039 O OG   . SER A 1 2  ? 14.819  19.505  5.118   1.00 0.00 ? 2  SER A OG   10 
ATOM 10040 H H    . SER A 1 2  ? 18.783  19.914  5.412   1.00 0.00 ? 2  SER A H    10 
ATOM 10041 H HA   . SER A 1 2  ? 16.939  17.950  4.224   1.00 0.00 ? 2  SER A HA   10 
ATOM 10042 H HB2  . SER A 1 2  ? 16.132  18.581  6.376   1.00 0.00 ? 2  SER A HB2  10 
ATOM 10043 H HB3  . SER A 1 2  ? 16.445  20.289  6.070   1.00 0.00 ? 2  SER A HB3  10 
ATOM 10044 H HG   . SER A 1 2  ? 14.685  18.897  4.388   1.00 0.00 ? 2  SER A HG   10 
ATOM 10045 N N    . SER A 1 3  ? 16.293  19.303  2.252   1.00 0.00 ? 3  SER A N    10 
ATOM 10046 C CA   . SER A 1 3  ? 16.024  20.047  1.026   1.00 0.00 ? 3  SER A CA   10 
ATOM 10047 C C    . SER A 1 3  ? 15.054  21.194  1.290   1.00 0.00 ? 3  SER A C    10 
ATOM 10048 O O    . SER A 1 3  ? 15.334  22.347  0.962   1.00 0.00 ? 3  SER A O    10 
ATOM 10049 C CB   . SER A 1 3  ? 15.452  19.116  -0.045  1.00 0.00 ? 3  SER A CB   10 
ATOM 10050 O OG   . SER A 1 3  ? 16.419  18.170  -0.467  1.00 0.00 ? 3  SER A OG   10 
ATOM 10051 H H    . SER A 1 3  ? 16.031  18.360  2.306   1.00 0.00 ? 3  SER A H    10 
ATOM 10052 H HA   . SER A 1 3  ? 16.959  20.455  0.674   1.00 0.00 ? 3  SER A HA   10 
ATOM 10053 H HB2  . SER A 1 3  ? 14.601  18.588  0.357   1.00 0.00 ? 3  SER A HB2  10 
ATOM 10054 H HB3  . SER A 1 3  ? 15.142  19.702  -0.898  1.00 0.00 ? 3  SER A HB3  10 
ATOM 10055 H HG   . SER A 1 3  ? 17.291  18.570  -0.443  1.00 0.00 ? 3  SER A HG   10 
ATOM 10056 N N    . GLY A 1 4  ? 13.910  20.869  1.885   1.00 0.00 ? 4  GLY A N    10 
ATOM 10057 C CA   . GLY A 1 4  ? 12.914  21.883  2.182   1.00 0.00 ? 4  GLY A CA   10 
ATOM 10058 C C    . GLY A 1 4  ? 11.597  21.626  1.479   1.00 0.00 ? 4  GLY A C    10 
ATOM 10059 O O    . GLY A 1 4  ? 11.300  20.494  1.096   1.00 0.00 ? 4  GLY A O    10 
ATOM 10060 H H    . GLY A 1 4  ? 13.740  19.934  2.123   1.00 0.00 ? 4  GLY A H    10 
ATOM 10061 H HA2  . GLY A 1 4  ? 12.744  21.902  3.248   1.00 0.00 ? 4  GLY A HA2  10 
ATOM 10062 H HA3  . GLY A 1 4  ? 13.293  22.845  1.871   1.00 0.00 ? 4  GLY A HA3  10 
ATOM 10063 N N    . SER A 1 5  ? 10.803  22.678  1.309   1.00 0.00 ? 5  SER A N    10 
ATOM 10064 C CA   . SER A 1 5  ? 9.507   22.560  0.651   1.00 0.00 ? 5  SER A CA   10 
ATOM 10065 C C    . SER A 1 5  ? 9.676   22.381  -0.855  1.00 0.00 ? 5  SER A C    10 
ATOM 10066 O O    . SER A 1 5  ? 10.295  23.208  -1.524  1.00 0.00 ? 5  SER A O    10 
ATOM 10067 C CB   . SER A 1 5  ? 8.652   23.797  0.936   1.00 0.00 ? 5  SER A CB   10 
ATOM 10068 O OG   . SER A 1 5  ? 9.095   24.909  0.178   1.00 0.00 ? 5  SER A OG   10 
ATOM 10069 H H    . SER A 1 5  ? 11.096  23.555  1.636   1.00 0.00 ? 5  SER A H    10 
ATOM 10070 H HA   . SER A 1 5  ? 9.010   21.689  1.052   1.00 0.00 ? 5  SER A HA   10 
ATOM 10071 H HB2  . SER A 1 5  ? 7.625   23.588  0.680   1.00 0.00 ? 5  SER A HB2  10 
ATOM 10072 H HB3  . SER A 1 5  ? 8.719   24.042  1.986   1.00 0.00 ? 5  SER A HB3  10 
ATOM 10073 H HG   . SER A 1 5  ? 8.745   24.848  -0.714  1.00 0.00 ? 5  SER A HG   10 
ATOM 10074 N N    . SER A 1 6  ? 9.120   21.294  -1.381  1.00 0.00 ? 6  SER A N    10 
ATOM 10075 C CA   . SER A 1 6  ? 9.212   21.003  -2.807  1.00 0.00 ? 6  SER A CA   10 
ATOM 10076 C C    . SER A 1 6  ? 7.953   21.462  -3.537  1.00 0.00 ? 6  SER A C    10 
ATOM 10077 O O    . SER A 1 6  ? 8.017   22.283  -4.451  1.00 0.00 ? 6  SER A O    10 
ATOM 10078 C CB   . SER A 1 6  ? 9.427   19.505  -3.030  1.00 0.00 ? 6  SER A CB   10 
ATOM 10079 O OG   . SER A 1 6  ? 9.400   19.186  -4.410  1.00 0.00 ? 6  SER A OG   10 
ATOM 10080 H H    . SER A 1 6  ? 8.639   20.672  -0.795  1.00 0.00 ? 6  SER A H    10 
ATOM 10081 H HA   . SER A 1 6  ? 10.060  21.543  -3.201  1.00 0.00 ? 6  SER A HA   10 
ATOM 10082 H HB2  . SER A 1 6  ? 10.386  19.217  -2.625  1.00 0.00 ? 6  SER A HB2  10 
ATOM 10083 H HB3  . SER A 1 6  ? 8.645   18.953  -2.530  1.00 0.00 ? 6  SER A HB3  10 
ATOM 10084 H HG   . SER A 1 6  ? 8.652   18.613  -4.592  1.00 0.00 ? 6  SER A HG   10 
ATOM 10085 N N    . GLY A 1 7  ? 6.809   20.924  -3.126  1.00 0.00 ? 7  GLY A N    10 
ATOM 10086 C CA   . GLY A 1 7  ? 5.551   21.290  -3.751  1.00 0.00 ? 7  GLY A CA   10 
ATOM 10087 C C    . GLY A 1 7  ? 5.560   21.059  -5.249  1.00 0.00 ? 7  GLY A C    10 
ATOM 10088 O O    . GLY A 1 7  ? 6.583   20.682  -5.820  1.00 0.00 ? 7  GLY A O    10 
ATOM 10089 H H    . GLY A 1 7  ? 6.819   20.274  -2.392  1.00 0.00 ? 7  GLY A H    10 
ATOM 10090 H HA2  . GLY A 1 7  ? 4.759   20.702  -3.311  1.00 0.00 ? 7  GLY A HA2  10 
ATOM 10091 H HA3  . GLY A 1 7  ? 5.358   22.335  -3.560  1.00 0.00 ? 7  GLY A HA3  10 
ATOM 10092 N N    . ARG A 1 8  ? 4.416   21.286  -5.888  1.00 0.00 ? 8  ARG A N    10 
ATOM 10093 C CA   . ARG A 1 8  ? 4.296   21.098  -7.328  1.00 0.00 ? 8  ARG A CA   10 
ATOM 10094 C C    . ARG A 1 8  ? 4.452   19.627  -7.700  1.00 0.00 ? 8  ARG A C    10 
ATOM 10095 O O    . ARG A 1 8  ? 5.111   19.290  -8.684  1.00 0.00 ? 8  ARG A O    10 
ATOM 10096 C CB   . ARG A 1 8  ? 5.345   21.935  -8.063  1.00 0.00 ? 8  ARG A CB   10 
ATOM 10097 C CG   . ARG A 1 8  ? 5.001   22.201  -9.519  1.00 0.00 ? 8  ARG A CG   10 
ATOM 10098 C CD   . ARG A 1 8  ? 6.228   22.619  -10.314 1.00 0.00 ? 8  ARG A CD   10 
ATOM 10099 N NE   . ARG A 1 8  ? 6.422   24.066  -10.302 1.00 0.00 ? 8  ARG A NE   10 
ATOM 10100 C CZ   . ARG A 1 8  ? 5.609   24.922  -10.912 1.00 0.00 ? 8  ARG A CZ   10 
ATOM 10101 N NH1  . ARG A 1 8  ? 4.553   24.477  -11.579 1.00 0.00 ? 8  ARG A NH1  10 
ATOM 10102 N NH2  . ARG A 1 8  ? 5.852   26.225  -10.855 1.00 0.00 ? 8  ARG A NH2  10 
ATOM 10103 H H    . ARG A 1 8  ? 3.635   21.586  -5.378  1.00 0.00 ? 8  ARG A H    10 
ATOM 10104 H HA   . ARG A 1 8  ? 3.312   21.429  -7.625  1.00 0.00 ? 8  ARG A HA   10 
ATOM 10105 H HB2  . ARG A 1 8  ? 5.447   22.886  -7.561  1.00 0.00 ? 8  ARG A HB2  10 
ATOM 10106 H HB3  . ARG A 1 8  ? 6.291   21.416  -8.028  1.00 0.00 ? 8  ARG A HB3  10 
ATOM 10107 H HG2  . ARG A 1 8  ? 4.594   21.300  -9.954  1.00 0.00 ? 8  ARG A HG2  10 
ATOM 10108 H HG3  . ARG A 1 8  ? 4.266   22.991  -9.567  1.00 0.00 ? 8  ARG A HG3  10 
ATOM 10109 H HD2  . ARG A 1 8  ? 7.098   22.145  -9.883  1.00 0.00 ? 8  ARG A HD2  10 
ATOM 10110 H HD3  . ARG A 1 8  ? 6.108   22.289  -11.335 1.00 0.00 ? 8  ARG A HD3  10 
ATOM 10111 H HE   . ARG A 1 8  ? 7.196   24.416  -9.815  1.00 0.00 ? 8  ARG A HE   10 
ATOM 10112 H HH11 . ARG A 1 8  ? 4.367   23.496  -11.622 1.00 0.00 ? 8  ARG A HH11 10 
ATOM 10113 H HH12 . ARG A 1 8  ? 3.942   25.123  -12.037 1.00 0.00 ? 8  ARG A HH12 10 
ATOM 10114 H HH21 . ARG A 1 8  ? 6.647   26.564  -10.353 1.00 0.00 ? 8  ARG A HH21 10 
ATOM 10115 H HH22 . ARG A 1 8  ? 5.240   26.868  -11.315 1.00 0.00 ? 8  ARG A HH22 10 
ATOM 10116 N N    . LYS A 1 9  ? 3.844   18.753  -6.905  1.00 0.00 ? 9  LYS A N    10 
ATOM 10117 C CA   . LYS A 1 9  ? 3.914   17.317  -7.149  1.00 0.00 ? 9  LYS A CA   10 
ATOM 10118 C C    . LYS A 1 9  ? 2.560   16.775  -7.595  1.00 0.00 ? 9  LYS A C    10 
ATOM 10119 O O    . LYS A 1 9  ? 1.505   17.222  -7.144  1.00 0.00 ? 9  LYS A O    10 
ATOM 10120 C CB   . LYS A 1 9  ? 4.377   16.587  -5.887  1.00 0.00 ? 9  LYS A CB   10 
ATOM 10121 C CG   . LYS A 1 9  ? 3.441   16.763  -4.703  1.00 0.00 ? 9  LYS A CG   10 
ATOM 10122 C CD   . LYS A 1 9  ? 2.351   15.705  -4.692  1.00 0.00 ? 9  LYS A CD   10 
ATOM 10123 C CE   . LYS A 1 9  ? 2.778   14.473  -3.910  1.00 0.00 ? 9  LYS A CE   10 
ATOM 10124 N NZ   . LYS A 1 9  ? 4.097   13.955  -4.368  1.00 0.00 ? 9  LYS A NZ   10 
ATOM 10125 H H    . LYS A 1 9  ? 3.333   19.083  -6.135  1.00 0.00 ? 9  LYS A H    10 
ATOM 10126 H HA   . LYS A 1 9  ? 4.633   17.149  -7.936  1.00 0.00 ? 9  LYS A HA   10 
ATOM 10127 H HB2  . LYS A 1 9  ? 4.454   15.531  -6.104  1.00 0.00 ? 9  LYS A HB2  10 
ATOM 10128 H HB3  . LYS A 1 9  ? 5.352   16.960  -5.607  1.00 0.00 ? 9  LYS A HB3  10 
ATOM 10129 H HG2  . LYS A 1 9  ? 4.012   16.686  -3.790  1.00 0.00 ? 9  LYS A HG2  10 
ATOM 10130 H HG3  . LYS A 1 9  ? 2.982   17.740  -4.762  1.00 0.00 ? 9  LYS A HG3  10 
ATOM 10131 H HD2  . LYS A 1 9  ? 1.465   16.119  -4.234  1.00 0.00 ? 9  LYS A HD2  10 
ATOM 10132 H HD3  . LYS A 1 9  ? 2.131   15.417  -5.710  1.00 0.00 ? 9  LYS A HD3  10 
ATOM 10133 H HE2  . LYS A 1 9  ? 2.846   14.731  -2.865  1.00 0.00 ? 9  LYS A HE2  10 
ATOM 10134 H HE3  . LYS A 1 9  ? 2.033   13.703  -4.043  1.00 0.00 ? 9  LYS A HE3  10 
ATOM 10135 H HZ1  . LYS A 1 9  ? 4.823   14.694  -4.272  1.00 0.00 ? 9  LYS A HZ1  10 
ATOM 10136 H HZ2  . LYS A 1 9  ? 4.041   13.668  -5.366  1.00 0.00 ? 9  LYS A HZ2  10 
ATOM 10137 H HZ3  . LYS A 1 9  ? 4.376   13.133  -3.797  1.00 0.00 ? 9  LYS A HZ3  10 
ATOM 10138 N N    . PRO A 1 10 ? 2.587   15.786  -8.502  1.00 0.00 ? 10 PRO A N    10 
ATOM 10139 C CA   . PRO A 1 10 ? 1.370   15.160  -9.027  1.00 0.00 ? 10 PRO A CA   10 
ATOM 10140 C C    . PRO A 1 10 ? 0.657   14.312  -7.980  1.00 0.00 ? 10 PRO A C    10 
ATOM 10141 O O    . PRO A 1 10 ? 1.275   13.832  -7.030  1.00 0.00 ? 10 PRO A O    10 
ATOM 10142 C CB   . PRO A 1 10 ? 1.889   14.278  -10.166 1.00 0.00 ? 10 PRO A CB   10 
ATOM 10143 C CG   . PRO A 1 10 ? 3.303   13.985  -9.804  1.00 0.00 ? 10 PRO A CG   10 
ATOM 10144 C CD   . PRO A 1 10 ? 3.808   15.204  -9.083  1.00 0.00 ? 10 PRO A CD   10 
ATOM 10145 H HA   . PRO A 1 10 ? 0.685   15.895  -9.422  1.00 0.00 ? 10 PRO A HA   10 
ATOM 10146 H HB2  . PRO A 1 10 ? 1.298   13.375  -10.222 1.00 0.00 ? 10 PRO A HB2  10 
ATOM 10147 H HB3  . PRO A 1 10 ? 1.824   14.816  -11.100 1.00 0.00 ? 10 PRO A HB3  10 
ATOM 10148 H HG2  . PRO A 1 10 ? 3.345   13.122  -9.157  1.00 0.00 ? 10 PRO A HG2  10 
ATOM 10149 H HG3  . PRO A 1 10 ? 3.883   13.812  -10.700 1.00 0.00 ? 10 PRO A HG3  10 
ATOM 10150 H HD2  . PRO A 1 10 ? 4.508   14.923  -8.310  1.00 0.00 ? 10 PRO A HD2  10 
ATOM 10151 H HD3  . PRO A 1 10 ? 4.268   15.890  -9.779  1.00 0.00 ? 10 PRO A HD3  10 
ATOM 10152 N N    . ARG A 1 11 ? -0.648  14.132  -8.160  1.00 0.00 ? 11 ARG A N    10 
ATOM 10153 C CA   . ARG A 1 11 ? -1.446  13.342  -7.230  1.00 0.00 ? 11 ARG A CA   10 
ATOM 10154 C C    . ARG A 1 11 ? -0.700  12.078  -6.811  1.00 0.00 ? 11 ARG A C    10 
ATOM 10155 O O    . ARG A 1 11 ? -0.316  11.264  -7.651  1.00 0.00 ? 11 ARG A O    10 
ATOM 10156 C CB   . ARG A 1 11 ? -2.787  12.969  -7.864  1.00 0.00 ? 11 ARG A CB   10 
ATOM 10157 C CG   . ARG A 1 11 ? -3.681  14.166  -8.145  1.00 0.00 ? 11 ARG A CG   10 
ATOM 10158 C CD   . ARG A 1 11 ? -4.495  14.553  -6.920  1.00 0.00 ? 11 ARG A CD   10 
ATOM 10159 N NE   . ARG A 1 11 ? -5.399  13.485  -6.503  1.00 0.00 ? 11 ARG A NE   10 
ATOM 10160 C CZ   . ARG A 1 11 ? -6.352  13.643  -5.591  1.00 0.00 ? 11 ARG A CZ   10 
ATOM 10161 N NH1  . ARG A 1 11 ? -6.524  14.819  -5.004  1.00 0.00 ? 11 ARG A NH1  10 
ATOM 10162 N NH2  . ARG A 1 11 ? -7.135  12.623  -5.265  1.00 0.00 ? 11 ARG A NH2  10 
ATOM 10163 H H    . ARG A 1 11 ? -1.084  14.540  -8.937  1.00 0.00 ? 11 ARG A H    10 
ATOM 10164 H HA   . ARG A 1 11 ? -1.627  13.946  -6.353  1.00 0.00 ? 11 ARG A HA   10 
ATOM 10165 H HB2  . ARG A 1 11 ? -2.601  12.459  -8.798  1.00 0.00 ? 11 ARG A HB2  10 
ATOM 10166 H HB3  . ARG A 1 11 ? -3.313  12.303  -7.198  1.00 0.00 ? 11 ARG A HB3  10 
ATOM 10167 H HG2  . ARG A 1 11 ? -3.065  15.004  -8.434  1.00 0.00 ? 11 ARG A HG2  10 
ATOM 10168 H HG3  . ARG A 1 11 ? -4.355  13.918  -8.951  1.00 0.00 ? 11 ARG A HG3  10 
ATOM 10169 H HD2  . ARG A 1 11 ? -3.817  14.775  -6.110  1.00 0.00 ? 11 ARG A HD2  10 
ATOM 10170 H HD3  . ARG A 1 11 ? -5.075  15.433  -7.154  1.00 0.00 ? 11 ARG A HD3  10 
ATOM 10171 H HE   . ARG A 1 11 ? -5.289  12.608  -6.924  1.00 0.00 ? 11 ARG A HE   10 
ATOM 10172 H HH11 . ARG A 1 11 ? -5.936  15.590  -5.249  1.00 0.00 ? 11 ARG A HH11 10 
ATOM 10173 H HH12 . ARG A 1 11 ? -7.243  14.936  -4.318  1.00 0.00 ? 11 ARG A HH12 10 
ATOM 10174 H HH21 . ARG A 1 11 ? -7.008  11.735  -5.705  1.00 0.00 ? 11 ARG A HH21 10 
ATOM 10175 H HH22 . ARG A 1 11 ? -7.851  12.742  -4.578  1.00 0.00 ? 11 ARG A HH22 10 
ATOM 10176 N N    . THR A 1 12 ? -0.498  11.921  -5.506  1.00 0.00 ? 12 THR A N    10 
ATOM 10177 C CA   . THR A 1 12 ? 0.203   10.759  -4.976  1.00 0.00 ? 12 THR A CA   10 
ATOM 10178 C C    . THR A 1 12 ? -0.144  9.501   -5.764  1.00 0.00 ? 12 THR A C    10 
ATOM 10179 O O    . THR A 1 12 ? -1.201  9.422   -6.392  1.00 0.00 ? 12 THR A O    10 
ATOM 10180 C CB   . THR A 1 12 ? -0.133  10.529  -3.490  1.00 0.00 ? 12 THR A CB   10 
ATOM 10181 O OG1  . THR A 1 12 ? 0.091   11.732  -2.746  1.00 0.00 ? 12 THR A OG1  10 
ATOM 10182 C CG2  . THR A 1 12 ? 0.711   9.404   -2.912  1.00 0.00 ? 12 THR A CG2  10 
ATOM 10183 H H    . THR A 1 12 ? -0.828  12.605  -4.887  1.00 0.00 ? 12 THR A H    10 
ATOM 10184 H HA   . THR A 1 12 ? 1.264   10.942  -5.059  1.00 0.00 ? 12 THR A HA   10 
ATOM 10185 H HB   . THR A 1 12 ? -1.176  10.255  -3.411  1.00 0.00 ? 12 THR A HB   10 
ATOM 10186 H HG1  . THR A 1 12 ? 1.030   11.930  -2.733  1.00 0.00 ? 12 THR A HG1  10 
ATOM 10187 H HG21 . THR A 1 12 ? 0.540   8.499   -3.476  1.00 0.00 ? 12 THR A HG21 10 
ATOM 10188 H HG22 . THR A 1 12 ? 0.437   9.242   -1.880  1.00 0.00 ? 12 THR A HG22 10 
ATOM 10189 H HG23 . THR A 1 12 ? 1.755   9.672   -2.969  1.00 0.00 ? 12 THR A HG23 10 
ATOM 10190 N N    . ILE A 1 13 ? 0.750   8.519   -5.727  1.00 0.00 ? 13 ILE A N    10 
ATOM 10191 C CA   . ILE A 1 13 ? 0.536   7.264   -6.436  1.00 0.00 ? 13 ILE A CA   10 
ATOM 10192 C C    . ILE A 1 13 ? -0.812  6.650   -6.074  1.00 0.00 ? 13 ILE A C    10 
ATOM 10193 O O    . ILE A 1 13 ? -1.317  5.776   -6.778  1.00 0.00 ? 13 ILE A O    10 
ATOM 10194 C CB   . ILE A 1 13 ? 1.651   6.246   -6.128  1.00 0.00 ? 13 ILE A CB   10 
ATOM 10195 C CG1  . ILE A 1 13 ? 3.021   6.843   -6.455  1.00 0.00 ? 13 ILE A CG1  10 
ATOM 10196 C CG2  . ILE A 1 13 ? 1.426   4.962   -6.912  1.00 0.00 ? 13 ILE A CG2  10 
ATOM 10197 C CD1  . ILE A 1 13 ? 4.167   6.140   -5.762  1.00 0.00 ? 13 ILE A CD1  10 
ATOM 10198 H H    . ILE A 1 13 ? 1.573   8.641   -5.209  1.00 0.00 ? 13 ILE A H    10 
ATOM 10199 H HA   . ILE A 1 13 ? 0.551   7.474   -7.496  1.00 0.00 ? 13 ILE A HA   10 
ATOM 10200 H HB   . ILE A 1 13 ? 1.610   6.009   -5.076  1.00 0.00 ? 13 ILE A HB   10 
ATOM 10201 H HG12 . ILE A 1 13 ? 3.189   6.783   -7.518  1.00 0.00 ? 13 ILE A HG12 10 
ATOM 10202 H HG13 . ILE A 1 13 ? 3.035   7.880   -6.151  1.00 0.00 ? 13 ILE A HG13 10 
ATOM 10203 H HG21 . ILE A 1 13 ? 2.365   4.438   -7.022  1.00 0.00 ? 13 ILE A HG21 10 
ATOM 10204 H HG22 . ILE A 1 13 ? 0.725   4.335   -6.382  1.00 0.00 ? 13 ILE A HG22 10 
ATOM 10205 H HG23 . ILE A 1 13 ? 1.031   5.200   -7.888  1.00 0.00 ? 13 ILE A HG23 10 
ATOM 10206 H HD11 . ILE A 1 13 ? 4.943   6.855   -5.533  1.00 0.00 ? 13 ILE A HD11 10 
ATOM 10207 H HD12 . ILE A 1 13 ? 3.813   5.686   -4.850  1.00 0.00 ? 13 ILE A HD12 10 
ATOM 10208 H HD13 . ILE A 1 13 ? 4.566   5.375   -6.414  1.00 0.00 ? 13 ILE A HD13 10 
ATOM 10209 N N    . TYR A 1 14 ? -1.390  7.115   -4.972  1.00 0.00 ? 14 TYR A N    10 
ATOM 10210 C CA   . TYR A 1 14 ? -2.679  6.611   -4.514  1.00 0.00 ? 14 TYR A CA   10 
ATOM 10211 C C    . TYR A 1 14 ? -3.551  7.747   -3.985  1.00 0.00 ? 14 TYR A C    10 
ATOM 10212 O O    . TYR A 1 14 ? -3.052  8.700   -3.387  1.00 0.00 ? 14 TYR A O    10 
ATOM 10213 C CB   . TYR A 1 14 ? -2.481  5.555   -3.426  1.00 0.00 ? 14 TYR A CB   10 
ATOM 10214 C CG   . TYR A 1 14 ? -2.047  4.209   -3.961  1.00 0.00 ? 14 TYR A CG   10 
ATOM 10215 C CD1  . TYR A 1 14 ? -0.747  4.001   -4.403  1.00 0.00 ? 14 TYR A CD1  10 
ATOM 10216 C CD2  . TYR A 1 14 ? -2.938  3.144   -4.023  1.00 0.00 ? 14 TYR A CD2  10 
ATOM 10217 C CE1  . TYR A 1 14 ? -0.347  2.773   -4.893  1.00 0.00 ? 14 TYR A CE1  10 
ATOM 10218 C CE2  . TYR A 1 14 ? -2.546  1.912   -4.510  1.00 0.00 ? 14 TYR A CE2  10 
ATOM 10219 C CZ   . TYR A 1 14 ? -1.250  1.732   -4.944  1.00 0.00 ? 14 TYR A CZ   10 
ATOM 10220 O OH   . TYR A 1 14 ? -0.854  0.507   -5.430  1.00 0.00 ? 14 TYR A OH   10 
ATOM 10221 H H    . TYR A 1 14 ? -0.938  7.812   -4.452  1.00 0.00 ? 14 TYR A H    10 
ATOM 10222 H HA   . TYR A 1 14 ? -3.176  6.156   -5.359  1.00 0.00 ? 14 TYR A HA   10 
ATOM 10223 H HB2  . TYR A 1 14 ? -1.725  5.896   -2.736  1.00 0.00 ? 14 TYR A HB2  10 
ATOM 10224 H HB3  . TYR A 1 14 ? -3.412  5.417   -2.895  1.00 0.00 ? 14 TYR A HB3  10 
ATOM 10225 H HD1  . TYR A 1 14 ? -0.042  4.819   -4.361  1.00 0.00 ? 14 TYR A HD1  10 
ATOM 10226 H HD2  . TYR A 1 14 ? -3.953  3.289   -3.682  1.00 0.00 ? 14 TYR A HD2  10 
ATOM 10227 H HE1  . TYR A 1 14 ? 0.669   2.632   -5.233  1.00 0.00 ? 14 TYR A HE1  10 
ATOM 10228 H HE2  . TYR A 1 14 ? -3.253  1.097   -4.550  1.00 0.00 ? 14 TYR A HE2  10 
ATOM 10229 H HH   . TYR A 1 14 ? -1.278  0.347   -6.277  1.00 0.00 ? 14 TYR A HH   10 
ATOM 10230 N N    . SER A 1 15 ? -4.856  7.636   -4.209  1.00 0.00 ? 15 SER A N    10 
ATOM 10231 C CA   . SER A 1 15 ? -5.798  8.653   -3.758  1.00 0.00 ? 15 SER A CA   10 
ATOM 10232 C C    . SER A 1 15 ? -5.886  8.675   -2.235  1.00 0.00 ? 15 SER A C    10 
ATOM 10233 O O    . SER A 1 15 ? -5.681  7.656   -1.576  1.00 0.00 ? 15 SER A O    10 
ATOM 10234 C CB   . SER A 1 15 ? -7.182  8.398   -4.357  1.00 0.00 ? 15 SER A CB   10 
ATOM 10235 O OG   . SER A 1 15 ? -8.062  9.476   -4.087  1.00 0.00 ? 15 SER A OG   10 
ATOM 10236 H H    . SER A 1 15 ? -5.193  6.852   -4.692  1.00 0.00 ? 15 SER A H    10 
ATOM 10237 H HA   . SER A 1 15 ? -5.439  9.613   -4.100  1.00 0.00 ? 15 SER A HA   10 
ATOM 10238 H HB2  . SER A 1 15 ? -7.093  8.282   -5.426  1.00 0.00 ? 15 SER A HB2  10 
ATOM 10239 H HB3  . SER A 1 15 ? -7.596  7.496   -3.930  1.00 0.00 ? 15 SER A HB3  10 
ATOM 10240 H HG   . SER A 1 15 ? -7.678  10.293  -4.415  1.00 0.00 ? 15 SER A HG   10 
ATOM 10241 N N    . SER A 1 16 ? -6.193  9.844   -1.683  1.00 0.00 ? 16 SER A N    10 
ATOM 10242 C CA   . SER A 1 16 ? -6.305  10.001  -0.237  1.00 0.00 ? 16 SER A CA   10 
ATOM 10243 C C    . SER A 1 16 ? -7.324  9.022   0.338   1.00 0.00 ? 16 SER A C    10 
ATOM 10244 O O    . SER A 1 16 ? -7.147  8.498   1.438   1.00 0.00 ? 16 SER A O    10 
ATOM 10245 C CB   . SER A 1 16 ? -6.706  11.436  0.112   1.00 0.00 ? 16 SER A CB   10 
ATOM 10246 O OG   . SER A 1 16 ? -7.949  11.776  -0.478  1.00 0.00 ? 16 SER A OG   10 
ATOM 10247 H H    . SER A 1 16 ? -6.345  10.621  -2.262  1.00 0.00 ? 16 SER A H    10 
ATOM 10248 H HA   . SER A 1 16 ? -5.338  9.791   0.195   1.00 0.00 ? 16 SER A HA   10 
ATOM 10249 H HB2  . SER A 1 16 ? -6.791  11.532  1.183   1.00 0.00 ? 16 SER A HB2  10 
ATOM 10250 H HB3  . SER A 1 16 ? -5.950  12.116  -0.253  1.00 0.00 ? 16 SER A HB3  10 
ATOM 10251 H HG   . SER A 1 16 ? -8.294  12.570  -0.063  1.00 0.00 ? 16 SER A HG   10 
ATOM 10252 N N    . PHE A 1 17 ? -8.393  8.779   -0.415  1.00 0.00 ? 17 PHE A N    10 
ATOM 10253 C CA   . PHE A 1 17 ? -9.442  7.864   0.019   1.00 0.00 ? 17 PHE A CA   10 
ATOM 10254 C C    . PHE A 1 17 ? -8.934  6.426   0.041   1.00 0.00 ? 17 PHE A C    10 
ATOM 10255 O O    . PHE A 1 17 ? -9.081  5.720   1.038   1.00 0.00 ? 17 PHE A O    10 
ATOM 10256 C CB   . PHE A 1 17 ? -10.658 7.975   -0.903  1.00 0.00 ? 17 PHE A CB   10 
ATOM 10257 C CG   . PHE A 1 17 ? -11.598 6.808   -0.797  1.00 0.00 ? 17 PHE A CG   10 
ATOM 10258 C CD1  . PHE A 1 17 ? -11.315 5.612   -1.437  1.00 0.00 ? 17 PHE A CD1  10 
ATOM 10259 C CD2  . PHE A 1 17 ? -12.766 6.908   -0.057  1.00 0.00 ? 17 PHE A CD2  10 
ATOM 10260 C CE1  . PHE A 1 17 ? -12.179 4.537   -1.341  1.00 0.00 ? 17 PHE A CE1  10 
ATOM 10261 C CE2  . PHE A 1 17 ? -13.633 5.836   0.043   1.00 0.00 ? 17 PHE A CE2  10 
ATOM 10262 C CZ   . PHE A 1 17 ? -13.339 4.650   -0.601  1.00 0.00 ? 17 PHE A CZ   10 
ATOM 10263 H H    . PHE A 1 17 ? -8.477  9.227   -1.283  1.00 0.00 ? 17 PHE A H    10 
ATOM 10264 H HA   . PHE A 1 17 ? -9.733  8.146   1.019   1.00 0.00 ? 17 PHE A HA   10 
ATOM 10265 H HB2  . PHE A 1 17 ? -11.209 8.869   -0.655  1.00 0.00 ? 17 PHE A HB2  10 
ATOM 10266 H HB3  . PHE A 1 17 ? -10.319 8.038   -1.926  1.00 0.00 ? 17 PHE A HB3  10 
ATOM 10267 H HD1  . PHE A 1 17 ? -10.407 5.523   -2.016  1.00 0.00 ? 17 PHE A HD1  10 
ATOM 10268 H HD2  . PHE A 1 17 ? -12.997 7.836   0.445   1.00 0.00 ? 17 PHE A HD2  10 
ATOM 10269 H HE1  . PHE A 1 17 ? -11.946 3.611   -1.845  1.00 0.00 ? 17 PHE A HE1  10 
ATOM 10270 H HE2  . PHE A 1 17 ? -14.540 5.927   0.621   1.00 0.00 ? 17 PHE A HE2  10 
ATOM 10271 H HZ   . PHE A 1 17 ? -14.015 3.811   -0.524  1.00 0.00 ? 17 PHE A HZ   10 
ATOM 10272 N N    . GLN A 1 18 ? -8.338  5.999   -1.068  1.00 0.00 ? 18 GLN A N    10 
ATOM 10273 C CA   . GLN A 1 18 ? -7.809  4.644   -1.177  1.00 0.00 ? 18 GLN A CA   10 
ATOM 10274 C C    . GLN A 1 18 ? -6.727  4.396   -0.132  1.00 0.00 ? 18 GLN A C    10 
ATOM 10275 O O    . GLN A 1 18 ? -6.596  3.289   0.392   1.00 0.00 ? 18 GLN A O    10 
ATOM 10276 C CB   . GLN A 1 18 ? -7.246  4.405   -2.579  1.00 0.00 ? 18 GLN A CB   10 
ATOM 10277 C CG   . GLN A 1 18 ? -8.311  4.356   -3.662  1.00 0.00 ? 18 GLN A CG   10 
ATOM 10278 C CD   . GLN A 1 18 ? -7.724  4.206   -5.052  1.00 0.00 ? 18 GLN A CD   10 
ATOM 10279 O OE1  . GLN A 1 18 ? -6.707  4.819   -5.378  1.00 0.00 ? 18 GLN A OE1  10 
ATOM 10280 N NE2  . GLN A 1 18 ? -8.363  3.388   -5.879  1.00 0.00 ? 18 GLN A NE2  10 
ATOM 10281 H H    . GLN A 1 18 ? -8.251  6.608   -1.829  1.00 0.00 ? 18 GLN A H    10 
ATOM 10282 H HA   . GLN A 1 18 ? -8.623  3.956   -1.004  1.00 0.00 ? 18 GLN A HA   10 
ATOM 10283 H HB2  . GLN A 1 18 ? -6.556  5.201   -2.817  1.00 0.00 ? 18 GLN A HB2  10 
ATOM 10284 H HB3  . GLN A 1 18 ? -6.715  3.465   -2.584  1.00 0.00 ? 18 GLN A HB3  10 
ATOM 10285 H HG2  . GLN A 1 18 ? -8.963  3.516   -3.471  1.00 0.00 ? 18 GLN A HG2  10 
ATOM 10286 H HG3  . GLN A 1 18 ? -8.885  5.270   -3.626  1.00 0.00 ? 18 GLN A HG3  10 
ATOM 10287 H HE21 . GLN A 1 18 ? -9.168  2.934   -5.551  1.00 0.00 ? 18 GLN A HE21 10 
ATOM 10288 H HE22 . GLN A 1 18 ? -8.006  3.273   -6.784  1.00 0.00 ? 18 GLN A HE22 10 
ATOM 10289 N N    . LEU A 1 19 ? -5.952  5.433   0.168   1.00 0.00 ? 19 LEU A N    10 
ATOM 10290 C CA   . LEU A 1 19 ? -4.879  5.328   1.151   1.00 0.00 ? 19 LEU A CA   10 
ATOM 10291 C C    . LEU A 1 19 ? -5.443  5.238   2.565   1.00 0.00 ? 19 LEU A C    10 
ATOM 10292 O O    . LEU A 1 19 ? -5.113  4.322   3.318   1.00 0.00 ? 19 LEU A O    10 
ATOM 10293 C CB   . LEU A 1 19 ? -3.940  6.530   1.040   1.00 0.00 ? 19 LEU A CB   10 
ATOM 10294 C CG   . LEU A 1 19 ? -2.855  6.437   -0.034  1.00 0.00 ? 19 LEU A CG   10 
ATOM 10295 C CD1  . LEU A 1 19 ? -2.179  7.785   -0.228  1.00 0.00 ? 19 LEU A CD1  10 
ATOM 10296 C CD2  . LEU A 1 19 ? -1.831  5.373   0.334   1.00 0.00 ? 19 LEU A CD2  10 
ATOM 10297 H H    . LEU A 1 19 ? -6.104  6.289   -0.282  1.00 0.00 ? 19 LEU A H    10 
ATOM 10298 H HA   . LEU A 1 19 ? -4.324  4.426   0.940   1.00 0.00 ? 19 LEU A HA   10 
ATOM 10299 H HB2  . LEU A 1 19 ? -4.541  7.401   0.827   1.00 0.00 ? 19 LEU A HB2  10 
ATOM 10300 H HB3  . LEU A 1 19 ? -3.451  6.656   1.996   1.00 0.00 ? 19 LEU A HB3  10 
ATOM 10301 H HG   . LEU A 1 19 ? -3.310  6.154   -0.973  1.00 0.00 ? 19 LEU A HG   10 
ATOM 10302 H HD11 . LEU A 1 19 ? -2.901  8.574   -0.079  1.00 0.00 ? 19 LEU A HD11 10 
ATOM 10303 H HD12 . LEU A 1 19 ? -1.779  7.847   -1.229  1.00 0.00 ? 19 LEU A HD12 10 
ATOM 10304 H HD13 . LEU A 1 19 ? -1.376  7.892   0.487   1.00 0.00 ? 19 LEU A HD13 10 
ATOM 10305 H HD21 . LEU A 1 19 ? -1.110  5.791   1.021   1.00 0.00 ? 19 LEU A HD21 10 
ATOM 10306 H HD22 . LEU A 1 19 ? -1.324  5.038   -0.559  1.00 0.00 ? 19 LEU A HD22 10 
ATOM 10307 H HD23 . LEU A 1 19 ? -2.331  4.537   0.800   1.00 0.00 ? 19 LEU A HD23 10 
ATOM 10308 N N    . ALA A 1 20 ? -6.298  6.193   2.918   1.00 0.00 ? 20 ALA A N    10 
ATOM 10309 C CA   . ALA A 1 20 ? -6.911  6.219   4.239   1.00 0.00 ? 20 ALA A CA   10 
ATOM 10310 C C    . ALA A 1 20 ? -7.180  4.806   4.748   1.00 0.00 ? 20 ALA A C    10 
ATOM 10311 O O    . ALA A 1 20 ? -7.015  4.521   5.933   1.00 0.00 ? 20 ALA A O    10 
ATOM 10312 C CB   . ALA A 1 20 ? -8.202  7.025   4.207   1.00 0.00 ? 20 ALA A CB   10 
ATOM 10313 H H    . ALA A 1 20 ? -6.522  6.896   2.273   1.00 0.00 ? 20 ALA A H    10 
ATOM 10314 H HA   . ALA A 1 20 ? -6.226  6.710   4.916   1.00 0.00 ? 20 ALA A HA   10 
ATOM 10315 H HB1  . ALA A 1 20 ? -7.971  8.075   4.307   1.00 0.00 ? 20 ALA A HB1  10 
ATOM 10316 H HB2  . ALA A 1 20 ? -8.708  6.855   3.268   1.00 0.00 ? 20 ALA A HB2  10 
ATOM 10317 H HB3  . ALA A 1 20 ? -8.839  6.716   5.022   1.00 0.00 ? 20 ALA A HB3  10 
ATOM 10318 N N    . ALA A 1 21 ? -7.597  3.926   3.843   1.00 0.00 ? 21 ALA A N    10 
ATOM 10319 C CA   . ALA A 1 21 ? -7.887  2.543   4.200   1.00 0.00 ? 21 ALA A CA   10 
ATOM 10320 C C    . ALA A 1 21 ? -6.621  1.694   4.181   1.00 0.00 ? 21 ALA A C    10 
ATOM 10321 O O    . ALA A 1 21 ? -6.405  0.862   5.064   1.00 0.00 ? 21 ALA A O    10 
ATOM 10322 C CB   . ALA A 1 21 ? -8.929  1.962   3.256   1.00 0.00 ? 21 ALA A CB   10 
ATOM 10323 H H    . ALA A 1 21 ? -7.710  4.214   2.913   1.00 0.00 ? 21 ALA A H    10 
ATOM 10324 H HA   . ALA A 1 21 ? -8.299  2.536   5.200   1.00 0.00 ? 21 ALA A HA   10 
ATOM 10325 H HB1  . ALA A 1 21 ? -8.878  2.474   2.306   1.00 0.00 ? 21 ALA A HB1  10 
ATOM 10326 H HB2  . ALA A 1 21 ? -8.736  0.910   3.111   1.00 0.00 ? 21 ALA A HB2  10 
ATOM 10327 H HB3  . ALA A 1 21 ? -9.913  2.092   3.682   1.00 0.00 ? 21 ALA A HB3  10 
ATOM 10328 N N    . LEU A 1 22 ? -5.787  1.907   3.170   1.00 0.00 ? 22 LEU A N    10 
ATOM 10329 C CA   . LEU A 1 22 ? -4.541  1.160   3.035   1.00 0.00 ? 22 LEU A CA   10 
ATOM 10330 C C    . LEU A 1 22 ? -3.660  1.343   4.267   1.00 0.00 ? 22 LEU A C    10 
ATOM 10331 O O    . LEU A 1 22 ? -3.293  0.372   4.928   1.00 0.00 ? 22 LEU A O    10 
ATOM 10332 C CB   . LEU A 1 22 ? -3.786  1.610   1.784   1.00 0.00 ? 22 LEU A CB   10 
ATOM 10333 C CG   . LEU A 1 22 ? -4.365  1.145   0.447   1.00 0.00 ? 22 LEU A CG   10 
ATOM 10334 C CD1  . LEU A 1 22 ? -3.637  1.810   -0.711  1.00 0.00 ? 22 LEU A CD1  10 
ATOM 10335 C CD2  . LEU A 1 22 ? -4.286  -0.370  0.329   1.00 0.00 ? 22 LEU A CD2  10 
ATOM 10336 H H    . LEU A 1 22 ? -6.012  2.582   2.497   1.00 0.00 ? 22 LEU A H    10 
ATOM 10337 H HA   . LEU A 1 22 ? -4.791  0.114   2.939   1.00 0.00 ? 22 LEU A HA   10 
ATOM 10338 H HB2  . LEU A 1 22 ? -3.768  2.689   1.778   1.00 0.00 ? 22 LEU A HB2  10 
ATOM 10339 H HB3  . LEU A 1 22 ? -2.775  1.235   1.855   1.00 0.00 ? 22 LEU A HB3  10 
ATOM 10340 H HG   . LEU A 1 22 ? -5.407  1.431   0.394   1.00 0.00 ? 22 LEU A HG   10 
ATOM 10341 H HD11 . LEU A 1 22 ? -4.357  2.164   -1.433  1.00 0.00 ? 22 LEU A HD11 10 
ATOM 10342 H HD12 . LEU A 1 22 ? -2.978  1.095   -1.180  1.00 0.00 ? 22 LEU A HD12 10 
ATOM 10343 H HD13 . LEU A 1 22 ? -3.058  2.643   -0.340  1.00 0.00 ? 22 LEU A HD13 10 
ATOM 10344 H HD21 . LEU A 1 22 ? -4.181  -0.645  -0.710  1.00 0.00 ? 22 LEU A HD21 10 
ATOM 10345 H HD22 . LEU A 1 22 ? -5.188  -0.810  0.728   1.00 0.00 ? 22 LEU A HD22 10 
ATOM 10346 H HD23 . LEU A 1 22 ? -3.433  -0.730  0.885   1.00 0.00 ? 22 LEU A HD23 10 
ATOM 10347 N N    . GLN A 1 23 ? -3.328  2.593   4.570   1.00 0.00 ? 23 GLN A N    10 
ATOM 10348 C CA   . GLN A 1 23 ? -2.492  2.903   5.724   1.00 0.00 ? 23 GLN A CA   10 
ATOM 10349 C C    . GLN A 1 23 ? -3.119  2.372   7.009   1.00 0.00 ? 23 GLN A C    10 
ATOM 10350 O O    . GLN A 1 23 ? -2.432  1.805   7.859   1.00 0.00 ? 23 GLN A O    10 
ATOM 10351 C CB   . GLN A 1 23 ? -2.276  4.413   5.834   1.00 0.00 ? 23 GLN A CB   10 
ATOM 10352 C CG   . GLN A 1 23 ? -1.207  4.945   4.893   1.00 0.00 ? 23 GLN A CG   10 
ATOM 10353 C CD   . GLN A 1 23 ? -0.668  6.295   5.325   1.00 0.00 ? 23 GLN A CD   10 
ATOM 10354 O OE1  . GLN A 1 23 ? -0.830  7.294   4.623   1.00 0.00 ? 23 GLN A OE1  10 
ATOM 10355 N NE2  . GLN A 1 23 ? -0.024  6.332   6.485   1.00 0.00 ? 23 GLN A NE2  10 
ATOM 10356 H H    . GLN A 1 23 ? -3.652  3.324   4.005   1.00 0.00 ? 23 GLN A H    10 
ATOM 10357 H HA   . GLN A 1 23 ? -1.536  2.422   5.580   1.00 0.00 ? 23 GLN A HA   10 
ATOM 10358 H HB2  . GLN A 1 23 ? -3.205  4.915   5.609   1.00 0.00 ? 23 GLN A HB2  10 
ATOM 10359 H HB3  . GLN A 1 23 ? -1.984  4.651   6.846   1.00 0.00 ? 23 GLN A HB3  10 
ATOM 10360 H HG2  . GLN A 1 23 ? -0.388  4.241   4.864   1.00 0.00 ? 23 GLN A HG2  10 
ATOM 10361 H HG3  . GLN A 1 23 ? -1.632  5.042   3.905   1.00 0.00 ? 23 GLN A HG3  10 
ATOM 10362 H HE21 . GLN A 1 23 ? 0.067   5.496   6.990   1.00 0.00 ? 23 GLN A HE21 10 
ATOM 10363 H HE22 . GLN A 1 23 ? 0.335   7.191   6.788   1.00 0.00 ? 23 GLN A HE22 10 
ATOM 10364 N N    . ARG A 1 24 ? -4.428  2.561   7.144   1.00 0.00 ? 24 ARG A N    10 
ATOM 10365 C CA   . ARG A 1 24 ? -5.147  2.103   8.327   1.00 0.00 ? 24 ARG A CA   10 
ATOM 10366 C C    . ARG A 1 24 ? -5.211  0.579   8.368   1.00 0.00 ? 24 ARG A C    10 
ATOM 10367 O O    . ARG A 1 24 ? -5.412  -0.016  9.427   1.00 0.00 ? 24 ARG A O    10 
ATOM 10368 C CB   . ARG A 1 24 ? -6.563  2.684   8.345   1.00 0.00 ? 24 ARG A CB   10 
ATOM 10369 C CG   . ARG A 1 24 ? -6.663  4.019   9.064   1.00 0.00 ? 24 ARG A CG   10 
ATOM 10370 C CD   . ARG A 1 24 ? -5.605  4.996   8.575   1.00 0.00 ? 24 ARG A CD   10 
ATOM 10371 N NE   . ARG A 1 24 ? -5.373  6.076   9.531   1.00 0.00 ? 24 ARG A NE   10 
ATOM 10372 C CZ   . ARG A 1 24 ? -4.555  5.971   10.573  1.00 0.00 ? 24 ARG A CZ   10 
ATOM 10373 N NH1  . ARG A 1 24 ? -3.895  4.843   10.791  1.00 0.00 ? 24 ARG A NH1  10 
ATOM 10374 N NH2  . ARG A 1 24 ? -4.397  6.998   11.398  1.00 0.00 ? 24 ARG A NH2  10 
ATOM 10375 H H    . ARG A 1 24 ? -4.921  3.020   6.433   1.00 0.00 ? 24 ARG A H    10 
ATOM 10376 H HA   . ARG A 1 24 ? -4.613  2.452   9.197   1.00 0.00 ? 24 ARG A HA   10 
ATOM 10377 H HB2  . ARG A 1 24 ? -6.896  2.822   7.327   1.00 0.00 ? 24 ARG A HB2  10 
ATOM 10378 H HB3  . ARG A 1 24 ? -7.219  1.984   8.839   1.00 0.00 ? 24 ARG A HB3  10 
ATOM 10379 H HG2  . ARG A 1 24 ? -7.640  4.443   8.882   1.00 0.00 ? 24 ARG A HG2  10 
ATOM 10380 H HG3  . ARG A 1 24 ? -6.530  3.858   10.124  1.00 0.00 ? 24 ARG A HG3  10 
ATOM 10381 H HD2  . ARG A 1 24 ? -4.681  4.459   8.422   1.00 0.00 ? 24 ARG A HD2  10 
ATOM 10382 H HD3  . ARG A 1 24 ? -5.933  5.422   7.638   1.00 0.00 ? 24 ARG A HD3  10 
ATOM 10383 H HE   . ARG A 1 24 ? -5.851  6.919   9.389   1.00 0.00 ? 24 ARG A HE   10 
ATOM 10384 H HH11 . ARG A 1 24 ? -4.012  4.068   10.170  1.00 0.00 ? 24 ARG A HH11 10 
ATOM 10385 H HH12 . ARG A 1 24 ? -3.279  4.767   11.575  1.00 0.00 ? 24 ARG A HH12 10 
ATOM 10386 H HH21 . ARG A 1 24 ? -4.892  7.851   11.237  1.00 0.00 ? 24 ARG A HH21 10 
ATOM 10387 H HH22 . ARG A 1 24 ? -3.781  6.919   12.182  1.00 0.00 ? 24 ARG A HH22 10 
ATOM 10388 N N    . ARG A 1 25 ? -5.039  -0.047  7.208   1.00 0.00 ? 25 ARG A N    10 
ATOM 10389 C CA   . ARG A 1 25 ? -5.079  -1.501  7.111   1.00 0.00 ? 25 ARG A CA   10 
ATOM 10390 C C    . ARG A 1 25 ? -3.697  -2.100  7.353   1.00 0.00 ? 25 ARG A C    10 
ATOM 10391 O O    . ARG A 1 25 ? -3.569  -3.178  7.933   1.00 0.00 ? 25 ARG A O    10 
ATOM 10392 C CB   . ARG A 1 25 ? -5.598  -1.928  5.737   1.00 0.00 ? 25 ARG A CB   10 
ATOM 10393 C CG   . ARG A 1 25 ? -5.945  -3.405  5.648   1.00 0.00 ? 25 ARG A CG   10 
ATOM 10394 C CD   . ARG A 1 25 ? -7.181  -3.737  6.469   1.00 0.00 ? 25 ARG A CD   10 
ATOM 10395 N NE   . ARG A 1 25 ? -8.409  -3.292  5.815   1.00 0.00 ? 25 ARG A NE   10 
ATOM 10396 C CZ   . ARG A 1 25 ? -8.942  -2.088  5.993   1.00 0.00 ? 25 ARG A CZ   10 
ATOM 10397 N NH1  . ARG A 1 25 ? -8.359  -1.214  6.802   1.00 0.00 ? 25 ARG A NH1  10 
ATOM 10398 N NH2  . ARG A 1 25 ? -10.061 -1.757  5.362   1.00 0.00 ? 25 ARG A NH2  10 
ATOM 10399 H H    . ARG A 1 25 ? -4.883  0.482   6.398   1.00 0.00 ? 25 ARG A H    10 
ATOM 10400 H HA   . ARG A 1 25 ? -5.754  -1.866  7.870   1.00 0.00 ? 25 ARG A HA   10 
ATOM 10401 H HB2  . ARG A 1 25 ? -6.486  -1.358  5.507   1.00 0.00 ? 25 ARG A HB2  10 
ATOM 10402 H HB3  . ARG A 1 25 ? -4.841  -1.713  4.997   1.00 0.00 ? 25 ARG A HB3  10 
ATOM 10403 H HG2  . ARG A 1 25 ? -6.133  -3.660  4.616   1.00 0.00 ? 25 ARG A HG2  10 
ATOM 10404 H HG3  . ARG A 1 25 ? -5.112  -3.983  6.018   1.00 0.00 ? 25 ARG A HG3  10 
ATOM 10405 H HD2  . ARG A 1 25 ? -7.228  -4.806  6.610   1.00 0.00 ? 25 ARG A HD2  10 
ATOM 10406 H HD3  . ARG A 1 25 ? -7.100  -3.251  7.430   1.00 0.00 ? 25 ARG A HD3  10 
ATOM 10407 H HE   . ARG A 1 25 ? -8.856  -3.922  5.213   1.00 0.00 ? 25 ARG A HE   10 
ATOM 10408 H HH11 . ARG A 1 25 ? -7.515  -1.461  7.278   1.00 0.00 ? 25 ARG A HH11 10 
ATOM 10409 H HH12 . ARG A 1 25 ? -8.762  -0.308  6.934   1.00 0.00 ? 25 ARG A HH12 10 
ATOM 10410 H HH21 . ARG A 1 25 ? -10.504 -2.413  4.752   1.00 0.00 ? 25 ARG A HH21 10 
ATOM 10411 H HH22 . ARG A 1 25 ? -10.462 -0.851  5.497   1.00 0.00 ? 25 ARG A HH22 10 
ATOM 10412 N N    . PHE A 1 26 ? -2.665  -1.393  6.904   1.00 0.00 ? 26 PHE A N    10 
ATOM 10413 C CA   . PHE A 1 26 ? -1.292  -1.856  7.070   1.00 0.00 ? 26 PHE A CA   10 
ATOM 10414 C C    . PHE A 1 26 ? -0.976  -2.104  8.542   1.00 0.00 ? 26 PHE A C    10 
ATOM 10415 O O    . PHE A 1 26 ? -0.602  -3.211  8.929   1.00 0.00 ? 26 PHE A O    10 
ATOM 10416 C CB   . PHE A 1 26 ? -0.313  -0.831  6.493   1.00 0.00 ? 26 PHE A CB   10 
ATOM 10417 C CG   . PHE A 1 26 ? 1.121   -1.278  6.542   1.00 0.00 ? 26 PHE A CG   10 
ATOM 10418 C CD1  . PHE A 1 26 ? 1.524   -2.428  5.883   1.00 0.00 ? 26 PHE A CD1  10 
ATOM 10419 C CD2  . PHE A 1 26 ? 2.064   -0.548  7.247   1.00 0.00 ? 26 PHE A CD2  10 
ATOM 10420 C CE1  . PHE A 1 26 ? 2.842   -2.842  5.925   1.00 0.00 ? 26 PHE A CE1  10 
ATOM 10421 C CE2  . PHE A 1 26 ? 3.383   -0.957  7.292   1.00 0.00 ? 26 PHE A CE2  10 
ATOM 10422 C CZ   . PHE A 1 26 ? 3.773   -2.106  6.632   1.00 0.00 ? 26 PHE A CZ   10 
ATOM 10423 H H    . PHE A 1 26 ? -2.830  -0.541  6.449   1.00 0.00 ? 26 PHE A H    10 
ATOM 10424 H HA   . PHE A 1 26 ? -1.188  -2.784  6.531   1.00 0.00 ? 26 PHE A HA   10 
ATOM 10425 H HB2  . PHE A 1 26 ? -0.566  -0.644  5.460   1.00 0.00 ? 26 PHE A HB2  10 
ATOM 10426 H HB3  . PHE A 1 26 ? -0.394  0.088   7.052   1.00 0.00 ? 26 PHE A HB3  10 
ATOM 10427 H HD1  . PHE A 1 26 ? 0.796   -3.006  5.330   1.00 0.00 ? 26 PHE A HD1  10 
ATOM 10428 H HD2  . PHE A 1 26 ? 1.761   0.350   7.764   1.00 0.00 ? 26 PHE A HD2  10 
ATOM 10429 H HE1  . PHE A 1 26 ? 3.143   -3.741  5.408   1.00 0.00 ? 26 PHE A HE1  10 
ATOM 10430 H HE2  . PHE A 1 26 ? 4.109   -0.379  7.846   1.00 0.00 ? 26 PHE A HE2  10 
ATOM 10431 H HZ   . PHE A 1 26 ? 4.803   -2.427  6.666   1.00 0.00 ? 26 PHE A HZ   10 
ATOM 10432 N N    . GLN A 1 27 ? -1.129  -1.066  9.358   1.00 0.00 ? 27 GLN A N    10 
ATOM 10433 C CA   . GLN A 1 27 ? -0.859  -1.170  10.787  1.00 0.00 ? 27 GLN A CA   10 
ATOM 10434 C C    . GLN A 1 27 ? -1.436  -2.462  11.356  1.00 0.00 ? 27 GLN A C    10 
ATOM 10435 O O    . GLN A 1 27 ? -0.758  -3.190  12.083  1.00 0.00 ? 27 GLN A O    10 
ATOM 10436 C CB   . GLN A 1 27 ? -1.444  0.033   11.527  1.00 0.00 ? 27 GLN A CB   10 
ATOM 10437 C CG   . GLN A 1 27 ? -2.849  0.401   11.076  1.00 0.00 ? 27 GLN A CG   10 
ATOM 10438 C CD   . GLN A 1 27 ? -3.924  -0.276  11.903  1.00 0.00 ? 27 GLN A CD   10 
ATOM 10439 O OE1  . GLN A 1 27 ? -4.653  -1.136  11.410  1.00 0.00 ? 27 GLN A OE1  10 
ATOM 10440 N NE2  . GLN A 1 27 ? -4.027  0.110   13.170  1.00 0.00 ? 27 GLN A NE2  10 
ATOM 10441 H H    . GLN A 1 27 ? -1.430  -0.209  8.990   1.00 0.00 ? 27 GLN A H    10 
ATOM 10442 H HA   . GLN A 1 27 ? 0.212   -1.179  10.922  1.00 0.00 ? 27 GLN A HA   10 
ATOM 10443 H HB2  . GLN A 1 27 ? -1.475  -0.189  12.584  1.00 0.00 ? 27 GLN A HB2  10 
ATOM 10444 H HB3  . GLN A 1 27 ? -0.803  0.887   11.366  1.00 0.00 ? 27 GLN A HB3  10 
ATOM 10445 H HG2  . GLN A 1 27 ? -2.972  1.471   11.161  1.00 0.00 ? 27 GLN A HG2  10 
ATOM 10446 H HG3  . GLN A 1 27 ? -2.970  0.107   10.044  1.00 0.00 ? 27 GLN A HG3  10 
ATOM 10447 H HE21 . GLN A 1 27 ? -3.413  0.802   13.494  1.00 0.00 ? 27 GLN A HE21 10 
ATOM 10448 H HE22 . GLN A 1 27 ? -4.714  -0.310  13.727  1.00 0.00 ? 27 GLN A HE22 10 
ATOM 10449 N N    . LYS A 1 28 ? -2.691  -2.742  11.022  1.00 0.00 ? 28 LYS A N    10 
ATOM 10450 C CA   . LYS A 1 28 ? -3.360  -3.947  11.499  1.00 0.00 ? 28 LYS A CA   10 
ATOM 10451 C C    . LYS A 1 28 ? -2.495  -5.180  11.258  1.00 0.00 ? 28 LYS A C    10 
ATOM 10452 O O    . LYS A 1 28 ? -2.324  -6.015  12.148  1.00 0.00 ? 28 LYS A O    10 
ATOM 10453 C CB   . LYS A 1 28 ? -4.712  -4.114  10.801  1.00 0.00 ? 28 LYS A CB   10 
ATOM 10454 C CG   . LYS A 1 28 ? -5.702  -4.955  11.588  1.00 0.00 ? 28 LYS A CG   10 
ATOM 10455 C CD   . LYS A 1 28 ? -6.379  -4.143  12.680  1.00 0.00 ? 28 LYS A CD   10 
ATOM 10456 C CE   . LYS A 1 28 ? -6.892  -5.035  13.801  1.00 0.00 ? 28 LYS A CE   10 
ATOM 10457 N NZ   . LYS A 1 28 ? -5.782  -5.734  14.506  1.00 0.00 ? 28 LYS A NZ   10 
ATOM 10458 H H    . LYS A 1 28 ? -3.179  -2.123  10.439  1.00 0.00 ? 28 LYS A H    10 
ATOM 10459 H HA   . LYS A 1 28 ? -3.523  -3.838  12.560  1.00 0.00 ? 28 LYS A HA   10 
ATOM 10460 H HB2  . LYS A 1 28 ? -5.145  -3.138  10.644  1.00 0.00 ? 28 LYS A HB2  10 
ATOM 10461 H HB3  . LYS A 1 28 ? -4.552  -4.587  9.843   1.00 0.00 ? 28 LYS A HB3  10 
ATOM 10462 H HG2  . LYS A 1 28 ? -6.457  -5.331  10.914  1.00 0.00 ? 28 LYS A HG2  10 
ATOM 10463 H HG3  . LYS A 1 28 ? -5.176  -5.784  12.041  1.00 0.00 ? 28 LYS A HG3  10 
ATOM 10464 H HD2  . LYS A 1 28 ? -5.666  -3.443  13.091  1.00 0.00 ? 28 LYS A HD2  10 
ATOM 10465 H HD3  . LYS A 1 28 ? -7.211  -3.603  12.252  1.00 0.00 ? 28 LYS A HD3  10 
ATOM 10466 H HE2  . LYS A 1 28 ? -7.430  -4.426  14.510  1.00 0.00 ? 28 LYS A HE2  10 
ATOM 10467 H HE3  . LYS A 1 28 ? -7.559  -5.772  13.379  1.00 0.00 ? 28 LYS A HE3  10 
ATOM 10468 H HZ1  . LYS A 1 28 ? -5.719  -5.401  15.490  1.00 0.00 ? 28 LYS A HZ1  10 
ATOM 10469 H HZ2  . LYS A 1 28 ? -4.878  -5.541  14.029  1.00 0.00 ? 28 LYS A HZ2  10 
ATOM 10470 H HZ3  . LYS A 1 28 ? -5.949  -6.760  14.508  1.00 0.00 ? 28 LYS A HZ3  10 
ATOM 10471 N N    . THR A 1 29 ? -1.951  -5.290  10.050  1.00 0.00 ? 29 THR A N    10 
ATOM 10472 C CA   . THR A 1 29 ? -1.104  -6.421  9.693   1.00 0.00 ? 29 THR A CA   10 
ATOM 10473 C C    . THR A 1 29 ? -0.222  -6.090  8.495   1.00 0.00 ? 29 THR A C    10 
ATOM 10474 O O    . THR A 1 29 ? -0.665  -5.442  7.547   1.00 0.00 ? 29 THR A O    10 
ATOM 10475 C CB   . THR A 1 29 ? -1.944  -7.671  9.369   1.00 0.00 ? 29 THR A CB   10 
ATOM 10476 O OG1  . THR A 1 29 ? -1.137  -8.640  8.691   1.00 0.00 ? 29 THR A OG1  10 
ATOM 10477 C CG2  . THR A 1 29 ? -3.143  -7.309  8.507   1.00 0.00 ? 29 THR A CG2  10 
ATOM 10478 H H    . THR A 1 29 ? -2.124  -4.592  9.384   1.00 0.00 ? 29 THR A H    10 
ATOM 10479 H HA   . THR A 1 29 ? -0.473  -6.646  10.541  1.00 0.00 ? 29 THR A HA   10 
ATOM 10480 H HB   . THR A 1 29 ? -2.301  -8.096  10.297  1.00 0.00 ? 29 THR A HB   10 
ATOM 10481 H HG1  . THR A 1 29 ? -0.951  -8.335  7.800   1.00 0.00 ? 29 THR A HG1  10 
ATOM 10482 H HG21 . THR A 1 29 ? -3.322  -8.096  7.789   1.00 0.00 ? 29 THR A HG21 10 
ATOM 10483 H HG22 . THR A 1 29 ? -2.945  -6.384  7.985   1.00 0.00 ? 29 THR A HG22 10 
ATOM 10484 H HG23 . THR A 1 29 ? -4.014  -7.189  9.134   1.00 0.00 ? 29 THR A HG23 10 
ATOM 10485 N N    . GLN A 1 30 ? 1.027   -6.542  8.543   1.00 0.00 ? 30 GLN A N    10 
ATOM 10486 C CA   . GLN A 1 30 ? 1.971   -6.293  7.460   1.00 0.00 ? 30 GLN A CA   10 
ATOM 10487 C C    . GLN A 1 30 ? 1.609   -7.110  6.224   1.00 0.00 ? 30 GLN A C    10 
ATOM 10488 O O    . GLN A 1 30 ? 1.791   -6.658  5.093   1.00 0.00 ? 30 GLN A O    10 
ATOM 10489 C CB   . GLN A 1 30 ? 3.395   -6.628  7.908   1.00 0.00 ? 30 GLN A CB   10 
ATOM 10490 C CG   . GLN A 1 30 ? 4.090   -5.486  8.631   1.00 0.00 ? 30 GLN A CG   10 
ATOM 10491 C CD   . GLN A 1 30 ? 5.564   -5.754  8.864   1.00 0.00 ? 30 GLN A CD   10 
ATOM 10492 O OE1  . GLN A 1 30 ? 6.387   -5.582  7.965   1.00 0.00 ? 30 GLN A OE1  10 
ATOM 10493 N NE2  . GLN A 1 30 ? 5.904   -6.177  10.075  1.00 0.00 ? 30 GLN A NE2  10 
ATOM 10494 H H    . GLN A 1 30 ? 1.321   -7.053  9.325   1.00 0.00 ? 30 GLN A H    10 
ATOM 10495 H HA   . GLN A 1 30 ? 1.920   -5.244  7.210   1.00 0.00 ? 30 GLN A HA   10 
ATOM 10496 H HB2  . GLN A 1 30 ? 3.359   -7.478  8.573   1.00 0.00 ? 30 GLN A HB2  10 
ATOM 10497 H HB3  . GLN A 1 30 ? 3.982   -6.886  7.039   1.00 0.00 ? 30 GLN A HB3  10 
ATOM 10498 H HG2  . GLN A 1 30 ? 3.993   -4.589  8.037   1.00 0.00 ? 30 GLN A HG2  10 
ATOM 10499 H HG3  . GLN A 1 30 ? 3.610   -5.337  9.587   1.00 0.00 ? 30 GLN A HG3  10 
ATOM 10500 H HE21 . GLN A 1 30 ? 5.194   -6.292  10.741  1.00 0.00 ? 30 GLN A HE21 10 
ATOM 10501 H HE22 . GLN A 1 30 ? 6.850   -6.358  10.253  1.00 0.00 ? 30 GLN A HE22 10 
ATOM 10502 N N    . TYR A 1 31 ? 1.095   -8.315  6.447   1.00 0.00 ? 31 TYR A N    10 
ATOM 10503 C CA   . TYR A 1 31 ? 0.710   -9.196  5.351   1.00 0.00 ? 31 TYR A CA   10 
ATOM 10504 C C    . TYR A 1 31 ? -0.778  -9.527  5.416   1.00 0.00 ? 31 TYR A C    10 
ATOM 10505 O O    . TYR A 1 31 ? -1.300  -9.896  6.469   1.00 0.00 ? 31 TYR A O    10 
ATOM 10506 C CB   . TYR A 1 31 ? 1.532   -10.485 5.393   1.00 0.00 ? 31 TYR A CB   10 
ATOM 10507 C CG   . TYR A 1 31 ? 2.992   -10.262 5.717   1.00 0.00 ? 31 TYR A CG   10 
ATOM 10508 C CD1  . TYR A 1 31 ? 3.918   -10.017 4.711   1.00 0.00 ? 31 TYR A CD1  10 
ATOM 10509 C CD2  . TYR A 1 31 ? 3.446   -10.296 7.030   1.00 0.00 ? 31 TYR A CD2  10 
ATOM 10510 C CE1  . TYR A 1 31 ? 5.253   -9.813  5.002   1.00 0.00 ? 31 TYR A CE1  10 
ATOM 10511 C CE2  . TYR A 1 31 ? 4.778   -10.092 7.331   1.00 0.00 ? 31 TYR A CE2  10 
ATOM 10512 C CZ   . TYR A 1 31 ? 5.678   -9.851  6.314   1.00 0.00 ? 31 TYR A CZ   10 
ATOM 10513 O OH   . TYR A 1 31 ? 7.007   -9.649  6.609   1.00 0.00 ? 31 TYR A OH   10 
ATOM 10514 H H    . TYR A 1 31 ? 0.974   -8.619  7.370   1.00 0.00 ? 31 TYR A H    10 
ATOM 10515 H HA   . TYR A 1 31 ? 0.913   -8.681  4.424   1.00 0.00 ? 31 TYR A HA   10 
ATOM 10516 H HB2  . TYR A 1 31 ? 1.123   -11.141 6.145   1.00 0.00 ? 31 TYR A HB2  10 
ATOM 10517 H HB3  . TYR A 1 31 ? 1.477   -10.970 4.429   1.00 0.00 ? 31 TYR A HB3  10 
ATOM 10518 H HD1  . TYR A 1 31 ? 3.582   -9.988  3.684   1.00 0.00 ? 31 TYR A HD1  10 
ATOM 10519 H HD2  . TYR A 1 31 ? 2.738   -10.486 7.824   1.00 0.00 ? 31 TYR A HD2  10 
ATOM 10520 H HE1  . TYR A 1 31 ? 5.958   -9.624  4.206   1.00 0.00 ? 31 TYR A HE1  10 
ATOM 10521 H HE2  . TYR A 1 31 ? 5.111   -10.122 8.358   1.00 0.00 ? 31 TYR A HE2  10 
ATOM 10522 H HH   . TYR A 1 31 ? 7.365   -8.975  6.027   1.00 0.00 ? 31 TYR A HH   10 
ATOM 10523 N N    . LEU A 1 32 ? -1.457  -9.392  4.282   1.00 0.00 ? 32 LEU A N    10 
ATOM 10524 C CA   . LEU A 1 32 ? -2.885  -9.677  4.206   1.00 0.00 ? 32 LEU A CA   10 
ATOM 10525 C C    . LEU A 1 32 ? -3.139  -11.016 3.520   1.00 0.00 ? 32 LEU A C    10 
ATOM 10526 O O    . LEU A 1 32 ? -2.444  -11.379 2.571   1.00 0.00 ? 32 LEU A O    10 
ATOM 10527 C CB   . LEU A 1 32 ? -3.609  -8.560  3.453   1.00 0.00 ? 32 LEU A CB   10 
ATOM 10528 C CG   . LEU A 1 32 ? -3.760  -7.235  4.201   1.00 0.00 ? 32 LEU A CG   10 
ATOM 10529 C CD1  . LEU A 1 32 ? -4.207  -6.134  3.251   1.00 0.00 ? 32 LEU A CD1  10 
ATOM 10530 C CD2  . LEU A 1 32 ? -4.745  -7.381  5.352   1.00 0.00 ? 32 LEU A CD2  10 
ATOM 10531 H H    . LEU A 1 32 ? -0.987  -9.095  3.475   1.00 0.00 ? 32 LEU A H    10 
ATOM 10532 H HA   . LEU A 1 32 ? -3.267  -9.726  5.216   1.00 0.00 ? 32 LEU A HA   10 
ATOM 10533 H HB2  . LEU A 1 32 ? -3.062  -8.366  2.544   1.00 0.00 ? 32 LEU A HB2  10 
ATOM 10534 H HB3  . LEU A 1 32 ? -4.599  -8.916  3.206   1.00 0.00 ? 32 LEU A HB3  10 
ATOM 10535 H HG   . LEU A 1 32 ? -2.802  -6.950  4.614   1.00 0.00 ? 32 LEU A HG   10 
ATOM 10536 H HD11 . LEU A 1 32 ? -5.274  -6.199  3.101   1.00 0.00 ? 32 LEU A HD11 10 
ATOM 10537 H HD12 . LEU A 1 32 ? -3.702  -6.249  2.304   1.00 0.00 ? 32 LEU A HD12 10 
ATOM 10538 H HD13 . LEU A 1 32 ? -3.960  -5.171  3.675   1.00 0.00 ? 32 LEU A HD13 10 
ATOM 10539 H HD21 . LEU A 1 32 ? -4.581  -8.326  5.848   1.00 0.00 ? 32 LEU A HD21 10 
ATOM 10540 H HD22 . LEU A 1 32 ? -5.755  -7.347  4.968   1.00 0.00 ? 32 LEU A HD22 10 
ATOM 10541 H HD23 . LEU A 1 32 ? -4.600  -6.574  6.055   1.00 0.00 ? 32 LEU A HD23 10 
ATOM 10542 N N    . ALA A 1 33 ? -4.139  -11.744 4.005   1.00 0.00 ? 33 ALA A N    10 
ATOM 10543 C CA   . ALA A 1 33 ? -4.487  -13.040 3.436   1.00 0.00 ? 33 ALA A CA   10 
ATOM 10544 C C    . ALA A 1 33 ? -5.046  -12.888 2.026   1.00 0.00 ? 33 ALA A C    10 
ATOM 10545 O O    . ALA A 1 33 ? -5.101  -11.782 1.485   1.00 0.00 ? 33 ALA A O    10 
ATOM 10546 C CB   . ALA A 1 33 ? -5.489  -13.757 4.329   1.00 0.00 ? 33 ALA A CB   10 
ATOM 10547 H H    . ALA A 1 33 ? -4.656  -11.400 4.763   1.00 0.00 ? 33 ALA A H    10 
ATOM 10548 H HA   . ALA A 1 33 ? -3.587  -13.638 3.394   1.00 0.00 ? 33 ALA A HA   10 
ATOM 10549 H HB1  . ALA A 1 33 ? -5.582  -14.785 4.011   1.00 0.00 ? 33 ALA A HB1  10 
ATOM 10550 H HB2  . ALA A 1 33 ? -5.146  -13.726 5.352   1.00 0.00 ? 33 ALA A HB2  10 
ATOM 10551 H HB3  . ALA A 1 33 ? -6.449  -13.268 4.256   1.00 0.00 ? 33 ALA A HB3  10 
ATOM 10552 N N    . LEU A 1 34 ? -5.459  -14.003 1.435   1.00 0.00 ? 34 LEU A N    10 
ATOM 10553 C CA   . LEU A 1 34 ? -6.013  -13.994 0.085   1.00 0.00 ? 34 LEU A CA   10 
ATOM 10554 C C    . LEU A 1 34 ? -7.234  -13.083 0.005   1.00 0.00 ? 34 LEU A C    10 
ATOM 10555 O O    . LEU A 1 34 ? -7.264  -12.110 -0.749  1.00 0.00 ? 34 LEU A O    10 
ATOM 10556 C CB   . LEU A 1 34 ? -6.392  -15.413 -0.341  1.00 0.00 ? 34 LEU A CB   10 
ATOM 10557 C CG   . LEU A 1 34 ? -7.608  -15.536 -1.260  1.00 0.00 ? 34 LEU A CG   10 
ATOM 10558 C CD1  . LEU A 1 34 ? -7.310  -14.929 -2.623  1.00 0.00 ? 34 LEU A CD1  10 
ATOM 10559 C CD2  . LEU A 1 34 ? -8.025  -16.993 -1.402  1.00 0.00 ? 34 LEU A CD2  10 
ATOM 10560 H H    . LEU A 1 34 ? -5.389  -14.854 1.916   1.00 0.00 ? 34 LEU A H    10 
ATOM 10561 H HA   . LEU A 1 34 ? -5.253  -13.617 -0.583  1.00 0.00 ? 34 LEU A HA   10 
ATOM 10562 H HB2  . LEU A 1 34 ? -5.545  -15.842 -0.855  1.00 0.00 ? 34 LEU A HB2  10 
ATOM 10563 H HB3  . LEU A 1 34 ? -6.595  -15.984 0.554   1.00 0.00 ? 34 LEU A HB3  10 
ATOM 10564 H HG   . LEU A 1 34 ? -8.436  -14.991 -0.827  1.00 0.00 ? 34 LEU A HG   10 
ATOM 10565 H HD11 . LEU A 1 34 ? -7.748  -13.944 -2.682  1.00 0.00 ? 34 LEU A HD11 10 
ATOM 10566 H HD12 . LEU A 1 34 ? -7.730  -15.557 -3.395  1.00 0.00 ? 34 LEU A HD12 10 
ATOM 10567 H HD13 . LEU A 1 34 ? -6.241  -14.858 -2.759  1.00 0.00 ? 34 LEU A HD13 10 
ATOM 10568 H HD21 . LEU A 1 34 ? -9.028  -17.042 -1.799  1.00 0.00 ? 34 LEU A HD21 10 
ATOM 10569 H HD22 . LEU A 1 34 ? -7.996  -17.471 -0.434  1.00 0.00 ? 34 LEU A HD22 10 
ATOM 10570 H HD23 . LEU A 1 34 ? -7.346  -17.497 -2.074  1.00 0.00 ? 34 LEU A HD23 10 
ATOM 10571 N N    . PRO A 1 35 ? -8.265  -13.404 0.800   1.00 0.00 ? 35 PRO A N    10 
ATOM 10572 C CA   . PRO A 1 35 ? -9.507  -12.625 0.839   1.00 0.00 ? 35 PRO A CA   10 
ATOM 10573 C C    . PRO A 1 35 ? -9.312  -11.255 1.479   1.00 0.00 ? 35 PRO A C    10 
ATOM 10574 O O    . PRO A 1 35 ? -10.186 -10.392 1.397   1.00 0.00 ? 35 PRO A O    10 
ATOM 10575 C CB   . PRO A 1 35 ? -10.439 -13.487 1.695   1.00 0.00 ? 35 PRO A CB   10 
ATOM 10576 C CG   . PRO A 1 35 ? -9.527  -14.295 2.552   1.00 0.00 ? 35 PRO A CG   10 
ATOM 10577 C CD   . PRO A 1 35 ? -8.298  -14.550 1.724   1.00 0.00 ? 35 PRO A CD   10 
ATOM 10578 H HA   . PRO A 1 35 ? -9.930  -12.504 -0.147  1.00 0.00 ? 35 PRO A HA   10 
ATOM 10579 H HB2  . PRO A 1 35 ? -11.079 -12.849 2.288   1.00 0.00 ? 35 PRO A HB2  10 
ATOM 10580 H HB3  . PRO A 1 35 ? -11.041 -14.116 1.056   1.00 0.00 ? 35 PRO A HB3  10 
ATOM 10581 H HG2  . PRO A 1 35 ? -9.272  -13.741 3.442   1.00 0.00 ? 35 PRO A HG2  10 
ATOM 10582 H HG3  . PRO A 1 35 ? -10.003 -15.229 2.814   1.00 0.00 ? 35 PRO A HG3  10 
ATOM 10583 H HD2  . PRO A 1 35 ? -7.418  -14.567 2.350   1.00 0.00 ? 35 PRO A HD2  10 
ATOM 10584 H HD3  . PRO A 1 35 ? -8.395  -15.479 1.181   1.00 0.00 ? 35 PRO A HD3  10 
ATOM 10585 N N    . GLU A 1 36 ? -8.161  -11.062 2.115   1.00 0.00 ? 36 GLU A N    10 
ATOM 10586 C CA   . GLU A 1 36 ? -7.853  -9.796  2.769   1.00 0.00 ? 36 GLU A CA   10 
ATOM 10587 C C    . GLU A 1 36 ? -7.307  -8.784  1.766   1.00 0.00 ? 36 GLU A C    10 
ATOM 10588 O O    . GLU A 1 36 ? -7.726  -7.627  1.745   1.00 0.00 ? 36 GLU A O    10 
ATOM 10589 C CB   . GLU A 1 36 ? -6.840  -10.011 3.896   1.00 0.00 ? 36 GLU A CB   10 
ATOM 10590 C CG   . GLU A 1 36 ? -7.443  -10.624 5.148   1.00 0.00 ? 36 GLU A CG   10 
ATOM 10591 C CD   . GLU A 1 36 ? -8.750  -9.967  5.548   1.00 0.00 ? 36 GLU A CD   10 
ATOM 10592 O OE1  . GLU A 1 36 ? -8.880  -8.740  5.358   1.00 0.00 ? 36 GLU A OE1  10 
ATOM 10593 O OE2  . GLU A 1 36 ? -9.643  -10.681 6.052   1.00 0.00 ? 36 GLU A OE2  10 
ATOM 10594 H H    . GLU A 1 36 ? -7.504  -11.789 2.146   1.00 0.00 ? 36 GLU A H    10 
ATOM 10595 H HA   . GLU A 1 36 ? -8.768  -9.409  3.190   1.00 0.00 ? 36 GLU A HA   10 
ATOM 10596 H HB2  . GLU A 1 36 ? -6.057  -10.665 3.540   1.00 0.00 ? 36 GLU A HB2  10 
ATOM 10597 H HB3  . GLU A 1 36 ? -6.407  -9.057  4.160   1.00 0.00 ? 36 GLU A HB3  10 
ATOM 10598 H HG2  . GLU A 1 36 ? -7.626  -11.673 4.968   1.00 0.00 ? 36 GLU A HG2  10 
ATOM 10599 H HG3  . GLU A 1 36 ? -6.740  -10.517 5.961   1.00 0.00 ? 36 GLU A HG3  10 
ATOM 10600 N N    . ARG A 1 37 ? -6.369  -9.229  0.936   1.00 0.00 ? 37 ARG A N    10 
ATOM 10601 C CA   . ARG A 1 37 ? -5.764  -8.363  -0.069  1.00 0.00 ? 37 ARG A CA   10 
ATOM 10602 C C    . ARG A 1 37 ? -6.799  -7.920  -1.098  1.00 0.00 ? 37 ARG A C    10 
ATOM 10603 O O    . ARG A 1 37 ? -6.794  -6.772  -1.543  1.00 0.00 ? 37 ARG A O    10 
ATOM 10604 C CB   . ARG A 1 37 ? -4.611  -9.086  -0.768  1.00 0.00 ? 37 ARG A CB   10 
ATOM 10605 C CG   . ARG A 1 37 ? -3.642  -8.149  -1.471  1.00 0.00 ? 37 ARG A CG   10 
ATOM 10606 C CD   . ARG A 1 37 ? -2.294  -8.814  -1.704  1.00 0.00 ? 37 ARG A CD   10 
ATOM 10607 N NE   . ARG A 1 37 ? -1.764  -9.419  -0.486  1.00 0.00 ? 37 ARG A NE   10 
ATOM 10608 C CZ   . ARG A 1 37 ? -0.872  -10.404 -0.482  1.00 0.00 ? 37 ARG A CZ   10 
ATOM 10609 N NH1  . ARG A 1 37 ? -0.414  -10.892 -1.626  1.00 0.00 ? 37 ARG A NH1  10 
ATOM 10610 N NH2  . ARG A 1 37 ? -0.437  -10.903 0.668   1.00 0.00 ? 37 ARG A NH2  10 
ATOM 10611 H H    . ARG A 1 37 ? -6.076  -10.162 1.002   1.00 0.00 ? 37 ARG A H    10 
ATOM 10612 H HA   . ARG A 1 37 ? -5.377  -7.490  0.435   1.00 0.00 ? 37 ARG A HA   10 
ATOM 10613 H HB2  . ARG A 1 37 ? -4.059  -9.654  -0.033  1.00 0.00 ? 37 ARG A HB2  10 
ATOM 10614 H HB3  . ARG A 1 37 ? -5.019  -9.764  -1.502  1.00 0.00 ? 37 ARG A HB3  10 
ATOM 10615 H HG2  . ARG A 1 37 ? -4.060  -7.863  -2.424  1.00 0.00 ? 37 ARG A HG2  10 
ATOM 10616 H HG3  . ARG A 1 37 ? -3.499  -7.270  -0.860  1.00 0.00 ? 37 ARG A HG3  10 
ATOM 10617 H HD2  . ARG A 1 37 ? -2.412  -9.582  -2.454  1.00 0.00 ? 37 ARG A HD2  10 
ATOM 10618 H HD3  . ARG A 1 37 ? -1.597  -8.070  -2.059  1.00 0.00 ? 37 ARG A HD3  10 
ATOM 10619 H HE   . ARG A 1 37 ? -2.089  -9.074  0.371   1.00 0.00 ? 37 ARG A HE   10 
ATOM 10620 H HH11 . ARG A 1 37 ? -0.739  -10.518 -2.495  1.00 0.00 ? 37 ARG A HH11 10 
ATOM 10621 H HH12 . ARG A 1 37 ? 0.259   -11.633 -1.621  1.00 0.00 ? 37 ARG A HH12 10 
ATOM 10622 H HH21 . ARG A 1 37 ? -0.780  -10.537 1.533   1.00 0.00 ? 37 ARG A HH21 10 
ATOM 10623 H HH22 . ARG A 1 37 ? 0.234   -11.643 0.670   1.00 0.00 ? 37 ARG A HH22 10 
ATOM 10624 N N    . ALA A 1 38 ? -7.684  -8.837  -1.473  1.00 0.00 ? 38 ALA A N    10 
ATOM 10625 C CA   . ALA A 1 38 ? -8.726  -8.540  -2.448  1.00 0.00 ? 38 ALA A CA   10 
ATOM 10626 C C    . ALA A 1 38 ? -9.729  -7.535  -1.891  1.00 0.00 ? 38 ALA A C    10 
ATOM 10627 O O    . ALA A 1 38 ? -10.383 -6.815  -2.645  1.00 0.00 ? 38 ALA A O    10 
ATOM 10628 C CB   . ALA A 1 38 ? -9.434  -9.818  -2.870  1.00 0.00 ? 38 ALA A CB   10 
ATOM 10629 H H    . ALA A 1 38 ? -7.637  -9.734  -1.082  1.00 0.00 ? 38 ALA A H    10 
ATOM 10630 H HA   . ALA A 1 38 ? -8.253  -8.114  -3.322  1.00 0.00 ? 38 ALA A HA   10 
ATOM 10631 H HB1  . ALA A 1 38 ? -8.933  -10.240 -3.729  1.00 0.00 ? 38 ALA A HB1  10 
ATOM 10632 H HB2  . ALA A 1 38 ? -9.412  -10.527 -2.056  1.00 0.00 ? 38 ALA A HB2  10 
ATOM 10633 H HB3  . ALA A 1 38 ? -10.459 -9.594  -3.125  1.00 0.00 ? 38 ALA A HB3  10 
ATOM 10634 N N    . GLU A 1 39 ? -9.846  -7.494  -0.568  1.00 0.00 ? 39 GLU A N    10 
ATOM 10635 C CA   . GLU A 1 39 ? -10.772 -6.579  0.089   1.00 0.00 ? 39 GLU A CA   10 
ATOM 10636 C C    . GLU A 1 39 ? -10.420 -5.128  -0.230  1.00 0.00 ? 39 GLU A C    10 
ATOM 10637 O O    . GLU A 1 39 ? -11.295 -4.321  -0.547  1.00 0.00 ? 39 GLU A O    10 
ATOM 10638 C CB   . GLU A 1 39 ? -10.753 -6.798  1.603   1.00 0.00 ? 39 GLU A CB   10 
ATOM 10639 C CG   . GLU A 1 39 ? -11.998 -6.286  2.307   1.00 0.00 ? 39 GLU A CG   10 
ATOM 10640 C CD   . GLU A 1 39 ? -12.045 -6.680  3.771   1.00 0.00 ? 39 GLU A CD   10 
ATOM 10641 O OE1  . GLU A 1 39 ? -10.984 -6.640  4.429   1.00 0.00 ? 39 GLU A OE1  10 
ATOM 10642 O OE2  . GLU A 1 39 ? -13.140 -7.029  4.257   1.00 0.00 ? 39 GLU A OE2  10 
ATOM 10643 H H    . GLU A 1 39 ? -9.297  -8.094  -0.020  1.00 0.00 ? 39 GLU A H    10 
ATOM 10644 H HA   . GLU A 1 39 ? -11.763 -6.786  -0.284  1.00 0.00 ? 39 GLU A HA   10 
ATOM 10645 H HB2  . GLU A 1 39 ? -10.663 -7.856  1.800   1.00 0.00 ? 39 GLU A HB2  10 
ATOM 10646 H HB3  . GLU A 1 39 ? -9.896  -6.289  2.017   1.00 0.00 ? 39 GLU A HB3  10 
ATOM 10647 H HG2  . GLU A 1 39 ? -12.017 -5.208  2.240   1.00 0.00 ? 39 GLU A HG2  10 
ATOM 10648 H HG3  . GLU A 1 39 ? -12.869 -6.691  1.812   1.00 0.00 ? 39 GLU A HG3  10 
ATOM 10649 N N    . LEU A 1 40 ? -9.135  -4.804  -0.144  1.00 0.00 ? 40 LEU A N    10 
ATOM 10650 C CA   . LEU A 1 40 ? -8.666  -3.451  -0.422  1.00 0.00 ? 40 LEU A CA   10 
ATOM 10651 C C    . LEU A 1 40 ? -8.850  -3.104  -1.896  1.00 0.00 ? 40 LEU A C    10 
ATOM 10652 O O    . LEU A 1 40 ? -9.115  -1.954  -2.244  1.00 0.00 ? 40 LEU A O    10 
ATOM 10653 C CB   . LEU A 1 40 ? -7.194  -3.310  -0.033  1.00 0.00 ? 40 LEU A CB   10 
ATOM 10654 C CG   . LEU A 1 40 ? -6.790  -3.934  1.303   1.00 0.00 ? 40 LEU A CG   10 
ATOM 10655 C CD1  . LEU A 1 40 ? -5.318  -3.679  1.588   1.00 0.00 ? 40 LEU A CD1  10 
ATOM 10656 C CD2  . LEU A 1 40 ? -7.655  -3.387  2.430   1.00 0.00 ? 40 LEU A CD2  10 
ATOM 10657 H H    . LEU A 1 40 ? -8.485  -5.491  0.113   1.00 0.00 ? 40 LEU A H    10 
ATOM 10658 H HA   . LEU A 1 40 ? -9.254  -2.768  0.172   1.00 0.00 ? 40 LEU A HA   10 
ATOM 10659 H HB2  . LEU A 1 40 ? -6.601  -3.775  -0.807  1.00 0.00 ? 40 LEU A HB2  10 
ATOM 10660 H HB3  . LEU A 1 40 ? -6.963  -2.255  0.009   1.00 0.00 ? 40 LEU A HB3  10 
ATOM 10661 H HG   . LEU A 1 40 ? -6.940  -5.003  1.254   1.00 0.00 ? 40 LEU A HG   10 
ATOM 10662 H HD11 . LEU A 1 40 ? -4.767  -4.603  1.489   1.00 0.00 ? 40 LEU A HD11 10 
ATOM 10663 H HD12 . LEU A 1 40 ? -5.206  -3.299  2.592   1.00 0.00 ? 40 LEU A HD12 10 
ATOM 10664 H HD13 . LEU A 1 40 ? -4.935  -2.954  0.884   1.00 0.00 ? 40 LEU A HD13 10 
ATOM 10665 H HD21 . LEU A 1 40 ? -7.205  -2.487  2.824   1.00 0.00 ? 40 LEU A HD21 10 
ATOM 10666 H HD22 . LEU A 1 40 ? -7.731  -4.125  3.215   1.00 0.00 ? 40 LEU A HD22 10 
ATOM 10667 H HD23 . LEU A 1 40 ? -8.640  -3.161  2.050   1.00 0.00 ? 40 LEU A HD23 10 
ATOM 10668 N N    . ALA A 1 41 ? -8.710  -4.107  -2.757  1.00 0.00 ? 41 ALA A N    10 
ATOM 10669 C CA   . ALA A 1 41 ? -8.865  -3.908  -4.193  1.00 0.00 ? 41 ALA A CA   10 
ATOM 10670 C C    . ALA A 1 41 ? -10.338 -3.863  -4.585  1.00 0.00 ? 41 ALA A C    10 
ATOM 10671 O O    . ALA A 1 41 ? -10.716 -3.178  -5.535  1.00 0.00 ? 41 ALA A O    10 
ATOM 10672 C CB   . ALA A 1 41 ? -8.146  -5.009  -4.958  1.00 0.00 ? 41 ALA A CB   10 
ATOM 10673 H H    . ALA A 1 41 ? -8.498  -5.001  -2.418  1.00 0.00 ? 41 ALA A H    10 
ATOM 10674 H HA   . ALA A 1 41 ? -8.405  -2.965  -4.451  1.00 0.00 ? 41 ALA A HA   10 
ATOM 10675 H HB1  . ALA A 1 41 ? -8.783  -5.366  -5.755  1.00 0.00 ? 41 ALA A HB1  10 
ATOM 10676 H HB2  . ALA A 1 41 ? -7.230  -4.618  -5.376  1.00 0.00 ? 41 ALA A HB2  10 
ATOM 10677 H HB3  . ALA A 1 41 ? -7.918  -5.824  -4.287  1.00 0.00 ? 41 ALA A HB3  10 
ATOM 10678 N N    . ALA A 1 42 ? -11.164 -4.597  -3.848  1.00 0.00 ? 42 ALA A N    10 
ATOM 10679 C CA   . ALA A 1 42 ? -12.596 -4.640  -4.118  1.00 0.00 ? 42 ALA A CA   10 
ATOM 10680 C C    . ALA A 1 42 ? -13.324 -3.509  -3.399  1.00 0.00 ? 42 ALA A C    10 
ATOM 10681 O O    . ALA A 1 42 ? -14.394 -3.077  -3.827  1.00 0.00 ? 42 ALA A O    10 
ATOM 10682 C CB   . ALA A 1 42 ? -13.171 -5.987  -3.706  1.00 0.00 ? 42 ALA A CB   10 
ATOM 10683 H H    . ALA A 1 42 ? -10.803 -5.122  -3.103  1.00 0.00 ? 42 ALA A H    10 
ATOM 10684 H HA   . ALA A 1 42 ? -12.738 -4.526  -5.183  1.00 0.00 ? 42 ALA A HA   10 
ATOM 10685 H HB1  . ALA A 1 42 ? -14.197 -5.858  -3.391  1.00 0.00 ? 42 ALA A HB1  10 
ATOM 10686 H HB2  . ALA A 1 42 ? -13.134 -6.666  -4.544  1.00 0.00 ? 42 ALA A HB2  10 
ATOM 10687 H HB3  . ALA A 1 42 ? -12.592 -6.390  -2.889  1.00 0.00 ? 42 ALA A HB3  10 
ATOM 10688 N N    . SER A 1 43 ? -12.737 -3.035  -2.305  1.00 0.00 ? 43 SER A N    10 
ATOM 10689 C CA   . SER A 1 43 ? -13.333 -1.957  -1.524  1.00 0.00 ? 43 SER A CA   10 
ATOM 10690 C C    . SER A 1 43 ? -12.838 -0.597  -2.009  1.00 0.00 ? 43 SER A C    10 
ATOM 10691 O O    . SER A 1 43 ? -13.632 0.278   -2.357  1.00 0.00 ? 43 SER A O    10 
ATOM 10692 C CB   . SER A 1 43 ? -13.005 -2.132  -0.040  1.00 0.00 ? 43 SER A CB   10 
ATOM 10693 O OG   . SER A 1 43 ? -13.643 -1.139  0.744   1.00 0.00 ? 43 SER A OG   10 
ATOM 10694 H H    . SER A 1 43 ? -11.884 -3.421  -2.015  1.00 0.00 ? 43 SER A H    10 
ATOM 10695 H HA   . SER A 1 43 ? -14.404 -2.005  -1.656  1.00 0.00 ? 43 SER A HA   10 
ATOM 10696 H HB2  . SER A 1 43 ? -13.341 -3.104  0.288   1.00 0.00 ? 43 SER A HB2  10 
ATOM 10697 H HB3  . SER A 1 43 ? -11.937 -2.054  0.101   1.00 0.00 ? 43 SER A HB3  10 
ATOM 10698 H HG   . SER A 1 43 ? -14.407 -1.520  1.184   1.00 0.00 ? 43 SER A HG   10 
ATOM 10699 N N    . LEU A 1 44 ? -11.521 -0.427  -2.029  1.00 0.00 ? 44 LEU A N    10 
ATOM 10700 C CA   . LEU A 1 44 ? -10.917 0.825   -2.471  1.00 0.00 ? 44 LEU A CA   10 
ATOM 10701 C C    . LEU A 1 44 ? -11.051 0.991   -3.981  1.00 0.00 ? 44 LEU A C    10 
ATOM 10702 O O    . LEU A 1 44 ? -10.872 2.085   -4.514  1.00 0.00 ? 44 LEU A O    10 
ATOM 10703 C CB   . LEU A 1 44 ? -9.442  0.873   -2.070  1.00 0.00 ? 44 LEU A CB   10 
ATOM 10704 C CG   . LEU A 1 44 ? -9.127  0.496   -0.622  1.00 0.00 ? 44 LEU A CG   10 
ATOM 10705 C CD1  . LEU A 1 44 ? -7.650  0.701   -0.326  1.00 0.00 ? 44 LEU A CD1  10 
ATOM 10706 C CD2  . LEU A 1 44 ? -9.983  1.309   0.339   1.00 0.00 ? 44 LEU A CD2  10 
ATOM 10707 H H    . LEU A 1 44 ? -10.939 -1.161  -1.740  1.00 0.00 ? 44 LEU A H    10 
ATOM 10708 H HA   . LEU A 1 44 ? -11.441 1.635   -1.984  1.00 0.00 ? 44 LEU A HA   10 
ATOM 10709 H HB2  . LEU A 1 44 ? -8.903  0.194   -2.713  1.00 0.00 ? 44 LEU A HB2  10 
ATOM 10710 H HB3  . LEU A 1 44 ? -9.088  1.881   -2.235  1.00 0.00 ? 44 LEU A HB3  10 
ATOM 10711 H HG   . LEU A 1 44 ? -9.356  -0.550  -0.471  1.00 0.00 ? 44 LEU A HG   10 
ATOM 10712 H HD11 . LEU A 1 44 ? -7.181  1.198   -1.161  1.00 0.00 ? 44 LEU A HD11 10 
ATOM 10713 H HD12 . LEU A 1 44 ? -7.179  -0.258  -0.167  1.00 0.00 ? 44 LEU A HD12 10 
ATOM 10714 H HD13 . LEU A 1 44 ? -7.541  1.306   0.562   1.00 0.00 ? 44 LEU A HD13 10 
ATOM 10715 H HD21 . LEU A 1 44 ? -9.631  2.330   0.357   1.00 0.00 ? 44 LEU A HD21 10 
ATOM 10716 H HD22 . LEU A 1 44 ? -9.912  0.886   1.330   1.00 0.00 ? 44 LEU A HD22 10 
ATOM 10717 H HD23 . LEU A 1 44 ? -11.012 1.288   0.011   1.00 0.00 ? 44 LEU A HD23 10 
ATOM 10718 N N    . GLY A 1 45 ? -11.370 -0.103  -4.666  1.00 0.00 ? 45 GLY A N    10 
ATOM 10719 C CA   . GLY A 1 45 ? -11.525 -0.057  -6.108  1.00 0.00 ? 45 GLY A CA   10 
ATOM 10720 C C    . GLY A 1 45 ? -10.220 -0.301  -6.839  1.00 0.00 ? 45 GLY A C    10 
ATOM 10721 O O    . GLY A 1 45 ? -10.094 0.017   -8.022  1.00 0.00 ? 45 GLY A O    10 
ATOM 10722 H H    . GLY A 1 45 ? -11.501 -0.949  -4.187  1.00 0.00 ? 45 GLY A H    10 
ATOM 10723 H HA2  . GLY A 1 45 ? -12.240 -0.810  -6.407  1.00 0.00 ? 45 GLY A HA2  10 
ATOM 10724 H HA3  . GLY A 1 45 ? -11.904 0.915   -6.387  1.00 0.00 ? 45 GLY A HA3  10 
ATOM 10725 N N    . LEU A 1 46 ? -9.246  -0.866  -6.135  1.00 0.00 ? 46 LEU A N    10 
ATOM 10726 C CA   . LEU A 1 46 ? -7.942  -1.152  -6.724  1.00 0.00 ? 46 LEU A CA   10 
ATOM 10727 C C    . LEU A 1 46 ? -7.827  -2.625  -7.104  1.00 0.00 ? 46 LEU A C    10 
ATOM 10728 O O    . LEU A 1 46 ? -8.762  -3.403  -6.909  1.00 0.00 ? 46 LEU A O    10 
ATOM 10729 C CB   . LEU A 1 46 ? -6.826  -0.776  -5.748  1.00 0.00 ? 46 LEU A CB   10 
ATOM 10730 C CG   . LEU A 1 46 ? -6.894  0.634   -5.161  1.00 0.00 ? 46 LEU A CG   10 
ATOM 10731 C CD1  . LEU A 1 46 ? -6.274  0.665   -3.773  1.00 0.00 ? 46 LEU A CD1  10 
ATOM 10732 C CD2  . LEU A 1 46 ? -6.200  1.628   -6.080  1.00 0.00 ? 46 LEU A CD2  10 
ATOM 10733 H H    . LEU A 1 46 ? -9.406  -1.098  -5.197  1.00 0.00 ? 46 LEU A H    10 
ATOM 10734 H HA   . LEU A 1 46 ? -7.844  -0.553  -7.617  1.00 0.00 ? 46 LEU A HA   10 
ATOM 10735 H HB2  . LEU A 1 46 ? -6.855  -1.477  -4.928  1.00 0.00 ? 46 LEU A HB2  10 
ATOM 10736 H HB3  . LEU A 1 46 ? -5.885  -0.873  -6.270  1.00 0.00 ? 46 LEU A HB3  10 
ATOM 10737 H HG   . LEU A 1 46 ? -7.931  0.929   -5.069  1.00 0.00 ? 46 LEU A HG   10 
ATOM 10738 H HD11 . LEU A 1 46 ? -5.289  0.224   -3.809  1.00 0.00 ? 46 LEU A HD11 10 
ATOM 10739 H HD12 . LEU A 1 46 ? -6.894  0.104   -3.088  1.00 0.00 ? 46 LEU A HD12 10 
ATOM 10740 H HD13 . LEU A 1 46 ? -6.199  1.688   -3.434  1.00 0.00 ? 46 LEU A HD13 10 
ATOM 10741 H HD21 . LEU A 1 46 ? -6.814  1.801   -6.951  1.00 0.00 ? 46 LEU A HD21 10 
ATOM 10742 H HD22 . LEU A 1 46 ? -5.245  1.229   -6.386  1.00 0.00 ? 46 LEU A HD22 10 
ATOM 10743 H HD23 . LEU A 1 46 ? -6.050  2.560   -5.554  1.00 0.00 ? 46 LEU A HD23 10 
ATOM 10744 N N    . THR A 1 47 ? -6.673  -3.002  -7.645  1.00 0.00 ? 47 THR A N    10 
ATOM 10745 C CA   . THR A 1 47 ? -6.435  -4.382  -8.052  1.00 0.00 ? 47 THR A CA   10 
ATOM 10746 C C    . THR A 1 47 ? -5.365  -5.034  -7.183  1.00 0.00 ? 47 THR A C    10 
ATOM 10747 O O    . THR A 1 47 ? -4.531  -4.348  -6.591  1.00 0.00 ? 47 THR A O    10 
ATOM 10748 C CB   . THR A 1 47 ? -6.002  -4.466  -9.527  1.00 0.00 ? 47 THR A CB   10 
ATOM 10749 O OG1  . THR A 1 47 ? -6.043  -5.826  -9.973  1.00 0.00 ? 47 THR A OG1  10 
ATOM 10750 C CG2  . THR A 1 47 ? -4.599  -3.908  -9.713  1.00 0.00 ? 47 THR A CG2  10 
ATOM 10751 H H    . THR A 1 47 ? -5.966  -2.336  -7.775  1.00 0.00 ? 47 THR A H    10 
ATOM 10752 H HA   . THR A 1 47 ? -7.360  -4.928  -7.937  1.00 0.00 ? 47 THR A HA   10 
ATOM 10753 H HB   . THR A 1 47 ? -6.688  -3.880  -10.122 1.00 0.00 ? 47 THR A HB   10 
ATOM 10754 H HG1  . THR A 1 47 ? -5.227  -6.268  -9.727  1.00 0.00 ? 47 THR A HG1  10 
ATOM 10755 H HG21 . THR A 1 47 ? -4.298  -3.386  -8.817  1.00 0.00 ? 47 THR A HG21 10 
ATOM 10756 H HG22 . THR A 1 47 ? -4.592  -3.224  -10.548 1.00 0.00 ? 47 THR A HG22 10 
ATOM 10757 H HG23 . THR A 1 47 ? -3.913  -4.718  -9.905  1.00 0.00 ? 47 THR A HG23 10 
ATOM 10758 N N    . GLN A 1 48 ? -5.396  -6.360  -7.110  1.00 0.00 ? 48 GLN A N    10 
ATOM 10759 C CA   . GLN A 1 48 ? -4.428  -7.104  -6.313  1.00 0.00 ? 48 GLN A CA   10 
ATOM 10760 C C    . GLN A 1 48 ? -3.001  -6.734  -6.704  1.00 0.00 ? 48 GLN A C    10 
ATOM 10761 O O    . GLN A 1 48 ? -2.082  -6.809  -5.888  1.00 0.00 ? 48 GLN A O    10 
ATOM 10762 C CB   . GLN A 1 48 ? -4.643  -8.609  -6.484  1.00 0.00 ? 48 GLN A CB   10 
ATOM 10763 C CG   . GLN A 1 48 ? -5.955  -9.107  -5.899  1.00 0.00 ? 48 GLN A CG   10 
ATOM 10764 C CD   . GLN A 1 48 ? -6.482  -10.337 -6.612  1.00 0.00 ? 48 GLN A CD   10 
ATOM 10765 O OE1  . GLN A 1 48 ? -5.728  -11.065 -7.258  1.00 0.00 ? 48 GLN A OE1  10 
ATOM 10766 N NE2  . GLN A 1 48 ? -7.783  -10.575 -6.497  1.00 0.00 ? 48 GLN A NE2  10 
ATOM 10767 H H    . GLN A 1 48 ? -6.085  -6.850  -7.604  1.00 0.00 ? 48 GLN A H    10 
ATOM 10768 H HA   . GLN A 1 48 ? -4.583  -6.843  -5.277  1.00 0.00 ? 48 GLN A HA   10 
ATOM 10769 H HB2  . GLN A 1 48 ? -4.631  -8.844  -7.538  1.00 0.00 ? 48 GLN A HB2  10 
ATOM 10770 H HB3  . GLN A 1 48 ? -3.835  -9.134  -5.997  1.00 0.00 ? 48 GLN A HB3  10 
ATOM 10771 H HG2  . GLN A 1 48 ? -5.800  -9.351  -4.859  1.00 0.00 ? 48 GLN A HG2  10 
ATOM 10772 H HG3  . GLN A 1 48 ? -6.690  -8.320  -5.978  1.00 0.00 ? 48 GLN A HG3  10 
ATOM 10773 H HE21 . GLN A 1 48 ? -8.323  -9.951  -5.968  1.00 0.00 ? 48 GLN A HE21 10 
ATOM 10774 H HE22 . GLN A 1 48 ? -8.151  -11.362 -6.948  1.00 0.00 ? 48 GLN A HE22 10 
ATOM 10775 N N    . THR A 1 49 ? -2.822  -6.335  -7.960  1.00 0.00 ? 49 THR A N    10 
ATOM 10776 C CA   . THR A 1 49 ? -1.507  -5.955  -8.460  1.00 0.00 ? 49 THR A CA   10 
ATOM 10777 C C    . THR A 1 49 ? -1.095  -4.583  -7.938  1.00 0.00 ? 49 THR A C    10 
ATOM 10778 O O    . THR A 1 49 ? 0.087   -4.241  -7.933  1.00 0.00 ? 49 THR A O    10 
ATOM 10779 C CB   . THR A 1 49 ? -1.476  -5.936  -10.000 1.00 0.00 ? 49 THR A CB   10 
ATOM 10780 O OG1  . THR A 1 49 ? -2.216  -7.047  -10.519 1.00 0.00 ? 49 THR A OG1  10 
ATOM 10781 C CG2  . THR A 1 49 ? -0.045  -5.989  -10.513 1.00 0.00 ? 49 THR A CG2  10 
ATOM 10782 H H    . THR A 1 49 ? -3.593  -6.296  -8.563  1.00 0.00 ? 49 THR A H    10 
ATOM 10783 H HA   . THR A 1 49 ? -0.794  -6.690  -8.116  1.00 0.00 ? 49 THR A HA   10 
ATOM 10784 H HB   . THR A 1 49 ? -1.932  -5.018  -10.343 1.00 0.00 ? 49 THR A HB   10 
ATOM 10785 H HG1  . THR A 1 49 ? -2.003  -7.168  -11.447 1.00 0.00 ? 49 THR A HG1  10 
ATOM 10786 H HG21 . THR A 1 49 ? 0.243   -5.015  -10.879 1.00 0.00 ? 49 THR A HG21 10 
ATOM 10787 H HG22 . THR A 1 49 ? 0.024   -6.710  -11.315 1.00 0.00 ? 49 THR A HG22 10 
ATOM 10788 H HG23 . THR A 1 49 ? 0.615   -6.281  -9.710  1.00 0.00 ? 49 THR A HG23 10 
ATOM 10789 N N    . GLN A 1 50 ? -2.077  -3.803  -7.499  1.00 0.00 ? 50 GLN A N    10 
ATOM 10790 C CA   . GLN A 1 50 ? -1.815  -2.468  -6.975  1.00 0.00 ? 50 GLN A CA   10 
ATOM 10791 C C    . GLN A 1 50 ? -1.598  -2.509  -5.465  1.00 0.00 ? 50 GLN A C    10 
ATOM 10792 O O    . GLN A 1 50 ? -0.622  -1.961  -4.953  1.00 0.00 ? 50 GLN A O    10 
ATOM 10793 C CB   . GLN A 1 50 ? -2.975  -1.529  -7.309  1.00 0.00 ? 50 GLN A CB   10 
ATOM 10794 C CG   . GLN A 1 50 ? -2.926  -0.982  -8.727  1.00 0.00 ? 50 GLN A CG   10 
ATOM 10795 C CD   . GLN A 1 50 ? -3.555  0.392   -8.845  1.00 0.00 ? 50 GLN A CD   10 
ATOM 10796 O OE1  . GLN A 1 50 ? -3.328  1.265   -8.007  1.00 0.00 ? 50 GLN A OE1  10 
ATOM 10797 N NE2  . GLN A 1 50 ? -4.350  0.592   -9.889  1.00 0.00 ? 50 GLN A NE2  10 
ATOM 10798 H H    . GLN A 1 50 ? -2.999  -4.133  -7.529  1.00 0.00 ? 50 GLN A H    10 
ATOM 10799 H HA   . GLN A 1 50 ? -0.917  -2.097  -7.445  1.00 0.00 ? 50 GLN A HA   10 
ATOM 10800 H HB2  . GLN A 1 50 ? -3.904  -2.065  -7.185  1.00 0.00 ? 50 GLN A HB2  10 
ATOM 10801 H HB3  . GLN A 1 50 ? -2.957  -0.694  -6.624  1.00 0.00 ? 50 GLN A HB3  10 
ATOM 10802 H HG2  . GLN A 1 50 ? -1.894  -0.916  -9.038  1.00 0.00 ? 50 GLN A HG2  10 
ATOM 10803 H HG3  . GLN A 1 50 ? -3.454  -1.661  -9.380  1.00 0.00 ? 50 GLN A HG3  10 
ATOM 10804 H HE21 . GLN A 1 50 ? -4.485  -0.150  -10.516 1.00 0.00 ? 50 GLN A HE21 10 
ATOM 10805 H HE22 . GLN A 1 50 ? -4.770  1.470   -9.990  1.00 0.00 ? 50 GLN A HE22 10 
ATOM 10806 N N    . VAL A 1 51 ? -2.515  -3.161  -4.758  1.00 0.00 ? 51 VAL A N    10 
ATOM 10807 C CA   . VAL A 1 51 ? -2.423  -3.274  -3.307  1.00 0.00 ? 51 VAL A CA   10 
ATOM 10808 C C    . VAL A 1 51 ? -1.231  -4.131  -2.897  1.00 0.00 ? 51 VAL A C    10 
ATOM 10809 O O    . VAL A 1 51 ? -0.703  -3.993  -1.793  1.00 0.00 ? 51 VAL A O    10 
ATOM 10810 C CB   . VAL A 1 51 ? -3.707  -3.880  -2.709  1.00 0.00 ? 51 VAL A CB   10 
ATOM 10811 C CG1  . VAL A 1 51 ? -3.448  -4.399  -1.303  1.00 0.00 ? 51 VAL A CG1  10 
ATOM 10812 C CG2  . VAL A 1 51 ? -4.830  -2.854  -2.710  1.00 0.00 ? 51 VAL A CG2  10 
ATOM 10813 H H    . VAL A 1 51 ? -3.271  -3.577  -5.223  1.00 0.00 ? 51 VAL A H    10 
ATOM 10814 H HA   . VAL A 1 51 ? -2.297  -2.280  -2.902  1.00 0.00 ? 51 VAL A HA   10 
ATOM 10815 H HB   . VAL A 1 51 ? -4.009  -4.714  -3.326  1.00 0.00 ? 51 VAL A HB   10 
ATOM 10816 H HG11 . VAL A 1 51 ? -2.730  -5.205  -1.343  1.00 0.00 ? 51 VAL A HG11 10 
ATOM 10817 H HG12 . VAL A 1 51 ? -3.059  -3.599  -0.690  1.00 0.00 ? 51 VAL A HG12 10 
ATOM 10818 H HG13 . VAL A 1 51 ? -4.372  -4.762  -0.878  1.00 0.00 ? 51 VAL A HG13 10 
ATOM 10819 H HG21 . VAL A 1 51 ? -4.593  -2.062  -3.404  1.00 0.00 ? 51 VAL A HG21 10 
ATOM 10820 H HG22 . VAL A 1 51 ? -5.753  -3.330  -3.008  1.00 0.00 ? 51 VAL A HG22 10 
ATOM 10821 H HG23 . VAL A 1 51 ? -4.943  -2.442  -1.718  1.00 0.00 ? 51 VAL A HG23 10 
ATOM 10822 N N    . LYS A 1 52 ? -0.810  -5.017  -3.793  1.00 0.00 ? 52 LYS A N    10 
ATOM 10823 C CA   . LYS A 1 52 ? 0.322   -5.896  -3.527  1.00 0.00 ? 52 LYS A CA   10 
ATOM 10824 C C    . LYS A 1 52 ? 1.626   -5.106  -3.483  1.00 0.00 ? 52 LYS A C    10 
ATOM 10825 O O    . LYS A 1 52 ? 2.398   -5.217  -2.530  1.00 0.00 ? 52 LYS A O    10 
ATOM 10826 C CB   . LYS A 1 52 ? 0.410   -6.987  -4.597  1.00 0.00 ? 52 LYS A CB   10 
ATOM 10827 C CG   . LYS A 1 52 ? -0.431  -8.213  -4.286  1.00 0.00 ? 52 LYS A CG   10 
ATOM 10828 C CD   . LYS A 1 52 ? -0.481  -9.169  -5.465  1.00 0.00 ? 52 LYS A CD   10 
ATOM 10829 C CE   . LYS A 1 52 ? 0.882   -9.787  -5.739  1.00 0.00 ? 52 LYS A CE   10 
ATOM 10830 N NZ   . LYS A 1 52 ? 1.253   -10.793 -4.706  1.00 0.00 ? 52 LYS A NZ   10 
ATOM 10831 H H    . LYS A 1 52 ? -1.271  -5.080  -4.656  1.00 0.00 ? 52 LYS A H    10 
ATOM 10832 H HA   . LYS A 1 52 ? 0.163   -6.359  -2.565  1.00 0.00 ? 52 LYS A HA   10 
ATOM 10833 H HB2  . LYS A 1 52 ? 0.077   -6.577  -5.539  1.00 0.00 ? 52 LYS A HB2  10 
ATOM 10834 H HB3  . LYS A 1 52 ? 1.440   -7.298  -4.693  1.00 0.00 ? 52 LYS A HB3  10 
ATOM 10835 H HG2  . LYS A 1 52 ? -0.003  -8.726  -3.438  1.00 0.00 ? 52 LYS A HG2  10 
ATOM 10836 H HG3  . LYS A 1 52 ? -1.437  -7.897  -4.048  1.00 0.00 ? 52 LYS A HG3  10 
ATOM 10837 H HD2  . LYS A 1 52 ? -1.184  -9.959  -5.248  1.00 0.00 ? 52 LYS A HD2  10 
ATOM 10838 H HD3  . LYS A 1 52 ? -0.804  -8.628  -6.343  1.00 0.00 ? 52 LYS A HD3  10 
ATOM 10839 H HE2  . LYS A 1 52 ? 0.857   -10.268 -6.705  1.00 0.00 ? 52 LYS A HE2  10 
ATOM 10840 H HE3  . LYS A 1 52 ? 1.624   -9.002  -5.747  1.00 0.00 ? 52 LYS A HE3  10 
ATOM 10841 H HZ1  . LYS A 1 52 ? 2.167   -10.545 -4.277  1.00 0.00 ? 52 LYS A HZ1  10 
ATOM 10842 H HZ2  . LYS A 1 52 ? 1.330   -11.736 -5.138  1.00 0.00 ? 52 LYS A HZ2  10 
ATOM 10843 H HZ3  . LYS A 1 52 ? 0.529   -10.823 -3.960  1.00 0.00 ? 52 LYS A HZ3  10 
ATOM 10844 N N    . ILE A 1 53 ? 1.865   -4.310  -4.519  1.00 0.00 ? 53 ILE A N    10 
ATOM 10845 C CA   . ILE A 1 53 ? 3.075   -3.500  -4.597  1.00 0.00 ? 53 ILE A CA   10 
ATOM 10846 C C    . ILE A 1 53 ? 3.119   -2.469  -3.473  1.00 0.00 ? 53 ILE A C    10 
ATOM 10847 O O    . ILE A 1 53 ? 4.191   -2.131  -2.970  1.00 0.00 ? 53 ILE A O    10 
ATOM 10848 C CB   . ILE A 1 53 ? 3.179   -2.772  -5.950  1.00 0.00 ? 53 ILE A CB   10 
ATOM 10849 C CG1  . ILE A 1 53 ? 3.119   -3.779  -7.101  1.00 0.00 ? 53 ILE A CG1  10 
ATOM 10850 C CG2  . ILE A 1 53 ? 4.464   -1.960  -6.017  1.00 0.00 ? 53 ILE A CG2  10 
ATOM 10851 C CD1  . ILE A 1 53 ? 2.898   -3.138  -8.453  1.00 0.00 ? 53 ILE A CD1  10 
ATOM 10852 H H    . ILE A 1 53 ? 1.212   -4.265  -5.248  1.00 0.00 ? 53 ILE A H    10 
ATOM 10853 H HA   . ILE A 1 53 ? 3.924   -4.160  -4.499  1.00 0.00 ? 53 ILE A HA   10 
ATOM 10854 H HB   . ILE A 1 53 ? 2.346   -2.091  -6.033  1.00 0.00 ? 53 ILE A HB   10 
ATOM 10855 H HG12 . ILE A 1 53 ? 4.048   -4.326  -7.142  1.00 0.00 ? 53 ILE A HG12 10 
ATOM 10856 H HG13 . ILE A 1 53 ? 2.307   -4.469  -6.923  1.00 0.00 ? 53 ILE A HG13 10 
ATOM 10857 H HG21 . ILE A 1 53 ? 5.293   -2.570  -5.690  1.00 0.00 ? 53 ILE A HG21 10 
ATOM 10858 H HG22 . ILE A 1 53 ? 4.633   -1.638  -7.033  1.00 0.00 ? 53 ILE A HG22 10 
ATOM 10859 H HG23 . ILE A 1 53 ? 4.378   -1.096  -5.374  1.00 0.00 ? 53 ILE A HG23 10 
ATOM 10860 H HD11 . ILE A 1 53 ? 3.384   -3.728  -9.216  1.00 0.00 ? 53 ILE A HD11 10 
ATOM 10861 H HD12 . ILE A 1 53 ? 1.840   -3.084  -8.658  1.00 0.00 ? 53 ILE A HD12 10 
ATOM 10862 H HD13 . ILE A 1 53 ? 3.315   -2.141  -8.451  1.00 0.00 ? 53 ILE A HD13 10 
ATOM 10863 N N    . TRP A 1 54 ? 1.949   -1.976  -3.084  1.00 0.00 ? 54 TRP A N    10 
ATOM 10864 C CA   . TRP A 1 54 ? 1.855   -0.985  -2.019  1.00 0.00 ? 54 TRP A CA   10 
ATOM 10865 C C    . TRP A 1 54 ? 2.302   -1.574  -0.686  1.00 0.00 ? 54 TRP A C    10 
ATOM 10866 O O    . TRP A 1 54 ? 3.085   -0.964  0.043   1.00 0.00 ? 54 TRP A O    10 
ATOM 10867 C CB   . TRP A 1 54 ? 0.421   -0.464  -1.904  1.00 0.00 ? 54 TRP A CB   10 
ATOM 10868 C CG   . TRP A 1 54 ? 0.305   0.780   -1.077  1.00 0.00 ? 54 TRP A CG   10 
ATOM 10869 C CD1  . TRP A 1 54 ? 0.366   2.069   -1.523  1.00 0.00 ? 54 TRP A CD1  10 
ATOM 10870 C CD2  . TRP A 1 54 ? 0.110   0.852   0.340   1.00 0.00 ? 54 TRP A CD2  10 
ATOM 10871 N NE1  . TRP A 1 54 ? 0.220   2.939   -0.468  1.00 0.00 ? 54 TRP A NE1  10 
ATOM 10872 C CE2  . TRP A 1 54 ? 0.061   2.217   0.685   1.00 0.00 ? 54 TRP A CE2  10 
ATOM 10873 C CE3  . TRP A 1 54 ? -0.030  -0.103  1.350   1.00 0.00 ? 54 TRP A CE3  10 
ATOM 10874 C CZ2  . TRP A 1 54 ? -0.120  2.647   1.997   1.00 0.00 ? 54 TRP A CZ2  10 
ATOM 10875 C CZ3  . TRP A 1 54 ? -0.210  0.325   2.652   1.00 0.00 ? 54 TRP A CZ3  10 
ATOM 10876 C CH2  . TRP A 1 54 ? -0.254  1.690   2.966   1.00 0.00 ? 54 TRP A CH2  10 
ATOM 10877 H H    . TRP A 1 54 ? 1.130   -2.285  -3.524  1.00 0.00 ? 54 TRP A H    10 
ATOM 10878 H HA   . TRP A 1 54 ? 2.507   -0.163  -2.273  1.00 0.00 ? 54 TRP A HA   10 
ATOM 10879 H HB2  . TRP A 1 54 ? 0.044   -0.244  -2.892  1.00 0.00 ? 54 TRP A HB2  10 
ATOM 10880 H HB3  . TRP A 1 54 ? -0.196  -1.227  -1.450  1.00 0.00 ? 54 TRP A HB3  10 
ATOM 10881 H HD1  . TRP A 1 54 ? 0.509   2.349   -2.555  1.00 0.00 ? 54 TRP A HD1  10 
ATOM 10882 H HE1  . TRP A 1 54 ? 0.228   3.917   -0.533  1.00 0.00 ? 54 TRP A HE1  10 
ATOM 10883 H HE3  . TRP A 1 54 ? 0.002   -1.160  1.128   1.00 0.00 ? 54 TRP A HE3  10 
ATOM 10884 H HZ2  . TRP A 1 54 ? -0.158  3.695   2.255   1.00 0.00 ? 54 TRP A HZ2  10 
ATOM 10885 H HZ3  . TRP A 1 54 ? -0.319  -0.399  3.446   1.00 0.00 ? 54 TRP A HZ3  10 
ATOM 10886 H HH2  . TRP A 1 54 ? -0.396  1.979   3.996   1.00 0.00 ? 54 TRP A HH2  10 
ATOM 10887 N N    . PHE A 1 55 ? 1.802   -2.765  -0.372  1.00 0.00 ? 55 PHE A N    10 
ATOM 10888 C CA   . PHE A 1 55 ? 2.150   -3.436  0.875   1.00 0.00 ? 55 PHE A CA   10 
ATOM 10889 C C    . PHE A 1 55 ? 3.590   -3.939  0.838   1.00 0.00 ? 55 PHE A C    10 
ATOM 10890 O O    . PHE A 1 55 ? 4.270   -3.982  1.863   1.00 0.00 ? 55 PHE A O    10 
ATOM 10891 C CB   . PHE A 1 55 ? 1.197   -4.605  1.133   1.00 0.00 ? 55 PHE A CB   10 
ATOM 10892 C CG   . PHE A 1 55 ? -0.029  -4.218  1.910   1.00 0.00 ? 55 PHE A CG   10 
ATOM 10893 C CD1  . PHE A 1 55 ? -1.042  -3.485  1.312   1.00 0.00 ? 55 PHE A CD1  10 
ATOM 10894 C CD2  . PHE A 1 55 ? -0.169  -4.588  3.238   1.00 0.00 ? 55 PHE A CD2  10 
ATOM 10895 C CE1  . PHE A 1 55 ? -2.170  -3.127  2.025   1.00 0.00 ? 55 PHE A CE1  10 
ATOM 10896 C CE2  . PHE A 1 55 ? -1.296  -4.233  3.956   1.00 0.00 ? 55 PHE A CE2  10 
ATOM 10897 C CZ   . PHE A 1 55 ? -2.298  -3.503  3.348   1.00 0.00 ? 55 PHE A CZ   10 
ATOM 10898 H H    . PHE A 1 55 ? 1.182   -3.202  -0.994  1.00 0.00 ? 55 PHE A H    10 
ATOM 10899 H HA   . PHE A 1 55 ? 2.052   -2.719  1.675   1.00 0.00 ? 55 PHE A HA   10 
ATOM 10900 H HB2  . PHE A 1 55 ? 0.874   -5.013  0.187   1.00 0.00 ? 55 PHE A HB2  10 
ATOM 10901 H HB3  . PHE A 1 55 ? 1.718   -5.368  1.691   1.00 0.00 ? 55 PHE A HB3  10 
ATOM 10902 H HD1  . PHE A 1 55 ? -0.944  -3.192  0.277   1.00 0.00 ? 55 PHE A HD1  10 
ATOM 10903 H HD2  . PHE A 1 55 ? 0.615   -5.159  3.714   1.00 0.00 ? 55 PHE A HD2  10 
ATOM 10904 H HE1  . PHE A 1 55 ? -2.953  -2.557  1.547   1.00 0.00 ? 55 PHE A HE1  10 
ATOM 10905 H HE2  . PHE A 1 55 ? -1.392  -4.528  4.990   1.00 0.00 ? 55 PHE A HE2  10 
ATOM 10906 H HZ   . PHE A 1 55 ? -3.179  -3.224  3.907   1.00 0.00 ? 55 PHE A HZ   10 
ATOM 10907 N N    . GLN A 1 56 ? 4.048   -4.318  -0.351  1.00 0.00 ? 56 GLN A N    10 
ATOM 10908 C CA   . GLN A 1 56 ? 5.407   -4.819  -0.522  1.00 0.00 ? 56 GLN A CA   10 
ATOM 10909 C C    . GLN A 1 56 ? 6.425   -3.695  -0.363  1.00 0.00 ? 56 GLN A C    10 
ATOM 10910 O O    . GLN A 1 56 ? 7.455   -3.866  0.287   1.00 0.00 ? 56 GLN A O    10 
ATOM 10911 C CB   . GLN A 1 56 ? 5.562   -5.474  -1.896  1.00 0.00 ? 56 GLN A CB   10 
ATOM 10912 C CG   . GLN A 1 56 ? 6.722   -6.453  -1.975  1.00 0.00 ? 56 GLN A CG   10 
ATOM 10913 C CD   . GLN A 1 56 ? 7.019   -6.893  -3.395  1.00 0.00 ? 56 GLN A CD   10 
ATOM 10914 O OE1  . GLN A 1 56 ? 7.394   -6.082  -4.242  1.00 0.00 ? 56 GLN A OE1  10 
ATOM 10915 N NE2  . GLN A 1 56 ? 6.853   -8.183  -3.663  1.00 0.00 ? 56 GLN A NE2  10 
ATOM 10916 H H    . GLN A 1 56 ? 3.458   -4.260  -1.131  1.00 0.00 ? 56 GLN A H    10 
ATOM 10917 H HA   . GLN A 1 56 ? 5.585   -5.560  0.242   1.00 0.00 ? 56 GLN A HA   10 
ATOM 10918 H HB2  . GLN A 1 56 ? 4.653   -6.005  -2.133  1.00 0.00 ? 56 GLN A HB2  10 
ATOM 10919 H HB3  . GLN A 1 56 ? 5.722   -4.701  -2.633  1.00 0.00 ? 56 GLN A HB3  10 
ATOM 10920 H HG2  . GLN A 1 56 ? 7.604   -5.981  -1.569  1.00 0.00 ? 56 GLN A HG2  10 
ATOM 10921 H HG3  . GLN A 1 56 ? 6.480   -7.326  -1.386  1.00 0.00 ? 56 GLN A HG3  10 
ATOM 10922 H HE21 . GLN A 1 56 ? 6.551   -8.770  -2.938  1.00 0.00 ? 56 GLN A HE21 10 
ATOM 10923 H HE22 . GLN A 1 56 ? 7.037   -8.494  -4.572  1.00 0.00 ? 56 GLN A HE22 10 
ATOM 10924 N N    . ASN A 1 57 ? 6.129   -2.546  -0.961  1.00 0.00 ? 57 ASN A N    10 
ATOM 10925 C CA   . ASN A 1 57 ? 7.020   -1.393  -0.886  1.00 0.00 ? 57 ASN A CA   10 
ATOM 10926 C C    . ASN A 1 57 ? 7.013   -0.791  0.516   1.00 0.00 ? 57 ASN A C    10 
ATOM 10927 O O    . ASN A 1 57 ? 8.064   -0.465  1.069   1.00 0.00 ? 57 ASN A O    10 
ATOM 10928 C CB   . ASN A 1 57 ? 6.606   -0.335  -1.910  1.00 0.00 ? 57 ASN A CB   10 
ATOM 10929 C CG   . ASN A 1 57 ? 7.068   -0.677  -3.313  1.00 0.00 ? 57 ASN A CG   10 
ATOM 10930 O OD1  . ASN A 1 57 ? 7.766   -1.668  -3.525  1.00 0.00 ? 57 ASN A OD1  10 
ATOM 10931 N ND2  . ASN A 1 57 ? 6.679   0.146   -4.281  1.00 0.00 ? 57 ASN A ND2  10 
ATOM 10932 H H    . ASN A 1 57 ? 5.292   -2.470  -1.465  1.00 0.00 ? 57 ASN A H    10 
ATOM 10933 H HA   . ASN A 1 57 ? 8.019   -1.732  -1.115  1.00 0.00 ? 57 ASN A HA   10 
ATOM 10934 H HB2  . ASN A 1 57 ? 5.529   -0.251  -1.917  1.00 0.00 ? 57 ASN A HB2  10 
ATOM 10935 H HB3  . ASN A 1 57 ? 7.035   0.615   -1.631  1.00 0.00 ? 57 ASN A HB3  10 
ATOM 10936 H HD21 . ASN A 1 57 ? 6.124   0.916   -4.039  1.00 0.00 ? 57 ASN A HD21 10 
ATOM 10937 H HD22 . ASN A 1 57 ? 6.963   -0.052  -5.198  1.00 0.00 ? 57 ASN A HD22 10 
ATOM 10938 N N    . LYS A 1 58 ? 5.822   -0.646  1.086   1.00 0.00 ? 58 LYS A N    10 
ATOM 10939 C CA   . LYS A 1 58 ? 5.676   -0.085  2.424   1.00 0.00 ? 58 LYS A CA   10 
ATOM 10940 C C    . LYS A 1 58 ? 6.523   -0.854  3.432   1.00 0.00 ? 58 LYS A C    10 
ATOM 10941 O O    . LYS A 1 58 ? 7.173   -0.261  4.293   1.00 0.00 ? 58 LYS A O    10 
ATOM 10942 C CB   . LYS A 1 58 ? 4.207   -0.109  2.852   1.00 0.00 ? 58 LYS A CB   10 
ATOM 10943 C CG   . LYS A 1 58 ? 3.847   0.977   3.852   1.00 0.00 ? 58 LYS A CG   10 
ATOM 10944 C CD   . LYS A 1 58 ? 3.778   2.343   3.191   1.00 0.00 ? 58 LYS A CD   10 
ATOM 10945 C CE   . LYS A 1 58 ? 2.899   2.318   1.950   1.00 0.00 ? 58 LYS A CE   10 
ATOM 10946 N NZ   . LYS A 1 58 ? 3.678   1.990   0.724   1.00 0.00 ? 58 LYS A NZ   10 
ATOM 10947 H H    . LYS A 1 58 ? 5.020   -0.924  0.594   1.00 0.00 ? 58 LYS A H    10 
ATOM 10948 H HA   . LYS A 1 58 ? 6.016   0.939   2.393   1.00 0.00 ? 58 LYS A HA   10 
ATOM 10949 H HB2  . LYS A 1 58 ? 3.587   0.017   1.977   1.00 0.00 ? 58 LYS A HB2  10 
ATOM 10950 H HB3  . LYS A 1 58 ? 3.991   -1.068  3.301   1.00 0.00 ? 58 LYS A HB3  10 
ATOM 10951 H HG2  . LYS A 1 58 ? 2.885   0.749   4.285   1.00 0.00 ? 58 LYS A HG2  10 
ATOM 10952 H HG3  . LYS A 1 58 ? 4.598   1.000   4.629   1.00 0.00 ? 58 LYS A HG3  10 
ATOM 10953 H HD2  . LYS A 1 58 ? 3.369   3.053   3.893   1.00 0.00 ? 58 LYS A HD2  10 
ATOM 10954 H HD3  . LYS A 1 58 ? 4.776   2.647   2.908   1.00 0.00 ? 58 LYS A HD3  10 
ATOM 10955 H HE2  . LYS A 1 58 ? 2.128   1.575   2.085   1.00 0.00 ? 58 LYS A HE2  10 
ATOM 10956 H HE3  . LYS A 1 58 ? 2.444   3.290   1.827   1.00 0.00 ? 58 LYS A HE3  10 
ATOM 10957 H HZ1  . LYS A 1 58 ? 4.566   1.512   0.982   1.00 0.00 ? 58 LYS A HZ1  10 
ATOM 10958 H HZ2  . LYS A 1 58 ? 3.906   2.860   0.202   1.00 0.00 ? 58 LYS A HZ2  10 
ATOM 10959 H HZ3  . LYS A 1 58 ? 3.126   1.362   0.106   1.00 0.00 ? 58 LYS A HZ3  10 
ATOM 10960 N N    . ARG A 1 59 ? 6.513   -2.178  3.318   1.00 0.00 ? 59 ARG A N    10 
ATOM 10961 C CA   . ARG A 1 59 ? 7.281   -3.029  4.219   1.00 0.00 ? 59 ARG A CA   10 
ATOM 10962 C C    . ARG A 1 59 ? 8.775   -2.744  4.094   1.00 0.00 ? 59 ARG A C    10 
ATOM 10963 O O    . ARG A 1 59 ? 9.510   -2.790  5.080   1.00 0.00 ? 59 ARG A O    10 
ATOM 10964 C CB   . ARG A 1 59 ? 7.005   -4.504  3.922   1.00 0.00 ? 59 ARG A CB   10 
ATOM 10965 C CG   . ARG A 1 59 ? 5.829   -5.072  4.699   1.00 0.00 ? 59 ARG A CG   10 
ATOM 10966 C CD   . ARG A 1 59 ? 5.851   -6.593  4.709   1.00 0.00 ? 59 ARG A CD   10 
ATOM 10967 N NE   . ARG A 1 59 ? 5.127   -7.158  3.573   1.00 0.00 ? 59 ARG A NE   10 
ATOM 10968 C CZ   . ARG A 1 59 ? 5.652   -7.293  2.361   1.00 0.00 ? 59 ARG A CZ   10 
ATOM 10969 N NH1  . ARG A 1 59 ? 6.899   -6.907  2.128   1.00 0.00 ? 59 ARG A NH1  10 
ATOM 10970 N NH2  . ARG A 1 59 ? 4.930   -7.817  1.378   1.00 0.00 ? 59 ARG A NH2  10 
ATOM 10971 H H    . ARG A 1 59 ? 5.976   -2.594  2.611   1.00 0.00 ? 59 ARG A H    10 
ATOM 10972 H HA   . ARG A 1 59 ? 6.968   -2.810  5.229   1.00 0.00 ? 59 ARG A HA   10 
ATOM 10973 H HB2  . ARG A 1 59 ? 6.799   -4.614  2.867   1.00 0.00 ? 59 ARG A HB2  10 
ATOM 10974 H HB3  . ARG A 1 59 ? 7.885   -5.079  4.170   1.00 0.00 ? 59 ARG A HB3  10 
ATOM 10975 H HG2  . ARG A 1 59 ? 5.877   -4.716  5.717   1.00 0.00 ? 59 ARG A HG2  10 
ATOM 10976 H HG3  . ARG A 1 59 ? 4.911   -4.736  4.240   1.00 0.00 ? 59 ARG A HG3  10 
ATOM 10977 H HD2  . ARG A 1 59 ? 6.877   -6.925  4.670   1.00 0.00 ? 59 ARG A HD2  10 
ATOM 10978 H HD3  . ARG A 1 59 ? 5.394   -6.940  5.624   1.00 0.00 ? 59 ARG A HD3  10 
ATOM 10979 H HE   . ARG A 1 59 ? 4.204   -7.450  3.723   1.00 0.00 ? 59 ARG A HE   10 
ATOM 10980 H HH11 . ARG A 1 59 ? 7.446   -6.514  2.867   1.00 0.00 ? 59 ARG A HH11 10 
ATOM 10981 H HH12 . ARG A 1 59 ? 7.293   -7.012  1.214   1.00 0.00 ? 59 ARG A HH12 10 
ATOM 10982 H HH21 . ARG A 1 59 ? 3.990   -8.109  1.550   1.00 0.00 ? 59 ARG A HH21 10 
ATOM 10983 H HH22 . ARG A 1 59 ? 5.326   -7.918  0.466   1.00 0.00 ? 59 ARG A HH22 10 
ATOM 10984 N N    . SER A 1 60 ? 9.217   -2.452  2.875   1.00 0.00 ? 60 SER A N    10 
ATOM 10985 C CA   . SER A 1 60 ? 10.623  -2.164  2.620   1.00 0.00 ? 60 SER A CA   10 
ATOM 10986 C C    . SER A 1 60 ? 10.993  -0.772  3.123   1.00 0.00 ? 60 SER A C    10 
ATOM 10987 O O    . SER A 1 60 ? 12.139  -0.338  2.999   1.00 0.00 ? 60 SER A O    10 
ATOM 10988 C CB   . SER A 1 60 ? 10.926  -2.276  1.125   1.00 0.00 ? 60 SER A CB   10 
ATOM 10989 O OG   . SER A 1 60 ? 12.281  -1.966  0.854   1.00 0.00 ? 60 SER A OG   10 
ATOM 10990 H H    . SER A 1 60 ? 8.581   -2.431  2.129   1.00 0.00 ? 60 SER A H    10 
ATOM 10991 H HA   . SER A 1 60 ? 11.213  -2.895  3.153   1.00 0.00 ? 60 SER A HA   10 
ATOM 10992 H HB2  . SER A 1 60 ? 10.727  -3.284  0.794   1.00 0.00 ? 60 SER A HB2  10 
ATOM 10993 H HB3  . SER A 1 60 ? 10.295  -1.588  0.580   1.00 0.00 ? 60 SER A HB3  10 
ATOM 10994 H HG   . SER A 1 60 ? 12.828  -2.249  1.590   1.00 0.00 ? 60 SER A HG   10 
ATOM 10995 N N    . LYS A 1 61 ? 10.014  -0.076  3.690   1.00 0.00 ? 61 LYS A N    10 
ATOM 10996 C CA   . LYS A 1 61 ? 10.234  1.267   4.213   1.00 0.00 ? 61 LYS A CA   10 
ATOM 10997 C C    . LYS A 1 61 ? 10.131  1.282   5.735   1.00 0.00 ? 61 LYS A C    10 
ATOM 10998 O O    . LYS A 1 61 ? 10.299  2.325   6.368   1.00 0.00 ? 61 LYS A O    10 
ATOM 10999 C CB   . LYS A 1 61 ? 9.219   2.243   3.614   1.00 0.00 ? 61 LYS A CB   10 
ATOM 11000 C CG   . LYS A 1 61 ? 9.652   2.829   2.281   1.00 0.00 ? 61 LYS A CG   10 
ATOM 11001 C CD   . LYS A 1 61 ? 9.496   1.824   1.153   1.00 0.00 ? 61 LYS A CD   10 
ATOM 11002 C CE   . LYS A 1 61 ? 10.331  2.211   -0.058  1.00 0.00 ? 61 LYS A CE   10 
ATOM 11003 N NZ   . LYS A 1 61 ? 9.691   3.299   -0.849  1.00 0.00 ? 61 LYS A NZ   10 
ATOM 11004 H H    . LYS A 1 61 ? 9.121   -0.475  3.759   1.00 0.00 ? 61 LYS A H    10 
ATOM 11005 H HA   . LYS A 1 61 ? 11.228  1.576   3.929   1.00 0.00 ? 61 LYS A HA   10 
ATOM 11006 H HB2  . LYS A 1 61 ? 8.282   1.725   3.468   1.00 0.00 ? 61 LYS A HB2  10 
ATOM 11007 H HB3  . LYS A 1 61 ? 9.066   3.057   4.308   1.00 0.00 ? 61 LYS A HB3  10 
ATOM 11008 H HG2  . LYS A 1 61 ? 9.044   3.695   2.064   1.00 0.00 ? 61 LYS A HG2  10 
ATOM 11009 H HG3  . LYS A 1 61 ? 10.690  3.124   2.348   1.00 0.00 ? 61 LYS A HG3  10 
ATOM 11010 H HD2  . LYS A 1 61 ? 9.816   0.853   1.500   1.00 0.00 ? 61 LYS A HD2  10 
ATOM 11011 H HD3  . LYS A 1 61 ? 8.456   1.780   0.862   1.00 0.00 ? 61 LYS A HD3  10 
ATOM 11012 H HE2  . LYS A 1 61 ? 11.299  2.546   0.281   1.00 0.00 ? 61 LYS A HE2  10 
ATOM 11013 H HE3  . LYS A 1 61 ? 10.452  1.342   -0.688  1.00 0.00 ? 61 LYS A HE3  10 
ATOM 11014 H HZ1  . LYS A 1 61 ? 9.267   4.001   -0.210  1.00 0.00 ? 61 LYS A HZ1  10 
ATOM 11015 H HZ2  . LYS A 1 61 ? 8.946   2.906   -1.458  1.00 0.00 ? 61 LYS A HZ2  10 
ATOM 11016 H HZ3  . LYS A 1 61 ? 10.400  3.771   -1.446  1.00 0.00 ? 61 LYS A HZ3  10 
ATOM 11017 N N    . ILE A 1 62 ? 9.856   0.119   6.316   1.00 0.00 ? 62 ILE A N    10 
ATOM 11018 C CA   . ILE A 1 62 ? 9.734   -0.001  7.764   1.00 0.00 ? 62 ILE A CA   10 
ATOM 11019 C C    . ILE A 1 62 ? 11.031  0.398   8.460   1.00 0.00 ? 62 ILE A C    10 
ATOM 11020 O O    . ILE A 1 62 ? 12.019  -0.335  8.425   1.00 0.00 ? 62 ILE A O    10 
ATOM 11021 C CB   . ILE A 1 62 ? 9.363   -1.437  8.180   1.00 0.00 ? 62 ILE A CB   10 
ATOM 11022 C CG1  . ILE A 1 62 ? 8.011   -1.831  7.581   1.00 0.00 ? 62 ILE A CG1  10 
ATOM 11023 C CG2  . ILE A 1 62 ? 9.331   -1.557  9.696   1.00 0.00 ? 62 ILE A CG2  10 
ATOM 11024 C CD1  . ILE A 1 62 ? 7.607   -3.256  7.887   1.00 0.00 ? 62 ILE A CD1  10 
ATOM 11025 H H    . ILE A 1 62 ? 9.734   -0.677  5.758   1.00 0.00 ? 62 ILE A H    10 
ATOM 11026 H HA   . ILE A 1 62 ? 8.945   0.662   8.088   1.00 0.00 ? 62 ILE A HA   10 
ATOM 11027 H HB   . ILE A 1 62 ? 10.123  -2.105  7.806   1.00 0.00 ? 62 ILE A HB   10 
ATOM 11028 H HG12 . ILE A 1 62 ? 7.247   -1.179  7.972   1.00 0.00 ? 62 ILE A HG12 10 
ATOM 11029 H HG13 . ILE A 1 62 ? 8.057   -1.722  6.507   1.00 0.00 ? 62 ILE A HG13 10 
ATOM 11030 H HG21 . ILE A 1 62 ? 10.006  -2.340  10.009  1.00 0.00 ? 62 ILE A HG21 10 
ATOM 11031 H HG22 . ILE A 1 62 ? 9.639   -0.621  10.138  1.00 0.00 ? 62 ILE A HG22 10 
ATOM 11032 H HG23 . ILE A 1 62 ? 8.329   -1.796  10.018  1.00 0.00 ? 62 ILE A HG23 10 
ATOM 11033 H HD11 . ILE A 1 62 ? 6.631   -3.452  7.469   1.00 0.00 ? 62 ILE A HD11 10 
ATOM 11034 H HD12 . ILE A 1 62 ? 8.328   -3.936  7.457   1.00 0.00 ? 62 ILE A HD12 10 
ATOM 11035 H HD13 . ILE A 1 62 ? 7.574   -3.398  8.958   1.00 0.00 ? 62 ILE A HD13 10 
ATOM 11036 N N    . LYS A 1 63 ? 11.020  1.566   9.093   1.00 0.00 ? 63 LYS A N    10 
ATOM 11037 C CA   . LYS A 1 63 ? 12.194  2.064   9.801   1.00 0.00 ? 63 LYS A CA   10 
ATOM 11038 C C    . LYS A 1 63 ? 12.879  0.942   10.575  1.00 0.00 ? 63 LYS A C    10 
ATOM 11039 O O    . LYS A 1 63 ? 12.345  0.440   11.564  1.00 0.00 ? 63 LYS A O    10 
ATOM 11040 C CB   . LYS A 1 63 ? 11.798  3.190   10.759  1.00 0.00 ? 63 LYS A CB   10 
ATOM 11041 C CG   . LYS A 1 63 ? 11.769  4.562   10.106  1.00 0.00 ? 63 LYS A CG   10 
ATOM 11042 C CD   . LYS A 1 63 ? 13.165  5.147   9.977   1.00 0.00 ? 63 LYS A CD   10 
ATOM 11043 C CE   . LYS A 1 63 ? 13.688  5.640   11.318  1.00 0.00 ? 63 LYS A CE   10 
ATOM 11044 N NZ   . LYS A 1 63 ? 15.118  6.047   11.239  1.00 0.00 ? 63 LYS A NZ   10 
ATOM 11045 H H    . LYS A 1 63 ? 10.202  2.107   9.085   1.00 0.00 ? 63 LYS A H    10 
ATOM 11046 H HA   . LYS A 1 63 ? 12.884  2.453   9.068   1.00 0.00 ? 63 LYS A HA   10 
ATOM 11047 H HB2  . LYS A 1 63 ? 10.814  2.982   11.153  1.00 0.00 ? 63 LYS A HB2  10 
ATOM 11048 H HB3  . LYS A 1 63 ? 12.505  3.218   11.575  1.00 0.00 ? 63 LYS A HB3  10 
ATOM 11049 H HG2  . LYS A 1 63 ? 11.335  4.472   9.121   1.00 0.00 ? 63 LYS A HG2  10 
ATOM 11050 H HG3  . LYS A 1 63 ? 11.164  5.224   10.709  1.00 0.00 ? 63 LYS A HG3  10 
ATOM 11051 H HD2  . LYS A 1 63 ? 13.832  4.386   9.601   1.00 0.00 ? 63 LYS A HD2  10 
ATOM 11052 H HD3  . LYS A 1 63 ? 13.135  5.977   9.285   1.00 0.00 ? 63 LYS A HD3  10 
ATOM 11053 H HE2  . LYS A 1 63 ? 13.098  6.489   11.629  1.00 0.00 ? 63 LYS A HE2  10 
ATOM 11054 H HE3  . LYS A 1 63 ? 13.587  4.846   12.042  1.00 0.00 ? 63 LYS A HE3  10 
ATOM 11055 H HZ1  . LYS A 1 63 ? 15.675  5.535   11.954  1.00 0.00 ? 63 LYS A HZ1  10 
ATOM 11056 H HZ2  . LYS A 1 63 ? 15.210  7.068   11.411  1.00 0.00 ? 63 LYS A HZ2  10 
ATOM 11057 H HZ3  . LYS A 1 63 ? 15.501  5.829   10.297  1.00 0.00 ? 63 LYS A HZ3  10 
ATOM 11058 N N    . LYS A 1 64 ? 14.065  0.554   10.119  1.00 0.00 ? 64 LYS A N    10 
ATOM 11059 C CA   . LYS A 1 64 ? 14.826  -0.506  10.770  1.00 0.00 ? 64 LYS A CA   10 
ATOM 11060 C C    . LYS A 1 64 ? 15.867  0.076   11.720  1.00 0.00 ? 64 LYS A C    10 
ATOM 11061 O O    . LYS A 1 64 ? 16.227  1.248   11.619  1.00 0.00 ? 64 LYS A O    10 
ATOM 11062 C CB   . LYS A 1 64 ? 15.511  -1.387  9.723   1.00 0.00 ? 64 LYS A CB   10 
ATOM 11063 C CG   . LYS A 1 64 ? 14.596  -2.439  9.120   1.00 0.00 ? 64 LYS A CG   10 
ATOM 11064 C CD   . LYS A 1 64 ? 15.380  -3.472  8.328   1.00 0.00 ? 64 LYS A CD   10 
ATOM 11065 C CE   . LYS A 1 64 ? 14.481  -4.242  7.373   1.00 0.00 ? 64 LYS A CE   10 
ATOM 11066 N NZ   . LYS A 1 64 ? 15.268  -5.016  6.373   1.00 0.00 ? 64 LYS A NZ   10 
ATOM 11067 H H    . LYS A 1 64 ? 14.439  0.993   9.326   1.00 0.00 ? 64 LYS A H    10 
ATOM 11068 H HA   . LYS A 1 64 ? 14.134  -1.109  11.338  1.00 0.00 ? 64 LYS A HA   10 
ATOM 11069 H HB2  . LYS A 1 64 ? 15.876  -0.758  8.924   1.00 0.00 ? 64 LYS A HB2  10 
ATOM 11070 H HB3  . LYS A 1 64 ? 16.348  -1.890  10.185  1.00 0.00 ? 64 LYS A HB3  10 
ATOM 11071 H HG2  . LYS A 1 64 ? 14.064  -2.939  9.916   1.00 0.00 ? 64 LYS A HG2  10 
ATOM 11072 H HG3  . LYS A 1 64 ? 13.889  -1.954  8.462   1.00 0.00 ? 64 LYS A HG3  10 
ATOM 11073 H HD2  . LYS A 1 64 ? 16.147  -2.969  7.757   1.00 0.00 ? 64 LYS A HD2  10 
ATOM 11074 H HD3  . LYS A 1 64 ? 15.839  -4.168  9.016   1.00 0.00 ? 64 LYS A HD3  10 
ATOM 11075 H HE2  . LYS A 1 64 ? 13.871  -4.924  7.944   1.00 0.00 ? 64 LYS A HE2  10 
ATOM 11076 H HE3  . LYS A 1 64 ? 13.846  -3.540  6.853   1.00 0.00 ? 64 LYS A HE3  10 
ATOM 11077 H HZ1  . LYS A 1 64 ? 15.305  -6.019  6.647   1.00 0.00 ? 64 LYS A HZ1  10 
ATOM 11078 H HZ2  . LYS A 1 64 ? 16.239  -4.647  6.319   1.00 0.00 ? 64 LYS A HZ2  10 
ATOM 11079 H HZ3  . LYS A 1 64 ? 14.827  -4.940  5.434   1.00 0.00 ? 64 LYS A HZ3  10 
ATOM 11080 N N    . SER A 1 65 ? 16.348  -0.752  12.642  1.00 0.00 ? 65 SER A N    10 
ATOM 11081 C CA   . SER A 1 65 ? 17.347  -0.319  13.612  1.00 0.00 ? 65 SER A CA   10 
ATOM 11082 C C    . SER A 1 65 ? 18.755  -0.463  13.044  1.00 0.00 ? 65 SER A C    10 
ATOM 11083 O O    . SER A 1 65 ? 19.016  -1.336  12.217  1.00 0.00 ? 65 SER A O    10 
ATOM 11084 C CB   . SER A 1 65 ? 17.220  -1.130  14.904  1.00 0.00 ? 65 SER A CB   10 
ATOM 11085 O OG   . SER A 1 65 ? 17.428  -2.510  14.661  1.00 0.00 ? 65 SER A OG   10 
ATOM 11086 H H    . SER A 1 65 ? 16.021  -1.676  12.672  1.00 0.00 ? 65 SER A H    10 
ATOM 11087 H HA   . SER A 1 65 ? 17.166  0.723   13.832  1.00 0.00 ? 65 SER A HA   10 
ATOM 11088 H HB2  . SER A 1 65 ? 17.957  -0.787  15.614  1.00 0.00 ? 65 SER A HB2  10 
ATOM 11089 H HB3  . SER A 1 65 ? 16.231  -0.993  15.316  1.00 0.00 ? 65 SER A HB3  10 
ATOM 11090 H HG   . SER A 1 65 ? 18.205  -2.807  15.140  1.00 0.00 ? 65 SER A HG   10 
ATOM 11091 N N    . GLY A 1 66 ? 19.660  0.400   13.494  1.00 0.00 ? 66 GLY A N    10 
ATOM 11092 C CA   . GLY A 1 66 ? 21.031  0.353   13.020  1.00 0.00 ? 66 GLY A CA   10 
ATOM 11093 C C    . GLY A 1 66 ? 21.963  -0.322  14.006  1.00 0.00 ? 66 GLY A C    10 
ATOM 11094 O O    . GLY A 1 66 ? 21.540  -1.104  14.858  1.00 0.00 ? 66 GLY A O    10 
ATOM 11095 H H    . GLY A 1 66 ? 19.395  1.075   14.153  1.00 0.00 ? 66 GLY A H    10 
ATOM 11096 H HA2  . GLY A 1 66 ? 21.059  -0.188  12.086  1.00 0.00 ? 66 GLY A HA2  10 
ATOM 11097 H HA3  . GLY A 1 66 ? 21.376  1.362   12.850  1.00 0.00 ? 66 GLY A HA3  10 
ATOM 11098 N N    . PRO A 1 67 ? 23.265  -0.021  13.898  1.00 0.00 ? 67 PRO A N    10 
ATOM 11099 C CA   . PRO A 1 67 ? 24.287  -0.594  14.779  1.00 0.00 ? 67 PRO A CA   10 
ATOM 11100 C C    . PRO A 1 67 ? 24.184  -0.067  16.206  1.00 0.00 ? 67 PRO A C    10 
ATOM 11101 O O    . PRO A 1 67 ? 24.390  -0.808  17.167  1.00 0.00 ? 67 PRO A O    10 
ATOM 11102 C CB   . PRO A 1 67 ? 25.602  -0.145  14.137  1.00 0.00 ? 67 PRO A CB   10 
ATOM 11103 C CG   . PRO A 1 67 ? 25.254  1.094   13.386  1.00 0.00 ? 67 PRO A CG   10 
ATOM 11104 C CD   . PRO A 1 67 ? 23.841  0.904   12.906  1.00 0.00 ? 67 PRO A CD   10 
ATOM 11105 H HA   . PRO A 1 67 ? 24.240  -1.673  14.790  1.00 0.00 ? 67 PRO A HA   10 
ATOM 11106 H HB2  . PRO A 1 67 ? 26.333  0.052   14.908  1.00 0.00 ? 67 PRO A HB2  10 
ATOM 11107 H HB3  . PRO A 1 67 ? 25.966  -0.917  13.476  1.00 0.00 ? 67 PRO A HB3  10 
ATOM 11108 H HG2  . PRO A 1 67 ? 25.315  1.949   14.041  1.00 0.00 ? 67 PRO A HG2  10 
ATOM 11109 H HG3  . PRO A 1 67 ? 25.921  1.214   12.546  1.00 0.00 ? 67 PRO A HG3  10 
ATOM 11110 H HD2  . PRO A 1 67 ? 23.313  1.846   12.905  1.00 0.00 ? 67 PRO A HD2  10 
ATOM 11111 H HD3  . PRO A 1 67 ? 23.834  0.464   11.920  1.00 0.00 ? 67 PRO A HD3  10 
ATOM 11112 N N    . SER A 1 68 ? 23.864  1.216   16.336  1.00 0.00 ? 68 SER A N    10 
ATOM 11113 C CA   . SER A 1 68 ? 23.737  1.843   17.647  1.00 0.00 ? 68 SER A CA   10 
ATOM 11114 C C    . SER A 1 68 ? 23.015  0.919   18.623  1.00 0.00 ? 68 SER A C    10 
ATOM 11115 O O    . SER A 1 68 ? 21.792  0.784   18.578  1.00 0.00 ? 68 SER A O    10 
ATOM 11116 C CB   . SER A 1 68 ? 22.983  3.169   17.530  1.00 0.00 ? 68 SER A CB   10 
ATOM 11117 O OG   . SER A 1 68 ? 23.582  4.013   16.562  1.00 0.00 ? 68 SER A OG   10 
ATOM 11118 H H    . SER A 1 68 ? 23.712  1.755   15.531  1.00 0.00 ? 68 SER A H    10 
ATOM 11119 H HA   . SER A 1 68 ? 24.731  2.035   18.020  1.00 0.00 ? 68 SER A HA   10 
ATOM 11120 H HB2  . SER A 1 68 ? 21.962  2.976   17.239  1.00 0.00 ? 68 SER A HB2  10 
ATOM 11121 H HB3  . SER A 1 68 ? 22.996  3.672   18.486  1.00 0.00 ? 68 SER A HB3  10 
ATOM 11122 H HG   . SER A 1 68 ? 24.081  4.704   17.004  1.00 0.00 ? 68 SER A HG   10 
ATOM 11123 N N    . SER A 1 69 ? 23.781  0.285   19.505  1.00 0.00 ? 69 SER A N    10 
ATOM 11124 C CA   . SER A 1 69 ? 23.217  -0.630  20.490  1.00 0.00 ? 69 SER A CA   10 
ATOM 11125 C C    . SER A 1 69 ? 22.143  -1.512  19.860  1.00 0.00 ? 69 SER A C    10 
ATOM 11126 O O    . SER A 1 69 ? 21.086  -1.739  20.448  1.00 0.00 ? 69 SER A O    10 
ATOM 11127 C CB   . SER A 1 69 ? 22.625  0.153   21.664  1.00 0.00 ? 69 SER A CB   10 
ATOM 11128 O OG   . SER A 1 69 ? 22.553  -0.651  22.829  1.00 0.00 ? 69 SER A OG   10 
ATOM 11129 H H    . SER A 1 69 ? 24.750  0.434   19.490  1.00 0.00 ? 69 SER A H    10 
ATOM 11130 H HA   . SER A 1 69 ? 24.015  -1.259  20.854  1.00 0.00 ? 69 SER A HA   10 
ATOM 11131 H HB2  . SER A 1 69 ? 23.247  1.011   21.871  1.00 0.00 ? 69 SER A HB2  10 
ATOM 11132 H HB3  . SER A 1 69 ? 21.629  0.484   21.407  1.00 0.00 ? 69 SER A HB3  10 
ATOM 11133 H HG   . SER A 1 69 ? 23.383  -0.595  23.308  1.00 0.00 ? 69 SER A HG   10 
ATOM 11134 N N    . GLY A 1 70 ? 22.423  -2.007  18.658  1.00 0.00 ? 70 GLY A N    10 
ATOM 11135 C CA   . GLY A 1 70 ? 21.472  -2.858  17.967  1.00 0.00 ? 70 GLY A CA   10 
ATOM 11136 C C    . GLY A 1 70 ? 21.651  -4.324  18.309  1.00 0.00 ? 70 GLY A C    10 
ATOM 11137 O O    . GLY A 1 70 ? 22.300  -4.662  19.299  1.00 0.00 ? 70 GLY A O    10 
ATOM 11138 H H    . GLY A 1 70 ? 23.281  -1.792  18.238  1.00 0.00 ? 70 GLY A H    10 
ATOM 11139 H HA2  . GLY A 1 70 ? 20.471  -2.556  18.238  1.00 0.00 ? 70 GLY A HA2  10 
ATOM 11140 H HA3  . GLY A 1 70 ? 21.600  -2.731  16.902  1.00 0.00 ? 70 GLY A HA3  10 
ATOM 11141 N N    . GLY A 1 1  ? 21.651  10.628  2.360   1.00 0.00 ? 1  GLY A N    11 
ATOM 11142 C CA   . GLY A 1 1  ? 20.238  10.884  2.571   1.00 0.00 ? 1  GLY A CA   11 
ATOM 11143 C C    . GLY A 1 1  ? 19.441  10.834  1.282   1.00 0.00 ? 1  GLY A C    11 
ATOM 11144 O O    . GLY A 1 1  ? 19.567  9.889   0.503   1.00 0.00 ? 1  GLY A O    11 
ATOM 11145 H H1   . GLY A 1 1  ? 22.052  10.797  1.481   1.00 0.00 ? 1  GLY A H1   11 
ATOM 11146 H HA2  . GLY A 1 1  ? 19.848  10.144  3.253   1.00 0.00 ? 1  GLY A HA2  11 
ATOM 11147 H HA3  . GLY A 1 1  ? 20.124  11.863  3.013   1.00 0.00 ? 1  GLY A HA3  11 
ATOM 11148 N N    . SER A 1 2  ? 18.618  11.853  1.058   1.00 0.00 ? 2  SER A N    11 
ATOM 11149 C CA   . SER A 1 2  ? 17.792  11.918  -0.143  1.00 0.00 ? 2  SER A CA   11 
ATOM 11150 C C    . SER A 1 2  ? 17.625  13.361  -0.609  1.00 0.00 ? 2  SER A C    11 
ATOM 11151 O O    . SER A 1 2  ? 17.822  14.301  0.162   1.00 0.00 ? 2  SER A O    11 
ATOM 11152 C CB   . SER A 1 2  ? 16.421  11.293  0.121   1.00 0.00 ? 2  SER A CB   11 
ATOM 11153 O OG   . SER A 1 2  ? 15.645  12.110  0.979   1.00 0.00 ? 2  SER A OG   11 
ATOM 11154 H H    . SER A 1 2  ? 18.562  12.576  1.717   1.00 0.00 ? 2  SER A H    11 
ATOM 11155 H HA   . SER A 1 2  ? 18.291  11.357  -0.919  1.00 0.00 ? 2  SER A HA   11 
ATOM 11156 H HB2  . SER A 1 2  ? 15.897  11.175  -0.815  1.00 0.00 ? 2  SER A HB2  11 
ATOM 11157 H HB3  . SER A 1 2  ? 16.552  10.326  0.585   1.00 0.00 ? 2  SER A HB3  11 
ATOM 11158 H HG   . SER A 1 2  ? 14.724  11.841  0.933   1.00 0.00 ? 2  SER A HG   11 
ATOM 11159 N N    . SER A 1 3  ? 17.260  13.529  -1.876  1.00 0.00 ? 3  SER A N    11 
ATOM 11160 C CA   . SER A 1 3  ? 17.069  14.857  -2.447  1.00 0.00 ? 3  SER A CA   11 
ATOM 11161 C C    . SER A 1 3  ? 15.966  15.612  -1.712  1.00 0.00 ? 3  SER A C    11 
ATOM 11162 O O    . SER A 1 3  ? 14.890  15.071  -1.460  1.00 0.00 ? 3  SER A O    11 
ATOM 11163 C CB   . SER A 1 3  ? 16.726  14.751  -3.934  1.00 0.00 ? 3  SER A CB   11 
ATOM 11164 O OG   . SER A 1 3  ? 15.600  13.916  -4.139  1.00 0.00 ? 3  SER A OG   11 
ATOM 11165 H H    . SER A 1 3  ? 17.118  12.740  -2.440  1.00 0.00 ? 3  SER A H    11 
ATOM 11166 H HA   . SER A 1 3  ? 17.996  15.401  -2.338  1.00 0.00 ? 3  SER A HA   11 
ATOM 11167 H HB2  . SER A 1 3  ? 16.506  15.734  -4.321  1.00 0.00 ? 3  SER A HB2  11 
ATOM 11168 H HB3  . SER A 1 3  ? 17.570  14.335  -4.466  1.00 0.00 ? 3  SER A HB3  11 
ATOM 11169 H HG   . SER A 1 3  ? 15.892  13.046  -4.421  1.00 0.00 ? 3  SER A HG   11 
ATOM 11170 N N    . GLY A 1 4  ? 16.243  16.866  -1.369  1.00 0.00 ? 4  GLY A N    11 
ATOM 11171 C CA   . GLY A 1 4  ? 15.265  17.676  -0.666  1.00 0.00 ? 4  GLY A CA   11 
ATOM 11172 C C    . GLY A 1 4  ? 14.329  18.404  -1.610  1.00 0.00 ? 4  GLY A C    11 
ATOM 11173 O O    . GLY A 1 4  ? 14.719  18.781  -2.715  1.00 0.00 ? 4  GLY A O    11 
ATOM 11174 H H    . GLY A 1 4  ? 17.118  17.245  -1.597  1.00 0.00 ? 4  GLY A H    11 
ATOM 11175 H HA2  . GLY A 1 4  ? 14.683  17.037  -0.019  1.00 0.00 ? 4  GLY A HA2  11 
ATOM 11176 H HA3  . GLY A 1 4  ? 15.786  18.404  -0.062  1.00 0.00 ? 4  GLY A HA3  11 
ATOM 11177 N N    . SER A 1 5  ? 13.089  18.602  -1.174  1.00 0.00 ? 5  SER A N    11 
ATOM 11178 C CA   . SER A 1 5  ? 12.092  19.285  -1.991  1.00 0.00 ? 5  SER A CA   11 
ATOM 11179 C C    . SER A 1 5  ? 11.429  20.414  -1.207  1.00 0.00 ? 5  SER A C    11 
ATOM 11180 O O    . SER A 1 5  ? 11.097  20.258  -0.032  1.00 0.00 ? 5  SER A O    11 
ATOM 11181 C CB   . SER A 1 5  ? 11.031  18.294  -2.474  1.00 0.00 ? 5  SER A CB   11 
ATOM 11182 O OG   . SER A 1 5  ? 11.512  17.523  -3.562  1.00 0.00 ? 5  SER A OG   11 
ATOM 11183 H H    . SER A 1 5  ? 12.838  18.278  -0.284  1.00 0.00 ? 5  SER A H    11 
ATOM 11184 H HA   . SER A 1 5  ? 12.597  19.705  -2.848  1.00 0.00 ? 5  SER A HA   11 
ATOM 11185 H HB2  . SER A 1 5  ? 10.769  17.629  -1.665  1.00 0.00 ? 5  SER A HB2  11 
ATOM 11186 H HB3  . SER A 1 5  ? 10.153  18.837  -2.793  1.00 0.00 ? 5  SER A HB3  11 
ATOM 11187 H HG   . SER A 1 5  ? 10.946  16.758  -3.687  1.00 0.00 ? 5  SER A HG   11 
ATOM 11188 N N    . SER A 1 6  ? 11.240  21.552  -1.867  1.00 0.00 ? 6  SER A N    11 
ATOM 11189 C CA   . SER A 1 6  ? 10.621  22.710  -1.233  1.00 0.00 ? 6  SER A CA   11 
ATOM 11190 C C    . SER A 1 6  ? 9.102   22.656  -1.368  1.00 0.00 ? 6  SER A C    11 
ATOM 11191 O O    . SER A 1 6  ? 8.373   22.929  -0.416  1.00 0.00 ? 6  SER A O    11 
ATOM 11192 C CB   . SER A 1 6  ? 11.153  24.003  -1.852  1.00 0.00 ? 6  SER A CB   11 
ATOM 11193 O OG   . SER A 1 6  ? 12.363  24.405  -1.233  1.00 0.00 ? 6  SER A OG   11 
ATOM 11194 H H    . SER A 1 6  ? 11.526  21.615  -2.803  1.00 0.00 ? 6  SER A H    11 
ATOM 11195 H HA   . SER A 1 6  ? 10.878  22.691  -0.184  1.00 0.00 ? 6  SER A HA   11 
ATOM 11196 H HB2  . SER A 1 6  ? 11.337  23.847  -2.904  1.00 0.00 ? 6  SER A HB2  11 
ATOM 11197 H HB3  . SER A 1 6  ? 10.421  24.787  -1.727  1.00 0.00 ? 6  SER A HB3  11 
ATOM 11198 H HG   . SER A 1 6  ? 12.422  24.010  -0.360  1.00 0.00 ? 6  SER A HG   11 
ATOM 11199 N N    . GLY A 1 7  ? 8.632   22.301  -2.560  1.00 0.00 ? 7  GLY A N    11 
ATOM 11200 C CA   . GLY A 1 7  ? 7.203   22.217  -2.800  1.00 0.00 ? 7  GLY A CA   11 
ATOM 11201 C C    . GLY A 1 7  ? 6.749   20.805  -3.111  1.00 0.00 ? 7  GLY A C    11 
ATOM 11202 O O    . GLY A 1 7  ? 7.563   19.944  -3.447  1.00 0.00 ? 7  GLY A O    11 
ATOM 11203 H H    . GLY A 1 7  ? 9.261   22.095  -3.283  1.00 0.00 ? 7  GLY A H    11 
ATOM 11204 H HA2  . GLY A 1 7  ? 6.681   22.567  -1.922  1.00 0.00 ? 7  GLY A HA2  11 
ATOM 11205 H HA3  . GLY A 1 7  ? 6.952   22.856  -3.634  1.00 0.00 ? 7  GLY A HA3  11 
ATOM 11206 N N    . ARG A 1 8  ? 5.447   20.565  -2.998  1.00 0.00 ? 8  ARG A N    11 
ATOM 11207 C CA   . ARG A 1 8  ? 4.887   19.247  -3.267  1.00 0.00 ? 8  ARG A CA   11 
ATOM 11208 C C    . ARG A 1 8  ? 3.566   19.361  -4.022  1.00 0.00 ? 8  ARG A C    11 
ATOM 11209 O O    . ARG A 1 8  ? 3.013   20.451  -4.166  1.00 0.00 ? 8  ARG A O    11 
ATOM 11210 C CB   . ARG A 1 8  ? 4.674   18.483  -1.959  1.00 0.00 ? 8  ARG A CB   11 
ATOM 11211 C CG   . ARG A 1 8  ? 3.596   19.083  -1.071  1.00 0.00 ? 8  ARG A CG   11 
ATOM 11212 C CD   . ARG A 1 8  ? 3.860   18.793  0.398   1.00 0.00 ? 8  ARG A CD   11 
ATOM 11213 N NE   . ARG A 1 8  ? 2.860   19.410  1.265   1.00 0.00 ? 8  ARG A NE   11 
ATOM 11214 C CZ   . ARG A 1 8  ? 2.636   19.027  2.517   1.00 0.00 ? 8  ARG A CZ   11 
ATOM 11215 N NH1  . ARG A 1 8  ? 3.338   18.034  3.046   1.00 0.00 ? 8  ARG A NH1  11 
ATOM 11216 N NH2  . ARG A 1 8  ? 1.708   19.638  3.244   1.00 0.00 ? 8  ARG A NH2  11 
ATOM 11217 H H    . ARG A 1 8  ? 4.849   21.293  -2.727  1.00 0.00 ? 8  ARG A H    11 
ATOM 11218 H HA   . ARG A 1 8  ? 5.592   18.705  -3.880  1.00 0.00 ? 8  ARG A HA   11 
ATOM 11219 H HB2  . ARG A 1 8  ? 4.394   17.466  -2.191  1.00 0.00 ? 8  ARG A HB2  11 
ATOM 11220 H HB3  . ARG A 1 8  ? 5.602   18.474  -1.407  1.00 0.00 ? 8  ARG A HB3  11 
ATOM 11221 H HG2  . ARG A 1 8  ? 3.577   20.153  -1.218  1.00 0.00 ? 8  ARG A HG2  11 
ATOM 11222 H HG3  . ARG A 1 8  ? 2.641   18.662  -1.347  1.00 0.00 ? 8  ARG A HG3  11 
ATOM 11223 H HD2  . ARG A 1 8  ? 3.843   17.724  0.549   1.00 0.00 ? 8  ARG A HD2  11 
ATOM 11224 H HD3  . ARG A 1 8  ? 4.835   19.178  0.658   1.00 0.00 ? 8  ARG A HD3  11 
ATOM 11225 H HE   . ARG A 1 8  ? 2.330   20.146  0.895   1.00 0.00 ? 8  ARG A HE   11 
ATOM 11226 H HH11 . ARG A 1 8  ? 4.038   17.573  2.501   1.00 0.00 ? 8  ARG A HH11 11 
ATOM 11227 H HH12 . ARG A 1 8  ? 3.168   17.748  3.989   1.00 0.00 ? 8  ARG A HH12 11 
ATOM 11228 H HH21 . ARG A 1 8  ? 1.177   20.387  2.849   1.00 0.00 ? 8  ARG A HH21 11 
ATOM 11229 H HH22 . ARG A 1 8  ? 1.541   19.349  4.185   1.00 0.00 ? 8  ARG A HH22 11 
ATOM 11230 N N    . LYS A 1 9  ? 3.065   18.228  -4.503  1.00 0.00 ? 9  LYS A N    11 
ATOM 11231 C CA   . LYS A 1 9  ? 1.809   18.199  -5.243  1.00 0.00 ? 9  LYS A CA   11 
ATOM 11232 C C    . LYS A 1 9  ? 0.818   17.237  -4.595  1.00 0.00 ? 9  LYS A C    11 
ATOM 11233 O O    . LYS A 1 9  ? 1.195   16.220  -4.011  1.00 0.00 ? 9  LYS A O    11 
ATOM 11234 C CB   . LYS A 1 9  ? 2.059   17.789  -6.696  1.00 0.00 ? 9  LYS A CB   11 
ATOM 11235 C CG   . LYS A 1 9  ? 2.752   18.861  -7.520  1.00 0.00 ? 9  LYS A CG   11 
ATOM 11236 C CD   . LYS A 1 9  ? 2.782   18.498  -8.995  1.00 0.00 ? 9  LYS A CD   11 
ATOM 11237 C CE   . LYS A 1 9  ? 3.067   19.714  -9.862  1.00 0.00 ? 9  LYS A CE   11 
ATOM 11238 N NZ   . LYS A 1 9  ? 4.436   20.252  -9.630  1.00 0.00 ? 9  LYS A NZ   11 
ATOM 11239 H H    . LYS A 1 9  ? 3.553   17.390  -4.356  1.00 0.00 ? 9  LYS A H    11 
ATOM 11240 H HA   . LYS A 1 9  ? 1.391   19.194  -5.225  1.00 0.00 ? 9  LYS A HA   11 
ATOM 11241 H HB2  . LYS A 1 9  ? 2.674   16.902  -6.707  1.00 0.00 ? 9  LYS A HB2  11 
ATOM 11242 H HB3  . LYS A 1 9  ? 1.110   17.565  -7.162  1.00 0.00 ? 9  LYS A HB3  11 
ATOM 11243 H HG2  . LYS A 1 9  ? 2.222   19.794  -7.400  1.00 0.00 ? 9  LYS A HG2  11 
ATOM 11244 H HG3  . LYS A 1 9  ? 3.767   18.974  -7.165  1.00 0.00 ? 9  LYS A HG3  11 
ATOM 11245 H HD2  . LYS A 1 9  ? 3.555   17.763  -9.161  1.00 0.00 ? 9  LYS A HD2  11 
ATOM 11246 H HD3  . LYS A 1 9  ? 1.823   18.084  -9.274  1.00 0.00 ? 9  LYS A HD3  11 
ATOM 11247 H HE2  . LYS A 1 9  ? 2.972   19.431  -10.899 1.00 0.00 ? 9  LYS A HE2  11 
ATOM 11248 H HE3  . LYS A 1 9  ? 2.344   20.482  -9.631  1.00 0.00 ? 9  LYS A HE3  11 
ATOM 11249 H HZ1  . LYS A 1 9  ? 4.465   21.267  -9.857  1.00 0.00 ? 9  LYS A HZ1  11 
ATOM 11250 H HZ2  . LYS A 1 9  ? 5.123   19.755  -10.233 1.00 0.00 ? 9  LYS A HZ2  11 
ATOM 11251 H HZ3  . LYS A 1 9  ? 4.708   20.122  -8.635  1.00 0.00 ? 9  LYS A HZ3  11 
ATOM 11252 N N    . PRO A 1 10 ? -0.479  17.562  -4.701  1.00 0.00 ? 10 PRO A N    11 
ATOM 11253 C CA   . PRO A 1 10 ? -1.550  16.738  -4.133  1.00 0.00 ? 10 PRO A CA   11 
ATOM 11254 C C    . PRO A 1 10 ? -1.720  15.416  -4.875  1.00 0.00 ? 10 PRO A C    11 
ATOM 11255 O O    . PRO A 1 10 ? -1.958  14.376  -4.262  1.00 0.00 ? 10 PRO A O    11 
ATOM 11256 C CB   . PRO A 1 10 ? -2.796  17.610  -4.303  1.00 0.00 ? 10 PRO A CB   11 
ATOM 11257 C CG   . PRO A 1 10 ? -2.480  18.504  -5.453  1.00 0.00 ? 10 PRO A CG   11 
ATOM 11258 C CD   . PRO A 1 10 ? -0.999  18.759  -5.383  1.00 0.00 ? 10 PRO A CD   11 
ATOM 11259 H HA   . PRO A 1 10 ? -1.386  16.542  -3.084  1.00 0.00 ? 10 PRO A HA   11 
ATOM 11260 H HB2  . PRO A 1 10 ? -3.652  16.983  -4.513  1.00 0.00 ? 10 PRO A HB2  11 
ATOM 11261 H HB3  . PRO A 1 10 ? -2.970  18.176  -3.400  1.00 0.00 ? 10 PRO A HB3  11 
ATOM 11262 H HG2  . PRO A 1 10 ? -2.733  18.013  -6.380  1.00 0.00 ? 10 PRO A HG2  11 
ATOM 11263 H HG3  . PRO A 1 10 ? -3.024  19.431  -5.357  1.00 0.00 ? 10 PRO A HG3  11 
ATOM 11264 H HD2  . PRO A 1 10 ? -0.585  18.847  -6.377  1.00 0.00 ? 10 PRO A HD2  11 
ATOM 11265 H HD3  . PRO A 1 10 ? -0.796  19.649  -4.807  1.00 0.00 ? 10 PRO A HD3  11 
ATOM 11266 N N    . ARG A 1 11 ? -1.596  15.465  -6.197  1.00 0.00 ? 11 ARG A N    11 
ATOM 11267 C CA   . ARG A 1 11 ? -1.736  14.271  -7.022  1.00 0.00 ? 11 ARG A CA   11 
ATOM 11268 C C    . ARG A 1 11 ? -0.733  13.200  -6.604  1.00 0.00 ? 11 ARG A C    11 
ATOM 11269 O O    . ARG A 1 11 ? 0.406   13.183  -7.073  1.00 0.00 ? 11 ARG A O    11 
ATOM 11270 C CB   . ARG A 1 11 ? -1.541  14.620  -8.499  1.00 0.00 ? 11 ARG A CB   11 
ATOM 11271 C CG   . ARG A 1 11 ? -1.755  13.443  -9.436  1.00 0.00 ? 11 ARG A CG   11 
ATOM 11272 C CD   . ARG A 1 11 ? -0.932  13.586  -10.707 1.00 0.00 ? 11 ARG A CD   11 
ATOM 11273 N NE   . ARG A 1 11 ? -1.280  14.793  -11.452 1.00 0.00 ? 11 ARG A NE   11 
ATOM 11274 C CZ   . ARG A 1 11 ? -0.690  15.153  -12.586 1.00 0.00 ? 11 ARG A CZ   11 
ATOM 11275 N NH1  . ARG A 1 11 ? 0.273   14.402  -13.103 1.00 0.00 ? 11 ARG A NH1  11 
ATOM 11276 N NH2  . ARG A 1 11 ? -1.062  16.266  -13.205 1.00 0.00 ? 11 ARG A NH2  11 
ATOM 11277 H H    . ARG A 1 11 ? -1.406  16.324  -6.629  1.00 0.00 ? 11 ARG A H    11 
ATOM 11278 H HA   . ARG A 1 11 ? -2.735  13.886  -6.882  1.00 0.00 ? 11 ARG A HA   11 
ATOM 11279 H HB2  . ARG A 1 11 ? -2.239  15.398  -8.769  1.00 0.00 ? 11 ARG A HB2  11 
ATOM 11280 H HB3  . ARG A 1 11 ? -0.535  14.986  -8.640  1.00 0.00 ? 11 ARG A HB3  11 
ATOM 11281 H HG2  . ARG A 1 11 ? -1.461  12.534  -8.931  1.00 0.00 ? 11 ARG A HG2  11 
ATOM 11282 H HG3  . ARG A 1 11 ? -2.801  13.389  -9.699  1.00 0.00 ? 11 ARG A HG3  11 
ATOM 11283 H HD2  . ARG A 1 11 ? 0.114   13.628  -10.441 1.00 0.00 ? 11 ARG A HD2  11 
ATOM 11284 H HD3  . ARG A 1 11 ? -1.109  12.724  -11.333 1.00 0.00 ? 11 ARG A HD3  11 
ATOM 11285 H HE   . ARG A 1 11 ? -1.989  15.362  -11.087 1.00 0.00 ? 11 ARG A HE   11 
ATOM 11286 H HH11 . ARG A 1 11 ? 0.555   13.563  -12.639 1.00 0.00 ? 11 ARG A HH11 11 
ATOM 11287 H HH12 . ARG A 1 11 ? 0.716   14.675  -13.958 1.00 0.00 ? 11 ARG A HH12 11 
ATOM 11288 H HH21 . ARG A 1 11 ? -1.788  16.834  -12.818 1.00 0.00 ? 11 ARG A HH21 11 
ATOM 11289 H HH22 . ARG A 1 11 ? -0.617  16.536  -14.058 1.00 0.00 ? 11 ARG A HH22 11 
ATOM 11290 N N    . THR A 1 12 ? -1.163  12.307  -5.719  1.00 0.00 ? 12 THR A N    11 
ATOM 11291 C CA   . THR A 1 12 ? -0.303  11.234  -5.236  1.00 0.00 ? 12 THR A CA   11 
ATOM 11292 C C    . THR A 1 12 ? -0.611  9.921   -5.946  1.00 0.00 ? 12 THR A C    11 
ATOM 11293 O O    . THR A 1 12 ? -1.726  9.710   -6.425  1.00 0.00 ? 12 THR A O    11 
ATOM 11294 C CB   . THR A 1 12 ? -0.457  11.031  -3.717  1.00 0.00 ? 12 THR A CB   11 
ATOM 11295 O OG1  . THR A 1 12 ? -0.202  12.262  -3.030  1.00 0.00 ? 12 THR A OG1  11 
ATOM 11296 C CG2  . THR A 1 12 ? 0.496   9.957   -3.215  1.00 0.00 ? 12 THR A CG2  11 
ATOM 11297 H H    . THR A 1 12 ? -2.081  12.373  -5.382  1.00 0.00 ? 12 THR A H    11 
ATOM 11298 H HA   . THR A 1 12 ? 0.721   11.510  -5.439  1.00 0.00 ? 12 THR A HA   11 
ATOM 11299 H HB   . THR A 1 12 ? -1.470  10.717  -3.512  1.00 0.00 ? 12 THR A HB   11 
ATOM 11300 H HG1  . THR A 1 12 ? 0.706   12.271  -2.717  1.00 0.00 ? 12 THR A HG1  11 
ATOM 11301 H HG21 . THR A 1 12 ? 1.515   10.283  -3.362  1.00 0.00 ? 12 THR A HG21 11 
ATOM 11302 H HG22 . THR A 1 12 ? 0.328   9.042   -3.763  1.00 0.00 ? 12 THR A HG22 11 
ATOM 11303 H HG23 . THR A 1 12 ? 0.322   9.785   -2.163  1.00 0.00 ? 12 THR A HG23 11 
ATOM 11304 N N    . ILE A 1 13 ? 0.382   9.041   -6.010  1.00 0.00 ? 13 ILE A N    11 
ATOM 11305 C CA   . ILE A 1 13 ? 0.216   7.747   -6.661  1.00 0.00 ? 13 ILE A CA   11 
ATOM 11306 C C    . ILE A 1 13 ? -1.089  7.083   -6.237  1.00 0.00 ? 13 ILE A C    11 
ATOM 11307 O O    . ILE A 1 13 ? -1.602  6.201   -6.927  1.00 0.00 ? 13 ILE A O    11 
ATOM 11308 C CB   . ILE A 1 13 ? 1.388   6.801   -6.341  1.00 0.00 ? 13 ILE A CB   11 
ATOM 11309 C CG1  . ILE A 1 13 ? 2.711   7.423   -6.792  1.00 0.00 ? 13 ILE A CG1  11 
ATOM 11310 C CG2  . ILE A 1 13 ? 1.176   5.451   -7.009  1.00 0.00 ? 13 ILE A CG2  11 
ATOM 11311 C CD1  . ILE A 1 13 ? 3.922   6.835   -6.101  1.00 0.00 ? 13 ILE A CD1  11 
ATOM 11312 H H    . ILE A 1 13 ? 1.248   9.267   -5.610  1.00 0.00 ? 13 ILE A H    11 
ATOM 11313 H HA   . ILE A 1 13 ? 0.193   7.912   -7.729  1.00 0.00 ? 13 ILE A HA   11 
ATOM 11314 H HB   . ILE A 1 13 ? 1.416   6.647   -5.273  1.00 0.00 ? 13 ILE A HB   11 
ATOM 11315 H HG12 . ILE A 1 13 ? 2.830   7.272   -7.853  1.00 0.00 ? 13 ILE A HG12 11 
ATOM 11316 H HG13 . ILE A 1 13 ? 2.692   8.483   -6.584  1.00 0.00 ? 13 ILE A HG13 11 
ATOM 11317 H HG21 . ILE A 1 13 ? 0.262   5.008   -6.643  1.00 0.00 ? 13 ILE A HG21 11 
ATOM 11318 H HG22 . ILE A 1 13 ? 1.107   5.586   -8.078  1.00 0.00 ? 13 ILE A HG22 11 
ATOM 11319 H HG23 . ILE A 1 13 ? 2.008   4.802   -6.781  1.00 0.00 ? 13 ILE A HG23 11 
ATOM 11320 H HD11 . ILE A 1 13 ? 3.600   6.157   -5.325  1.00 0.00 ? 13 ILE A HD11 11 
ATOM 11321 H HD12 . ILE A 1 13 ? 4.524   6.301   -6.821  1.00 0.00 ? 13 ILE A HD12 11 
ATOM 11322 H HD13 . ILE A 1 13 ? 4.508   7.631   -5.663  1.00 0.00 ? 13 ILE A HD13 11 
ATOM 11323 N N    . TYR A 1 14 ? -1.623  7.512   -5.098  1.00 0.00 ? 14 TYR A N    11 
ATOM 11324 C CA   . TYR A 1 14 ? -2.868  6.959   -4.581  1.00 0.00 ? 14 TYR A CA   11 
ATOM 11325 C C    . TYR A 1 14 ? -3.762  8.060   -4.019  1.00 0.00 ? 14 TYR A C    11 
ATOM 11326 O O    . TYR A 1 14 ? -3.276  9.075   -3.520  1.00 0.00 ? 14 TYR A O    11 
ATOM 11327 C CB   . TYR A 1 14 ? -2.578  5.919   -3.498  1.00 0.00 ? 14 TYR A CB   11 
ATOM 11328 C CG   . TYR A 1 14 ? -2.099  4.593   -4.044  1.00 0.00 ? 14 TYR A CG   11 
ATOM 11329 C CD1  . TYR A 1 14 ? -0.790  4.431   -4.481  1.00 0.00 ? 14 TYR A CD1  11 
ATOM 11330 C CD2  . TYR A 1 14 ? -2.955  3.501   -4.121  1.00 0.00 ? 14 TYR A CD2  11 
ATOM 11331 C CE1  . TYR A 1 14 ? -0.349  3.221   -4.981  1.00 0.00 ? 14 TYR A CE1  11 
ATOM 11332 C CE2  . TYR A 1 14 ? -2.522  2.287   -4.619  1.00 0.00 ? 14 TYR A CE2  11 
ATOM 11333 C CZ   . TYR A 1 14 ? -1.218  2.153   -5.048  1.00 0.00 ? 14 TYR A CZ   11 
ATOM 11334 O OH   . TYR A 1 14 ? -0.782  0.946   -5.544  1.00 0.00 ? 14 TYR A OH   11 
ATOM 11335 H H    . TYR A 1 14 ? -1.167  8.217   -4.593  1.00 0.00 ? 14 TYR A H    11 
ATOM 11336 H HA   . TYR A 1 14 ? -3.382  6.477   -5.400  1.00 0.00 ? 14 TYR A HA   11 
ATOM 11337 H HB2  . TYR A 1 14 ? -1.814  6.300   -2.838  1.00 0.00 ? 14 TYR A HB2  11 
ATOM 11338 H HB3  . TYR A 1 14 ? -3.479  5.738   -2.931  1.00 0.00 ? 14 TYR A HB3  11 
ATOM 11339 H HD1  . TYR A 1 14 ? -0.111  5.270   -4.427  1.00 0.00 ? 14 TYR A HD1  11 
ATOM 11340 H HD2  . TYR A 1 14 ? -3.976  3.610   -3.784  1.00 0.00 ? 14 TYR A HD2  11 
ATOM 11341 H HE1  . TYR A 1 14 ? 0.673   3.115   -5.317  1.00 0.00 ? 14 TYR A HE1  11 
ATOM 11342 H HE2  . TYR A 1 14 ? -3.202  1.450   -4.671  1.00 0.00 ? 14 TYR A HE2  11 
ATOM 11343 H HH   . TYR A 1 14 ? -0.149  1.100   -6.250  1.00 0.00 ? 14 TYR A HH   11 
ATOM 11344 N N    . SER A 1 15 ? -5.072  7.850   -4.102  1.00 0.00 ? 15 SER A N    11 
ATOM 11345 C CA   . SER A 1 15 ? -6.035  8.826   -3.605  1.00 0.00 ? 15 SER A CA   11 
ATOM 11346 C C    . SER A 1 15 ? -6.106  8.791   -2.081  1.00 0.00 ? 15 SER A C    11 
ATOM 11347 O O    . SER A 1 15 ? -5.795  7.776   -1.457  1.00 0.00 ? 15 SER A O    11 
ATOM 11348 C CB   . SER A 1 15 ? -7.419  8.554   -4.197  1.00 0.00 ? 15 SER A CB   11 
ATOM 11349 O OG   . SER A 1 15 ? -8.387  9.438   -3.657  1.00 0.00 ? 15 SER A OG   11 
ATOM 11350 H H    . SER A 1 15 ? -5.398  7.021   -4.510  1.00 0.00 ? 15 SER A H    11 
ATOM 11351 H HA   . SER A 1 15 ? -5.705  9.805   -3.916  1.00 0.00 ? 15 SER A HA   11 
ATOM 11352 H HB2  . SER A 1 15 ? -7.383  8.690   -5.267  1.00 0.00 ? 15 SER A HB2  11 
ATOM 11353 H HB3  . SER A 1 15 ? -7.711  7.539   -3.972  1.00 0.00 ? 15 SER A HB3  11 
ATOM 11354 H HG   . SER A 1 15 ? -8.315  10.293  -4.088  1.00 0.00 ? 15 SER A HG   11 
ATOM 11355 N N    . SER A 1 16 ? -6.517  9.907   -1.488  1.00 0.00 ? 16 SER A N    11 
ATOM 11356 C CA   . SER A 1 16 ? -6.625  10.007  -0.038  1.00 0.00 ? 16 SER A CA   11 
ATOM 11357 C C    . SER A 1 16 ? -7.617  8.982   0.505   1.00 0.00 ? 16 SER A C    11 
ATOM 11358 O O    . SER A 1 16 ? -7.432  8.440   1.595   1.00 0.00 ? 16 SER A O    11 
ATOM 11359 C CB   . SER A 1 16 ? -7.060  11.418  0.367   1.00 0.00 ? 16 SER A CB   11 
ATOM 11360 O OG   . SER A 1 16 ? -8.298  11.760  -0.230  1.00 0.00 ? 16 SER A OG   11 
ATOM 11361 H H    . SER A 1 16 ? -6.750  10.683  -2.040  1.00 0.00 ? 16 SER A H    11 
ATOM 11362 H HA   . SER A 1 16 ? -5.651  9.806   0.382   1.00 0.00 ? 16 SER A HA   11 
ATOM 11363 H HB2  . SER A 1 16 ? -7.166  11.465  1.440   1.00 0.00 ? 16 SER A HB2  11 
ATOM 11364 H HB3  . SER A 1 16 ? -6.311  12.127  0.047   1.00 0.00 ? 16 SER A HB3  11 
ATOM 11365 H HG   . SER A 1 16 ? -8.926  11.046  -0.098  1.00 0.00 ? 16 SER A HG   11 
ATOM 11366 N N    . PHE A 1 17 ? -8.669  8.722   -0.263  1.00 0.00 ? 17 PHE A N    11 
ATOM 11367 C CA   . PHE A 1 17 ? -9.691  7.763   0.139   1.00 0.00 ? 17 PHE A CA   11 
ATOM 11368 C C    . PHE A 1 17 ? -9.123  6.348   0.183   1.00 0.00 ? 17 PHE A C    11 
ATOM 11369 O O    . PHE A 1 17 ? -9.393  5.588   1.112   1.00 0.00 ? 17 PHE A O    11 
ATOM 11370 C CB   . PHE A 1 17 ? -10.880 7.819   -0.823  1.00 0.00 ? 17 PHE A CB   11 
ATOM 11371 C CG   . PHE A 1 17 ? -11.639 6.526   -0.912  1.00 0.00 ? 17 PHE A CG   11 
ATOM 11372 C CD1  . PHE A 1 17 ? -12.344 6.044   0.180   1.00 0.00 ? 17 PHE A CD1  11 
ATOM 11373 C CD2  . PHE A 1 17 ? -11.650 5.793   -2.087  1.00 0.00 ? 17 PHE A CD2  11 
ATOM 11374 C CE1  . PHE A 1 17 ? -13.043 4.855   0.101   1.00 0.00 ? 17 PHE A CE1  11 
ATOM 11375 C CE2  . PHE A 1 17 ? -12.348 4.603   -2.173  1.00 0.00 ? 17 PHE A CE2  11 
ATOM 11376 C CZ   . PHE A 1 17 ? -13.046 4.134   -1.077  1.00 0.00 ? 17 PHE A CZ   11 
ATOM 11377 H H    . PHE A 1 17 ? -8.761  9.187   -1.122  1.00 0.00 ? 17 PHE A H    11 
ATOM 11378 H HA   . PHE A 1 17 ? -10.027 8.034   1.129   1.00 0.00 ? 17 PHE A HA   11 
ATOM 11379 H HB2  . PHE A 1 17 ? -11.566 8.584   -0.492  1.00 0.00 ? 17 PHE A HB2  11 
ATOM 11380 H HB3  . PHE A 1 17 ? -10.522 8.064   -1.811  1.00 0.00 ? 17 PHE A HB3  11 
ATOM 11381 H HD1  . PHE A 1 17 ? -12.343 6.607   1.102   1.00 0.00 ? 17 PHE A HD1  11 
ATOM 11382 H HD2  . PHE A 1 17 ? -11.104 6.159   -2.945  1.00 0.00 ? 17 PHE A HD2  11 
ATOM 11383 H HE1  . PHE A 1 17 ? -13.588 4.490   0.959   1.00 0.00 ? 17 PHE A HE1  11 
ATOM 11384 H HE2  . PHE A 1 17 ? -12.348 4.041   -3.095  1.00 0.00 ? 17 PHE A HE2  11 
ATOM 11385 H HZ   . PHE A 1 17 ? -13.591 3.204   -1.142  1.00 0.00 ? 17 PHE A HZ   11 
ATOM 11386 N N    . GLN A 1 18 ? -8.335  6.002   -0.830  1.00 0.00 ? 18 GLN A N    11 
ATOM 11387 C CA   . GLN A 1 18 ? -7.729  4.678   -0.909  1.00 0.00 ? 18 GLN A CA   11 
ATOM 11388 C C    . GLN A 1 18 ? -6.619  4.525   0.126   1.00 0.00 ? 18 GLN A C    11 
ATOM 11389 O O    . GLN A 1 18 ? -6.560  3.528   0.846   1.00 0.00 ? 18 GLN A O    11 
ATOM 11390 C CB   . GLN A 1 18 ? -7.173  4.431   -2.312  1.00 0.00 ? 18 GLN A CB   11 
ATOM 11391 C CG   . GLN A 1 18 ? -8.243  4.384   -3.391  1.00 0.00 ? 18 GLN A CG   11 
ATOM 11392 C CD   . GLN A 1 18 ? -7.667  4.148   -4.773  1.00 0.00 ? 18 GLN A CD   11 
ATOM 11393 O OE1  . GLN A 1 18 ? -6.544  4.555   -5.069  1.00 0.00 ? 18 GLN A OE1  11 
ATOM 11394 N NE2  . GLN A 1 18 ? -8.436  3.485   -5.630  1.00 0.00 ? 18 GLN A NE2  11 
ATOM 11395 H H    . GLN A 1 18 ? -8.157  6.652   -1.541  1.00 0.00 ? 18 GLN A H    11 
ATOM 11396 H HA   . GLN A 1 18 ? -8.498  3.949   -0.703  1.00 0.00 ? 18 GLN A HA   11 
ATOM 11397 H HB2  . GLN A 1 18 ? -6.480  5.222   -2.556  1.00 0.00 ? 18 GLN A HB2  11 
ATOM 11398 H HB3  . GLN A 1 18 ? -6.646  3.488   -2.317  1.00 0.00 ? 18 GLN A HB3  11 
ATOM 11399 H HG2  . GLN A 1 18 ? -8.931  3.584   -3.163  1.00 0.00 ? 18 GLN A HG2  11 
ATOM 11400 H HG3  . GLN A 1 18 ? -8.774  5.324   -3.394  1.00 0.00 ? 18 GLN A HG3  11 
ATOM 11401 H HE21 . GLN A 1 18 ? -9.321  3.192   -5.325  1.00 0.00 ? 18 GLN A HE21 11 
ATOM 11402 H HE22 . GLN A 1 18 ? -8.090  3.319   -6.530  1.00 0.00 ? 18 GLN A HE22 11 
ATOM 11403 N N    . LEU A 1 19 ? -5.740  5.519   0.194   1.00 0.00 ? 19 LEU A N    11 
ATOM 11404 C CA   . LEU A 1 19 ? -4.630  5.496   1.140   1.00 0.00 ? 19 LEU A CA   11 
ATOM 11405 C C    . LEU A 1 19 ? -5.137  5.341   2.571   1.00 0.00 ? 19 LEU A C    11 
ATOM 11406 O O    . LEU A 1 19 ? -4.733  4.426   3.287   1.00 0.00 ? 19 LEU A O    11 
ATOM 11407 C CB   . LEU A 1 19 ? -3.801  6.775   1.017   1.00 0.00 ? 19 LEU A CB   11 
ATOM 11408 C CG   . LEU A 1 19 ? -2.697  6.761   -0.041  1.00 0.00 ? 19 LEU A CG   11 
ATOM 11409 C CD1  . LEU A 1 19 ? -1.877  8.039   0.026   1.00 0.00 ? 19 LEU A CD1  11 
ATOM 11410 C CD2  . LEU A 1 19 ? -1.805  5.541   0.136   1.00 0.00 ? 19 LEU A CD2  11 
ATOM 11411 H H    . LEU A 1 19 ? -5.839  6.288   -0.406  1.00 0.00 ? 19 LEU A H    11 
ATOM 11412 H HA   . LEU A 1 19 ? -4.007  4.648   0.899   1.00 0.00 ? 19 LEU A HA   11 
ATOM 11413 H HB2  . LEU A 1 19 ? -4.475  7.584   0.780   1.00 0.00 ? 19 LEU A HB2  11 
ATOM 11414 H HB3  . LEU A 1 19 ? -3.339  6.963   1.976   1.00 0.00 ? 19 LEU A HB3  11 
ATOM 11415 H HG   . LEU A 1 19 ? -3.149  6.706   -1.023  1.00 0.00 ? 19 LEU A HG   11 
ATOM 11416 H HD11 . LEU A 1 19 ? -1.148  8.041   -0.771  1.00 0.00 ? 19 LEU A HD11 11 
ATOM 11417 H HD12 . LEU A 1 19 ? -1.369  8.091   0.978   1.00 0.00 ? 19 LEU A HD12 11 
ATOM 11418 H HD13 . LEU A 1 19 ? -2.530  8.892   -0.081  1.00 0.00 ? 19 LEU A HD13 11 
ATOM 11419 H HD21 . LEU A 1 19 ? -0.771  5.853   0.162   1.00 0.00 ? 19 LEU A HD21 11 
ATOM 11420 H HD22 . LEU A 1 19 ? -1.955  4.862   -0.690  1.00 0.00 ? 19 LEU A HD22 11 
ATOM 11421 H HD23 . LEU A 1 19 ? -2.054  5.044   1.062   1.00 0.00 ? 19 LEU A HD23 11 
ATOM 11422 N N    . ALA A 1 20 ? -6.027  6.240   2.978   1.00 0.00 ? 20 ALA A N    11 
ATOM 11423 C CA   . ALA A 1 20 ? -6.593  6.201   4.321   1.00 0.00 ? 20 ALA A CA   11 
ATOM 11424 C C    . ALA A 1 20 ? -6.780  4.764   4.796   1.00 0.00 ? 20 ALA A C    11 
ATOM 11425 O O    . ALA A 1 20 ? -6.135  4.326   5.748   1.00 0.00 ? 20 ALA A O    11 
ATOM 11426 C CB   . ALA A 1 20 ? -7.918  6.947   4.357   1.00 0.00 ? 20 ALA A CB   11 
ATOM 11427 H H    . ALA A 1 20 ? -6.311  6.946   2.360   1.00 0.00 ? 20 ALA A H    11 
ATOM 11428 H HA   . ALA A 1 20 ? -5.906  6.703   4.987   1.00 0.00 ? 20 ALA A HA   11 
ATOM 11429 H HB1  . ALA A 1 20 ? -8.114  7.282   5.365   1.00 0.00 ? 20 ALA A HB1  11 
ATOM 11430 H HB2  . ALA A 1 20 ? -7.869  7.801   3.697   1.00 0.00 ? 20 ALA A HB2  11 
ATOM 11431 H HB3  . ALA A 1 20 ? -8.711  6.289   4.035   1.00 0.00 ? 20 ALA A HB3  11 
ATOM 11432 N N    . ALA A 1 21 ? -7.667  4.035   4.126   1.00 0.00 ? 21 ALA A N    11 
ATOM 11433 C CA   . ALA A 1 21 ? -7.938  2.647   4.480   1.00 0.00 ? 21 ALA A CA   11 
ATOM 11434 C C    . ALA A 1 21 ? -6.670  1.803   4.399   1.00 0.00 ? 21 ALA A C    11 
ATOM 11435 O O    . ALA A 1 21 ? -6.405  0.977   5.274   1.00 0.00 ? 21 ALA A O    11 
ATOM 11436 C CB   . ALA A 1 21 ? -9.016  2.072   3.574   1.00 0.00 ? 21 ALA A CB   11 
ATOM 11437 H H    . ALA A 1 21 ? -8.150  4.440   3.376   1.00 0.00 ? 21 ALA A H    11 
ATOM 11438 H HA   . ALA A 1 21 ? -8.307  2.627   5.495   1.00 0.00 ? 21 ALA A HA   11 
ATOM 11439 H HB1  . ALA A 1 21 ? -8.805  1.030   3.381   1.00 0.00 ? 21 ALA A HB1  11 
ATOM 11440 H HB2  . ALA A 1 21 ? -9.978  2.162   4.056   1.00 0.00 ? 21 ALA A HB2  11 
ATOM 11441 H HB3  . ALA A 1 21 ? -9.029  2.615   2.641   1.00 0.00 ? 21 ALA A HB3  11 
ATOM 11442 N N    . LEU A 1 22 ? -5.891  2.013   3.344   1.00 0.00 ? 22 LEU A N    11 
ATOM 11443 C CA   . LEU A 1 22 ? -4.651  1.271   3.148   1.00 0.00 ? 22 LEU A CA   11 
ATOM 11444 C C    . LEU A 1 22 ? -3.751  1.380   4.375   1.00 0.00 ? 22 LEU A C    11 
ATOM 11445 O O    . LEU A 1 22 ? -3.498  0.390   5.060   1.00 0.00 ? 22 LEU A O    11 
ATOM 11446 C CB   . LEU A 1 22 ? -3.913  1.789   1.912   1.00 0.00 ? 22 LEU A CB   11 
ATOM 11447 C CG   . LEU A 1 22 ? -4.487  1.365   0.560   1.00 0.00 ? 22 LEU A CG   11 
ATOM 11448 C CD1  . LEU A 1 22 ? -3.811  2.126   -0.570  1.00 0.00 ? 22 LEU A CD1  11 
ATOM 11449 C CD2  . LEU A 1 22 ? -4.332  -0.136  0.362   1.00 0.00 ? 22 LEU A CD2  11 
ATOM 11450 H H    . LEU A 1 22 ? -6.155  2.684   2.680   1.00 0.00 ? 22 LEU A H    11 
ATOM 11451 H HA   . LEU A 1 22 ? -4.907  0.233   2.995   1.00 0.00 ? 22 LEU A HA   11 
ATOM 11452 H HB2  . LEU A 1 22 ? -3.921  2.867   1.951   1.00 0.00 ? 22 LEU A HB2  11 
ATOM 11453 H HB3  . LEU A 1 22 ? -2.893  1.436   1.965   1.00 0.00 ? 22 LEU A HB3  11 
ATOM 11454 H HG   . LEU A 1 22 ? -5.543  1.599   0.535   1.00 0.00 ? 22 LEU A HG   11 
ATOM 11455 H HD11 . LEU A 1 22 ? -4.489  2.871   -0.958  1.00 0.00 ? 22 LEU A HD11 11 
ATOM 11456 H HD12 . LEU A 1 22 ? -3.543  1.437   -1.357  1.00 0.00 ? 22 LEU A HD12 11 
ATOM 11457 H HD13 . LEU A 1 22 ? -2.920  2.608   -0.196  1.00 0.00 ? 22 LEU A HD13 11 
ATOM 11458 H HD21 . LEU A 1 22 ? -5.281  -0.559  0.066   1.00 0.00 ? 22 LEU A HD21 11 
ATOM 11459 H HD22 . LEU A 1 22 ? -4.010  -0.590  1.288   1.00 0.00 ? 22 LEU A HD22 11 
ATOM 11460 H HD23 . LEU A 1 22 ? -3.598  -0.324  -0.407  1.00 0.00 ? 22 LEU A HD23 11 
ATOM 11461 N N    . GLN A 1 23 ? -3.274  2.591   4.646   1.00 0.00 ? 23 GLN A N    11 
ATOM 11462 C CA   . GLN A 1 23 ? -2.404  2.829   5.792   1.00 0.00 ? 23 GLN A CA   11 
ATOM 11463 C C    . GLN A 1 23 ? -2.988  2.209   7.057   1.00 0.00 ? 23 GLN A C    11 
ATOM 11464 O O    . GLN A 1 23 ? -2.274  1.580   7.838   1.00 0.00 ? 23 GLN A O    11 
ATOM 11465 C CB   . GLN A 1 23 ? -2.194  4.330   5.996   1.00 0.00 ? 23 GLN A CB   11 
ATOM 11466 C CG   . GLN A 1 23 ? -1.051  4.902   5.172   1.00 0.00 ? 23 GLN A CG   11 
ATOM 11467 C CD   . GLN A 1 23 ? -0.720  6.333   5.547   1.00 0.00 ? 23 GLN A CD   11 
ATOM 11468 O OE1  . GLN A 1 23 ? -1.408  6.948   6.362   1.00 0.00 ? 23 GLN A OE1  11 
ATOM 11469 N NE2  . GLN A 1 23 ? 0.338   6.871   4.952   1.00 0.00 ? 23 GLN A NE2  11 
ATOM 11470 H H    . GLN A 1 23 ? -3.512  3.340   4.063   1.00 0.00 ? 23 GLN A H    11 
ATOM 11471 H HA   . GLN A 1 23 ? -1.451  2.366   5.586   1.00 0.00 ? 23 GLN A HA   11 
ATOM 11472 H HB2  . GLN A 1 23 ? -3.100  4.849   5.723   1.00 0.00 ? 23 GLN A HB2  11 
ATOM 11473 H HB3  . GLN A 1 23 ? -1.983  4.513   7.039   1.00 0.00 ? 23 GLN A HB3  11 
ATOM 11474 H HG2  . GLN A 1 23 ? -0.172  4.293   5.327   1.00 0.00 ? 23 GLN A HG2  11 
ATOM 11475 H HG3  . GLN A 1 23 ? -1.327  4.873   4.128   1.00 0.00 ? 23 GLN A HG3  11 
ATOM 11476 H HE21 . GLN A 1 23 ? 0.838   6.322   4.312   1.00 0.00 ? 23 GLN A HE21 11 
ATOM 11477 H HE22 . GLN A 1 23 ? 0.574   7.795   5.175   1.00 0.00 ? 23 GLN A HE22 11 
ATOM 11478 N N    . ARG A 1 24 ? -4.290  2.390   7.253   1.00 0.00 ? 24 ARG A N    11 
ATOM 11479 C CA   . ARG A 1 24 ? -4.969  1.850   8.424   1.00 0.00 ? 24 ARG A CA   11 
ATOM 11480 C C    . ARG A 1 24 ? -4.848  0.329   8.469   1.00 0.00 ? 24 ARG A C    11 
ATOM 11481 O O    . ARG A 1 24 ? -4.694  -0.259  9.539   1.00 0.00 ? 24 ARG A O    11 
ATOM 11482 C CB   . ARG A 1 24 ? -6.444  2.255   8.417   1.00 0.00 ? 24 ARG A CB   11 
ATOM 11483 C CG   . ARG A 1 24 ? -6.720  3.563   9.140   1.00 0.00 ? 24 ARG A CG   11 
ATOM 11484 C CD   . ARG A 1 24 ? -5.625  4.585   8.880   1.00 0.00 ? 24 ARG A CD   11 
ATOM 11485 N NE   . ARG A 1 24 ? -5.961  5.898   9.424   1.00 0.00 ? 24 ARG A NE   11 
ATOM 11486 C CZ   . ARG A 1 24 ? -5.057  6.827   9.713   1.00 0.00 ? 24 ARG A CZ   11 
ATOM 11487 N NH1  . ARG A 1 24 ? -3.769  6.589   9.510   1.00 0.00 ? 24 ARG A NH1  11 
ATOM 11488 N NH2  . ARG A 1 24 ? -5.441  7.998   10.206  1.00 0.00 ? 24 ARG A NH2  11 
ATOM 11489 H H    . ARG A 1 24 ? -4.806  2.900   6.594   1.00 0.00 ? 24 ARG A H    11 
ATOM 11490 H HA   . ARG A 1 24 ? -4.496  2.263   9.302   1.00 0.00 ? 24 ARG A HA   11 
ATOM 11491 H HB2  . ARG A 1 24 ? -6.772  2.360   7.393   1.00 0.00 ? 24 ARG A HB2  11 
ATOM 11492 H HB3  . ARG A 1 24 ? -7.021  1.477   8.893   1.00 0.00 ? 24 ARG A HB3  11 
ATOM 11493 H HG2  . ARG A 1 24 ? -7.661  3.964   8.794   1.00 0.00 ? 24 ARG A HG2  11 
ATOM 11494 H HG3  . ARG A 1 24 ? -6.777  3.371   10.201  1.00 0.00 ? 24 ARG A HG3  11 
ATOM 11495 H HD2  . ARG A 1 24 ? -4.711  4.239   9.338   1.00 0.00 ? 24 ARG A HD2  11 
ATOM 11496 H HD3  . ARG A 1 24 ? -5.481  4.674   7.813   1.00 0.00 ? 24 ARG A HD3  11 
ATOM 11497 H HE   . ARG A 1 24 ? -6.908  6.095   9.582   1.00 0.00 ? 24 ARG A HE   11 
ATOM 11498 H HH11 . ARG A 1 24 ? -3.477  5.709   9.138   1.00 0.00 ? 24 ARG A HH11 11 
ATOM 11499 H HH12 . ARG A 1 24 ? -3.090  7.291   9.727   1.00 0.00 ? 24 ARG A HH12 11 
ATOM 11500 H HH21 . ARG A 1 24 ? -6.412  8.181   10.360  1.00 0.00 ? 24 ARG A HH21 11 
ATOM 11501 H HH22 . ARG A 1 24 ? -4.760  8.696   10.423  1.00 0.00 ? 24 ARG A HH22 11 
ATOM 11502 N N    . ARG A 1 25 ? -4.921  -0.300  7.301   1.00 0.00 ? 25 ARG A N    11 
ATOM 11503 C CA   . ARG A 1 25 ? -4.821  -1.751  7.207   1.00 0.00 ? 25 ARG A CA   11 
ATOM 11504 C C    . ARG A 1 25 ? -3.377  -2.210  7.384   1.00 0.00 ? 25 ARG A C    11 
ATOM 11505 O O    . ARG A 1 25 ? -3.111  -3.225  8.027   1.00 0.00 ? 25 ARG A O    11 
ATOM 11506 C CB   . ARG A 1 25 ? -5.360  -2.235  5.860   1.00 0.00 ? 25 ARG A CB   11 
ATOM 11507 C CG   . ARG A 1 25 ? -5.507  -3.745  5.769   1.00 0.00 ? 25 ARG A CG   11 
ATOM 11508 C CD   . ARG A 1 25 ? -6.648  -4.247  6.640   1.00 0.00 ? 25 ARG A CD   11 
ATOM 11509 N NE   . ARG A 1 25 ? -7.948  -4.057  6.002   1.00 0.00 ? 25 ARG A NE   11 
ATOM 11510 C CZ   . ARG A 1 25 ? -9.100  -4.065  6.664   1.00 0.00 ? 25 ARG A CZ   11 
ATOM 11511 N NH1  . ARG A 1 25 ? -9.112  -4.251  7.977   1.00 0.00 ? 25 ARG A NH1  11 
ATOM 11512 N NH2  . ARG A 1 25 ? -10.242 -3.885  6.013   1.00 0.00 ? 25 ARG A NH2  11 
ATOM 11513 H H    . ARG A 1 25 ? -5.044  0.224   6.482   1.00 0.00 ? 25 ARG A H    11 
ATOM 11514 H HA   . ARG A 1 25 ? -5.421  -2.177  7.998   1.00 0.00 ? 25 ARG A HA   11 
ATOM 11515 H HB2  . ARG A 1 25 ? -6.330  -1.790  5.692   1.00 0.00 ? 25 ARG A HB2  11 
ATOM 11516 H HB3  . ARG A 1 25 ? -4.686  -1.913  5.080   1.00 0.00 ? 25 ARG A HB3  11 
ATOM 11517 H HG2  . ARG A 1 25 ? -5.706  -4.017  4.743   1.00 0.00 ? 25 ARG A HG2  11 
ATOM 11518 H HG3  . ARG A 1 25 ? -4.587  -4.207  6.094   1.00 0.00 ? 25 ARG A HG3  11 
ATOM 11519 H HD2  . ARG A 1 25 ? -6.502  -5.300  6.830   1.00 0.00 ? 25 ARG A HD2  11 
ATOM 11520 H HD3  . ARG A 1 25 ? -6.634  -3.707  7.575   1.00 0.00 ? 25 ARG A HD3  11 
ATOM 11521 H HE   . ARG A 1 25 ? -7.962  -3.917  5.033   1.00 0.00 ? 25 ARG A HE   11 
ATOM 11522 H HH11 . ARG A 1 25 ? -8.253  -4.386  8.470   1.00 0.00 ? 25 ARG A HH11 11 
ATOM 11523 H HH12 . ARG A 1 25 ? -9.981  -4.255  8.473   1.00 0.00 ? 25 ARG A HH12 11 
ATOM 11524 H HH21 . ARG A 1 25 ? -10.236 -3.743  5.024   1.00 0.00 ? 25 ARG A HH21 11 
ATOM 11525 H HH22 . ARG A 1 25 ? -11.108 -3.891  6.512   1.00 0.00 ? 25 ARG A HH22 11 
ATOM 11526 N N    . PHE A 1 26 ? -2.447  -1.455  6.808   1.00 0.00 ? 26 PHE A N    11 
ATOM 11527 C CA   . PHE A 1 26 ? -1.030  -1.785  6.900   1.00 0.00 ? 26 PHE A CA   11 
ATOM 11528 C C    . PHE A 1 26 ? -0.595  -1.914  8.357   1.00 0.00 ? 26 PHE A C    11 
ATOM 11529 O O    . PHE A 1 26 ? -0.057  -2.942  8.765   1.00 0.00 ? 26 PHE A O    11 
ATOM 11530 C CB   . PHE A 1 26 ? -0.189  -0.716  6.198   1.00 0.00 ? 26 PHE A CB   11 
ATOM 11531 C CG   . PHE A 1 26 ? 1.197   -1.177  5.848   1.00 0.00 ? 26 PHE A CG   11 
ATOM 11532 C CD1  . PHE A 1 26 ? 1.390   -2.328  5.100   1.00 0.00 ? 26 PHE A CD1  11 
ATOM 11533 C CD2  . PHE A 1 26 ? 2.306   -0.461  6.266   1.00 0.00 ? 26 PHE A CD2  11 
ATOM 11534 C CE1  . PHE A 1 26 ? 2.664   -2.755  4.776   1.00 0.00 ? 26 PHE A CE1  11 
ATOM 11535 C CE2  . PHE A 1 26 ? 3.582   -0.883  5.944   1.00 0.00 ? 26 PHE A CE2  11 
ATOM 11536 C CZ   . PHE A 1 26 ? 3.761   -2.032  5.199   1.00 0.00 ? 26 PHE A CZ   11 
ATOM 11537 H H    . PHE A 1 26 ? -2.721  -0.657  6.308   1.00 0.00 ? 26 PHE A H    11 
ATOM 11538 H HA   . PHE A 1 26 ? -0.877  -2.732  6.406   1.00 0.00 ? 26 PHE A HA   11 
ATOM 11539 H HB2  . PHE A 1 26 ? -0.682  -0.424  5.283   1.00 0.00 ? 26 PHE A HB2  11 
ATOM 11540 H HB3  . PHE A 1 26 ? -0.100  0.144   6.845   1.00 0.00 ? 26 PHE A HB3  11 
ATOM 11541 H HD1  . PHE A 1 26 ? 0.531   -2.895  4.769   1.00 0.00 ? 26 PHE A HD1  11 
ATOM 11542 H HD2  . PHE A 1 26 ? 2.168   0.438   6.850   1.00 0.00 ? 26 PHE A HD2  11 
ATOM 11543 H HE1  . PHE A 1 26 ? 2.800   -3.654  4.193   1.00 0.00 ? 26 PHE A HE1  11 
ATOM 11544 H HE2  . PHE A 1 26 ? 4.439   -0.316  6.277   1.00 0.00 ? 26 PHE A HE2  11 
ATOM 11545 H HZ   . PHE A 1 26 ? 4.757   -2.364  4.947   1.00 0.00 ? 26 PHE A HZ   11 
ATOM 11546 N N    . GLN A 1 27 ? -0.832  -0.862  9.134   1.00 0.00 ? 27 GLN A N    11 
ATOM 11547 C CA   . GLN A 1 27 ? -0.464  -0.857  10.545  1.00 0.00 ? 27 GLN A CA   11 
ATOM 11548 C C    . GLN A 1 27 ? -0.973  -2.113  11.245  1.00 0.00 ? 27 GLN A C    11 
ATOM 11549 O O    . GLN A 1 27 ? -0.218  -2.806  11.927  1.00 0.00 ? 27 GLN A O    11 
ATOM 11550 C CB   . GLN A 1 27 ? -1.023  0.388   11.236  1.00 0.00 ? 27 GLN A CB   11 
ATOM 11551 C CG   . GLN A 1 27 ? -0.531  1.692   10.629  1.00 0.00 ? 27 GLN A CG   11 
ATOM 11552 C CD   . GLN A 1 27 ? 0.980   1.806   10.638  1.00 0.00 ? 27 GLN A CD   11 
ATOM 11553 O OE1  . GLN A 1 27 ? 1.598   1.951   11.693  1.00 0.00 ? 27 GLN A OE1  11 
ATOM 11554 N NE2  . GLN A 1 27 ? 1.586   1.742   9.457   1.00 0.00 ? 27 GLN A NE2  11 
ATOM 11555 H H    . GLN A 1 27 ? -1.264  -0.071  8.750   1.00 0.00 ? 27 GLN A H    11 
ATOM 11556 H HA   . GLN A 1 27 ? 0.614   -0.838  10.606  1.00 0.00 ? 27 GLN A HA   11 
ATOM 11557 H HB2  . GLN A 1 27 ? -2.100  0.368   11.169  1.00 0.00 ? 27 GLN A HB2  11 
ATOM 11558 H HB3  . GLN A 1 27 ? -0.734  0.368   12.276  1.00 0.00 ? 27 GLN A HB3  11 
ATOM 11559 H HG2  . GLN A 1 27 ? -0.875  1.752   9.607   1.00 0.00 ? 27 GLN A HG2  11 
ATOM 11560 H HG3  . GLN A 1 27 ? -0.943  2.515   11.195  1.00 0.00 ? 27 GLN A HG3  11 
ATOM 11561 H HE21 . GLN A 1 27 ? 1.029   1.627   8.658   1.00 0.00 ? 27 GLN A HE21 11 
ATOM 11562 H HE22 . GLN A 1 27 ? 2.562   1.813   9.433   1.00 0.00 ? 27 GLN A HE22 11 
ATOM 11563 N N    . LYS A 1 28 ? -2.258  -2.401  11.071  1.00 0.00 ? 28 LYS A N    11 
ATOM 11564 C CA   . LYS A 1 28 ? -2.870  -3.574  11.685  1.00 0.00 ? 28 LYS A CA   11 
ATOM 11565 C C    . LYS A 1 28 ? -2.053  -4.829  11.393  1.00 0.00 ? 28 LYS A C    11 
ATOM 11566 O O    . LYS A 1 28 ? -1.781  -5.628  12.289  1.00 0.00 ? 28 LYS A O    11 
ATOM 11567 C CB   . LYS A 1 28 ? -4.301  -3.754  11.174  1.00 0.00 ? 28 LYS A CB   11 
ATOM 11568 C CG   . LYS A 1 28 ? -5.219  -4.446  12.168  1.00 0.00 ? 28 LYS A CG   11 
ATOM 11569 C CD   . LYS A 1 28 ? -4.983  -5.947  12.192  1.00 0.00 ? 28 LYS A CD   11 
ATOM 11570 C CE   . LYS A 1 28 ? -5.643  -6.596  13.399  1.00 0.00 ? 28 LYS A CE   11 
ATOM 11571 N NZ   . LYS A 1 28 ? -4.786  -6.508  14.614  1.00 0.00 ? 28 LYS A NZ   11 
ATOM 11572 H H    . LYS A 1 28 ? -2.810  -1.810  10.515  1.00 0.00 ? 28 LYS A H    11 
ATOM 11573 H HA   . LYS A 1 28 ? -2.895  -3.415  12.752  1.00 0.00 ? 28 LYS A HA   11 
ATOM 11574 H HB2  . LYS A 1 28 ? -4.716  -2.782  10.950  1.00 0.00 ? 28 LYS A HB2  11 
ATOM 11575 H HB3  . LYS A 1 28 ? -4.276  -4.343  10.269  1.00 0.00 ? 28 LYS A HB3  11 
ATOM 11576 H HG2  . LYS A 1 28 ? -5.033  -4.048  13.154  1.00 0.00 ? 28 LYS A HG2  11 
ATOM 11577 H HG3  . LYS A 1 28 ? -6.245  -4.257  11.888  1.00 0.00 ? 28 LYS A HG3  11 
ATOM 11578 H HD2  . LYS A 1 28 ? -5.395  -6.383  11.294  1.00 0.00 ? 28 LYS A HD2  11 
ATOM 11579 H HD3  . LYS A 1 28 ? -3.919  -6.135  12.230  1.00 0.00 ? 28 LYS A HD3  11 
ATOM 11580 H HE2  . LYS A 1 28 ? -6.579  -6.095  13.593  1.00 0.00 ? 28 LYS A HE2  11 
ATOM 11581 H HE3  . LYS A 1 28 ? -5.831  -7.635  13.175  1.00 0.00 ? 28 LYS A HE3  11 
ATOM 11582 H HZ1  . LYS A 1 28 ? -3.937  -5.943  14.411  1.00 0.00 ? 28 LYS A HZ1  11 
ATOM 11583 H HZ2  . LYS A 1 28 ? -4.492  -7.460  14.913  1.00 0.00 ? 28 LYS A HZ2  11 
ATOM 11584 H HZ3  . LYS A 1 28 ? -5.311  -6.059  15.390  1.00 0.00 ? 28 LYS A HZ3  11 
ATOM 11585 N N    . THR A 1 29 ? -1.663  -4.996  10.132  1.00 0.00 ? 29 THR A N    11 
ATOM 11586 C CA   . THR A 1 29 ? -0.878  -6.153  9.723   1.00 0.00 ? 29 THR A CA   11 
ATOM 11587 C C    . THR A 1 29 ? -0.182  -5.901  8.390   1.00 0.00 ? 29 THR A C    11 
ATOM 11588 O O    . THR A 1 29 ? -0.746  -5.271  7.495   1.00 0.00 ? 29 THR A O    11 
ATOM 11589 C CB   . THR A 1 29 ? -1.755  -7.414  9.601   1.00 0.00 ? 29 THR A CB   11 
ATOM 11590 O OG1  . THR A 1 29 ? -0.950  -8.536  9.221   1.00 0.00 ? 29 THR A OG1  11 
ATOM 11591 C CG2  . THR A 1 29 ? -2.861  -7.206  8.578   1.00 0.00 ? 29 THR A CG2  11 
ATOM 11592 H H    . THR A 1 29 ? -1.912  -4.325  9.464   1.00 0.00 ? 29 THR A H    11 
ATOM 11593 H HA   . THR A 1 29 ? -0.129  -6.333  10.480  1.00 0.00 ? 29 THR A HA   11 
ATOM 11594 H HB   . THR A 1 29 ? -2.207  -7.613  10.562  1.00 0.00 ? 29 THR A HB   11 
ATOM 11595 H HG1  . THR A 1 29 ? -1.514  -9.231  8.874   1.00 0.00 ? 29 THR A HG1  11 
ATOM 11596 H HG21 . THR A 1 29 ? -3.314  -8.158  8.339   1.00 0.00 ? 29 THR A HG21 11 
ATOM 11597 H HG22 . THR A 1 29 ? -2.445  -6.770  7.682   1.00 0.00 ? 29 THR A HG22 11 
ATOM 11598 H HG23 . THR A 1 29 ? -3.610  -6.545  8.987   1.00 0.00 ? 29 THR A HG23 11 
ATOM 11599 N N    . GLN A 1 30 ? 1.044   -6.398  8.264   1.00 0.00 ? 30 GLN A N    11 
ATOM 11600 C CA   . GLN A 1 30 ? 1.815   -6.226  7.039   1.00 0.00 ? 30 GLN A CA   11 
ATOM 11601 C C    . GLN A 1 30 ? 1.418   -7.265  5.995   1.00 0.00 ? 30 GLN A C    11 
ATOM 11602 O O    . GLN A 1 30 ? 1.457   -6.998  4.794   1.00 0.00 ? 30 GLN A O    11 
ATOM 11603 C CB   . GLN A 1 30 ? 3.312   -6.330  7.335   1.00 0.00 ? 30 GLN A CB   11 
ATOM 11604 C CG   . GLN A 1 30 ? 3.824   -5.248  8.272   1.00 0.00 ? 30 GLN A CG   11 
ATOM 11605 C CD   . GLN A 1 30 ? 3.696   -5.633  9.733   1.00 0.00 ? 30 GLN A CD   11 
ATOM 11606 O OE1  . GLN A 1 30 ? 3.975   -6.770  10.114  1.00 0.00 ? 30 GLN A OE1  11 
ATOM 11607 N NE2  . GLN A 1 30 ? 3.274   -4.684  10.560  1.00 0.00 ? 30 GLN A NE2  11 
ATOM 11608 H H    . GLN A 1 30 ? 1.439   -6.891  9.012   1.00 0.00 ? 30 GLN A H    11 
ATOM 11609 H HA   . GLN A 1 30 ? 1.603   -5.243  6.649   1.00 0.00 ? 30 GLN A HA   11 
ATOM 11610 H HB2  . GLN A 1 30 ? 3.512   -7.291  7.786   1.00 0.00 ? 30 GLN A HB2  11 
ATOM 11611 H HB3  . GLN A 1 30 ? 3.857   -6.258  6.405   1.00 0.00 ? 30 GLN A HB3  11 
ATOM 11612 H HG2  . GLN A 1 30 ? 4.866   -5.064  8.054   1.00 0.00 ? 30 GLN A HG2  11 
ATOM 11613 H HG3  . GLN A 1 30 ? 3.257   -4.345  8.101   1.00 0.00 ? 30 GLN A HG3  11 
ATOM 11614 H HE21 . GLN A 1 30 ? 3.069   -3.801  10.186  1.00 0.00 ? 30 GLN A HE21 11 
ATOM 11615 H HE22 . GLN A 1 30 ? 3.181   -4.906  11.509  1.00 0.00 ? 30 GLN A HE22 11 
ATOM 11616 N N    . TYR A 1 31 ? 1.037   -8.449  6.461   1.00 0.00 ? 31 TYR A N    11 
ATOM 11617 C CA   . TYR A 1 31 ? 0.635   -9.529  5.568   1.00 0.00 ? 31 TYR A CA   11 
ATOM 11618 C C    . TYR A 1 31 ? -0.885  -9.642  5.499   1.00 0.00 ? 31 TYR A C    11 
ATOM 11619 O O    . TYR A 1 31 ? -1.571  -9.583  6.520   1.00 0.00 ? 31 TYR A O    11 
ATOM 11620 C CB   . TYR A 1 31 ? 1.236   -10.856 6.035   1.00 0.00 ? 31 TYR A CB   11 
ATOM 11621 C CG   . TYR A 1 31 ? 2.660   -10.735 6.530   1.00 0.00 ? 31 TYR A CG   11 
ATOM 11622 C CD1  . TYR A 1 31 ? 3.673   -10.292 5.688   1.00 0.00 ? 31 TYR A CD1  11 
ATOM 11623 C CD2  . TYR A 1 31 ? 2.992   -11.065 7.838   1.00 0.00 ? 31 TYR A CD2  11 
ATOM 11624 C CE1  . TYR A 1 31 ? 4.975   -10.181 6.135   1.00 0.00 ? 31 TYR A CE1  11 
ATOM 11625 C CE2  . TYR A 1 31 ? 4.291   -10.956 8.294   1.00 0.00 ? 31 TYR A CE2  11 
ATOM 11626 C CZ   . TYR A 1 31 ? 5.279   -10.513 7.439   1.00 0.00 ? 31 TYR A CZ   11 
ATOM 11627 O OH   . TYR A 1 31 ? 6.575   -10.404 7.889   1.00 0.00 ? 31 TYR A OH   11 
ATOM 11628 H H    . TYR A 1 31 ? 1.027   -8.601  7.429   1.00 0.00 ? 31 TYR A H    11 
ATOM 11629 H HA   . TYR A 1 31 ? 1.013   -9.302  4.582   1.00 0.00 ? 31 TYR A HA   11 
ATOM 11630 H HB2  . TYR A 1 31 ? 0.638   -11.249 6.842   1.00 0.00 ? 31 TYR A HB2  11 
ATOM 11631 H HB3  . TYR A 1 31 ? 1.228   -11.556 5.213   1.00 0.00 ? 31 TYR A HB3  11 
ATOM 11632 H HD1  . TYR A 1 31 ? 3.431   -10.032 4.668   1.00 0.00 ? 31 TYR A HD1  11 
ATOM 11633 H HD2  . TYR A 1 31 ? 2.216   -11.412 8.505   1.00 0.00 ? 31 TYR A HD2  11 
ATOM 11634 H HE1  . TYR A 1 31 ? 5.749   -9.834  5.466   1.00 0.00 ? 31 TYR A HE1  11 
ATOM 11635 H HE2  . TYR A 1 31 ? 4.530   -11.217 9.314   1.00 0.00 ? 31 TYR A HE2  11 
ATOM 11636 H HH   . TYR A 1 31 ? 6.596   -9.849  8.672   1.00 0.00 ? 31 TYR A HH   11 
ATOM 11637 N N    . LEU A 1 32 ? -1.405  -9.806  4.287   1.00 0.00 ? 32 LEU A N    11 
ATOM 11638 C CA   . LEU A 1 32 ? -2.844  -9.928  4.083   1.00 0.00 ? 32 LEU A CA   11 
ATOM 11639 C C    . LEU A 1 32 ? -3.197  -11.295 3.506   1.00 0.00 ? 32 LEU A C    11 
ATOM 11640 O O    . LEU A 1 32 ? -2.393  -11.913 2.809   1.00 0.00 ? 32 LEU A O    11 
ATOM 11641 C CB   . LEU A 1 32 ? -3.342  -8.824  3.149   1.00 0.00 ? 32 LEU A CB   11 
ATOM 11642 C CG   . LEU A 1 32 ? -3.221  -7.394  3.677   1.00 0.00 ? 32 LEU A CG   11 
ATOM 11643 C CD1  . LEU A 1 32 ? -3.858  -6.411  2.707   1.00 0.00 ? 32 LEU A CD1  11 
ATOM 11644 C CD2  . LEU A 1 32 ? -3.859  -7.277  5.053   1.00 0.00 ? 32 LEU A CD2  11 
ATOM 11645 H H    . LEU A 1 32 ? -0.808  -9.845  3.512   1.00 0.00 ? 32 LEU A H    11 
ATOM 11646 H HA   . LEU A 1 32 ? -3.325  -9.821  5.043   1.00 0.00 ? 32 LEU A HA   11 
ATOM 11647 H HB2  . LEU A 1 32 ? -2.777  -8.886  2.232   1.00 0.00 ? 32 LEU A HB2  11 
ATOM 11648 H HB3  . LEU A 1 32 ? -4.385  -9.013  2.941   1.00 0.00 ? 32 LEU A HB3  11 
ATOM 11649 H HG   . LEU A 1 32 ? -2.174  -7.138  3.770   1.00 0.00 ? 32 LEU A HG   11 
ATOM 11650 H HD11 . LEU A 1 32 ? -4.756  -6.845  2.292   1.00 0.00 ? 32 LEU A HD11 11 
ATOM 11651 H HD12 . LEU A 1 32 ? -3.164  -6.190  1.909   1.00 0.00 ? 32 LEU A HD12 11 
ATOM 11652 H HD13 . LEU A 1 32 ? -4.107  -5.499  3.230   1.00 0.00 ? 32 LEU A HD13 11 
ATOM 11653 H HD21 . LEU A 1 32 ? -4.336  -6.313  5.148   1.00 0.00 ? 32 LEU A HD21 11 
ATOM 11654 H HD22 . LEU A 1 32 ? -3.097  -7.377  5.813   1.00 0.00 ? 32 LEU A HD22 11 
ATOM 11655 H HD23 . LEU A 1 32 ? -4.595  -8.057  5.175   1.00 0.00 ? 32 LEU A HD23 11 
ATOM 11656 N N    . ALA A 1 33 ? -4.407  -11.761 3.799   1.00 0.00 ? 33 ALA A N    11 
ATOM 11657 C CA   . ALA A 1 33 ? -4.869  -13.053 3.307   1.00 0.00 ? 33 ALA A CA   11 
ATOM 11658 C C    . ALA A 1 33 ? -5.466  -12.925 1.909   1.00 0.00 ? 33 ALA A C    11 
ATOM 11659 O O    . ALA A 1 33 ? -5.839  -11.833 1.480   1.00 0.00 ? 33 ALA A O    11 
ATOM 11660 C CB   . ALA A 1 33 ? -5.888  -13.650 4.266   1.00 0.00 ? 33 ALA A CB   11 
ATOM 11661 H H    . ALA A 1 33 ? -5.003  -11.222 4.360   1.00 0.00 ? 33 ALA A H    11 
ATOM 11662 H HA   . ALA A 1 33 ? -4.018  -13.717 3.264   1.00 0.00 ? 33 ALA A HA   11 
ATOM 11663 H HB1  . ALA A 1 33 ? -6.654  -12.918 4.476   1.00 0.00 ? 33 ALA A HB1  11 
ATOM 11664 H HB2  . ALA A 1 33 ? -6.336  -14.523 3.816   1.00 0.00 ? 33 ALA A HB2  11 
ATOM 11665 H HB3  . ALA A 1 33 ? -5.395  -13.930 5.185   1.00 0.00 ? 33 ALA A HB3  11 
ATOM 11666 N N    . LEU A 1 34 ? -5.552  -14.047 1.203   1.00 0.00 ? 34 LEU A N    11 
ATOM 11667 C CA   . LEU A 1 34 ? -6.103  -14.061 -0.147  1.00 0.00 ? 34 LEU A CA   11 
ATOM 11668 C C    . LEU A 1 34 ? -7.279  -13.097 -0.265  1.00 0.00 ? 34 LEU A C    11 
ATOM 11669 O O    . LEU A 1 34 ? -7.267  -12.160 -1.063  1.00 0.00 ? 34 LEU A O    11 
ATOM 11670 C CB   . LEU A 1 34 ? -6.549  -15.476 -0.522  1.00 0.00 ? 34 LEU A CB   11 
ATOM 11671 C CG   . LEU A 1 34 ? -7.764  -15.574 -1.446  1.00 0.00 ? 34 LEU A CG   11 
ATOM 11672 C CD1  . LEU A 1 34 ? -7.398  -15.143 -2.857  1.00 0.00 ? 34 LEU A CD1  11 
ATOM 11673 C CD2  . LEU A 1 34 ? -8.321  -16.990 -1.446  1.00 0.00 ? 34 LEU A CD2  11 
ATOM 11674 H H    . LEU A 1 34 ? -5.238  -14.887 1.599   1.00 0.00 ? 34 LEU A H    11 
ATOM 11675 H HA   . LEU A 1 34 ? -5.325  -13.746 -0.826  1.00 0.00 ? 34 LEU A HA   11 
ATOM 11676 H HB2  . LEU A 1 34 ? -5.721  -15.964 -1.013  1.00 0.00 ? 34 LEU A HB2  11 
ATOM 11677 H HB3  . LEU A 1 34 ? -6.784  -16.001 0.392   1.00 0.00 ? 34 LEU A HB3  11 
ATOM 11678 H HG   . LEU A 1 34 ? -8.537  -14.909 -1.085  1.00 0.00 ? 34 LEU A HG   11 
ATOM 11679 H HD11 . LEU A 1 34 ? -7.222  -14.078 -2.875  1.00 0.00 ? 34 LEU A HD11 11 
ATOM 11680 H HD12 . LEU A 1 34 ? -8.208  -15.386 -3.529  1.00 0.00 ? 34 LEU A HD12 11 
ATOM 11681 H HD13 . LEU A 1 34 ? -6.503  -15.662 -3.171  1.00 0.00 ? 34 LEU A HD13 11 
ATOM 11682 H HD21 . LEU A 1 34 ? -8.963  -17.123 -0.587  1.00 0.00 ? 34 LEU A HD21 11 
ATOM 11683 H HD22 . LEU A 1 34 ? -7.506  -17.697 -1.399  1.00 0.00 ? 34 LEU A HD22 11 
ATOM 11684 H HD23 . LEU A 1 34 ? -8.889  -17.153 -2.349  1.00 0.00 ? 34 LEU A HD23 11 
ATOM 11685 N N    . PRO A 1 35 ? -8.319  -13.330 0.549   1.00 0.00 ? 35 PRO A N    11 
ATOM 11686 C CA   . PRO A 1 35 ? -9.522  -12.491 0.557   1.00 0.00 ? 35 PRO A CA   11 
ATOM 11687 C C    . PRO A 1 35 ? -9.256  -11.103 1.131   1.00 0.00 ? 35 PRO A C    11 
ATOM 11688 O O    . PRO A 1 35 ? -9.781  -10.107 0.635   1.00 0.00 ? 35 PRO A O    11 
ATOM 11689 C CB   . PRO A 1 35 ? -10.489 -13.265 1.455   1.00 0.00 ? 35 PRO A CB   11 
ATOM 11690 C CG   . PRO A 1 35 ? -9.612  -14.077 2.345   1.00 0.00 ? 35 PRO A CG   11 
ATOM 11691 C CD   . PRO A 1 35 ? -8.402  -14.429 1.525   1.00 0.00 ? 35 PRO A CD   11 
ATOM 11692 H HA   . PRO A 1 35 ? -9.945  -12.395 -0.433  1.00 0.00 ? 35 PRO A HA   11 
ATOM 11693 H HB2  . PRO A 1 35 ? -11.093 -12.570 2.021   1.00 0.00 ? 35 PRO A HB2  11 
ATOM 11694 H HB3  . PRO A 1 35 ? -11.124 -13.893 0.849   1.00 0.00 ? 35 PRO A HB3  11 
ATOM 11695 H HG2  . PRO A 1 35 ? -9.324  -13.494 3.207   1.00 0.00 ? 35 PRO A HG2  11 
ATOM 11696 H HG3  . PRO A 1 35 ? -10.130 -14.973 2.653   1.00 0.00 ? 35 PRO A HG3  11 
ATOM 11697 H HD2  . PRO A 1 35 ? -7.520  -14.459 2.148   1.00 0.00 ? 35 PRO A HD2  11 
ATOM 11698 H HD3  . PRO A 1 35 ? -8.547  -15.376 1.027   1.00 0.00 ? 35 PRO A HD3  11 
ATOM 11699 N N    . GLU A 1 36 ? -8.439  -11.047 2.178   1.00 0.00 ? 36 GLU A N    11 
ATOM 11700 C CA   . GLU A 1 36 ? -8.106  -9.780  2.819   1.00 0.00 ? 36 GLU A CA   11 
ATOM 11701 C C    . GLU A 1 36 ? -7.573  -8.778  1.799   1.00 0.00 ? 36 GLU A C    11 
ATOM 11702 O O    . GLU A 1 36 ? -8.003  -7.625  1.762   1.00 0.00 ? 36 GLU A O    11 
ATOM 11703 C CB   . GLU A 1 36 ? -7.071  -10.000 3.924   1.00 0.00 ? 36 GLU A CB   11 
ATOM 11704 C CG   . GLU A 1 36 ? -7.186  -9.010  5.071   1.00 0.00 ? 36 GLU A CG   11 
ATOM 11705 C CD   . GLU A 1 36 ? -7.409  -7.588  4.594   1.00 0.00 ? 36 GLU A CD   11 
ATOM 11706 O OE1  . GLU A 1 36 ? -8.573  -7.230  4.320   1.00 0.00 ? 36 GLU A OE1  11 
ATOM 11707 O OE2  . GLU A 1 36 ? -6.419  -6.833  4.495   1.00 0.00 ? 36 GLU A OE2  11 
ATOM 11708 H H    . GLU A 1 36 ? -8.052  -11.877 2.528   1.00 0.00 ? 36 GLU A H    11 
ATOM 11709 H HA   . GLU A 1 36 ? -9.009  -9.383  3.258   1.00 0.00 ? 36 GLU A HA   11 
ATOM 11710 H HB2  . GLU A 1 36 ? -7.191  -10.996 4.321   1.00 0.00 ? 36 GLU A HB2  11 
ATOM 11711 H HB3  . GLU A 1 36 ? -6.082  -9.910  3.497   1.00 0.00 ? 36 GLU A HB3  11 
ATOM 11712 H HG2  . GLU A 1 36 ? -8.018  -9.298  5.696   1.00 0.00 ? 36 GLU A HG2  11 
ATOM 11713 H HG3  . GLU A 1 36 ? -6.275  -9.042  5.650   1.00 0.00 ? 36 GLU A HG3  11 
ATOM 11714 N N    . ARG A 1 37 ? -6.634  -9.227  0.972   1.00 0.00 ? 37 ARG A N    11 
ATOM 11715 C CA   . ARG A 1 37 ? -6.040  -8.370  -0.047  1.00 0.00 ? 37 ARG A CA   11 
ATOM 11716 C C    . ARG A 1 37 ? -7.087  -7.936  -1.069  1.00 0.00 ? 37 ARG A C    11 
ATOM 11717 O O    . ARG A 1 37 ? -7.179  -6.759  -1.416  1.00 0.00 ? 37 ARG A O    11 
ATOM 11718 C CB   . ARG A 1 37 ? -4.895  -9.099  -0.752  1.00 0.00 ? 37 ARG A CB   11 
ATOM 11719 C CG   . ARG A 1 37 ? -4.436  -8.418  -2.031  1.00 0.00 ? 37 ARG A CG   11 
ATOM 11720 C CD   . ARG A 1 37 ? -3.535  -9.326  -2.853  1.00 0.00 ? 37 ARG A CD   11 
ATOM 11721 N NE   . ARG A 1 37 ? -4.165  -10.613 -3.135  1.00 0.00 ? 37 ARG A NE   11 
ATOM 11722 C CZ   . ARG A 1 37 ? -3.484  -11.719 -3.411  1.00 0.00 ? 37 ARG A CZ   11 
ATOM 11723 N NH1  . ARG A 1 37 ? -2.159  -11.696 -3.442  1.00 0.00 ? 37 ARG A NH1  11 
ATOM 11724 N NH2  . ARG A 1 37 ? -4.129  -12.853 -3.657  1.00 0.00 ? 37 ARG A NH2  11 
ATOM 11725 H H    . ARG A 1 37 ? -6.332  -10.156 1.050   1.00 0.00 ? 37 ARG A H    11 
ATOM 11726 H HA   . ARG A 1 37 ? -5.648  -7.492  0.444   1.00 0.00 ? 37 ARG A HA   11 
ATOM 11727 H HB2  . ARG A 1 37 ? -4.052  -9.157  -0.079  1.00 0.00 ? 37 ARG A HB2  11 
ATOM 11728 H HB3  . ARG A 1 37 ? -5.218  -10.099 -0.999  1.00 0.00 ? 37 ARG A HB3  11 
ATOM 11729 H HG2  . ARG A 1 37 ? -5.302  -8.159  -2.622  1.00 0.00 ? 37 ARG A HG2  11 
ATOM 11730 H HG3  . ARG A 1 37 ? -3.891  -7.521  -1.775  1.00 0.00 ? 37 ARG A HG3  11 
ATOM 11731 H HD2  . ARG A 1 37 ? -3.307  -8.835  -3.788  1.00 0.00 ? 37 ARG A HD2  11 
ATOM 11732 H HD3  . ARG A 1 37 ? -2.620  -9.495  -2.305  1.00 0.00 ? 37 ARG A HD3  11 
ATOM 11733 H HE   . ARG A 1 37 ? -5.143  -10.652 -3.118  1.00 0.00 ? 37 ARG A HE   11 
ATOM 11734 H HH11 . ARG A 1 37 ? -1.670  -10.844 -3.256  1.00 0.00 ? 37 ARG A HH11 11 
ATOM 11735 H HH12 . ARG A 1 37 ? -1.649  -12.532 -3.649  1.00 0.00 ? 37 ARG A HH12 11 
ATOM 11736 H HH21 . ARG A 1 37 ? -5.128  -12.874 -3.634  1.00 0.00 ? 37 ARG A HH21 11 
ATOM 11737 H HH22 . ARG A 1 37 ? -3.616  -13.685 -3.864  1.00 0.00 ? 37 ARG A HH22 11 
ATOM 11738 N N    . ALA A 1 38 ? -7.873  -8.895  -1.547  1.00 0.00 ? 38 ALA A N    11 
ATOM 11739 C CA   . ALA A 1 38 ? -8.914  -8.612  -2.528  1.00 0.00 ? 38 ALA A CA   11 
ATOM 11740 C C    . ALA A 1 38 ? -9.897  -7.572  -2.000  1.00 0.00 ? 38 ALA A C    11 
ATOM 11741 O O    . ALA A 1 38 ? -10.374 -6.720  -2.749  1.00 0.00 ? 38 ALA A O    11 
ATOM 11742 C CB   . ALA A 1 38 ? -9.647  -9.891  -2.904  1.00 0.00 ? 38 ALA A CB   11 
ATOM 11743 H H    . ALA A 1 38 ? -7.751  -9.814  -1.232  1.00 0.00 ? 38 ALA A H    11 
ATOM 11744 H HA   . ALA A 1 38 ? -8.438  -8.224  -3.417  1.00 0.00 ? 38 ALA A HA   11 
ATOM 11745 H HB1  . ALA A 1 38 ? -9.917  -10.427 -2.006  1.00 0.00 ? 38 ALA A HB1  11 
ATOM 11746 H HB2  . ALA A 1 38 ? -10.540 -9.644  -3.459  1.00 0.00 ? 38 ALA A HB2  11 
ATOM 11747 H HB3  . ALA A 1 38 ? -9.003  -10.508 -3.512  1.00 0.00 ? 38 ALA A HB3  11 
ATOM 11748 N N    . GLU A 1 39 ? -10.195 -7.648  -0.707  1.00 0.00 ? 39 GLU A N    11 
ATOM 11749 C CA   . GLU A 1 39 ? -11.123 -6.714  -0.081  1.00 0.00 ? 39 GLU A CA   11 
ATOM 11750 C C    . GLU A 1 39 ? -10.723 -5.271  -0.376  1.00 0.00 ? 39 GLU A C    11 
ATOM 11751 O O    . GLU A 1 39 ? -11.575 -4.419  -0.633  1.00 0.00 ? 39 GLU A O    11 
ATOM 11752 C CB   . GLU A 1 39 ? -11.169 -6.943  1.431   1.00 0.00 ? 39 GLU A CB   11 
ATOM 11753 C CG   . GLU A 1 39 ? -12.272 -6.166  2.131   1.00 0.00 ? 39 GLU A CG   11 
ATOM 11754 C CD   . GLU A 1 39 ? -12.452 -6.583  3.577   1.00 0.00 ? 39 GLU A CD   11 
ATOM 11755 O OE1  . GLU A 1 39 ? -11.432 -6.768  4.273   1.00 0.00 ? 39 GLU A OE1  11 
ATOM 11756 O OE2  . GLU A 1 39 ? -13.614 -6.725  4.014   1.00 0.00 ? 39 GLU A OE2  11 
ATOM 11757 H H    . GLU A 1 39 ? -9.781  -8.350  -0.161  1.00 0.00 ? 39 GLU A H    11 
ATOM 11758 H HA   . GLU A 1 39 ? -12.104 -6.894  -0.493  1.00 0.00 ? 39 GLU A HA   11 
ATOM 11759 H HB2  . GLU A 1 39 ? -11.324 -7.995  1.619   1.00 0.00 ? 39 GLU A HB2  11 
ATOM 11760 H HB3  . GLU A 1 39 ? -10.223 -6.646  1.857   1.00 0.00 ? 39 GLU A HB3  11 
ATOM 11761 H HG2  . GLU A 1 39 ? -12.026 -5.114  2.104   1.00 0.00 ? 39 GLU A HG2  11 
ATOM 11762 H HG3  . GLU A 1 39 ? -13.201 -6.331  1.605   1.00 0.00 ? 39 GLU A HG3  11 
ATOM 11763 N N    . LEU A 1 40 ? -9.422  -5.004  -0.336  1.00 0.00 ? 40 LEU A N    11 
ATOM 11764 C CA   . LEU A 1 40 ? -8.908  -3.664  -0.598  1.00 0.00 ? 40 LEU A CA   11 
ATOM 11765 C C    . LEU A 1 40 ? -9.031  -3.313  -2.077  1.00 0.00 ? 40 LEU A C    11 
ATOM 11766 O O    . LEU A 1 40 ? -9.366  -2.183  -2.431  1.00 0.00 ? 40 LEU A O    11 
ATOM 11767 C CB   . LEU A 1 40 ? -7.447  -3.562  -0.158  1.00 0.00 ? 40 LEU A CB   11 
ATOM 11768 C CG   . LEU A 1 40 ? -7.132  -4.074  1.248   1.00 0.00 ? 40 LEU A CG   11 
ATOM 11769 C CD1  . LEU A 1 40 ? -5.795  -3.530  1.727   1.00 0.00 ? 40 LEU A CD1  11 
ATOM 11770 C CD2  . LEU A 1 40 ? -8.242  -3.692  2.216   1.00 0.00 ? 40 LEU A CD2  11 
ATOM 11771 H H    . LEU A 1 40 ? -8.792  -5.724  -0.126  1.00 0.00 ? 40 LEU A H    11 
ATOM 11772 H HA   . LEU A 1 40 ? -9.498  -2.965  -0.024  1.00 0.00 ? 40 LEU A HA   11 
ATOM 11773 H HB2  . LEU A 1 40 ? -6.851  -4.129  -0.857  1.00 0.00 ? 40 LEU A HB2  11 
ATOM 11774 H HB3  . LEU A 1 40 ? -7.160  -2.521  -0.204  1.00 0.00 ? 40 LEU A HB3  11 
ATOM 11775 H HG   . LEU A 1 40 ? -7.064  -5.153  1.225   1.00 0.00 ? 40 LEU A HG   11 
ATOM 11776 H HD11 . LEU A 1 40 ? -5.021  -3.808  1.027   1.00 0.00 ? 40 LEU A HD11 11 
ATOM 11777 H HD12 . LEU A 1 40 ? -5.566  -3.941  2.699   1.00 0.00 ? 40 LEU A HD12 11 
ATOM 11778 H HD13 . LEU A 1 40 ? -5.848  -2.453  1.796   1.00 0.00 ? 40 LEU A HD13 11 
ATOM 11779 H HD21 . LEU A 1 40 ? -8.945  -4.508  2.297   1.00 0.00 ? 40 LEU A HD21 11 
ATOM 11780 H HD22 . LEU A 1 40 ? -8.753  -2.813  1.849   1.00 0.00 ? 40 LEU A HD22 11 
ATOM 11781 H HD23 . LEU A 1 40 ? -7.818  -3.483  3.187   1.00 0.00 ? 40 LEU A HD23 11 
ATOM 11782 N N    . ALA A 1 41 ? -8.760  -4.290  -2.936  1.00 0.00 ? 41 ALA A N    11 
ATOM 11783 C CA   . ALA A 1 41 ? -8.845  -4.086  -4.377  1.00 0.00 ? 41 ALA A CA   11 
ATOM 11784 C C    . ALA A 1 41 ? -10.289 -3.875  -4.818  1.00 0.00 ? 41 ALA A C    11 
ATOM 11785 O O    . ALA A 1 41 ? -10.561 -3.108  -5.741  1.00 0.00 ? 41 ALA A O    11 
ATOM 11786 C CB   . ALA A 1 41 ? -8.233  -5.268  -5.115  1.00 0.00 ? 41 ALA A CB   11 
ATOM 11787 H H    . ALA A 1 41 ? -8.498  -5.169  -2.593  1.00 0.00 ? 41 ALA A H    11 
ATOM 11788 H HA   . ALA A 1 41 ? -8.272  -3.203  -4.623  1.00 0.00 ? 41 ALA A HA   11 
ATOM 11789 H HB1  . ALA A 1 41 ? -8.436  -6.177  -4.567  1.00 0.00 ? 41 ALA A HB1  11 
ATOM 11790 H HB2  . ALA A 1 41 ? -8.664  -5.338  -6.102  1.00 0.00 ? 41 ALA A HB2  11 
ATOM 11791 H HB3  . ALA A 1 41 ? -7.166  -5.127  -5.196  1.00 0.00 ? 41 ALA A HB3  11 
ATOM 11792 N N    . ALA A 1 42 ? -11.212 -4.561  -4.152  1.00 0.00 ? 42 ALA A N    11 
ATOM 11793 C CA   . ALA A 1 42 ? -12.629 -4.448  -4.474  1.00 0.00 ? 42 ALA A CA   11 
ATOM 11794 C C    . ALA A 1 42 ? -13.264 -3.266  -3.750  1.00 0.00 ? 42 ALA A C    11 
ATOM 11795 O O    . ALA A 1 42 ? -14.130 -2.583  -4.297  1.00 0.00 ? 42 ALA A O    11 
ATOM 11796 C CB   . ALA A 1 42 ? -13.356 -5.738  -4.121  1.00 0.00 ? 42 ALA A CB   11 
ATOM 11797 H H    . ALA A 1 42 ? -10.934 -5.157  -3.426  1.00 0.00 ? 42 ALA A H    11 
ATOM 11798 H HA   . ALA A 1 42 ? -12.718 -4.294  -5.540  1.00 0.00 ? 42 ALA A HA   11 
ATOM 11799 H HB1  . ALA A 1 42 ? -12.662 -6.565  -4.168  1.00 0.00 ? 42 ALA A HB1  11 
ATOM 11800 H HB2  . ALA A 1 42 ? -13.760 -5.661  -3.123  1.00 0.00 ? 42 ALA A HB2  11 
ATOM 11801 H HB3  . ALA A 1 42 ? -14.159 -5.902  -4.824  1.00 0.00 ? 42 ALA A HB3  11 
ATOM 11802 N N    . SER A 1 43 ? -12.829 -3.030  -2.517  1.00 0.00 ? 43 SER A N    11 
ATOM 11803 C CA   . SER A 1 43 ? -13.358 -1.932  -1.716  1.00 0.00 ? 43 SER A CA   11 
ATOM 11804 C C    . SER A 1 43 ? -12.786 -0.596  -2.180  1.00 0.00 ? 43 SER A C    11 
ATOM 11805 O O    . SER A 1 43 ? -13.523 0.367   -2.394  1.00 0.00 ? 43 SER A O    11 
ATOM 11806 C CB   . SER A 1 43 ? -13.037 -2.152  -0.236  1.00 0.00 ? 43 SER A CB   11 
ATOM 11807 O OG   . SER A 1 43 ? -13.595 -1.124  0.564   1.00 0.00 ? 43 SER A OG   11 
ATOM 11808 H H    . SER A 1 43 ? -12.136 -3.610  -2.136  1.00 0.00 ? 43 SER A H    11 
ATOM 11809 H HA   . SER A 1 43 ? -14.430 -1.915  -1.845  1.00 0.00 ? 43 SER A HA   11 
ATOM 11810 H HB2  . SER A 1 43 ? -13.445 -3.099  0.081   1.00 0.00 ? 43 SER A HB2  11 
ATOM 11811 H HB3  . SER A 1 43 ? -11.965 -2.157  -0.100  1.00 0.00 ? 43 SER A HB3  11 
ATOM 11812 H HG   . SER A 1 43 ? -13.013 -0.945  1.307   1.00 0.00 ? 43 SER A HG   11 
ATOM 11813 N N    . LEU A 1 44 ? -11.467 -0.546  -2.333  1.00 0.00 ? 44 LEU A N    11 
ATOM 11814 C CA   . LEU A 1 44 ? -10.794 0.671   -2.771  1.00 0.00 ? 44 LEU A CA   11 
ATOM 11815 C C    . LEU A 1 44 ? -10.807 0.784   -4.292  1.00 0.00 ? 44 LEU A C    11 
ATOM 11816 O O    . LEU A 1 44 ? -10.256 1.726   -4.860  1.00 0.00 ? 44 LEU A O    11 
ATOM 11817 C CB   . LEU A 1 44 ? -9.352  0.693   -2.260  1.00 0.00 ? 44 LEU A CB   11 
ATOM 11818 C CG   . LEU A 1 44 ? -9.165  0.418   -0.767  1.00 0.00 ? 44 LEU A CG   11 
ATOM 11819 C CD1  . LEU A 1 44 ? -7.691  0.463   -0.396  1.00 0.00 ? 44 LEU A CD1  11 
ATOM 11820 C CD2  . LEU A 1 44 ? -9.957  1.419   0.063   1.00 0.00 ? 44 LEU A CD2  11 
ATOM 11821 H H    . LEU A 1 44 ? -10.933 -1.346  -2.147  1.00 0.00 ? 44 LEU A H    11 
ATOM 11822 H HA   . LEU A 1 44 ? -11.327 1.513   -2.355  1.00 0.00 ? 44 LEU A HA   11 
ATOM 11823 H HB2  . LEU A 1 44 ? -8.797  -0.055  -2.805  1.00 0.00 ? 44 LEU A HB2  11 
ATOM 11824 H HB3  . LEU A 1 44 ? -8.942  1.670   -2.471  1.00 0.00 ? 44 LEU A HB3  11 
ATOM 11825 H HG   . LEU A 1 44 ? -9.536  -0.572  -0.541  1.00 0.00 ? 44 LEU A HG   11 
ATOM 11826 H HD11 . LEU A 1 44 ? -7.491  1.357   0.175   1.00 0.00 ? 44 LEU A HD11 11 
ATOM 11827 H HD12 . LEU A 1 44 ? -7.094  0.470   -1.296  1.00 0.00 ? 44 LEU A HD12 11 
ATOM 11828 H HD13 . LEU A 1 44 ? -7.442  -0.406  0.194   1.00 0.00 ? 44 LEU A HD13 11 
ATOM 11829 H HD21 . LEU A 1 44 ? -10.798 0.920   0.521   1.00 0.00 ? 44 LEU A HD21 11 
ATOM 11830 H HD22 . LEU A 1 44 ? -10.315 2.213   -0.577  1.00 0.00 ? 44 LEU A HD22 11 
ATOM 11831 H HD23 . LEU A 1 44 ? -9.320  1.833   0.830   1.00 0.00 ? 44 LEU A HD23 11 
ATOM 11832 N N    . GLY A 1 45 ? -11.443 -0.183  -4.946  1.00 0.00 ? 45 GLY A N    11 
ATOM 11833 C CA   . GLY A 1 45 ? -11.519 -0.173  -6.396  1.00 0.00 ? 45 GLY A CA   11 
ATOM 11834 C C    . GLY A 1 45 ? -10.165 -0.367  -7.048  1.00 0.00 ? 45 GLY A C    11 
ATOM 11835 O O    . GLY A 1 45 ? -9.968  -0.001  -8.208  1.00 0.00 ? 45 GLY A O    11 
ATOM 11836 H H    . GLY A 1 45 ? -11.865 -0.910  -4.441  1.00 0.00 ? 45 GLY A H    11 
ATOM 11837 H HA2  . GLY A 1 45 ? -12.178 -0.966  -6.716  1.00 0.00 ? 45 GLY A HA2  11 
ATOM 11838 H HA3  . GLY A 1 45 ? -11.928 0.774   -6.717  1.00 0.00 ? 45 GLY A HA3  11 
ATOM 11839 N N    . LEU A 1 46 ? -9.227  -0.941  -6.303  1.00 0.00 ? 46 LEU A N    11 
ATOM 11840 C CA